1TXQA

Crystal structure of the eb1 c-terminal domain complexed with the cap-gly domain of p150glued
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
74
structure length
74
Chain Sequence
RPLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dynactin 1
publication title Structural Basis for the Activation of Microtubule Assembly by the EB1 and p150(Glued) Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/protein binding
total genus 13
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2004-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 1txqA00
2E3HA 2M02A 1WHHA 2COWA 2COYA 2HL5C 3RDVA 2HKNA 1WHLA 1TXQA 3TQ7P 2CP3A 2HQHA 2E3IA 2CP0A 2HL3A 1WHGA 2CP7A 2CP6A 2CP5A 1TOVA 2E4HA 2Z0WA 1IXDA 1WHJA 4B6MA 2COZA 2MPXC 2CP2A 1LPLA 3E2UA 1WHKA 2HKQB 1WHMA 2QK0A
chains in the Genus database with same CATH superfamily
2EKOA 1UTIA 3MEVA 4R56A 4OMNA 1OU8A 3H0IA 3TSZA 1LNXA 5KYNA 2M51A 2NUPB 3OW2S 2K9GA 3NTKA 1WHGA 1OOTA 1WQ7A 4OP0A 2DETA 2JN0A 3OYLA 1ZA2B 3EH2A 1UFFA 3VYGA 4AG2C 5GANh 3OBWA 4ANJA 1G5VA 1KC8R 2A3LA 2NUPA 4X1VA 4O6JA 3REBB 1U8RA 2RI5A 4ZTFA 1QKWA 3DB3A 1M8VA 2ZGWA 4JJDA 2DXUA 4LN2A 1X01A 2CP0A 1RADB 3KUFA 4LE9A 4EDUA 2GTOA 2X4XA 1PRLC 4B6MA 1UE9A 4EMKA 2MMPA 2HSPA 1VQ9A 4HCZA 1YJWQ 2P4TA 1OU9A 3OS2A 1M2OA 4C92G 9ATCB 2DNUA 1Y07A 1YJWT 2YT6A 3CD6Q 1O9SA 1NJIU 1KQ1A 1K1ZA 2RI3A 2C0OA 5GAMf 1MNEA 4PJLA 3CD6T 1WDXA 1TU0B 2EBPA 1WZOA 1YJNQ 1WPYA 3CXCP 1VQ6Q 2V8IA 3HRUA 4X9DA 5GAOr 3OYAA 1WXBA 1YJNT 3F70A 2EAYA 2D0QB 2DBMA 1ACMB 2CSQA 4M7DA 2X3XD 1KD1C 1R0BG 2DM1A 1ZSZC 4RTYA 1Y96B 3EHQA 1NE8A 4M77G 1NPRA 2Y4XA 2I0NA 5GAMd 1UHFA 1JB0E 5DLOA 2QA4T 4M78B 3M5AA 2LX9A 1ABQA 1B7TA 1UGQB 3MP6A 3JB9I 1IHVA 1VQ7Q 1Y96A 4C0DB 1SSHA 3JB9J 4C92C 2RJCA 4KGVB 5LJ5h 1VQ7T 1FWZA 3EG9A 1QW1A 3M53A 5GAN2 2K5LA 4JLIA 2LNHB 2RQTA 4OF1A 2OI3A 4CRIA 3MP8A 5IHIA 4HVWA 2FZGB 3M57A 3QDFA 1K9MU 2R5MA 2DPPB 2BZ8A 1Y0MA 2EJFA 4FYXB 4HCCA 4IIMA 3PIOA 2VXEA 1VYUA 8ATCB 3VUBA 1YBYA 2EGCA 4PLLA 1NG2A 2BE7D 5GMKl 1E7OA 4M77C 1GL5A 2KK4A 4BI4A 4C92D 2GQVA 2GFAA 1D1BA 3G1JA 1IB8A 1FMVA 3CCMA 2DFUA 4ZTJA 2YWWA 4RTUA 4X9CA 2HBPA 2HQHA 1Q81R 3E9GA 3JB9F 5CR2A 3FC3A 4BDYA 1MHNA 5J3BA 3RIRA 2DJQA 3A98A 1J3TA 2FPFA 2XG8D 1BBZA 5GANj 1XJWB 2EWNA 4TVRA 2O01E 2P4RA 4C5IA 3PMTA 2F69A 3P8BB 2MWOA 2ZPIB 4M77D 2WSEE 1K8AR 3H6ZA 3MEUA 4F7UF 1JBMA 4KH1B 2OTLA 3OS1A 1P92A 1WIEA 2CZ7B 3I9QA 4J9CA 3MKDA 2CP7A 2DL4A 2LDMA 4F14A 1SPKA 2HNIA 2DYBA 3SHWA 2E6NA 2L3SA 3L2ZA 3OS0A 1QP3A 1VQMQ 4DA4A 3CXCS 2QTVA 1Q82C 4J7FA 3CEYA 2DRMA 2JUFA 3NTIA 1WHLA 5LJ3h 3TQ7P 2JJ9A 1VQMT 4OMQA 2RHYA 3X26B 2W0ZA 2J7IA 2EJ9A 3LWHA 4HVUA 2VGMA 3MHXA 4M78E 2EQIA 2VVKA 2QK0A 3OYJA 1K73R 4FL6A 3J81E 2H3EB 2Y90A 3WXMB 5FU7C 3BY7A 3R6NA 1VOMA 5KYXA 4M7AF 1G3SA 2QASA 2JM9A 1YJ9A 2CDTA 2KYMA 3FDRA 2M1HA 3CQTA 1YI2Q 2HKQB 2QAZA 4ORZA 3M58A 3OMCA 1RAEB 3GLXA 2QYZA 1R0CB 5LJ5j 1YI2T 1OV3A 4KGXB 4HCKA 1Y57A 3OQ5A 4JRKA 3JSCA 3CCQQ 4J83A 1M3AA 3HRSA 3QZ9B 1X6GA 2E6ZA 1M1KU 3CPWP 1M90R 3CCQT 3DLMA 5A2QE 2BE9B 4DBRA 2LCSA 2AZVA 4C0FA 1YIJQ 3V8LA 5CKDA 4FT4A 2E3IA 1WJRA 4B9WA 2L89A 4DQ2A 4O5VA 3GBQA 5I2MA 4AFSC 2A7YA 3PE0A 4ZGEB 2GBQA 4XTUA 2E12A 2RB6A 4OMFB 3A5ZB 2EJGA 1BCMA 3PFSA 1Q7YC 3CMAQ 2DVJA 4F7UA 4MMKA 2CZ0B 4A53A 4C8QB 2XK0A 2R5AA 3PIPA 1K8AC 3JCMe 1YNZA 2QQSA 3CMAT 1UG1A 3CMEA 2DXBA 2XICA 3UDCA 4F17A 3OYYA 1QLYA 2YSQA 1AWJA 3BDLA 1OZ3A 1UGSB 3M0QA 4J7IA 4J9GA 2JS0A 1H3HA 2L5QA 2X3WD 5GAN4 4XTWA 4JRIA 3ZBDA 4M7DG 2ECZA 3RKWA 1MMGA 4M7AB 3KFVA 5IH2A 2E41A 1SHFA 1V76A 2QTXA 3L2QA 5ECAA 1FX7A 1GRIA 2CH4W 1U1SA 2HEQA 3OYBA 3I55Q 5LJ3j 4FM4B 2DTIA 3OYNA 1D09B 3VYHB 1YWPA 3G6ET 4M7AA 1PRMC 1KG1A 3C4SA 2EQJA 2JMAA 2F2WA 3D7SB 1Q95G 3HKSA 4QQGA 1NEBA 3G71A 2EGEA 4JZ4A 4BD3A 2CH4A 2EQUA 1NJIR 1ZUYA 5A0LA 3VU3C 2O88A 3G4SA 2L2PA 2IVWA 1RLQC 2EQKA 4PJJA 3CCEQ 2RJFA 1WNLA 3URGA 1BI0A 1QCOA 1KHCA 4NS5A 4UC4A 3CCLQ 4DOVA 1H641 3M0SA 5GANe 4PFZA 3LGFA 1YHQA 2D8HA 4IUPA 5GAOq 3NHNA 3CCLT 2HSEB 3VV0A 2RA2A 1W2BP 2XHCA 5KYUB 3SWNB 1CKAA 2OTJA 2L8DA 3QYHB 2QQ9A 3VRYA 1RABB 4GY5A 4GBQA 4C5EA 2DERA 1Z9ZA 1TSFA 1D0ZA 