1TXQA

Crystal structure of the eb1 c-terminal domain complexed with the cap-gly domain of p150glued
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
74
structure length
74
Chain Sequence
RPLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/protein binding
molecule keywords Dynactin 1
publication title Structural Basis for the Activation of Microtubule Assembly by the EB1 and p150(Glued) Complex
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2004-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 1txqA00
2E3HA 1TXQA 2Z0WA 2CP6A 2M02A 2CP5A 2MPXC 3E2UA 2HL3A 1TOVA 2CP7A 2HL5C 2COWA 2HKQB 1WHJA 3RDVA 1WHKA 2HKNA 2QK0A 2E4HA 3TQ7P 2E3IA 2HQHA 1WHGA 1LPLA 2CP3A 4B6MA 2CP0A 1WHMA 1IXDA 1WHLA 2CP2A 2COYA 1WHHA 2COZA
chains in the Genus database with same CATH superfamily
4J9EA 1CKAA 2WSEE 2L3RA 4RTYA 4KUIA 3RKYA 2GNCA 2DJQA 2EYYA 2SRCA 3PIOA 3VS5A 3CCUT 1YNZA 5KCHA 3M9QA 4FW2A 1M2VA 4KBMB 3S3NA 1K0XA 1RABB 3EG1A 5FU7C 5KYUA 2NYSA 4M77F 2KXCA 1WGSA 1X27A 2RI3A 4LUEA 4XTZA 3OYFA 5FWBA 1EIFA 1RL2A 3CC4A 4ATOA 4R56A 4ZTJA 1Q86C 3EFOA 1VQLQ 4BDZA 2FRYA 3HFNA 3JCMc 4IUQA 4B6MA 3HRTA 2ZPBB 1FXXA 1VQKQ 2P84A 1IREB 3CCJT 1VQ9A 1M4ZA 4CC2A 1B07A 1VQ5A 3UF4A 2H3EB 1SG5A 3CCMA 2L3SA 1QLYA 1BKBA 2OTLA 3I55Q 3FEOA 1WHJA 1UGRB 1TWBA 3QO3A 1W2BP 1ZX6A 1JXMA 3EHRA 4M7AA 1WYXA 2OX7A 2D1XA 1LNXA 1YIJA 1PNJA 3SEMA 1H92A 2DK3A 4RTXA 5DLQE 4A4FA 2F2WA 2QQAA 3ASKA 4JRIA 4C92B 1K9AA 3CC4T 1YJ9A 3JB9F 1MMNA 2RQWA 4BD3A 3QZ5B 3A8OB 4E2FB 3KBGA 1YCSB 2BUDA 2AHJB 4QW2A 2L0AA 1Q86U 2YSQA 2DL5A 3A8MB 3QPHA 2YUQA 4KGZB 4PFOA 1VQKT 2RJFA 5IXBA 3L2UA 3CC7A 5DLOA 1VQ9T 4J9DA 4FSXA 3SDZA 2DM1A 2RA2A 1VQ5T 2F5TX 5I2MA 2EQIA 3CCMT 3QSUA 5ECAA 3PMIA 5I11A 5CQYA 3TQ7P 2CP3A 5EC7A 4M77B 2RD1A 2CGHA 4MZPA 2OAUA 2DA9A 4Z88A 1YIJT 1Q7YC 3P8HA 2DF6A 2CDTA 5LJ3e 1UEBA 2GF7A 4XQ3A 2QQBA 3A98A 4F14A 3EG0A 2ED1A 2YUOA 3OYLA 1K73U 1Q95G 3NGPA 1G3SA 4EMKB 4EPCA 4ZN3A 3LGLA 2KROA 3L2ZA 4FT2A 4RG8A 2COZA 4KUDK 2LNHB 4HVVA 2JW4A 4C8QC 3ER0A 1KD1U 4MMLA 2K79A 5HK0A 4JZ4A 1UECA 1KK7A 2KT1A 1QVPA 5LJ5d 2JN0A 3MEWA 1U1TA 4LDUA 1YITQ 4HA8A 2FG0A 2DYIA 2COWA 4FW1A 1VQ7Q 4Z02A 2LX7A 1RAHB 1QMCA 3VJPA 3AT1B 3INZA 1OYXA 1XTDA 3FJ5A 1AD5A 2SEMA 1PD1A 2VKNA 3X28B 4L59A 3UA7A 1Q7YU 2GCXA 1RAIB 3G4SA 4QQ6A 2VGMA 4C0DC 4IKFA 3EG2A 3OYGA 5IT9E 4FT4A 1VIEA 2CP2A 2K3YA 1CSKA 3HRSA 2DKGA 3G6ET 2LJ1A 4RTVA 4HXJA 4DQ2A 5GMKm 4OGCA 2DZ9A 1NZ9A 2JUFA 1SKUB 3OYCA 2VB6A 3EG9A 3TREA 1M2OA 2EJGA 1A0NB 2O4XA 2K5LA 3EH1A 4TVRA 3V7CA 3CD6Q 1Y71A 1D0YA 3GIBA 1YI2A 4JZ3A 2DTHA 1NG2A 2O4XB 1YJWQ 1AWOA 1HK9A 5J3BA 4DBQA 1R0CB 1VQ4Q 2FPDA 1WXUA 2O01E 2PVOB 5KYWB 3G4ST 2HSPA 1QQJA 1K9MU 3FB9A 1WHLA 1U1SA 3VRZA 3KFVA 1X6BA 4BI4A 1PRLC 4QT7A 3SD4A 4DBFA 2JM8A 4Y91A 3QKJA 3N5BB 3H8ZA 4M7DA 1D1AA 2GGRA 2RF0A 2K3BA 1XQHA 4GY5A 3SWNB 1Q81R 1PCXA 3MP6A 1VQPQ 2VUBA 3VU3C 2F2VA 4IIOA 4JRPA 1M1KU 3JCMX 1KIKA 5LJ3j 3ME9A 2CT3A 4JLIA 4M75F 5GAN8 3TU4K 2KDSA 2LQWA 2YLCA 2KT8A 3VS4A 1N8RR 4D8KA 3NTKA 4M78A 2JJ9A 1YI2T 4KRTA 1RI9A 2QGFB 1VQ4T 1KC8R 2HKQB 3RERA 2PTKA 2KY9A 2QAZA 2J06A 3C0CA 4OB3B 3PGGA 3D7SB 3C94A 1QVFS 3H0FA 3ZL7C 2CREA 1VQMQ 4Z8AA 4RTUA 4AFQC 2MK5A 3HPWA 4JPBW 4AFUC 1GBQA 4B9XA 2HZYA 1BI2A 2Y4XA 4BDYA 3OMGA 1WHKA 4ZGEB 1VQPT 4OMPA 4J9BA 4M7AC 1OULA 2CP0A 5L8RE 5IN1A 1WJQA 4C92C 1ZA2B 3NHNA 4BACA 4XU2A 2EPDA 4XU3A 4HVUA 3CMEQ 3OSSC 1Y57A 5FRNA 5I2SA 3EAEA 1M3BA 1UE9A 2GTJA 1S1NA 1SPKA 2K5IA 1H8KA 1QVFA 2ZPFB 2YRDA 2C0TA 4J7FA 3IQLA 5J39A 4ELZC 2HQHA 5LJ3h 3EHQA 4JRQA 3VV0A 4J9HA 2E3HA 2EQJA 3OS1A 2XDBA 1SF9A 3SHWA 4WCIA 2QEXQ 1Y96B 5IXFA 2G6FX 1OPLA 4KGVB 2EYQA 2DERA 2D8JA 2HL5C 2RK1A 2L2PA 4M75A 1SHGA 3LWHA 3WXMB 2QTXA 2P0QA 3PFSA 1OZ3A 4LDVA 1KQ1A 5DM7R 2LTOA 2ZPIB 4A54A 2EGEA 2RHZA 4BI8B 3M0PA 4M75B 3JCMV 2JTEA 3CCRQ 3CMAQ 1UJYA 1RLPC 5GMKl 2NUPA 1PSFA 4C5EA 3V8JA 4LN2A 2EVRA 2DPPB 4C0ZA 2DBKA 2YWWA 2LT4A 4C8QE 2H3JA 2YT6A 3CCEA 1Y0MA 2A28A 5M9OA 4BY6B 2CYZB 2HQXA 2HQEA 1WFWA 4CC3A 5A0LA 2EGCA 2L3PA 5IHKA 1ZUKA 2X9HA 4XU1A 3CBPA 4LE9A 3G71A 2ED0A 4J9IA 1SEMA 2QQ9A 2E70A 4OMLA 3X24B 4JJNK 3RMSA 