4PKCC

Benzylsuccinate alpha-gamma complex
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
41
structure length
41
Chain Sequence
b'CANFFPVPKDADDYEAGKADCVREKEDEKGKYWLSKPIFEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TutD
publication title Structures of benzylsuccinate synthase elucidate roles of accessory subunits in glycyl radical enzyme activation and activity.
pubmed doi rcsb
source organism Thauera aromatica
molecule tags Lyase
total genus 3
structure length 41
sequence length 41
ec nomenclature ec 4.1.99.11: Benzylsuccinate synthase.
pdb deposition date 2014-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08201 BssC_TutF BssC/TutF protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1070 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4pkcC00
4PKCC
chains in the Genus database with same CATH superfamily
4L59A 4ZTJA 1B7TA 1FMKA 3GBQA 3N5BB 2FHDA 2JS0A 2PUKB 1M3BA 1B3QA 4M77G 3FC3A 1X27A 4JRIA 1D09B 1SHGA 2QDYB 3KUFA 4M7AB 3QIIA 2QQSA 3SD4A 2LTOA 1XTDA 5CQYA 1VQKT 3WVDB 4X9DA 1WA7A 4M77A 4J7IA 3CC7Q 4CC4B 3M0SA 1BYMA 2FYKA 2ABLA 3ASKA 5J3BA 3OBWA 4C8QC 2DA9A 1RADB 1MV0B 1N5ZA 5I22A 4C0DB 4FIBA 1P92A 2GQIA 1TTHB 1I0CA 1YWOA 3HTRA 4RTVA 4A53A 3DB3A 1M90U 2JM9A 2GQVA 1QVFA 1Z9ZA 2EKHA 2COYA 1PC0A 3INZA 4BI8B 2RHZA 5DLOA 3VJPA 2K4YA 4A4GA 2A28A 3M4GA 5GAOq 3OW2S 4KH0B 1T0HA 2RQTA 1M90R 1WJSA 1OZ2A 2KY9A 2XKOC 5GAMh 3R6OA 1BI2A 1UTIA 2QGFB 2K9GA 2XK0A 1Q82C 4ESRA 1I81A 2P4TA 1YHQQ 1NM7A 2V8KA 2EJFA 3CCJT 5HK3A 1B34B 3QO3A 4PFZA 2RHUA 1K1ZA 4PLIA 2EKOA 4EMGA 3V8LA 1GCPA 2PVDB 2LP5A 1U8RA 2K3YA 2X4YA 2KDSA 3H0FA 4AFZC 5LJ5d 5GMKh 3FB9A 1NYGA 1GCQC 2LJ3A 3H9NA 4GLKA 2ZPBB 2HDAA 4BI4A 4XU0A 3CXCP 5KYYB 2EYYA 2O2OA 2X4WA 1ZSZA 3CCQT 1D0XA 2KRSA 3QDRB 2VUBA 4FYXB 5GANh 3LLRA 3QPHA 4RTWA 1NPPA 3H41A 3QYHB 2R5MA 3UA6A 3MO8A 3A98A 2V8IA 4ZN3A 1BK2A 3OYAA 2L3PA 4N4IA 4P5NA 1K9MU 1BIAA 3S3NA 3RMQA 4F7UF 1SRMA 1OV3A 4C8QF 1Q7YU 2HBWA 5GJVB 3CCSA 2R57A 2AKKA 3CCEA 2MF2A 2LCCA 4QVCA 4KGXB 1UE9A 2MWOA 2QYZA 2V1QA 5CKBA 3REBB 4KBMB 1Q7YR 2BKDN 3MKDA 4GBQA 4XU2A 1IHVA 4OB2B 1M2VA 2CP3A 3SDZA 3CCSQ 2RQUA 1NJIU 1CKAA 3CCEQ 1D1BA 3O8VA 4F7UE 2GFUA 3TREA 2CP7A 2E70A 4JLGA 2LDMA 2VV5A 1X6GA 3OW2A 3RUXA 4C8QE 4WTOB 1K73C 3H6ZA 2BZ8A 2X35A 4M7DB 2JW4A 3PGGA 2DJQA 1X6BA 5GAMe 1X69A 1EZZB 1QVFP 5D6WA 1WHLA 2DXTA 2XD0A 3SWNC 4WCIA 1PSFA 4QT7A 2HL5C 1HXDA 2RHYA 4J9EA 4QQ6A 2MMPA 4OMLA 3J7AF 4FU6A 1VQ5A 3A8OB 3VRZA 3CCVA 2EW3A 1H3HA 1WHGA 4DEYA 1W1FA 1RAAB 5GMKi 1GBRA 2E12A 5A0LA 3PVLA 2HNIA 3EGDB 2VXEA 1D1AA 3OYKA 1W2BA 2DL8A 3VS3A 3OYFA 1PSEA 1UUEA 5EG2A 1UFFA 5L23A 1VQ5Q 4JJCA 1K0SA 2VGMA 3VV0A 5D6XA 1YJ9A 2EFIA 3UT1A 2E41A 5LL6S 4M75G 5GAOl 2X51A 1UECA 1RAIB 1ZBXA 3NMZC 1G3YA 1VQOA 3A8HB 2C0OA 4F7UB 1M2OA 2D1XA 3M58A 3UA7A 2YUPA 4J6YA 3AT1B 4XTXA 1X6OA 2H3EB 4OMQA 1Q81U 4KUDK 2CZ1B 4IUPA 1RI0A 3VYHB 5ECAA 4M75D 2RM4A 2NUPB 1MMGA 2AT1B 5CK9A 3X26B 1N27A 2HSPA 2YLBA 1YITA 4FM4B 1Q81R 3TSZA 1YNZA 4Z8AA 5GAN3 2L3SA 2K2MA 2C0TA 2VYTA 1MUZA 2FB7A 3C95A 4E47A 1WXUA 1OZ3A 3JB9G 2J05A 4C0ZA 1H8KA 2MAMA 4JJDA 2OTJA 4AMCA 4IIMA 4RG8A 3EH1A 2ZPIB 1QVGP 3CCUT 4FSSA 1NE8A 3L2QA 3WXMB 4KULA 1HJDA 3PT9A 4XK8E 4EIKA 2DPPB 2FPDA 4HKEA 4PLLA 4LUEA 5LJ3f 3JB9D 4CC2A 4C0GA 5FU6C 4BE2A 2OTJQ 1AEYA 2HD0A 2BE7D 2VASA 4XTUA 1PNJA 4PFOA 3RESA 2YRCA 3EH2A 3CPFA 4HT9A 5KCOA 5J39A 2KXCA 3E2UA 1X01A 1QKWA 1FMVA 3V8KA 3CCVT 1K0XA 4HVVA 1XQHA 1UGPB 3HFNA 2DYIA 3EFOB 3HRUA 1NPRA 1R0BG 2OAUA 3HRSA 1I5OB 1QLYA 2LQKA 1X43A 2K5LA 2FZKB 2XG8D 2SRCA 2YSQA 4J9CA 1WGSA 1YJWA 2KXDA 2RMOA 3FDRA 5FLXE 5A2QE 4OGCA 2P84A 2RF0A 3OYIA 1YJ9T 3OYDA 4KH1B 2DD4A 3GNFB 1KD1R 1XNIA 2VB6A 1TUGB 5LJ5e 1VQOT 1N8RU 3M54A 4XQ3A 3QG1A 3O5ZA 1I07A 3L2RA 4BACA 1YJWQ 2DK3A 2IG0A 3JRZA 2EJGA 2X3XD 2VGNA 1YCSB 4RCBA 1FWZA 4CI0C 1N8RR 2ROTA 4BI3A 1BI3A 3DLLA 4MMKA 5FROA 3G4ST 3NTIA 2YHTA 4DEXA 2G6FX 1I5LA 4KRTA 4HT8A 1YITT 3LWIA 1I4K1 1TUCA 3VS1A 4JRKA 1IGQA 4XTVA 2OI3A 2JVVA 2MPXC 3NFCA 3OA6A 5LJ5j 3TCJA 3UDCA 2XDBA 3RKXA 2KNBB 5FU7B 2E64A 2DL4A 5CKDA 3C12A 5GAMf 3JCMJ 2CH4W 1WJQA 3E9FA 1MMAA 2RH2A 3OS5A 4II1A 1OYXA 4FYYB 2Y90A 4M77C 2JN0A 1E7OA 2E5KA 1WXTA 3MCAB 5HKCA 3CEYA 1M30A 2VC8A 4RUGA 1JB0E 3SWNB 4LD6A 1YIJA 2EGAA 3EGUA 1MHNA 4QQDA 1VQ8A 2K2VA 1W70A 3I5RA 1H641 2R58A 5CIUA 4M78A 4M7AG 3CC4T 1K8AR 3CCLA 4C92D 2EYQA 2DRKA 1YWPA 1VQMA 1YIJQ 4XTWA 1VQ8Q 1YJWT 3C0CA 4IUTA 2P0PA 3EFSA 2MCNA 3LYIA 4M7AA 2QXFA 3UPUA 2WSCE 1QVFS 1SKUB 4M7AD 2HEQA 4PJOA 1SSFA 3CCLQ 1OI1A 1OX9A 1WHKA 2DL7A 1BCMA 1VQ4A 1ZHIA 3RMSA 3ER0A 3SHWA 1VQMQ 3JSCA 4AFSC 1GFCA 4QKUA 2OTLA 3CXCA 2M51A 3OSSC 4BY6C 2RJEA 2VWFA 4B6MA 1VQLA 4N0AC 2QGGA 1WYXA 3OYMA 3EAEA 3LWHA 1VQ4Q 4GY5A 3I9QA 3L2VA 3M0QA 1UGVA 1VA7A 2DL3A 2XU8A 2EPDA 3JV3A 4OP0A 2OTLQ 5GANd 3MP1A 1R8OB 1VQNA 5GAN5 2K3XA 2YXYA 3Q1JA 3VS6A 3EG9B 4D8KA 1BI1A 4M78B 4Z02A 2X3WD 5AYFA 2CH4A 3CMAQ 4RTYA 3CC7A 2FPFA 3PVQA 3RERA 1B34A 1YP5A 2LJ1A 2OX7A 4DBFA 1LJOA 2ZPEB 1W6XA 1VQNQ 3IQLA 1D3BB 1AZEA 3MEVA 1QWFA 4PFPA 4PJOB 3HL8A 2DKGA 2R5AA 2CUBA 4E7LA 3LH5A 1UEBA 1TSFA 3V7RA 1Y07A 2E65A 4M77D 4AG2C 5KYYA 2HMAA 4LNPA 2FL7A 2KT1A 2CGHA 4OMNA 4LDYA 3SEMA 2I0NA 2EGEA 4J9IA 4JDSA 1Y71A 3VS7A 4OB0B 3MHXA 2HSEB 4D6WA 1NBEB 1SEMA 1NZ9A 4E7HA 1QVGS 3V7CA 2BZYA 3MJXA 1O9SA 3QUIA 2BIVA 2E4HA 4ZN1A 3GIBA 4O5VA 2G3RA 4AT1B 2CSIA 3E19A 1BB9A 4J8OA 5KCHA 1YHQA 1PD0A 4CC7A 3ZFJA 2KRMA 3LGFA 5GAOp 5CAIA 5KYWB 5LJ5f 2OAWA 3M9QA 1M3AA 3EGXB 5LJ5g 3EHRA 1AWXA 4CRIA 2A0FB 2QASA 2HQHA 3JCMV 3I55A 1KHIA 1XJWB 4OGEA 4JS4A 1M8VA 4HVWA 3GOXA 1VQLT 3MP8A 3AHUA 5KYXB 3BDUA 4A4KA 2J6FA 1XOVA 3L2WA 4L6V5 2ESWA 2BE9B 5CKFA 3L2UA 5D7UA 2JMCA 2RB6A 2RI2A 1F1BB 4M7DG 1IO6A 3TVTA 3FIFA 3I55Q 1TS9A 2FRYA 2GF7A 2D8HA 3JCMh 1M3CA 4QQGA 2DEUA 1VQNT 1FYNA 3RR6A 3LGLA 4HCZA 4DA4A 1ZQ1A 1YBYA 2KRNA 1GRIA 2EVRA 4M7DA 4X1VA 4BE0A 2JT4A 1VQ9A 1YFNA 4NL3A 2DAQA 2NWMA 3CC7T 4LDVA 2CUDA 2HKQB 1R77A 3VS0A 2QTXA 2AKLA 4E7ZA 4LE9A 1M90C 4EMKB 1K73U 1KFZA 4LDWA 5EC7A 1W2BS 4JZ4A 1Y96B 3NGPA 4JJNK 4J9GA 2KEAA 1LNXA 2DBKA 3OQ5A 1VQ9Q 3CD6A 3QZ5B 2VVKA 2KK4A 4M75C 4N4HA 1Y7XA 3S3MA 1UGRB 2PZ1A 2LX7A 1IZ6A 2KYBA 1K9MR 2EYZA 3G71A 1C0MA 4HA8A 