1XNIA

Tandem tudor domain of 53bp1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
118
structure length
118
Chain Sequence
SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tumor suppressor p53-binding protein 1
publication title Methylated lysine 79 of histone H3 targets 53BP1 to DNA double-strand breaks
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 24
structure length 118
sequence length 118
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2004-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1xniA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1xniA01
2HQXA 3CMEA 4N4HA 4LD6A 2RHUA 1YHQT 1EIFA 2D9TA 3LH0A 4BD3A 1Q86C 1KHIA 1Q81C 1VQMA 4E7LA 3CMET 5FLXE 3F70A 3E9GA 3CCQA 1VQ4A 2P0KA 1NPRA 3DB4A 2K3YA 1RL2A 2CKKA 2EIFA 1VQMT 3META 1N8RU 1WGSA 3OYEA 2BKDN 2JOYA 3CXCA 3CC7T 1YIJA 1VQ4T 1UEBA 3CCUA 4BDZA 1M90C 1QVFS 2B8AA 2R58A 3L2UA 4PLIA 4Q5WA 1JJ2S 5DLQE 1YIJT 3OQ5A 3CCJA 3CCUT 3NTIA 3GOXA 3Q1JA 4QQ6A 5LL6S 3CCRA 1KHCA 3KUFA 3CCJT 3UWNA 3OB9A 4BACA 3CCEA 2QQSA 1VQNA 4BE1A 3CCRT 2E6ZA 3ME9A 1VQPA 1WJRA 4FL6A 1WJSA 3TREA 2E6NA 4IUPA 4N4IA 1VQNT 3FDRA 4PLLA 5J3BA 3KBGA 2G3RA 3PMTA 1S72T 1VQPT 1Q82U 3E9FA 1K9MC 5J39A 1M1KC 4IUUA 3OYLA 2JZ2A 1YJWT 4A4HA 4C5IA 4BDYA 2WACA 2XK0A 3PIOA 4OVAA 3CD6A 1K73C 3CCSA 2XHCA 1BKBA 1VQ7A 5HY6A 3FEOA 1KQSA 4HCZA 2L8DA 2M16A 3CMAT 4E7JA 3OYIA 3DLMA 2LQ8A 3CD6T 4PL6A 1Q86U 1Q81U 2RHZA 1VQ7T 3OS1A 3CPFA 2E5QA 3J7AF 3BDLA 1YJ9T 3L2RA 2JNGA 3MP8A 2GFUA 3S3OA 3L2WA 2RHYA 2HQEA 1OZ3A 3P8HA 3LLRA 2RHXA 4ZN1A 1W2BA 2X4XA 4ZTFA 4RG2A 1M1GA 3CXCS 3OW2A 5KH6A 4TVRA 3L2VA 1VQLA 2K3XA 2RJCA 3M9QA 2X4WA 2MWPA 3G71A 3DLLA 3OS2A 4IURA 3P8BB 1VQLT 3OYBA 2RJFA 3G71T 2OTJA 4QW2A 3CCLA 2IG0A 1Q7YC 5KE3A 4C5EA 4ZTJA 3CPWA 1K8AC 2KDSA 4IUQA 2FHDA 3OMCA 5D6YA 5M9OA 3CCVA 3MEVA 3CCQT 5A2QE 3J80E 3CCLT 3OYCA 3SD4A 1NPPA 2RI2A 3MP6A 2M1HA 3ZEHA 5FRMA 1VQKA 2RI3A 5IAYA 3EAEA 4QQDA 2O4XB 1NJIU 1VQKT 2BIVA 4E7KA 2RJEA 2DIGA 3OS0A 1OI1A 3I56A 3JAME 1KQSS 1X6OA 3G4SA 2NLUA 3CCET 2EFIA 2RHIA 1VQ9A 2QA4A 1VQ6A 5FROA 3A5ZB 4YTLA 1H3ZA 3G4ST 3OYKA 2MI6A 1VQOA 5KCOA 3CC4A 1VQ6T 2LCCA 2F5KA 2R5MA 3UT1A 1W2BS 3NTKA 1VQOT 5DM7R 3H8ZA 3OW2S 4N4GA 2GF7A 3CC4T 5IN1A 4L59A 4B9XA 3L42A 1KD1C 3MP1A 3C4SA 4BE2A 2OTLA 3ASKA 1KC8C 1N27A 3CCST 4IUTA 5KE2A 2VYTA 2LDMA 1VQ5A 3DB3A 3CC2A 2MWOA 5J26A 1QVGA 3L2QA 2OTLT 1XNIA 3S6WA 3OYGA 3QJ6A 4QVZA 3CPWS 1RI0A 3CC2T 3PMIA 2JUFA 1OZ2A 2DO3A 1YJNA 3CEYA 3P8DA 3HKSA 2R5AA 3OYDA 1M90U 2BUDA 4C5GA 3S3NA 2X35A 2EQJA 2X4YA 5CIUA 5D6WA 2DIQA 3NTHA 2KVQG 1YBYA 2JTFA 3PIPA 4B9WA 4BE0A 3I55A 2XDPA 3G6EA 2E70A 4FU6A 2OTJT 4GY5A 3I55T 3G6ET 3LYIA 3OYFA 4CRIA 3CC7A 3OYYA 3CCVT 3PFSA 2EQUA 4ZN3A 1K9MU 3CCMA 1M1KU 2GFAA 4X34A 1XTDA 2RO0A 4Z02A 1K73U 3CCMT 4A4FA 2DAQA 3H6ZA 4A4GA 4UC4A 1KD1U 2RJDA 3OYAA 1KC8U 3I56T 3OYMA 5FRNA 1YITA 1VQ8A 3MEUA 2EQMA 3LX7A 4QQGA 4E7HA 2L89A 1QVGS 1VQ9T 2QA4T 3QIIA 1N8RC 2LCLA 5IT9E 2QQRA 1S72A 3QBYA 3S3MA 1YITT 1WJQA 1VQ8T 1QVFA 3ER0A 1JJ2A 1SSFA 2PQWA 3QKJA 2M0OA 2JVVA 2L3RA 1YJWA 1G5VA 5C0MA 3LGFA 2LVMA 3O8VA 3FLGA 3FC3A 3MEAA 3CMAA 2EQKA 2LRQA 3OA6A 4II1A 1YI2A 3MEWA 2O4XA 1NJIC 1Q7YU 5D6XA 3OYNA 1K8AU 1OYXA 1YJ9A 1VQ5T 3OYJA 1YI2T 4C5HA 1IZ6A 1NZ9A 5KCHA 2R57A 3PNWC 3MO8A 1Q82C 4E7IA 1MHNA 4IKFA 3J81E 2EKOA 3OYHA 1YJNT 4NS5A 2QEXA 4EDUA 2RI5A 3LGLA 4IUVA 4A4EA 2YRVA 2LTOA 3OMGA 3OY9A 1YHQA 5C6SA 2QEXT
chains in the Genus database with same CATH superfamily
5IH2A 2FRYA 2HQXA 2RK2A 4LD6A 3INZA 3JSCA 3I55Q 4BI4A 2JJ9A 1EIFA 1RADB 3LW5E 1Q86C 1NEGA 3CMET 1Y0MA 3VUZA 3E9GA 1JU5C 3CCQA 2XIDA 1RLPC 4D6WA 4RTVA 3VRZA 1GBQA 5ECAA 4ORZA 2QAZA 1VQMT 1N8RU 3G7ZA 5LJ3h 2W0ZA 2DVJA 1UEBA 1VQ4T 2K6DA 4M7DE 3CCUQ 1M90C 4E2FB 1NJIR 4RTZA 4A54A 2R58A 4X9CA 2ECZA 4OMFB 3UA6A 3L2UA 1JJ2S 2HD0A 4LDYA 5DLQE 1PWTA 1SRMA 3CCJA 1BIBA 5LJ3g 2DTIA 4C8QG 3OBYA 1Z9ZA 2CSQA 4J9FA 1TH7A 2HNIA 4BACA 1PD0A 2M0YA 1VQNA 3JCMJ 4P5NA 5CO7A 3NFCA 2O01E 5CVIA 2NUTA 1S72Q 2RB6A 3QZ9B 5L23A 8AT1B 4M75B 5GANf 5IHIA 1Y96A 3KBGA 4O6JA 2BTTA 2DILA 3IQLA 3C95A 3E9FA 1M1KC 4RTTA 2DXUA 5LJ3d 2JZ2A 5GAN5 4F7UA 1YJWT 4A4HA 3VUBA 5CKHA 4OVAA 4HCZA 3VV0A 1K73C 2V1QA 1VYUA 1D1AA 4LUEA 4XTYA 1BYMA 3RESA 1M8VA 3JB9I 1YJ9Q 3DLMA 2DPPB 2F2VA 3CD6T 4PL6A 1Q86U 1VQ7T 3JCMb 2DF6A 3CPFA 1M90R 3J7AF 3BDLA 3QWYA 3QYHB 2GFUA 3V7SA 2RHYA 4JPBW 4O5VA 3PTAA 2PZ1A 1UGQB 2ZPBB 4M75F 2QEXQ 1VIFA 1T0HA 1SHGA 4F17A 1W2BA 2FVUA 5KH6A 9ATCB 1IGUA 1UJYA 3L2VA 4DOWA 1VQLA 2QTXA 4OF1A 4OP0A 3M9QA 2X4WA 1EZZB 2EGAA 1G83A 1RUWA 1X69A 5CKDA 2DXTA 3VS0A 2CUDA 4OB3B 1HSQA 2HZYA 3G71T 2OTJA 2EBPA 4QW2A 1X01A 5IHNA 4AG1C 5KE3A 2E1HA 1PD1A 1M1KR 4GLKA 4DEXA 4DOVA 1IXDA 3R6OA 5LJ3f 3J80E 1YIJQ 1UHCA 3SD4A 1NPPA 2JMAA 2ENMA 3PT9A 1ZUUA 2AKLA 1K73R 4Z88A 4PFPA 4OMNA 3ZEHA 1VQKA 5KYXA 2RI3A 4EPCA 2P4TA 4L6V5 3CCRQ 2RMOA 1NYFA 5FU6B 2K2MA 4M78A 3A8GB 3H9NA 3JB9J 1OULA 5FU7C 3QSUA 3EH2A 1ZSGA 2OI3A 3I56A 4XU0A 1KQSS 2DTHA 2O9SA 1VQPQ 3M0TA 3E1SA 2NLUA 3CCET 5EC7A 1MUZA 1VQ9A 2QA4A 3M55A 1VQ6A 4EMKA 1H3ZA 2XMFA 2W10A 3G4ST 4OB2B 3TSWA 3OYKA 2VUBA 1M3BA 2D8JA 5A0LA 1BB9A 3CC4A 1TUDA 2R5MA 3UT1A 1PRLC 2OAUA 2X4JA 1VQOT 4N4GA 3OW2S 2J6OA 5CKEA 2GF7A 3CCSQ 4ZNXA 2PUKB 3X24B 5FWBA 3TCJA 5DY9A 4PJLA 4LE9A 1TG0A 2F5TX 3C4SA 1KC8C 2OTLQ 2A36A 3LWIA 4M78C 5GMKj 2LDMA 3CC2A 4OGEA 4M75E 1Y07A 5J26A 1V1CA 3X20B 3JCMe 3L1AA 3L2QA 3M59A 2YUOA 4DBQA 3TSZA 4QVZA 4XTVA 2O9VA 1N9RA 2D8HA 4FT2A 1KJWA 1YJNA 3CEYA 4EMKC 4FT4A 2JM9A 1WHJA 2EWNA 3JCMQ 4C92G 2X4YA 5CIUA 2JTMA 3L2ZA 2WSFE 2GBQA 2RQUA 2JTFA 1TTHB 2EGEA 4B9WA 2ZPEB 4V2SA 3I55A 5LJ5j 3RDVA 5GAOr 3GNGA 4XQ3A 2Y4YA 4HT8A 1YN8A 2DETA 3CCVQ 1QW1A 4KT0E 4ZGJB 5LJ5e 1Y96B 2IPOB 2QDYB 2DERA 3VU3C 4RCBA 2J06A 4ZN3A 1TOVA 1K9MU 2B86A 4QVCA 2DL5A 3WXMB 1KC8R 4GBQA 4M78D 2I2LA 4RTYA 2LP5A 1T3LA 4C8QA 4OMPA 3WVDB 2RO0A 1B34A 2LZ6B 4Z02A 4KRTA 3CCMT 1QMCA 3M58A 1D0ZA 4A4GA 2EW3A 2RJDA 1I07A 1KC8U 2CGHA 2VC8A 4MZMA 2VKNA 2CS7A 5FRNA 2E10A 3LX7A 4QQGA 4M77G 1QVGS 1F1BB 3M57A 2YLBA 4VUBA 1S72A 3GNFB 2AZVA 2SRCA 4CC4B 2RQRA 1QCNA 2CP0A 1BI1A 3ER0A 5GAMh 1SSFA 1I0CA 1V76A 2PQWA 2FO0A 4E6RA 3QPHA 3ZBDA 1M27C 1G5VA 5FU7B 7AT1B 4HCKA 4J9IA 3FLGA 1I5OB 4C8QC 1KK7A 2VGMA 5GAMg 4BUGA 4F14A 4MMKA 2NUPA 2XKOC 1HXDA 1RACB 2ROTA 1M4ZA 2O4XA 3KFVA 1DJ7B 2H8HA 2BZYA 1OYXA 1YJ9A 1BI0A 1VQ5T 1ABOA 3OYJA 2L5QA 4OMMA 2GGRA 1U1SA 1WNLA 1T0JA 3I35A 1NZ9A 2ABLA 2V8IA 2V8KA 4ELYC 2HL3A 3PNWC 1NYGA 2JN0A 3MO8A 4F16A 1YP5A 3UPUA 4R0KA 2QEXA 4EDUA 2LT1A 2QGGA 1GCQA 3I5SA 5GAMd 1FWZA 2A08A 3URGA 5C6SA 2D6FA 4PJOA 1AWWA 1ZA1B 3UATA 2QGFB 1GFDA 4N4HA 1MGQA 2MIOA 1TUCA 2KR3A 3ZL7C 3SDZA 4JDSA 3TEEA 1YHQT 3LH0A 2K2VA 1KHIA 1Q81C 1N5ZA 3M0RA 2FZGB 2MF2A 4M4ZA 3ULRB 1RLQC 2RQVA 2P0KA 2K3YA 2FZCB 1AZGB 1RL2A 2CKKA 4KGXB 3PVLA 4C8QD 3META 1QKWA 2KY9A 3OYEA 1JO8A 1GL5A 3CXCA 3CC7T 1YIJA 4RTWA 2YDLA 4OMLA 1LVKA 2C0OA 1O75A 2L3QA 4PLIA 2K5IA 1TWBA 2P4RA 2AT1B 1H8KA 3E2UA 3GBQA 2GNCA 2DKGA 1LOJA 2ZPHB 1UFFA 1X2QA 1GCQC 3CBMA 3REAB 4C0DB 2VXFA 3CCRA 2EJ9A 2CP3A 