4PKCC

Benzylsuccinate alpha-gamma complex
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
41
structure length
41
Chain Sequence
CANFFPVPKDADDYEAGKADCVREKEDEKGKYWLSKPIFEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TutD
publication title Structures of benzylsuccinate synthase elucidate roles of accessory subunits in glycyl radical enzyme activation and activity.
pubmed doi rcsb
source organism Thauera aromatica
molecule tags Lyase
total genus 3
structure length 41
sequence length 41
ec nomenclature ec 4.1.99.11: Benzylsuccinate synthase.
pdb deposition date 2014-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08201 BssC_TutF BssC/TutF protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1070 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4pkcC00
4PKCC
chains in the Genus database with same CATH superfamily
1SPKA 2DXBA 1OPLA 1B34B 1TS9A 2OAUA 4M77A 3X20B 5GAMg 3NTKA 3M0UA 1KSWA 3VYGA 3A8LB 3PMIA 2F5TX 4HT8A 1BK2A 3CBPA 1MMDA 2EYQA 1VQ4T 4M7AA 2YWWA 1PKTA 4ZTJA 3EFOA 1RLQC 1NEGA 2E64A 2DL8A 1O75A 5GAN4 4J6XA 1LPLA 1N6AA 5GAOn 1B34A 1G3WA 1AHJB 4B9WA 2EW3A 4ZN3A 2MF2A 5AT1B 5KYXB 2YUPA 1F1BB 2CKKA 3GP8A 4CRIA 3JCMc 4IUUA 1UGVA 2O4XB 4JZ4A 2QI2A 4J5YA 4J7IA 4OMPA 3CBOA 3RBBB 2DL3A 4EMKA 1RL2A 5HK3A 3CC2T 4FW1A 2JS2A 1JJ2S 2PUOB 5CCAA 1QVFA 2BZ8A 1UB4A 2QK0A 2KYMA 4FYWB 4JJDA 3UDCA 4LDXA 1YJ9T 2JTMA 3U23A 2ZZDA 4Z88A 2O4XA 2KQWA 4KULA 1YIJT 5GANj 3BE3A 4ZGDB 2ZPBB 5GAN5 1C1AA 3JAME 5HCKA 1WPYA 1X6GA 3WVEB 3P8BB 4BACA 2A28A 1UUEA 3RR6A 1G3YA 1N9RA 1GBQA 2FPEA 3H41A 1M3AA 2PVGB 5EC7A 2IPOB 3PGGA 3C12A 3M55A 3CC7A 5HY6A 1SHFA 5J26A 4XTYA 2EKOA 5A0GA 2C06A 1C0MA 1IRXA 1UHCA 1TWBA 4LN2A 2OX7A 3QJYA 3EGUA 4JUVA 1BB9A 4HKEA 4HVVA 1JQQA 2L0AA 1FMKA 2DLPA 3CC7Q 5GAMe 1RAIB 1ZA1B 3OMCA 1MV3A 2VB6A 1ZBJA 2BZYA 2L89A 2NYSA 4DBRA 4RCCA 1ZSZB 4QQDA 2COZA 1NZ9A 3G71A 2BUDA 2X4JA 1TTHB 2P0QA 1D1BA 2KI7A 4IIOA 3META 3QWYA 2DZ9A 2J6OA 4PKCC 1BI2A 4PJJA 2CH4A 3MCAB 2KRNA 2YDLA 5KCHA 4PJMA 3SWNB 3M0QA 1P92A 5KYYA 2ROLA 4KT0E 5KE2A 3G71Q 3HKSA 4M78C 2LVMA 5GANf 2K5IA 5GMKi 1QW1A 2DILA 3V7CA 1XOVA 5FRMA 2F2XA 4OMNA 4C92G 5DLQE 1ZSZA 1Q82U 3DLMA 4DEYA 2NUTB 4Y92A 2FO0A 3JCMf 4IUPA 1MMNA 5FRNA 2P0PA 2PZ1A 3QYHB 5CKEA 5DLOA 1RAHB 2G6FX 1TUDA 2H3EB 5LJ5g 1I5LA 4FYXB 3HRUA 4OVAA 3SWNA 1M3BA 2EYXA 1GCPA 1WXUA 3CCSA 3BDLA 3VV0A 1KQ2A 2LQ8A 4QVZA 3RIRA 1Q82C 3A5ZB 2FPFA 2X3WD 4RUGA 1K73C 2NUTA 5DM7R 2D1XA 2PVOB 2QG9B 4EIKA 4OB0B 4E7KA 2DIGA 5KYUB 4PJOE 2W10A 3UF4A 3PTAA 4C92F 4KUIA 1QP3A 3MEAA 2SRCA 3KBGA 3CPFA 1FMVA 3CD6A 3S6WA 3GOXA 1V29B 2ECZA 3ZBDA 2K2VA 3NHNA 4M77D 2EJFA 3OYDA 4FM4B 4IKFA 1LNXA 2Y4XA 3EH2A 2AT1B 3OYFA 1IXDA 3CPWS 4LDYA 3CD6Q 1YITQ 3CC7T 4M7AD 5KYUA 2JM9A 3CCJA 4F04B 2XU8A 4II1A 4XTXA 4EDUA 2KR3A 3PIOA 2DL4A 1K9AA 4PJOA 2EIFA 1PSFA 1YJNT 1UG1A 1Q95G 3OYJA 5GAMd 2EAYA 5LJ3f 2XHCA 1PM3A 4JRQA 3CCJQ 2EBPA 1K73R 1GCQA 2OI3A 2X4YA 2F2VA 4HCZA 5DY9A 2DA9A 2DTIA 1FX7A 2MWOA 2WSCE 1SSFA 2DTOA 4QVCA 2RMOA 2OTLA 1K0XA 4GY5A 2HSEB 3QDFA 5IAYA 3LW5E 2JXBA 5GAOr 3L2UA 2B8AA 1WJQA 4M78G 1D0YA 1OQKA 3X24B 2JUFA 4OF1A 4LDVA 1CKBA 2RPNA 2DM1A 4MMLA 4C5EA 2OTLQ 2A3LA 4C0ZA 4E7SA 1AWXA 4NS5A 4AMCA 5LJ5e 3CCEA 2RQWA 5GAN6 4NOYA 2DVEA 3LWIA 1WQ7A 4BY6B 2P4TA 1M8MA 3WVDB 3OYHA 3GPLA 4LUEA 3NFCA 3GIBA 1PC0A 2Y4YA 4FL6A 3EHRA 4ZGEB 3CCST 3BW1A 3X25B 4ELYC 1YWPA 3OS1A 1VQ6A 1UECA 3I55A 3EHQA 5CK9A 1S1NA 3JB9J 4Z02A 3CCLQ 2M51A 2RI3A 4C0FA 4M75G 3JCMh 5FU7B 4N0AC 2V1QA 5M9OA 2BE7D 1GFDA 2ZGWA 4HCKA 2RJFA 2CUDA 4V2SA 3I55Q 1X6BA 2E41A 1BYMA 3THKA 1GFCA 1TUCA 4LDUA 1QVGP 5I11A 1UJ0A 3ZFJA 3CD6T 4C0GA 2O2OA 4Y91A 4DOVA 2K3YA 1MMGA 4BY6C 2KK4A 4ME7A 4MZMA 1UHFA 2FZCB 3VUZA 1WNLA 3A8OB 5CR2A 3CCJT 1MHNA 1NYFA 2QYZA 4J6YA 3CCUA 3TVTA 2AIRB 1FYNA 2XD0A 4M75F 2MPXC 2YT6A 2HNIA 1KD1U 1VQPQ 5D6WA 2V26A 2EJ9A 3EGDA 4QW2A 5FU7C 1B3QA 2P0KA 1VQLA 4E7IA 1G83A 1KHCA 4PFOA 3ZEHA 2LDMA 3OYGA 1K76A 2L3QA 2QDLA 1ZBXA 2CH4W 3E9GA 2OTLT 4N4GA 2E1HA 1S72A 1SSHA 3S3OA 1KD1C 3UA6A 1VQLQ 4XK8E 1W4SA 3GLXA 1IHWA 5GMKl 2OTJA 5LJ3h 1O9SA 3T9NA 1S72Q 1YFNA 1D3BB 2RJDA 3CCET 1WIEA 1K1ZA 4L5GA 2EWNA 2O88A 2RHXA 4IUQA 1OZ2A 3RUXA 1VQ5A 1QVGA 3JV3A 2YHTA 2XICA 2OTJQ 5CAIA 1AWJA 3CMEA 4FT4A 3DB4A 3JB9H 3HHTB 1KG1A 5A0LA 1YI2A 2EQKA 1PCXA 3JCMV 2YUOA 4KGVB 4C5HA 1KQ1A 3FEOA 4O6JA 2X4XA 1EX4A 3QYGB 1VQ6T 3M0TA 4FSXA 2A0FB 3I55T 2J06A 4F17A 2KMTA 4KRTA 3OSVA 1HYOA 1QCNA 2NUZA 4OB1B 4DBQA 1YI2Q 4RG8A 3FC3A 2ZCFB 2A36A 3QWXX 4PJOD 3UATA 1WJRA 2K57A 2LC4A 2E6NA 3PNWC 2AZVA 4JLIA 1ZX6A 1UGQB 2QEXA 1KD1R 3R6OA 4E7LA 4D8DA 1W70A 1OPKA 3Q1JA 3C94A 1G2BA 1FWZA 1HSQA 5GMKe 1KC8U 3H0IA 2DD5A 2F1LA 4A4EA 2G3RA 1Y96B 4MDWA 1WHHA 2KRSA 1WYXA 1Y57A 1BIBA 1G3TA 4M7DG 3QBYA 2KVQG 2MI6A 2FHDA 2RB6A 3CCUT 1WFWA 4C92E 1IO6A 1TH7A 2NWMA 3EFOB 5IH2A 4RTTA 5IHKA 2RK1A 1KC8C 3ZL7C 4MZTA 4PFZA 2H8HA 3CCVT 2DERA 4C92B 1V1CA 2FYKA 2QQAA 1Y96A 4OGCA 1VQLT 1JEGA 2CREA 2HEQA 4RTWA 2DAQA 3OYIA 2CP6A 1PRMC 2GCXA 4DBHA 3GBQA 1S72T 3H9NA 4EMKB 1AWOA 1OYXA 1IGQA 2LX9A 1YCYA 2DE0X 4J9HA 4X9CA 3VJPA 2RM4A 1BI0A 2R5AA 2DYIA 3L2QA 4AT1B 3TREA 4JS5A 1RI0A 2SEMA 2X35A 3SEMA 4C8QG 4C92A 2J7IA 3G7ZA 4M7DF 5L23A 4OMOA 4BI4A 2OTJT 2DEUA 5J39A 3QSUA 1UFFA 1PSEA 4M77C 3FRNA 3I35A 2X9HA 4QKUA 2CT4A 1T0HA 1JU5C 2K3BA 2LQNA 2HQEA 4J9CA 2Y90A 2EQMA 1MMAA 2KT1A 1VQ5T 4RCBA 4M7AC 2L2PA 3CMET 3LX7A 1U8RA 1UGPB 4C0DB 1YI2T 5GAN3 2DXTA 1QVFS 2L8DA 4LNPA 1PRLC 1KC8R 4XU3A 1DJ7B 1A0NB 4BI3A 2MAMA 1PG5B 3V7SA 2RQRA 2V8IA 4QT7A 2VGNA 5GAOq 3HRTA 4C8QF 2M16A 2JZ2A 1WLPB 4EMKC 2O9SA 2JTEA 5IT9E 4J9FA 4FYVB 3HPWA 4OMFB 8ATCB 1NLPC 2J05A 1ZUUA 4OMLA 3DKMA 2QEXT 3JB9D 4DEXA 3M4YA 3O5ZA 3BFMA 1WI7A 2WSEE 4CC4B 1D09B 1ZHIA 3QZ5B 2FL7A 2K4YA 4JPBW 4LD6A 4BE0A 1X27A 2DYBA 3OBYA 1R8OB 3RESA 4C5IA 2DVJA 1ARKA 2B86A 2K3XA 1M5Q1 2DTHA 4DBFA 1GBRA 3QIIA 1BU1A 4WF2A 4XTZA 1YJNA 2ZPGB 5FROA 3M53A 2KGTA 5KYYB 3QUIA 4FW2A 1QCOA 4CC2A 4GBQA 2DKGA 1K9MU 1VQKA 1M30A 1H641 5A0DA 1NE8A 4UC4A 2VWFA 4A4FA 2PQWA 1YJNQ 7AT1B 3MEVA 1M1KU 1B7TA 5CKBA 1HK9A 3LH0A 1AZGB 3H8ZA 1WDXA 1VQKQ 1RUWA 4AFSC 1IB8A 3GNGA 1D1CA 3E19A 3QDRB 1BBZA 3HRSA 1K9MC 4K11A 2AZSA 2E65A 4M75E 4X9DA 3P8DA 