2CP7A

Solution structure of the 1st cap-gly domain in mouse clip-170/restin
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
84
structure length
84
Chain Sequence
GSSGSSGFRVGERVWVNGNKPGFIQFLGETQFAPGQWAGIVLDEPIGKNDGSVAGVRYFQCEPLKGIFTRPSKLTRKVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the 1st CAP-Gly domain in mouse CLIP-170/restin
rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords Restin
total genus 7
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2cp7A00
2HQHA 2HKNA 1WHLA 1WHHA 2HL5C 2COYA 1WHKA 2CP7A 3RDVA 2CP6A 2E4HA 2E3IA 2CP2A 3E2UA 4B6MA 2COWA 1WHMA 1TXQA 2M02A 1TOVA 1IXDA 3TQ7P 2CP3A 2QK0A 2Z0WA 2HL3A 1WHGA 1WHJA 2MPXC 2COZA 2E3HA 2HKQB 2CP0A 1LPLA 2CP5A
chains in the Genus database with same CATH superfamily
3CCVA 1M90R 4LDXA 2PNIA 2EKHA 3X24B 1UG1A 2IVWA 3CCRT 3FIFA 2DE0X 4AG1C 4PJOF 4RTYA 4RTTA 4RTWA 2DLPA 1RLPC 2DERA 4A4KA 2FVUA 3CBPA 1FMVA 3GNFB 4IUUA 2K3YA 4C8QG 4R55A 1F1BB 1G8XA 1KJWA 3G71A 1RI9A 2BZ8A 1KC8U 4KH0B 2P0PA 2A28A 4FW2A 3MEWA 4NL3A 3I56Q 2LMJA 2RPNA 2BE9B 2EBPA 2KVQG 2O2OA 3MCAB 3M5AA 1VQ9Q 3GBQA 4J9FA 3OYFA 2CSIA 1YWPA 5CQXA 4MDWA 1YHQA 2J6OA 3CQTA 3M0TA 3ZBDA 3ER0A 5IH2A 1PWTA 3CCEQ 4RTUA 3EGXA 2VUBA 3DLLA 3VRZA 4M75C 2D0QB 2YUOA 2A37A 1X01A 2LDMA 2WSCE 2DJZA 1R8OB 2DEQA 3CCUQ 5CAIA 3VU3C 3OYYA 2IG0A 3OYDA 3FC3A 2YWWA 3A98A 1JXOA 1QCNA 2MOXA 2DETA 2XDPA 1AOJA 3CD6Q 3GNGA 3I55T 2DRMA 2KE9A 4C5GA 2BKDN 4C8QC 4CC4B 4HKEA 1Q7YU 2GFUA 2KRNA 3TVTA 2YLCA 4A53A 2X35A 3LH5A 2WACA 3EG2A 4UC4A 2L5QA 3E19A 2KGTA 4LUEA 4V2SA 4F14A 4OMNA 3ME9A 3FEOA 3J7AF 5GMKe 4M7DA 3SWNC 3VUZA 5CO7A 1M3CA 3UDCA 2RN8A 1ZUKA 1CKBA 4ESRA 3CCRA 3CCJT 1I0CA 5GAMh 4DQ2A 4M78B 2DJQA 3V7CA 2GBQA 3M0SA 1RL2A 1UTIA 2RQUA 1VQ6Q 2DYIA 3H0FA 1SKUB 2JT4A 9ATCB 3VS2A 2DNUA 4OVAA 1PKTA 3OMCA 2G3RA 3RUXA 4JJNK 1R77A 2C06A 2LTOA 3M59A 4FYXB 2F5KA 2CT3A 4C0DC 1TUCA 1VQNQ 2CH4W 2E70A 3I56T 3CCST 2QXFA 2WSFE 2DM1A 3LX7A 3VS0A 3CPWA 2F69A 1VYTA 4GBQA 4ELZC 3HTRA 4OB0B 2F2WA 1AZGB 2GF7A 3I5RA 1YJWA 1UUEA 2AK5A 2DFUA 2L3RA 1YJNQ 3TCJA 3OS0A 3RMQA 1V76A 2YRDA 5IAYA 5GAOq 3H41A 3H6ZA 3P8HA 4C0GA 2ED1A 4LD9K 3C4SA 1M2OA 2V8KA 1MMDA 2QQBA 5GAN3 1K1ZA 1VQOQ 3QYGB 2PUOB 1VQMA 3GOXA 5KYYA 1QKXA 5DM7R 3CMAA 1YBYA 3TREA 2L89A 3M56A 4RTXA 1D1BA 3QJYA 3FJPA 1VQLQ 3OW2P 2EIFA 2EQIA 1UDLA 5IHIA 4BI4A 1GFCA 2DBMA 5KH6A 3X20B 1OULA 2HCKA 2DZ9A 1I5OB 4X9DA 3FLGA 4OB1B 1M9SA 2XDDA 5GAN7 3RMSA 2QDLA 3OW2A 2K5IA 4M77A 3CBMA 4N0AC 3SD4A 2CGHA 3CCMQ 3H0HA 5LJ5f 2I2LA 2O9SA 2FHDA 1Z9QA 3T9NA 2YLBA 1M8MA 3EGUA 1BYMA 3RKXA 5DLQE 4M77C 4N0AA 4IKFA 3CCJA 1PC0A 4QKUA 3RERA 2O01E 3I55Q 2FB7A 1I1JA 1E6HA 1RAGB 4J9EA 2JOYA 1UJ0A 4RG8A 4F7UE 1D0ZA 4FW1A 3I35A 4RTZA 1R0CB 4QW2A 1Q81U 2VV5A 1IXDA 4FT4A 1O9SA 1H3ZA 3GIBA 4E7JA 1YJNA 1K0XA 4HT8A 1TUDA 1KD1C 1K76A 1VQ7T 3H9NA 1YIJQ 3NGPA 1YI2Q 2NYSA 2VC8A 4XTWA 2P4TA 4O5VA 4CRIA 4DEYA 1OYXA 5I2MA 2GGRA 2NUTB 4FIBA 2LP5A 2GNCA 2QQSA 4FM4B 2JMAA 2M02A 4LE9A 5GAN8 1W4SA 2CUDA 2NWMA 5I2SA 1NM7A 5GAN2 1VQOT 2J6KA 2QQAA 2HDAA 2LX7A 2CP0A 3M58A 2EGEA 2ED0A 2V1QA 1QVGS 3OYKA 2Y90A 4EMGA 3PTAA 2RO0A 4OGEA 2AZSA 3RBBB 1PRLC 1H3HA 2OTLT 2RHIA 3V8LA 4ZGJB 1S72A 4EDUA 1VQLT 2DVEA 2R57A 1M3BA 4O6JA 2IPOB 2RNAA 1VIEA 2HAXA 2HQXA 4TVRA 2W0ZA 1MV0B 5LJ5d 2WSEE 3CPWP 4M7AA 2BE7D 1R0BG 2O9VA 2M9UA 4PLIA 2QAZA 4Z88A 5FU6C 3E9GA 1N6AA 4FT2A 2QGFB 1VYUA 1M2VB 3G6EQ 1Q81R 1EZZB 1VQMT 2ZPIB 1XTDA 4ZGDB 1YITQ 4M7AC 2PQWA 2LNHB 2JXBA 4X1VA 5LL6S 2DF6A 3JSCA 3RNJA 2X3WD 2KK4A 2V1RA 4J6WA 3VJPA 1U1TA 4JJCA 2FPEA 2C0TA 4NS5A 3EFSA 3RESA 2DO3A 4CI0C 1KC8C 4AG2C 4F17A 2RMOA 1PM3A 3CC7T 1D0YA 1WDXA 1WI7A 2XG8D 1X6GA 3SWNA 4JRIA 1YHQQ 2K2VA 1HJDA 2FG0A 4ANJA 3QKJA 4RUGA 3VV0A 1PSEA 1IGQA 1NPPA 4JS4A 1M1FA 4DEXA 3G6EA 3LYIA 3VYGA 4DBRA 2KT8A 4ZNXA 5KYNA 3D7SB 2V26A 1TU0B 3RKWA 4BE0A 1TOVA 2DKGA 2RI2A 4MZMA 3CCQQ 4C8QA 5KYUA 1CKAA 2YRVA 1SSFA 1O75A 2K79A 3RKYA 3MO8A 4PNOA 1S72Q 1RABB 7AT1B 2EAYA 3UF4A 2XICA 1LPLA 2KDSA 4C92C 3P8BB 2DTIA 6AT1B 3EG1A 2KEAA 3CCVQ 4KGVB 1ABQA 2GQIA 4F7UF 3HRSA 1VQ8A 1Q7YC 1YJWT 4EMKB 2ECZA 4M7DG 1EX4A 4C8QF 