1XNIA

Tandem tudor domain of 53bp1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
118
structure length
118
Chain Sequence
SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Methylated lysine 79 of histone H3 targets 53BP1 to DNA double-strand breaks
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords Tumor suppressor p53-binding protein 1
total genus 24
structure length 118
sequence length 118
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2004-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1xniA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1xniA01
2DO3A 3CCET 1RI0A 3ZEHA 1G5VA 3I55T 4HCZA 1Q86C 3UT1A 1H3ZA 3P8BB 5M9OA 1XNIA 4IUQA 4A4EA 4FL6A 3MP1A 3PIPA 3OYFA 3CCJT 3NTIA 1YIJT 1YJ9T 3CMAT 3CEYA 4QQGA 1NJIU 4A4FA 2RI3A 3E9GA 2DIGA 3G71A 3OYHA 1WJRA 3OYIA 1SSFA 1VQ7T 4IKFA 5J3BA 5KCOA 5FRMA 3CCQT 3QIIA 4E7LA 2XK0A 3S3MA 2L3RA 3ME9A 3G4ST 4IUVA 5J26A 1WJSA 3G6ET 2E5QA 1M1GA 4Q5WA 3MO8A 2EQKA 2RHZA 1VQOT 2GFUA 5C0MA 5D6YA 2O4XB 4RG2A 3CC4A 2JOYA 2XDPA 3CC7T 3CCEA 3OYMA 5DM7R 3OW2S 3CXCS 4NS5A 4IURA 1K8AC 1VQ8A 3F70A 4CRIA 1KD1C 3CCRT 2G3RA 3OYKA 3EAEA 3OW2A 1YJNT 2BIVA 3UWNA 3OYLA 1UEBA 3KBGA 2KDSA 3L2RA 3PMIA 5KE3A 3CD6T 3DLLA 4ZTJA 4QQ6A 3MEWA 3CC2A 1YITT 2D9TA 2L8DA 1KQSA 5FLXE 2MWOA 2K3YA 2IG0A 1Q7YU 3NTHA 3OMGA 1IZ6A 4PL6A 2LVMA 1VQLA 4B9WA 2R57A 3MEAA 3FDRA 2R5AA 3OMCA 3CCQA 2DIQA 3CCJA 1MHNA 2EQJA 3PFSA 3CCVA 2FHDA 3PMTA 3L42A 4C5GA 5D6WA 4E7JA 3OYBA 3CXCA 3OY9A 3LX7A 3S6WA 1OYXA 2RJEA 1QVFS 3CCVT 3QJ6A 2EIFA 1YHQT 1YIJA 2X4YA 2JZ2A 3P8DA 4II1A 2QQRA 1QVGA 3CCRA 4C5EA 2M0OA 5KCHA 3CCMA 1VQPT 3OYNA 1Q81C 1VQ6A 2X4XA 2JTFA 3CCLA 4BDZA 5J39A 1M90C 2EFIA 2JVVA 4BACA 1VQ5T 4ZN1A 1K8AU 1YI2A 4QW2A 1NJIC 2JUFA 1JJ2S 3ASKA 3M9QA 3CCUT 3L2WA 2RO0A 3J80E 2MWPA 3ER0A 4ZTFA 5KH6A 1WJQA 5C6SA 2R5MA 2PQWA 3HKSA 3CCST 1VQ4A 4A4HA 2F5KA 2RHYA 3A5ZB 1BKBA 2L89A 3G71T 1N8RU 2NLUA 3QBYA 4ZN3A 3OQ5A 3OYGA 1S72T 3S3NA 5DLQE 4B9XA 3G6EA 2GF7A 3J7AF 3MEVA 3CC4T 1YJWA 4E7HA 2RI5A 3NTKA 4IUPA 3OYJA 3S3OA 1VQPA 3Q1JA 3OB9A 4PLIA 2BKDN 1XTDA 4C5IA 3PIOA 1VQ6T 4BD3A 2E70A 3DB3A 3KUFA 1Q82C 1NZ9A 5HY6A 3BDLA 3LYIA 4UC4A 2RJCA 1VQ5A 1K9MC 1M1KU 1OI1A 2VYTA 1VQNA 3CD6A 4E7KA 3OYYA 1Q81U 5FRNA 5A2QE 1RL2A 3CCMT 5CIUA 1M1KC 1VQ4T 2DAQA 3G4SA 2XHCA 4E7IA 4C5HA 1Q82U 2LQ8A 3H8ZA 1VQNT 3OS0A 1W2BS 1K73C 2GFAA 2O4XA 2EQMA 2E6ZA 2YRVA 1VQ9A 1S72A 1NPPA 2RHIA 3CPWA 3OS1A 2MI6A 3FEOA 5IAYA 2HQXA 4TVRA 1KHCA 1Q86U 3J81E 1KHIA 4LD6A 2WACA 1YJNA 2QA4A 2X35A 4N4GA 2E6NA 4EDUA 3MP8A 2M16A 2OTJT 1VQMA 2RJFA 3CCUA 1KC8U 1N27A 5FROA 5LL6S 2QQSA 3L2UA 5IN1A 3CPWS 4PLLA 3CMET 1YITA 3SD4A 5KE2A 1OZ2A 1X6OA 3LGFA 2RHUA 3QKJA 3LLRA 1EIFA 3OYEA 3CCLT 1VQMT 3C4SA 3CMAA 2HQEA 4IUTA 4QQDA 3E9FA 1W2BA 2LCLA 2LTOA 3P8HA 1KC8C 2P0KA 3I56A 2QEXA 4GY5A 4BE2A 1WGSA 4N4IA 4BE0A 3LH0A 3L2QA 1VQ7A 3TREA 1K9MU 3OS2A 3OYCA 1QVGS 3O8VA 3CPFA 1VQ9T 2BUDA 1YJ9A 3I55A 2RI2A 4Z02A 3H6ZA 1VQOA 4OVAA 3FLGA 4N4HA 2QA4T 2OTJA 2CKKA 1YJWT 4FU6A 2OTLT 5D6XA 1VQ8T 3CMEA 2EKOA 2LCCA 1NPRA 4QVZA 1OZ3A 2EQUA 3OA6A 2OTLA 1K73U 4BE1A 4L59A 3FC3A 1Q7YC 3I56T 2QEXT 3CCSA 2LDMA 2B8AA 4IUUA 3OYDA 2RJDA 3OYAA 3MP6A 3MEUA 2K3XA 2LRQA 1VQLT 1JJ2A 5IT9E 1YI2T 1N8RC 2M1HA 1M90U 4BDYA 4X34A 1KD1U 2JNGA 2X4WA 1VQKA 3PNWC 1QVFA 4YTLA 3CC2T 2RHXA 3GOXA 3LGLA 2R58A 3DLMA 4A4GA 3L2VA 1YBYA 3DB4A 2KVQG 1VQKT 3JAME 1YHQA 1KQSS 3META 3CC7A
chains in the Genus database with same CATH superfamily
2DO3A 2JXBA 4XTVA 3FB9A 4J9GA 1LJOA 3QG1A 4EMHA 2DLPA 1RAGB 1H3ZA 2A36A 4HT9A 4JRPA 1UTIA 4AFUC 2QYZA 3WVDB 1D0YA 1KSWA 4RTXA 3CC7Q 2G6FX 1BI3A 4HXJA 1JEGA 4A4EA 4FL6A 5CKBA 3ZBDA 4N0AA 2HSPA 2FPDA 3NTIA 1YIJT 4JUVA 3A1PA 1YJ9T 3H0FA 4GLMA 4LN2A 1VQ7Q 2DZCA 2AT1B 4F17A 1ABOA 2RI3A 3E9GA 3EG3A 1UGVA 2DIGA 4FSXA 3OYHA 3CMAQ 4RCBA 3SB2A 1OU9A 4XU1A 2YRCA 3OYIA 1SSFA 5KCOA 2XK0A 1SF9A 2FB7A 2L3RA 3CCEQ 3EFOA 4XQ3A 4M7DG 4Q5WA 3GBQA 3JB9H 2EQKA 3TEEA 5LJ5g 1TUGB 5C0MA 2KYBA 5GMKm 3GLXA 3RBBB 1GBRA 4AT1B 3CCEA 2YUOA 1X75C 4MZPA 1IB8A 1M2VA 2OJ2A 4E2FB 2MF2A 2C0OA 2NYSA 3O5ZA 1KD1C 1IO6A 1JRIA 2WSCE 3OYKA 1YJNT 2BE7D 3JCMg 1UEBA 2FG0A 3KBGA 2KDSA 3R6OA 1R0CB 3VS5A 2VUBA 1K4US 5KE3A 2VASA 1ZSZB 1KQ1A 1H92A 1QCFA 4ZTJA 1AWXA 5FU7B 2XI9A 3MEWA 3QUIA 1WLPB 3CC2A 1KQSA 3RKWA 2CUDA 2FYKA 2IG0A 5FWCA 2QGGA 1Q7YU 3NTHA 2KE9A 4OMOA 2LVMA 4PL6A 4M7AC 1C1AA 2JW4A 1SHGA 3MEAA 2R5AA 4PJLA 3OMCA 1U1SA 4ELZC 2YRDA 2I2LA 1WI7A 5A0GA 1NYFA 5GAN7 3THKA 5L8RE 3QZ9B 3PMTA 4MMLA 5D6WA 1BU1A 3OYBA 3EGUA 5GAOr 5CAIA 1SPKA 3S6WA 2K2VA 3VS6A 4EMKA 3V8JA 1I81A 2HBPA 2ESWA 1YIJA 4DQ2A 4II1A 2DXCA 5GJVB 2QQRA 1W6XA 1QVGA 3QSUA 2W10A 2GTJA 2A08A 2DF6A 4XU3A 2X4XA 3VU3C 2JTFA 1WHJA 3CC4Q 4BDZA 3CCUQ 4AG1C 2GGRA 3MHXA 3GNGA 1QW1A 3C12A 4ZN1A 2A3LA 1ZBXA 5LJ5d 3ASKA 1UHCA 2FRWA 1HSQA 2NUPA 1D1AA 1G3TA 3G71Q 5KH6A 3QHSA 2RM4A 1I5OB 2PQWA 3SEMA 2VWFA 5CO7A 3IQLA 4OMPA 3VS1A 1R77A 1Q81R 2LCSA 4A4HA 1RLPC 5KYYB 2DA9A 4ZNXA 4M7DF 3M56A 2EPDA 4P5NA 2VVKA 1D1CA 2X51A 4OB1B 4KGXB 5LJ5j 3PVLA 3QDFA 2ED1A 3HPWA 5DLQE 1YN8A 2YWWA 2HCKA 1VQPQ 5LJ5e 3A8HB 3H0IA 1VIFA 1R8OB 3MEVA 1VA7A 3TSZA 1YJWA 2COWA 2MYSA 4IUPA 2DJQA 2WSFE 4XTWA 1AWJA 4ZGEB 4M78D 2BKDN 3PIOA 1VQ6T 3GF5A 4FW2A 3JB9I 1ZQ1A 1LNXA 2DTIA 4M77C 3EHQA 2RH2A 4C8QA 2RJCA 1VQ5A 4F7UA 4HCCA 1M1KU 1OI1A 1VIEA 2AZSA 1N6AA 2PU9B 2ZPHB 4M75G 5LJ3j 1YWOA 2ROTA 1M1FA 3NFCA 5CIUA 4VUBA 3CCMT 1Q7YR 1VQ4T 4ME7A 4AMCA 2QTVA 5CKFA 1KC8R 1TWBA 4RCCA 1D09B 4XU2A 2GFAA 2QDLA 2EKHA 7AT1B 1YFNA 4DOWA 2EQMA 2J6KA 4M7DE 5GAOp 2YRVA 4M7DC 1VQ9A 1NPPA 2RHIA 4GBQA 4PJOB 1H3HA 2MMPA 2HQXA 1KHCA 1Q86U 1D0ZA 2Y4XA 1S1NA 5GAMh 3BE3A 1WHHA 3QDRB 4N4GA 5CR2A 4EDUA 4J6WA 1N27A 2ZPIB 2FVUA 1W4SA 2CP6A 3CPWS 4BI3A 3CQTA 3VYHB 4HVVA 5LJ5h 3M4GA 2LQKA 1G2BA 4XU0A 2DL7A 2RHUA 2OTJQ 3M0PA 4XTYA 5GAN2 1OX9A 2P84A 3C4SA 4EIKA 2DX1A 1WDXA 1VYVA 1X6GA 2F2XA 2LCLA 2LTOA 2QEXA 5LJ3f 4BE2A 3FJPA 5A0DA 3QWYA 1QP3A 2C0IA 3GP8A 3G7ZA 2L3PA 3REAB 3HHTB 3TREA 3V8LA 2OX7A 2QEXQ 2DZ9A 2CREA 2EYZA 4JJNK 3EFSA 2BUDA 4EMKB 1YJ9A 3I55A 4LDUA 2RI2A 4J7FA 3H6ZA 2HMAA 3URGA 3FJ5A 2AKKA 4HVWA 4OVAA 1AD5A 4JJDA 1WZOA 3FLGA 1YNZA 4M77G 2OTJA 1H641 2OTLT 2O31A 4FSSA 2RA2A 2EJFA 4FT2A 1VUBA 3JCMQ 1IGUA 4ESRA 4C92D 1VQKQ 1YJWQ 5CQXA 1OZ3A 2KR3A 4M75F 5IXFA 4X9CA 4BE1A 4L59A 2K79A 3FC3A 3OBYA 5GJWB 3RDVA 3SFMA 4J9FA 3I56T 1GCQA 1PSFA 4IUUA 2MOXA 1QKWA 1KG1A 2NUTB 1T3SA 4M78E 1KQSP 1K9MR 5KYWA 2LRQA 4Y92A 1JJ2A 2BZYA 4Z88A 4JPBW 1FWZA 1Q82R 2QI2A 1PHTA 4F04B 3SWNA 1WHGA 4RTYA 3EG2A 4LDWA 3CC2T 2RHXA 2RK2A 2PUKB 4KH0B 3PT9A 1Z9QA 1PSEA 4M7DB 2DRMA 4KRTA 4PJOG 2J7IA 2JT4A 3N5BB 3H0HA 2LT4A 3META 3CC7A 2GCXA 2P0QA 1ZA2B 4FM4B 2COZA 8AT1B 3A8OB 1RI0A 1UFFA 2YUNA 1WIEA 1YIJQ 2EJGA 3P8BB 2YLCA 1XNIA 1T0HA 4IUQA 4ZGDB 3I55Q 1VQLQ 1KD1R 2VXEA 2CZ6B 2AK5A 4J8OA 3CMAT 2CZ7B 1EZZB 5I21A 2LJ3A 2NUTA 3JCMd 2X3WD 3JB9G 5DY9A 1CSKA 1TU0B 5D7UA 2E12A 2X9HA 3MPUB 4WCIA 4IKFA 5J3BA 5FRMA 4KT0E 3EG1A 3CCQT 5A0LA 2RF0A 1XQHA 3QIIA 4ORZA 3RKXA 3ME9A 2ZGWA 3G4ST 5J26A 4L6V5 4ATOA 