2CT4A 3R6OA 1KQSP 2DX1A 1FMKA 3VS4A 2NUTB 2CUBA 3CC4A 2K7AA 4OVAA 1V1CA 5KYUA 1VIEA 2V8JA 1ZA1B 3H8ZA 4F16A 1VQNQ 4M7DD 2XI9A 4M78C 4C8QE 4KUIA 4D6WA 4DEYA 1VQNT 2MCNA 3CCUA 3GP8A 1I5LA 3HFNA 4Z8AA 4A4EA 2KE9A 1YITQ 2DD5A 3CCJQ 3VJPA 1SRLA 3PVQA 4DBQA 1SF9A 2J06A 1K9MR 1MUZA 4JS4A 1FYNA 5HCKA 2KT1A 2VWFA 3ZFJA 1NM7A 2KRNA 5HKCA 2FVUA 1GXIE 2KI7A 3FRNA 3QG1A 2RK1A 3HSBA 4M7AE 2CP5A 4IKFA 2C0TA 4CC2A 2KQWA 1VIFA 1Z9QA 2K5FA 5FROA 4LDYA 3CCVA 5AT1B 2M9UA 2XU8A 3HTRA 2DL3A 4ZN1A 3V8JA 1JU5C 5IHNA 1GBQA 4CC7A 5LJ5e 1WFWA 1BU1A 2R58A 4N4GA 2KSSA 4QT7A 1TG0A 2JM8A 2B8AA 3V8KA 2O4XA 1R77A 2DJZA 2KROA 1PHTA 2CP2A 2LZ6B 2LCCA 4OB0B 3REAB 2XDDA 3JB9H 4PJOF 4JJNK 1VQ8Q 1HD3A 4C5GA 3QUIA 3MJXA 2EKHA 5IXFA 1C0MA 1UGVA 1FMWA 2DRKA 4M78F 2FEIA 2RHUA 4LXCA 1S72A 1UGPB 3H0FA 1S1NA 1KSWA 5GAMg 3SEMA 3VRZA 4P5NA 4HCBA 2KR3A 2QXFA 1Q86U 1TTHB 3J7AF 2RQRA 5L23A 1W2BS 2V1QA 3U23A 1N9SA 3JB9G 3DKMA 1VQ4Q 3OYHA 1XTDA 4MZTA 4KUDK 2FPDA 3JCMQ 4NL3A 4MZPA 1VQ4T 5GJWB 1QVPA 2RNAA 3EGUA 1KQSS 3EFOB 4KBMB 1FXXA 4ATOA 2IIMA 3E19A 1VQ9T 4OMMA 1N8RC 1X6BA 4PK4A 4F7UG 1BCOA 5CKHA 1VQKQ 2DTHA 2E4HA 2K2MA 3KBGA 1WHJA 2WACA 1Y71A 4JUVA 1VQKT 1GFDA 2RQWA 4BACA 1YCSB 4QQDA 5LJ3e 1IGUA 4WTOB 4JJBA 4KGZB 1ZQ1A 3S6WA 4KRTA 1WA7A 5L8RE 3CCRQ 2JTFA 1TUCA 1I1JA 1V29B 1OPLA 2LP5A 2EIFA 3CCRT 1M1KR 3ME9A 2XD0A 4FSSA 5LL6S 4EIKA 2KY9A 2D8JA 3FIFA 2E64A 3QWXX 1WHKA 2P0QA 1RL2A 2ATCB 2DVEA 4PJOB 3MEWA 4N0AA 4M7AG 3PMIA 5EG2A 2QA4Q 2LVMA 2Y4YA 2FYKA 4RTVA 1EZZB 1OQKA 4HVVA 1YJWA 2HBWA 4IUTA 1B34B 3X25B 1IGQA 3EGDB 1YCYA 2PUOB 4PJOA 3OYCA 3CD6A 3QWYA 1M1GA 5HY6A 3M4GA 3JB9D 1A0NB 4Z88A 1E6HA 2ZPHB 2A37A 1YJNA 1N9RA 1VQ6A 3QSUA 4KH0B 4C8QC 2MI6A 4M78A 1QKXA 1PWTA 1D1AA 2DAQA 3X28B 1I4K1 1WHHA 2DEQA 2RQVA 2NYSA 3PGGA 4D8DA 1JXOA 1RI9A 2FG0A 1RAIB 2KXDA 3QJYA 3OSSC 1PD1A 1RACB 4E7LA 4RTXA 4BI3A 2KEAA 4M7AC 1QP2A 1YWOA 1VQ7A 3QYGB 3RESA 2CREA 2KRMA 1D3BB 5IAYA 2O31A 4IIOA 3OW2A 1LCKA 1W2BA 1KC8C 1ABOA 1PSFA 3CPFA 2LQNA 3CC2Q 2JS2A 4JJCA 3OA6A 2L3QA 1EFNA 1KQSA 3CC2T 1X2QA 3RMSA 2L3PA 4M75B 3VKIA 3M0TA 1O75A 1KD1U 4M7AD 4BUGA 2I2LA 4Z89A 5GMKm 2BKDN 2EVRA 3H0HA 4DBFA 3E9FA 1RAAB 4BY6B 2E70A 4M4ZA 1NLOC 2JXBA 1WXUA 4JPBW 4LNPA 2QQAA 1K4US 8AT1B 2CT3A 1UHCA 2E5QA 4C8QF 5FRMA 2PTKA 3VS1A 2WSFE 4PJOE 1RAGB 2D0NA 2DILA 3SWNC 1NYGA 3OYKA 5CKBA 5DLQE 1NBEB 2GQIA 2AK5A 4MDWA 2CZ6B 4J8OA 2DO3A 4A4GA 5I11A 1K9AA 4L59A 4HKEA 3GIBA 1WHMA 1UDLA 5CAIA 5GMKj 4JRPA 5KE2A 1OULA 4V2SA 3J80E 2VXFA 1PKTA 1MMAA 3OS5A 3VS6A 3CC7Q 3I5SA 3RKYA 3S3NA 2GTJA 4B9XA 4ZGDB 1VQMA 4QKUA 1QCFA 3CC7T 1OX9A 1W1FA 1QVGP 1VQLQ 1AZGB 2COWA 3A8LB 2ED0A 3FJ5A 3JCMf 1IZ6A 5FWBA 2LQ8A 1RLPC 1M8MA 2NWMA 1VQLT 1H92A 2VC8A 1VQPQ 3V7SA 3PVLA 3BW1A 1SHGA 1YP5A 1W70A 1AZEA 3M55A 2MAMA 4PJNA 2KVQG 2M0OA 1M30A 3MPUB 1VQPT 2RH2A 1RI0A 3O8VA 2GGRA 3OYFA 3CBPA 2YUOA 3T9NA 2HL3A 4ZN3A 3JCMd 2LQKA 4JZ3A 1Q81C 3NFCA 4AG1C 2DD4A 3TREA 1YI2A 4NOYA 3RNJA 1AWWA 5GAMh 1VYVA 1Q82U 2D6FA 1ZSZB 1GCPA 3LH0A 2YUQA 5J39A 1QVFP 1AOJA 4MMLA 5KYWB 2AZSA 3JCMP 4PKCC 3H9NA 3CCQA 1KJWA 5FU6C 2DZCA 2RPNA 2EPDA 2AT1B 5GAOl 3HP9A 1IO6A 2MF2A 5AYFA 3IQLA 1SRMA 1UJYA 3E2UA 1YIJA 1DJ7B 2QQRA 1SG5A 1Q86R 1XNIA 4C8QA 2LJ3A 4AFUC 2RM4A 2KDSA 4BI8B 3META 1UECA 5IN1A 1SKUB 5I22A 2LT1A 5GANf 1TOVA 1GCQC 3V7CA 1G3WA 2W10A 2DEUA 2JTMA 3L2UA 4XTZA 5CKEA 2K3XA 3BDUA 2HZYA 1PM3A 3CXCA 3CMAA 3G6EQ 1AHJB 2AHJB 2FB7A 2FRYA 3TEEA 2MYSA 3CCSQ 4PNOA 4PJOG 2LJ0A 3WVEB 1K73C 3L2RA 4M77B 2PVOB 3AT1B 2X4WA 3E1SA 3CCST 2A0FB 2DMOA 1X69A 2ZPEB 4Y92A 3I56Q 5GAN8 5GANd 3G4ST 3QJ6A 4M78G 2PQWA 2QEXQ 3OYEA 3I56T 1AWXA 5CKFA 2RF0A 3KXTA 1RUWA 4MDXA 4RTZA 2QEXT 1QVGS 3EG0A 2GCXA 4ZGJB 1K76A 1AVZC 3BE3A 2RK2A 3LWIA 4FU6A 4J5YA 3GF5A 4RG2A 4FYYB 4LUDA 3GOXA 2HQXA 4XQ3A 2CUDA 1C6VX 2LX7A 4N0AC 5KYYB 3I55A 4J9BA 1XOVA 3M9QA 1M27C 1Q7YU 5I21A 1M90C 5GAN3 4PL6A 3CPWS 3JCMb 1QQJA 3M56A 1K8AU 3QXEB 3EG3A 1QCNA 4PJOC 3JCMJ 3A8MB 4OMPA 4LDXA 2ZZDA 2GNCA 2DA9A 1UUEA 1U1TA 3SWNA 2X4YA 1XQHA 3VS0A 3I5RA 4E7ZA 5LJ5f 3LGLA 5DY9A 3M54A 5GAN5 4XTVA 4XU0A 2X4JA 4RTWA 3CCEA 1CKBA 3CCLA 4XK8E 4C0DC 4RUGA 5CK9A 1QVFS 