1QMCA 3OYCA 8AT1B 3ZBDA 5DY9A 4B9WA 1WX6A 3MP6A 3MEAA 1PWTA 3CD6Q 2F69A 2DNUA 3ZL7C 1QVGA 3M53A 2HKNA 5FRMA 1WIEA 3EGDA 4E7KA 4ZGJB 1QQJA 2QEXQ 1CKBA 4EMHA 3G71Q 2L8DA 3PIPA 1YHQT 4D8DA 2MOXA 2D0NA 2DYBA 1RAFB 2DXBA 1UG1A 3G1JA 3QWXX 3QWYA 1NJIR 4F7UA 2DX1A 1S1NA 2EBPA 4ELYC 1QVPA 5KE2A 1N9RA 2COWA 1AZGB 4BY6B 5CR2A 1X2QA 4MZPA 1EFNA 3RNJA 1KC8U 3OYJA 2D9TA 2O4XB 1OULA 2NUPA 4EPCA 1WDXA 1H3ZA 1K9MC 2RD1A 3J81E 3CMEA 1VQPA 1HSQA 5FW9A 2YT6A 4R0KA 1KK7A 1OPLA 1KC8R 4PJLA 2CZ7B 3X24B 4R56A 1NLOC 2CZ6B 1K76A 2F2VA 2DTIA 1Q7YC 3QZ9B 3OYNA 3CC2A 2QAZA 5GAOm 4PKCC 2QG9B 2JOYA 1BKBA 3JCMe 1UJYA 1WXBA 5C6SA 1VQ7A 2K5FA 3CMEQ 2CP5A 3M4YA 1VQPQ 1KIKA 3EG3A 1ZLMA 4C5EA 2MK5A 3PIOA 3QJ6A 2DRMA 2FRWA 1NJIC 1G5VA 2EGCA 3HRTA 4E7JA 1M1KU 3CC2Q 2NUTB 4M75F 4F14A 4LDXA 4E7SA 2ECZA 2PTKA 5LJ5h 5IT9E 3CD6T 1VQ7Q 2PVOB 1HYOA 2EYWA 5I21A 1WHJA 1Q86U 1M1KR 3CCST 4ZGEB 3CCET 5DLQE 3G71T 2EQMA 1MMDA 4A4FA 5HY6A 2E5QA 4C8QB 4ZGDB 2DL5A 3H0IA 2RK1A 3EFOA 2D0QB 1LPLA 5CKEA 2WSFE 3UF4A 1Q86R 1V76A 2RA2A 1YI2A 5GMKj 2A37A 2X4XA 2LCLA 1AWOA 4M75E 3OYGA 5D6YA 1D1CA 1QCOA 3CCMA 5A0GA 2F2WA 1MNEA 3JB9F 5GANj 1CSKA 2AHJB 1KG1A 5FRNA 2DO3A 2HL3A 1YI2Q 3P8HA 1VYTA 1NEBA 3JCMQ 4FYVB 4IUQA 3FLGA 3M0UA 3S3OA 1V1CA 2CT4A 1ZSGA 1TUDA 4ME7A 3CCMQ 2FO0A 2QA4A 2P4RA 2F5KA 3G6EA 2AZSA 1WHMA 3T9NA 1ZUKA 3P8DA 4DBRA 4C92C 3UWNA 2RNAA 3EG0A 2ZZDA 2YRVA 5GAN6 3VU3C 3ZEHA 5GAN2 4YTLA 5KYUB 3CC2T 2QA4Q 1VQ5T 4RG2A 5IHNA 2ED0A 3G6EQ 4X9CA 3OYHA 3VS5A 4M7AC 4A4EA 1Q81C 2E1HA 2K57A 3BE3A 2EQJA 1PM3A 4AG1C 1ZBJA 3FJPA 2H3JA 3A8MB 3D7SB 2EQKA 1D0YA 3M0PA 2CT3A 2DERA 3SWNA 4AFQC 1Y57A 4M75B 3F70A 2M16A 1IGUA 1Y0MA 5GAN7 4XTZA 2DXCA 3E1SA 2LX9A 5LJ3d 1WFWA 2IIMA 3CXCS 2JZ2A 3OS0A 4XU1A 1FX7A 2JTEA 2EIFA 1MV3A 3QHSA 4Q5WA 3HFOA 4MZTA 1B07A 2KGTA 1TG0A 2Y4XA 2E3HA 3GP8A 4OMMA 2J6OA 3VRYA 2CZ0B 2DFUA 2YRDA 1YN8A 3CCMT 3FRNA 1T3LA 4QVDA 2GGRA 3L42A 4OMPA 1NYFA 2KMTA 1PKTA 3TSWA 2FVUA 4F04B 2OTJT 4IUUA 5A0DA 3OYEA 3CPWA 4IUVA 1UGQB 2JM8A 1WHHA 1VQ6A 3REAB 3JCMP 4C5HA 4ANJA 4C92F 1KD1C 1X75C 4HCKA 4M78G 2O01E 5HK0A 2LJ0A 2DILA 2KYMA 3H8ZA 3OS2A 1C1AA 3PTAA 1N8RC 1VQ6Q 4M7AF 2I2LA 3JCMf 2DTOA 5GAN8 2LNHB 5M9OA 3QDFA 2MWPA 3CQTA 3JCMg 3EG9A 1BI0A 2PNIA 4M78D 1WQ7A 4PJOG 2E6ZA 1VQKA 3RKWA 4DBHA 4C92E 2F1LA 1OOTA 1AWWA 1FMWA 1IRXA 4LN2A 1D3BA 4BB7A 1WJRA 4IKFA 1OU8A 1OX8A 2DLPA 1SSHA 5GAMd 2C06A 2LVMA 1EIFA 1UDLA 3CBPA 3JB9J 2K5IA 1PRLC 4PJOD 3HP9A 4M7AE 4AFUC 1VQKQ 3LW5E 4J83A 1SG5A 3UATA 1NLPC 1VOMA 2DIQA 3H0HA 4MZMA 1WPYA 2F5TX 2QTVA 1QCFA 3WVEB 3I35A 4JJBA 2JS2A 2EQIA 1H92A 1YJNA 4FW2A 1TU0B 2PVGB 1PCXA 2KQWA 1M1GA 3M56A 4OMFB 2FZCB 1IHWA 1ZSZC 1UB4A 3EFRA 3GLXA 2X9HA 2FEIA 4M7DC 2E10A 3SB2A 1K8AC 3VS4A 3CMAA 1G3WA 2MYSA 1TOVA 5KYWA 2CREA 4N4GA 4PL6A 1YJNQ 2LQNA 3EGXA 4F16A 7AT1B 4FSXA 4BDZA 1RUWA 2K7AA 4M77F 3ULRB 2JNGA 1G8XA 4C0FA 4XU3A 2RPNA 1KQ1A 1PD1A 5KYXA 4KGZB 4Z88A 3HKSA 3GPLA 5I2SA 2KROA 1BCOA 2QK0A 3CCQA 4F17A 1TH7A 4E2FB 5KH6A 4C92B 1UHCA 4ZNXA 2B8AA 5FU6B 1N9SA 2L3QA 1YIJT 3KFVA 1Q82U 3MPUB 1VQ8T 2EQUA 4KT0E 2QQRA 3BFMA 2L3RA 3L1AA 3CPWP 4M77E 1AWJA 3I5SA 3M57A 3ME9A 5I2MA 1GBQA 4BD3A 5GMKl 5CKHA 3CCQQ 3CCLT 2LCSA 2RJCA 1Q82R 2QI2A 3NPFA 3BDLA 1VQMT 1UGSB 3M55A 3V7SA 1I8FA 2CSQA 3OYLA 2RJFA 4EMKA 3FJ5A 2DZ9A 1NEGA 2DBMA 2O31A 1Y96A 2LC4A 3A8LB 5J26A 1WLPB 1QP3A 1K9AA 2RQWA 4VUBA 1PKSA 3NTHA 2HAXA 3OYBA 1VQ4T 4NL2A 4PJNA 1KQ2A 3KBGA 2SEMA 1RACB 2IPOB 1JO8A 2COZA 1E6HA 1RAGB 2OTLT 1G3TA 4JZ3A 3VUBA 4J7FA 1YJNT 2XIDA 4DBQA 1AD5A 2PQWA 4ORZA 4M7DF 3VUZA 4FW1A 3I56A 1JJ2A 1OU9A 4C5IA 2Y4YA 4BDYA 4CC3A 3J80E 2WSEE 1IXDA 1GFDA 3DB4A 2LT4A 3RKYA 2DE0X 1K4US 3CMAT 1AT1B 1BU1A 1I1JA 2IVWA 3NTKA 2B86A 3LH0A 4RCCA 2LZ6B 2LNVA 2PU9B 1MGQA 4A4HA 1VIFA 2YLCA 1C6VX 2LQ8A 4RTXA 3I56Q 2A36A 2KAFA 5IHIA 1KQSA 2HZYA 4M7DD 2C0IA 2M0OA 2DD5A 5LJ3e 4M7DE 4N0AA 1RI9A 4M77B 1SPKA 2O4XA 2M0YA 4RTUA 1QW1A 4DOWA 2M9UA 4JRPA 4RMOA 1ABQA 2ATCB 2GBQA 1AOJA 3M0RA 2YUOA 4V2SA 2LT1A 3X20B 1K73R 9ATCB 2A3LA 2ED1A 1QKXA 2DM1A 2QEXA 3VKIA 4J9HA 1GL5A 3BY7A 3MEUA 1DJ7B 4JLIA 1RAHB 3OMCA 5LJ3j 3JB9H 3PMIA 2E6NA 4HCBA 2JUFA 5GAOr 4PJJA 2EYXA 3JCMW 3CCRA 4F7UG 3HSBA 4UC4A 1GXIE 2NUTA 3DKMA 2RHIA 5GJWB 1IB8A 4J9FA 1M27C 4A63B 4C8QG 5DM7R 1JXOA 1WZOA 4M4ZA 4HVUA 3RDVA 3QSUA 1RLQC 1M5Q1 3QKJA 2BUDA 2K3BA 1R0CB 1T0JA 4L5GA 4J9BA 1LCKA 3I55T 3CCRQ 2J06A 2XMFA 2EJ9A 4DOVA 4C8QA 3EHQA 1VIEA 2RK2A 5KE3A 4C8QD 5IN1A 1PRMC 5CO7A 4RTZA 4O6JA 3I56T 2A08A 1WNLA 2RI3A 1S72A 3OMGA 3A5ZB 3RIRA 3E9GA 4BUGA 5FU7C 1ZSZB 3JCMX 2O9VA 2AIRB 3SFMA 2CYZB 2GFAA 3C94A 2D6FA 5KYNA 3META 5C0MA 4PJMA 2GTJA 1X2KA 2DVJA 3X25B 8ATCB 3CCUA 4MDXA 2L0AA 2DEQA 5IAYA 2GNCA 4FL6A 2MI6A 2ENMA 1S72Q 4J6WA 1VQ9T 4J9DA 4Y28E 1LVKA 2BZXA 1JJ2P 3QYGB 3CCUQ 2VXFA 4LDUA 3TU4K 5GMKe 2O88A 2M02A 2ZAEA 2PUOB 2KBTA 1M4ZA 4QW2A 2ZPGB 3HPWA 2P0KA 3URGA 6AT1B 5GAMj 4ATOA 1GCQA 1QCNA 3QXEB 2RO0A 1KJWA 2LRQA 3GF5A 1KQSP 2JTMA 1G2BA 5GANe 5KYUA 4XTYA 2K6DA 2QEXT 1M2VB 2J6KA 1JEGA 4XAXB 2CDTA 5GAN4 1KC8C 3CCVQ 5I11A 4K11A 1RAEB 1ZUYA 4ZTFA 2JTFA 3OB9A 1VYUA 3CCRT 2FZGB 2RQVA 2RHXA 3GNGA 2W0ZA 1JRIA 4PNOA 3JCMb 4FCYA 5IXFA 1O75A 3M59A 4WF2A 4Z89A 4Y92A 5FWCA 1OQKA 2XI9A 4MMLA 3JAME 1YJ9Q 4M75A 5IHKA 2ZGWA 1G3SA 1KHCA 1U3OA 2DXUA 2QQBA 4OVAA 3G4SA 4IIOA 1VQOQ 2L5QA 2MIOA 4OB3B 2V1RA 1D0ZA 1U06A 2AK5A 2DMOA 3CPWS 2CP6A 1OEBA 2XDDA 3DLMA 3A8GB 1M1KC 1S72T 3OSVA 1ACMB 3X28B 5IH2A 3CMET 3OYYA 1JBMA 1VQPT 4M78C 4X34A 3EG2A 3G4SQ 1QP2A 2HQXA 2W10A 2X4JA 4E7IA 4KUIA 1YITQ 1VUBA 1Q86C 1SRLA 2KT8A 2V8JA 2ZPFB 2A7YA 5L8RE 1WQWA 2DIGA 2FPEA 2QQ9A 1VQ7T 3KXTA 3OW2P 4PJOC 5GAOn 5LJ3g 2JJ9A 3OBYA 3C4SA 3LX7A 1KSWA 4NS5A 2VKNA 5AT1B 4OB1B 3QBYA 2L89A 4FT4A 1SHFA 1M8MA 3CC4A 1IREB 2J7IA 1YCYA 4C0DC 3PFSA 2DTHA 2HCKA 2NYSA 4IURA 1PG5B 1HD3A 1FXXA 1LOJA 5IXBA 4EDUA 1KD1U 4GLMA 1ABOA 4OMOA 3TQ7P 1JU5C 1JQQA 2ROLA 3OY9A 3M0TA 2XDPA 2HBPA 3CC4Q 1RLPC 3BW1A 2M1HA 4BE1A 1YI2T 2E3IA 4JS5A 4LD9K 4LUDA 1OPKA 3CBOA 5CVIA 2XICA 4FYWB 2RJDA 1Q95G 2GTOA 3NHNA 1PHTA 4JPBW 5HCKA 1W2BP 1U5SA 2HQEA 1T3SA 2XHCA 2CKKA 3THKA 1SF9A 2RN8A 1QWEA 2DVEA 1N6AA 3EG1A 4RKUE 1TWBA 1U1SA 4A54A 1EX4A 3S6WA 2WACA 3P8BB 1A0NB 1J3TA 1E6GA 1V29B 2YUQA 1U1TA 3HHTB 1MNDA 2QA4T 2LMJA 4M78F 2QDLA 3G6ET 2KVQG 4PK4A 2GCXA 2V26A 4FT2A 3TEEA 1ZA2B 3JCMc 4LXCA 3PNWC 5GAMg 1BBZA 1NG2A 3RBBB 1UHFA 4C5GA 2P0QA 4HXJA 2KSSA 4J5YA 4QVZA 4B9XA 4PJOF 4EMKC 2KI7A 2Z0WA 2YWWA 4JUVA 5FWBA 4C92G 1AVZC 2LQWA 4NOYA 5CCAA 1K8AU 4M78E 2OJ2A 2NUZA 1JXMA 2RQRA 2H8HA 4MDWA 2RI5A 2YDLA 2AZVA 2K79A 4J6XA 1W4SA 4C92A 4RTTA 2DZCA 2FG0A 5GANf 2CP0A 1M1FA 5GANg 1RL2A 3V8JA 2DF6A 3VYGA 4PJOE 1WI7A 1ZUUA 2JXBA 2BTTA 3G7ZA 1TXQA 4E6RA 2KR3A 2L2PA 4OF1A 3L2ZA 1ZA1B 2YUNA 1Z9QA 3JB9I 4R55A 4Y91A 1HK9A 4TVRA 3JCMd 2CS7A 2ZPHB 3FEOA 4DQ2A 1VYVA 3PE0A 1JJ2S 4ELZC 3U23A 1AHJB 3M5AA 2O9SA 3R6NA 3MEWA 2KE9A 1ARKA 2DETA 2QQAA 1G83A 1M9SA 3CCJA 3OS1A 5CQXA 4JRQA 2DJZA 2EAYA 4KGVB 5LJ3h 1KQSS 2D8JA 1BIBA 1VQ6T 1UJ0A 5GMKm 2JMAA 1MMNA 4HCCA 2F2XA 1VQLQ 2CP2A 3PMTA 3QJYA 3CBMA 3VS2A 3CCJQ 1RABB 2ZCFB 3A1PA 2EWNA 2NLUA 1ZX6A
