5GAOn

Head region of the yeast spliceosomal u4/u6.u5 tri-snrnp
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
82
structure length
82
Chain Sequence
NGIPVKLLNEAQGHIVSLELTTGATYRGKLVESEDSMNVQLRDVIATEPQGAVTHMDQIFVRGSQIKFIVVPDLLKNAPLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Small nuclear ribonucleoprotein-associated protein B
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
total genus 9
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
n PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gaon00
4HT9A 2YLCA 3HFNA 3V7RA 5GAMj 4M75C 1D3BA 4M78G 5GANe 5GMKj 4M7AD 4PNOA 4EMKA 3EFSA 3JCMV 4C92F 3JCMd 4C92E 5GAOn 4M7DA 4EMGA 2DTIA 2QTXA 4M78F 1HXDA 4M78E 4X9DA 3V7CA 4JRKA 4WF2A 4XTXA 5LJ3h 5LJ3g 1M8VA 5GAOp 3V8KA 3QSUA 5GMKe 2EJGA 1MGQA 2E41A 4M77A 3JB9F 4V2SA 4M7AB 3BFMA 4RCCA 3RERA 2Y90A 4M7AC 2RM4A 3BW1A 5GAOq 3JCMb 2HNIA 3FIFA 2DXTA 4M75A 5GMKm 4M7DF 3BY7A 4M78A 4A53A 5LJ5g 5LJ5h 3JB9I 2I2LA 4QVDA 1LOJA 4PJOD 2VC8A 2RB6A 2E10A 1JRIA 3RUXA 4F7UB 5LJ3j 5GAOm 4M75G 5GANg 5GANh 1Y96A 2DZCA 5LJ3f 5GAOl 3JCMQ 5GAOr 3L2ZA 4M77F 5GAN3 4M77E 2DKGA 4RCBA 4X9CA 4C8QB 4XTUA 4C92D 2YLBA 3M4GA 4N0AC 2EAYA 4XU1A 4C8QC 5GMKi 3JB9J 2VXFA 1I4K1 3GIBA 4M75F 3VU3C 3JCMX 2VXEA 4M75E 1B34A 5GAN6 4PJOB 5LJ5f 3SB2A 3SWNA 1N9RA 1WQWA 3V7SA 3QUIA 4JLIA 2E64A 5GAMe 4Y91A 4XTYA 3JB9D 2E65A 2FB7A 3QHSA 5LJ3d 4A54A 3JB9H 2DTHA 5GANf 1WPYA 4XU3A 4M7AG 4C92B 4HT8A 2ZGWA 4M7DD 5I21A 4OP0A 1U1TA 4J6YA 4MMKA 5GMKl 1KQ1A 2DVEA 3JCMe 4C8QA 4N0AA 4M7AF 4M7AE 5LJ5d 4F7UG 5DY9A 4XU0A 4DQ2A 3L1AA 3V8LA 4M77D 4J6WA 2DTOA 5LJ5j 3PGGA 4C8QG 4EMKB 5GANd 3HFOA 3JCMJ 4M7DB 4M75D 4F7UE 1I5LA 1YCYA 4M78D 5GAN5 4M7DC 3QO3A 4M7AA 1LNXA 2YHTA 4QVCA 4PJOG 2RD1A 4PJOC 4C8QF 4J5YA 1I8FA 4C8QE 2EWNA 5GAMh 3RESA 5GAMg 5GMKh 5GAN2 2E1HA 1BIAA 4XQ3A 3JCMP 2DJZA 2EJ9A 3RKYA 3FJPA 1M5Q1 4M77B 4XTVA 5GAN8 4F7UA 4NL2A 4C92C 3RKWA 1WQ7A 3HSBA 3FB9A 1LJOA 4NOYA 2DXUA 1I81A 4M75B 4M78B 3JCMh 3JCMg 3V8JA 1N9SA 4M78C 1TH7A 4MMLA 4J6XA 5GAN4 1X01A 2FYKA 2CGHA 3RKXA 3BDUA 2EJFA 5GAMf 1D3BB 1Y96B 3JB9G 4PJOA 2JN0A 2RA2A 3RIRA 1KQ2A 4EMKC 4F7UF 5LJ3e 4HA8A 1BIBA 5GAN7 4M7DG 4XU2A 5CAIA 4XTWA 1H641 5GANj 1B34B 1HK9A 4C8QD 3JCMf 3JCMc 2K57A 4C92A 4EMHA 3AHUA 1WNLA 3SWNB 4XTZA 3SWNC 2DEQA 1U1SA 3EFRA 4M7DE 1JBMA 3INZA 4JUVA 5LJ5e 4M77G 5GAMd 4M77C 4JRIA 4PJOF 4NL3A 2DZ9A 3JCMW 4PJOE 4C92G
chains in the Genus database with same CATH superfamily
1G3SA 2AHJB 4M7AD 2B8AA 3JCMV 3EGXA 1MV0B 2F2WA 1WYXA 2XKOC 3X25B 3N5BB 4WF2A 3VS0A 5ECAA 5C0MA 1VQ4T 5CQXA 1IRXA 4WCIA 1AWOA 2L89A 3OYNA 2HQHA 2GQVA 1MV3A 4A53A 4XAXB 4JRQA 2HAXA 2VC8A 1WHHA 5FU7C 2J6FA 3VS5A 4J9HA 3EG9B 4RTZA 1GCPA 3PMIA 2LVMA 3LGFA 5GAN6 3SWNA 2V8KA 3JB9D 3OYMA 4AG2C 2RJDA 1T0HA 1VQPQ 1XNIA 3GNFB 1AVZC 5I2SA 3NPFA 3RDVA 3RMSA 5LJ5j 2DMOA 3NGPA 3SEMA 3CCRQ 3SD4A 2DAQA 2F5TX 1AD5A 4M75D 5GAN5 1ZBXA 1I5LA 1VQ6Q 2X9HA 3CD6A 3M0TA 3TU4K 5IH2A 1UUEA 4C0GA 2DXUA 1YITQ 4M78B 3VYGA 4ZTFA 4OF1A 2EQJA 2OX7A 2ED0A 3CC2Q 1GXIE 3MEUA 2LCCA 3EAEA 2F2XA 3GPLA 1UECA 4HA8A 2PNIA 5FRNA 5KCHA 1H641 3FEOA 2NUPA 2CREA 2KYMA 3EFRA 2EBPA 2ZPIB 1U8RA 1NZ9A 2K3XA 2JJ9A 3CCMA 2A0FB 3CC7A 4B9WA 3I56Q 3SDZA 5D7UA 1WJRA 1KC8U 1RLPC 2E41A 1MMAA 3MEWA 4BE2A 2HZYA 1YBYA 2RM4A 1UDLA 4C0DB 2DXTA 5GMKm 4A4FA 1VQOT 5D6XA 1JRIA 5A0GA 3CPWS 2OJ2A 5KYXB 4RTTA 1VQKA 1RI0A 5GAN3 3EG0A 1I4K1 4KH1B 3JCMX 4M75E 3QPHA 2AKLA 3UF4A 2AIRB 1YJ9A 2PVGB 1W2BA 2GTJA 1M90C 2E4HA 4LDWA 2HL5C 2OTJQ 5FWBA 3TSWA 3G7ZA 1VYUA 2DL5A 3RR6A 3OBYA 3TCJA 1BI1A 1IGQA 2JS2A 2O88A 1M9SA 1W4SA 1QVFS 2EQUA 5D6WA 4GY5A 2F2VA 4J8OA 1OPKA 5IHNA 1UGVA 5LJ3j 3JCMh 4HVWA 5A2QE 2ZPHB 3M0UA 2KY9A 1X01A 2QQSA 2P0KA 1D1BA 4QKUA 1ZBJA 1TUCA 1RAAB 1WGSA 1YJNQ 3A8GB 2HKNA 1PRLC 1Y07A 2LQ8A 2EFIA 1ZSZC 1EZZB 1K8AU 3AHUA 4AFSC 1PM3A 5CKDA 3WVDB 4M7DE 4NL3A 2DZ9A 2A3LA 3P8BB 4DBRA 1KK7A 3FLGA 3JSCA 2CZ0B 1X75C 1IHWA 2KXCA 4N4IA 3M0QA 4XTXA 2LQKA 1BCOA 3EG2A 4EIKA 3JAME 1N8RC 2DRKA 2H8HA 5LJ5h 2MPXC 2K4YA 1X43A 4JJNK 5AT1B 5GANg 1VQ5Q 1GBQA 5LJ3f 2RHXA 1VQPT 3LH5A 4CC7A 3WVEB 5KH6A 1WHGA 4J9BA 3ZEHA 1QWEA 3QUIA 4FT2A 1CKAA 2IIMA 4M7AG 4KGZB 1QLYA 1PC0A 2O9SA 4C92B 3PT9A 1RAGB 2O31A 3MP1A 1MMDA 5CO7A 4LE9A 1Q86U 4WTOB 2HMAA 2L3QA 5HCKA 3CCVA 3FDRA 4JS4A 1WIEA 4KBMB 1C0MA 3VV0A 3EGXB 3CC2T 3VJPA 2OTLA 3RESA 3G6EQ 3PFSA 3L2WA 1IZ6A 1ACMB 2RI2A 4F04B 1UE9A 3I55T 3O5ZA 1E6HA 4EDUA 1K8AC 3JB9G 2L8DA 3MEAA 1KQ2A 1GCQC 3VS7A 4K11A 4OGEA 1SRLA 2KR3A 1EFNA 4RTWA 1YI2A 3SWNB 2KRSA 4KRTA 1HSQA 5GAMd 4C92G 4J9DA 5KYWA 1OX8A 1SG5A 2QA4Q 5GMKj 2B86A 1KQSS 4OB1B 1ZSZA 2JTEA 3QZ9B 1K9MR 4J9IA 4II1A 1S72A 2BTTA 3X28B 2V1QA 4LN2A 3BY7A 4C5EA 1G2BA 1VYTA 2RB6A 4D6WA 3RMQA 3EH2A 2D8HA 2K2MA 2OTJT 4C8QB 4C0ZA 2YLBA 2DE0X 4N0AC 5FU6C 3S3OA 1M1GA 3MCAB 4LD6A 1UJYA 2VV5A 4A54A 2LT1A 2EYYA 1T3LA 1SSFA 2NUPB 4E7KA 3OYYA 2RJFA 2KDSA 1UGPB 5IXFA 1CSKA 1LVKA 4E47A 3A5ZB 2A7YA 4M77D 2DTOA 4QQGA 3QIIA 4FYYB 4F7UE 2RK1A 5CIUA 2Z0WA 2DF6A 2MI6A 4RMOA 1QVGS 3M56A 1R0BG 4BUGA 4XQ3A 1PSFA 4FM4B 4XTVA 1X27A 3OYJA 1RAIB 1QVPA 1Z9QA 3EGUA 2PVOB 1NYGA 1HD3A 2CGHA 2A28A 5CCAA 3KXTA 2EW3A 1M2OA 2CZ1B 4EMKC 2Y4XA 2K5LA 4OMFB 2K79A 1BKBA 3HRSA 1IHVA 2ZPGB 2WACA 5I2MA 3PNWC 4JRIA 4OB3B 3LYIA 2QGFB 1KD1R 1K76A 3OW2A 3LWHA 3CMEA 4M75C 4Y92A 1GCQA 4E6RA 1AWJA 3PE0A 2OAWA 1FMVA 4ZNXA 1VQ5T 3AT1B 2BE9B 1B3QA 4X34A 1BBZA 1TXQA 1Q82R 5GAOp 4FCYA 4F17A 3CMAA 3JB9F 4E7HA 1GRIA 1VOMA 2HNIA 4RG8A 2LCLA 4E7IA 1Q81R 3J7AF 2DYBA 2K7AA 3ZBDA 2DRMA 4DBQA 3M54A 2W0ZA 2R57A 3SHWA 2E5KA 3H41A 4M77E 2DKGA 2EGEA 4RCBA 1XJWB 2DLPA 4OVAA 4M75F 2PTKA 2V8JA 1WZOA 1X6GA 2DBMA 1X2QA 3SB2A 2DBKA 5GAMe 3QJYA 2QEXT 1NPPA 2EYXA 4OP0A 2D1XA 3G6ET 4N0AA 2DFUA 4XU0A 2QQRA 3O8VA 2IPOB 5LL6S 3CCJA 1M2VA 4PJNA 5M9OA 3CMET 2M0OA 4M7DC 1FXXA 1QWFA 2HBPA 4M7AA 4QVCA 4OB2B 4ORZA 2ROTA 4FSXA 2RJCA 1M3BA 1VQOQ 5GMKh 2E1HA 3QXEB 3JCMP 3RKYA 1YFNA 1SPKA 5CKFA 4ANJA 1WJSA 3OMCA 3PVQA 1M3AA 2NLUA 1M1FA 2KQWA 2CKKA 2ZCFB 1D1CA 2HCKA 4FIBA 2EJFA 3QDFA 3NFCA 4AG1C 4DOVA 3RIRA 2QA4T 3LGLA 1NJIR 1OU8A 2CYZB 4A4EA 1RAEB 4XU2A 5CAIA 2KMTA 2NYSA 2MF2A 3VS3A 3A8OB 2G3RA 4FSSA 2EYWA 5HKCA 2JNGA 5KYYA 2XK0A 3VUZA 4BACA 3OBWA 1YN8A 1VQ7A 3CCMQ 4Y28E 4EMKA 1Q7YR 4M78E 3C0CA 3REAB 5LJ3g 4LXCA 3IQLA 2R58A 4RCCA 3BW1A 3PIOA 1ABQA 4M75A 2HD0A 3M53A 5CKEA 1H3HA 4EPCA 1P92A 1KHCA 5IHIA 1IGUA 2K9GA 1VQKQ 1ABOA 3OYLA 1HJDA 1RLQC 3UDCA 2GGRA 2RMOA 2NUZA 4LUDA 1XQHA 1YJ9Q 1WA7A 2E6NA 4OB0B 3CBOA 3LLRA 2WSEE 2ZGWA 1VQ9A 1Y7XA 1M8MA 2DL4A 2V26A 2QQAA 1X69A 5KYWB 1OZ3A 2FHDA 3PGGA 5GANd 4HVVA 5FWCA 1ZSZB 1PKSA 2HQEA 1RAHB 3H6ZA 3CCSA 2EWNA 4HCKA 3CEYA 4A4GA 1G5VA 4HKEA 3GF5A 1G3WA 4RG2A 4OMOA 1WQ7A 3DB3A 3V8JA 3EH1A 4PFZA 5FROA 4D8KA 1KG1A 