3WVDB 1HXDA 5GAMj 2NUTA 2LRQA 2XDBA 4PJOD 1VQOQ 5GMKe 4OB1B 3H41A 5LJ5d 1KQ2A 2YUNA 1GBRA 2BTTA 1VQOT 1B3QA 2LCLA 3JV3A 2BZXA 4M78D 3OB9A 1BYMA 3EGXB 1JRIA 2DL8A 5FWCA 1VQNA 1QWFA 3NMZC 2F5TX 2K3BA 1HSQA 1M5Q1 3OSVA 3OBYA 5D6WA 2YRVA 2HL5C 5DM7R 2WSCE 2PNIA 1MV3A 2KT8A 2KRSA 3HFOA 4FW1A 4MZMA 1YITA 2EQMA 2YUPA 3CCJA 3UA7A 2Z0WA 2C06A 2DKGA 2LQWA 2DTOA 3DLLA 2L0AA 3OYDA 3LLRA 3JAME 1VQ5Q 3EHRA 2PVDB 1KD1R 2DIGA 2XMFA 3RBBB 4JDSA 1VQ5T 3GNGA 3EG2A 4XAXB 3SB2A 1BI3A 1NJIC 2VASA 2EYQA 2BUDA 5CIUA 2DLPA 4QW2A 2LC4A 1BK2A 3LYIA 1WYXA 2VUBA 3SDZA 5LJ3f 2B86A 2CSIA 1G83A 2EFIA 3JCMc 5D7UA 4BY6C 5KCHA 1ZBJA 4PJMA 4ESRA 2E5KA 5IHKA 1QVGA 1LVKA 5HK0A 3RUXA 1NEGA 1PKSA 2A08A 2MOXA 1T3LA 1VYTA 4JS5A 2ABLA 2V1RA 3HPWA 2HQEA 4ELZC 2EYWA 4EMHA 2FRWA 3BFMA 3EFRA 3L1AA 3EH1A 4R0KA 1VQ9Q 5LJ3d 4J9HA 2ZPFB 1VQ8A 3CPWA 5A0DA 2F2VA 1ZSGA 4XTYA 4N4HA 1GCQA 2GF7A 3OMGA 4Q5WA 3JCMW 4OB3B 5D6YA 4RCBA 2J6FA 2CP6A 2MK5A 1I0CA 2K4YA 2BIVA 4RKUE 2PU9B 3FB9A 2H3JA 2O9VA 2EGAA 2J6KA 2ZPBB 3EFOA 4EMKB 2K3YA 4IUUA 3MEAA 1K9MC 3ER0A 4C8QG 2ESWA 2XDPA 4J9IA 1QVFA 1VQ4A 4E7KA 1Y7XA 5C0MA 3PTAA 1U5SA 3RR6A 2CKKA 3RDVA 3L2WA 3HRTA 1OYXA 4PFPA 4PFOA 4A4HA 4M75F 3VS2A 3S3OA 2RHZA 3X20B 3CBMA 1AEYA 5CQXA 5GMKh 2RHIA 3C95A 4M7DB 1VQKA 3Q1JA 5GAN7 1T3SA 1YFNA 4BE0A 2A28A 4HA8A 1X6OA 4E7HA 1TS9A 3A8HB 2DIQA 1Q82R 4HT8A 1BB9A 3M59A 5KH6A 4GLKA 1HK9A 1VQ6T 2OAWA 1YN8A 4YTLA 2DE0X 3I35A 1MMDA 3NPFA 3CCRA 6AT1B 3OYGA 2ENMA 1N5ZA 1W6XA 3AHUA 2E1HA 2RJDA 1KK7A 1K0XA 4AMCA 5FW9A 1IRXA 4E7JA 4CC4B 1CSKA 5J26A 3LH5A 1AWOA 3M0PA 1AD5A 3EG9B 1WQWA 1WXTA 4CI0C 1IHWA 1B34A 3EGDA 5KCOA 4R55A 1JJ2P 3CCMQ 4J6WA 2RJEA 1N8RU 2RHXA 3VS7A 4J6XA 2QA4A 3VS5A 4N4IA 3QKJA 3CCMT 2ZCFB 4FYVB 2PVGB 3NGPA 2VB6A 3MCAB 3A8OB 5GAMe 2VYTA 3ULRB 2JTEA 2YRCA 4FW2A 4C8QD 4C0ZA 4Z02A 4FIBA 2NUZA 4L6V5 4RMOA 2MIOA 1I07A 2JZ2A 1OI1A 1BIBA 3N5BB 1TWBA 1JQQA 2JNGA 1SSFA 2CYZB 3C12A 4GLMA 2OTLQ 3VUZA 3L2VA 2CGHA 5GJVB 2MPXC 1WLPB 2OTLT 1WJQA 1G8XA 1D3BA 2FL7A 1E6GA 2J6OA 1RAHB 4RCCA 2DXCA 2K2VA 1QMCA 1ZLMA 3FLGA 1MNDA 5CVIA 2QQBA 3MO8A 1ZX6A 2F2XA 2KYBA 4XU1A 1PCXA 2ROLA 2YLBA 3JCMg 2BZYA 1Q7YR 1N6AA 2RO0A 4L5GA 1M1KC 3HL8A 2SEMA 4M75A 2JVVA 2P0KA 3C0CA 4M7DE 1HYOA 1WJSA 3CC2A 3OYIA 2JT4A 3QHSA 1LOJA 1M1FA 2RD1A 1YJ9Q 2LMJA 1ZUUA 4IUQA 4C92F 1M2VB 3RERA 4BE1A 1YJ9T 1T0JA 2COYA 2FPEA 5IXBA 4BE2A 1B07A 2F1LA 4X34A 1WX6A 4C0GA 5KYXB 2DXTA 2KGTA 2OAUA 2HD0A 1M2VA 3THKA 4FCYA 1I5OB 2DYIA 1G3YA 2M02A 3M0RA 1UJ0A 3UPUA 1KIKA 4JRQA 4E47A 1KC8U 2V8KA 4E6RA 4M77F 2EYXA 2VGNA 3TSWA 2R57A 1JJ2S 3M4YA 5A0GA 1TUDA 2K6DA 2KAFA 3EAEA 4DOWA 1JEGA 2RQUA 4XU2A 2SRCA 7AT1B 1PC0A 2CZ1B 5GANg 3CBOA 2JW4A 3RMQA 3V7RA 1D0YA 3FJPA 1QWEA 3CC7A 4OMOA 2RI2A 2H8HA 2AIRB 3QO3A 2YLCA 4EPCA 4WCIA 5GMKi 3CMEQ 3VS3A 2EYYA 3ZL7C 2FZCB 4IURA 2COZA 3GNFB 4J6YA 1VQLA 4RG8A 3CMET 1F1BB 2K5IA 1X27A 1AT1B 4OB2B 4M75E 2GFUA 3X24B 4F7UB 1VQPA 1BI2A 1YIJT 2KNBB 2PUKB 4QVDA 2G3RA 2P84A 4Y91A 3QZ5B 1MGQA 2O2OA 3UA6A 4LD9K 4LDUA 2EYZA 1C1AA 2DL5A 2D1XA 4E2FB 2IG0A 4FSXA 3GPLA 1ZSZA 4J9FA 2LJ1A 1ZUKA 4C92B 2PZ1A 1LJOA 4VUBA 5KYWA 2HKNA 2X51A 3A8GB 3PNWC 1BIAA 1I8FA 3UWNA 1JXMA 1TUGB 2NLUA 4ME7A 3RKXA 5I2SA 1R8OB 1TH7A 3QDRB 2A36A 5IT9E 2ZPGB 4C92A 3QBYA 1PSEA 4J9EA 2LNVA 1OZ2A 3EFSA 3G71Q 2F5KA 2AKLA 2CP3A 4LDWA 2KBTA 2ED1A 2HDAA 2E65A 3JCMX 5GAOm 3G71T 4RTTA 3G4SQ 1U3OA 5LJ5g 1D1CA 2LT4A 5GAN6 2E10A 3PT9A 3JCMV 1OX8A 1UEBA 1PD0A 4DBHA 2X35A 3QIIA 1N27A 1YHQQ 5M9OA 4HT9A 1WI7A 4ZNXA 1M3CA 1RAFB 4EMKC 2HCKA 2DF6A 4M77A 3I55T 5D6XA 3MP1A 1YHQT 1G3TA 1UGRB 2HAXA 4AT1B 1Q81U 2OTJQ 3TU4K 4PLIA 3UT1A 5CO7A 1I81A 4II1A 2OTJT 3G6EA 2KMTA 3UATA 1K0SA 3ASKA 3TCJA 4F04B 2FHDA 1UB4A 4QQ6A 3TVTA 4DEXA 3CCSA 5GAOn 3CC4Q 3C94A 1HJDA 3CC4T 4BDZA 1JJ2A 3LW5E 4J9DA 3CCUQ 3I56A 4M7DC 1H8KA 1EX4A 2ROTA 5KYYA 1OEBA 2C0IA 2QEXA 1ZHIA 4XU3A 3CCET 2YRDA 2KXCA 3CCUT 5EC7A 4KT0E 3OW2P 1KFZA 5CCAA 4FYWB 2J05A 3FEOA 5HK3A 2JOYA 2ZAEA 5FRNA 1X43A 2YDLA 4F7UE 2RN8A 1VA7A 1T0HA 2OX7A 2YXYA 3SD4A 4XTXA 1NZ9A 3OY9A 4OMLA 4AFZC 4LD6A 3NTHA 4OGCA 1H3ZA 4IUVA 2QG9B 5FU7B 1LPLA 1NPPA 3CCVQ 4A63B 