chains in the Genus database with same CATH topology
5LJ5j 4L59A 4ZTJA 2LCLA 3BY7A 3MEUA 1DJ7B 3N5BB 2FHDA 2PUKB 4JLIA 4M75E 3TCJA 3OMCA 3UDCA 5LJ3j 2XDBA 3JB9H 3PMIA 3OYGA 3RKXA 4M77G 2E6NA 3FC3A 5FU7B 5D6YA 4HCBA 2JUFA 5GAOr 2E64A 4JRIA 5CKDA 3CCMA 3JCMW 3C12A 5A0GA 5GAMf 3JCMJ 3CCRA 3JB9F 4F7UG 1WJQA 3E9FA 2AHJB 5GANj 2QDYB 2RH2A 3KUFA 3HSBA 4UC4A 4M7AB 5FRNA 3OS5A 2QQSA 3QIIA 3SD4A 2DO3A 4II1A 1GXIE 1OYXA 2LTOA 1XTDA 3DKMA 2RHIA 5CQYA 2Y90A 1VQKT 4M77C 3WVDB 4C8QG 3P8HA 5DM7R 2JN0A 4X9DA 3JCMQ 4M77A 4IUQA 4J7IA 3QSUA 3FLGA 3MCAB 5HKCA 1M5Q1 3QKJA 2BUDA 3CEYA 3S3OA 1BYMA 2VC8A 2FYKA 4L5GA 4ME7A 3ASKA 5J3BA 1JB0E 3OBWA 3I55T 2QA4A 4C8QC 3SWNB 2F5KA 4LD6A 1YIJA 3G6EA 2EJ9A 4DOVA 1MHNA 4QQDA 4FIBA 4C0DB 4C8QA 1P92A 1VQ8A 2K2VA 1VIEA 2RK2A 3T9NA 5KE3A 3P8DA 4C8QD 1H641 2R58A 4C92C 5CIUA 1QVGS 5IN1A 3UWNA 4M78A 4A53A 5CO7A 4M7AG 4O6JA 3I56T 3DB3A 3CC4T 2ZZDA 1WNLA 2YRVA 2RI3A 4C92D 2GQVA 3OMGA 5GAN6 3A5ZB 1S72A 3RIRA 3CCLA 3E9GA 3VU3C 3ZEHA 5FU7C 4BUGA 1QVFA 3JCMX 3INZA 5GAN2 4YTLA 4BI8B 3CC2T 2EYQA 2RHZA 5DLOA 3SFMA 3VJPA 2CYZB 1VQMA 4RG2A 1VQ5T 2GFAA 3C94A 4XTWA 2D6FA 2K4YA 4X9CA 4A4GA 3M4GA 3META 5C0MA 3OYHA 1YJWT 4M7AC 4IUTA 4A4EA 3X25B 5GAOq 3CCUA 3OW2S 2P0PA 3EFSA 1Q81C 2E1HA 2K57A 1YI2A 4MDXA 1WJSA 3LYIA 1OZ2A 4M7AA 2QXFA 3UPUA 2EQJA 2KY9A 2WSCE 1QVFS 2XKOC 2DEQA 4M7AD 5IAYA 4PJOA 5GAMh 4FL6A 2MI6A 1SSFA 3FJPA 1BI2A 2H3JA 3R6OA 1OI1A 3A8MB 1VQ4A 2XK0A 4J6WA 1VQ9T 1Q82C 1ZHIA 1I81A 3RMSA 3ER0A 2P4TA 4Y28E 2V8KA 2EJFA 3CCJT 5HK3A 2EQKA 3JSCA 3QYGB 1B34B 3QO3A 3VKIA 2RHUA 2OTLA 1K73C 4PLIA 2EKOA 2VXFA 3CXCA 4LDUA 4EMGA 3SWNA 3V8LA 3OSSC 4BY6C 2PVDB 2RJEA 3TU4K 4M75B 5GMKe 3F70A 2PUOB 1U8RA 1VQLA 2K3YA 4E7HA 2M16A 2X4YA 1M4ZA 2KDSA 5GAN7 4N0AC 5LJ5d 4QW2A 3OYMA 2ZPGB 3HPWA 4XTZA 3FB9A 5GMKh 2DXCA 2P0KA 3EAEA 3E1SA 3URGA 3LWHA 4GY5A 2LX9A 5LJ3d 3L2VA 4GLKA 5GAMj 4ATOA 2ZPBB 4BI4A 4XU0A 3CXCS 2JZ2A 2RO0A 2XU8A 2LRQA 3GF5A 3QXEB 3OS0A 2JTMA 2X4WA 4XU1A 1FX7A 3CCQT 4OP0A 5GANe 2EIFA 4XTYA 5GANd 2QEXT 3QDRB 3MP1A 2VUBA 4XAXB 3QHSA 5GANh 4Q5WA 3LLRA 3HFOA 5GAN4 3QPHA 1NPPA 4MZTA 1R8OB 1KC8C 1VQNA 2Y4XA 5GAN5 2K3XA 3Q1JA 3GP8A 3QYHB 2CZ0B 2R5MA 4ZTFA 1BI1A 3MO8A 4M78B 3CCMT 2JTFA 3OB9A 2V8IA 3FRNA 4ZN3A 3OYAA 3CCRT 4N4IA 2RHXA 3GNGA 4P5NA 4Z02A 4QVDA 1JRIA 5AYFA 1K9MU 4PNOA 3JCMb 1BIAA 3S3NA 3CC7A 3L42A 3RMQA 4F7UF 3RERA 1O75A 1B34A 2KMTA 3M59A 4WF2A 2FVUA 1LJOA 2ZPEB 2OTJT 4C8QF 4IUUA 1D3BB 5A0DA 1Q7YU 2XI9A 3OYEA 4MMLA 3JAME 4M75A 3CCSA 2R57A 3MEVA 2ZGWA 1UGQB 4IUVA 1G3SA 3CPWA 3CCEA 2MF2A 1KHCA 2LCCA 3JCMP 4C5HA 4QVCA 4PJOB 2DXUA 2DKGA 3HL8A 2R5AA 4C92F 1KD1C 2MWOA 1VQ6A 4E7LA 1X75C 2QQBA 4OVAA 3G4SA 2L5QA 1UEBA 5CKBA 3V7RA 1Y07A 2E65A 4M77D 4KBMB 4M78G 4OB3B 2BKDN 2O01E 5HK0A 3CPWS 2FL7A 4XU2A 2XDDA 2CGHA 3DLMA 4OB2B 4LDYA 3A8GB 3H8ZA 1M1KC 3OS2A 3SDZA 1S72T 1NJIU 3OSVA 3PTAA 1N8RC 3X28B 4JDSA 1Y71A 4OB0B 3MHXA 2I2LA 3JCMf 3O8VA 4M7AF 3CMET 4F7UE 2GFUA 3OYYA 3TREA 1JBMA 2DTOA 2E70A 5GAN8 1VQPT 4M78C 4D6WA 5M9OA 4JLGA 2MWPA 4X34A 2LDMA 3JCMg 2VV5A 1NZ9A 1QP2A 1BI0A 2HQXA 2X4JA 3V7CA 3RUXA 3QUIA 1O9SA 4C8QE 3OW2A 2BIVA 4KUIA 4ZN1A 1VUBA 4O5VA 4E7IA 2G3RA 1Q86C 3GIBA 4M78D 3H6ZA 1WQ7A 4PJOG 3E19A 4J8OA 2V8JA 2E6ZA 2ZPFB 5KCHA 2X35A 1VQKA 1YHQA 2A7YA 5L8RE 3RKWA 1WQWA 2DIGA 3ZFJA 4C92E 4M7DB 3LGFA 5GAOp 5CAIA 5LJ5f 2QQ9A 3PGGA 3M9QA 1VQ7T 5LJ5g 3KXTA 1D3BA 4BB7A 1WJRA 4CRIA 4IKFA 5GAMe 4PJOC 5GAMd 5GAOn 3JCMV 5LJ3g 2LVMA 1EIFA 2C06A 3I55A 3CBPA 3OBYA 3JB9J 1KHIA 2K5IA 4OGEA 5D6WA 4PJOD 3HP9A 4JS4A 4M7AE 1M8VA 3C4SA 3LX7A 2DXTA 3LW5E 3GOXA 4NS5A 1VQLT 3MP8A 4J83A 4OB1B 3AHUA 2XD0A 3QBYA 2DIQA 3OA6A 2L89A 3BDUA 4FT4A 4MZMA 1WPYA 4A4KA 2F5TX 1XOVA 3SWNC 3L2WA 3CC4A 1IREB 4L6V5 1PSFA 1YCYA 3WVEB 1HXDA 2RHYA 3PFSA 4QQ6A 2MMPA 5CKFA 4C0DC 2RB6A 2DTHA 3L2UA 3J7AF 2RI2A 4FU6A 1YJNA 4IURA 4M7DG 2PVGB 3FIFA 1FXXA 1VQ5A 3A8OB 2KQWA 3CCVA 1LOJA 1M1GA 3M56A 4OMFB 4EDUA 2GF7A 1KD1U 3JCMh 4QQGA 4V2SA 1VQNT 1UB4A 5GMKi 3OY9A 2E12A 3EFRA 5A0LA 3GLXA 3LGLA 4HCZA 4M7DC 2XDPA 2HBPA 4DA4A 1ZQ1A 1YBYA 2E10A 3SB2A 1K8AC 3CMAA 3BW1A 2M1HA 1G3WA 4BE1A 2HNIA 4M7DA 1YI2T 4JS5A 2VXEA 3OYKA 1W2BA 4LD9K 3OYFA 4BE0A 1VQ9A 4N4GA 4PL6A 3CBOA 5CVIA 4NL3A 2XICA 1PSEA 2DAQA 5EG2A 2VGMA 3VV0A 3CC7T 4LDVA 4FSXA 5D6XA 1YJ9A 4BDZA 2EFIA 2QTXA 3UT1A 2E41A 2RJDA 5LL6S 4M75G 5GAOl 1M90C 4EMKB 1K73U 4M77F 4LDWA 1ZBXA 2JNGA 1W2BS 1G3YA 1VQOA 1Y96B 4JJNK 3A8HB 4F7UB 2HQEA 4C0FA 4XU3A 3M58A 2XHCA 1LNXA 1KQ1A 2CKKA 4J6YA 3OQ5A 3HKSA 2DVEA 3GPLA 3CD6A 3QZ5B 1N6AA 4RKUE 4XTXA 1X6OA 5I2SA 1M90U 1U1SA 4A54A 2KK4A 4M75C 4N4HA 1Y7XA 2WACA 1UGRB 3P8BB 3S6WA 3S3MA 1Q81U 4KUDK 2CZ1B 1IZ6A 4IUPA 3CCQA 1V29B 1TH7A 1RI0A 3VYHB 5KH6A 4C92B 1U1TA 3HHTB 4M75D 2RM4A 3G71A 2B8AA 4HA8A 5FU6B 4M78F 2QA4T 1N9SA 3OYCA 1YIJT 5CK9A 3G6ET 3ZBDA 1Q82U 3X26B 1N27A 5DY9A 4B9WA 2YLBA 2KVQG 1VQ8T 3MP6A 3MEAA 2GCXA 3TEEA 4FT2A 2EQUA 4FM4B 1YITA 4KT0E 2F69A 2QQRA 5GAN3 3BFMA 2L3RA 1QVGA 3L1AA 3M53A 4M77E 5FRMA 3M57A 3ME9A 4E7KA 5I2MA 3JCMc 4BD3A 5GMKl 3PNWC 5CKHA 4ZGJB 3CCLT 5GAMg 2VYTA 2FB7A 3C95A 2RJCA 4C5GA 4EMHA 4E47A 2L8DA 2P0QA 2QI2A 3PIPA 1YHQT 1OZ3A 3JB9G 2KSSA 3BDLA 4J5YA 4QVZA 4B9XA 4C0ZA 4PJOF 4EMKC 1VQMT 2MAMA 1UGSB 2DXBA 3M55A 3V7SA 1I8FA 2OTJA 4RG8A 3OYLA 2RJFA 4EMKA 2ZPIB 4JUVA 3CCUT 