3LH0A 3G4SA 1M90U 1ZLMA 2CP2A 3OYCA 1SHGA 3L42A 4OMNA 4BY6C 1D0ZA 4OMQA 2CH4A 3JCMf 3JCMc 3I9QA 1U1SA 2AZSA 2BUDA 4BE0A 3CPFA 2IG0A 1QW1A 1Q95G 4M77G 4HCCA 3TVTA 2YXYA 2CP3A 1HYOA 2BZ8A 2L3SA 2ATCB 3HRTA 1QVFA 5GJWB 4EMGA 2MK5A 3UT1A 2ZPBB 1M30A 3I5RA 4J83A 4DBHA 4PJJA 5HK3A 5KYUA 2Y90A 1BI2A 4GLMA 2XDBA 1VUBA 3I55Q 1FWZA 1TTHB 4DEXA 4PJOD 4CC2A 2G6FX 4ZGDB 3QZ5B 4BE1A 5GAOm 3M55A 2M02A 3JCMQ 5GAOr 3OMGA 4LDYA 2COWA 2VXFA 2MYSA 2FPEA 2CUBA 3G4ST 5LJ5f 3ULRB 3OW2P 5L8RE 3CXCA 2K2VA 3JB9H 1IO6A 5FLXE 4M7DD 4J7FA 2LX9A 4E2FB 4PFPA 3EHRA 4KULA 5EG2A 3CD6T 1N8RU 2RQVA 1YJWA 4IUUA 1VQLA 1B7TA 3CCVQ 1C1AA 1JXMA 2FPDA 3JCMJ 3OYFA 4LUEA 2DETA 1NBEB 3THKA 1SSHA 1N5ZA 1E6GA 2YHTA 1VQMA 2RD1A 5EC7A 1KHIA 2EYZA 2FZKB 1YWOA 2FL7A 2LMJA 2SEMA 2V1RA 4NL2A 2CP7A 1FMWA 1LJOA 1I81A 4MMLA 2OAUA 2QI2A 2FZGB 4IUQA 1U06A 1D3BB 3CCMT 2O9VA 4Z89A 2RQRA 3CC7T 1TU0B 1BIBA 3OYEA 2ZPEB 2QAZA 3GBQA 4C8QD 1YI2Q 4Z02A 2K6DA 2KXDA 4X1VA 1JBMA 4IIOA 1ZUYA 4M77C 2JW4A 4PJOE 4OMPA 2CP0A 1A0NB 5GAMj 4HCBA 3GP8A 5GANe 5AYFA 1KFZA 2ZAEA 3KFVA 1MMGA 5FU6B 4AT1B 1M4ZA 1K1ZA 2H3EB 3LWIA 2QTXA 3URGA 4DEYA 2FZCB 4JRKA 1ZHIA 1M2VB 3H0FA 2YSQA 1VQKT 2EPDA 3ZL7C 2RHIA 2LJ3A 3E19A 1YJWT 2EJGA 2X35A 3OQ5A 1RUWA 2E70A 4M7AB 1K9MC 2DL3A 2RK2A 3FIFA 1O9SA 1Y0MA 1VQMT 1YJ9T 3C94A 2E10A 3A8LB 3H0HA 5KYNA 2VYTA 2CZ7B 2R5AA 4M77F 1K73R 4ME7A 4XTUA 1VQ6A 2CS7A 3OA6A 4QW2A 4GLKA 1UGRB 4FT4A 3TEEA 3J80E 2FB7A 1WPYA 1CKBA 4Q5WA 1YITA 4BDZA 2QYZA 2PVDB 5KYYB 3C4SA 2BZXA 5KE2A 1RACB 4IKFA 2HKQB 4J9GA 2DERA 1ARKA 4IUVA 1PWTA 1MNEA 4EMKB 1UJ0A 4FW1A 4TVRA 1XOVA 2EGAA 3H9NA 2JS0A 1G8XA 1YHQA 2YDLA 1BYMA 4C8QE 2RNAA 5FW9A 1EIFA 4M75B 3FRNA 1N9SA 4M78C 5GAN4 4MDWA 3VUBA 1VQ8A 4RUGA 1W6XA 7AT1B 3E2UA 3MP8A 1ZA2B 2QEXQ 2JXBA 2CH4W 1AT1B 2EKOA 1FX7A 2EQMA 3M0PA 4FYVB 4XTZA 2DEQA 3INZA 1U3OA 4UC4A 4RTUA 3CMEQ 1OULA 1BU1A 1WHKA 1T3SA 2SRCA 3UA7A 1KD1C 4RKUE 4M78F 5CVIA 2CT3A 1YCSB 2HEQA 2MCNA 1D0YA 1JJ2A 2EKHA 4M77A 8ATCB 5IXBA 2J06A 2QTVA 1Q82C 2FPFA 1C6VX 2ENMA 1RADB 3RUXA 3A98A 3OY9A 2BKDN 1G3YA 1UEBA 4M75G 1Q81C 3OYBA 2DD4A 3CBPA 2KRMA 3J81E 1KJWA 5GMKi 1M3CA 3GIBA 2M0YA 2O4XA 3OS2A 2L2PA 1VQ8T 3QJ6A 4ZGJB 2I0NA 4JLGA 3QKJA 5J39A 4N4HA 2GNCA 3CCVT 1MHNA 2CDTA 2E65A 1AZEA 5LJ3d 2DTHA 2JTFA 1PSEA 5I22A 1TS9A 2OTLT 4DBFA 1W70A 3HTRA 3CCLA 5DY9A 3VYHB 4PL6A 1H92A 4J6WA 3CCJQ 2LZ6B 4VUBA 4N4GA 2DX1A 1YCYA 3P8DA 2AT1B 4PJOG 1NG2A 5GAMh 1OI1A 2EJ9A 1WFWA 2E12A 5GAN8 1KC8R 3EGDA 5KYUB 3CCUA 3RKWA 3TREA 3JCMg 4AFZC 2A37A 1YI2T 1H8KA 3G71A 1N6AA 2VWFA 3EG3A 2FYKA 2JMCA 2CZ6B 2OI3A 2RQUA 3CXCP 3M59A 3L2QA 4RTXA 4M7DG 1T0JA 4BI8B 2E3IA 4EMHA 1NJIC 1AWWA 3MPUB 3DKMA 1PD1A 4ZGEB 1S72T 3FC3A 1AOJA 1VQ7Q 2YUQA 1D1AA 1H3ZA 4XK8E 2LQWA 1M27C 2AKKA 8AT1B 3PMTA 1W2BP 4IURA 3VS2A 4AFQC 1Q7YC 2LX7A 4CC4B 4V2SA 1QP2A 3BFMA 2D9TA 3HP9A 3GNGA 5LJ5g 2E3HA 2DM1A 3BDLA 2RO0A 4HXJA 5FU7B 2COZA 3M0RA 2LQNA 3UPUA 1OQKA 1Y96A 2IVWA 4JJCA 3EFOA 2VB6A 2VGMA 4XU1A 4A4HA 3JB9J 2R5MA 3G71T 3CC4A 4IUTA 4B6MA 5A0LA 3X24B 4ESRA 3EHQA 5IN1A 1VQNA 5CKBA 3ZFJA 2XU8A 4J9CA 5IAYA 1IXDA 4PFOA 1OZ2A 2FO0A 2X4XA 2W10A 5DM7R 4QT7A 3QYHB 3WXMB 2YRVA 1S1NA 1PKTA 3OB9A 4M78D 3QO3A 4LDVA 4A4KA 3E9FA 3I35A 3QYGB 4PJOC 2DNUA 2HL3A 4J5YA 4RTVA 3CCSQ 3OYGA 4A63B 3UWNA 3H8ZA 2LP5A 3DLLA 2K3BA 2COYA 2XG8D 2GFUA 3JRZA 3G4SQ 1PG5B 3U23A 3S3NA 3CCQA 5LJ3e 3PVLA 2F1LA 1GFCA 2J6KA 2EYQA 4PKCC 1I5OB 3L2UA 3CD6Q 3SWNC 4JZ4A 1BB9A 4PJOF 1K0SA 1U5SA 4E7LA 3CMAT 3FJ5A 4PJMA 2XMFA 1OOTA 3EFSA 1UTIA 3M57A 2CP5A 3LX7A 2KGTA 1BCMA 2QK0A 2MMPA 3R6OA 3I5SA 1Q86R 4LDXA 2NWMA 3MKDA 2ECZA 2X4YA 2FRWA 1JO8A 2XICA 4M7DF 2RF0A 2YWWA 2HSPA 2GCXA 5IT9E 1V29B 2E6ZA 3OW2S 2JM8A 3QDRB 1N27A 1NPRA 1VQ4A 3CC7Q 2KSSA 2FG0A 2A36A 4RTYA 4C8QC 1UB4A 3DLMA 2DXBA 1UFFA 2FVUA 4C5GA 4JLIA 2XDDA 3CCJT 1LCKA 3VS4A 3CCQT 1K73U 4IUPA 1QKWA 2GQIA 3ASKA 2JZ2A 2DPPB 2X3XD 3OYKA 4R55A 4MMKA 1UHCA 2ZPFB 1QKXA 4F7UG 3G1JA 3L1AA 3V8LA 4JPBW 1JJ2P 1UGSB 2L5QA 2Y4YA 1YJWQ 3PTAA 1VQLQ 1PD0A 2LJ0A 4ELYC 1KIKA 2HSEB 2QQBA 4OMLA 2LNHB 1VQMQ 4C8QF 1I8FA 3C95A 4M77B 4FW2A 3PIPA 2KT1A 4J7IA 3UA6A 3FB9A 1Y57A 5A0DA 1TUGB 1E7OA 1QCNA 4O6JA 3X26B 1RI9A 3NTHA 1NYFA 1J3TA 2QASA 3A1PA 4PJOA 2RA2A 2MWPA 1VQ7T 1WXBA 3H0IA 1SF9A 3E9GA 2O4XB 1SEMA 3EG1A 3NTKA 4QQ6A 5KE3A 2C0OA 2RQWA 3CPWA 1UGQB 2VUBA 4PNOA 3M0SA 4M7DA 1ZX6A 3CQTA 3X20B 3F70A 4JS5A 1F1BB 4FYWB 5GMKe 1OPLA 4E7ZA 2KI7A 3RERA 5GAOq 2RHUA 1ZSGA 1WDXA 1GBRA 1QQJA 4QVDA 3NHNA 5CKHA 1R77A 3EGDB 2WSCE 2DIQA 1M1KR 5GANh 2HDAA 1VQ9T 3OSSC 5KCOA 4C92D 1X6BA 4L6V5 1YIJA 2KRNA 1B34A 2DO3A 1K73C 2C06A 1VQOA 3ME9A 1PNJA 3RNJA 1TUDA 4Y91A 2JTMA 4Z8AA 1KQ1A 3CCST 2NUTA 2P0PA 1JEGA 4C8QA 2EGCA 4M7AE 4CRIA 3L2VA 1K9MU 1D0XA 3M4YA 3HFOA 4BB7A 4PLIA 4KGVB 1YHQQ 2ESWA 3MP6A 3OYAA 1OEBA 2L0AA 4ZTJA 1LPLA 3VS1A 5IHKA 1NEGA 1IREB 1NEBA 4L59A 3META 1JB0E 4J6XA 3REBB 1VQ8Q 4PLLA 5CQYA 2KAFA 5J3BA 1Z9ZA 1Y96B 2AZVA 3EFOB 4BI3A 4F7UF 3HPWA 1NLPC 2EQIA 1DJ7B 3NMZC 1TSFA 1YIJT 2QGGA 4O5VA 2KNBB 5DLOA 2OTLQ 3CCEA 2CUDA 2JVVA 2VVKA 2QDYB 1BK2A 2RN8A 4IIMA 4M78G 2M9UA 1MUZA 1RAFB 3JCMd 4C92E 1HXDA 3BE3A 2E5QA 1W1FA 2KROA 1MGQA 4L5GA 3JCMb 2RHYA 1I07A 2GBQA 2I2LA 4FL6A 3QG1A 2DZCA 2JM9A 2VKNA 1AHJB 5CR2A 2EAYA 4JJBA 3VRYA 2AK5A 2GF7A 1OU9A 1WQWA 2DD5A 3V7SA 1KD1U 1S72Q 1VQLT 4HVUA 4R56A 4XU3A 9ATCB 2RJEA 5CK9A 1VQPA 2F5KA 5I21A 5HY6A 1WX6A 2DVEA 2P4TA 3CCET 1SRMA 5LJ5d 3CCLQ 1Q82U 3OYHA 1TG0A 3CCRA 1D09B 4C5IA 4E7JA 2J7IA 1Q81U 3QWYA 4HCZA 2RQTA 3GOXA 4FU6A 1V1CA 1WHJA 1R8OB 2H3JA 1BI3A 3CXCS 2VASA 2J05A 5L23A 3A8HB 4F7UA 5DLQE 3TSZA 4MZMA 4J9FA 3CCUQ 3NTIA 4NOYA 1SKUB 2XI9A 2EQKA 3G71Q 1KC8C 2LT4A 4JZ3A 3RBBB 1KQSA 1RABB 3CC2A 1PRMC 5GAMf 2P0QA 1WI7A 1VIFA 5GAN7 2FEIA 4ELZC 4KUDK 2EIFA 2WSFE 3I55A 2GTOA 4JUVA 1W2BS 4MDXA 3VRZA 1WLPB 2X4WA 4CC3A 3HFNA 3UATA 2PUOB 1RL2A 2K5FA 1X2KA 3I56A 4KUIA 1I1JA 1JU5C 2M1HA 1UG1A 2DJQA 3A8MB 3CCRT 2XHCA 3Q1JA 2HBWA 4PJLA 4FYXB 4C0FA 1VQ6T 1ZA1B 4D8DA 3E1SA 1LOJA 2QG9B 2YUPA 2MWOA 2DEUA 2J6OA 1NJIU 1OYXA 4LD9K 1TWBA 4X9CA 1YITT 3M4GA 3CC4Q 4ZN3A 4PJOB 1QP3A 1FMKA 3CPWP 1M90R 1QVGA 2E64A 4J9EA 4OMMA 1QCOA 4XTYA 3LW5E 3CMAQ 1WHLA 1VQNQ 1K4US 3OS0A 2KK4A 4C0DC 2ROLA 2OTJA 1YHQT 1U1TA 4J6YA 1Q7YU 2QQ9A 2O2OA 3JCMe 2O01E 3GLXA 1AWXA 4DQ2A 3KBGA 4F16A 5I11A 1VYVA 4M7DB 4KT0E 1LNXA 3I56T 2ABLA 2DL7A 4AFUC 2F69A 1BIAA 2DYIA 2DJZA 1OV3A 2CSIA 3EG9A 1QVFP 3M58A 1NE8A 4JJDA 2D0NA 4MZPA 4R0KA 1YJNA 5J26A 2GFAA 2KYBA 3M5AA 1WXUA 3S6WA 4ZN1A 4QVZA 3CCQQ 2DL8A 1B34B 4B9XA 2BZYA 5LJ5e 2JT4A 2K5IA 2MIOA 5HK0A 2RHZA 2DK3A 4E7SA 1YP5A 3JV3A 2NUTB 1GFDA 5GAOn 1PHTA 2YT6A 4P5NA 2DILA 3V7CA 4X9DA 2HQXA 3HL8A 5LJ3h 1M8VA 1N8RR 3V8KA 4M7AC 1Q86C 1OX9A 2LCSA 2RH2A 2YRCA 4LDUA 2KBTA 4M78A 1JQQA 3JB9I 