2L2PA 4J8OA 4BDYA 3L2RA 2EYWA 3REBB 1AT1B 1G3TA 1NJIU 3CC2Q 3NFCA 3CC7Q 2ZPFB 4E7IA 1MUZA 4F7UB 4M78F 2PTKA 4M75G 2RB6A 4M78A 2FEIA 5GJWB 3AHUA 2RK2A 3V7SA 1B3QA 4IIOA 2OTJQ 4FSXA 3BDLA 2MIOA 4J7IA 2M51A 5HK0A 4C8QD 4KBMB 4OMQA 4OGCA 4BD3A 4M7DB 2DIGA 5KYXB 3SDZA 4PJOE 1VQKA 2XU8A 1UGQB 3JB9I 3CCSA 4X9CA 1VQ8T 1H641 3X26B 2E12A 1UGVA 5CQYA 3P8DA 2EWNA 1RAEB 3PIOA 1BK2A 2XKOC 3F70A 4ATOA 2CP5A 1VQ9A 4M75D 2RHUA 4XU3A 2EGAA 1LCKA 2D0NA 1TSFA 1Z9ZA 1VQ5Q 3M55A 4RCBA 2E5QA 5EC7A 4CC3A 4PJOC 2LCLA 3QUIA 1IREB 1YCYA 2DL8A 5J39A 1Q86R 3A8LB 1AHJB 2AKKA 1K8AC 1PD1A 4M7AG 1U1SA 2P4RA 2EQJA 1VQ9T 4PJNA 2QA4T 2RQTA 4C92B 1LNXA 2KYBA 4C8QE 1C6VX 1WHMA 3JCMg 4JRPA 4RCCA 1FYNA 5GANg 2KBTA 4KT0E 1P92A 1Q86C 5GAN5 4PJLA 1HXDA 2KROA 2P84A 2DILA 2DXBA 2CZ7B 1VQ5A 3VYHB 3PVLA 4AFQC 3OBYA 4CC7A 1KFZA 4BE2A 4IUQA 1FX7A 4FU6A 1OQKA 2RQVA 4PJJA 5FLXE 3M0UA 5LJ3j 2H3JA 3ZEHA 4J9HA 2YT6A 3HFNA 2OAWA 2QTXA 1QKWA 4EMKA 2RJDA 2LRQA 4M7DD 1S72T 2OX7A 1WHJA 3GPLA 2RHZA 3EHQA 3VS4A 4C92G 2ATCB 1SG5A 4A4EA 3M9QA 4C92E 1OOTA 3MPUB 3KXTA 3Q1JA 1GCQC 1EFNA 3TEEA 1WPYA 1RUWA 3I55A 3VUBA 3EG9B 3LW5E 3OYEA 3L2UA 1B34B 5L8RE 4F7UG 2V8IA 1WQ7A 3CC4Q 2RJEA 1M1KC 5HY6A 4C0ZA 1KC8R 1DJ7B 2IIMA 2HBPA 5LJ3d 2CZ1B 3WXMB 1VQ4Q 2GCXA 1X6OA 3QBYA 1M8VA 3OS2A 1OZ3A 1WJSA 4KULA 4PFOA 1T0HA 1FXXA 3TQ7P 3CBOA 2ABLA 3BDUA 1U5SA 3NMZC 4JRQA 3META 1BI2A 4IUTA 5AYFA 1S1NA 3C94A 4LDWA 1ZX6A 2XMFA 1Q81C 4XAXB 1VQ5T 1HSQA 1Y96B 3KFVA 4F16A 1UGPB 1KD1U 2DK3A 2DXCA 2EFIA 1UGSB 3WVEB 1FMWA 2A3LA 2DD5A 2Z0WA 3PGGA 1QVPA 3EG9A 1AWWA 4L5GA 2ZPHB 1OU9A 4M77D 2HMAA 4Z02A 1QVFS 1UECA 4FL6A 4FYWB 1M2VA 3QZ9B 5GAMf 1MNDA 4AMCA 3G7ZA 4OP0A 4LDVA 1AWXA 3H0IA 1N9RA 2FPDA 1OX9A 2CSQA 2GTJA 1KK7A 4M7AB 4KGZB 3UWNA 3CD6A 3CCET 4KGXB 2DX1A 1WYXA 1MMGA 2F2VA 2PVOB 4E2FB 3CPWS 3BW1A 1X27A 4M7AF 3OYGA 2YXYA 4J9GA 5KYWB 1NEGA 2F2XA 4M78G 3BFMA 2RI5A 1VIFA 3L1AA 4AT1B 3MEVA 4GY5A 4JJDA 5J3BA 4N4GA 1GCPA 4LN2A 5A0GA 4BI3A 2DL7A 1QVGA 1BIBA 4ELYC 2ZCFB 1N8RC 3UPUA 2HBWA 4E47A 3FDRA 1JB0E 5CKEA 2HL5C 3JB9D 1WHKA 5GAMj 1T3SA 2KAFA 3QO3A 1IB8A 4B6MA 3KBGA 2X4JA 1PKSA 1VQ6A 3EG3A 3C95A 1KD1R 1QCFA 4QVZA 3GP8A 3QDRB 4L59A 3OQ5A 1B7TA 1H92A 1MHNA 2HKNA 2YUQA 2COYA 3NHNA 4E7LA 3CEYA 5GMKm 4M77E 1J3TA 2DRKA 1Q82R 5CKFA 2E6ZA 3A1PA 2DXTA 1X69A 4LDYA 3VKIA 2BTTA 2X4WA 5EG2A 5KYXA 4M7AD 2MPXC 3HL8A 4D6WA 2DVJA 3OYCA 1WIEA 1HD3A 4C5IA 2MCNA 1QCOA 5LJ5e 2EYXA 2K3BA 1BCOA 4RMOA 4M77B 5AT1B 3CCQT 5FWBA 4Q5WA 1SHGA 1G2BA 4HCKA 4JLGA 4F7UA 3JCMh 2B8AA 2HNIA 1PD0A 3QSUA 1Y7XA 2FZKB 5GMKi 4M77F 2EYQA 2KMTA 2C0OA 3WVDB 2K4YA 3MEUA 1W6XA 3UA6A 3TSZA 1M5Q1 2DTHA 1PCXA 4PK4A 1PSFA 2LJ3A 1D1CA 2LZ6B 3S3NA 2QQ9A 2QQRA 3CC2T 3OYLA 3VS3A 5M9OA 2A7YA 5CKDA 2EQUA 2D9TA 2AIRB 2E6NA 1NJIC 3QG1A 2K3XA 3BY7A 1XOVA 1NG2A 2QEXT 4M78D 3A8MB 3HP9A 1JXMA 2DAQA 2HQHA 1K9MR 4D8DA 2RJCA 3C12A 1V1CA 3QZ5B 4PFZA 5KYUB 2KT1A 2COWA 1I07A 2FL7A 3QJ6A 4J9CA 4C5HA 1H8KA 4EMHA 3CXCA 1OI1A 2ENMA 4OF1A 2FO0A 5CKHA 2EYZA 4XTVA 5LJ5j 4J9DA 5LJ3g 2KY9A 2BUDA 1VQKT 1G5VA 1KIKA 4PJMA 4MDXA 1B07A 2PZ1A 3S3OA 1U8RA 2LJ0A 4C0FA 4M7AE 1EIFA 1UB4A 3DB3A 3O5ZA 2MYSA 3SWNB 5CR2A 2X3XD 3INZA 1VQLA 2P0QA 1KHCA 2OTLQ 4OMPA 1LOJA 2HL3A 1RI0A 5FU7B 1FMKA 2XI9A 1NEBA 1ZUYA 5GMKl 2L3PA 3M0QA 3A5ZB 4OMOA 2VVKA 3A8GB 1KQSS 1MGQA 2KRSA 5IT9E 2ROTA 4C92F 4MMLA 5I11A 1AD5A 3U23A 1TXQA 1K8AU 1YIJA 2JM8A 2YDLA 2CYZB 1ZBXA 3VRYA 2ZAEA 4BB7A 2EVRA 1MV3A 5CVIA 1Q82C 5FRMA 3THKA 2RJFA 4M75F 1RAHB 2MI6A 2CT4A 3SEMA 1PG5B 4EIKA 1BCMA 1IRXA 3CCUT 1BBZA 1Q86U 1I81A 1K73C 4PLLA 1WX6A 1YJ9T 2ZZDA 2RHYA 2JNGA 2PVGB 2EKOA 3CMET 4JJBA 3N5BB 4PJOD 3CCSQ 1VQKQ 3CD6T 2YUPA 1WHGA 3EFRA 2XK0A 1RACB 2HZYA 1UGRB 2RA2A 5IXFA 1BKBA 2L0AA 3JV3A 4R56A 1TH7A 2E65A 4BACA 1NLPC 4ZN1A 2E64A 2X4YA 1D09B 1ACMB 1RAIB 5FWCA 2O4XB 5GANh 1PNJA 4PKCC 3FB9A 2DD4A 2FPFA 1SSHA 1WFWA 2CH4A 2XIDA 2ZPEB 2RQWA 1WJRA 1ZLMA 1TG0A 3V8JA 1X43A 1W2BS 4D8KA 2NUZA 1SRLA 2PU9B 5KE2A 3EGXB 1WZOA 4RG2A 1M1KU 3DLMA 1X6BA 2DL5A 4J5YA 4MZPA 2GTOA 4J6XA 5KYWA 1Y07A 2HEQA 1VQMQ 1QW1A 1SPKA 3GLXA 4EMKC 4JRKA 4II1A 1YITT 2P0KA 2KYMA 1JJ2P 