4C92G 2DZ9A 1KG1A 1Y96A 2LC4A 1NE8A 3A8LB 4NOYA 5J26A 4F7UA 3L2QA 3WXMB 5CCAA 1QP3A 4KULA 1K8AU 4M78E 4ELYC 3PT9A 4XK8E 4VUBA 1QVPA 5KE2A 3NTHA 2DPPB 3OYBA 2HAXA 1N9RA 1VQ4T 4NL2A 4HKEA 4BY6B 4MDWA 2RI5A 4PLLA 3KBGA 5CR2A 1KQ2A 5LJ3f 4MZPA 3JB9D 1KC8U 4J6XA 4C0GA 1W4SA 5FU6C 3OYJA 4BE2A 4C92A 2D9TA 2OTLT 2O4XB 2DZCA 2HD0A 1G3TA 4XTUA 3VUBA 4EPCA 4J7FA 3RESA 1H3ZA 3CPFA 5GANf 4HT9A 1K9MC 1YJNT 2RD1A 5KCOA 2XIDA 5J39A 3J81E 3CMEA 1M1FA 5GANg 1RL2A 1VQPA 3V8JA 1X01A 3V8KA 3VYGA 3CCVT 4PJOE 2CZ7B 3X24B 4R56A 2PQWA 4M7DF 3VUZA 2CZ6B 3I56A 3G7ZA 1JJ2A 2DTIA 1Q7YC 1XQHA 1UGPB 4C5IA 2Y4YA 4BDYA 3J80E 2WSEE 3HFNA 3DB4A 2LT4A 4OF1A 3RKYA 3HRUA 3QZ9B 1NPRA 3L2ZA 3OYNA 2OAUA 3HRSA 3CC2A 5GAOm 4PKCC 2LQKA 3CMAT 2K5LA 2JOYA 1BKBA 3JB9I 3JCMe 2XG8D 4Y91A 4R55A 1HK9A 4TVRA 2IVWA 3NTKA 2CS7A 2ZPHB 3FEOA 3JCMd 5C6SA 1WGSA 1YJWA 2K5FA 4DQ2A 1VQ7A 3M4YA 3LH0A 3FDRA 4RCCA 5FLXE 1JJ2S 5A2QE 2PU9B 2LNVA 4A4HA 1MGQA 4OGCA 4ELZC 1AHJB 4C5EA 3M5AA 1VIFA 3OYIA 2YLCA 1YJ9T 3MEWA 2LQ8A 3PIOA 3OYDA 2KAFA 3QJ6A 1KQSA 2DD4A 2QQAA 1NJIC 1G5VA 3GNFB 3HRTA 4E7JA 1M1KU 4M7DD 1XNIA 5LJ5e 1VQOT 1M9SA 1N8RU 3M54A 4M75F 4XQ3A 3CCJA 2M0OA 4LDXA 3QG1A 3OS1A 2DD5A 5LJ3e 4M7DE 4N0AA 5CQXA 5LJ5h 4JRQA 5IT9E 2DJZA 3L2RA 4BACA 4M77B 3CD6T 2DK3A 2EAYA 2O4XA 2PVOB 2IG0A 3JRZA 5LJ3h 5I21A 2EJGA 1KQSS 1QW1A 4DOWA 2VGNA 1Q86U 2M9UA 3CCST 4RCBA 4JRPA 1BIBA 4ZGEB 4RMOA 1FWZA 4CI0C 1VQ6T 3CCET 5DLQE 5GMKm 3G71T 2EQMA 4BI3A 1BI3A 4A4FA 3DLLA 4HCCA 5HY6A 2E5QA 4MMKA 5FROA 2LT1A 3NTIA 2YHTA 4C8QB 3G4ST 3PMTA 3QJYA 3X20B 3CBMA 4ZGDB 1I5LA 2RK1A 4HT8A 1YITT 2ZCFB 2D0QB 3LWIA 1I4K1 2A3LA 5CKEA 2WSFE 4JRKA 4XTVA 2QEXA 2EWNA 2RA2A 2NLUA 5GMKj 2JVVA 2X4XA 3NFCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PKC C; 
#chains in the Genus database with same CATH topology
 4L59 A;  4ZTJ A;  1B7T A;  1FMK A;  3GBQ A;  3N5B B;  2FHD A;  2JS0 A;  2PUK B;  1M3B A;  1B3Q A;  4M77 G;  3FC3 A;  1X27 A;  4JRI A;  1D09 B;  1SHG A;  2QDY B;  3KUF A;  4M7A B;  3QII A;  2QQS A;  3SD4 A;  2LTO A;  1XTD A;  5CQY A;  1VQK T;  3WVD B;  4X9D A;  1WA7 A;  4M77 A;  4J7I A;  3CC7 Q;  4CC4 B;  3M0S A;  1BYM A;  2FYK A;  2ABL A;  3ASK A;  5J3B A;  3OBW A;  4C8Q C;  2DA9 A;  1RAD B;  1MV0 B;  1N5Z A;  5I22 A;  4C0D B;  4FIB A;  1P92 A;  2GQI A;  1TTH B;  1I0C A;  1YWO A;  3HTR A;  4RTV A;  4A53 A;  3DB3 A;  1M90 U;  2JM9 A;  2GQV A;  1QVF A;  1Z9Z A;  2EKH A;  2COY A;  1PC0 A;  3INZ A;  4BI8 B;  2RHZ A;  5DLO A;  3VJP A;  2K4Y A;  4A4G A;  2A28 A;  3M4G A;  5GAO q;  3OW2 S;  4KH0 B;  1T0H A;  2RQT A;  1M90 R;  1WJS A;  1OZ2 A;  2KY9 A;  2XKO C;  5GAM h;  3R6O A;  1BI2 A;  1UTI A;  2QGF B;  2K9G A;  2XK0 A;  1Q82 C;  4ESR A;  1I81 A;  2P4T A;  1YHQ Q;  1NM7 A;  2V8K A;  2EJF A;  3CCJ T;  5HK3 A;  1B34 B;  3QO3 A;  4PFZ A;  2RHU A;  1K1Z A;  4PLI A;  2EKO A;  4EMG A;  3V8L A;  1GCP A;  2PVD B;  2LP5 A;  1U8R A;  2K3Y A;  2X4Y A;  2KDS A;  3H0F A;  4AFZ C;  5LJ5 d;  5GMK h;  3FB9 A;  1NYG A;  1GCQ C;  2LJ3 A;  3H9N A;  4GLK A;  2ZPB B;  2HDA A;  4BI4 A;  4XU0 A;  3CXC P;  5KYY B;  2EYY A;  2O2O A;  2X4W A;  1ZSZ A;  3CCQ T;  1D0X A;  2KRS A;  3QDR B;  2VUB A;  4FYX B;  5GAN h;  3LLR A;  3QPH A;  4RTW A;  1NPP A;  3H41 A;  3QYH B;  2R5M A;  3UA6 A;  3MO8 A;  3A98 A;  2V8I A;  4ZN3 A;  1BK2 A;  3OYA A;  2L3P A;  4N4I A;  4P5N A;  1K9M U;  1BIA A;  3S3N A;  3RMQ A;  4F7U F;  1SRM A;  1OV3 A;  4C8Q F;  1Q7Y U;  2HBW A;  5GJV B;  3CCS A;  2R57 A;  2AKK A;  3CCE A;  2MF2 A;  2LCC A;  4QVC A;  4KGX B;  1UE9 A;  2MWO A;  2QYZ A;  2V1Q A;  5CKB A;  3REB B;  4KBM B;  1Q7Y R;  2BKD N;  3MKD A;  4GBQ A;  4XU2 A;  1IHV A;  4OB2 B;  1M2V A;  2CP3 A;  3SDZ A;  3CCS Q;  2RQU A;  1NJI U;  1CKA A;  3CCE Q;  1D1B A;  3O8V A;  4F7U E;  2GFU A;  3TRE A;  2CP7 A;  2E70 A;  4JLG A;  2LDM A;  2VV5 A;  1X6G A;  3OW2 A;  3RUX A;  4C8Q E;  4WTO B;  1K73 C;  3H6Z A;  2BZ8 A;  2X35 A;  4M7D B;  2JW4 A;  3PGG A;  2DJQ A;  1X6B A;  5GAM e;  1X69 A;  1EZZ B;  1QVF P;  5D6W A;  1WHL A;  2DXT A;  2XD0 A;  3SWN C;  4WCI A;  1PSF A;  4QT7 A;  2HL5 C;  1HXD A;  2RHY A;  4J9E A;  4QQ6 A;  2MMP A;  4OML A;  3J7A F;  4FU6 A;  1VQ5 A;  3A8O B;  3VRZ A;  3CCV A;  2EW3 A;  1H3H A;  1WHG A;  4DEY A;  1W1F A;  1RAA B;  5GMK i;  1GBR A;  2E12 A;  5A0L A;  3PVL A;  2HNI A;  3EGD B;  2VXE A;  1D1A A;  3OYK A;  1W2B A;  2DL8 A;  3VS3 A;  3OYF A;  1PSE A;  1UUE A;  5EG2 A;  1UFF A;  5L23 A;  1VQ5 Q;  4JJC A;  1K0S A;  2VGM A;  3VV0 A;  5D6X A;  1YJ9 A;  2EFI A;  3UT1 A;  2E41 A;  5LL6 S;  4M75 G;  5GAO l;  2X51 A;  1UEC A;  1RAI B;  1ZBX A;  3NMZ C;  1G3Y A;  1VQO A;  3A8H B;  2C0O A;  4F7U B;  1M2O A;  2D1X A;  3M58 A;  3UA7 A;  2YUP A;  4J6Y A;  3AT1 B;  4XTX A;  1X6O A;  2H3E B;  4OMQ A;  1Q81 U;  4KUD K;  2CZ1 B;  4IUP A;  1RI0 A;  3VYH B;  5ECA A;  4M75 D;  2RM4 A;  2NUP B;  1MMG A;  2AT1 B;  5CK9 A;  3X26 B;  1N27 A;  2HSP A;  2YLB A;  1YIT A;  4FM4 B;  1Q81 R;  3TSZ A;  1YNZ A;  4Z8A A;  5GAN 3;  2L3S A;  2K2M A;  2C0T A;  2VYT A;  1MUZ A;  2FB7 A;  3C95 A;  4E47 A;  1WXU A;  1OZ3 A;  3JB9 G;  2J05 A;  4C0Z A;  1H8K A;  2MAM A;  4JJD A;  2OTJ A;  4AMC A;  4IIM A;  4RG8 A;  3EH1 A;  2ZPI B;  1QVG P;  3CCU T;  4FSS A;  1NE8 A;  3L2Q A;  3WXM B;  4KUL A;  1HJD A;  3PT9 A;  4XK8 E;  4EIK A;  2DPP B;  2FPD A;  4HKE A;  4PLL A;  4LUE A;  5LJ3 f;  3JB9 D;  4CC2 A;  4C0G A;  5FU6 C;  4BE2 A;  2OTJ Q;  1AEY A;  2HD0 A;  2BE7 D;  2VAS A;  4XTU A;  1PNJ A;  4PFO A;  3RES A;  2YRC A;  3EH2 A;  3CPF A;  4HT9 A;  5KCO A;  5J39 A;  2KXC A;  3E2U A;  1X01 A;  1QKW A;  1FMV A;  3V8K A;  3CCV T;  1K0X A;  4HVV A;  1XQH A;  1UGP B;  3HFN A;  2DYI A;  3EFO B;  3HRU A;  1NPR A;  1R0B G;  2OAU A;  3HRS A;  1I5O B;  1QLY A;  2LQK A;  1X43 A;  2K5L A;  2FZK B;  2XG8 D;  2SRC A;  2YSQ A;  4J9C A;  1WGS A;  1YJW A;  2KXD A;  2RMO A;  3FDR A;  5FLX E;  5A2Q E;  4OGC A;  2P84 A;  2RF0 A;  3OYI A;  1YJ9 T;  3OYD A;  4KH1 B;  2DD4 A;  3GNF B;  1KD1 R;  1XNI A;  2VB6 A;  1TUG B;  5LJ5 e;  1VQO T;  1N8R U;  3M54 A;  4XQ3 A;  3QG1 A;  3O5Z A;  1I07 A;  3L2R A;  4BAC A;  1YJW Q;  2DK3 A;  2IG0 A;  3JRZ A;  2EJG