1XNIA

Tandem tudor domain of 53bp1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
118
structure length
118
Chain Sequence
SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle
molecule keywords Tumor suppressor p53-binding protein 1
publication title Methylated lysine 79 of histone H3 targets 53BP1 to DNA double-strand breaks
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 118
sequence length 118
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2004-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1xniA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1xniA01
3DLLA 1QVGA 4IUPA 4A4FA 4IUUA 4GY5A 2LTOA 2RHYA 3OYLA 3OW2S 1WGSA 2EKOA 2XK0A 2E70A 3CCMA 3DB4A 1W2BA 1UEBA 1KHCA 4UC4A 1VQ9T 4TVRA 2HQEA 3NTHA 2QQSA 3UWNA 3DLMA 2GFAA 2LCCA 1S72T 1YJ9T 4BDYA 3CD6T 2E6NA 1VQOT 1YITT 3I56T 2CKKA 4EDUA 4A4HA 4C5GA 3CC7T 1Q82U 3OYCA 1IZ6A 4X34A 2JUFA 4N4GA 5DLQE 3OQ5A 2GF7A 4C5HA 1Q7YC 3P8BB 3L2QA 1VQKT 1YJ9A 2QEXT 3OYBA 1KQSS 3CD6A 4B9XA 5FRNA 1YITA 5M9OA 3I56A 3TREA 3MP6A 3CC7A 4E7LA 2DO3A 1JJ2S 4E7JA 3FEOA 1EIFA 1NJIU 3J80E 4PL6A 3SD4A 2X4XA 2JOYA 3CXCA 1M1KC 1OZ3A 1RI0A 4LD6A 2VYTA 3H8ZA 1YIJA 3CC2T 5A2QE 3I55A 1X6OA 4IUTA 1KQSA 5LL6S 2JTFA 2RI2A 2XDPA 2P0KA 1Q81U 2YRVA 1SSFA 2OTLT 1QVFA 3KBGA 3MEVA 1VQMA 3CMAT 3OYHA 2G3RA 2MWOA 1XNIA 1VQNT 3OYFA 2L89A 5FLXE 3A5ZB 2R58A 4II1A 1YJNA 1VQPT 3E9FA 3OYIA 1YJWA 2OTLA 3HKSA 1K8AC 3CMAA 2GFUA 4ZTFA 3C4SA 4QW2A 1KD1C 1VQNA 4OVAA 2M16A 2R5MA 1YI2A 5DM7R 1K73U 4YTLA 1VQPA 2RHXA 3FLGA 4L59A 1Q86U 3LGFA 2FHDA 4BE2A 1M90U 3J81E 5FRMA 3P8HA 2JZ2A 3OB9A 3QIIA 3CPFA 3CCUT 3MEAA 3S3MA 2DIGA 4RG2A 2NLUA 2LRQA 3OYMA 1KHIA 2RHUA 4HCZA 4C5IA 3MEWA 1N8RC 4E7KA 2KVQG 1VQ5A 1YBYA 2E6ZA 2XHCA 3EAEA 1VQLA 1NPPA 2LDMA 3CCUA 2RJCA 3OYNA 3S6WA 5KH6A 3OW2A 2QA4A 3CCQA 3PIPA 3L2RA 2M1HA 3NTKA 4IUVA 2JVVA 1H3ZA 4PLIA 1YIJT 4ZN1A 2IG0A 3OS0A 5C6SA 3I55T 5HY6A 2RHIA 1K9MU 4QQDA 1MHNA 2EQMA 4BE1A 3G71T 3LGLA 2JNGA 3PFSA 3O8VA 1VQMT 3MEUA 1Q82C 1VQ4T 2K3XA 2RJDA 3G71A 3J7AF 4IURA 3MO8A 3CCET 5J3BA 1WJQA 4FU6A 1YJNT 4A4GA 1JJ2A 1YJWT 2MWPA 3OS1A 3NTIA 1VQ7T 2BIVA 2BUDA 1VQ4A 3CCRT 1NJIC 1OYXA 3PIOA 3BDLA 2MI6A 3H6ZA 3QJ6A 4C5EA 3OMGA 3OA6A 3CCEA 3DB3A 4ZN3A 1YI2T 3G6EA 2B8AA 1QVGS 2E5QA 3QKJA 5D6XA 3S3NA 4IKFA 3CMET 3OYJA 4PLLA 2KDSA 3CPWS 1VQ7A 3LH0A 3PMTA 3CCST 2X4WA 2EQJA 3CCRA 2R57A 2O4XA 2RJEA 4E7IA 2DAQA 4B9WA 1W2BS 1YHQT 1Q81C 3CCVT 3CMEA 1VQ5T 3OYYA 3OS2A 5D6WA 3CCSA 1VQLT 1KC8U 4QQGA 2QA4T 3CCQT 2R5AA 1YHQA 1BKBA 3CPWA 2QQRA 3L42A 3CCVA 3G4SA 5KCHA 3OYGA 1VQ8A 2RHZA 3L2UA 2OTJT 3CCJA 2D9TA 3ER0A 3ME9A 1Q7YU 2DIQA 5C0MA 3META 3QBYA 4N4HA 1K73C 1M1GA 1Q86C 5KE2A 5D6YA 2RJFA 3ZEHA 1M90C 3CC4T 3MP1A 2OTJA 1KC8C 2LVMA 1M1KU 2L8DA 2LQ8A 4ZTJA 2BKDN 3CXCS 3F70A 1OI1A 1VQ9A 4Q5WA 2LCLA 5J39A 4BE0A 3FC3A 2O4XB 5IT9E 2RO0A 3E9GA 3CC4A 1XTDA 2PQWA 4QQ6A 1NPRA 1S72A 3KUFA 3ASKA 2RI5A 2RI3A 1VQOA 2X4YA 1RL2A 3OYEA 3CEYA 4CRIA 1QVFS 4NS5A 3MP8A 4BDZA 3OY9A 2L3RA 2M0OA 3FDRA 3PMIA 3L2VA 3G6ET 3UT1A 3LLRA 1VQKA 3CCLT 2EQUA 2QEXA 2X35A 4BD3A 1VQ6T 1K8AU 2WACA 1K9MC 1N27A 4E7HA 3JAME 4IUQA 3OYDA 4FL6A 1KD1U 4A4EA 1OZ2A 3OYKA 2EIFA 2EQKA 5KCOA 5FROA 4N4IA 1G5VA 3S3OA 3CCLA 2HQXA 3CC2A 3LX7A 4QVZA 1VQ6A 1WJRA 5IN1A 3OMCA 4BACA 2K3YA 3Q1JA 5CIUA 2F5KA 3LYIA 5KE3A 3OYAA 1WJSA 2EFIA 3L2WA 5J26A 3G4ST 1VQ8T 4Z02A 1N8RU 3M9QA 1NZ9A 3CCMT 3P8DA 3CCJT 3PNWC 5IAYA 3GOXA
chains in the Genus database with same CATH superfamily
2ZPBB 3CBOA 3RBBB 1E6HA 1VQMQ 2CH4W 5LJ3h 2RMOA 2KE9A 1KD1R 2CSIA 1G83A 2D0QB 2RK2A 4GY5A 2LTOA 2COZA 2LC4A 3CCEQ 1WGSA 1R0BG 1YWPA 4PJOA 3WVDB 2E10A 3CCMA 2HL3A 3DB4A 3QWYA 2EBPA 1SF9A 1JU5C 4M75F 1TUGB 2YT6A 4JJNK 1RAIB 3GF5A 2VGMA 3M0QA 4VUBA 1ACMB 4FSSA 1BB9A 2JTEA 2CP6A 4DBFA 1S72T 2E3HA 3QJYA 3CCSQ 1VQOT 2DKGA 2DETA 3I56T 2KRMA 3QSUA 2EGEA 3OYCA 2VVKA 2AK5A 1QQJA 2JUFA 2MMPA 4GBQA 5DLQE 4C5HA 3OBYA 4C8QE 5CQXA 1KQSS 3CD6A 1PNJA 1YITA 5M9OA 3CCUQ 1TTHB 1UFFA 4E7JA 4FIBA 1NJIU 4GLKA 3SD4A 4L6V5 3V8KA 1QMCA 3INZA 3TVTA 1RI0A 2QGFB 3JV3A 4FM4B 2CP3A 1YIJA 2FRYA 1C0MA 2JS0A 5LJ3f 3KXTA 2F1LA 1Q82R 4M78C 3M57A 1R8OB 1N9SA 5LL6S 4QKUA 4RTYA 5GAMg 3OSVA 2F2VA 2YRVA 3CC4Q 2NYSA 1OU9A 2FB7A 4JRQA 2DPPB 4DEXA 2MWOA 2QI2A 3DKMA 4F7UB 4J9GA 3QDFA 3EFOB 2DE0X 1KK7A 2HSEB 2X51A 1BI0A 2FPFA 3E9FA 1YJWA 4QT7A 1M2VB 4C92F 3CMAA 4ZTFA 2H3EB 4QW2A 1U06A 2KXCA 1S1NA 2LP5A 2F5TX 1YI2A 2IVWA 2RM4A 2SRCA 5DM7R 1VQPA 1QP3A 1Q81R 3G6EQ 1MNDA 3J81E 5FRMA 2V8KA 3CCUT 1VQ6Q 2VWFA 2Y90A 1M4ZA 4RG2A 2ED0A 1NLPC 4HCZA 4C5IA 1BCMA 1TSFA 2EGAA 4M78E 5FW9A 1C1AA 1WLPB 3UDCA 1ZUYA 1VQLA 1FMVA 1NPPA 3SB2A 5LJ5j 3NHNA 3OSSC 3CCQA 2ECZA 2A28A 2I2LA 4J7IA 4PJOD 2GQIA 2FPEA 1QKWA 8AT1B 1M9SA 2QQ9A 3SEMA 2V8JA 2LCSA 2M0YA 4PK4A 1H8KA 1RAFB 5HCKA 1D3BA 3CCMQ 4PNOA 3CQTA 3OS0A 1ZA2B 3I55T 3M5AA 3E1SA 5HY6A 1ZX6A 1M5Q1 1SRMA 2DLPA 4QQDA 3JCMP 2RNAA 1WQ7A 2PU9B 4LDYA 1WZOA 5GAMe 4BE1A 3G71T 3V7CA 3PT9A 1ABOA 1Y07A 4RKUE 2LQNA 4PJLA 5KYXA 2LNHB 4M7AA 2HBWA 3C0CA 4M77G 1I4K1 4LD9K 5KYUA 3A8HB 1OEBA 1K1ZA 2E12A 4CI0C 1VQ9Q 4OP0A 1GCPA 3BDUA 2RQRA 4LE9A 5EC7A 1QKXA 1YJNT 2DTHA 2COYA 3MHXA 7AT1B 1VQ7T 2DTOA 1WXBA 2KAFA 5D7UA 3A98A 2BUDA 3CD6Q 4DOWA 1YITQ 1HXDA 3BDLA 5GANe 1WXTA 1UECA 3H6ZA 2O9SA 1QVGS 3ZBDA 2RN8A 4V2SA 1SG5A 3S3NA 4IKFA 2DL4A 2JM8A 4OB3B 3OYJA 4PLLA 1K0SA 4M7DA 3LH0A 2QEXQ 2KBTA 4J9HA 2O4XA 2RJEA 4BY6B 1OQKA 2DAQA 4QVDA 1KFZA 4B9WA 5FU7B 4HCCA 1JQQA 1LVKA 4MDWA 4C8QF 5LJ3g 4XU0A 4OMPA 1UG1A 4F17A 2XDDA 1V1CA 1UTIA 1B3QA 2CREA 1AWJA 2KROA 3M4GA 4C0ZA 2YUNA 3G4SA 2RHZA 3ME9A 3CCJA 1ZUKA 2YUOA 5DLOA 3CMAQ 1OV3A 3META 2KYBA 2KGTA 2KI7A 3QBYA 1CKAA 4N4HA 1K73C 4J6XA 1FWZA 4PJOC 2RJFA 1X2QA 3MP1A 1M90C 2G6FX 3UPUA 2LVMA 3VS6A 1TG0A 1ZBXA 2DYIA 2L8DA 1WHHA 5GMKi 1KC8R 3EG9B 4ZTJA 2YRCA 1RAGB 2LCLA 4KGVB 4D6WA 1WA7A 2DX1A 5CKDA 5IT9E 2RO0A 3M56A 5LJ5h 3RDVA 2V8IA 1WYXA 2FO0A 3RMQA 1NPRA 1S72A 3ASKA 2RI5A 1WFWA 1VQOA 4RUGA 2X3XD 3OYEA 1Y0MA 3CEYA 4CRIA 3M59A 5AT1B 4BDZA 2M0OA 3EFSA 1WQWA 2J6OA 2JXBA 2KNBB 4BY6C 3M55A 1HD3A 2CDTA 2ZZDA 1OPLA 5L8RE 3TU4K 4RCBA 3EH2A 2OJ2A 5GAMd 2WACA 1K9MC 2P84A 1W2BP 3VS4A 3VS1A 4IUQA 5IXBA 5LJ3e 3OYKA 2NUZA 4M7AD 2ENMA 4XK8E 2EQKA 1TOVA 2RF0A 3C12A 4AT1B 1IHWA 3CCLA 4PJOE 2HQXA 2KRNA 3LX7A 5CK9A 2K4YA 1WJRA 3OMCA 2GTOA 4BACA 2CGHA 3RKYA 2FRWA 4O5VA 1D3BB 3LYIA 1LCKA 2E64A 2DXUA 3VJPA 4PJNA 3VUZA 5GANd 1I5OB 2VB6A 3O5ZA 2QASA 3UF4A 3JCMh 3VKIA 4BI3A 2AIRB 2JN0A 4BUGA 4KH0B 5KYUB 1I1JA 2RHYA 5CCAA 2IPOB 2DYBA 1D09B 3T9NA 4R56A 1RABB 4JRKA 2HDAA 1SEMA 2E70A 5GAOm 4Y91A 3TQ7P 3CXCP 4DBQA 1W2BA 2C0OA 1I0CA 2QTXA 2EYZA 1M3BA 3LH5A 2K2VA 1KHCA 4UC4A 1R77A 4LUDA 4TVRA 2I0NA 3UWNA 2PUOB 4XQ3A 2DXCA 4F7UA 3V7RA 2LCCA 2CYZB 2SEMA 3HL8A 1YJ9T 4BDYA 3HHTB 4EDUA 3CC7T 1M27C 4M7DB 1UGRB 4X34A 3JCMX 1RI9A 3OQ5A 2GF7A 5GAN3 2QK0A 1VYTA 1VQ5Q 1MGQA 2K5FA 1RLQC 1OU8A 3QYGB 1KJWA 4B9XA 5FRNA 1UGSB 4IIMA 2E3IA 3MP6A 4XTZA 3VRZA 2DO3A 1JJ2S 2QA4Q 1MUZA 1KQ2A 3J80E 1X6GA 2JOYA 3CXCA 5IXFA 4LD6A 4AG2C 5I11A 1FMKA 1OPKA 2A08A 5GANf 