4M7DF 4DOVA 4M75E 3EH1A 5A0DA 2LCCA 1N8RR 4HT9A 2JS0A 4A4HA 3HHTB 2JN0A 2DA9A 1RAFB 2R58A 3S3MA 4FYYB 2LX9A 4E7SA 1OEBA 4M78C 1K8AR 2VASA 1WHLA 2M0YA 1PHTA 8ATCB 5A0LA 4XTYA 4XQ3A 4M78E 1A0NB 2VWFA 5CKBA 3EAEA 2QTVA 3LGFA 2SRCA 3DKMA 4WCIA 1NLOC 1VYVA 5GMKh 1D1AA 3L42A 3L2WA 4P5NA 4IIMA 2Y4XA 3CC2A 1WXBA 2LT4A 2QA4Q 2L3SA 3PT9A 4PL6A 5D6YA 3G71Q 2HQEA 2EQMA 3UA7A 4LD6A 1ZSZA 1Y57A 3V8KA 2RM4A 3CPFA 4N4HA 4E7ZA 1Q7YR 5GANe 5FROA 2EJGA 1M90C 2CZ6B 1N8RU 1KG1A 2FRYA 2JW4A 2G6FX 3LWIA 1B34A 1RAAB 2JTFA 4OMLA 1BIAA 4QQGA 4WF2A 3MEAA 2M0OA 3TSWA 4DBHA 2DIQA 3X28B 1JJ2S 1HYOA 3CCQA 2E10A 2GQVA 1CSKA 1VQ7A 1QMCA 2M1HA 4QVDA 3M57A 3DB4A 2E3HA 2QA4A 2QG9B 1UJYA 1VQ4A 2CS7A 5C0MA 4KH1B 2E5KA 2CP7A 4HCZA 2RH2A 4DOWA 1Y0MA 3M54A 3OSSC 2DL3A 4JZ4A 2DTOA 1YJ9Q 4BI8B 2O88A 1YIJT 2K6DA 2LVMA 5A2QE 5KCOA 4C92A 5I22A 4IUPA 2ZGWA 3EFOA 1W2BP 1BI0A 5L23A 2K7AA 2VYTA 3EGDB 1WQWA 4BE1A 1TUGB 1YI2T 2O31A 1UFFA 3MKDA 2HD0A 2YHTA 3OA6A 1K9MC 1ARKA 3I56A 1U06A 2E4HA 2A36A 1G3YA 4HVWA 4GLMA 4A4FA 4B9XA 3JCMd 1YITA 2VXEA 4A4GA 3LH0A 4AFSC 1NE8A 3HFOA 3HRUA 1QQJA 2EJ9A 4IURA 2COZA 3OYHA 5LJ3f 2OJ2A 1KQ1A 2RF0A 4E7KA 5IHNA 1NJIR 1KQ2A 2ZPGB 4BY6C 1GCQA 2OTJT 1IGUA 2VKNA 5LJ5h 2EGCA 1JQQA 2QI2A 5DY9A 2R5MA 1ZA2B 4RTVA 1Q95G 5GMKj 1AWJA 1GBRA 5J26A 1NYFA 5CCAA 2JJ9A 2K2MA 3JB9G 2VGMA 1KQSP 1N5ZA 3JB9H 5FU6B 3UATA 2VGNA 4CC2A 1QVFP 1VQPA 3CCLA 2L8DA 2DBKA 2LC4A 2FZCB 2JUFA 4LUDA 3TU4K 1YI2A 1IHWA 1VQPQ 1UHCA 3CC4A 4DBFA 3X25B 2KSSA 1SRMA 3CCJQ 3PMTA 4EPCA 1X2KA 1HK9A 1AEYA 2H8HA 2VXFA 1YNZA 1N27A 1MMAA 3VS6A 5GAOm 2FRWA 4VUBA 1OU8A 1XQHA 5D6WA 3JCMf 2DEUA 2MWOA 1K9AA 2KXDA 2BZYA 1IHVA 1TS9A 1Q82U 1AWOA 4C8QB 1YFNA 2LT1A 3OYIA 5D6XA 1YCSB 3CC7A 3QYHB 1C1AA 1I8FA 3JCMP 5HK3A 3M4GA 1K73U 3L2VA 1AZEA 4C5EA 4YTLA 1D3BB 4R0KA 1VQ8Q 3H8ZA 3CCLT 2OTLA 3CCRQ 1GL5A 2EQKA 4K11A 4M7DE 3HPWA 1QLYA 2PUKB 4WTOB 3PIPA 3SHWA 4C92D 5KE3A 1XNIA 4MMKA 5HKCA 2CREA 1VQOA 1YN8A 4HVVA 2OAUA 3FJ5A 4Z8AA 2JVVA 3ASKA 2QK0A 3JCMQ 3JB9J 4HA8A 4XTZA 1SHFA 5KCHA 4XU1A 2K5LA 5LJ5g 3L2QA 3M4YA 2C0IA 1VUBA 4RKUE 2ZPBB 2RHXA 3JCMb 2RK1A 4JUVA 1ABOA 1NZ9A 2XD0A 3C0CA 5ECAA 1KHIA 3FRNA 3JCMe 1JO8A 5CIUA 2YSQA 2YUNA 2EW3A 4AFUC 4JZ3A 2DPPB 4NOYA 4KRTA 2B86A 1E6GA 2K5FA 5CK9A 4XTUA 1MNEA 1VQNT 2O4XA 1QVFA 1QP2A 1MMNA 3GF5A 2LQWA 2D8JA 3CXCS 3HKSA 3VS7A 2M16A 4OMMA 1WJQA 1GBQA 3JRZA 3OB9A 2EJFA 1K4US 5FW9A 5GAN4 1JBMA 4J7FA 3PVQA 3OYNA 1M1KR 1JJ2A 4XTXA 2LQNA 4Z89A 4HVUA 2CP3A 3REAB 3CXCP 4X34A 4XU0A 2NUTA 3O8VA 3URGA 2FZGB 2LQKA 3OS1A 2EYYA 1JRIA 3QWYA 4J9IA 1VQPT 2NUPB 3OMGA 2JTEA 2MK5A 2QGGA 1N9SA 3QPHA 3OSVA 2GFAA 1KQSA 1KSWA 1WXUA 2HSEB 1GFDA 3VS1A 4Y28E 2J05A 2DL4A 4M77G 1X2QA 2OI3A 3RR6A 4QVCA 2J06A 2X9HA 1LJOA 3G4SQ 4J9BA 3NPFA 4Y92A 2CKKA 3AT1B 3A8OB 3MP6A 1JEGA 5GJVB 1VA7A 3OYBA 3PE0A 3CCVT 2JZ2A 3PMIA 1ZQ1A 1UEBA 1YJ9A 3UT1A 1ZSGA 2QEXA 4ZTFA 3R6NA 4J6YA 3EHRA 1RLQC 5GAMe 1M90U 2W10A 3CCUA 3OYJA 2KXCA 4XU2A 2JM9A 8AT1B 2MWPA 1M4ZA 4M75B 3HRTA 3L2ZA 2QEXQ 3OBWA 4M4ZA 1ZA1B 2F1LA 4B9WA 1VQ7Q 2I0NA 3JCMJ 4KUDK 4ME7A 2JMCA 1LVKA 3OYMA 5GANj 2BIVA 1ZUUA 4BUGA 3CCEA 3LWHA 4A63B 1NYGA 3RIRA 3QXEB 1IZ6A 2PVDB 3LLRA 1G83A 2AZVA 2RI3A 4LXCA 3QIIA 3ULRB 2AKLA 4IUVA 2MMPA 3E1SA 2J7IA 4HXJA 5GAOr 4NL2A 2CUBA 1W2BA 5KYYB 1BI3A 5GAMd 3G4SA 1SEMA 3MP1A 1ZSZC 3OY9A 1WHHA 5HCKA 3SB2A 5LJ3e 3G6ET 3MP8A 2QYZA 4PFPA 3HSBA 2E3IA 1QWFA 2CP2A 1OPLA 4XK8E 2ROLA 4Y91A 1OZ2A 4JPBW 5C6SA 2RQRA 2E41A 3JCMX 1ZHIA 3EH2A 2JTMA 1U3OA 1V29B 2DXUA 2KI7A 4M75A 1K9MU 3VS5A 1OX8A 1OV3A 2SEMA 4OB3B 3CC4T 4ZTJA 4LDUA 2VB6A 3CMEQ 4N4IA 4MZTA 2K9GA 2ESWA 3QDFA 4AFZC 5GANf 3SFMA 2KNBB 3MJXA 1M27C 3E2UA 3CCMT 1VOMA 2RD1A 2KQWA 4J83A 3NTHA 4HCBA 1PRMC 1BB9A 3ZFJA 1XJWB 3NTIA 3PFSA 5IHKA 3M0PA 2KR3A 3KUFA 4L6V5 1GXIE 3LGLA 4ORZA 1K73R 1X75C 3G4ST 1VQ4T 3QHSA 4FYVB 4DA4A 5GAOn 1K0SA 1M3AA 1WXTA 3MHXA 1NBEB 5I21A 5GAOl 1UE9A 1QVGP 2FYKA 3PNWC 2NLUA 3CMAT 2NUPA 2A0FB 1TTHB 3R6OA 1W1FA 1YJNT 1T0JA 3JCMV 1G3SA 2L3QA 1JU5C 4QQ6A 3EG0A 3JCMW 3CCMA 5FRNA 4FSSA 4QT7A 3EGDA 5D7UA 3EFOB 2CDTA 2EPDA 1I4K1 3IQLA 1AVZC 2QASA 4HCCA 4BY6B 