1XNIA

Tandem tudor domain of 53bp1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
118
structure length
118
Chain Sequence
SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tumor suppressor p53-binding protein 1
publication title Methylated lysine 79 of histone H3 targets 53BP1 to DNA double-strand breaks
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 24
structure length 118
sequence length 118
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2004-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1xniA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1xniA01
3CC2T 3M9QA 3CXCA 3P8DA 5CIUA 3KBGA 2DIGA 1YJNT 2QEXT 2EQKA 3E9FA 3MP1A 3DLLA 4RG2A 2DAQA 3H8ZA 3FEOA 1VQNT 1YI2A 2QQSA 2BUDA 2XHCA 3LGFA 2R5MA 1UEBA 3QKJA 1VQ8T 2D9TA 3Q1JA 3FLGA 1JJ2S 5HY6A 3OYKA 2P0KA 4NS5A 4BDZA 4N4GA 3CC7A 4N4IA 2MWOA 3CCST 2OTLT 3J80E 2EQJA 3DB3A 3CCQT 2MWPA 4UC4A 2E70A 1K9MU 2O4XB 1SSFA 4N4HA 2LTOA 4C5EA 2EQUA 3CCUA 1VQ7A 5J3BA 3GOXA 3OW2A 2EKOA 3JAME 1OZ2A 3CCET 3I55A 2L8DA 2LQ8A 3OYJA 5LL6S 1YJ9A 3OA6A 4BE0A 4PLIA 3QBYA 3CCMA 1OYXA 2NLUA 4E7IA 1NPPA 1YJNA 1W2BA 2QEXA 3PNWC 4C5HA 2K3XA 4A4EA 1KHIA 4C5GA 3CCVA 1VQOT 1Q7YU 3CPWA 1N8RU 1KQSA 2E5QA 4QQDA 2RHIA 3PMIA 4PL6A 3CMEA 1VQ9A 2JOYA 3I56A 2PQWA 2R5AA 3OS0A 2OTLA 5D6XA 3P8HA 1RL2A 3LLRA 3CCUT 1VQ7T 2RJFA 2RHXA 3L42A 1OZ3A 2WACA 2X4XA 3SD4A 5KCHA 3I55T 1KD1C 1VQPT 1WGSA 2OTJT 2M1HA 3CMAA 1Q82U 3CEYA 5KCOA 5D6WA 1K9MC 3J81E 1YITA 3QIIA 3OYAA 3CCMT 1QVGA 2VYTA 1YJWA 3OYHA 2E6ZA 3OYDA 3OYIA 3OMCA 1NJIC 2EFIA 1VQKT 3L2WA 3OMGA 4FU6A 3NTIA 2DIQA 3L2RA 1KC8U 4BD3A 3CCVT 4CRIA 3FC3A 4IKFA 4IUPA 3HKSA 1VQOA 1M1KU 3F70A 3CMET 5FRMA 5FLXE 1VQ9T 3CCRA 5D6YA 3I56T 2GF7A 2JTFA 2E6NA 1KD1U 1Q7YC 1N8RC 2B8AA 4FL6A 3NTHA 3L2UA 2QA4T 3LGLA 3MO8A 3O8VA 2RHZA 1NPRA 1K73U 1YBYA 4IUVA 1NJIU 3CMAT 3CC4A 5KE2A 1VQPA 1WJQA 2OTJA 2M0OA 1YITT 5J39A 4Q5WA 1NZ9A 3ASKA 1YJWT 2GFAA 4E7KA 4L59A 3CXCS 4LD6A 4A4GA 2LRQA 3S6WA 1VQ5A 3MEUA 4QQ6A 1Q82C 1VQKA 3MEVA 2L3RA 1YIJA 3ZEHA 5DM7R 2BIVA 1YHQA 3DLMA 4BACA 3FDRA 3MEWA 1KHCA 3DB4A 4BE2A 3S3OA 4II1A 3CCRT 2GFUA 4EDUA 3KUFA 4QW2A 1KC8C 3OYNA 3OYEA 2RJEA 4ZTFA 1VQ4A 1M1KC 1WJRA 2FHDA 5DLQE 2JNGA 4E7HA 3P8BB 3J7AF 2JVVA 3LH0A 1JJ2A 5KH6A 2QA4A 3PMTA 2DO3A 2CKKA 1Q86C 2YRVA 1BKBA 1QVFA 2RJCA 2O4XA 4C5IA 2KVQG 3CC4T 3OW2S 5IAYA 3H6ZA 2JUFA 2BKDN 3BDLA 2LDMA 3NTKA 4E7JA 4Z02A 3PFSA 2RJDA 4ZN3A 2EIFA 3S3MA 1K73C 4E7LA 1IZ6A 1EIFA 1VQ5T 2IG0A 1VQ6T 4PLLA 1W2BS 1XTDA 3G4SA 3E9GA 5J26A 1YIJT 3OS1A 3CD6A 1YHQT 1M1GA 5C6SA 1N27A 2HQEA 3LX7A 3CPWS 3MP8A 3UT1A 3META 1KQSS 3OYCA 1Q86U 4QVZA 2EQMA 2X4YA 3MEAA 4IUQA 3CPFA 2F5KA 1VQ4T 1OI1A 4YTLA 3EAEA 3TREA 1VQLT 3CCJT 2RI5A 2RHUA 4A4FA 2X4WA 1M90C 3ME9A 4IUUA 4A4HA 3QJ6A 5KE3A 2KDSA 1QVFS 4B9XA 3OYLA 3A5ZB 4OVAA 2R58A 3PIOA 3G6EA 5IN1A 2JZ2A 2RI2A 2R57A 4B9WA 3OY9A 2QQRA 3G71A 2LVMA 1RI0A 3ER0A 3CCLT 1QVGS 4X34A 2MI6A 3OB9A 3OYFA 1VQMA 4HCZA 3OYMA 4TVRA 1VQ6A 3G4ST 3CD6T 5C0MA 3OYBA 5M9OA 2RI3A 3C4SA 4ZN1A 1S72A 2LCCA 3CC2A 2HQXA 5FRNA 2M16A 2RO0A 2XDPA 1M90U 1Q81C 1H3ZA 2X35A 3OQ5A 3OS2A 3OYYA 3OYGA 4ZTJA 1YI2T 1K8AC 1VQNA 1G5VA 5IT9E 1WJSA 1VQLA 3CCJA 1VQ8A 1XNIA 4BE1A 2RHYA 3CC7T 2LCLA 1MHNA 1X6OA 3L2QA 3PIPA 2L89A 3G6ET 4IURA 2XK0A 2G3RA 3CCSA 4GY5A 3L2VA 3G71T 3LYIA 3CCQA 3S3NA 5A2QE 3CCLA 4IUTA 1VQMT 2K3YA 1Q81U 4QQGA 4BDYA 3CCEA 3UWNA 3MP6A 1YJ9T 1S72T 1K8AU 5FROA
chains in the Genus database with same CATH superfamily
1RAIB 5IHNA 1B34B 1CSKA 1LCKA 3CXCA 3VUBA 1IB8A 5LJ3g 4GLKA 1QCNA 2DIGA 1KSWA 5CK9A 4JUVA 3THKA 2HBWA 3MP1A 4M75D 4F7UB 1SPKA 2DXTA 1ZQ1A 3H8ZA 2DEUA 2DTOA 2JM9A 3LGFA 1JQQA 3LWIA 4Y92A 1A0NB 3PE0A 4OMNA 1VQ8T 4C0FA 1W6XA 5IH2A 3EH2A 3X26B 2ZAEA 2A08A 4C92G 1WXUA 3CC7A 2DM1A 2G6FX 2KY9A 2KXCA 2MWOA 2PUOB 3CCST 1TU0B 4O6JA 5GMKe 1B3QA 3EG3A 4RTTA 1I5OB 2VXFA 1SRLA 2E65A 2DFUA 4L5GA 2EQUA 1TH7A 4EMKA 3M58A 1WA7A 2XU8A 1J3TA 2D6FA 2PUKB 2J6OA 2CH4W 5GANd 2E1HA 1ZX6A 2P4RA 3JB9D 3OYJA 3C95A 1D3BB 1RADB 3VS1A 4BE0A 1G3SA 1RAAB 2CP3A 3CCMA 1Y71A 2DA9A 2HZYA 3URGA 2K5LA 4E7IA 2FG0A 1NPPA 3JCMP 4J8OA 1UGPB 2HD0A 1RACB 4M7AA 1K0SA 2HMAA 4VUBA 1AWXA 2EGAA 4OMOA 1CKAA 1Q7YU 3CPWA 1M3AA 3REAB 1N8RU 1KQSA 2EAYA 4QT7A 4C92E 4FSXA 1BCOA 3REBB 1VQ9A 2VC8A 4M77B 2M9UA 4XTUA 1MMAA 5D6XA 1U06A 4J9CA 2CS7A 2JT4A 1RLPC 2MIOA 1FMVA 2VASA 2YRDA 4EPCA 2D1XA 1NLOC 3GBQA 2RJFA 2HBPA 1UG1A 1EFNA 1QVPA 4FYWB 3SD4A 5GAOq 4OGCA 3QYHB 1I8FA 2OTJT 2M1HA 3OS5A 3CMAA 1W2BP 4WF2A 1Q82U 3BE3A 1AD5A 1OQKA 4GLMA 3C12A 2LCSA 5D6WA 5I22A 1RUWA 1OPLA 3QIIA 2BZYA 1SHFA 4Z8AA 4HT9A 2FPFA 3OYIA 2MF2A 1UJYA 1BI0A 2V1QA 3OMCA 3M0QA 4AT1B 2J6KA 3OMGA 5L23A 3FJPA 4XU3A 4IKFA 4IUPA 3AHUA 1M1KU 4ORZA 2HDAA 2GTOA 3CMET 4ZGJB 1ZA1B 2EYYA 3I56T 4CC2A 3QZ5B 4XTWA 4BI8B 5GANf 2IVWA 2C0IA 4PNOA 4C0DB 4C8QB 1EX4A 4JS4A 2CZ0B 4JRKA 3LGLA 3MO8A 2KRSA 1YJ9Q 4E7SA 1QVGP 4J83A 3I5RA 3VU3C 1JBMA 1WJQA 2AT1B 3V7RA 2OTJA 5LJ5j 1X2KA 2HAXA 1BIBA 1FMWA 5FWCA 1W70A 2ED1A 1YJWT 4E7KA 4ESRA 4L59A 3CXCS 3RKXA 3HFOA 1ARKA 1M4ZA 4M7AD 4M78D 1B34A 4QQ6A 2DLPA 4A4KA 1P92A 3RKYA 1GCPA 2PZ1A 3EH1A 2OX7A 1ACMB 1YIJA 2E10A 1YHQA 1BI3A 4F7UA 1ZSGA 1N9SA 3FDRA 5I21A 5FWBA 3ULRB 4LD9K 4II1A 1X75C 2GFUA 2SRCA 3OYNA 1D1BA 3OYEA 2DXBA 4MMLA 4PJOF 2YRCA 4Z88A 4JS5A 4HCBA 2OI3A 3A8GB 3CCEQ 2L5QA 2JVVA 3I9QA 1YN8A 1BKBA 4LDWA 4ZNXA 1M3CA 1KD1R 4KGZB 4C5IA 2DEQA 5GMKj 2CSQA 2FYKA 1OU8A 3EFRA 5GAN2 4JPBW 2P0PA 1ZA2B 2D8HA 2ECZA 2A36A 1U8RA 1QCFA 2CT4A 1FWZA 1D3BA 1K73C 1BI2A 4KGVB 2X3WD 2PVGB 2YLBA 4DBQA 3V7CA 2DVEA 5CKHA 3G4SA 5J26A 2GQIA 3TEEA 3PGGA 4XQ3A 2HQEA 3A98A 3LX7A 3CPWS 3HHTB 2KGTA 1KQSS 1B7TA 5FU7C 1Q86U 4E7ZA 2EQMA 4IUQA 3MEAA 3SB2A 4J5YA 3DKMA 3HPWA 2YUNA 1QVFP 1U5SA 3CCUQ 3TVTA 1Q7YR 2F5KA 1WQWA 1WI7A 1VQ7Q 1OI1A 2DYIA 4QKUA 3R6NA 1N8RR 2WSCE 4M75F 2A37A 3EAEA 1R8OB 2RI5A 2RHUA 3VS2A 4WCIA 4F04B 2F2XA 3EG1A 3QJ6A 4MZPA 4E47A 3JCMW 2O88A 4C92D 4OVAA 4X9DA 2LNHB 5IN1A 4B9WA 3A8OB 4RG8A 3EG2A 2LVMA 2XD0A 4M75E 1D1CA 2C0OA 2JMCA 5HKCA 5IHIA 1Q82R 2QI2A 3CD6T 1M8MA 4DEYA 5KYUA 5GAOl 2RI3A 1BBZA 2QQAA 4XTXA 5CQXA 1OX9A 1QMCA 2KR3A 3HRUA 2L0AA 5GAN8 2EW3A 3NPFA 2J06A 2RA2A 3A1PA 2FPDA 3OQ5A 1M1KR 4KGXB 2CREA 1AT1B 4KUDK 2DZ9A 2CZ1B 2DX1A 4F14A 4RMOA 3QO3A 2LCLA 5LJ3j 1X6OA 5KYXB 5GANe 4M7DF 3JV3A 3O5ZA 1K1ZA 2G3RA 2ZPBB 3L2VA 2EYQA 5KYNA 1H641 3G71T 1MV0B 3CCQA 4JLIA 1UDLA 4OB1B 3JB9H 3JB9J 2L3QA 5GAMd 9ATCB 2H3EB 3M54A 2ZPIB 4JJCA 4M7DE 3CC2T 4A63B 3P8DA 3D7SB 1G2BA 2AZSA 1YJNT 2QEXT 5CQYA 3EFSA 3DLLA 2JM8A 4RTZA 1VQNT 1AVZC 2X3XD 1TUCA 2BUDA 3EHRA 2R5MA 2QGFB 3CBMA 2FPEA 3CC4Q 3QKJA 1Y96A 2EJ9A 1SHGA 2KYMA 3Q1JA 5IXFA 4LUEA 3OYKA 1D0ZA 2RM4A 2KI7A 3TSWA 1WPYA 4M77C 4DBHA 3JCMX 4ME7A 1IREB 2OTLT 1T3SA 1D09B 1LVKA 1H3HA 2MWPA 1TXQA 3M4GA 4N4HA 2H8HA 2LTOA 2CP0A 4BY6B 4XU0A 3CXCP 3OW2A 3QG1A 2ZCFB 2DYBA 5GJVB 2L8DA 2X4JA 3I55A 3PVLA 2LQ8A 5FW9A 4AFQC 5LL6S 1GRIA 4PLIA 3NHNA 1TSFA 2E3IA 3JSCA 1VQ4Q 1VOMA 1OYXA 2O31A 2NWMA 2XI9A 1IHWA 1NYGA 4J9HA 4K11A 2E4HA 3C0CA 1YJNA 5FU7B 3L2ZA 3PNWC 