1TXQA

Crystal structure of the eb1 c-terminal domain complexed with the cap-gly domain of p150glued
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
74
structure length
74
Chain Sequence
b'RPLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dynactin 1
publication title Structural Basis for the Activation of Microtubule Assembly by the EB1 and p150(Glued) Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/protein binding
total genus 13
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2004-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 1txqA00
2HL3A 1LPLA 4B6MA 2CP7A 1TOVA 2COWA 2CP6A 2CP0A 2CP3A 1WHLA 1TXQA 1WHHA 3RDVA 2HQHA 2E3HA 1IXDA 2HKQB 2E4HA 1WHMA 2COYA 3TQ7P 2Z0WA 2MPXC 3E2UA 2M02A 2HL5C 1WHJA 1WHGA 2QK0A 2HKNA 2CP2A 2E3IA 2CP5A 1WHKA 2COZA
chains in the Genus database with same CATH superfamily
4M7AC 1XJWB 4LUEA 3CCJA 1I4K1 2CDTA 4J5YA 1H641 2RI5A 4XQ3A 1K9MR 1VQLA 3G71A 1QCOA 3X20B 1PD1A 1SKUB 3MCAB 3CCJT 2D8HA 4OMQA 2OTLA 4GLMA 1SSFA 5IHIA 2VKNA 3FDRA 1VQLT 3G71T 5GJWB 3X24B 3OQ5A 1UFFA 5A0DA 1M1KC 2P0PA 1I5LA 2OTLT 2JXBA 3A8MB 2RJDA 2BKDN 2E6NA 3TEEA 3INZA 1BK2A 4FYVB 4JS5A 1BCMA 1PHTA 3VUZA 3VJPA 1Y0MA 3EH2A 2DXCA 4RTZA 2DL5A 3TSZA 3TQ7P 4HCKA 3EG0A 4C92A 2K57A 2QQRA 1WDXA 4M77F 1SF9A 2P0QA 2PNIA 5FU7B 4B9WA 3NTHA 3OA6A 3U23A 5I2MA 1TH7A 5IAYA 1RI9A 2R5MA 1UGPB 2JS0A 2NLUA 1EFNA 2KMTA 2O88A 1UDLA 3OYNA 2F5TX 1YI2Q 2K3YA 1M9SA 2HBWA 2DIQA 4M7DB 1VQ8A 5KYXA 1N5ZA 3PT9A 3HFOA 3OMCA 2E64A 1O9SA 4J9GA 1KD1C 2MK5A 1RI0A 2XMFA 1VQ8T 1G3WA 2JTFA 3UF4A 3JCMP 4OF1A 3M5AA 2HDAA 1X43A 1VQKA 3KUFA 4MZPA 2DXBA 5GAMe 3E1SA 4JJDA 1M30A 1JJ2P 1VQKT 4NL3A 1AHJB 1JQQA 4L59A 3M53A 2HKNA 2L3QA 5GANh 3CCJQ 2DF6A 2KROA 2QGFB 2HQEA 2E41A 3NTIA 5C0MA 4FIBA 2K79A 2YUPA 3EG9A 4JJCA 1NZ9A 4XTWA 2XI9A 4E7KA 2KXCA 2P84A 1G5VA 4ZTJA 1Q86U 5CO7A 3CC2A 2AKLA 2XDBA 3META 1YNZA 2EYQA 2MOXA 3S3NA 2M9UA 4M4ZA 1K8AR 4M75B 3OYJA 2ENMA 4M75F 4OMMA 4F7UA 1Q7YR 3ZL7C 5HCKA 1NYFA 2CH4A 2HZYA 4XTUA 5IHNA 4GLKA 5GAMh 4C0FA 2MYSA 2RM4A 2D0QB 2YLCA 3MP6A 4N4IA 2LJ1A 1QMCA 2DX1A 2QA4Q 1YITA 2LTOA 3OMGA 4FW1A 2EGCA 2VV5A 5CKFA 2RHYA 1LPLA 1YITT 2E1HA 5A0LA 3ER0A 2DRMA 5KYWB 4RTWA 2HKQB 2Y4XA 1MGQA 2C06A 2OTJQ 2IPOB 1PCXA 2LDMA 2LX7A 1Z9QA 2QQSA 4F7UE 2DL4A 2XICA 4R56A 5GAN5 5HY6A 2EYYA 5KCHA 3EGDB 2FZCB 2K5IA 5KE3A 1K9MU 4KUDK 1YCYA 3JV3A 3OYBA 1WHMA 3JCMJ 2E5KA 3A8OB 2L5QA 3CCSA 4BACA 1IHWA 4OB0B 2DTOA 3GNGA 3M56A 3M9QA 4EIKA 1VQMA 3CMAA 2PVGB 3CCST 4C8QA 5GAOp 4XU0A 3OYDA 2YRCA 1ZBXA 3KBGA 2K5LA 1H3ZA 1VQMT 3CMAT 1K73C 5FU6C 3ULRB 4II1A 2H8HA 3E19A 4LNPA 4C92B 3M59A 3EFRA 3NPFA 4FM4B 1NJIC 1VQ7A 2LNHB 4Y91A 1TTHB 2KYMA 1UGVA 4L5GA 4XTYA 1UB4A 1AWJA 4L6V5 1AD5A 1VQ7T 1MMDA 4X9CA 2FZGB 2PVDB 1N8RR 4F17A 2DZ9A 2J6OA 3TSWA 1KQSP 5KYXB 1M1KR 3L2UA 1W70A 2EQUA 1PD0A 4C8QE 2DEUA 2E70A 3LGFA 2KDSA 3V8JA 2E3HA 2JM8A 3FRNA 2NUTB 5AYFA 3C12A 1AZEA 5I2SA 3I5RA 3CC7Q 2B8AA 3EG3A 4FCYA 2O2OA 3HHTB 2LMJA 4E2FB 4RG2A 3RIRA 2G6FX 4NL2A 1QVPA 2P4TA 1B3QA 4HKEA 2COWA 4EMKB 2KK4A 3ZBDA 1F1BB 4FSSA 3WXMB 2RF0A 3HP9A 2DA9A 2P4RA 4M75D 2ZGWA 2KR3A 2C0TA 8AT1B 2D0NA 3X26B 3HRUA 3OY9A 2EJ9A 4JRKA 3QPHA 2CP7A 5EC7A 1Q7YU 1MNEA 2HCKA 4F7UF 5D6XA 4ZN1A 1QLYA 3EG1A 4BDZA 3OS5A 1YIJA 2DXUA 2EYXA 4EMGA 1D1BA 1YIJT 1KIKA 3EAEA 3ME9A 2RO0A 1WXUA 4OMFB 1PSFA 1RAIB 1QCFA 2EGAA 3FEOA 3S3OA 2DRKA 3CPWA 1KQSA 2DBMA 4ZN3A 3CCRQ 2RQTA 3VYHB 2QI2A 4M7AE 4BI4A 2EW3A 3TCJA 2CT4A 2LJ0A 5LJ5e 2YLBA 3H41A 4NS5A 1K9AA 2YUOA 3I55A 1Y7XA 3A98A 3L2VA 1Q81C 5DLQE 3I55T 4PJOG 1HK9A 3F70A 3CCEA 1TU0B 3CPWS 5A0GA 1UJ0A 4C0ZA 4DBRA 4Z8AA 2JT4A 3G4SA 2YUQA 3BE3A 4E7IA 1X2KA 3CCET 4E7SA 7AT1B 1ACMB 5FWCA 4C8QF 4PJOC 3G4ST 1WJQA 4C92D 3V8LA 2P0KA 2JS2A 5L23A 5CKBA 1ZA2B 3G6EA 4DA4A 1G2BA 4DQ2A 4ZGEB 3CCLQ 3L2RA 1HXDA 2KXDA 2XD0A 3EHRA 4V2SA 1WXBA 2K7AA 2YXYA 3DLMA 3L42A 3OSVA 5GAOl 4E7JA 3G6ET 1XQHA 4M78G 1RACB 3V7RA 4BY6C 5LJ5h 3OS2A 4HVWA 5FRNA 1YIJQ 2K9GA 1IHVA 2YHTA 1S72Q 3MHXA 3UA7A 2DM1A 5A2QE 3CXCS 1W2BA 4CI0C 1N8RU 4QVCA 4M78C 3OW2P 4E7LA 1JXOA 2M51A 2KRMA 1K0SA 3PVLA 4TVRA 2HSPA 1M5Q1 3H0IA 