2DX1A 5CQYA 2RHIA 2ESWA 1OZ3A 4M77G 4E47A 2AKLA 3HFOA 4PK4A 3CC4A 2FPDA 3OYKA 1NYGA 2H3JA 5GAMh 5LJ3j 1RAFB 3VRZA 3CCRT 4CC7A 4Y28E 5GAN2 1NG2A 4KUDK 3A1PA 2RI5A 5GANg 4KGZB 3CC4Q 2DNUA 2ZAEA 5KYNA 2F69A 2ZPEB 4PLIA 2FRWA 3VS6A 4A54A 2JM8A 4ZN1A 3CMAA 3REBB 4RG2A 1M1GA 1HD3A 4F14A 1ZSZC 4M75A 2HDAA 5FWBA 4F7UG 3L2VA 2VV5A 3CCSQ 3JCMP 4OB2B 4EMGA 2DPPB 3OYAA 3CMAQ 4M77F 4DA4A 3SWNC 1VQ7T 2DIQA 3INZA 3PT9A 1QVPA 4Q5WA 2GNCA 1OULA 3PE0A 5KYWB 5GAN7 2M0YA 4PJOB 1K9MR 4J6WA 3J7AF 1QMCA 3MEUA 4XU1A 2RO0A 1OX9A 3JCMJ 2GFUA 3RKWA 1HJDA 2VVKA 1M27C 3FLGA 2ED1A 1R0CB 1IHVA 2DO3A 1KFZA 2E5QA 4B6MA 1XTDA 1YP5A 2ED0A 3JRZA 1WHGA 2E5KA 4F7UF 1LVKA 4PL6A 1BIAA 1U5SA 4C92D 5KYWA 2QXFA 1KJWA 3RDVA 9ATCB 4HCCA 3FJ5A 3E2UA 3L2ZA 4BUGA 1Q82R 4HVWA 5FWCA 2GQVA 2LCCA 1VQKT 1U06A 2E70A 1M9SA 2C0IA 3JCMb 3MEWA 3HL8A 2R58A 1RABB 1ZSGA 2HQXA 2VKNA 3PFSA 1BCOA 1G3SA 1W2BP 2ZPIB 2X51A 1WXBA 5GMKj 1LCKA 1J3TA 1X2QA 4PJOC 3P8HA 1UEBA 4FIBA 3EFSA 1N9SA 4J9EA 2LJ0A 5GMKm 3G6EA 3VS4A 3RERA 1NPPA 1GCQC 4E7HA 3CC4T 4XU2A 3TQ7P 5GANe 2RQTA 2X3XD 1M3CA 3VS1A 5IHIA 3SFMA 3G6EQ 3SDZA 1Y7XA 3L2RA 2EPDA 1WQWA 2KROA 1WHJA 3CCEQ 2JNGA 3R6NA 1IREB 1WGSA 2X4WA 3KUFA 1KQSP 1Q7YU 4RTUA 3QG1A 2K6DA 3CMAT 4OMMA 1NEBA 1SF9A 2OAWA 2NLUA 4BB7A 4ZTFA 3REAB 3OS5A 2QDYB 4M7DE 4HCBA 3VRYA 4M78F 1Q86U 3X28B 4J83A 4FCYA 2EYZA 4PJLA 3FDRA 2CP7A 2LTOA 1WHKA 2CYZB 4OGEA 1WXTA 3UA7A 3OYYA 1VQ6Q 2EGAA 3A8HB 1YJWA 1Q7YC 1QP2A 1JBMA 4BE1A 3V7RA 2DRMA 3TSZA 2QA4A 4XQ3A 1AWWA 2K5LA 3BY7A 1SKUB 4O5VA 3OYMA 4ZNXA 4CI0C 3CXCP 1Y07A 3LGLA 2DD4A 2QQ9A 1YJWQ 3OYBA 2DBMA 3EGDB 3VS7A 4FT2A 3OW2P 1W2BA 4ZGJB 2QA4Q 2VUBA 4C8QE 4DQ2A 3M0PA 4L59A 4B9XA 4BDZA 3V8LA 2VXFA 2WSFE 4AFZC 2EGCA 3A8MB 2DF6A 1D0XA 2LJ1A 3O8VA 1I07A 3CCVA 2MCNA 4JJNK 2EQJA 2DL5A 4LXCA 2RHUA 1AEYA 4J9DA 2E4HA 3CCUQ 4KGXB 3L42A 5CIUA 1T3LA 1M1FA 4F16A 2E10A 2JS0A 1GL5A 3CCVQ 5J3BA 2COYA 1KQSA 3E1SA 1X43A 3QZ9B 1OOTA 1Q7YR 5KE3A 3EG3A 4C8QA 2HL5C 2DXCA 5CKHA 4DOWA 3C95A 4M75D 3LGFA 3BDUA 2JMCA 2EYYA 3G6ET 2COWA 2FG0A 4OP0A 5LJ5d 2ABLA 2EFIA 2QTXA 2LT1A 2XI9A 4HA8A 2AKKA 2D8JA 5GANd 4BE2A 4A4GA 3VS3A 4R56A 3H0HA 4EPCA 4D6WA 2QQBA 1M2OA 2A08A 1QCFA 4ELZC 2EQUA 2QQSA 2XK0A 3V8KA 5GAMj 2E3IA 3MKDA 1X6OA 2F5KA 3OYCA 4E6RA 1QVGS 2RNAA 2CZ1B 1JRIA 3TCJA 3CXCA 2E6ZA 2HSPA 4PJNA 1UDLA 1VQ5Q 4C5GA 1IGUA 2DK3A 3JSCA 3OW2A 5FW9A 1MNDA 3CMEQ 2DETA 1VQNA 3A8GB 3M0RA 1R0BG 2NUPB 1N27A 2DRKA 2P4RA 1KIKA 2L5QA 4AFUC 5D6XA 1NM7A 2M0OA 5GAOl 6AT1B 2LX7A 1K8AU 3I9QA 1CKAA 1HXDA 1VYVA 3QXEB 1YJWT 1M2VB 1VQNQ 3S3MA 4AFQC 3I56T 1RLPC 1I0CA 3OMGA 2QA4T 1VQOA 2JN0A 2J6KA 3TSWA 2DL7A 2ZPHB 4J7FA 2PU9B 2NUPA 5C0MA 2QGFB 3OYEA 2YLCA 2QEXQ 1JJ2P 1K8AC 4BD3A 1JB0E 1XNIA 2KT8A 2O31A 2HKQB 3OYNA 1X69A 2CZ0B 1M2VA 5CQXA 4OMQA 1YBYA 1VQ9A 2HZYA 2MIOA 3F70A 3V8JA 4P5NA 8AT1B 3MP6A 1VQ9Q 3CCQT 2HL3A 3J80E 5GAMf 2YUNA 1AT1B 1ZLMA 3VS0A 3QPHA 2CUBA 3ASKA 3EG0A 5GMKh 2K5FA 1B07A 1NLOC 2EYWA 3ULRB 1ZUKA 3QJ6A 2CP3A 1PNJA 3NTHA 1BCMA 4TVRA 2ATCB 1RI9A 1ABQA 4F7UE 2RN8A 1VYTA 2IG0A 3JCMW 3JB9G 4XTUA 2BE9B 3A98A 1QKWA 2W0ZA 3GNFB 2DXUA 3LWHA 1TOVA 4F7UB 2XG8D 3QHSA 3NMZC 1U3OA 2L3RA 3CCMA 3JB9I 3CCRA 3FIFA 2GFAA 3VS2A 1YNZA 2V1RA 1K8AR 1VOMA 2RQVA 4E7ZA 1GXIE 3D7SB 3M9QA 4JRPA 1UJYA 4RTVA 4BI8B 5CKDA 1Q81U 3HFNA 3CCMQ 1OX8A 3CCRQ 1KHIA 1AOJA 4C92C 4F7UA 1U1TA 4R0KA 5CKFA 1JJ2A 2HMAA 5CO7A 4GLMA 3M54A 3ER0A 2XDDA 4M7DD 2A37A 1VQNT 4MDXA 3G4SA 2KYBA 3JB9F 3EAEA 4NL2A 5GJVB 1VQ7A 1BI1A 3OS0A 1M8VA 1ABOA 5KYXA 1Q81C 1ACMB 1OU8A 1XJWB 3RMQA 4KH1B 5LJ5j 2MWPA 2KRMA 3G4SQ 1E7OA 5C6SA 1VQOT 5I21A 2VXEA 3OSSC 1VQ7Q 2L3SA 3M5AA 4ANJA 3VU3C 1H3HA 2JMAA 2FZGB 3C4SA 4WTOB 4M78E 3MJXA 1X2KA 1WHMA 1M90U 5IXFA 4JJBA 5GAN8 4C8QD 2CSQA 4NL3A 4C0DC 2KY9A 1YHQA 2YRDA 1VQ9T 1K4US 2LT4A 4M78B 2RA2A 2MMPA 3RMSA 1UTIA 3L1AA 3CEYA 1T0JA 3FJPA 4R55A 2CP5A 1XQHA 4RTXA 2JVVA 2LP5A 4JRKA 2RK2A 4FU6A 2QQRA 1ZUYA 5I22A 2FRYA 1YHQQ 5GJWB 1M90C 3EG1A 4XU0A 4JZ3A 2D0QB 2R5MA 1H8KA 3LLRA 1UGSB 1MUZA 3M4GA 4M78A 2AK5A 2HAXA 3MHXA 1Q81R 4RMOA 2LQKA 2RD1A 1Z9QA 2RJEA 5IN1A 4D8KA 4ESRA 2YUQA 3OQ5A 3EH1A 1I4K1 2BZXA 1RADB 2YRVA 3CPWP 1H3ZA 5KCOA 4Z89A 1VA7A 2XDBA 2EQIA 1PD0A 1M1KC 4A53A 4IIMA 5GAOp 4M75B 1YWOA 2LMJA 1OV3A 3CCMT 2GTOA 2JOYA 5ECAA 5LJ5f 4M7AG 5I2SA 3EG9B 3TU4K 2LNHB 3MP1A 4J9IA 4QVDA 1NJIU 3UWNA 2PNIA 1NBEB 3MO8A 1D0ZA 3NGPA 2LZ6B 1K73U 1T3SA 3JCMg 2LJ3A 2QTVA 5HKCA 4J9GA 2VC8A 5A2QE 2Z0WA 2E12A 3AT1B 1QWFA 2KBTA 1WZOA 3EG9A 3G4ST 1M90R 1NJIC 4L6V5 1TSFA 3C0CA 3QO3A 1SRLA 1FXXA 2D6FA 1QQJA 2KNBB 3DB3A 2CSIA 2GGRA 2DFUA 1TUGB 3OB9A 2PTKA 2RF0A 4N4HA 1RAEB 2KEAA 4M7AF 1H92A 1OU9A 3M57A 2A7YA 3QKJA 2DZCA 1OEBA 1NPRA 2I0NA 1MGQA 4M75C 1YCSB 3H6ZA 2KXDA 2VASA 3OA6A 4FSSA 1E6HA 2LNVA 2V8JA 4LE9A 1M1KR 2K7AA 3PIPA 2MOXA 2BKDN 4PNOA 1YITA 3HP9A 4HVUA 2M02A 2IIMA 5D6YA 5HK0A 3VYHB 5IXBA 4PFPA 2MYSA 3UPUA 1YHQT 3PVQA 3CPWA 3VS5A 5L8RE 2QAZA 1I5OB 3SB2A 3HTRA 1EIFA 2C0TA 1FMWA 3MPUB 1G5VA 2KDSA 4JJCA 3X26B 1VQ8A 1RAAB 3LH5A 4AG2C 3N5BB 2DEQA 2FB7A 4OB3B 4M4ZA 3EGXB 5FLXE 2OJ2A 1NJIR 4IURA 1MV0B 2YXYA 2DBKA 4BDYA 1JO8A 4E7JA 5LJ3g 1E6GA 3RKYA 1YN8A 2ROTA 1VQ8Q 2RJCA 4KBMB 3UT1A 4MZPA 4MMKA 1PKSA 2XMFA 4RKUE 2HBWA 5KH6A 3G71T 2DMOA 1R77A 1ZQ1A 1JXOA 3EGXA 3FB9A 1PHTA 2HQHA 3PMTA 2EKHA 5D7UA 2KSSA 3JCMQ 2KXCA 3SHWA 3KFVA 4JS4A 3JCMe 2LRQA 1OI1A 2R57A 4IUVA 4ATOA 1TXQA 1WHLA 1AVZC 1AD5A 4Z8AA 1D1AA 2I2LA 4N0AA 2D9TA 3M56A 3DLLA 4QQGA 2CP0A 2ENMA 3CCLA 1VIFA 2K9GA 4HXJA 4VUBA 1MNEA 4RTYA 4CC3A 2CP2A 5GAOm 5LJ5h 2XKOC 4M7DB 3KXTA 5GANh 2BTTA 2XIDA 1QLYA 4X34A 1ZA2B 3I56A 1Y71A 1VIEA 2D8HA 4AG1C 1W6XA 3AHUA 3CBMA 2RHYA 2RI2A 2IVWA 1LJOA 2O9VA 2VGMA 1Q86C 2EJGA 1WJSA 2CZ7B 1TG0A 1K0SA 2GQIA 4XTVA 2EGEA 3I56Q 2GF7A 2MK5A 4M78D 1I1JA 1WA7A 4M7DA 1BI3A 2AHJB 3LYIA 4LDWA 1YITT 1W2BS 4JDSA 2GBQA 2GTJA 1TU0B 3CQTA 1G8XA 2HD0A 3OY9A 1VQMA 4LD9K 1V76A 4RTZA 4C8QB 2E3HA 1VQPA 2CDTA 2PVDB 1N8RU 3NPFA 2K2MA 1EZZB 3CCQA 3MP8A 4GLKA 2PUKB 2QASA 2FZKB 3EFRA 4N4IA 1VQ8T 5LJ3e 1I8FA 1CSKA 4M7DC 1LOJA 1VQMQ 3J81E 1SHGA 1QWEA 1SRMA 4PJOG 3NTIA 3OYLA 2CGHA 3M58A 3CCQQ 1I81A 1QKXA 1KQSS 3E9FA 4A63B 4J9BA 3H0FA 1N8RC 2DJZA 2QGGA 4XTWA 2KAFA 2YLBA 1IZ6A 5AYFA 4KH0B 2JW4A 2FVUA 2RHZA 1Q86R 4FYYB 1VQ4A 3HSBA 3RNJA 3OS2A 4JRIA 2M1HA 3I5SA 3SD4A 2XDPA 2KE9A 3ME9A 1Z9ZA 3L2WA 3JCMd 2WACA 2HKNA 3S3NA 2JTFA 2P84A 1WX6A 4EMHA 1VQ4Q 3JCMX 4C8QC 1UGRB 1RACB 2K79A 2HBPA 3CXCS 1W1FA 2J6FA 5IHNA 4PJOF 2LQWA 3PVLA 4X1VA 1VYUA 3CC2A 1X01A 1PD1A 2D0NA 5FU6B 3OW2S 3CCLT 3OBWA 1RAGB 2YSQA 4XAXB 2ZPFB 5I2MA 2JJ9A 4PLLA 2CT3A 3TEEA 1YJ9A 3WXMB 2M9UA 1D3BA 1M4ZA 1VUBA 4ORZA 3CC2Q 3I5RA 4E2FB 2RH2A 3M0SA 1GRIA 1U1SA 1YIJA 1AZEA 3VKIA 3G1JA 1BKBA 3EG2A 2V8KA 1N8RR 4WCIA 2O01E 1N5ZA 2YRCA 2FEIA 1KK7A 1PWTA 4IUTA 1YJ9Q 1YIJQ 4LUDA 1VQOQ 4JLGA 1EFNA 2JT4A 4M77E 2C0OA 5CVIA 3VUBA 1QVFP 4J8OA 1C6VX 2CS7A 1SG5A 4HT9A 1UE9A 3M59A 1VQMT 1SEMA 2BIVA 2EVRA 2F2WA 2HCKA 4M77B 4YTLA 1Y0MA 1VQPT 4M7AE 2LCSA 5FU6C 4QQ6A 2CZ6B 2RQUA 5EG2A 5LJ3d 1JXMA 3URGA 4A4HA 5LL6S 3GF5A 3IQLA 4M7AB 4A4KA 2LCLA 3RKXA 2DJQA 2L3PA 1X75C 2VYTA