2QEXA 5L8RE 2F69A 2DPPB 2EYWA 1VQLQ 4KULA 5FU6C 4C5HA 2ESWA 3VS3A 4M7AF 4M78F 2YHTA 3VS4A 2XKOC 4PFZA 2J05A 3CCVA 1NM7A 3LWHA 4MDXA 4RUGA 2DTIA 3M53A 1PKSA 3PMIA 2KEAA 2DL3A 3AT1B 2DXUA 3QJYA 5GAMf 4XU2A 3CCLQ 3OS0A 1BU1A 1I0CA 4C8QC 2OTLA 5HK3A 5LJ5e 1UJ0A 2NUZA 4M7AE 2QYZA 4PJOC 1X69A 3JCMh 1K9AA 1OZ3A 3E19A 2DD4A 1WGSA 3HL8A 2FZCB 3IQLA 3CEYA 1K76A 4KUIA 1SKUB 1YWPA 3HRSA 1AOJA 3ZL7C 1YITA 3CCMT 2CP2A 4CI0C 2MCNA 3CPWP 3OYHA 3OYDA 2KBTA 1FXXA 1KQSP 2OAUA 3JCMc 1NJIC 2EFIA 3TU4K 4FU6A 3NTIA 3M0UA 1V76A 3L2RA 4AG2C 2DILA 2EQIA 2KT8A 4CRIA 3CC7Q 1OEBA 3HKSA 1YNZA 5GAMg 3G6EQ 4J9EA 5GAOm 1V29B 1NYFA 1VQ9T 3CCRA 5D6YA 3I5SA 3UATA 2GF7A 1SF9A 3GNFB 2E6NA 1UTIA 1KD1U 1JRIA 5KYXA 1EZZB 1SEMA 3L2UA 2FZKB 4GBQA 1K4US 3A8LB 3VRZA 1IXDA 1WFWA 2FRWA 5GANj 1K73U 3R6OA 4IUVA 4DOWA 3CMAT 5KE2A 3NMZC 4F7UG 5DLOA 1G3WA 2ZGWA 4C92F 2GFAA 1BIAA 1C0MA 2MMPA 1D1AA 4V2SA 3QWXX 2LRQA 3CBPA 1VQ5A 1VQ8Q 1TWBA 3SEMA 2PU9B 3VS5A 4JDSA 2XG8D 1X01A 1OPKA 3BDUA 2DZCA 1U3OA 2DL7A 3RR6A 5GAN6 2A3LA 1NEGA 4IIOA 3CCSQ 4L6V5 2LX7A 1KHCA 2CT3A 4ELYC 4M7DD 2RH2A 2IPOB 3KUFA 1OU9A 2JTMA 1KJWA 2KRMA 1WLPB 2A28A 1VUBA 2LT4A 3EG9B 3EGDB 1WJRA 2FHDA 2JNGA 2MYSA 2HSEB 1AWWA 2QASA 3CMAQ 2K4YA 1AWOA 1Y07A 1FMKA 4CC7A 3G7ZA 2EWNA 3M5AA 1UGQB 2KVQG 3OW2S 3A8HB 3QHSA 1HYOA 2CZ6B 2LNVA 5CO7A 1NE8A 3FB9A 2LDMA 3WVEB 1F1BB 4Z02A 3PFSA 2RK1A 2RJDA 4ZN3A 2EIFA 2EGEA 3U23A 4AFZC 1I5LA 3JCMQ 1WHMA 1VQ6T 3JCMV 4PLLA 1XTDA 2Z0WA 5FU6B 1YIJT 2LP5A 2DJZA 4M77G 5AT1B 1YHQT 1M1GA 1ZUUA 3H9NA 5C6SA 2RF0A 1GBQA 2VKNA 3JCMb 3UT1A 3META 3OYCA 2YLCA 3HFNA 1O75A 5LJ3e 1MUZA 4NOYA 2FL7A 3H41A 1OV3A 1W4SA 2KNBB 4FYXB 4R0KA 2FVUA 2OTJQ 3PT9A 3TREA 3CCJT 3JCMd 3X24B 5CKBA 1M90C 1GCQC 4PJOB 2O2OA 1JEGA 2KDSA 5KYWA 2CDTA 2YDLA 3OYLA 2EPDA 2R58A 1RLQC 2QQRA 1H92A 4X1VA 2CUDA 4OGEA 1YIJQ 4XK8E 3M0PA 3V8KA 1PHTA 2MI6A 3OB9A 4PJNA 3M59A 5EC7A 1VQMA 5KYYB 4TVRA 1MMNA 2ROLA 3G4ST 1VQ6A 3CMEQ 3GLXA 2MOXA 5GAMh 1S1NA 1GBRA 3I56Q 1LJOA 1S72A 4HKEA 1WHJA 4C8QG 3RDVA 2HQXA 2FRYA 2YSQA 4JLGA 1Q81C 1H3ZA 2DXCA 2GQVA 1YI2T 1K8AC 1BYMA 5IT9E 4RTXA 5GAN3 4M78C 4OMLA 2X9HA 3CCJA 4LDXA 4PFPA 1Y57A 1ZUKA 2KSSA 4M75B 7AT1B 4BE1A 3JB9I 1ZBXA 1YCYA 2RHYA 1MHNA 2VV5A 1TTHB 1YJWQ 1MMDA 2L89A 1QP3A 4GY5A 1R0CB 4WTOB 3BY7A 1K73R 1PD0A 5CKFA 4BY6C 1RAFB 2RQUA 3EGUA 1PRLC 4LXCA 8AT1B 2MK5A 3OBWA 4HA8A 4BI3A 3EFOB 4QQGA 3M57A 3UA7A 3OBYA 3CCEA 2AKLA 2JMAA 1G83A 2HSPA 2KROA 2CP7A 4PJLA 2PVOB 2DJQA 2KT1A 3M9QA 1GL5A 1D0XA 1QQJA 3JCMf 3VS6A 1Q95G 1LOJA 2EQKA 4B6MA 4MZMA 1V1CA 4JJBA 4DBFA 1UB4A 2EJFA 2JN0A 4RG2A 2DAQA 1YI2A 3GF5A 4M77A 5IHKA 1UEBA 2O9VA 2P84A 3EG9A 3EGDA 3FLGA 4JRIA 5HY6A 2ZZDA 4HVVA 1SSHA 3INZA 4BDZA 2K2VA 5I2SA 2V8KA 4N4IA 1I07A 1TS9A 3J80E 1RABB 4LN2A 5I2MA 3CCQT 2E70A 1SSFA 4RTYA 1MMGA 4C5EA 4J9IA 3CCUA 4P5NA 1VQ7A 3GOXA 1I81A 1Y7XA 2JTEA 1OZ2A 2L3SA 2RN8A 3QPHA 2DBMA 3JB9G 3JCMg 1RI9A 2AHJB 5GAN7 2DE0X 2RD1A 1KIKA 3HTRA 3QBYA 2NLUA 4C92C 4X9CA 2F2VA 2NUTB 3QZ9B 4C0ZA 2K5IA 2J7IA 2K3XA 2XDBA 1PSFA 4LUDA 2M51A 3ZFJA 1I4K1 1O9SA 1VQOT 1BI1A 3BFMA 3EG0A 4QQDA 1M8VA 5A0GA 1PC0A 4C8QA 3WVDB 1RAGB 3V7SA 8ATCB 5CAIA 1FX7A 1U1SA 4JZ4A 4DEXA 1X27A 4PFOA 4HCKA 3CCQQ 1KQ1A 2JOYA 2LJ3A 2E64A 2FZGB 5D7UA 4PJOA 3OW2P 2VB6A 2RNAA 2HL5C 4JJNK 2RQWA 5CKEA 1MNDA 3P8HA 4C0GA 1RL2A 3QWYA 3CD6Q 3LLRA 2MPXC 3UPUA 5A0DA 2RHXA 3SWNC 3L42A 1UGSB 4MMKA 3FRNA 3I55T 1VQPT 1MGQA 4Y28E 4PJJA 5I11A 5KYYA 1K9MC 1H8KA 3QYGB 3J81E 2QTVA 2E6ZA 2NYSA 4PJMA 2I2LA 1VQKT 1U1TA 1BK2A 4BD3A 2P4TA 3E2UA 3CCVT 2ZPFB 1ABOA 4M77D 3UDCA 2QTXA 1VQOA 2L3PA 3I35A 2RK2A 3F70A 2DNUA 4M7AB 5FLXE 4M78B 3G71Q 1W1FA 1BB9A 5HCKA 2OAWA 3VS7A 4FL6A 3NTHA 1WX6A 1HXDA 2QA4T 1KQ2A 2EVRA 2LQNA 3O8VA 2RHZA 1WHLA 1JB0E 1WHHA 2GBQA 2VUBA 1NPRA 4DOVA 1HD3A 3CC2Q 2HKNA 2ROTA 4JZ3A 3CC4A 2B86A 1VQPA 1G3TA 4JRPA 1YJNQ 2NUPB 2QEXQ 3ZBDA 2M0OA 1YITT 5J39A 2EYZA 4Q5WA 1UHCA 2DD5A 3ASKA 1QKXA 2QDLA 1N6AA 2XIDA 2PNIA 1VQNQ 3CCVQ 1GFCA 1M5Q1 4A4GA 3S6WA 3MEUA 4OMPA 4FT4A 4ZGDB 1VQKA 4E2FB 2L3RA 3GPLA 2BIVA 1E7OA 2QGGA 2O9SA 2COYA 3DLMA 2K7AA 4DBRA 4C8QD 3RMSA 3GP8A 3JCMe 2GCXA 2OTLQ 1YWOA 4BE2A 3S3OA 1OX8A 2BZ8A 3CCRT 3MJXA 4LDYA 4KH0B 4PK4A 4QW2A 2ZPGB 1KC8C 2BE9B 2RJEA 4OP0A 3X20B 1PSEA 1VQ4A 1PG5B 1WHKA 3SDZA 4E7HA 3P8BB 3J7AF 1JJ2A 4OF1A 2QA4A 3PMTA 3CQTA 2BZXA 2CKKA 3VKIA 3MKDA 1MNEA 1Q86C 1HJDA 2YRVA 2COWA 2CYZB 2M02A 2RJCA 5GAOr 2EKHA 4O5VA 5GJWB 2Y90A 3H6ZA 2DK3A 2JUFA 1WNLA 2BKDN 2LQWA 2RQRA 3BDLA 3NTKA 2ABLA 2LC4A 3RERA 4LDUA 4E7JA 2DKGA 1B07A 4KH1B 3S3MA 4E7LA 4R55A 1NJIR 1EIFA 1VQ5T 4C92B 2IG0A 1WZOA 3WXMB 4XTVA 3RESA 1JXMA 3SFMA 4NL2A 3MCAB 2HKQB 4XU1A 4F16A 1UGVA 2I0NA 4RKUE 1WQ7A 1N27A 1X6BA 1WYXA 4FCYA 4OMMA 3MP8A 3RIRA 5LJ5h 2K3BA 3M0RA 2W10A 4LNPA 3FJ5A 4OMFB 1ZSZC 2EBPA 4F17A 2DL4A 4ANJA 5IXBA 1GCQA 2AZVA 3M0SA 4FSSA 2VVKA 1Z9ZA 2K79A 4YTLA 1VIFA 4A4FA 2X4WA 1AZEA 3ME9A 4IUUA 2M0YA 2KYBA 4M75C 1G8XA 4A4HA 2DTHA 6AT1B 2DL5A 3SWNB 3CCMQ 2YUPA 1QVFS 2EYXA 3A5ZB 1PCXA 2CP6A 1WHGA 4BI4A 1G3YA 3PIOA 1VQ5Q 1LPLA 3G6EA 4RTUA 2RI2A 2R57A 3OY9A 2SEMA 4A54A 2QG9B 1I1JA 2PTKA 2DETA 1RI0A 5DY9A 2HNIA 1X2QA 1WXTA 4X34A 2JS0A 3JCMJ 1NLPC 2V8IA 1WDXA 4HCZA 1JU5C 2AK5A 5C0MA 1VQ9Q 2KAFA 2K6DA 3OYBA 2D0QB 3C4SA 1MV3A 5GMKh 2DMOA 4F7UF 2BE7D 2LCCA 2F2WA 4HVUA 5FRNA 2M16A 2RO0A 1UUEA 1C1AA 4M78A 3OS2A 3OYYA 4ZTJA 1UGRB 2ZPHB 1G5VA 3QXEB 3TQ7P 1WJSA 2VXEA 2K5FA 1VQ8A 2DBKA 4J6XA 5GAN4 4J9DA 4XTZA 4F7UE 2KK4A 5CCAA 2YWWA 3L2QA 5EG2A 3E1SA 2OJ2A 1IO6A 3QSUA 3CCSA 2WSFE 5AYFA 2V26A 2LZ6B 1E6HA 3LYIA 1X6GA 4M7DC 2XDDA 2NUPA 5CVIA 1PNJA 3QDFA 1VQMT 3LH5A 1WXBA 4JJDA 1Y0MA 5ECAA 1YJ9T 2GGRA 1SG5A 1S72T 3VYGA 2LJ1A 1UFFA 1K0XA 2CZ7B 3GNGA 5CIUA 2VWFA 2RPNA 3KBGA 5KYUB 2DRMA 1ZBJA 3E9FA 3TSZA 1N9RA 4RTWA 3FEOA 1ZLMA 2QQSA 3QDRB 2XHCA 2AKKA 1M90R 3VRYA 4M77F 2D9TA 1JJ2S 2QDYB 1QWEA 1TG0A 2P0KA 3VUZA 4NS5A 3X25B 4HCCA 5GAMe 2KQWA 4N4GA 3PTAA 5GMKl 4FT2A 4OB3B 1QKWA 2FO0A 1VQMQ 2QXFA 2EQJA 1VQ6Q 3DB3A 1GFDA 4UC4A 1K9MU 2O4XB 1YHQQ 3L1AA 2K57A 4EMGA 2FB7A 1S72Q 4D8DA 4AFSC 5J3BA 2EKOA 3JAME 4HVWA 4M77E 4J7IA 3CCET 4J9BA 5HK0A 4EIKA 4C92A 1GXIE 3UA6A 3V8LA 2DL8A 4EMKC 5LJ5d 3OA6A 1YJ9A 2E5KA 5LJ3h 2VGMA 1IGQA 5A0LA 2YUOA 2ED0A 1VYVA 1E6GA 1AHJB 1M2VB 1Q81R 4PJOG 1W2BA 3CCJQ 1ZSZB 1K8AR 4A4EA 1D0YA 1KHIA 1UE9A 4C5GA 1NEBA 3RBBB 1M9SA 2E5QA 2RHIA 4M7AC 5GANg 3GIBA 4PL6A 1YFNA 3CMEA 4C8QF 2QQBA 1PKTA 2PQWA 3I56A 2R5AA 2Y4XA 2AIRB 1M3BA 1XQHA 1Y96B 3SWNA 2IIMA 4MDWA 4ZGEB 3G4SQ 4KRTA 1T0JA 2KE9A 2E41A 2K9GA 2CGHA 3TCJA 4J7FA 3CCUT 1PWTA 1VQ7T 2C06A 4XAXB 2WACA 2D8JA 2X4XA 5KCHA 4AFUC 1KD1C 1OOTA 2V1RA 4N0AA 2J6FA 2YT6A 2A0FB 4C8QE 5KCOA 4OB0B 3H0FA 5GAN5 1YCSB 4D8KA 4FYVB 3OYAA 4PJOE 1QVGA 1QP2A 2VYTA 1YI2Q 2DVJA 3V8JA 5CR2A 1YJWA 2LMJA 5GMKi 1RAHB 3PVQA 4M75G 3L2WA 1DJ7B 4CC3A 4J9FA 2DIQA 1KC8U 1X43A 2KMTA 3FC3A 2O01E 2WSEE 3M56A 5FRMA 1VA7A 2QAZA 2JTFA 4AG1C 5GAOp 2PVDB 2ATCB 4OMQA 1Q7YC 1LNXA 4RCBA 1NBEB 1N8RC 2B8AA 3CBOA 5LJ5f 2DF6A 2XMFA 4LE9A 2YXYA 4M7DB 3EHQA 4IIMA 2RQTA 2JJ9A 1YBYA 1NJIU 2E3HA 