5KYYB 3CCJT 2FRWA 3DKMA 3OB9A 1YITQ 1PKSA 1VQ8Q 1D09B 2PUOB 1N9SA 4GLMA 4M7DG 3ME9A 4ME7A 1VQPA 4RG8A 2HBWA 2K57A 3TREA 1M2VA 3H41A 2E3IA 4C0ZA 1VQNT 5GAMf 3FDRA 4PLLA 1XQHA 2DK3A 2G3RA 1G8XA 3TVTA 4L5GA 1YJWQ 1IRXA 1BI3A 1UGVA 2LJ3A 5J39A 2QI2A 1MMNA 4IUUA 4FYWB 2KXDA 3EFOA 2WACA 2XK0A 3CCSA 2XHCA 3NHNA 2L8DA 3BFMA 2M02A 3CMAT 1G3TA 3BDUA 2Y4XA 1EX4A 1YCSB 2QQAA 2LQ8A 1Q81U 2PTKA 2CUBA 3VS2A 1VIEA 1EFNA 4J5YA 5KYUB 3MP8A 3S3OA 4Y28E 4RTUA 2O31A 2LJ0A 4J83A 2WSEE 3T9NA 1WXTA 1ZBXA 4XK8E 5GANj 2DMOA 4C92A 1OZ3A 3P8HA 3LLRA 4JZ4A 4PJOD 2RHXA 3HRUA 1M1FA 1M1GA 4TVRA 4ZGDB 1TUGB 1SG5A 2JS2A 2CP7A 2MWPA 3OS2A 3GPLA 4RCCA 2LCSA 2RM4A 4IURA 5GAN7 1M3AA 1VQLT 2KMTA 2EJGA 4AFQC 1WHKA 1Q95G 2IG0A 4MZPA 1H3HA 1MV0B 2AK5A 1FMKA 4R56A 1K8AC 3G1JA 1M9SA 2A7YA 2FHDA 4PJNA 1Z9QA 3OMCA 5M9OA 4DBHA 3CCVA 3A8OB 5FWCA 2CP6A 2L3SA 2RI2A 2DEQA 2M1HA 4M7AA 4NL3A 1JB0E 3V8JA 4AFUC 4QT7A 1WHMA 4C92C 5GAOm 1KD1R 2EKHA 4A4KA 5GAN3 3MHXA 2HQHA 3RNJA 1U5SA 4AT1B 1ZQ1A 2NUPB 5GAOp 1QVPA 2O4XB 1NJIU 2BIVA 1VQKT 3CCEQ 2EGCA 3OS0A 2ED1A 2X3WD 2RHIA 4JRQA 3M54A 3HRSA 4YTLA 2CZ7B 1X6GA 3TQ7P 4J9GA 2KE9A 4JZ3A 5LJ3j 3QWXX 2KI7A 1ZSZA 4XU1A 3H0HA 1VQ6T 2HKNA 2F5KA 2KT8A 1QVGP 2E64A 1RABB 5GMKi 4R55A 3NTKA 4M7AC 2KNBB 5DM7R 5LJ3e 4PJOB 1KG1A 1JRIA 3CC4T 2JT4A 1K8AR 4L59A 3KXTA 1M3CA 2NWMA 4JRIA 2K3BA 1QWFA 1N27A 4IUTA 1HYOA 5KE2A 4J7IA 2VYTA 4KULA 2E41A 5GAOl 2DZCA 3M5AA 3RMSA 4C92D 2CP2A 2COZA 1SSHA 1XNIA 5I11A 3OYGA 4E47A 3C0CA 2DL7A 2LNHB 4J9EA 1E7OA 2FL7A 3CPWS 1RI0A 3CC2T 1AHJB 1FMWA 2XICA 2YSQA 3UDCA 1C1AA 4RTXA 2K9GA 3H0IA 2JUFA 1NM7A 2DO3A 4WCIA 1M90U 1I8FA 1IREB 4C5GA 4KGZB 4DBRA 3HRTA 2X35A 1ZSZC 4J6WA 1BCOA 5D6WA 1RAAB 2DIQA 4MMLA 1KQ1A 2MPXC 1NG2A 4M75G 4PJOF 2PU9B 1QLYA 5CR2A 1H92A 2P0QA 1AT1B 5IHKA 1KFZA 2LT4A 4BE0A 3D7SB 1G3WA 4HKEA 3CCLQ 1ZA2B 2KYBA 2M9UA 3EGUA 2DXBA 1MMGA 3EGDA 4HVVA 3EG9B 4M7AD 3QDFA 1NLOC 3I55T 2D0QB 3LYIA 2FPEA 4CRIA 2BZ8A 1BIAA 2QG9B 2Z0WA 1JXOA 1D3BA 3OSSC 2A37A 1M1KU 1BK2A 2GFAA 4X34A 1R0CB 3RKYA 1WX6A 1K73U 4WF2A 2VWFA 1B7TA 1R0BG 4A4FA 5AYFA 2RN8A 3EGXA 4UC4A 1K0XA 2AIRB 4M7DA 1WYXA 3CBOA 5GJVB 1WPYA 2DE0X 2YUPA 3OYMA 1YITA 1VQ8A 2DX1A 2RPNA 4E7HA 4ZGEB 4KH1B 2DRKA 2IVWA 2E5KA 3RERA 1KSWA 2XDDA 3QBYA 3S3MA 1U1TA 5HKCA 1ZUKA 2A3LA 2I0NA 1E6HA 1JJ2A 1U8RA 4JUVA 3QKJA 2M0OA 2Y90A 2L3RA 1YJWA 4JLGA 5C0MA 2MYSA 4XTWA 4F04B 1RAFB 3FC3A 5FW9A 5I2MA 3V7CA 1K0SA 1VQ5Q 4NL2A 2CH4W 5D6XA 3OYNA 2RQWA 2COYA 1W2BP 4M7DC 2DYIA 5GMKe 2FB7A 3JB9D 2YT6A 4C5HA 2F1LA 3JV3A 3JCMd 5HK0A 2XDBA 3M0QA 1W6XA 1OQKA 4XTUA 4M7AB 4C92F 3X25B 1MHNA 4IKFA 1NE8A 3J81E 4PJOE 5GAOn 3VS7A 1OOTA 3VKIA 1BBZA 4JJNK 3UA7A 4IUVA 4A4EA 2YRVA 2LTOA 3R6NA 3OMGA 2QEXT 2RQTA 1FMVA 3EG2A 4Y91A 3AHUA 1WHLA 2RHUA 3G6EQ 2QQBA 4MDWA 1PSEA 2KAFA 2NUTB 2D9TA 2ZZDA 4BD3A 2XD0A 2ZPIB 2KRNA 2KROA 1LNXA 2RF0A 2BE9B 3CC7Q 1D0XA 3DB4A 2LQWA 2JS0A 1WGSA 2BKDN 2JOYA 4F7UB 3CCUA 4M7AF 3EFSA 1I4K1 1IO6A 4BDZA 2ZCFB 1QVFS 1VYTA 4Q5WA 1OX9A 4M7DD 3RKXA 2KYMA 1YIJT 2M51A 3A8HB 4IIMA 4FM4B 5HCKA 2DD5A 4FW1A 4Z89A 3Q1JA 5LL6S 1G3SA 4WTOB 1KHCA 2EYQA 2CZ0B 2DEUA 3CCEA 2QQSA 2H3JA 2E12A 1JXMA 3CCRT 2E6ZA 1ZHIA 1WJRA 1VYVA 4HA8A 4RUGA 2E6NA 5CCAA 3GP8A 1X75C 1BCMA 3FIFA 5CKBA 4LDVA 1WFWA 3QO3A 2KRSA 2X9HA 1QP3A 2X51A 3M56A 2YUQA 3PMTA 1VQPT 1MMDA 1W4SA 4F7UF 1OU8A 1PKTA 1UHFA 4PFOA 1GBRA 3QXEB 3CMAQ 4CC3A 4BDYA 4CC7A 1YI2Q 1WA7A 5HY6A 3FEOA 1KQSA 2DLPA 1S1NA 1ZLMA 3OYIA 1NEBA 1C0MA 3EGDB 2RHZA 1OPKA 3L2RA 2P84A 3M53A 2X3XD 4B6MA 2ATCB 1PHTA 4XAXB 3EH1A 5GAMj 5KYXB 3JB9F 2X4XA 4ZTFA 4LUDA 3OW2A 2DNUA 4M78B 3CPWP 2C0TA 4XU3A 2K3XA 4FYVB 3CMEQ 4E7ZA 4PNOA 3DLLA 1JBMA 2XI9A 3P8BB 1VQMQ 3OYBA 4JRKA 4EMKB 3CCLA 1Q7YC 1VQ4Q 4JJBA 4ZTJA 4J6YA 4M7AE 2DL3A 1KIKA 1OU9A 2YHTA 1U3OA 2DYBA 5D6YA 2CZ1B 2KSSA 3RMQA 2A28A 3CCQT 2EYZA 2HL5C 1MMAA 1AWOA 3OYCA 2JM8A 1QQJA 3QHSA 2HBPA 3VS6A 2HSEB 5FRMA 2ROLA 1X6BA 1QWEA 4M78F 3LH5A 3RKWA 1SPKA 4XTXA 2L3PA 5IAYA 1CKBA 1UTIA 4QQDA 4BB7A 2ZGWA 1B3QA 2RJEA 2DIGA 3CBPA 3THKA 5I21A 4ESRA 3JAME 1QCOA 4HVUA 1RAGB 4JJCA 1X6OA 4LDWA 2EFIA 1WDXA 1WI7A 4PKCC 4F7UE 5FROA 4LN2A 1SF9A 2MI6A 4D8KA 2GCXA 2KEAA 5KCOA 2J7IA 2LCCA 1BI2A 2CT4A 3PGGA 2RNAA 1W2BS 1Q7YR 3CD6Q 1WLPB 1VQ7Q 2V1RA 1AWXA 4AG2C 4B9XA 2ED0A 1SKUB 1KD1C 3MP1A 4BE2A 2OTLA 2CYZB 1VQ5A 4KH0B 1X43A 2HCKA 2MWOA 1QVGA 5CKFA 3S6WA 2HAXA 4LDUA 3NPFA 1AWJA 3QJ6A 2QASA 3X26B 1HK9A 1PSFA 1OZ2A 4C8QB 4Y92A 3P8DA 2R5AA 3OYDA 2K7AA 2BUDA 1SEMA 2VASA 3JCMX 1B34B 4JS4A 3S3NA 5GANe 2GTJA 3G71Q 4J7FA 3O5ZA 4EIKA 2KVQG 1VUBA 3MJXA 2DZ9A 4FW2A 3RBBB 1UG1A 1GXIE 1XJWB 3PIPA 4EMHA 2EQIA 1AVZC 1GCPA 4DEYA 3G6EA 2E70A 3CXCP 4FU6A 3QYGB 1N8RR 2DM1A 3VS4A 2FZKB 2V26A 2OTJT 4AFZC 5FU6C 1TS9A 1VOMA 4J9DA 2MK5A 4FSXA 3HSBA 2QDLA 3CC7A 2F2XA 1IHVA 4M78E 2EQUA 1NBEB 2KXCA 4C8QF 2FPDA 2J6FA 1AZEA 4BY6C 1H641 1UGSB 2ZAEA 1XTDA 2EPDA 2DXCA 5I22A 2BZXA 2DAQA 2KGTA 3H6ZA 4M77A 1QVFP 3V7RA 1KD1U 2PVOB 3AT1B 2AHJB 3X28B 3G4SQ 4LNPA 3I56T 3HFOA 4J9CA 2DTOA 3HPWA 4XU2A 2EQMA 4QKUA 2LJ1A 1X2KA 2LC4A 4MZTA 1VQ9T 2QA4T 2KRMA 2LCLA 1VQOQ 2QQRA 4RMOA 5IT9E 3HL8A 2KT1A 1YITT 1WJQA 1VQ8T 2WSCE 2FEIA 1NLPC 4LXCA 3RUXA 2L2PA 1WHHA 2MMPA 2RH2A 1PM3A 4J9HA 5GMKm 5CQXA 2RD1A 4C0GA 2DFUA 3O8VA 4JS5A 3HFNA 1Q86R 3MEAA 3CMAA 4KBMB 5IXFA 2LRQA 4J6XA 3NGPA 2OAWA 1YI2A 1PC0A 1RAHB 3M0UA 3VJPA 4KUIA 4M77C 1K8AU 5GAN8 3CQTA 2K5LA 2DBMA 3I5RA 2BE7D 4X1VA 3GIBA 4JRPA 3JCMP 2RA2A 2C06A 4HCCA 1OPLA 1UGRB 1Q82C 1GRIA 4FIBA 4E7IA 1V29B 1YJNT 4NS5A 4CC2A 2YLCA 2RI5A 1IHWA 3EG0A 5D7UA 3V8LA 2LQNA 3RR6A 3OY9A 1OX8A 3JRZA 3SWNA 3CMEA 3QG1A 4OB1B 2K5FA 4OB0B 3EG1A 3M0PA 3JCMV 1SHFA 1I81A 1YCYA 1VQMA 1IB8A 4E7LA 1M2VB 4C0FA 4PJOG 1M2OA 3FRNA 5FLXE 5GMKl 1WQ7A 3F70A 1G3YA 1UUEA 4XTZA 4C8QE 1VQ4A 1NPRA 2F2WA 1PCXA 2EIFA 2QK0A 2E65A 2VV5A 3EFRA 3CCMQ 8ATCB 2PNIA 2GQVA 2EYYA 1PG5B 2E3HA 2ESWA 3EFOB 3A8MB 5GJWB 4AFSC 2G6FX 1UDLA 4M77D 2B8AA 1M5Q1 3VYGA 2DRMA 3OQ5A 3CCUT 4KUDK 3NTIA 3MCAB 3GOXA 4QQ6A 3JCMh 2LX7A 1UECA 1WXUA 3KUFA 3UWNA 4ATOA 3SWNC 2YRDA 3MPUB 1Q82R 3U23A 5GMKh 4PFZA 4BE1A 2D0NA 1C6VX 4C92B 2PVGB 4FL6A 3JCMg 3VRYA 1WJSA 1M8MA 2FG0A 4N4IA 3QUIA 4IUPA 4CI0C 4BY6B 4DQ2A 1YWPA 4OMQA 6AT1B 5J3BA 1LPLA 2YXYA 1S72T 1Q82U 2CZ6B 1K9MC 4A53A 2EAYA 4FYXB 2KK4A 3A98A 3OYLA 4LD9K 4FCYA 4C5IA 1KQ2A 3A8LB 1YNZA 2O2OA 5GAN2 3VYHB 3ZFJA 1FXXA 3PIOA 1ZBJA 5KYWA 3CD6A 2COWA 1G2BA 2A0FB 2K79A 1BKBA 3QDRB 1VQ7A 5GAOq 2M16A 4E7JA 2HKQB 5LJ5h 1UB4A 4KGVB 2VXEA 2DJQA 3FJ5A 3OS1A 2FYKA 1A0NB 2E5QA 1RAIB 5KYYA 4OMOA 1YJ9T 1XOVA 4LDXA 3JCMW 2JNGA 3L2WA 2EJFA 5DLOA 1RAEB 1UGPB 4PK4A 2HQEA 2ZPFB 3SHWA 3JCMc 5LJ5g 3SFMA 4ZN1A 1WHGA 3EHQA 2IIMA 3M4YA 2HEQA 4RG2A 3CXCS 3E19A 3HP9A 1YHQQ 4DBFA 1WQWA 2RJCA 3G71A 4M77B 1O9SA 5L8RE 3EG3A 5I2SA 1CSKA 2RJFA 2VGNA 2EYXA 1AD5A 4EMGA 4J8OA 3CCQQ 2DJZA 1K9MR 2OX7A 4C5EA 4A63B 3CPWA 2LMJA 4IUQA 2EYWA 2KDSA 1ZSZB 3H0FA 1W1FA 4C0DC 5LJ5d 2RK1A 3MEVA 1ACMB 5A2QE 4JLIA 2GQIA 3CCLT 2E4HA 2DA9A 1PNJA 3MP6A 5CAIA 1E6GA 4BI8B 1I1JA 5KYUA 4OGCA 4FYYB 1P92A 2MAMA 3CCJQ 2DBKA 