5CR2A 1JRIA 3I55A 2XICA 1MMNA 4M78D 2MAMA 1X6OA 3RR6A 2E4HA 2LQKA 1VIFA 4FYVB 1VOMA 3GPLA 2JT4A 1G3WA 1KQSA 1AZEA 4OMNA 5FWBA 4RTTA 4M7AC 2JTFA 2RI2A 3L2ZA 2CZ0B 2XDPA 1UGPB 1VUBA 2K9GA 1TWBA 2LNVA 3QWXX 1X2KA 1N6AA 2A36A 1RUWA 2G3RA 4PFPA 2DL5A 4C8QG 9ATCB 1LJOA 3OW2P 3OYFA 1NJIR 1VQNT 6AT1B 3UA7A 1UE9A 1G3YA 4NL3A 4BB7A 3A5ZB 1YJNA 3HRSA 2WSCE 2COWA 3OYIA 4J6YA 2OTLA 2K5IA 5LJ3d 5IH2A 1UJYA 2KR3A 2BZXA 2DXBA 1UHFA 2QYZA 1OX9A 4M75A 3VV0A 2R5MA 2LZ6B 1K73U 4YTLA 4M7DC 2IIMA 3LGFA 4J5YA 3SFMA 2FHDA 2M51A 3I9QA 2AHJB 1M90U 2LJ0A 3CCLQ 5GJVB 1PRLC 2P0QA 2JZ2A 3CPFA 3S3MA 2AZSA 2QGGA 3FB9A 2GCXA 5IHNA 2PTKA 3VYHB 2EQIA 2D8JA 3OYMA 3MEWA 4FYWB 1N8RC 2HAXA 4J9FA 5GAOn 4OB2B 4M7AE 3CMEQ 2LDMA 3GNGA 2NUPB 3A8OB 3OW2A 2AZVA 1JB0E 2QDLA 4BI8B 4CC3A 2EAYA 4PJOF 1YHQQ 3M0RA 3NTKA 1ABQA 1H3ZA 3CCVQ 1VQ8Q 4XTVA 3THKA 4Y92A 4ZN1A 2DNUA 1D1BA 4EPCA 5LJ5g 1U8RA 1J3TA 4IIOA 1PG5B 3QO3A 1K9MU 2MOXA 1WI7A 1PCXA 1EX4A 1AD5A 3KFVA 2O88A 3A1PA 4FT4A 4M78G 1CKBA 4M7DE 3O8VA 1M8MA 1YNZA 2ZCFB 4LXCA 3VS3A 1VQMT 3LW5E 1SHFA 2QQAA 2HMAA 3AHUA 3QZ9B 2J6FA 2PVOB 1UUEA 2CUDA 4IURA 3J7AF 4MZPA 1G3TA 3CCET 2RQWA 3M0PA 2JMAA 3NTIA 2DVJA 1IB8A 1NG2A 4C92A 1AHJB 1VQ4A 2OX7A 4ESRA 4AMCA 1G3SA 4OF1A 2QXFA 2MI6A 5IHIA 3QJ6A 1GFDA 2ZPHB 2PNIA 3OA6A 3DB3A 4ZN3A 2X3WD 3EG9A 5GJWB 2HL5C 5D6XA 3HPWA 3CMET 3HFNA 3CPWS 2LQWA 2YXYA 3PMTA 3CCST 1VQKQ 1VYUA 1WPYA 3CCRA 2R57A 1G8XA 2FZCB 2VXEA 5GAN6 1YHQT 2O2OA 2DL3A 1RAAB 3REBB 5GANg 3CCVT 1N9RA 3PTAA 4XTYA 3PVQA 4RTUA 3M54A 2F2XA 1Z9ZA 3I35A 3JSCA 3H41A 3CC2Q 4HT8A 4M77B 2H8HA 1MMGA 2DF6A 3H0IA 2V1QA 2O31A 2RA2A 4KGXB 3G1JA 1R0CB 1Q95G 3L42A 1ZSGA 2ZPIB 2L0AA 3L2UA 5LJ5e 1V29B 2OTLQ 2XI9A 2DIQA 1WHGA 5C0MA 4LDWA 3JB9I 1GRIA 5GAN4 1RADB 4F04B 1X01A 1QCNA 3RERA 1EFNA 2XKOC 1Q86C 5KE2A 2LX9A 5D6YA 4XTWA 3ZEHA 1I07A 3CC4T 2K3BA 4JRIA 2OTJA 1AWWA 3JCMW 1KC8C 2NWMA 1SHGA 1KG1A 4RTWA 3F70A 5EG2A 3N5BB 2FL7A 1SSHA 2FEIA 1RACB 3M0SA 1XQHA 1XTDA 4M75B 2GGRA 2VGNA 2D6FA 3M0UA 2BZYA 2J06A 1WDXA 1TS9A 2DVEA 5CO7A 3LWIA 3VUBA 2KRSA 3M0TA 1D1CA 1AWOA 1YCYA 3PMIA 3G6ET 2JMCA 3EG0A 4AG1C 4E7SA 2QQBA 4BD3A 1VQ6T 1WHMA 2L2PA 3JCMV 4JZ3A 4E2FB 4E7ZA 5DY9A 3EG2A 3JAME 3JCMe 4A4EA 2EIFA 2FZGB 4M7AF 4Z8AA 1G5VA 1E6GA 3V8LA 1X27A 1GCQA 2DTIA 1AT1B 1H3HA 3EHRA 1GXIE 1YIJQ 1JBMA 5GAN7 2MYSA 3JCMJ 4FT2A 4PFZA 3SHWA 4HCBA 3Q1JA 2CT4A 2F5KA 2P4RA 2W0ZA 3VS0A 5KE3A 3X26B 4FSXA 4DBRA 4EMKA 1D0ZA 1B34A 1MMDA 3EG1A 1YP5A 4Z02A 1N8RU 1D0XA 4F7UE 2J6KA 3CCMT 3P8DA 3JCMc 3X24B 2A0FB 3DLLA 4IUPA 4A4FA 2O9VA 1FYNA 2BZ8A 4IUUA 1VQ4Q 4OMMA 1B07A 3TEEA 1OOTA 4KUDK 1NYGA 2L5QA 1WX6A 1K0XA 2K6DA 1T3SA 4ORZA 3EFRA 2EKOA 2XK0A 2LJ1A 1YJWQ 3E2UA 4PJOG 3MJXA 4M75C 2ABLA 4ZGJB 5HK3A 3CCRQ 1BYMA 2ZPEB 1VQ9T 2HQEA 1PHTA 1W1FA 4C92B 2QQSA 4LNPA 4DBHA 1O9SA 3AT1B 2XDBA 1SKUB 1YI2Q 5I22A 2GFAA 1VQPQ 2JJ9A 3QHSA 1KSWA 5GAN8 1GL5A 1B7TA 1QVFP 3CD6T 2XD0A 2J7IA 1YITT 1W6XA 2CKKA 3GP8A 4A4HA 5LJ5d 2DRKA 4J9IA 2HKNA 3V8JA 3JB9J 2ATCB 1IZ6A 5GMKl 3SDZA 3QXEB 4N4GA 3RNJA 2QDYB 5IHKA 1OULA 1Q7YC 3P8BB 3L2QA 2HEQA 2QEXT 2CZ7B 1VQLQ 1D1AA 3I56A 3TREA 2KMTA 3WXMB 2ESWA 3FEOA 3CCQQ 1EIFA 1NYFA 3V7SA 4ANJA 2X4XA 4QVCA 1PSEA 1M1KC 4DEYA 1FX7A 2GTJA 5FU7C 3R6OA 5GMKj 3OS5A 3QPHA 3H8ZA 1HJDA 4J8OA 2L3QA 3M53A 5A2QE 4LUEA 1M3AA 1BU1A 4KBMB 2HKQB 1MV0B 1QVPA 2DM1A 4M78F 4IUTA 4M75E 1WHJA 2DL8A 1JO8A 2NUPA 2P0KA 4J7FA 2X9HA 1QVFA 3KBGA 2KK4A 1VQMA 3CMAT 3FJ5A 2L89A 5FLXE 2E65A 2ZAEA 2R58A 1VQPT 1X69A 2YDLA 4HA8A 1AOJA 3HKSA 4C92C 3JCMd 1K8AC 3VRYA 2O01E 4KULA 1T0JA 3C4SA 4OB1B 5KYYA 1KD1C 1RLPC 2YLCA 2L3PA 4HT9A 4C0DB 2M16A 4HXJA 1IREB 5LJ5f 3FJPA 4M7DD 2FVUA 2DJQA 2OI3A 2RHXA 3FLGA 4L59A 5KYNA 4MMLA 4DA4A 1Q86U 3A8GB 4BE2A 1K8AR 2ZPGB 1YCSB 3P8HA 3H0FA 1BIBA 3OB9A 3QIIA 2HBPA 2BE9B 3MEAA 2YHTA 4JLIA 4ZGEB 2K79A 3E19A 3JCMQ 2E1HA 4JS5A 1GBRA 3R6NA 1E7OA 2LRQA 1KHIA 2RHUA 1BIAA 3RUXA 3EGDB 1SPKA 1KQSP 1TUDA 1YBYA 2XHCA 5GAN5 1PKSA 3D7SB 5FU6B 3CCUA 3RIRA 5KH6A 3C94A 1IXDA 3M4YA 2XU8A 4OMLA 4C8QB 2GNCA 3X20B 5CKFA 2ZPFB 3PGGA 1K76A 2YWWA 1K73R 3L2RA 3ULRB 2JVVA 1TU0B 3G4SQ 3QG1A 1M90R 4N0AA 3RKWA 4ZNXA 4PLIA 4EMKB 4GLMA 1AWXA 2DD4A 4J9EA 4CC7A 8ATCB 3CCJQ 4C92E 1B34B 3URGA 1MNEA 2CP2A 2DK3A 2CP0A 3JRZA 1X75C 1V76A 1MHNA 4XU1A 2ED1A 4F7UF 4M77A 1HYOA 3JB9D 3REAB 3JCMf 1Q82C 4M7AG 2K3XA 3TSZA 2EVRA 4MMKA 2RJDA 2NUTB 4KUIA 3QZ5B 3G71A 3MO8A 1MMAA 4FU6A 2RQUA 4A4GA 1WHLA 4C0DC 4FW2A 2FG0A 1VIEA 3OS1A 3FRNA 4OGCA 2KEAA 1S72Q 1U5SA 2EPDA 4AFUC 1OYXA 1K9MR 1VQOQ 3I56Q 3PIOA 4MZTA 2LX7A 3TSWA 5GMKh 4ELYC 2B8AA 3G6EA 1ZLMA 2VUBA 2E5QA 1NM7A 3QKJA 1O75A 1G2BA 4ATOA 2KDSA 1VQ7A 2X4WA 2DZ9A 2EQJA 2YUPA 2HD0A 4WF2A 1C6VX 4C0FA 4M7DG 4LDUA 2BTTA 4E7IA 3BW1A 4X9DA 5FU6C 1W2BS 3HRTA 1Q81C 2GBQA 1GCQC 2KSSA 2KXDA 3X28B 1UGVA 3M58A 1XJWB 3OYYA 1VQ5T 3OS2A 1UHCA 2CZ6B 5D6WA 4RCCA 4D8DA 1GBQA 3OBWA 3RESA 3ZL7C 1WHKA 2E41A 2Y4XA 4QQGA 1IRXA 2QA4T 2R5AA 4EMKC 2Y4YA 4HKEA 1BKBA 3CPWA 3C95A 2QQRA 5ECAA 3HFOA 2Z0WA 2RK1A 3ZFJA 2PUKB 4JUVA 1BI3A 1GFCA 4E6RA 3SWNB 2EJGA 3VYGA 2D9TA 3ER0A 3PE0A 2LT4A 5GAOr 1Q7YU 4OB0B 2FZKB 1WXUA 4PKCC 1VYVA 3VS2A 2OAUA 1QP2A 1M1GA 3EG3A 4FW1A 4JJBA 2PVGB 2HSPA 2EWNA 1M1KU 4KT0E 1H92A 2E5KA 1EZZB 2LQ8A 4F14A 1ZBJA 2A7YA 2K57A 2F69A 3CXCS 1OI1A 1VQ9A 2FYKA 5J39A 4BE0A 1AEYA 2GQVA 3FIFA 1VA7A 2DXTA 4MZMA 2KY9A 5KYYB 3JB9G 2ROLA 4ME7A 2AT1B 4KRTA 4A53A 4FYXB 2VASA 1N5ZA 1YWOA 3H0HA 4LDXA 2RI3A 2X4YA 5HKCA 5GMKm 2JW4A 2XMFA 2CT3A 2P0PA 1QVGP 1IGUA 5CKBA 3MP8A 5GAOq 3OY9A 2CH4A 3FDRA 1JEGA 2VKNA 1X6BA 1M3CA 2DMOA 3CCLT 2EQUA 2QEXA 1PM3A 2D0NA 4XAXB 1K8AU 5KYWB 1N27A 1KIKA 1M8VA 4KGZB 4CC4B 4M77D 4HCKA 4E7HA 3QYHB 4EIKA 2MIOA 3OYDA 1KD1U 4O6JA 5AYFA 4AFZC 5FROA 4N4IA 4RTVA 3S3OA 1QWFA 2AKKA 4J83A 1AZGB 3RKXA 5CKHA 2YLBA 3SWNC 1H641 4JZ4A 3I55Q 1AVZC 4FCYA 1P92A 1WJSA 3TCJA 3JCMg 3G71Q 4K11A 1ZSZA 5FWCA 4EMHA 1VQ8T 1NZ9A 2KQWA 5IAYA 3GOXA 2W10A 4ZGDB 1QVGA 4NOYA 1I81A 5GAOl 1HK9A 4CC2A 3OYLA 3OW2S 3H9NA 5CKEA 1YJNQ 2DEQA 1BI2A 2HCKA 3UATA 4J9DA 4M75D 1VQ7Q 3EGUA 2VXFA 1UEBA 2WSEE 2RB6A 2CSQA 4HVUA 3NTHA 2HZYA 1BCOA 3DLMA 1NLOC 3EGXB 3NGPA 2DZCA 4Z89A 1N8RR 4B6MA 4F7UG 2E6NA 2MPXC 1QWEA 4C5GA 5A0DA 4D8KA 1Q82U 3L1AA 4RG8A 2B86A 2C0TA 2ZGWA 3NFCA 2MCNA 1YJ9A 1VQKT 4MDXA 3OYBA 4LDVA 3CC7A 4E7LA 2RQVA 4JDSA 4PL6A 4N0AC 5GAMj 1OZ3A 2C06A 1A0NB 1ZA1B 2VYTA 3CC2T 4OMOA 4PJOB 4DQ2A 4X9CA 4HVVA 3EGDA 2HNIA 3BY7A 4M77C 2LJ3A 1BBZA 1T3LA 4AFSC 2PVDB 3MCAB 1Q81U 1SSFA 1I8FA 4RTZA 2OTLT 4C8QA 3RMSA 3MEVA 1PSFA 3OYHA 4FYYB 1Y57A 3QUIA 4XU3A 1XNIA 1TH7A 2C0IA 1YFNA 2FPDA 1X43A 5GANj 1U3OA 2HQHA 2K2MA 4WCIA 3HP9A 4II1A 4C92D 2A3LA 2YUQA 3GLXA 1W70A 2MK5A 3QDRB 2GFUA 2D8HA 4XU2A 4JLGA 4OGEA 1VQNA 2RH2A 1BI1A 1ZHIA 2M9UA 4OVAA 1XOVA 4R55A 4M7DF 1Y71A 1JXOA 4M75G 4JPBW 1Z9QA 2MF2A 5GAOp 1UGQB 2DA9A 3A8MB 2NUTA 1Y96A 4EMGA 4P5NA 1LNXA 2EYQA 2DIGA 1TUCA 1QCOA 2NLUA 2CP5A 4RMOA 2CP7A 4E7KA 2KVQG 4M77E 1VQ5A 2RQTA 2V1RA 1PRMC 2E6ZA 2F2WA 3EAEA 2EJFA 1M2OA 4XTUA 3VS5A 1JJ2P 1W4SA 2RJCA 3VS7A 3OYNA 2KT1A 3S6WA 3GIBA 2QA4A 