1ZQ1A 1R0CB 2DXCA 2YUOA 1VQ5A 3MEVA 5GAOl 4ATOA 3L2ZA 1VQ4Q 5GJVB 3MO8A 4C5HA 2KE9A 2PUKB 2FRYA 2VGNA 3ER0A 3VU3C 4PK4A 2L3RA 2VXEA 3CCLT 4JDSA 1NLOC 4AMCA 4KGXB 1YJNT 2CP6A 1M1KU 1JJ2S 2X4JA 3QHSA 2JOYA 2XIDA 3OYDA 3HHTB 5GMKl 1YWPA 4M7AF 1Y71A 1YNZA 2YRDA 1QMCA 3P8HA 3CCUT 4YTLA 4C8QG 2ED1A 2QEXA 4KH0B 3VS6A 2X3WD 5FRMA 1WHMA 2JUFA 2DIGA 2XDPA 3G6EA 2K3YA 2PZ1A 4LNPA 2X51A 5C6SA 4C92C 3S3MA 1VQ9Q 5KYXA 3HSBA 2P4RA 2CT4A 1K8AR 1EX4A 1KSWA 2LJ1A 3RKXA 1V76A 4DOWA 2A08A 2M51A 2JN0A 4BY6B 2PQWA 4F14A 1XTDA 5GANj 1HK9A 2LRQA 3HKSA 2K57A 1WNLA 4QQDA 2KEAA 1I0CA 3KUFA 3CBMA 6AT1B 2BIVA 1BI0A 3JCMW 1GL5A 4BDYA 4HT9A 2YLCA 5D6YA 2QA4A 3V7RA 1MMNA 2PU9B 1D3BA 1FYNA 1MNDA 1WJQA 2P84A 2JMAA 1AZGB 1IB8A 2L3PA 4BI4A 4C92F 2XD0A 1NM7A 2MOXA 2DTIA 2LC4A 2MAMA 3M9QA 2D0QB 1WXTA 2RPNA 3OSVA 3QSUA 2DVJA 2KVQG 2KT8A 3CC4T 1KQSP 1UHFA 1K0XA 4OGCA 1ZUUA 3QWXX 3OS5A 3MJXA 4Z88A 1G3TA 2M16A 4F7UB 1VQNT 3HRUA 1TOVA 2QXFA 3R6NA 1M1KC 1YIJQ 1PCXA 1VA7A 2V8IA 1VIEA 1N9RA 1G83A 4M4ZA 5GANf 3MHXA 4HT8A 1B07A 3QBYA 3D7SB 3C12A 3T9NA 3L2RA 1ZUKA 1X6OA 1SHFA 2RI5A 2BE7D 2DA9A 2D8JA 4JRPA 5GAMg 2ZZDA 5GAN2 2LDMA 4CI0C 1O75A 1M5Q1 3FJPA 4BD3A 3OS1A 1JXOA 1TH7A 1AEYA 3TQ7P 1QVGP 1K9AA 2LTOA 3BDUA 4NS5A 1QCFA 4GBQA 2D6FA 3VKIA 2C0TA 2QDLA 2YUNA 3SFMA 4XTWA 2LNVA 3DB4A 4DA4A 2C0IA 2CSQA 4C92A 3OYIA 2RI3A 4MZTA 3CCEQ 2EVRA
chains in the Genus database with same CATH topology
1G3SA 3OW2A 3LWHA 3CMEA 4M75C 4M78G 2AHJB 2M9UA 4M7AD 2B8AA 3JCMV 3JCMd 1KD1C 4C92E 4RKUE 4M78F 1HXDA 2XKOC 5CVIA 3X25B 3N5BB 1VQ5T 4WF2A 4X34A 2E5QA 5C0MA 5GAOp 1VQ4T 5CQXA 1MGQA 3CMAA 1JJ2A 4M77A 3JB9F 4L5GA 1Q82C 2L89A 3OYNA 3JCMb 4E7HA 2HNIA 4RG8A 2GQVA 2RHYA 2LCLA 4XAXB 4A53A 4JRQA 2HAXA 4E7IA 2I2LA 4FL6A 2VC8A 3J7AF 3QG1A 3RUXA 5FU7C 3OY9A 2BKDN 1G3YA 3ZBDA 1UEBA 3M54A 4M75G 1Q81C 3OYBA 2R57A 2DZCA 2DD4A 4M77E 2DKGA 1AHJB 3CBPA 4RCBA 3PMIA 5CR2A 3J81E 2EAYA 5GMKi 2LVMA 3LGFA 3GIBA 3OS2A 2O4XA 4OVAA 4M75F 2V8JA 1VQ8T 5GAN6 3QJ6A 2GF7A 3SB2A 4JLGA 4ZGJB 3QKJA 3SWNA 5J39A 1WQWA 2DD5A 3V7SA 5GAMe 4N4HA 1KD1U 2V8KA 3CCVT 3QJYA 3JB9D 1VQLT 1MHNA 3OYMA 2E65A 2QEXT 5LJ3d 2RJDA 2DTHA 4R56A 4XU3A 2JTFA 1NPPA 2RJEA 5CK9A 1VQPA 2F5KA 5I21A 4OP0A 1PSEA 5HY6A 2DVEA 2OTLT 2P4TA 3G6ET 1XNIA 4N0AA 3GNFB 3CCET 3CCLA 5I2SA 5LJ5d 1Q82U 5DY9A 3VYHB 4XU0A 4PL6A 3RMSA 3OYHA 2QQRA 3O8VA 5LL6S 3CCJA 4J6WA 5LJ5j 3CCRA 4VUBA 4C5IA 3SD4A 5M9OA 3CMET 4N4GA 2DAQA 2F5TX 2M0OA 1YCYA 1FXXA 1ZBXA 3P8DA 4M75D 5GAN5 2HBPA 4E7JA 1Q81U 4QVCA 4HCZA 4OB2B 4PJOG 4M7AA 4FSXA 2RJCA 3GOXA 5GAMh 3CD6A 5GMKh 4FU6A 1OI1A 2E1HA 3QXEB 1R8OB 3JCMP 2EJ9A 3RKYA 2H3JA 3TU4K 1BI3A 2E12A 5CKFA 3CXCS 5GAN8 3A8HB 1WJSA 4F7UA 5DLQE 3CCUA 3OMCA 4MZMA 3RKWA 4C0GA 2NLUA 3NTIA 1M1FA 2DXUA 2KQWA 4M78B 4NOYA 2XI9A 3JCMg 3TREA 3G71A 2EQKA 2CKKA 1N6AA 2LT4A 2ZCFB 3VYGA 4ZTFA 1KC8C 4OF1A 2FYKA 1KQSA 2EQJA 4FIBA 2EJFA 3CC2A 2CZ6B 5GAMf 3CC2T 1GXIE 3NFCA 3MEUA 4DOVA 2LCCA 3RIRA 3M59A 2P0QA 3EAEA 3L2QA 3GPLA 1VIFA 3LGLA 2QA4T 2CYZB 4HA8A 5GAN7 4A4EA 5KCHA 4XU2A 5FRNA 5CAIA 4M7DG 2KMTA 1H641 4BI8B 4ELZC 2MF2A 4EMHA 4KUDK 3A8OB 1NJIC 3FEOA 2EIFA 2G3RA 2WSFE 3I55A 5HKCA 2JNGA 3EFRA 3DKMA 2XK0A 4JUVA 2ZPIB 1W2BS 3VUZA 4BACA 1U8RA 4MDXA 1NZ9A 3OBWA 4ZGEB 1S72T 2X4WA 3FC3A 2K3XA 1VQ7A 3HFNA 3CCMA 2PUOB 3CC7A 4Y28E 1RL2A 2K5FA 4EMKA 1H3ZA 4B9WA 3I56A 4XK8E 4KUIA 2M1HA 3PMTA 4M78E 3SDZA 1WJRA 1KC8U 4IURA 5LJ3g 1Q7YC 3A8MB 2C06A 3CCRT 2E41A 2XHCA 3MEWA 2R58A 4V2SA 1QP2A 4BE2A 3BFMA 1YBYA 3Q1JA 4RCCA 2D9TA 3HP9A 2RM4A 3BW1A 4C0DB 3GNGA 4C0FA 3PIOA 1VQ6T 2DXTA 4M75A 5GMKm 5LJ5g 4A4FA 2HD0A 3E1SA 3M53A 1LOJA 3BDLA 1VQOT 2RO0A 5CKEA 5D6XA 2MWOA 1JRIA 5FU7B 5A0GA 4EPCA 1P92A 3CPWS 1NJIU 1KHCA 3UPUA 1OYXA 1Y96A 1VQKA 1RI0A 2IVWA 4LD9K 5GAN3 4X9CA 3OYLA 2VGMA 1YITT 3M4GA 4XU1A 4A4HA 3JB9J 2R5MA 3G71T 1I4K1 3UDCA 3CC4A 3JCMX 4M75E 3QPHA 4ZN3A 4IUTA 4PJOB 1QP3A 1XQHA 1YJ9A 1QVGA 5A0LA 2E64A 2E6NA 4OB0B 3X24B 4XTYA 2PVGB 3CBOA 3LW5E 5IN1A 1VQNA 1W2BA 3LLRA 2WSEE 1M90C 3OS0A 5CKBA 2KK4A 4LDWA 3ZFJA 4C0DC 2ZGWA 1VQ9A 2XU8A 2OTJA 1Y7XA 1YHQT 1U1TA 4J6YA 5IAYA 1Q7YU 2QQ9A 3JCMe 2O01E 1OZ2A 3G7ZA 2QQAA 3GLXA 3OBYA 3TCJA 2X4XA 4DQ2A 3KBGA 5DM7R 3QYHB 1OZ3A 3WXMB 1BI1A 2FHDA 3PGGA 2YRVA 5GANd 1M9SA 1W4SA 1QVFS 4M7DB 4KT0E 3OB9A 4M78D 2EQUA 3QO3A 4LDVA 5D6WA 4A4KA 1LNXA 2HQEA 3E9FA 4GY5A 3I56T 3QYGB 4PJOC 3H6ZA 3CCSA 4J5YA 2EWNA 3OYGA 3UWNA 3H8ZA 3CEYA 2F69A 1BIAA 4A4GA 3DLLA 2DJZA 4J8OA 1G5VA 4HKEA 3GF5A 4M7DC 1G3WA 4RG2A 1WQ7A 2XG8D 3M58A 5LJ3j 3JCMh 1NE8A 3DB3A 2ZPHB 5FROA 3V8JA 5A2QE 2KY9A 1KG1A 1X01A 2QQSA 3LH0A 2GFUA 2P0KA 3G4SA 3JRZA 4MZPA 1M90U 1YJNA 1WGSA 3S3NA 3A8GB 5J26A 1Y07A 2GFAA 5LJ3e 3OYCA 3M5AA 2LQ8A 3S6WA 4ZN1A 4QVZA 3L42A 2EFIA 4BY6C 1B34B 2EYQA 4PKCC 1K8AU 3JCMf 3JCMc 3AHUA 3L2UA 4B9XA 3SWNC 1U1SA 2BUDA 3WVDB 5CKDA 4BE0A 4M7DE 3CPFA 5LJ5e 2IG0A 1QW1A 4M77G 4PJOF 4NL3A 2DZ9A 4HCCA 2K5IA 5HK0A 4E7LA 3CMAT 2RHZA 2A3LA 3P8BB 2DK3A 3FLGA 3JSCA 3EFSA 2CZ0B 3M57A 3HRTA 5GAOn 3LX7A 1QVFA 4P5NA 4EMGA 1X75C 3V7CA 4X9DA 3UT1A 2ZPBB 2HQXA 2MMPA 4J83A 4N4IA 3R6OA 3HL8A 4XTXA 5LJ3h 2LQKA 1M8VA 3V8KA 4LDXA 2X4YA 5HK3A 2XICA 2Y90A 1Q86C 1BI2A 3JAME 4M7AC 2RH2A 4LDUA 1N8RC 2XDBA 1VUBA 4M7DF 4M78A 5LJ5h 3JB9I 1FWZA 1ZQ1A 4PJOD 2GCXA 2K4YA 2DXCA 5IT9E 1V29B 3QZ5B 4ZGDB 4JJNK 2E6ZA 4BE1A 1VQ5A 3MEVA 5GAOm 3QDRB 5GANg 1N27A 1NPRA 3M55A 5LJ3f 5GAOl 3OW2S 2RHXA 3JCMQ 5GAOr 1VQ4A 1VQPT 3L2ZA 2KSSA 3OMGA 3WVEB 4ATOA 3MO8A 4LDYA 4C5HA 4C8QC 5KH6A 1UB4A 3DLMA 2DXBA 2PUKB 2VXFA 2VGNA 3ER0A 3VU3C 2L3RA 2VXEA 3G4ST 3CCLT 3ZEHA 2FVUA 4C5GA 5LJ5f 4JDSA 3QUIA 4JLIA 2XDDA 4FT2A 3CCJT 1YJNT 1M1KU 1JJ2S 2X4JA 3QHSA 5L8RE 2JOYA 4M7AG 3CXCA 2K2VA 2XIDA 3CCQT 1K73U 3JB9H 4IUPA 3ASKA 2JZ2A 2DPPB 4C92B 3HHTB 3PT9A 5FLXE 3OYDA 4J7FA 4M7DD 2LX9A 3OYKA 4R55A 4MMKA 5GMKl 3MP1A 4KULA 1YI2T 5EG2A 3CD6T 2ZPFB 1Y71A 5CO7A 4M7AF 1Q86U 4F7UG 1N8RU 3P8HA 3L1AA 3V8LA 1UGSB 2L5QA 2Y4YA 4YTLA 3CCUT 1YJWA 3CCVA 4C8QG 4IUUA 3FDRA 3PTAA 4JS4A 1VQLA 4KBMB 2QEXA 3JCMJ 3OYFA 3VV0A 4ELYC 5FRMA 2QQBA 2YHTA 1VQMA 2RD1A 2JUFA 4C8QF 3VJPA 1I8FA 3C95A 2OTLA 2DIGA 2XDPA 3RESA 2K3YA 3G6EA 1KHIA 3PFSA 3L2WA 2FL7A 4M77B 1IZ6A 4NL2A 4C92C 5C6SA 3PIPA 4J7IA 5A0DA 3FB9A 3S3MA 1LJOA 3HSBA 1I81A 2RI2A 4MMLA 2OAUA 3I55T 4O6JA 3X26B 4EDUA 3RKXA 2QI2A 3NTHA 4DOWA 4IUQA 1K8AC 1D3BB 3JB9G 2L8DA 3MEAA 4PJOA 2JN0A 2RA2A 2MWPA 1VQ7T 3CCMT 1KQ2A 4OGEA 3CC7T 3OYEA 1BIBA 4BY6B 3E9GA 2O4XB 2PQWA 2ZPEB 1XTDA 5GANj 1YI2A 1HK9A 2LRQA 3HKSA 4C8QD 2K57A 3NTKA 4QQ6A 1WNLA 4QQDA 3SWNB 4Z02A 5KE3A 3KUFA 1JBMA 3CBMA 2BIVA 5GAMd 1BI0A 4M77C 4PJOE 3JCMW 3CPWA 4C92G 1UGQB 4BDYA 4HT9A 2YLCA 2VUBA 5D6YA 3V7RA 5GAMj 3GP8A 2PU9B 2QA4A 1D3BA 5GANe 5GMKj 4HCBA 5AYFA 4PNOA 1WJQA 1I5LA 1KQSS 