chains in the Genus database with same CATH topology
2DXBA 4QW2A 5FU7C 1UGSB 3HL8A 2P0KA 2R58A 1VQLA 1B34B 4E7IA 3M4GA 4M78A 1KHCA 2HAXA 3MHXA 2HQXA 3PFSA 2OAUA 4M77A 3ZEHA 2LDMA 3X20B 4RMOA 2LQKA 2RD1A 5GAMg 2RJEA 1G3SA 3NTKA 5IN1A 3OYGA 3VYGA 3A8LB 3OQ5A 2F5TX 2ZPIB 1ZBXA 3E9GA 3PMIA 2OTLT 4N4GA 5GMKj 4HT8A 1I4K1 2E1HA 1S72A 4PJOC 3S3OA 1KD1C 3P8HA 1UEBA 2YRVA 3CBPA 3EFSA 4FIBA 1N9SA 5KCOA 1H3ZA 2EYQA 1VQ4T 2XDBA 4M7AA 4XK8E 4ZTJA 5GMKm 3G6EA 1M1KC 1W4SA 4A53A 5GAOp 3RERA 3GLXA 2E64A 1NPPA 1O75A 4M75B 5GAN4 4E7HA 4J6XA 5GMKl 1N6AA 3CCMT 3CC4T 2OTJA 5LJ3h 5GAOn 1O9SA 1B34A 3T9NA 2JOYA 4XU2A 1G3WA 1AHJB 4B9WA 5GANe 4ZN3A 5I2SA 5LJ5f 3TU4K 1D3BB 4M7AG 3MP1A 2RJDA 3CCET 3LLRA 2MF2A 4QVDA 1NJIU 3UWNA 4L5GA 2EWNA 3SFMA 2CKKA 3GP8A 4CRIA 3SDZA 1Y7XA 3JCMc 3L2RA 4IUUA 2RHXA 4IUQA 1OZ2A 2O4XB 3RUXA 1WQWA 2QI2A 3MO8A 1QVGA 1VQ5A 4J5YA 4J7IA 2YHTA 2XICA 2JNGA 5CAIA 3JCMg 1K73U 3CMEA 1IREB 1WGSA 2X4WA 3CBOA 3DB4A 3KUFA 4FT4A 5HKCA 3JB9H 3HHTB 4EMKA 1Q7YU 1RL2A 5HK3A 1KG1A 3QG1A 3CC2T 5A0LA 1YI2A 2VC8A 1JJ2S 2PUOB 2EQKA 5CCAA 5A2QE 3CMAT 2E12A 3JCMV 1QVFA 2NLUA 4BB7A 4C5HA 1KQ1A 3FEOA 4ZTFA 1UB4A 3OS5A 4O6JA 2QDYB 4M7DE 2X4XA 3G4ST 4HCBA 3QYGB 1NJIC 1VQ6T 4M78F 1Q86U 4L6V5 4FSXA 3I55T 3X28B 3UDCA 2KMTA 4LDXA 3QO3A 4J83A 1FXXA 1YJ9T 2JTMA 2D6FA 3FDRA 3DB3A 3OSVA 2ZZDA 2LTOA 4OB1B 2CYZB 4OGEA 2O4XA 2KQWA 4RG8A 3OYYA 3FC3A 4KULA 3OB9A 1YIJT 4N4HA 2ZCFB 5GANj 3A8HB 1YJWA 1Q7YC 1QP2A 1JBMA 4ZGDB 2ZPBB 4BE1A 4PJOD 3V7RA 4M7AF 1WJRA 2K57A 5GAN5 2LC4A 2E6NA 3M57A 3PNWC 4JLIA 2QA4A 2A7YA 4XQ3A 3QKJA 2DZCA 1UGQB 2K5LA 1NPRA 2QEXA 1MGQA 4M75C 3R6OA 3BY7A 3JAME 3H6ZA 4O5VA 3OYMA 4E7LA 4CI0C 3OA6A 1WPYA 3WVEB 1Y07A 2LNVA 2V8JA 3LGLA 3P8BB 3Q1JA 2DD4A 3C94A 2QQ9A 3PIPA 3OYBA 2BKDN 4BACA 1FWZA 5GMKe 1KC8U 4PNOA 4FT2A 1YITA 1G3YA 1N9RA 2DD5A 3HP9A 1W2BA 4ZGJB 5D6YA 4A4EA 5HK0A 2G3RA 2PVGB 2VUBA 3VYHB 1Y96B 3PGGA 4MDWA 4C8QE 4DQ2A 3UPUA 1YHQT 4L59A 4B9XA 3CPWA 4BDZA 3C12A 3M55A 3CC7A 3V8LA 2VXFA 1BIBA 1G3TA 5HY6A 5L8RE 4M7DG 3QBYA 2WSFE 5J26A 2KVQG 4XTYA 2EKOA 2MI6A 2FHDA 5A0GA 2C06A 2RB6A 3CCUT 4C92E 3SB2A 1EIFA 1TH7A 3A8MB 3O8VA 1G5VA 2KDSA 3QJYA 3X26B 3CCVA 4JUVA 4HKEA 4JJNK 1VQ8A 2EQJA 2RK1A 1KC8C 2RHUA 3N5BB 2DEQA 4MZTA 2FB7A 4OB3B 3CCVT 3L42A 5FLXE 5GAMe 4C92B 5CIUA 2FYKA 4IURA 2QQAA 1Y96A 3OMCA 4OGCA 1M1FA 4BDYA 1VQLT 2E10A 4E7JA 5LJ3g 2L89A 3RKYA 5J3BA 2DAQA 3OYIA 1KQSA 4RCCA 4QQDA 3E1SA 1NZ9A 2RJCA 4KBMB 3UT1A 3QZ9B 2BUDA 4MZPA 3G71A 2X4JA 2P0QA 2GCXA 4MMKA 5KE3A 4C8QA 4RKUE 5KH6A 2DXCA 1S72T 5CKHA 4DOWA 4EMKB 1OYXA 3G71T 2LX9A 3C95A 1YCYA 3META 4M75D 3LGFA 4X9CA 3VJPA 2RM4A 1BI0A 2DZ9A 2R5AA 1BI2A 3BDUA 4PKCC 3L2QA 3TREA 3MCAB 4JS5A 5KCHA 1ZQ1A 3SWNB 3G6ET 1RI0A 2X35A 3FB9A 4OP0A 4C8QG 4C92A 5LJ5d 1P92A 2EFIA 3G7ZA 2QTXA 3PMTA 4KT0E 5KE2A 4M7DF 3HKSA 2LT1A 2XI9A 4HA8A 4M78C 4BI4A 2LVMA 2OTJT 5GANf 5GANd 5J39A 4BE2A 3QSUA 2K5IA 4A4GA 1PSEA 4M77C 2KSSA 3FRNA 1QW1A 5GMKi 4R56A 3V7CA 4EPCA 1XOVA 4D6WA 3JCMQ 5FRMA 2QQBA 4JS4A 3JCMe 2LRQA 5DLQE 4C92G 1OI1A 2R57A 4ELZC 1Q82U 2EQUA 2HQEA 2QQSA 2XK0A 3DLMA 3V8KA 3JCMf 5GAMj 1X6OA 4IUVA 4ATOA 2Y90A 2EQMA 2F5KA 4IUPA 3OYCA 5FRNA 2P0PA 3QYHB 1QVGS 1VQ5T 5CKEA 4RCBA 2CZ1B 1JRIA 3TCJA 5DLOA 4M7AC 5LJ5g 1I5LA 3CMET 3CXCA 2I2LA 4N0AA 3LX7A 2D9TA 1U8RA 3HRUA 1UGPB 3M56A 4OVAA 3SWNA 3DLLA 2E6ZA 4QQGA 4C0DB 1YI2T 5GAN3 3CCSA 2DXTA 3BDLA 4C5GA 1QVFS 2L8DA 2DK3A 3VV0A 1VIFA 3JSCA 3OW2A 3CCLA 1VQNA 4VUBA 3A8GB 4XU3A 1DJ7B 2LQ8A 1KQ2A 4QVZA 3RIRA 1Q82C 3A5ZB 5GAOm 1N27A 2XKOC 4BI3A 2MAMA 5LJ5h 1K73C 3V7SA 4M7DB 2L5QA 3KXTA 2V8IA 5D6XA 5DM7R 2VGNA 2M0OA 5GANh 5GAOq 5GAOl 2XIDA 3HRTA 1K8AU 4X34A 4C8QF 2PVOB 3I56A 1Y71A 1VIEA 2JZ2A 2M16A 1HXDA 4EMKC 3AHUA 3QXEB 1YJWT 3CBMA 3S3MA 2RHYA 5IT9E 2RI2A 2IVWA 3HPWA 4OB0B 4OMFB 4E7KA 3I56T 1LJOA 2VGMA 1Q86C 2DIGA 4PJOE 3PTAA 3OMGA 4C92F 2QA4T 1VQOA 2JN0A 2EJGA 1WJSA 3DKMA 2QEXT 3JB9D 2CZ7B 3M4YA 4KUIA 1QP3A 3MEAA 4XTVA 3BFMA 2WSEE 3KBGA 3CPFA 1ZHIA 2ZPHB 2GF7A 4J7FA 3CD6A 3S6WA 3QZ5B 2FL7A 2PU9B 4M78D 1V29B 3ZBDA 3GOXA 5C0MA 2K4YA 1BI3A 2AHJB 4M7DA 2K2VA 3LYIA 2YLCA 4LDWA 4M77D 3OYEA 4LD6A 1K8AC 4BE0A 4BD3A 1JB0E 1YITT 2EJFA 1R8OB 3OBYA 1W2BS 3OYDA 3RESA 4FM4B 4JDSA 1XNIA 3OYNA 4IKFA 4C5IA 1LNXA 2CZ0B 2Y4XA 5CQXA 3OYFA 2HD0A 1YBYA 3CPWS 1VQ9A 2K3XA 4LDYA 3OY9A 1VQMA 3CC7T 4LD9K 1M5Q1 2DTHA 4M7AD 4C8QB 1VQPA 2PVDB 3F70A 1N8RU 3CCJA 2XU8A 3QIIA 4XTZA 4II1A 4WF2A 3V8JA 4P5NA 4XTXA 1YJNA 4EDUA 3CCQA 3MP8A 2ZPGB 2PUKB 4GLKA 3PIOA 5FROA 3MP6A 3EFRA 3M53A 4N4IA 1VQ8T 4PJOA 2EIFA 1PSFA 3QUIA 5LJ3e 1I8FA 1YJNT 4M7DC 1LOJA 3OYJA 3J80E 5GAMf 3CCQT 5GAMd 2DKGA 2EAYA 1K9MU 1VQKA 3J81E 5LJ3f 2XHCA 1H641 5A0DA 4JRQA 1NE8A 3QPHA 4UC4A 3ASKA 4PJOG 4A4FA 5GMKh 2PQWA 2K5FA 3NTIA 3OYLA 2CGHA 2X4YA 3M58A 1I81A 3MEVA 1M1KU 3QJ6A 3E9FA 4HCZA 5DY9A 1KQSS 3NTHA 2DTIA 1FX7A 2DJZA 4TVRA 1N8RC 2MWOA 2WSCE 1SSFA 5CKBA 1HK9A 4XTWA 2DTOA 2KAFA 2YLBA 3LH0A 1IZ6A 4F7UE 4QVCA 5AYFA 3H8ZA 2OTLA 2FVUA 2IG0A 3JCMW 3JB9G 4GY5A 3GNGA 4XTUA 3E19A 5IAYA 3QDRB 2RHZA 3LW5E 3HRSA 5GAOr 3L2UA 2B8AA 3GNFB 1VQ4A 1K9MC 3HSBA 2E65A 4M75E 2DXUA 1WJQA 3P8DA 4M78G 4X9DA 5CQYA 3OS2A 3LWHA 2RHIA 4JRIA 4F7UB 1OZ3A 3X24B 4M77G 4E47A 2XG8D 2JUFA 3HFOA 4OF1A 3QHSA 4LDVA 2M1HA 3SD4A 2L3RA 2XDPA 3CCMA 3CC4A 4MMLA 3ME9A 4C5EA 