2CUBA 3EGXB 2RMOA 2MAMA 2HQHA 4PKCC 1NZ9A 4KT0E 1QCOA 3C94A 5GAOn 3UF4A 2QK0A 1Z9QA 4J6YA 2H3JA 2ENMA 2X51A 4FW2A 3VYHB 3HSBA 1TOVA 3LW5E 4LD6A 1IHVA 1VYTA 4FW1A 3MHXA 1M30A 1IGUA 1Q82C 3X28B 3MEVA 2LX9A 2EJGA 2JXBA 3FIFA 3ZEHA 3NFCA 5DM7R 3A8MB 4BACA 1WIEA 3JB9F 2V8JA 1ZHIA 3MEWA 4Y91A 4ATOA 3OSVA 3DB4A 2F1LA 4M7DG 2A7YA 3HRTA 4EDUA 5LJ5g 1HSQA 1VYUA 1PM3A 2JS2A 4CC4B 1XOVA 4JRQA 4ZTFA 3RMQA 1XJWB 1JO8A 1OULA 2P0QA 4AMCA 1M1KC 2GTJA 5DLQE 3NGPA 3LH0A 5KH6A 1KFZA 1QLYA 1M2OA 4D6WA 2DO3A 1R77A 2VGNA 4ELZC 1TUDA 2DERA 5GAMj 3H0HA 1QVFA 2K2MA 2O4XA 3CC4T 3OSSC 4Z89A 5IAYA 3M4YA 4M4ZA 5LJ3d 2RB6A 1K9MR 1KK7A 5GMKm 2FEIA 2L2PA 4EMKB 4EMHA 4LDVA 4N0AC 1VQOQ 1IZ6A 3M55A 4NL3A 4FYYB 2ZPEB 1AWJA 4XTYA 3KXTA 1FYNA 1W2BS 3VJPA 1M2VA 3E9GA 3OS1A 3HP9A 3T9NA 3CD6A 3RKWA 5GANh 1CKBA 1ZSZA 2YUQA 4FM4B 1PD1A 3JRZA 3KFVA 2LQKA 2CP5A 1JJ2P 1M1FA 4MZTA 2KRNA 2Y4YA 4QVZA 2X4YA 1HK9A 3CPFA 4A53A 2COZA 2GNCA 4DQ2A 4M75A 1VQ4T 1NG2A 2RQVA 3H0IA 3I55Q 1VQPQ 1VQLT 2CH4A 3G1JA 3SHWA 2HL3A 5KE3A 4KBMB 4RCCA 4B9XA 2D0NA 2HEQA 4BUGA 3BW1A 2JZ2A 4FIBA 3EFOA 1AZGB 1VQKQ 3G71A 3ER0A 2F5TX 3CCLT 1M27C 1QVGS 4M7AG 1ZUYA 4M78G 2XICA 3OYFA 4R56A 3OYMA 2LT1A 3MPUB 3VS0A 3VV0A 5M9OA 1KG1A 4ZN1A 2KXDA 4QVDA 1YP5A 1C6VX 3CC2A 1UECA 2W0ZA 4OB2B 2HCKA 4QVCA 1R0BG 2XDPA 1M90U 1RAEB 2QA4Q 4PJOD 1KC8R 2X35A 2DRKA 3OYGA 3N5BB 2LJ0A 5LJ3f 4RTVA 1VQNA 1AEYA 4E6RA 2BTTA 1ABQA 1N5ZA 1Q86R 4DA4A 1QW1A 1SRMA 1T3LA 3QUIA 1BCMA 5CKDA 1XNIA 2CSIA 1VQLA 1YITQ 3CC7T 2EGCA 1PRMC 1T0HA 4M7DA 4J9GA 3PIPA 4IURA 3G6ET 2E12A 2XK0A 4C0DC 1QWFA 3RUXA 1JXOA 4BB7A 3RNJA 3S3NA 4M78E 1UHFA 5KYWB 1TUGB 3EGXA 5A2QE 3CCLA 4HT8A 4IUTA 3M0TA 2K3YA 2C0TA 1Q81U 1VIEA 4BDYA 1IRXA 3UWNA 2JW4A 2NUTA 3CCRQ 3MP6A 2QQ9A 4HXJA 1K8AU 4J6WA 5FROA
chains in the Genus database with same CATH topology
4M7DE 2PVOB 3CC2T 1B34B 2CZ7B 3M9QA 3CXCA 3VUBA 3P8DA 3GNGA 3JCMf 5CIUA 5LJ3g 4GLKA 2DIGA 3KBGA 5CK9A 4JUVA 1YJNT 1LOJA 2EQKA 2QEXT 5CQYA 3EFSA 4MZMA 3E9FA 1UB4A 1N9RA 3MP1A 3DLLA 4M75D 4F7UB 2EJFA 2DXTA 2JN0A 1ZQ1A 4RG2A 2DAQA 3H8ZA 3FEOA 1VQNT 2DTOA 1YI2A 2QQSA 3QDRB 2BUDA 2XHCA 3LGFA 3GF5A 2R5MA 3CBMA 3LWIA 4M77A 1UEBA 3QKJA 4M77F 1VQ8T 1Y96A 2D9TA 2EJ9A 3Q1JA 3FLGA 4JRIA 4C0FA 1JJ2S 5HY6A 3OYKA 2ZZDA 2QDYB 3INZA 3VUZA 5GMKj 2P0KA 3X26B 2RM4A 4NS5A 3X25B 4HCCA 5GAMe 4BDZA 1WPYA 2KQWA 2K2VA 4M77C 4N4GA 4C92G 3PTAA 3CC7A 5GMKl 5I2SA 2V8KA 4N4IA 2KY9A 4FT2A 3JCMX 2MWOA 2PUOB 3CCST 4ME7A 4O6JA 4OB3B 1IREB 5GMKe 2OTLT 3J80E 2QXFA 2EQJA 5I2MA 3DB3A 3CCQT 2VXFA 2MWPA 4UC4A 2E70A 2O4XB 3M4GA 1SSFA 4N4HA 1K9MU 3L1AA 2E65A 2K57A 2LTOA 4L5GA 4C5EA 2FB7A 2EQUA 4BY6B 4EMGA 3CCUA 1TH7A 4P5NA 4XU0A 4EMKA 5J3BA 3GOXA 2EKOA 3M58A 2XU8A 3OW2A 3QG1A 1VQ7A 1I81A 1Y7XA 4M77E 3JAME 2D6FA 1OZ2A 2PUKB 2ZCFB 3QPHA 4J7IA 5GANd 3CCET 5HK0A 2L8DA 2X4JA 3I55A 3JCMg 3JB9G 2E1HA 3JB9D 4C92A 2LQ8A 3OYJA 2AHJB 3C95A 4V2SA 1GXIE 1D3BB 5LL6S 5GAN7 2RD1A 3V8LA 1YJ9A 4EMKC 5LJ5d 3OA6A 4BE0A 1G3SA 5LJ3h 4PLIA 2VGMA 3JSCA 3QBYA 5A0LA 3CCMA 1Y71A 1OYXA 2NLUA 4C92C 1AHJB 2XI9A 3URGA 2K5LA 4X9CA 4E7IA 1NPPA 3QZ9B 4PJOG 4C0ZA 3JCMP 4J8OA 2K5IA 1YJNA 1UGPB 2HD0A 3L2ZA 3PNWC 5FU7B 5L8RE 2F69A 2DPPB 2QEXA 1W2BA 4KULA 5FU6C 4C5HA 2K3XA 2XDBA 4M7AA 1PSFA 4VUBA 4A4EA 4M7AF 4M78F 3ZFJA 2YHTA 1KHIA 4C5GA 1I4K1 2XKOC 1O9SA 3CCVA 1VQOT 3LWHA 4MDXA 1BI1A 1Q7YU 3CPWA 3BFMA 1M9SA 2DTIA 3M53A 1N8RU 2E5QA 2RHIA 3PMIA 4QQDA 5GANg 2EAYA 1KQSA 4M7AC 3GIBA 1M8VA 5A0GA 4PL6A 4C92E 2DXUA 4C8QA 3WVDB 3CMEA 4FSXA 3V7SA 5CAIA 1FX7A 1U1SA 1VQ9A 3QJYA 4C8QF 2VC8A 1KQ1A 2JOYA 2QQBA 2E64A 2PQWA 5GAMf 4XU2A 3I56A 4PJOA 2R5AA 4M77B 3OS0A 2Y4XA 4JJNK 1XQHA 2M9UA 1Y96B 4C8QC 4XTUA 3SWNA 5CKEA 2OTLA 5HK3A 5D6XA 5LJ5e 4MDWA 3P8HA 4ZGEB 4C0GA 4M7AE 1RL2A 2CS7A 2E41A 3LLRA 4PJOC 2CGHA 3TCJA 4EPCA 4J7FA 3UPUA 3CCUT 1VQ7T 2RJFA 2HBPA 5A0DA 2RHXA 2C06A 1QVPA 3SWNC 3L42A 1UGSB 4MMKA 4XAXB 1OZ3A 2WACA 2X4XA 3E19A 3SD4A 3FRNA 5KCHA 5GAOq 2DD4A 4OGCA 3QYHB 3I55T 1KD1C 1I8FA 1WGSA 1VQPT 2OTJT 2M1HA 1MGQA 3HL8A 3OS5A 4N0AA 3CMAA 4WF2A 4Y28E 1Q82U 4C8QE 3CEYA 5KCOA 4KUIA 4OB0B 3C12A 3HRSA 5D6WA 1K9MC 5GAN5 3QYGB 3J81E 1YITA 3QIIA 3OYAA 3CCMT 1QVGA 1QP2A 4PJOE 2VYTA 4HT9A 3V8JA 4CI0C 5CR2A 1YJWA 5GMKi 3OYHA 2E6ZA 3OYDA 3OYIA 1FXXA 2MF2A 2OAUA 3JCMc 1BI0A 2I2LA 3OMCA 1NJIC 2EFIA 4M75G 3JCMh 3L2WA 1VQKT 1U1TA 1DJ7B 3TU4K 3OMGA 4FU6A 3NTIA 2DIQA 3L2RA 4BD3A 1KC8U 2P4TA 3FJPA 2KMTA 2ZPFB 4XU3A 4M77D 3CCVT 4CRIA 3FC3A 3UDCA 4IKFA 2QTXA 3HKSA 4IUPA 3AHUA 1VQOA 5GAMg 1M1KU 2RK2A 2O01E 3F70A 2WSEE 3M56A 4M7AB 5GAOm 5FLXE 1V29B 3CMET 4M78B 5FRMA 1VQ9T 4ZGJB 3CCRA 5D6YA 3I56T 2GF7A 3QZ5B 4XTWA 2JTFA 3GNFB 2E6NA 4BI8B 5GANf 5GAOp 2IVWA 2PVDB 1KD1U 4PNOA 1JRIA 1Q7YC 1LNXA 4RCBA 4C0DB 4C8QB 1N8RC 2B8AA 4FL6A 3CBOA 3NTHA 5LJ5f 3L2UA 4JS4A 1HXDA 2QA4T 1KQ2A 2CZ0B 4JRKA 3LGLA 3MO8A 3O8VA 4M7DB 2RHZA 3A8LB 1JB0E 2VUBA 5GANj 1NPRA 4J83A 4DOVA 1K73U 3R6OA 1YBYA 4IUVA 3VU3C 4DOWA 1NJIU 3CMAT 5KE2A 3CC4A 1VQPA 1JBMA 1G3TA 1WJQA 3V7RA 4F7UG 5LJ5j 4JRPA 2OTJA 5DLOA 3ZBDA 2HAXA 1G3WA 2ZGWA 4C92F 1BIBA 2M0OA 1YITT 5J39A 2MAMA 4PKCC 4Q5WA 1NZ9A 2DD5A 3ASKA 4KT0E 3C94A 1N6AA 2GFAA 2XIDA 1BIAA 5GAOn 1YJWT 4J6YA 4E7KA 2H3JA 4L59A 2MMPA 3CXCS 3VYHB 3HSBA 3RKXA 1M5Q1 3LW5E 3HFOA 4LD6A 2LRQA 1M4ZA 3S6WA 4A4GA 4M7AD 3CBPA 3MEUA 1B34A 4M78D 4QQ6A 1VQ5A 4A4KA 3MHXA 1Q82C 1P92A 3RKYA 4ZGDB 4FT4A 2PU9B 1VQKA 3X28B 3MEVA 2LX9A 2EJGA 3FIFA 4JDSA 2L3RA 2E10A 3ZEHA 3NFCA 3GPLA 2XG8D 2BIVA 5DM7R 1YIJA 3A8MB 1YHQA 1BI3A 1X01A 3BDUA 3DLMA 2DZCA 4F7UA 4BACA 1N9SA 3FDRA 5I21A 3JB9F 2V8JA 1ZHIA 3MEWA 4Y91A 4ATOA 5GAN6 2A3LA 3RMSA 4C8QD 3GP8A 4L6V5 3JCMe 2GCXA 1KHCA 3OSVA 3DB4A 4BE2A 3S3OA 4II1A 3CCRT 4LD9K 4M7DG 4ELYC 2A7YA 3HRTA 4LDYA 1X75C 2GFUA 4M7DD 4EDUA 2RH2A 5LJ5g 3KUFA 4QW2A 2JTMA 2ZPGB 1KC8C 3OYNA 3OYEA 1XOVA 2RJEA 1VUBA 2DXBA 4MMLA 4OP0A 4PJOF 4JRQA 2LT4A 3RMQA 1PSEA 3X20B 4ZTFA 2P0QA 1VQ4A 4JS5A 1M1KC 4HCBA 1WJRA 2FHDA 3SDZA 5DLQE 2JNGA 3A8GB 4E7HA 3P8BB 2L5QA 2JVVA 3LH0A 3J7AF 2K4YA 5KH6A 4OF1A 4D6WA 2QA4A 3PMTA 1Y07A 2DO3A 1JJ2A 2CKKA 3VKIA 2VGNA 4ELZC 1Q86C 5GAMj 2YRVA 1BKBA 4LDWA 1QVFA 2CYZB 2RJCA 3G7ZA 2EWNA 2O4XA 3M5AA 5GAOr 1UGQB 4C5IA 2KVQG 2DEQA 3OSSC 3A8HB 2Y90A 3QHSA 4O5VA 3H6ZA 2DK3A 3M4YA 2JUFA 5IAYA 1WNLA 5LJ3d 2FYKA 2RB6A 3EFRA 2CZ6B 2LNVA 2BKDN 5CO7A 1NE8A 3BDLA 3FB9A 5GAN2 2LDMA 3NTKA 2LC4A 2P0PA 3RERA 4LDUA 3WVEB 5GMKm 4E7JA 4Z02A 4EMKB 1U8RA 3PFSA 2DKGA 1FWZA 2RK1A 2RJDA 4EMHA 4ZN3A 1D3BA 2EIFA 4LDVA 3S3MA 4N0AC 1K73C 4E7LA 1BI2A 4R55A 2YLBA 1IZ6A 2PVGB 3M55A 4NL3A 1EIFA 1VQ5T 1I5LA 3V7CA 4C92B 3JCMQ 2ZPEB 2DVEA 2IG0A 5CKHA 3WXMB 1VQ6T 4XTVA 3RESA 3JCMV 4XTYA 3KXTA 4PLLA 3SFMA 1XTDA 4NL2A 3VJPA 1W2BS 3MCAB 5FU6B 3G4SA 3E9GA 4XU1A 3HP9A 5J26A 3T9NA 2DJZA 3OS1A 4M77G 1YIJT 4RKUE 3TEEA 3RKWA 1YHQT 3PGGA 3CD6A 1M1GA 5GANh 1WQ7A 4XQ3A 5C6SA 1N27A 2HQEA 4FM4B 3LX7A 3JCMb 3CPWS 3HHTB 3MP8A 3JRZA 3RIRA 3UT1A 3META 5LJ5h 1KQSS 2LQKA 3OYCA 5FU7C 1M1FA 4MZTA 1Q86U 2Y4YA 2YLCA 4OMFB 4QVZA 3VYGA 2EQMA 2X4YA 3MEAA 4IUQA 1HK9A 3CPFA 3SB2A 