4XTXA 4Y28E 3PIPA 2KYMA 1TXQA 1NBEB 2CUBA 4PFOA 2M1HA 4IUVA 2CZ1B 2JTMA 3CBPA 1Q86R 1DJ7B 4A4KA 4C0GA 1ZQ1A 1YIJT 2IG0A 4J9BA 1ZSZB 1KQ1A 5C6SA 5A0GA 2RHIA 2OAWA 2EQMA 1PD0A 2DEUA 3LGLA 1UB4A 3NPFA 4M78A 3HTRA 5GMKe 1FMWA 2YSQA 3VU3C 2JNGA 1MV3A 3PFSA 4R0KA 1IGQA 2OTJQ 4PJJA 4J9CA 5CAIA 3JB9F 3MEUA 2XG8D 1ARKA 3HSBA 2PZ1A 4PJMA 1VQ4T 1LOJA 3BE3A 1PC0A 3SWNA 2QG9B 5CQYA 1K4US 1SRLA 5J3BA 2EW3A 1WJQA 5I2SA 1JJ2A 1PKTA 1YJWT 2MWPA 2WSFE 2JM9A 2K5LA 2BIVA 2DL7A 1YJ9Q 3UA6A 3CCRT 1PD1A 1NJIC 3CBMA 1QCFA 5GAMh 4C92G 3CC7Q 4L5GA 4C5EA 3OMGA 3CCEA 1YI2T 5LJ3j 1K9AA 3IQLA 4JS4A 2DILA 1M1FA 2DFUA 2EYWA 1QLYA 4A54A 2K7AA 2DD5A 2ROTA 1WNLA 2DERA 4BI4A 2LMJA 4J6WA 4NL2A 2EJ9A 4E47A 2P4TA 3NMZC 4C8QD 2EYXA 3CMEA 5A0LA 2D1XA 1WIEA 1Y7XA 3CCSA 2V26A 1VQLT 2DRMA 1KC8U 5L23A 5KYXB 5GANh 4M7AB 4HVWA 4X1VA 3CCQT 4JJDA 1YHQA 1FXXA 1ZSZC 5I21A 3CCVA 4Z88A 2H3JA 5KCHA 3OYGA 1VQ8A 5KYWA 2OTJT 2EKHA 3X25B 3WVEB 1D0YA 2X4JA 3A8LB 2A37A 2AKLA 3PVLA 1VQNQ 1IHVA 3JCMb 3G7ZA 4OMQA 2J05A 4F16A 1UDLA 5CVIA 3LWHA 3EFOA 3GBQA 2BKDN 1NEBA 5GAMf 4Q5WA 1NEGA 4WTOB 2JS2A 2QAZA 2CS7A 3FC3A 2YRDA 1M2VA 3U23A 1U1TA 1I5LA 2O4XB 3E9GA 2XIDA 3CC4A 4LN2A 4OMFB 2VV5A 2PQWA 1RAHB 2M02A 4QQ6A 1CSKA 4RTXA 3KUFA 4M4ZA 1T0HA 2L3SA 1Q7YR 4AFQC 1RL2A 2RD1A 1QVFS 3BFMA 4NS5A 1Y96B 3EH1A 3HRUA 2DJZA 1M30A 3MPUB 3MKDA 2L3RA 5HK0A 3CPWP 3L2VA 3UT1A 1NE8A 3LLRA 3JB9H 1VQKA 3I5SA 1M1KR 1QW1A 2X35A 1PWTA 1BK2A 2RPNA 1F1BB 2LT1A 4JRPA 2EYYA 4FL6A 3EGXA 4DOVA 4M77F 1OZ2A 2BE7D 5GAN2 2DBKA 2DBMA 5KCOA 1U1SA 2KT8A 3EHQA 4QVZA 3CC2A 1VQ6A 2QTVA 1LPLA 1YN8A 5IN1A 2EGCA 4KH1B 1OX8A 2K3YA 5CIUA 3OYAA 2EFIA 3I5RA 4ELZC 1ZUUA 4C8QC 3L2WA 5I2MA 1UJ0A 2VC8A 5J26A 3G4ST 3GNFB 1HSQA 4JJCA 3M9QA 1JXMA 1RAEB 3PNWC 3CCJT 4M78B 4A63B 1IO6A
chains in the Genus database with same CATH topology
2ZPBB 3CBOA 4ZGDB 3DLLA 1QVGA 4NOYA 1I81A 4IUPA 4A4FA 3JCMh 5GAOl 3VKIA 4BI3A 2JN0A 5LJ3h 4BUGA 4IUUA 1HK9A 3TEEA 2D0QB 2RK2A 4GY5A 4KUDK 2L5QA 2LTOA 2RHYA 3OYLA 5CCAA 2LC4A 3OW2S 4R56A 3T9NA 3EFRA 1WGSA 2EKOA 4PJOA 2XK0A 5CKEA 4JRKA 3WVDB 2E10A 2DEQA 1BI2A 2E70A 4Y91A 5GAOm 3CCMA 3DB4A 1W2BA 4PJOG 4M75D 2QTXA 2VXFA 1UEBA 4M75C 4M75F 2K2VA 2WSEE 1KHCA 4UC4A 4ZGJB 5HK3A 1BYMA 2ZPEB 2RB6A 1VQ9T 4TVRA 2HQEA 3NTHA 4C92B 4JJNK 2QQSA 3UWNA 2PUOB 1O9SA 3GF5A 2XDBA 2VGMA 3DLMA 2GFAA 4VUBA 4XQ3A 3QHSA 2DZCA 2DXCA 4F7UA 3V7RA 5GAN8 2LCCA 1S72T 2CYZB 3HL8A 3QJYA 1YJ9T 4BDYA 3CD6T 2XD0A 4F7UG 2E6NA 1VQOT 2DKGA 1YITT 3I56T 2CKKA 3HHTB 3GP8A 4EDUA 5A0DA 4A4HA 4C5GA 5LJ5d 3CC7T 3QSUA 4M7DB 1Q82U 3V8JA 1UGRB 3JB9J 3L1AA 3OYCA 4RG8A 1IZ6A 5GMKl 4X34A 3JCMX 3SDZA 2JUFA 2MMPA 3QXEB 2ZGWA 4N4GA 3OQ5A 3NFCA 2GF7A 5DLQE 4C5HA 2QDYB 5GAN3 3OBYA 1Q7YC 3P8BB 3L2QA 4C8QE 1MGQA 1VQKT 2K5FA 1YJ9A 4MDXA 5CQXA 3QYGB 2QEXT 3OYBA 1KQSS 4B9XA 3CD6A 2CZ7B 5FRNA 1UGSB 4LDVA 5M9OA 3I56A 1YITA 3TREA 3MP6A 3CC7A 4XTZA 4E7LA 2DO3A 2KMTA 3WXMB 1JJ2S 4E7JA 3FEOA 1EIFA 4FIBA 1NJIU 4JDSA 1KQ2A 4PL6A 4GLKA 3SD4A 3J80E 4L6V5 3V8KA 4N0AC 3V7SA 3INZA 2X4XA 2JOYA 4QVCA 5GAMj 1PSEA 3CXCA 1M1KC 1OZ3A 1RI0A 4FM4B 4LD6A 2C06A 1FX7A 5FU7C 5GMKj 3R6OA 2VYTA 3OS5A 3QPHA 3H8ZA 4J8OA 1YIJA 3CC2T 3M53A 5GANf 5CR2A 1JRIA 5A2QE 3I55A 2XICA 5LJ3f 3KXTA 4PJOB 4KBMB 4DQ2A 4M78D 4X9CA 2MAMA 1X6OA 1QVPA 2HNIA 2LQKA 3M57A 4M78C 1VIFA 4M78F 4IUTA 1R8OB 3BY7A 4M75E 4M77C 4M78B 3GPLA 1G3WA 1N9SA 5LL6S 1KQSA 2PVDB 4M7AC 2JTFA 2RI2A 3L2ZA 2CZ0B 3MCAB 2XDPA 1UGPB 1VUBA 2P0KA 4J7FA 3OSVA 5GAMg 1SSFA 2YRVA 1I8FA 1Q81U 2OTLT 1QVFA 4C8QA 2FB7A 2LNVA 3KBGA 4JRQA 3RMSA 3MEVA 1N6AA 2KK4A 1VQMA 1PSFA 2DPPB 3OYHA 3CMAT 2G3RA 2MWOA 2QI2A 4C8QG 3DKMA 3QUIA 4XU3A 4F7UB 1LJOA 1XNIA 1TH7A 3OYFA 1VQNT 2L89A 5FLXE 2E65A 5GANj 1G3YA 4NL3A 4BB7A 3HP9A 2R58A 3A5ZB 4II1A 1YJNA 1VQPT 3HRSA 2WSCE 4C92D 1BI0A 2A3LA 3E9FA 3OYIA 4J6YA 1YJWA 4HA8A 2OTLA 3HKSA 4C92C 3JCMd 4C92F 1K8AC 2K5IA 3GLXA 5LJ3d 2O01E 3QDRB 3CMAA 2GFUA 4ZTFA 4XU2A 4KULA 4JLGA 3C4SA 4OB1B 4QW2A 2DXBA 4OGEA 1KD1C 1VQNA 2RH2A 1BI1A 1ZHIA 2YLCA 4HT9A 4M75A 4C0DB 2M9UA 2F5TX 2M16A 2R5MA 1IREB 4OVAA 3VV0A 3FJPA 2IVWA 2RM4A 5LJ5f 5DM7R 1YI2A 1K73U 4YTLA 1VQPA 1XOVA 2FVUA 4R55A 4DA4A 2RHXA 1QP3A 1Y71A 3FLGA 4L59A 4M75G 4MMLA 4M7DC 1Q86U 4M7DF 3LGFA 3A8GB 4J5YA 2MF2A 3SFMA 2FHDA 4BE2A 2AHJB 5GAOp 1M90U 2ZPGB 3J81E 1UGQB 5FRMA 3A8MB 2V8KA 3P8HA 1BIBA 1Y96A 2JZ2A 2P0QA 3OB9A 3CPFA 3QIIA 4EMGA 2HBPA 3CCUT 2Y90A 3MEAA 1M4ZA 3S3MA 3FB9A 4P5NA 2GCXA 2YHTA 4JLIA 1LNXA 4ZGEB 2EYQA 2DIGA 3E19A 3JCMQ 2E1HA 4RG2A 4JS5A 3VYHB 2NLUA 2LRQA 3OYMA 1KHIA 2RHUA 1BIAA 4HCZA 4C5IA 3MEWA 4RMOA 4M78E 1N8RC 3RUXA 4E7KA 2KVQG 4M77E 1VQ5A 1YBYA 2HAXA 3UDCA 2E6ZA 4OB2B 5GAOn 2XHCA 3EAEA 5GAN5 1VQLA 4M7AE 1NPPA 3SB2A 2EJFA 5LJ5j 2LDMA 3GNGA 4XTUA 1W4SA 2RJCA 3OSSC 5FU6B 3CCUA 3A8OB 3RIRA 3S6WA 3OYNA 5KH6A 3OW2A 3GIBA 3C94A 2QA4A 3M4YA 3CCQA 2XU8A 4XTXA 4C8QB 4Y28E 1JB0E 3PIPA 2I2LA 3X20B 4BI8B 5CKFA 4J7IA 4PJOD 2ZPFB 3PGGA 2EAYA 4PJOF 3L2RA 2M1HA 3NTKA 2CZ1B 4IUVA 2JVVA 2JTMA 3CBPA 1M9SA 1H3ZA 2QQ9A 1DJ7B 3QG1A 2V8JA 4A4KA 4N0AA 4XTVA 3RKWA 4C0GA 4PLIA 1D3BA 1ZQ1A 2IG0A 4EMKB 2DD4A 4PNOA 4EPCA 4ZN1A 5LJ5g 1YIJT 3OS0A 4C92E 1B34B 1KQ1A 3URGA 5C6SA 3I55T 2DK3A 3E1SA 3M5AA 5HY6A 2RHIA 3QO3A 5A0GA 1K9MU 1M5Q1 3JRZA 4QQDA 3JCMP 1X75C 1WQ7A 2PU9B 4LDYA 1MHNA 4XU1A 5GAMe 2EQMA 4BE1A 3G71T 3V7CA 3LGLA 1UB4A 3PT9A 4M78A 4F7UF 5GMKe 1Y07A 4RKUE 4M77A 3VU3C 4FT4A 2JNGA 3PFSA 4M7AA 4M78G 3JB9D 4M7DE 4M77G 3O8VA 1I4K1 2ZCFB 3JCMf 5CAIA 4LD9K 1VQMT 3MEUA 3JB9F 2XG8D 3LW5E 1Q82C 2QQAA 3A8HB 4M7AG 3HSBA 3AHUA 2K3XA 1VQ4T 2E12A 1LOJA 3QZ9B 4MMKA 2RJDA 2PVOB 3SWNA 4CI0C 4KUIA 3QZ5B 4IURA 3G71A 3J7AF 4OP0A 3MO8A 4MZPA 1G3TA 5CQYA 3CCET 3BDUA 5J3BA 1WJQA 4FU6A 5I2SA 1YJNT 4A4GA 1JJ2A 4C0DC 2DTHA 1YJWT 2MWPA 1VIEA 3MHXA 3OS1A 3NTIA 2WSFE 1VQ7T 2DTOA 3FRNA 2K5LA 2KAFA 4OGCA 2BIVA 4C92A 1AHJB 2BUDA 1VQ4A 3CCRT 1NJIC 1OYXA 3CBMA 4DOWA 3PIOA 1G3SA 1HXDA 3BDLA 4MZTA 2QXFA 4OF1A 4C92G 2MI6A 5GANe 4L5GA 3H6ZA 3QJ6A 5GAMh 4C5EA 2ZPHB 3OMGA 5GMKh 3OA6A 3CCEA 4ELYC 2B8AA 3DB3A 4ZN3A 3G6EA 1YI2T 2VUBA 5LJ3j 2E5QA 1QVGS 3ZBDA 3QKJA 1O75A 5D6XA 4V2SA 3S3NA 4JS4A 4IKFA 4OB3B 3HPWA 3CMET 3HFNA 3OYJA 4ATOA 1M1FA 4PLLA 2KDSA 4M7DA 4A54A 3CPWS 1VQ7A 3LH0A 3PMTA 3CCST 2X4WA 2DZ9A 2EQJA 2DD5A 2HD0A 1WPYA 4WF2A 3CCRA 1WNLA 2R57A 2O4XA 4C0FA 4BI4A 4M7DG 4LDUA 2RJEA 4BY6B 4E7IA 2DAQA 4J6WA 3BW1A 4NL2A 4QVDA 4M7DD 4X9DA 2VXEA 5FU6C 2EJ9A 4E47A 2P4TA 4B9WA 5FU7B 5GAN6 1YHQT 4C8QD 1W2BS 4HCCA 3HRTA 1Q81C 5GANg 4MDWA 2KSSA 4C8QF 1N9RA 3CCVT 3PTAA 3X28B 4XTYA 5LJ3g 4XU0A 3CMEA 5A0LA 3M58A 1VQ5T 3M54A 3OYYA 3OS2A 1Y7XA 2CZ6B 3JSCA 5D6WA 3CCSA 4RCCA 1VQLT 2XDDA 1KC8U 3OBWA 3RESA 4HT8A 4M77B 2E41A 2Y4XA 4QQGA 5GANh 2QA4T 4M7AB 2R5AA 3CCQT 2RA2A 4EMKC 2Y4YA 1YHQA 4HKEA 1BKBA 1FXXA 3CPWA 3C95A 2QQRA 3HFOA 3L42A 3M4GA 2RK1A 3ZFJA 4C0ZA 5I21A 3CCVA 2PUKB 4JUVA 2H3JA 5KCHA 3OYGA 3G4SA 2RHZA 2ZPIB 1BI3A 3L2UA 1VQ8A 3SWNB 5LJ5e 2OTJT 2EJGA 1V29B 3ME9A 2D9TA 3ER0A 3VYGA 2XI9A 3X25B 3CCJA 3WVEB 2LT4A 5GAOr 1Q7YU 2DIQA 2X4JA 4OB0B 4LDWA 5C0MA 