3JB9I 3FIFA 2GFAA 3CCRA 2A3LA 4C0ZA 3L2WA 3OYKA 3JCMd 2WACA 3S3NA 2H3JA 2JTFA 5LJ3j 5GAMh 4NS5A 3CCEA 5LJ5e 5GAN6 3CCRT 4NOYA 4EMHA 2DVEA 4C8QC 3JCMX 3M9QA 4Y28E 5GAN2 4JRPA 1GXIE 1UGRB 4KUDK 2HBPA 3LWIA 4BI8B 1WQ7A 4BY6B 2P4TA 2RI5A 5GANg 3OYHA 3WVDB 5CKDA 1Q81U 3HFNA 3GPLA 3NFCA 3CXCS 2F69A 1KHIA 4PJOF 4C92C 2ZPEB 3GIBA 4F7UA 3CC2A 2Y4YA 1U1TA 1X01A 4FL6A 4PLIA 4A54A 4ZGEB 4ZN1A 5CKFA 3CMAA 3CCST 1JJ2A 5FU6B 5CO7A 3OW2S 3M54A 3CCLT 3ER0A 2XDDA 4M7DD 3BW1A 4RG2A 1M1GA 3OBWA 1VQNT 4XAXB 3X25B 4MDXA 4ELYC 3G4SA 4M75A 3OS1A 2ZPFB 1VQ6A 3EAEA 5I2MA 4F7UG 3JB9F 3L2VA 4PLLA 3I55A 5CK9A 2VV5A 3JCMP 4OB2B 3TEEA 4NL2A 3JB9J 4Z02A 1YJ9A 3WXMB 2M9UA 1D3BA 1M4ZA 1BI1A 4EMGA 1VUBA 2DPPB 2RI3A 3OS0A 3OYAA 1VQ7A 1M8VA 1Q81C 4C0FA 2RH2A 1U1SA 4M75G 4M77F 5FU7B 4N0AC 3RMQA 3JCMh 3VKIA 4DA4A 1X75C 1YIJA 1BKBA 3SWNC 1VQ7T 5M9OA 2V8KA 2ZGWA 5LJ5j 2MWPA 2RJFA 2O01E 2DIQA 3INZA 4V2SA 3PT9A 5C6SA 1QVPA 4Q5WA 4IUTA 2E41A 1VQOT 5I21A 2VXEA 3OSSC 1BYMA 5GAN7 3M5AA 4LDUA 4PJOB 3VU3C 3ZFJA 4J6WA 3J7AF 3MEUA 3CD6T 4XU1A 2RO0A 3JCMJ 2GFUA 3RKWA 3C4SA 4C0GA 4JLGA 4M78E 4Y91A 4DOVA 2K3YA 4M77E 1M90U 5CVIA 3FLGA 3VUBA 5GAN8 4J8OA 4BY6C 2CS7A 2DO3A 4C8QD 2E5QA 2KK4A 4C0DC 4NL3A 1XTDA 3JRZA 2KY9A 4HT9A 4ME7A 1YHQA 4MZMA 3M59A 1VQ9T 2LT4A 4M78B 2RA2A 1VQMT 2BIVA 2MMPA 4F7UF 3RMSA 3VUZA 4M77B 4YTLA 4PL6A 1BIAA 1VQPT 4M7AE 1WNLA 3A8OB 4C92D 5FU6C 2QXFA 3L1AA 5CR2A 1MHNA 3CEYA 4QQ6A 3CCJT 2CZ6B 4J6YA 3FJPA 4R55A 3CCUA 4HCCA 1XQHA 2JVVA 2XD0A 5EG2A 4M75F 3L2ZA 4JRKA 4BUGA 5LJ3d 2HNIA 2RK2A 4FU6A 2QQRA 1KD1U 3URGA 4A4HA 5LL6S 1M90C 3GF5A 4M7AB 4XU0A 2GQVA 2LCCA 4A4KA 1VQKT 2E70A 2LCLA 3RKXA 5D6WA 2D0QB 1M9SA 2R5MA 2EJ9A 3JCMb 3MEWA 2VYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PKC C; 
#chains in the Genus database with same CATH topology
 1SPK A;  2DXB A;  1OPL A;  1B34 B;  1TS9 A;  2OAU A;  4M77 A;  3X20 B;  5GAM g;  3NTK A;  3M0U A;  1KSW A;  3VYG A;  3A8L B;  3PMI A;  2F5T X;  4HT8 A;  1BK2 A;  3CBP A;  1MMD A;  2EYQ A;  1VQ4 T;  4M7A A;  2YWW A;  1PKT A;  4ZTJ A;  3EFO A;  1RLQ C;  1NEG A;  2E64 A;  2DL8 A;  1O75 A;  5GAN 4;  4J6X A;  1LPL A;  1N6A A;  5GAO n;  1B34 A;  1G3W A;  1AHJ B;  4B9W A;  2EW3 A;  4ZN3 A;  2MF2 A;  5AT1 B;  5KYX B;  2YUP A;  1F1B B;  2CKK A;  3GP8 A;  4CRI A;  3JCM c;  4IUU A;  1UGV A;  2O4X B;  4JZ4 A;  2QI2 A;  4J5Y A;  4J7I A;  4OMP A;  3CBO A;  3RBB B;  2DL3 A;  4EMK A;  1RL2 A;  5HK3 A;  3CC2 T;  4FW1 A;  2JS2 A;  1JJ2 S;  2PUO B;  5CCA A;  1QVF A;  2BZ8 A;  1UB4 A;  2QK0 A;  2KYM A;  4FYW B;  4JJD A;  3UDC A;  4LDX A;  1YJ9 T;  2JTM A;  3U23 A;  2ZZD A;  4Z88 A;  2O4X A;  2KQW A;  4KUL A;  1YIJ T;  5GAN j;  3BE3 A;  4ZGD B;  2ZPB B;  5GAN 5;  1C1A A;  3JAM E;  5HCK A;  1WPY A;  1X6G A;  3WVE B;  3P8B B;  4BAC A;  2A28 A;  1UUE A;  3RR6 A;  1G3Y A;  1N9R A;  1GBQ A;  2FPE A;  3H41 A;  1M3A A;  2PVG B;  5EC7 A;  2IPO B;  3PGG A;  3C12 A;  3M55 A;  3CC7 A;  5HY6 A;  1SHF A;  5J26 A;  4XTY A;  2EKO A;  5A0G A;  2C06 A;  1C0M A;  1IRX A;  1UHC A;  1TWB A;  4LN2 A;  2OX7 A;  3QJY A;  3EGU A;  4JUV A;  1BB9 A;  4HKE A;  4HVV A;  1JQQ A;  2L0A A;  1FMK A;  2DLP A;  3CC7 Q;  5GAM e;  1RAI B;  1ZA1 B;  3OMC A;  1MV3 A;  2VB6 A;  1ZBJ A;  2BZY A;  2L89 A;  2NYS A;  4DBR A;  4RCC A;  1ZSZ B;  4QQD A;  2COZ A;  1NZ9 A;  3G71 A;  2BUD A;  2X4J A;  1TTH B;  2P0Q A;  1D1B A;  2KI7 A;  4IIO A;  3MET A;  3QWY A;  2DZ9 A;  2J6O A;  4PKC C;  1BI2 A;  4PJJ A;  2CH4 A;  3MCA B;  2KRN A;  2YDL A;  5KCH A;  4PJM A;  3SWN B;  3M0Q A;  1P92 A;  5KYY A;  2ROL A;  4KT0 E;  5KE2 A;  3G71 Q;  3HKS A;  4M78 C;  2LVM A;  5GAN f;  2K5I A;  5GMK i;  1QW1 A;  2DIL A;  3V7C A;  1XOV A;  5FRM A;  2F2X A;  4OMN A;  4C92 G;  5DLQ E;  1ZSZ A;  1Q82 U;  3DLM A;  4DEY A;  2NUT B;  4Y92 A;  2FO0 A;  3JCM f;  4IUP A;  1MMN A;  5FRN A;  2P0P A;  2PZ1 A;  3QYH B;  5CKE A;  5DLO A;  1RAH B;  2G6F X;  1TUD A;  2H3E B;  5LJ5 g;  1I5L A;  4FYX B;  3HRU A;  4OVA A;  3SWN A;  1M3B A;  2EYX A;  1GCP A;  1WXU A;  3CCS A;  3BDL A;  3VV0 A;  1KQ2 A;  2LQ8 A;  4QVZ A;  3RIR A;  1Q82 C;  3A5Z B;  2FPF A;  2X3W D;  4RUG A;  1K73 C;  2NUT A;  5DM7 R;  2D1X A;  2PVO B;  2QG9 B;  4EIK A;  4OB0 B;  4E7K A;  2DIG A;  5KYU B;  4PJO E;  2W10 A;  3UF4 A;  3PTA A;  4C92 F;  4KUI A;  1QP3 A;  3MEA A;  2SRC A;  3KBG A;  3CPF A;  1FMV A;  3CD6 A;  3S6W A;  3GOX A;  1V29 B;  2ECZ A;  3ZBD A;  2K2V A;  3NHN A;  4M77 D;  2EJF A;  3OYD A;  4FM4 B;  4IKF A;  1LNX A;  2Y4X A;  3EH2 A;  2AT1 B;  3OYF A;  1IXD A;  3CPW S;  4LDY A;  3CD6 Q;  1YIT Q;  3CC7 T;  4M7A D;  5KYU A;  2JM9 A;  3CCJ A;  4F04 B;  2XU8 A;  4II1 A;  4XTX A;  4EDU A;  2KR3 A;  3PIO A;  2DL4 A;  1K9A A;  4PJO A;  2EIF A;  1PSF A;  1YJN T;  1UG1 A;  1Q95 G;  3OYJ A;  5GAM d;  2EAY A;  5LJ3 f;  2XHC A;  1PM3 A;  4JRQ A;  3CCJ Q;  2EBP A;  1K73 R;  1GCQ A;  2OI3 A;  2X4Y A;  2F2V A;  4HCZ A;  5DY9 A;  2DA9 A;  2DTI A;  1FX7 A;  2MWO A;  2WSC E;  1SSF A;  2DTO A;  4QVC A;  2RMO A;  2OTL A;  1K0X A;  4GY5 A;  2HSE B;  3QDF A;  5IAY A;  3LW5 E;  2JXB A;  5GAO r;  3L2U A;  2B8A A;  1WJQ A;  4M78 G;  1D0Y A;  1OQK A;  3X24 B;  2JUF A;  4OF1 A;  4LDV A;  1CKB A;  2RPN A;  2DM1 A;  4MML A;  4C5E A;  2OTL Q;  2A3L A;  4C0Z A;  4E7S A;  1AWX A;  4NS5 A;  4AMC A;  5LJ5 e;  3CCE A;  2RQW A;  5GAN 6;  4NOY A;  2DVE A;  3LWI A;  1WQ7 A;  4BY6 B;  2P4T A;  1M8M A;  3WVD B;  3OYH A;  3GPL A;  4LUE A;  3NFC A;  3GIB A;  1PC0 A;  2Y4Y A;  4FL6 A;  3EHR A;  4ZGE B;  3CCS T;  3BW1 A;  3X25 B;  4ELY C;  1YWP A;  3OS1 A;  1VQ6 A;  1UEC A;  3I55 A;  3EHQ A;  5CK9 A;  1S1N A;  3JB9 J;  4Z02 A;  3CCL Q;  2M51 A;  2RI3 A;  4C0F A;  4M75 G;  3JCM h;  5FU7 B;  4N0A C;  2V1Q A;  5M9O A;  2BE7 D;  1GFD A;  2ZGW A;  4HCK A;  2RJF A;  2CUD A;  4V2S A;  3I55 Q;  1X6B A;  2E41 A;  1BYM A;  3THK A;  1GFC A;  1TUC A;  4LDU A;  1QVG P;  5I11 A;  1UJ0 A;  3ZFJ A;  3CD6 T;  4C0G A;  2O2O A;  4Y91 A;  4DOV A;  2K3Y A;  1MMG A;  4BY6 C;  2KK4 A;  4ME7 A;  4MZM A;  1UHF A;  2FZC B;  3VUZ A;  1WNL A;  3A8O B;  5CR2 A;  3CCJ T;  1MHN A;  1NYF A;  2QYZ A;  4J6Y A;  3CCU A;  3TVT A;  2AIR B;  1FYN