1WIEA 1W70A 3JCMf 5KYNA 1D0YA 3HHTB 4M7AG 2DVEA 3EAEA 4N0AA 4HXJA 4AMCA 4M77F 4E7KA 4Z8AA 2NYSA 1OI1A 2OJ2A 1MNEA 1VQNQ 1Y71A 1BU1A 1JJ2P 3G4SA 1RI9A 3M4GA 2AZSA 1M30A 1K4US 3A5ZB 2VVKA 2O88A 1VQOA 1HJDA 1I5LA 1TSFA 3C94A 3H8ZA 5CK9A 3SWNB 5A0DA 2PVDB 3C12A 5IN1A 2CSIA 1UE9A 3VS5A 1ZX6A 3UF4A 3L42A 4F7UG 3ASKA 4RKUE 5LJ5f 3OBWA 3CCST 4C92E 2CT3A 4K11A 4N0AC 4JJDA 2CDTA 3DB3A 5GAN6 2LNVA 2D1XA 1WXBA 2JW4A 2OTLT 2F69A 1D3BB 2JTEA 1AOJA 3A1PA 2YWWA 1ZUYA 1FYNA 5A0GA 3PMIA 1GFCA 3PE0A 4E7SA 2QXFA 4M75A 3OSVA 3HKSA 1ARKA 1VA7A 3QJYA 2YRCA 2HSPA 1MV3A 1VQLQ 5GAMe 2EQJA 3GF5A 4PJJA 3EGXB 3NTHA 5CQYA 4FSSA 4M7DB 2GTOA 3BE3A 1YBYA 3JB9G 1QP2A 3V8KA 3TU4K 4J9BA 1OEBA 2OTJQ 3BY7A 2SEMA 2XDPA 1YFNA 1K76A 2QTVA 2J05A 1Y7XA 2XU8A 5EG2A 1CKAA 4NOYA 1QKXA 3BW1A 1LJOA 2NUZA 2JMCA 2KQWA 3N5BB 2CREA 4GY5A 5GAN4 1K9AA 4BI3A 3OYFA 3G6ET 3VS1A 3JB9H 2CP5A 3M0SA 3OYYA 3PFSA 3CCVT 5AT1B 2LQKA 1YWOA 2QYZA 1QCFA 3CCMA 2ZPGB 1VQKQ 1IGQA 4M75C 4M77E 4ELZC 3RIRA 2FPFA 1D1BA 1TU0B 1K1ZA 4X9DA 1R77A 2EVRA 3HTRA 5KYWB 2J6KA 2MCNA 4M7DF 1MNDA 2AKKA 1JQQA 2DL8A 4ANJA 3I56Q 1OV3A 1AEYA 4DA4A 2KBTA 3OYAA 2YUNA 4M78G 1TXQA 2QQ9A 1VQ9Q 2QA4Q 1X27A 3EHRA 3I9QA 4PJOC 3MEUA 1VQ6Q 1UJ0A 2L89A 5IXBA 3QIIA 1N8RC 2L0AA 2H3EB 2JXBA 3CC4Q 3EG9A 3PVQA 3OS5A 1QVFA 5GANh 1WZOA 3FB9A 1KQSP 2P0PA 2XG8D 1B07A 2JVVA 4MDXA 1Y57A 2K4YA 3LGFA 2LVMA 4HCBA 1Q81R 1J3TA 3LWHA 5GANg 2EQKA 4IIOA 3GLXA 3OA6A 1SRLA 4II1A 5HK3A 2HMAA 3MEWA 3CC2Q 1PRMC 4PJMA 3VS3A 1NJIC 2DL4A 3SB2A 1Q7YU 3SEMA 1R8OB 4M75D 4HVWA 1T3SA 2C0IA 3OW2P 1YI2T 1U06A 1IZ6A 3REBB 1JEGA 2V8JA 3NMZC 3WVEB 1YJNQ 5KCHA 2R57A 4D8DA 4QVDA 1D1CA 2LX9A 3FJPA 1HD3A 2HDAA 4HT9A 2DD4A 2VB6A 3MKDA 2CH4A 3OYHA 2EKOA 1N6AA 3QZ5B 1FX7A 3LGLA 1LCKA 5GANd 1ABQA 1YHQA 2MOXA
chains in the Genus database with same CATH topology
3JRZA 3SWNA 2HQXA 4Y91A 3CMEA 2RK2A 4N4HA 1MGQA 2RHUA 3INZA 4LD6A 3JSCA 3AHUA 3QG1A 2QQBA 4MDWA 1PSEA 2KAFA 2K5FA 4OB1B 4OB0B 3SDZA 4JDSA 3JCMV 1I81A 3TEEA 4BI4A 1YHQT 1EIFA 2D9TA 3LH0A 1YCYA 2ZZDA 4BD3A 2XD0A 2K2VA 1KHIA 3LW5E 1Q81C 1Q86C 1VQMA 4E7LA 3CMET 4C0FA 4PJOG 2ZPIB 3FRNA 2MF2A 5FLXE 1WQ7A 3F70A 1G3YA 3VUZA 5GMKl 4XTZA 3E9GA 1LNXA 4C8QE 3CCQA 2P0KA 1VQ4A 2XIDA 1NPRA 2K3YA 3DB4A 1RL2A 4D6WA 2CKKA 2EIFA 1VQMT 2E65A 4C8QD 3META 2KY9A 1WGSA 2VV5A 2BKDN 2JOYA 3OYEA 1N8RU 3G7ZA 3EFRA 3CXCA 3CC7T 2GQVA 1YIJA 5LJ3h 1VQ4T 1UEBA 4F7UB 3CCUA 4M7AF 4M7DE 3EFSA 3A8MB 1I4K1 4BDZA 1O75A 1M90C 2ZCFB 1QVFS 4M77D 2B8AA 4A54A 2R58A 4X9CA 4OMFB 3L2UA 4PLIA 2K5IA 4Q5WA 1JJ2S 2HD0A 1M5Q1 4LDYA 5DLQE 3RKXA 3VYGA 4M7DD 1YIJT 3A8HB 3OQ5A 3CCJA 1BIBA 3CCUT 4FM4B 4KUDK 2DD5A 2DKGA 3NTIA 1LOJA 3MCAB 3GOXA 2ZPHB 3Q1JA 3CBMA 4QQ6A 5LJ3g 2DTIA 5LL6S 3JCMh 4C0DB 4C8QG 1G3SA 2VXFA 3OBYA 3CCRA 2EJ9A 1KHCA 2EYQA 3KUFA 3UWNA 3CCJT 2CZ0B 4ATOA 3DKMA 3SWNC 3OB9A 1TH7A 2HNIA 4BACA 3CCEA 2QQSA 5GMKh 2H3JA 2E12A 1N9SA 2PUOB 1VQNA 3JCMJ 4P5NA 5CO7A 4BE1A 4M7DG 3CCRT 2E6ZA 3ME9A 3NFCA 4ME7A 1ZHIA 4C92B 2PVGB 1WJRA 2O01E 4RG8A 5CVIA 4FL6A 1VQPA 3JCMg 2K57A 1WJSA 2RB6A 4HA8A 2E6NA 3QZ9B 3QUIA 4IUPA 4N4IA 3TREA 5CCAA 1X75C 3FIFA 5CKBA 4M75B 4BY6B 4LDVA 4DQ2A 4C0ZA 5GANf 1VQNT 5GAMf 3FDRA 3QO3A 4PLLA 1Y96A 1QP3A 5J3BA 4CI0C 1XQHA 3M56A 2DK3A 3KBGA 2G3RA 4O6JA 3PMTA 1S72T 1VQPT 3C95A 4L5GA 1Q82U 3E9FA 1BI3A 2CZ6B 1K9MC 4A53A 5J39A 1W4SA 2QI2A 4F7UF 2EAYA 2KK4A 1M1KC 4IUUA 2DXUA 5LJ3d 3OYLA 4LD9K 2JZ2A 3QXEB 5GAN5 4F7UA 1YJWT 4A4HA 4C5IA 1KQ2A 3A8LB 4BDYA 2WACA 3VUBA 2XK0A 3VYHB 5CKHA 3ZFJA 5GAN2 1FXXA 4OVAA 3PIOA 3CD6A 4HCZA 3VV0A 2XHCA 1BKBA 3QDRB 5HY6A 3FEOA 3CCSA 1K73C 5GAOq 1KQSA 1VQ7A 4XTYA 2L8DA 2M16A 3BFMA 3CMAT 1BYMA 3RESA 4E7JA 1G3TA 3BDUA 1M8VA 2Y4XA 3JB9I 3OYIA 3DLMA 2QQAA 5LJ5h 1UB4A 2LQ8A 2DPPB 3CD6T 4PL6A 1Q86U 2VXEA 2RHZA 1Q81U 3JCMb 3OS1A 2FYKA 1VQ7T 3CPFA 2E5QA 3J7AF 1VIEA 3BDLA 4J5YA 3L2RA 1XOVA 3QYHB 1YJ9T 4LDXA 3JCMW 2JNGA 3MP8A 2GFUA 3M53A 4Y28E 3L2WA 3S3OA 4J83A 3V7SA 2RHYA 2WSEE 4O5VA 2EJFA 5DLOA 3T9NA 3PTAA 1ZBXA 1UGPB 1UGQB 4XK8E 2ZPBB 5GANj 4M75F 2HQEA 2ZPFB 4XAXB 1VIFA 4C92A 5GAMj 3JCMc 5LJ5g 1OZ3A 3P8HA 3LLRA 4PJOD 2RHXA 3SFMA 4ZN1A 3HRUA 1M1FA 1W2BA 2X4XA 3JB9F 2FVUA 4ZTFA 3M4YA 1M1GA 4RG2A 3CXCS 3E19A 3OW2A 5KH6A 4TVRA 3HP9A 4M78B 4ZGDB 3L2VA 1WQWA 4DOWA 1VQLA 4XU3A 2K3XA 2RJCA 2QTXA 4OF1A 4OP0A 4PNOA 3M9QA 2X4WA 2MWPA 3G71A 3OS2A 3DLLA 3GPLA 4M77B 4RCCA 1O9SA 5L8RE 1JBMA 2RM4A 4IURA 5I2SA 2XI9A 3P8BB 5GAN7 1VQLT 5CKDA 2DXTA 3OYBA 2RJFA 2VGNA 4JRKA 2KMTA 2EJGA 4OB3B 3G71T 4EMGA 4EMKB 2OTJA 4QW2A 4J8OA 1X01A 3CCLA 2IG0A 4MZPA 1Q7YC 2DJZA 5KE3A 4C5EA 4ZTJA 3CPWA 4J6YA 4M7AE 2E1HA 4R56A 1K8AC 1M9SA 2A7YA 2KDSA 4IUQA 2YHTA 2FHDA 4GLKA 3OMCA 4DOVA 5D6YA 5M9OA 2CZ1B 2KSSA 3RMQA 4C0DC 5LJ5d 3CCVA 2RK1A 3MEVA 3A8OB 3CCQT 3R6OA 5A2QE 4JLIA 5LJ3f 3J80E 3CCLT 3OYCA 3SD4A 1NPPA 2RI2A 3MP6A 5CAIA 2DEQA 3PT9A 4BI8B 2M1HA 3QHSA 4OGCA 1QVGA 4M7AA 4NL3A 1JB0E 1P92A 2HBPA 3V8JA 2MAMA 3ZEHA 5FRMA 4C92C 5GAOm 4A4KA 1VQKA 5GAN3 4M78F 2RI3A 3MHXA 4EPCA 3JCMf 3RKWA 4XTXA 2P4TA 4L6V5 5IAYA 3HHTB 5FU6B 4M7AG 2DVEA 3EAEA 4M78A 1ZQ1A 3A8GB 4QQDA 4N0AA 4BB7A 2ZGWA 1QVPA 2O4XB 5GAOp 4M77F 1NJIU 2BIVA 4E7KA 3JB9J 1VQKT 2RJEA 5FU7C 3QSUA 2DIGA 3CBPA 3OS0A 1OI1A 5I21A 3I56A 3JAME 4XU0A 1Y71A 1KQSS 2DTHA 1X6OA 3G4SA 3E1SA 2NLUA 4LDWA 3CCET 2EFIA 2RHIA 1VQ9A 2QA4A 4JRQA 3M55A 3M54A 3M4GA 4PKCC 4F7UE 3HRSA 1VQ6A 5FROA 4EMKA 3A5ZB 2CZ7B 4YTLA 1H3ZA 3G4ST 4OB2B 5LJ3j 2MI6A 3OYKA 1VQOA 2VUBA 2GCXA 2D6FA 5KCOA 4XU1A 5A0LA 3CC4A 1VQ6T 2LCCA 2F5KA 1BI2A 2R5MA 2E64A 3UT1A 3PGGA 5GMKi 2OAUA 4R55A 1I5LA 2X4JA 3NTKA 1W2BS 1VQOT 4M7AC 5DM7R 5LJ3e 4PJOB 3C94A 3H8ZA 4N4GA 3OW2S 1KG1A 5CKEA 5CK9A 1JRIA 2GF7A 3SWNB 3CC4T 5A0DA 2PVDB 3C12A 5IN1A 2PUKB 4L59A 4B9XA 3KXTA 3X24B 4JRIA 3TCJA 5DY9A 3L42A 1KD1C 2F5TX 3C4SA 3MP1A 4F7UG 3ASKA 4BE2A 4RKUE 5LJ5f 1KC8C 2OTLA 1N27A 3OBWA 4IUTA 2CYZB 4C92E 5KE2A 3CCST 3LWIA 4M78C 4J7IA 2VYTA 5GMKj 2LDMA 4N0AC 1VQ5A 3DB3A 4KULA 3CC2A 2E41A 5GAN6 4OGEA 4M75E 1Y07A 2LNVA 2MWOA 5J26A 3X20B 3JCMe 2DZCA 3M5AA 3RMSA 4C92D 5GAOl 3L1AA 3L2QA 3M59A 5CKFA 3S6WA 1XNIA 2F69A 3OYGA 4LDUA 2HAXA 2OTLT 1D3BB 4E47A 3QJ6A 3X26B 4QVZA 4XTVA 1HK9A 2FL7A 1PSFA 1RI0A 3CPWS 1AHJB 2XICA 3UDCA 1N9RA 3PMIA 5A0GA 3CC2T 4FT2A 1OZ2A 2JUFA 2QXFA 4M75A 2DO3A 1YJNA 3CEYA 3OSVA 4C8QB 3P8DA 2R5AA 3HKSA 4EMKC 4FT4A 3OYDA 2BUDA 3QJYA 1M90U 3JCMX 1B34B 4JS4A 1I8FA 1IREB 4C5GA 3S3NA 5GANe 2EWNA 5GAMe 3JCMQ 3HRTA 2X35A 4C92G 2EQJA 2X4YA 3GF5A 4J6WA 5CIUA 2JTMA 2DIQA 4MMLA 5D6WA 4J7FA 3NTHA 5CQYA 3L2ZA 1KQ1A 4M7DB 2KVQG 2WSFE 1VUBA 2DZ9A 4M75G 4PJOF 2PU9B 1GXIE 5CR2A 1YBYA 2JTFA 3JB9G 1QP2A 3PIPA 2P0QA 4EMHA 3V8KA 2LT4A 4B9WA 3TU4K 2ZPEB 4BE0A 4HKEA 1G3WA 4V2SA 3BY7A 3I55A 2XDPA 3G6EA 5LJ5j 2E70A 5GAOr 2M9UA 2XU8A 3QYGB 1Y7XA 4FU6A 5EG2A 2DXBA 3GNGA 4NOYA 4XQ3A 2Y4YA 3BW1A 1LJOA 4HT8A 2KQWA 3N5BB 2OTJT 4M7AD 4GY5A 5GAN4 1QW1A 5FU6C 4BI3A 4KT0E 3I55T 2D0QB 3OYFA 3LYIA 4ZGJB 3G6ET 4FSXA 4CRIA 3HSBA 5LJ5e 1Y96B 3CC7A 2QDYB 3JB9H 3VU3C 3OYYA 3PFSA 1BIAA 4M78E 3CCVT 4RCBA 2EQUA 4ZN3A 1D3BA 