4J5YA 4A53A 3HFNA 3DKMA 3HPWA 1O75A 4DQ2A 2F5KA 1WQWA 4M75A 5LJ3e 1VQ4T 1OI1A 2WSCE 4NOYA 2FL7A 4M75F 3EAEA 4YTLA 1W4SA 1VIFA 1R8OB 2FVUA 3PT9A 3TREA 1VQLT 3CCJT 2RI5A 2RHUA 3X24B 2X4WA 4A4FA 5CKBA 3JCMd 1M90C 3ME9A 4IUUA 4PJOB 4M75C 4A4HA 2DTHA 3QJ6A 4MZPA 4E47A 3JCMW 3SWNB 5KE3A 2KDSA 4KBMB 1QVFS 4RCCA 4B9XA 3OYLA 4C92D 3A5ZB 4OVAA 4X9DA 4BUGA 2R58A 3BW1A 4BI4A 1G3YA 3PIOA 3G6EA 5IN1A 2RI2A 2JZ2A 4FIBA 2R57A 4B9WA 3OY9A 2QQRA 4A54A 3A8OB 4RG8A 3G71A 4OGEA 2LVMA 1RI0A 3ER0A 2F5TX 4XK8E 3CCLT 2XD0A 4M75E 5DY9A 1QVGS 2HNIA 4X34A 3V8KA 4M7AG 2MI6A 4M78G 2XICA 5HKCA 3OB9A 3JCMJ 3M59A 3OYFA 4R56A 1VQMA 2V8IA 4HCZA 3OYMA 4TVRA 1VQ6A 2QI2A 3G4ST 2LT1A 3GLXA 3CD6T 5C0MA 5GAMh 3VV0A 2KAFA 5GAOl 3OYBA 5M9OA 2D0QB 2RI3A 3C4SA 1KG1A 4ZN1A 1LJOA 1S72A 4QVDA 2QQAA 4HKEA 5GMKh 4C8QG 4XTXA 4F7UF 2LCCA 5CQXA 3CC2A 2HQXA 3HRUA 5GAN8 5FRNA 2M16A 4JLGA 4OB2B 2RO0A 4QVCA 2XDPA 1M90U 2RA2A 1Q81C 4PJOD 1H3ZA 2DXCA 2X35A 4M78A 3OQ5A 2GQVA 3OYYA 3OS2A 3OYGA 4ZTJA 1YI2T 3N5BB 1K8AC 1BYMA 1UGRB 5LJ3f 2ZPHB 1VQNA 1G5VA 5IT9E 3QXEB 5GAN3 1WJSA 4DA4A 2VXEA 2K5FA 1QW1A 4M78C 1VQLA 3QUIA 3CCJA 5CKDA 1XNIA 1VQ8A 4KUDK 4LDXA 4J6XA 2DZ9A 5GAN4 3CC4T 2KSSA 2CZ1B 4M75B 4XTZA 4F7UE 2KK4A 3JB9I 4BE1A 1ZBXA 1YCYA 2RHYA 3QO3A 2LCLA 5CCAA 5LJ3j 1MHNA 4RMOA 2VV5A 3CC7T 4M7DA 1X6OA 3L2QA 5GANe 5EG2A 3E1SA 4M7DF 3PIPA 2L89A 4IURA 3G6ET 1QP3A 2E12A 2G3RA 2XK0A 2ZPBB 4GY5A 4C0DC 3L2VA 3CCSA 3QSUA 2EYQA 2WSFE 5AYFA 1H641 3RUXA 3G71T 3LYIA 4BB7A 3CCQA 3S3NA 4JLIA 4M78E 2XDDA 4M7DC 3BY7A 4OB1B 3JB9H 5CVIA 5CKFA 4BY6C 3JB9J 5A2QE 3CCLA 4HT8A 4IUTA 3OBWA 4BI3A 4HA8A 1VQMT 5GAMd 3OW2S 2K3YA 4QQGA 1Q81U 1VIEA 3M57A 4BDYA 3OBYA 3UWNA 3CCEA 3MP6A 1YJ9T 2QQ9A 3M54A 2ZPIB 1S72T 1K8AU 4J6WA 5FROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC2 T;  3M9Q A;  3CXC A;  3P8D A;  5CIU A;  3KBG A;  2DIG A;  1YJN T;  2QEX T;  2EQK A;  3E9F A;  3MP1 A;  3DLL A;  4RG2 A;  2DAQ A;  3H8Z A;  3FEO A;  1VQN T;  1YI2 A;  2QQS A;  2BUD A;  2XHC A;  3LGF A;  2R5M A;  1UEB A;  3QKJ A;  1VQ8 T;  2D9T A;  3Q1J A;  3FLG A;  1JJ2 S;  5HY6 A;  3OYK A;  2P0K A;  4NS5 A;  4BDZ A;  4N4G A;  3CC7 A;  4N4I A;  2MWO A;  3CCS T;  2OTL T;  3J80 E;  2EQJ A;  3DB3 A;  3CCQ T;  2MWP A;  4UC4 A;  2E70 A;  1K9M U;  2O4X B;  1SSF A;  4N4H A;  2LTO A;  4C5E A;  2EQU A;  3CCU A;  1VQ7 A;  5J3B A;  3GOX A;  3OW2 A;  2EKO A;  3JAM E;  1OZ2 A;  3CCE T;  3I55 A;  2L8D A;  2LQ8 A;  3OYJ A;  5LL6 S;  1YJ9 A;  3OA6 A;  4BE0 A;  4PLI A;  3QBY A;  3CCM A;  1OYX A;  2NLU A;  4E7I A;  1NPP A;  1YJN A;  1W2B A;  2QEX A;  3PNW C;  4C5H A;  2K3X A;  4A4E A;  1KHI A;  4C5G A;  3CCV A;  1VQO T;  1Q7Y U;  3CPW A;  1N8R U;  1KQS A;  2E5Q A;  4QQD A;  2RHI A;  3PMI A;  4PL6 A;  3CME A;  1VQ9 A;  2JOY A;  3I56 A;  2PQW A;  2R5A A;  3OS0 A;  2OTL A;  5D6X A;  3P8H A;  1RL2 A;  3LLR A;  3CCU T;  1VQ7 T;  2RJF A;  2RHX A;  3L42 A;  1OZ3 A;  2WAC A;  2X4X A;  3SD4 A;  5KCH A;  3I55 T;  1KD1 C;  1VQP T;  1WGS A;  2OTJ T;  2M1H A;  3CMA A;  1Q82 U;  3CEY A;  5KCO A;  5D6W A;  1K9M C;  3J81 E;  1YIT A;  3QII A;  3OYA A;  3CCM T;  1QVG A;  2VYT A;  1YJW A;  3OYH A;  2E6Z A;  3OYD A;  3OYI A;  3OMC A;  1NJI C;  2EFI A;  1VQK T;  3L2W A;  3OMG A;  4FU6 A;  3NTI A;  2DIQ A;  3L2R A;  1KC8 U;  4BD3 A;  3CCV T;  4CRI A;  3FC3 A;  4IKF A;  4IUP A;  3HKS A;  1VQO A;  1M1K U;  3F70 A;  3CME T;  5FRM A;  5FLX E;  1VQ9 T;  3CCR A;  5D6Y A;  3I56 T;  2GF7 A;  2JTF A;  2E6N A;  1KD1 U;  1Q7Y C;  1N8R C;  2B8A A;  4FL6 A;  3NTH A;  3L2U A;  2QA4 T;  3LGL A;  3MO8 A;  3O8V A;  2RHZ A;  1NPR A;  1K73 U;  1YBY A;  4IUV A;  1NJI U;  3CMA T;  3CC4 A;  5KE2 A;  1VQP A;  1WJQ A;  2OTJ A;  2M0O A;  1YIT T;  5J39 A;  4Q5W A;  1NZ9 A;  3ASK A;  1YJW T;  2GFA A;  4E7K A;  4L59 A;  3CXC S;  4LD6 A;  4A4G A;  2LRQ A;  3S6W A;  1VQ5 A;  3MEU A;  4QQ6 A;  1Q82 C;  1VQK A;  3MEV A;  2L3R A;  1YIJ A;  3ZEH A;  5DM7 R;  2BIV A;  1YHQ A;  3DLM A;  4BAC A;  3FDR A;  3MEW A;  1KHC A;  3DB4 A;  4BE2 A;  3S3O A;  4II1 A;  3CCR T;  2GFU A;  4EDU A;  3KUF A;  4QW2 A;  1KC8 C;  3OYN A;  3OYE A;  2RJE A;  4ZTF A;  1VQ4 A;  1M1K C;  1WJR A;  2FHD A;  5DLQ E;  2JNG A;  4E7H A;  3P8B B;  3J7A F;  2JVV A;  3LH0 A;  1JJ2 A;  5KH6 A;  2QA4 A;  3PMT A;  2DO3 A;  2CKK A;  1Q86 C;  2YRV A;  1BKB A;  1QVF A;  2RJC A;  2O4X A;  4C5I A;  2KVQ G;  3CC4 T;  3OW2 S;  5IAY A;  3H6Z A;  2JUF A;  2BKD N;  3BDL A;  2LDM A;  3NTK A;  4E7J A;  4Z02 A;  3PFS A;  2RJD A;  4ZN3 A;  2EIF A;  3S3M A;  1K73 C;  4E7L A;  1IZ6 A;  1EIF A;  1VQ5 T;  2IG0 A;  1VQ6 T;  4PLL A;  1W2B S;  1XTD A;  3G4S A;  3E9G A;  5J26 A;  1YIJ T;  3OS1 A;  3CD6 A;  1YHQ T;  1M1G A;  5C6S A;  1N27 A;  2HQE A;  3LX7 A;  3CPW S;  3MP8 A;  3UT1 A;  3MET A;  1KQS S;  3OYC A;  1Q86 U;  4QVZ A;  2EQM A;  2X4Y A;  3MEA A;  4IUQ A;  3CPF A;  2F5K A;  1VQ4 T;  1OI1 A;  4YTL A;  3EAE A;  3TRE A;  1VQL T;  3CCJ T;  2RI5 A;  2RHU A;  4A4F A;  2X4W A;  1M90 C;  3ME9 A;  4IUU A;  4A4H A;  3QJ6 A;  5KE3 A;  2KDS A;  1QVF S;  4B9X A;  3OYL A;  3A5Z B;  4OVA A;  2R58 A;  3PIO A;  3G6E A;  5IN1 A;  2JZ2 A;  2RI2 A;  2R57 A;  4B9W A;  3OY9 A;  2QQR A;  3G71 A;  2LVM A;  1RI0 A;  3ER0 A;  3CCL T;  1QVG S;  4X34 A;  2MI6 A;  3OB9 A;  3OYF A;  1VQM A;  4HCZ A;  3OYM A;  4TVR A;  1VQ6 A;  3G4S T;  3CD6 T;  5C0M A;  3OYB A;  5M9O A;  2RI3 A;  3C4S A;  4ZN1 A;  1S72 A;  2LCC A;  3CC2 A;  2HQX A;  5FRN A;  2M16 A;  2RO0 A;  2XDP A;  1M90 U;  1Q81 C;  1H3Z A;  2X35 A;  3OQ5 A;  3OS2 A;  3OYY A;  3OYG A;  4ZTJ A;  1YI2 T;  1K8A C;  1VQN A;  1G5V A;  5IT9 E;  1WJS A;  1VQL A;  3CCJ A;  1VQ8 A;  1XNI A;  4BE1 A;  2RHY A;  3CC7 T;  2LCL A;  1MHN A;  1X6O A;  3L2Q A;  3PIP A;  2L89 A;  3G6E T;  4IUR A;  2XK0 A;  2G3R A;  3CCS A;  4GY5 A;  3L2V A;  3G71 T;  3LYI A;  3CCQ A;  3S3N A;  5A2Q E;  3CCL A;  4IUT A;  1VQM T;  2K3Y A;  1Q81 U;  4QQG A;  4BDY A;  3CCE A;  3UWN A;  3MP6 A;  1YJ9 T;  1S72 T;  1K8A U;  5FRO A; 
#chains in the Genus database with same CATH topology
