2CP7A

Solution structure of the 1st cap-gly domain in mouse clip-170/restin
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
84
structure length
84
Chain Sequence
GSSGSSGFRVGERVWVNGNKPGFIQFLGETQFAPGQWAGIVLDEPIGKNDGSVAGVRYFQCEPLKGIFTRPSKLTRKVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Restin
publication title Solution structure of the 1st CAP-Gly domain in mouse CLIP-170/restin
rcsb
source organism Mus musculus
total genus 7
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2cp7A00
2CP6A 2COYA 2HKNA 2QK0A 1LPLA 1WHMA 3TQ7P 2COWA 2Z0WA 2CP3A 2CP7A 1TOVA 4B6MA 2HL3A 1TXQA 3E2UA 2E3IA 3RDVA 1WHGA 1WHHA 2COZA 2MPXC 2E4HA 1WHLA 1IXDA 2CP2A 2HL5C 2HKQB 2M02A 1WHKA 1WHJA 2CP0A 2HQHA 2E3HA 2CP5A
chains in the Genus database with same CATH superfamily
2BTTA 4FYWB 2EVRA 3CCUT 1WXBA 2JN0A 2YUQA 1YFNA 3FJPA 1FXXA 1WPYA 1E6HA 4PJMA 2PVOB 2LX9A 1UGRB 1R77A 2COZA 1X6BA 4C92A 4R0KA 2QAZA 2FRWA 5CR2A 4C8QC 1MHNA 2JS0A 4BI4A 4OF1A 1H8KA 2K3YA 3M53A 1VQ9T 2DJQA 2JTMA 1F1BB 2XI9A 4HVUA 2JS2A 3A98A 1QQJA 4M75F 2YRCA 5CQYA 1Q81U 2YUPA 1YJWT 1WJQA 2MPXC 4MZPA 2HL5C 3JSCA 3JCMg 3P8DA 1W2BS 1XTDA 1QVFP 1VQ6Q 2COYA 2G3RA 3ZBDA 4MZMA 2GTOA 1Q81C 1OZ3A 3S6WA 1UE9A 4ELYC 1X01A 2DTIA 1TH7A 1BK2A 2WSFE 2LJ3A 4M7DE 2M02A 2LCLA 4YTLA 1N9SA 1VQKQ 1WZOA 2BZXA 3CCRT 1NYGA 1YBYA 1KQSS 1QVGS 1MMGA 4NL2A 5GAOm 2QEXT 4BDYA 1WHMA 4HVWA 4JLIA 3SWNC 2QDYB 3HSBA 2FPFA 3H0HA 3ER0A 4C8QD 3CCSA 3VS1A 2JTFA 2ECZA 2Y4XA 5D7UA 2OJ2A 2DYIA 3VS2A 4JJDA 5IH2A 2LMJA 3EG3A 4PFZA 2L0AA 1T0JA 2K6DA 1SPKA 3QYGB 1M1FA 2BIVA 4J9CA 1X2QA 4B6MA 2KBTA 2QQBA 1OX9A 2BZYA 2EJ9A 1HSQA 1GL5A 1E6GA 5I2MA 1K1ZA 4M7DB 1WX6A 1K9MU 3A8HB 3SHWA 1QLYA 4MDWA 1BYMA 2GCXA 3CCMT 1ZBXA 3QXEB 2CZ1B 4BUGA 1QWEA 2OI3A 2RNAA 4A4EA 1Z9QA 1K9MC 4E7HA 3DLMA 1I5OB 1U3OA 1AD5A 2DL5A 4HCBA 1NEBA 3JRZA 2L3RA 3J7AF 3L2UA 2AIRB 1BI3A 2K3XA 4JDSA 2LQNA 4QW2A 4A4GA 1AOJA 2CP3A 1YJNA 3CD6A 2RD1A 3VS6A 4JZ4A 5FROA 1G2BA 1WA7A 5LJ3g 3M55A 5D6YA 3CMAA 1EX4A 4AMCA 1OV3A 2CH4W 2LQKA 1C0MA 4C0ZA 1QCOA 2CP6A 3RKWA 3VS7A 3VS3A 3M0RA 3RR6A 1YIJT 2LJ0A 3CCLA 1AWWA 5LJ5f 2DAQA 4IUPA 1ZUYA 1MV3A 1YJNT 1VQ5A 4XTZA 1YP5A 2CZ6B 2BKDN 2GQIA 2K7AA 3PNWC 5HKCA 3J80E 4X34A 2AZSA 1QCFA 4PJOC 3BDLA 5GAN5 1MUZA 1K4US 3JB9F 2DBMA 1UGSB 5GJVB 5GANh 4FL6A 2I0NA 5I22A 4FW2A 5GAN8 3HL8A 2O4XB 1IO6A 2DNUA 1T3LA 2PQWA 2CUDA 3JV3A 1Y71A 4EMKC 2JUFA 4ANJA 2KT8A 2QTXA 3NMZC 2JNGA 4OVAA 2EYXA 1N6AA 4IURA 3UDCA 2QGGA 2LC4A 3H8ZA 3OMCA 4BE2A 1TWBA 3CC4A 2IVWA 1SHFA 2DK3A 2JMAA 3MKDA 1PD1A 4ZN3A 4DQ2A 4F7UG 5HK3A 1NZ9A 2EW3A 2RM4A 3WVDB 3JCMf 2CKKA 2X4JA 2DE0X 5GAMd 1M3BA 1G8XA 1H641 1WI7A 4M77C 3M0PA 3QZ9B 4PJOD 1M2OA 3L2WA 4Q5WA 4DBRA 2LNVA 2VUBA 3CC4T 1PCXA 4PJLA 2RHXA 1WHKA 3BDUA 3GLXA 1V1CA 1GCQA 3A8LB 4F16A 1B34A 1GBRA 2QXFA 1RAHB 1VYTA 2LJ1A 5D6XA 1VQ7A 2DKGA 3HFOA 3LGFA 4JRPA 3LH5A 2EYQA 4CI0C 2OTLT 2XICA 2DX1A 2OX7A 2LQWA 1C1AA 4ZGJB 4EDUA 4XK8E 3G71A 1MMAA 3CCUQ 1WHJA 5A2QE 2HEQA 3NFCA 2L3PA 1KC8U 4M75D 4FW1A 3QPHA 5LJ3h 2COWA 3OYKA 3FJ5A 4C0DB 1I1JA 1U8RA 4KGZB 4FYXB 2HQEA 3REAB 2KROA 4F14A 4N0AC 2QASA 3MEWA 1KC8C 1YWPA 4OGEA 4F7UA 1EIFA 3QDFA 4PLLA 3SWNB 3JCMc 3EGDA 8ATCB 2CP5A 2LCCA 2M0OA 2DBKA 1RACB 1T3SA 2HNIA 2X4XA 2RHZA 2K2VA 1TS9A 2FO0A 1M90U 2NUTA 4K11A 1VQLA 1K9MR 4MMKA 3EFOA 1JJ2A 4M78G 2QA4T 4Z88A 3CCQA 2KT1A 3PVLA 2LCSA 1PRLC 1PWTA 5CVIA 4JLGA 3VKIA 3RNJA 4E7LA 1M90C 1B3QA 5DM7R 3E9FA 2JXBA 4OB2B 4ORZA 4AG1C 2RQTA 2GGRA 2HBWA 1W4SA 2GBQA 1PC0A 4J7IA 1MNDA 4PFOA 4XTWA 5FW9A 2O88A 1ZBJA 5CKDA 3OYHA 3H6ZA 2K5FA 5LJ3f 3QG1A 2GQVA 2XMFA 2LX7A 2MF2A 1TUGB 2OAUA 4Y92A 3CC7T 1WGSA 5A0GA 1S72T 3C12A 3UA6A 2QTVA 1VQ8T 3CXCS 1VOMA 6AT1B 5FRNA 4DA4A 2NUTB 3I55T 3ZEHA 2RJCA 3P8BB 1KK7A 4IIMA 1VQPT 3V7CA 2FZGB 2KQWA 4BDZA 4XTYA 3I9QA 2FHDA 4KUDK 2L3SA 2E3HA 1Y7XA 1UEBA 5KYYA 1NPRA 3RESA 5KYUA 1OOTA 3A5ZB 3L2ZA 5L23A 1N27A 2K4YA 2BZ8A 1JJ2P 1ACMB 3CCSQ 3NTKA 1QP2A 4M78A 5C0MA 3OS0A 4BY6B 3HRSA 4OB0B 1G5VA 1OYXA 2E5KA 2OTJA 4RTZA 2GFAA 5GMKl 1YJ9A 5HK0A 5I11A 4M75E 2MCNA 1Y96A 1OULA 3REBB 3OW2A 3JB9H 5KH6A 1UGVA 4LDYA 3QWXX 3OBYA 