4C92F 5FU6B 4OB1B 4BI4A 2XD0A 4M7DA 1M4ZA 3LWIA 2DTIA 2LC4A 2MAMA 2QTXA 3M9QA 2D0QB 3URGA 3X20B 4JRKA 3QZ9B 1ZHIA 3F70A 4JS5A 3CCQA 1VQKT 2RHIA 3E19A 4II1A 3OSVA 3QSUA 1YJWT 5GMKe 2EJGA 2X35A 3OQ5A 3X28B 1S72A 2E70A 2KVQG 4M7AB 3RERA 1K9MC 5GAOq 3CC4T 2RK2A 2RHUA 3FIFA 1O9SA 4OGCA 3BY7A 1VQMT 3OS5A 4C5EA 1YJ9T 4QVDA 3C94A 2RB6A 2E10A 3A8LB 5CKHA 4D6WA 1G3TA 2M16A 2WSCE 4F7UB 3RMQA 1VQNT 2DIQA 5GANh 2VYTA 2CZ7B 2R5AA 3HRUA 2QXFA 4M77F 1VQ9T 3OSSC 2OTJT 4C8QB 5KCOA 4ME7A 4XTUA 4C0ZA 2YLBA 4N0AC 4L6V5 4C92D 1YIJA 5FU6C 1M1KC 3S3OA 1VQ6A 1B34A 1M1GA 2CS7A 2DO3A 3MCAB 2V8IA 3OA6A 1K73C 4LD6A 4QW2A 4GLKA 1VIEA 1N9RA 3ME9A 1VQOA 1UGRB 4FT4A 3TEEA 2VV5A 4Y91A 3J80E 2FB7A 4A54A 5GANf 1WPYA 2LT1A 3MHXA 4Q5WA 2JTMA 1SSFA 4HT8A 4E7KA 1YITA 4BDZA 3QBYA 1KQ1A 3CCST 3OYYA 2PVDB 2RJFA 2P0PA 2KDSA 3C4SA 4C8QA 3C12A 4M7AE 1UGPB 4CRIA 5KE2A 3T9NA 3L2VA 1K9MU 3L2RA 4IKFA 4E47A 1X6OA 3A5ZB 2A7YA 4M77D 2DTOA 4IUVA 3M4YA 2RI5A 4EMKB 4QQGA 3HFOA 4TVRA 1XOVA 3QIIA 4BB7A 4F7UE 4PLIA 2RK1A 5CIUA 1YHQA 4JRPA 1BYMA 3MP6A 2MI6A 5GAMg 4C8QE 2ZZDA 3M56A 5GAN2 4RMOA 3OYAA 4BUGA 4ZTJA 1QVGS 2LDMA 4XQ3A 4CI0C 1PSFA 1EIFA 1M5Q1 1O75A 3FJPA 4FM4B 4XTVA 4BD3A 3OYJA 1IREB 3OS1A 1QVPA 4L59A 4M75B 3META 3FRNA 1N9SA 4M78C 2PVOB 1JB0E 1TH7A 4J6XA 4MDWA 5GAN4 3VUBA 1VQ8A 2CGHA 2LTOA 3BDUA 3MP8A 2KAFA 4PLLA 5CQYA 5J3BA 4NS5A 5CCAA 3KXTA 1Y96B 2D6FA 4BI3A 2CZ1B 4EMKC 3VKIA 2Y4XA 4F7UF 3HPWA 2K5LA 1DJ7B 2EKOA 4XTWA 2LNVA 3DB4A 1FX7A 4OMFB 3SFMA 4DA4A 1BKBA 1YIJT 3HRSA 4C92A 3OYIA 2RI3A 2ZPGB 2EQMA 2WACA 4MZTA 4O5VA 4XTZA 5DLOA 2DEQA 5I2MA 3CCEA 3INZA 3PNWC 2JVVA 4JRIA 4OB3B 4UC4A 2QDYB 3LYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HT9 A;  2YLC A;  3HFN A;  3V7R A;  5GAM j;  4M75 C;  1D3B A;  4M78 G;  5GAN e;  5GMK j;  4M7A D;  4PNO A;  4EMK A;  3EFS A;  3JCM V;  4C92 F;  3JCM d;  4C92 E;  5GAO n;  4M7D A;  4EMG A;  2DTI A;  2QTX A;  4M78 F;  1HXD A;  4M78 E;  4X9D A;  3V7C A;  4JRK A;  4WF2 A;  4XTX A;  5LJ3 h;  5LJ3 g;  1M8V A;  5GAO p;  3V8K A;  3QSU A;  5GMK e;  2EJG A;  1MGQ A;  2E41 A;  4M77 A;  3JB9 F;  4V2S A;  4M7A B;  3BFM A;  4RCC A;  3RER A;  2Y90 A;  4M7A C;  2RM4 A;  3BW1 A;  5GAO q;  3JCM b;  2HNI A;  3FIF A;  2DXT A;  4M75 A;  5GMK m;  4M7D F;  3BY7 A;  4M78 A;  4A53 A;  5LJ5 g;  5LJ5 h;  3JB9 I;  2I2L A;  4QVD A;  1LOJ A;  4PJO D;  2VC8 A;  2RB6 A;  2E10 A;  1JRI A;  3RUX A;  4F7U B;  5LJ3 j;  5GAO m;  4M75 G;  5GAN g;  5GAN h;  1Y96 A;  2DZC A;  5LJ3 f;  5GAO l;  3JCM Q;  5GAO r;  3L2Z A;  4M77 F;  5GAN 3;  4M77 E;  2DKG A;  4RCB A;  4X9C A;  4C8Q B;  4XTU A;  4C92 D;  2YLB A;  3M4G A;  4N0A C;  2EAY A;  4XU1 A;  4C8Q C;  5GMK i;  3JB9 J;  2VXF A;  1I4K 1;  3GIB A;  4M75 F;  3VU3 C;  3JCM X;  2VXE A;  4M75 E;  1B34 A;  5GAN 6;  4PJO B;  5LJ5 f;  3SB2 A;  3SWN A;  1N9R A;  1WQW A;  3V7S A;  3QUI A;  4JLI A;  2E64 A;  5GAM e;  4Y91 A;  4XTY A;  3JB9 D;  2E65 A;  2FB7 A;  3QHS A;  5LJ3 d;  4A54 A;  3JB9 H;  2DTH A;  5GAN f;  1WPY A;  4XU3 A;  4M7A G;  4C92 B;  4HT8 A;  2ZGW A;  4M7D D;  5I21 A;  4OP0 A;  1U1T A;  4J6Y A;  4MMK A;  5GMK l;  1KQ1 A;  2DVE A;  3JCM e;  4C8Q A;  4N0A A;  4M7A F;  4M7A E;  5LJ5 d;  4F7U G;  5DY9 A;  4XU0 A;  4DQ2 A;  3L1A A;  3V8L A;  4M77 D;  4J6W A;  2DTO A;  5LJ5 j;  3PGG A;  4C8Q G;  4EMK B;  5GAN d;  3HFO A;  3JCM J;  4M7D B;  4M75 D;  4F7U E;  1I5L A;  1YCY A;  4M78 D;  5GAN 5;  4M7D C;  3QO3 A;  4M7A A;  1LNX A;  2YHT A;  4QVC A;  4PJO G;  2RD1 A;  4PJO C;  4C8Q F;  4J5Y A;  1I8F A;  4C8Q E;  2EWN A;  5GAM h;  3RES A;  5GAM g;  5GMK h;  5GAN 2;  2E1H A;  1BIA A;  4XQ3 A;  3JCM P;  2DJZ A;  2EJ9 A;  3RKY A;  3FJP A;  1M5Q 1;  4M77 B;  4XTV A;  5GAN 8;  4F7U A;  4NL2 A;  4C92 C;  3RKW A;  1WQ7 A;  3HSB A;  3FB9 A;  1LJO A;  4NOY A;  2DXU A;  1I81 A;  4M75 B;  4M78 B;  3JCM h;  3JCM g;  3V8J A;  1N9S A;  4M78 C;  1TH7 A;  4MML A;  4J6X A;  5GAN 4;  1X01 A;  2FYK A;  2CGH A;  3RKX A;  3BDU A;  2EJF A;  5GAM f;  1D3B B;  1Y96 B;  3JB9 G;  4PJO A;  2JN0 A;  2RA2 A;  3RIR A;  1KQ2 A;  4EMK C;  4F7U F;  5LJ3 e;  4HA8 A;  1BIB A;  5GAN 7;  4M7D G;  4XU2 A;  5CAI A;  4XTW A;  1H64 1;  5GAN j;  1B34 B;  1HK9 A;  4C8Q D;  3JCM f;  3JCM c;  2K57 A;  4C92 A;  4EMH A;  3AHU A;  1WNL A;  3SWN B;  4XTZ A;  3SWN C;  2DEQ A;  1U1S A;  3EFR A;  4M7D E;  1JBM A;  3INZ A;  4JUV A;  5LJ5 e;  4M77 G;  5GAM d;  4M77 C;  4JRI A;  4PJO F;  4NL3 A;  2DZ9 A;  3JCM W;  4PJO E;  4C92 G; 
#chains in the Genus database with same CATH topology
 1G3S A;  2AHJ B;  4M7A D;  2B8A A;  3JCM V;  3EGX A;  1MV0 B;  2F2W A;  1WYX A;  2XKO C;  3X25 B;  3N5B B;  4WF2 A;  3VS0 A;  5ECA A;  5C0M A;  1VQ4 T;  5CQX A;  1IRX A;  4WCI A;  1AWO A;  2L89 A;  3OYN A;  2HQH A;  2GQV A;  1MV3 A;  4A53 A;  4XAX B;  4JRQ A;  2HAX A;  2VC8 A;  1WHH A;  5FU7 C;  2J6F A;  3VS5 A;  4J9H A;  3EG9 B;  4RTZ A;  1GCP A;  3PMI A;  2LVM A;  3LGF A;  5GAN 6;  3SWN A;  2V8K A;  3JB9 D;  3OYM A;  4AG2 C;  2RJD A;  1T0H A;  1VQP Q;  1XNI A;  3GNF B;  1AVZ C;  5I2S A;  3NPF A;  3RDV A;  3RMS A;  5LJ5 j;  2DMO A;  3NGP A;  3SEM A;  3CCR Q;  3SD4 A;  2DAQ A;  2F5T X;  1AD5 A;  4M75 D;  5GAN 5;  1ZBX A;  1I5L A;  1VQ6 Q;  2X9H A;  3CD6 A;  3M0T A;  3TU4 K;  5IH2 A;  1UUE A;  4C0G A;  2DXU A;  1YIT Q;  4M78 B;  3VYG A;  4ZTF A;  4OF1 A;  2EQJ A;  2OX7 A;  2ED0 A;  3CC2 Q;  1GXI E;  3MEU A;  2LCC A;  3EAE A;  2F2X A;  3GPL A;  1UEC A;  4HA8 A;  2PNI A;  5FRN A;  5KCH A;  1H64 1;  3FEO A;  2NUP A;  2CRE A;  2KYM A;  3EFR A;  2EBP A;  2ZPI B;  1U8R A;  1NZ9 A;  2K3X A;  2JJ9 A;  3CCM A;  2A0F B;  3CC7 A;  4B9W A;  3I56 Q;  3SDZ A;  5D7U A;  1WJR A;  1KC8 U;  1RLP C;  2E41 A;  1MMA A;  3MEW A;  4BE2 A;  2HZY A;  1YBY A;  2RM4 A;  1UDL A;  4C0D B;  2DXT A;  5GMK m;  4A4F A;  1VQO T;  5D6X A;  1JRI A;  5A0G A;  3CPW S;  2OJ2 A;  5KYX B;  4RTT A;  1VQK A;  1RI0 A;  5GAN 3;  3EG0 A;  1I4K 1;  4KH1 B;  3JCM X;  4M75 E;  3QPH A;  2AKL A;  3UF4 A;  2AIR B;  1YJ9 A;  2PVG B;  1W2B A;  2GTJ A;  1M90 C;  2E4H A;  4LDW A;  2HL5 C;  2OTJ Q;  5FWB A;  3TSW A;  3G7Z A;  1VYU A;  2DL5 A;  3RR6 A;  3OBY A;  3TCJ A;  1BI1 A;  1IGQ A;  2JS2 A;  2O88 A;  1M9S A;  1W4S A;  1QVF S;  2EQU A;  5D6W A;  4GY5 A;  2F2V A;  4J8O A;  1OPK A;  5IHN A;  1UGV A;  5LJ3 j;  3JCM h;  4HVW A;  5A2Q E;  2ZPH B;  3M0U A;  2KY9 A;  1X01 A;  2QQS A;  2P0K A;  1D1B A;  4QKU A;  1ZBJ A;  1TUC A;  1RAA B;  1WGS A;  1YJN Q;  3A8G B;  2HKN A;  1PRL C;  1Y07 A;  2LQ8 A;  2EFI A;  1ZSZ C;  1EZZ B;  1K8A U;  3AHU A;  4AFS C;  1PM3 A;  5CKD A;  3WVD B;  4M7D E;  4NL3 A;  2DZ9 A;  2A3L A;  3P8B B;  4DBR A;  1KK7 A;  3FLG A;  3JSC A;  2CZ0 B;  1X75 C;  1IHW A;  2KXC