2LQKA 1K9MU 3OSSC 4QVCA 3WXMB 4C8QF 3CCMA 1M1KU 4M78D 2ZPGB 4BY6C 1H641 4M75C 1UGSB 4M77E 4ELZC 2I2LA 3RIRA 2GFAA 4X34A 4C8QA 1XTDA 3RKYA 2DXCA 4X9DA 3WVDB 2RO0A 1B34A 4Z02A 1K73U 3CCMT 4WF2A 4M7DF 3M58A 4A4FA 2DAQA 5AYFA 3H6ZA 4M77A 4A4GA 4UC4A 3V7RA 1KD1U 2PVOB 4DA4A 4M7DA 2RJDA 3OYAA 2AHJB 3X28B 3CBOA 1KC8U 1WPYA 4M78G 2CGHA 2VC8A 2QQ9A 4MZMA 3I56T 4PJOC 2CS7A 3HFOA 2DTOA 3OYMA 1YITA 5FRNA 3HPWA 4XU2A 3MEUA 2E10A 2EQMA 1VQ8A 3LX7A 4QQGA 4E7HA 4ZGEB 2LC4A 4M77G 2L89A 1QVGS 4MZTA 1VQ9T 2QA4T 3QIIA 2IVWA 3M57A 2LCLA 2YLBA 1N8RC 4VUBA 2QQRA 4RMOA 5IT9E 3RERA 3HL8A 1S72A 3GNFB 2XDDA 3QBYA 3S3MA 1YITT 1WJQA 1VQ8T 1U1TA 3OS5A 5HKCA 2WSCE 1QVFA 1BI1A 3ER0A 3RUXA 5GANh 2A3LA 5GAMh 1JJ2A 1SSFA 3FB9A 1U8RA 4JUVA 2P0PA 2PQWA 2XG8D 3QKJA 2M0OA 2MMPA 2RH2A 2Y90A 2JVVA 2L3RA 3QPHA 1YJWA 5GMKm 4JLGA 5CQXA 2RD1A 3ZBDA 4C0GA 1G5VA 4IKFA 4MDXA 2K4YA 5FU7B 3LGFA 5C0MA 2LVMA 3O8VA 4JS5A 3HFNA 4XTWA 4HCBA 3FLGA 3FC3A 3MEAA 5I2MA 3LWHA 3CMAA 4KBMB 4C8QC 5GANg 2EQKA 2VGMA 3GLXA 2LRQA 5GAMg 4II1A 4J6XA 3OA6A 4BUGA 5HK3A 4MMKA 3V7CA 1YI2A 3GP8A 2XKOC 1HXDA 3MEWA 1M4ZA 2O4XA 4NL2A 1DJ7B 1NJIC 3SB2A 1Q7YU 5D6XA 3VJPA 4KUIA 3OYNA 1R8OB 4M77C 1OYXA 1K8AU 4M75D 5GAN8 1YJ9A 1BI0A 4M7DC 2K5LA 5GMKe 1VQ5T 3OYJA 2L5QA 2FB7A 1YI2T 3JB9D 4C5HA 1IZ6A 1U1SA 1WNLA 3JCMd 2XDBA 5HK0A 1NZ9A 2V8JA 3GIBA 4JRPA 3WVEB 2V8IA 2V8KA 2RA2A 3JCMP 5KCHA 2C06A 4HCCA 2R57A 4ELYC 4QVDA 3PNWC 2LX9A 2JN0A 3FJPA 1UGRB 3MO8A 4XTUA 4M7AB 4HT9A 2DD4A 4C92F 1Q82C 4FIBA 1MHNA 3X25B 1NE8A 1V29B 2EKOA 3J81E 3OYHA 5GAOn 4E7IA 4PJOE 3UPUA 1YJNT 4NS5A 2QEXA 4EDUA 3VKIA 1N6AA 2RI5A 2YLCA 4JJNK 2LT1A 3QZ5B 1FX7A 3LGLA 4IUVA 5GANd 3V8LA 4A4EA 5GAMd 2YRVA 1FWZA 2LTOA 3OMGA 3OY9A 1YHQA 3URGA 5C6SA 4PJOA 2QEXT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HQX A;  3CME A;  4N4H A;  4LD6 A;  2RHU A;  1YHQ T;  1EIF A;  2D9T A;  3LH0 A;  4BD3 A;  1Q86 C;  1KHI A;  1Q81 C;  1VQM A;  4E7L A;  3CME T;  5FLX E;  3F70 A;  3E9G A;  3CCQ A;  1VQ4 A;  2P0K A;  1NPR A;  3DB4 A;  2K3Y A;  1RL2 A;  2CKK A;  2EIF A;  1VQM T;  3MET A;  1N8R U;  1WGS A;  3OYE A;  2BKD N;  2JOY A;  3CXC A;  3CC7 T;  1YIJ A;  1VQ4 T;  1UEB A;  3CCU A;  4BDZ A;  1M90 C;  1QVF S;  2B8A A;  2R58 A;  3L2U A;  4PLI A;  4Q5W A;  1JJ2 S;  5DLQ E;  1YIJ T;  3OQ5 A;  3CCJ A;  3CCU T;  3NTI A;  3GOX A;  3Q1J A;  4QQ6 A;  5LL6 S;  3CCR A;  1KHC A;  3KUF A;  3CCJ T;  3UWN A;  3OB9 A;  4BAC A;  3CCE A;  2QQS A;  1VQN A;  4BE1 A;  3CCR T;  2E6Z A;  3ME9 A;  1VQP A;  1WJR A;  4FL6 A;  1WJS A;  3TRE A;  2E6N A;  4IUP A;  4N4I A;  1VQN T;  3FDR A;  4PLL A;  5J3B A;  3KBG A;  2G3R A;  3PMT A;  1S72 T;  1VQP T;  1Q82 U;  3E9F A;  1K9M C;  5J39 A;  1M1K C;  4IUU A;  3OYL A;  2JZ2 A;  1YJW T;  4A4H A;  4C5I A;  4BDY A;  2WAC A;  2XK0 A;  3PIO A;  4OVA A;  3CD6 A;  1K73 C;  3CCS A;  2XHC A;  1BKB A;  1VQ7 A;  5HY6 A;  3FEO A;  1KQS A;  4HCZ A;  2L8D A;  2M16 A;  3CMA T;  4E7J A;  3OYI A;  3DLM A;  2LQ8 A;  3CD6 T;  4PL6 A;  1Q86 U;  1Q81 U;  2RHZ A;  1VQ7 T;  3OS1 A;  3CPF A;  2E5Q A;  3J7A F;  3BDL A;  1YJ9 T;  3L2R A;  2JNG A;  3MP8 A;  2GFU A;  3S3O A;  3L2W A;  2RHY A;  2HQE A;  1OZ3 A;  3P8H A;  3LLR A;  2RHX A;  4ZN1 A;  1W2B A;  2X4X A;  4ZTF A;  4RG2 A;  1M1G A;  3CXC S;  3OW2 A;  5KH6 A;  4TVR A;  3L2V A;  1VQL A;  2K3X A;  2RJC A;  3M9Q A;  2X4W A;  2MWP A;  3G71 A;  3DLL A;  3OS2 A;  4IUR A;  3P8B B;  1VQL T;  3OYB A;  2RJF A;  3G71 T;  2OTJ A;  4QW2 A;  3CCL A;  2IG0 A;  1Q7Y C;  5KE3 A;  4C5E A;  4ZTJ A;  3CPW A;  1K8A C;  2KDS A;  4IUQ A;  2FHD A;  3OMC A;  5D6Y A;  5M9O A;  3CCV A;  3MEV A;  3CCQ T;  5A2Q E;  3J80 E;  3CCL T;  3OYC A;  3SD4 A;  1NPP A;  2RI2 A;  3MP6 A;  2M1H A;  3ZEH A;  5FRM A;  1VQK A;  2RI3 A;  5IAY A;  3EAE A;  4QQD A;  2O4X B;  1NJI U;  1VQK T;  2BIV A;  4E7K A;  2RJE A;  2DIG A;  3OS0 A;  1OI1 A;  3I56 A;  3JAM E;  1KQS S;  1X6O A;  3G4S A;  2NLU A;  3CCE T;  2EFI A;  2RHI A;  1VQ9 A;  2QA4 A;  1VQ6 A;  5FRO A;  3A5Z B;  4YTL A;  1H3Z A;  3G4S T;  3OYK A;  2MI6 A;  1VQO A;  5KCO A;  3CC4 A;  1VQ6 T;  2LCC A;  2F5K A;  2R5M A;  3UT1 A;  1W2B S;  3NTK A;  1VQO T;  5DM7 R;  3H8Z A;  3OW2 S;  4N4G A;  2GF7 A;  3CC4 T;  5IN1 A;  4L59 A;  4B9X A;  3L42 A;  1KD1 C;  3MP1 A;  3C4S A;  4BE2 A;  2OTL A;  3ASK A;  1KC8 C;  1N27 A;  3CCS T;  4IUT A;  5KE2 A;  2VYT A;  2LDM A;  1VQ5 A;  3DB3 A;  3CC2 A;  2MWO A;  5J26 A;  1QVG A;  3L2Q A;  2OTL T;  1XNI A;  3S6W A;  3OYG A;  3QJ6 A;  4QVZ A;  3CPW S;  1RI0 A;  3CC2 T;  3PMI A;  2JUF A;  1OZ2 A;  2DO3 A;  1YJN A;  3CEY A;  3P8D A;  3HKS A;  2R5A A;  3OYD A;  1M90 U;  2BUD A;  4C5G A;  3S3N A;  2X35 A;  2EQJ A;  2X4Y A;  5CIU A;  5D6W A;  2DIQ A;  3NTH A;  2KVQ G;  1YBY A;  2JTF A;  3PIP A;  4B9W A;  4BE0 A;  3I55 A;  2XDP A;  3G6E A;  2E70 A;  4FU6 A;  2OTJ T;  4GY5 A;  3I55 T;  3G6E T;  3LYI A;  3OYF A;  4CRI A;  3CC7 A;  3OYY A;  3CCV T;  3PFS A;  2EQU A;  4ZN3 A;  1K9M U;  3CCM A;  1M1K U;  2GFA A;  4X34 A;  1XTD A;  2RO0 A;  4Z02 A;  1K73 U;  3CCM T;  4A4F A;  2DAQ A;  3H6Z A;  4A4G A;  4UC4 A;  1KD1 U;  2RJD A;  3OYA A;  1KC8 U;  3I56 T;  3OYM A;  5FRN A;  1YIT A;  1VQ8 A;  3MEU A;  2EQM A;  3LX7 A;  4QQG A;  4E7H A;  2L89 A;  1QVG S;  1VQ9 T;  2QA4 T;  3QII A;  1N8R C;  2LCL A;  5IT9 E;  2QQR A;  1S72 A;  3QBY A;  3S3M A;  1YIT T;  1WJQ A;  1VQ8 T;  1QVF A;  3ER0 A;  1JJ2 A;  1SSF A;  2PQW A;  3QKJ A;  2M0O A;  2JVV A;  2L3R A;  1YJW A;  1G5V A;  5C0M A;  3LGF A;  2LVM A;  3O8V A;  3FLG A;  3FC3 A;  3MEA A;  3CMA A;  2EQK A;  2LRQ A;  3OA6 A;  4II1 A;  1YI2 A;  3MEW A;  2O4X A;  1NJI C;  1Q7Y U;  5D6X A;  3OYN A;  1K8A U;  1OYX A;  1YJ9 A;  1VQ5 T;  3OYJ A;  1YI2 T;  4C5H A;  1IZ6 A;  1NZ9 A;  5KCH A;  2R57 A;  3PNW C;  3MO8 A;  1Q82 C;  4E7I A;  1MHN A;  4IKF A;  3J81 E;  2EKO A;  3OYH A;  1YJN T;  4NS5 A;  2QEX A;  4EDU A;  2RI5 A;  3LGL A;  4IUV A;  4A4E A;  2YRV A;  2LTO A;  3OMG A;  3OY9 A;  1YHQ A;  5C6S A;  2QEX T; 
#chains in the Genus database with same CATH topology