5DLOA 3JB9I 3A8LB 3META 5GAN4 4PKCC 3QBYA 4N4HA 1K73C 4J6XA 1X01A 2OAUA 1FWZA 1QP2A 3RERA 1M1GA 2XKOC 4PJOC 1Q86C 5KE2A 2LX9A 5D6YA 2RJFA 4XTWA 3ZEHA 3MP1A 3JCMb 2PVGB 3CC4T 1M90C 3G7ZA 4JRIA 2OTJA 3UPUA 3JCMW 1KC8C 2LVMA 2EWNA 5CVIA 1M1KU 4KT0E 3LWHA 1ZBXA 5GMKi 2L8DA 2LQ8A 4ZTJA 1U8RA 2A7YA 2BKDN 2K57A 1KG1A 2F69A 3F70A 5GAMf 5EG2A 3CXCS 1OI1A 4Q5WA 1VQ9A 2LCLA 2FYKA 4D6WA 5J39A 4BE0A 3N5BB 2FL7A 2CS7A 3FC3A 2GQVA 3FIFA 2DXTA 4MZMA 5CKDA 1U1TA 1I5LA 2KY9A 2O4XB 2RO0A 3E9GA 3M56A 5IT9E 2XIDA 3JB9G 3CC4A 5LJ5h 4ME7A 2V8IA 4OMFB 2VV5A 1XQHA 1XTDA 2PQWA 4QQ6A 4A53A 4M75B 3RMQA 1NPRA 1S72A 2VGNA 3ASKA 3KUFA 2RI5A 2D6FA 4LDXA 2RI3A 2X4YA 2DVEA 5HKCA 5GMKm 1VQOA 1RL2A 5CO7A 3OYEA 3LWIA 2RD1A 3VUBA 3CEYA 4CRIA 2P0PA 3BFMA 3M59A 4NS5A 5CKBA 1QVFS 1Y96B 3HRUA 3MP8A 2DJZA 4BDZA 1YCYA 5GAOq 3OY9A 2L3RA 2M0OA 1WQWA 3EFSA 3FDRA 3PMIA 4BY6C 3UT1A 5HK0A 3L2VA 3M55A 3G6ET 1NE8A 2ZZDA 3LLRA 3JB9H 5L8RE 3TU4K 3CCLT 1VQKA 4RCBA 2EQUA 2QQBA 1QW1A 2QEXA 2X35A 5GAMd 4BD3A 1VQ6T 4XAXB 1K8AU 2WACA 3JCMV 1K9MC 1N27A 2LT1A 1M8VA 4JRPA 4M77D 4E7HA 5DY9A 3QYHB 4IUQA 3JCMe 3JAME 3OYDA 4FL6A 4A4EA 1KD1U 4DOVA 5LJ3e 4M77F 1OZ2A 3OYKA 4M7AD 5GAN2 2EIFA 4O6JA 2EQKA 4XK8E 5AYFA 5KCOA 4M7AF 5FROA 4N4IA 3C12A 1G5VA 1U1SA 3S3OA 3CCLA 4PJOE 2HQXA 3V8LA 3LX7A 2DTIA 4QVZA 5CK9A 3CC2A 2K4YA 4J83A 1VQ6A 1GXIE 3RKXA 5CKHA 1WJRA 5IN1A 3OMCA 2YLBA 1JBMA 3SWNC 5GAN7 4BACA 1H641 2CGHA 3JCMJ 3RKYA 2K3YA 4O5VA 4FT2A 1D3BB 4HCBA 1P92A 3Q1JA 2F5KA 2E64A 3LYIA 5CIUA 1WJSA 2EFIA 5KE3A 3X26B 4FSXA 3OYAA 2DXUA 3TCJA 3VJPA 4ELZC 4C8QC 3JCMg 4EMKA 3L2WA 5I2MA 2VC8A 5J26A 3G4ST 3GNFB 1B34A 1VQ8T 4EMHA 3VUZA 5GANd 4Z02A 1N8RU 3M9QA 1NZ9A 4F7UE 3CCMT 3P8DA 3PNWC 3JCMc 2KQWA 5IAYA 3X24B 3GOXA 3CCJT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DLL A;  1QVG A;  4IUP A;  4A4F A;  4IUU A;  4GY5 A;  2LTO A;  2RHY A;  3OYL A;  3OW2 S;  1WGS A;  2EKO A;  2XK0 A;  2E70 A;  3CCM A;  3DB4 A;  1W2B A;  1UEB A;  1KHC A;  4UC4 A;  1VQ9 T;  4TVR A;  2HQE A;  3NTH A;  2QQS A;  3UWN A;  3DLM A;  2GFA A;  2LCC A;  1S72 T;  1YJ9 T;  4BDY A;  3CD6 T;  2E6N A;  1VQO T;  1YIT T;  3I56 T;  2CKK A;  4EDU A;  4A4H A;  4C5G A;  3CC7 T;  1Q82 U;  3OYC A;  1IZ6 A;  4X34 A;  2JUF A;  4N4G A;  5DLQ E;  3OQ5 A;  2GF7 A;  4C5H A;  1Q7Y C;  3P8B B;  3L2Q A;  1VQK T;  1YJ9 A;  2QEX T;  3OYB A;  1KQS S;  3CD6 A;  4B9X A;  5FRN A;  1YIT A;  5M9O A;  3I56 A;  3TRE A;  3MP6 A;  3CC7 A;  4E7L A;  2DO3 A;  1JJ2 S;  4E7J A;  3FEO A;  1EIF A;  1NJI U;  3J80 E;  4PL6 A;  3SD4 A;  2X4X A;  2JOY A;  3CXC A;  1M1K C;  1OZ3 A;  1RI0 A;  4LD6 A;  2VYT A;  3H8Z A;  1YIJ A;  3CC2 T;  5A2Q E;  3I55 A;  1X6O A;  4IUT A;  1KQS A;  5LL6 S;  2JTF A;  2RI2 A;  2XDP A;  2P0K A;  1Q81 U;  2YRV A;  1SSF A;  2OTL T;  1QVF A;  3KBG A;  3MEV A;  1VQM A;  3CMA T;  3OYH A;  2G3R A;  2MWO A;  1XNI A;  1VQN T;  3OYF A;  2L89 A;  5FLX E;  3A5Z B;  2R58 A;  4II1 A;  1YJN A;  1VQP T;  3E9F A;  3OYI A;  1YJW A;  2OTL A;  3HKS A;  1K8A C;  3CMA A;  2GFU A;  4ZTF A;  3C4S A;  4QW2 A;  1KD1 C;  1VQN A;  4OVA A;  2M16 A;  2R5M A;  1YI2 A;  5DM7 R;  1K73 U;  4YTL A;  1VQP A;  2RHX A;  3FLG A;  4L59 A;  1Q86 U;  3LGF A;  2FHD A;  4BE2 A;  1M90 U;  3J81 E;  5FRM A;  3P8H A;  2JZ2 A;  3OB9 A;  3QII A;  3CPF A;  3CCU T;  3MEA A;  3S3M A;  2DIG A;  4RG2 A;  2NLU A;  2LRQ A;  3OYM A;  1KHI A;  2RHU A;  4HCZ A;  4C5I A;  3MEW A;  1N8R C;  4E7K A;  2KVQ G;  1VQ5 A;  1YBY A;  2E6Z A;  2XHC A;  3EAE A;  1VQL A;  1NPP A;  2LDM A;  3CCU A;  2RJC A;  3OYN A;  3S6W A;  5KH6 A;  3OW2 A;  2QA4 A;  3CCQ A;  3PIP A;  3L2R A;  2M1H A;  3NTK A;  4IUV A;  2JVV A;  1H3Z A;  4PLI A;  1YIJ T;  4ZN1 A;  2IG0 A;  3OS0 A;  5C6S A;  3I55 T;  5HY6 A;  2RHI A;  1K9M U;  4QQD A;  1MHN A;  2EQM A;  4BE1 A;  3G71 T;  3LGL A;  2JNG A;  3PFS A;  3O8V A;  1VQM T;  3MEU A;  1Q82 C;  1VQ4 T;  2K3X A;  2RJD A;  3G71 A;  3J7A F;  4IUR A;  3MO8 A;  3CCE T;  5J3B A;  1WJQ A;  4FU6 A;  1YJN T;  4A4G A;  1JJ2 A;  1YJW T;  2MWP A;  3OS1 A;  3NTI A;  1VQ7 T;  2BIV A;  2BUD A;  1VQ4 A;  3CCR T;  1NJI C;  1OYX A;  3PIO A;  3BDL A;  2MI6 A;  3H6Z A;  3QJ6 A;  4C5E A;  3OMG A;  3OA6 A;  3CCE A;  3DB3 A;  4ZN3 A;  1YI2 T;  3G6E A;  2B8A A;  1QVG S;  2E5Q A;  3QKJ A;  5D6X A;  3S3N A;  4IKF A;  3CME T;  3OYJ A;  4PLL A;  2KDS A;  3CPW S;  1VQ7 A;  3LH0 A;  3PMT A;  3CCS T;  2X4W A;  2EQJ A;  3CCR A;  2R57 A;  2O4X A;  2RJE A;  4E7I A;  2DAQ A;  4B9W A;  1W2B S;  1YHQ T;  1Q81 C;  3CCV T;  3CME A;  1VQ5 T;  3OYY A;  3OS2 A;  5D6W A;  3CCS A;  1VQL T;  1KC8 U;  4QQG A;  2QA4 T;  3CCQ T;  2R5A A;  1YHQ A;  1BKB A;  3CPW A;  2QQR A;  3L42 A;  3CCV A;  3G4S A;  5KCH A;  3OYG A;  1VQ8 A;  2RHZ A;  3L2U A;  2OTJ T;  3CCJ A;  2D9T A;  3ER0 A;  3ME9 A;  1Q7Y U;  2DIQ A;  5C0M A;  3MET A;  3QBY A;  4N4H A;  1K73 C;  1M1G A;  1Q86 C;  5KE2 A;  5D6Y A;  2RJF A;  3ZEH A;  1M90 C;  3CC4 T;  3MP1 A;  2OTJ A;  1KC8 C;  2LVM A;  1M1K U;  2L8D A;  2LQ8 A;  4ZTJ A;  2BKD N;  3CXC S;  3F70 A;  1OI1 A;  1VQ9 A;  4Q5W A;  2LCL A;  5J39 A;  4BE0 A;  3FC3 A;  2O4X B;  5IT9 E;  2RO0 A;  3E9G A;  3CC4 A;  1XTD A;  2PQW A;  4QQ6 A;  1NPR A;  1S72 A;  3KUF A;  3ASK A;  2RI5 A;  2RI3 A;  1VQO A;  2X4Y A;  1RL2 A;  3OYE A;  3CEY A;  4CRI A;  1QVF S;  4NS5 A;  3MP8 A;  4BDZ A;  3OY9 A;  2L3R A;  2M0O A;  3FDR A;  3PMI A;  3L2V A;  3G6E T;  3UT1 A;  3LLR A;  1VQK A;  3CCL T;  2EQU A;  2QEX A;  2X35 A;  4BD3 A;  1VQ6 T;  1K8A U;  2WAC A;  1K9M C;  1N27 A;  4E7H A;  3JAM E;  4IUQ A;  3OYD A;  4FL6 A;  1KD1 U;  4A4E A;  1OZ2 A;  3OYK A;  2EIF A;  2EQK A;  5KCO A;  5FRO A;  4N4I A;  1G5V A;  3S3O A;  3CCL A;  2HQX A;  3CC2 A;  3LX7 A;  4QVZ A;  1VQ6 A;  1WJR A;  5IN1 A;  3OMC A;  4BAC A;  2K3Y A;  3Q1J A;  5CIU A;  2F5K A;  3LYI A;  5KE3 A;  3OYA A;  1WJS A;  2EFI A;  3L2W A;  5J26 A;  3G4S T;  1VQ8 T;  4Z02 A;  1N8R U;  3M9Q A;  1NZ9 A;  3CCM T;  3P8D A;  3CCJ T;  3PNW C;  5IAY A;  3GOX A; 
#chains in the Genus database with same CATH topology