3REAB 4QKUA 2PZ1A 1K76A 2GFUA 2FHDA 2PUKB 3CBOA 3QO3A 1UGSB 3FIFA 2QDLA 2DFUA 2CREA 2OI3A 3JSCA 1VQ5Q 4HA8A 3CCQQ 2XK0A 2A36A 2DLPA 3IQLA 1W2BS 2DTIA 1RAAB 1VQOA 4HCCA 2KRNA 2EKOA 2DL7A 2VYTA 4OMNA 4LD9K 1VQOT 3QSUA 1D1CA 3DKMA 2GTOA 4QVZA 2YRVA 2F2WA 4HXJA 1QKXA 2ZPGB 4E7ZA 1XOVA 3JCMe 3JCMW 2CS7A 3HKSA 4N0AC 2GBQA 4BD3A 1M1GA 1KC8C 4JDSA 5GMKi 1U8RA 2HNIA 1AZGB 2E12A 2VB6A 1BCOA 3VKIA 4PLLA 2KGTA 4J8OA 3G6EQ 4J9DA 4XU1A 5GMKl 1XTDA 2CKKA 2JJ9A 1T0HA 3PMIA 1PC0A 3JRZA 4J9FA 3VU3C 1OX9A 2QG9B 2WSCE 1PKTA 3QZ9B 2EQMA 3UPUA 3CC4A 1OULA 4WF2A 3CCVQ 2DBKA 4J9EA 3CC4T 1BI2A 3JCMh 3M58A 1SSHA 2K2VA 2I2LA 5AT1B 1C1AA 3R6NA 3RKYA 3PIOA 1Q82C 2HAXA 2EVRA 4O6JA 1GCPA 1TS9A 4ZTFA 4AFZC 3QBYA 1QVGP 1YJ9Q 2W10A 2X4YA 5LL6S 2KY9A 2YDLA 3UT1A 2LCCA 3MP1A 2FRYA 1JXMA 2NUPA 3JCMb 3DB4A 4LN2A 4DBQA 4C8QD 2CSIA 4GBQA 2O9SA 2YT6A 2NUZA 2CUDA 4Q5WA 3QIIA 2K3XA 5LJ3f 2YSQA 3LH5A 3VS2A 4LDXA 1Y96A 4PJNA 1V1CA 2X35A 1ARKA 2GFAA 3RKWA 2RI3A 4OP0A 2J7IA 1BI0A 1ABOA 4CC3A 3H6ZA 3KFVA 5KYUA 4OGCA 2QQ9A 3HFNA 2CP5A 4M77B 4D6WA 2QTXA 1ZUKA 2J05A 2GCXA 2EKHA 3SWNB 1GXIE 3J7AF 1VQNA 4BE0A 2AZVA 1VQ6Q 5CKHA 3LW5E 1TUGB 1Q81R 1DJ7B 4PKCC 1VQNT 3RUXA 2DXTA 1S1NA 2J06A 2MAMA 1UUEA 2QK0A 5LJ3g 3C0CA 1OPLA 4BDYA 2JZ2A 1M90U 1UJYA 4LDYA 3THKA 3LYIA 2FVUA 1X6OA 2JN0A 3QG1A 1RAEB 3QKJA 2ZPHB 1YJWQ 2O01E 2QGGA 2D6FA 4ZNXA 2GGRA 4E6RA 2XHCA 1X75C 1JO8A 4LDUA 4QT7A 2L8DA 2R57A 1T0JA 1G3TA 4ELYC 4QW2A 2DILA 1VQLQ 1GRIA 3G71Q 4KBMB 2DE0X 3URGA 2OTLQ 1VA7A 5IN1A 3RR6A 4FL6A 2F2XA 2CGHA 2RN8A 4MMKA 3JB9J 3MJXA 4FT2A 3BFMA 2DVJA 5GANd 3CC2T 4RCBA 4XTXA 4M7DG 1TG0A 3HRSA 5GAN8 4OB2B 2A7YA 2LRQA 1VYTA 4XAXB 2VXFA 3E2UA 4M7DC 1AWXA 4JLIA 2A0FB 1MMGA 3L2ZA 4OVAA 1WHGA 4DBFA 1U1SA 1GCQC 4PJOA 2X3XD 3QXEB 1YWPA 2ABLA 4OB1B 4NOYA 2ED1A 3A8LB 3BW1A 2R5AA 2XIDA 1RAHB 1VQ8Q 1VQPA 4IUUA 4HT9A 1I8FA 2HL5C 3VS4A 2DYBA 8ATCB 2KBTA 1VQPT 1OI1A 5GAN6 1KC8R 1VQKQ 1JJ2A 5IT9E 2IG0A 1PM3A 1ZA1B 1LJOA 1BYMA 4M78A 4XU2A 2KQWA 4WCIA 2Z0WA 4RTVA 1K4US 2NUPB 2AT1B 2L3SA 3EG2A 3MEVA 4CC2A 5LJ3j 1GFCA 2LT4A 3C4SA 1AT1B 2X9HA 4PJOE 1HYOA 3EGUA 3OBYA 1V29B 2FG0A 4FW2A 4IIOA 4PLIA 1NEGA 2BIVA 1NYGA 2FL7A 5CKEA 2DJQA 3RMQA 1Y96B 3CC2Q 2FPEA 2DL8A 2RB6A 1PWTA 1UGRB 4M77D 1JJ2S 2I0NA 2FPFA 2VUBA 2K3BA 4J6YA 5KYUB 3EFOA 1YBYA 1Q82R 2MIOA 1YJNA 1YHQA 4ANJA 3H0HA 4BE2A 1M3AA 5CVIA 3JB9H 1YJNT 2JM9A 3O8VA 4M78E 4KGXB 1M8MA 1YHQT 1NE8A 1V76A 3MPUB 1YITQ 3M0PA 1SPKA 3QJYA 1RAGB 3I9QA 1OPKA 3EH1A 4DOWA 1WHJA 1ZQ1A 5LJ3d 1CKBA 2OX7A 4JJBA 4J6WA 4JZ4A 2PQWA 2DK3A 3FC3A 3SEMA 2L3PA 2RQWA 3TVTA 3CQTA 4K11A 2EIFA 1VQPQ 2X3WD 1Q86C 2NWMA 4MDWA 3A1PA 1NM7A 1OQKA 4QQ6A 3E9GA 2QAZA 3ZFJA 3KXTA 4IKFA 4BE1A 1OX8A 3GP8A 2EQKA 3CCUA 2WSFE 2KSSA 4KGZB 2PVOB 4C92G 2ED0A 3CCUT 2CP3A 1WJSA 3OYFA 3SHWA 1HD3A 3EG9B 3NMZC 3VRYA 4MDXA 1KJWA 1N6AA 3CCSQ 3CCMA 1U3OA 1YCSB 4C92C 1VQMQ 3G1JA 2K4YA 3CMAQ 3NFCA 4HCBA 3QWYA 3CCMT 4M7AA 1WLPB 2EQJA 1KD1R 1LCKA 2GQIA 2FEIA 1K8AU 3I56A 4HVVA 1CSKA 4J83A 2CP0A 4F7UB 3GPLA 2OJ2A 1AWWA 3VS1A 3JB9G 5J26A 4D8DA 2DYIA 3I56T 2LC4A 2LCLA 2RNAA 3S6WA 3R6OA 2VGMA 4FT4A 1WGSA 5KYYA 3FB9A 1GBRA 2XDPA 1VQ7Q 2C0IA 2F5KA 1I81A 2VVKA 4AMCA 1SRLA 1I1JA 1AVZC 1KHIA 2HL3A 3TREA 4J9IA 4AG2C 4PJOB 5L8RE 2CP6A 4PJOF 1IGUA 1K9MC 4OMOA 5GMKe 1UE9A 5HKCA 3LWHA 4FSXA 1D3BA 5GMKj 4LE9A 1GL5A 5D6YA 1M2OA 4ZGJB 4J9HA 4C0DB 2QEXA 1OEBA 1UEBA 5I22A 4OMLA 4PFZA 1LNXA 1HSQA 1M1FA 3PFSA 2KEAA 3BDLA 4DBHA 2JTEA 2DTHA 2QEXT 1KSWA 2CYZB 1B07A 3LH0A 4B6MA 4LDVA 4EMKC 1QVFP 1KQ2A 1PSEA 2DKGA 3QDRB 2RI2A 2ATCB 4R55A 5D7UA 2C0OA 4M78F 1Y71A 2LP5A 2KT1A 2LQNA 3OSSC 4C0GA 1A0NB 5J39A 1KQSS 3M4YA 1FMKA 2MCNA 4R0KA 1ZSGA 2AHJB 3OB9A 3JCMV 4C8QB 5CQXA 3V8KA 3CCMQ 2O9VA 4J6XA 2XG8D 4PNOA 2E4HA 2V1QA 1C0MA 3VS3A 3GOXA 3QHSA 1AWOA 2O31A 3M57A 4BB7A 5GAOn 4O5VA 3EFOB 4B9XA 4JLGA 4X34A 4JS4A 2FB7A 2K2MA 3VS6A 3OYYA 3UA6A 2NYSA 3JCMc 4A4GA 1IB8A 4UC4A 3RBBB 2MMPA 5M9OA 5EG2A 1UHCA 4RTYA 1BI1A 1G8XA 3X28B 1MUZA 4N4HA 1NBEB 2OAUA 2XKOC 1X6BA 4IUPA 1M1KU 5IHKA 2L3RA 2EAYA 3CD6A 1OOTA 2DNUA 2L0AA 3OBWA 5GANf 1QWEA 3RDVA 3LLRA 3CD6T 1K73R 1XNIA 1Y07A 