4BB7A 1N8RR 1SEMA 2DBKA 4C92E 2LTOA 5FLXE 1K73U 4M75G 1BKBA 1TXQA 3CCVT 1IREB 4WF2A 1GFCA 1Q86C 3P8HA 2QDYB 3INZA 1X75C 5LJ3g 1M3BA 3EG1A 1D0XA 4QVZA 1IXDA 1JO8A 5GAOp 1M4ZA 4JLGA 4LUEA 4AFQC 4A54A 2QI2A 2HMAA 3LX7A 1YITT 3UF4A 4EMGA 3CCJT 2M16A 2XKOC 4C5HA 2G6FX 2MWPA 1ARKA 2RMOA 1KHIA 1MV0B 3SFMA 2DZ9A 2OJ2A 1U06A 4M77E 4NL2A 1W4SA 2DL7A 3EGXA 4E7IA 4LDVA 3JCMh 2VKNA 1MMNA 2O9SA 2FZKB 2O4XB 1OPKA 1VQOA 1NLPC 2JMCA 2M0YA 4D8KA 1M90U 2E3HA 1M9SA 1S72Q 4M7DF 4KULA 3O5ZA 1NYFA 2QGFB 5C6SA 3S3MA 2AKKA 2IPOB 3DB4A 3OYMA 1PG5B 1WGSA 3M0UA 1S72T 4M75C 3L42A 4OGEA 2XIDA 4HXJA 3G7ZA 2EW3A 2P0PA 1VUBA 1X2KA 4E7SA 4A4FA 4CC3A 4Y28E 4K11A 2YHTA 5FU6B 3P8DA 1G2BA 2FO0A 2D9TA 1PNJA 3QPHA 2L3RA 2K57A 1BI1A 3HHTB 3ZEHA 2V26A 4QVCA 4FT2A 2K79A 1ZBXA 3A1PA 1VQ8T 2QGGA 2QDLA 1VQ5A 4ELYC 2CS7A 2X9HA 2VV5A 2DK3A 5KE3A 1EIFA 4M75D 4A4KA 3JRZA 5CQYA
chains in the Genus database with same CATH topology
2E3HA 2M02A 1WHHA 2COWA 2COYA 2HL5C 3RDVA 2HKNA 1WHLA 1TXQA 3TQ7P 2CP3A 2HQHA 2E3IA 2CP0A 2HL3A 1WHGA 2CP7A 2CP6A 2CP5A 1TOVA 2E4HA 2Z0WA 1IXDA 1WHJA 4B6MA 2COZA 2MPXC 2CP2A 1LPLA 3E2UA 1WHKA 2HKQB 1WHMA 2QK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E3H A;  2M02 A;  1WHH A;  2COW A;  2COY A;  2HL5 C;  3RDV A;  2HKN A;  1WHL A;  1TXQ A;  3TQ7 P;  2CP3 A;  2HQH A;  2E3I A;  2CP0 A;  2HL3 A;  1WHG A;  2CP7 A;  2CP6 A;  2CP5 A;  1TOV A;  2E4H A;  2Z0W A;  1IXD A;  1WHJ A;  4B6M A;  2COZ A;  2MPX C;  2CP2 A;  1LPL A;  3E2U A;  1WHK A;  2HKQ B;  1WHM A;  2QK0 A; 
#chains in the Genus database with same CATH topology
 2EKO A;  1UTI A;  3MEV A;  4R56 A;  4OMN A;  1OU8 A;  3H0I A;  3TSZ A;  1LNX A;  5KYN A;  2M51 A;  2NUP B;  3OW2 S;  2K9G A;  3NTK A;  1WHG A;  1OOT A;  1WQ7 A;  4OP0 A;  2DET A;  2JN0 A;  3OYL A;  1ZA2 B;  3EH2 A;  1UFF A;  3VYG A;  4AG2 C;  5GAN h;  3OBW A;  4ANJ A;  1G5V A;  1KC8 R;  2A3L A;  2NUP A;  4X1V A;  4O6J A;  3REB B;  1U8R A;  2RI5 A;  4ZTF A;  1QKW A;  3DB3 A;  1M8V A;  2ZGW A;  4JJD A;  2DXU A;  4LN2 A;  1X01 A;  2CP0 A;  1RAD B;  3KUF A;  4LE9 A;  4EDU A;  2GTO A;  2X4X A;  1PRL C;  4B6M A;  1UE9 A;  4EMK A;  2MMP A;  2HSP A;  1VQ9 A;  4HCZ A;  1YJW Q;  2P4T A;  1OU9 A;  3OS2 A;  1M2O A;  4C92 G;  9ATC B;  2DNU A;  1Y07 A;  1YJW T;  2YT6 A;  3CD6 Q;  1O9S A;  1NJI U;  1KQ1 A;  1K1Z A;  2RI3 A;  2C0O A;  5GAM f;  1MNE A;  4PJL A;  3CD6 T;  1WDX A;  1TU0 B;  2EBP A;  1WZO A;  1YJN Q;  1WPY A;  3CXC P;  1VQ6 Q;  2V8I A;  3HRU A;  4X9D A;  5GAO r;  3OYA A;  1WXB A;  1YJN T;  3F70 A;  2EAY A;  2D0Q B;  2DBM A;  1ACM B;  2CSQ A;  4M7D A;  2X3X D;  1KD1 C;  1R0B G;  2DM1 A;  1ZSZ C;  4RTY A;  1Y96 B;  3EHQ A;  1NE8 A;  4M77 G;  1NPR A;  2Y4X A;  2I0N A;  5GAM d;  1UHF A;  1JB0 E;  5DLO A;  2QA4 T;  4M78 B;  3M5A A;  2LX9 A;  1ABQ A;  1B7T A;  1UGQ B;  3MP6 A;  3JB9 I;  1IHV A;  1VQ7 Q;  1Y96 A;  4C0D B;  1SSH A;  3JB9 J;  4C92 C;  2RJC A;  4KGV B;  5LJ5 h;  1VQ7 T;  1FWZ A;  3EG9 A;  1QW1 A;  3M53 A;  5GAN 2;  2K5L A;  4JLI A;  2LNH B;  2RQT A;  4OF1 A;  2OI3 A;  4CRI A;  3MP8 A;  5IHI A;  4HVW A;  2FZG B;  3M57 A;  3QDF A;  1K9M U;  2R5M A;  2DPP B;  2BZ8 A;  1Y0M A;  2EJF A;  4FYX B;  4HCC A;  4IIM A;  3PIO A;  2VXE A;  1VYU A;  8ATC B;  3VUB A;  1YBY A;  2EGC A;  4PLL A;  1NG2 A;  2BE7 D;  5GMK l;  1E7O A;  4M77 C;  1GL5 A;  2KK4 A;  4BI4 A;  4C92 D;  2GQV A;  2GFA A;  1D1B A;  3G1J A;  1IB8 A;  1FMV A;  3CCM A;  2DFU A;  4ZTJ A;  2YWW A;  4RTU A;  4X9C A;  2HBP A;  2HQH A;  1Q81 R;  3E9G A;  3JB9 F;  5CR2 A;  3FC3 A;  4BDY A;  1MHN A;  5J3B A;  3RIR A;  2DJQ A;  3A98 A;  1J3T A;  2FPF A;  2XG8 D;  1BBZ A;  5GAN j;  1XJW B;  2EWN A;  4TVR A;  2O01 E;  2P4R A;  4C5I A;  3PMT A;  2F69 A;  3P8B B;  2MWO A;  2ZPI B;  4M77 D;  2WSE E;  1K8A R;  3H6Z A;  3MEU A;  4F7U F;  1JBM A;  4KH1 B;  2OTL A;  3OS1 A;  1P92 A;  1WIE A;  2CZ7 B;  3I9Q A;  4J9C A;  3MKD A;  2CP7 A;  2DL4 A;  2LDM A;  4F14 A;  1SPK A;  2HNI A;  2DYB A;  3SHW A;  2E6N A;  2L3S A;  3L2Z A;  3OS0 A;  1QP3 A;  1VQM Q;  4DA4 A;  3CXC S;  2QTV A;  1Q82 C;  4J7F A;  3CEY