4M77F 3G6ET 1M1GA 1WXTA 3U23A 4CC2A 3MO8A 2E64A 1BCMA 1E6HA 2GFUA 4RTWA 8ATCB 2DD4A 4C0FA 2HQHA 2M9UA 3CC4A 3FRNA 3OYMA 2LQWA 3OW2S 1UECA 3M57A 3CXCS 5CVIA 4DBHA 4V2SA 3F70A 4OB2B 1KJWA 2XD0A 1XOVA 3CCRT 2G3RA 3EAEA 1I4K1 1ARKA 2BIVA 1MMAA 2CP5A 5LJ3e 3L2RA 1Q95G 2B86A 3DLLA 1I0CA 2DERA 1I5LA 4J5YA 2GBQA 2D0QB 1PRMC 2E3IA 1UDLA 4WTOB 1YITT 4AFSC 1RAIB 2KI7A 4BY6C 2VKNA 3PE0A 1PKSA 1WHLA 1XJWB 3QPHA 4LDXA 1VQ5Q 2YXYA 2BZXA 2ZPFB 3A8LB 2DRKA 4JZ4A 3ZFJA 3PFSA 4MDXA 3CCVA 2QG9B 2FHDA 2RQVA 4JJBA 4PJOF 4DEYA 4EMKC 4PJOC 3VS4A 3L42A 4M75B 3PTAA 3CXCA 1N8RR 3OY9A 3LX7A 1W2BP 2FO0A 1RABB 1MV0B 1M30A 1QVFS 5GAMf 3CCVT 3QJ6A 1KK7A 1DJ7B 1YHQT 4JZ3A 1AVZC 2JZ2A 3TSWA 4JRIA 2FZCB 2CSIA 2CS7A 3CXCP 3OYNA 2EYWA 1PWTA 2CP0A 3CCLA 2KRNA 1MV3A 2OI3A 4BACA 2JS2A 3JCMh 1M8MA 2YSQA 1M27C 3CBOA 4QT7A 4PJMA 1JB0E 3JB9F 1YI2A 2DILA 4QVDA 2F69A 3L2WA 3ER0A 4ZTFA 4RTVA 3X20B 1WJQA 3H9NA 2R5MA 1C0MA 3VRZA 2Y4YA 1OEBA 3EG9B 3CCST 1VQ4A 2RHYA 4AFQC 3A5ZB 1RAEB 1X69A 5KYWB 2EWNA 1NG2A 1D1BA 1T3LA 4XK8E 3OQ5A 3FIFA 1UJYA 3M55A 1S72T 3S3NA 1OX8A 2KNBB 3G6EA 1I07A 2CT3A 1BBZA 3OYJA 3S3OA 5KYXB 3C94A 3UPUA 1VQPA 3EH1A 4BUGA 2DXBA 3Q1JA 5AYFA 1M9SA 4C5IA 1U8RA 4BD3A 5GMKl 2DEQA 2CH4W 5GAOl 2K5LA 1VYUA 1NZ9A 3BDLA 3VV0A 2X4JA 3L2ZA 5GMKj 4C0GA 2KEAA 2FPFA 2VYTA 4N0AC 2DK3A 5FU6B 4A63B 1RL2A 2F2VA 1M1KC 5FU6C 2DAQA 4KGZB 5I22A 1W1FA 1BI1A 1WFWA 1VQNT 1K73C 2PUOB 3QXEB 1I8FA 4FT4A 1IHWA 2O4XA 4E7ZA 2M51A 5GAN4 1MMNA 3OS1A 1ZSZC 5IAYA 1ABQA 1X01A 2ROLA 1RAHB 5FWBA 1PG5B 4LD6A 1M3AA 4KGVB 1UHFA 1YJNA 1QVGP 4JRKA 2NUPB 3UA7A 1AEYA 2LMJA 3SWNB 2M16A 4BY6B 2OTJT 2RJFA 5FROA 5LL6S 3VUBA 1NBEB 2P0PA 5IN1A 4C0DC 1N9SA 5KE2A 1BIBA 1OZ2A 9ATCB 4O5VA 1BCOA 3LLRA 2H3JA 3HRTA 5GAMg 3OYEA 1VOMA 2KXDA 1X43A 3INZA 2KT1A 1WHKA 3CMAA 4JLGA 2HQEA 4RUGA 2MK5A 1YCYA 2QK0A 4MMKA 1G3WA 1KFZA 3EGXB 2P0KA 1JXOA 1WGSA 2DMOA 2W0ZA 3V7RA 3LH0A 1E6GA 5KYXA 2YUQA 3OBWA 2XDDA 4D8DA 5GANf 3E1SA 3O8VA 1NEGA 2QQAA 4CC7A 1VQ9T 3HRSA 4OMLA 2K2MA 4Z02A 3VS3A 2CP3A 1TS9A 2DTHA 1VQOA 1RLQC 3HRUA 4C92C 3RNJA 1UGRB 4M75D 4PK4A 1LCKA 2XKOC 2CKKA 3CPWP 1YJWT 4RTZA 3X24B 3CBMA 2FZGB 4CC4B 3CMEA 3RKYA 4LUEA 1NLOC 2PVGB 2LCCA 2V8IA 4M78F 4AFZC 1F1BB 1VQ8Q 1X6BA 4KUDK 3MJXA 1ZA1B 2Y90A 1Q7YC 2JMCA 2B8AA 3MP6A 2K3XA 2YLBA 4FW1A 5IHKA 2ZCFB 2DL5A 2QGFB 4OMFB 1UE9A 2IIMA 2KAFA 1X2QA 4BDYA 1BI2A 1A0NB 1YJ9Q 2QA4Q 2C0TA 1FMWA 4DBQA 3V7CA 2E3HA 3LGLA 3GNFB 3M53A 1YI2Q 2R58A 4A4GA 2LC4A 3QYHB 3LW5E 3L2VA 3JCMf 4C92E 3RR6A 4JDSA 2DVJA 3JAME 2V26A 3VYGA 3CCET 2LNVA 5IHNA 3EG0A 4MDWA 1J3TA 3A98A 1YCSB 1ZUUA 3I55T 4HCZA 1Q86C 1Z9ZA 4MZTA 1OV3A 3M59A 1G3YA 4CI0C 5GAOq 4NOYA 2ABLA 4F7UG 5I2SA 3CCJT 1FXXA 1MUZA 5DLOA 3EH2A 1K8AR 4M4ZA 2ECZA 2RN8A 4DA4A 2ED0A 3CEYA 3UDCA 2FEIA 4A4FA 1D0XA 3CCQQ 2PZ1A 1V1CA 3HFOA 3PVQA 1IHVA 3ULRB 2K4YA 4FIBA 1WJRA 2KSSA 3X28B 2L3SA 5GAN5 4E7LA 2NUZA 3H41A 4C92A 2HAXA 3S3MA 2CP2A 2F5TX 1PRLC 4ZGJB 2LNHB 1WJSA 4KBMB 4C92B 2RHZA 3JCMV 2E10A 2HD0A 5EC7A 5HK0A 1JO8A 4RG2A 2JOYA 5IXBA 1NJIR 2QQBA 1TOVA 3CCRQ 3REBB 3CC7T 2KK4A 3M54A 1HD3A 5DM7R 2KMTA 1Y7XA 4NS5A 4LD9K 1VQOQ 4M78G 2IVWA 2V8KA 5GAMj 2O9VA 2PVOB 4Y28E 2CYZB 4CRIA 2GTOA 2SEMA 1M5Q1 4RKUE 1QMCA 1M2VB 1HK9A 2DNUA 2XG8D 5GANd 2XIDA 5FU7C 4RG8A 1OQKA 1ZLMA 1W70A 4PNOA 1AZGB 2YUPA 4QQ6A 4JRQA 5I2MA 1RUWA 4DEXA 2D8HA 3LWIA 2D9TA 1GBQA 3V8KA 2MWOA 2K3YA 4OMNA 2E4HA 3CD6Q 2KBTA 4OGCA 2RK1A 1IZ6A 4B9WA 5CKHA 2R57A 3OW2P 3VS2A 2DIQA 2K57A 2HKQB 2KT8A 4IIOA 3JB9J 2CH4A 1PM3A 1YHQQ 4E7JA 3QJYA 4XTZA 3NPFA 4XTUA 3SDZA 1OYXA 1Q86R 2RJEA 2CT4A 2E1HA 2DE0X 1YJNQ 1TUCA 1PC0A 1NYGA 4PFOA 5CKDA 2F2WA 4OMMA 3P8DA 2LJ1A 4E47A 1SSHA 2M0OA 5KCHA 3CCMA 1VQPT 4LDVA 5GAMd 4D8KA 1VQ6A 5GMKi 4F7UF 2L3QA 5GAOm 4RMOA 3GPLA 1YP5A 2JJ9A 5J39A 3AT1B 2E5KA 2EFIA 2XU8A 3M0QA 5KYUB 1K8AU 2MPXC 1B07A 4QW2A 1VQ6Q 3CCSQ 2JUFA 1O9SA 1JJ2S 4PFPA 2RO0A 1K0XA 1RAAB 4FYWB 2YDLA 1RACB 4HVUA 5C6SA 4M77A 1U3OA 4KULA 3HKSA 2RQUA 1AWWA 3E2UA 1V29B 1S72Q 1D3BA 2J6FA 3RIRA 4RTUA 4A53A 3QBYA 4ZN3A 1TTHB 3RUXA 2HBWA 5GAN8 2K9GA 3OYGA 1SRMA 4J9BA 3EGDA 2HEQA 1G83A 1G3SA 4OF1A 5ECAA 2HDAA 1UUEA 4B9XA 1ACMB 5HKCA 2GF7A 4PKCC 3VRYA 2M02A 2P4RA 4XAXB 3CC4T 1QWEA 4E7HA 4PJOE 2RI5A 2IPOB 3EGXA 3OB9A 2C06A 3JV3A 2DYBA 1FX7A 4M7DD 3M58A 1XTDA 2D6FA 5GAN3 1GCQC 4FYVB 2E70A 5GAOn 3JCMX 3M0TA 3E19A 1TXQA 4J9DA 1Q82C 3LYIA 1Y96A 4UC4A 1M2OA 3BFMA 1K9MC 3JCMb 3WXMB 1SKUB 4MZMA 4M77E 1VQNA 4M75A 2K6DA 3OYYA 1Q81U 1UGQB 2COYA 5A2QE 2JM8A 4J6XA 1K76A 2CP7A 4J9IA 4E7IA 2KGTA 4C5HA 5GMKh 1Q82U 3G1JA 3OS0A 4AG2C 3OS5A 3HSBA 2GQVA 3BDUA 2FL7A 3GIBA 2EAYA 1C6VX 4PFZA 4O6JA 4R0KA 1H8KA 1S72A 3QO3A 3CPWA 4JLIA 5GANj 2JMAA 2EJ9A 3J81E 2VC8A 1ZBJA 1KHIA 3UA6A 4BB7A 2QA4A 2X35A 3HL8A 2BZ8A 5LJ5f 2DBKA 2E6NA 3MP8A 2VV5A 3CCUA 3L2UA 2QQSA 2DJZA 3CMET 3SD4A 1OULA 1FMKA 2Z0WA 3ZL7C 3CCMQ 1N5ZA 1D3BB 3QKJA 4EMGA 3EFRA 1EIFA 5IHIA 3CCLT 2OTLQ 1VQMT 5CQYA 4F7UB 4OB0B 1SHFA 3E9FA 2O88A 1PNJA 3P8HA 4IIMA 2EGAA 1K73R 4K11A 3RMQA 3I56A 4GY5A 1CKBA 1QVFP 4N4IA 1K9AA 1BB9A 3L2QA 2I0NA 1WYXA 1HYOA 2DEUA 1LPLA 3I56Q 2J05A 1K9MU 1QVGS 3TQ7P 2YHTA 1K0SA 2JM9A 2L0AA 4LNPA 2OAWA 3CPFA 2LJ0A 3VS0A 1UGPB 1IRXA 2VB6A 1MMGA 4HA8A 2DL3A 4FCYA 4C0DB 4C8QD 1MNDA 2K5FA 4QVCA 2L2PA 1EFNA 2XDBA 4LDYA 4N4HA 2MAMA 4GLKA 3BY7A 4HCKA 2O9SA 3CC2Q 2A37A 3LH5A 5D6XA 2DTOA 3M0RA 3M4YA 2ZPGB 4X9DA 4OGEA 1U1TA 1BI0A 1VQ8T 1M4ZA 1JXMA 2M0YA 2EKOA 4ANJA 4M7AA 4PJJA 2AHJB 2FPEA 2SRCA 2X3XD 1NPRA 4DBRA 1M90R 4QVZA 4M75C 1K73U 1JJ2P 1IREB 4C8QC 1T0JA 2KXCA 2QEXT 2QXFA 3C95A 1MNEA 1JBMA 2LDMA 5I11A 2V8JA 4LUDA 3OYDA 3MEUA 4C8QE 2LQNA 1VQLT 4C0ZA 2D1XA 2LZ6B 5IT9E 2DETA 3JSCA 1LOJA 1YI2T 2M1HA 5LJ3d 2J6OA 4X34A 2JNGA 2X4WA 4E7SA 3L1AA 5EG2A 5CCAA 1VQKA 3PNWC 1SEMA 2XMFA 3DLMA 2A0FB 4OP0A 2KYMA 1GFDA 4M7AE 1VQKT 4BI8B 2RQWA 2K3BA 2GNCA 5GANe 3G4SQ 2E65A 2HL3A 4Z8AA 1FMVA 1MMDA 3ZEHA 1G5VA 3VS7A 2QTXA 3C0CA 2CZ1B 3UT1A 4HKEA 2FZKB 3CCJQ 1X2KA 3D7SB 2QDYB 4C92F 5M9OA 4M7AF 4ELYC 4M77B 2DL8A 3I5SA 2EGEA 3X26B 3CBPA 1ZSZA 3MP1A 6AT1B 3PIPA 3OYFA 1QCNA 5GAMe 2MCNA 2MIOA 4X1VA 3NHNA 4J83A 3NGPA 3RERA 1KIKA 4R56A 4QQGA 1NJIU 3JRZA 3WVEB 5GAN6 2RPNA 1UGSB 1TUDA 3G71A 1GL5A 3HP9A 2F1LA 4QKUA 5LJ3g 1ZUKA 3JCMW 2HKNA 1VQ7T 2VXFA 1AWOA 1Y0MA 4LE9A 4DBFA 4IUVA 2BE9B 3M0SA 1WQWA 2K5IA 2E5QA 3JCMc 1HJDA 1VQOT 5D6YA 1NLPC 2O4XB 2PVDB 4L5GA 5KYYA 1SRLA 2XDPA 1V76A 2DD5A 1B34B 4BI4A 3X25B 2CUBA 4IURA 1K8AC 2ENMA 1OU8A 4J9EA 1VQ8A 2K7AA 2V1QA 4M78C 3MCAB 1TH7A 2XICA 1TG0A 1AHJB 3OW2A 2DBMA 3UWNA 3OYLA 1VYTA 4M78B 4RTTA 1GRIA 3PMIA 4PJOD 3CD6T 4HT8A 2DM1A 4M7AB 1RAFB 2ZAEA 2L8DA 1UJ0A 1AOJA 4Y91A 5FLXE 5LJ3h 2RD1A 1JQQA 2KROA 1B3QA 1QQJA 3EHRA 3OMGA 3G6EQ 4M7DA 1VQLA 4EPCA 3VUZA 2RB6A 3FDRA 4D6WA 2EVRA 3CCQA 4JS4A 3CCJA 1MHNA 2EQJA 3QWXX 4C5GA 3VJPA 2VGNA 3VKIA 2D0NA 2EYQA 1OOTA 2LT1A 3TCJA 1NM7A 2LX7A 4C8QB 2EYXA 1U5SA 2EIFA 3A8MB 2X4YA 3BW1A 4C92G 1FYNA 3CCRA 4M7AG 4C5EA 4NL3A 1YITQ 1Q81C 2PTKA 5KYUA 2O2OA 1WHMA 2EGCA 2EYYA 5L23A 1M90C 2JVVA 1K1ZA 3I35A 2DPPB 1VQ5T 4C8QG 1X27A 