4M7DA 3CMEA 1UTIA 1IZ6A 1P92A 3REBB 3I5SA 1JBMA 1ZSZC 4MMLA 4JPBW 5ECAA 1GCQA 3OYMA 1N9RA 3CMET 1NJIR 2LNVA 2RK2A 1Q7YC 3I55Q 1Q95G 1FMWA 3SDZA 1WFWA 3QWXX 4KGVB 2AIRB 2QDYB 1SEMA 3MP8A 2CZ6B 4JUVA 2JTMA 2H3EB 3CCEQ 3EGXA 3G4SQ 3OYLA 2JMCA 1VYVA 1O75A 5GAMf 5GANg 1KD1U 2G3RA 2RQVA 3AT1B 4M7AB 2V8KA 2DO3A 4M7AF 4RUGA 1JEGA 2V8JA 3SD4A 4E47A 3GNFB 1R8OB 5GAOr 2HQHA 3GLXA 1IREB 9ATCB 4C5IA 4M7DE 3L2QA 1MV0B 2QQAA 4BI3A 1ZUYA 1WIEA 2VXEA 4PJOD 4C5EA 1NLPC 2F69A 2RHZA 2E6ZA 4Z88A 3V7CA 2KAFA 2MWOA 1KQ1A 4XTZA 5GAOm 1JU5C 2VGNA 1RAFB 2HSEB 4C5GA 3OW2A 2L2PA 2A3LA 3MO8A 1R0BG 3MEWA 3T9NA 4FYXB 2RMOA 2IVWA 2EGEA 4Z02A 1WI7A 1BIAA 1E6HA 5GAMg 1W1FA 1TSFA 4EMHA 1YI2A 2EBPA 2MF2A 3HSBA 1NPRA 1H92A 1PKSA 4P5NA 4Y92A 3L1AA 1YI2T 4FYWB 4M78D 3A8GB 2XU8A 1GFDA 5CK9A 5KYWA 5CKDA 4F16A 4DOVA 4F14A 2QASA 2DERA 4A63B 2KI7A 1TWBA 3OW2S 1TUCA 2JUFA 1KG1A 2QTVA 4M75E 2R58A 2F2VA 3OYGA 1VQOQ 2QYZA 2DEQA 2KE9A 2E65A 3EGDA 1T3LA 2M16A 2LQKA 4EDUA 2D8JA 1N8RC 1X2QA 4FYYB 3JAME 1AEYA 1M8VA 4AT1B 1SG5A 2FPDA 5GJVB 2MI6A 3TU4K 2EWNA 2ZZDA 1Y57A 3V7SA 3JB9I 4J9BA 4AFSC 3OYIA 2ZCFB 1M3CA 1YP5A 5GMKm 1UHFA 1VIEA 1T3SA 2V1RA 5DLOA 1BI3A 2QA4A 5GANe 5GANj 5KYNA 1OU9A 1NLOC 2QA4T 3BDUA 3CC4Q 2ZPIB 3PVQA 1VQ9A 1FX7A 1SHGA 2YRDA 2KVQG 2ZPBB 2RQUA 1U06A 1K73U 1H3HA 2LQWA 1VQ9T 1QVGA 1IO6A 4HVUA 4M7DF 2OTJA 3UWNA 5GAN4 3HPWA 2E3IA 2PU9B 1NJIU 3N5BB 2HEQA 2H3JA 4KRTA 1WQ7A 2EJFA 2OTJT 4DEXA 1OZ2A 1WHLA 4M77G 2NUTA 1KFZA 2LX9A 1IXDA 4M7AD 4C92E 5CIUA 5GAMj 1ZLMA 3NTKA 4Y28E 3EGXB 3VUBA 3M0SA 2HD0A 4IURA 5IH2A 1TOVA 4M77C 4EMKA 3EFSA 2CZ1B 1QVGS 5FU7C 3SWNC 2JMAA 2JW4A 5HK3A 2YWWA 2J6KA 2EPDA 2HMAA 1B34A 4QQDA 4FU6A 2AKKA 2VWFA 3J81E 1OV3A 4HT8A 6AT1B 2M0OA 2ZAEA 2EJGA 1KK7A 2BE9B 4YTLA 1VQNQ 1D0ZA 1NG2A 2CZ0B 2KYBA 5KH6A 2X4XA 1WHHA 4RCCA 2XDDA 5FU6B 1WPYA 1JB0E 4J9CA 1WA7A 5GAMd 1FYNA 1X27A 1WQWA 4XK8E 4ZGDB 1G83A 2DZCA 3H8ZA 5FROA 5IXBA 2M0YA 2SRCA 3OS1A 1I5OB 1M4ZA 1WHKA 1K1ZA 1JRIA 4D8KA 3PMTA 1VQ9Q 5GAOq 3OYKA 4CRIA 2DMOA 2V8IA 1C6VX 4M75G 2RHIA 1EZZB 1Z9ZA 4E7HA 3OYAA 1PNJA 1B7TA 2LZ6B 4PL6A 4PJJA 1J3TA 3M0RA 1EX4A 1W6XA 4ELZC 4AFQC 3AHUA 3CC7A 4RTUA 5LJ3e 2WSEE 4JRQA 4M75C 3RERA 2RJFA 3BY7A 3SB2A 1VUBA 1ZBJA 2ZPEB 3CC7T 4KH0B 2RJEA 2EFIA 5GAN3 2GTJA 5LJ5f 4X1VA 3G7ZA 3M4GA 3GF5A 2FO0A 2QXFA 1ZSZA 4IUVA 2KNBB 4J7IA 1HJDA 3CPFA 1RL2A 4ATOA 1M90C 3M54A 2M1HA 3M0UA 1I0CA 3LX7A 1FMVA 3RNJA 4WTOB 4XTVA 1M3BA 2FYKA 5I21A 2SEMA 2HBPA 2WACA 1VYUA 2DJZA 4LXCA 4CC7A 1Q81U 4MZTA 4RG8A 1IRXA 2BZYA 4C92F 4N0AA 5LJ3h 4KUIA 5LJ5g 1VIFA 2BE7D 1YFNA 2Y4YA 3P8DA 4RTXA 4M7DD 1X6GA 2LQ8A 2E10A 3S3MA 4A4KA 3QJ6A 1WX6A 2A08A 4AFUC 2W0ZA 5DM7R 3JCMQ 2L89A 1WYXA 2YUNA 3CCRA 1D0YA 2LJ3A 3CPWP 1W4SA 4A53A 4RKUE 1UGQB 2PUOB 1NEBA 2CP2A 3JB9F 2E5QA 3CCRT 1ZUUA 1RUWA 1ABQA 2RHUA 3P8BB 3ZEHA 3GIBA 3RKXA 1NPPA 3C94A 1M2VA 4VUBA 4DEYA 3I35A 3MEAA 5IXFA 1VOMA 2LCSA 4HCZA 1OZ3A 1QCNA 2JNGA 4KH1B 4GY5A 5CAIA 2QQBA 1RADB 2A28A 5C6SA 2D1XA 1LVKA 2EYZA 3SFMA 1RLPC 3OYCA 1PRMC 3RMSA 3H0FA 3VS5A 1WNLA 2JOYA 2ROLA 1WZOA 5DY9A 3CXCP 5CQYA 2ROTA 1B34B 3QZ5B 2O4XA 4JRPA 3A8HB 2OAWA 5D6WA 3DLLA 5HK0A 2RPNA 4C5HA 1QQJA 1E7OA 3CCLA 3OYEA 1D0XA 2DD4A 2ESWA 1YJNQ 1YHQQ 1MNDA 4PJMA 2X51A 3C95A 2CUBA 3WVEB 4A54A 3CCLT 5FRMA 3JCMf 3OYHA 3HTRA 1WXTA 4JRIA 4IUTA 2X4JA 1S72A 2ECZA 1X69A 1D1AA 1KHCA 1U1TA 2RK1A 3ASKA 2DL3A 4KT0E 4LDWA 1S72T 5J3BA 1VQ4A 4LD6A 1WJRA 4PJLA 4AG1C 4BY6B 1W2BP 2BTTA 1YWOA 1BKBA 3J80E 1LOJA 1MHNA 1KC8U 3UDCA 2IIMA 2GNCA 1VQ4T 3PNWC 3QYGB 3VRZA 3P8HA 3PGGA 4BUGA 1IGQA 1N9SA 4QVDA 2JVVA 2RHXA 1UECA 3LWIA 2HQXA 1RLQC 4M78B 4F7UG 4OMPA 3PIPA 3CCUQ 1VQ5A 3JCMg 3CCQA 1QP2A 2EQIA 3LGLA 1QWFA 1BB9A 1I07A 1EIFA 2DPPB 3VV0A 5LJ5j 1VQ5T 3CCQT 5GMKh 3CEYA 3JCMX 3X25B 1TXQA 1SRMA 2FRWA 2DETA 1E6GA 2K6DA 2LT1A 1FXXA 4PFOA 3MKDA 2M02A 1ZSZB 1UG1A 4MZMA 3FJ5A 3CXCA 3I56Q 4XU3A 3M0QA 1G3SA 1Q82U 1BIBA 3QUIA 5I11A 1BBZA 1MMNA 4X9DA 3GBQA 2BZ8A 2CZ7B 2VC8A 4OB3B 3L2WA 2PTKA 4C0DC 2DD5A 2MPXC 3CBPA 3Q1JA 3UATA 4M77A 1FWZA 2COZA 2CSQA 1OYXA 3SWNA 2B86A 5GAN7 3EHQA 5LJ5d 3DB3A 4IIMA 3RESA 2DVEA 1X01A 5FWBA 1CKAA 2GF7A 