A;  2DRM A;  2JUF A;  3NTI A;  1WHL A;  5LJ3 h;  3TQ7 P;  2JJ9 A;  1VQM T;  4OMQ A;  2RHY A;  3X26 B;  2W0Z A;  2J7I A;  2EJ9 A;  3LWH A;  4HVU A;  2VGM A;  3MHX A;  4M78 E;  2EQI A;  2VVK A;  2QK0 A;  3OYJ A;  1K73 R;  4FL6 A;  3J81 E;  2H3E B;  2Y90 A;  3WXM B;  5FU7 C;  3BY7 A;  3R6N A;  1VOM A;  5KYX A;  4M7A F;  1G3S A;  2QAS A;  2JM9 A;  1YJ9 A;  2CDT A;  2KYM A;  3FDR A;  2M1H A;  3CQT A;  1YI2 Q;  2HKQ B;  2QAZ A;  4ORZ A;  3M58 A;  3OMC A;  1RAE B;  3GLX A;  2QYZ A;  1R0C B;  5LJ5 j;  1YI2 T;  1OV3 A;  4KGX B;  4HCK A;  1Y57 A;  3OQ5 A;  4JRK A;  3JSC A;  3CCQ Q;  4J83 A;  1M3A A;  3HRS A;  3QZ9 B;  1X6G A;  2E6Z A;  1M1K U;  3CPW P;  1M90 R;  3CCQ T;  3DLM A;  5A2Q E;  2BE9 B;  4DBR A;  2LCS A;  2AZV A;  4C0F A;  1YIJ Q;  3V8L A;  5CKD A;  4FT4 A;  2E3I A;  1WJR A;  4B9W A;  2L89 A;  4DQ2 A;  4O5V A;  3GBQ A;  5I2M A;  4AFS C;  2A7Y A;  3PE0 A;  4ZGE B;  2GBQ A;  4XTU A;  2E12 A;  2RB6 A;  4OMF B;  3A5Z B;  2EJG A;  1BCM A;  3PFS A;  1Q7Y C;  3CMA Q;  2DVJ A;  4F7U A;  4MMK A;  2CZ0 B;  4A53 A;  4C8Q B;  2XK0 A;  2R5A A;  3PIP A;  1K8A C;  3JCM e;  1YNZ A;  2QQS A;  3CMA T;  1UG1 A;  3CME A;  2DXB A;  2XIC A;  3UDC A;  4F17 A;  3OYY A;  1QLY A;  2YSQ A;  1AWJ A;  3BDL A;  1OZ3 A;  1UGS B;  3M0Q A;  4J7I A;  4J9G A;  2JS0 A;  1H3H A;  2L5Q A;  2X3W D;  5GAN 4;  4XTW A;  4JRI A;  3ZBD A;  4M7D G;  2ECZ A;  3RKW A;  1MMG A;  4M7A B;  3KFV A;  5IH2 A;  2E41 A;  1SHF A;  1V76 A;  2QTX A;  3L2Q A;  5ECA A;  1FX7 A;  1GRI A;  2CH4 W;  1U1S A;  2HEQ A;  3OYB A;  3I55 Q;  5LJ3 j;  4FM4 B;  2DTI A;  3OYN A;  1D09 B;  3VYH B;  1YWP A;  3G6E T;  4M7A A;  1PRM C;  1KG1 A;  3C4S A;  2EQJ A;  2JMA A;  2F2W A;  3D7S B;  1Q95 G;  3HKS A;  4QQG A;  1NEB A;  3G71 A;  2EGE A;  4JZ4 A;  4BD3 A;  2CH4 A;  2EQU A;  1NJI R;  1ZUY A;  5A0L A;  3VU3 C;  2O88 A;  3G4S A;  2L2P A;  2IVW A;  1RLQ C;  2EQK A;  4PJJ A;  3CCE Q;  2RJF A;  1WNL A;  3URG A;  1BI0 A;  1QCO A;  1KHC A;  4NS5 A;  4UC4 A;  3CCL Q;  4DOV A;  1H64 1;  3M0S A;  5GAN e;  4PFZ A;  3LGF A;  1YHQ A;  2D8H A;  4IUP A;  5GAO q;  3NHN A;  3CCL T;  2HSE B;  3VV0 A;  2RA2 A;  1W2B P;  2XHC A;  5KYU B;  3SWN B;  1CKA A;  2OTJ A;  2L8D A;  3QYH B;  2QQ9 A;  3VRY A;  1RAB B;  4GY5 A;  4GBQ A;  4C5E A;  2DER A;  1Z9Z A;  1TSF A;  1D0Z A;  2CT4 A;  3R6O A;  1KQS P;  2DX1 A;  1FMK A;  3VS4 A;  2NUT B;  2CUB A;  3CC4 A;  2K7A A;  4OVA A;  1V1C A;  5KYU A;  1VIE A;  2V8J A;  1ZA1 B;  3H8Z A;  4F16 A;  1VQN Q;  4M7D D;  2XI9 A;  4M78 C;  4C8Q E;  4KUI A;  4D6W A;  4DEY A;  1VQN T;  2MCN A;  3CCU A;  3GP8 A;  1I5L A;  3HFN A;  4Z8A A;  4A4E A;  2KE9 A;  1YIT Q;  2DD5 A;  3CCJ Q;  3VJP A;  1SRL A;  3PVQ A;  4DBQ A;  1SF9 A;  2J06 A;  1K9M R;  1MUZ A;  4JS4 A;  1FYN A;  5HCK A;  2KT1 A;  2VWF A;  3ZFJ A;  1NM7 A;  2KRN A;  5HKC A;  2FVU A;  1GXI E;  2KI7 A;  3FRN A;  3QG1 A;  2RK1 A;  3HSB A;  4M7A E;  2CP5 A;  4IKF A;  2C0T A;  4CC2 A;  2KQW A;  1VIF A;  1Z9Q A;  2K5F A;  5FRO A;  4LDY A;  3CCV A;  5AT1 B;  2M9U A;  2XU8 A;  3HTR A;  2DL3 A;  4ZN1 A;  3V8J A;  1JU5 C;  5IHN A;  1GBQ A;  4CC7 A;  5LJ5 e;  1WFW A;  1BU1 A;  2R58 A;  4N4G A;  2KSS A;  4QT7 A;  1TG0 A;  2JM8 A;  2B8A A;  3V8K A;  2O4X A;  1R77 A;  2DJZ A;  2KRO A;  1PHT A;  2CP2 A;  2LZ6 B;  2LCC A;  4OB0 B;  3REA B;  2XDD A;  3JB9 H;  4PJO F;  4JJN K;  1VQ8 Q;  1HD3 A;  4C5G A;  3QUI A;  3MJX A;  2EKH A;  5IXF A;  1C0M A;  1UGV A;  1FMW A;  2DRK A;  4M78 F;  2FEI A;  2RHU A;  4LXC A;  1S72 A;  1UGP B;  3H0F A;  1S1N A;  1KSW A;  5GAM g;  3SEM A;  3VRZ A;  4P5N A;  4HCB A;  2KR3 A;  2QXF A;  1Q86 U;  1TTH B;  3J7A F;  2RQR A;  5L23 A;  1W2B S;  2V1Q A;  3U23 A;  1N9S A;  3JB9 G;  3DKM A;  1VQ4 Q;  3OYH A;  1XTD A;  4MZT A;  4KUD K;  2FPD A;  3JCM Q;  4NL3 A;  4MZP A;  1VQ4 T;  5GJW B;  1QVP A;  2RNA A;  3EGU A;  1KQS S;  3EFO B;  4KBM B;  1FXX A;  4ATO A;  2IIM A;  3E19 A;  1VQ9 T;  4OMM A;  1N8R C;  1X6B A;  4PK4 A;  4F7U G;  1BCO A;  5CKH A;  1VQK Q;  2DTH A;  2E4H A;  2K2M A;  3KBG A;  1WHJ A;  2WAC A;  1Y71 A;  4JUV A;  1VQK T;  