 2ZPB B;  3CBO A;  3RBB B;  1E6H A;  1VQM Q;  2CH4 W;  5LJ3 h;  2RMO A;  2KE9 A;  1KD1 R;  2CSI A;  1G83 A;  2D0Q B;  2RK2 A;  4GY5 A;  2LTO A;  2COZ A;  2LC4 A;  3CCE Q;  1WGS A;  1R0B G;  1YWP A;  4PJO A;  3WVD B;  2E10 A;  3CCM A;  2HL3 A;  3DB4 A;  3QWY A;  2EBP A;  1SF9 A;  1JU5 C;  4M75 F;  1TUG B;  2YT6 A;  4JJN K;  1RAI B;  3GF5 A;  2VGM A;  3M0Q A;  4VUB A;  1ACM B;  4FSS A;  1BB9 A;  2JTE A;  2CP6 A;  4DBF A;  1S72 T;  2E3H A;  3QJY A;  3CCS Q;  1VQO T;  2DKG A;  2DET A;  3I56 T;  2KRM A;  3QSU A;  2EGE A;  3OYC A;  2VVK A;  2AK5 A;  1QQJ A;  2JUF A;  2MMP A;  4GBQ A;  5DLQ E;  4C5H A;  3OBY A;  4C8Q E;  5CQX A;  1KQS S;  3CD6 A;  1PNJ A;  1YIT A;  5M9O A;  3CCU Q;  1TTH B;  1UFF A;  4E7J A;  4FIB A;  1NJI U;  4GLK A;  3SD4 A;  4L6V 5;  3V8K A;  1QMC A;  3INZ A;  3TVT A;  1RI0 A;  2QGF B;  3JV3 A;  4FM4 B;  2CP3 A;  1YIJ A;  2FRY A;  1C0M A;  2JS0 A;  5LJ3 f;  3KXT A;  2F1L A;  1Q82 R;  4M78 C;  3M57 A;  1R8O B;  1N9S A;  5LL6 S;  4QKU A;  4RTY A;  5GAM g;  3OSV A;  2F2V A;  2YRV A;  3CC4 Q;  2NYS A;  1OU9 A;  2FB7 A;  4JRQ A;  2DPP B;  4DEX A;  2MWO A;  2QI2 A;  3DKM A;  4F7U B;  4J9G A;  3QDF A;  3EFO B;  2DE0 X;  1KK7 A;  2HSE B;  2X51 A;  1BI0 A;  2FPF A;  3E9F A;  1YJW A;  4QT7 A;  1M2V B;  4C92 F;  3CMA A;  4ZTF A;  2H3E B;  4QW2 A;  1U06 A;  2KXC A;  1S1N A;  2LP5 A;  2F5T X;  1YI2 A;  2IVW A;  2RM4 A;  2SRC A;  5DM7 R;  1VQP A;  1QP3 A;  1Q81 R;  3G6E Q;  1MND A;  3J81 E;  5FRM A;  2V8K A;  3CCU T;  1VQ6 Q;  2VWF A;  2Y90 A;  1M4Z A;  4RG2 A;  2ED0 A;  1NLP C;  4HCZ A;  4C5I A;  1BCM A;  1TSF A;  2EGA A;  4M78 E;  5FW9 A;  1C1A A;  1WLP B;  3UDC A;  1ZUY A;  1VQL A;  1FMV A;  1NPP A;  3SB2 A;  5LJ5 j;  3NHN A;  3OSS C;  3CCQ A;  2ECZ A;  2A28 A;  2I2L A;  4J7I A;  4PJO D;  2GQI A;  2FPE A;  1QKW A;  8AT1 B;  1M9S A;  2QQ9 A;  3SEM A;  2V8J A;  2LCS A;  2M0Y A;  4PK4 A;  1H8K A;  1RAF B;  5HCK A;  1D3B A;  3CCM Q;  4PNO A;  3CQT A;  3OS0 A;  1ZA2 B;  3I55 T;  3M5A A;  3E1S A;  5HY6 A;  1ZX6 A;  1M5Q 1;  1SRM A;  2DLP A;  4QQD A;  3JCM P;  2RNA A;  1WQ7 A;  2PU9 B;  4LDY A;  1WZO A;  5GAM e;  4BE1 A;  3G71 T;  3V7C A;  3PT9 A;  1ABO A;  1Y07 A;  4RKU E;  2LQN A;  4PJL A;  5KYX A;  2LNH B;  4M7A A;  2HBW A;  3C0C A;  4M77 G;  1I4K 1;  4LD9 K;  5KYU A;  3A8H B;  1OEB A;  1K1Z A;  2E12 A;  4CI0 C;  1VQ9 Q;  4OP0 A;  1GCP A;  3BDU A;  2RQR A;  4LE9 A;  5EC7 A;  1QKX A;  1YJN T;  2DTH A;  2COY A;  3MHX A;  7AT1 B;  1VQ7 T;  2DTO A;  1WXB A;  2KAF A;  5D7U A;  3A98 A;  2BUD A;  3CD6 Q;  4DOW A;  1YIT Q;  1HXD A;  3BDL A;  5GAN e;  1WXT A;  1UEC A;  3H6Z A;  2O9S A;  1QVG S;  3ZBD A;  2RN8 A;  4V2S A;  1SG5 A;  3S3N A;  4IKF A;  2DL4 A;  2JM8 A;  4OB3 B;  3OYJ A;  4PLL A;  1K0S A;  4M7D A;  3LH0 A;  2QEX Q;  2KBT A;  4J9H A;  2O4X A;  2RJE A;  4BY6 B;  1OQK A;  2DAQ A;  4QVD A;  1KFZ A;  4B9W A;  5FU7 B;  4HCC A;  1JQQ A;  1LVK A;  4MDW A;  4C8Q F;  5LJ3 g;  4XU0 A;  4OMP A;  1UG1 A;  4F17 A;  2XDD A;  1V1C A;  1UTI A;  1B3Q A;  2CRE A;  1AWJ A;  2KRO A;  3M4G A;  4C0Z A;  2YUN A;  3G4S A;  2RHZ A;  3ME9 A;  3CCJ A;  1ZUK A;  2YUO A;  5DLO A;  3CMA Q;  1OV3 A;  3MET A;  2KYB A;  2KGT A;  2KI7 A;  3QBY A;  1CKA A;  4N4H A;  1K73 C;  4J6X A;  1FWZ A;  4PJO C;  2RJF A;  1X2Q A;  3MP1 A;  1M90 C;  2G6F X;  3UPU A;  2LVM A;  3VS6 A;  1TG0 A;  1ZBX A;  2DYI A;  2L8D A;  1WHH A;  5GMK i;  1KC8 R;  3EG9 B;  4ZTJ A;  2YRC A;  1RAG B;  2LCL A;  4KGV B;  4D6W A;  1WA7 A;  2DX1 A;  5CKD A;  5IT9 E;  2RO0 A;  3M56 A;  5LJ5 h;  3RDV A;  2V8I A;  1WYX A;  2FO0 A;  3RMQ A;  1NPR A;  1S72 A;  3ASK A;  2RI5 A;  1WFW A;  1VQO A;  4RUG A;  2X3X D;  3OYE A;  1Y0M A;  3CEY A;  4CRI A;  3M59 A;  5AT1 B;  4BDZ A;  2M0O A;  3EFS A;  1WQW A;  2J6O A;  2JXB A;  2KNB B;  4BY6 C;  3M55 A;  1HD3 A;  2CDT A;  2ZZD A;  1OPL A;  5L8R E;  3TU4 K;  4RCB A;  3EH2 A;  2OJ2 A;  5GAM d;  2WAC A;  1K9M C;  2P84 A;  1W2B P;  3VS4 A;  3VS1 A;  4IUQ A;  5IXB A;  5LJ3 e;  3OYK A;  2NUZ A;  4M7A D;  2ENM A;  4XK8 E;  2EQK A;  1TOV A;  2RF0 A;  3C12 A;  4AT1 B;  1IHW A;  3CCL A;  4PJO E;  2HQX A;  2KRN A;  3LX7 A;  5CK9 A;  2K4Y A;  1WJR A;  3OMC A;  2GTO A;  4BAC A;  2CGH A;  3RKY A;  2FRW A;  4O5V A;  1D3B B;  3LYI A;  1LCK A;  2E64 A;  2DXU A;  3VJP A;  4PJN A;  3VUZ A;  5GAN d;  1I5O B;  2VB6 A;  3O5Z A;  2QAS A;  3UF4 A;  3JCM h;  3VKI A;  4BI3 A;  2AIR B;  2JN0 A;  4BUG A;  4KH0 B;  5KYU B;  1I1J A;  2RHY A;  5CCA A;  2IPO B;  2DYB A;  1D09 B;  3T9N A;  4R56 A;  1RAB B;  4JRK A;  2HDA A;  1SEM A;  2E70 A;  5GAO m;  4Y91 A;  3TQ7 P;  3CXC P;  4DBQ A;  1W2B A;  2C0O A;  1I0C A;  2QTX A;  2EYZ A;  1M3B A;  3LH5 A;  2K2V A;  1KHC A;  4UC4 A;  1R77 A;  4LUD A;  4TVR A;  2I0N A;  3UWN A;  2PUO B;  4XQ3 A;  2DXC A;  4F7U A;  3V7R A;  2LCC A;  2CYZ B;  2SEM A;  3HL8 A;  1YJ9 T;  4BDY A;  3HHT B;  4EDU A;  3CC7 T;  1M27 C;  4M7D B;  1UGR B;  4X34 A;  3JCM X;  1RI9 A;  3OQ5 A;  2GF7 A;  5GAN 3;  2QK0 A;  1VYT A;  1VQ5 Q;  1MGQ A;  2K5F A;  1RLQ C;  1OU8 A;  3QYG B;  1KJW A;  4B9X A;  5FRN A;  1UGS B;  4IIM A;  2E3I A;  3MP6 A;  4XTZ A;  3VRZ A;  2DO3 A;  1JJ2 S;  2QA4 Q;  1MUZ A;  1KQ2 A;  3J80 E;  1X6G A;  2JOY A;  3CXC A;  5IXF A;  4LD6 A;  4AG2 C;  5I11 A;  1FMK A;  1OPK A;  2A08 A;  5GAN f;  5CR2 A;  1JRI A;  3I55 A;  2XIC A;  1MMN A;  4M78 D;  2MAM A;  1X6O A;  3RR6 A;  2E4H A;  2LQK A;  1VIF A;  4FYV B;  1VOM A;  3GPL A;  2JT4 A;  1G3W A;  1KQS A;  1AZE A;  4OMN A;  5FWB A;  4RTT A;  4M7A C;  2JTF A;  2RI2 A;  3L2Z A;  2CZ0 B;  2XDP A;  1UGP B;  1VUB A;  2K9G A;  1TWB A;  2LNV A;  3QWX X;  1X2K A;  1N6A A;  2A36 A;  1RUW A;  2G3R A;  4PFP A;  2DL5 A;  4C8Q G;  9ATC B;  1LJO A;  3OW2 P;  3OYF A;  1NJI R;  1VQN T;  6AT1 B;  3UA7 A;  1UE9 A;  1G3Y A;  4NL3 A;  4BB7 A;  3A5Z B;  1YJN A;  3HRS A;  2WSC E;  2COW A;  3OYI A;  4J6Y A;  2OTL A;  2K5I A;  5LJ3 d;  5IH2 A;  1UJY A;  2KR3 A;  2BZX A;  2DXB A;  1UHF A;  2QYZ A;  1OX9 A;  4M75 A;  3VV0 A;  2R5M A;  2LZ6 B;  1K73 U;  4YTL A;  4M7D C;  2IIM A;  3LGF A;  4J5Y A;  3SFM A;  2FHD A;  2M51 A;  3I9Q A;  2AHJ B;  1M90 U;  2LJ0 A;  3CCL Q;  5GJV B;  1PRL C;  2P0Q A;  2JZ2 A;  3CPF A;  3S3M A;  2AZS A;  2QGG A;  3FB9 A;  2GCX A;  5IHN A;  2PTK A;  3VYH B;  2EQI A;  2D8J A;  3OYM A;  3MEW A;  4FYW B;  1N8R C;  2HAX A;  4J9F A;  5GAO n;  4OB2 B;  4M7A E;  3CME Q;  2LDM A;  3GNG A;  2NUP B;  3A8O B;  3OW2 A;  2AZV A;  1JB0 E;  2QDL A;  4BI8 B;  4CC3 A;  2EAY A;  4PJO F;  1YHQ Q;  3M0R A;  3NTK A;  1ABQ A;  1H3Z A;  3CCV Q;  1VQ8 Q;  4XTV A;  3THK A;  4Y92 A;  4ZN1 A;  2DNU A;  1D1B A;  4EPC A;  5LJ5 g;  1U8R A;  1J3T A;  4IIO A;  1PG5 B;  3QO3 A;  1K9M U;  2MOX A;  1WI7 A;  1PCX A;  1EX4 A;  1AD5 A;  3KFV A;  2O88 A;  3A1P A;  4FT4 A;  4M78 G;  1CKB A;  4M7D E;  3O8V A;  1M8M A;  1YNZ A;  2ZCF B;  4LXC A;  3VS3 A;  1VQM T;  3LW5 E;  1SHF A;  2QQA A;  2HMA A;  3AHU A;  3QZ9 B;  2J6F A;  2PVO B;  1UUE A;  2CUD A;  4IUR A;  3J7A F;  4MZP A;  1G3T A;  3CCE T;  2RQW A;  3M0P A;  2JMA A;  3NTI A;  2DVJ A;  1IB8 A;  1NG2 A;  4C92 A;  1AHJ B;  1VQ4 A;  2OX7 A;  4ESR A;  4AMC A;  1G3S A;  4OF1 A;  2QXF A;  2MI6 A;  5IHI A;  3QJ6 A;  1GFD A;  2ZPH B;  2PNI A;  3OA6 A;  3DB3 A;  4ZN3 A;  2X3W D;  3EG9 A;  5GJW B;  2HL5 C;  5D6X A;  3HPW A;  3CME T;  3HFN A;  3CPW S;  2LQW A;  2YXY A;  3PMT A;  3CCS T;  1VQK Q;  1VYU A;  1WPY A;  3CCR A;  2R57 A;  1G8X A;  2FZC B;  2VXE A;  5GAN 6;  1YHQ T;  2O2O A;  2DL3 A;  1RAA B;  3REB B;  5GAN g;  3CCV T;  1N9R A;  3PTA A;  4XTY A;  3PVQ A;  4RTU A;  3M54 A;  2F2X A;  1Z9Z A;  3I35 A;  3JSC A;  3H41 A;  3CC2 Q;  4HT8 A;  4M77 B;  2H8H A;  1MMG A;  2DF6 A;  3H0I A;  2V1Q A;  2O31 A;  2RA2 A;  4KGX B;  3G1J A;  1R0C B;  1Q95 G;  3L42 A;  1ZSG A;  2ZPI B;  2L0A A;  3L2U A;  5LJ5 e;  1V29 B;  2OTL Q;  2XI9 A;  2DIQ A;  1WHG A;  5C0M A;  4LDW A;  3JB9 I;  1GRI A;  5GAN 4;  1RAD B;  4F04 B;  1X01 A;  1QCN