 5IH2 A;  2FRY A;  2HQX A;  2RK2 A;  4LD6 A;  3INZ A;  3JSC A;  3I55 Q;  4BI4 A;  2JJ9 A;  1EIF A;  1RAD B;  3LW5 E;  1Q86 C;  1NEG A;  3CME T;  1Y0M A;  3VUZ A;  3E9G A;  1JU5 C;  3CCQ A;  2XID A;  1RLP C;  4D6W A;  4RTV A;  3VRZ A;  1GBQ A;  5ECA A;  4ORZ A;  2QAZ A;  1VQM T;  1N8R U;  3G7Z A;  5LJ3 h;  2W0Z A;  2DVJ A;  1UEB A;  1VQ4 T;  2K6D A;  4M7D E;  3CCU Q;  1M90 C;  4E2F B;  1NJI R;  4RTZ A;  4A54 A;  2R58 A;  4X9C A;  2ECZ A;  4OMF B;  3UA6 A;  3L2U A;  1JJ2 S;  2HD0 A;  4LDY A;  5DLQ E;  1PWT A;  1SRM A;  3CCJ A;  1BIB A;  5LJ3 g;  2DTI A;  4C8Q G;  3OBY A;  1Z9Z A;  2CSQ A;  4J9F A;  1TH7 A;  2HNI A;  4BAC A;  1PD0 A;  2M0Y A;  1VQN A;  3JCM J;  4P5N A;  5CO7 A;  3NFC A;  2O01 E;  5CVI A;  2NUT A;  1S72 Q;  2RB6 A;  3QZ9 B;  5L23 A;  8AT1 B;  4M75 B;  5GAN f;  5IHI A;  1Y96 A;  3KBG A;  4O6J A;  2BTT A;  2DIL A;  3IQL A;  3C95 A;  3E9F A;  1M1K C;  4RTT A;  2DXU A;  5LJ3 d;  2JZ2 A;  5GAN 5;  4F7U A;  1YJW T;  4A4H A;  3VUB A;  5CKH A;  4OVA A;  4HCZ A;  3VV0 A;  1K73 C;  2V1Q A;  1VYU A;  1D1A A;  4LUE A;  4XTY A;  1BYM A;  3RES A;  1M8V A;  3JB9 I;  1YJ9 Q;  3DLM A;  2DPP B;  2F2V A;  3CD6 T;  4PL6 A;  1Q86 U;  1VQ7 T;  3JCM b;  2DF6 A;  3CPF A;  1M90 R;  3J7A F;  3BDL A;  3QWY A;  3QYH B;  2GFU A;  3V7S A;  2RHY A;  4JPB W;  4O5V A;  3PTA A;  2PZ1 A;  1UGQ B;  2ZPB B;  4M75 F;  2QEX Q;  1VIF A;  1T0H A;  1SHG A;  4F17 A;  1W2B A;  2FVU A;  5KH6 A;  9ATC B;  1IGU A;  1UJY A;  3L2V A;  4DOW A;  1VQL A;  2QTX A;  4OF1 A;  4OP0 A;  3M9Q A;  2X4W A;  1EZZ B;  2EGA A;  1G83 A;  1RUW A;  1X69 A;  5CKD A;  2DXT A;  3VS0 A;  2CUD A;  4OB3 B;  1HSQ A;  2HZY A;  3G71 T;  2OTJ A;  2EBP A;  4QW2 A;  1X01 A;  5IHN A;  4AG1 C;  5KE3 A;  2E1H A;  1PD1 A;  1M1K R;  4GLK A;  4DEX A;  4DOV A;  1IXD A;  3R6O A;  5LJ3 f;  3J80 E;  1YIJ Q;  1UHC A;  3SD4 A;  1NPP A;  2JMA A;  2ENM A;  3PT9 A;  1ZUU A;  2AKL A;  1K73 R;  4Z88 A;  4PFP A;  4OMN A;  3ZEH A;  1VQK A;  5KYX A;  2RI3 A;  4EPC A;  2P4T A;  4L6V 5;  3CCR Q;  2RMO A;  1NYF A;  5FU6 B;  2K2M A;  4M78 A;  3A8G B;  3H9N A;  3JB9 J;  1OUL A;  5FU7 C;  3QSU A;  3EH2 A;  1ZSG A;  2OI3 A;  3I56 A;  4XU0 A;  1KQS S;  2DTH A;  2O9S A;  1VQP Q;  3M0T A;  3E1S A;  2NLU A;  3CCE T;  5EC7 A;  1MUZ A;  1VQ9 A;  2QA4 A;  3M55 A;  1VQ6 A;  4EMK A;  1H3Z A;  2XMF A;  2W10 A;  3G4S T;  4OB2 B;  3TSW A;  3OYK A;  2VUB A;  1M3B A;  2D8J A;  5A0L A;  1BB9 A;  3CC4 A;  1TUD A;  2R5M A;  3UT1 A;  1PRL C;  2OAU A;  2X4J A;  1VQO T;  4N4G A;  3OW2 S;  2J6O A;  5CKE A;  2GF7 A;  3CCS Q;  4ZNX A;  2PUK B;  3X24 B;  5FWB A;  3TCJ A;  5DY9 A;  4PJL A;  4LE9 A;  1TG0 A;  2F5T X;  3C4S A;  1KC8 C;  2OTL Q;  2A36 A;  3LWI A;  4M78 C;  5GMK j;  2LDM A;  3CC2 A;  4OGE A;  4M75 E;  1Y07 A;  5J26 A;  1V1C A;  3X20 B;  3JCM e;  3L1A A;  3L2Q A;  3M59 A;  2YUO A;  4DBQ A;  3TSZ A;  4QVZ A;  4XTV A;  2O9V A;  1N9R A;  2D8H A;  4FT2 A;  1KJW A;  1YJN A;  3CEY A;  4EMK C;  4FT4 A;  2JM9 A;  1WHJ A;  2EWN A;  3JCM Q;  4C92 G;  2X4Y A;  5CIU A;  2JTM A;  3L2Z A;  2WSF E;  2GBQ A;  2RQU A;  2JTF A;  1TTH B;  2EGE A;  4B9W A;  2ZPE B;  4V2S A;  3I55 A;  5LJ5 j;  3RDV A;  5GAO r;  3GNG A;  4XQ3 A;  2Y4Y A;  4HT8 A;  1YN8 A;  2DET A;  3CCV Q;  1QW1 A;  4KT0 E;  4ZGJ B;  5LJ5 e;  1Y96 B;  2IPO B;  2QDY B;  2DER A;  3VU3 C;  4RCB A;  2J06 A;  4ZN3 A;  1TOV A;  1K9M U;  2B86 A;  4QVC A;  2DL5 A;  3WXM B;  1KC8 R;  4GBQ A;  4M78 D;  2I2L A;  4RTY A;  2LP5 A;  1T3L A;  4C8Q A;  4OMP A;  3WVD B;  2RO0 A;  1B34 A;  2LZ6 B;  4Z02 A;  4KRT A;  3CCM T;  1QMC A;  3M58 A;  1D0Z A;  4A4G A;  2EW3 A;  2RJD A;  1I07 A;  1KC8 U;  2CGH A;  2VC8 A;  4MZM A;  2VKN A;  2CS7 A;  5FRN A;  2E10 A;  3LX7 A;  4QQG A;  4M77 G;  1QVG S;  1F1B B;  3M57 A;  2YLB A;  4VUB A;  1S72 A;  3GNF B;  2AZV A;  2SRC A;  4CC4 B;  2RQR A;  1QCN A;  2CP0 A;  1BI1 A;  3ER0 A;  5GAM h;  1SSF A;  1I0C A;  1V76 A;  2PQW A;  2FO0 A;  4E6R A;  3QPH A;  3ZBD A;  1M27 C;  1G5V A;  5FU7 B;  7AT1 B;  4HCK A;  4J9I A;  3FLG A;  1I5O B;  4C8Q C;  1KK7 A;  2VGM A;  5GAM g;  4BUG A;  4F14 A;  4MMK A;  2NUP A;  2XKO C;  1HXD A;  1RAC B;  2ROT A;  1M4Z A;  2O4X A;  3KFV A;  1DJ7 B;  2H8H A;  2BZY A;  1OYX A;  1YJ9 A;  1BI0 A;  1VQ5 T;  1ABO A;  3OYJ A;  2L5Q A;  4OMM A;  2GGR A;  1U1S A;  1WNL A;  1T0J A;  3I35 A;  1NZ9 A;  2ABL A;  2V8I A;  2V8K A;  4ELY C;  2HL3 A;  3PNW C;  1NYG A;  2JN0 A;  3MO8 A;  4F16 A;  1YP5 A;  3UPU A;  4R0K A;  2QEX A;  4EDU A;  2LT1 A;  2QGG A;  1GCQ A;  3I5S A;  5GAM d;  1FWZ A;  2A08 A;  3URG A;  5C6S A;  2D6F A;  4PJO A;  1AWW A;  1ZA1 B;  3UAT A;  2QGF B;  1GFD A;  4N4H A;  1MGQ A;  2MIO A;  1TUC A;  2KR3 A;  3ZL7 C;  3SDZ A;  4JDS A;  3TEE A;  1YHQ T;  3LH0 A;  2K2V A;  1KHI A;  1Q81 C;  1N5Z A;  3M0R A;  2FZG B;  2MF2 A;  4M4Z A;  3ULR B;  1RLQ C;  2RQV A;  2P0K A;  2K3Y A;  2FZC B;  1AZG B;  1RL2 A;  2CKK A;  4KGX B;  3PVL A;  4C8Q D;  3MET A;  1QKW A;  2KY9 A;  3OYE A;  1JO8 A;  1GL5 A;  3CXC A;  3CC7 T;  1YIJ A;  4RTW A;  2YDL A;  4OML A;  1LVK A;  2C0O A;  1O75 A;  2L3Q A;  4PLI A;  2K5I A;  1TWB A;  2P4R A;  2AT1 B;  1H8K A;  3E2U A;  3GBQ A;  2GNC A;  2DKG A;  1LOJ A;  2ZPH B;  1UFF A;  1X2Q A;  1GCQ C;  3CBM A;  3REA B;  4C0D B;  2VXF A;  3CCR A;  2EJ9 A;  2CP3 A;  5KYY B;  3CCJ T;  2FRW A;  3DKM A;  3OB9 A;  1YIT Q;  1PKS A;  1VQ8 Q;  1D09 B;  2PUO B;  1N9S A;  4GLM A;  4M7D G;  3ME9 A;  4ME7 A;  1VQP A;  4RG8 A;  2HBW A;  2K57 A;  3TRE A;  1M2V A;  3H41 A;  2E3I A;  4C0Z A;  1VQN T;  5GAM f;  3FDR A;  4PLL A;  1XQH A;  2DK3 A;  2G3R A;  1G8X A;  3TVT A;  4L5G A;  1YJW Q;  1IRX A;  1BI3 A;  1UGV A;  2LJ3 A;  5J39 A;  2QI2 A;  1MMN A;  4IUU A;  4FYW B;  2KXD A;  3EFO A;  2WAC A;  2XK0 A;  3CCS A;  2XHC A;  3NHN A;  2L8D A;  3BFM A;  2M02 A;  3CMA T;  1G3T A;  3BDU A;  2Y4X A;  1EX4 A;  1YCS B;  2QQA A;  2LQ8 A;  1Q81 U;  2PTK A;  2CUB A;  3VS2 A;  1VIE A;  1EFN A;  4J5Y A;  5KYU B;  3MP8 A;  3S3O A;  4Y28 E;  4RTU A;  2O31 A;  2LJ0 A;  4J83 A;  2WSE E;  3T9N A;  1WXT A;  1ZBX A;  4XK8 E;  5GAN j;  2DMO A;  4C92 A;  1OZ3 A;  3P8H A;  3LLR A;  4JZ4 A;  4PJO D;  2RHX A;  3HRU A;  1M1F A;  1M1G A;  4TVR A;  4ZGD B;  1TUG B;  1SG5 A;  2JS2 A;  2CP7 A;  2MWP A;  3OS2 A;  3GPL A;  4RCC A;  2LCS A;  2RM4 A;  4IUR A;  5GAN 7;  1M3A A;  1VQL T;  2KMT A;  2EJG A;  4AFQ C;  1WHK A;  1Q95 G;  2IG0 A;  4MZP A;  1H3H A;  1MV0 B;  2AK5 A;  1FMK A;  4R56 A;  1K8A C;  3G1J A;  1M9S A;  2A7Y A;  2FHD A;  4PJN A;  1Z9Q A;  3OMC A;  5M9O A;  4DBH A;  3CCV A;  3A8O B;  5FWC A;  2CP6 A;  2L3S A;  2RI2 A;  2DEQ A;  2M1H A;  4M7A A;  4NL3 A;  1JB0 E;  3V8J A;  4AFU C;  4QT7 A;  1WHM A;  4C92 C;  5GAO m;  1KD1 R;  2EKH A;  4A4K A;  5GAN 3;  3MHX A;  2HQH A;  3RNJ A;  1U5S A;  4AT1 B;  1ZQ1 A;  2NUP B;  5GAO p;  1QVP A;  2O4X B;  1NJI U;  2BIV A;  1VQK T;  3CCE Q;  2EGC A;  3OS0 A;  2ED1 A;  2X3W D;  2RHI A;  4JRQ A;  3M54 A;  3HRS A;  4YTL A;  2CZ7 B;  1X6G A;  3TQ7 P;  4J9G A;  2KE9 A;  4JZ3 A;  5LJ3 j;  3QWX X;  2KI7 A;  1ZSZ A;  4XU1 A;  3H0H A;  1VQ6 T;  2HKN A;  2F5K A;  2KT8 A;  1QVG P;  2E64 A;  1RAB B;  5GMK i;  4R55 A;  3NTK A;  4M7A C;  2KNB B;  5DM7 R;  5LJ3 e;  4PJO B;  1KG1 A;  1JRI A;  3CC4 T;  2JT4 A;  1K8A R;  4L59 A;  3KXT A;  1M3C A;  2NWM A;  4JRI A;  2K3B A;  1QWF A;  1N27 A;  4IUT A;  1HYO A;  5KE2 A;  4J7I A;  2VYT A;  4KUL A;  2E41 A;  5GAO l;  2DZC A;  3M5A A;  3RMS A;  4C92 D;  2CP2 A;  2COZ A;  1SSH A;  1XNI A;  5I11 A;  3OYG A;  4E47 A;  3C0C A;  2DL7 A;  2LNH B;  4J9E A;  1E7O A;  2FL7 A;  3CPW S;  1RI0 A;  3CC2 T;  1AHJ B;  1FMW A;  2XIC A;  2YSQ A;  3UDC A;  1C1A A;  4RTX A;  2K9G A;  3H0I A;  2JUF A;  1NM7 A;  2DO3 A;  4WCI A;  1M90 U;  1I8F A;  1IRE B;  4C5G A;  4KGZ B;  4DBR A;  3HRT A;  2X35 A;  1ZSZ C;  4J6W A;  1BCO A;  5D6W A;  1RAA B;  2DIQ A;  4MML A;  1KQ1 A;  2MPX C;  1NG2 A;  4M75 G;  4PJO F;  2PU9 B;  1QLY A;  5CR2 A;  1H92 