2X51A 2HKQB 4ZN3A 1FWZA 1Y71A 4A54A 2J6FA 3J81E 5IXBA 5FU7C 2YRCA 1W70A 3M0RA 4BDZA 1QWEA 2DMOA 1WA7A 3OS5A 1VQ6T 4DBQA 2DZCA 2D8HA 3E9FA 1WLPB 1YHQT 2KRMA 2Y4YA 1QP3A 4QQDA 2D1XA 5GAOp 3V7RA 3JCMc 2H3EB 1T3LA 2QDYB 2XDBA 2HSPA 3JAME 2LNVA 3S6WA 2CP6A 3JB9F 2MF2A 3NTKA 2BZXA 4JDSA 4FCYA 1C0MA 4JLIA 3CMAQ 5GAMg 1BI1A 3J80E 3QWXX 2F5TX 3I9QA 1BU1A 2CZ0B 4GLKA 1YWOA 2R5AA 1UHFA 3OYAA 2V8JA 1Y96A 4OB2B 2K57A 1M30A 2AT1B 3RDVA 2D6FA 4LNPA 1ZBJA 1I5LA 2A08A 3G71T 1WNLA 3A8HB 1TWBA 4M7DC 1IO6A 4PJOG 2E1HA 1YJWQ 5LJ3h 1ZSZB 2MAMA 3OW2S 2JS2A 1D3BA 2LJ1A 1WGSA 4C0DB 1YP5A 4KUIA 4E7HA 5GAN6 4ZGEB 3CCLQ 5DLOA 2AHJB 3ZL7C 1SF9A 4OMFB 1E7OA 4F04B 2XHCA 3M53A 4PJOA 2OTJA 2X4XA 5GANd 1D0XA 2LCSA 3G1JA 2LQ8A 3CMEA 1VQNA 1M1GA 1G3WA 4E6RA 4JS5A 3I5SA 1OPKA 1RADB 1NPRA 1GRIA 4PJOB 3BE3A 2DYBA 5IN1A
chains in the Genus database with same CATH topology
2HQHA 2HKNA 1WHLA 1WHHA 2HL5C 2COYA 1WHKA 2CP7A 3RDVA 2CP6A 2E4HA 2E3IA 2CP2A 3E2UA 4B6MA 2COWA 1WHMA 1TXQA 2M02A 1TOVA 1IXDA 3TQ7P 2CP3A 2QK0A 2Z0WA 2HL3A 1WHGA 1WHJA 2MPXC 2COZA 2E3HA 2HKQB 2CP0A 1LPLA 2CP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HQH A;  2HKN A;  1WHL A;  1WHH A;  2HL5 C;  2COY A;  1WHK A;  2CP7 A;  3RDV A;  2CP6 A;  2E4H A;  2E3I A;  2CP2 A;  3E2U A;  4B6M A;  2COW A;  1WHM A;  1TXQ A;  2M02 A;  1TOV A;  1IXD A;  3TQ7 P;  2CP3 A;  2QK0 A;  2Z0W A;  2HL3 A;  1WHG A;  1WHJ A;  2MPX C;  2COZ A;  2E3H A;  2HKQ B;  2CP0 A;  1LPL A;  2CP5 A; 
#chains in the Genus database with same CATH topology
 3CCV A;  1M90 R;  4LDX A;  2PNI A;  2EKH A;  3X24 B;  1UG1 A;  2IVW A;  3CCR T;  3FIF A;  2DE0 X;  4AG1 C;  4PJO F;  4RTY A;  4RTT A;  4RTW A;  2DLP A;  1RLP C;  2DER A;  4A4K A;  2FVU A;  3CBP A;  1FMV A;  3GNF B;  4IUU A;  2K3Y A;  4C8Q G;  4R55 A;  1F1B B;  1G8X A;  1KJW A;  3G71 A;  1RI9 A;  2BZ8 A;  1KC8 U;  4KH0 B;  2P0P A;  2A28 A;  4FW2 A;  3MEW A;  4NL3 A;  3I56 Q;  2LMJ A;  2RPN A;  2BE9 B;  2EBP A;  2KVQ G;  2O2O A;  3MCA B;  3M5A A;  1VQ9 Q;  3GBQ A;  4J9F A;  3OYF A;  2CSI A;  1YWP A;  5CQX A;  4MDW A;  1YHQ A;  2J6O A;  3CQT A;  3M0T A;  3ZBD A;  3ER0 A;  5IH2 A;  1PWT A;  3CCE Q;  4RTU A;  3EGX A;  2VUB A;  3DLL A;  3VRZ A;  4M75 C;  2D0Q B;  2YUO A;  2A37 A;  1X01 A;  2LDM A;  2WSC E;  2DJZ A;  1R8O B;  2DEQ A;  3CCU Q;  5CAI A;  3VU3 C;  3OYY A;  2IG0 A;  3OYD A;  3FC3 A;  2YWW A;  3A98 A;  1JXO A;  1QCN A;  2MOX A;  2DET A;  2XDP A;  1AOJ A;  3CD6 Q;  3GNG A;  3I55 T;  2DRM A;  2KE9 A;  4C5G A;  2BKD N;  4C8Q C;  4CC4 B;  4HKE A;  1Q7Y U;  2GFU A;  2KRN A;  3TVT A;  2YLC A;  4A53 A;  2X35 A;  3LH5 A;  2WAC A;  3EG2 A;  4UC4 A;  2L5Q A;  3E19 A;  2KGT A;  4LUE A;  4V2S A;  4F14 A;  4OMN A;  3ME9 A;  3FEO A;  3J7A F;  5GMK e;  4M7D A;  3SWN C;  3VUZ A;  5CO7 A;  1M3C A;  3UDC A;  2RN8 A;  1ZUK A;  1CKB A;  4ESR A;  3CCR A;  3CCJ T;  1I0C A;  5GAM h;  4DQ2 A;  4M78 B;  2DJQ A;  3V7C A;  2GBQ A;  3M0S A;  1RL2 A;  1UTI A;  2RQU A;  1VQ6 Q;  2DYI A;  3H0F A;  1SKU B;  2JT4 A;  9ATC B;  3VS2 A;  2DNU A;  4OVA A;  1PKT A;  3OMC A;  2G3R A;  3RUX A;  4JJN K;  1R77 A;  2C06 A;  2LTO A;  3M59 A;  4FYX B;  2F5K A;  2CT3 A;  4C0D C;  1TUC A;  1VQN Q;  2CH4 W;  2E70 A;  3I56 T;  3CCS T;  2QXF A;  2WSF E;  2DM1 A;  3LX7 A;  3VS0 A;  3CPW A;  2F69 A;  1VYT A;  4GBQ A;  4ELZ C;  3HTR A;  4OB0 B;  2F2W A;  1AZG B;  2GF7 A;  3I5R A;  1YJW A;  1UUE A;  2AK5 A;  2DFU A;  2L3R A;  1YJN Q;  3TCJ A;  3OS0 A;  3RMQ A;  1V76 A;  2YRD A;  5IAY A;  5GAO q;  3H41 A;  3H6Z A;  3P8H A;  4C0G A;  2ED1 A;  4LD9 K;  3C4S A;  1M2O A;  2V8K A;  1MMD A;  2QQB A;  5GAN 3;  1K1Z A;  1VQO Q;  3QYG B;  2PUO B;  1VQM A;  3GOX A;  5KYY A;  1QKX A;  5DM7 R;  3CMA A;  1YBY A;  3TRE A;  2L89 A;  3M56 A;  4RTX A;  1D1B A;  3QJY A;  3FJP A;  1VQL Q;  3OW2 P;  2EIF A;  2EQI A;  1UDL A;  5IHI A;  4BI4 A;  1GFC A;  2DBM A;  5KH6 A;  3X20 B;  1OUL A;  2HCK A;  2DZ9 A;  1I5O B;  4X9D A;  3FLG A;  4OB1 B;  1M9S A;  2XDD A;  5GAN 7;  3RMS A;  2QDL A;  3OW2 A;  2K5I A;  4M77 A;  3CBM A;  4N0A C;  3SD4 A;  2CGH A;  