1K0XA 1BU1A 4JZ3A 4A4HA 4A4EA 2X4WA 3JB9D 2QEXQ 1M27C 5GAN2 2CT3A 3NGPA 2DAQA 4C8QG 3CCVA 3M0TA 4N4GA 1VQ4Q 4ME7A 3PTAA 3M55A 1QVFA 3VYGA 1K8AC 1M90R 2LVMA 3CCVT 1OU8A 4BI8B 3HRTA 1PRLC 4C8QC 3VS0A 4LUDA 1YJ9A 1QP3A 2D9TA 3QDFA 1M2VB 1N27A 2CH4W 5CR2A 4RMOA 3O5ZA 2COYA 1ZX6A 4F04B 1YJ9T 1YN8A 4M77E 2ZPFB 1AOJA 2RD1A 4Z89A 4QQGA 4J7FA 1RABB 1ZHIA 3OS0A 3QYHB 4A4FA 2RQRA 4IUQA 2AZSA 3E9FA 1QVFS 3NHNA 2RJCA 1Q86R 2K5FA 2FZKB 3H9NA 4ESRA 2O4XB 2BUDA 2F1LA 1QW1A 1QKWA 3A5ZB 5KYYB 3FJPA 4RTTA 1PG5B 5FLXE 4M75A 2BZXA 3CBMA 3WVDB 3PE0A 5CCAA 2RH2A 1MV3A 2DIGA 2KRSA 4EPCA 1R77A 3MEUA 1R0CB 2MWPA 2V26A 1D09B 1D3BB 3D7SB 3FLGA 1VQ6A 3HL8A 4PFPA 1TUDA 3VS7A 5KCOA 4JJNK 2EYWA 4CC4B 1VQ6T 2GQVA 2RA2A 3CD6Q 2J6FA 1H8KA 1MMAA 5FW9A 4OGEA 2AK5A 4M7AG 1SHFA 3CMEQ 1G3YA 5KE2A 1YJWA 2KT8A 2Y90A 2A37A 1U5SA 4PK4A 4ORZA 3JCMd 4KULA 1GBQA 2VASA 1YJWT
chains in the Genus database with same CATH topology
2HL3A 1LPLA 4B6MA 2CP7A 1TOVA 2COWA 2CP6A 2CP0A 2CP3A 1WHLA 1TXQA 1WHHA 3RDVA 2HQHA 2E3HA 1IXDA 2HKQB 2E4HA 1WHMA 2COYA 3TQ7P 2Z0WA 2MPXC 3E2UA 2M02A 2HL5C 1WHJA 1WHGA 2QK0A 2HKNA 2CP2A 2E3IA 2CP5A 1WHKA 2COZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HL3 A;  1LPL A;  4B6M A;  2CP7 A;  1TOV A;  2COW A;  2CP6 A;  2CP0 A;  2CP3 A;  1WHL A;  1TXQ A;  1WHH A;  3RDV A;  2HQH A;  2E3H A;  1IXD A;  2HKQ B;  2E4H A;  1WHM A;  2COY A;  3TQ7 P;  2Z0W A;  2MPX C;  3E2U A;  2M02 A;  2HL5 C;  1WHJ A;  1WHG A;  2QK0 A;  2HKN A;  2CP2 A;  2E3I A;  2CP5 A;  1WHK A;  2COZ A; 
#chains in the Genus database with same CATH topology
 4M7A C;  1XJW B;  4LUE A;  3CCJ A;  1I4K 1;  2CDT A;  4J5Y A;  1H64 1;  2RI5 A;  4XQ3 A;  1K9M R;  1VQL A;  3G71 A;  1QCO A;  3X20 B;  1PD1 A;  1SKU B;  3MCA B;  3CCJ T;  2D8H A;  4OMQ A;  2OTL A;  4GLM A;  1SSF A;  5IHI A;  2VKN A;  3FDR A;  1VQL T;  3G71 T;  5GJW B;  3X24 B;  3OQ5 A;  1UFF A;  5A0D A;  1M1K C;  2P0P A;  1I5L A;  2OTL T;  2JXB A;  3A8M B;  2RJD A;  2BKD N;  2E6N A;  3TEE A;  3INZ A;  1BK2 A;  4FYV B;  4JS5 A;  1BCM A;  1PHT A;  3VUZ A;  3VJP A;  1Y0M A;  3EH2 A;  2DXC A;  4RTZ A;  2DL5 A;  3TSZ A;  3TQ7 P;  4HCK A;  3EG0 A;  4C92 A;  2K57 A;  2QQR A;  1WDX A;  4M77 F;  1SF9 A;  2P0Q A;  2PNI A;  5FU7 B;  4B9W A;  3NTH A;  3OA6 A;  3U23 A;  5I2M A;  1TH7 A;  5IAY A;  1RI9 A;  2R5M A;  1UGP B;  2JS0 A;  2NLU A;  1EFN A;  2KMT A;  2O88 A;  1UDL A;  3OYN A;  2F5T X;  1YI2 Q;  2K3Y A;  1M9S A;  2HBW A;  2DIQ A;  4M7D B;  1VQ8 A;  5KYX A;  1N5Z A;  3PT9 A;  3HFO A;  3OMC A;  2E64 A;  1O9S A;  4J9G A;  1KD1 C;  2MK5 A;  1RI0 A;  2XMF A;  1VQ8 T;  1G3W A;  2JTF A;  3UF4 A;  3JCM P;  4OF1 A;  3M5A A;  2HDA A;  1X43 A;  1VQK A;  3KUF A;  4MZP A;  2DXB A;  5GAM e;  3E1S A;  4JJD A;  1M30 A;  1JJ2 P;  1VQK T;  4NL3 A;  1AHJ B;  1JQQ A;  4L59 A;  3M53 A;  2HKN A;  2L3Q A;  5GAN h;  3CCJ Q;  2DF6 A;  2KRO A;  2QGF B;  2HQE A;  2E41 A;  3NTI A;  5C0M A;  4FIB A;  2K79 A;  2YUP A;  3EG9 A;  4JJC A;  1NZ9 A;  4XTW A;  2XI9 A;  4E7K A;  2KXC A;  2P84 A;  1G5V A;  4ZTJ A;  1Q86 U;  5CO7 A;  3CC2 A;  2AKL A;  2XDB A;  3MET A;  1YNZ A;  2EYQ A;  2MOX A;  3S3N A;  2M9U A;  4M4Z A;  1K8A R;  4M75 B;  3OYJ A;  2ENM A;  4M75 F;  4OMM A;  4F7U A;  1Q7Y R;  3ZL7 C;  5HCK A;  1NYF A;  2CH4 A;  2HZY A;  4XTU A;  5IHN A;  4GLK A;  5GAM h;  4C0F A;  2MYS A;  2RM4 A;  2D0Q B;  2YLC A;  3MP6 A;  4N4I A;  2LJ1 A;  1QMC A;  2DX1 A;  2QA4 Q;  1YIT A;  2LTO A;  3OMG A;  4FW1 A;  2EGC A;  2VV5 A;  5CKF A;  2RHY A;  1LPL A;  1YIT T;  2E1H A;  5A0L A;  3ER0 A;  2DRM A;  5KYW B;  4RTW A;  2HKQ B;  2Y4X A;  1MGQ A;  2C06 A;  2OTJ Q;  2IPO B;  1PCX A;  2LDM A;  2LX7 A;  1Z9Q A;  2QQS A;  4F7U E;  2DL4 A;  2XIC A;  4R56 A;  5GAN 5;  5HY6 A;  2EYY A;  5KCH A;  3EGD B;  2FZC B;  2K5I A;  5KE3 A;  1K9M U;  4KUD K;  1YCY A;  3JV3 A;  3OYB A;  1WHM A;  3JCM J;  2E5K A;  3A8O B;  2L5Q A;  3CCS A;  4BAC A;  1IHW A;  4OB0 B;  2DTO A;  3GNG A;  3M56 A;  3M9Q A;  4EIK A;  1VQM A;  3CMA A;  2PVG B;  3CCS T;  4C8Q A;  5GAO p;  4XU0 A;  3OYD A;  2YRC A;  1ZBX A;  3KBG A;  