A;  2P0Q A;  1AT1 B;  5IHK A;  1KFZ A;  2LT4 A;  4BE0 A;  3D7S B;  1G3W A;  4HKE A;  3CCL Q;  1ZA2 B;  2KYB A;  2M9U A;  3EGU A;  2DXB A;  1MMG A;  3EGD A;  4HVV A;  3EG9 B;  4M7A D;  3QDF A;  1NLO C;  3I55 T;  2D0Q B;  3LYI A;  2FPE A;  4CRI A;  2BZ8 A;  1BIA A;  2QG9 B;  2Z0W A;  1JXO A;  1D3B A;  3OSS C;  2A37 A;  1M1K U;  1BK2 A;  2GFA A;  4X34 A;  1R0C B;  3RKY A;  1WX6 A;  1K73 U;  4WF2 A;  2VWF A;  1B7T A;  1R0B G;  4A4F A;  5AYF A;  2RN8 A;  3EGX A;  4UC4 A;  1K0X A;  2AIR B;  4M7D A;  1WYX A;  3CBO A;  5GJV B;  1WPY A;  2DE0 X;  2YUP A;  3OYM A;  1YIT A;  1VQ8 A;  2DX1 A;  2RPN A;  4E7H A;  4ZGE B;  4KH1 B;  2DRK A;  2IVW A;  2E5K A;  3RER A;  1KSW A;  2XDD A;  3QBY A;  3S3M A;  1U1T A;  5HKC A;  1ZUK A;  2A3L A;  2I0N A;  1E6H A;  1JJ2 A;  1U8R A;  4JUV A;  3QKJ A;  2M0O A;  2Y90 A;  2L3R A;  1YJW A;  4JLG A;  5C0M A;  2MYS A;  4XTW A;  4F04 B;  1RAF B;  3FC3 A;  5FW9 A;  5I2M A;  3V7C A;  1K0S A;  1VQ5 Q;  4NL2 A;  2CH4 W;  5D6X A;  3OYN A;  2RQW A;  2COY A;  1W2B P;  4M7D C;  2DYI A;  5GMK e;  2FB7 A;  3JB9 D;  2YT6 A;  4C5H A;  2F1L A;  3JV3 A;  3JCM d;  5HK0 A;  2XDB A;  3M0Q A;  1W6X A;  1OQK A;  4XTU A;  4M7A B;  4C92 F;  3X25 B;  1MHN A;  4IKF A;  1NE8 A;  3J81 E;  4PJO E;  5GAO n;  3VS7 A;  1OOT A;  3VKI A;  1BBZ A;  4JJN K;  3UA7 A;  4IUV A;  4A4E A;  2YRV A;  2LTO A;  3R6N A;  3OMG A;  2QEX T;  2RQT A;  1FMV A;  3EG2 A;  4Y91 A;  3AHU A;  1WHL A;  2RHU A;  3G6E Q;  2QQB A;  4MDW A;  1PSE A;  2KAF A;  2NUT B;  2D9T A;  2ZZD A;  4BD3 A;  2XD0 A;  2ZPI B;  2KRN A;  2KRO A;  1LNX A;  2RF0 A;  2BE9 B;  3CC7 Q;  1D0X A;  3DB4 A;  2LQW A;  2JS0 A;  1WGS A;  2BKD N;  2JOY A;  4F7U B;  3CCU A;  4M7A F;  3EFS A;  1I4K 1;  1IO6 A;  4BDZ A;  2ZCF B;  1QVF S;  1VYT A;  4Q5W A;  1OX9 A;  4M7D D;  3RKX A;  2KYM A;  1YIJ T;  2M51 A;  3A8H B;  4IIM A;  4FM4 B;  5HCK A;  2DD5 A;  4FW1 A;  4Z89 A;  3Q1J A;  5LL6 S;  1G3S A;  4WTO B;  1KHC A;  2EYQ A;  2CZ0 B;  2DEU A;  3CCE A;  2QQS A;  2H3J A;  2E12 A;  1JXM A;  3CCR T;  2E6Z A;  1ZHI A;  1WJR A;  1VYV A;  4HA8 A;  4RUG A;  2E6N A;  5CCA A;  3GP8 A;  1X75 C;  1BCM A;  3FIF A;  5CKB A;  4LDV A;  1WFW A;  3QO3 A;  2KRS A;  2X9H A;  1QP3 A;  2X51 A;  3M56 A;  2YUQ A;  3PMT A;  1VQP T;  1MMD A;  1W4S A;  4F7U F;  1OU8 A;  1PKT A;  1UHF A;  4PFO A;  1GBR A;  3QXE B;  3CMA Q;  4CC3 A;  4BDY A;  4CC7 A;  1YI2 Q;  1WA7 A;  5HY6 A;  3FEO A;  1KQS A;  2DLP A;  1S1N A;  1ZLM A;  3OYI A;  1NEB A;  1C0M A;  3EGD B;  2RHZ A;  1OPK A;  3L2R A;  2P84 A;  3M53 A;  2X3X D;  4B6M A;  2ATC B;  1PHT A;  4XAX B;  3EH1 A;  5GAM j;  5KYX B;  3JB9 F;  2X4X A;  4ZTF A;  4LUD A;  3OW2 A;  2DNU A;  4M78 B;  3CPW P;  2C0T A;  4XU3 A;  2K3X A;  4FYV B;  3CME Q;  4E7Z A;  4PNO A;  3DLL A;  1JBM A;  2XI9 A;  3P8B B;  1VQM Q;  3OYB A;  4JRK A;  4EMK B;  3CCL A;  1Q7Y C;  1VQ4 Q;  4JJB A;  4ZTJ A;  4J6Y A;  4M7A E;  2DL3 A;  1KIK A;  1OU9 A;  2YHT A;  1U3O A;  2DYB A;  5D6Y A;  2CZ1 B;  2KSS A;  3RMQ A;  2A28 A;  3CCQ T;  2EYZ A;  2HL5 C;  1MMA A;  1AWO A;  3OYC A;  2JM8 A;  1QQJ A;  3QHS A;  2HBP A;  3VS6 A;  2HSE B;  5FRM A;  2ROL A;  1X6B A;  1QWE A;  4M78 F;  3LH5 A;  3RKW A;  1SPK A;  4XTX A;  2L3P A;  5IAY A;  1CKB A;  1UTI A;  4QQD A;  4BB7 A;  2ZGW A;  1B3Q A;  2RJE A;  2DIG A;  3CBP A;  3THK A;  5I21 A;  4ESR A;  3JAM E;  1QCO A;  4HVU A;  1RAG B;  4JJC A;  1X6O A;  4LDW A;  2EFI A;  1WDX A;  1WI7 A;  4PKC C;  4F7U E;  5FRO A;  4LN2 A;  1SF9 A;  2MI6 A;  4D8K A;  2GCX A;  2KEA A;  5KCO A;  2J7I A;  2LCC A;  1BI2 A;  2CT4 A;  3PGG A;  2RNA A;  1W2B S;  1Q7Y R;  3CD6 Q;  1WLP B;  1VQ7 Q;  2V1R A;  1AWX A;  4AG2 C;  4B9X A;  2ED0 A;  1SKU B;  1KD1 C;  3MP1 A;  4BE2 A;  2OTL A;  2CYZ B;  1VQ5 A;  4KH0 B;  1X43 A;  2HCK A;  2MWO A;  1QVG A;  5CKF A;  3S6W A;  2HAX A;  4LDU A;  3NPF A;  1AWJ A;  3QJ6 A;  2QAS A;  3X26 B;  1HK9 A;  1PSF A;  1OZ2 A;  4C8Q B;  4Y92 A;  3P8D A;  2R5A A;  3OYD A;  2K7A A;  2BUD A;  1SEM A;  2VAS A;  3JCM X;  1B34 B;  4JS4 A;  3S3N A;  5GAN e;  2GTJ A;  3G71 Q;  4J7F A;  3O5Z A;  4EIK A;  2KVQ G;  1VUB A;  3MJX A;  2DZ9 A;  4FW2 A;  3RBB B;  1UG1 A;  1GXI E;  1XJW B;  3PIP A;  4EMH A;  2EQI A;  1AVZ C;  1GCP A;  4DEY A;  3G6E A;  2E70 A;  3CXC P;  4FU6 A;  3QYG B;  1N8R R;  2DM1 A;  3VS4 A;  2FZK B;  2V26 A;  2OTJ T;  4AFZ C;  5FU6 C;  1TS9 A;  1VOM A;  4J9D A;  2MK5 A;  4FSX A;  3HSB A;  2QDL A;  3CC7 A;  2F2X A;  1IHV A;  4M78 E;  2EQU A;  1NBE B;  2KXC A;  4C8Q F;  2FPD A;  2J6F A;  1AZE A;  4BY6 C;  1H64 1;  1UGS B;  2ZAE A;  1XTD A;  2EPD A;  2DXC A;  5I22 A;  2BZX A;  2DAQ A;  2KGT A;  3H6Z A;  4M77 A;  1QVF P;  3V7R A;  1KD1 U;  2PVO B;  3AT1 B;  2AHJ B;  3X28 B;  3G4S Q;  4LNP A;  3I56 T;  3HFO A;  4J9C A;  2DTO A;  3HPW A;  4XU2 A;  2EQM A;  4QKU A;  2LJ1 A;  1X2K A;  2LC4 A;  4MZT A;  1VQ9 T;  2QA4 T;  2KRM A;  2LCL A;  1VQO Q;  2QQR A;  4RMO A;  5IT9 E;  3HL8 A;  2KT1 A;  1YIT T;  1WJQ A;  1VQ8 T;  2WSC E;  2FEI A;  1NLP C;  4LXC A;  3RUX A;  2L2P A;  1WHH A;  2MMP A;  2RH2 A;  1PM3 A;  4J9H A;  5GMK m;  5CQX A;  2RD1 A;  4C0G A;  2DFU A;  3O8V A;  4JS5 A;  3HFN A;  1Q86 R;  3MEA A;  3CMA A;  4KBM B;  5IXF A;  2LRQ A;  4J6X A;  3NGP A;  2OAW A;  1YI2 A;  1PC0 A;  1RAH B;  3M0U A;  3VJP A;  4KUI A;  4M77 C;  1K8A U;  5GAN 8;  3CQT A;  2K5L A;  2DBM A;  3I5R A;  2BE7 D;  4X1V A;  3GIB A;  4JRP A;  3JCM P;  2RA2 A;  2C06 A;  4HCC A;  1OPL A;  1UGR B;  1Q82 C;  1GRI A;  4FIB A;  4E7I A;  1V29 B;  1YJN T;  4NS5 A;  4CC2 A;  2YLC A;  2RI5 A;  1IHW A;  3EG0 A;  5D7U A;  3V8L A;  2LQN A;  3RR6 A;  3OY9 A;  1OX8 A;  3JRZ A;  3SWN A;  3CME A;  3QG1 A;  4OB1 B;  2K5F A;  4OB0 B;  3EG1 A;  3M0P A;  3JCM V;  1SHF A;  1I81 A;  1YCY A;  1VQM A;  1IB8 A;  4E7L A;  1M2V B;  4C0F A;  4PJO G;  1M2O A;  3FRN A;  5FLX E;  5GMK l;  1WQ7 A;  3F70 A;  1G3Y A;  1UUE A;  4XTZ A;  4C8Q E;  1VQ4 A;  1NPR A;  2F2W A;  1PCX A;  2EIF A;  2QK0 A;  2E65 A;  2VV5 A;  3EFR A;  3CCM Q;  8ATC B;  2PNI A;  2GQV A;  2EYY A;  1PG5 B;  2E3H A;  2ESW A;  3EFO B;  3A8M B;  5GJW B;  4AFS C;  2G6F X;  1UDL A;  4M77 D;  2B8A A;  1M5Q 1;  3VYG A;  2DRM A;  3OQ5 A;  3CCU T;  4KUD K;  3NTI A;  3MCA B;  3GOX A;  4QQ6 A;  3JCM h;  2LX7 A;  1UEC A;  1WXU A;  3KUF A;  3UWN A;  4ATO A;  3SWN C;  2YRD A;  3MPU B;  1Q82 R;  3U23 A;  5GMK h;  4PFZ A;  4BE1 A;  2D0N A;  1C6V X;  4C92 B;  2PVG B;  4FL6 A;  3JCM g;  3VRY A;  1WJS A;  1M8M A;  2FG0 A;  4N4I A;  3QUI A;  4IUP A;  4CI0 C;  4BY6 B;  4DQ2 A;  1YWP A;  4OMQ A;  6AT1 B;  5J3B A;  1LPL A;  2YXY A;  1S72 T;  1Q82 U;  2CZ6 B;  1K9M C;  4A53 A;  2EAY A;  4FYX B;  2KK4 A;  3A98 A;  3OYL A;  4LD9 K;  4FCY A;  4C5I A;  1KQ2 A;  3A8L B;  1YNZ A;  2O2O A;  5GAN 2;  3VYH B;  3ZFJ A;  1FXX A;  3PIO A;  1ZBJ A;  5KYW A;  3CD6 A;  2COW A;  1G2B A;  2A0F B;  2K79 A;  1BKB A;  3QDR B;  1VQ7 A;  5GAO q;  2M16 A;  4E7J A;  2HKQ B;  5LJ5 h;  1UB4 A;  4KGV B;  2VXE A;  2DJQ A;  3FJ5 A;  3OS1 