A;  2XD0 A;  4M75 F;  2MPX C;  2YT6 A;  2HNI A;  1KD1 U;  1VQP Q;  5D6W A;  2V26 A;  2EJ9 A;  3EGD A;  4QW2 A;  5FU7 C;  1B3Q A;  2P0K A;  1VQL A;  4E7I A;  1G83 A;  1KHC A;  4PFO A;  3ZEH A;  2LDM A;  3OYG A;  1K76 A;  2L3Q A;  2QDL A;  1ZBX A;  2CH4 W;  3E9G A;  2OTL T;  4N4G A;  2E1H A;  1S72 A;  1SSH A;  3S3O A;  1KD1 C;  3UA6 A;  1VQL Q;  4XK8 E;  1W4S A;  3GLX A;  1IHW A;  5GMK l;  2OTJ A;  5LJ3 h;  1O9S A;  3T9N A;  1S72 Q;  1YFN A;  1D3B B;  2RJD A;  3CCE T;  1WIE A;  1K1Z A;  4L5G A;  2EWN A;  2O88 A;  2RHX A;  4IUQ A;  1OZ2 A;  3RUX A;  1VQ5 A;  1QVG A;  3JV3 A;  2YHT A;  2XIC A;  2OTJ Q;  5CAI A;  1AWJ A;  3CME A;  4FT4 A;  3DB4 A;  3JB9 H;  3HHT B;  1KG1 A;  5A0L A;  1YI2 A;  2EQK A;  1PCX A;  3JCM V;  2YUO A;  4KGV B;  4C5H A;  1KQ1 A;  3FEO A;  4O6J A;  2X4X A;  1EX4 A;  3QYG B;  1VQ6 T;  3M0T A;  4FSX A;  2A0F B;  3I55 T;  2J06 A;  4F17 A;  2KMT A;  4KRT A;  3OSV A;  1HYO A;  1QCN A;  2NUZ A;  4OB1 B;  4DBQ A;  1YI2 Q;  4RG8 A;  3FC3 A;  2ZCF B;  2A36 A;  3QWX X;  4PJO D;  3UAT A;  1WJR A;  2K57 A;  2LC4 A;  2E6N A;  3PNW C;  2AZV A;  4JLI A;  1ZX6 A;  1UGQ B;  2QEX A;  1KD1 R;  3R6O A;  4E7L A;  4D8D A;  1W70 A;  1OPK A;  3Q1J A;  3C94 A;  1G2B A;  1FWZ A;  1HSQ A;  5GMK e;  1KC8 U;  3H0I A;  2DD5 A;  2F1L A;  4A4E A;  2G3R A;  1Y96 B;  4MDW A;  1WHH A;  2KRS A;  1WYX A;  1Y57 A;  1BIB A;  1G3T A;  4M7D G;  3QBY A;  2KVQ G;  2MI6 A;  2FHD A;  2RB6 A;  3CCU T;  1WFW A;  4C92 E;  1IO6 A;  1TH7 A;  2NWM A;  3EFO B;  5IH2 A;  4RTT A;  5IHK A;  2RK1 A;  1KC8 C;  3ZL7 C;  4MZT A;  4PFZ A;  2H8H A;  3CCV T;  2DER A;  4C92 B;  1V1C A;  2FYK A;  2QQA A;  1Y96 A;  4OGC A;  1VQL T;  1JEG A;  2CRE A;  2HEQ A;  4RTW A;  2DAQ A;  3OYI A;  2CP6 A;  1PRM C;  2GCX A;  4DBH A;  3GBQ A;  1S72 T;  3H9N A;  4EMK B;  1AWO A;  1OYX A;  1IGQ A;  2LX9 A;  1YCY A;  2DE0 X;  4J9H A;  4X9C A;  3VJP A;  2RM4 A;  1BI0 A;  2R5A A;  2DYI A;  3L2Q A;  4AT1 B;  3TRE A;  4JS5 A;  1RI0 A;  2SEM A;  2X35 A;  3SEM A;  4C8Q G;  4C92 A;  2J7I A;  3G7Z A;  4M7D F;  5L23 A;  4OMO A;  4BI4 A;  2OTJ T;  2DEU A;  5J39 A;  3QSU A;  1UFF A;  1PSE A;  4M77 C;  3FRN A;  3I35 A;  2X9H A;  4QKU A;  2CT4 A;  1T0H A;  1JU5 C;  2K3B A;  2LQN A;  2HQE A;  4J9C A;  2Y90 A;  2EQM A;  1MMA A;  2KT1 A;  1VQ5 T;  4RCB A;  4M7A C;  2L2P A;  3CME T;  3LX7 A;  1U8R A;  1UGP B;  4C0D B;  1YI2 T;  5GAN 3;  2DXT A;  1QVF S;  2L8D A;  4LNP A;  1PRL C;  1KC8 R;  4XU3 A;  1DJ7 B;  1A0N B;  4BI3 A;  2MAM A;  1PG5 B;  3V7S A;  2RQR A;  2V8I A;  4QT7 A;  2VGN A;  5GAO q;  3HRT A;  4C8Q F;  2M16 A;  2JZ2 A;  1WLP B;  4EMK C;  2O9S A;  2JTE A;  5IT9 E;  4J9F A;  4FYV B;  3HPW A;  4OMF B;  8ATC B;  1NLP C;  2J05 A;  1ZUU A;  4OML A;  3DKM A;  2QEX T;  3JB9 D;  4DEX A;  3M4Y A;  3O5Z A;  3BFM A;  1WI7 A;  2WSE E;  4CC4 B;  1D09 B;  1ZHI A;  3QZ5 B;  2FL7 A;  2K4Y A;  4JPB W;  4LD6 A;  4BE0 A;  1X27 A;  2DYB A;  3OBY A;  1R8O B;  3RES A;  4C5I A;  2DVJ A;  1ARK A;  2B86 A;  2K3X A;  1M5Q 1;  2DTH A;  4DBF A;  1GBR A;  3QII A;  1BU1 A;  4WF2 A;  4XTZ A;  1YJN A;  2ZPG B;  5FRO A;  3M53 A;  2KGT A;  5KYY B;  3QUI A;  4FW2 A;  1QCO A;  4CC2 A;  4GBQ A;  2DKG A;  1K9M U;  1VQK A;  1M30 A;  1H64 1;  5A0D A;  1NE8 A;  4UC4 A;  2VWF A;  4A4F A;  2PQW A;  1YJN Q;  7AT1 B;  3MEV A;  1M1K U;  1B7T A;  5CKB A;  1HK9 A;  3LH0 A;  1AZG B;  3H8Z A;  1WDX A;  1VQK Q;  1RUW A;  4AFS C;  1IB8 A;  3GNG A;  1D1C A;  3E19 A;  3QDR B;  1BBZ A;  3HRS A;  1K9M C;  4K11 A;  2AZS A;  2E65 A;  4M75 E;  4X9D A;  3P8D A;  2DX1 A;  5CQY A;  2RHI A;  2ESW A;  1OZ3 A;  4M77 G;  4E47 A;  2AKL A;  3HFO A;  4PK4 A;  3CC4 A;  2FPD A;  3OYK A;  1NYG A;  2H3J A;  5GAM h;  5LJ3 j;  1RAF B;  3VRZ A;  3CCR T;  4CC7 A;  4Y28 E;  5GAN 2;  1NG2 A;  4KUD K;  3A1P A;  2RI5 A;  5GAN g;  4KGZ B;  3CC4 Q;  2DNU A;  2ZAE A;  5KYN A;  2F69 A;  2ZPE B;  4PLI A;  2FRW A;  3VS6 A;  4A54 A;  2JM8 A;  4ZN1 A;  3CMA A;  3REB B;  4RG2 A;  1M1G A;  1HD3 A;  4F14 A;  1ZSZ C;  4M75 A;  2HDA A;  5FWB A;  4F7U G;  3L2V A;  2VV5 A;  3CCS Q;  3JCM P;  4OB2 B;  4EMG A;  2DPP B;  3OYA A;  3CMA Q;  4M77 F;  4DA4 A;  3SWN C;  1VQ7 T;  2DIQ A;  3INZ A;  3PT9 A;  1QVP A;  4Q5W A;  2GNC A;  1OUL A;  3PE0 A;  5KYW B;  5GAN 7;  2M0Y A;  4PJO B;  1K9M R;  4J6W A;  3J7A F;  1QMC A;  3MEU A;  4XU1 A;  2RO0 A;  1OX9 A;  3JCM J;  2GFU A;  3RKW A;  1HJD A;  2VVK A;  1M27 C;  3FLG A;  2ED1 A;  1R0C B;  1IHV A;  2DO3 A;  1KFZ A;  2E5Q A;  4B6M A;  1XTD A;  1YP5 A;  2ED0 A;  3JRZ A;  1WHG A;  2E5K A;  4F7U F;  1LVK A;  4PL6 A;  1BIA A;  1U5S A;  4C92 D;  5KYW A;  2QXF A;  1KJW A;  3RDV A;  9ATC B;  4HCC A;  3FJ5 A;  3E2U A;  3L2Z A;  4BUG A;  1Q82 R;  4HVW A;  5FWC A;  2GQV A;  2LCC A;  1VQK T;  1U06 A;  2E70 A;  1M9S A;  2C0I A;  3JCM b;  3MEW A;  3HL8 A;  2R58 A;  1RAB B;  1ZSG A;  2HQX A;  2VKN A;  3PFS A;  1BCO A;  1G3S A;  1W2B P;  2ZPI B;  2X51 A;  1WXB A;  5GMK j;  1LCK A;  1J3T A;  1X2Q A;  4PJO C;  3P8H A;  1UEB A;  4FIB A;  3EFS A;  1N9S A;  4J9E A;  2LJ0 A;  5GMK m;  3G6E A;  3VS4 A;  3RER A;  1NPP A;  1GCQ C;  4E7H A;  3CC4 T;  4XU2 A;  3TQ7 P;  5GAN e;  2RQT A;  2X3X D;  1M3C A;  3VS1 A;  5IHI A;  3SFM A;  3G6E Q;  3SDZ A;  1Y7X A;  3L2R A;  2EPD A;  1WQW A;  2KRO A;  1WHJ A;  3CCE Q;  2JNG A;  3R6N A;  1IRE B;  1WGS A;  2X4W A;  3KUF A;  1KQS P;  1Q7Y U;  4RTU A;  3QG1 A;  2K6D A;  3CMA T;  4OMM A;  1NEB A;  1SF9 A;  2OAW A;  2NLU A;  4BB7 A;  4ZTF A;  3REA B;  3OS5 A;  2QDY B;  4M7D E;  4HCB A;  3VRY A;  4M78 F;  1Q86 U;  3X28 B;  4J83 A;  4FCY A;  2EYZ A;  4PJL A;  3FDR A;  2CP7 A;  2LTO A;  1WHK A;  2CYZ B;  4OGE A;  1WXT A;  3UA7 A;  3OYY A;  1VQ6 Q;  2EGA A;  3A8H B;  1YJW A;  1Q7Y C;  1QP2 A;  1JBM A;  4BE1 A;  3V7R A;  2DRM A;  3TSZ A;  2QA4 A;  4XQ3 A;  1AWW A;  2K5L A;  3BY7 A;  1SKU B;  4O5V A;  3OYM A;  4ZNX A;  4CI0 C;  3CXC P;  1Y07 A;  3LGL A;  2DD4 A;  2QQ9 A;  1YJW Q;  3OYB A;  2DBM A;  3EGD B;  3VS7 A;  4FT2 A;  3OW2 P;  1W2B A;  4ZGJ B;  2QA4 Q;  2VUB A;  4C8Q E;  4DQ2 A;  3M0P A;  4L59 A;  4B9X A;  4BDZ A;  3V8L A;  2VXF A;  2WSF E;  4AFZ C;  2EGC A;  3A8M