A;  2X3X D;  2VGN A;  1YCS B;  4RCB A;  1FWZ A;  4CI0 C;  1N8R R;  2ROT A;  4BI3 A;  1BI3 A;  3DLL A;  4MMK A;  5FRO A;  3G4S T;  3NTI A;  2YHT A;  4DEX A;  2G6F X;  1I5L A;  4KRT A;  4HT8 A;  1YIT T;  3LWI A;  1I4K 1;  1TUC A;  3VS1 A;  4JRK A;  1IGQ A;  4XTV A;  2OI3 A;  2JVV A;  2MPX C;  3NFC A;  3OA6 A;  5LJ5 j;  3TCJ A;  3UDC A;  2XDB A;  3RKX A;  2KNB B;  5FU7 B;  2E64 A;  2DL4 A;  5CKD A;  3C12 A;  5GAM f;  3JCM J;  2CH4 W;  1WJQ A;  3E9F A;  1MMA A;  2RH2 A;  3OS5 A;  4II1 A;  1OYX A;  4FYY B;  2Y90 A;  4M77 C;  2JN0 A;  1E7O A;  2E5K A;  1WXT A;  3MCA B;  5HKC A;  3CEY A;  1M30 A;  2VC8 A;  4RUG A;  1JB0 E;  3SWN B;  4LD6 A;  1YIJ A;  2EGA A;  3EGU A;  1MHN A;  4QQD A;  1VQ8 A;  2K2V A;  1W70 A;  3I5R A;  1H64 1;  2R58 A;  5CIU A;  4M78 A;  4M7A G;  3CC4 T;  1K8A R;  3CCL A;  4C92 D;  2EYQ A;  2DRK A;  1YWP A;  1VQM A;  1YIJ Q;  4XTW A;  1VQ8 Q;  1YJW T;  3C0C A;  4IUT A;  2P0P A;  3EFS A;  2MCN A;  3LYI A;  4M7A A;  2QXF A;  3UPU A;  2WSC E;  1QVF S;  1SKU B;  4M7A D;  2HEQ A;  4PJO A;  1SSF A;  3CCL Q;  1OI1 A;  1OX9 A;  1WHK A;  2DL7 A;  1BCM A;  1VQ4 A;  1ZHI A;  3RMS A;  3ER0 A;  3SHW A;  1VQM Q;  3JSC A;  4AFS C;  1GFC A;  4QKU A;  2OTL A;  3CXC A;  2M51 A;  3OSS C;  4BY6 C;  2RJE A;  2VWF A;  4B6M A;  1VQL A;  4N0A C;  2QGG A;  1WYX A;  3OYM A;  3EAE A;  3LWH A;  1VQ4 Q;  4GY5 A;  3I9Q A;  3L2V A;  3M0Q A;  1UGV A;  1VA7 A;  2DL3 A;  2XU8 A;  2EPD A;  3JV3 A;  4OP0 A;  2OTL Q;  5GAN d;  3MP1 A;  1R8O B;  1VQN A;  5GAN 5;  2K3X A;  2YXY A;  3Q1J A;  3VS6 A;  3EG9 B;  4D8K A;  1BI1 A;  4M78 B;  4Z02 A;  2X3W D;  5AYF A;  2CH4 A;  3CMA Q;  4RTY A;  3CC7 A;  2FPF A;  3PVQ A;  3RER A;  1B34 A;  1YP5 A;  2LJ1 A;  2OX7 A;  4DBF A;  1LJO A;  2ZPE B;  1W6X A;  1VQN Q;  3IQL A;  1D3B B;  1AZE A;  3MEV A;  1QWF A;  4PFP A;  4PJO B;  3HL8 A;  2DKG A;  2R5A A;  2CUB A;  4E7L A;  3LH5 A;  1UEB A;  1TSF A;  3V7R A;  1Y07 A;  2E65 A;  4M77 D;  4AG2 C;  5KYY A;  2HMA A;  4LNP A;  2FL7 A;  2KT1 A;  2CGH A;  4OMN A;  4LDY A;  3SEM A;  2I0N A;  2EGE A;  4J9I A;  4JDS A;  1Y71 A;  3VS7 A;  4OB0 B;  3MHX A;  2HSE B;  4D6W A;  1NBE B;  1SEM A;  1NZ9 A;  4E7H A;  1QVG S;  3V7C A;  2BZY A;  3MJX A;  1O9S A;  3QUI A;  2BIV A;  2E4H A;  4ZN1 A;  3GIB A;  4O5V A;  2G3R A;  4AT1 B;  2CSI A;  3E19 A;  1BB9 A;  4J8O A;  5KCH A;  1YHQ A;  1PD0 A;  4CC7 A;  3ZFJ A;  2KRM A;  3LGF A;  5GAO p;  5CAI A;  5KYW B;  5LJ5 f;  2OAW A;  3M9Q A;  1M3A A;  3EGX B;  5LJ5 g;  3EHR A;  1AWX A;  4CRI A;  2A0F B;  2QAS A;  2HQH A;  3JCM V;  3I55 A;  1KHI A;  1XJW B;  4OGE A;  4JS4 A;  1M8V A;  4HVW A;  3GOX A;  1VQL T;  3MP8 A;  3AHU A;  5KYX B;  3BDU A;  4A4K A;  2J6F A;  1XOV A;  3L2W A;  4L6V 5;  2ESW A;  2BE9 B;  5CKF A;  3L2U A;  5D7U A;  2JMC A;  2RB6 A;  2RI2 A;  1F1B B;  4M7D G;  1IO6 A;  3TVT A;  3FIF A;  3I55 Q;  1TS9 A;  2FRY A;  2GF7 A;  2D8H A;  3JCM h;  1M3C A;  4QQG A;  2DEU A;  1VQN T;  1FYN A;  3RR6 A;  3LGL A;  4HCZ A;  4DA4 A;  1ZQ1 A;  1YBY A;  2KRN A;  1GRI A;  2EVR A;  4M7D A;  4X1V A;  4BE0 A;  2JT4 A;  1VQ9 A;  1YFN A;  4NL3 A;  2DAQ A;  2NWM A;  3CC7 T;  4LDV A;  2CUD A;  2HKQ B;  1R77 A;  3VS0 A;  2QTX A;  2AKL A;  4E7Z A;  4LE9 A;  1M90 C;  4EMK B;  1K73 U;  1KFZ A;  4LDW A;  5EC7 A;  1W2B S;  4JZ4 A;  1Y96 B;  3NGP A;  4JJN K;  4J9G A;  2KEA A;  1LNX A;  2DBK A;  3OQ5 A;  1VQ9 Q;  3CD6 A;  3QZ5 B;  2VVK A;  2KK4 A;  4M75 C;  4N4H A;  1Y7X A;  3S3M A;  1UGR B;  2PZ1 A;  2LX7 A;  1IZ6 A;  2KYB A;  1K9M R;  2EYZ A;  3G71 A;  1C0M A;  4HA8 A;  1QMC A;  3OYC A;  8AT1 B;  3ZBD A;  5DY9 A;  4B9W A;  1WX6 A;  3MP6 A;  3MEA A;  1PWT A;  3CD6 Q;  2F69 A;  2DNU A;  3ZL7 C;  1QVG A;  3M53 A;  2HKN A;  5FRM A;  1WIE A;  3EGD A;  4E7K A;  4ZGJ B;  1QQJ A;  2QEX Q;  1CKB A;  4EMH A;  3G71 Q;  2L8D A;  3PIP A;  1YHQ T;  4D8D A;  2MOX A;  2D0N A;  2DYB A;  1RAF B;  2DXB A;  1UG1 A;  3G1J A;  3QWX X;  3QWY A;  1NJI R;  4F7U A;  2DX1 A;  1S1N A;  2EBP A;  4ELY C;  1QVP A;  5KE2 A;  1N9R A;  2COW A;  1AZG B;  4BY6 B;  5CR2 A;  1X2Q A;  4MZP A;  1EFN A;  3RNJ A;  1KC8 U;  3OYJ A;  2D9T A;  2O4X B;  1OUL A;  2NUP A;  4EPC A;  1WDX A;  1H3Z A;  1K9M C;  2RD1 A;  3J81 E;  3CME A;  1VQP A;  1HSQ A;  5FW9 A;  2YT6 A;  4R0K A;  1KK7 A;  1OPL A;  1KC8 R;  4PJL A;  2CZ7 B;  3X24 B;  4R56 A;  1NLO C;  2CZ6 B;  1K76 A;  2F2V A;  2DTI A;  1Q7Y C;  3QZ9 B;  3OYN A;  3CC2 A;  2QAZ A;  5GAO m;  4PKC C;  2QG9 B;  2JOY A;  1BKB A;  3JCM e;  1UJY A;  1WXB A;  5C6S A;  1VQ7 A;  2K5F A;  3CME Q;  2CP5 A;  3M4Y A;  1VQP Q;  1KIK A;  3EG3 A;  1ZLM A;  4C5E A;  2MK5 A;  3PIO A;  3QJ6 A;  2DRM A;  2FRW A;  1NJI C;  1G5V A;  2EGC A;  3HRT A;  4E7J A;  1M1K U;  3CC2 Q;  2NUT B;  4M75 F;  4F14 A;  4LDX A;  4E7S A;  2ECZ A;  2PTK A;  5LJ5 h;  5IT9 E;  3CD6 T;  1VQ7 Q;  2PVO B;  1HYO A;  2EYW A;  5I21 A;  1WHJ A;  1Q86 U;  1M1K R;  3CCS T;  4ZGE B;  3CCE T;  5DLQ E;  3G71 T;  2EQM A;  1MMD A;  4A4F A;  5HY6 A;  2E5Q A;  4C8Q B;  4ZGD B;  2DL5 A;  3H0I A;  2RK1 A;  3EFO A;  2D0Q B;  1LPL A;  5CKE A;  2WSF E;  3UF4 A;  1Q86 R;  1V76 A;  2RA2 A;  1YI2 A;  5GMK j;  2A37 A;  2X4X A;  2LCL A;  1AWO A;  4M75 E;  3OYG A;  5D6Y A;  1D1C A;  1QCO A;  3CCM A;  5A0G A;  2F2W A;  1MNE A;  3JB9 F;  5GAN j;  1CSK A;  2AHJ B;  1KG1 A;  5FRN A;  2DO3 A;  2HL3 A;  1YI2 Q;  3P8H A;  1VYT A;  1NEB A;  3JCM Q;  4FYV B;  4IUQ A;  3FLG A;  3M0U A;  3S3O A;  1V1C A;  2CT4 A;  1ZSG A;  1TUD A;  4ME7 A;  3CCM Q;  2FO0 A;  2QA4 A;  2P4R A;  2F5K A;  3G6E A;  2AZS A;  1WHM A;  3T9N A;  1ZUK A;  3P8D A;  4DBR A;  4C92 C;  3UWN A;  2RNA A;  3EG0 A;  2ZZD A;  2YRV A;  5GAN 6;  3VU3 C;  3ZEH A;  5GAN 2;  4YTL A;  5KYU B;  3CC2 T;  2QA4 Q;  1VQ5 T;  4RG2 A;  5IHN A;  2ED0 A;  3G6E Q;  4X9C A;  3OYH A;  3VS5 A;  4M7A C;  4A4E A;  1Q81 C;  2E1H A;  2K57 A;  3BE3 A;  2EQJ A;  1PM3 A;  4AG1 C;  1ZBJ A;  3FJP A;  2H3J A;  3A8M B;  3D7S B;  2EQK A;  1D0Y A;  3M0P A;  2CT3 A;  2DER A;  3SWN A;  4AFQ C;  1Y57 A;  4M75 B;  3F70 A;  2M16 A;  1IGU A;  1Y0M A;  5GAN 7;  4XTZ A;  2DXC A;  3E1S A;  2LX9 A;  5LJ3 d;  1WFW A;  2IIM A;  3CXC S;  2JZ2 