1BI1A 5A0LA 1GFCA 1YITT 1QVGA 4HVVA 3SDZA 2F69A 2RJEA 3V8KA 4FYYB 4F04B 2X9HA 1M2VA 3I35A 4QQ6A 5KCOA 3JCMP 4QQGA 1OPLA 2QI2A 2L5QA 3KUFA 3GNFB 2FZCB 2P4TA 3HRTA 1SF9A 4LNPA 5KYUB 1WQ7A 1TTHB 4EMKB 4EIKA 4F7UF 1D1CA 5GAMe 1X6GA 4N4GA 1IREB 3CCET 3JB9D 4E7ZA 3PIOA 3HKSA 4M75B 2KVQG 4PNOA 4LDVA 1XJWB 3BFMA 3CCJT 1YJNQ 1NJIU 3CD6Q 3R6NA 4IUVA 2H3JA 1EZZB 3CC2T 2YUNA 2VXEA 2D1XA 1B7TA 5LJ5d 3V7SA 1VQNT 4M7AG 4OMMA 3OYIA 3CMAQ 1RLPC 1NJIC 4PFPA 4GY5A 3X26B 2EQMA 3OW2P 5KE2A 2KE9A 3CCLQ 4LUDA 2KY9A 2GF7A 4A4KA 1M1GA 2J06A 4LN2A 1K76A 1VQ5Q 1QVGP 2P4RA 3EFRA 1AEYA 1KC8R 4LE9A 2VKNA 4A4HA 1D1BA 4P5NA 1WHLA 2VYTA 2WACA 2BUDA 4CC7A 4J9EA 1N8RU 1VQ9A 3NTHA 3NPFA 2EFIA 1VQMT 2DF6A 3TREA 2DPPB 3C95A 5AYFA 1M1KU 1I4K1 3OSSC 4XU1A 2EQUA 1YI2T 3X28B 1N8RC 4ZNXA 1YJWA 1BCMA 3RERA 1TUCA 3QWYA 1M90R 1KD1U 1ZSZB 1ARKA 3GPLA 4M7DG 3LH0A 2HKQB 5C6SA 4C92E 3FDRA 5DLQE 1M1KC 2CP0A 4XU3A 2X4YA 1CKBA 1VYUA 2L89A 1WFWA 3JCMd 3WXMB 4M78F 5GAN3 3G6ET 1K9AA 1UTIA 4X1VA 3G4ST 1KD1C 4PKCC 2H8HA 3CC4Q 4M7AA 2HZYA 3EFSA 3I56T 1I0CA 2O2OA 4HCKA 5KYXA 4D6WA 5GANj 2ABLA 2FB7A 4Y91A 1BI2A 1RABB 2FYKA 3S3OA 4ZTFA 3CCRA 4RCBA 1U5SA 2RK1A 2SEMA 2QEXA 3CPWS 1O75A 4LDXA 3MO8A 3VJPA 4AFSC 4GBQA 1ZX6A 1U1TA 4IIOA 4XU2A 1YN8A 1Q82U 3CBMA 2KAFA 5GAN6 3KBGA 2RHYA 1M8MA 5GANg 1LCKA 1Y0MA 1IXDA 1KQ1A 4J9DA 1IRXA 2LTOA 1VQ7Q 4A54A 3MHXA 4C92B 4C0DC 1HXDA 1Q82C 1NLPC 3VS5A 2PU9B 4PJJA 1H92A 2HDAA 2YSQA 3MJXA 1OU8A 4R55A 4XTXA 1WHGA 3M0UA 3G71Q 1GCQC 2RF0A 3CCVT 3A1PA 1IHVA 1UUEA 2EPDA 2K9GA 1VA7A 2PUKB 4GLKA 3CCMA 3CMET 1G3SA 1GRIA 2DTHA 2K5IA 1D3BA 2L2PA 2VVKA 4BACA 1HD3A 2O31A 2JM8A 5IT9E 2CP2A 1AWOA 1AZEA 3RMSA 3OB9A 1M30A 1V76A 3SB2A 1VQLQ 4XQ3A 3D7SB 1D0YA 2DRKA 2PVDB 3VUBA 4J9HA 1U1SA 1E7OA 3CCQQ 4AFQC 2DFUA 5LJ3j 1BIAA 4WCIA 2QQ9A 3CC7Q 1WHHA 5GMKh 2ZCFB 1NLOC 4EMHA 1QWFA 4DEYA 2FG0A 4CC2A 2XU8A 1XNIA 2HAXA 2O01E 1YIJA 2RO0A 1VQ4T 3RUXA 4C8QG 4QT7A 3TQ7P 4ZGEB 2LT4A 4JS4A 1MNEA 3PIPA 4ESRA 4C92F 1BB9A 1NJIR 4OGCA 3JCMQ 1D3BB 2DD5A 1PKTA 2CS7A 1QVFS 2EGEA 2D8HA 1ZLMA 5LJ5e 3VS4A 4QVCA 1WNLA 1I8FA 2K79A 3H0FA 4J6WA 4BY6C 2CYZB 4M7AF 1FX7A 1VQOT 1RAFB 2A36A 2B8AA 3N5BB 1BBZA 4BI3A 2VASA 5HCKA 3OYLA 4OB1B 2QGFB 3QO3A 2XK0A 3OYFA 2ESWA 1NM7A 3M0QA 5CQXA 4JJBA 4DBFA 2MK5A 4E47A 2IPOB 4BE1A 2JTEA 1PHTA 4HCCA 3FIFA 1ZUKA 2XD0A 7AT1B 2J7IA 2FEIA 2DL3A 3MEUA 1B07A 1QMCA 3QJYA 4KH0B 2YT6A 2E65A 1N8RR 3M4GA 2OTJQ 4C5HA 3CXCA 1YHQA 2XDDA 1YJ9Q 1M1KR 1S1NA 3BW1A 4MZTA 2AK5A 3MCAB 3M4YA 1X75C 1KD1R 4EPCA 3MEAA 1JXOA 1ZSGA 3OSVA 3JCMe 1Z9ZA 1J3TA 1ABOA 4M75C 5GAOl 3SEMA 1PSFA 2YDLA 1YHQT 4KGVB 3VYHB 3OYCA 4J5YA 4HT8A 4OMFB 3TSWA 3KFVA 3E9GA 1Q81R 3A8GB 1EFNA 2BE7D 5GMKi 2YUOA 5CCAA 1QVPA 3QBYA 2OTLA 1WJSA 2MWOA 2CDTA 3JCMJ 2IG0A 2LZ6B 2E1HA 3S3MA 2RK2A 2EQKA 2GNCA 2JJ9A 4DOWA 2E3IA 3V8LA 3UA7A 2DTOA 4IKFA 4OMNA 1X2KA 2XDBA 1BU1A 1Q82R 5GANf 1WQWA 4JZ3A 2QQSA 1QKWA 1LOJA 1QW1A 1WJRA 3QDRB 4LXCA 3KXTA 4JPBW 1WXTA 3M54A 3OYBA 2A3LA 1JQQA 1RAGB 2ZPHB 4ATOA 3P8HA 2KI7A 3NGPA 3CXCP 2E41A 1DJ7B 2DIQA 2GTJA 5EG2A 4M78D 2KGTA 2P0QA 3VU3C 4D8DA 1RLQC 3HHTB 3JCMX 1FMKA 1W1FA 1UDLA 5FLXE 1AVZC 3EHQA 4QQDA 1JBMA 1ZSZC 3OYAA 1VQ6T 3EGXA 3PTAA 2QA4A 3AT1B 1QCNA 9ATCB 4FCYA 3I5RA 2D9TA 1VQ9Q 4OMOA 4F7UE 1UHFA 4RG2A 1Q86U 2K3BA 1M27C 1PNJA 2SRCA 1B34B 1G83A 4PJOG 5KCHA 2JZ2A 4ELZC 4RG8A 2EIFA 1VQKT 1YJWQ 1M8VA 4N4IA 3F70A 2HL3A 2A28A 1Q86C 1UB4A 1V29B 3OYYA 4JRKA 4J9BA 4J9GA 2VWFA 2E6NA 1JB0E 4JJNK 4II1A 1JXMA 3CC7A 1S72A 4LD9K 1WLPB 2AHJB 4J8OA 2RQWA 2V8KA 2K5LA 2V1QA 2ZPGB 1TSFA 1X6OA 1VQ8A 3TVTA 2A37A 1OU9A 1OZ2A 2D8JA 2FVUA 3JCMW 3PE0A 2JM9A 4DEXA 3I55A 1K8AU 1W70A 4RTYA 3SD4A 4C92C 5GAOr 4O6JA 1VQPA 3GNGA 3CCRQ 2WSCE 5GJWB 2QEXQ 5CIUA 4C0GA 4AG2C 4F7UB 8AT1B 3QYHB 1K8AC 3CPFA 4NOYA 2J05A 3EGDB 1LVKA 2F2WA 3INZA 1FYNA 5IHNA 2DM1A 1LNXA 3ME9A 3UF4A 3EH1A 4HXJA 4OMPA 3EFOB 1KSWA 4HT9A 2RQVA 4M77G 4A53A 3H0IA 4J6YA 4CC4B 1U06A 3RKYA 1VIFA 2PVGB 2MYSA 3CBOA 2W0ZA 3A8OB 1R0BG 1YITA 1W2BA 3OYEA 2R57A 1SKUB 4M78E 2DMOA 1W6XA 4FSSA 4KGXB 4PLIA 4L5GA 2E64A 5L8RE 1YCYA 2RMOA 1RADB 3HTRA 2G6FX 2JW4A 3CCMQ 