B;  2DF6 A;  1D0X A;  2LJ1 A;  3O8V A;  1I07 A;  3CCV A;  2MCN A;  4JJN K;  2EQJ A;  2DL5 A;  4LXC A;  2RHU A;  1AEY A;  4J9D A;  2E4H A;  3CCU Q;  4KGX B;  3L42 A;  5CIU A;  1T3L A;  1M1F A;  4F16 A;  2E10 A;  2JS0 A;  1GL5 A;  3CCV Q;  5J3B A;  2COY A;  1KQS A;  3E1S A;  1X43 A;  3QZ9 B;  1OOT A;  1Q7Y R;  5KE3 A;  3EG3 A;  4C8Q A;  2HL5 C;  2DXC A;  5CKH A;  4DOW A;  3C95 A;  4M75 D;  3LGF A;  3BDU A;  2JMC A;  2EYY A;  3G6E T;  2COW A;  2FG0 A;  4OP0 A;  5LJ5 d;  2ABL A;  2EFI A;  2QTX A;  2LT1 A;  2XI9 A;  4HA8 A;  2AKK A;  2D8J A;  5GAN d;  4BE2 A;  4A4G A;  3VS3 A;  4R56 A;  3H0H A;  4EPC A;  4D6W A;  2QQB A;  1M2O A;  2A08 A;  1QCF A;  4ELZ C;  2EQU A;  2QQS A;  2XK0 A;  3V8K A;  5GAM j;  2E3I A;  3MKD A;  1X6O A;  2F5K A;  3OYC A;  4E6R A;  1QVG S;  2RNA A;  2CZ1 B;  1JRI A;  3TCJ A;  3CXC A;  2E6Z A;  2HSP A;  4PJN A;  1UDL A;  1VQ5 Q;  4C5G A;  1IGU A;  2DK3 A;  3JSC A;  3OW2 A;  5FW9 A;  1MND A;  3CME Q;  2DET A;  1VQN A;  3A8G B;  3M0R A;  1R0B G;  2NUP B;  1N27 A;  2DRK A;  2P4R A;  1KIK A;  2L5Q A;  4AFU C;  5D6X A;  1NM7 A;  2M0O A;  5GAO l;  6AT1 B;  2LX7 A;  1K8A U;  3I9Q A;  1CKA A;  1HXD A;  1VYV A;  3QXE B;  1YJW T;  1M2V B;  1VQN Q;  3S3M A;  4AFQ C;  3I56 T;  1RLP C;  1I0C A;  3OMG A;  2QA4 T;  1VQO A;  2JN0 A;  2J6K A;  3TSW A;  2DL7 A;  2ZPH B;  4J7F A;  2PU9 B;  2NUP A;  5C0M A;  2QGF B;  3OYE A;  2YLC A;  2QEX Q;  1JJ2 P;  1K8A C;  4BD3 A;  1JB0 E;  1XNI A;  2KT8 A;  2O31 A;  2HKQ B;  3OYN A;  1X69 A;  2CZ0 B;  1M2V A;  5CQX A;  4OMQ A;  1YBY A;  1VQ9 A;  2HZY A;  2MIO A;  3F70 A;  3V8J A;  4P5N A;  8AT1 B;  3MP6 A;  1VQ9 Q;  3CCQ T;  2HL3 A;  3J80 E;  5GAM f;  2YUN A;  1AT1 B;  1ZLM A;  3VS0 A;  3QPH A;  2CUB A;  3ASK A;  3EG0 A;  5GMK h;  2K5F A;  1B07 A;  1NLO C;  2EYW A;  3ULR B;  1ZUK A;  3QJ6 A;  2CP3 A;  1PNJ A;  3NTH A;  1BCM A;  4TVR A;  2ATC B;  1RI9 A;  1ABQ A;  4F7U E;  2RN8 A;  1VYT A;  2IG0 A;  3JCM W;  3JB9 G;  4XTU A;  2BE9 B;  3A98 A;  1QKW A;  2W0Z A;  3GNF B;  2DXU A;  3LWH A;  1TOV A;  4F7U B;  2XG8 D;  3QHS A;  3NMZ C;  1U3O A;  2L3R A;  3CCM A;  3JB9 I;  3CCR A;  3FIF A;  2GFA A;  3VS2 A;  1YNZ A;  2V1R A;  1K8A R;  1VOM A;  2RQV A;  4E7Z A;  1GXI E;  3D7S B;  3M9Q A;  4JRP A;  1UJY A;  4RTV A;  4BI8 B;  5CKD A;  1Q81 U;  3HFN A;  3CCM Q;  1OX8 A;  3CCR Q;  1KHI A;  1AOJ A;  4C92 C;  4F7U A;  1U1T A;  4R0K A;  5CKF A;  1JJ2 A;  2HMA A;  5CO7 A;  4GLM A;  3M54 A;  3ER0 A;  2XDD A;  4M7D D;  2A37 A;  1VQN T;  4MDX A;  3G4S A;  2KYB A;  3JB9 F;  3EAE A;  4NL2 A;  5GJV B;  1VQ7 A;  1BI1 A;  3OS0 A;  1M8V A;  1ABO A;  5KYX A;  1Q81 C;  1ACM B;  1OU8 A;  1XJW B;  3RMQ A;  4KH1 B;  5LJ5 j;  2MWP A;  2KRM A;  3G4S Q;  1E7O A;  5C6S A;  1VQO T;  5I21 A;  2VXE A;  3OSS C;  1VQ7 Q;  2L3S A;  3M5A A;  4ANJ A;  3VU3 C;  1H3H A;  2JMA A;  2FZG B;  3C4S A;  4WTO B;  4M78 E;  3MJX A;  1X2K A;  1WHM A;  1M90 U;  5IXF A;  4JJB A;  5GAN 8;  4C8Q D;  2CSQ A;  4NL3 A;  4C0D C;  2KY9 A;  1YHQ A;  2YRD A;  1VQ9 T;  1K4U S;  2LT4 A;  4M78 B;  2RA2 A;  2MMP A;  3RMS A;  1UTI A;  3L1A A;  3CEY A;  1T0J A;  3FJP A;  4R55 A;  2CP5 A;  1XQH A;  4RTX A;  2JVV A;  2LP5 A;  4JRK A;  2RK2 A;  4FU6 A;  2QQR A;  1ZUY A;  5I22 A;  2FRY A;  1YHQ Q;  5GJW B;  1M90 C;  3EG1 A;  4XU0 A;  4JZ3 A;  2D0Q B;  2R5M A;  1H8K A;  3LLR A;  1UGS B;  1MUZ A;  3M4G A;  4M78 A;  2AK5 A;  2HAX A;  3MHX A;  1Q81 R;  4RMO A;  2LQK A;  2RD1 A;  1Z9Q A;  2RJE A;  5IN1 A;  4D8K A;  4ESR A;  2YUQ A;  3OQ5 A;  3EH1 A;  1I4K 1;  2BZX A;  1RAD B;  2YRV A;  3CPW P;  1H3Z A;  5KCO A;  4Z89 A;  1VA7 A;  2XDB A;  2EQI A;  1PD0 A;  1M1K C;  4A53 A;  4IIM A;  5GAO p;  4M75 B;  1YWO A;  2LMJ A;  1OV3 A;  3CCM T;  2GTO A;  2JOY A;  5ECA A;  5LJ5 f;  4M7A G;  5I2S A;  3EG9 B;  3TU4 K;  2LNH B;  3MP1 A;  4J9I A;  4QVD A;  1NJI U;  3UWN A;  2PNI A;  1NBE B;  3MO8 A;  1D0Z A;  3NGP A;  2LZ6 B;  1K73 U;  1T3S A;  3JCM g;  2LJ3 A;  2QTV A;  5HKC A;  4J9G A;  2VC8 A;  5A2Q E;  2Z0W A;  2E12 A;  3AT1 B;  1QWF A;  2KBT A;  1WZO A;  3EG9 A;  3G4S T;  1M90 R;  1NJI C;  4L6V 5;  1TSF A;  3C0C A;  3QO3 A;  1SRL A;  1FXX A;  2D6F A;  1QQJ A;  2KNB B;  3DB3 A;  2CSI A;  2GGR A;  2DFU A;  1TUG B;  3OB9 A;  2PTK A;  2RF0 A;  4N4H A;  1RAE B;  2KEA A;  4M7A F;  1H92 A;  1OU9 A;  3M57 A;  2A7Y A;  3QKJ A;  2DZC A;  1OEB A;  1NPR A;  2I0N A;  1MGQ A;  4M75 C;  1YCS B;  3H6Z A;  2KXD A;  2VAS A;  3OA6 A;  4FSS A;  1E6H A;  2LNV A;  2V8J A;  4LE9 A;  1M1K R;  2K7A A;  3PIP A;  2MOX A;  2BKD N;  4PNO A;  1YIT A;  3HP9 A;  4HVU A;  2M02 A;  2IIM A;  5D6Y A;  5HK0 A;  3VYH B;  5IXB A;  4PFP A;  2MYS A;  3UPU A;  1YHQ T;  3PVQ A;  3CPW A;  3VS5 A;  5L8R E;  2QAZ A;  1I5O B;  3SB2 A;  3HTR A;  1EIF A;  2C0T A;  1FMW A;  3MPU B;  1G5V A;  2KDS A;  4JJC A;  3X26 B;  1VQ8 A;  1RAA B;  3LH5 A;  4AG2 C;  3N5B B;  2DEQ A;  2FB7 A;  4OB3 B;  4M4Z A;  3EGX B;  5FLX E;  2OJ2 A;  1NJI R;  4IUR A;  1MV0 B;  2YXY A;  2DBK A;  4BDY A;  1JO8 A;  4E7J A;  5LJ3 g;  1E6G A;  3RKY A;  1YN8 A;  2ROT A;  1VQ8 Q;  2RJC A;  4KBM B;  3UT1 A;  4MZP A;  4MMK A;  1PKS A;  2XMF A;  4RKU E;  2HBW A;  5KH6 A;  3G71 T;  2DMO A;  1R77 A;  1ZQ1 A;  1JXO A;  3EGX A;  3FB9 A;  1PHT A;  2HQH A;  3PMT A;  2EKH A;  5D7U A;  2KSS A;  3JCM Q;  2KXC A;  3SHW A;  3KFV A;  4JS4 A;  3JCM e;  2LRQ A;  1OI1 A;  2R57 A;  4IUV A;  4ATO A;  1TXQ A;  1WHL A;  1AVZ C;  1AD5 A;  4Z8A A;  1D1A A;  2I2L A;  4N0A A;  2D9T A;  3M56 A;  3DLL A;  4QQG A;  2CP0 A;  2ENM A;  3CCL A;  1VIF A;  2K9G A;  4HXJ A;  4VUB A;  1MNE A;  4RTY A;  4CC3 A;  2CP2 A;  5GAO m;  5LJ5 h;  2XKO C;  4M7D B;  3KXT A;  5GAN h;  2BTT A;  2XID A;  1QLY A;  4X34 A;  1ZA2 B;  3I56 A;  1Y71 A;  1VIE A;  2D8H A;  4AG1 C;  1W6X A;  3AHU A;  3CBM A;  2RHY A;  2RI2 A;  2IVW A;  1LJO A;  2O9V A;  2VGM A;  1Q86 C;  2EJG A;  1WJS A;  2CZ7 B;  1TG0 A;  1K0S A;  2GQI A;  4XTV A;  2EGE A;  3I56 Q;  2GF7 A;  2MK5 A;  4M78 D;  1I1J A;  1WA7 A;  4M7D A;  1BI3 A;  2AHJ B;  3LYI A;  4LDW A;  1YIT T;  1W2B S;  4JDS A;  2GBQ A;  2GTJ A;  1TU0 B;  3CQT A;  1G8X A;  2HD0 A;  3OY9 A;  1VQM A;  