A;  3OS0 A;  4XU1 A;  1FX7 A;  2JTE A;  2EIF A;  1MV3 A;  3QHS A;  4Q5W A;  3HFO A;  4MZT A;  1B07 A;  2KGT A;  1TG0 A;  2Y4X A;  2E3H A;  3GP8 A;  4OMM A;  2J6O A;  3VRY A;  2CZ0 B;  2DFU A;  2YRD A;  1YN8 A;  3CCM T;  3FRN A;  1T3L A;  4QVD A;  2GGR A;  3L42 A;  4OMP A;  1NYF A;  2KMT A;  1PKT A;  3TSW A;  2FVU A;  4F04 B;  2OTJ T;  4IUU A;  5A0D A;  3OYE A;  3CPW A;  4IUV A;  1UGQ B;  2JM8 A;  1WHH A;  1VQ6 A;  3REA B;  3JCM P;  4C5H A;  4ANJ A;  4C92 F;  1KD1 C;  1X75 C;  4HCK A;  4M78 G;  2O01 E;  5HK0 A;  2LJ0 A;  2DIL A;  2KYM A;  3H8Z A;  3OS2 A;  1C1A A;  3PTA A;  1N8R C;  1VQ6 Q;  4M7A F;  2I2L A;  3JCM f;  2DTO A;  5GAN 8;  2LNH B;  5M9O A;  3QDF A;  2MWP A;  3CQT A;  3JCM g;  3EG9 A;  1BI0 A;  2PNI A;  4M78 D;  1WQ7 A;  4PJO G;  2E6Z A;  1VQK A;  3RKW A;  4DBH A;  4C92 E;  2F1L A;  1OOT A;  1AWW A;  1FMW A;  1IRX A;  4LN2 A;  1D3B A;  4BB7 A;  1WJR A;  4IKF A;  1OU8 A;  1OX8 A;  2DLP A;  1SSH A;  5GAM d;  2C06 A;  2LVM A;  1EIF A;  1UDL A;  3CBP A;  3JB9 J;  2K5I A;  1PRL C;  4PJO D;  3HP9 A;  4M7A E;  4AFU C;  1VQK Q;  3LW5 E;  4J83 A;  1SG5 A;  3UAT A;  1NLP C;  1VOM A;  2DIQ A;  3H0H A;  4MZM A;  1WPY A;  2F5T X;  2QTV A;  1QCF A;  3WVE B;  3I35 A;  4JJB A;  2JS2 A;  2EQI A;  1H92 A;  1YJN A;  4FW2 A;  1TU0 B;  2PVG B;  1PCX A;  2KQW A;  1M1G A;  3M56 A;  4OMF B;  2FZC B;  1IHW A;  1ZSZ C;  1UB4 A;  3EFR A;  3GLX A;  2X9H A;  2FEI A;  4M7D C;  2E10 A;  3SB2 A;  1K8A C;  3VS4 A;  3CMA A;  1G3W A;  2MYS A;  1TOV A;  5KYW A;  2CRE A;  4N4G A;  4PL6 A;  1YJN Q;  2LQN A;  3EGX A;  4F16 A;  7AT1 B;  4FSX A;  4BDZ A;  1RUW A;  2K7A A;  4M77 F;  3ULR B;  2JNG A;  1G8X A;  4C0F A;  4XU3 A;  2RPN A;  1KQ1 A;  1PD1 A;  5KYX A;  4KGZ B;  4Z88 A;  3HKS A;  3GPL A;  5I2S A;  2KRO A;  1BCO A;  2QK0 A;  3CCQ A;  4F17 A;  1TH7 A;  4E2F B;  5KH6 A;  4C92 B;  1UHC A;  4ZNX A;  2B8A A;  5FU6 B;  1N9S A;  2L3Q A;  1YIJ T;  3KFV A;  1Q82 U;  3MPU B;  1VQ8 T;  2EQU A;  4KT0 E;  2QQR A;  3BFM A;  2L3R A;  3L1A A;  3CPW P;  4M77 E;  1AWJ A;  3I5S A;  3M57 A;  3ME9 A;  5I2M A;  1GBQ A;  4BD3 A;  5GMK l;  5CKH A;  3CCQ Q;  3CCL T;  2LCS A;  2RJC A;  1Q82 R;  2QI2 A;  3NPF A;  3BDL A;  1VQM T;  1UGS B;  3M55 A;  3V7S A;  1I8F A;  2CSQ A;  3OYL A;  2RJF A;  4EMK A;  3FJ5 A;  2DZ9 A;  1NEG A;  2DBM A;  2O31 A;  1Y96 A;  2LC4 A;  3A8L B;  5J26 A;  1WLP B;  1QP3 A;  1K9A A;  2RQW A;  4VUB A;  1PKS A;  3NTH A;  2HAX A;  3OYB A;  1VQ4 T;  4NL2 A;  4PJN A;  1KQ2 A;  3KBG A;  2SEM A;  1RAC B;  2IPO B;  1JO8 A;  2COZ A;  1E6H A;  1RAG B;  2OTL T;  1G3T A;  4JZ3 A;  3VUB A;  4J7F A;  1YJN T;  2XID A;  4DBQ A;  1AD5 A;  2PQW A;  4ORZ A;  4M7D F;  3VUZ A;  4FW1 A;  3I56 A;  1JJ2 A;  1OU9 A;  4C5I A;  2Y4Y A;  4BDY A;  4CC3 A;  3J80 E;  2WSE E;  1IXD A;  1GFD A;  3DB4 A;  2LT4 A;  3RKY A;  2DE0 X;  1K4U S;  3CMA T;  1AT1 B;  1BU1 A;  1I1J A;  2IVW A;  3NTK A;  2B86 A;  3LH0 A;  4RCC A;  2LZ6 B;  2LNV A;  2PU9 B;  1MGQ A;  4A4H A;  1VIF A;  2YLC A;  1C6V X;  2LQ8 A;  4RTX A;  3I56 Q;  2A36 A;  2KAF A;  5IHI A;  1KQS A;  2HZY A;  4M7D D;  2C0I A;  2M0O A;  2DD5 A;  5LJ3 e;  4M7D E;  4N0A A;  1RI9 A;  4M77 B;  1SPK A;  2O4X A;  2M0Y A;  4RTU A;  1QW1 A;  4DOW A;  2M9U A;  4JRP A;  4RMO A;  1ABQ A;  2ATC B;  2GBQ A;  1AOJ A;  3M0R A;  2YUO A;  4V2S A;  2LT1 A;  3X20 B;  1K73 R;  9ATC B;  2A3L A;  2ED1 A;  1QKX A;  2DM1 A;  2QEX A;  3VKI A;  4J9H A;  1GL5 A;  3BY7 A;  3MEU A;  1DJ7 B;  4JLI A;  1RAH B;  3OMC A;  5LJ3 j;  3JB9 H;  3PMI A;  2E6N A;  4HCB A;  2JUF A;  5GAO r;  4PJJ A;  2EYX A;  3JCM W;  3CCR A;  4F7U G;  3HSB A;  4UC4 A;  1GXI E;  2NUT A;  3DKM A;  2RHI A;  5GJW B;  1IB8 A;  4J9F A;  1M27 C;  4A63 B;  4C8Q G;  5DM7 R;  1JXO A;  1WZO A;  4M4Z A;  4HVU A;  3RDV A;  3QSU A;  1RLQ C;  1M5Q 1;  3QKJ A;  2BUD A;  2K3B A;  1R0C B;  1T0J A;  4L5G A;  4J9B A;  1LCK A;  3I55 T;  3CCR Q;  2J06 A;  2XMF A;  2EJ9 A;  4DOV A;  4C8Q A;  3EHQ A;  1VIE A;  2RK2 A;  5KE3 A;  4C8Q D;  5IN1 A;  1PRM C;  5CO7 A;  4RTZ A;  4O6J A;  3I56 T;  2A08 A;  1WNL A;  2RI3 A;  1S72 A;  3OMG A;  3A5Z B;  3RIR A;  3E9G A;  4BUG A;  5FU7 C;  1ZSZ B;  3JCM X;  2O9V A;  2AIR B;  3SFM A;  2CYZ B;  2GFA A;  3C94 A;  2D6F A;  5KYN A;  3MET A;  5C0M A;  4PJM A;  2GTJ A;  1X2K A;  2DVJ A;  3X25 B;  8ATC B;  3CCU A;  4MDX A;  2L0A A;  2DEQ A;  5IAY A;  2GNC A;  4FL6 A;  2MI6 A;  2ENM A;  1S72 Q;  4J6W A;  1VQ9 T;  4J9D A;  4Y28 E;  1LVK A;  2BZX A;  1JJ2 P;  3QYG B;  3CCU Q;  2VXF A;  4LDU A;  3TU4 K;  5GMK e;  2O88 A;  2M02 A;  2ZAE A;  2PUO B;  2KBT A;  1M4Z A;  4QW2 A;  2ZPG B;  3HPW A;  2P0K A;  3URG A;  6AT1 B;  5GAM j;  4ATO A;  1GCQ A;  1QCN A;  3QXE B;  2RO0 A;  1KJW A;  2LRQ A;  3GF5 A;  1KQS P;  2JTM A;  1G2B A;  5GAN e;  5KYU A;  4XTY A;  2K6D A;  2QEX T;  1M2V B;  2J6K A;  1JEG A;  4XAX B;  2CDT A;  5GAN 4;  1KC8 C;  3CCV Q;  5I11 A;  4K11 A;  1RAE B;  1ZUY A;  4ZTF A;  2JTF A;  3OB9 A;  1VYU A;  3CCR T;  2FZG B;  2RQV A;  2RHX A;  3GNG A;  2W0Z A;  1JRI A;  4PNO A;  3JCM b;  4FCY A;  5IXF A;  1O75 A;  3M59 A;  4WF2 A;  4Z89 A;  4Y92 A;  5FWC A;  1OQK A;  2XI9 A;  4MML A;  3JAM E;  1YJ9 Q;  4M75 A;  5IHK A;  2ZGW A;  1G3S A;  1KHC A;  1U3O A;  2DXU A;  2QQB A;  4OVA A;  3G4S A;  4IIO A;  1VQO Q;  2L5Q A;  2MIO A;  4OB3 B;  2V1R A;  1D0Z A;  1U06 A;  2AK5 A;  2DMO A;  3CPW S;  2CP6 A;  1OEB A;  2XDD A;  3DLM A;  3A8G B;  1M1K C;  1S72 T;  3OSV A;  1ACM B;  3X28 B;  5IH2 A;  3CME T;  3OYY A;  1JBM A;  1VQP T;  4M78 C;  4X34 A;  3EG2 A;  3G4S Q;  1QP2 A;  2HQX A;  2W10 A;  2X4J A;  4E7I A;  4KUI A;  1YIT Q;  1VUB A;  1Q86 C;  1SRL A;  2KT8 A;  2V8J A;  2ZPF B;  2A7Y A;  5L8R E;  1WQW A;  2DIG A;  2FPE A;  2QQ9 A;  1VQ7 T;  3KXT A;  3OW2 P;  4PJO C;  5GAO n;  5LJ3 g;  2JJ9 A;  3OBY A;  3C4S A;  3LX7 A;  1KSW A;  4NS5 A;  2VKN A;  5AT1 B;  4OB1 B;  3QBY A;  2L89 A;  4FT4 A;  1SHF A;  1M8M A;  3CC4 A;  1IRE B;  2J7I A;  1YCY A;  4C0D C;  3PFS A;  2DTH A;  2HCK A;  2NYS A;  4IUR A;  1PG5 B;  1HD3 A;  1FXX A;  1LOJ A;  5IXB A;  4EDU A;  1KD1 U;  4GLM A;  1ABO A;  4OMO A;  3TQ7 P;  1JU5 C;  1JQQ A;  