A;  3RER A;  1EFN A;  2XKO C;  1Q86 C;  5KE2 A;  2LX9 A;  5D6Y A;  4XTW A;  3ZEH A;  1I07 A;  3CC4 T;  2K3B A;  4JRI A;  2OTJ A;  1AWW A;  3JCM W;  1KC8 C;  2NWM A;  1SHG A;  1KG1 A;  4RTW A;  3F70 A;  5EG2 A;  3N5B B;  2FL7 A;  1SSH A;  2FEI A;  1RAC B;  3M0S A;  1XQH A;  1XTD A;  4M75 B;  2GGR A;  2VGN A;  2D6F A;  3M0U A;  2BZY A;  2J06 A;  1WDX A;  1TS9 A;  2DVE A;  5CO7 A;  3LWI A;  3VUB A;  2KRS A;  3M0T A;  1D1C A;  1AWO A;  1YCY A;  3PMI A;  3G6E T;  2JMC A;  3EG0 A;  4AG1 C;  4E7S A;  2QQB A;  4BD3 A;  1VQ6 T;  1WHM A;  2L2P A;  3JCM V;  4JZ3 A;  4E2F B;  4E7Z A;  5DY9 A;  3EG2 A;  3JAM E;  3JCM e;  4A4E A;  2EIF A;  2FZG B;  4M7A F;  4Z8A A;  1G5V A;  1E6G A;  3V8L A;  1X27 A;  1GCQ A;  2DTI A;  1AT1 B;  1H3H A;  3EHR A;  1GXI E;  1YIJ Q;  1JBM A;  5GAN 7;  2MYS A;  3JCM J;  4FT2 A;  4PFZ A;  3SHW A;  4HCB A;  3Q1J A;  2CT4 A;  2F5K A;  2P4R A;  2W0Z A;  3VS0 A;  5KE3 A;  3X26 B;  4FSX A;  4DBR A;  4EMK A;  1D0Z A;  1B34 A;  1MMD A;  3EG1 A;  1YP5 A;  4Z02 A;  1N8R U;  1D0X A;  4F7U E;  2J6K A;  3CCM T;  3P8D A;  3JCM c;  3X24 B;  2A0F B;  3DLL A;  4IUP A;  4A4F A;  2O9V A;  1FYN A;  2BZ8 A;  4IUU A;  1VQ4 Q;  4OMM A;  1B07 A;  3TEE A;  1OOT A;  4KUD K;  1NYG A;  2L5Q A;  1WX6 A;  1K0X A;  2K6D A;  1T3S A;  4ORZ A;  3EFR A;  2EKO A;  2XK0 A;  2LJ1 A;  1YJW Q;  3E2U A;  4PJO G;  3MJX A;  4M75 C;  2ABL A;  4ZGJ B;  5HK3 A;  3CCR Q;  1BYM A;  2ZPE B;  1VQ9 T;  2HQE A;  1PHT A;  1W1F A;  4C92 B;  2QQS A;  4LNP A;  4DBH A;  1O9S A;  3AT1 B;  2XDB A;  1SKU B;  1YI2 Q;  5I22 A;  2GFA A;  1VQP Q;  2JJ9 A;  3QHS A;  1KSW A;  5GAN 8;  1GL5 A;  1B7T A;  1QVF P;  3CD6 T;  2XD0 A;  2J7I A;  1YIT T;  1W6X A;  2CKK A;  3GP8 A;  4A4H A;  5LJ5 d;  2DRK A;  4J9I A;  2HKN A;  3V8J A;  3JB9 J;  2ATC B;  1IZ6 A;  5GMK l;  3SDZ A;  3QXE B;  4N4G A;  3RNJ A;  2QDY B;  5IHK A;  1OUL A;  1Q7Y C;  3P8B B;  3L2Q A;  2HEQ A;  2QEX T;  2CZ7 B;  1VQL Q;  1D1A A;  3I56 A;  3TRE A;  2KMT A;  3WXM B;  2ESW A;  3FEO A;  3CCQ Q;  1EIF A;  1NYF A;  3V7S A;  4ANJ A;  2X4X A;  4QVC A;  1PSE A;  1M1K C;  4DEY A;  1FX7 A;  2GTJ A;  5FU7 C;  3R6O A;  5GMK j;  3OS5 A;  3QPH A;  3H8Z A;  1HJD A;  4J8O A;  2L3Q A;  3M53 A;  5A2Q E;  4LUE A;  1M3A A;  1BU1 A;  4KBM B;  2HKQ B;  1MV0 B;  1QVP A;  2DM1 A;  4M78 F;  4IUT A;  4M75 E;  1WHJ A;  2DL8 A;  1JO8 A;  2NUP A;  2P0K A;  4J7F A;  2X9H A;  1QVF A;  3KBG A;  2KK4 A;  1VQM A;  3CMA T;  3FJ5 A;  2L89 A;  5FLX E;  2E65 A;  2ZAE A;  2R58 A;  1VQP T;  1X69 A;  2YDL A;  4HA8 A;  1AOJ A;  3HKS A;  4C92 C;  3JCM d;  1K8A C;  3VRY A;  2O01 E;  4KUL A;  1T0J A;  3C4S A;  4OB1 B;  5KYY A;  1KD1 C;  1RLP C;  2YLC A;  2L3P A;  4HT9 A;  4C0D B;  2M16 A;  4HXJ A;  1IRE B;  5LJ5 f;  3FJP A;  4M7D D;  2FVU A;  2DJQ A;  2OI3 A;  2RHX A;  3FLG A;  4L59 A;  5KYN A;  4MML A;  4DA4 A;  1Q86 U;  3A8G B;  4BE2 A;  1K8A R;  2ZPG B;  1YCS B;  3P8H A;  3H0F A;  1BIB A;  3OB9 A;  3QII A;  2HBP A;  2BE9 B;  3MEA A;  2YHT A;  4JLI A;  4ZGE B;  2K79 A;  3E19 A;  3JCM Q;  2E1H A;  4JS5 A;  1GBR A;  3R6N A;  1E7O A;  2LRQ A;  1KHI A;  2RHU A;  1BIA A;  3RUX A;  3EGD B;  1SPK A;  1KQS P;  1TUD A;  1YBY A;  2XHC A;  5GAN 5;  1PKS A;  3D7S B;  5FU6 B;  3CCU A;  3RIR A;  5KH6 A;  3C94 A;  1IXD A;  3M4Y A;  2XU8 A;  4OML A;  4C8Q B;  2GNC A;  3X20 B;  5CKF A;  2ZPF B;  3PGG A;  1K76 A;  2YWW A;  1K73 R;  3L2R A;  3ULR B;  2JVV A;  1TU0 B;  3G4S Q;  3QG1 A;  1M90 R;  4N0A A;  3RKW A;  4ZNX A;  4PLI A;  4EMK B;  4GLM A;  1AWX A;  2DD4 A;  4J9E A;  4CC7 A;  8ATC B;  3CCJ Q;  4C92 E;  1B34 B;  3URG A;  1MNE A;  2CP2 A;  2DK3 A;  2CP0 A;  3JRZ A;  1X75 C;  1V76 A;  1MHN A;  4XU1 A;  2ED1 A;  4F7U F;  4M77 A;  1HYO A;  3JB9 D;  3REA B;  3JCM f;  1Q82 C;  4M7A G;  2K3X A;  3TSZ A;  2EVR A;  4MMK A;  2RJD A;  2NUT B;  4KUI A;  3QZ5 B;  3G71 A;  3MO8 A;  1MMA A;  4FU6 A;  2RQU A;  4A4G A;  1WHL A;  4C0D C;  4FW2 A;  2FG0 A;  1VIE A;  3OS1 A;  3FRN A;  4OGC A;  2KEA A;  1S72 Q;  1U5S A;  2EPD A;  4AFU C;  1OYX A;  1K9M R;  1VQO Q;  3I56 Q;  3PIO A;  4MZT A;  2LX7 A;  3TSW A;  5GMK h;  4ELY C;  2B8A A;  3G6E A;  1ZLM A;  2VUB A;  2E5Q A;  1NM7 A;  3QKJ A;  1O75 A;  1G2B A;  4ATO A;  2KDS A;  1VQ7 A;  2X4W A;  2DZ9 A;  2EQJ A;  2YUP A;  2HD0 A;  4WF2 A;  1C6V X;  4C0F A;  4M7D G;  4LDU A;  2BTT A;  4E7I A;  3BW1 A;  4X9D A;  5FU6 C;  1W2B S;  3HRT A;  1Q81 C;  2GBQ A;  1GCQ C;  2KSS A;  2KXD A;  3X28 B;  1UGV A;  3M58 A;  1XJW B;  3OYY A;  1VQ5 T;  3OS2 A;  1UHC A;  2CZ6 B;  5D6W A;  4RCC A;  4D8D A;  1GBQ A;  3OBW A;  3RES A;  3ZL7 C;  1WHK A;  2E41 A;  2Y4X A;  4QQG A;  1IRX A;  2QA4 T;  2R5A A;  4EMK C;  2Y4Y A;  4HKE A;  1BKB A;  3CPW A;  3C95 A;  2QQR A;  5ECA A;  3HFO A;  2Z0W A;  2RK1 A;  3ZFJ A;  2PUK B;  4JUV A;  1BI3 A;  1GFC A;  4E6R A;  3SWN B;  2EJG A;  3VYG A;  2D9T A;  3ER0 A;  3PE0 A;  2LT4 A;  5GAO r;  1Q7Y U;  4OB0 B;  2FZK B;  1WXU A;  4PKC C;  1VYV A;  3VS2 A;  2OAU A;  1QP2 A;  1M1G A;  3EG3 A;  4FW1 A;  4JJB A;  2PVG B;  2HSP A;  2EWN A;  1M1K U;  4KT0 E;  1H92 A;  2E5K A;  1EZZ B;  2LQ8 A;  4F14 A;  1ZBJ A;  2A7Y A;  2K57 A;  2F69 A;  3CXC S;  1OI1 A;  1VQ9 A;  2FYK A;  5J39 A;  4BE0 A;  1AEY A;  2GQV A;  3FIF A;  1VA7 A;  2DXT A;  4MZM A;  2KY9 A;  5KYY B;  3JB9 G;  2ROL A;  4ME7 A;  2AT1 B;  4KRT A;  4A53 A;  4FYX B;  2VAS A;  1N5Z A;  1YWO A;  3H0H A;  4LDX A;  2RI3 A;  2X4Y A;  5HKC A;  5GMK m;  2JW4 A;  2XMF A;  2CT3 A;  2P0P A;  1QVG P;  1IGU A;  5CKB A;  3MP8 A;  5GAO q;  3OY9 A;  2CH4 A;  3FDR A;  1JEG A;  2VKN A;  1X6B A;  1M3C A;  2DMO A;  3CCL T;  2EQU A;  2QEX A;  1PM3 A;  2D0N A;  4XAX B;  1K8A U;  5KYW B;  1N27 A;  1KIK A;  1M8V A;  4KGZ B;  4CC4 B;  4M77 D;  4HCK A;  4E7H A;  3QYH B;  4EIK A;  2MIO A;  3OYD A;  1KD1 U;  4O6J A;  5AYF A;  4AFZ C;  5FRO A;  4N4I A;  4RTV A;  3S3O A;  1QWF A;  2AKK A;  4J83 A;  1AZG B;  3RKX A;  5CKH A;  2YLB A;  3SWN C;  1H64 1;  4JZ4 A;  3I55 Q;  1AVZ C;  4FCY A;  1P92 A;  1WJS A;  3TCJ A;  3JCM g;  3G71 Q;  4K11 A;  1ZSZ A;  5FWC A;  4EMH A;  1VQ8 T;  1NZ9 A;  2KQW A;  5IAY A;  3GOX A;  2W10 A;  4ZGD B;  1QVG A;  4NOY A;  1I81 A;  5GAO l;  1HK9 A;  4CC2 A;  3OYL A;  3OW2 S;  3H9N A;  5CKE A;  1YJN Q;  2DEQ A;  1BI2 A;  2HCK A;  3UAT A;  4J9D A;  4M75 D;  1VQ7 Q;  3EGU A;  2VXF A;  1UEB A;  2WSE E;  2RB6 A;  2CSQ A;  4HVU A;  3NTH A;  2HZY A;  1BCO A;  3DLM A;  1NLO C;  3EGX B;  3NGP A;  2DZC A;  4Z89 A;  1N8R R;  4B6M A;  4F7U G;  2E6N A;  2MPX C;  1QWE A;  4C5G A;  5A0D A;  4D8K A;  1Q82 U;  3L1A A;  4RG8 A;  2B86 A;  2C0T A;  2ZGW A;  3NFC A;  2MCN A;  1YJ9 A;  1VQK T;  4MDX A;  3OYB A;  4LDV A;  3CC7 A;  4E7L A;  2RQV A;  4JDS A;  4PL6 A;  4N0A C;  5GAM j;  1OZ3 A;  2C06 A;  1A0N B;  1ZA1 B;  2VYT A;  3CC2 T;  4OMO A;  4PJO B;  4DQ2 A;  4X9C A;  4HVV A;  3EGD A;  2HNI A;  3BY7 A;  4M77 C;  2LJ3 A;  1BBZ A;  1T3L A;  4AFS C;  2PVD B;  3MCA B;  1Q81 U;  1SSF A;  1I8F A;  4RTZ A;  2OTL T;  4C8Q