2EQUA 4C8QA 3CMAT 1QP3A 1MV0B 1JQQA 1AWXA 1MNDA 1KJWA 5EG2A 1U5SA 3M0UA 1JBMA 3E9GA 4F04B 4PJOF 1QVGA 1SSFA 4VUBA 2HKNA 3FDRA 1IZ6A 4FL6A 3E19A 3X25B 1YJNQ 1T3LA 3ZBDA 1AOJA 2HMAA 2RI2A 2DL4A 1IHVA 1IO6A 5GANd 2CSIA 4LXCA 3BW1A 4J9GA 3CCET 1YHQT 1VQNQ 4FYYB 1HYOA 1VUBA 1CKBA 2LCLA 2QGGA 4BE1A 4FU6A 5AYFA 2F5KA 4OF1A 4F7UF 1S72A 3PMTA 4LDXA 4CC7A 3OBWA 3C4SA 3RKWA 5FRMA 1Q82U 2B8AA 3GF5A 3CCQA 3G71T 4QVCA 4RKUE 3S6WA 3CCLA 2DXBA 1V1CA 3EGDB 4PFPA 2M02A 2E6NA 3CCSQ 5GAOq 2YUNA 4C5HA 1YBYA 2XI9A 3I9QA 2P4RA 1WDXA 2QQSA 4XK8E 4MZTA 1YJNT 2MWPA 4J6YA 2VWFA 2BE9B 2FL7A 4M4ZA 3VKIA 1QCNA 3M0TA 2AT1B 1VQNT 2KXDA 2P0PA 1RI0A 1YWPA 4M7DC 1WNLA 2LT1A 4M7DG 2YRVA 1C0MA 1IGUA 2YLBA 3T9NA 2EBPA 1E6HA 1BI3A 1B7TA 2BE7D 3PIPA 1S72T 1QP2A 2RHYA 3QUIA 1TS9A 1M90R 2MI6A 3TEEA 2E65A 4N4IA 4AT1B 3CCQT 3M58A 2CZ1B 3CCLT 4M78C 4A4EA 4M78G 1JJ2A 2KK4A 1UUEA 2R5AA 2LQ8A 4PJOB 2Y4YA 2E41A 5LJ3d 1X69A 1OU8A 4A53A 5FW9A 1FX7A 2DILA 1GCPA 5HCKA 2MMPA 1RACB 4YTLA 2LP5A 2FZGB 2HSEB 1VQLA 4M7AE 2LJ3A 4BUGA 2A3LA 5GAMf 1GFCA 2DYBA 2F2XA 4ELYC 2FB7A 3QZ9B 4F7UB 5CKBA 1T0JA 3HP9A 2XICA 1VQKA 1BK2A 2RHXA 1TTHB 2QASA 1HD3A 2EYXA 4JDSA 1H3HA 4JJBA 4OMFB 1GBRA 4NL2A 2ROTA 4P5NA 2LX9A 4HT8A 2B86A 3OS2A 3I55A 2RH2A 3X20B 1PKSA 3J7AF 5GAOm 2H8HA 2EGAA 3HL8A 4C92A 1UG1A 5GANf 3OYNA 2RQRA 1NJIR 2HBWA 2JT4A 1WI7A 2XHCA 2IPOB 1UHCA 1WXBA 2PVGB 4C5GA 3BY7A 3PVLA 2KNBB 1C1AA 1MNEA 3I56Q 1VQLT 2M1HA 4N4HA 4GLKA 4M75C 3VS0A 3VS2A 4Y92A 4IUUA 5FROA 4PJOD 3M0SA 5CQXA 1N5ZA 2RK2A 4EMGA 2K57A 3MEUA 4KGXB 5I22A 2JXBA 3S3MA 4HCCA 2DL7A 3C95A 2DEQA 2JM9A 4XU0A 4KH1B 4M77A 4KT0E 1ABQA 2J6FA 1WIEA 3MJXA 1BCOA 3VS6A 3I55T 2L3QA 1RAEB 5CIUA 1PG5B 4BY6C 2CUDA 3REAB 4PJMA 4HKEA 3DLMA 3R6NA 3OS0A 1KQSS 1NLPC 2HBPA 5GAN5 4EMKA 3M59A 3JCMW 1Q81C 1TOVA 4KH0B 2LNVA 2PUKB 4JS4A 2FPEA 4N4GA 2E10A 2XMFA 1JU5C 4PJLA 3HKSA 1M1FA 4OB0B 4DOVA 1H3ZA 3QG1A 2DMOA 4DEYA 1QWEA 1N8RC 1B34B 1ZUUA 2DL3A 3NTHA 3G6EA 3UATA 3QYGB 1KC8C 4C8QG 2VXFA 2AZVA 1W6XA 1I0CA 2F1LA 4RG2A 1YITA 1UGPB 1KQSA 4E47A 1WHGA 5KE2A 5GAN2 2DTIA 2DD4A 4RTWA 1PD0A 2D0QB 3RR6A 3JAME 1Y07A 1VQ7A 1NYFA 3FLGA 4A63B 4K11A 1QVFP 3UT1A 1VIFA 1VA7A 2OJ2A 3JCMd 4PJJA 1FMVA 4ZN1A 1YFNA 3J81E 5GAOr 3HFOA 3NTIA 4QQGA 2J6OA 2RQTA 3L1AA 1MUZA 3LH5A 1PC0A 1Q81U 2VV5A 3RIRA 4E7HA 3M0QA 5KYXB 1ZLMA 3LGFA 2QG9B 4GLMA 3OYYA 2XD0A 2OTJQ 3DB4A 2BZYA 4D6WA 2R57A 1E6GA 3A8GB 3VUBA 2A36A 2AKLA 2I2LA 4C5IA 2A7YA 2VYTA 2WSFE 3WVEB 4E6RA 2E4HA 1BIBA 4ZGDB 1OV3A 1YITT 1JB0E 1WHMA 4M7DE 3CD6A 1K0SA 2EJ9A 5AT1B 1VQ7T 3OSVA 1K73R 2DZCA 1YJWA 5KYWA 2CP5A 2MPXC 1I07A 1VQ4A 3OB9A 2X3XD 4Q5WA 3E9FA 4O6JA 2QA4Q 1VOMA 1WXTA 3A8LB 5KH6A 1C6VX 5CKDA 1ZSZB 2HCKA 3MO8A 1PKTA 2DNUA 1KD1R 4HT9A 4M78E 3AHUA 2JS2A 2DRKA 4IUPA 4Y28E 4J83A 3SWNA 1LJOA 2E5KA 3CCVQ 5CK9A 2IG0A 3P8DA 1MGQA 1B3QA 3CC2Q 2M9UA 2FO0A 3JSCA 5FWCA 4LDWA 1VQPA 2PU9B 3V7RA 2FPFA 1XOVA 1BB9A 1AHJB 5CO7A 2VXEA 2VGNA 4A4GA 2COYA 1G3TA 5GAMg 1QVGP 3V8KA 3CD6T 1MMDA 3JB9H 2E12A 4EMHA 4DBHA 1YJWT 2DIQA 2QA4T 3THKA 1SRLA 1F1BB 3NPFA 4OMOA 3GBQA 3GNFB 4JS5A 1LPLA 2EW3A 3ULRB 1N27A 1VQMA 3GNGA 4XTYA 1VYTA 3NMZC 2DO3A 3BDLA 2GQVA 1R77A 5GANg 3CEYA 2CS7A 3OA6A 5LJ5f 1G3YA 4IUVA 2MF2A 3QDFA 3BDUA 5IAYA 2LC4A 1I5OB 3WVDB 3CMEA 2IVWA 4M7AG 2O88A 3E1SA 4C92G 2A08A 1VQ6Q 5FLXE 3JCMf 5FU7B 2JMAA 1BYMA 1IGQA 2X4JA 2EWNA 1M5Q1 1FMKA 2LCCA 4M75E 1M1GA 2RO0A 4RCCA 2V8JA 3L2RA 2O9VA 3SB2A 1K9MR 1BI1A 3OY9A 1Y96A 4RCBA 3FJPA 2FEIA 4PNOA 2QEXA 1ACMB 2DLPA 1VQMT 2KGTA 1UHFA 1ARKA 1RADB 4KULA 3C12A 4X9DA 1TUDA 2K7AA 1M1KR 4M77C 4HVWA 2RHUA 5A0GA 4M77G 2J7IA 1OI1A 1YWOA 4RMOA 4CI0C 1JJ2P 3SFMA 4OVAA 2EYZA 3CMET 3CMAA 3CCRA 2BKDN 2M16A 3QIIA 3UDCA 4B9WA 2ZPGB 1KFZA 4EMKC 2K2MA 4FSSA 2DX1A 2KSSA 1X2QA 2E64A 2RNAA 4J8OA 2QYZA 4FM4B 4X1VA 1OOTA 1HXDA 3OYKA 2E3IA 1M90C 1MMGA 2K3XA 1VQOQ 4CRIA 3MPUB 4M78D 2DVJA 1D09B 1QVGS 2PUOB 2ABLA 1YHQA 3OYDA 1QW1A 2E5QA 1SSHA 2QEXT 3A8HB 2NUTB 3CXCS 4QQDA 2QTVA 4OP0A 1NE8A 5L23A 1HSQA 3OBYA 4JRKA 4E7LA 2I0NA 1VQ8Q 2NUZA 2LVMA 2ZGWA 1WPYA 3QJ6A 1GXIE 2GFAA 2VC8A 1WQ7A 2EQMA 2X4WA 2RHIA 4FYVB 5A2QE 2GFUA 