A;  4N4I A;  3M0Q A;  4XTX A;  2LQK A;  1BCO A;  3EG2 A;  4EIK A;  3JAM E;  1N8R C;  2DRK A;  2H8H A;  5LJ5 h;  2MPX C;  2K4Y A;  1X43 A;  4JJN K;  5AT1 B;  5GAN g;  1VQ5 Q;  1GBQ A;  5LJ3 f;  2RHX A;  1VQP T;  3LH5 A;  4CC7 A;  3WVE B;  5KH6 A;  1WHG A;  4J9B A;  3ZEH A;  1QWE A;  3QUI A;  4FT2 A;  1CKA A;  2IIM A;  4M7A G;  4KGZ B;  1QLY A;  1PC0 A;  2O9S A;  4C92 B;  3PT9 A;  1RAG B;  2O31 A;  3MP1 A;  1MMD A;  5CO7 A;  4LE9 A;  1Q86 U;  4WTO B;  2HMA A;  2L3Q A;  5HCK A;  3CCV A;  3FDR A;  4JS4 A;  1WIE A;  4KBM B;  1C0M A;  3VV0 A;  3EGX B;  3CC2 T;  3VJP A;  2OTL A;  3RES A;  3G6E Q;  3PFS A;  3L2W A;  1IZ6 A;  1ACM B;  2RI2 A;  4F04 B;  1UE9 A;  3I55 T;  3O5Z A;  1E6H A;  4EDU A;  1K8A C;  3JB9 G;  2L8D A;  3MEA A;  1KQ2 A;  1GCQ C;  3VS7 A;  4K11 A;  4OGE A;  1SRL A;  2KR3 A;  1EFN A;  4RTW A;  1YI2 A;  3SWN B;  2KRS A;  4KRT A;  1HSQ A;  5GAM d;  4C92 G;  4J9D A;  5KYW A;  1OX8 A;  1SG5 A;  2QA4 Q;  5GMK j;  2B86 A;  1KQS S;  4OB1 B;  1ZSZ A;  2JTE A;  3QZ9 B;  1K9M R;  4J9I A;  4II1 A;  1S72 A;  2BTT A;  3X28 B;  2V1Q A;  4LN2 A;  3BY7 A;  4C5E A;  1G2B A;  1VYT A;  2RB6 A;  4D6W A;  3RMQ A;  3EH2 A;  2D8H A;  2K2M A;  2OTJ T;  4C8Q B;  4C0Z A;  2YLB A;  2DE0 X;  4N0A C;  5FU6 C;  3S3O A;  1M1G A;  3MCA B;  4LD6 A;  1UJY A;  2VV5 A;  4A54 A;  2LT1 A;  2EYY A;  1T3L A;  1SSF A;  2NUP B;  4E7K A;  3OYY A;  2RJF A;  2KDS A;  1UGP B;  5IXF A;  1CSK A;  1LVK A;  4E47 A;  3A5Z B;  2A7Y A;  4M77 D;  2DTO A;  4QQG A;  3QII A;  4FYY B;  4F7U E;  2RK1 A;  5CIU A;  2Z0W A;  2DF6 A;  2MI6 A;  4RMO A;  1QVG S;  3M56 A;  1R0B G;  4BUG A;  4XQ3 A;  1PSF A;  4FM4 B;  4XTV A;  1X27 A;  3OYJ A;  1RAI B;  1QVP A;  1Z9Q A;  3EGU A;  2PVO B;  1NYG A;  1HD3 A;  2CGH A;  2A28 A;  5CCA A;  3KXT A;  2EW3 A;  1M2O A;  2CZ1 B;  4EMK C;  2Y4X A;  2K5L A;  4OMF B;  2K79 A;  1BKB A;  3HRS A;  1IHV A;  2ZPG B;  2WAC A;  5I2M A;  3PNW C;  4JRI A;  4OB3 B;  3LYI A;  2QGF B;  1KD1 R;  1K76 A;  3OW2 A;  3LWH A;  3CME A;  4M75 C;  4Y92 A;  1GCQ A;  4E6R A;  1AWJ A;  3PE0 A;  2OAW A;  1FMV A;  4ZNX A;  1VQ5 T;  3AT1 B;  2BE9 B;  1B3Q A;  4X34 A;  1BBZ A;  1TXQ A;  1Q82 R;  5GAO p;  4FCY A;  4F17 A;  3CMA A;  3JB9 F;  4E7H A;  1GRI A;  1VOM A;  2HNI A;  4RG8 A;  2LCL A;  4E7I A;  1Q81 R;  3J7A F;  2DYB A;  2K7A A;  3ZBD A;  2DRM A;  4DBQ A;  3M54 A;  2W0Z A;  2R57 A;  3SHW A;  2E5K A;  3H41 A;  4M77 E;  2DKG A;  2EGE A;  4RCB A;  1XJW B;  2DLP A;  4OVA A;  4M75 F;  2PTK A;  2V8J A;  1WZO A;  1X6G A;  2DBM A;  1X2Q A;  3SB2 A;  2DBK A;  5GAM e;  3QJY A;  2QEX T;  1NPP A;  2EYX A;  4OP0 A;  2D1X A;  3G6E T;  4N0A A;  2DFU A;  4XU0 A;  2QQR A;  3O8V A;  2IPO B;  5LL6 S;  3CCJ A;  1M2V A;  4PJN A;  5M9O A;  3CME T;  2M0O A;  4M7D C;  1FXX A;  1QWF A;  2HBP A;  4M7A A;  4QVC A;  4OB2 B;  4ORZ A;  2ROT A;  4FSX A;  2RJC A;  1M3B A;  1VQO Q;  5GMK h;  2E1H A;  3QXE B;  3JCM P;  3RKY A;  1YFN A;  1SPK A;  5CKF A;  4ANJ A;  1WJS A;  3OMC A;  3PVQ A;  1M3A A;  2NLU A;  1M1F A;  2KQW A;  2CKK A;  2ZCF B;  1D1C A;  2HCK A;  4FIB A;  2EJF A;  3QDF A;  3NFC A;  4AG1 C;  4DOV A;  3RIR A;  2QA4 T;  3LGL A;  1NJI R;  1OU8 A;  2CYZ B;  4A4E A;  1RAE B;  4XU2 A;  5CAI A;  2KMT A;  2NYS A;  2MF2 A;  3VS3 A;  3A8O B;  2G3R A;  4FSS A;  2EYW A;  5HKC A;  2JNG A;  5KYY A;  2XK0 A;  3VUZ A;  4BAC A;  3OBW A;  1YN8 A;  1VQ7 A;  3CCM Q;  4Y28 E;  4EMK A;  1Q7Y R;  4M78 E;  3C0C A;  3REA B;  5LJ3 g;  4LXC A;  3IQL A;  2R58 A;  4RCC A;  3BW1 A;  3PIO A;  1ABQ A;  4M75 A;  2HD0 A;  3M53 A;  5CKE A;  1H3H A;  4EPC A;  1P92 A;  1KHC A;  5IHI A;  1IGU A;  2K9G A;  1VQK Q;  1ABO A;  3OYL A;  1HJD A;  1RLQ C;  3UDC A;  2GGR A;  2RMO A;  2NUZ A;  4LUD A;  1XQH A;  1YJ9 Q;  1WA7 A;  2E6N A;  4OB0 B;  3CBO A;  3LLR A;  2WSE E;  2ZGW A;  1VQ9 A;  1Y7X A;  1M8M A;  2DL4 A;  2V26 A;  2QQA A;  1X69 A;  5KYW B;  1OZ3 A;  2FHD A;  3PGG A;  5GAN d;  4HVV A;  5FWC A;  1ZSZ B;  1PKS A;  2HQE A;  1RAH B;  3H6Z A;  3CCS A;  2EWN A;  4HCK A;  3CEY A;  4A4G A;  1G5V A;  4HKE A;  3GF5 A;  1G3W A;  4RG2 A;  4OMO A;  1WQ7 A;  3DB3 A;  3V8J A;  3EH1 A;  4PFZ A;  5FRO A;  4D8K A;  1KG1 A;  3LH0 A;  3G4S A;  1M90 U;  1ZLM A;  2CP2 A;  3OYC A;  1SHG A;  3L42 A;  4OMN A;  4BY6 C;  1D0Z A;  4OMQ A;  2CH4 A;  3JCM f;  3JCM c;  3I9Q A;  1U1S A;  2AZS A;  2BUD A;  4BE0 A;  3CPF A;  2IG0 A;  1QW1 A;  1Q95 G;  4M77 G;  4HCC A;  3TVT A;  2YXY A;  2CP3 A;  1HYO A;  2BZ8 A;  2L3S A;  2ATC B;  3HRT A;  1QVF A;  5GJW B;  4EMG A;  2MK5 A;  3UT1 A;  2ZPB B;  1M30 A;  3I5R A;  4J83 A;  4DBH A;  4PJJ A;  5HK3 A;  5KYU A;  2Y90 A;  1BI2 A;  4GLM A;  2XDB A;  1VUB A;  3I55 Q;  1FWZ A;  1TTH B;  4DEX A;  4PJO D;  4CC2 A;  2G6F X;  4ZGD B;  3QZ5 B;  4BE1 A;  5GAO m;  3M55 A;  2M02 A;  3JCM Q;  5GAO r;  3OMG A;  4LDY A;  2COW A;  2VXF A;  2MYS A;  2FPE A;  2CUB A;  3G4S T;  5LJ5 f;  3ULR B;  3OW2 P;  5L8R E;  3CXC A;  2K2V A;  3JB9 H;  1IO6 A;  5FLX E;  4M7D D;  4J7F A;  2LX9 A;  4E2F B;  4PFP A;  3EHR A;  4KUL A;  5EG2 A;  3CD6 T;  1N8R U;  2RQV A;  1YJW A;  4IUU A;  1VQL A;  1B7T A;  3CCV Q;  1C1A A;  1JXM A;  2FPD A;  3JCM J;  3OYF A;  4LUE A;  2DET A;  1NBE B;  3THK A;  1SSH A;  1N5Z A;  1E6G A;  2YHT A;  1VQM A;  2RD1 A;  5EC7 A;  1KHI A;  2EYZ A;  2FZK B;  1YWO A;  2FL7 A;  2LMJ A;  2SEM A;  2V1R A;  4NL2 A;  2CP7 A;  1FMW A;  1LJO A;  1I81 A;  4MML A;  2OAU A;  2QI2 A;  2FZG B;  4IUQ A;  1U06 A;  1D3B B;  3CCM T;  2O9V A;  4Z89 A;  2RQR A;  3CC7 T;  1TU0 B;  1BIB A;  3OYE A;  2ZPE B;  2QAZ A;  3GBQ A;  4C8Q D;  1YI2 Q;  4Z02 A;  2K6D A;  2KXD A;  4X1V A;  1JBM A;  4IIO A;  1ZUY A;  4M77 C;  2JW4 A;  4PJO E;  4OMP A;  2CP0 A;  1A0N B;  5GAM j;  4HCB A;  3GP8 A;  5GAN e;  5AYF A;  1KFZ A;  2ZAE A;  3KFV A;  1MMG A;  5FU6 B;  4AT1 B;  1M4Z A;  1K1Z A;  2H3E B;  3LWI A;  2QTX A;  3URG A;  4DEY A;  2FZC B;  4JRK A;  1ZHI A;  1M2V B;  3H0F A;  2YSQ A;  1VQK T;  2EPD A;  3ZL7 C;  2RHI A;  2LJ3 A;  3E19 A;  1YJW T;  2EJG A;  2X35 A;  3OQ5 A;  1RUW A;  2E70 A;  4M7A B;  1K9M C;  2DL3 A;  2RK2 A;  3FIF A;  1O9S A;  1Y0M A;  1VQM T;  1YJ9 T;  3C94 A;  2E10 A;  3A8L B;  3H0H A;  5KYN A;  2VYT A;  2CZ7 B;  2R5A A;  4M77 F;  1K73 R;  4ME7 A;  4XTU A;  1VQ6 A;  2CS7 A;  3OA6 A;  4QW2 A;  4GLK A;  1UGR B;  4FT4 A;  3TEE A;  3J80 E;  2FB7 A;  1WPY A;  1CKB A;  4Q5W A;  1YIT A;  4BDZ A;  2QYZ A;  2PVD B;  5KYY B;  3C4S A;  2BZX A;  5KE2 A;  1RAC B;  4IKF A;  2HKQ B;  4J9G A;  2DER A;  1ARK A;  4IUV A;  1PWT A;  1MNE A;  4EMK B;  1UJ0 A;  4FW1 A;  4TVR A;  1XOV A;  2EGA A;  3H9N A;  2JS0 A;  1G8X A;  1YHQ A;  2YDL A;  1BYM A;  4C8Q E;  2RNA A;  5FW9 A;  1EIF A;  4M75 