4LDWA 2YLBA 1YCSB 3VRYA 2W10A 4J83A 5J26A 1D1AA 4C92D 2KXCA 4ME7A 1TOVA 2DO3A 2M9UA 1MGQA 1X69A 2EJFA 2F5TX 3X25B 1KQSA 3LX7A 5GAMh 3CCEA 2ZPBB 4M7AD 5KYNA 5I21A 1IZ6A 4AFUC 2HQHA 2CUBA 2ZAEA 3CCJA 4X9CA 4A63B 3CC2A 1PM3A 5FU6B 5KYYB 1X27A 1JRIA 4LDUA 1VQNA 1ZUUA 1PRMC 2JVVA 4PJNA 1CKAA 4WF2A 1R8OB 2A08A 4M78B 1H3ZA 4M77A 1SHGA 4E6RA 2NUPA 3FC3A 3UATA 5IAYA 1MMNA 1AZGB 2EWNA 5DY9A 1VQOQ 1YIJQ 2LQ8A 2X51A 5M9OA 3JB9J 2DLPA 1Y96B 3QKJA 4IUTA 4L59A 5CKBA 1W2BP 4QVDA 1NG2A 1D09B 1D0XA 1PSEA 4XAXB 2DIGA 4RTTA 1UG1A 5FRMA 4HCZA 1M3AA 3QIIA 4O5VA 1M2VB 5GAOq 3LW5E 4BD3A 2MAMA 1VQMA 5GMKj 3LLRA 5FU7B 2DD4A 4E7JA 2MWPA 1RL2A 2MI6A 1BIBA 1YI2A 1KQSP 5IN1A 2JT4A 1IB8A 1WXUA 4C0FA 2F1LA 3X24B 2LDMA 2KSSA 1HJDA 3MP8A 2A7YA 5GAOn 2EGCA 3UPUA 4N0AA 2O9SA 2IIMA 2E70A 2H3EB 3G6EA 3G4SA 4ZGDB 1Q86R 3I56A 1YHQQ 4BI8B 1SRMA 4IUUA 1FMWA 5DLOA 4RTXA 3MPUB 2ED1A 3GP8A 3M5AA 2V26A 2DXUA 5EC7A 3GIBA 3C4SA 2CGHA 1RAAB 2DZ9A 4Y28E 2DXTA 2RH2A 2DA9A 2P84A 3DKMA 2DL4A 1OPKA 2E5QA 4FU6A 4M7AE 4C5GA 4J9FA 2YWWA 4JS5A 2L3QA 4E7SA 2ROLA 1RUWA 1M4ZA 3U23A 1K8AR 3CEYA 5GANd 2OTLQ 5AT1B 2RJDA 2M16A 5FWCA 2YRDA 3S3NA 3CCVA 4ZTJA 2ZGWA 4FYVB 2M0YA 4LD6A 2KNBB 3AHUA 3WVEB 2EAYA 5CKEA 3VV0A 3CMEA 4HKEA 3RBBB 2DJZA 3DB4A 1TUDA 3M57A 3QUIA 2F2VA 1G3WA 1KJWA 2XIDA 4M77F 1WIEA 2LVMA 1N9RA 1UGQB 4M7AB 4IUQA 3OW2S 2ED0A 2EYWA 2ATCB 3LYIA 4M7DA 1K73U 5KYXB 5IXBA 4KBMB 5CKFA 4C5IA 2KXDA 2YRVA 1ABQA 1NEGA 2ENMA 3NHNA 4JRIA 1JU5C 3JAME 2Y90A 4KUIA 1WDXA 2AKKA 5A0DA 4FSXA 2MMPA 2RHIA 2QA4Q 2R5MA 1O9SA 1K73C 1IHWA 2X35A 2QG9B 1TXQA 3EG9A 3E2UA 3PMIA 3ZFJA 3QSUA 1UFFA 1IGUA 1K0SA 2QYZA 4QKUA 3TU4K 3OQ5A 1VQ4A 2DEUA 1MV0B 1YWOA 1XQHA 3JCMb 2QQAA 4FT2A 1P92A 3Q1JA 3VS0A 2NLUA 1VIEA 1HK9A 2I2LA 3OS2A 1I07A 3X20B 4RMOA 2OAWA 2CSQA 1GFDA 3CCST 2E10A 3SFMA 2P0KA 3EG0A 1S72Q 1I5LA 1AWXA 2DVJA 5LJ3d 3OYNA 5LJ5h 1VQ8Q 1SSHA 4GLMA 1UECA 2CZ0B 4B9XA 5CO7A 3OY9A 1VQOA 2PUOB 5CK9A 1NPPA 2NUZA 3I55Q 3BE3A 3HRUA 2Z0WA 2X3XD 2CP7A 2HSEB 1RI0A 1VQPQ 3OYGA 2BE9B 2C0IA 3LGLA 4QVZA 4MDXA 3EG9B 3QZ5B 4J9IA 2WSEE 3E1SA 4UC4A 3RKXA 1AT1B 2ROTA 3HP9A 5GAN4 2O9VA 2LT1A 1Q95G 4KULA 3M0TA 2QK0A 1FWZA 2HMAA 3MEVA 2EKHA 4RTUA 3OYMA 4MMLA 1GCPA 4RKUE 3LWIA 2O4XA 3TSZA 5FWBA 3MP1A 5GMKe 5HY6A 4FT4A 1BI0A 1SG5A 3O8VA 5CAIA 2P0PA 4DBHA 3ZL7C 2YXYA 2VC8A 1KG1A 1YITQ 4XU0A 3EG2A 1MMDA 3CBPA 3TEEA 4KRTA 2RJFA 1VYVA 3QHSA 2CH4A 2L8DA 3VYGA 3JCMh 3CD6T 1ZA2B 4FM4B 2AT1B 1K0XA 1OQKA 3CQTA 2EQJA 3PMTA 5FU6C 2XG8D 3FLGA 2RN8A 2E6ZA 3CMAT 3GF5A 2HBPA 2HKNA 3G1JA 1SSFA 2FRYA 4C8QA 4M78C 4C8QE 5GAN2 1UJ0A 3G7ZA 2KRSA 3PVQA 1JO8A 3L2RA 3CCLT 3CCEQ 4M7DF 3T9NA 4F17A 2C0OA 4FIBA 1YNZA 1SRLA 3LWHA 1VQ5T 3UT1A 4J6XA 3M59A 2V1RA 4EMGA 3CCJQ 2VB6A 1C6VX 2DL7A 3FRNA 3CC2Q 4E7IA 4B9WA 1A0NB 2RHUA 4CC3A 2AZVA 3OBWA 1VQNQ 2LRQA 5KE3A 1LPLA 3V7RA 1Q7YU 1M5Q1 5GANe 3OS5A 3M0SA 3DLLA 1TU0B 2HCKA 4BE0A 3O5ZA 2NWMA 1PG5B 3J81E 5FU7C 1UJYA 3H9NA 3HPWA 3TCJA 5I2SA 1Q7YC 5GAMj 2FL7A 2HD0A 1GBQA 2KRMA 1KIKA 2PNIA 2FPDA 1VQ6A 5GMKm 4C8QB 3ULRB 1R0CB 2J6OA 2LP5A 2J6FA 3SWNA 3C0CA 1Y07A 2M1HA 2YHTA 1VQMQ 2DEQA 2GFUA 2XHCA 5GAMg 3E19A 2VXFA 1K73R 2ZPIB 1YI2Q 1VQKA 3RMQA 4DOVA 2D0QB 4A4FA 1XOVA 3THKA 2HQXA 1PD0A 1OX8A 2QQRA 3G6EQ 3VUZA 2M51A 3G4SQ 2F2XA 1D0ZA 1WYXA 1Y57A 3I5SA 2Y4YA 2DZCA 1ZQ1A 4BB7A 3I56Q 2RQRA 2K57A 1VQ7T 4R56A 5J3BA 1M3CA 2DXCA 1I81A 3HFNA 2KYMA 1FMVA 1QKXA 2KDSA 2CSIA 2E12A 4M4ZA 2EBPA 1N5ZA 2ZPEB 2EGAA 4L6V5 1JEGA 1PKSA 2VV5A 2XKOC 5GAOp 4VUBA 3G71T 3FB9A 4M77D 1G3TA 2DILA 3RIRA 4PL6A 3ASKA 5LJ3e 1NE8A 3V8JA 2C0TA 2J6KA 3NTIA 3JCMV 3FEOA 2CT4A 3RDVA 3EGXB 2RI3A 4V2SA 2MIOA 2RI2A 5LL6S 5IXFA 2JMCA 2ZZDA 4C8QF 4M75G 4D8KA 2YLCA 2DETA 2RB6A 1TG0A 2DERA 4NS5A 4RCCA 4M7AC 2EKOA 5J39A 2K2MA 2V8JA 4WTOB 1ZHIA 4HA8A 3CCVQ 2F5KA 1VQLT 4J7FA 5KYWA 3UWNA 4NL3A 1CSKA 1HYOA 1LJOA 2FZKB 1KHIA 1VUBA 5IHKA 2C06A 1KHCA 3CCQT 3DB3A 4AT1B 3URGA 4E2FB 3CMEQ 2KMTA 1SEMA 4RTVA 1BCOA 2D0NA 4PJOA 4PJOE 2DRMA 3OYDA 2VGMA 4Z8AA 4XTUA 4OMLA 2ZPFB 3CPWA 2PZ1A 3A8MB 1OEBA 2EQIA 3OYJA 2DVEA 4XTVA 2E4HA 1OI1A 3L1AA 3BY7A 3OMGA 2D6FA 1H3HA 2DL8A 4EMKA 