4LD9 K;  1V76 A;  4RTZ A;  4C8Q B;  2E3H A;  1VQP A;  2CDT A;  2PVD B;  1N8R U;  3NPF A;  2K2M A;  1EZZ B;  3CCQ A;  3MP8 A;  4GLK A;  2PUK B;  2QAS A;  2FZK B;  3EFR A;  4N4I A;  1VQ8 T;  5LJ3 e;  1I8F A;  1CSK A;  4M7D C;  1LOJ A;  1VQM Q;  3J81 E;  1SHG A;  1QWE A;  1SRM A;  4PJO G;  3NTI A;  3OYL A;  2CGH A;  3M58 A;  3CCQ Q;  1I81 A;  1QKX A;  1KQS S;  3E9F A;  4A63 B;  4J9B A;  3H0F A;  1N8R C;  2DJZ A;  2QGG A;  4XTW A;  2KAF A;  2YLB A;  1IZ6 A;  5AYF A;  4KH0 B;  2JW4 A;  2FVU A;  2RHZ A;  1Q86 R;  4FYY B;  1VQ4 A;  3HSB A;  3RNJ A;  3OS2 A;  4JRI A;  2M1H A;  3I5S A;  3SD4 A;  2XDP A;  2KE9 A;  3ME9 A;  1Z9Z A;  3L2W A;  3JCM d;  2WAC A;  2HKN A;  3S3N A;  2JTF A;  2P84 A;  1WX6 A;  4EMH A;  1VQ4 Q;  3JCM X;  4C8Q C;  1UGR B;  1RAC B;  2K79 A;  2HBP A;  3CXC S;  1W1F A;  2J6F A;  5IHN A;  4PJO F;  2LQW A;  3PVL A;  4X1V A;  1VYU A;  3CC2 A;  1X01 A;  1PD1 A;  2D0N A;  5FU6 B;  3OW2 S;  3CCL T;  3OBW A;  1RAG B;  2YSQ A;  4XAX B;  2ZPF B;  5I2M A;  2JJ9 A;  4PLL A;  2CT3 A;  3TEE A;  1YJ9 A;  3WXM B;  2M9U A;  1D3B A;  1M4Z A;  1VUB A;  4ORZ A;  3CC2 Q;  3I5R A;  4E2F B;  2RH2 A;  3M0S A;  1GRI A;  1U1S A;  1YIJ A;  1AZE A;  3VKI A;  3G1J A;  1BKB A;  3EG2 A;  2V8K A;  1N8R R;  4WCI A;  2O01 E;  1N5Z A;  2YRC A;  2FEI A;  1KK7 A;  1PWT A;  4IUT A;  1YJ9 Q;  1YIJ Q;  4LUD A;  1VQO Q;  4JLG A;  1EFN A;  2JT4 A;  4M77 E;  2C0O A;  5CVI A;  3VUB A;  1QVF P;  4J8O A;  1C6V X;  2CS7 A;  1SG5 A;  4HT9 A;  1UE9 A;  3M59 A;  1VQM T;  1SEM A;  2BIV A;  2EVR A;  2F2W A;  2HCK A;  4M77 B;  4YTL A;  1Y0M A;  1VQP T;  4M7A E;  2LCS A;  5FU6 C;  4QQ6 A;  2CZ6 B;  2RQU A;  5EG2 A;  5LJ3 d;  1JXM A;  3URG A;  4A4H A;  5LL6 S;  3GF5 A;  3IQL A;  4M7A B;  4A4K A;  2LCL A;  3RKX A;  2DJQ A;  2L3P A;  1X75 C;  2VYT A; 
#chains in the Genus database with same CATH homology
 2DXB A;  4QW2 A;  5FU7 C;  1UGS B;  3HL8 A;  2P0K A;  2R58 A;  1VQL A;  1B34 B;  4E7I A;  3M4G A;  4M78 A;  1KHC A;  2HAX A;  3MHX A;  2HQX A;  3PFS A;  2OAU A;  4M77 A;  3ZEH A;  2LDM A;  3X20 B;  4RMO A;  2LQK A;  2RD1 A;  5GAM g;  2RJE A;  1G3S A;  3NTK A;  5IN1 A;  3OYG A;  3VYG A;  3A8L B;  3OQ5 A;  2F5T X;  2ZPI B;  1ZBX A;  3E9G A;  3PMI A;  2OTL T;  4N4G A;  5GMK j;  4HT8 A;  1I4K 1;  2E1H A;  1S72 A;  4PJO C;  3S3O A;  1KD1 C;  3P8H A;  1UEB A;  2YRV A;  3CBP A;  3EFS A;  4FIB A;  1N9S A;  5KCO A;  1H3Z A;  2EYQ A;  1VQ4 T;  2XDB A;  4M7A A;  4XK8 E;  4ZTJ A;  5GMK m;  3G6E A;  1M1K C;  1W4S A;  4A53 A;  5GAO p;  3RER A;  3GLX A;  2E64 A;  1NPP A;  1O75 A;  4M75 B;  5GAN 4;  4E7H A;  4J6X A;  5GMK l;  1N6A A;  3CCM T;  3CC4 T;  2OTJ A;  5LJ3 h;  5GAO n;  1O9S A;  1B34 A;  3T9N A;  2JOY A;  4XU2 A;  1G3W A;  1AHJ B;  4B9W A;  5GAN e;  4ZN3 A;  5I2S A;  5LJ5 f;  3TU4 K;  1D3B B;  4M7A G;  3MP1 A;  2RJD A;  3CCE T;  3LLR A;  2MF2 A;  4QVD A;  1NJI U;  3UWN A;  4L5G A;  2EWN A;  3SFM A;  2CKK A;  3GP8 A;  4CRI A;  3SDZ A;  1Y7X A;  3JCM c;  3L2R A;  4IUU A;  2RHX A;  4IUQ A;  1OZ2 A;  2O4X B;  3RUX A;  1WQW A;  2QI2 A;  3MO8 A;  1QVG A;  1VQ5 A;  4J5Y A;  4J7I A;  2YHT A;  2XIC A;  2JNG A;  5CAI A;  3JCM g;  1K73 U;  3CME A;  1IRE B;  1WGS A;  2X4W A;  3CBO A;  3DB4 A;  3KUF A;  4FT4 A;  5HKC A;  3JB9 H;  3HHT B;  4EMK A;  1Q7Y U;  1RL2 A;  5HK3 A;  1KG1 A;  3QG1 A;  3CC2 T;  5A0L A;  1YI2 A;  2VC8 A;  1JJ2 S;  2PUO B;  2EQK A;  5CCA A;  5A2Q E;  3CMA T;  2E12 A;  3JCM V;  1QVF A;  2NLU A;  4BB7 A;  4C5H A;  1KQ1 A;  3FEO A;  4ZTF A;  1UB4 A;  3OS5 A;  4O6J A;  2QDY B;  4M7D E;  2X4X A;  3G4S T;  4HCB A;  3QYG B;  1NJI C;  1VQ6 T;  4M78 F;  1Q86 U;  4L6V 5;  4FSX A;  3I55 T;  3X28 B;  3UDC A;  2KMT A;  4LDX A;  3QO3 A;  4J83 A;  1FXX A;  1YJ9 T;  2JTM A;  2D6F A;  3FDR A;  3DB3 A;  3OSV A;  2ZZD A;  2LTO A;  4OB1 B;  2CYZ B;  4OGE A;  2O4X A;  2KQW A;  4RG8 A;  3OYY A;  3FC3 A;  4KUL A;  3OB9 A;  1YIJ T;  4N4H A;  2ZCF B;  5GAN j;  3A8H B;  1YJW A;  1Q7Y C;  1QP2 A;  1JBM A;  4ZGD B;  2ZPB B;  4BE1 A;  4PJO D;  3V7R A;  4M7A F;  1WJR A;  2K57 A;  5GAN 5;  2LC4 A;  2E6N A;  3M57 A;  3PNW C;  4JLI A;  2QA4 A;  2A7Y A;  4XQ3 A;  3QKJ A;  2DZC A;  1UGQ B;  2K5L A;  1NPR A;  2QEX A;  1MGQ A;  4M75 C;  3R6O A;  3BY7 A;  3JAM E;  3H6Z A;  4O5V A;  3OYM A;  4E7L A;  4CI0 C;  3OA6 A;  1WPY A;  3WVE B;  1Y07 A;  2LNV A;  2V8J A;  3LGL A;  3P8B B;  3Q1J A;  2DD4 A;  3C94 A;  2QQ9 A;  3PIP A;  3OYB A;  2BKD N;  4BAC A;  1FWZ A;  5GMK e;  1KC8 U;  4PNO A;  4FT2 A;  1YIT A;  1G3Y A;  1N9R A;  2DD5 A;  3HP9 A;  1W2B A;  4ZGJ B;  5D6Y A;  4A4E A;  5HK0 A;  2G3R A;  2PVG B;  2VUB A;  3VYH B;  1Y96 B;  3PGG A;  4MDW A;  4C8Q E;  4DQ2 A;  3UPU A;  1YHQ T;  4L59 A;  4B9X A;  3CPW A;  4BDZ A;  3C12 A;  3M55 A;  3CC7 A;  3V8L A;  2VXF A;  1BIB A;  1G3T A;  5HY6 A;  5L8R E;  4M7D G;  3QBY A;  2WSF E;  5J26 A;  2KVQ G;  4XTY A;  2EKO A;  2MI6 A;  2FHD A;  5A0G A;  2C06 A;  2RB6 A;  3CCU T;  4C92 E;  3SB2 A;  1EIF A;  1TH7 A;  3A8M B;  3O8V A;  1G5V A;  2KDS A;  3QJY A;  3X26 B;  3CCV A;  4JUV A;  4HKE A;  4JJN K;  1VQ8 A;  2EQJ A;  2RK1 A;  1KC8 C;  2RHU A;  3N5B B;  2DEQ A;  4MZT A;  2FB7 A;  4OB3 B;  3CCV T;  3L42 A;  5FLX E;  5GAM e;  4C92 B;  5CIU A;  2FYK A;  4IUR A;  2QQA A;  1Y96 A;  3OMC A;  4OGC A;  1M1F A;  4BDY A;  1VQL T;  2E10 A;  4E7J A;  5LJ3 g;  2L89 A;  3RKY A;  5J3B A;  2DAQ A;  3OYI A;  1KQS A;  4RCC A;  4QQD A;  3E1S A;  1NZ9 A;  2RJC A;  4KBM B;  3UT1 A;  3QZ9 B;  2BUD A;  4MZP A;  3G71 A;  2X4J A;  2P0Q A;  2GCX A;  4MMK A;  5KE3 A;  4C8Q A;  4RKU E;  5KH6 A;  2DXC A;  1S72 T;  5CKH A;  4DOW A;  4EMK B;  1OYX A;  3G71 T;  2LX9 A;  3C95 A;  1YCY A;  3MET A;  4M75 D;  3LGF A;  4X9C A;  3VJP A;  2RM4 A;  1BI0 A;  2DZ9 A;  2R5A A;  1BI2 A;  3BDU A;  4PKC C;  3L2Q A;  3TRE A;  3MCA B;  4JS5 A;  5KCH A;  1ZQ1 A;  3SWN B;  3G6E T;  1RI0 A;  2X35 A;  3FB9 A;  4OP0 A;  4C8Q G;  4C92 A;  5LJ5 d;  1P92 A;  2EFI A;  3G7Z A;  2QTX A;  3PMT A;  4KT0 E;  5KE2 A;  4M7D F;  3HKS A;  2LT1 A;  2XI9 A;  4HA8 A;  4M78 C;  4BI4 A;  2LVM A;  2OTJ T;  5GAN f;  5GAN d;  5J39 A;  4BE2 A;  3QSU A;  2K5I A;  4A4G A;  