B;  3FRN A;  1N9S A;  4M78 C;  5GAN 4;  4MDW A;  3VUB A;  1VQ8 A;  4RUG A;  1W6X A;  7AT1 B;  3E2U A;  3MP8 A;  1ZA2 B;  2QEX Q;  2JXB A;  2CH4 W;  1AT1 B;  2EKO A;  1FX7 A;  2EQM A;  3M0P A;  4FYV B;  4XTZ A;  2DEQ A;  3INZ A;  1U3O A;  4UC4 A;  4RTU A;  3CME Q;  1OUL A;  1BU1 A;  1WHK A;  1T3S A;  2SRC A;  3UA7 A;  1KD1 C;  4RKU E;  4M78 F;  5CVI A;  2CT3 A;  1YCS B;  2HEQ A;  2MCN A;  1D0Y A;  1JJ2 A;  2EKH A;  4M77 A;  8ATC B;  5IXB A;  2J06 A;  2QTV A;  1Q82 C;  2FPF A;  1C6V X;  2ENM A;  1RAD B;  3RUX A;  3A98 A;  3OY9 A;  2BKD N;  1G3Y A;  1UEB A;  4M75 G;  1Q81 C;  3OYB A;  2DD4 A;  3CBP A;  2KRM A;  3J81 E;  1KJW A;  5GMK i;  1M3C A;  3GIB A;  2M0Y A;  2O4X A;  3OS2 A;  2L2P A;  1VQ8 T;  3QJ6 A;  4ZGJ B;  2I0N A;  4JLG A;  3QKJ A;  5J39 A;  4N4H A;  2GNC A;  3CCV T;  1MHN A;  2CDT A;  2E65 A;  1AZE A;  5LJ3 d;  2DTH A;  2JTF A;  1PSE A;  5I22 A;  1TS9 A;  2OTL T;  4DBF A;  1W70 A;  3HTR A;  3CCL A;  5DY9 A;  3VYH B;  4PL6 A;  1H92 A;  4J6W A;  3CCJ Q;  2LZ6 B;  4VUB A;  4N4G A;  2DX1 A;  1YCY A;  3P8D A;  2AT1 B;  4PJO G;  1NG2 A;  5GAM h;  1OI1 A;  2EJ9 A;  1WFW A;  2E12 A;  5GAN 8;  1KC8 R;  3EGD A;  5KYU B;  3CCU A;  3RKW A;  3TRE A;  3JCM g;  4AFZ C;  2A37 A;  1YI2 T;  1H8K A;  3G71 A;  1N6A A;  2VWF A;  3EG3 A;  2FYK A;  2JMC A;  2CZ6 B;  2OI3 A;  2RQU A;  3CXC P;  3M59 A;  3L2Q A;  4RTX A;  4M7D G;  1T0J A;  4BI8 B;  2E3I A;  4EMH A;  1NJI C;  1AWW A;  3MPU B;  3DKM A;  1PD1 A;  4ZGE B;  1S72 T;  3FC3 A;  1AOJ A;  1VQ7 Q;  2YUQ A;  1D1A A;  1H3Z A;  4XK8 E;  2LQW A;  1M27 C;  2AKK A;  8AT1 B;  3PMT A;  1W2B P;  4IUR A;  3VS2 A;  4AFQ C;  1Q7Y C;  2LX7 A;  4CC4 B;  4V2S A;  1QP2 A;  3BFM A;  2D9T A;  3HP9 A;  3GNG A;  5LJ5 g;  2E3H A;  2DM1 A;  3BDL A;  2RO0 A;  4HXJ A;  5FU7 B;  2COZ A;  3M0R A;  2LQN A;  3UPU A;  1OQK A;  1Y96 A;  2IVW A;  4JJC A;  3EFO A;  2VB6 A;  2VGM A;  4XU1 A;  4A4H A;  3JB9 J;  2R5M A;  3G71 T;  3CC4 A;  4IUT A;  4B6M A;  5A0L A;  3X24 B;  4ESR A;  3EHQ A;  5IN1 A;  1VQN A;  5CKB A;  3ZFJ A;  2XU8 A;  4J9C A;  5IAY A;  1IXD A;  4PFO A;  1OZ2 A;  2FO0 A;  2X4X A;  2W10 A;  5DM7 R;  4QT7 A;  3QYH B;  3WXM B;  2YRV A;  1S1N A;  1PKT A;  3OB9 A;  4M78 D;  3QO3 A;  4LDV A;  4A4K A;  3E9F A;  3I35 A;  3QYG B;  4PJO C;  2DNU A;  2HL3 A;  4J5Y A;  4RTV A;  3CCS Q;  3OYG A;  4A63 B;  3UWN A;  3H8Z A;  2LP5 A;  3DLL A;  2K3B A;  2COY A;  2XG8 D;  2GFU A;  3JRZ A;  3G4S Q;  1PG5 B;  3U23 A;  3S3N A;  3CCQ A;  5LJ3 e;  3PVL A;  2F1L A;  1GFC A;  2J6K A;  2EYQ A;  4PKC C;  1I5O B;  3L2U A;  3CD6 Q;  3SWN C;  4JZ4 A;  1BB9 A;  4PJO F;  1K0S A;  1U5S A;  4E7L A;  3CMA T;  3FJ5 A;  4PJM A;  2XMF A;  1OOT A;  3EFS A;  1UTI A;  3M57 A;  2CP5 A;  3LX7 A;  2KGT A;  1BCM A;  2QK0 A;  2MMP A;  3R6O A;  3I5S A;  1Q86 R;  4LDX A;  2NWM A;  3MKD A;  2ECZ A;  2X4Y A;  2FRW A;  1JO8 A;  2XIC A;  4M7D F;  2RF0 A;  2YWW A;  2HSP A;  2GCX A;  5IT9 E;  1V29 B;  2E6Z A;  3OW2 S;  2JM8 A;  3QDR B;  1N27 A;  1NPR A;  1VQ4 A;  3CC7 Q;  2KSS A;  2FG0 A;  2A36 A;  4RTY A;  4C8Q C;  1UB4 A;  3DLM A;  2DXB A;  1UFF A;  2FVU A;  4C5G A;  4JLI A;  2XDD A;  3CCJ T;  1LCK A;  3VS4 A;  3CCQ T;  1K73 U;  4IUP A;  1QKW A;  2GQI A;  3ASK A;  2JZ2 A;  2DPP B;  2X3X D;  3OYK A;  4R55 A;  4MMK A;  1UHC A;  2ZPF B;  1QKX A;  4F7U G;  3G1J A;  3L1A A;  3V8L A;  4JPB W;  1JJ2 P;  1UGS B;  2L5Q A;  2Y4Y A;  1YJW Q;  3PTA A;  1VQL Q;  1PD0 A;  2LJ0 A;  4ELY C;  1KIK A;  2HSE B;  2QQB A;  4OML A;  2LNH B;  1VQM Q;  4C8Q F;  1I8F A;  3C95 A;  4M77 B;  4FW2 A;  3PIP A;  2KT1 A;  4J7I A;  3UA6 A;  3FB9 A;  1Y57 A;  5A0D A;  1TUG B;  1E7O A;  1QCN A;  4O6J A;  3X26 B;  1RI9 A;  3NTH A;  1NYF A;  1J3T A;  2QAS A;  3A1P A;  4PJO A;  2RA2 A;  2MWP A;  1VQ7 T;  1WXB A;  3H0I A;  1SF9 A;  3E9G A;  2O4X B;  1SEM A;  3EG1 A;  3NTK A;  4QQ6 A;  5KE3 A;  2C0O A;  2RQW A;  3CPW A;  1UGQ B;  2VUB A;  4PNO A;  3M0S A;  4M7D A;  1ZX6 A;  3CQT A;  3X20 B;  3F70 A;  4JS5 A;  1F1B B;  4FYW B;  5GMK e;  1OPL A;  4E7Z A;  2KI7 A;  3RER A;  5GAO q;  2RHU A;  1ZSG A;  1WDX A;  1GBR A;  1QQJ A;  4QVD A;  3NHN A;  5CKH A;  1R77 A;  3EGD B;  2WSC E;  2DIQ A;  1M1K R;  5GAN h;  2HDA A;  1VQ9 T;  3OSS C;  5KCO A;  4C92 D;  1X6B A;  4L6V 5;  1YIJ A;  2KRN A;  1B34 A;  2DO3 A;  1K73 C;  2C06 A;  1VQO A;  3ME9 A;  1PNJ A;  3RNJ A;  1TUD A;  4Y91 A;  2JTM A;  4Z8A A;  1KQ1 A;  3CCS T;  2NUT A;  2P0P A;  1JEG A;  4C8Q A;  2EGC A;  4M7A E;  4CRI A;  3L2V A;  1K9M U;  1D0X A;  3M4Y A;  3HFO A;  4BB7 A;  4PLI A;  4KGV B;  1YHQ Q;  2ESW A;  3MP6 A;  3OYA A;  1OEB A;  2L0A A;  4ZTJ A;  1LPL A;  3VS1 A;  5IHK A;  1NEG A;  1IRE B;  1NEB A;  4L59 A;  3MET A;  1JB0 E;  4J6X A;  3REB B;  1VQ8 Q;  4PLL A;  5CQY A;  2KAF A;  5J3B A;  1Z9Z A;  1Y96 B;  2AZV A;  3EFO B;  4BI3 A;  4F7U F;  3HPW A;  1NLP C;  2EQI A;  1DJ7 B;  3NMZ C;  1TSF A;  1YIJ T;  2QGG A;  4O5V A;  2KNB B;  5DLO A;  2OTL Q;  3CCE A;  2CUD A;  2JVV A;  2VVK A;  2QDY B;  1BK2 A;  2RN8 A;  4IIM A;  4M78 G;  2M9U A;  1MUZ A;  1RAF B;  3JCM d;  4C92 E;  1HXD A;  3BE3 A;  2E5Q A;  1W1F A;  2KRO A;  1MGQ A;  4L5G A;  3JCM b;  2RHY A;  1I07 A;  2GBQ A;  2I2L A;  4FL6 A;  3QG1 A;  2DZC A;  2JM9 A;  2VKN A;  1AHJ B;  5CR2 A;  2EAY A;  4JJB A;  3VRY A;  2AK5 A;  2GF7 A;  1OU9 A;  1WQW A;  2DD5 A;  3V7S A;  1KD1 U;  1S72 Q;  1VQL T;  4HVU A;  4R56 A;  4XU3 A;  9ATC B;  2RJE A;  5CK9 A;  1VQP A;  2F5K A;  5I21 A;  5HY6 A;  1WX6 A;  2DVE A;  2P4T A;  3CCE T;  1SRM A;  5LJ5 d;  3CCL Q;  1Q82 U;  3OYH A;  1TG0 A;  3CCR A;  1D09 B;  4C5I A;  4E7J A;  2J7I A;  1Q81 U;  3QWY A;  4HCZ A;  2RQT A;  3GOX A;  4FU6 A;  1V1C A;  1WHJ A;  1R8O B;  2H3J A;  1BI3 A;  3CXC S;  2VAS A;  2J05 A;  5L23 A;  3A8H B;  4F7U A;  5DLQ E;  3TSZ A;  4MZM A;  4J9F A;  3CCU Q;  3NTI A;  4NOY A;  1SKU B;  2XI9 A;  2EQK A;  3G71 Q;  1KC8 C;  2LT4 A;  4JZ3 A;  3RBB B;  1KQS A;  1RAB B;  3CC2 A;  1PRM C;  5GAM f;  2P0Q A;  1WI7 A;  1VIF A;  5GAN 7;  2FEI A;  4ELZ C;  4KUD K;  2EIF A;  2WSF E;  3I55 A;  2GTO A;  4JUV A;  1W2B S;  4MDX A;  3VRZ A;  1WLP B;  2X4W A;  4CC3 A;  3HFN A;  3UAT A;  2PUO B;  1RL2 A;  2K5F A;  1X2K A;  3I56 A;  4KUI A;  1I1J A;  1JU5 C;  2M1H A;  1UG1 A;  2DJQ A;  3A8M B;  3CCR T;  2XHC A;  3Q1J A;  2HBW A;  4PJL A;  4FYX B;  4C0F A;  1VQ6 T;  1ZA1 B;  4D8D A;  3E1S A;  1LOJ A;  2QG9 B;  2YUP A;  2MWO A;  2DEU A;  2J6O A;  1NJI U;  1OYX A;  4LD9 K;  1TWB A;  4X9C A;  1YIT T;  3M4G A;  3CC4 Q;  4ZN3 A;  4PJO B;  1QP3 A;  1FMK A;  3CPW P;  1M90 R;  1QVG A;  2E64 A;  4J9E A;  4OMM A;  1QCO A;  4XTY A;  3LW5 E;  3CMA Q;  1WHL A;  1VQN Q;  1K4U S;  3OS0 A;  2KK4 A;  