1GFD A;  2RQW A;  4BAC A;  1YCS B;  4QQD A;  5LJ3 e;  1IGU A;  4WTO B;  4JJB A;  4KGZ B;  1ZQ1 A;  3S6W A;  4KRT A;  1WA7 A;  5L8R E;  3CCR Q;  2JTF A;  1TUC A;  1I1J A;  1V29 B;  1OPL A;  2LP5 A;  2EIF A;  3CCR T;  1M1K R;  3ME9 A;  2XD0 A;  4FSS A;  5LL6 S;  4EIK A;  2KY9 A;  2D8J A;  3FIF A;  2E64 A;  3QWX X;  1WHK A;  2P0Q A;  1RL2 A;  2ATC B;  2DVE A;  4PJO B;  3MEW A;  4N0A A;  4M7A G;  3PMI A;  5EG2 A;  2QA4 Q;  2LVM A;  2Y4Y A;  2FYK A;  4RTV A;  1EZZ B;  1OQK A;  4HVV A;  1YJW A;  2HBW A;  4IUT A;  1B34 B;  3X25 B;  1IGQ A;  3EGD B;  1YCY A;  2PUO B;  4PJO A;  3OYC A;  3CD6 A;  3QWY A;  1M1G A;  5HY6 A;  3M4G A;  3JB9 D;  1A0N B;  4Z88 A;  1E6H A;  2ZPH B;  2A37 A;  1YJN A;  1N9R A;  1VQ6 A;  3QSU A;  4KH0 B;  4C8Q C;  2MI6 A;  4M78 A;  1QKX A;  1PWT A;  1D1A A;  2DAQ A;  3X28 B;  1I4K 1;  1WHH A;  2DEQ A;  2RQV A;  2NYS A;  3PGG A;  4D8D A;  1JXO A;  1RI9 A;  2FG0 A;  1RAI B;  2KXD A;  3QJY A;  3OSS C;  1PD1 A;  1RAC B;  4E7L A;  4RTX A;  4BI3 A;  2KEA A;  4M7A C;  1QP2 A;  1YWO A;  1VQ7 A;  3QYG B;  3RES A;  2CRE A;  2KRM A;  1D3B B;  5IAY A;  2O31 A;  4IIO A;  3OW2 A;  1LCK A;  1W2B A;  1KC8 C;  1ABO A;  1PSF A;  3CPF A;  2LQN A;  3CC2 Q;  2JS2 A;  4JJC A;  3OA6 A;  2L3Q A;  1EFN A;  1KQS A;  3CC2 T;  1X2Q A;  3RMS A;  2L3P A;  4M75 B;  3VKI A;  3M0T A;  1O75 A;  1KD1 U;  4M7A D;  4BUG A;  2I2L A;  4Z89 A;  5GMK m;  2BKD N;  2EVR A;  3H0H A;  4DBF A;  3E9F A;  1RAA B;  4BY6 B;  2E70 A;  4M4Z A;  1NLO C;  2JXB A;  1WXU A;  4JPB W;  4LNP A;  2QQA A;  1K4U S;  8AT1 B;  2CT3 A;  1UHC A;  2E5Q A;  4C8Q F;  5FRM A;  2PTK A;  3VS1 A;  2WSF E;  4PJO E;  1RAG B;  2D0N A;  2DIL A;  3SWN C;  1NYG A;  3OYK A;  5CKB A;  5DLQ E;  1NBE B;  2GQI A;  2AK5 A;  4MDW A;  2CZ6 B;  4J8O A;  2DO3 A;  4A4G A;  5I11 A;  1K9A A;  4L59 A;  4HKE A;  3GIB A;  1WHM A;  1UDL A;  5CAI A;  5GMK j;  4JRP A;  5KE2 A;  1OUL A;  4V2S A;  3J80 E;  2VXF A;  1PKT A;  1MMA A;  3OS5 A;  3VS6 A;  3CC7 Q;  3I5S A;  3RKY A;  3S3N A;  2GTJ A;  4B9X A;  4ZGD B;  1VQM A;  4QKU A;  1QCF A;  3CC7 T;  1OX9 A;  1W1F A;  1QVG P;  1VQL Q;  1AZG B;  2COW A;  3A8L B;  2ED0 A;  3FJ5 A;  3JCM f;  1IZ6 A;  5FWB A;  2LQ8 A;  1RLP C;  1M8M A;  2NWM A;  1VQL T;  1H92 A;  2VC8 A;  1VQP Q;  3V7S A;  3PVL A;  3BW1 A;  1SHG A;  1YP5 A;  1W70 A;  1AZE A;  3M55 A;  2MAM A;  4PJN A;  2KVQ G;  2M0O A;  1M30 A;  3MPU B;  1VQP T;  2RH2 A;  1RI0 A;  3O8V A;  2GGR A;  3OYF A;  3CBP A;  2YUO A;  3T9N A;  2HL3 A;  4ZN3 A;  3JCM d;  2LQK A;  4JZ3 A;  1Q81 C;  3NFC A;  4AG1 C;  2DD4 A;  3TRE A;  1YI2 A;  4NOY A;  3RNJ A;  1AWW A;  5GAM h;  1VYV A;  1Q82 U;  2D6F A;  1ZSZ B;  1GCP A;  3LH0 A;  2YUQ A;  5J39 A;  1QVF P;  1AOJ A;  4MML A;  5KYW B;  2AZS A;  3JCM P;  4PKC C;  3H9N A;  3CCQ A;  1KJW A;  5FU6 C;  2DZC A;  2RPN A;  2EPD A;  2AT1 B;  5GAO l;  3HP9 A;  1IO6 A;  2MF2 A;  5AYF A;  3IQL A;  1SRM A;  1UJY A;  3E2U A;  1YIJ A;  1DJ7 B;  2QQR A;  1SG5 A;  1Q86 R;  1XNI A;  4C8Q A;  2LJ3 A;  4AFU C;  2RM4 A;  2KDS A;  4BI8 B;  3MET A;  1UEC A;  5IN1 A;  1SKU B;  5I22 A;  2LT1 A;  5GAN f;  1TOV A;  1GCQ C;  3V7C A;  1G3W A;  2W10 A;  2DEU A;  2JTM A;  3L2U A;  4XTZ A;  5CKE A;  2K3X A;  3BDU A;  2HZY A;  1PM3 A;  3CXC A;  3CMA A;  3G6E Q;  1AHJ B;  2AHJ B;  2FB7 A;  2FRY A;  3TEE A;  2MYS A;  3CCS Q;  4PNO A;  4PJO G;  2LJ0 A;  3WVE B;  1K73 C;  3L2R A;  4M77 B;  2PVO B;  3AT1 B;  2X4W A;  3E1S A;  3CCS T;  2A0F B;  2DMO A;  1X69 A;  2ZPE B;  4Y92 A;  3I56 Q;  5GAN 8;  5GAN d;  3G4S T;  3QJ6 A;  4M78 G;  2PQW A;  2QEX Q;  3OYE A;  3I56 T;  1AWX A;  5CKF A;  2RF0 A;  3KXT A;  1RUW A;  4MDX A;  4RTZ A;  2QEX T;  1QVG S;  3EG0 A;  2GCX A;  4ZGJ B;  1K76 A;  1AVZ C;  3BE3 A;  2RK2 A;  3LWI A;  4FU6 A;  4J5Y A;  3GF5 A;  4RG2 A;  4FYY B;  4LUD A;  3GOX A;  2HQX A;  4XQ3 A;  2CUD A;  1C6V X;  2LX7 A;  4N0A C;  5KYY B;  3I55 A;  4J9B A;  1XOV A;  3M9Q A;  1M27 C;  1Q7Y U;  5I21 A;  1M90 C;  5GAN 3;  4PL6 A;  3CPW S;  3JCM b;  1QQJ A;  3M56 A;  1K8A U;  3QXE B;  3EG3 A;  1QCN A;  4PJO C;  3JCM J;  3A8M