3CCM Q;  3H0H A;  5LJ5 f;  2I2L A;  2O9S A;  2FHD A;  1Z9Q A;  3T9N A;  2YLB A;  1M8M A;  3EGU A;  1BYM A;  3RKX A;  5DLQ E;  4M77 C;  4N0A A;  4IKF A;  3CCJ A;  1PC0 A;  4QKU A;  3RER A;  2O01 E;  3I55 Q;  2FB7 A;  1I1J A;  1E6H A;  1RAG B;  4J9E A;  2JOY A;  1UJ0 A;  4RG8 A;  4F7U E;  1D0Z A;  4FW1 A;  3I35 A;  4RTZ A;  1R0C B;  4QW2 A;  1Q81 U;  2VV5 A;  1IXD A;  4FT4 A;  1O9S A;  1H3Z A;  3GIB A;  4E7J A;  1YJN A;  1K0X A;  4HT8 A;  1TUD A;  1KD1 C;  1K76 A;  1VQ7 T;  3H9N A;  1YIJ Q;  3NGP A;  1YI2 Q;  2NYS A;  2VC8 A;  4XTW A;  2P4T A;  4O5V A;  4CRI A;  4DEY A;  1OYX A;  5I2M A;  2GGR A;  2NUT B;  4FIB A;  2LP5 A;  2GNC A;  2QQS A;  4FM4 B;  2JMA A;  2M02 A;  4LE9 A;  5GAN 8;  1W4S A;  2CUD A;  2NWM A;  5I2S A;  1NM7 A;  5GAN 2;  1VQO T;  2J6K A;  2QQA A;  2HDA A;  2LX7 A;  2CP0 A;  3M58 A;  2EGE A;  2ED0 A;  2V1Q A;  1QVG S;  3OYK A;  2Y90 A;  4EMG A;  3PTA A;  2RO0 A;  4OGE A;  2AZS A;  3RBB B;  1PRL C;  1H3H A;  2OTL T;  2RHI A;  3V8L A;  4ZGJ B;  1S72 A;  4EDU A;  1VQL T;  2DVE A;  2R57 A;  1M3B A;  4O6J A;  2IPO B;  2RNA A;  1VIE A;  2HAX A;  2HQX A;  4TVR A;  2W0Z A;  1MV0 B;  5LJ5 d;  2WSE E;  3CPW P;  4M7A A;  2BE7 D;  1R0B G;  2O9V A;  2M9U A;  4PLI A;  2QAZ A;  4Z88 A;  5FU6 C;  3E9G A;  1N6A A;  4FT2 A;  2QGF B;  1VYU A;  1M2V B;  3G6E Q;  1Q81 R;  1EZZ B;  1VQM T;  2ZPI B;  1XTD A;  4ZGD B;  1YIT Q;  4M7A C;  2PQW A;  2LNH B;  2JXB A;  4X1V A;  5LL6 S;  2DF6 A;  3JSC A;  3RNJ A;  2X3W D;  2KK4 A;  2V1R A;  4J6W A;  3VJP A;  1U1T A;  4JJC A;  2FPE A;  2C0T A;  4NS5 A;  3EFS A;  3RES A;  2DO3 A;  4CI0 C;  1KC8 C;  4AG2 C;  4F17 A;  2RMO A;  1PM3 A;  3CC7 T;  1D0Y A;  1WDX A;  1WI7 A;  2XG8 D;  1X6G A;  3SWN A;  4JRI A;  1YHQ Q;  2K2V A;  1HJD A;  2FG0 A;  4ANJ A;  3QKJ A;  4RUG A;  3VV0 A;  1PSE A;  1IGQ A;  1NPP A;  4JS4 A;  1M1F A;  4DEX A;  3G6E A;  3LYI A;  3VYG A;  4DBR A;  2KT8 A;  4ZNX A;  5KYN A;  3D7S B;  2V26 A;  1TU0 B;  3RKW A;  4BE0 A;  1TOV A;  2DKG A;  2RI2 A;  4MZM A;  3CCQ Q;  4C8Q A;  5KYU A;  1CKA A;  2YRV A;  1SSF A;  1O75 A;  2K79 A;  3RKY A;  3MO8 A;  4PNO A;  1S72 Q;  1RAB B;  7AT1 B;  2EAY A;  3UF4 A;  2XIC A;  1LPL A;  2KDS A;  4C92 C;  3P8B B;  2DTI A;  6AT1 B;  3EG1 A;  2KEA A;  3CCV Q;  4KGV B;  1ABQ A;  2GQI A;  4F7U F;  3HRS A;  1VQ8 A;  1Q7Y C;  1YJW T;  4EMK B;  2ECZ A;  4M7D G;  1EX4 A;  4C8Q F;  2L2P A;  4J8O A;  4BDY A;  3L2R A;  2EYW A;  3REB B;  1AT1 B;  1G3T A;  1NJI U;  3CC2 Q;  3NFC A;  3CC7 Q;  2ZPF B;  4E7I A;  1MUZ A;  4F7U B;  4M78 F;  2PTK A;  4M75 G;  2RB6 A;  4M78 A;  2FEI A;  5GJW B;  3AHU A;  2RK2 A;  3V7S A;  1B3Q A;  4IIO A;  2OTJ Q;  4FSX A;  3BDL A;  2MIO A;  4J7I A;  2M51 A;  5HK0 A;  4C8Q D;  4KBM B;  4OMQ A;  4OGC A;  4BD3 A;  4M7D B;  2DIG A;  5KYX B;  3SDZ A;  4PJO E;  1VQK A;  2XU8 A;  1UGQ B;  3JB9 I;  3CCS A;  4X9C A;  1VQ8 T;  1H64 1;  3X26 B;  2E12 A;  1UGV A;  5CQY A;  3P8D A;  2EWN A;  1RAE B;  3PIO A;  1BK2 A;  2XKO C;  3F70 A;  4ATO A;  2CP5 A;  1VQ9 A;  4M75 D;  2RHU A;  4XU3 A;  2EGA A;  1LCK A;  2D0N A;  1TSF A;  1Z9Z A;  1VQ5 Q;  3M55 A;  4RCB A;  2E5Q A;  5EC7 A;  4CC3 A;  4PJO C;  2LCL A;  3QUI A;  1IRE B;  1YCY A;  2DL8 A;  5J39 A;  1Q86 R;  3A8L B;  1AHJ B;  2AKK A;  1K8A C;  1PD1 A;  4M7A G;  1U1S A;  2P4R A;  2EQJ A;  1VQ9 T;  4PJN A;  2QA4 T;  2RQT A;  4C92 B;  1LNX A;  2KYB A;  4C8Q E;  1C6V X;  1WHM A;  3JCM g;  4JRP A;  4RCC A;  1FYN A;  5GAN g;  2KBT A;  4KT0 E;  1P92 A;  1Q86 C;  5GAN 5;  4PJL A;  1HXD A;  2KRO A;  2P84 A;  2DIL A;  2DXB A;  2CZ7 B;  1VQ5 A;  3VYH B;  3PVL A;  4AFQ C;  3OBY A;  4CC7 A;  1KFZ A;  4BE2 A;  4IUQ A;  1FX7 A;  4FU6 A;  1OQK A;  2RQV A;  4PJJ A;  5FLX E;  3M0U A;  5LJ3 j;  2H3J A;  3ZEH A;  4J9H A;  2YT6 A;  3HFN A;  2OAW A;  2QTX A;  1QKW A;  4EMK A;  2RJD A;  2LRQ A;  4M7D D;  1S72 T;  2OX7 A;  1WHJ A;  3GPL A;  2RHZ A;  3EHQ A;  3VS4 A;  4C92 G;  2ATC B;  1SG5 A;  4A4E A;  3M9Q A;  4C92 E;  1OOT A;  3MPU B;  3KXT A;  3Q1J A;  1GCQ C;  1EFN A;  3TEE A;  1WPY A;  1RUW A;  3I55 A;  3VUB A;  3EG9 