1NJIC 1WXBA 2BTTA 1ZHIA 3M9QA 5AT1B 3CCUT 3NMZC 3J80E 2MWPA 5GANg 4F7UE 3SHWA 1WX6A 2LP5A 2F5KA 1WA7A 1NE8A 5GMKe 1M3CA 2A7YA 1BKBA 1OPKA 2L89A 3EG9A 1B34A 3OSSC 3G71T 3CCVQ 1N8RU 2NLUA 5IH2A 4CC3A 3M0UA 3LWHA 1IGQA 1N9RA 1IXDA 4A54A 1CKAA 1OPLA 1Y57A 3J7AF 4M7AD 2A28A 3HTRA 3NTKA 2DVEA 2EQIA 1GXIE 3TVTA 5FW9A 2NWMA 4KH1B 4PLIA 4HCBA 2RQTA 1M3BA 4WF2A 3DB3A 1Y96B 3KUFA 5HY6A 1KQ2A 5CKEA 3CD6A 2HNIA 4E7KA 1I1JA 5FRNA 2VGMA 4J6YA 1WNLA 2HZYA 2OAUA 1BYMA 2FRYA 2RMOA 3G4SA 2XHCA 4PJNA 2LX9A 5GANh 2LQ8A 3H8ZA 1W2BS 1PCXA 4Z89A 1HXDA 1VQ4Q 1SG5A 1JU5C 2E41A 1ZUYA 2E6ZA 3UF4A 1QWFA 2DFUA 1AT1B 4B6MA 3KFVA 2MI6A 3FEOA 3TU4K 4TVRA 1UG1A 2CDTA 5HCKA 1M1KR 1P92A 2WACA 3HFNA 3CMEQ 1VQ9Q 1WXUA 3MKDA 2ATCB 2L5QA 2KY9A 1VQMA 2DL4A 4J7IA 1KC8U 3OSVA 3CCLQ 4M77D 2DXTA 1VQMQ 1MGQA 4PLLA 3M5AA 1YITA 1BIAA 1PD1A 1X6OA 4C8QF 4NL2A 3LGFA 2RNAA 2P4TA 2CZ0B 4XTXA 1AZEA 3I5RA 1GFCA 1QKXA 4JS5A 2JTEA 4A4KA 4IUTA 3RESA 4QQDA 3SWNC 1VQNQ 1W2BA 1RI9A 2HSEB 2JTMA 1GCPA 5KYNA 1KC8C 2JS0A 1WPYA 1E7OA 3V7SA 2KRSA 4FYXB 4BE0A 4FYYB 4F16A 3EFOB 3JB9D 2QASA 1UB4A 2YT6A 1VQ7A 1Y71A 3OS2A 2AZVA 3OYCA 1EX4A 4M78A 2GQIA 1ZSGA 1G8XA 2PNIA 3AHUA 3JCMe 4E6RA 2DXUA 2AIRB 4R55A 1Y07A 4KUIA 1QP2A 2QA4T 4J9CA 1PD0A 3PGGA 2QQ9A 4FU6A 1M8VA 2CSQA 3I9QA 1QLYA 1R0BG 4F14A 2H3EB 2KRMA 3DKMA 4PJOA 2HL5C 2EQUA 2AKLA 3OA6A 4OB3B 2OTLA 2DKGA 1U06A 2WSEE 4LXCA 2ZPBB 3QZ5B 1YWPA 2O01E 2ZPEB 3CCSA 2EW3A 3EGDB 3T9NA 3QYGB 2RJDA 1TSFA 1B7TA 3OYAA 3RMSA 2H8HA 2V1RA 2KQWA 2ZZDA 4JJCA 2D8JA 2DYIA 1QVPA 4M75E 1QCOA 1N8RC 5CK9A 4DOVA 1NEBA 1RADB 2J06A 1M90U 1KD1U 1PKTA 3A8GB 1O75A 1QVFA 2JN0A 4YTLA 2CGHA 3GOXA 2RQRA 2EBPA 1LVKA 3JCMJ 5HK3A 2QAZA 4OMQA 3UATA 1WQ7A 1YBYA 1ZX6A 3DB4A 1BK2A 2KVQG 3JCMP 3R6NA 1YHQA 1KQSS 3KXTA 4J9HA
chains in the Genus database with same CATH topology
2GCXA 2DO3A 2P0QA 4FM4B 3CCET 2E65A 2LNVA 4MDWA 3A8OB 1RI0A 3FB9A 4XTVA 3ZEHA 1G5VA 2QTXA 1LJOA 3QG1A 3I55T 2CZ1B 4HCZA 3UT1A 4EMHA 1Q86C 1H3ZA 4HKEA 4HT9A 4JRPA 2EJGA 3P8BB 4M7DD 2QDYB 2YLCA 3WVDB 4MZTA 4C92F 1XNIA 5M9OA 3M59A 4M7AF 4ELYC 4M77B 1G3YA 1BI3A 4CI0C 4IUQA 4ZGDB 1M8VA 4A4EA 5GAOq 4FL6A 3CBPA 4NOYA 5CKBA 3X26B 3MP1A 4N0AA 3ZBDA 3PIPA 4F7UG 2VXEA 2CZ6B 5I2SA 3OYFA 3CCJT 1FXXA 3NTIA 1YIJT 5DLOA 4JUVA 4J8OA 5GAMe 1YJ9T 3CMAT 4J83A 4DA4A 3RERA 2CZ7B 3CEYA 3UDCA 4QQGA 5I21A 4R56A 3JRZA 2DZCA 3WVEB 1NJIU 4A4FA 2OTLT 3JCMd 3HFOA 5GAN6 3JB9G 2RI3A 3E9GA 1YITA 5DY9A 1UGSB 2DIGA 2K4YA 4FSXA 3G71A 3HP9A 4FIBA 4RCBA 3SB2A 3OYHA 4XU1A 1WJRA 2KSSA 5LJ3g 3OYIA 3JCMW 2E12A 3X28B 1SSFA 1VQ7T 4IKFA 2VXFA 5J3BA 4KT0E 5KCOA 5FRMA 5GAN5 5A0LA 3CCQT 1XQHA 3QIIA 4E7LA 2XK0A 4C92A 2HAXA 3S3MA 2FB7A 2L3RA 3RKXA 2F5TX 3ME9A 4ZGJB 2ZGWA 4IUVA 3G4ST 5J26A 4L6V5 4ATOA 1WJSA 1WQWA 4M77F 2K5IA 3G6ET 2E5QA 3JCMc 4XQ3A 4M7DG 4KBMB 1M1GA 4Q5WA 3MO8A 4C92B 3JB9H 2EQKA 2RHZA 3TEEA 5LJ5g 2E64A 1VQOT 2GFUA 5C0MA 2DD4A 4C0FA 5D6YA 2O4XB 2PVDB 4L5GA 3JCMV 3GLXA 5GMKm 2E10A 2HD0A 5HK0A 2M9UA 4RG2A 3FRNA 2JOYA 3CC4A 2XDPA 2QQBA 3CC7T 2DD5A 1B34B 3CCEA 3OYMA 2KK4A 3M54A 1X75C 5DM7R 3OW2S 3M57A 4MZPA 2KMTA 4BI4A 1Y7XA 4NS5A 5CVIA 3CXCS 3X25B 4LD9K 4M78G 2IVWA 2MF2A 2V8KA 4IURA 5GAMj 1K8AC 1VQ8A 2PVOB 4Y28E 3F70A 4M78C 4OB2B 2CYZB 3MCAB 1TH7A 4CRIA 4V2SA 1KD1C 2XD0A 1XOVA 2XICA 1M5Q1 3CCRT 4RKUE 1JRIA 2G3RA 2WSCE 3EAEA 1AHJB 3OYKA 1HK9A 2XG8D 1I4K1 5GANd 3OW2A 1YJNT 2BIVA 2XIDA 5FU7C 3JCMg 1UEBA 4RG8A 3UWNA 3OYLA 3KBGA 2KDSA 3R6OA 4M78B 5LJ3e 3L2RA 2VUBA 3PMIA 4PNOA 5KE3A 4PJOD 1KQ1A 3DLLA 3CD6T 4ZTJA 1I5LA 4QQ6A 4HT8A 4JRQA 4J5YA 5FU7B 5I2MA 2D0QB 2XI9A 3MEWA 3QUIA 4M7AB 3CC2A 3LWIA 1YITT 2D9TA 2L8DA 3V8KA 5FLXE 3RKWA 4Y91A 1KQSA 5LJ3h 2MWOA 2K3YA 2RD1A 2FYKA 2IG0A 4BY6C 1Q7YU 3NTHA 3OMGA 4OGCA 2RK1A 4M7DA 1IZ6A 4PL6A 2LVMA 3QPHA 4B9WA 4EPCA 1VQLA 4LDXA 4M7AC 5CKHA 2R57A 3VUZA 2RB6A 3MEAA 3FDRA 2R5AA 4D6WA 3OMCA 1U1SA 2ZPFB 4ELZC 3A8LB 3CCQA 2DIQA 2I2LA 2K57A 3ZFJA 3CCJA 4JS4A 5A0GA 1MHNA 2EQJA 3PFSA 5GAN7 4MDXA 3CCVA 2D6FA 2FHDA 5L8RE 4PJOF 3QZ9B 4EMKC 3JB9J 4PJOC 3PMTA 3L42A 4C5GA 4MMLA 3VJPA 4M75B 2VGNA 3QJYA 5D6WA 3PTAA 3VKIA 3OYBA 4E7JA 3CXCA 4XTZA 2EYQA 3OY9A 3LX7A 5GAOr 5CAIA 2LT1A 3S6WA 4XTUA 2K2VA 3SDZA 1OYXA 3TCJA 2RJEA 4C8QB 4EMKA 2E1HA 1QVFS 5GAMf 3CCVT 3V8JA 1I81A 3QJ6A 5CKDA 2EIFA 2HBPA 1YHQT 1DJ7B 3A8MB 1YIJA 4DQ2A 2X4YA 3BW1A 2JZ2A 2DXCA 3P8DA 4II1A 4JRIA 2QQRA 4C92G 1QVGA 3CCRA 2CS7A 4M7AG 3QSUA 4C5EA 4E47A 4NL3A 2M0OA 5KCHA 3CCMA 1VQPT 4LDVA 5GAMd 3OYNA 1Q81C 1VQ6A 4XU3A 4F7UF 5GMKi 2X4XA 3VU3C 5GAOm 2JTFA 4RMOA 3GPLA 3CCLA 4BDZA 5J39A 3MHXA 1M90C 3GNGA 2EFIA 2JVVA 1QW1A 2XU8A 4BACA 3JCMh 2DPPB 1VQ5T 3C12A 4ZN1A 1K8AU 3CBOA 2A3LA 4C8QG 1ZBXA 1JB0E 3JB9F 4QW2A 1YI2A 5LJ5d 2JUFA 1O9SA 3ASKA 1NJIC 1JJ2S 4QVDA 1ZHIA 3M9QA 2F69A 3CCUT 3L2WA 2RO0A 3J80E 2MWPA 3ER0A 4ZTFA 5GANg 1G3TA 3X20B 4F7UE 3QHSA 1WJQA 5KH6A 2RM4A 5C6SA 2R5MA 2PQWA 5CO7A 4M77A 4KULA 3HKSA 2Y4YA 3CCST 1VQ4A 4A4HA 2F5KA 2RHYA 1NE8A 1V29B 5GMKe 3A5ZB 2A7YA 1D3BA 1BKBA 3OSSC 2L89A 3RIRA 1B34A 3G71T 4M7DF 3M56A 4A53A 1N8RU 2NLUA 3QBYA 2EWNA 4P5NA 3RUXA 4ZN3A 4OB1B 5GAN8 4XK8E 3OQ5A 5LJ5j 3LWHA 3OYGA 1N9RA 3FIFA 3M55A 1S72T 3S3NA 1G3SA 4A54A 3HPWA 5DLQE 4OF1A 4B9XA 5LJ5e 3G6EA 5HKCA 2GF7A 4PKCC 3A8HB 1VIFA 1R8OB 3MEVA 3J7AF 4M7AD 4XAXB 3CC4T 4E7HA 1YJWA 4PJOE 2RI5A 3NTKA 2DVEA 4IUPA 3OYJA 3S3OA 2WSFE 1GXIE 3C94A 3UPUA 1VQPA 4XTWA 4BUGA 2DXBA 3Q1JA 4ZGEB 3OB9A 2C06A 5AYFA 4M78D 1FX7A 1M9SA 2BKDN 1XTDA 3M58A 4PLIA 4C5IA 5GAN3 3PIOA 1U8RA 4HCBA 3GF5A 4BD3A 1VQ6T 5GMKl 3JB9I 2DEQA 4WF2A 2E70A 5GAOn 3JCMX 1ZQ1A 3DB3A 3E19A 1LNXA 1Y96B 5GAOl 3KUFA 2K5LA 2DTIA 1Q82C 4M77C 1NZ9A 5HY6A 3BDLA 3VV0A 3LYIA 1Y96A 2RH2A 4UC4A 4C8QA 1KQ2A 2X4JA 3L2ZA 2RJCA 3BFMA 5CKEA 4C0GA 4F7UA 5GMKj 1K9MC 3JCMb 1VQ5A 1M1KU 1OI1A 4HCCA 1VIEA 2VYTA 3WXMB 4N0AC 2DK3A 4MZMA 4M77E 1VQNA 1N6AA 4M75A 2PU9B 5FU6B 2ZPHB 4M75G 3CD6A 2HNIA 4E7KA 3OYYA 1Q81U 5LJ3j 5FRNA 1M1FA 1UGQB 2VGMA 3NFCA 1WNLA 4J6YA 1RL2A 5CIUA 4VUBA 4J6XA 5A2QE 3CCMT 2OAUA 1VQ4T 1M1KC 1BYMA 5FU6C 2DAQA 4ME7A 3G4SA 2XHCA 4E7IA 4C5HA 5GMKh 2LX9A 5GANh 1BI1A 1Q82U 2LQ8A 3H8ZA 3OS0A 5CKFA 3OS5A 1W2BS 1K73C 1VQNT 3HSBA 2PUOB 2GQVA 4RCCA 3BDUA 3QXEB 1I8FA 2FL7A 4XU2A 2GFAA 3GIBA 1HXDA 4FT4A 2EAYA 2O4XA 4DOWA 2EQMA 2E41A 4M7DE 2E6ZA 5GAOp 4O6JA 2YRVA 4M7DC 1VQ9A 5GAN4 1S72A 1NPPA 3QO3A 2RHIA 3CPWA 4JLIA 4PJOB 5GANj 3OS1A 2MI6A 3FEOA 5IAYA 2MMPA 2HQXA 3TU4K 1X01A 2EJ9A 4TVRA 1KHCA 1Q86U 3J81E 2VC8A 2Y4XA 1KHIA 4LD6A 5GAMh 1P92A 2WACA 3HFNA 4BB7A 2QA4A 1YJNA 2X35A 3QDRB 3HL8A 5LJ5f 4N4GA 4JRKA 5CR2A 5GAN2 2E6NA 4EDUA 2L5QA 3MP8A 4J6WA 3SWNB 2M16A 2KY9A 2VV5A 4BY6B 2OTJT 1VQMA 4J7IA 2RJFA 3CCUA 1N27A 2ZPIB 3OSVA 5LL6S 2QQSA 4M77D 5FROA 3L2UA 2DXTA 1KC8U 3VUBA 2FVUA 2P0PA 1MGQA 5IN1A 1W4SA 4C0DC 3CPWS 1N9SA 4PLLA 4BI3A 2DJZA 3M5AA 3CMET 3SD4A 3VYHB 1BIAA 1BIBA 1OZ2A 3M4GA 5KE2A 2LQKA 1X6OA 4C8QF 5LJ5h 4NL2A 1D3BB 4O5VA 3LGFA 2RHUA 4XU0A 2P4TA 2CZ0B 2H3JA 3HRTA 3EFRA 3LLRA 1EIFA 3QKJA 4XTXA 4XTYA 4EMGA 5GAMg 3OYEA 3CCLT 1VQMT 3C4SA 3INZA 5CQYA 4F7UB 3CMAA 