2X3WD 2RQUA 3EHRA 4JJCA 4M7DC 1RI9A 2LNHB 4ZN1A 2JOYA 5KYWB 2B86A 5ECAA 3EH2A 4E7KA 2EJGA 2KRNA 4M75A 1VQ4Q 1NYFA 2KYBA 4Z02A 1QP3A 2QDLA 2HSPA 3PT9A 4DBQA 1X43A 2CT3A 1G3YA 3GBQA 2KEAA 4PJOB 1AHJB 4X9DA 4OMQA 4Z89A 2PTKA 1KQ2A 2NYSA 3JB9I 2CZ7B 5GAN7 1Q7YR 4M77E 5D6WA 2OTJT 1YJ9T 4AFZC 2AKLA 1NBEB 2EYZA 2DXBA 1GXIE 1ZA1B 3EGUA 2XDPA 3CPWP 1KFZA 1BKBA 3GOXA 4OB3B 1UGPB 3OA6A 4CRIA 3H41A 4KH1B 4C92G 3M9QA 2A0FB 2KK4A 4N4HA 3M58A 5IHIA 4RUGA 4M7DD 4KT0E 4JUVA 3L2QA 5GAMf 2R5AA 5LJ5j 3L42A 3VRZA 3IQLA 2CREA 3PGGA 2RPNA 2RI5A 3MP6A 3OS1A 2R58A 2DYBA 1ZSZA 5CKHA 1IGQA 3M56A 2MOXA 4JRQA 3QJ6A 3L2VA 3EG1A 4M77B 4TVRA 4C5EA 2NUPB 1T0HA 2V8IA 2FPEA 1RAIB 3CCUA 1JJ2S 1QVFA 3PFSA 2EYYA 5LJ5g 1UHCA 2X4WA 3C94A 2VGNA 1AWJA 4LUEA 1RAEB 3R6OA 3META 4RTWA 3JB9G 1M9SA 4PK4A 2KR3A 3EAEA 4PJOF 2RA2A 4OP0A
chains in the Genus database with same CATH topology
2CP6A 2COYA 2HKNA 2QK0A 1LPLA 1WHMA 3TQ7P 2COWA 2Z0WA 2CP3A 2CP7A 1TOVA 4B6MA 2HL3A 1TXQA 3E2UA 2E3IA 3RDVA 1WHGA 1WHHA 2COZA 2MPXC 2E4HA 1WHLA 1IXDA 2CP2A 2HL5C 2HKQB 2M02A 1WHKA 1WHJA 2CP0A 2HQHA 2E3HA 2CP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CP6 A;  2COY A;  2HKN A;  2QK0 A;  1LPL A;  1WHM A;  3TQ7 P;  2COW A;  2Z0W A;  2CP3 A;  2CP7 A;  1TOV A;  4B6M A;  2HL3 A;  1TXQ A;  3E2U A;  2E3I A;  3RDV A;  1WHG A;  1WHH A;  2COZ A;  2MPX C;  2E4H A;  1WHL A;  1IXD A;  2CP2 A;  2HL5 C;  2HKQ B;  2M02 A;  1WHK A;  1WHJ A;  2CP0 A;  2HQH A;  2E3H A;  2CP5 A; 
#chains in the Genus database with same CATH topology
 2BTT A;  4FYW B;  2EVR A;  3CCU T;  1WXB A;  2JN0 A;  2YUQ A;  1YFN A;  3FJP A;  1FXX A;  1WPY A;  1E6H A;  4PJM A;  2PVO B;  2LX9 A;  1UGR B;  1R77 A;  2COZ A;  1X6B A;  4C92 A;  4R0K A;  2QAZ A;  2FRW A;  5CR2 A;  4C8Q C;  1MHN A;  2JS0 A;  4BI4 A;  4OF1 A;  1H8K A;  2K3Y A;  3M53 A;  1VQ9 T;  2DJQ A;  2JTM A;  1F1B B;  2XI9 A;  4HVU A;  2JS2 A;  3A98 A;  1QQJ A;  4M75 F;  2YRC A;  5CQY A;  1Q81 U;  2YUP A;  1YJW T;  1WJQ A;  2MPX C;  4MZP A;  2HL5 C;  3JSC A;  3JCM g;  3P8D A;  1W2B S;  1XTD A;  1QVF P;  1VQ6 Q;  2COY A;  2G3R A;  3ZBD A;  4MZM A;  2GTO A;  1Q81 C;  1OZ3 A;  3S6W A;  1UE9 A;  4ELY C;  1X01 A;  2DTI A;  1TH7 A;  1BK2 A;  2WSF E;  2LJ3 A;  4M7D E;  2M02 A;  2LCL A;  4YTL A;  1N9S A;  1VQK Q;  1WZO A;  2BZX A;  3CCR T;  1NYG A;  1YBY A;  1KQS S;  1QVG S;  1MMG A;  4NL2 A;  5GAO m;  2QEX T;  4BDY A;  1WHM A;  4HVW A;  4JLI A;  3SWN C;  2QDY B;  3HSB A;  2FPF A;  3H0H A;  3ER0 A;  4C8Q D;  3CCS A;  3VS1 A;  2JTF A;  2ECZ A;  2Y4X A;  5D7U A;  2OJ2 A;  2DYI A;  3VS2 A;  4JJD A;  5IH2 A;  2LMJ A;  3EG3 A;  4PFZ A;  2L0A A;  1T0J A;  2K6D A;  1SPK A;  3QYG B;  1M1F A;  2BIV A;  4J9C A;  1X2Q A;  4B6M A;  2KBT A;  2QQB A;  1OX9 A;  2BZY A;  2EJ9 A;  1HSQ A;  1GL5 A;  1E6G A;  5I2M A;  1K1Z A;  4M7D B;  1WX6 A;  1K9M U;  3A8H B;  3SHW A;  1QLY A;  4MDW A;  1BYM A;  2GCX A;  3CCM T;  1ZBX A;  3QXE B;  2CZ1 B;  4BUG A;  1QWE A;  2OI3 A;  2RNA A;  4A4E A;  1Z9Q A;  1K9M C;  4E7H A;  3DLM A;  1I5O B;  1U3O A;  1AD5 A;  2DL5 A;  4HCB A;  1NEB A;  3JRZ A;  2L3R A;  3J7A F;  3L2U A;  2AIR B;  1BI3 A;  2K3X A;  4JDS A;  2LQN A;  4QW2 A;  4A4G A;  1AOJ A;  2CP3 A;  1YJN A;  3CD6 A;  2RD1 A;  3VS6 A;  4JZ4 A;  5FRO A;  1G2B A;  1WA7 A;  5LJ3 g;  3M55 A;  5D6Y A;  3CMA A;  1EX4 A;  4AMC A;  1OV3 A;  2CH4 W;  2LQK A;  1C0M A;  4C0Z A;  1QCO A;  2CP6 A;  3RKW A;  3VS7 A;  3VS3 A;  3M0R A;  3RR6 A;  1YIJ T;  2LJ0 A;  3CCL A;  1AWW A;  5LJ5 f;  2DAQ A;  4IUP A;  1ZUY A;  1MV3 A;  1YJN T;  1VQ5 A;  4XTZ A;  1YP5 A;  2CZ6 B;  2BKD N;  2GQI A;  2K7A A;  3PNW C;  5HKC A;  3J80 E;  4X34 A;  2AZS A;  1QCF A;  4PJO C;  3BDL A;  5GAN 5;  1MUZ A;  1K4U S;  3JB9 F;  2DBM A;  1UGS B;  5GJV B;  5GAN h;  4FL6 A;  2I0N A;  5I22 A;  4FW2 A;  5GAN 8;  3HL8 A;  2O4X B;  1IO6 A;  2DNU A;  1T3L A;  2PQW A;  2CUD A;  3JV3 A;  1Y71 A;  4EMK C;  2JUF A;  4ANJ A;  2KT8 A;  2QTX A;  3NMZ C;  2JNG A;  4OVA A;  2EYX A;  1N6A A;  4IUR A;  3UDC A;  2QGG A;  2LC4 A;  3H8Z A;  3OMC A;  4BE2 A;  1TWB A;  