B;  3LW5 E;  3OYE A;  3L2U A;  1B34 B;  5L8R E;  4F7U G;  2V8I A;  1WQ7 A;  3CC4 Q;  2RJE A;  1M1K C;  5HY6 A;  4C0Z A;  1KC8 R;  1DJ7 B;  2IIM A;  2HBP A;  5LJ3 d;  2CZ1 B;  3WXM B;  1VQ4 Q;  2GCX A;  1X6O A;  3QBY A;  1M8V A;  3OS2 A;  1OZ3 A;  1WJS A;  4KUL A;  4PFO A;  1T0H A;  1FXX A;  3TQ7 P;  3CBO A;  2ABL A;  3BDU A;  1U5S A;  3NMZ C;  4JRQ A;  3MET A;  1BI2 A;  4IUT A;  5AYF A;  1S1N A;  3C94 A;  4LDW A;  1ZX6 A;  2XMF A;  1Q81 C;  4XAX B;  1VQ5 T;  1HSQ A;  1Y96 B;  3KFV A;  4F16 A;  1UGP B;  1KD1 U;  2DK3 A;  2DXC A;  2EFI A;  1UGS B;  3WVE B;  1FMW A;  2A3L A;  2DD5 A;  2Z0W A;  3PGG A;  1QVP A;  3EG9 A;  1AWW A;  4L5G A;  2ZPH B;  1OU9 A;  4M77 D;  2HMA A;  4Z02 A;  1QVF S;  1UEC A;  4FL6 A;  4FYW B;  1M2V A;  3QZ9 B;  5GAM f;  1MND A;  4AMC A;  3G7Z A;  4OP0 A;  4LDV A;  1AWX A;  3H0I A;  1N9R A;  2FPD A;  1OX9 A;  2CSQ A;  2GTJ A;  1KK7 A;  4M7A B;  4KGZ B;  3UWN A;  3CD6 A;  3CCE T;  4KGX B;  2DX1 A;  1WYX A;  1MMG A;  2F2V A;  2PVO B;  4E2F B;  3CPW S;  3BW1 A;  1X27 A;  4M7A F;  3OYG A;  2YXY A;  4J9G A;  5KYW B;  1NEG A;  2F2X A;  4M78 G;  3BFM A;  2RI5 A;  1VIF A;  3L1A A;  4AT1 B;  3MEV A;  4GY5 A;  4JJD A;  5J3B A;  4N4G A;  1GCP A;  4LN2 A;  5A0G A;  4BI3 A;  2DL7 A;  1QVG A;  1BIB A;  4ELY C;  2ZCF B;  1N8R C;  3UPU A;  2HBW A;  4E47 A;  3FDR A;  1JB0 E;  5CKE A;  2HL5 C;  3JB9 D;  1WHK A;  5GAM j;  1T3S A;  2KAF A;  3QO3 A;  1IB8 A;  4B6M A;  3KBG A;  2X4J A;  1PKS A;  1VQ6 A;  3EG3 A;  3C95 A;  1KD1 R;  1QCF A;  4QVZ A;  3GP8 A;  3QDR B;  4L59 A;  3OQ5 A;  1B7T A;  1H92 A;  1MHN A;  2HKN A;  2YUQ A;  2COY A;  3NHN A;  4E7L A;  3CEY A;  5GMK m;  4M77 E;  1J3T A;  2DRK A;  1Q82 R;  5CKF A;  2E6Z A;  3A1P A;  2DXT A;  1X69 A;  4LDY A;  3VKI A;  2BTT A;  2X4W A;  5EG2 A;  5KYX A;  4M7A D;  2MPX C;  3HL8 A;  4D6W A;  2DVJ A;  3OYC A;  1WIE A;  1HD3 A;  4C5I A;  2MCN A;  1QCO A;  5LJ5 e;  2EYX A;  2K3B A;  1BCO A;  4RMO A;  4M77 B;  5AT1 B;  3CCQ T;  5FWB A;  4Q5W A;  1SHG A;  1G2B A;  4HCK A;  4JLG A;  4F7U A;  3JCM h;  2B8A A;  2HNI A;  1PD0 A;  3QSU A;  1Y7X A;  2FZK B;  5GMK i;  4M77 F;  2EYQ A;  2KMT A;  2C0O A;  3WVD B;  2K4Y A;  3MEU A;  1W6X A;  3UA6 A;  3TSZ A;  1M5Q 1;  2DTH A;  1PCX A;  4PK4 A;  1PSF A;  2LJ3 A;  1D1C A;  2LZ6 B;  3S3N A;  2QQ9 A;  2QQR A;  3CC2 T;  3OYL A;  3VS3 A;  5M9O A;  2A7Y A;  5CKD A;  2EQU A;  2D9T A;  2AIR B;  2E6N A;  1NJI C;  3QG1 A;  2K3X A;  3BY7 A;  1XOV A;  1NG2 A;  2QEX T;  4M78 D;  3A8M B;  3HP9 A;  1JXM A;  2DAQ A;  2HQH A;  1K9M R;  4D8D A;  2RJC A;  3C12 A;  1V1C A;  3QZ5 B;  4PFZ A;  5KYU B;  2KT1 A;  2COW A;  1I07 A;  2FL7 A;  3QJ6 A;  4J9C A;  4C5H A;  1H8K A;  4EMH A;  3CXC A;  1OI1 A;  2ENM A;  4OF1 A;  2FO0 A;  5CKH A;  2EYZ A;  4XTV A;  5LJ5 j;  4J9D A;  5LJ3 g;  2KY9 A;  2BUD A;  1VQK T;  1G5V A;  1KIK A;  4PJM A;  4MDX A;  1B07 A;  2PZ1 A;  3S3O A;  1U8R A;  2LJ0 A;  4C0F A;  4M7A E;  1EIF A;  1UB4 A;  3DB3 A;  3O5Z A;  2MYS A;  3SWN B;  5CR2 A;  2X3X D;  3INZ A;  1VQL A;  2P0Q A;  1KHC A;  2OTL Q;  4OMP A;  1LOJ A;  2HL3 A;  1RI0 A;  5FU7 B;  1FMK A;  2XI9 A;  1NEB A;  1ZUY A;  5GMK l;  2L3P A;  3M0Q A;  3A5Z B;  4OMO A;  2VVK A;  3A8G B;  1KQS S;  1MGQ A;  2KRS A;  5IT9 E;  2ROT A;  4C92 F;  4MML A;  5I11 A;  1AD5 A;  3U23 A;  1TXQ A;  1K8A U;  1YIJ A;  2JM8 A;  2YDL A;  2CYZ B;  1ZBX A;  3VRY A;  2ZAE A;  4BB7 A;  2EVR A;  1MV3 A;  5CVI A;  1Q82 C;  5FRM A;  3THK A;  2RJF A;  4M75 F;  1RAH B;  2MI6 A;  2CT4 A;  3SEM A;  1PG5 B;  4EIK A;  1BCM A;  1IRX A;  3CCU T;  1BBZ A;  1Q86 U;  1I81 A;  1K73 C;  4PLL A;  1WX6 A;  1YJ9 T;  2ZZD A;  2RHY A;  2JNG A;  2PVG B;  2EKO A;  3CME T;  4JJB A;  3N5B B;  4PJO D;  3CCS Q;  1VQK Q;  3CD6 T;  2YUP A;  1WHG A;  3EFR A;  2XK0 A;  1RAC B;  2HZY A;  1UGR B;  2RA2 A;  5IXF A;  1BKB A;  2L0A A;  3JV3 A;  4R56 A;  1TH7 A;  2E65 A;  4BAC A;  1NLP C;  4ZN1 A;  2E64 A;  2X4Y A;  1D09 B;  1ACM B;  1RAI B;  5FWC A;  2O4X B;  5GAN h;  1PNJ A;  4PKC C;  3FB9 A;  2DD4 A;  2FPF A;  1SSH A;  1WFW A;  2CH4 A;  2XID