4JS5A 4A4KA 4JLGA 2HQEA 4IUTA 4OB0B 4QQDA 3RESA 3E9FA 3SWNC 1W2BA 1YCYA 2JTMA 2LCLA 4MMKA 2LTOA 1G3WA 3P8HA 1KC8C 2P0KA 1WPYA 3RMQA 3I56A 5LJ3f 2QEXA 4GY5A 4BE2A 3FJPA 1WGSA 4N4IA 3V7SA 1QP3A 5A0DA 4BE0A 3V7RA 3GP8A 3G7ZA 3LH0A 3JB9D 1UB4A 3L2QA 1VQ7A 3HHTB 3TREA 1Y71A 3V8LA 3OBWA 2DZ9A 2XDDA 1K9MU 3OS2A 5GANf 3OYCA 3E1SA 1QVGS 4M78A 3O8VA 2YHTA 2QQAA 3CPFA 4JJNK 3EFSA 1VQ9T 2BUDA 3HRSA 4EMKB 1YJ9A 3I55A 3AHUA 4LDUA 3JCMe 2RI2A 1UGPB 4Z02A 4HA8A 4J7FA 3H6ZA 4C0DB 2DXUA 4C8QD 3URGA 2DTHA 1VQOA 3HRUA 2K5FA 4C92C 4QVCA 4OVAA 2XDBA 4R55A 1Y07A 4KUIA 1UGRB 4M75D 3FLGA 2MAMA 4GLKA 4LDYA 4M77G 1QP2A 4N4HA 3BY7A 1H641 2XKOC 2CKKA 2QA4T 2OTJA 3PGGA 1YJWT 2QQ9A 4FU6A 2DTOA 3CBMA 2RA2A 2EJFA 3M4YA 2ZPGB 5D6XA 3X24B 4OGEA 1U1TA 4FT2A 1BI0A 1VUBA 4X9DA 3JCMQ 3CMEA 1M4ZA 1VQ8T 2EKOA 3RKYA 4M7AA 2AHJB 2PVGB 2LCCA 3DKMA 1NPRA 4C92D 4PJOA 2V8IA 4QVZA 5CQXA 1OZ3A 2EQUA 4M75C 4M78F 3OA6A 4M75F 4OB3B 2OTLA 2DKGA 4X9CA 4BE1A 1K73U 4KUDK 4L59A 1IREB 2Y90A 2WSEE 4C8QC 3FC3A 3OBYA 1Q7YC 3SFMA 2ZPBB 3QZ5B 3I56T 2QEXT 2QXFA 2O01E 2ZPEB 3C95A 1JBMA 3CCSA 1PSFA 3T9NA 2LDMA 2B8AA 2V8JA 4IUUA 3OYDA 3QYGB 2RJDA 3OYAA 3MP6A 3MEUA 4C8QE 3RMSA 1KG1A 2K3XA 4M78E 2KQWA 2YLBA 2ZZDA 2LRQA 1VQLT 1JJ2A 4C0ZA 1QVPA 4M75E 1FWZA 2ZCFB 2QI2A 5IT9E 3JSCA 4OMFB 1LOJA 1YI2T 1N8RC 3SWNA 2M1HA 5CK9A 2KAFA 4DOVA 5LJ3d 1M90U 4BDYA 1BI2A 4X34A 1KD1U 2JNGA 3A8GB 2X4WA 1O75A 3L1AA 5EG2A 5CCAA 3PNWC 1VQKA 1QVFA 4LDWA 2JN0A 4YTLA 3CC2T 2CGHA 2RHXA 3V7CA 2RK2A 3GOXA 2PUKB 3PT9A 3LGLA 3GNFB 3M53A 3JCMJ 2R58A 5HK3A 3DLMA 4A4GA 2LC4A 1WQ7A 4OP0A 1PSEA 3QYHB 3LW5E 3L2VA 3JCMf 4M7DB 1YBYA 4C92E 3DB4A 2KVQG 4PJOG 4M7AE 3JCMP 4JDSA 1VQKT 4BI8B 3JAME 1YHQA 1KQSS 3N5BB 3KXTA 2LT4A 3META 3VYGA 5GANe 3CC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DO3 A;  3CCE T;  1RI0 A;  3ZEH A;  1G5V A;  3I55 T;  4HCZ A;  1Q86 C;  3UT1 A;  1H3Z A;  3P8B B;  5M9O A;  1XNI A;  4IUQ A;  4A4E A;  4FL6 A;  3MP1 A;  3PIP A;  3OYF A;  3CCJ T;  3NTI A;  1YIJ T;  1YJ9 T;  3CMA T;  3CEY A;  4QQG A;  1NJI U;  4A4F A;  2RI3 A;  3E9G A;  2DIG A;  3G71 A;  3OYH A;  1WJR A;  3OYI A;  1SSF A;  1VQ7 T;  4IKF A;  5J3B A;  5KCO A;  5FRM A;  3CCQ T;  3QII A;  4E7L A;  2XK0 A;  3S3M A;  2L3R A;  3ME9 A;  3G4S T;  4IUV A;  5J26 A;  1WJS A;  3G6E T;  2E5Q A;  1M1G A;  4Q5W A;  3MO8 A;  2EQK A;  2RHZ A;  1VQO T;  2GFU A;  5C0M A;  5D6Y A;  2O4X B;  4RG2 A;  3CC4 A;  2JOY A;  2XDP A;  3CC7 T;  3CCE A;  3OYM A;  5DM7 R;  3OW2 S;  3CXC S;  4NS5 A;  4IUR A;  1K8A C;  1VQ8 A;  3F70 A;  4CRI A;  1KD1 C;  3CCR T;  2G3R A;  3OYK A;  3EAE A;  3OW2 A;  1YJN T;  2BIV A;  3UWN A;  3OYL A;  1UEB A;  3KBG A;  2KDS A;  3L2R A;  3PMI A;  5KE3 A;  3CD6 T;  3DLL A;  4ZTJ A;  4QQ6 A;  3MEW A;  3CC2 A;  1YIT T;  2D9T A;  2L8D A;  1KQS A;  5FLX E;  2MWO A;  2K3Y A;  2IG0 A;  1Q7Y U;  3NTH A;  3OMG A;  1IZ6 A;  4PL6 A;  2LVM A;  1VQL A;  4B9W A;  2R57 A;  3MEA A;  3FDR A;  2R5A A;  3OMC A;  3CCQ A;  2DIQ A;  3CCJ A;  1MHN A;  2EQJ A;  3PFS A;  3CCV A;  2FHD A;  3PMT A;  3L42 A;  4C5G A;  5D6W A;  4E7J A;  3OYB A;  3CXC A;  3OY9 A;  3LX7 A;  3S6W A;  1OYX A;  2RJE A;  1QVF S;  3CCV T;  3QJ6 A;  2EIF A;  1YHQ T;  1YIJ A;  2X4Y A;  2JZ2 A;  3P8D A;  4II1 A;  2QQR A;  1QVG A;  3CCR A;  4C5E A;  2M0O A;  5KCH A;  3CCM A;  1VQP T;  3OYN A;  1Q81 C;  1VQ6 A;  2X4X A;  2JTF A;  3CCL A;  4BDZ A;  5J39 A;  1M90 C;  2EFI A;  2JVV A;  4BAC A;  1VQ5 T;  4ZN1 A;  1K8A U;  1YI2 A;  4QW2 A;  1NJI C;  2JUF A;  1JJ2 S;  3ASK A;  3M9Q A;  3CCU T;  3L2W A;  2RO0 A;  3J80 E;  2MWP A;  3ER0 A;  4ZTF A;  5KH6 A;  1WJQ A;  5C6S A;  2R5M A;  2PQW A;  3HKS A;  3CCS T;  1VQ4 A;  4A4H A;  2F5K A;  2RHY A;  3A5Z B;  1BKB A;  2L89 A;  3G71 T;  1N8R U;  2NLU A;  3QBY A;  4ZN3 A;  3OQ5 A;  3OYG A;  1S72 T;  3S3N A;  5DLQ E;  4B9X A;  3G6E A;  2GF7 A;  3J7A F;  3MEV A;  3CC4 T;  1YJW A;  4E7H A;  2RI5 A;  3NTK A;  4IUP A;  3OYJ A;  3S3O A;  1VQP A;  3Q1J A;  3OB9 A;  4PLI A;  2BKD N;  1XTD A;  4C5I A;  3PIO A;  1VQ6 T;  4BD3 A;  2E70 A;  3DB3 A;  3KUF A;  1Q82 C;  1NZ9 A;  5HY6 A;  3BDL A;  3LYI A;  4UC4 A;  2RJC A;  1VQ5 A;  1K9M C;  1M1K U;  1OI1 A;  2VYT A;  1VQN A;  3CD6 A;  4E7K A;  3OYY A;  1Q81 U;  5FRN A;  5A2Q E;  1RL2 A;  3CCM T;  5CIU A;  1M1K C;  1VQ4 T;  2DAQ A;  3G4S A;  2XHC A;  4E7I A;  4C5H A;  1Q82 U;  2LQ8 A;  3H8Z A;  1VQN T;  3OS0 A;  1W2B S;  1K73 C;  2GFA A;  2O4X A;  2EQM A;  2E6Z A;  2YRV A;  1VQ9 A;  1S72 A;  1NPP A;  2RHI A;  3CPW A;  3OS1 A;  2MI6 A;  3FEO A;  5IAY A;  2HQX A;  4TVR A;  1KHC A;  1Q86 U;  3J81 E;  1KHI A;  4LD6 A;  2WAC A;  1YJN A;  2QA4 A;  2X35 A;  4N4G A;  2E6N A;  4EDU A;  3MP8 A;  2M16 A;  2OTJ T;  1VQM A;  2RJF A;  3CCU A;  1KC8 U;  1N27 A;  5FRO A;  5LL6 S;  2QQS A;  3L2U A;  5IN1 A;  3CPW S;  4PLL A;  3CME T;  1YIT A;  3SD4 A;  5KE2 A;  1OZ2 A;  1X6O A;  3LGF A;  2RHU A;  3QKJ A;  3LLR A;  1EIF A;  3OYE A;  3CCL T;  1VQM T;  3C4S A;  3CMA A;  2HQE A;  4IUT A;  4QQD A;  3E9F A;  1W2B A;  2LCL A;  2LTO A;  3P8H A;  1KC8 C;  2P0K A;  3I56 A;  2QEX A;  4GY5 A;  4BE2 A;  1WGS A;  4N4I A;  4BE0 A;  3LH0 A;  3L2Q A;  1VQ7 A;  3TRE A;  1K9M U;  3OS2 A;  3OYC A;  1QVG S;  3O8V A;  3CPF A;  1VQ9 T;  2BUD A;  1YJ9 A;  3I55 A;  2RI2 A;  4Z02 A;  3H6Z A;  1VQO A;  4OVA A;  3FLG A;  4N4H A;  2QA4 T;  2OTJ A;  2CKK A;  1YJW T;  4FU6 A;  2OTL T;  5D6X A;  1VQ8 T;  3CME A;  2EKO A;  2LCC A;  1NPR A;  4QVZ A;  1OZ3 A;  2EQU A;  3OA6 A;  2OTL A;  1K73 U;  4BE1 A;  4L59 A;  3FC3 A;  1Q7Y C;  3I56 T;  2QEX T;  3CCS A;  2LDM A;  2B8A A;  4IUU A;  3OYD A;  2RJD A;  3OYA A;  3MP6 A;  3MEU A;  2K3X A;  2LRQ A;  1VQL T;  1JJ2 A;  5IT9 E;  1YI2 T;  1N8R C;  2M1H A;  1M90 U;  4BDY A;  4X34 A;  1KD1 U;  2JNG A;  2X4W A;  1VQK A;  3PNW C;  1QVF A;  4YTL A;  3CC2 T;  2RHX A;  3GOX A;  3LGL A;  2R58 A;  3DLM A;  4A4G A;  3L2V A;  1YBY A;  3DB4 A;  2KVQ G;  1VQK T;  3JAM E;  1YHQ A;  1KQS S;  3MET A;  3CC7 A; 
#chains in the Genus database with same CATH topology