A;  3RMS A;  3MEV A;  1PSF A;  3OYH A;  4FYY B;  1Y57 A;  3QUI A;  4XU3 A;  1XNI A;  1TH7 A;  2C0I A;  1YFN A;  2FPD A;  1X43 A;  5GAN j;  1U3O A;  2HQH A;  2K2M A;  4WCI A;  3HP9 A;  4II1 A;  4C92 D;  2A3L A;  2YUQ A;  3GLX A;  1W70 A;  2MK5 A;  3QDR B;  2GFU A;  2D8H A;  4XU2 A;  4JLG A;  4OGE A;  1VQN A;  2RH2 A;  1BI1 A;  1ZHI A;  2M9U A;  4OVA A;  1XOV A;  4R55 A;  4M7D F;  1Y71 A;  1JXO A;  4M75 G;  4JPB W;  1Z9Q A;  2MF2 A;  5GAO p;  1UGQ B;  2DA9 A;  3A8M B;  2NUT A;  1Y96 A;  4EMG A;  4P5N A;  1LNX A;  2EYQ A;  2DIG A;  1TUC A;  1QCO A;  2NLU A;  2CP5 A;  4RMO A;  2CP7 A;  4E7K A;  2KVQ G;  4M77 E;  1VQ5 A;  2RQT A;  2V1R A;  1PRM C;  2E6Z A;  2F2W A;  3EAE A;  2EJF A;  1M2O A;  4XTU A;  3VS5 A;  1JJ2 P;  1W4S A;  2RJC A;  3VS7 A;  3OYN A;  2KT1 A;  3S6W A;  3GIB A;  2QA4 A;  4XTX A;  4Y28 E;  3PIP A;  2KYM A;  1TXQ A;  1NBE B;  2CUB A;  4PFO A;  2M1H A;  4IUV A;  2CZ1 B;  2JTM A;  3CBP A;  1Q86 R;  1DJ7 B;  4A4K A;  4C0G A;  1ZQ1 A;  1YIJ T;  2IG0 A;  4J9B A;  1ZSZ B;  1KQ1 A;  5C6S A;  5A0G A;  2RHI A;  2OAW A;  2EQM A;  1PD0 A;  2DEU A;  3LGL A;  1UB4 A;  3NPF A;  4M78 A;  3HTR A;  5GMK e;  1FMW A;  2YSQ A;  3VU3 C;  2JNG A;  1MV3 A;  3PFS A;  4R0K A;  1IGQ A;  2OTJ Q;  4PJJ A;  4J9C A;  5CAI A;  3JB9 F;  3MEU A;  2XG8 D;  1ARK A;  3HSB A;  2PZ1 A;  4PJM A;  1VQ4 T;  1LOJ A;  3BE3 A;  1PC0 A;  3SWN A;  2QG9 B;  5CQY A;  1K4U S;  1SRL A;  5J3B A;  2EW3 A;  1WJQ A;  5I2S A;  1JJ2 A;  1PKT A;  1YJW T;  2MWP A;  2WSF E;  2JM9 A;  2K5L A;  2BIV A;  2DL7 A;  1YJ9 Q;  3UA6 A;  3CCR T;  1PD1 A;  1NJI C;  3CBM A;  1QCF A;  5GAM h;  4C92 G;  3CC7 Q;  4L5G A;  4C5E A;  3OMG A;  3CCE A;  1YI2 T;  5LJ3 j;  1K9A A;  3IQL A;  4JS4 A;  2DIL A;  1M1F A;  2DFU A;  2EYW A;  1QLY A;  4A54 A;  2K7A A;  2DD5 A;  2ROT A;  1WNL A;  2DER A;  4BI4 A;  2LMJ A;  4J6W A;  4NL2 A;  2EJ9 A;  4E47 A;  2P4T A;  3NMZ C;  4C8Q D;  2EYX A;  3CME A;  5A0L A;  2D1X A;  1WIE A;  1Y7X A;  3CCS A;  2V26 A;  1VQL T;  2DRM A;  1KC8 U;  5L23 A;  5KYX B;  5GAN h;  4M7A B;  4HVW A;  4X1V A;  3CCQ T;  4JJD A;  1YHQ A;  1FXX A;  1ZSZ C;  5I21 A;  3CCV A;  4Z88 A;  2H3J A;  5KCH A;  3OYG A;  1VQ8 A;  5KYW A;  2OTJ T;  2EKH A;  3X25 B;  3WVE B;  1D0Y A;  2X4J A;  3A8L B;  2A37 A;  2AKL A;  3PVL A;  1VQN Q;  1IHV A;  3JCM b;  3G7Z A;  4OMQ A;  2J05 A;  4F16 A;  1UDL A;  5CVI A;  3LWH A;  3EFO A;  3GBQ A;  2BKD N;  1NEB A;  5GAM f;  4Q5W A;  1NEG A;  4WTO B;  2JS2 A;  2QAZ A;  2CS7 A;  3FC3 A;  2YRD A;  1M2V A;  3U23 A;  1U1T A;  1I5L A;  2O4X B;  3E9G A;  2XID A;  3CC4 A;  4LN2 A;  4OMF B;  2VV5 A;  2PQW A;  1RAH B;  2M02 A;  4QQ6 A;  1CSK A;  4RTX A;  3KUF A;  4M4Z A;  1T0H A;  2L3S A;  1Q7Y R;  4AFQ C;  1RL2 A;  2RD1 A;  1QVF S;  3BFM A;  4NS5 A;  1Y96 B;  3EH1 A;  3HRU A;  2DJZ A;  1M30 A;  3MPU B;  3MKD A;  2L3R A;  5HK0 A;  3CPW P;  3L2V A;  3UT1 A;  1NE8 A;  3LLR A;  3JB9 H;  1VQK A;  3I5S A;  1M1K R;  1QW1 A;  2X35 A;  1PWT A;  1BK2 A;  2RPN A;  1F1B B;  2LT1 A;  4JRP A;  2EYY A;  4FL6 A;  3EGX A;  4DOV A;  4M77 F;  1OZ2 A;  2BE7 D;  5GAN 2;  2DBK A;  2DBM A;  5KCO A;  1U1S A;  2KT8 A;  3EHQ A;  4QVZ A;  3CC2 A;  1VQ6 A;  2QTV A;  1LPL A;  1YN8 A;  5IN1 A;  2EGC A;  4KH1 B;  1OX8 A;  2K3Y A;  5CIU A;  3OYA A;  2EFI A;  3I5R A;  4ELZ C;  1ZUU A;  4C8Q C;  3L2W A;  5I2M A;  1UJ0 A;  2VC8 A;  5J26 A;  3G4S T;  3GNF B;  1HSQ A;  4JJC A;  3M9Q A;  1JXM A;  1RAE B;  3PNW C;  3CCJ T;  4M78 B;  4A63 B;  1IO6 A; 
#chains in the Genus database with same CATH homology
 2ZPB B;  3CBO A;  4ZGD B;  3DLL A;  1QVG A;  4NOY A;  1I81 A;  4IUP A;  4A4F A;  3JCM h;  5GAO l;  3VKI A;  4BI3 A;  2JN0 A;  5LJ3 h;  4BUG A;  4IUU A;  1HK9 A;  3TEE A;  2D0Q B;  2RK2 A;  4GY5 A;  4KUD K;  2L5Q A;  2LTO A;  2RHY A;  3OYL A;  5CCA A;  2LC4 A;  3OW2 S;  4R56 A;  3T9N A;  3EFR A;  1WGS A;  2EKO A;  4PJO A;  2XK0 A;  5CKE A;  4JRK A;  3WVD B;  2E10 A;  2DEQ A;  1BI2 A;  2E70 A;  4Y91 A;  5GAO m;  3CCM A;  3DB4 A;  1W2B A;  4PJO G;  4M75 D;  2QTX A;  2VXF A;  1UEB A;  4M75 C;  4M75 F;  2K2V A;  2WSE E;  1KHC A;  4UC4 A;  4ZGJ B;  5HK3 A;  1BYM A;  2ZPE B;  2RB6 A;  1VQ9 T;  4TVR A;  2HQE A;  3NTH A;  4C92 B;  4JJN K;  2QQS A;  3UWN A;  2PUO B;  1O9S A;  3GF5 A;  2XDB A;  2VGM A;  3DLM A;  2GFA A;  4VUB A;  4XQ3 A;  3QHS A;  2DZC A;  2DXC A;  4F7U A;  3V7R A;  5GAN 8;  2LCC A;  1S72 T;  2CYZ B;  3HL8 A;  3QJY A;  1YJ9 T;  4BDY A;  3CD6 T;  2XD0 A;  4F7U G;  2E6N A;  1VQO T;  2DKG A;  1YIT T;  3I56 T;  2CKK A;  3HHT B;  3GP8 A;  4EDU A;  5A0D A;  4A4H A;  4C5G A;  5LJ5 d;  3CC7 T;  3QSU A;  4M7D B;  1Q82 U;  3V8J A;  1UGR B;  3JB9 J;  3L1A A;  3OYC A;  4RG8 A;  1IZ6 A;  5GMK l;  4X34 A;  3JCM X;  3SDZ A;  2JUF A;  2MMP A;  3QXE B;  2ZGW A;  4N4G A;  3OQ5 A;  3NFC A;  2GF7 A;  5DLQ E;  4C5H A;  2QDY B;  5GAN 3;  3OBY A;  1Q7Y C;  3P8B B;  3L2Q A;  4C8Q E;  1MGQ A;  1VQK T;  2K5F A;  1YJ9 A;  4MDX A;  5CQX A;  3QYG B;  2QEX T;  3OYB A;  1KQS S;  4B9X A;  3CD6 A;  2CZ7 B;  5FRN A;  1UGS B;  4LDV A;  5M9O A;  3I56 A;  1YIT A;  3TRE A;  3MP6 A;  3CC7 A;  4XTZ A;  4E7L A;  2DO3 A;  2KMT A;  3WXM B;  1JJ2 S;  4E7J A;  3FEO A;  1EIF A;  4FIB A;  1NJI U;  4JDS A;  1KQ2 A;  4PL6 A;  4GLK A;  3SD4 A;  3J80 E;  4L6V 5;  3V8K A;  4N0A C;  3V7S A;  3INZ A;  2X4X A;  2JOY A;  4QVC A;  5GAM j;  1PSE A;  3CXC A;  1M1K C;  1OZ3 A;  1RI0 A;  4FM4 B;  4LD6 A;  2C06 A;  1FX7 A;  5FU7 C;  5GMK j;  3R6O A;  2VYT A;  3OS5 A;  3QPH A;  3H8Z A;  4J8O A;  1YIJ A;  3CC2 T;  3M53 A;  5GAN f;  5CR2 A;  1JRI A;  5A2Q E;  3I55 A;  2XIC A;  5LJ3 f;  3KXT A;  4PJO B;  4KBM B;  4DQ2 A;  4M78 D;  4X9C A;  2MAM A;  1X6O A;  1QVP A;  2HNI A;  2LQK A;  3M57 A;  4M78 C;  1VIF A;  4M78 F;  4IUT A;  1R8O B;  3BY7 A;  4M75 E;  4M77 C;  4M78 B;  3GPL A;  1G3W A;  1N9S A;  5LL6 S;  1KQS A;  2PVD B;  4M7A C;  2JTF A;  2RI2 A;  3L2Z A;  2CZ0 B;  3MCA B;  2XDP A;  1UGP B;  1VUB A;  2P0K A;  4J7F A;  3OSV A;  5GAM g;  1SSF A;  2YRV A;  1I8F A;  1Q81 U;  2OTL T;  1QVF A;  4C8Q A;  2FB7 A;  2LNV A;  3KBG A;  4JRQ A;  3RMS A;  3MEV A;  1N6A A;  2KK4 A;  1VQM A;  1PSF A;  2DPP B;  3OYH A;  3CMA T;  2G3R A;  2MWO A;  2QI2 A;  4C8Q G;  3DKM A;  3QUI A;  4XU3 A;  4F7U B;  1LJO A;  1XNI A;  1TH7 A;  3OYF A;  1VQN T;  2L89 A;  5FLX E;  2E65 A;  5GAN j;  1G3Y A;  4NL3 A;  4BB7 A;  3HP9 A;  2R58 A;  3A5Z B;  4II1 A;  1YJN A;  1VQP T;  3HRS A;  2WSC E;  4C92 D;  1BI0 A;  2A3L A;  3E9F A;  3OYI A;  4J6Y A;  1YJW A;  4HA8 A;  2OTL A;  3HKS A;  4C92 C;  3JCM d;  4C92 F;  1K8A C;  2K5I A;  3GLX A;  5LJ3 d;  2O01 E;  3QDR B;  3CMA A;  2GFU A;  4ZTF A;  4XU2 A;  4KUL A;  4JLG A;  3C4S A;  4OB1 B;  4QW2 A;  2DXB A;  4OGE A;  1KD1 C;  1VQN A;  2RH2 A;  1BI1 A;  1ZHI A;  2YLC A;  4HT9 A;  4M75 A;  4C0D B;  2M9U A;  2F5T X;  2M16 A;  2R5M A;  1IRE B;  4OVA A;  3VV0 A;  3FJP A;  2IVW A;  2RM4 A;  5LJ5 f;  5DM7 R;  1YI2 A;  1K73 U;  4YTL A;  1VQP A;  1XOV A;  2FVU A;  