A;  2ZPE B;  2RQW A;  1WJR A;  1ZLM A;  1TG0 A;  3V8J A;  1X43 A;  1W2B S;  4D8K A;  2NUZ A;  1SRL A;  2PU9 B;  5KE2 A;  3EGX B;  1WZO A;  4RG2 A;  1M1K U;  3DLM A;  1X6B A;  2DL5 A;  4J5Y A;  4MZP A;  2GTO A;  4J6X A;  5KYW A;  1Y07 A;  2HEQ A;  1VQM Q;  1QW1 A;  1SPK A;  3GLX A;  4EMK C;  4JRK A;  4II1 A;  1YIT T;  2P0K A;  2KYM A;  1JJ2 P;  4M7D F;  4DOV A;  4M75 E;  3EH1 A;  5A0D A;  2LCC A;  1N8R R;  4HT9 A;  2JS0 A;  4A4H A;  3HHT B;  2JN0 A;  2DA9 A;  1RAF B;  2R58 A;  3S3M A;  4FYY B;  2LX9 A;  4E7S A;  1OEB A;  4M78 C;  1K8A R;  2VAS A;  1WHL A;  2M0Y A;  1PHT A;  8ATC B;  5A0L A;  4XTY A;  4XQ3 A;  4M78 E;  1A0N B;  2VWF A;  5CKB A;  3EAE A;  2QTV A;  3LGF A;  2SRC A;  3DKM A;  4WCI A;  1NLO C;  1VYV A;  5GMK h;  1D1A A;  3L42 A;  3L2W A;  4P5N A;  4IIM A;  2Y4X A;  3CC2 A;  1WXB A;  2LT4 A;  2QA4 Q;  2L3S A;  3PT9 A;  4PL6 A;  5D6Y A;  3G71 Q;  2HQE A;  2EQM A;  3UA7 A;  4LD6 A;  1ZSZ A;  1Y57 A;  3V8K A;  2RM4 A;  3CPF A;  4N4H A;  4E7Z A;  1Q7Y R;  5GAN e;  5FRO A;  2EJG A;  1M90 C;  2CZ6 B;  1N8R U;  1KG1 A;  2FRY A;  2JW4 A;  2G6F X;  3LWI A;  1B34 A;  1RAA B;  2JTF A;  4OML A;  1BIA A;  4QQG A;  4WF2 A;  3MEA A;  2M0O A;  3TSW A;  4DBH A;  2DIQ A;  3X28 B;  1JJ2 S;  1HYO A;  3CCQ A;  2E10 A;  2GQV A;  1CSK A;  1VQ7 A;  1QMC A;  2M1H A;  4QVD A;  3M57 A;  3DB4 A;  2E3H A;  2QA4 A;  2QG9 B;  1UJY A;  1VQ4 A;  2CS7 A;  5C0M A;  4KH1 B;  2E5K A;  2CP7 A;  4HCZ A;  2RH2 A;  4DOW A;  1Y0M A;  3M54 A;  3OSS C;  2DL3 A;  4JZ4 A;  2DTO A;  1YJ9 Q;  4BI8 B;  2O88 A;  1YIJ T;  2K6D A;  2LVM A;  5A2Q E;  5KCO A;  4C92 A;  5I22 A;  4IUP A;  2ZGW A;  3EFO A;  1W2B P;  1BI0 A;  5L23 A;  2K7A A;  2VYT A;  3EGD B;  1WQW A;  4BE1 A;  1TUG B;  1YI2 T;  2O31 A;  1UFF A;  3MKD A;  2HD0 A;  2YHT A;  3OA6 A;  1K9M C;  1ARK A;  3I56 A;  1U06 A;  2E4H A;  2A36 A;  1G3Y A;  4HVW A;  4GLM A;  4A4F A;  4B9X A;  3JCM d;  1YIT A;  2VXE A;  4A4G A;  3LH0 A;  4AFS C;  1NE8 A;  3HFO A;  3HRU A;  1QQJ A;  2EJ9 A;  4IUR A;  2COZ A;  3OYH A;  5LJ3 f;  2OJ2 A;  1KQ1 A;  2RF0 A;  4E7K A;  5IHN A;  1NJI R;  1KQ2 A;  2ZPG B;  4BY6 C;  1GCQ A;  2OTJ T;  1IGU A;  2VKN A;  5LJ5 h;  2EGC A;  1JQQ A;  2QI2 A;  5DY9 A;  2R5M A;  1ZA2 B;  4RTV A;  1Q95 G;  5GMK j;  1AWJ A;  1GBR A;  5J26 A;  1NYF A;  5CCA A;  2JJ9 A;  2K2M A;  3JB9 G;  2VGM A;  1KQS P;  1N5Z A;  3JB9 H;  5FU6 B;  3UAT A;  2VGN A;  4CC2 A;  1QVF P;  1VQP A;  3CCL A;  2L8D A;  2DBK A;  2LC4 A;  2FZC B;  2JUF A;  4LUD A;  3TU4 K;  1YI2 A;  1IHW A;  1VQP Q;  1UHC A;  3CC4 A;  4DBF A;  3X25 B;  2KSS A;  1SRM A;  3CCJ Q;  3PMT A;  4EPC A;  1X2K A;  1HK9 A;  1AEY A;  2H8H A;  2VXF A;  1YNZ A;  1N27 A;  1MMA A;  3VS6 A;  5GAO m;  2FRW A;  4VUB A;  1OU8 A;  1XQH A;  5D6W A;  3JCM f;  2DEU A;  2MWO A;  1K9A A;  2KXD A;  2BZY A;  1IHV A;  1TS9 A;  1Q82 U;  1AWO A;  4C8Q B;  1YFN A;  2LT1 A;  3OYI A;  5D6X A;  1YCS B;  3CC7 A;  3QYH B;  1C1A A;  1I8F A;  3JCM P;  5HK3 A;  3M4G A;  1K73 U;  3L2V A;  1AZE A;  4C5E A;  4YTL A;  1D3B B;  4R0K A;  1VQ8 Q;  3H8Z A;  3CCL T;  2OTL A;  3CCR Q;  1GL5 A;  2EQK A;  4K11 A;  4M7D E;  3HPW A;  1QLY A;  2PUK B;  4WTO B;  3PIP A;  3SHW A;  4C92 D;  5KE3 A;  1XNI A;  4MMK A;  5HKC A;  2CRE A;  1VQO A;  1YN8 A;  4HVV A;  2OAU A;  3FJ5 A;  4Z8A A;  2JVV A;  3ASK A;  2QK0 A;  3JCM Q;  3JB9 J;  4HA8 A;  4XTZ A;  1SHF A;  5KCH A;  4XU1 A;  2K5L A;  5LJ5 g;  3L2Q A;  3M4Y A;  2C0I A;  1VUB A;  4RKU E;  2ZPB B;  2RHX A;  3JCM b;  2RK1 A;  4JUV A;  1ABO A;  1NZ9 A;  2XD0 A;  3C0C A;  5ECA A;  1KHI A;  3FRN A;  3JCM e;  1JO8 A;  5CIU A;  2YSQ A;  2YUN A;  2EW3 A;  4AFU C;  4JZ3 A;  2DPP B;  4NOY A;  4KRT A;  2B86 A;  1E6G A;  2K5F A;  5CK9 A;  4XTU A;  1MNE A;  1VQN T;  2O4X A;  1QVF A;  1QP2 A;  1MMN A;  3GF5 A;  2LQW A;  2D8J A;  3CXC S;  3HKS A;  3VS7 A;  2M16 A;  4OMM A;  1WJQ A;  1GBQ A;  3JRZ A;  3OB9 A;  2EJF A;  1K4U S;  5FW9 A;  5GAN 4;  1JBM A;  4J7F A;  3PVQ A;  3OYN A;  1M1K R;  1JJ2 A;  4XTX A;  2LQN A;  4Z89 A;  4HVU A;  2CP3 A;  3REA B;  3CXC P;  4X34 A;  