 2DO3 A;  2JXB A;  4XTV A;  3FB9 A;  4J9G A;  1LJO A;  3QG1 A;  4EMH A;  2DLP A;  1RAG B;  1H3Z A;  2A36 A;  4HT9 A;  4JRP A;  1UTI A;  4AFU C;  2QYZ A;  3WVD B;  1D0Y A;  1KSW A;  4RTX A;  3CC7 Q;  2G6F X;  1BI3 A;  4HXJ A;  1JEG A;  4A4E A;  4FL6 A;  5CKB A;  3ZBD A;  4N0A A;  2HSP A;  2FPD A;  3NTI A;  1YIJ T;  4JUV A;  3A1P A;  1YJ9 T;  3H0F A;  4GLM A;  4LN2 A;  1VQ7 Q;  2DZC A;  2AT1 B;  4F17 A;  1ABO A;  2RI3 A;  3E9G A;  3EG3 A;  1UGV A;  2DIG A;  4FSX A;  3OYH A;  3CMA Q;  4RCB A;  3SB2 A;  1OU9 A;  4XU1 A;  2YRC A;  3OYI A;  1SSF A;  5KCO A;  2XK0 A;  1SF9 A;  2FB7 A;  2L3R A;  3CCE Q;  3EFO A;  4XQ3 A;  4M7D G;  4Q5W A;  3GBQ A;  3JB9 H;  2EQK A;  3TEE A;  5LJ5 g;  1TUG B;  5C0M A;  2KYB A;  5GMK m;  3GLX A;  3RBB B;  1GBR A;  4AT1 B;  3CCE A;  2YUO A;  1X75 C;  4MZP A;  1IB8 A;  1M2V A;  2OJ2 A;  4E2F B;  2MF2 A;  2C0O A;  2NYS A;  3O5Z A;  1KD1 C;  1IO6 A;  1JRI A;  2WSC E;  3OYK A;  1YJN T;  2BE7 D;  3JCM g;  1UEB A;  2FG0 A;  3KBG A;  2KDS A;  3R6O A;  1R0C B;  3VS5 A;  2VUB A;  1K4U S;  5KE3 A;  2VAS A;  1ZSZ B;  1KQ1 A;  1H92 A;  1QCF A;  4ZTJ A;  1AWX A;  5FU7 B;  2XI9 A;  3MEW A;  3QUI A;  1WLP B;  3CC2 A;  1KQS A;  3RKW A;  2CUD A;  2FYK A;  2IG0 A;  5FWC A;  2QGG A;  1Q7Y U;  3NTH A;  2KE9 A;  4OMO A;  2LVM A;  4PL6 A;  4M7A C;  1C1A A;  2JW4 A;  1SHG A;  3MEA A;  2R5A A;  4PJL A;  3OMC A;  1U1S A;  4ELZ C;  2YRD A;  2I2L A;  1WI7 A;  5A0G A;  1NYF A;  5GAN 7;  3THK A;  5L8R E;  3QZ9 B;  3PMT A;  4MML A;  5D6W A;  1BU1 A;  3OYB A;  3EGU A;  5GAO r;  5CAI A;  1SPK A;  3S6W A;  2K2V A;  3VS6 A;  4EMK A;  3V8J A;  1I81 A;  2HBP A;  2ESW A;  1YIJ A;  4DQ2 A;  4II1 A;  2DXC A;  5GJV B;  2QQR A;  1W6X A;  1QVG A;  3QSU A;  2W10 A;  2GTJ A;  2A08 A;  2DF6 A;  4XU3 A;  2X4X A;  3VU3 C;  2JTF A;  1WHJ A;  3CC4 Q;  4BDZ A;  3CCU Q;  4AG1 C;  2GGR A;  3MHX A;  3GNG A;  1QW1 A;  3C12 A;  4ZN1 A;  2A3L A;  1ZBX A;  5LJ5 d;  3ASK A;  1UHC A;  2FRW A;  1HSQ A;  2NUP A;  1D1A A;  1G3T A;  3G71 Q;  5KH6 A;  3QHS A;  2RM4 A;  1I5O B;  2PQW A;  3SEM A;  2VWF A;  5CO7 A;  3IQL A;  4OMP A;  3VS1 A;  1R77 A;  1Q81 R;  2LCS A;  4A4H A;  1RLP C;  5KYY B;  2DA9 A;  4ZNX A;  4M7D F;  3M56 A;  2EPD A;  4P5N A;  2VVK A;  1D1C A;  2X51 A;  4OB1 B;  4KGX B;  5LJ5 j;  3PVL A;  3QDF A;  2ED1 A;  3HPW A;  5DLQ E;  1YN8 A;  2YWW A;  2HCK A;  1VQP Q;  5LJ5 e;  3A8H B;  3H0I A;  1VIF A;  1R8O B;  3MEV A;  1VA7 A;  3TSZ A;  1YJW A;  2COW A;  2MYS A;  4IUP A;  2DJQ A;  2WSF E;  4XTW A;  1AWJ A;  4ZGE B;  4M78 D;  2BKD N;  3PIO A;  1VQ6 T;  3GF5 A;  4FW2 A;  3JB9 I;  1ZQ1 A;  1LNX A;  2DTI A;  4M77 C;  3EHQ A;  2RH2 A;  4C8Q A;  2RJC A;  1VQ5 A;  4F7U A;  4HCC A;  1M1K U;  1OI1 A;  1VIE A;  2AZS A;  1N6A A;  2PU9 B;  2ZPH B;  4M75 G;  5LJ3 j;  1YWO A;  2ROT A;  1M1F A;  3NFC A;  5CIU A;  4VUB A;  3CCM T;  1Q7Y R;  1VQ4 T;  4ME7 A;  4AMC A;  2QTV A;  5CKF A;  1KC8 R;  1TWB A;  4RCC A;  1D09 B;  4XU2 A;  2GFA A;  2QDL A;  2EKH A;  7AT1 B;  1YFN A;  4DOW A;  2EQM A;  2J6K A;  4M7D E;  5GAO p;  2YRV A;  4M7D C;  1VQ9 A;  1NPP A;  2RHI A;  4GBQ A;  4PJO B;  1H3H A;  2MMP A;  2HQX A;  1KHC A;  1Q86 U;  1D0Z A;  2Y4X A;  1S1N A;  5GAM h;  3BE3 A;  1WHH A;  3QDR B;  4N4G A;  5CR2 A;  4EDU A;  4J6W A;  1N27 A;  2ZPI B;  2FVU A;  1W4S A;  2CP6 A;  3CPW S;  4BI3 A;  3CQT A;  3VYH B;  4HVV A;  5LJ5 h;  3M4G A;  2LQK A;  1G2B A;  4XU0 A;  2DL7 A;  2RHU A;  2OTJ Q;  3M0P A;  4XTY A;  5GAN 2;  1OX9 A;  2P84 A;  3C4S A;  4EIK A;  2DX1 A;  1WDX A;  1VYV A;  1X6G A;  2F2X A;  2LCL A;  2LTO A;  2QEX A;  5LJ3 f;  4BE2 A;  3FJP A;  5A0D A;  3QWY A;  1QP3 A;  2C0I A;  3GP8 A;  3G7Z A;  2L3P A;  3REA B;  3HHT B;  3TRE A;  3V8L A;  2OX7 A;  2QEX Q;  2DZ9 A;  2CRE A;  2EYZ A;  4JJN K;  3EFS A;  2BUD A;  4EMK B;  1YJ9 A;  3I55 A;  4LDU A;  2RI2 A;  4J7F A;  3H6Z A;  2HMA A;  3URG A;  3FJ5 A;  2AKK A;  4HVW A;  4OVA A;  1AD5 A;  4JJD A;  1WZO A;  3FLG A;  1YNZ A;  4M77 G;  2OTJ A;  1H64 1;  2OTL T;  2O31 A;  4FSS A;  2RA2 A;  2EJF A;  4FT2 A;  1VUB A;  3JCM Q;  1IGU A;  4ESR A;  4C92 D;  1VQK Q;  1YJW Q;  5CQX A;  1OZ3 A;  2KR3 A;  4M75 F;  5IXF A;  4X9C A;  4BE1 A;  4L59 A;  2K79 A;  3FC3 A;  3OBY A;  5GJW B;  3RDV A;  3SFM A;  4J9F A;  3I56 T;  1GCQ A;  1PSF A;  4IUU A;  2MOX A;  1QKW A;  1KG1 A;  2NUT B;  1T3S A;  4M78 E;  1KQS P;  1K9M R;  5KYW A;  2LRQ A;  4Y92 A;  1JJ2 A;  2BZY A;  4Z88 A;  4JPB W;  1FWZ A;  1Q82 R;  2QI2 A;  1PHT A;  4F04 B;  3SWN A;  1WHG A;  4RTY A;  3EG2 A;  4LDW A;  3CC2 T;  2RHX A;  2RK2 A;  2PUK B;  4KH0 B;  3PT9 A;  1Z9Q A;  1PSE A;  4M7D B;  2DRM A;  4KRT A;  4PJO G;  2J7I A;  2JT4 A;  3N5B B;  3H0H A;  2LT4 A;  3MET A;  3CC7 A;  2GCX A;  2P0Q A;  1ZA2 B;  4FM4 B;  2COZ A;  8AT1 B;  3A8O B;  1RI0 A;  1UFF A;  2YUN A;  1WIE A;  1YIJ Q;  2EJG A;  3P8B B;  2YLC A;  1XNI A;  1T0H A;  4IUQ A;  4ZGD B;  3I55 Q;  1VQL Q;  1KD1 R;  2VXE A;  2CZ6 B;  2AK5 A;  4J8O A;  3CMA T;  2CZ7 B;  1EZZ B;  5I21 A;  2LJ3 A;  2NUT A;  3JCM d;  2X3W D;  3JB9 G;  5DY9 A;  1CSK A;  1TU0 B;  5D7U A;  2E12 A;  2X9H A;  3MPU B;  4WCI A;  4IKF A;  5J3B A;  5FRM A;  4KT0 E;  3EG1 A;  3CCQ T;  5A0L A;  2RF0 A;  1XQH A;  3QII A;  4ORZ A;  3RKX A;  3ME9 A;  2ZGW A;  3G4S T;  5J26 A;  4L6V 5;  4ATO A;  4M77 F;  3G6E T;  1M1G A;  1WXT A;  3U23 A;  4CC2 A;  3MO8 A;  2E64 A;  1BCM A;  1E6H A;  2GFU A;  4RTW A;  8ATC B;  2DD4 A;  4C0F A;  2HQH A;  2M9U A;  3CC4 A;  3FRN A;  3OYM A;  2LQW A;  3OW2 S;  1UEC A;  3M57 A;  3CXC S;  5CVI A;  4DBH A;  4V2S A;  3F70 A;  4OB2 B;  1KJW A;  2XD0 A;  1XOV A;  3CCR T;  2G3R A;  3EAE A;  1I4K 1;  1ARK A;  2BIV A;  1MMA A;  2CP5 A;  5LJ3 e;  3L2R A;  1Q95 G;  2B86 A;  3DLL A;  1I0C A;  2DER A;  1I5L A;  4J5Y A;  2GBQ A;  2D0Q B;  1PRM C;  2E3I A;  1UDL A;  4WTO B;  1YIT T;  4AFS C;  1RAI B;  2KI7 A;  4BY6 C;  2VKN A;  3PE0 A;  1PKS A;  1WHL A;  1XJW B;  3QPH A;  4LDX A;  1VQ5 Q;  2YXY A;  2BZX A;  2ZPF B;  3A8L B;  2DRK A;  4JZ4 A;  3ZFJ A;  3PFS A;  4MDX A;  3CCV A;  2QG9 B;  2FHD A;  2RQV A;  4JJB A;  4PJO F;  4DEY A;  4EMK C;  4PJO C;  3VS4 A;  3L42 A;  4M75 B;  3PTA A;  3CXC A;  1N8R R;  3OY9 A;  3LX7 A;  1W2B P;  2FO0 A;  1RAB B;  1MV0 B;  1M30 A;  1QVF S;  5GAM f;  3CCV T;  3QJ6 A;  1KK7 A;  1DJ7 B;  1YHQ T;  4JZ3 A;  1AVZ C;  2JZ2 A;  3TSW A;  4JRI A;  2FZC B;  2CSI A;  2CS7 A;  3CXC P;  3OYN A;  2EYW A;  1PWT A;  2CP0 A;  3CCL A;  2KRN A;  1MV3 A;  2OI3 A;  4BAC A;  2JS2 A;  3JCM h;  1M8M A;  2YSQ A;  1M27 C;  3CBO A;  4QT7 A;  4PJM A;  1JB0 E;  3JB9 F;  1YI2 A;  2DIL A;  4QVD A;  2F69 A;  3L2W A;  3ER0 A;  4ZTF A;  4RTV A;  3X20 B;  1WJQ A;  3H9N A;  2R5M A;  1C0M A;  3VRZ A;  2Y4Y A;  1OEB A;  3EG9 B;  3CCS T;  1VQ4 A;  2RHY A;  4AFQ C;  3A5Z B;  1RAE B;  1X69 A;  5KYW B;  2EWN A;  1NG2 A;  1D1B A;  1T3L A;  4XK8 E;  3OQ5 A;  3FIF A;  1UJY A;  3M55 A;  1S72 T;  3S3N A;  1OX8 A;  2KNB B;  3G6E A;  1I07 A;  2CT3 A;  1BBZ A;  3OYJ A;  3S3O A;  5KYX B;  3C94 A;  3UPU A;  1VQP A;  3EH1 A;  4BUG A;  2DXB A;  3Q1J A;  5AYF A;  1M9S A;  4C5I A;  1U8R A;  4BD3 A;  5GMK l;  2DEQ A;  2CH4 W;  5GAO l;  2K5L A;  1VYU A;  1NZ9 A;  3BDL A;  3VV0 A;  2X4J A;  3L2Z A;  5GMK j;  4C0G A;  2KEA A;  2FPF A;  2VYT A;  4N0A C;  2DK3 A;  5FU6 B;  4A63 B;  1RL2 A;  2F2V A;  1M1K C;  5FU6 C;  2DAQ A;  4KGZ B;  5I22 A;  1W1F A;  1BI1 A;  1WFW A;  1VQN T;  1K73 C;  2PUO B;  3QXE B;  1I8F A;  4FT4 A;  1IHW A;  2O4X A;  4E7Z A;  2M51 A;  5GAN 4;  1MMN A;  3OS1 A;  1ZSZ C;  5IAY A;  1ABQ A;  1X01 A;  2ROL A;  1RAH B;  5FWB A;  1PG5 B;  4LD6 A;  1M3A A;  4KGV B;  1UHF A;  1YJN A;  1QVG P;  4JRK A;  2NUP B;  3UA7 A;  1AEY A;  2LMJ A;  3SWN B;  2M16 A;  4BY6 B;  2OTJ T;  2RJF A;  5FRO A;  5LL6 S;  3VUB A;  1NBE B;  2P0P A;  5IN1 A;  4C0D C;  1N9S A;  5KE2 A;  1BIB A;  1OZ2 A;  9ATC B;  4O5V A;  1BCO A;  3LLR A;  2H3J A;  3HRT A;  5GAM g;  3OYE A;  1VOM A;  2KXD A;  1X43 