3CC4 A;  2IVW A;  1SHF A;  2DK3 A;  2JMA A;  3MKD A;  1PD1 A;  4ZN3 A;  4DQ2 A;  4F7U G;  5HK3 A;  1NZ9 A;  2EW3 A;  2RM4 A;  3WVD B;  3JCM f;  2CKK A;  2X4J A;  2DE0 X;  5GAM d;  1M3B A;  1G8X A;  1H64 1;  1WI7 A;  4M77 C;  3M0P A;  3QZ9 B;  4PJO D;  1M2O A;  3L2W A;  4Q5W A;  4DBR A;  2LNV A;  2VUB A;  3CC4 T;  1PCX A;  4PJL A;  2RHX A;  1WHK A;  3BDU A;  3GLX A;  1V1C A;  1GCQ A;  3A8L B;  4F16 A;  1B34 A;  1GBR A;  2QXF A;  1RAH B;  1VYT A;  2LJ1 A;  5D6X A;  1VQ7 A;  2DKG A;  3HFO A;  3LGF A;  4JRP A;  3LH5 A;  2EYQ A;  4CI0 C;  2OTL T;  2XIC A;  2DX1 A;  2OX7 A;  2LQW A;  1C1A A;  4ZGJ B;  4EDU A;  4XK8 E;  3G71 A;  1MMA A;  3CCU Q;  1WHJ A;  5A2Q E;  2HEQ A;  3NFC A;  2L3P A;  1KC8 U;  4M75 D;  4FW1 A;  3QPH A;  5LJ3 h;  2COW A;  3OYK A;  3FJ5 A;  4C0D B;  1I1J A;  1U8R A;  4KGZ B;  4FYX B;  2HQE A;  3REA B;  2KRO A;  4F14 A;  4N0A C;  2QAS A;  3MEW A;  1KC8 C;  1YWP A;  4OGE A;  4F7U A;  1EIF A;  3QDF A;  4PLL A;  3SWN B;  3JCM c;  3EGD A;  8ATC B;  2CP5 A;  2LCC A;  2M0O A;  2DBK A;  1RAC B;  1T3S A;  2HNI A;  2X4X A;  2RHZ A;  2K2V A;  1TS9 A;  2FO0 A;  1M90 U;  2NUT A;  4K11 A;  1VQL A;  1K9M R;  4MMK A;  3EFO A;  1JJ2 A;  4M78 G;  2QA4 T;  4Z88 A;  3CCQ A;  2KT1 A;  3PVL A;  2LCS A;  1PRL C;  1PWT A;  5CVI A;  4JLG A;  3VKI A;  3RNJ A;  4E7L A;  1M90 C;  1B3Q A;  5DM7 R;  3E9F A;  2JXB A;  4OB2 B;  4ORZ A;  4AG1 C;  2RQT A;  2GGR A;  2HBW A;  1W4S A;  2GBQ A;  1PC0 A;  4J7I A;  1MND A;  4PFO A;  4XTW A;  5FW9 A;  2O88 A;  1ZBJ A;  5CKD A;  3OYH A;  3H6Z A;  2K5F A;  5LJ3 f;  3QG1 A;  2GQV A;  2XMF A;  2LX7 A;  2MF2 A;  1TUG B;  2OAU A;  4Y92 A;  3CC7 T;  1WGS A;  5A0G A;  1S72 T;  3C12 A;  3UA6 A;  2QTV A;  1VQ8 T;  3CXC S;  1VOM A;  6AT1 B;  5FRN A;  4DA4 A;  2NUT B;  3I55 T;  3ZEH A;  2RJC A;  3P8B B;  1KK7 A;  4IIM A;  1VQP T;  3V7C A;  2FZG B;  2KQW A;  4BDZ A;  4XTY A;  3I9Q A;  2FHD A;  4KUD K;  2L3S A;  2E3H A;  1Y7X A;  1UEB A;  5KYY A;  1NPR A;  3RES A;  5KYU A;  1OOT A;  3A5Z B;  3L2Z A;  5L23 A;  1N27 A;  2K4Y A;  2BZ8 A;  1JJ2 P;  1ACM B;  3CCS Q;  3NTK A;  1QP2 A;  4M78 A;  5C0M A;  3OS0 A;  4BY6 B;  3HRS A;  4OB0 B;  1G5V A;  1OYX A;  2E5K A;  2OTJ A;  4RTZ A;  2GFA A;  5GMK l;  1YJ9 A;  5HK0 A;  5I11 A;  4M75 E;  2MCN A;  1Y96 A;  1OUL A;  3REB B;  3OW2 A;  3JB9 H;  5KH6 A;  1UGV A;  4LDY A;  3QWX X;  3OBY A;  1BI1 A;  5A0L A;  1GFC A;  1YIT T;  1QVG A;  4HVV A;  3SDZ A;  2F69 A;  2RJE A;  3V8K A;  4FYY B;  4F04 B;  2X9H A;  1M2V A;  3I35 A;  4QQ6 A;  5KCO A;  3JCM P;  4QQG A;  1OPL A;  2QI2 A;  2L5Q A;  3KUF A;  3GNF B;  2FZC B;  2P4T A;  3HRT A;  1SF9 A;  4LNP A;  5KYU B;  1WQ7 A;  1TTH B;  4EMK B;  4EIK A;  4F7U F;  1D1C A;  5GAM e;  1X6G A;  4N4G A;  1IRE B;  3CCE T;  3JB9 D;  4E7Z A;  3PIO A;  3HKS A;  4M75 B;  2KVQ G;  4PNO A;  4LDV A;  1XJW B;  3BFM A;  3CCJ T;  1YJN Q;  1NJI U;  3CD6 Q;  3R6N A;  4IUV A;  2H3J A;  1EZZ B;  3CC2 T;  2YUN A;  2VXE A;  2D1X A;  1B7T A;  5LJ5 d;  3V7S A;  1VQN T;  4M7A G;  4OMM A;  3OYI A;  3CMA Q;  1RLP C;  1NJI C;  4PFP A;  4GY5 A;  3X26 B;  2EQM A;  3OW2 P;  5KE2 A;  2KE9 A;  3CCL Q;  4LUD A;  2KY9 A;  2GF7 A;  4A4K A;  1M1G A;  2J06 A;  4LN2 A;  1K76 A;  1VQ5 Q;  1QVG P;  2P4R A;  3EFR A;  1AEY A;  1KC8 R;  4LE9 A;  2VKN A;  4A4H A;  1D1B A;  4P5N A;  1WHL A;  2VYT A;  2WAC A;  2BUD A;  4CC7 A;  4J9E A;  1N8R U;  1VQ9 A;  3NTH A;  3NPF A;  2EFI A;  1VQM T;  2DF6 A;  3TRE A;  2DPP B;  3C95 A;  5AYF A;  1M1K U;  1I4K 1;  3OSS C;  4XU1 A;  2EQU A;  1YI2 T;  3X28 B;  1N8R C;  4ZNX A;  1YJW A;  1BCM A;  3RER A;  1TUC A;  3QWY A;  1M90 R;  1KD1 U;  1ZSZ B;  1ARK A;  3GPL A;  4M7D G;  3LH0 A;  2HKQ B;  5C6S A;  4C92 E;  3FDR A;  5DLQ E;  1M1K C;  2CP0 A;  4XU3 A;  2X4Y A;  1CKB A;  1VYU A;  2L89 A;  1WFW A;  3JCM d;  3WXM B;  4M78 F;  5GAN 3;  3G6E T;  1K9A A;  1UTI A;  4X1V A;  3G4S T;  1KD1 C;  4PKC C;  2H8H A;  3CC4 Q;  4M7A A;  2HZY A;  3EFS A;  3I56 T;  1I0C A;  2O2O A;  4HCK A;  5KYX A;  4D6W A;  5GAN j;  2ABL A;  2FB7 A;  4Y91 A;  1BI2 A;  1RAB B;  2FYK