2K5L A;  1H3Z A;  1VQM T;  3CMA T;  1K73 C;  5FU6 C;  3ULR B;  4II1 A;  2H8H A;  3E19 A;  4LNP A;  4C92 B;  3M59 A;  3EFR A;  3NPF A;  4FM4 B;  1NJI C;  1VQ7 A;  2LNH B;  4Y91 A;  1TTH B;  2KYM A;  1UGV A;  4L5G A;  4XTY A;  1UB4 A;  1AWJ A;  4L6V 5;  1AD5 A;  1VQ7 T;  1MMD A;  4X9C A;  2FZG B;  2PVD B;  1N8R R;  4F17 A;  2DZ9 A;  2J6O A;  3TSW A;  1KQS P;  5KYX B;  1M1K R;  3L2U A;  1W70 A;  2EQU A;  1PD0 A;  4C8Q E;  2DEU A;  2E70 A;  3LGF A;  2KDS A;  3V8J A;  2E3H A;  2JM8 A;  3FRN A;  2NUT B;  5AYF A;  3C12 A;  1AZE A;  5I2S A;  3I5R A;  3CC7 Q;  2B8A A;  3EG3 A;  4FCY A;  2O2O A;  3HHT B;  2LMJ A;  4E2F B;  4RG2 A;  3RIR A;  2G6F X;  4NL2 A;  1QVP A;  2P4T A;  1B3Q A;  4HKE A;  2COW A;  4EMK B;  2KK4 A;  3ZBD A;  1F1B B;  4FSS A;  3WXM B;  2RF0 A;  3HP9 A;  2DA9 A;  2P4R A;  4M75 D;  2ZGW A;  2KR3 A;  2C0T A;  8AT1 B;  2D0N A;  3X26 B;  3HRU A;  3OY9 A;  2EJ9 A;  4JRK A;  3QPH A;  2CP7 A;  5EC7 A;  1Q7Y U;  1MNE A;  2HCK A;  4F7U F;  5D6X A;  4ZN1 A;  1QLY A;  3EG1 A;  4BDZ A;  3OS5 A;  1YIJ A;  2DXU A;  2EYX A;  4EMG A;  1D1B A;  1YIJ T;  1KIK A;  3EAE A;  3ME9 A;  2RO0 A;  1WXU A;  4OMF B;  1PSF A;  1RAI B;  1QCF A;  2EGA A;  3FEO A;  3S3O A;  2DRK A;  3CPW A;  1KQS A;  2DBM A;  4ZN3 A;  3CCR Q;  2RQT A;  3VYH B;  2QI2 A;  4M7A E;  4BI4 A;  2EW3 A;  3TCJ A;  2CT4 A;  2LJ0 A;  5LJ5 e;  2YLB A;  3H41 A;  4NS5 A;  1K9A A;  2YUO A;  3I55 A;  1Y7X A;  3A98 A;  3L2V A;  1Q81 C;  5DLQ E;  3I55 T;  4PJO G;  1HK9 A;  3F70 A;  3CCE A;  1TU0 B;  3CPW S;  5A0G A;  1UJ0 A;  4C0Z A;  4DBR A;  4Z8A A;  2JT4 A;  3G4S A;  2YUQ A;  3BE3 A;  4E7I A;  1X2K A;  3CCE T;  4E7S A;  7AT1 B;  1ACM B;  5FWC A;  4C8Q F;  4PJO C;  3G4S T;  1WJQ A;  4C92 D;  3V8L A;  2P0K A;  2JS2 A;  5L23 A;  5CKB A;  1ZA2 B;  3G6E A;  4DA4 A;  1G2B A;  4DQ2 A;  4ZGE B;  3CCL Q;  3L2R A;  1HXD A;  2KXD A;  2XD0 A;  3EHR A;  4V2S A;  1WXB A;  2K7A A;  2YXY A;  3DLM A;  3L42 A;  3OSV A;  5GAO l;  4E7J A;  3G6E T;  1XQH A;  4M78 G;  1RAC B;  3V7R A;  4BY6 C;  5LJ5 h;  3OS2 A;  4HVW A;  5FRN A;  1YIJ Q;  2K9G A;  1IHV A;  2YHT A;  1S72 Q;  3MHX A;  3UA7 A;  2DM1 A;  5A2Q E;  3CXC S;  1W2B A;  4CI0 C;  1N8R U;  4QVC A;  4M78 C;  3OW2 P;  4E7L A;  1JXO A;  2M51 A;  2KRM A;  1K0S A;  3PVL A;  4TVR A;  2HSP A;  1M5Q 1;  3H0I A;  3REA B;  4QKU A;  2PZ1 A;  1K76 A;  2GFU A;  2FHD A;  2PUK B;  3CBO A;  3QO3 A;  1UGS B;  3FIF A;  2QDL A;  2DFU A;  2CRE A;  2OI3 A;  3JSC A;  1VQ5 Q;  4HA8 A;  3CCQ Q;  2XK0 A;  2A36 A;  2DLP A;  3IQL A;  1W2B S;  2DTI A;  1RAA B;  1VQO A;  4HCC A;  2KRN A;  2EKO A;  2DL7 A;  2VYT A;  4OMN A;  4LD9 K;  1VQO T;  3QSU A;  1D1C A;  3DKM A;  2GTO A;  4QVZ A;  2YRV A;  2F2W A;  4HXJ A;  1QKX A;  2ZPG B;  4E7Z A;  1XOV A;  3JCM e;  3JCM W;  2CS7 A;  3HKS A;  4N0A C;  2GBQ A;  4BD3 A;  1M1G A;  1KC8 C;  4JDS A;  5GMK i;  1U8R A;  2HNI A;  1AZG B;  2E12 A;  2VB6 A;  1BCO A;  3VKI A;  4PLL A;  2KGT A;  4J8O A;  3G6E Q;  4J9D A;  4XU1 A;  5GMK l;  1XTD A;  2CKK A;  2JJ9 A;  1T0H A;  3PMI A;  1PC0 A;  3JRZ A;  4J9F A;  3VU3 C;  1OX9 A;  2QG9 B;  2WSC E;  1PKT A;  3QZ9 B;  2EQM A;  3UPU A;  3CC4 A;  1OUL A;  4WF2 A;  3CCV Q;  2DBK A;  4J9E A;  3CC4 T;  1BI2 A;  3JCM h;  3M58 A;  1SSH A;  2K2V A;  2I2L A;  5AT1 B;  1C1A A;  3R6N A;  3RKY A;  3PIO A;  1Q82 C;  2HAX A;  2EVR A;  4O6J A;  1GCP A;  1TS9 A;  4ZTF A;  4AFZ C;  3QBY A;  1QVG P;  1YJ9 Q;  2W10 A;  2X4Y A;  5LL6 S;  2KY9 A;  2YDL A;  3UT1 A;  2LCC A;  3MP1 A;  2FRY A;  1JXM A;  2NUP A;  3JCM b;  3DB4 A;  4LN2 A;  4DBQ A;  4C8Q D;  2CSI A;  4GBQ A;  2O9S A;  2YT6 A;  2NUZ A;  2CUD A;  4Q5W A;  3QII A;  2K3X A;  5LJ3 f;  2YSQ A;  3LH5 A;  3VS2 A;  4LDX A;  1Y96 A;  4PJN A;  1V1C A;  2X35 A;  1ARK A;  2GFA A;  3RKW A;  2RI3 A;  4OP0 A;  2J7I A;  1BI0 A;  1ABO A;  4CC3 A;  3H6Z A;  3KFV A;  5KYU A;  4OGC A;  2QQ9 A;  3HFN A;  2CP5 A;  4M77 B;  4D6W A;  2QTX A;  1ZUK A;  2J05 A;  2GCX A;  2EKH A;  3SWN B;  1GXI E;  3J7A F;  1VQN A;  4BE0 A;  2AZV A;  1VQ6 Q;  5CKH A;  3LW5 E;  1TUG B;  1Q81 R;  1DJ7 B;  4PKC C;  