 1RAI B;  5IHN A;  1B34 B;  1CSK A;  1LCK A;  3CXC A;  3VUB A;  1IB8 A;  5LJ3 g;  4GLK A;  1QCN A;  2DIG A;  1KSW A;  5CK9 A;  4JUV A;  3THK A;  2HBW A;  3MP1 A;  4M75 D;  4F7U B;  1SPK A;  2DXT A;  1ZQ1 A;  3H8Z A;  2DEU A;  2DTO A;  2JM9 A;  3LGF A;  1JQQ A;  3LWI A;  4Y92 A;  1A0N B;  3PE0 A;  4OMN A;  1VQ8 T;  4C0F A;  1W6X A;  5IH2 A;  3EH2 A;  3X26 B;  2ZAE A;  2A08 A;  4C92 G;  1WXU A;  3CC7 A;  2DM1 A;  2G6F X;  2KY9 A;  2KXC A;  2MWO A;  2PUO B;  3CCS T;  1TU0 B;  4O6J A;  5GMK e;  1B3Q A;  3EG3 A;  4RTT A;  1I5O B;  2VXF A;  1SRL A;  2E65 A;  2DFU A;  4L5G A;  2EQU A;  1TH7 A;  4EMK A;  3M58 A;  1WA7 A;  2XU8 A;  1J3T A;  2D6F A;  2PUK B;  2J6O A;  2CH4 W;  5GAN d;  2E1H A;  1ZX6 A;  2P4R A;  3JB9 D;  3OYJ A;  3C95 A;  1D3B B;  1RAD B;  3VS1 A;  4BE0 A;  1G3S A;  1RAA B;  2CP3 A;  3CCM A;  1Y71 A;  2DA9 A;  2HZY A;  3URG A;  2K5L A;  4E7I A;  2FG0 A;  1NPP A;  3JCM P;  4J8O A;  1UGP B;  2HD0 A;  1RAC B;  4M7A A;  1K0S A;  2HMA A;  4VUB A;  1AWX A;  2EGA A;  4OMO A;  1CKA A;  1Q7Y U;  3CPW A;  1M3A A;  3REA B;  1N8R U;  1KQS A;  2EAY A;  4QT7 A;  4C92 E;  4FSX A;  1BCO A;  3REB B;  1VQ9 A;  2VC8 A;  4M77 B;  2M9U A;  4XTU A;  1MMA A;  5D6X A;  1U06 A;  4J9C A;  2CS7 A;  2JT4 A;  1RLP C;  2MIO A;  1FMV A;  2VAS A;  2YRD A;  4EPC A;  2D1X A;  1NLO C;  3GBQ A;  2RJF A;  2HBP A;  1UG1 A;  1EFN A;  1QVP A;  4FYW B;  3SD4 A;  5GAO q;  4OGC A;  3QYH B;  1I8F A;  2OTJ T;  2M1H A;  3OS5 A;  3CMA A;  1W2B P;  4WF2 A;  1Q82 U;  3BE3 A;  1AD5 A;  1OQK A;  4GLM A;  3C12 A;  2LCS A;  5D6W A;  5I22 A;  1RUW A;  1OPL A;  3QII A;  2BZY A;  1SHF A;  4Z8A A;  4HT9 A;  2FPF A;  3OYI A;  2MF2 A;  1UJY A;  1BI0 A;  2V1Q A;  3OMC A;  3M0Q A;  4AT1 B;  2J6K A;  3OMG A;  5L23 A;  3FJP A;  4XU3 A;  4IKF A;  4IUP A;  3AHU A;  1M1K U;  4ORZ A;  2HDA A;  2GTO A;  3CME T;  4ZGJ B;  1ZA1 B;  2EYY A;  3I56 T;  4CC2 A;  3QZ5 B;  4XTW A;  4BI8 B;  5GAN f;  2IVW A;  2C0I A;  4PNO A;  4C0D B;  4C8Q B;  1EX4 A;  4JS4 A;  2CZ0 B;  4JRK A;  3LGL A;  3MO8 A;  2KRS A;  1YJ9 Q;  4E7S A;  1QVG P;  4J83 A;  3I5R A;  3VU3 C;  1JBM A;  1WJQ A;  2AT1 B;  3V7R A;  2OTJ A;  5LJ5 j;  1X2K A;  2HAX A;  1BIB A;  1FMW A;  5FWC A;  1W70 A;  2ED1 A;  1YJW T;  4E7K A;  4ESR A;  4L59 A;  3CXC S;  3RKX A;  3HFO A;  1ARK A;  1M4Z A;  4M7A D;  4M78 D;  1B34 A;  4QQ6 A;  2DLP A;  4A4K A;  1P92 A;  3RKY A;  1GCP A;  2PZ1 A;  3EH1 A;  2OX7 A;  1ACM B;  1YIJ A;  2E10 A;  1YHQ A;  1BI3 A;  4F7U A;  1ZSG A;  1N9S A;  3FDR A;  5I21 A;  5FWB A;  3ULR B;  4LD9 K;  4II1 A;  1X75 C;  2GFU A;  2SRC A;  3OYN A;  1D1B A;  3OYE A;  2DXB A;  4MML A;  4PJO F;  2YRC A;  4Z88 A;  4JS5 A;  4HCB A;  2OI3 A;  3A8G B;  3CCE Q;  2L5Q A;  2JVV A;  3I9Q A;  1YN8 A;  1BKB A;  4LDW A;  4ZNX A;  1M3C A;  1KD1 R;  4KGZ B;  4C5I A;  2DEQ A;  5GMK j;  2CSQ A;  2FYK A;  1OU8 A;  3EFR A;  5GAN 2;  4JPB W;  2P0P A;  1ZA2 B;  2D8H A;  2ECZ A;  2A36 A;  1U8R A;  1QCF A;  2CT4 A;  1FWZ A;  1D3B A;  1K73 C;  1BI2 A;  4KGV B;  2X3W D;  2PVG B;  2YLB A;  4DBQ A;  3V7C A;  2DVE A;  5CKH A;  3G4S A;  5J26 A;  2GQI A;  3TEE A;  3PGG A;  4XQ3 A;  2HQE A;  3A98 A;  3LX7 A;  3CPW S;  3HHT B;  2KGT A;  1KQS S;  1B7T A;  5FU7 C;  1Q86 U;  4E7Z A;  2EQM A;  4IUQ A;  3MEA A;  3SB2 A;  4J5Y A;  3DKM A;  3HPW A;  2YUN A;  1QVF P;  1U5S A;  3CCU Q;  3TVT A;  1Q7Y R;  2F5K A;  1WQW A;  1WI7 A;  1VQ7 Q;  1OI1 A;  2DYI A;  4QKU A;  3R6N A;  1N8R R;  2WSC E;  4M75 F;  2A37 A;  3EAE A;  1R8O B;  2RI5 A;  2RHU A;  3VS2 A;  4WCI A;  4F04 B;  2F2X A;  3EG1 A;  3QJ6 A;  4MZP A;  4E47 A;  3JCM W;  2O88 A;  4C92 D;  4OVA A;  4X9D A;  2LNH B;  5IN1 A;  4B9W A;  3A8O B;  4RG8 A;  3EG2 A;  2LVM A;  2XD0 A;  4M75 E;  1D1C A;  2C0O A;  2JMC A;  5HKC A;  5IHI A;  1Q82 R;  2QI2 A;  3CD6 T;  1M8M A;  4DEY A;  5KYU A;  5GAO l;  2RI3 A;  1BBZ A;  2QQA A;  4XTX A;  5CQX A;  1OX9 A;  1QMC A;  2KR3 A;  3HRU A;  2L0A A;  5GAN 8;  2EW3 A;  3NPF A;  2J06 A;  2RA2 A;  3A1P A;  2FPD A;  3OQ5 A;  1M1K R;  4KGX B;  2CRE A;  1AT1 B;  4KUD K;  2DZ9 A;  2CZ1 B;  2DX1 A;  4F14 A;  4RMO A;  3QO3 A;  2LCL A;  5LJ3 j;  1X6O A;  5KYX B;  5GAN e;  4M7D F;  3JV3 A;  3O5Z A;  1K1Z A;  2G3R A;  2ZPB B;  3L2V A;  2EYQ A;  5KYN A;  1H64 1;  3G71 T;  1MV0 B;  3CCQ A;  4JLI A;  1UDL A;  4OB1 B;  3JB9 H;  3JB9 J;  2L3Q A;  5GAM d;  9ATC B;  2H3E B;  3M54 A;  2ZPI B;  4JJC A;  4M7D E;  3CC2 T;  4A63 B;  3P8D A;  3D7S B;  1G2B A;  2AZS A;  1YJN T;  2QEX T;  5CQY A;  3EFS A;  3DLL A;  2JM8 A;  4RTZ A;  1VQN T;  1AVZ C;  2X3X D;  1TUC A;  2BUD A;  3EHR A;  2R5M A;  2QGF B;  3CBM A;  2FPE A;  3CC4 Q;  3QKJ A;  1Y96 A;  2EJ9 A;  1SHG A;  2KYM A;  3Q1J A;  5IXF A;  4LUE A;  3OYK A;  1D0Z A;  2RM4 A;  2KI7 A;  3TSW A;  1WPY A;  4M77 C;  4DBH A;  3JCM X;  4ME7 A;  1IRE B;  2OTL T;  1T3S A;  1D09 B;  1LVK A;  1H3H A;  2MWP A;  1TXQ A;  3M4G A;  4N4H A;  2H8H A;  2LTO A;  2CP0 A;  4BY6 B;  4XU0 A;  3CXC P;  3OW2 A;  3QG1 A;  2ZCF B;  2DYB A;  5GJV B;  2L8D A;  2X4J A;  3I55 A;  3PVL A;  2LQ8 A;  5FW9 A;  4AFQ C;  5LL6 S;  1GRI A;  4PLI A;  3NHN A;  1TSF A;  2E3I A;  3JSC A;  1VQ4 Q;  1VOM A;  1OYX A;  2O31 A;  2NWM A;  2XI9 A;  1IHW A;  1NYG A;  4J9H A;  4K11 A;  2E4H A;  3C0C A;  1YJN A;  5FU7 B;  3L2Z A;  3PNW C;  2QEX A;  5L8R E;  2F69 A;  2DPP B;  2EYW A;  1VQL Q;  4KUL A;  5FU6 C;  4C5H A;  2ESW A;  3VS3 A;  4M7A F;  4M78 F;  2YHT A;  3VS4 A;  2XKO C;  4PFZ A;  2J05 A;  3CCV A;  1NM7 A;  3LWH A;  4MDX A;  4RUG A;  2DTI A;  3M53 A;  1PKS A;  3PMI A;  2KEA A;  2DL3 A;  3AT1 B;  2DXU A;  3QJY A;  5GAM f;  4XU2 A;  3CCL Q;  3OS0 A;  1BU1 A;  1I0C A;  4C8Q C;  2OTL A;  5HK3 A;  5LJ5 e;  1UJ0 A;  2NUZ A;  4M7A E;  2QYZ A;  4PJO C;  1X69 A;  3JCM h;  1K9A A;  1OZ3 A;  3E19 A;  2DD4 A;  1WGS A;  3HL8 A;  2FZC B;  3IQL A;  3CEY A;  1K76 A;  4KUI A;  1SKU B;  1YWP A;  3HRS A;  1AOJ A;  3ZL7 C;  1YIT A;  3CCM T;  2CP2 A;  4CI0 C;  2MCN A;  3CPW P;  3OYH A;  3OYD A;  2KBT A;  1FXX A;  1KQS P;  2OAU A;  3JCM c;  1NJI C;  2EFI A;  3TU4 K;  4FU6 A;  3NTI A;  3M0U A;  1V76 A;  3L2R A;  4AG2 C;  2DIL A;  2EQI A;  2KT8 A;  4CRI A;  3CC7 Q;  1OEB A;  3HKS A;  1YNZ A;  5GAM g;  3G6E Q;  4J9E A;  5GAO m;  1V29 B;  1NYF A;  1VQ9 T;  3CCR A;  5D6Y A;  3I5S A;  3UAT A;  2GF7 A;  1SF9 A;  3GNF B;  2E6N A;  1UTI A;  1KD1 U;  1JRI A;  5KYX A;  1EZZ B;  1SEM A;  3L2U A;  2FZK B;  4GBQ A;  1K4U S;  3A8L B;  3VRZ A;  1IXD A;  1WFW A;  2FRW A;  5GAN j;  1K73 U;  3R6O A;  4IUV A;  4DOW A;  3CMA T;  5KE2 A;  3NMZ C;  4F7U G;  5DLO A;  1G3W A;  2ZGW A;  4C92 F;  2GFA A;  1BIA A;  1C0M A;  2MMP A;  1D1A A;  4V2S A;  3QWX X;  2LRQ A;  3CBP A;  1VQ5 A;  1VQ8 Q;  1TWB A;  3SEM A;  2PU9 B;  3VS5 A;  4JDS A;  2XG8 D;  1X01 A;  1OPK A;  3BDU A;  2DZC A;  1U3O A;  2DL7 A;  3RR6 A;  5GAN 6;  2A3L A;  1NEG A;  4IIO A;  3CCS Q;  4L6V 5;  2LX7 A;  1KHC A;  2CT3 A;  4ELY C;  4M7D D;  2RH2 A;  2IPO B;  3KUF A;  1OU9 A;  2JTM A;  1KJW A;  2KRM A;  1WLP B;  2A28 A;  1VUB A;  2LT4 A;  3EG9 B;  3EGD B;  1WJR A;  2FHD A;  2JNG A;  2MYS A;  2HSE B;  1AWW A;  2QAS A;  3CMA Q;  2K4Y A;  1AWO A;  1Y07 A;  1FMK A;  4CC7 A;  3G7Z A;  2EWN A;  3M5A A;  1UGQ B;  2KVQ G;  3OW2 S;  3A8H B;  3QHS A;  1HYO A;  2CZ6 B;  2LNV A;  5CO7 A;  1NE8 A;  3FB9 A;  2LDM A;  3WVE B;  1F1B B;  4Z02 A;  3PFS A;  2RK1 A;  2RJD A;  4ZN3 A;  2EIF A;  2EGE A;  3U23 A;  4AFZ C;  1I5L A;  3JCM Q;  1WHM A;  1VQ6 T;  3JCM V;  4PLL A;  1XTD A;  2Z0W A;  5FU6 B;  1YIJ T;  2LP5 A;  2DJZ A;  4M77 G;  5AT1 B;  1YHQ T;  1M1G A;  1ZUU A;  3H9N A;  5C6S A;  2RF0 A;  1GBQ A;  2VKN A;  3JCM b;  3UT1 A;  3MET A;  3OYC A;  2YLC A;  3HFN A;  1O75 A;  5LJ3 e;  1MUZ A;  4NOY A;  2FL7 A;  3H41 A;  1OV3 A;  1W4S A;  2KNB B;  4FYX B;  4R0K A;  2FVU A;  2OTJ Q;  3PT9 A;  3TRE A;  3CCJ T;  3JCM d;  3X24 B;  5CKB A;  1M90 C;  1GCQ C;  4PJO B;  2O2O A;  1JEG A;  2KDS A;  5KYW A;  2CDT A;  2YDL