A;  3S3O A;  4ZTF A;  3CCR A;  4RCB A;  1U5S A;  2RK1 A;  2SEM A;  2QEX A;  3CPW S;  1O75 A;  4LDX A;  3MO8 A;  3VJP A;  4AFS C;  4GBQ A;  1ZX6 A;  1U1T A;  4IIO A;  4XU2 A;  1YN8 A;  1Q82 U;  3CBM A;  2KAF A;  5GAN 6;  3KBG A;  2RHY A;  1M8M A;  5GAN g;  1LCK A;  1Y0M A;  1IXD A;  1KQ1 A;  4J9D A;  1IRX A;  2LTO A;  1VQ7 Q;  4A54 A;  3MHX A;  4C92 B;  4C0D C;  1HXD A;  1Q82 C;  1NLP C;  3VS5 A;  2PU9 B;  4PJJ A;  1H92 A;  2HDA A;  2YSQ A;  3MJX A;  1OU8 A;  4R55 A;  4XTX A;  1WHG A;  3M0U A;  3G71 Q;  1GCQ C;  2RF0 A;  3CCV T;  3A1P A;  1IHV A;  1UUE A;  2EPD A;  2K9G A;  1VA7 A;  2PUK B;  4GLK A;  3CCM A;  3CME T;  1G3S A;  1GRI A;  2DTH A;  2K5I A;  1D3B A;  2L2P A;  2VVK A;  4BAC A;  1HD3 A;  2O31 A;  2JM8 A;  5IT9 E;  2CP2 A;  1AWO A;  1AZE A;  3RMS A;  3OB9 A;  1M30 A;  1V76 A;  3SB2 A;  1VQL Q;  4XQ3 A;  3D7S B;  1D0Y A;  2DRK A;  2PVD B;  3VUB A;  4J9H A;  1U1S A;  1E7O A;  3CCQ Q;  4AFQ C;  2DFU A;  5LJ3 j;  1BIA A;  4WCI A;  2QQ9 A;  3CC7 Q;  1WHH A;  5GMK h;  2ZCF B;  1NLO C;  4EMH A;  1QWF A;  4DEY A;  2FG0 A;  4CC2 A;  2XU8 A;  1XNI A;  2HAX A;  2O01 E;  1YIJ A;  2RO0 A;  1VQ4 T;  3RUX A;  4C8Q G;  4QT7 A;  3TQ7 P;  4ZGE B;  2LT4 A;  4JS4 A;  1MNE A;  3PIP A;  4ESR A;  4C92 F;  1BB9 A;  1NJI R;  4OGC A;  3JCM Q;  1D3B B;  2DD5 A;  1PKT A;  2CS7 A;  1QVF S;  2EGE A;  2D8H A;  1ZLM A;  5LJ5 e;  3VS4 A;  4QVC A;  1WNL A;  1I8F A;  2K79 A;  3H0F A;  4J6W A;  4BY6 C;  2CYZ B;  4M7A F;  1FX7 A;  1VQO T;  1RAF B;  2A36 A;  2B8A A;  3N5B B;  1BBZ A;  4BI3 A;  2VAS A;  5HCK A;  3OYL A;  4OB1 B;  2QGF B;  3QO3 A;  2XK0 A;  3OYF A;  2ESW A;  1NM7 A;  3M0Q A;  5CQX A;  4JJB A;  4DBF A;  2MK5 A;  4E47 A;  2IPO B;  4BE1 A;  2JTE A;  1PHT A;  4HCC A;  3FIF A;  1ZUK A;  2XD0 A;  7AT1 B;  2J7I A;  2FEI A;  2DL3 A;  3MEU A;  1B07 A;  1QMC A;  3QJY A;  4KH0 B;  2YT6 A;  2E65 A;  1N8R R;  3M4G A;  2OTJ Q;  4C5H A;  3CXC A;  1YHQ A;  2XDD A;  1YJ9 Q;  1M1K R;  1S1N A;  3BW1 A;  4MZT A;  2AK5 A;  3MCA B;  3M4Y A;  1X75 C;  1KD1 R;  4EPC A;  3MEA A;  1JXO A;  1ZSG A;  3OSV A;  3JCM e;  1Z9Z A;  1J3T A;  1ABO A;  4M75 C;  5GAO l;  3SEM A;  1PSF A;  2YDL A;  1YHQ T;  4KGV B;  3VYH B;  3OYC A;  4J5Y A;  4HT8 A;  4OMF B;  3TSW A;  3KFV A;  3E9G A;  1Q81 R;  3A8G B;  1EFN A;  2BE7 D;  5GMK i;  2YUO A;  5CCA A;  1QVP A;  3QBY A;  2OTL A;  1WJS A;  2MWO A;  2CDT A;  3JCM J;  2IG0 A;  2LZ6 B;  2E1H A;  3S3M A;  2RK2 A;  2EQK A;  2GNC A;  2JJ9 A;  4DOW A;  2E3I A;  3V8L A;  3UA7 A;  2DTO A;  4IKF A;  4OMN A;  1X2K A;  2XDB A;  1BU1 A;  1Q82 R;  5GAN f;  1WQW A;  4JZ3 A;  2QQS A;  1QKW A;  1LOJ A;  1QW1 A;  1WJR A;  3QDR B;  4LXC A;  3KXT A;  4JPB W;  1WXT A;  3M54 A;  3OYB A;  2A3L A;  1JQQ A;  1RAG B;  2ZPH B;  4ATO A;  3P8H A;  2KI7 A;  3NGP A;  3CXC P;  2E41 A;  1DJ7 B;  2DIQ A;  2GTJ A;  5EG2 A;  4M78 D;  2KGT A;  2P0Q A;  3VU3 C;  4D8D A;  1RLQ C;  3HHT B;  3JCM X;  1FMK A;  1W1F A;  1UDL A;  5FLX E;  1AVZ C;  3EHQ A;  4QQD A;  1JBM A;  1ZSZ C;  3OYA A;  1VQ6 T;  3EGX A;  3PTA A;  2QA4 A;  3AT1 B;  1QCN A;  9ATC B;  4FCY A;  3I5R A;  2D9T A;  1VQ9 Q;  4OMO A;  4F7U E;  1UHF A;  4RG2 A;  1Q86 U;  2K3B A;  1M27 C;  1PNJ A;  2SRC A;  1B34 B;  1G83 A;  4PJO G;  5KCH A;  2JZ2 A;  4ELZ C;  4RG8 A;  2EIF A;  1VQK T;  1YJW Q;  1M8V A;  4N4I A;  3F70 A;  2HL3 A;  2A28 A;  1Q86 C;  1UB4 A;  1V29 B;  3OYY A;  4JRK A;  4J9B A;  4J9G A;  2VWF A;  2E6N A;  1JB0 E;  4JJN K;  4II1 A;  1JXM A;  3CC7 A;  1S72 A;  4LD9 K;  1WLP B;  2AHJ B;  4J8O A;  2RQW A;  2V8K A;  2K5L A;  2V1Q A;  2ZPG B;  1TSF A;  1X6O A;  1VQ8 A;  3TVT A;  2A37 A;  1OU9 A;  1OZ2 A;  2D8J A;  2FVU A;  3JCM W;  3PE0 A;  2JM9 A;  4DEX A;  3I55 A;  1K8A U;  1W70 A;  4RTY A;  3SD4 A;  4C92 C;  5GAO r;  4O6J A;  1VQP A;  3GNG A;  3CCR Q;  2WSC E;  5GJW B;  2QEX Q;  5CIU A;  4C0G A;  4AG2 C;  4F7U B;  8AT1 B;  3QYH B;  1K8A C;  3CPF A;  4NOY A;  2J05 A;  3EGD B;  1LVK A;  2F2W A;  3INZ A;  1FYN A;  5IHN A;  2DM1 A;  1LNX A;  3ME9 A;  3UF4 A;  3EH1 A;  4HXJ A;  4OMP A;  3EFO B;  1KSW A;  4HT9 