A;  3INZ A;  2KT1 A;  1WHK A;  3CMA A;  4JLG A;  2HQE A;  4RUG A;  2MK5 A;  1YCY A;  2QK0 A;  4MMK A;  1G3W A;  1KFZ A;  3EGX B;  2P0K A;  1JXO A;  1WGS A;  2DMO A;  2W0Z A;  3V7R A;  3LH0 A;  1E6G A;  5KYX A;  2YUQ A;  3OBW A;  2XDD A;  4D8D A;  5GAN f;  3E1S A;  3O8V A;  1NEG A;  2QQA A;  4CC7 A;  1VQ9 T;  3HRS A;  4OML A;  2K2M A;  4Z02 A;  3VS3 A;  2CP3 A;  1TS9 A;  2DTH A;  1VQO A;  1RLQ C;  3HRU A;  4C92 C;  3RNJ A;  1UGR B;  4M75 D;  4PK4 A;  1LCK A;  2XKO C;  2CKK A;  3CPW P;  1YJW T;  4RTZ A;  3X24 B;  3CBM A;  2FZG B;  4CC4 B;  3CME A;  3RKY A;  4LUE A;  1NLO C;  2PVG B;  2LCC A;  2V8I A;  4M78 F;  4AFZ C;  1F1B B;  1VQ8 Q;  1X6B A;  4KUD K;  3MJX A;  1ZA1 B;  2Y90 A;  1Q7Y C;  2JMC A;  2B8A A;  3MP6 A;  2K3X A;  2YLB A;  4FW1 A;  5IHK A;  2ZCF B;  2DL5 A;  2QGF B;  4OMF B;  1UE9 A;  2IIM A;  2KAF A;  1X2Q A;  4BDY A;  1BI2 A;  1A0N B;  1YJ9 Q;  2QA4 Q;  2C0T A;  1FMW A;  4DBQ A;  3V7C A;  2E3H A;  3LGL A;  3GNF B;  3M53 A;  1YI2 Q;  2R58 A;  4A4G A;  2LC4 A;  3QYH B;  3LW5 E;  3L2V A;  3JCM f;  4C92 E;  3RR6 A;  4JDS A;  2DVJ A;  3JAM E;  2V26 A;  3VYG A;  3CCE T;  2LNV A;  5IHN A;  3EG0 A;  4MDW A;  1J3T A;  3A98 A;  1YCS B;  1ZUU A;  3I55 T;  4HCZ A;  1Q86 C;  1Z9Z A;  4MZT A;  1OV3 A;  3M59 A;  1G3Y A;  4CI0 C;  5GAO q;  4NOY A;  2ABL A;  4F7U G;  5I2S A;  3CCJ T;  1FXX A;  1MUZ A;  5DLO A;  3EH2 A;  1K8A R;  4M4Z A;  2ECZ A;  2RN8 A;  4DA4 A;  2ED0 A;  3CEY A;  3UDC A;  2FEI A;  4A4F A;  1D0X A;  3CCQ Q;  2PZ1 A;  1V1C A;  3HFO A;  3PVQ A;  1IHV A;  3ULR B;  2K4Y A;  4FIB A;  1WJR A;  2KSS A;  3X28 B;  2L3S A;  5GAN 5;  4E7L A;  2NUZ A;  3H41 A;  4C92 A;  2HAX A;  3S3M A;  2CP2 A;  2F5T X;  1PRL C;  4ZGJ B;  2LNH B;  1WJS A;  4KBM B;  4C92 B;  2RHZ A;  3JCM V;  2E10 A;  2HD0 A;  5EC7 A;  5HK0 A;  1JO8 A;  4RG2 A;  2JOY A;  5IXB A;  1NJI R;  2QQB A;  1TOV A;  3CCR Q;  3REB B;  3CC7 T;  2KK4 A;  3M54 A;  1HD3 A;  5DM7 R;  2KMT A;  1Y7X A;  4NS5 A;  4LD9 K;  1VQO Q;  4M78 G;  2IVW A;  2V8K A;  5GAM j;  2O9V A;  2PVO B;  4Y28 E;  2CYZ B;  4CRI A;  2GTO A;  2SEM A;  1M5Q 1;  4RKU E;  1QMC A;  1M2V B;  1HK9 A;  2DNU A;  2XG8 D;  5GAN d;  2XID A;  5FU7 C;  4RG8 A;  1OQK A;  1ZLM A;  1W70 A;  4PNO A;  1AZG B;  2YUP A;  4QQ6 A;  4JRQ A;  5I2M A;  1RUW A;  4DEX A;  2D8H A;  3LWI A;  2D9T A;  1GBQ A;  3V8K A;  2MWO A;  2K3Y A;  4OMN A;  2E4H A;  3CD6 Q;  2KBT A;  4OGC A;  2RK1 A;  1IZ6 A;  4B9W A;  5CKH A;  2R57 A;  3OW2 P;  3VS2 A;  2DIQ A;  2K57 A;  2HKQ B;  2KT8 A;  4IIO A;  3JB9 J;  2CH4 A;  1PM3 A;  1YHQ Q;  4E7J A;  3QJY A;  4XTZ A;  3NPF A;  4XTU A;  3SDZ A;  1OYX A;  1Q86 R;  2RJE A;  2CT4 A;  2E1H A;  2DE0 X;  1YJN Q;  1TUC A;  1PC0 A;  1NYG A;  4PFO A;  5CKD A;  2F2W A;  4OMM A;  3P8D A;  2LJ1 A;  4E47 A;  1SSH A;  2M0O A;  5KCH A;  3CCM A;  1VQP T;  4LDV A;  5GAM d;  4D8K A;  1VQ6 A;  5GMK i;  4F7U F;  2L3Q A;  5GAO m;  4RMO A;  3GPL A;  1YP5 A;  2JJ9 A;  5J39 A;  3AT1 B;  2E5K A;  2EFI A;  2XU8 A;  3M0Q A;  5KYU B;  1K8A U;  2MPX C;  1B07 A;  4QW2 A;  1VQ6 Q;  3CCS Q;  2JUF A;  1O9S A;  1JJ2 S;  4PFP A;  2RO0 A;  1K0X A;  1RAA B;  4FYW B;  2YDL A;  1RAC B;  4HVU A;  5C6S A;  4M77 A;  1U3O A;  4KUL A;  3HKS A;  2RQU A;  1AWW A;  3E2U A;  1V29 B;  1S72 Q;  1D3B A;  2J6F A;  3RIR A;  4RTU A;  4A53 A;  3QBY A;  4ZN3 A;  1TTH B;  3RUX A;  2HBW A;  5GAN 8;  2K9G A;  3OYG A;  1SRM A;  4J9B A;  3EGD A;  2HEQ A;  1G83 A;  1G3S A;  4OF1 A;  5ECA A;  2HDA A;  1UUE A;  4B9X A;  1ACM B;  5HKC A;  2GF7 A;  4PKC C;  3VRY A;  2M02 A;  2P4R A;  4XAX B;  3CC4 T;  1QWE A;  4E7H A;  4PJO E;  2RI5 A;  2IPO B;  3EGX A;  3OB9 A;  2C06 A;  3JV3 A;  2DYB A;  1FX7 A;  4M7D D;  3M58 A;  1XTD A;  2D6F A;  5GAN 3;  1GCQ C;  4FYV B;  2E70 A;  5GAO n;  3JCM X;  3M0T A;  3E19 A;  1TXQ A;  4J9D A;  1Q82 C;  3LYI A;  1Y96 A;  4UC4 A;  1M2O A;  3BFM A;  1K9M C;  3JCM b;  3WXM B;  1SKU B;  4MZM A;  4M77 E;  1VQN A;  4M75 A;  2K6D A;  3OYY A;  1Q81 U;  1UGQ B;  2COY A;  5A2Q E;  2JM8 A;  4J6X A;  1K76 A;  2CP7 A;  4J9I A;  4E7I A;  2KGT A;  4C5H A;  5GMK h;  1Q82 U;  3G1J A;  3OS0 A;  4AG2 C;  3OS5 A;  3HSB A;  2GQV A;  3BDU A;  2FL7 A;  3GIB A;  2EAY A;  1C6V X;  4PFZ A;  4O6J A;  4R0K A;  1H8K A;  1S72 A;  3QO3 A;  3CPW A;  4JLI A;  5GAN j;  2JMA A;  2EJ9 A;  3J81 E;  2VC8 A;  1ZBJ A;  1KHI A;  3UA6 A;  4BB7 A;  2QA4 A;  2X35 A;  3HL8 A;  2BZ8 A;  5LJ5 f;  2DBK A;  2E6N A;  3MP8 A;  2VV5 A;  3CCU A;  3L2U A;  2QQS A;  2DJZ A;  3CME T;  3SD4 A;  1OUL A;  1FMK A;  2Z0W A;  3ZL7 C;  3CCM Q;  1N5Z A;  1D3B B;  3QKJ A;  4EMG A;  3EFR A;  1EIF A;  5IHI A;  3CCL T;  2OTL Q;  1VQM T;  5CQY A;  4F7U B;  4OB0 B;  1SHF A;  3E9F A;  2O88 A;  1PNJ A;  3P8H A;  4IIM A;  2EGA A;  1K73 R;  4K11 A;  3RMQ A;  3I56 A;  4GY5 A;  1CKB A;  1QVF P;  4N4I A;  1K9A A;  1BB9 A;  3L2Q A;  2I0N A;  1WYX A;  1HYO A;  2DEU A;  1LPL A;  3I56 Q;  2J05 A;  1K9M U;  1QVG S;  3TQ7 P;  2YHT A;  1K0S A;  2JM9 A;  2L0A A;  4LNP A;  2OAW A;  3CPF A;  2LJ0 A;  3VS0 A;  1UGP B;  1IRX A;  2VB6 A;  1MMG A;  4HA8 A;  2DL3 A;  4FCY A;  4C0D B;  4C8Q D;  1MND A;  2K5F A;  4QVC A;  2L2P A;  1EFN A;  2XDB A;  4LDY A;  4N4H A;  2MAM A;  4GLK A;  3BY7 A;  4HCK A;  2O9S A;  3CC2 Q;  2A37 A;  3LH5 A;  5D6X A;  2DTO A;  3M0R A;  3M4Y A;  2ZPG B;  4X9D A;  4OGE A;  1U1T A;  1BI0 A;  1VQ8 T;  1M4Z A;  1JXM A;  2M0Y A;  2EKO A;  4ANJ A;  4M7A A;  4PJJ A;  2AHJ B;  2FPE A;  2SRC A;  2X3X D;  1NPR A;  4DBR A;  1M90 R;  4QVZ A;  4M75 C;  1K73 U;  1JJ2 P;  1IRE B;  4C8Q C;  1T0J A;  2KXC A;  2QEX T;  2QXF A;  3C95 A;  1MNE A;  1JBM A;  2LDM A;  5I11 A;  2V8J A;  4LUD A;  3OYD A;  3MEU A;  4C8Q E;  2LQN A;  1VQL T;  4C0Z A;  2D1X A;  2LZ6 B;  5IT9 E;  2DET A;  3JSC A;  1LOJ A;  1YI2 T;  2M1H A;  5LJ3 d;  2J6O A;  4X34 A;  2JNG A;  2X4W A;  4E7S A;  3L1A A;  5EG2 A;  5CCA A;  1VQK A;  3PNW C;  1SEM A;  2XMF A;  3DLM A;  2A0F B;  4OP0 A;  2KYM A;  1GFD A;  4M7A E;  1VQK T;  4BI8 B;  2RQW A;  2K3B A;  2GNC A;  5GAN e;  3G4S Q;  2E65 A;  2HL3 A;  4Z8A A;  1FMV A;  1MMD A;  3ZEH A;  1G5V A;  3VS7 A;  2QTX A;  3C0C A;  2CZ1 B;  3UT1 A;  4HKE A;  2FZK B;  3CCJ Q;  1X2K A;  3D7S B;  2QDY B;  4C92 F;  5M9O A;  4M7A F;  4ELY C;  4M77 B;  2DL8 A;  3I5S A;  2EGE A;  3X26 B;  3CBP A;  1ZSZ A;  3MP1 A;  6AT1 B;  3PIP A;  3OYF A;  1QCN A;  5GAM e;  2MCN A;  2MIO A;  4X1V A;  3NHN A;  4J83 A;  3NGP A;  3RER A;  1KIK A;  4R56 A;  4QQG A;  1NJI U;  3JRZ A;  3WVE B;  5GAN 6;  2RPN A;  1UGS B;  1TUD A;  3G71 A;  1GL5 A;  3HP9 A;  2F1L A;  4QKU A;  5LJ3 g;  1ZUK A;  3JCM W;  2HKN A;  1VQ7 T;  2VXF A;  1AWO A;  1Y0M A;  4LE9 A;  4DBF A;  4IUV A;  2BE9 B;  3M0S A;  1WQW A;  2K5I A;  2E5Q A;  3JCM c;  1HJD A;  1VQO T;  5D6Y A;  1NLP C;  2O4X B;  2PVD B;  4L5G A;  5KYY A;  1SRL A;  2XDP A;  1V76 A;  2DD5 A;  1B34 B;  4BI4 A;  3X25 B;  2CUB A;  4IUR A;  1K8A C;  2ENM A;  1OU8 A;  4J9E A;  1VQ8 A;  2K7A A;  2V1Q A;  4M78 C;  3MCA B;  