A;  3OYL A;  2EPD A;  2R58 A;  1RLQ C;  2QQR A;  1H92 A;  4X1V A;  2CUD A;  4OGE A;  1YIJ Q;  4XK8 E;  3M0P A;  3V8K A;  1PHT A;  2MI6 A;  3OB9 A;  4PJN A;  3M59 A;  5EC7 A;  1VQM A;  5KYY B;  4TVR A;  1MMN A;  2ROL A;  3G4S T;  1VQ6 A;  3CME Q;  3GLX A;  2MOX A;  5GAM h;  1S1N A;  1GBR A;  3I56 Q;  1LJO A;  1S72 A;  4HKE A;  1WHJ A;  4C8Q G;  3RDV A;  2HQX A;  2FRY A;  2YSQ A;  4JLG A;  1Q81 C;  1H3Z A;  2DXC A;  2GQV A;  1YI2 T;  1K8A C;  1BYM A;  5IT9 E;  4RTX A;  5GAN 3;  4M78 C;  4OML A;  2X9H A;  3CCJ A;  4LDX A;  4PFP A;  1Y57 A;  1ZUK A;  2KSS A;  4M75 B;  7AT1 B;  4BE1 A;  3JB9 I;  1ZBX A;  1YCY A;  2RHY A;  1MHN A;  2VV5 A;  1TTH B;  1YJW Q;  1MMD A;  2L89 A;  1QP3 A;  4GY5 A;  1R0C B;  4WTO B;  3BY7 A;  1K73 R;  1PD0 A;  5CKF A;  4BY6 C;  1RAF B;  2RQU A;  3EGU A;  1PRL C;  4LXC A;  8AT1 B;  2MK5 A;  3OBW A;  4HA8 A;  4BI3 A;  3EFO B;  4QQG A;  3M57 A;  3UA7 A;  3OBY A;  3CCE A;  2AKL A;  2JMA A;  1G83 A;  2HSP A;  2KRO A;  2CP7 A;  4PJL A;  2PVO B;  2DJQ A;  2KT1 A;  3M9Q A;  1GL5 A;  1D0X A;  1QQJ A;  3JCM f;  3VS6 A;  1Q95 G;  1LOJ A;  2EQK A;  4B6M A;  4MZM A;  1V1C A;  4JJB A;  4DBF A;  1UB4 A;  2EJF A;  2JN0 A;  4RG2 A;  2DAQ A;  1YI2 A;  3GF5 A;  4M77 A;  5IHK A;  1UEB A;  2O9V A;  2P84 A;  3EG9 A;  3EGD A;  3FLG A;  4JRI A;  5HY6 A;  2ZZD A;  4HVV A;  1SSH A;  3INZ A;  4BDZ A;  2K2V A;  5I2S A;  2V8K A;  4N4I A;  1I07 A;  1TS9 A;  3J80 E;  1RAB B;  4LN2 A;  5I2M A;  3CCQ T;  2E70 A;  1SSF A;  4RTY A;  1MMG A;  4C5E A;  4J9I A;  3CCU A;  4P5N A;  1VQ7 A;  3GOX A;  1I81 A;  1Y7X A;  2JTE A;  1OZ2 A;  2L3S A;  2RN8 A;  3QPH A;  2DBM A;  3JB9 G;  3JCM g;  1RI9 A;  2AHJ B;  5GAN 7;  2DE0 X;  2RD1 A;  1KIK A;  3HTR A;  3QBY A;  2NLU A;  4C92 C;  4X9C A;  2F2V A;  2NUT B;  3QZ9 B;  4C0Z A;  2K5I A;  2J7I A;  2K3X A;  2XDB A;  1PSF A;  4LUD A;  2M51 A;  3ZFJ A;  1I4K 1;  1O9S A;  1VQO T;  1BI1 A;  3BFM A;  3EG0 A;  4QQD A;  1M8V A;  5A0G A;  1PC0 A;  4C8Q A;  3WVD B;  1RAG B;  3V7S A;  8ATC B;  5CAI A;  1FX7 A;  1U1S A;  4JZ4 A;  4DEX A;  1X27 A;  4PFO A;  4HCK A;  3CCQ Q;  1KQ1 A;  2JOY A;  2LJ3 A;  2E64 A;  2FZG B;  5D7U A;  4PJO A;  3OW2 P;  2VB6 A;  2RNA A;  2HL5 C;  4JJN K;  2RQW A;  5CKE A;  1MND A;  3P8H A;  4C0G A;  1RL2 A;  3QWY A;  3CD6 Q;  3LLR A;  2MPX C;  3UPU A;  5A0D A;  2RHX A;  3SWN C;  3L42 A;  1UGS B;  4MMK A;  3FRN A;  3I55 T;  1VQP T;  1MGQ A;  4Y28 E;  4PJJ A;  5I11 A;  5KYY A;  1K9M C;  1H8K A;  3QYG B;  3J81 E;  2QTV A;  2E6Z A;  2NYS A;  4PJM A;  2I2L A;  1VQK T;  1U1T A;  1BK2 A;  4BD3 A;  2P4T A;  3E2U A;  3CCV T;  2ZPF B;  1ABO A;  4M77 D;  3UDC A;  2QTX A;  1VQO A;  2L3P A;  3I35 A;  2RK2 A;  3F70 A;  2DNU A;  4M7A B;  5FLX E;  4M78 B;  3G71 Q;  1W1F A;  1BB9 A;  5HCK A;  2OAW A;  3VS7 A;  4FL6 A;  3NTH A;  1WX6 A;  1HXD A;  2QA4 T;  1KQ2 A;  2EVR A;  2LQN A;  3O8V A;  2RHZ A;  1WHL A;  1JB0 E;  1WHH A;  2GBQ A;  2VUB A;  1NPR A;  4DOV A;  1HD3 A;  3CC2 Q;  2HKN A;  2ROT A;  4JZ3 A;  3CC4 A;  2B86 A;  1VQP A;  1G3T A;  4JRP A;  1YJN Q;  2NUP B;  2QEX Q;  3ZBD A;  2M0O A;  1YIT T;  5J39 A;  2EYZ A;  4Q5W A;  1UHC A;  2DD5 A;  3ASK A;  1QKX A;  2QDL A;  1N6A A;  2XID A;  2PNI A;  1VQN Q;  3CCV Q;  1GFC A;  1M5Q 1;  4A4G A;  3S6W A;  3MEU A;  4OMP A;  4FT4 A;  4ZGD B;  1VQK A;  4E2F B;  2L3R A;  3GPL A;  2BIV A;  1E7O A;  2QGG A;  2O9S A;  2COY A;  3DLM A;  2K7A A;  4DBR A;  4C8Q D;  3RMS A;  3GP8 A;  3JCM e;  2GCX A;  2OTL Q;  1YWO A;  4BE2 A;  3S3O A;  1OX8 A;  2BZ8 A;  3CCR T;  3MJX A;  4LDY A;  4KH0 B;  4PK4 A;  4QW2 A;  2ZPG B;  1KC8 C;  2BE9 B;  2RJE A;  4OP0 A;  3X20 B;  1PSE A;  1VQ4 A;  1PG5 B;  1WHK A;  3SDZ A;  4E7H A;  3P8B B;  3J7A F;  1JJ2 A;  4OF1 A;  2QA4 A;  3PMT A;  3CQT A;  2BZX A;  2CKK A;  3VKI A;  3MKD A;  1MNE A;  1Q86 C;  1HJD A;  2YRV A;  2COW A;  2CYZ B;  2M02 A;  2RJC A;  5GAO r;  2EKH A;  4O5V A;  5GJW B;  2Y90 A;  3H6Z A;  2DK3 A;  2JUF A;  1WNL A;  2BKD N;  2LQW A;  2RQR A;  3BDL A;  3NTK A;  2ABL A;  2LC4 A;  3RER A;  4LDU A;  4E7J A;  2DKG A;  1B07 A;  4KH1 B;  3S3M A;  4E7L A;  4R55 A;  1NJI R;  1EIF A;  1VQ5 T;  4C92 B;  2IG0 A;  1WZO A;  3WXM B;  4XTV A;  3RES A;  1JXM A;  3SFM A;  4NL2 A;  3MCA B;  2HKQ B;  4XU1 A;  4F16 A;  1UGV A;  2I0N A;  4RKU E;  1WQ7 A;  1N27 A;  1X6B A;  1WYX A;  4FCY A;  4OMM A;  3MP8 A;  3RIR A;  5LJ5 h;  2K3B A;  3M0R A;  2W10 A;  4LNP A;  3FJ5 A;  4OMF B;  1ZSZ C;  2EBP A;  4F17 A;  2DL4 A;  4ANJ A;  5IXB A;  1GCQ A;  2AZV A;  3M0S A;  4FSS A;  2VVK A;  1Z9Z A;  2K79 A;  4YTL A;  1VIF A;  4A4F A;  2X4W A;  1AZE A;  3ME9 A;  4IUU A;  2M0Y A;  2KYB A;  4M75 C;  1G8X A;  4A4H A;  2DTH A;  6AT1 B;  2DL5 A;  3SWN B;  3CCM Q;  2YUP A;  1QVF S;  2EYX A;  3A5Z B;  1PCX A;  2CP6 A;  1WHG A;  4BI4 A;  1G3Y A;  3PIO A;  1VQ5 Q;  1LPL A;  3G6E A;  4RTU A;  2RI2 A;  2R57 A;  3OY9 A;  2SEM A;  4A54 A;  2QG9 B;  1I1J A;  2PTK A;  2DET A;  1RI0 A;  5DY9 A;  2HNI A;  1X2Q A;  1WXT A;  4X34 A;  2JS0 A;  3JCM J;  1NLP C;  2V8I A;  1WDX A;  4HCZ A;  1JU5 C;  2AK5 A;  5C0M A;  1VQ9 Q;  2KAF A;  2K6D A;  3OYB A;  2D0Q B;  3C4S A;  1MV3 A;  5GMK h;  2DMO A;  4F7U F;  2BE7 D;  2LCC A;  2F2W A;  4HVU A;  5FRN A;  2M16 A;  2RO0 A;  1UUE A;  1C1A A;  4M78 A;  3OS2 A;  3OYY A;  4ZTJ A;  1UGR B;  2ZPH B;  1G5V A;  3QXE B;  3TQ7 P;  1WJS A;  2VXE A;  2K5F A;  1VQ8 A;  2DBK A;  4J6X A;  5GAN 4;  4J9D A;  4XTZ A;  4F7U E;  2KK4 A;  5CCA A;  2YWW A;  3L2Q A;  5EG2 A;  3E1S A;  2OJ2 A;  1IO6 A;  3QSU A;  3CCS A;  2WSF E;  5AYF A;  2V26 A;  2LZ6 B;  1E6H A;  3LYI A;  1X6G A;  4M7D C;  2XDD A;  2NUP A;  5CVI A;  1PNJ A;  3QDF A;  1VQM T;  3LH5 A;  1WXB A;  4JJD A;  1Y0M A;  5ECA A;  1YJ9 T;  2GGR A;  1SG5 A;  1S72 T;  3VYG A;  2LJ1 A;  1UFF A;  1K0X A;  2CZ7 B;  3GNG A;  5CIU A;  2VWF A;  2RPN A;  3KBG A;  5KYU B;  2DRM A;  1ZBJ A;  3E9F A;  3TSZ A;  1N9R A;  4RTW A;  3FEO A;  1ZLM A;  2QQS A;  3QDR B;  2XHC A;  2AKK A;  1M90 R;  3VRY A;  4M77 F;  2D9T A;  1JJ2 S;  2QDY B;  1QWE A;  1TG0 A;  2P0K A;  3VUZ A;  4NS5 A;  3X25 B;  4HCC A;  5GAM e;  2KQW A;  4N4G A;  3PTA A;  5GMK l;  4FT2 A;  4OB3 B;  1QKW A;  2FO0 A;  1VQM Q;  2QXF A;  2EQJ A;  1VQ6 Q;  3DB3 A;  1GFD A;  4UC4 A;  1K9M U;  2O4X B;  1YHQ Q;  3L1A A;  2K57 A;  4EMG A;  2FB7 A;  1S72 Q;  4D8D A;  4AFS C;  5J3B A;  2EKO A;  3JAM E;  4HVW A;  4M77 E;  4J7I A;  3CCE T;  4J9B A;  5HK0 A;  4EIK A;  4C92 A;  1GXI E;  3UA6 A;  3V8L A;  2DL8 A;  4EMK C;  5LJ5 d;  3OA6 A;  1YJ9 A;  2E5K A;  5LJ3 h;  2VGM A;  1IGQ A;  5A0L A;  2YUO A;  2ED0 A;  1VYV A;  1E6G A;  1AHJ B;  1M2V B;  1Q81 R;  4PJO G;  1W2B A;  3CCJ Q;  1ZSZ B;  1K8A R;  4A4E A;  1D0Y A;  1KHI A;  1UE9 A;  4C5G A;  1NEB A;  3RBB B;  1M9S A;  2E5Q A;  2RHI A;  4M7A C;  5GAN g;  3GIB A;  4PL6 A;  1YFN A;  3CME A;  4C8Q F;  2QQB A;  1PKT A;  2PQW A;  3I56 A;  2R5A A;  2Y4X A;  2AIR B;  1M3B A;  1XQH A;  1Y96 B;  3SWN A;  2IIM A;  4MDW A;  4ZGE B;  3G4S Q;  