A;  2RQV A;  4M77 G;  4A53 A;  3H0I A;  4J6Y A;  4CC4 B;  1U06 A;  3RKY A;  1VIF A;  2PVG B;  2MYS A;  3CBO A;  2W0Z A;  3A8O B;  1R0B G;  1YIT A;  1W2B A;  3OYE A;  2R57 A;  1SKU B;  4M78 E;  2DMO A;  1W6X A;  4FSS A;  4KGX B;  4PLI A;  4L5G A;  2E64 A;  5L8R E;  1YCY A;  2RMO A;  1RAD B;  3HTR A;  2G6F X;  2JW4 A;  3CCM Q;  4LDW A;  2YLB A;  1YCS B;  3VRY A;  2W10 A;  4J83 A;  5J26 A;  1D1A A;  4C92 D;  2KXC A;  4ME7 A;  1TOV A;  2DO3 A;  2M9U A;  1MGQ A;  1X69 A;  2EJF A;  2F5T X;  3X25 B;  1KQS A;  3LX7 A;  5GAM h;  3CCE A;  2ZPB B;  4M7A D;  5KYN A;  5I21 A;  1IZ6 A;  4AFU C;  2HQH A;  2CUB A;  2ZAE A;  3CCJ A;  4X9C A;  4A63 B;  3CC2 A;  1PM3 A;  5FU6 B;  5KYY B;  1X27 A;  1JRI A;  4LDU A;  1VQN A;  1ZUU A;  1PRM C;  2JVV A;  4PJN A;  1CKA A;  4WF2 A;  1R8O B;  2A08 A;  4M78 B;  1H3Z A;  4M77 A;  1SHG A;  4E6R A;  2NUP A;  3FC3 A;  3UAT A;  5IAY A;  1MMN A;  1AZG B;  2EWN A;  5DY9 A;  1VQO Q;  1YIJ Q;  2LQ8 A;  2X51 A;  5M9O A;  3JB9 J;  2DLP A;  1Y96 B;  3QKJ A;  4IUT A;  4L59 A;  5CKB A;  1W2B P;  4QVD A;  1NG2 A;  1D09 B;  1D0X A;  1PSE A;  4XAX B;  2DIG A;  4RTT A;  1UG1 A;  5FRM A;  4HCZ A;  1M3A A;  3QII A;  4O5V A;  1M2V B;  5GAO q;  3LW5 E;  4BD3 A;  2MAM A;  1VQM A;  5GMK j;  3LLR A;  5FU7 B;  2DD4 A;  4E7J A;  2MWP A;  1RL2 A;  2MI6 A;  1BIB A;  1YI2 A;  1KQS P;  5IN1 A;  2JT4 A;  1IB8 A;  1WXU A;  4C0F A;  2F1L A;  3X24 B;  2LDM A;  2KSS A;  1HJD A;  3MP8 A;  2A7Y A;  5GAO n;  2EGC A;  3UPU A;  4N0A A;  2O9S A;  2IIM A;  2E70 A;  2H3E B;  3G6E A;  3G4S A;  4ZGD B;  1Q86 R;  3I56 A;  1YHQ Q;  4BI8 B;  1SRM A;  4IUU A;  1FMW A;  5DLO A;  4RTX A;  3MPU B;  2ED1 A;  3GP8 A;  3M5A A;  2V26 A;  2DXU A;  5EC7 A;  3GIB A;  3C4S A;  2CGH A;  1RAA B;  2DZ9 A;  4Y28 E;  2DXT A;  2RH2 A;  2DA9 A;  2P84 A;  3DKM A;  2DL4 A;  1OPK A;  2E5Q A;  4FU6 A;  4M7A E;  4C5G A;  4J9F A;  2YWW A;  4JS5 A;  2L3Q A;  4E7S A;  2ROL A;  1RUW A;  1M4Z A;  3U23 A;  1K8A R;  3CEY A;  5GAN d;  2OTL Q;  5AT1 B;  2RJD A;  2M16 A;  5FWC A;  2YRD A;  3S3N A;  3CCV A;  4ZTJ A;  2ZGW A;  4FYV B;  2M0Y A;  4LD6 A;  2KNB B;  3AHU A;  3WVE B;  2EAY A;  5CKE A;  3VV0 A;  3CME A;  4HKE A;  3RBB B;  2DJZ A;  3DB4 A;  1TUD A;  3M57 A;  3QUI A;  2F2V A;  1G3W A;  1KJW A;  2XID A;  4M77 F;  1WIE A;  2LVM A;  1N9R A;  1UGQ B;  4M7A B;  4IUQ A;  3OW2 S;  2ED0 A;  2EYW A;  2ATC B;  3LYI A;  4M7D A;  1K73 U;  5KYX B;  5IXB A;  4KBM B;  5CKF A;  4C5I A;  2KXD A;  2YRV A;  1ABQ A;  1NEG A;  2ENM A;  3NHN A;  4JRI A;  1JU5 C;  3JAM E;  2Y90 A;  4KUI A;  1WDX A;  2AKK A;  5A0D A;  4FSX A;  2MMP A;  2RHI A;  2QA4 Q;  2R5M A;  1O9S A;  1K73 C;  1IHW A;  2X35 A;  2QG9 B;  1TXQ A;  3EG9 A;  3E2U A;  3PMI A;  3ZFJ A;  3QSU A;  1UFF A;  1IGU A;  1K0S A;  2QYZ A;  4QKU A;  3TU4 K;  3OQ5 A;  1VQ4 A;  2DEU A;  1MV0 B;  1YWO A;  1XQH A;  3JCM b;  2QQA A;  4FT2 A;  1P92 A;  3Q1J A;  3VS0 A;  2NLU A;  1VIE A;  1HK9 A;  2I2L A;  3OS2 A;  1I07 A;  3X20 B;  4RMO A;  2OAW A;  2CSQ A;  1GFD A;  3CCS T;  2E10 A;  3SFM A;  2P0K A;  3EG0 A;  1S72 Q;  1I5L A;  1AWX A;  2DVJ A;  5LJ3 d;  3OYN A;  5LJ5 h;  1VQ8 Q;  1SSH A;  4GLM A;  1UEC A;  2CZ0 B;  4B9X A;  5CO7 A;  3OY9 A;  1VQO A;  2PUO B;  5CK9 A;  1NPP A;  2NUZ A;  3I55 Q;  3BE3 A;  3HRU A;  2Z0W A;  2X3X D;  2CP7 A;  2HSE B;  1RI0 A;  1VQP Q;  3OYG A;  2BE9 B;  2C0I A;  3LGL A;  4QVZ A;  4MDX A;  3EG9 B;  3QZ5 B;  4J9I A;  2WSE E;  3E1S A;  4UC4 A;  3RKX A;  1AT1 B;  2ROT A;  3HP9 A;  5GAN 4;  2O9V A;  2LT1 A;  1Q95 G;  4KUL A;  3M0T A;  2QK0 A;  1FWZ A;  2HMA A;  3MEV A;  2EKH A;  4RTU A;  3OYM A;  4MML A;  1GCP A;  4RKU E;  3LWI A;  2O4X A;  3TSZ A;  5FWB A;  3MP1 A;  5GMK e;  5HY6 A;  4FT4 A;  1BI0 A;  1SG5 A;  3O8V A;  5CAI A;  2P0P A;  4DBH A;  3ZL7 C;  2YXY A;  2VC8 A;  1KG1 A;  1YIT Q;  4XU0 A;  3EG2 A;  1MMD A;  3CBP A;  3TEE A;  4KRT A;  2RJF A;  1VYV A;  3QHS A;  2CH4 A;  2L8D A;  3VYG A;  3JCM h;  3CD6 T;  1ZA2 B;  4FM4 B;  2AT1 B;  1K0X A;  1OQK A;  3CQT A;  2EQJ A;  3PMT A;  5FU6 C;  2XG8 D;  3FLG A;  2RN8 A;  