2PQWA 1ZBXA 2E6ZA 1U8RA 3CCRT 2EJFA 3JB9G 2ZAEA 2MIOA 1G83A 2DXTA 1EFNA 1MHNA 2RB6A 2EFIA 2JTFA 3JB9J 3RNJA 1YJNA 1UDLA 4DBRA 1M27C 3CXCA 3MKDA 3I35A 1VQNA 5IH2A 5CKEA 4ZGJB 1FMWA 1M90U 2HD0A 4J5YA 2RJCA 2BZ8A 1FWZA 3KUFA 1VQ8T 2V26A 1RAAB 2K9GA 5A0DA 1NJIC 3EGDA 4IIMA 3FC3A 2BIVA 1AEYA 1GCQA 1SRMA 1WA7A 3CCSA 3LLRA 2M0OA 3VRYA 3TVTA 2D9TA 1ZSZC 2ROLA 2ECZA 3JB9I 4RTZA 1YP5A 4O5VA 1I1JA 3VYGA 3M4GA 1N6AA 2QK0A 5D6WA 3MP8A 2DETA 1JXOA 5GJWB 1OX9A 3M57A 2ESWA 1JJ2S 2KRNA 1TUGB 2LMJA 4C0DB 2R5MA 4F16A 3SWNC 5GAOp 5GMKi 2RQVA 4NS5A 4MMKA 3CCUQ 4J7IA 4AFZC 2FYKA 1NEGA 4JLGA 4EIKA 1D3BB 3JCMb 1AT1B 2PZ1A 5IHIA 2KBTA 2XDDA 4N0AA 5I21A 4HCBA 3S3OA 4MDXA 3QHSA 5CKHA 2GBQA 2OI3A 4IUTA 3QWXX 1GL5A 1UJ0A 1VYUA 2F69A 4M7AF 4E7ZA 4PJOA 5HY6A 2MWOA 3V8LA 1KQSP 3OS5A 1NJIU 2QI2A 1K8AR 1RLQC 3CCST 4L6V5 1KG1A 2JMCA 1I4K1 2AZSA 1V29B 4C8QD 1I8FA 3CPWS 3ZEHA 5LJ5g 1VYVA 5CAIA 5GAMe 3CCJQ 2P0KA 4EDUA 3PE0A 4OMNA 4ZNXA 3I5SA 2D0NA 4J6XA 4F7UA 2YHTA 4RTTA 5KE3A 1M9SA 4ORZA 3OYHA 3HSBA 4XTVA 1I81A 3JCMg 4OGEA 4C92E 2XG8D 1Q82R 1N9SA 4LD9K 1OPKA 3CBOA 3VS3A 5CKFA 1IXDA 1M2VB 3DKMA 1W70A 3QBYA 1TU0B 1AZGB 5KYUB 4A4HA 1QKXA 5GANe 4XTWA 3URGA 2C0IA 2RM4A 4IURA 3CC4Q 3CPWA 1IHWA 2JOYA 3JV3A 2BTTA 2FHDA 4C0FA 3EG3A 4QKUA 3F70A 2KRMA 2CZ6B 2EAYA 3LH0A 3EFOB 3CQTA 1O75A 4PK4A 4ANJA 5FU6B 1TXQA 3TSZA 3EFRA 4A4KA 1LOJA 3L2VA 4M77E 1VQ9Q 3UPUA 3LYIA 3LWIA 2HL3A 1VQ5Q 1JEGA 3I56A 2KE9A 3CCMQ 4E7KA 2HDAA 1LCKA 1WLPB 2KEAA 2OTLQ 4J6WA 2X4YA 3U23A 4M75G 2AIRB 3H0IA 1YIJQ 1K73C 1SHFA 4PLIA 1I5LA 1D0ZA 4M7AB 3CPFA 4BE2A 2EIFA 5GMKe 2RN8A 1YJ9Q 1ZA1B 3HTRA 1KD1C 4WTOB 3M5AA 1GRIA 1RAGB 3RUXA 1UB4A 3FRNA 2ATCB 2YXYA 3EGXA 9ATCB 2MCNA 4XTUA 3JCMJ 3UA6A 3CC7Q 3EH2A 1BIAA 4J9FA 1WQWA 2K2VA 1V76A 2X51A 5KYYA 3EGXB 3L2WA 2R58A 3I56T 1UFFA 1B34A 2OTLT 2CUBA 2CH4W 3OW2S 2CSQA 3GLXA 2RJDA 5KYYB 2CKKA 3GOXA 3UWNA 3R6OA 4J9CA 3P8BB 3OYJA 3M55A 4PLLA 3JRZA 5D6XA 2RI5A 4OMQA 2EYWA 1PHTA 1X75C 3BE3A 2DTOA 2DIGA 2DJZA 4LDYA 4X9CA 1YJ9T 4FYWB 5LJ3f 2MYSA 2RQUA 5GAMj 4GBQA 4PKCC 3LX7A 3OYIA 3G6EQ 3CC7T 5J26A 3OW2A 4DOWA 4M7AD 2O9SA 3HHTB 2FVUA 4C92D 5C0MA 1MMAA 1X6OA 3MEAA 5KYXA 2FZCB 1QCOA 1K4US 2YDLA 1Q86R 1QCFA 4M7DF 4RUGA 1IB8A 1Y7XA 3QYHB 3QXEB 2ZZDA 1G5VA 3NFCA 3RESA 1WHHA 1AVZC 5LL6S 8ATCB 2OTJA 2DVEA 3REBB 1K76A 1GCQC 5GANj 1Z9QA 2LZ6B 1K9MC 3I5RA 2FRWA 1D1BA 2C06A 3VS7A 1N8RU 1W2BS 2O31A 3G4SQ 4M78F 3X26B 3CBMA 1HJDA 1KC8U 2KR3A 4R55A 2PNIA 4V2SA 3FIFA 4M77D 2XDPA 5CVIA 4LNPA 1NPPA 3JCMP 1E7OA 4Z89A 1M1KC 1NM7A 4NOYA 1ZSZA 4HCZA 2QA4A 2RPNA 3OYMA 1BI0A 3OMCA 5GAOl 2IIMA 4BB7A 1UTIA 5GAMh 4F17A 4N0AC 2K4YA 2L5QA 3RMQA 1PWTA 3EG9B 2NLUA 1AWWA 2ENMA 2J6KA 3CCVA 4BE0A 2OAWA 1W2BA 2OTJT 4PJOC 2CZ7B 4PJOG 5GMKj 4PL6A 1YI2Q 1RUWA 3CC2A 2XIDA 2XU8A 1AWJA 1ZBJA 2DD5A 2J05A 4ESRA 4HCKA 2KRSA 1X43A 5HK3A 4FCYA 3PVQA 2L89A 5GANh 4FYXB 4CC4B 2DE0X 3L42A 1Q7YR 1G3WA 2GQIA 5GAN7 4F7UG 4E7IA 4JUVA 3CXCP 1RAFB 1OZ2A 2JS0A 3JB9D 4M7DB 3G7ZA 2X3WD 1BCMA 3M56A 3VYHB 3M4YA 5LJ5e 2KQWA 2CT4A 2K5FA 2YUPA 5CCAA 2ZPEB 1PRMC 3O8VA 2W10A 1FYNA 4QVDA 3CCVT 1TUCA 3JCMe 4DEXA 2LRQA 2DEUA 3CC2T 3DB3A 8AT1B 3RDVA 3TCJA 1M8MA 2LQNA 5FU6C 4AMCA 1Z9ZA 4M78B 2QDLA 2A0FB 3ZFJA 1VQ6A 1KHIA 2GTOA 2M51A 3M53A 3MHXA 1EZZB 4PJNA 5GMKh 3GPLA 4C0GA 1UGQB 2D8HA 1G2BA 1G8XA 4OB2B 4PFZA 4UC4A 1P92A 4MZMA 2DRMA 2KYMA 3DLLA 4E7JA 4X34A 3H9NA 2E1HA 2JNGA 2ZPHB 1ZHIA 7AT1B 1ZUYA 5DY9A 4MDWA 1NEBA 1ABOA 1X2KA 2X35A 2MAMA 2LQKA 1AZEA 4C8QF 4AG1C 1X01A 2XKOC 1OEBA 3J80E 2AK5A 3G1JA 1NPRA 1XJWB 1U06A 4M7DD 4JJCA 4OB1B 2C0OA 2EKOA 3HRUA 2ZCFB 1VQ6T 3RKXA 1J3TA 4JJDA 2V1RA 3OYBA 2CP6A 5GAN4 3MCAB 4QVZA 1T3SA 3E2UA 2X4XA 3A5ZB 1W1FA 4LUDA 1WJSA 2KAFA 2M0YA 1LVKA 2DAQA 2MOXA 3QDRB 2G3RA 1M8VA 2DBMA 2PVDB 1D1CA 3VUZA 1VQOA 1R0BG 2V1QA 2NUTA 1UGSB 2CH4A 1MV3A 3RBBB 5LJ3g 2Z0WA 1BBZA 5GAOn 1K8AC 1O9SA 3M54A 1PSEA 2YRCA 3OYAA 5HKCA 1PM3A 1KSWA 3MP1A 5GAN6 3MEVA 1OQKA 5KYNA 4DA4A 1VQ8A 3META 2V8KA 2RJEA 3JCMQ 2NUPB 1TH7A 2NWMA 3PNWC 1M3CA 3CPWP 3PTAA 2A37A 4FIBA 1EX4A 1JRIA 5KCOA 3QWYA 4D8DA 3CCEQ 1YHQQ 4ZTFA 2DXCA 2KI7A 1WX6A 1ZQ1A 