B;  4OMP A;  4LDX A;  2ZZD A;  2GNC A;  2DA9 A;  1UUE A;  1U1T A;  3SWN A;  2X4Y A;  1XQH A;  3VS0 A;  3I5R A;  4E7Z A;  5LJ5 f;  3LGL A;  5DY9 A;  3M54 A;  5GAN 5;  4XTV A;  4XU0 A;  2X4J A;  4RTW A;  3CCE A;  1CKB A;  3CCL A;  4XK8 E;  4C0D C;  4RUG A;  5CK9 A;  1QVF S;  3WVD B;  1HXD A;  5GAM j;  2NUT A;  2LRQ A;  2XDB A;  4PJO D;  1VQO Q;  5GMK e;  4OB1 B;  3H41 A;  5LJ5 d;  1KQ2 A;  2YUN A;  1GBR A;  2BTT A;  1VQO T;  1B3Q A;  2LCL A;  3JV3 A;  2BZX A;  4M78 D;  3OB9 A;  1BYM A;  3EGX B;  1JRI A;  2DL8 A;  5FWC A;  1VQN A;  1QWF A;  3NMZ C;  2F5T X;  2K3B A;  1HSQ A;  1M5Q 1;  3OSV A;  3OBY A;  5D6W A;  2YRV A;  2HL5 C;  5DM7 R;  2WSC E;  2PNI A;  1MV3 A;  2KT8 A;  2KRS A;  3HFO A;  4FW1 A;  4MZM A;  1YIT A;  2EQM A;  2YUP A;  3CCJ A;  3UA7 A;  2Z0W A;  2C06 A;  2DKG A;  2LQW A;  2DTO A;  3DLL A;  2L0A A;  3OYD A;  3LLR A;  3JAM E;  1VQ5 Q;  3EHR A;  2PVD B;  1KD1 R;  2DIG A;  2XMF A;  3RBB B;  4JDS A;  1VQ5 T;  3GNG A;  3EG2 A;  4XAX B;  3SB2 A;  1BI3 A;  1NJI C;  2VAS A;  2EYQ A;  2BUD A;  5CIU A;  2DLP A;  4QW2 A;  2LC4 A;  1BK2 A;  3LYI A;  1WYX A;  2VUB A;  3SDZ A;  5LJ3 f;  2B86 A;  2CSI A;  1G83 A;  2EFI A;  3JCM c;  5D7U A;  4BY6 C;  5KCH A;  1ZBJ A;  4PJM A;  4ESR A;  2E5K A;  5IHK A;  1QVG A;  1LVK A;  5HK0 A;  3RUX A;  1NEG A;  1PKS A;  2A08 A;  2MOX A;  1T3L A;  1VYT A;  4JS5 A;  2ABL A;  2V1R A;  3HPW A;  2HQE A;  4ELZ C;  2EYW A;  4EMH A;  2FRW A;  3BFM A;  3EFR A;  3L1A A;  3EH1 A;  4R0K A;  1VQ9 Q;  5LJ3 d;  4J9H A;  2ZPF B;  1VQ8 A;  3CPW A;  5A0D A;  2F2V A;  1ZSG A;  4XTY A;  4N4H A;  1GCQ A;  2GF7 A;  3OMG A;  4Q5W A;  3JCM W;  4OB3 B;  5D6Y A;  4RCB A;  2J6F A;  2CP6 A;  2MK5 A;  1I0C A;  2K4Y A;  2BIV A;  4RKU E;  2PU9 B;  3FB9 A;  2H3J A;  2O9V A;  2EGA A;  2J6K A;  2ZPB B;  3EFO A;  4EMK B;  2K3Y A;  4IUU A;  3MEA A;  1K9M C;  3ER0 A;  4C8Q G;  2ESW A;  2XDP A;  4J9I A;  1QVF A;  1VQ4 A;  4E7K A;  1Y7X A;  5C0M A;  3PTA A;  1U5S A;  3RR6 A;  2CKK A;  3RDV A;  3L2W A;  3HRT A;  1OYX A;  4PFP A;  4PFO A;  4A4H A;  4M75 F;  3VS2 A;  3S3O A;  2RHZ A;  3X20 B;  3CBM A;  1AEY A;  5CQX A;  5GMK h;  2RHI A;  3C95 A;  4M7D B;  1VQK A;  3Q1J A;  5GAN 7;  1T3S A;  1YFN A;  4BE0 A;  2A28 A;  4HA8 A;  1X6O A;  4E7H A;  1TS9 A;  3A8H B;  2DIQ A;  1Q82 R;  4HT8 A;  1BB9 A;  3M59 A;  5KH6 A;  4GLK A;  1HK9 A;  1VQ6 T;  2OAW A;  1YN8 A;  4YTL A;  2DE0 X;  3I35 A;  1MMD A;  3NPF A;  3CCR A;  6AT1 B;  3OYG A;  2ENM A;  1N5Z A;  1W6X A;  3AHU A;  2E1H A;  2RJD A;  1KK7 A;  1K0X A;  4AMC A;  5FW9 A;  1IRX A;  4E7J A;  4CC4 B;  1CSK A;  5J26 A;  3LH5 A;  1AWO A;  3M0P A;  1AD5 A;  3EG9 B;  1WQW A;  1WXT A;  4CI0 C;  1IHW A;  1B34 A;  3EGD A;  5KCO A;  4R55 A;  1JJ2 P;  3CCM Q;  4J6W A;  2RJE A;  1N8R U;  2RHX A;  3VS7 A;  4J6X A;  2QA4 A;  3VS5 A;  4N4I A;  3QKJ A;  3CCM T;  2ZCF B;  4FYV B;  2PVG B;  3NGP A;  2VB6 A;  3MCA B;  3A8O B;  5GAM e;  2VYT A;  3ULR B;  2JTE A;  2YRC A;  4FW2 A;  4C8Q D;  4C0Z A;  4Z02 A;  4FIB A;  2NUZ A;  4L6V 5;  4RMO A;  2MIO A;  1I07 A;  2JZ2 A;  1OI1 A;  1BIB A;  3N5B B;  1TWB A;  1JQQ A;  2JNG A;  1SSF A;  2CYZ B;  3C12 A;  4GLM A;  2OTL Q;  3VUZ A;  3L2V A;  2CGH A;  5GJV B;  2MPX C;  1WLP B;  2OTL T;  1WJQ A;  1G8X A;  1D3B A;  2FL7 A;  1E6G A;  2J6O A;  1RAH B;  4RCC A;  2DXC A;  2K2V A;  1QMC A;  1ZLM A;  3FLG A;  1MND A;  5CVI A;  2QQB A;  3MO8 A;  1ZX6 A;  2F2X A;  2KYB A;  4XU1 A;  1PCX A;  2ROL A;  2YLB A;  3JCM g;  2BZY A;  1Q7Y R;  1N6A A;  2RO0 A;  4L5G A;  1M1K C;  3HL8 A;  2SEM A;  4M75 A;  2JVV A;  2P0K A;  3C0C A;  4M7D E;  1HYO A;  1WJS A;  3CC2 A;  3OYI A;  2JT4 A;  3QHS A;  1LOJ A;  1M1F A;  2RD1 A;  1YJ9 Q;  2LMJ A;  1ZUU A;  4IUQ A;  4C92 F;  1M2V B;  3RER A;  4BE1 A;  1YJ9 T;  1T0J A;  2COY A;  2FPE A;  5IXB A;  4BE2 A;  1B07 A;  2F1L A;  4X34 A;  1WX6 A;  4C0G A;  5KYX B;  2DXT A;  2KGT A;  2OAU A;  2HD0 A;  1M2V A;  3THK A;  4FCY A;  1I5O B;  2DYI A;  1G3Y A;  2M02 A;  3M0R A;  1UJ0 A;  3UPU A;  1KIK A;  4JRQ A;  4E47 A;  1KC8 U;  2V8K A;  4E6R A;  4M77 F;  2EYX A;  