4KRT A;  1T0J A;  2KE9 A;  2E41 A;  2K9G A;  2CGH A;  3TCJ A;  4J7F A;  3CCU T;  1PWT A;  1VQ7 T;  2C06 A;  4XAX B;  2WAC A;  2D8J A;  2X4X A;  5KCH A;  4AFU C;  1KD1 C;  1OOT A;  2V1R A;  4N0A A;  2J6F A;  2YT6 A;  2A0F B;  4C8Q E;  5KCO A;  4OB0 B;  3H0F A;  5GAN 5;  1YCS B;  4D8K A;  4FYV B;  3OYA A;  4PJO E;  1QVG A;  1QP2 A;  2VYT A;  1YI2 Q;  2DVJ A;  3V8J A;  5CR2 A;  1YJW A;  2LMJ A;  5GMK i;  1RAH B;  3PVQ A;  4M75 G;  3L2W A;  1DJ7 B;  4CC3 A;  4J9F A;  2DIQ A;  1KC8 U;  1X43 A;  2KMT A;  3FC3 A;  2O01 E;  2WSE E;  3M56 A;  5FRM A;  1VA7 A;  2QAZ A;  2JTF A;  4AG1 C;  5GAO p;  2PVD B;  2ATC B;  4OMQ A;  1Q7Y C;  1LNX A;  4RCB A;  1NBE B;  1N8R C;  2B8A A;  3CBO A;  5LJ5 f;  2DF6 A;  2XMF A;  4LE9 A;  2YXY A;  4M7D B;  3EHQ A;  4IIM A;  2RQT A;  2JJ9 A;  1YBY A;  1NJI U;  2E3H A;  2CUB A;  3EGX B;  2RMO A;  2MAM A;  2HQH A;  4PKC C;  1NZ9 A;  4KT0 E;  1QCO A;  3C94 A;  5GAO n;  3UF4 A;  2QK0 A;  1Z9Q A;  4J6Y A;  2H3J A;  2ENM A;  2X51 A;  4FW2 A;  3VYH B;  3HSB A;  1TOV A;  3LW5 E;  4LD6 A;  1IHV A;  1VYT A;  4FW1 A;  3MHX A;  1M30 A;  1IGU A;  1Q82 C;  3X28 B;  3MEV A;  2LX9 A;  2EJG A;  2JXB A;  3FIF A;  3ZEH A;  3NFC A;  5DM7 R;  3A8M B;  4BAC A;  1WIE A;  3JB9 F;  2V8J A;  1ZHI A;  3MEW A;  4Y91 A;  4ATO A;  3OSV A;  3DB4 A;  2F1L A;  4M7D G;  2A7Y A;  3HRT A;  4EDU A;  5LJ5 g;  1HSQ A;  1VYU A;  1PM3 A;  2JS2 A;  4CC4 B;  1XOV A;  4JRQ A;  4ZTF A;  3RMQ A;  1XJW B;  1JO8 A;  1OUL A;  2P0Q A;  4AMC A;  1M1K C;  2GTJ A;  5DLQ E;  3NGP A;  3LH0 A;  5KH6 A;  1KFZ A;  1QLY A;  1M2O A;  4D6W A;  2DO3 A;  1R77 A;  2VGN A;  4ELZ C;  1TUD A;  2DER A;  5GAM j;  3H0H A;  1QVF A;  2K2M A;  2O4X A;  3CC4 T;  3OSS C;  4Z89 A;  5IAY A;  3M4Y A;  4M4Z A;  5LJ3 d;  2RB6 A;  1K9M R;  1KK7 A;  5GMK m;  2FEI A;  2L2P A;  4EMK B;  4EMH A;  4LDV A;  4N0A C;  1VQO Q;  1IZ6 A;  3M55 A;  4NL3 A;  4FYY B;  2ZPE B;  1AWJ A;  4XTY A;  3KXT A;  1FYN A;  1W2B S;  3VJP A;  1M2V A;  3E9G A;  3OS1 A;  3HP9 A;  3T9N A;  3CD6 A;  3RKW A;  5GAN h;  1CKB A;  1ZSZ A;  2YUQ A;  4FM4 B;  1PD1 A;  3JRZ A;  3KFV A;  2LQK A;  2CP5 A;  1JJ2 P;  1M1F A;  4MZT A;  2KRN A;  2Y4Y A;  4QVZ A;  2X4Y A;  1HK9 A;  3CPF A;  4A53 A;  2COZ A;  2GNC A;  4DQ2 A;  4M75 A;  1VQ4 T;  1NG2 A;  2RQV A;  3H0I A;  3I55 Q;  1VQP Q;  1VQL T;  2CH4 A;  3G1J A;  3SHW A;  2HL3 A;  5KE3 A;  4KBM B;  4RCC A;  4B9X A;  2D0N A;  2HEQ A;  4BUG A;  3BW1 A;  2JZ2 A;  4FIB A;  3EFO A;  1AZG B;  1VQK Q;  3G71 A;  3ER0 A;  2F5T X;  3CCL T;  1M27 C;  1QVG S;  4M7A G;  1ZUY A;  4M78 G;  2XIC A;  3OYF A;  4R56 A;  3OYM A;  2LT1 A;  3MPU B;  3VS0 A;  3VV0 A;  5M9O A;  1KG1 A;  4ZN1 A;  2KXD A;  4QVD A;  1YP5 A;  1C6V X;  3CC2 A;  1UEC A;  2W0Z A;  4OB2 B;  2HCK A;  4QVC A;  1R0B G;  2XDP A;  1M90 U;  1RAE B;  2QA4 Q;  4PJO D;  1KC8 R;  2X35 A;  2DRK A;  3OYG A;  3N5B B;  2LJ0 A;  5LJ3 f;  4RTV A;  1VQN A;  1AEY A;  4E6R A;  2BTT A;  1ABQ A;  1N5Z A;  1Q86 R;  4DA4 A;  1QW1 A;  1SRM A;  1T3L A;  3QUI A;  1BCM A;  5CKD A;  1XNI A;  2CSI A;  1VQL A;  1YIT Q;  3CC7 T;  2EGC A;  1PRM C;  1T0H A;  4M7D A;  4J9G A;  3PIP A;  4IUR A;  3G6E T;  2E12 A;  2XK0 A;  4C0D C;  1QWF A;  3RUX A;  1JXO A;  4BB7 A;  3RNJ A;  3S3N A;  4M78 E;  1UHF A;  5KYW B;  1TUG B;  3EGX A;  5A2Q E;  3CCL A;  4HT8 A;  4IUT A;  3M0T A;  2K3Y A;  2C0T A;  1Q81 U;  1VIE A;  4BDY A;  1IRX A;  3UWN A;  2JW4 A;  2NUT A;  3CCR Q;  3MP6 A;  2QQ9 A;  4HXJ A;  1K8A U;  4J6W A;  5FRO A; 
#chains in the Genus database with same CATH homology
 4M7D E;  2PVO B;  3CC2 T;  1B34 B;  2CZ7 B;  3M9Q A;  3CXC A;  3VUB A;  3P8D A;  3GNG A;  3JCM f;  5CIU A;  5LJ3 g;  4GLK A;  2DIG A;  3KBG A;  5CK9 A;  4JUV A;  1YJN T;  1LOJ A;  2EQK A;  2QEX T;  5CQY A;  3EFS A;  4MZM A;  3E9F A;  1UB4 A;  1N9R A;  3MP1 A;  3DLL A;  4M75 D;  4F7U B;  2EJF A;  2DXT A;  2JN0 A;  1ZQ1 A;  4RG2 A;  2DAQ A;  3H8Z A;  3FEO A;  1VQN T;  2DTO A;  1YI2 A;  2QQS A;  3QDR B;  2BUD A;  2XHC A;  3LGF A;  3GF5 A;  2R5M A;  3CBM A;  3LWI A;  4M77 A;  1UEB A;  3QKJ A;  4M77 F;  1VQ8 T;  1Y96 A;  2D9T A;  2EJ9 A;  3Q1J A;  3FLG A;  4JRI A;  4C0F A;  1JJ2 S;  5HY6 A;  3OYK A;  2ZZD A;  2QDY B;  3INZ A;  3VUZ A;  5GMK j;  2P0K A;  3X26 B;  2RM4 A;  4NS5 A;  3X25 B;  4HCC A;  5GAM e;  4BDZ A;  1WPY A;  2KQW A;  2K2V A;  4M77 C;  4N4G A;  4C92 G;  3PTA A;  3CC7 A;  5GMK l;  5I2S A;  2V8K A;  4N4I A;  2KY9 A;  4FT2 A;  3JCM X;  2MWO A;  2PUO B;  3CCS T;  4ME7 A;  4O6J A;  4OB3 B;  1IRE B;  5GMK e;  2OTL T;  3J80 E;  2QXF A;  2EQJ A;  5I2M A;  3DB3 A;  3CCQ T;  2VXF A;  2MWP A;  4UC4 A;  2E70 A;  2O4X B;  3M4G A;  1SSF A;  4N4H A;  1K9M U;  3L1A A;  2E65 A;  2K57 A;  2LTO A;  4L5G A;  4C5E A;  2FB7 A;  2EQU A;  4BY6 B;  4EMG A;  3CCU A;  1TH7 A;  4P5N A;  4XU0 A;  4EMK A;  5J3B A;  3GOX A;  2EKO A;  3M58 A;  2XU8 A;  3OW2 A;  3QG1 A;  1VQ7 A;  1I81 A;  1Y7X A;  4M77 E;  3JAM E;  2D6F A;  1OZ2 A;  2PUK B;  2ZCF B;  3QPH A;  4J7I A;  5GAN d;  3CCE T;  5HK0 A;  2L8D A;  2X4J A;  3I55 A;  3JCM g;  3JB9 G;  2E1H A;  3JB9 D;  4C92 A;  2LQ8 A;  3OYJ A;  2AHJ B;  3C95 A;  4V2S A;  1GXI E;  1D3B B;  5LL6 S;  5GAN 7;  2RD1 A;  3V8L A;  1YJ9 A;  4EMK C;  5LJ5 d;  3OA6 A;  4BE0 A;  1G3S A;  5LJ3 h;  4PLI A;  2VGM A;  3JSC A;  3QBY A;  5A0L A;  3CCM A;  1Y71 A;  1OYX A;  2NLU A;  4C92 C;  1AHJ B;  2XI9 A;  3URG A;  2K5L A;  4X9C A;  4E7I A;  1NPP A;  3QZ9 B;  4PJO G;  4C0Z A;  3JCM P;  4J8O A;  2K5I A;  1YJN A;  1UGP B;  2HD0 A;  3L2Z A;  3PNW C;  5FU7 B;  5L8R E;  2F69 A;  2DPP B;  2QEX A;  1W2B A;  4KUL A;  5FU6 C;  4C5H A;  2K3X A;  2XDB A;  4M7A A;  1PSF A;  4VUB A;  4A4E A;  4M7A F;  4M78 F;  3ZFJ A;  2YHT A;  1KHI A;  4C5G A;  1I4K 1;  2XKO C;  1O9S A;  3CCV A;  1VQO T;  3LWH A;  4MDX A;  1BI1 A;  1Q7Y U;  3CPW A;  3BFM A;  1M9S A;  2DTI A;  3M53 A;  1N8R U;  2E5Q A;  2RHI A;  3PMI A;  4QQD A;  5GAN g;  2EAY A;  1KQS A;  4M7A C;  3GIB A;  1M8V A;  5A0G A;  4PL6 A;  4C92 E;  2DXU A;  4C8Q A;  3WVD B;  3CME A;  4FSX A;  3V7S A;  5CAI A;  1FX7 A;  1U1S A;  1VQ9 A;  3QJY A;  4C8Q F;  2VC8 A;  1KQ1 A;  2JOY A;  2QQB A;  2E64 A;  2PQW A;  5GAM f;  4XU2 A;  3I56 A;  4PJO A;  2R5A A;  4M77 B;  3OS0 A;  2Y4X A;  4JJN K;  1XQH A;  2M9U A;  1Y96 B;  4C8Q C;  4XTU A;  3SWN A;  5CKE A;  2OTL A;  5HK3 A;  5D6X A;  5LJ5 e;  4MDW A;  3P8H A;  4ZGE B;  4C0G A;  4M7A E;  1RL2 A;  2CS7 A;  2E41 A;  3LLR A;  4PJO C;  2CGH A;  3TCJ A;  4EPC A;  4J7F A;  3UPU A;  3CCU T;  1VQ7 T;  2RJF A;  2HBP A;  5A0D A;  2RHX A;  2C06 A;  1QVP A;  3SWN C;  3L42 A;  1UGS B;  4MMK A;  4XAX B;  1OZ3 A;  2WAC A;  2X4X A;  3E19 A;  3SD4 A;  3FRN A;  5KCH A;  5GAO q;  2DD4 A;  4OGC A;  3QYH B;  3I55 T;  1KD1 C;  1I8F A;  1WGS A;  1VQP T;  2OTJ T;  2M1H A;  1MGQ A;  3HL8 A;  3OS5 A;  4N0A A;  3CMA A;  4WF2 A;  4Y28 E;  1Q82 U;  4C8Q E;  3CEY A;  5KCO A;  4KUI A;  4OB0 B;  3C12 A;  3HRS A;  5D6W A;  1K9M C;  5GAN 5;  3QYG B;  3J81 E;  1YIT A;  