2ROL A;  3OY9 A;  3M0T A;  2XDP A;  2HBP A;  3CC4 Q;  1RLP C;  3BW1 A;  2M1H A;  4BE1 A;  1YI2 T;  2E3I A;  4JS5 A;  4LD9 K;  4LUD A;  1OPK A;  3CBO A;  5CVI A;  2XIC A;  4FYW B;  2RJD A;  1Q95 G;  2GTO A;  3NHN A;  1PHT A;  4JPB W;  5HCK A;  1W2B P;  1U5S A;  2HQE A;  1T3S A;  2XHC A;  2CKK A;  3THK A;  1SF9 A;  2RN8 A;  1QWE A;  2DVE A;  1N6A A;  3EG1 A;  4RKU E;  1TWB A;  1U1S A;  4A54 A;  1EX4 A;  3S6W A;  2WAC A;  3P8B B;  1A0N B;  1J3T A;  1E6G A;  1V29 B;  2YUQ A;  1U1T A;  3HHT B;  1MND A;  2QA4 T;  2LMJ A;  4M78 F;  2QDL A;  3G6E T;  2KVQ G;  4PK4 A;  2GCX A;  2V26 A;  4FT2 A;  3TEE A;  1ZA2 B;  3JCM c;  4LXC A;  3PNW C;  5GAM g;  1BBZ A;  1NG2 A;  3RBB B;  1UHF A;  4C5G A;  2P0Q A;  4HXJ A;  2KSS A;  4J5Y A;  4QVZ A;  4B9X A;  4PJO F;  4EMK C;  2KI7 A;  2Z0W A;  2YWW A;  4JUV A;  5FWB A;  4C92 G;  1AVZ C;  2LQW A;  4NOY A;  5CCA A;  1K8A U;  4M78 E;  2OJ2 A;  2NUZ A;  1JXM A;  2RQR A;  2H8H A;  4MDW A;  2RI5 A;  2YDL A;  2AZV A;  2K79 A;  4J6X A;  1W4S A;  4C92 A;  4RTT A;  2DZC A;  2FG0 A;  5GAN f;  2CP0 A;  1M1F A;  5GAN g;  1RL2 A;  3V8J A;  2DF6 A;  3VYG A;  4PJO E;  1WI7 A;  1ZUU A;  2JXB A;  2BTT A;  3G7Z A;  1TXQ A;  4E6R A;  2KR3 A;  2L2P A;  4OF1 A;  3L2Z A;  1ZA1 B;  2YUN A;  1Z9Q A;  3JB9 I;  4R55 A;  4Y91 A;  1HK9 A;  4TVR A;  3JCM d;  2CS7 A;  2ZPH B;  3FEO A;  4DQ2 A;  1VYV A;  3PE0 A;  1JJ2 S;  4ELZ C;  3U23 A;  1AHJ B;  3M5A A;  2O9S A;  3R6N A;  3MEW A;  2KE9 A;  1ARK A;  2DET A;  2QQA A;  1G83 A;  1M9S A;  3CCJ A;  3OS1 A;  5CQX A;  4JRQ A;  2DJZ A;  2EAY A;  4KGV B;  5LJ3 h;  1KQS S;  2D8J A;  1BIB A;  1VQ6 T;  1UJ0 A;  5GMK m;  2JMA A;  1MMN A;  4HCC A;  2F2X A;  1VQL Q;  2CP2 A;  3PMT A;  3QJY A;  3CBM A;  3VS2 A;  3CCJ Q;  1RAB B;  2ZCF B;  3A1P A;  2EWN A;  2NLU A;  1ZX6 A; 
#chains in the Genus database with same CATH homology
 5LJ5 j;  4L59 A;  4ZTJ A;  2LCL A;  3BY7 A;  3MEU A;  1DJ7 B;  3N5B B;  2FHD A;  2PUK B;  4JLI A;  4M75 E;  3TCJ A;  3OMC A;  3UDC A;  5LJ3 j;  2XDB A;  3JB9 H;  3PMI A;  3OYG A;  3RKX A;  4M77 G;  2E6N A;  3FC3 A;  5FU7 B;  5D6Y A;  4HCB A;  2JUF A;  5GAO r;  2E64 A;  4JRI A;  5CKD A;  3CCM A;  3JCM W;  3C12 A;  5A0G A;  5GAM f;  3JCM J;  3CCR A;  3JB9 F;  4F7U G;  1WJQ A;  3E9F A;  2AHJ B;  5GAN j;  2QDY B;  2RH2 A;  3KUF A;  3HSB A;  4UC4 A;  4M7A B;  5FRN A;  3OS5 A;  2QQS A;  3QII A;  3SD4 A;  2DO3 A;  4II1 A;  1GXI E;  1OYX A;  2LTO A;  1XTD A;  3DKM A;  2RHI A;  5CQY A;  2Y90 A;  1VQK T;  4M77 C;  3WVD B;  4C8Q G;  3P8H A;  5DM7 R;  2JN0 A;  4X9D A;  3JCM Q;  4M77 A;  4IUQ A;  4J7I A;  3QSU A;  3FLG A;  3MCA B;  5HKC A;  1M5Q 1;  3QKJ A;  2BUD A;  3CEY A;  3S3O A;  1BYM A;  2VC8 A;  2FYK A;  4L5G A;  4ME7 A;  3ASK A;  5J3B A;  1JB0 E;  3OBW A;  3I55 T;  2QA4 A;  4C8Q C;  3SWN B;  2F5K A;  4LD6 A;  1YIJ A;  3G6E A;  2EJ9 A;  4DOV A;  1MHN A;  4QQD A;  4FIB A;  4C0D B;  4C8Q A;  1P92 A;  1VQ8 A;  2K2V A;  1VIE A;  2RK2 A;  3T9N A;  5KE3 A;  3P8D A;  4C8Q D;  1H64 1;  2R58 A;  4C92 C;  5CIU A;  1QVG S;  5IN1 A;  3UWN A;  4M78 A;  4A53 A;  5CO7 A;  4M7A G;  4O6J A;  3I56 T;  3DB3 A;  3CC4 T;  2ZZD A;  1WNL A;  2YRV A;  2RI3 A;  4C92 D;  2GQV A;  3OMG A;  5GAN 6;  3A5Z B;  1S72 A;  3RIR A;  3CCL A;  3E9G A;  3VU3 C;  3ZEH A;  5FU7 C;  4BUG A;  1QVF A;  3JCM X;  3INZ A;  5GAN 2;  4YTL A;  4BI8 B;  3CC2 T;  2EYQ A;  2RHZ A;  5DLO A;  3SFM A;  3VJP A;  2CYZ B;  1VQM A;  4RG2 A;  1VQ5 T;  2GFA A;  3C94 A;  4XTW A;  2D6F A;  2K4Y A;  4X9C A;  4A4G A;  3M4G A;  3MET A;  5C0M A;  3OYH A;  1YJW T;  4M7A C;  4IUT A;  4A4E A;  3X25 B;  5GAO q;  3CCU A;  3OW2 S;  2P0P A;  3EFS A;  1Q81 C;  2E1H A;  2K57 A;  1YI2 A;  4MDX A;  1WJS A;  3LYI A;  1OZ2 A;  4M7A A;  2QXF A;  3UPU A;  2EQJ A;  2KY9 A;  2WSC E;  1QVF S;  2XKO C;  2DEQ A;  4M7A D;  5IAY A;  4PJO A;  5GAM h;  4FL6 A;  2MI6 A;  1SSF A;  3FJP A;  1BI2 A;  2H3J A;  3R6O A;  1OI1 A;  3A8M B;  1VQ4 A;  2XK0 A;  4J6W A;  1VQ9 T;  1Q82 C;  1ZHI A;  1I81 A;  3RMS A;  3ER0 A;  2P4T A;  4Y28 E;  2V8K A;  2EJF A;  3CCJ T;  5HK3 A;  2EQK A;  3JSC A;  3QYG B;  1B34 B;  3QO3 A;  3VKI A;  2RHU A;  2OTL A;  1K73 C;  4PLI A;  2EKO A;  2VXF A;  3CXC A;  4LDU A;  4EMG A;  3SWN A;  3V8L A;  3OSS C;  4BY6 C;  2PVD B;  2RJE A;  3TU4 K;  4M75 B;  5GMK e;  3F70 A;  2PUO B;  1U8R A;  1VQL A;  2K3Y A;  4E7H A;  2M16 A;  2X4Y A;  1M4Z A;  2KDS A;  5GAN 7;  4N0A C;  5LJ5 d;  4QW2 A;  3OYM A;  2ZPG B;  3HPW A;  4XTZ A;  3FB9 A;  5GMK h;  2DXC A;  2P0K A;  3EAE A;  3E1S A;  3URG A;  3LWH A;  4GY5 A;  2LX9 A;  5LJ3 d;  3L2V A;  4GLK A;  5GAM j;  4ATO A;  2ZPB B;  4BI4 A;  4XU0 A;  3CXC S;  2JZ2 A;  2RO0 A;  2XU8 A;  2LRQ A;  3GF5 A;  3QXE B;  3OS0 A;  2JTM A;  2X4W A;  4XU1 A;  1FX7 A;  3CCQ T;  4OP0 A;  5GAN e;  2EIF A;  4XTY A;  5GAN d;  2QEX T;  3QDR B;  3MP1 A;  2VUB A;  4XAX B;  3QHS A;  5GAN h;  4Q5W A;  3LLR A;  3HFO A;  5GAN 4;  3QPH A;  1NPP A;  4MZT A;  1R8O B;  1KC8 C;  1VQN A;  2Y4X A;  5GAN 5;  2K3X A;  3Q1J A;  3GP8 A;  3QYH B;  2CZ0 B;  2R5M A;  4ZTF A;  1BI1 A;  3MO8 A;  4M78 B;  3CCM T;  2JTF A;  3OB9 A;  2V8I A;  3FRN A;  4ZN3 A;  3OYA A;  3CCR T;  4N4I A;  2RHX A;  3GNG A;  4P5N A;  4Z02 A;  4QVD A;  1JRI A;  5AYF A;  1K9M U;  4PNO A;  3JCM b;  1BIA A;  3S3N A;  3CC7 A;  3L42 A;  3RMQ A;  4F7U F;  3RER A;  1O75 A;  1B34 A;  2KMT A;  3M59 A;  4WF2 A;  2FVU A;  1LJO A;  2ZPE B;  2OTJ T;  4C8Q F;  4IUU A;  1D3B B;  5A0D A;  1Q7Y U;  2XI9 A;  3OYE A;  4MML A;  3JAM E;  4M75 A;  3CCS A;  2R57 A;  3MEV A;  2ZGW A;  1UGQ B;  4IUV A;  1G3S A;  3CPW A;  3CCE A;  2MF2 A;  1KHC A;  2LCC A;  3JCM P;  4C5H A;  4QVC A;  4PJO B;  2DXU A;  2DKG A;  3HL8 A;  2R5A A;  4C92 F;  1KD1 C;  2MWO A;  1VQ6 A;  4E7L A;  1X75 C;  2QQB A;  4OVA A;  3G4S A;  2L5Q A;  1UEB A;  5CKB A;  3V7R A;  1Y07 A;  2E65 A;  4M77 D;  4KBM B;  4M78 G;  4OB3 B;  2BKD N;  2O01 E;  5HK0 A;  3CPW S;  2FL7 A;  4XU2 A;  2XDD A;  2CGH A;  3DLM A;  4OB2 B;  4LDY A;  3A8G B;  3H8Z A;  1M1K C;  3OS2 A;  3SDZ A;  1S72 T;  1NJI U;  3OSV A;  3PTA A;  1N8R C;  3X28 B;  4JDS A;  1Y71 A;  4OB0 B;  3MHX A;  2I2L A;  