2LJ0A 1Q82C 1YCYA 2AKKA 2HNIA 5GAMd 1NYGA 1R8OB 4WF2A 5LJ5j 1N9RA 5C6SA 2EKHA 1VQOT 2HAXA 6AT1B 3H41A 1DJ7B 1JO8A 1YN8A 2JVVA 2VASA 2K6DA 3QJYA 3G71Q 2DFUA 1H641 3O5ZA 2KVQG 2RMOA 1OX8A 3Q1JA 4L5GA 4R0KA 1M30A 2KYBA 3OYEA 3H6ZA 1QWFA 3A1PA 4C8QB 2QQRA 5D6YA 1K8AU 1GFDA 2QDYB 1WJRA 3TSWA 1TSFA 1TG0A 2WACA 3VS1A 1U3OA 2LCSA 5IHNA 2FZKB 2XK0A 4E7SA 2CZ0B 1KHCA 2DXUA 3GP8A 1T0HA 4M75D 1K1ZA 3BFMA 2L8DA 3PT9A 2CP7A 3EFSA 4XAXB 3H0HA 1KQ2A 2HEQA 1S72Q 4PJOE 5CR2A 2VVKA 2P4TA 4LD6A 4ME7A 2LDMA 2EQKA 3CCQQ 1D0XA 1D3BA 1QKWA 3V7SA 1ZSGA 2WSCE 3CCUA 3CCLQ 1NLOC 1OU9A 1W4SA 2O2OA 2Y90A 5GJVB 2D6FA 3LW5E 2V8IA 5LJ5h 4II1A 1M3AA 2W0ZA 1WZOA 4NL3A 1UGVA 4BI3A 1X6GA 5D7UA 1NBEB 4OMMA 3OQ5A 2JTMA 4F7UE 3L2QA 1BU1A 2BZXA 3JCMh 4C92F 3EGUA 5GAN3 3KXTA 4AG2C 2QXFA 1IRXA 1XNIA 2DL8A 4XTXA 4AFSC 2KMTA 3OW2P 2JZ2A 3CCJA 3M0RA
chains in the Genus database with same CATH topology
2E3HA 1TXQA 2Z0WA 2CP6A 2M02A 2CP5A 2MPXC 3E2UA 2HL3A 1TOVA 2CP7A 2HL5C 2COWA 2HKQB 1WHJA 3RDVA 1WHKA 2HKNA 2QK0A 2E4HA 3TQ7P 2E3IA 2HQHA 1WHGA 1LPLA 2CP3A 4B6MA 2CP0A 1WHMA 1IXDA 1WHLA 2CP2A 2COYA 1WHHA 2COZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E3H A;  1TXQ A;  2Z0W A;  2CP6 A;  2M02 A;  2CP5 A;  2MPX C;  3E2U A;  2HL3 A;  1TOV A;  2CP7 A;  2HL5 C;  2COW A;  2HKQ B;  1WHJ A;  3RDV A;  1WHK A;  2HKN A;  2QK0 A;  2E4H A;  3TQ7 P;  2E3I A;  2HQH A;  1WHG A;  1LPL A;  2CP3 A;  4B6M A;  2CP0 A;  1WHM A;  1IXD A;  1WHL A;  2CP2 A;  2COY A;  1WHH A;  2COZ A; 
#chains in the Genus database with same CATH topology
 4J9E A;  1CKA A;  2WSE E;  2L3R A;  4RTY A;  4KUI A;  3RKY A;  2GNC A;  2DJQ A;  2EYY A;  2SRC A;  3PIO A;  3VS5 A;  3CCU T;  1YNZ A;  5KCH A;  3M9Q A;  4FW2 A;  1M2V A;  4KBM B;  3S3N A;  1K0X A;  1RAB B;  3EG1 A;  5FU7 C;  5KYU A;  2NYS A;  4M77 F;  2KXC A;  1WGS A;  1X27 A;  2RI3 A;  4LUE A;  4XTZ A;  3OYF A;  5FWB A;  1EIF A;  1RL2 A;  3CC4 A;  4ATO A;  4R56 A;  4ZTJ A;  1Q86 C;  3EFO A;  1VQL Q;  4BDZ A;  2FRY A;  3HFN A;  3JCM c;  4IUQ A;  4B6M A;  3HRT A;  2ZPB B;  1FXX A;  1VQK Q;  2P84 A;  1IRE B;  3CCJ T;  1VQ9 A;  1M4Z A;  4CC2 A;  1B07 A;  1VQ5 A;  3UF4 A;  2H3E B;  1SG5 A;  3CCM A;  2L3S A;  1QLY A;  1BKB A;  2OTL A;  3I55 Q;  3FEO A;  1WHJ A;  1UGR B;  1TWB A;  3QO3 A;  1W2B P;  1ZX6 A;  1JXM A;  3EHR A;  4M7A A;  1WYX A;  2OX7 A;  2D1X A;  1LNX A;  1YIJ A;  1PNJ A;  3SEM A;  1H92 A;  2DK3 A;  4RTX A;  5DLQ E;  4A4F A;  2F2W A;  2QQA A;  3ASK A;  4JRI A;  4C92 B;  1K9A A;  3CC4 T;  1YJ9 A;  3JB9 F;  1MMN A;  2RQW A;  4BD3 A;  3QZ5 B;  3A8O B;  4E2F B;  3KBG A;  1YCS B;  2BUD A;  2AHJ B;  4QW2 A;  2L0A A;  1Q86 U;  2YSQ A;  2DL5 A;  3A8M B;  3QPH A;  2YUQ A;  4KGZ B;  4PFO A;  1VQK T;  2RJF A;  5IXB A;  3L2U A;  3CC7 A;  5DLO A;  1VQ9 T;  4J9D A;  4FSX A;  3SDZ A;  2DM1 A;  2RA2 A;  1VQ5 T;  2F5T X;  5I2M A;  2EQI A;  3CCM T;  3QSU A;  5ECA A;  3PMI A;  5I11 A;  5CQY A;  3TQ7 P;  2CP3 A;  5EC7 A;  4M77 B;  2RD1 A;  2CGH A;  4MZP A;  2OAU A;  2DA9 A;  4Z88 A;  1YIJ T;  1Q7Y C;  3P8H A;  2DF6 A;  2CDT A;  5LJ3 e;  1UEB A;  2GF7 A;  4XQ3 A;  2QQB A;  3A98 A;  4F14 A;  3EG0 A;  2ED1 A;  2YUO A;  3OYL A;  1K73 U;  1Q95 G;  3NGP A;  1G3S A;  4EMK B;  4EPC A;  4ZN3 A;  3LGL A;  2KRO A;  3L2Z A;  4FT2 A;  4RG8 A;  2COZ A;  4KUD K;  2LNH B;  4HVV A;  2JW4 A;  4C8Q C;  3ER0 A;  1KD1 U;  4MML A;  2K79 A;  5HK0 A;  4JZ4 A;  1UEC A;  1KK7 A;  2KT1 A;  1QVP A;  5LJ5 d;  2JN0 A;  3MEW A;  1U1T A;  4LDU A;  1YIT Q;  4HA8 A;  2FG0 A;  2DYI A;  2COW A;  4FW1 A;  1VQ7 Q;  4Z02 A;  2LX7 A;  1RAH B;  1QMC A;  3VJP A;  3AT1 B;  3INZ A;  1OYX A;  1XTD A;  3FJ5 A;  1AD5 A;  2SEM A;  1PD1 A;  2VKN A;  3X28 B;  4L59 A;  3UA7 A;  1Q7Y U;  2GCX A;  1RAI B;  3G4S A;  4QQ6 A;  2VGM A;  4C0D C;  4IKF A;  3EG2 A;  3OYG A;  5IT9 E;  4FT4 A;  1VIE A;  2CP2 A;  2K3Y A;  1CSK A;  3HRS A;  2DKG A;  3G6E T;  2LJ1 A;  4RTV A;  4HXJ A;  4DQ2 A;  5GMK m;  4OGC A;  2DZ9 A;  1NZ9 A;  2JUF A;  1SKU B;  3OYC A;  2VB6 A;  3EG9 A;  3TRE A;  1M2O A;  2EJG A;  1A0N B;  2O4X A;  2K5L A;  3EH1 