1VQN T;  3RUX A;  2DXT A;  1S1N A;  2J06 A;  2MAM A;  1UUE A;  2QK0 A;  5LJ3 g;  3C0C A;  1OPL A;  4BDY A;  2JZ2 A;  1M90 U;  1UJY A;  4LDY A;  3THK A;  3LYI A;  2FVU A;  1X6O A;  2JN0 A;  3QG1 A;  1RAE B;  3QKJ A;  2ZPH B;  1YJW Q;  2O01 E;  2QGG A;  2D6F A;  4ZNX A;  2GGR A;  4E6R A;  2XHC A;  1X75 C;  1JO8 A;  4LDU A;  4QT7 A;  2L8D A;  2R57 A;  1T0J A;  1G3T A;  4ELY C;  4QW2 A;  2DIL A;  1VQL Q;  1GRI A;  3G71 Q;  4KBM B;  2DE0 X;  3URG A;  2OTL Q;  1VA7 A;  5IN1 A;  3RR6 A;  4FL6 A;  2F2X A;  2CGH A;  2RN8 A;  4MMK A;  3JB9 J;  3MJX A;  4FT2 A;  3BFM A;  2DVJ A;  5GAN d;  3CC2 T;  4RCB A;  4XTX A;  4M7D G;  1TG0 A;  3HRS A;  5GAN 8;  4OB2 B;  2A7Y A;  2LRQ A;  1VYT A;  4XAX B;  2VXF A;  3E2U A;  4M7D C;  1AWX A;  4JLI A;  2A0F B;  1MMG A;  3L2Z A;  4OVA A;  1WHG A;  4DBF A;  1U1S A;  1GCQ C;  4PJO A;  2X3X D;  3QXE B;  1YWP A;  2ABL A;  4OB1 B;  4NOY A;  2ED1 A;  3A8L B;  3BW1 A;  2R5A A;  2XID A;  1RAH B;  1VQ8 Q;  1VQP A;  4IUU A;  4HT9 A;  1I8F A;  2HL5 C;  3VS4 A;  2DYB A;  8ATC B;  2KBT A;  1VQP T;  1OI1 A;  5GAN 6;  1KC8 R;  1VQK Q;  1JJ2 A;  5IT9 E;  2IG0 A;  1PM3 A;  1ZA1 B;  1LJO A;  1BYM A;  4M78 A;  4XU2 A;  2KQW A;  4WCI A;  2Z0W A;  4RTV A;  1K4U S;  2NUP B;  2AT1 B;  2L3S A;  3EG2 A;  3MEV A;  4CC2 A;  5LJ3 j;  1GFC A;  2LT4 A;  3C4S A;  1AT1 B;  2X9H A;  4PJO E;  1HYO A;  3EGU A;  3OBY A;  1V29 B;  2FG0 A;  4FW2 A;  4IIO A;  4PLI A;  1NEG A;  2BIV A;  1NYG A;  2FL7 A;  5CKE A;  2DJQ A;  3RMQ A;  1Y96 B;  3CC2 Q;  2FPE A;  2DL8 A;  2RB6 A;  1PWT A;  1UGR B;  4M77 D;  1JJ2 S;  2I0N A;  2FPF A;  2VUB A;  2K3B A;  4J6Y A;  5KYU B;  3EFO A;  1YBY A;  1Q82 R;  2MIO A;  1YJN A;  1YHQ A;  4ANJ A;  3H0H A;  4BE2 A;  1M3A A;  5CVI A;  3JB9 H;  1YJN T;  2JM9 A;  3O8V A;  4M78 E;  4KGX B;  1M8M A;  1YHQ T;  1NE8 A;  1V76 A;  3MPU B;  1YIT Q;  3M0P A;  1SPK A;  3QJY A;  1RAG B;  3I9Q A;  1OPK A;  3EH1 A;  4DOW A;  1WHJ A;  1ZQ1 A;  5LJ3 d;  1CKB A;  2OX7 A;  4JJB A;  4J6W A;  4JZ4 A;  2PQW A;  2DK3 A;  3FC3 A;  3SEM A;  2L3P A;  2RQW A;  3TVT A;  3CQT A;  4K11 A;  2EIF A;  1VQP Q;  2X3W D;  1Q86 C;  2NWM A;  4MDW A;  3A1P A;  1NM7 A;  1OQK A;  4QQ6 A;  3E9G A;  2QAZ A;  3ZFJ A;  3KXT A;  4IKF A;  4BE1 A;  1OX8 A;  3GP8 A;  2EQK A;  3CCU A;  2WSF E;  2KSS A;  4KGZ B;  2PVO B;  4C92 G;  2ED0 A;  3CCU T;  2CP3 A;  1WJS A;  3OYF A;  3SHW A;  1HD3 A;  3EG9 B;  3NMZ C;  3VRY A;  4MDX A;  1KJW A;  1N6A A;  3CCS Q;  3CCM A;  1U3O A;  1YCS B;  4C92 C;  1VQM Q;  3G1J A;  2K4Y A;  3CMA Q;  3NFC A;  4HCB A;  3QWY A;  3CCM T;  4M7A A;  1WLP B;  2EQJ A;  1KD1 R;  1LCK A;  2GQI A;  2FEI A;  1K8A U;  3I56 A;  4HVV A;  1CSK A;  4J83 A;  2CP0 A;  4F7U B;  3GPL A;  2OJ2 A;  1AWW A;  3VS1 A;  3JB9 G;  5J26 A;  4D8D A;  2DYI A;  3I56 T;  2LC4 A;  2LCL A;  2RNA A;  3S6W A;  3R6O A;  2VGM A;  4FT4 A;  1WGS A;  5KYY A;  3FB9 A;  1GBR A;  2XDP A;  1VQ7 Q;  2C0I A;  2F5K A;  1I81 A;  2VVK A;  4AMC A;  1SRL A;  1I1J A;  1AVZ C;  1KHI A;  2HL3 A;  3TRE A;  4J9I A;  4AG2 C;  4PJO B;  5L8R E;  2CP6 A;  4PJO F;  1IGU A;  1K9M C;  4OMO A;  5GMK e;  1UE9 A;  5HKC A;  3LWH A;  4FSX A;  1D3B A;  5GMK j;  4LE9 A;  1GL5 A;  5D6Y A;  1M2O A;  4ZGJ B;  4J9H A;  4C0D B;  2QEX A;  1OEB A;  1UEB A;  5I22 A;  4OML A;  4PFZ A;  1LNX A;  1HSQ A;  1M1F A;  3PFS A;  2KEA A;  3BDL A;  4DBH A;  2JTE A;  2DTH A;  2QEX T;  1KSW A;  2CYZ B;  1B07 A;  3LH0 A;  4B6M A;  4LDV A;  4EMK C;  1QVF P;  1KQ2 A;  1PSE A;  2DKG A;  3QDR B;  2RI2 A;  2ATC B;  4R55 A;  5D7U A;  2C0O A;  4M78 F;  1Y71 A;  2LP5 A;  2KT1 A;  2LQN A;  3OSS C;  4C0G A;  1A0N B;  5J39 A;  1KQS S;  3M4Y A;  1FMK A;  2MCN A;  4R0K A;  1ZSG A;  2AHJ B;  3OB9 A;  3JCM V;  4C8Q B;  5CQX A;  3V8K A;  3CCM Q;  2O9V A;  4J6X A;  2XG8 D;  4PNO A;  2E4H A;  2V1Q A;  1C0M A;  3VS3 A;  3GOX A;  3QHS A;  1AWO A;  2O31 A;  3M57 A;  4BB7 A;  5GAO n;  4O5V A;  3EFO B;  4B9X A;  4JLG A;  4X34 A;  4JS4 A;  2FB7 A;  2K2M A;  3VS6 A;  3OYY A;  3UA6 A;  2NYS A;  3JCM c;  4A4G A;  1IB8 A;  4UC4 A;  3RBB B;  2MMP A;  5M9O A;  5EG2 