A;  2FYK A;  1A0N B;  2E5Q A;  1RAI B;  5KYY A;  4OMO A;  1YJ9 T;  1XOV A;  4LDX A;  3JCM W;  2JNG A;  3L2W A;  2EJF A;  5DLO A;  1RAE B;  1UGP B;  4PK4 A;  2HQE A;  2ZPF B;  3SHW A;  3JCM c;  5LJ5 g;  3SFM A;  4ZN1 A;  1WHG A;  3EHQ A;  2IIM A;  3M4Y A;  2HEQ A;  4RG2 A;  3CXC S;  3E19 A;  3HP9 A;  1YHQ Q;  4DBF A;  1WQW A;  2RJC A;  3G71 A;  4M77 B;  1O9S A;  5L8R E;  3EG3 A;  5I2S A;  1CSK A;  2RJF A;  2VGN A;  2EYX A;  1AD5 A;  4EMG A;  4J8O A;  3CCQ Q;  2DJZ A;  1K9M R;  2OX7 A;  4C5E A;  4A63 B;  3CPW A;  2LMJ A;  4IUQ A;  2EYW A;  2KDS A;  1ZSZ B;  3H0F A;  1W1F A;  4C0D C;  5LJ5 d;  2RK1 A;  3MEV A;  1ACM B;  5A2Q E;  4JLI A;  2GQI A;  3CCL T;  2E4H A;  2DA9 A;  1PNJ A;  3MP6 A;  5CAI A;  1E6G A;  4BI8 B;  1I1J A;  5KYU A;  4OGC A;  4FYY B;  1P92 A;  2MAM A;  3CCJ Q;  2DBK A;  1WIE A;  1W70 A;  3JCM f;  5KYN A;  1D0Y A;  3HHT B;  4M7A G;  2DVE A;  3EAE A;  4N0A A;  4HXJ A;  4AMC A;  4M77 F;  4E7K A;  4Z8A A;  2NYS A;  1OI1 A;  2OJ2 A;  1MNE A;  1VQN Q;  1Y71 A;  1BU1 A;  1JJ2 P;  3G4S A;  1RI9 A;  3M4G A;  2AZS A;  1M30 A;  1K4U S;  3A5Z B;  2VVK A;  2O88 A;  1VQO A;  1HJD A;  1I5L A;  1TSF A;  3C94 A;  3H8Z A;  5CK9 A;  3SWN B;  5A0D A;  2PVD B;  3C12 A;  5IN1 A;  2CSI A;  1UE9 A;  3VS5 A;  1ZX6 A;  3UF4 A;  3L42 A;  4F7U G;  3ASK A;  4RKU E;  5LJ5 f;  3OBW A;  3CCS T;  4C92 E;  2CT3 A;  4K11 A;  4N0A C;  4JJD A;  2CDT A;  3DB3 A;  5GAN 6;  2LNV A;  2D1X A;  1WXB A;  2JW4 A;  2OTL T;  2F69 A;  1D3B B;  2JTE A;  1AOJ A;  3A1P A;  2YWW A;  1ZUY A;  1FYN A;  5A0G A;  3PMI A;  1GFC A;  3PE0 A;  4E7S A;  2QXF A;  4M75 A;  3OSV A;  3HKS A;  1ARK A;  1VA7 A;  3QJY A;  2YRC A;  2HSP A;  1MV3 A;  1VQL Q;  5GAM e;  2EQJ A;  3GF5 A;  4PJJ A;  3EGX B;  3NTH A;  5CQY A;  4FSS A;  4M7D B;  2GTO A;  3BE3 A;  1YBY A;  3JB9 G;  1QP2 A;  3V8K A;  3TU4 K;  4J9B A;  1OEB A;  2OTJ Q;  3BY7 A;  2SEM A;  2XDP A;  1YFN A;  1K76 A;  2QTV A;  2J05 A;  1Y7X A;  2XU8 A;  5EG2 A;  1CKA A;  4NOY A;  1QKX A;  3BW1 A;  1LJO A;  2NUZ A;  2JMC A;  2KQW A;  3N5B B;  2CRE A;  4GY5 A;  5GAN 4;  1K9A A;  4BI3 A;  3OYF A;  3G6E T;  3VS1 A;  3JB9 H;  2CP5 A;  3M0S A;  3OYY A;  3PFS A;  3CCV T;  5AT1 B;  2LQK A;  1YWO A;  2QYZ A;  1QCF A;  3CCM A;  2ZPG B;  1VQK Q;  1IGQ A;  4M75 C;  4M77 E;  4ELZ C;  3RIR A;  2FPF A;  1D1B A;  1TU0 B;  1K1Z A;  4X9D A;  1R77 A;  2EVR A;  3HTR A;  5KYW B;  2J6K A;  2MCN A;  4M7D F;  1MND A;  2AKK A;  1JQQ A;  2DL8 A;  4ANJ A;  3I56 Q;  1OV3 A;  1AEY A;  4DA4 A;  2KBT A;  3OYA A;  2YUN A;  4M78 G;  1TXQ A;  2QQ9 A;  1VQ9 Q;  2QA4 Q;  1X27 A;  3EHR A;  3I9Q A;  4PJO C;  3MEU A;  1VQ6 Q;  1UJ0 A;  2L89 A;  5IXB A;  3QII A;  1N8R C;  2L0A A;  2H3E B;  2JXB A;  3CC4 Q;  3EG9 A;  3PVQ A;  3OS5 A;  1QVF A;  5GAN h;  1WZO A;  3FB9 A;  1KQS P;  2P0P A;  2XG8 D;  1B07 A;  2JVV A;  4MDX A;  1Y57 A;  2K4Y A;  3LGF A;  2LVM A;  4HCB A;  1Q81 R;  1J3T A;  3LWH A;  5GAN g;  2EQK A;  4IIO A;  3GLX A;  3OA6 A;  1SRL A;  4II1 A;  5HK3 A;  2HMA A;  3MEW A;  3CC2 Q;  1PRM C;  4PJM A;  3VS3 A;  1NJI C;  2DL4 A;  3SB2 A;  1Q7Y U;  3SEM A;  1R8O B;  4M75 D;  4HVW A;  1T3S A;  2C0I A;  3OW2 P;  1YI2 T;  1U06 A;  1IZ6 A;  3REB B;  1JEG A;  2V8J A;  3NMZ C;  3WVE B;  1YJN Q;  5KCH A;  2R57 A;  4D8D A;  4QVD A;  1D1C A;  2LX9 A;  3FJP A;  1HD3 A;  2HDA A;  4HT9 A;  2DD4 A;  2VB6 A;  3MKD A;  2CH4 A;  3OYH A;  2EKO A;  1N6A A;  3QZ5 B;  1FX7 A;  3LGL A;  1LCK A;  5GAN d;  1ABQ A;  1YHQ A;  2MOX A; 
#chains in the Genus database with same CATH homology
 3JRZ A;  3SWN A;  2HQX A;  4Y91 A;  3CME A;  2RK2 A;  4N4H A;  1MGQ A;  2RHU A;  3INZ A;  4LD6 A;  3JSC A;  3AHU A;  3QG1 A;  2QQB A;  4MDW A;  1PSE A;  2KAF A;  2K5F A;  4OB1 B;  4OB0 B;  3SDZ A;  4JDS A;  3JCM V;  1I81 A;  3TEE A;  4BI4 A;  1YHQ T;  1EIF A;  2D9T A;  3LH0 A;  1YCY A;  2ZZD A;  4BD3 A;  2XD0 A;  2K2V A;  1KHI A;  3LW5 E;  1Q81 C;  1Q86 C;  1VQM A;  4E7L A;  3CME T;  4C0F A;  4PJO G;  2ZPI B;  3FRN A;  2MF2 A;  5FLX E;  1WQ7 A;  3F70 A;  1G3Y A;  3VUZ A;  5GMK l;  4XTZ A;  3E9G A;  1LNX A;  4C8Q E;  3CCQ A;  2P0K A;  1VQ4 A;  2XID A;  1NPR A;  2K3Y A;  3DB4 A;  1RL2 A;  4D6W A;  2CKK A;  2EIF A;  1VQM T;  2E65 A;  4C8Q D;  3MET A;  2KY9 A;  1WGS A;  2VV5 A;  2BKD N;  2JOY A;  3OYE A;  1N8R U;  3G7Z A;  3EFR A;  3CXC A;  3CC7 T;  2GQV A;  1YIJ A;  5LJ3 h;  1VQ4 T;  1UEB A;  4F7U B;  3CCU A;  4M7A F;  4M7D E;  3EFS A;  3A8M B;  1I4K 1;  4BDZ A;  1O75 A;  1M90 C;  2ZCF B;  1QVF S;  4M77 D;  2B8A A;  4A54 A;  2R58 A;  4X9C A;  4OMF B;  3L2U A;  4PLI A;  2K5I A;  4Q5W A;  1JJ2 S;  2HD0 A;  1M5Q 1;  4LDY A;  5DLQ E;  3RKX A;  3VYG A;  4M7D D;  1YIJ T;  3A8H B;  3OQ5 A;  3CCJ A;  1BIB A;  3CCU T;  4FM4 B;  4KUD K;  2DD5 A;  2DKG A;  3NTI A;  1LOJ A;  3MCA B;  3GOX A;  2ZPH B;  3Q1J A;  3CBM A;  4QQ6 A;  5LJ3 g;  2DTI A;  5LL6 S;  3JCM h;  4C0D B;  4C8Q G;  1G3S A;  2VXF A;  3OBY A;  3CCR A;  2EJ9 A;  1KHC A;  2EYQ A;  3KUF A;  3UWN A;  3CCJ T;  2CZ0 B;  4ATO A;  3DKM A;  3SWN C;  3OB9 A;  1TH7 A;  2HNI A;  4BAC A;  3CCE A;  2QQS A;  5GMK h;  2H3J A;  2E12 A;  1N9S A;  2PUO B;  1VQN A;  3JCM J;  4P5N A;  5CO7 A;  4BE1 A;  4M7D G;  3CCR T;  2E6Z A;  3ME9 A;  3NFC A;  4ME7 A;  1ZHI A;  4C92 B;  2PVG B;  1WJR A;  2O01 E;  4RG8 A;  5CVI A;  4FL6 A;  1VQP A;  3JCM g;  2K57 A;  1WJS A;  2RB6 A;  4HA8 A;  2E6N A;  3QZ9 B;  3QUI A;  4IUP A;  4N4I A;  3TRE A;  5CCA A;  1X75 C;  3FIF A;  5CKB A;  4M75 B;  4BY6 B;  4LDV A;  4DQ2 A;  4C0Z A;  5GAN f;  1VQN T;  5GAM f;  3FDR A;  3QO3 A;  4PLL A;  1Y96 A;  1QP3 A;  5J3B A;  4CI0 C;  1XQH A;  3M56 A;  2DK3 A;  3KBG A;  2G3R A;  4O6J A;  3PMT A;  1S72 T;  1VQP T;  3C95 A;  4L5G A;  1Q82 U;  3E9F A;  1BI3 A;  2CZ6 B;  1K9M C;  4A53 A;  5J39 A;  1W4S A;  2QI2 A;  4F7U F;  2EAY A;  2KK4 A;  1M1K C;  4IUU A;  2DXU A;  5LJ3 d;  3OYL A;  4LD9 K;  2JZ2 A;  3QXE B;  5GAN 5;  4F7U A;  1YJW T;  4A4H A;  4C5I A;  1KQ2 A;  3A8L B;  4BDY A;  2WAC A;  3VUB A;  2XK0 A;  3VYH B;  5CKH A;  3ZFJ A;  5GAN 2;  1FXX A;  4OVA A;  3PIO A;  3CD6 A;  4HCZ A;  3VV0 A;  2XHC A;  1BKB A;  3QDR B;  5HY6 A;  3FEO A;  3CCS A;  1K73 C;  5GAO q;  1KQS A;  1VQ7 A;  4XTY A;  2L8D A;  2M16 A;  3BFM A;  3CMA T;  1BYM A;  3RES A;  4E7J A;  1G3T A;  3BDU A;  1M8V A;  2Y4X A;  3JB9 I;  3OYI A;  3DLM A;  2QQA A;  5LJ5 h;  1UB4 A;  2LQ8 A;  2DPP B;  3CD6 T;  4PL6 A;  1Q86 U;  2VXE A;  2RHZ A;  1Q81 U;  3JCM b;  3OS1 A;  2FYK A;  1VQ7 T;  3CPF A;  2E5Q A;  3J7A F;  1VIE A;  3BDL A;  4J5Y A;  3L2R A;  1XOV A;  3QYH B;  1YJ9 T;  4LDX A;  3JCM W;  2JNG A;  3MP8 A;  2GFU A;  3M53 A;  4Y28 E;  3L2W A;  3S3O A;  4J83 A;  3V7S A;  2RHY A;  2WSE E;  4O5V A;  2EJF A;  5DLO A;  3T9N A;  3PTA A;  1ZBX A;  1UGP B;  1UGQ B;  4XK8 E;  2ZPB B;  5GAN j;  4M75 F;  2HQE A;  2ZPF B;  4XAX B;  1VIF A;  4C92 A;  5GAM j;  3JCM c;  5LJ5 g;  1OZ3 A;  3P8H A;  3LLR A;  4PJO D;  2RHX A;  3SFM A;  4ZN1 A;  3HRU A;  1M1F A;  1W2B A;  