4R55 A;  4DA4 A;  2RHX A;  1QP3 A;  1Y71 A;  3FLG A;  4L59 A;  4M75 G;  4MML A;  4M7D C;  1Q86 U;  4M7D F;  3LGF A;  3A8G B;  4J5Y A;  2MF2 A;  3SFM A;  2FHD A;  4BE2 A;  2AHJ B;  5GAO p;  1M90 U;  2ZPG B;  3J81 E;  1UGQ B;  5FRM A;  3A8M B;  2V8K A;  3P8H A;  1BIB A;  1Y96 A;  2JZ2 A;  2P0Q A;  3OB9 A;  3CPF A;  3QII A;  4EMG A;  2HBP A;  3CCU T;  2Y90 A;  3MEA A;  1M4Z A;  3S3M A;  3FB9 A;  4P5N A;  2GCX A;  2YHT A;  4JLI A;  1LNX A;  4ZGE B;  2EYQ A;  2DIG A;  3E19 A;  3JCM Q;  2E1H A;  4RG2 A;  4JS5 A;  3VYH B;  2NLU A;  2LRQ A;  3OYM A;  1KHI A;  2RHU A;  1BIA A;  4HCZ A;  4C5I A;  3MEW A;  4RMO A;  4M78 E;  1N8R C;  3RUX A;  4E7K A;  2KVQ G;  4M77 E;  1VQ5 A;  1YBY A;  2HAX A;  3UDC A;  2E6Z A;  4OB2 B;  5GAO n;  2XHC A;  3EAE A;  5GAN 5;  1VQL A;  4M7A E;  1NPP A;  3SB2 A;  2EJF A;  5LJ5 j;  2LDM A;  3GNG A;  4XTU A;  1W4S A;  2RJC A;  3OSS C;  5FU6 B;  3CCU A;  3A8O B;  3RIR A;  3S6W A;  3OYN A;  5KH6 A;  3OW2 A;  3GIB A;  3C94 A;  2QA4 A;  3M4Y A;  3CCQ A;  2XU8 A;  4XTX A;  4C8Q B;  4Y28 E;  1JB0 E;  3PIP A;  2I2L A;  3X20 B;  4BI8 B;  5CKF A;  4J7I A;  4PJO D;  2ZPF B;  3PGG A;  2EAY A;  4PJO F;  3L2R A;  2M1H A;  3NTK A;  2CZ1 B;  4IUV A;  2JVV A;  2JTM A;  3CBP A;  1M9S A;  1H3Z A;  2QQ9 A;  1DJ7 B;  3QG1 A;  2V8J A;  4A4K A;  4N0A A;  4XTV A;  3RKW A;  4C0G A;  4PLI A;  1D3B A;  1ZQ1 A;  2IG0 A;  4EMK B;  2DD4 A;  4PNO A;  4EPC A;  4ZN1 A;  5LJ5 g;  1YIJ T;  3OS0 A;  4C92 E;  1B34 B;  1KQ1 A;  3URG A;  5C6S A;  3I55 T;  2DK3 A;  3E1S A;  3M5A A;  5HY6 A;  2RHI A;  3QO3 A;  5A0G A;  1K9M U;  1M5Q 1;  3JRZ A;  4QQD A;  3JCM P;  1X75 C;  1WQ7 A;  2PU9 B;  4LDY A;  1MHN A;  4XU1 A;  5GAM e;  2EQM A;  4BE1 A;  3G71 T;  3V7C A;  3LGL A;  1UB4 A;  3PT9 A;  4M78 A;  4F7U F;  5GMK e;  1Y07 A;  4RKU E;  4M77 A;  3VU3 C;  4FT4 A;  2JNG A;  3PFS A;  4M7A A;  4M78 G;  3JB9 D;  4M7D E;  4M77 G;  3O8V A;  1I4K 1;  2ZCF B;  3JCM f;  5CAI A;  4LD9 K;  1VQM T;  3MEU A;  3JB9 F;  2XG8 D;  3LW5 E;  1Q82 C;  2QQA A;  3A8H B;  4M7A G;  3HSB A;  3AHU A;  2K3X A;  1VQ4 T;  2E12 A;  1LOJ A;  3QZ9 B;  4MMK A;  2RJD A;  2PVO B;  3SWN A;  4CI0 C;  4KUI A;  3QZ5 B;  4IUR A;  3G71 A;  3J7A F;  4OP0 A;  3MO8 A;  4MZP A;  1G3T A;  5CQY A;  3CCE T;  3BDU A;  5J3B A;  1WJQ A;  4FU6 A;  5I2S A;  1YJN T;  4A4G A;  1JJ2 A;  4C0D C;  2DTH A;  1YJW T;  2MWP A;  1VIE A;  3MHX A;  3OS1 A;  3NTI A;  2WSF E;  1VQ7 T;  2DTO A;  3FRN A;  2K5L A;  2KAF A;  4OGC A;  2BIV A;  4C92 A;  1AHJ B;  2BUD A;  1VQ4 A;  3CCR T;  1NJI C;  1OYX A;  3CBM A;  4DOW A;  3PIO A;  1G3S A;  1HXD A;  3BDL A;  4MZT A;  2QXF A;  4OF1 A;  4C92 G;  2MI6 A;  5GAN e;  4L5G A;  3H6Z A;  3QJ6 A;  5GAM h;  4C5E A;  2ZPH B;  3OMG A;  5GMK h;  3OA6 A;  3CCE A;  4ELY C;  2B8A A;  3DB3 A;  4ZN3 A;  3G6E A;  1YI2 T;  2VUB A;  5LJ3 j;  2E5Q A;  1QVG S;  3ZBD A;  3QKJ A;  1O75 A;  5D6X A;  4V2S A;  3S3N A;  4JS4 A;  4IKF A;  4OB3 B;  3HPW A;  3CME T;  3HFN A;  3OYJ A;  4ATO A;  1M1F A;  4PLL A;  2KDS A;  4M7D A;  4A54 A;  3CPW S;  1VQ7 A;  3LH0 A;  3PMT A;  3CCS T;  2X4W A;  2DZ9 A;  2EQJ A;  2DD5 A;  2HD0 A;  1WPY A;  4WF2 A;  3CCR A;  1WNL A;  2R57 A;  2O4X A;  4C0F A;  4BI4 A;  4M7D G;  4LDU A;  2RJE A;  4BY6 B;  4E7I A;  2DAQ A;  4J6W A;  3BW1 A;  4NL2 A;  4QVD A;  4M7D D;  4X9D A;  2VXE A;  5FU6 C;  2EJ9 A;  4E47 A;  2P4T A;  4B9W A;  5FU7 B;  5GAN 6;  1YHQ T;  4C8Q D;  1W2B S;  4HCC A;  3HRT A;  1Q81 C;  5GAN g;  4MDW A;  2KSS A;  4C8Q F;  1N9R A;  3CCV T;  3PTA A;  3X28 B;  4XTY A;  5LJ3 g;  4XU0 A;  3CME A;  5A0L A;  3M58 A;  1VQ5 T;  3M54 A;  3OYY A;  3OS2 A;  1Y7X A;  2CZ6 B;  3JSC A;  5D6W A;  3CCS A;  4RCC A;  1VQL T;  2XDD A;  1KC8 U;  3OBW A;  3RES A;  4HT8 A;  4M77 B;  2E41 A;  2Y4X A;  4QQG A;  5GAN h;  2QA4 T;  4M7A B;  2R5A A;  3CCQ T;  2RA2 A;  4EMK C;  2Y4Y A;  1YHQ A;  4HKE A;  1BKB A;  1FXX A;  3CPW A;  3C95 A;  2QQR A;  3HFO A;  3L42 A;  3M4G A;  2RK1 A;  3ZFJ A;  4C0Z A;  5I21 A;  3CCV A;  2PUK B;  4JUV A;  2H3J A;  5KCH A;  3OYG A;  3G4S A;  2RHZ A;  2ZPI B;  1BI3 A;  3L2U A;  1VQ8 A;  3SWN B;  5LJ5 e;  2OTJ T;  2EJG A;  1V29 B;  3ME9 A;  2D9T A;  3ER0 A;  3VYG A;  2XI9 A;  3X25 B;  3CCJ A;  3WVE B;  2LT4 A;  5GAO r;  1Q7Y U;  2DIQ A;  2X4J A;  4OB0 B;  4LDW A;  5C0M A;  5DLO A;  3JB9 I;  3A8L B;  3MET A;  5GAN 4;  4PKC C;  3QBY A;  4N4H A;  1K73 C;  4J6X A;  1X01 A;  2OAU A;  1FWZ A;  1QP2 A;  3RER A;  1M1G A;  2XKO C;  4PJO C;  1Q86 C;  5KE2 A;  2LX9 A;  5D6Y A;  2RJF A;  4XTW A;  3ZEH A;  3MP1 A;  3JCM b;  2PVG B;  3CC4 T;  1M90 C;  3G7Z A;  4JRI A;  2OTJ A;  3UPU A;  3JCM W;  1KC8 C;  2LVM A;  2EWN A;  5CVI A;  1M1K U;  4KT0 E;  3LWH A;  1ZBX A;  5GMK i;  2L8D A;  2LQ8 A;  4ZTJ A;  1U8R A;  2A7Y A;  2BKD N;  2K57 A;  1KG1 A;  2F69 A;  3F70 A;  5GAM f;  5EG2 A;  3CXC S;  1OI1 A;  4Q5W A;  1VQ9 A;  2LCL A;  2FYK A;  4D6W A;  5J39 A;  4BE0 A;  3N5B B;  2FL7 A;  2CS7 A;  3FC3 A;  2GQV A;  3FIF A;  2DXT A;  4MZM A;  5CKD A;  1U1T A;  1I5L A;  2KY9 A;  2O4X B;  2RO0 A;  3E9G A;  3M56 A;  5IT9 E;  2XID A;  3JB9 G;  3CC4 A;  5LJ5 h;  4ME7 A;  2V8I A;  4OMF B;  2VV5 A;  1XQH A;  1XTD A;  2PQW A;  4QQ6 A;  4A53 A;  4M75 B;  3RMQ A;  1NPR A;  1S72 A;  2VGN A;  3ASK A;  3KUF A;  2RI5 A;  2D6F A;  4LDX A;  2RI3 A;  2X4Y A;  2DVE A;  5HKC A;  5GMK m;  1VQO A;  1RL2 A;  5CO7 A;  3OYE A;  3LWI A;  2RD1 A;  3VUB A;  3CEY A;  4CRI A;  2P0P A;  3BFM A;  3M59 A;  4NS5 A;  5CKB A;  1QVF S;  1Y96 B;  3HRU A;  3MP8 A;  2DJZ A;  4BDZ A;  1YCY A;  5GAO q;  3OY9 A;  2L3R A;  2M0O A;  1WQW A;  3EFS A;  3FDR A;  3PMI A;  4BY6 C;  3UT1 A;  5HK0 A;  3L2V A;  3M55 A;  3G6E T;  1NE8 A;  2ZZD A;  3LLR A;  3JB9 H;  5L8R E;  3TU4 K;  3CCL T;  1VQK A;  4RCB A;  2EQU A;  2QQB A;  1QW1 A;  2QEX A;  2X35 A;  5GAM d;  4BD3 A;  1VQ6 T;  4XAX B;  1K8A U;  2WAC A;  3JCM V;  1K9M C;  1N27 A;  2LT1 A;  1M8V A;  4JRP A;  4M77 D;  4E7H A;  5DY9 A;  3QYH B;  4IUQ A;  3JCM e;  3JAM E;  3OYD A;  4FL6 A;  4A4E A;  1KD1 U;  4DOV A;  5LJ3 e;  4M77 F;  1OZ2 A;  3OYK A;  4M7A D;  5GAN 2;  2EIF A;  4O6J A;  2EQK A;  4XK8 E;  5AYF A;  5KCO A;  4M7A F;  5FRO A;  4N4I A;  3C12 A;  1G5V A;  1U1S A;  3S3O A;  3CCL A;  4PJO E;  2HQX A;  3V8L A;  3LX7 A;  2DTI A;  4QVZ A;  5CK9 A;  3CC2 A;  2K4Y A;  4J83 A;  1VQ6 A;  1GXI E;  3RKX A;  5CKH A;  1WJR A;  5IN1 A;  3OMC A;  2YLB A;  1JBM A;  3SWN C;  5GAN 7;  4BAC A;  1H64 1;  2CGH A;  3JCM J;  3RKY A;  2K3Y A;  4O5V A;  4FT2 A;  1D3B B;  4HCB A;  1P92 A;  3Q1J A;  2F5K A;  2E64 A;  3LYI A;  5CIU A;  1WJS A;  2EFI A;  5KE3 A;  3X26 B;  4FSX A;  3OYA A;  2DXU A;  3TCJ A;  3VJP A;  4ELZ C;  4C8Q C;  3JCM g;  4EMK A;  3L2W A;  5I2M A;  2VC8 A;  5J26 A;  3G4S T;  3GNF B;  1B34 A;  1VQ8 T;  4EMH A;  3VUZ A;  5GAN d;  4Z02 A;  1N8R U;  3M9Q A;  1NZ9 A;  4F7U E;  3CCM T;  3P8D A;  3PNW C;  3JCM c;  2KQW A;  5IAY A;  3X24 B;  3GOX A;  3CCJ T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...