2VGN A;  3TSW A;  2R57 A;  1JJ2 S;  3M4Y A;  5A0G A;  1TUD A;  2K6D A;  2KAF A;  3EAE A;  4DOW A;  1JEG A;  2RQU A;  4XU2 A;  2SRC A;  7AT1 B;  1PC0 A;  2CZ1 B;  5GAN g;  3CBO A;  2JW4 A;  3RMQ A;  3V7R A;  1D0Y A;  3FJP A;  1QWE A;  3CC7 A;  4OMO A;  2RI2 A;  2H8H A;  2AIR B;  3QO3 A;  2YLC A;  4EPC A;  4WCI A;  5GMK i;  3CME Q;  3VS3 A;  2EYY A;  3ZL7 C;  2FZC B;  4IUR A;  2COZ A;  3GNF B;  4J6Y A;  1VQL A;  4RG8 A;  3CME T;  1F1B B;  2K5I A;  1X27 A;  1AT1 B;  4OB2 B;  4M75 E;  2GFU A;  3X24 B;  4F7U B;  1VQP A;  1BI2 A;  1YIJ T;  2KNB B;  2PUK B;  4QVD A;  2G3R A;  2P84 A;  4Y91 A;  3QZ5 B;  1MGQ A;  2O2O A;  3UA6 A;  4LD9 K;  4LDU A;  2EYZ A;  1C1A A;  2DL5 A;  2D1X A;  4E2F B;  2IG0 A;  4FSX A;  3GPL A;  1ZSZ A;  4J9F A;  2LJ1 A;  1ZUK A;  4C92 B;  2PZ1 A;  1LJO A;  4VUB A;  5KYW A;  2HKN A;  2X51 A;  3A8G B;  3PNW C;  1BIA A;  1I8F A;  3UWN A;  1JXM A;  1TUG B;  2NLU A;  4ME7 A;  3RKX A;  5I2S A;  1R8O B;  1TH7 A;  3QDR B;  2A36 A;  5IT9 E;  2ZPG B;  4C92 A;  3QBY A;  1PSE A;  4J9E A;  2LNV A;  1OZ2 A;  3EFS A;  3G71 Q;  2F5K A;  2AKL A;  2CP3 A;  4LDW A;  2KBT A;  2ED1 A;  2HDA A;  2E65 A;  3JCM X;  5GAO m;  3G71 T;  4RTT A;  3G4S Q;  1U3O A;  5LJ5 g;  1D1C A;  2LT4 A;  5GAN 6;  2E10 A;  3PT9 A;  3JCM V;  1OX8 A;  1UEB A;  1PD0 A;  4DBH A;  2X35 A;  3QII A;  1N27 A;  1YHQ Q;  5M9O A;  4HT9 A;  1WI7 A;  4ZNX A;  1M3C A;  1RAF B;  4EMK C;  2HCK A;  2DF6 A;  4M77 A;  3I55 T;  5D6X A;  3MP1 A;  1YHQ T;  1G3T A;  1UGR B;  2HAX A;  4AT1 B;  1Q81 U;  2OTJ Q;  3TU4 K;  4PLI A;  3UT1 A;  5CO7 A;  1I81 A;  4II1 A;  2OTJ T;  3G6E A;  2KMT A;  3UAT A;  1K0S A;  3ASK A;  3TCJ A;  4F04 B;  2FHD A;  1UB4 A;  4QQ6 A;  3TVT A;  4DEX A;  3CCS A;  5GAO n;  3CC4 Q;  3C94 A;  1HJD A;  3CC4 T;  4BDZ A;  1JJ2 A;  3LW5 E;  4J9D A;  3CCU Q;  3I56 A;  4M7D C;  1H8K A;  1EX4 A;  2ROT A;  5KYY A;  1OEB A;  2C0I A;  2QEX A;  1ZHI A;  4XU3 A;  3CCE T;  2YRD A;  2KXC A;  3CCU T;  5EC7 A;  4KT0 E;  3OW2 P;  1KFZ A;  5CCA A;  4FYW B;  2J05 A;  3FEO A;  5HK3 A;  2JOY A;  2ZAE A;  5FRN A;  1X43 A;  2YDL A;  4F7U E;  2RN8 A;  1VA7 A;  1T0H A;  2OX7 A;  2YXY A;  3SD4 A;  4XTX A;  1NZ9 A;  3OY9 A;  4OML A;  4AFZ C;  4LD6 A;  3NTH A;  4OGC A;  1H3Z A;  4IUV A;  2QG9 B;  5FU7 B;  1LPL A;  1NPP A;  3CCV Q;  4A63 B;  4BB7 A;  1N8R R;  1SEM A;  2DBK A;  4C92 E;  2LTO A;  5FLX E;  1K73 U;  4M75 G;  1BKB A;  1TXQ A;  3CCV T;  1IRE B;  4WF2 A;  1GFC A;  1Q86 C;  3P8H A;  2QDY B;  3INZ A;  1X75 C;  5LJ3 g;  1M3B A;  3EG1 A;  1D0X A;  4QVZ A;  1IXD A;  1JO8 A;  5GAO p;  1M4Z A;  4JLG A;  4LUE A;  4AFQ C;  4A54 A;  2QI2 A;  2HMA A;  3LX7 A;  1YIT T;  3UF4 A;  4EMG A;  3CCJ T;  2M16 A;  2XKO C;  4C5H A;  2G6F X;  2MWP A;  1ARK A;  2RMO A;  1KHI A;  1MV0 B;  3SFM A;  2DZ9 A;  2OJ2 A;  1U06 A;  4M77 E;  4NL2 A;  1W4S A;  2DL7 A;  3EGX A;  4E7I A;  4LDV A;  3JCM h;  2VKN A;  1MMN A;  2O9S A;  2FZK B;  2O4X B;  1OPK A;  1VQO A;  1NLP C;  2JMC A;  2M0Y A;  4D8K A;  1M90 U;  2E3H A;  1M9S A;  1S72 Q;  4M7D F;  4KUL A;  3O5Z A;  1NYF A;  2QGF B;  5C6S A;  3S3M A;  2AKK A;  2IPO B;  3DB4 A;  3OYM A;  1PG5 B;  1WGS A;  3M0U A;  1S72 T;  4M75 C;  3L42 A;  4OGE A;  2XID A;  4HXJ A;  3G7Z A;  2EW3 A;  2P0P A;  1VUB A;  1X2K A;  4E7S A;  4A4F A;  4CC3 A;  4Y28 E;  4K11 A;  2YHT A;  5FU6 B;  3P8D A;  1G2B A;  2FO0 A;  2D9T A;  1PNJ A;  3QPH A;  2L3R A;  2K57 A;  1BI1 A;  3HHT B;  3ZEH A;  2V26 A;  4QVC A;  4FT2 A;  2K79 A;  1ZBX A;  3A1P A;  1VQ8 T;  2QGG A;  2QDL A;  1VQ5 A;  4ELY C;  2CS7 A;  2X9H A;  2VV5 A;  2DK3 A;  5KE3 A;  1EIF A;  4M75 D;  4A4K A;  3JRZ A;  5CQY A; 
#chains in the Genus database with same CATH homology
 2E3H A;  2M02 A;  1WHH A;  2COW A;  2COY A;  2HL5 C;  3RDV A;  2HKN A;  1WHL A;  1TXQ A;  3TQ7 P;  2CP3 A;  2HQH A;  2E3I A;  2CP0 A;  2HL3 A;  1WHG A;  2CP7 A;  2CP6 A;  2CP5 A;  1TOV A;  2E4H A;  2Z0W A;  1IXD A;  1WHJ A;  4B6M A;  2COZ A;  2MPX C;  2CP2 A;  1LPL A;  3E2U A;  1WHK A;  2HKQ B;  1WHM A;  2QK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...