1TH7 A;  2XIC A;  1TG0 A;  1AHJ B;  3OW2 A;  2DBM A;  3UWN A;  3OYL A;  1VYT A;  4M78 B;  4RTT A;  1GRI A;  3PMI A;  4PJO D;  3CD6 T;  4HT8 A;  2DM1 A;  4M7A B;  1RAF B;  2ZAE A;  2L8D A;  1UJ0 A;  1AOJ A;  4Y91 A;  5FLX E;  5LJ3 h;  2RD1 A;  1JQQ A;  2KRO A;  1B3Q A;  1QQJ A;  3EHR A;  3OMG A;  3G6E Q;  4M7D A;  1VQL A;  4EPC A;  3VUZ A;  2RB6 A;  3FDR A;  4D6W A;  2EVR A;  3CCQ A;  4JS4 A;  3CCJ A;  1MHN A;  2EQJ A;  3QWX X;  4C5G A;  3VJP A;  2VGN A;  3VKI A;  2D0N A;  2EYQ A;  1OOT A;  2LT1 A;  3TCJ A;  1NM7 A;  2LX7 A;  4C8Q B;  2EYX A;  1U5S A;  2EIF A;  3A8M B;  2X4Y A;  3BW1 A;  4C92 G;  1FYN A;  3CCR A;  4M7A G;  4C5E A;  4NL3 A;  1YIT Q;  1Q81 C;  2PTK A;  5KYU A;  2O2O A;  1WHM A;  2EGC A;  2EYY A;  5L23 A;  1M90 C;  2JVV A;  1K1Z A;  3I35 A;  2DPP B;  1VQ5 T;  4C8Q G;  1X27 A;  1NJI C;  1WXB A;  2BTT A;  1ZHI A;  3M9Q A;  5AT1 B;  3CCU T;  3NMZ C;  3J80 E;  2MWP A;  5GAN g;  4F7U E;  3SHW A;  1WX6 A;  2LP5 A;  2F5K A;  1WA7 A;  1NE8 A;  5GMK e;  1M3C A;  2A7Y A;  1BKB A;  1OPK A;  2L89 A;  3EG9 A;  1B34 A;  3OSS C;  3G71 T;  3CCV Q;  1N8R U;  2NLU A;  5IH2 A;  4CC3 A;  3M0U A;  3LWH A;  1IGQ A;  1N9R A;  1IXD A;  4A54 A;  1CKA A;  1OPL A;  1Y57 A;  3J7A F;  4M7A D;  2A28 A;  3HTR A;  3NTK A;  2DVE A;  2EQI A;  1GXI E;  3TVT A;  5FW9 A;  2NWM A;  4KH1 B;  4PLI A;  4HCB A;  2RQT A;  1M3B A;  4WF2 A;  3DB3 A;  1Y96 B;  3KUF A;  5HY6 A;  1KQ2 A;  5CKE A;  3CD6 A;  2HNI A;  4E7K A;  1I1J A;  5FRN A;  2VGM A;  4J6Y A;  1WNL A;  2HZY A;  2OAU A;  1BYM A;  2FRY A;  2RMO A;  3G4S A;  2XHC A;  4PJN A;  2LX9 A;  5GAN h;  2LQ8 A;  3H8Z A;  1W2B S;  1PCX A;  4Z89 A;  1HXD A;  1VQ4 Q;  1SG5 A;  1JU5 C;  2E41 A;  1ZUY A;  2E6Z A;  3UF4 A;  1QWF A;  2DFU A;  1AT1 B;  4B6M A;  3KFV A;  2MI6 A;  3FEO A;  3TU4 K;  4TVR A;  1UG1 A;  2CDT A;  5HCK A;  1M1K R;  1P92 A;  2WAC A;  3HFN A;  3CME Q;  1VQ9 Q;  1WXU A;  3MKD A;  2ATC B;  2L5Q A;  2KY9 A;  1VQM A;  2DL4 A;  4J7I A;  1KC8 U;  3OSV A;  3CCL Q;  4M77 D;  2DXT A;  1VQM Q;  1MGQ A;  4PLL A;  3M5A A;  1YIT A;  1BIA A;  1PD1 A;  1X6O A;  4C8Q F;  4NL2 A;  3LGF A;  2RNA A;  2P4T A;  2CZ0 B;  4XTX A;  1AZE A;  3I5R A;  1GFC A;  1QKX A;  4JS5 A;  2JTE A;  4A4K A;  4IUT A;  3RES A;  4QQD A;  3SWN C;  1VQN Q;  1W2B A;  1RI9 A;  2HSE B;  2JTM A;  1GCP A;  5KYN A;  1KC8 C;  2JS0 A;  1WPY A;  1E7O A;  3V7S A;  2KRS A;  4FYX B;  4BE0 A;  4FYY B;  4F16 A;  3EFO B;  3JB9 D;  2QAS A;  1UB4 A;  2YT6 A;  1VQ7 A;  1Y71 A;  3OS2 A;  2AZV A;  3OYC A;  1EX4 A;  4M78 A;  2GQI A;  1ZSG A;  1G8X A;  2PNI A;  3AHU A;  3JCM e;  4E6R A;  2DXU A;  2AIR B;  4R55 A;  1Y07 A;  4KUI A;  1QP2 A;  2QA4 T;  4J9C A;  1PD0 A;  3PGG A;  2QQ9 A;  4FU6 A;  1M8V A;  2CSQ A;  3I9Q A;  1QLY A;  1R0B G;  4F14 A;  2H3E B;  2KRM A;  3DKM A;  4PJO A;  2HL5 C;  2EQU A;  2AKL A;  3OA6 A;  4OB3 B;  2OTL A;  2DKG A;  1U06 A;  2WSE E;  4LXC A;  2ZPB B;  3QZ5 B;  1YWP A;  2O01 E;  2ZPE B;  3CCS A;  2EW3 A;  3EGD B;  3T9N A;  3QYG B;  2RJD A;  1TSF A;  1B7T A;  3OYA A;  3RMS A;  2H8H A;  2V1R A;  2KQW A;  2ZZD A;  4JJC A;  2D8J A;  2DYI A;  1QVP A;  4M75 E;  1QCO A;  1N8R C;  5CK9 A;  4DOV A;  1NEB A;  1RAD B;  2J06 A;  1M90 U;  1KD1 U;  1PKT A;  3A8G B;  1O75 A;  1QVF A;  2JN0 A;  4YTL A;  2CGH A;  3GOX A;  2RQR A;  2EBP A;  1LVK A;  3JCM J;  5HK3 A;  2QAZ A;  4OMQ A;  3UAT A;  1WQ7 A;  1YBY A;  1ZX6 A;  3DB4 A;  1BK2 A;  2KVQ G;  3JCM P;  3R6N A;  1YHQ A;  1KQS S;  3KXT A;  4J9H A; 
#chains in the Genus database with same CATH homology
 2GCX A;  2DO3 A;  2P0Q A;  4FM4 B;  3CCE T;  2E65 A;  2LNV A;  4MDW A;  3A8O B;  1RI0 A;  3FB9 A;  4XTV A;  3ZEH A;  1G5V A;  2QTX A;  1LJO A;  3QG1 A;  3I55 T;  2CZ1 B;  4HCZ A;  3UT1 A;  4EMH A;  1Q86 C;  1H3Z A;  4HKE A;  4HT9 A;  4JRP A;  2EJG A;  3P8B B;  4M7D D;  2QDY B;  2YLC A;  3WVD B;  4MZT A;  4C92 F;  1XNI A;  5M9O A;  3M59 A;  4M7A F;  4ELY C;  4M77 B;  1G3Y A;  1BI3 A;  4CI0 C;  4IUQ A;  4ZGD B;  1M8V A;  4A4E A;  5GAO q;  4FL6 A;  3CBP A;  4NOY A;  5CKB A;  3X26 B;  3MP1 A;  4N0A A;  3ZBD A;  3PIP A;  4F7U G;  2VXE A;  2CZ6 B;  5I2S A;  3OYF A;  3CCJ T;  1FXX A;  3NTI A;  1YIJ T;  5DLO A;  4JUV A;  4J8O A;  5GAM e;  1YJ9 T;  3CMA T;  4J83 A;  4DA4 A;  3RER A;  2CZ7 B;  3CEY A;  3UDC A;  4QQG A;  5I21 A;  4R56 A;  3JRZ A;  2DZC A;  3WVE B;  1NJI U;  4A4F A;  2OTL T;  3JCM d;  3HFO A;  5GAN 6;  3JB9 G;  2RI3 A;  3E9G A;  1YIT A;  5DY9 A;  1UGS B;  2DIG A;  2K4Y A;  4FSX A;  3G71 A;  3HP9 A;  4FIB A;  4RCB A;  3SB2 A;  3OYH A;  4XU1 A;  1WJR A;  2KSS A;  5LJ3 g;  3OYI A;  3JCM W;  2E12 A;  3X28 B;  1SSF A;  1VQ7 T;  4IKF A;  2VXF A;  5J3B A;  4KT0 E;  5KCO A;  5FRM A;  5GAN 5;  5A0L A;  3CCQ T;  1XQH A;  3QII A;  4E7L A;  2XK0 A;  4C92 A;  2HAX A;  3S3M A;  2FB7 A;  2L3R A;  3RKX A;  2F5T X;  3ME9 A;  4ZGJ B;  2ZGW A;  4IUV A;  3G4S T;  5J26 A;  4L6V 5;  4ATO A;  1WJS A;  1WQW A;  4M77 F;  2K5I A;  3G6E T;  2E5Q A;  3JCM c;  4XQ3 A;  4M7D G;  4KBM B;  1M1G A;  4Q5W A;  3MO8 A;  4C92 B;  3JB9 H;  2EQK A;  2RHZ A;  3TEE A;  5LJ5 g;  2E64 A;  1VQO T;  2GFU A;  5C0M A;  2DD4 A;  4C0F A;  5D6Y A;  2O4X B;  2PVD B;  4L5G A;  3JCM V;  3GLX A;  5GMK m;  2E10 A;  2HD0 A;  5HK0 A;  2M9U A;  4RG2 A;  3FRN A;  2JOY A;  3CC4 A;  2XDP A;  2QQB A;  3CC7 T;  2DD5 A;  1B34 B;  3CCE A;  3OYM A;  2KK4 A;  3M54 A;  1X75 C;  5DM7 R;  3OW2 S;  3M57 A;  4MZP A;  2KMT A;  4BI4 A;  1Y7X A;  4NS5 A;  5CVI A;  3CXC S;  3X25 B;  4LD9 K;  4M78 G;  2IVW A;  2MF2 A;  2V8K A;  4IUR A;  5GAM j;  1K8A C;  1VQ8 A;  2PVO B;  4Y28 E;  3F70 A;  4M78 C;  4OB2 B;  2CYZ B;  3MCA B;  1TH7 A;  4CRI A;  4V2S A;  1KD1 C;  2XD0 A;  1XOV A;  2XIC A;  1M5Q 1;  3CCR T;  4RKU E;  1JRI A;  2G3R A;  2WSC E;  3EAE A;  1AHJ B;  3OYK A;  1HK9 A;  2XG8 D;  1I4K 1;  5GAN d;  3OW2 A;  1YJN T;  2BIV A;  2XID A;  5FU7 C;  3JCM g;  1UEB A;  4RG8 A;  3UWN A;  3OYL A;  3KBG A;  2KDS A;  3R6O A;  4M78 B;  5LJ3 e;  3L2R A;  2VUB A;  3PMI A;  4PNO A;  5KE3 A;  4PJO D;  1KQ1 A;  3DLL A;  3CD6 T;  4ZTJ A;  1I5L A;  4QQ6 A;  4HT8 A;  4JRQ A;  4J5Y A;  5FU7 B;  5I2M A;  2D0Q B;  2XI9 A;  3MEW A;  3QUI A;  4M7A B;  3CC2 A;  3LWI A;  1YIT T;  2D9T A;  2L8D A;  3V8K A;  5FLX E;  3RKW A;  4Y91 A;  1KQS A;  5LJ3 h;  2MWO A;  2K3Y A;  2RD1 A;  2FYK A;  2IG0 A;  4BY6 C;  1Q7Y U;  3NTH A;  3OMG A;  4OGC A;  2RK1 A;  4M7D A;  1IZ6 A;  4PL6 A;  2LVM A;  3QPH A;  4B9W A;  4EPC A;  1VQL A;  4LDX A;  4M7A C;  5CKH A;  2R57 A;  3VUZ A;  2RB6 A;  3MEA A;  3FDR A;  2R5A A;  4D6W A;  3OMC A;  1U1S A;  2ZPF B;  4ELZ C;  3A8L B;  3CCQ A;  2DIQ A;  2I2L A;  2K57 A;  3ZFJ A;  3CCJ A;  4JS4 A;  5A0G A;  1MHN A;  2EQJ A;  3PFS A;  5GAN 7;  4MDX A;  3CCV A;  2D6F A;  2FHD A;  5L8R E;  4PJO F;  3QZ9 B;  4EMK C;  3JB9 J;  4PJO C;  3PMT A;  3L42 A;  4C5G A;  4MML A;  3VJP A;  4M75 B;  2VGN A;  3QJY A;  5D6W A;  3PTA A;  3VKI A;  3OYB A;  4E7J A;  3CXC A;  4XTZ A;  2EYQ A;  3OY9 A;  3LX7 A;  