A;  4TVR A;  3V7C A;  3CD6 Q;  1Y71 A;  1D0Y A;  3GIB A;  1YI2 A;  4JZ3 A;  2DTH A;  1NG2 A;  2O4X B;  1YJW Q;  1AWO A;  1HK9 A;  5J3B A;  4DBQ A;  1R0C B;  1VQ4 Q;  2FPD A;  1WXU A;  2O01 E;  2PVO B;  5KYW B;  3G4S T;  2HSP A;  1QQJ A;  1K9M U;  3FB9 A;  1WHL A;  1U1S A;  3VRZ A;  3KFV A;  1X6B A;  4BI4 A;  1PRL C;  4QT7 A;  3SD4 A;  4DBF A;  2JM8 A;  4Y91 A;  3QKJ A;  3N5B B;  3H8Z A;  4M7D A;  1D1A A;  2GGR A;  2RF0 A;  2K3B A;  1XQH A;  4GY5 A;  3SWN B;  1Q81 R;  1PCX A;  3MP6 A;  1VQP Q;  2VUB A;  3VU3 C;  2F2V A;  4IIO A;  4JRP A;  1M1K U;  3JCM X;  1KIK A;  5LJ3 j;  3ME9 A;  2CT3 A;  4JLI A;  4M75 F;  5GAN 8;  3TU4 K;  2KDS A;  2LQW A;  2YLC A;  2KT8 A;  3VS4 A;  1N8R R;  4D8K A;  3NTK A;  4M78 A;  2JJ9 A;  1YI2 T;  4KRT A;  1RI9 A;  2QGF B;  1VQ4 T;  1KC8 R;  2HKQ B;  3RER A;  2PTK A;  2KY9 A;  2QAZ A;  2J06 A;  3C0C A;  4OB3 B;  3PGG A;  3D7S B;  3C94 A;  1QVF S;  3H0F A;  3ZL7 C;  2CRE A;  1VQM Q;  4Z8A A;  4RTU A;  4AFQ C;  2MK5 A;  3HPW A;  4JPB W;  4AFU C;  1GBQ A;  4B9X A;  2HZY A;  1BI2 A;  2Y4X A;  4BDY A;  3OMG A;  1WHK A;  4ZGE B;  1VQP T;  4OMP A;  4J9B A;  4M7A C;  1OUL A;  2CP0 A;  5L8R E;  5IN1 A;  1WJQ A;  4C92 C;  1ZA2 B;  3NHN A;  4BAC A;  4XU2 A;  2EPD A;  4XU3 A;  4HVU A;  3CME Q;  3OSS C;  1Y57 A;  5FRN A;  5I2S A;  3EAE A;  1M3B A;  1UE9 A;  2GTJ A;  1S1N A;  1SPK A;  2K5I A;  1H8K A;  1QVF A;  2ZPF B;  2YRD A;  2C0T A;  4J7F A;  3IQL A;  5J39 A;  4ELZ C;  2HQH A;  5LJ3 h;  3EHQ A;  4JRQ A;  3VV0 A;  4J9H A;  2E3H A;  2EQJ A;  3OS1 A;  2XDB A;  1SF9 A;  3SHW A;  4WCI A;  2QEX Q;  1Y96 B;  5IXF A;  2G6F X;  1OPL A;  4KGV B;  2EYQ A;  2DER A;  2D8J A;  2HL5 C;  2RK1 A;  2L2P A;  4M75 A;  1SHG A;  3LWH A;  3WXM B;  2QTX A;  2P0Q A;  3PFS A;  1OZ3 A;  4LDV A;  1KQ1 A;  5DM7 R;  2LTO A;  2ZPI B;  4A54 A;  2EGE A;  2RHZ A;  4BI8 B;  3M0P A;  4M75 B;  3JCM V;  2JTE A;  3CCR Q;  3CMA Q;  1UJY A;  1RLP C;  5GMK l;  2NUP A;  1PSF A;  4C5E A;  3V8J A;  4LN2 A;  2EVR A;  2DPP B;  4C0Z A;  2DBK A;  2YWW A;  2LT4 A;  4C8Q E;  2H3J A;  2YT6 A;  3CCE A;  1Y0M A;  2A28 A;  5M9O A;  4BY6 B;  2CYZ B;  2HQX A;  2HQE A;  1WFW A;  4CC3 A;  5A0L A;  2EGC A;  2L3P A;  5IHK A;  1ZUK A;  2X9H A;  4XU1 A;  3CBP A;  4LE9 A;  3G71 A;  2ED0 A;  4J9I A;  1SEM A;  2QQ9 A;  2E70 A;  4OML A;  3X24 B;  4JJN K;  3RMS A;  2EQU A;  4C8Q A;  3CMA T;  1QP3 A;  1MV0 B;  1JQQ A;  1AWX A;  1MND A;  1KJW A;  5EG2 A;  1U5S A;  3M0U A;  1JBM A;  3E9G A;  4F04 B;  4PJO F;  1QVG A;  1SSF A;  4VUB A;  2HKN A;  3FDR A;  1IZ6 A;  4FL6 A;  3E19 A;  3X25 B;  1YJN Q;  1T3L A;  3ZBD A;  1AOJ A;  2HMA A;  2RI2 A;  2DL4 A;  1IHV A;  1IO6 A;  5GAN d;  2CSI A;  4LXC A;  3BW1 A;  4J9G A;  3CCE T;  1YHQ T;  1VQN Q;  4FYY B;  1HYO A;  1VUB A;  1CKB A;  2LCL A;  2QGG A;  4BE1 A;  4FU6 A;  5AYF A;  2F5K A;  4OF1 A;  4F7U F;  1S72 A;  3PMT A;  4LDX A;  4CC7 A;  3OBW A;  3C4S A;  3RKW A;  5FRM A;  1Q82 U;  2B8A A;  3GF5 A;  3CCQ A;  3G71 T;  4QVC A;  4RKU E;  3S6W A;  3CCL A;  2DXB A;  1V1C A;  3EGD B;  4PFP A;  2M02 A;  2E6N A;  3CCS Q;  5GAO q;  2YUN A;  4C5H A;  1YBY A;  2XI9 A;  3I9Q A;  2P4R A;  1WDX A;  2QQS A;  4XK8 E;  4MZT A;  1YJN T;  2MWP A;  4J6Y A;  2VWF A;  2BE9 B;  2FL7 A;  4M4Z A;  3VKI A;  1QCN A;  3M0T A;  2AT1 B;  1VQN T;  2KXD A;  2P0P A;  1RI0 A;  1YWP A;  4M7D C;  1WNL A;  2LT1 A;  4M7D G;  2YRV A;  1C0M A;  1IGU A;  2YLB A;  3T9N A;  2EBP A;  1E6H A;  1BI3 A;  1B7T A;  2BE7 D;  3PIP A;  1S72 T;  1QP2 A;  2RHY A;  3QUI A;  1TS9 A;  1M90 R;  2MI6 A;  3TEE A;  2E65 A;  4N4I A;  4AT1 B;  3CCQ T;  3M58 A;  2CZ1 B;  3CCL T;  4M78 C;  4A4E A;  4M78 G;  1JJ2 A;  2KK4 A;  1UUE A;  2R5A A;  2LQ8 A;  4PJO B;  2Y4Y A;  2E41 A;  5LJ3 d;  1X69 A;  1OU8 A;  4A53 A;  5FW9 A;  1FX7 A;  2DIL A;  1GCP A;  5HCK A;  2MMP A;  1RAC B;  4YTL A;  2LP5 A;  2FZG B;  2HSE B;  1VQL A;  4M7A E;  2LJ3 A;  4BUG A;  2A3L A;  5GAM f;  1GFC A;  2DYB A;  2F2X A;  4ELY C;  2FB7 A;  3QZ9 B;  4F7U B;  5CKB A;  1T0J A;  3HP9 A;  2XIC A;  1VQK A;  1BK2 A;  2RHX A;  1TTH B;  2QAS