2E6Z A;  3CMA T;  3GF5 A;  2HBP A;  2HKN A;  3G1J A;  1SSF A;  2FRY A;  4C8Q A;  4M78 C;  4C8Q E;  5GAN 2;  1UJ0 A;  3G7Z A;  2KRS A;  3PVQ A;  1JO8 A;  3L2R A;  3CCL T;  3CCE Q;  4M7D F;  3T9N A;  4F17 A;  2C0O A;  4FIB A;  1YNZ A;  1SRL A;  3LWH A;  1VQ5 T;  3UT1 A;  4J6X A;  3M59 A;  2V1R A;  4EMG A;  3CCJ Q;  2VB6 A;  1C6V X;  2DL7 A;  3FRN A;  3CC2 Q;  4E7I A;  4B9W A;  1A0N B;  2RHU A;  4CC3 A;  2AZV A;  3OBW A;  1VQN Q;  2LRQ A;  5KE3 A;  1LPL A;  3V7R A;  1Q7Y U;  1M5Q 1;  5GAN e;  3OS5 A;  3M0S A;  3DLL A;  1TU0 B;  2HCK A;  4BE0 A;  3O5Z A;  2NWM A;  1PG5 B;  3J81 E;  5FU7 C;  1UJY A;  3H9N A;  3HPW A;  3TCJ A;  5I2S A;  1Q7Y C;  5GAM j;  2FL7 A;  2HD0 A;  1GBQ A;  2KRM A;  1KIK A;  2PNI A;  2FPD A;  1VQ6 A;  5GMK m;  4C8Q B;  3ULR B;  1R0C B;  2J6O A;  2LP5 A;  2J6F A;  3SWN A;  3C0C A;  1Y07 A;  2M1H A;  2YHT A;  1VQM Q;  2DEQ A;  2GFU A;  2XHC A;  5GAM g;  3E19 A;  2VXF A;  1K73 R;  2ZPI B;  1YI2 Q;  1VQK A;  3RMQ A;  4DOV A;  2D0Q B;  4A4F A;  1XOV A;  3THK A;  2HQX A;  1PD0 A;  1OX8 A;  2QQR A;  3G6E Q;  3VUZ A;  2M51 A;  3G4S Q;  2F2X A;  1D0Z A;  1WYX A;  1Y57 A;  3I5S A;  2Y4Y A;  2DZC A;  1ZQ1 A;  4BB7 A;  3I56 Q;  2RQR A;  2K57 A;  1VQ7 T;  4R56 A;  5J3B A;  1M3C A;  2DXC A;  1I81 A;  3HFN A;  2KYM A;  1FMV A;  1QKX A;  2KDS A;  2CSI A;  2E12 A;  4M4Z A;  2EBP A;  1N5Z A;  2ZPE B;  2EGA A;  4L6V 5;  1JEG A;  1PKS A;  2VV5 A;  2XKO C;  5GAO p;  4VUB A;  3G71 T;  3FB9 A;  4M77 D;  1G3T A;  2DIL A;  3RIR A;  4PL6 A;  3ASK A;  5LJ3 e;  1NE8 A;  3V8J A;  2C0T A;  2J6K A;  3NTI A;  3JCM V;  3FEO A;  2CT4 A;  3RDV A;  3EGX B;  2RI3 A;  4V2S A;  2MIO A;  2RI2 A;  5LL6 S;  5IXF A;  2JMC A;  2ZZD A;  4C8Q F;  4M75 G;  4D8K A;  2YLC A;  2DET A;  2RB6 A;  1TG0 A;  2DER A;  4NS5 A;  4RCC A;  4M7A C;  2EKO A;  5J39 A;  2K2M A;  2V8J A;  4WTO B;  1ZHI A;  4HA8 A;  3CCV Q;  2F5K A;  1VQL T;  4J7F A;  5KYW A;  3UWN A;  4NL3 A;  1CSK A;  1HYO A;  1LJO A;  2FZK B;  1KHI A;  1VUB A;  5IHK A;  2C06 A;  1KHC A;  3CCQ T;  3DB3 A;  4AT1 B;  3URG A;  4E2F B;  3CME Q;  2KMT A;  1SEM A;  4RTV A;  1BCO A;  2D0N A;  4PJO A;  4PJO E;  2DRM A;  3OYD A;  2VGM A;  4Z8A A;  4XTU A;  4OML A;  2ZPF B;  3CPW A;  2PZ1 A;  3A8M B;  1OEB A;  2EQI A;  3OYJ A;  2DVE A;  4XTV A;  2E4H A;  1OI1 A;  3L1A A;  3BY7 A;  3OMG A;  2D6F A;  1H3H A;  2DL8 A;  4EMK A;  2X3W D;  2RQU A;  3EHR A;  4JJC A;  4M7D C;  1RI9 A;  2LNH B;  4ZN1 A;  2JOY A;  5KYW B;  2B86 A;  5ECA A;  3EH2 A;  4E7K A;  2EJG A;  2KRN A;  4M75 A;  1VQ4 Q;  1NYF A;  2KYB A;  4Z02 A;  1QP3 A;  2QDL A;  2HSP A;  3PT9 A;  4DBQ A;  1X43 A;  2CT3 A;  1G3Y A;  3GBQ A;  2KEA A;  4PJO B;  1AHJ B;  4X9D A;  4OMQ A;  4Z89 A;  2PTK A;  1KQ2 A;  2NYS A;  3JB9 I;  2CZ7 B;  5GAN 7;  1Q7Y R;  4M77 E;  5D6W A;  2OTJ T;  1YJ9 T;  4AFZ C;  2AKL A;  1NBE B;  2EYZ A;  2DXB A;  1GXI E;  1ZA1 B;  3EGU A;  2XDP A;  3CPW P;  1KFZ A;  1BKB A;  3GOX A;  4OB3 B;  1UGP B;  3OA6 A;  4CRI A;  3H41 A;  4KH1 B;  4C92 G;  3M9Q A;  2A0F B;  2KK4 A;  4N4H A;  3M58 A;  5IHI A;  4RUG A;  4M7D D;  4KT0 E;  4JUV A;  3L2Q A;  5GAM f;  2R5A A;  5LJ5 j;  3L42 A;  3VRZ A;  3IQL A;  2CRE A;  3PGG A;  2RPN A;  2RI5 A;  3MP6 A;  3OS1 A;  2R58 A;  2DYB A;  1ZSZ A;  5CKH A;  1IGQ A;  3M56 A;  2MOX A;  4JRQ A;  3QJ6 A;  3L2V A;  3EG1 A;  4M77 B;  4TVR A;  4C5E A;  2NUP B;  1T0H A;  2V8I A;  2FPE A;  1RAI B;  3CCU A;  1JJ2 S;  1QVF A;  3PFS A;  2EYY A;  5LJ5 g;  1UHC A;  2X4W A;  3C94 A;  2VGN A;  1AWJ A;  4LUE A;  1RAE B;  3R6O A;  3MET A;  4RTW A;  3JB9 G;  1M9S A;  4PK4 A;  2KR3 A;  3EAE A;  4PJO F;  2RA2 A;  4OP0 A; 
#chains in the Genus database with same CATH homology
 2CP6 A;  2COY A;  2HKN A;  2QK0 A;  1LPL A;  1WHM A;  3TQ7 P;  2COW A;  2Z0W A;  2CP3 A;  2CP7 A;  1TOV A;  4B6M A;  2HL3 A;  1TXQ A;  3E2U A;  2E3I A;  3RDV A;  1WHG A;  1WHH A;  2COZ A;  2MPX C;  2E4H A;  1WHL A;  1IXD A;  2CP2 A;  2HL5 C;  2HKQ B;  2M02 A;  1WHK A;  1WHJ A;  2CP0 A;  2HQH A;  2E3H A;  2CP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...