5GAO r;  5CAI A;  2LT1 A;  3S6W A;  4XTU A;  2K2V A;  3SDZ A;  1OYX A;  3TCJ A;  2RJE A;  4C8Q B;  4EMK A;  2E1H A;  1QVF S;  5GAM f;  3CCV T;  3V8J A;  1I81 A;  3QJ6 A;  5CKD A;  2EIF A;  2HBP A;  1YHQ T;  1DJ7 B;  3A8M B;  1YIJ A;  4DQ2 A;  2X4Y A;  3BW1 A;  2JZ2 A;  2DXC A;  3P8D A;  4II1 A;  4JRI A;  2QQR A;  4C92 G;  1QVG A;  3CCR A;  2CS7 A;  4M7A G;  3QSU A;  4C5E A;  4E47 A;  4NL3 A;  2M0O A;  5KCH A;  3CCM A;  1VQP T;  4LDV A;  5GAM d;  3OYN A;  1Q81 C;  1VQ6 A;  4XU3 A;  4F7U F;  5GMK i;  2X4X A;  3VU3 C;  5GAO m;  2JTF A;  4RMO A;  3GPL A;  3CCL A;  4BDZ A;  5J39 A;  3MHX A;  1M90 C;  3GNG A;  2EFI A;  2JVV A;  1QW1 A;  2XU8 A;  4BAC A;  3JCM h;  2DPP B;  1VQ5 T;  3C12 A;  4ZN1 A;  1K8A U;  3CBO A;  2A3L A;  4C8Q G;  1ZBX A;  1JB0 E;  3JB9 F;  4QW2 A;  1YI2 A;  5LJ5 d;  2JUF A;  1O9S A;  3ASK A;  1NJI C;  1JJ2 S;  4QVD A;  1ZHI A;  3M9Q A;  2F69 A;  3CCU T;  3L2W A;  2RO0 A;  3J80 E;  2MWP A;  3ER0 A;  4ZTF A;  5GAN g;  1G3T A;  3X20 B;  4F7U E;  3QHS A;  1WJQ A;  5KH6 A;  2RM4 A;  5C6S A;  2R5M A;  2PQW A;  5CO7 A;  4M77 A;  4KUL A;  3HKS A;  2Y4Y A;  3CCS T;  1VQ4 A;  4A4H A;  2F5K A;  2RHY A;  1NE8 A;  1V29 B;  5GMK e;  3A5Z B;  2A7Y A;  1D3B A;  1BKB A;  3OSS C;  2L89 A;  3RIR A;  1B34 A;  3G71 T;  4M7D F;  3M56 A;  4A53 A;  1N8R U;  2NLU A;  3QBY A;  2EWN A;  4P5N A;  3RUX A;  4ZN3 A;  4OB1 B;  5GAN 8;  4XK8 E;  3OQ5 A;  5LJ5 j;  3LWH A;  3OYG A;  1N9R A;  3FIF A;  3M55 A;  1S72 T;  3S3N A;  1G3S A;  4A54 A;  3HPW A;  5DLQ E;  4OF1 A;  4B9X A;  5LJ5 e;  3G6E A;  5HKC A;  2GF7 A;  4PKC C;  3A8H B;  1VIF A;  1R8O B;  3MEV A;  3J7A F;  4M7A D;  4XAX B;  3CC4 T;  4E7H A;  1YJW A;  4PJO E;  2RI5 A;  3NTK A;  2DVE A;  4IUP A;  3OYJ A;  3S3O A;  2WSF E;  1GXI E;  3C94 A;  3UPU A;  1VQP A;  4XTW A;  4BUG A;  2DXB A;  3Q1J A;  4ZGE B;  3OB9 A;  2C06 A;  5AYF A;  4M78 D;  1FX7 A;  1M9S A;  2BKD N;  1XTD A;  3M58 A;  4PLI A;  4C5I A;  5GAN 3;  3PIO A;  1U8R A;  4HCB A;  3GF5 A;  4BD3 A;  1VQ6 T;  5GMK l;  3JB9 I;  2DEQ A;  4WF2 A;  2E70 A;  5GAO n;  3JCM X;  1ZQ1 A;  3DB3 A;  3E19 A;  1LNX A;  1Y96 B;  5GAO l;  3KUF A;  2K5L A;  2DTI A;  1Q82 C;  4M77 C;  1NZ9 A;  5HY6 A;  3BDL A;  3VV0 A;  3LYI A;  1Y96 A;  2RH2 A;  4UC4 A;  4C8Q A;  1KQ2 A;  2X4J A;  3L2Z A;  2RJC A;  3BFM A;  5CKE A;  4C0G A;  4F7U A;  5GMK j;  1K9M C;  3JCM b;  1VQ5 A;  1M1K U;  1OI1 A;  4HCC A;  1VIE A;  2VYT A;  3WXM B;  4N0A C;  2DK3 A;  4MZM A;  4M77 E;  1VQN A;  1N6A A;  4M75 A;  2PU9 B;  5FU6 B;  2ZPH B;  4M75 G;  3CD6 A;  2HNI A;  4E7K A;  3OYY A;  1Q81 U;  5LJ3 j;  5FRN A;  1M1F A;  1UGQ B;  2VGM A;  3NFC A;  1WNL A;  4J6Y A;  1RL2 A;  5CIU A;  4VUB A;  4J6X A;  5A2Q E;  3CCM T;  2OAU A;  1VQ4 T;  1M1K C;  1BYM A;  5FU6 C;  2DAQ A;  4ME7 A;  3G4S A;  2XHC A;  4E7I A;  4C5H A;  5GMK h;  2LX9 A;  5GAN h;  1BI1 A;  1Q82 U;  2LQ8 A;  3H8Z A;  3OS0 A;  5CKF A;  3OS5 A;  1W2B S;  1K73 C;  1VQN T;  3HSB A;  2PUO B;  2GQV A;  4RCC A;  3BDU A;  3QXE B;  1I8F A;  2FL7 A;  4XU2 A;  2GFA A;  3GIB A;  1HXD A;  4FT4 A;  2EAY A;  2O4X A;  4DOW A;  2EQM A;  2E41 A;  4M7D E;  2E6Z A;  5GAO p;  4O6J A;  2YRV A;  4M7D C;  1VQ9 A;  5GAN 4;  1S72 A;  1NPP A;  3QO3 A;  2RHI A;  3CPW A;  4JLI A;  4PJO B;  5GAN j;  3OS1 A;  2MI6 A;  3FEO A;  5IAY A;  2MMP A;  2HQX A;  3TU4 K;  1X01 A;  2EJ9 A;  4TVR A;  1KHC A;  1Q86 U;  3J81 E;  2VC8 A;  2Y4X A;  1KHI A;  4LD6 A;  5GAM h;  1P92 A;  2WAC A;  3HFN A;  4BB7 A;  2QA4 A;  1YJN A;  2X35 A;  3QDR B;  3HL8 A;  5LJ5 f;  4N4G A;  4JRK A;  5CR2 A;  5GAN 2;  2E6N A;  4EDU A;  2L5Q A;  3MP8 A;  4J6W A;  3SWN B;  2M16 A;  2KY9 A;  2VV5 A;  4BY6 B;  2OTJ T;  1VQM A;  4J7I A;  2RJF A;  3CCU A;  1N27 A;  2ZPI B;  3OSV A;  5LL6 S;  2QQS A;  4M77 D;  5FRO A;  3L2U A;  2DXT A;  1KC8 U;  3VUB A;  2FVU A;  2P0P A;  1MGQ A;  5IN1 A;  1W4S A;  4C0D C;  3CPW S;  1N9S A;  4PLL A;  4BI3 A;  2DJZ A;  3M5A A;  3CME T;  3SD4 A;  3VYH B;  1BIA A;  1BIB A;  1OZ2 A;  3M4G A;  5KE2 A;  2LQK A;  1X6O A;  4C8Q F;  5LJ5 h;  4NL2 A;  1D3B B;  4O5V A;  3LGF A;  2RHU A;  4XU0 A;  2P4T A;  2CZ0 B;  2H3J A;  3HRT A;  3EFR A;  3LLR A;  1EIF A;  3QKJ A;  4XTX A;  4XTY A;  4EMG A;  5GAM g;  3OYE A;  3CCL T;  1VQM T;  3C4S A;  3INZ A;  5CQY A;  4F7U B;  3CMA A;  4JS5 A;  4A4K A;  4JLG A;  2HQE A;  4IUT A;  4OB0 B;  4QQD A;  3RES A;  3E9F A;  3SWN C;  1W2B A;  1YCY A;  2JTM A;  2LCL A;  4MMK A;  2LTO A;  1G3W A;  3P8H A;  1KC8 C;  2P0K A;  1WPY A;  3RMQ A;  3I56 A;  5LJ3 f;  2QEX A;  4GY5 A;  4BE2 A;  3FJP A;  1WGS A;  4N4I A;  3V7S A;  1QP3 A;  5A0D A;  4BE0 A;  3V7R A;  3GP8 A;  3G7Z A;  3LH0 A;  3JB9 D;  1UB4 A;  3L2Q A;  1VQ7 A;  3HHT B;  3TRE A;  1Y71 A;  3V8L A;  3OBW A;  2DZ9 A;  2XDD A;  1K9M U;  3OS2 A;  5GAN f;  3OYC A;  3E1S A;  1QVG S;  4M78 A;  3O8V A;  2YHT A;  2QQA A;  3CPF A;  4JJN K;  3EFS A;  1VQ9 T;  2BUD A;  3HRS A;  4EMK B;  1YJ9 A;  3I55 A;  3AHU A;  4LDU A;  3JCM e;  2RI2 A;  1UGP B;  4Z02 A;  4HA8 A;  4J7F A;  3H6Z A;  4C0D B;  2DXU A;  4C8Q D;  3URG A;  2DTH A;  1VQO A;  3HRU A;  2K5F A;  4C92 C;  4QVC A;  4OVA A;  2XDB A;  4R55 A;  1Y07 A;  4KUI A;  1UGR B;  4M75 D;  3FLG A;  2MAM A;  4GLK A;  4LDY A;  4M77 G;  1QP2 A;  4N4H A;  3BY7 A;  1H64 1;  2XKO C;  2CKK A;  2QA4 T;  2OTJ A;  3PGG A;  1YJW T;  2QQ9 A;  4FU6 A;  2DTO A;  3CBM A;  2RA2 A;  2EJF A;  3M4Y A;  2ZPG B;  5D6X A;  3X24 B;  4OGE A;  1U1T A;  4FT2 A;  1BI0 A;  1VUB A;  4X9D A;  3JCM Q;  3CME A;  1M4Z A;  1VQ8 T;  2EKO A;  3RKY A;  4M7A A;  2AHJ B;  2PVG B;  2LCC A;  3DKM A;  1NPR A;  4C92 D;  4PJO A;  2V8I A;  4QVZ A;  5CQX A;  1OZ3 A;  2EQU A;  4M75 C;  4M78 F;  3OA6 A;  4M75 F;  4OB3 B;  2OTL A;  2DKG A;  4X9C A;  4BE1 A;  1K73 U;  4KUD K;  4L59 A;  1IRE B;  2Y90 A;  2WSE E;  4C8Q C;  3FC3 A;  3OBY A;  1Q7Y C;  3SFM A;  2ZPB B;  3QZ5 B;  3I56 T;  2QEX T;  2QXF A;  2O01 E;  2ZPE B;  3C95 A;  1JBM A;  3CCS A;  1PSF A;  3T9N A;  2LDM A;  2B8A A;  2V8J A;  4IUU A;  3OYD A;  3QYG B;  2RJD A;  3OYA A;  3MP6 A;  3MEU A;  4C8Q E;  3RMS A;  1KG1 A;  2K3X A;  4M78 E;  2KQW A;  2YLB A;  2ZZD A;  2LRQ A;  1VQL T;  1JJ2 A;  4C0Z A;  1QVP A;  4M75 E;  1FWZ A;  2ZCF B;  2QI2 A;  5IT9 E;  3JSC A;  4OMF B;  1LOJ A;  1YI2 T;  1N8R C;  3SWN A;  2M1H A;  5CK9 A;  2KAF A;  4DOV A;  5LJ3 d;  1M90 U;  4BDY A;  1BI2 A;  4X34 A;  1KD1 U;  2JNG A;  3A8G B;  2X4W A;  1O75 A;  3L1A A;  5EG2 A;  5CCA A;  3PNW C;  1VQK A;  1QVF A;  4LDW A;  2JN0 A;  4YTL A;  3CC2 T;  2CGH A;  2RHX A;  3V7C A;  2RK2 A;  3GOX A;  2PUK B;  3PT9 A;  3LGL A;  3GNF B;  3M53 A;  3JCM J;  2R58 A;  5HK3 A;  3DLM A;  4A4G A;  2LC4 A;  1WQ7 A;  4OP0 A;  1PSE A;  3QYH B;  3LW5 E;  3L2V A;  3JCM f;  4M7D B;  1YBY A;  4C92 E;  3DB4 A;  2KVQ G;  4PJO G;  4M7A E;  3JCM P;  4JDS A;  1VQK T;  4BI8 B;  3JAM E;  1YHQ A;  1KQS S;  3N5B B;  3KXT A;  2LT4 A;  3MET A;  3VYG A;  5GAN e;  3CC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...