1PSE A;  4M77 C;  2KSS A;  3FRN A;  1QW1 A;  5GMK i;  4R56 A;  3V7C A;  4EPC A;  1XOV A;  4D6W A;  3JCM Q;  5FRM A;  2QQB A;  4JS4 A;  3JCM e;  2LRQ A;  5DLQ E;  4C92 G;  1OI1 A;  2R57 A;  4ELZ C;  1Q82 U;  2EQU A;  2HQE A;  2QQS A;  2XK0 A;  3DLM A;  3V8K A;  3JCM f;  5GAM j;  1X6O A;  4IUV A;  4ATO A;  2Y90 A;  2EQM A;  2F5K A;  4IUP A;  3OYC A;  5FRN A;  2P0P A;  3QYH B;  1QVG S;  1VQ5 T;  5CKE A;  4RCB A;  2CZ1 B;  1JRI A;  3TCJ A;  5DLO A;  4M7A C;  5LJ5 g;  1I5L A;  3CME T;  3CXC A;  2I2L A;  4N0A A;  3LX7 A;  2D9T A;  1U8R A;  3HRU A;  1UGP B;  3M56 A;  4OVA A;  3SWN A;  3DLL A;  2E6Z A;  4QQG A;  4C0D B;  1YI2 T;  5GAN 3;  3CCS A;  2DXT A;  3BDL A;  4C5G A;  1QVF S;  2L8D A;  2DK3 A;  3VV0 A;  1VIF A;  3JSC A;  3OW2 A;  3CCL A;  1VQN A;  4VUB A;  3A8G B;  4XU3 A;  1DJ7 B;  2LQ8 A;  1KQ2 A;  4QVZ A;  3RIR A;  1Q82 C;  3A5Z B;  5GAO m;  1N27 A;  2XKO C;  4BI3 A;  2MAM A;  5LJ5 h;  1K73 C;  3V7S A;  4M7D B;  2L5Q A;  3KXT A;  2V8I A;  5D6X A;  5DM7 R;  2VGN A;  2M0O A;  5GAN h;  5GAO q;  5GAO l;  2XID A;  3HRT A;  1K8A U;  4X34 A;  4C8Q F;  2PVO B;  3I56 A;  1Y71 A;  1VIE A;  2JZ2 A;  2M16 A;  1HXD A;  4EMK C;  3AHU A;  3QXE B;  1YJW T;  3CBM A;  3S3M A;  2RHY A;  5IT9 E;  2RI2 A;  2IVW A;  3HPW A;  4OB0 B;  4OMF B;  4E7K A;  3I56 T;  1LJO A;  2VGM A;  1Q86 C;  2DIG A;  4PJO E;  3PTA A;  3OMG A;  4C92 F;  2QA4 T;  1VQO A;  2JN0 A;  2EJG A;  1WJS A;  3DKM A;  2QEX T;  3JB9 D;  2CZ7 B;  3M4Y A;  4KUI A;  1QP3 A;  3MEA A;  4XTV A;  3BFM A;  2WSE E;  3KBG A;  3CPF A;  1ZHI A;  2ZPH B;  2GF7 A;  4J7F A;  3CD6 A;  3S6W A;  3QZ5 B;  2FL7 A;  2PU9 B;  4M78 D;  1V29 B;  3ZBD A;  3GOX A;  5C0M A;  2K4Y A;  1BI3 A;  2AHJ B;  4M7D A;  2K2V A;  3LYI A;  2YLC A;  4LDW A;  4M77 D;  3OYE A;  4LD6 A;  1K8A C;  4BE0 A;  4BD3 A;  1JB0 E;  1YIT T;  2EJF A;  1R8O B;  3OBY A;  1W2B S;  3OYD A;  3RES A;  4FM4 B;  4JDS A;  1XNI A;  3OYN A;  4IKF A;  4C5I A;  1LNX A;  2CZ0 B;  2Y4X A;  5CQX A;  3OYF A;  2HD0 A;  1YBY A;  3CPW S;  1VQ9 A;  2K3X A;  4LDY A;  3OY9 A;  1VQM A;  3CC7 T;  4LD9 K;  1M5Q 1;  2DTH A;  4M7A D;  4C8Q B;  1VQP A;  2PVD B;  3F70 A;  1N8R U;  3CCJ A;  2XU8 A;  3QII A;  4XTZ A;  4II1 A;  4WF2 A;  3V8J A;  4P5N A;  4XTX A;  1YJN A;  4EDU A;  3CCQ A;  3MP8 A;  2ZPG B;  2PUK B;  4GLK A;  3PIO A;  5FRO A;  3MP6 A;  3EFR A;  3M53 A;  4N4I A;  1VQ8 T;  4PJO A;  2EIF A;  1PSF A;  3QUI A;  5LJ3 e;  1I8F A;  1YJN T;  4M7D C;  1LOJ A;  3OYJ A;  3J80 E;  5GAM f;  3CCQ T;  5GAM d;  2DKG A;  2EAY A;  1K9M U;  1VQK A;  3J81 E;  5LJ3 f;  2XHC A;  1H64 1;  5A0D A;  4JRQ A;  1NE8 A;  3QPH A;  4UC4 A;  3ASK A;  4PJO G;  4A4F A;  5GMK h;  2PQW A;  2K5F A;  3NTI A;  3OYL A;  2CGH A;  2X4Y A;  3M58 A;  1I81 A;  3MEV A;  1M1K U;  3QJ6 A;  3E9F A;  4HCZ A;  5DY9 A;  1KQS S;  3NTH A;  2DTI A;  1FX7 A;  2DJZ A;  4TVR A;  1N8R C;  2MWO A;  2WSC E;  1SSF A;  5CKB A;  1HK9 A;  4XTW A;  2DTO A;  2KAF A;  2YLB A;  3LH0 A;  1IZ6 A;  4F7U E;  4QVC A;  5AYF A;  3H8Z A;  2OTL A;  2FVU A;  2IG0 A;  3JCM W;  3JB9 G;  4GY5 A;  3GNG A;  4XTU A;  3E19 A;  5IAY A;  3QDR B;  2RHZ A;  3LW5 E;  3HRS A;  5GAO r;  3L2U A;  2B8A A;  3GNF B;  1VQ4 A;  1K9M C;  3HSB A;  2E65 A;  4M75 E;  2DXU A;  1WJQ A;  3P8D A;  4M78 G;  4X9D A;  5CQY A;  3OS2 A;  3LWH A;  2RHI A;  4JRI A;  4F7U B;  1OZ3 A;  3X24 B;  4M77 G;  4E47 A;  2XG8 D;  2JUF A;  3HFO A;  4OF1 A;  3QHS A;  4LDV A;  2M1H A;  3SD4 A;  2L3R A;  2XDP A;  3CCM A;  3CC4 A;  4MML A;  3ME9 A;  4C5E A;  3JB9 I;  3FIF A;  2GFA A;  3CCR A;  2A3L A;  4C0Z A;  3L2W A;  3OYK A;  3JCM d;  2WAC A;  3S3N A;  2H3J A;  2JTF A;  5LJ3 j;  5GAM h;  4NS5 A;  3CCE A;  5LJ5 e;  5GAN 6;  3CCR T;  4NOY A;  4EMH A;  2DVE A;  4C8Q C;  3JCM X;  3M9Q A;  4Y28 E;  5GAN 2;  4JRP A;  1GXI E;  1UGR B;  4KUD K;  2HBP A;  3LWI A;  4BI8 B;  1WQ7 A;  4BY6 B;  2P4T A;  2RI5 A;  5GAN g;  3OYH A;  3WVD B;  5CKD A;  1Q81 U;  3HFN A;  3GPL A;  3NFC A;  3CXC S;  2F69 A;  1KHI A;  4PJO F;  4C92 C;  2ZPE B;  3GIB A;  4F7U A;  3CC2 A;  2Y4Y A;  1U1T A;  1X01 A;  4FL6 A;  4PLI A;  4A54 A;  4ZGE B;  4ZN1 A;  5CKF A;  3CMA A;  3CCS T;  1JJ2 A;  5FU6 B;  5CO7 A;  3OW2 S;  3M54 A;  3CCL T;  3ER0 A;  2XDD A;  4M7D D;  3BW1 A;  4RG2 A;  1M1G A;  3OBW A;  1VQN T;  4XAX B;  3X25 B;  4MDX A;  4ELY C;  3G4S A;  4M75 A;  3OS1 A;  2ZPF B;  1VQ6 A;  3EAE A;  5I2M A;  4F7U G;  3JB9 F;  3L2V A;  4PLL A;  3I55 A;  5CK9 A;  2VV5 A;  3JCM P;  4OB2 B;  3TEE A;  4NL2 A;  3JB9 J;  4Z02 A;  1YJ9 A;  3WXM B;  2M9U A;  1D3B A;  1M4Z A;  1BI1 A;  4EMG A;  1VUB A;  2DPP B;  2RI3 A;  3OS0 A;  3OYA A;  1VQ7 A;  1M8V A;  1Q81 C;  4C0F A;  2RH2 A;  1U1S A;  4M75 G;  4M77 F;  5FU7 B;  4N0A C;  3RMQ A;  3JCM h;  3VKI A;  4DA4 A;  1X75 C;  1YIJ A;  1BKB A;  3SWN C;  1VQ7 T;  5M9O A;  2V8K A;  2ZGW A;  5LJ5 j;  2MWP A;  2RJF A;  2O01 E;  2DIQ A;  3INZ A;  4V2S A;  3PT9 A;  5C6S A;  1QVP A;  4Q5W A;  4IUT A;  2E41 A;  1VQO T;  5I21 A;  2VXE A;  3OSS C;  1BYM A;  5GAN 7;  3M5A A;  4LDU A;  4PJO B;  3VU3 C;  3ZFJ A;  4J6W A;  3J7A F;  3MEU A;  3CD6 T;  4XU1 A;  2RO0 A;  3JCM J;  2GFU A;  3RKW A;  3C4S A;  4C0G A;  4JLG A;  4M78 E;  4Y91 A;  4DOV A;  2K3Y A;  4M77 E;  1M90 U;  5CVI A;  3FLG A;  3VUB A;  5GAN 8;  4J8O A;  4BY6 C;  2CS7 A;  2DO3 A;  4C8Q D;  2E5Q A;  2KK4 A;  4C0D C;  4NL3 A;  1XTD A;  3JRZ A;  2KY9 A;  4HT9 A;  4ME7 A;  1YHQ A;  4MZM A;  3M59 A;  1VQ9 T;  2LT4 A;  4M78 B;  2RA2 A;  1VQM T;  2BIV A;  2MMP A;  4F7U F;  3RMS A;  3VUZ A;  4M77 B;  4YTL A;  4PL6 A;  1BIA A;  1VQP T;  4M7A E;  1WNL A;  3A8O B;  4C92 D;  5FU6 C;  2QXF A;  3L1A A;  5CR2 A;  1MHN A;  3CEY A;  4QQ6 A;  3CCJ T;  2CZ6 B;  4J6Y A;  3FJP A;  4R55 A;  3CCU A;  4HCC A;  1XQH A;  2JVV A;  2XD0 A;  5EG2 A;  4M75 F;  3L2Z A;  4JRK A;  4BUG A;  5LJ3 d;  2HNI A;  2RK2 A;  4FU6 A;  2QQR A;  1KD1 U;  3URG A;  4A4H A;  5LL6 S;  1M90 C;  3GF5 A;  4M7A B;  4XU0 A;  2GQV A;  2LCC A;  4A4K A;  1VQK T;  2E70 A;  2LCL A;  3RKX A;  5D6W A;  2D0Q B;  1M9S A;  2R5M A;  2EJ9 A;  3JCM b;  3MEW A;  2VYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...