4C0D C;  2ROL A;  2OTJ A;  1YHQ T;  1U1T A;  4J6Y A;  1Q7Y U;  2QQ9 A;  2O2O A;  3JCM e;  2O01 E;  3GLX A;  1AWX A;  4DQ2 A;  3KBG A;  4F16 A;  5I11 A;  1VYV A;  4M7D B;  4KT0 E;  1LNX A;  3I56 T;  2ABL A;  2DL7 A;  4AFU C;  2F69 A;  1BIA A;  2DYI A;  2DJZ A;  1OV3 A;  2CSI A;  3EG9 A;  1QVF P;  3M58 A;  1NE8 A;  4JJD A;  2D0N A;  4MZP A;  4R0K A;  1YJN A;  5J26 A;  2GFA A;  2KYB A;  3M5A A;  1WXU A;  3S6W A;  4ZN1 A;  4QVZ A;  3CCQ Q;  2DL8 A;  1B34 B;  4B9X A;  2BZY A;  5LJ5 e;  2JT4 A;  2K5I A;  2MIO A;  5HK0 A;  2RHZ A;  2DK3 A;  4E7S A;  1YP5 A;  3JV3 A;  2NUT B;  1GFD A;  5GAO n;  1PHT A;  2YT6 A;  4P5N A;  2DIL A;  3V7C A;  4X9D A;  2HQX A;  3HL8 A;  5LJ3 h;  1M8V A;  1N8R R;  3V8K A;  4M7A C;  1Q86 C;  1OX9 A;  2LCS A;  2RH2 A;  2YRC A;  4LDU A;  2KBT A;  4M78 A;  1JQQ A;  3JB9 I;  1ZQ1 A;  1R0C B;  2DXC A;  2YUO A;  1VQ5 A;  3MEV A;  5GAO l;  4ATO A;  3L2Z A;  1VQ4 Q;  5GJV B;  3MO8 A;  4C5H A;  2KE9 A;  2PUK B;  2FRY A;  2VGN A;  3ER0 A;  3VU3 C;  4PK4 A;  2L3R A;  2VXE A;  3CCL T;  4JDS A;  1NLO C;  4AMC A;  4KGX B;  1YJN T;  2CP6 A;  1M1K U;  1JJ2 S;  2X4J A;  3QHS A;  2JOY A;  2XID A;  3OYD A;  3HHT B;  5GMK l;  1YWP A;  4M7A F;  1Y71 A;  1YNZ A;  2YRD A;  1QMC A;  3P8H A;  3CCU T;  4YTL A;  4C8Q G;  2ED1 A;  2QEX A;  4KH0 B;  3VS6 A;  2X3W D;  5FRM A;  1WHM A;  2JUF A;  2DIG A;  2XDP A;  3G6E A;  2K3Y A;  2PZ1 A;  4LNP A;  2X51 A;  5C6S A;  4C92 C;  3S3M A;  1VQ9 Q;  5KYX A;  3HSB A;  2P4R A;  2CT4 A;  1K8A R;  1EX4 A;  1KSW A;  2LJ1 A;  3RKX A;  1V76 A;  4DOW A;  2A08 A;  2M51 A;  2JN0 A;  4BY6 B;  2PQW A;  4F14 A;  1XTD A;  5GAN j;  1HK9 A;  2LRQ A;  3HKS A;  2K57 A;  1WNL A;  4QQD A;  2KEA A;  1I0C A;  3KUF A;  3CBM A;  6AT1 B;  2BIV A;  1BI0 A;  3JCM W;  1GL5 A;  4BDY A;  4HT9 A;  2YLC A;  5D6Y A;  2QA4 A;  3V7R A;  1MMN A;  2PU9 B;  1D3B A;  1FYN A;  1MND A;  1WJQ A;  2P84 A;  2JMA A;  1AZG B;  1IB8 A;  2L3P A;  4BI4 A;  4C92 F;  2XD0 A;  1NM7 A;  2MOX A;  2DTI A;  2LC4 A;  2MAM A;  3M9Q A;  2D0Q B;  1WXT A;  2RPN A;  3OSV A;  3QSU A;  2DVJ A;  2KVQ G;  2KT8 A;  3CC4 T;  1KQS P;  1UHF A;  1K0X A;  4OGC A;  1ZUU A;  3QWX X;  3OS5 A;  3MJX A;  4Z88 A;  1G3T A;  2M16 A;  4F7U B;  1VQN T;  3HRU A;  1TOV A;  2QXF A;  3R6N A;  1M1K C;  1YIJ Q;  1PCX A;  1VA7 A;  2V8I A;  1VIE A;  1N9R A;  1G83 A;  4M4Z A;  5GAN f;  3MHX A;  4HT8 A;  1B07 A;  3QBY A;  3D7S B;  3C12 A;  3T9N A;  3L2R A;  1ZUK A;  1X6O A;  1SHF A;  2RI5 A;  2BE7 D;  2DA9 A;  2D8J A;  4JRP A;  5GAM g;  2ZZD A;  5GAN 2;  2LDM A;  4CI0 C;  1O75 A;  1M5Q 1;  3FJP A;  4BD3 A;  3OS1 A;  1JXO A;  1TH7 A;  1AEY A;  3TQ7 P;  1QVG P;  1K9A A;  2LTO A;  3BDU A;  4NS5 A;  1QCF A;  4GBQ A;  2D6F A;  3VKI A;  2C0T A;  2QDL A;  2YUN A;  3SFM A;  4XTW A;  2LNV A;  3DB4 A;  4DA4 A;  2C0I A;  2CSQ A;  4C92 A;  3OYI A;  2RI3 A;  4MZT A;  3CCE Q;  2EVR A; 
#chains in the Genus database with same CATH homology
 1G3S A;  3OW2 A;  3LWH A;  3CME A;  4M75 C;  4M78 G;  2AHJ B;  2M9U A;  4M7A D;  2B8A A;  3JCM V;  3JCM d;  1KD1 C;  4C92 E;  4RKU E;  4M78 F;  1HXD A;  2XKO C;  5CVI A;  3X25 B;  3N5B B;  1VQ5 T;  4WF2 A;  4X34 A;  2E5Q A;  5C0M A;  5GAO p;  1VQ4 T;  5CQX A;  1MGQ A;  3CMA A;  1JJ2 A;  4M77 A;  3JB9 F;  4L5G A;  1Q82 C;  2L89 A;  3OYN A;  3JCM b;  4E7H A;  2HNI A;  4RG8 A;  2GQV A;  2RHY A;  2LCL A;  4XAX B;  4A53 A;  4JRQ A;  2HAX A;  4E7I A;  2I2L A;  4FL6 A;  2VC8 A;  3J7A F;  3QG1 A;  3RUX A;  5FU7 C;  3OY9 A;  2BKD N;  1G3Y A;  3ZBD A;  1UEB A;  3M54 A;  4M75 G;  1Q81 C;  3OYB A;  2R57 A;  2DZC A;  2DD4 A;  4M77 E;  2DKG A;  1AHJ B;  3CBP A;  4RCB A;  3PMI A;  5CR2 A;  3J81 E;  2EAY A;  5GMK i;  2LVM A;  3LGF A;  3GIB A;  3OS2 A;  2O4X A;  4OVA A;  4M75 F;  2V8J A;  1VQ8 T;  5GAN 6;  3QJ6 A;  2GF7 A;  3SB2 A;  4JLG A;  4ZGJ B;  3QKJ A;  3SWN A;  5J39 A;  1WQW A;  2DD5 A;  3V7S A;  5GAM e;  4N4H A;  1KD1 U;  2V8K A;  3CCV T;  3QJY A;  3JB9 D;  1VQL T;  1MHN A;  3OYM A;  2E65 A;  2QEX T;  5LJ3 d;  2RJD A;  2DTH A;  4R56 A;  4XU3 A;  2JTF A;  1NPP A;  2RJE A;  5CK9 A;  1VQP A;  2F5K A;  5I21 A;  4OP0 A;  1PSE A;  5HY6 A;  2DVE A;  2OTL T;  2P4T A;  3G6E T;  1XNI A;  4N0A A;  3GNF B;  3CCE T;  3CCL A;  5I2S A;  5LJ5 d;  1Q82 U;  5DY9 A;  3VYH B;  4XU0 A;  4PL6 A;  3RMS A;  3OYH A;  2QQR A;  3O8V A;  5LL6 S;  3CCJ A;  4J6W A;  5LJ5 j;  3CCR A;  4VUB A;  4C5I A;  3SD4 A;  5M9O A;  3CME T;  4N4G A;  2DAQ A;  2F5T X;  2M0O A;  1YCY A;  1FXX A;  1ZBX A;  3P8D A;  4M75 D;  5GAN 5;  2HBP A;  4E7J A;  1Q81 U;  4QVC A;  4HCZ A;  4OB2 B;  4PJO G;  4M7A A;  4FSX A;  2RJC A;  3GOX A;  5GAM h;  3CD6 A;  5GMK h;  4FU6 A;  1OI1 A;  2E1H A;  3QXE B;  1R8O B;  3JCM P;  2EJ9 A;  3RKY A;  2H3J A;  3TU4 K;  1BI3 A;  2E12 A;  5CKF A;  3CXC S;  5GAN 8;  3A8H B;  1WJS A;  4F7U A;  5DLQ E;  3CCU A;  3OMC A;  4MZM A;  3RKW A;  4C0G A;  2NLU A;  3NTI A;  1M1F A;  2DXU A;  2KQW A;  4M78 B;  4NOY A;  2XI9 A;  3JCM g;  3TRE A;  3G71 A;  2EQK A;  2CKK A;  1N6A A;  2LT4 A;  2ZCF B;  3VYG A;  4ZTF A;  1KC8 C;  4OF1 A;  2FYK A;  1KQS A;  2EQJ A;  4FIB A;  2EJF A;  3CC2 A;  2CZ6 B;  5GAM f;  3CC2 T;  1GXI E;  3NFC A;  3MEU A;  4DOV A;  2LCC A;  3RIR A;  3M59 A;  2P0Q A;  3EAE A;  3L2Q A;  3GPL A;  1VIF A;  3LGL A;  2QA4 T;  2CYZ B;  4HA8 A;  5GAN 7;  4A4E A;  5KCH A;  4XU2 A;  5FRN A;  5CAI A;  4M7D G;  2KMT A;  1H64 1;  4BI8 B;  4ELZ C;  2MF2 A;  4EMH A;  4KUD K;  3A8O B;  1NJI C;  3FEO A;  2EIF A;  2G3R A;  2WSF E;  3I55 A;  5HKC A;  2JNG A;  3EFR A;  3DKM A;  2XK0 A;  4JUV A;  2ZPI B;  1W2B S;  3VUZ A;  4BAC A;  1U8R A;  4MDX A;  1NZ9 A;  3OBW A;  4ZGE B;  1S72 T;  2X4W A;  3FC3 A;  2K3X A;  1VQ7 A;  3HFN A;  3CCM A;  2PUO B;  3CC7 A;  4Y28 E;  1RL2 A;  2K5F A;  4EMK A;  1H3Z A;  4B9W A;  3I56 A;  4XK8 E;  4KUI A;  2M1H A;  3PMT A;  4M78 E;  3SDZ A;  1WJR A;  1KC8 U;  4IUR A;  5LJ3 g;  1Q7Y C;  3A8M B;  2C06 A;  3CCR T;  2E41 A;  2XHC A;  3MEW A;  2R58 A;  4V2S A;  1QP2 A;  4BE2 A;  3BFM A;  1YBY A;  3Q1J A;  4RCC A;  2D9T A;  3HP9 A;  2RM4 A;  3BW1 A;  4C0D B;  3GNG A;  4C0F A;  3PIO A;  1VQ6 T;  2DXT A;  4M75 A;  5GMK m;  5LJ5 g;  4A4F A;  2HD0 A;  3E1S A;  3M53 A;  1LOJ A;  3BDL A;  1VQO T;  2RO0 A;  5CKE A;  5D6X A;  2MWO A;  1JRI A;  5FU7 B;  5A0G A;  4EPC A;  1P92 A;  3CPW S;  1NJI U;  1KHC A;  3UPU A;  1OYX A;  1Y96 A;  1VQK A;  1RI0 A;  2IVW A;  4LD9 K;  5GAN 3;  4X9C A;  3OYL A;  2VGM A;  1YIT T;  3M4G A;  4XU1 A;  4A4H A;  3JB9 J;  2R5M A;  3G71 T;  1I4K 1;  3UDC A;  3CC4 A;  3JCM X;  4M75 E;  3QPH A;  4ZN3 A;  4IUT A;  4PJO B;  1QP3 A;  1XQH A;  1YJ9 A;  1QVG A;  5A0L A;  2E64 A;  2E6N A;  4OB0 B;  3X24 B;  4XTY A;  2PVG B;  3CBO A;  3LW5 E;  5IN1 A;  1VQN A;  1W2B A;  3LLR A;  2WSE E;  1M90 C;  3OS0 A;  5CKB A;  2KK4 A;  4LDW A;  3ZFJ A;  4C0D C;  2ZGW A;  1VQ9 A;  2XU8 A;  2OTJ A;  1Y7X A;  1YHQ T;  1U1T A;  4J6Y A;  5IAY A;  1Q7Y U;  2QQ9 A;  3JCM e;  2O01 E;  1OZ2 A;  3G7Z A;  2QQA A;  3GLX A;  3OBY A;  3TCJ A;  2X4X A;  4DQ2 A;  3KBG A;  5DM7 R;  3QYH B;  1OZ3 A;  3WXM B;  1BI1 A;  2FHD A;  3PGG A;  2YRV A;  5GAN d;  1M9S A;  1W4S A;  1QVF S;  4M7D B;  4KT0 E;  3OB9 A;  4M78 D;  2EQU A;  3QO3 A;  4LDV A;  5D6W A;  4A4K A;  1LNX A;  2HQE A;  3E9F A;  4GY5 A;  3I56 T;  3QYG B;  4PJO C;  3H6Z A;  3CCS A;  4J5Y A;  2EWN A;  3OYG A;  3UWN A;  3H8Z A;  3CEY A;  2F69 A;  1BIA A;  4A4G A;  3DLL A;  2DJZ A;  4J8O A;  1G5V A;  4HKE A;  3GF5 A;  4M7D C;  1G3W A;  4RG2 A;  1WQ7 A;  2XG8 D;  3M58 A;  5LJ3 j;  3JCM h;  1NE8 A;  3DB3 A;  2ZPH B;  5FRO A;  3V8J A;  5A2Q E;  2KY9 A;  1KG1 A;  1X01 A;  2QQS A;  3LH0 A;  2GFU A;  2P0K A;  3G4S A;  3JRZ A;  4MZP A;  1M90 U;  1YJN A;  1WGS A;  3S3N A;  3A8G B;  5J26 A;  1Y07 A;  2GFA A;  5LJ3 e;  3OYC A;  3M5A A;  2LQ8 A;  3S6W A;  4ZN1 A;  4QVZ A;  3L42 A;  2EFI A;  4BY6 C;  1B34 B;  2EYQ A;  4PKC C;  1K8A U;  3JCM f;  3JCM c;  3AHU A;  3L2U A;  4B9X A;  3SWN C;  1U1S A;  2BUD A;  3WVD B;  5CKD A;  4BE0 A;  4M7D E;  3CPF A;  5LJ5 e;  2IG0 A;  1QW1 A;  4M77 G;  4PJO F;  4NL3 A;  2DZ9 A;  4HCC A;  2K5I A;  5HK0 A;  4E7L A;  3CMA T;  2RHZ A;  2A3L A;  3P8B B;  2DK3 A;  3FLG A;  3JSC A;  3EFS A;  2CZ0 B;  3M57 A;  3HRT A;  5GAO n;  3LX7 A;  1QVF A;  4P5N A;  4EMG A;  1X75 C;  3V7C A;  4X9D A;  3UT1 A;  2ZPB B;  2HQX A;  2MMP A;  4J83 A;  4N4I A;  3R6O A;  3HL8 A;  4XTX A;  5LJ3 h;  2LQK A;  1M8V A;  3V8K A;  4LDX A;  2X4Y A;  5HK3 A;  2XIC A;  2Y90 A;  1Q86 C;  1BI2 A;  3JAM E;  4M7A C;  2RH2 A;  4LDU A;  1N8R C;  2XDB A;  1VUB A;  4M7D F;  4M78 A;  5LJ5 h;  3JB9 I;  1FWZ A;  1ZQ1 A;  4PJO D;  2GCX A;  2K4Y A;  2DXC A;  5IT9 E;  1V29 B;  3QZ5 B;  4ZGD B;  4JJN K;  2E6Z A;  4BE1 A;  1VQ5 A;  3MEV A;  5GAO m;  3QDR B;  5GAN g;  1N27 A;  1NPR A;  3M55 A;  5LJ3 f;  5GAO l;  3OW2 S;  2RHX A;  3JCM Q;  5GAO r;  1VQ4 A;  1VQP T;  3L2Z A;  2KSS A;  3OMG A;  3WVE B;  4ATO A;  3MO8 A;  4LDY A;  4C5H A;  4C8Q C;  5KH6 A;  1UB4 A;  3DLM A;  2DXB A;  2PUK B;  2VXF A;  2VGN A;  3ER0 A;  3VU3 C;  2L3R A;  2VXE A;  3G4S T;  3CCL T;  3ZEH A;  2FVU A;  4C5G A;  5LJ5 f;  4JDS A;  3QUI A;  4JLI A;  2XDD A;  4FT2 A;  3CCJ T;  1YJN T;  1M1K U;  1JJ2 S;  2X4J A;  3QHS A;  5L8R E;  2JOY A;  4M7A G;  3CXC A;  2K2V A;  2XID A;  3CCQ T;  1K73 U;  3JB9 H;  4IUP A;  3ASK A;  2JZ2 A;  2DPP B;  4C92 B;  3HHT B;  3PT9 A;  5FLX E;  3OYD A;  4J7F A;  4M7D D;  2LX9 A;  3OYK A;  4R55 A;  4MMK A;  5GMK l;  3MP1 A;  4KUL A;  1YI2 T;  5EG2 A;  3CD6 T;  2ZPF B;  1Y71 A;  5CO7 A;  4M7A F;  1Q86 U;  4F7U G;  1N8R U;  3P8H A;  3L1A A;  3V8L A;  1UGS B;  2L5Q A;  2Y4Y A;  4YTL A;  3CCU T;  1YJW A;  3CCV A;  4C8Q G;  4IUU A;  3FDR A;  3PTA A;  4JS4 A;  1VQL A;  4KBM B;  2QEX A;  3JCM J;  3OYF A;  3VV0 A;  4ELY C;  5FRM A;  2QQB A;  2YHT A;  1VQM A;  2RD1 A;  2JUF A;  4C8Q F;  3VJP A;  1I8F A;  3C95 A;  2OTL A;  2DIG A;  2XDP A;  3RES A;  2K3Y A;  3G6E A;  1KHI A;  3PFS A;  3L2W A;  2FL7 A;  4M77 B;  1IZ6 A;  4NL2 A;  4C92 C;  5C6S A;  3PIP A;  4J7I A;  5A0D A;  3FB9 A;  3S3M A;  1LJO A;  3HSB A;  1I81 A;  2RI2 A;  4MML A;  2OAU A;  3I55 T;  4O6J A;  3X26 B;  4EDU A;  3RKX A;  2QI2 A;  3NTH A;  4DOW A;  4IUQ A;  1K8A C;  1D3B B;  3JB9 G;  2L8D A;  3MEA A;  4PJO A;  2JN0 A;  2RA2 A;  2MWP A;  1VQ7 T;  3CCM T;  1KQ2 A;  4OGE A;  3CC7 T;  3OYE A;  1BIB A;  4BY6 B;  3E9G A;  2O4X B;  2PQW A;  2ZPE B;  1XTD A;  5GAN j;  1YI2 A;  1HK9 A;  2LRQ A;  3HKS A;  4C8Q D;  2K57 A;  3NTK A;  4QQ6 A;  1WNL A;  4QQD A;  3SWN B;  4Z02 A;  5KE3 A;  3KUF A;  1JBM A;  3CBM A;  2BIV A;  5GAM d;  1BI0 A;  4M77 C;  4PJO E;  3JCM W;  3CPW A;  4C92 G;  1UGQ B;  4BDY A;  4HT9 A;  2YLC A;  2VUB A;  5D6Y A;  3V7R A;  5GAM j;  3GP8 A;  2PU9 B;  2QA4 A;  1D3B A;  5GAN e;  5GMK j;  4HCB A;  5AYF A;  4PNO A;  1WJQ A;  1I5L A;  1KQS S;  4C92 F;  5FU6 B;  4OB1 B;  4BI4 A;  2XD0 A;  4M7D A;  1M4Z A;  3LWI A;  2DTI A;  2LC4 A;  2MAM A;  2QTX A;  3M9Q A;  2D0Q B;  3URG A;  3X20 B;  4JRK A;  3QZ9 B;  1ZHI A;  3F70 A;  4JS5 A;  3CCQ A;  1VQK T;  2RHI A;  3E19 A;  4II1 A;  3OSV A;  3QSU A;  1YJW T;  5GMK e;  2EJG A;  2X35 A;  3OQ5 A;  3X28 B;  1S72 A;  2E70 A;  2KVQ G;  4M7A B;  3RER A;  1K9M C;  5GAO q;  3CC4 T;  2RK2 A;  2RHU A;  3FIF A;  1O9S A;  4OGC A;  3BY7 A;  1VQM T;  3OS5 A;  4C5E A;  1YJ9 T;  4QVD A;  3C94 A;  2RB6 A;  2E10 A;  3A8L B;  5CKH A;  4D6W A;  1G3T A;  2M16 A;  2WSC E;  4F7U B;  3RMQ A;  1VQN T;  2DIQ A;  5GAN h;  2VYT A;  2CZ7 B;  2R5A A;  3HRU A;  2QXF A;  4M77 F;  1VQ9 T;  3OSS C;  2OTJ T;  4C8Q B;  5KCO A;  4ME7 A;  4XTU A;  4C0Z A;  2YLB A;  4N0A C;  4L6V 5;  4C92 D;  1YIJ A;  5FU6 C;  1M1K C;  3S3O A;  1VQ6 A;  1B34 A;  1M1G A;  2CS7 A;  2DO3 A;  3MCA B;  2V8I A;  3OA6 A;  1K73 C;  4LD6 A;  4QW2 A;  4GLK A;  1VIE A;  1N9R A;  3ME9 A;  1VQO A;  1UGR B;  4FT4 A;  3TEE A;  2VV5 A;  4Y91 A;  3J80 E;  2FB7 A;  4A54 A;  5GAN f;  1WPY A;  2LT1 A;  3MHX A;  4Q5W A;  2JTM A;  1SSF A;  4HT8 A;  4E7K A;  1YIT A;  4BDZ A;  3QBY A;  1KQ1 A;  3CCS T;  3OYY A;  2PVD B;  2RJF A;  2P0P A;  2KDS A;  3C4S A;  4C8Q A;  3C12 A;  4M7A E;  1UGP B;  4CRI A;  5KE2 A;  3T9N A;  3L2V A;  1K9M U;  3L2R A;  4IKF A;  4E47 A;  1X6O A;  3A5Z B;  2A7Y A;  4M77 D;  2DTO A;  4IUV A;  3M4Y A;  2RI5 A;  4EMK B;  4QQG A;  3HFO A;  4TVR A;  1XOV A;  3QII A;  4BB7 A;  4F7U E;  4PLI A;  2RK1 A;  5CIU A;  1YHQ A;  4JRP A;  1BYM A;  3MP6 A;  2MI6 A;  5GAM g;  4C8Q E;  2ZZD A;  3M56 A;  5GAN 2;  4RMO A;  3OYA A;  4BUG A;  4ZTJ A;  1QVG S;  2LDM A;  4XQ3 A;  4CI0 C;  1PSF A;  1EIF A;  1M5Q 1;  1O75 A;  3FJP A;  4FM4 B;  4XTV A;  4BD3 A;  3OYJ A;  1IRE B;  3OS1 A;  1QVP A;  4L59 A;  4M75 B;  3MET A;  3FRN A;  1N9S A;  4M78 C;  2PVO B;  1JB0 E;  1TH7 A;  4J6X A;  4MDW A;  5GAN 4;  3VUB A;  1VQ8 A;  2CGH A;  2LTO A;  3BDU A;  3MP8 A;  2KAF A;  4PLL A;  5CQY A;  5J3B A;  4NS5 A;  5CCA A;  3KXT A;  1Y96 B;  2D6F A;  4BI3 A;  2CZ1 B;  4EMK C;  3VKI A;  2Y4X A;  4F7U F;  3HPW A;  2K5L A;  1DJ7 B;  2EKO A;  4XTW A;  2LNV A;  3DB4 A;  1FX7 A;  4OMF B;  3SFM A;  4DA4 A;  1BKB A;  1YIJ T;  3HRS A;  4C92 A;  3OYI A;  2RI3 A;  2ZPG B;  2EQM A;  2WAC A;  4MZT A;  4O5V A;  4XTZ A;  5DLO A;  2DEQ A;  5I2M A;  3CCE A;  3INZ A;  3PNW C;  2JVV A;  4JRI A;  4OB3 B;  4UC4 A;  2QDY B;  3LYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...