A;  1HD3 A;  2EYX A;  4JDS A;  1H3H A;  4JJB A;  4OMF B;  1GBR A;  4NL2 A;  2ROT A;  4P5N A;  2LX9 A;  4HT8 A;  2B86 A;  3OS2 A;  3I55 A;  2RH2 A;  3X20 B;  1PKS A;  3J7A F;  5GAO m;  2H8H A;  2EGA A;  3HL8 A;  4C92 A;  1UG1 A;  5GAN f;  3OYN A;  2RQR A;  1NJI R;  2HBW A;  2JT4 A;  1WI7 A;  2XHC A;  2IPO B;  1UHC A;  1WXB A;  2PVG B;  4C5G A;  3BY7 A;  3PVL A;  2KNB B;  1C1A A;  1MNE A;  3I56 Q;  1VQL T;  2M1H A;  4N4H A;  4GLK A;  4M75 C;  3VS0 A;  3VS2 A;  4Y92 A;  4IUU A;  5FRO A;  4PJO D;  3M0S A;  5CQX A;  1N5Z A;  2RK2 A;  4EMG A;  2K57 A;  3MEU A;  4KGX B;  5I22 A;  2JXB A;  3S3M A;  4HCC A;  2DL7 A;  3C95 A;  2DEQ A;  2JM9 A;  4XU0 A;  4KH1 B;  4M77 A;  4KT0 E;  1ABQ A;  2J6F A;  1WIE A;  3MJX A;  1BCO A;  3VS6 A;  3I55 T;  2L3Q A;  1RAE B;  5CIU A;  1PG5 B;  4BY6 C;  2CUD A;  3REA B;  4PJM A;  4HKE A;  3DLM A;  3R6N A;  3OS0 A;  1KQS S;  1NLP C;  2HBP A;  5GAN 5;  4EMK A;  3M59 A;  3JCM W;  1Q81 C;  1TOV A;  4KH0 B;  2LNV A;  2PUK B;  4JS4 A;  2FPE A;  4N4G A;  2E10 A;  2XMF A;  1JU5 C;  4PJL A;  3HKS A;  1M1F A;  4OB0 B;  4DOV A;  1H3Z A;  3QG1 A;  2DMO A;  4DEY A;  1QWE A;  1N8R C;  1B34 B;  1ZUU A;  2DL3 A;  3NTH A;  3G6E A;  3UAT A;  3QYG B;  1KC8 C;  4C8Q G;  2VXF A;  2AZV A;  1W6X A;  1I0C A;  2F1L A;  4RG2 A;  1YIT A;  1UGP B;  1KQS A;  4E47 A;  1WHG A;  5KE2 A;  5GAN 2;  2DTI A;  2DD4 A;  4RTW A;  1PD0 A;  2D0Q B;  3RR6 A;  3JAM E;  1Y07 A;  1VQ7 A;  1NYF A;  3FLG A;  4A63 B;  4K11 A;  1QVF P;  3UT1 A;  1VIF A;  1VA7 A;  2OJ2 A;  3JCM d;  4PJJ A;  1FMV A;  4ZN1 A;  1YFN A;  3J81 E;  5GAO r;  3HFO A;  3NTI A;  4QQG A;  2J6O A;  2RQT A;  3L1A A;  1MUZ A;  3LH5 A;  1PC0 A;  1Q81 U;  2VV5 A;  3RIR A;  4E7H A;  3M0Q A;  5KYX B;  1ZLM A;  3LGF A;  2QG9 B;  4GLM A;  3OYY A;  2XD0 A;  2OTJ Q;  3DB4 A;  2BZY A;  4D6W A;  2R57 A;  1E6G A;  3A8G B;  3VUB A;  2A36 A;  2AKL A;  2I2L A;  4C5I A;  2A7Y A;  2VYT A;  2WSF E;  3WVE B;  4E6R A;  2E4H A;  1BIB A;  4ZGD B;  1OV3 A;  1YIT T;  1JB0 E;  1WHM A;  4M7D E;  3CD6 A;  1K0S A;  2EJ9 A;  5AT1 B;  1VQ7 T;  3OSV A;  1K73 R;  2DZC A;  1YJW A;  5KYW A;  2CP5 A;  2MPX C;  1I07 A;  1VQ4 A;  3OB9 A;  2X3X D;  4Q5W A;  3E9F A;  4O6J A;  2QA4 Q;  1VOM A;  1WXT A;  3A8L B;  5KH6 A;  1C6V X;  5CKD A;  1ZSZ B;  2HCK A;  3MO8 A;  1PKT A;  2DNU A;  1KD1 R;  4HT9 A;  4M78 E;  3AHU A;  2JS2 A;  2DRK A;  4IUP A;  4Y28 E;  4J83 A;  3SWN A;  1LJO A;  2E5K A;  3CCV Q;  5CK9 A;  2IG0 A;  3P8D A;  1MGQ A;  1B3Q A;  3CC2 Q;  2M9U A;  2FO0 A;  3JSC A;  5FWC A;  4LDW A;  1VQP A;  2PU9 B;  3V7R A;  2FPF A;  1XOV A;  1BB9 A;  1AHJ B;  5CO7 A;  2VXE A;  2VGN A;  4A4G A;  2COY A;  1G3T A;  5GAM g;  1QVG P;  3V8K A;  3CD6 T;  1MMD A;  3JB9 H;  2E12 A;  4EMH A;  4DBH A;  1YJW T;  2DIQ A;  2QA4 T;  3THK A;  1SRL A;  1F1B B;  3NPF A;  4OMO A;  3GBQ A;  3GNF B;  4JS5 A;  1LPL A;  2EW3 A;  3ULR B;  1N27 A;  1VQM A;  3GNG A;  4XTY A;  1VYT A;  3NMZ C;  2DO3 A;  3BDL A;  2GQV A;  1R77 A;  5GAN g;  3CEY A;  2CS7 A;  3OA6 A;  5LJ5 f;  1G3Y A;  4IUV A;  2MF2 A;  3QDF A;  3BDU A;  5IAY A;  2LC4 A;  1I5O B;  3WVD B;  3CME A;  2IVW A;  4M7A G;  2O88 A;  3E1S A;  4C92 G;  2A08 A;  1VQ6 Q;  5FLX E;  3JCM f;  5FU7 B;  2JMA A;  1BYM A;  1IGQ A;  2X4J A;  2EWN A;  1M5Q 1;  1FMK A;  2LCC A;  4M75 E;  1M1G A;  2RO0 A;  4RCC A;  2V8J A;  3L2R A;  2O9V A;  3SB2 A;  1K9M R;  1BI1 A;  3OY9 A;  1Y96 A;  4RCB A;  3FJP A;  2FEI A;  4PNO A;  2QEX A;  1ACM B;  2DLP A;  1VQM T;  2KGT A;  1UHF A;  1ARK A;  1RAD B;  4KUL A;  3C12 A;  4X9D A;  1TUD A;  2K7A A;  1M1K R;  4M77 C;  4HVW A;  2RHU A;  5A0G A;  4M77 G;  2J7I A;  1OI1 A;  1YWO A;  4RMO A;  4CI0 C;  1JJ2 P;  3SFM A;  4OVA A;  2EYZ A;  3CME T;  3CMA A;  3CCR A;  2BKD N;  2M16 A;  3QII A;  3UDC A;  4B9W A;  2ZPG B;  1KFZ A;  4EMK C;  2K2M A;  4FSS A;  2DX1 A;  2KSS A;  1X2Q A;  2E64 A;  2RNA A;  4J8O A;  2QYZ A;  4FM4 B;  4X1V A;  1OOT A;  1HXD A;  3OYK A;  2E3I A;  1M90 C;  1MMG A;  2K3X A;  1VQO Q;  4CRI A;  3MPU B;  4M78 D;  2DVJ A;  1D09 B;  1QVG S;  2PUO B;  2ABL A;  1YHQ A;  3OYD A;  1QW1 A;  2E5Q A;  1SSH A;  2QEX T;  3A8H B;  2NUT B;  3CXC S;  4QQD A;  2QTV A;  4OP0 A;  1NE8 A;  5L23 A;  1HSQ A;  3OBY A;  4JRK A;  4E7L A;  2I0N A;  1VQ8 Q;  2NUZ A;  2LVM A;  2ZGW A;  1WPY A;  3QJ6 A;  1GXI E;  2GFA A;  2VC8 A;  1WQ7 A;  2EQM A;  2X4W A;  2RHI A;  4FYV B;  5A2Q E;  2GFU A;  2PQW A;  1ZBX A;  2E6Z A;  1U8R A;  3CCR T;  2EJF A;  3JB9 G;  2ZAE A;  2MIO A;  1G83 A;  2DXT A;  1EFN A;  1MHN A;  2RB6 A;  2EFI A;  2JTF A;  3JB9 J;  3RNJ A;  1YJN A;  1UDL A;  4DBR A;  1M27 C;  3CXC A;  3MKD A;  3I35 A;  1VQN A;  5IH2 A;  5CKE A;  4ZGJ B;  1FMW A;  1M90 U;  2HD0 A;  4J5Y A;  2RJC A;  2BZ8 A;  1FWZ A;  3KUF A;  1VQ8 T;  2V26 A;  1RAA B;  2K9G A;  5A0D A;  1NJI C;  3EGD A;  4IIM A;  3FC3 A;  2BIV A;  1AEY A;  1GCQ A;  1SRM A;  1WA7 A;  3CCS A;  3LLR A;  2M0O A;  3VRY A;  3TVT A;  2D9T A;  1ZSZ C;  2ROL A;  2ECZ A;  3JB9 I;  4RTZ A;  1YP5 A;  4O5V A;  1I1J A;  3VYG A;  3M4G A;  1N6A A;  2QK0 A;  5D6W A;  3MP8 A;  2DET A;  1JXO A;  5GJW B;  1OX9 A;  3M57 A;  2ESW A;  1JJ2 S;  2KRN A;  1TUG B;  2LMJ A;  4C0D B;  2R5M A;  4F16 A;  3SWN C;  5GAO p;  5GMK i;  2RQV A;  4NS5 A;  4MMK A;  3CCU Q;  4J7I A;  4AFZ C;  2FYK A;  1NEG A;  4JLG A;  4EIK A;  1D3B B;  3JCM b;  1AT1 B;  2PZ1 A;  5IHI A;  2KBT A;  2XDD A;  4N0A A;  5I21 A;  4HCB A;  3S3O A;  4MDX A;  3QHS A;  5CKH A;  2GBQ A;  2OI3 A;  4IUT A;  3QWX X;  1GL5 A;  1UJ0 A;  1VYU A;  2F69 A;  4M7A F;  4E7Z A;  4PJO A;  5HY6 A;  2MWO A;  3V8L A;  1KQS P;  3OS5 A;  1NJI U;  2QI2 A;  1K8A R;  1RLQ C;  3CCS T;  4L6V 5;  1KG1 A;  2JMC A;  1I4K 1;  2AZS A;  1V29 B;  4C8Q D;  1I8F A;  3CPW S;  3ZEH A;  5LJ5 g;  1VYV A;  5CAI A;  5GAM e;  3CCJ Q;  2P0K A;  4EDU A;  3PE0 A;  4OMN A;  4ZNX A;  3I5S A;  2D0N A;  4J6X A;  4F7U A;  2YHT A;  4RTT A;  5KE3 A;  1M9S A;  4ORZ A;  3OYH A;  3HSB A;  4XTV A;  1I81 A;  3JCM g;  4OGE A;  4C92 E;  2XG8 D;  1Q82 R;  1N9S A;  4LD9 K;  1OPK A;  3CBO A;  3VS3 A;  5CKF A;  1IXD A;  1M2V B;  3DKM A;  1W70 A;  3QBY A;  1TU0 B;  1AZG B;  5KYU B;  4A4H A;  1QKX A;  5GAN e;  4XTW A;  3URG A;  2C0I A;  2RM4 A;  4IUR A;  3CC4 Q;  3CPW A;  1IHW A;  2JOY A;  3JV3 A;  2BTT A;  2FHD A;  4C0F A;  3EG3 A;  4QKU A;  3F70 A;  2KRM A;  2CZ6 B;  2EAY A;  3LH0 A;  3EFO B;  3CQT A;  1O75 A;  4PK4 A;  4ANJ A;  5FU6 B;  1TXQ A;  3TSZ A;  3EFR A;  4A4K A;  1LOJ A;  3L2V A;  4M77 E;  1VQ9 Q;  3UPU A;  3LYI A;  3LWI A;  2HL3 A;  1VQ5 Q;  1JEG A;  3I56 A;  2KE9 A;  3CCM Q;  4E7K A;  2HDA A;  1LCK A;  1WLP B;  2KEA A;  2OTL Q;  4J6W A;  2X4Y A;  3U23 A;  4M75 G;  2AIR B;  3H0I A;  1YIJ Q;  1K73 C;  1SHF A;  4PLI A;  1I5L A;  1D0Z A;  4M7A B;  3CPF A;  4BE2 A;  2EIF A;  5GMK e;  2RN8 A;  1YJ9 Q;  1ZA1 B;  3HTR A;  1KD1 C;  4WTO B;  3M5A A;  1GRI A;  1RAG B;  3RUX A;  1UB4 A;  3FRN A;  2ATC B;  2YXY A;  3EGX A;  9ATC B;  2MCN A;  4XTU A;  3JCM J;  3UA6 A;  3CC7 Q;  3EH2 A;  1BIA A;  4J9F A;  1WQW A;  2K2V A;  1V76 A;  2X51 A;  5KYY A;  3EGX B;  3L2W A;  2R58 A;  3I56 T;  1UFF A;  1B34 A;  2OTL T;  2CUB A;  2CH4 W;  3OW2 S;  2CSQ A;  3GLX A;  2RJD A;  5KYY B;  2CKK A;  3GOX A;  3UWN A;  3R6O A;  4J9C A;  3P8B B;  3OYJ A;  3M55 A;  4PLL A;  3JRZ A;  5D6X A;  2RI5 A;  4OMQ A;  2EYW A;  1PHT A;  1X75 C;  3BE3 A;  2DTO A;  2DIG A;  2DJZ A;  4LDY A;  4X9C A;  1YJ9 T;  4FYW B;  5LJ3 f;  2MYS A;  2RQU A;  5GAM j;  4GBQ A;  4PKC C;  3LX7 A;  3OYI A;  3G6E Q;  3CC7 T;  5J26 A;  3OW2 A;  4DOW A;  4M7A D;  2O9S A;  3HHT B;  2FVU A;  4C92 D;  5C0M A;  1MMA A;  1X6O A;  3MEA A;  5KYX A;  2FZC B;  1QCO A;  1K4U S;  2YDL A;  1Q86 R;  1QCF A;  4M7D F;  4RUG A;  1IB8 A;  1Y7X A;  3QYH B;  3QXE B;  2ZZD A;  1G5V A;  3NFC A;  3RES A;  1WHH A;  1AVZ C;  5LL6 S;  8ATC B;  2OTJ A;  2DVE A;  3REB B;  1K76 A;  1GCQ C;  5GAN j;  1Z9Q A;  2LZ6 B;  1K9M C;  3I5R A;  2FRW A;  1D1B A;  2C06 A;  3VS7 A;  1N8R U;  1W2B S;  2O31 A;  3G4S Q;  4M78 F;  3X26 B;  3CBM A;  1HJD A;  1KC8 U;  2KR3 A;  4R55 A;  2PNI A;  4V2S A;  3FIF A;  4M77 D;  2XDP A;  5CVI A;  4LNP A;  1NPP A;  3JCM P;  1E7O A;  4Z89 