3QII A;  3OYA A;  3CCM T;  1QVG A;  1QP2 A;  4PJO E;  2VYT A;  4HT9 A;  3V8J A;  4CI0 C;  5CR2 A;  1YJW A;  5GMK i;  3OYH A;  2E6Z A;  3OYD A;  3OYI A;  1FXX A;  2MF2 A;  2OAU A;  3JCM c;  1BI0 A;  2I2L A;  3OMC A;  1NJI C;  2EFI A;  4M75 G;  3JCM h;  3L2W A;  1VQK T;  1U1T A;  1DJ7 B;  3TU4 K;  3OMG A;  4FU6 A;  3NTI A;  2DIQ A;  3L2R A;  4BD3 A;  1KC8 U;  2P4T A;  3FJP A;  2KMT A;  2ZPF B;  4XU3 A;  4M77 D;  3CCV T;  4CRI A;  3FC3 A;  3UDC A;  4IKF A;  2QTX A;  3HKS A;  4IUP A;  3AHU A;  1VQO A;  5GAM g;  1M1K U;  2RK2 A;  2O01 E;  3F70 A;  2WSE E;  3M56 A;  4M7A B;  5GAO m;  5FLX E;  1V29 B;  3CME T;  4M78 B;  5FRM A;  1VQ9 T;  4ZGJ B;  3CCR A;  5D6Y A;  3I56 T;  2GF7 A;  3QZ5 B;  4XTW A;  2JTF A;  3GNF B;  2E6N A;  4BI8 B;  5GAN f;  5GAO p;  2IVW A;  2PVD B;  1KD1 U;  4PNO A;  1JRI A;  1Q7Y C;  1LNX A;  4RCB A;  4C0D B;  4C8Q B;  1N8R C;  2B8A A;  4FL6 A;  3CBO A;  3NTH A;  5LJ5 f;  3L2U A;  4JS4 A;  1HXD A;  2QA4 T;  1KQ2 A;  2CZ0 B;  4JRK A;  3LGL A;  3MO8 A;  3O8V A;  4M7D B;  2RHZ A;  3A8L B;  1JB0 E;  2VUB A;  5GAN j;  1NPR A;  4J83 A;  4DOV A;  1K73 U;  3R6O A;  1YBY A;  4IUV A;  3VU3 C;  4DOW A;  1NJI U;  3CMA T;  5KE2 A;  3CC4 A;  1VQP A;  1JBM A;  1G3T A;  1WJQ A;  3V7R A;  4F7U G;  5LJ5 j;  4JRP A;  2OTJ A;  5DLO A;  3ZBD A;  2HAX A;  1G3W A;  2ZGW A;  4C92 F;  1BIB A;  2M0O A;  1YIT T;  5J39 A;  2MAM A;  4PKC C;  4Q5W A;  1NZ9 A;  2DD5 A;  3ASK A;  4KT0 E;  3C94 A;  1N6A A;  2GFA A;  2XID A;  1BIA A;  5GAO n;  1YJW T;  4J6Y A;  4E7K A;  2H3J A;  4L59 A;  2MMP A;  3CXC S;  3VYH B;  3HSB A;  3RKX A;  1M5Q 1;  3LW5 E;  3HFO A;  4LD6 A;  2LRQ A;  1M4Z A;  3S6W A;  4A4G A;  4M7A D;  3CBP A;  3MEU A;  1B34 A;  4M78 D;  4QQ6 A;  1VQ5 A;  4A4K A;  3MHX A;  1Q82 C;  1P92 A;  3RKY A;  4ZGD B;  4FT4 A;  2PU9 B;  1VQK A;  3X28 B;  3MEV A;  2LX9 A;  2EJG A;  3FIF A;  4JDS A;  2L3R A;  2E10 A;  3ZEH A;  3NFC A;  3GPL A;  2XG8 D;  2BIV A;  5DM7 R;  1YIJ A;  3A8M B;  1YHQ A;  1BI3 A;  1X01 A;  3BDU A;  3DLM A;  2DZC A;  4F7U A;  4BAC A;  1N9S A;  3FDR A;  5I21 A;  3JB9 F;  2V8J A;  1ZHI A;  3MEW A;  4Y91 A;  4ATO A;  5GAN 6;  2A3L A;  3RMS A;  4C8Q D;  3GP8 A;  4L6V 5;  3JCM e;  2GCX A;  1KHC A;  3OSV A;  3DB4 A;  4BE2 A;  3S3O A;  4II1 A;  3CCR T;  4LD9 K;  4M7D G;  4ELY C;  2A7Y A;  3HRT A;  4LDY A;  1X75 C;  2GFU A;  4M7D D;  4EDU A;  2RH2 A;  5LJ5 g;  3KUF A;  4QW2 A;  2JTM A;  2ZPG B;  1KC8 C;  3OYN A;  3OYE A;  1XOV A;  2RJE A;  1VUB A;  2DXB A;  4MML A;  4OP0 A;  4PJO F;  4JRQ A;  2LT4 A;  3RMQ A;  1PSE A;  3X20 B;  4ZTF A;  2P0Q A;  1VQ4 A;  4JS5 A;  1M1K C;  4HCB A;  1WJR A;  2FHD A;  3SDZ A;  5DLQ E;  2JNG A;  3A8G B;  4E7H A;  3P8B B;  2L5Q A;  2JVV A;  3LH0 A;  3J7A F;  2K4Y A;  5KH6 A;  4OF1 A;  4D6W A;  2QA4 A;  3PMT A;  1Y07 A;  2DO3 A;  1JJ2 A;  2CKK A;  3VKI A;  2VGN A;  4ELZ C;  1Q86 C;  5GAM j;  2YRV A;  1BKB A;  4LDW A;  1QVF A;  2CYZ B;  2RJC A;  3G7Z A;  2EWN A;  2O4X A;  3M5A A;  5GAO r;  1UGQ B;  4C5I A;  2KVQ G;  2DEQ A;  3OSS C;  3A8H B;  2Y90 A;  3QHS A;  4O5V A;  3H6Z A;  2DK3 A;  3M4Y A;  2JUF A;  5IAY A;  1WNL A;  5LJ3 d;  2FYK A;  2RB6 A;  3EFR A;  2CZ6 B;  2LNV A;  2BKD N;  5CO7 A;  1NE8 A;  3BDL A;  3FB9 A;  5GAN 2;  2LDM A;  3NTK A;  2LC4 A;  2P0P A;  3RER A;  4LDU A;  3WVE B;  5GMK m;  4E7J A;  4Z02 A;  4EMK B;  1U8R A;  3PFS A;  2DKG A;  1FWZ A;  2RK1 A;  2RJD A;  4EMH A;  4ZN3 A;  1D3B A;  2EIF A;  4LDV A;  3S3M A;  4N0A C;  1K73 C;  4E7L A;  1BI2 A;  4R55 A;  2YLB A;  1IZ6 A;  2PVG B;  3M55 A;  4NL3 A;  1EIF A;  1VQ5 T;  1I5L A;  3V7C A;  4C92 B;  3JCM Q;  2ZPE B;  2DVE A;  2IG0 A;  5CKH A;  3WXM B;  1VQ6 T;  4XTV A;  3RES A;  3JCM V;  4XTY A;  3KXT A;  4PLL A;  3SFM A;  1XTD A;  4NL2 A;  3VJP A;  1W2B S;  3MCA B;  5FU6 B;  3G4S A;  3E9G A;  4XU1 A;  3HP9 A;  5J26 A;  3T9N A;  2DJZ A;  3OS1 A;  4M77 G;  1YIJ T;  4RKU E;  3TEE A;  3RKW A;  1YHQ T;  3PGG A;  3CD6 A;  1M1G A;  5GAN h;  1WQ7 A;  4XQ3 A;  5C6S A;  1N27 A;  2HQE A;  4FM4 B;  3LX7 A;  3JCM b;  3CPW S;  3HHT B;  3MP8 A;  3JRZ A;  3RIR A;  3UT1 A;  3MET A;  5LJ5 h;  1KQS S;  2LQK A;  3OYC A;  5FU7 C;  1M1F A;  4MZT A;  1Q86 U;  2Y4Y A;  2YLC A;  4OMF B;  4QVZ A;  3VYG A;  2EQM A;  2X4Y A;  3MEA A;  4IUQ A;  1HK9 A;  3CPF A;  3SB2 A;  4J5Y A;  4A53 A;  3HFN A;  3DKM A;  3HPW A;  1O75 A;  4DQ2 A;  2F5K A;  1WQW A;  4M75 A;  5LJ3 e;  1VQ4 T;  1OI1 A;  2WSC E;  4NOY A;  2FL7 A;  4M75 F;  3EAE A;  4YTL A;  1W4S A;  1VIF A;  1R8O B;  2FVU A;  3PT9 A;  3TRE A;  1VQL T;  3CCJ T;  2RI5 A;  2RHU A;  3X24 B;  2X4W A;  4A4F A;  5CKB A;  3JCM d;  1M90 C;  3ME9 A;  4IUU A;  4PJO B;  4M75 C;  4A4H A;  2DTH A;  3QJ6 A;  4MZP A;  4E47 A;  3JCM W;  3SWN B;  5KE3 A;  2KDS A;  4KBM B;  1QVF S;  4RCC A;  4B9X A;  3OYL A;  4C92 D;  3A5Z B;  4OVA A;  4X9D A;  4BUG A;  2R58 A;  3BW1 A;  4BI4 A;  1G3Y A;  3PIO A;  3G6E A;  5IN1 A;  2RI2 A;  2JZ2 A;  4FIB A;  2R57 A;  4B9W A;  3OY9 A;  2QQR A;  4A54 A;  3A8O B;  4RG8 A;  3G71 A;  4OGE A;  2LVM A;  1RI0 A;  3ER0 A;  2F5T X;  4XK8 E;  3CCL T;  2XD0 A;  4M75 E;  5DY9 A;  1QVG S;  2HNI A;  4X34 A;  3V8K A;  4M7A G;  2MI6 A;  4M78 G;  2XIC A;  5HKC A;  3OB9 A;  3JCM J;  3M59 A;  3OYF A;  4R56 A;  1VQM A;  2V8I A;  4HCZ A;  3OYM A;  4TVR A;  1VQ6 A;  2QI2 A;  3G4S T;  2LT1 A;  3GLX A;  3CD6 T;  5C0M A;  5GAM h;  3VV0 A;  2KAF A;  5GAO l;  3OYB A;  5M9O A;  2D0Q B;  2RI3 A;  3C4S A;  1KG1 A;  4ZN1 A;  1LJO A;  1S72 A;  4QVD A;  2QQA A;  4HKE A;  5GMK h;  4C8Q G;  4XTX A;  4F7U F;  2LCC A;  5CQX A;  3CC2 A;  2HQX A;  3HRU A;  5GAN 8;  5FRN A;  2M16 A;  4JLG A;  4OB2 B;  2RO0 A;  4QVC A;  2XDP A;  1M90 U;  2RA2 A;  1Q81 C;  4PJO D;  1H3Z A;  2DXC A;  2X35 A;  4M78 A;  3OQ5 A;  2GQV A;  3OYY A;  3OS2 A;  3OYG A;  4ZTJ A;  1YI2 T;  3N5B B;  1K8A C;  1BYM A;  1UGR B;  5LJ3 f;  2ZPH B;  1VQN A;  1G5V A;  5IT9 E;  3QXE B;  5GAN 3;  1WJS A;  4DA4 A;  2VXE A;  2K5F A;  1QW1 A;  4M78 C;  1VQL A;  3QUI A;  3CCJ A;  5CKD A;  1XNI A;  1VQ8 A;  4KUD K;  4LDX A;  4J6X A;  2DZ9 A;  5GAN 4;  3CC4 T;  2KSS A;  2CZ1 B;  4M75 B;  4XTZ A;  4F7U E;  2KK4 A;  3JB9 I;  4BE1 A;  1ZBX A;  1YCY A;  2RHY A;  3QO3 A;  2LCL A;  5CCA A;  5LJ3 j;  1MHN A;  4RMO A;  2VV5 A;  3CC7 T;  4M7D A;  1X6O A;  3L2Q A;  5GAN e;  5EG2 A;  3E1S A;  4M7D F;  3PIP A;  2L89 A;  4IUR A;  3G6E T;  1QP3 A;  2E12 A;  2G3R A;  2XK0 A;  2ZPB B;  4GY5 A;  4C0D C;  3L2V A;  3CCS A;  3QSU A;  2EYQ A;  2WSF E;  5AYF A;  1H64 1;  3RUX A;  3G71 T;  3LYI A;  4BB7 A;  3CCQ A;  3S3N A;  4JLI A;  4M78 E;  2XDD A;  4M7D C;  3BY7 A;  4OB1 B;  3JB9 H;  5CVI A;  5CKF A;  4BY6 C;  3JB9 J;  5A2Q E;  3CCL A;  4HT8 A;  4IUT A;  3OBW A;  4BI3 A;  4HA8 A;  1VQM T;  5GAM d;  3OW2 S;  2K3Y A;  4QQG A;  1Q81 U;  1VIE A;  3M57 A;  4BDY A;  3OBY A;  3UWN A;  3CCE A;  3MP6 A;  1YJ9 T;  2QQ9 A;  3M54 A;  2ZPI B;  1S72 T;  1K8A U;  4J6W A;  5FRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...