3JCM f;  3O8V A;  4M7A F;  3CME T;  4F7U E;  2GFU A;  3OYY A;  3TRE A;  1JBM A;  2DTO A;  2E70 A;  5GAN 8;  1VQP T;  4M78 C;  4D6W A;  5M9O A;  4JLG A;  2MWP A;  4X34 A;  2LDM A;  3JCM g;  2VV5 A;  1NZ9 A;  1QP2 A;  1BI0 A;  2HQX A;  2X4J A;  3V7C A;  3RUX A;  3QUI A;  1O9S A;  4C8Q E;  3OW2 A;  2BIV A;  4KUI A;  4ZN1 A;  1VUB A;  4O5V A;  4E7I A;  2G3R A;  1Q86 C;  3GIB A;  4M78 D;  3H6Z A;  1WQ7 A;  4PJO G;  3E19 A;  4J8O A;  2V8J A;  2E6Z A;  2ZPF B;  5KCH A;  2X35 A;  1VQK A;  1YHQ A;  2A7Y A;  5L8R E;  3RKW A;  1WQW A;  2DIG A;  3ZFJ A;  4C92 E;  4M7D B;  3LGF A;  5GAO p;  5CAI A;  5LJ5 f;  2QQ9 A;  3PGG A;  3M9Q A;  1VQ7 T;  5LJ5 g;  3KXT A;  1D3B A;  4BB7 A;  1WJR A;  4CRI A;  4IKF A;  5GAM e;  4PJO C;  5GAM d;  5GAO n;  3JCM V;  5LJ3 g;  2LVM A;  1EIF A;  2C06 A;  3I55 A;  3CBP A;  3OBY A;  3JB9 J;  1KHI A;  2K5I A;  4OGE A;  5D6W A;  4PJO D;  3HP9 A;  4JS4 A;  4M7A E;  1M8V A;  3C4S A;  3LX7 A;  2DXT A;  3LW5 E;  3GOX A;  4NS5 A;  1VQL T;  3MP8 A;  4J83 A;  4OB1 B;  3AHU A;  2XD0 A;  3QBY A;  2DIQ A;  3OA6 A;  2L89 A;  3BDU A;  4FT4 A;  4MZM A;  1WPY A;  4A4K A;  2F5T X;  1XOV A;  3SWN C;  3L2W A;  3CC4 A;  1IRE B;  4L6V 5;  1PSF A;  1YCY A;  3WVE B;  1HXD A;  2RHY A;  3PFS A;  4QQ6 A;  2MMP A;  5CKF A;  4C0D C;  2RB6 A;  2DTH A;  3L2U A;  3J7A F;  2RI2 A;  4FU6 A;  1YJN A;  4IUR A;  4M7D G;  2PVG B;  3FIF A;  1FXX A;  1VQ5 A;  3A8O B;  2KQW A;  3CCV A;  1LOJ A;  1M1G A;  3M56 A;  4OMF B;  4EDU A;  2GF7 A;  1KD1 U;  3JCM h;  4QQG A;  4V2S A;  1VQN T;  1UB4 A;  5GMK i;  3OY9 A;  2E12 A;  3EFR A;  5A0L A;  3GLX A;  3LGL A;  4HCZ A;  4M7D C;  2XDP A;  2HBP A;  4DA4 A;  1ZQ1 A;  1YBY A;  2E10 A;  3SB2 A;  1K8A C;  3CMA A;  3BW1 A;  2M1H A;  1G3W A;  4BE1 A;  2HNI A;  4M7D A;  1YI2 T;  4JS5 A;  2VXE A;  3OYK A;  1W2B A;  4LD9 K;  3OYF A;  4BE0 A;  1VQ9 A;  4N4G A;  4PL6 A;  3CBO A;  5CVI A;  4NL3 A;  2XIC A;  1PSE A;  2DAQ A;  5EG2 A;  2VGM A;  3VV0 A;  3CC7 T;  4LDV A;  4FSX A;  5D6X A;  1YJ9 A;  4BDZ A;  2EFI A;  2QTX A;  3UT1 A;  2E41 A;  2RJD A;  5LL6 S;  4M75 G;  5GAO l;  1M90 C;  4EMK B;  1K73 U;  4M77 F;  4LDW A;  1ZBX A;  2JNG A;  1W2B S;  1G3Y A;  1VQO A;  1Y96 B;  4JJN K;  3A8H B;  4F7U B;  2HQE A;  4C0F A;  4XU3 A;  3M58 A;  2XHC A;  1LNX A;  1KQ1 A;  2CKK A;  4J6Y A;  3OQ5 A;  3HKS A;  2DVE A;  3GPL A;  3CD6 A;  3QZ5 B;  1N6A A;  4RKU E;  4XTX A;  1X6O A;  5I2S A;  1M90 U;  1U1S A;  4A54 A;  2KK4 A;  4M75 C;  4N4H A;  1Y7X A;  2WAC A;  1UGR B;  3P8B B;  3S6W A;  3S3M A;  1Q81 U;  4KUD K;  2CZ1 B;  1IZ6 A;  4IUP A;  3CCQ A;  1V29 B;  1TH7 A;  1RI0 A;  3VYH B;  5KH6 A;  4C92 B;  1U1T A;  3HHT B;  4M75 D;  2RM4 A;  3G71 A;  2B8A A;  4HA8 A;  5FU6 B;  4M78 F;  2QA4 T;  1N9S A;  3OYC A;  1YIJ T;  5CK9 A;  3G6E T;  3ZBD A;  1Q82 U;  3X26 B;  1N27 A;  5DY9 A;  4B9W A;  2YLB A;  2KVQ G;  1VQ8 T;  3MP6 A;  3MEA A;  2GCX A;  3TEE A;  4FT2 A;  2EQU A;  4FM4 B;  1YIT A;  4KT0 E;  2F69 A;  2QQR A;  5GAN 3;  3BFM A;  2L3R A;  1QVG A;  3L1A A;  3M53 A;  4M77 E;  5FRM A;  3M57 A;  3ME9 A;  4E7K A;  5I2M A;  3JCM c;  4BD3 A;  5GMK l;  3PNW C;  5CKH A;  4ZGJ B;  3CCL T;  5GAM g;  2VYT A;  2FB7 A;  3C95 A;  2RJC A;  4C5G A;  4EMH A;  4E47 A;  2L8D A;  2P0Q A;  2QI2 A;  3PIP A;  1YHQ T;  1OZ3 A;  3JB9 G;  2KSS A;  3BDL A;  4J5Y A;  4QVZ A;  4B9X A;  4C0Z A;  4PJO F;  4EMK C;  1VQM T;  2MAM A;  1UGS B;  2DXB A;  3M55 A;  3V7S A;  1I8F A;  2OTJ A;  4RG8 A;  3OYL A;  2RJF A;  4EMK A;  2ZPI B;  4JUV A;  3CCU T;  4C92 G;  2DZ9 A;  1KG1 A;  1Y96 A;  2LC4 A;  1NE8 A;  3A8L B;  4NOY A;  5J26 A;  4F7U A;  3L2Q A;  3WXM B;  5CCA A;  1QP3 A;  4KUL A;  1K8A U;  4M78 E;  4ELY C;  3PT9 A;  4XK8 E;  4VUB A;  1QVP A;  5KE2 A;  3NTH A;  2DPP B;  3OYB A;  2HAX A;  1N9R A;  1VQ4 T;  4NL2 A;  4HKE A;  4BY6 B;  4MDW A;  2RI5 A;  4PLL A;  3KBG A;  5CR2 A;  1KQ2 A;  5LJ3 f;  4MZP A;  3JB9 D;  1KC8 U;  4J6X A;  4C0G A;  1W4S A;  5FU6 C;  3OYJ A;  4BE2 A;  4C92 A;  2D9T A;  2OTL T;  2O4X B;  2DZC A;  2HD0 A;  1G3T A;  4XTU A;  3VUB A;  4EPC A;  4J7F A;  3RES A;  1H3Z A;  3CPF A;  5GAN f;  4HT9 A;  1K9M C;  1YJN T;  2RD1 A;  5KCO A;  2XID A;  5J39 A;  3J81 E;  3CME A;  1M1F A;  5GAN g;  1RL2 A;  1VQP A;  3V8J A;  1X01 A;  3V8K A;  3VYG A;  3CCV T;  4PJO E;  2CZ7 B;  3X24 B;  4R56 A;  2PQW A;  4M7D F;  3VUZ A;  2CZ6 B;  3I56 A;  3G7Z A;  1JJ2 A;  2DTI A;  1Q7Y C;  1XQH A;  1UGP B;  4C5I A;  2Y4Y A;  4BDY A;  3J80 E;  2WSE E;  3HFN A;  3DB4 A;  2LT4 A;  4OF1 A;  3RKY A;  3HRU A;  3QZ9 B;  1NPR A;  3L2Z A;  3OYN A;  2OAU A;  3HRS A;  3CC2 A;  5GAO m;  4PKC C;  2LQK A;  3CMA T;  2K5L A;  2JOY A;  1BKB A;  3JB9 I;  3JCM e;  2XG8 D;  4Y91 A;  4R55 A;  1HK9 A;  4TVR A;  2IVW A;  3NTK A;  2CS7 A;  2ZPH B;  3FEO A;  3JCM d;  5C6S A;  1WGS A;  1YJW A;  2K5F A;  4DQ2 A;  1VQ7 A;  3M4Y A;  3LH0 A;  3FDR A;  4RCC A;  5FLX E;  1JJ2 S;  5A2Q E;  2PU9 B;  2LNV A;  4A4H A;  1MGQ A;  4OGC A;  4ELZ C;  1AHJ B;  4C5E A;  3M5A A;  1VIF A;  3OYI A;  2YLC A;  1YJ9 T;  3MEW A;  2LQ8 A;  3PIO A;  3OYD A;  2KAF A;  3QJ6 A;  1KQS A;  2DD4 A;  2QQA A;  1NJI C;  1G5V A;  3GNF B;  3HRT A;  4E7J A;  1M1K U;  4M7D D;  1XNI A;  5LJ5 e;  1VQO T;  1M9S A;  1N8R U;  3M54 A;  4M75 F;  4XQ3 A;  3CCJ A;  2M0O A;  4LDX A;  3QG1 A;  3OS1 A;  2DD5 A;  5LJ3 e;  4M7D E;  4N0A A;  5CQX A;  5LJ5 h;  4JRQ A;  5IT9 E;  2DJZ A;  3L2R A;  4BAC A;  4M77 B;  3CD6 T;  2DK3 A;  2EAY A;  2O4X A;  2PVO B;  2IG0 A;  3JRZ A;  5LJ3 h;  5I21 A;  2EJG A;  1KQS S;  1QW1 A;  4DOW A;  2VGN A;  1Q86 U;  2M9U A;  3CCS T;  4RCB A;  4JRP A;  1BIB A;  4ZGE B;  4RMO A;  1FWZ A;  4CI0 C;  1VQ6 T;  3CCE T;  5DLQ E;  5GMK m;  3G71 T;  2EQM A;  4BI3 A;  1BI3 A;  4A4F A;  3DLL A;  4HCC A;  5HY6 A;  2E5Q A;  4MMK A;  5FRO A;  2LT1 A;  3NTI A;  2YHT A;  4C8Q B;  3G4S T;  3PMT A;  3QJY A;  3X20 B;  3CBM A;  4ZGD B;  1I5L A;  2RK1 A;  4HT8 A;  1YIT T;  2ZCF B;  2D0Q B;  3LWI A;  1I4K 1;  2A3L A;  5CKE A;  2WSF E;  4JRK A;  4XTV A;  2QEX A;  2EWN A;  2RA2 A;  2NLU A;  5GMK j;  2JVV A;  2X4X A;  3NFC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...