A;  1UHC A;  4RTY A;  1BI1 A;  1G8X A;  3X28 B;  1MUZ A;  4N4H A;  1NBE B;  2OAU A;  2XKO C;  1X6B A;  4IUP A;  1M1K U;  5IHK A;  2L3R A;  2EAY A;  3CD6 A;  1OOT A;  2DNU A;  2L0A A;  3OBW A;  5GAN f;  1QWE A;  3RDV A;  3LLR A;  3CD6 T;  1K73 R;  1XNI A;  1Y07 A;  4M7D A;  3CME A;  1UTI A;  1IZ6 A;  1P92 A;  3REB B;  3I5S A;  1JBM A;  1ZSZ C;  4MML A;  4JPB W;  5ECA A;  1GCQ A;  3OYM A;  1N9R A;  3CME T;  1NJI R;  2LNV A;  2RK2 A;  1Q7Y C;  3I55 Q;  1Q95 G;  1FMW A;  3SDZ A;  1WFW A;  3QWX X;  4KGV B;  2AIR B;  2QDY B;  1SEM A;  3MP8 A;  2CZ6 B;  4JUV A;  2JTM A;  2H3E B;  3CCE Q;  3EGX A;  3G4S Q;  3OYL A;  2JMC A;  1VYV A;  1O75 A;  5GAM f;  5GAN g;  1KD1 U;  2G3R A;  2RQV A;  3AT1 B;  4M7A B;  2V8K A;  2DO3 A;  4M7A F;  4RUG A;  1JEG A;  2V8J A;  3SD4 A;  4E47 A;  3GNF B;  1R8O B;  5GAO r;  2HQH A;  3GLX A;  1IRE B;  9ATC B;  4C5I A;  4M7D E;  3L2Q A;  1MV0 B;  2QQA A;  4BI3 A;  1ZUY A;  1WIE A;  2VXE A;  4PJO D;  4C5E A;  1NLP C;  2F69 A;  2RHZ A;  2E6Z A;  4Z88 A;  3V7C A;  2KAF A;  2MWO A;  1KQ1 A;  4XTZ A;  5GAO m;  1JU5 C;  2VGN A;  1RAF B;  2HSE B;  4C5G A;  3OW2 A;  2L2P A;  2A3L A;  3MO8 A;  1R0B G;  3MEW A;  3T9N A;  4FYX B;  2RMO A;  2IVW A;  2EGE A;  4Z02 A;  1WI7 A;  1BIA A;  1E6H A;  5GAM g;  1W1F A;  1TSF A;  4EMH A;  1YI2 A;  2EBP A;  2MF2 A;  3HSB A;  1NPR A;  1H92 A;  1PKS A;  4P5N A;  4Y92 A;  3L1A A;  1YI2 T;  4FYW B;  4M78 D;  3A8G B;  2XU8 A;  1GFD A;  5CK9 A;  5KYW A;  5CKD A;  4F16 A;  4DOV A;  4F14 A;  2QAS A;  2DER A;  4A63 B;  2KI7 A;  1TWB A;  3OW2 S;  1TUC A;  2JUF A;  1KG1 A;  2QTV A;  4M75 E;  2R58 A;  2F2V A;  3OYG A;  1VQO Q;  2QYZ A;  2DEQ A;  2KE9 A;  2E65 A;  3EGD A;  1T3L A;  2M16 A;  2LQK A;  4EDU A;  2D8J A;  1N8R C;  1X2Q A;  4FYY B;  3JAM E;  1AEY A;  1M8V A;  4AT1 B;  1SG5 A;  2FPD A;  5GJV B;  2MI6 A;  3TU4 K;  2EWN A;  2ZZD A;  1Y57 A;  3V7S A;  3JB9 I;  4J9B A;  4AFS C;  3OYI A;  2ZCF B;  1M3C A;  1YP5 A;  5GMK m;  1UHF A;  1VIE A;  1T3S A;  2V1R A;  5DLO A;  1BI3 A;  2QA4 A;  5GAN e;  5GAN j;  5KYN A;  1OU9 A;  1NLO C;  2QA4 T;  3BDU A;  3CC4 Q;  2ZPI B;  3PVQ A;  1VQ9 A;  1FX7 A;  1SHG A;  2YRD A;  2KVQ G;  2ZPB B;  2RQU A;  1U06 A;  1K73 U;  1H3H A;  2LQW A;  1VQ9 T;  1QVG A;  1IO6 A;  4HVU A;  4M7D F;  2OTJ A;  3UWN A;  5GAN 4;  3HPW A;  2E3I A;  2PU9 B;  1NJI U;  3N5B B;  2HEQ A;  2H3J A;  4KRT A;  1WQ7 A;  2EJF A;  2OTJ T;  4DEX A;  1OZ2 A;  1WHL A;  4M77 G;  2NUT A;  1KFZ A;  2LX9 A;  1IXD A;  4M7A D;  4C92 E;  5CIU A;  5GAM j;  1ZLM A;  3NTK A;  4Y28 E;  3EGX B;  3VUB A;  3M0S A;  2HD0 A;  4IUR A;  5IH2 A;  1TOV A;  4M77 C;  4EMK A;  3EFS A;  2CZ1 B;  1QVG S;  5FU7 C;  3SWN C;  2JMA A;  2JW4 A;  5HK3 A;  2YWW A;  2J6K A;  2EPD A;  2HMA A;  1B34 A;  4QQD A;  4FU6 A;  2AKK A;  2VWF A;  3J81 E;  1OV3 A;  4HT8 A;  6AT1 B;  2M0O A;  2ZAE A;  2EJG A;  1KK7 A;  2BE9 B;  4YTL A;  1VQN Q;  1D0Z A;  1NG2 A;  2CZ0 B;  2KYB A;  5KH6 A;  2X4X A;  1WHH A;  4RCC A;  2XDD A;  5FU6 B;  1WPY A;  1JB0 E;  4J9C A;  1WA7 A;  5GAM d;  1FYN A;  1X27 A;  1WQW A;  4XK8 E;  4ZGD B;  1G83 A;  2DZC A;  3H8Z A;  5FRO A;  5IXB A;  2M0Y A;  2SRC A;  3OS1 A;  1I5O B;  1M4Z A;  1WHK A;  1K1Z A;  1JRI A;  4D8K A;  3PMT A;  1VQ9 Q;  5GAO q;  3OYK A;  4CRI A;  2DMO A;  2V8I A;  1C6V X;  4M75 G;  2RHI A;  1EZZ B;  1Z9Z A;  4E7H A;  3OYA A;  1PNJ A;  1B7T A;  2LZ6 B;  4PL6 A;  4PJJ A;  1J3T A;  3M0R A;  1EX4 A;  1W6X A;  4ELZ C;  4AFQ C;  3AHU A;  3CC7 A;  4RTU A;  5LJ3 e;  2WSE E;  4JRQ A;  4M75 C;  3RER A;  2RJF A;  3BY7 A;  3SB2 A;  1VUB A;  1ZBJ A;  2ZPE B;  3CC7 T;  4KH0 B;  2RJE A;  2EFI A;  5GAN 3;  2GTJ A;  5LJ5 f;  4X1V A;  3G7Z A;  3M4G A;  3GF5 A;  2FO0 A;  2QXF A;  1ZSZ A;  4IUV A;  2KNB B;  4J7I A;  1HJD A;  3CPF A;  1RL2 A;  4ATO A;  1M90 C;  3M54 A;  2M1H A;  3M0U A;  1I0C A;  3LX7 A;  1FMV A;  3RNJ A;  4WTO B;  4XTV A;  1M3B A;  2FYK A;  5I21 A;  2SEM A;  2HBP A;  2WAC A;  1VYU A;  2DJZ A;  4LXC A;  4CC7 A;  1Q81 U;  4MZT A;  4RG8 A;  1IRX A;  2BZY A;  4C92 F;  4N0A A;  5LJ3 h;  4KUI A;  5LJ5 g;  