2X4X A;  3JB9 F;  2FVU A;  4ZTF A;  3M4Y A;  1M1G A;  4RG2 A;  3CXC S;  3E19 A;  3OW2 A;  5KH6 A;  4TVR A;  3HP9 A;  4M78 B;  4ZGD B;  3L2V A;  1WQW A;  4DOW A;  1VQL A;  4XU3 A;  2K3X A;  2RJC A;  2QTX A;  4OF1 A;  4OP0 A;  4PNO A;  3M9Q A;  2X4W A;  2MWP A;  3G71 A;  3OS2 A;  3DLL A;  3GPL A;  4M77 B;  4RCC A;  1O9S A;  5L8R E;  1JBM A;  2RM4 A;  4IUR A;  5I2S A;  2XI9 A;  3P8B B;  5GAN 7;  1VQL T;  5CKD A;  2DXT A;  3OYB A;  2RJF A;  2VGN A;  4JRK A;  2KMT A;  2EJG A;  4OB3 B;  3G71 T;  4EMG A;  4EMK B;  2OTJ A;  4QW2 A;  4J8O A;  1X01 A;  3CCL A;  2IG0 A;  4MZP A;  1Q7Y C;  2DJZ A;  5KE3 A;  4C5E A;  4ZTJ A;  3CPW A;  4J6Y A;  4M7A E;  2E1H A;  4R56 A;  1K8A C;  1M9S A;  2A7Y A;  2KDS A;  4IUQ A;  2YHT A;  2FHD A;  4GLK A;  3OMC A;  4DOV A;  5D6Y A;  5M9O A;  2CZ1 B;  2KSS A;  3RMQ A;  4C0D C;  5LJ5 d;  3CCV A;  2RK1 A;  3MEV A;  3A8O B;  3CCQ T;  3R6O A;  5A2Q E;  4JLI A;  5LJ3 f;  3J80 E;  3CCL T;  3OYC A;  3SD4 A;  1NPP A;  2RI2 A;  3MP6 A;  5CAI A;  2DEQ A;  3PT9 A;  4BI8 B;  2M1H A;  3QHS A;  4OGC A;  1QVG A;  4M7A A;  4NL3 A;  1JB0 E;  1P92 A;  2HBP A;  3V8J A;  2MAM A;  3ZEH A;  5FRM A;  4C92 C;  5GAO m;  4A4K A;  1VQK A;  5GAN 3;  4M78 F;  2RI3 A;  3MHX A;  4EPC A;  3JCM f;  3RKW A;  4XTX A;  2P4T A;  4L6V 5;  5IAY A;  3HHT B;  5FU6 B;  4M7A G;  2DVE A;  3EAE A;  4M78 A;  1ZQ1 A;  3A8G B;  4QQD A;  4N0A A;  4BB7 A;  2ZGW A;  1QVP A;  2O4X B;  5GAO p;  4M77 F;  1NJI U;  2BIV A;  4E7K A;  3JB9 J;  1VQK T;  2RJE A;  5FU7 C;  3QSU A;  2DIG A;  3CBP A;  3OS0 A;  1OI1 A;  5I21 A;  3I56 A;  3JAM E;  4XU0 A;  1Y71 A;  1KQS S;  2DTH A;  1X6O A;  3G4S A;  3E1S A;  2NLU A;  4LDW A;  3CCE T;  2EFI A;  2RHI A;  1VQ9 A;  2QA4 A;  4JRQ A;  3M55 A;  3M54 A;  3M4G A;  4PKC C;  4F7U E;  3HRS A;  1VQ6 A;  5FRO A;  4EMK A;  3A5Z B;  2CZ7 B;  4YTL A;  1H3Z A;  3G4S T;  4OB2 B;  5LJ3 j;  2MI6 A;  3OYK A;  1VQO A;  2VUB A;  2GCX A;  2D6F A;  5KCO A;  4XU1 A;  5A0L A;  3CC4 A;  1VQ6 T;  2LCC A;  2F5K A;  1BI2 A;  2R5M A;  2E64 A;  3UT1 A;  3PGG A;  5GMK i;  2OAU A;  4R55 A;  1I5L A;  2X4J A;  3NTK A;  1W2B S;  1VQO T;  4M7A C;  5DM7 R;  5LJ3 e;  4PJO B;  3C94 A;  3H8Z A;  4N4G A;  3OW2 S;  1KG1 A;  5CKE A;  5CK9 A;  1JRI A;  2GF7 A;  3SWN B;  3CC4 T;  5A0D A;  2PVD B;  3C12 A;  5IN1 A;  2PUK B;  4L59 A;  4B9X A;  3KXT A;  3X24 B;  4JRI A;  3TCJ A;  5DY9 A;  3L42 A;  1KD1 C;  2F5T X;  3C4S A;  3MP1 A;  4F7U G;  3ASK A;  4BE2 A;  4RKU E;  5LJ5 f;  1KC8 C;  2OTL A;  1N27 A;  3OBW A;  4IUT A;  2CYZ B;  4C92 E;  5KE2 A;  3CCS T;  3LWI A;  4M78 C;  4J7I A;  2VYT A;  5GMK j;  2LDM A;  4N0A C;  1VQ5 A;  3DB3 A;  4KUL A;  3CC2 A;  2E41 A;  5GAN 6;  4OGE A;  4M75 E;  1Y07 A;  2LNV A;  2MWO A;  5J26 A;  3X20 B;  3JCM e;  2DZC A;  3M5A A;  3RMS A;  4C92 D;  5GAO l;  3L1A A;  3L2Q A;  3M59 A;  5CKF A;  3S6W A;  1XNI A;  2F69 A;  3OYG A;  4LDU A;  2HAX A;  2OTL T;  1D3B B;  4E47 A;  3QJ6 A;  3X26 B;  4QVZ A;  4XTV A;  1HK9 A;  2FL7 A;  1PSF A;  1RI0 A;  3CPW S;  1AHJ B;  2XIC A;  3UDC A;  1N9R A;  3PMI A;  5A0G A;  3CC2 T;  4FT2 A;  1OZ2 A;  2JUF A;  2QXF A;  4M75 A;  2DO3 A;  1YJN A;  3CEY A;  3OSV A;  4C8Q B;  3P8D A;  2R5A A;  3HKS A;  4EMK C;  4FT4 A;  3OYD A;  2BUD A;  3QJY A;  1M90 U;  3JCM X;  1B34 B;  4JS4 A;  1I8F A;  1IRE B;  4C5G A;  3S3N A;  5GAN e;  2EWN A;  5GAM e;  3JCM Q;  3HRT A;  2X35 A;  4C92 G;  2EQJ A;  2X4Y A;  3GF5 A;  4J6W A;  5CIU A;  2JTM A;  2DIQ A;  4MML A;  5D6W A;  4J7F A;  3NTH A;  5CQY A;  3L2Z A;  1KQ1 A;  4M7D B;  2KVQ G;  2WSF E;  1VUB A;  2DZ9 A;  4M75 G;  4PJO F;  2PU9 B;  1GXI E;  5CR2 A;  1YBY A;  2JTF A;  3JB9 G;  1QP2 A;  3PIP A;  2P0Q A;  4EMH A;  3V8K A;  2LT4 A;  4B9W A;  3TU4 K;  2ZPE B;  4BE0 A;  4HKE A;  1G3W A;  4V2S A;  3BY7 A;  3I55 A;  2XDP A;  3G6E A;  5LJ5 j;  2E70 A;  5GAO r;  2M9U A;  2XU8 A;  3QYG B;  1Y7X A;  4FU6 A;  5EG2 A;  2DXB A;  3GNG A;  4NOY A;  4XQ3 A;  2Y4Y A;  3BW1 A;  1LJO A;  4HT8 A;  2KQW A;  3N5B B;  2OTJ T;  4M7A D;  4GY5 A;  5GAN 4;  1QW1 A;  5FU6 C;  4BI3 A;  4KT0 E;  3I55 T;  2D0Q B;  3OYF A;  3LYI A;  4ZGJ B;  3G6E T;  4FSX A;  4CRI A;  3HSB A;  5LJ5 e;  1Y96 B;  3CC7 A;  2QDY B;  3JB9 H;  3VU3 C;  3OYY A;  3PFS A;  1BIA A;  4M78 E;  3CCV T;  4RCB A;  2EQU A;  4ZN3 A;  1D3B A;  2LQK A;  1K9M U;  3OSS C;  4QVC A;  3WXM B;  4C8Q F;  3CCM A;  1M1K U;  4M78 D;  2ZPG B;  4BY6 C;  1H64 1;  4M75 C;  1UGS B;  4M77 E;  4ELZ C;  2I2L A;  3RIR A;  2GFA A;  4X34 A;  4C8Q A;  1XTD A;  3RKY A;  2DXC A;  4X9D A;  3WVD B;  2RO0 A;  1B34 A;  4Z02 A;  1K73 U;  3CCM T;  4WF2 A;  4M7D F;  3M58 A;  4A4F A;  2DAQ A;  5AYF A;  3H6Z A;  4M77 A;  4A4G A;  4UC4 A;  3V7R A;  1KD1 U;  2PVO B;  4DA4 A;  4M7D A;  2RJD A;  3OYA A;  2AHJ B;  3X28 B;  3CBO A;  1KC8 U;  1WPY A;  4M78 G;  2CGH A;  2VC8 A;  2QQ9 A;  4MZM A;  3I56 T;  4PJO C;  2CS7 A;  3HFO A;  2DTO A;  3OYM A;  1YIT A;  5FRN A;  3HPW A;  4XU2 A;  3MEU A;  2E10 A;  2EQM A;  1VQ8 A;  3LX7 A;  4QQG A;  4E7H A;  4ZGE B;  2LC4 A;  4M77 G;  2L89 A;  1QVG S;  4MZT A;  1VQ9 T;  2QA4 T;  3QII A;  2IVW A;  3M57 A;  2LCL A;  2YLB A;  1N8R C;  4VUB A;  2QQR A;  4RMO A;  5IT9 E;  3RER A;  3HL8 A;  1S72 A;  3GNF B;  2XDD A;  3QBY A;  3S3M A;  1YIT T;  1WJQ A;  1VQ8 T;  1U1T A;  3OS5 A;  5HKC A;  2WSC E;  1QVF A;  1BI1 A;  3ER0 A;  3RUX A;  5GAN h;  2A3L A;  5GAM h;  1JJ2 A;  1SSF A;  3FB9 A;  1U8R A;  4JUV A;  2P0P A;  2PQW A;  2XG8 D;  3QKJ A;  2M0O A;  2MMP A;  2RH2 A;  2Y90 A;  2JVV A;  2L3R A;  3QPH A;  1YJW A;  5GMK m;  4JLG A;  5CQX A;  2RD1 A;  3ZBD A;  4C0G A;  1G5V A;  4IKF A;  4MDX A;  2K4Y A;  5FU7 B;  3LGF A;  5C0M A;  2LVM A;  3O8V A;  4JS5 A;  3HFN A;  4XTW A;  4HCB A;  3FLG A;  3FC3 A;  3MEA A;  5I2M A;  3LWH A;  3CMA A;  4KBM B;  4C8Q C;  5GAN g;  2EQK A;  2VGM A;  3GLX A;  2LRQ A;  5GAM g;  4II1 A;  4J6X A;  3OA6 A;  4BUG A;  5HK3 A;  4MMK A;  3V7C A;  1YI2 A;  3GP8 A;  2XKO C;  1HXD A;  3MEW A;  1M4Z A;  2O4X A;  4NL2 A;  1DJ7 B;  1NJI C;  3SB2 A;  1Q7Y U;  5D6X A;  3VJP A;  4KUI A;  3OYN A;  1R8O B;  4M77 C;  1OYX A;  1K8A U;  4M75 D;  5GAN 8;  1YJ9 A;  1BI0 A;  4M7D C;  2K5L A;  5GMK e;  1VQ5 T;  3OYJ A;  2L5Q A;  2FB7 A;  1YI2 T;  3JB9 D;  4C5H A;  1IZ6 A;  1U1S A;  1WNL A;  3JCM d;  2XDB A;  5HK0 A;  1NZ9 A;  2V8J A;  3GIB A;  4JRP A;  3WVE B;  2V8I A;  2V8K A;  2RA2 A;  3JCM P;  5KCH A;  2C06 A;  4HCC A;  2R57 A;  4ELY C;  4QVD A;  3PNW C;  2LX9 A;  2JN0 A;  3FJP A;  1UGR B;  3MO8 A;  4XTU A;  4M7A B;  4HT9 A;  2DD4 A;  4C92 F;  1Q82 C;  4FIB A;  1MHN A;  3X25 B;  1NE8 A;  1V29 B;  2EKO A;  3J81 E;  3OYH A;  5GAO n;  4E7I A;  4PJO E;  3UPU A;  1YJN T;  4NS5 A;  2QEX A;  4EDU A;  3VKI A;  1N6A A;  2RI5 A;  2YLC A;  4JJN K;  2LT1 A;  3QZ5 B;  1FX7 A;  3LGL A;  4IUV A;  5GAN d;  3V8L A;  4A4E A;  5GAM d;  2YRV A;  1FWZ A;  2LTO A;  3OMG A;  3OY9 A;  1YHQ A;  3URG A;  5C6S A;  4PJO A;  2QEX T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...