A;  1M1K C;  1NM7 A;  4NOY A;  1ZSZ A;  4HCZ A;  2QA4 A;  2RPN A;  3OYM A;  1BI0 A;  3OMC A;  5GAO l;  2IIM A;  4BB7 A;  1UTI A;  5GAM h;  4F17 A;  4N0A C;  2K4Y A;  2L5Q A;  3RMQ A;  1PWT A;  3EG9 B;  2NLU A;  1AWW A;  2ENM A;  2J6K A;  3CCV A;  4BE0 A;  2OAW A;  1W2B A;  2OTJ T;  4PJO C;  2CZ7 B;  4PJO G;  5GMK j;  4PL6 A;  1YI2 Q;  1RUW A;  3CC2 A;  2XID A;  2XU8 A;  1AWJ A;  1ZBJ A;  2DD5 A;  2J05 A;  4ESR A;  4HCK A;  2KRS A;  1X43 A;  5HK3 A;  4FCY A;  3PVQ A;  2L89 A;  5GAN h;  4FYX B;  4CC4 B;  2DE0 X;  3L42 A;  1Q7Y R;  1G3W A;  2GQI A;  5GAN 7;  4F7U G;  4E7I A;  4JUV A;  3CXC P;  1RAF B;  1OZ2 A;  2JS0 A;  3JB9 D;  4M7D B;  3G7Z A;  2X3W D;  1BCM A;  3M56 A;  3VYH B;  3M4Y A;  5LJ5 e;  2KQW A;  2CT4 A;  2K5F A;  2YUP A;  5CCA A;  2ZPE B;  1PRM C;  3O8V A;  2W10 A;  1FYN A;  4QVD A;  3CCV T;  1TUC A;  3JCM e;  4DEX A;  2LRQ A;  2DEU A;  3CC2 T;  3DB3 A;  8AT1 B;  3RDV A;  3TCJ A;  1M8M A;  2LQN A;  5FU6 C;  4AMC A;  1Z9Z A;  4M78 B;  2QDL A;  2A0F B;  3ZFJ A;  1VQ6 A;  1KHI A;  2GTO A;  2M51 A;  3M53 A;  3MHX A;  1EZZ B;  4PJN A;  5GMK h;  3GPL A;  4C0G A;  1UGQ B;  2D8H A;  1G2B A;  1G8X A;  4OB2 B;  4PFZ A;  4UC4 A;  1P92 A;  4MZM A;  2DRM A;  2KYM A;  3DLL A;  4E7J A;  4X34 A;  3H9N A;  2E1H A;  2JNG A;  2ZPH B;  1ZHI A;  7AT1 B;  1ZUY A;  5DY9 A;  4MDW A;  1NEB A;  1ABO A;  1X2K A;  2X35 A;  2MAM A;  2LQK A;  1AZE A;  4C8Q F;  4AG1 C;  1X01 A;  2XKO C;  1OEB A;  3J80 E;  2AK5 A;  3G1J A;  1NPR A;  1XJW B;  1U06 A;  4M7D D;  4JJC A;  4OB1 B;  2C0O A;  2EKO A;  3HRU A;  2ZCF B;  1VQ6 T;  3RKX A;  1J3T A;  4JJD A;  2V1R A;  3OYB A;  2CP6 A;  5GAN 4;  3MCA B;  4QVZ A;  1T3S A;  3E2U A;  2X4X A;  3A5Z B;  1W1F A;  4LUD A;  1WJS A;  2KAF A;  2M0Y A;  1LVK A;  2DAQ A;  2MOX A;  3QDR B;  2G3R A;  1M8V A;  2DBM A;  2PVD B;  1D1C A;  3VUZ A;  1VQO A;  1R0B G;  2V1Q A;  2NUT A;  1UGS B;  2CH4 A;  1MV3 A;  3RBB B;  5LJ3 g;  2Z0W A;  1BBZ A;  5GAO n;  1K8A C;  1O9S A;  3M54 A;  1PSE A;  2YRC A;  3OYA A;  5HKC A;  1PM3 A;  1KSW A;  3MP1 A;  5GAN 6;  3MEV A;  1OQK A;  5KYN A;  4DA4 A;  1VQ8 A;  3MET A;  2V8K A;  2RJE A;  3JCM Q;  2NUP B;  1TH7 A;  2NWM A;  3PNW C;  1M3C A;  3CPW P;  3PTA A;  2A37 A;  4FIB A;  1EX4 A;  1JRI A;  5KCO A;  3QWY A;  4D8D A;  3CCE Q;  1YHQ Q;  4ZTF A;  2DXC A;  2KI7 A;  1WX6 A;  1ZQ1 A;  2LJ0 A;  1Q82 C;  1YCY A;  2AKK A;  2HNI A;  5GAM d;  1NYG A;  1R8O B;  4WF2 A;  5LJ5 j;  1N9R A;  5C6S A;  2EKH A;  1VQO T;  2HAX A;  6AT1 B;  3H41 A;  1DJ7 B;  1JO8 A;  1YN8 A;  2JVV A;  2VAS A;  2K6D A;  3QJY A;  3G71 Q;  2DFU A;  1H64 1;  3O5Z A;  2KVQ G;  2RMO A;  1OX8 A;  3Q1J A;  4L5G A;  4R0K A;  1M30 A;  2KYB A;  3OYE A;  3H6Z A;  1QWF A;  3A1P A;  4C8Q B;  2QQR A;  5D6Y A;  1K8A U;  1GFD A;  2QDY B;  1WJR A;  3TSW A;  1TSF A;  1TG0 A;  2WAC A;  3VS1 A;  1U3O A;  2LCS A;  5IHN A;  2FZK B;  2XK0 A;  4E7S A;  2CZ0 B;  1KHC A;  2DXU A;  3GP8 A;  1T0H A;  4M75 D;  1K1Z A;  3BFM A;  2L8D A;  3PT9 A;  2CP7 A;  3EFS A;  4XAX B;  3H0H A;  1KQ2 A;  2HEQ A;  1S72 Q;  4PJO E;  5CR2 A;  2VVK A;  2P4T A;  4LD6 A;  4ME7 A;  2LDM A;  2EQK A;  3CCQ Q;  1D0X A;  1D3B A;  1QKW A;  3V7S A;  1ZSG A;  2WSC E;  3CCU A;  3CCL Q;  1NLO C;  1OU9 A;  1W4S A;  2O2O A;  2Y90 A;  5GJV B;  2D6F A;  3LW5 E;  2V8I A;  5LJ5 h;  4II1 A;  1M3A A;  2W0Z A;  1WZO A;  4NL3 A;  1UGV A;  4BI3 A;  1X6G A;  5D7U A;  1NBE B;  4OMM A;  3OQ5 A;  2JTM A;  4F7U E;  3L2Q A;  1BU1 A;  2BZX A;  3JCM h;  4C92 F;  3EGU A;  5GAN 3;  3KXT A;  4AG2 C;  2QXF A;  1IRX A;  1XNI A;  2DL8 A;  4XTX A;  4AFS C;  2KMT A;  3OW2 P;  2JZ2 A;  3CCJ A;  3M0R A; 
#chains in the Genus database with same CATH homology
 2E3H A;  1TXQ A;  2Z0W A;  2CP6 A;  2M02 A;  2CP5 A;  2MPX C;  3E2U A;  2HL3 A;  1TOV A;  2CP7 A;  2HL5 C;  2COW A;  2HKQ B;  1WHJ A;  3RDV A;  1WHK A;  2HKN A;  2QK0 A;  2E4H A;  3TQ7 P;  2E3I A;  2HQH A;  1WHG A;  1LPL A;  2CP3 A;  4B6M A;  2CP0 A;  1WHM A;  1IXD A;  1WHL A;  2CP2 A;  2COY A;  1WHH A;  2COZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...