4XU0 A;  2NUT A;  3O8V A;  3URG A;  2FZG B;  2LQK A;  3OS1 A;  2EYY A;  1JRI A;  3QWY A;  4J9I A;  1VQP T;  2NUP B;  3OMG A;  2JTE A;  2MK5 A;  2QGG A;  1N9S A;  3QPH A;  3OSV A;  2GFA A;  1KQS A;  1KSW A;  1WXU A;  2HSE B;  1GFD A;  3VS1 A;  4Y28 E;  2J05 A;  2DL4 A;  4M77 G;  1X2Q A;  2OI3 A;  3RR6 A;  4QVC A;  2J06 A;  2X9H A;  1LJO A;  3G4S Q;  4J9B A;  3NPF A;  4Y92 A;  2CKK A;  3AT1 B;  3A8O B;  3MP6 A;  1JEG A;  5GJV B;  1VA7 A;  3OYB A;  3PE0 A;  3CCV T;  2JZ2 A;  3PMI A;  1ZQ1 A;  1UEB A;  1YJ9 A;  3UT1 A;  1ZSG A;  2QEX A;  4ZTF A;  3R6N A;  4J6Y A;  3EHR A;  1RLQ C;  5GAM e;  1M90 U;  2W10 A;  3CCU A;  3OYJ A;  2KXC A;  4XU2 A;  2JM9 A;  8AT1 B;  2MWP A;  1M4Z A;  4M75 B;  3HRT A;  3L2Z A;  2QEX Q;  3OBW A;  4M4Z A;  1ZA1 B;  2F1L A;  4B9W A;  1VQ7 Q;  2I0N A;  3JCM J;  4KUD K;  4ME7 A;  2JMC A;  1LVK A;  3OYM A;  5GAN j;  2BIV A;  1ZUU A;  4BUG A;  3CCE A;  3LWH A;  4A63 B;  1NYG A;  3RIR A;  3QXE B;  1IZ6 A;  2PVD B;  3LLR A;  1G83 A;  2AZV A;  2RI3 A;  4LXC A;  3QII A;  3ULR B;  2AKL A;  4IUV A;  2MMP A;  3E1S A;  2J7I A;  4HXJ A;  5GAO r;  4NL2 A;  2CUB A;  1W2B A;  5KYY B;  1BI3 A;  5GAM d;  3G4S A;  1SEM A;  3MP1 A;  1ZSZ C;  3OY9 A;  1WHH A;  5HCK A;  3SB2 A;  5LJ3 e;  3G6E T;  3MP8 A;  2QYZ A;  4PFP A;  3HSB A;  2E3I A;  1QWF A;  2CP2 A;  1OPL A;  4XK8 E;  2ROL A;  4Y91 A;  1OZ2 A;  4JPB W;  5C6S A;  2RQR A;  2E41 A;  3JCM X;  1ZHI A;  3EH2 A;  2JTM A;  1U3O A;  1V29 B;  2DXU A;  2KI7 A;  4M75 A;  1K9M U;  3VS5 A;  1OX8 A;  1OV3 A;  2SEM A;  4OB3 B;  3CC4 T;  4ZTJ A;  4LDU A;  2VB6 A;  3CME Q;  4N4I A;  4MZT A;  2K9G A;  2ESW A;  3QDF A;  4AFZ C;  5GAN f;  3SFM A;  2KNB B;  3MJX A;  1M27 C;  3E2U A;  3CCM T;  1VOM A;  2RD1 A;  2KQW A;  4J83 A;  3NTH A;  4HCB A;  1PRM C;  1BB9 A;  3ZFJ A;  1XJW B;  3NTI A;  3PFS A;  5IHK A;  3M0P A;  2KR3 A;  3KUF A;  4L6V 5;  1GXI E;  3LGL A;  4ORZ A;  1K73 R;  1X75 C;  3G4S T;  1VQ4 T;  3QHS A;  4FYV B;  4DA4 A;  5GAO n;  1K0S A;  1M3A A;  1WXT A;  3MHX A;  1NBE B;  5I21 A;  5GAO l;  1UE9 A;  1QVG P;  2FYK A;  3PNW C;  2NLU A;  3CMA T;  2NUP A;  2A0F B;  1TTH B;  3R6O A;  1W1F A;  1YJN T;  1T0J A;  3JCM V;  1G3S A;  2L3Q A;  1JU5 C;  4QQ6 A;  3EG0 A;  3JCM W;  3CCM A;  5FRN A;  4FSS A;  4QT7 A;  3EGD A;  5D7U A;  3EFO B;  2CDT A;  2EPD A;  1I4K 1;  3IQL A;  1AVZ C;  2QAS A;  4HCC A;  4BY6 B;  2X51 A;  2HKQ B;  4ZN3 A;  1FWZ A;  1Y71 A;  4A54 A;  2J6F A;  3J81 E;  5IXB A;  5FU7 C;  2YRC A;  1W70 A;  3M0R A;  4BDZ A;  1QWE A;  2DMO A;  1WA7 A;  3OS5 A;  1VQ6 T;  4DBQ A;  2DZC A;  2D8H A;  3E9F A;  1WLP B;  1YHQ T;  2KRM A;  2Y4Y A;  1QP3 A;  4QQD A;  2D1X A;  5GAO p;  3V7R A;  3JCM c;  2H3E B;  1T3L A;  2QDY B;  2XDB A;  2HSP A;  3JAM E;  2LNV A;  3S6W A;  2CP6 A;  3JB9 F;  2MF2 A;  3NTK A;  2BZX A;  4JDS A;  4FCY A;  1C0M A;  4JLI A;  3CMA Q;  5GAM g;  1BI1 A;  3J80 E;  3QWX X;  2F5T X;  3I9Q A;  1BU1 A;  2CZ0 B;  4GLK A;  1YWO A;  2R5A A;  1UHF A;  3OYA A;  2V8J A;  1Y96 A;  4OB2 B;  2K57 A;  1M30 A;  2AT1 B;  3RDV A;  2D6F A;  4LNP A;  1ZBJ A;  1I5L A;  2A08 A;  3G71 T;  1WNL A;  3A8H B;  1TWB A;  4M7D C;  1IO6 A;  4PJO G;  2E1H A;  1YJW Q;  5LJ3 h;  1ZSZ B;  2MAM A;  3OW2 S;  2JS2 A;  1D3B A;  2LJ1 A;  1WGS A;  4C0D B;  1YP5 A;  4KUI A;  4E7H A;  5GAN 6;  4ZGE B;  3CCL Q;  5DLO A;  2AHJ B;  3ZL7 C;  1SF9 A;  4OMF B;  1E7O A;  4F04 B;  2XHC A;  3M53 A;  4PJO A;  2OTJ A;  2X4X A;  5GAN d;  1D0X A;  2LCS A;  3G1J A;  2LQ8 A;  3CME A;  1VQN A;  1M1G A;  1G3W A;  4E6R A;  4JS5 A;  3I5S A;  1OPK A;  1RAD B;  1NPR A;  1GRI A;  4PJO B;  3BE3 A;  2DYB A;  5IN1 A; 
#chains in the Genus database with same CATH homology
 2HQH A;  2HKN A;  1WHL A;  1WHH A;  2HL5 C;  2COY A;  1WHK A;  2CP7 A;  3RDV A;  2CP6 A;  2E4H A;  2E3I A;  2CP2 A;  3E2U A;  4B6M A;  2COW A;  1WHM A;  1TXQ A;  2M02 A;  1TOV A;  1IXD A;  3TQ7 P;  2CP3 A;  2QK0 A;  2Z0W A;  2HL3 A;  1WHG A;  1WHJ A;  2MPX C;  2COZ A;  2E3H A;  2HKQ B;  2CP0 A;  1LPL A;  2CP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...