1VIF A;  2BE7 D;  1YFN A;  2Y4Y A;  3P8D A;  4RTX A;  4M7D D;  1X6G A;  2LQ8 A;  2E10 A;  3S3M A;  4A4K A;  3QJ6 A;  1WX6 A;  2A08 A;  4AFU C;  2W0Z A;  5DM7 R;  3JCM Q;  2L89 A;  1WYX A;  2YUN A;  3CCR A;  1D0Y A;  2LJ3 A;  3CPW P;  1W4S A;  4A53 A;  4RKU E;  1UGQ B;  2PUO B;  1NEB A;  2CP2 A;  3JB9 F;  2E5Q A;  3CCR T;  1ZUU A;  1RUW A;  1ABQ A;  2RHU A;  3P8B B;  3ZEH A;  3GIB A;  3RKX A;  1NPP A;  3C94 A;  1M2V A;  4VUB A;  4DEY A;  3I35 A;  3MEA A;  5IXF A;  1VOM A;  2LCS A;  4HCZ A;  1OZ3 A;  1QCN A;  2JNG A;  4KH1 B;  4GY5 A;  5CAI A;  2QQB A;  1RAD B;  2A28 A;  5C6S A;  2D1X A;  1LVK A;  2EYZ A;  3SFM A;  1RLP C;  3OYC A;  1PRM C;  3RMS A;  3H0F A;  3VS5 A;  1WNL A;  2JOY A;  2ROL A;  1WZO A;  5DY9 A;  3CXC P;  5CQY A;  2ROT A;  1B34 B;  3QZ5 B;  2O4X A;  4JRP A;  3A8H B;  2OAW A;  5D6W A;  3DLL A;  5HK0 A;  2RPN A;  4C5H A;  1QQJ A;  1E7O A;  3CCL A;  3OYE A;  1D0X A;  2DD4 A;  2ESW A;  1YJN Q;  1YHQ Q;  1MND A;  4PJM A;  2X51 A;  3C95 A;  2CUB A;  3WVE B;  4A54 A;  3CCL T;  5FRM A;  3JCM f;  3OYH A;  3HTR A;  1WXT A;  4JRI A;  4IUT A;  2X4J A;  1S72 A;  2ECZ A;  1X69 A;  1D1A A;  1KHC A;  1U1T A;  2RK1 A;  3ASK A;  2DL3 A;  4KT0 E;  4LDW A;  1S72 T;  5J3B A;  1VQ4 A;  4LD6 A;  1WJR A;  4PJL A;  4AG1 C;  4BY6 B;  1W2B P;  2BTT A;  1YWO A;  1BKB A;  3J80 E;  1LOJ A;  1MHN A;  1KC8 U;  3UDC A;  2IIM A;  2GNC A;  1VQ4 T;  3PNW C;  3QYG B;  3VRZ A;  3P8H A;  3PGG A;  4BUG A;  1IGQ A;  1N9S A;  4QVD A;  2JVV A;  2RHX A;  1UEC A;  3LWI A;  2HQX A;  1RLQ C;  4M78 B;  4F7U G;  4OMP A;  3PIP A;  3CCU Q;  1VQ5 A;  3JCM g;  3CCQ A;  1QP2 A;  2EQI A;  3LGL A;  1QWF A;  1BB9 A;  1I07 A;  1EIF A;  2DPP B;  3VV0 A;  5LJ5 j;  1VQ5 T;  3CCQ T;  5GMK h;  3CEY A;  3JCM X;  3X25 B;  1TXQ A;  1SRM A;  2FRW A;  2DET A;  1E6G A;  2K6D A;  2LT1 A;  1FXX A;  4PFO A;  3MKD A;  2M02 A;  1ZSZ B;  1UG1 A;  4MZM A;  3FJ5 A;  3CXC A;  3I56 Q;  4XU3 A;  3M0Q A;  1G3S A;  1Q82 U;  1BIB A;  3QUI A;  5I11 A;  1BBZ A;  1MMN A;  4X9D A;  3GBQ A;  2BZ8 A;  2CZ7 B;  2VC8 A;  4OB3 B;  3L2W A;  2PTK A;  4C0D C;  2DD5 A;  2MPX C;  3CBP A;  3Q1J A;  3UAT A;  4M77 A;  1FWZ A;  2COZ A;  2CSQ A;  1OYX A;  3SWN A;  2B86 A;  5GAN 7;  3EHQ A;  5LJ5 d;  3DB3 A;  4IIM A;  3RES A;  2DVE A;  1X01 A;  5FWB A;  1CKA A;  2GF7 A;  1K0X A;  1BU1 A;  4JZ3 A;  4A4H A;  4A4E A;  2X4W A;  3JB9 D;  2QEX Q;  1M27 C;  5GAN 2;  2CT3 A;  3NGP A;  2DAQ A;  4C8Q G;  3CCV A;  3M0T A;  4N4G A;  1VQ4 Q;  4ME7 A;  3PTA A;  3M55 A;  1QVF A;  3VYG A;  1K8A C;  1M90 R;  2LVM A;  3CCV T;  1OU8 A;  4BI8 B;  3HRT A;  1PRL C;  4C8Q C;  3VS0 A;  4LUD A;  1YJ9 A;  1QP3 A;  2D9T A;  3QDF A;  1M2V B;  1N27 A;  2CH4 W;  5CR2 A;  4RMO A;  3O5Z A;  2COY A;  1ZX6 A;  4F04 B;  1YJ9 T;  1YN8 A;  4M77 E;  2ZPF B;  1AOJ A;  2RD1 A;  4Z89 A;  4QQG A;  4J7F A;  1RAB B;  1ZHI A;  3OS0 A;  3QYH B;  4A4F A;  2RQR A;  4IUQ A;  2AZS A;  3E9F A;  1QVF S;  3NHN A;  2RJC A;  1Q86 R;  2K5F A;  2FZK B;  3H9N A;  4ESR A;  2O4X B;  2BUD A;  2F1L A;  1QW1 A;  1QKW A;  3A5Z B;  5KYY B;  3FJP A;  4RTT A;  1PG5 B;  5FLX E;  4M75 A;  2BZX A;  3CBM A;  3WVD B;  3PE0 A;  5CCA A;  2RH2 A;  1MV3 A;  2DIG A;  2KRS A;  4EPC A;  1R77 A;  3MEU A;  1R0C B;  2MWP A;  2V26 A;  1D09 B;  1D3B B;  3D7S B;  3FLG A;  1VQ6 A;  3HL8 A;  4PFP A;  1TUD A;  3VS7 A;  5KCO A;  4JJN K;  2EYW A;  4CC4 B;  1VQ6 T;  2GQV A;  2RA2 A;  3CD6 Q;  2J6F A;  1H8K A;  1MMA A;  5FW9 A;  4OGE A;  2AK5 A;  4M7A G;  1SHF A;  3CME Q;  1G3Y A;  5KE2 A;  1YJW A;  2KT8 A;  2Y90 A;  2A37 A;  1U5S A;  4PK4 A;  4ORZ A;  3JCM d;  4KUL A;  1GBQ A;  2VAS A;  1YJW T; 
#chains in the Genus database with same CATH homology
 2HL3 A;  1LPL A;  4B6M A;  2CP7 A;  1TOV A;  2COW A;  2CP6 A;  2CP0 A;  2CP3 A;  1WHL A;  1TXQ A;  1WHH A;  3RDV A;  2HQH A;  2E3H A;  1IXD A;  2HKQ B;  2E4H A;  1WHM A;  2COY A;  3TQ7 P;  2Z0W A;  2MPX C;  3E2U A;  2M02 A;  2HL5 C;  1WHJ A;  1WHG A;  2QK0 A;  2HKN A;  2CP2 A;  2E3I A;  2CP5 A;  1WHK A;  2COZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...