4PKCC

Benzylsuccinate alpha-gamma complex
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
41
structure length
41
Chain Sequence
CANFFPVPKDADDYEAGKADCVREKEDEKGKYWLSKPIFEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords TutD
publication title Structures of benzylsuccinate synthase elucidate roles of accessory subunits in glycyl radical enzyme activation and activity.
pubmed doi rcsb
source organism Thauera aromatica
total genus 3
structure length 41
sequence length 41
ec nomenclature ec 4.1.99.11: Benzylsuccinate synthase.
pdb deposition date 2014-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08201 BssC_TutF BssC/TutF protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1070 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4pkcC00
4PKCC
chains in the Genus database with same CATH superfamily
2DILA 2JZ2A 3LW5E 4RTYA 3H0IA 1I8FA 3G7ZA 5GMKi 2PUOB 4MZTA 2DAQA 3CBMA 3ER0A 2MCNA 1NPPA 2HKNA 2NUZA 3S3OA 2E70A 4LN2A 4JS4A 3ZEHA 4BI4A 1Q86C 1TWBA 2RHXA 4OB1B 3BY7A 2L8DA 3CMAA 1N9SA 3I56A 3CC4A 2YSQA 5IXBA 1K9AA 5M9OA 2ZAEA 1VQ6Q 4ELYC 1FX7A 1VQ7A 2DIGA 4R55A 1RAHB 3PIPA 4M78B 1MNEA 1LOJA 3L2VA 5HY6A 2K5LA 3CCRT 5GAMj 5GAN8 1SSHA 2R57A 5CO7A 3REBB 1KD1R 2O9SA 4PJLA 2EW3A 2RM4A 1FYNA 1V29B 2EBPA 1IHWA 1ZSGA 1M2VA 3URGA 3QHSA 1Q7YC 2D8HA 2F1LA 3OYCA 1QWEA 2COZA 1Q82U 4PJNA 1SG5A 2ZPEB 1M1KU 3CBOA 3S6WA 1O75A 2ED0A 1VQPT 1WLPB 2PVGB 5KCOA 1VYTA 3JCMh 3G6EQ 2V1RA 2GGRA 4BDYA 5KYXA 4E7HA 1SF9A 1MMNA 1N5ZA 4M75C 1OQKA 1OV3A 2XK0A 3HL8A 3G4SA 4A4KA 4EMGA 5I21A 4C8QB 3QYGB 1IZ6A 1M3BA 3OYLA 1S72T 5I22A 3AHUA 1M30A 2EQMA 5GAOn 1D1AA 1PRMC 3UA7A 1ZBXA 2RK2A 3EAEA 4C5IA 1ABQA 3VU3C 3CCRA 3CC2T 3RKXA 1UECA 2OTJT 4R56A 1XTDA 2JMCA 1EIFA 2P0KA 2QGGA 2YRCA 3CCVT 2XMFA 2A08A 2PTKA 3PMIA 3SDZA 1NYFA 2FL7A 2NUTB 1K76A 3CXCS 2LNVA 2WSEE 4MZPA 3EG0A 4LD6A 2CYZB 3VJPA 2CS7A 1I4K1 4XAXB 2DPPB 4ME7A 5GMKm 3I9QA 3E1SA 1NLOC 4C5EA 1KC8R 1M1GA 1X2QA 1VQPA 4QW2A 3RR6A 4QQGA 3UWNA 3ZFJA 3OBYA 3FEOA 5GAN4 4E7LA 4CRIA 1YFNA 1WHMA 5J26A 2QA4Q 4J8OA 1XQHA 1AWOA 2EKOA 4AFQC 2ROTA 3L2WA 1S72A 1R77A 1Y96B 2DK3A 2CZ0B 2K3YA 3INZA 2CP6A 1UB4A 1OZ3A 5LJ5d 4UC4A 3RESA 4JJCA 1Y07A 1VQ6T 1IGQA 2LCCA 2CP0A 2EKHA 4KGZB 5IN1A 2M0OA 3GNFB 2LT4A 1KD1U 3CC2A 2GQIA 4ZGJB 1JJ2A 2OTJA 1W2BP 2DERA 1VQ4A 4M7DB 4D8DA 2E5QA 3A8LB 4CC3A 1OEBA 3E9FA 3CCVA 2GTOA 1MGQA 2CP5A 5CKFA 5KYWB 2DETA 2V1QA 4XU1A 2E41A 1K9MR 3CPWP 4RKUE 1OULA 4XTUA 5IHIA 4XQ3A 3CMEQ 1D0XA 4DBQA 1TG0A 3G6ET 5D6YA 4BI3A 2QDLA 5KYNA 2QGFB 2JW4A 3EFOA 1ZUYA 4PJOB 4C5GA 2P0PA 2DRKA 3HRTA 3M0QA 1YNZA 2AHJB 2GTJA 2V8IA 4XU2A 2K2VA 5FROA 3X20B 4ORZA 2LQKA 2JTFA 1OI1A 2DYIA 2VVKA 1QQJA 4J7IA 2GFAA 2QQSA 1VQ6A 3RKYA 1WGSA 1IXDA 4M78D 1QP3A 2HBWA 4A4GA 4EMHA 2JM9A 2PNIA 3OYBA 4J6WA 3FIFA 2ZPIB 2LDMA 1JBMA 3HTRA 3V8JA 2RPNA 5GAOm 3KUFA 5KE3A 3EG3A 3QYHB 4KBMB 3GBQA 1K0SA 1WHLA 1WPYA 2OX7A 5GAN3 1NEGA 1OX8A 1D0ZA 1TSFA 2K3BA 3QWXX 2C0TA 3NTHA 3UF4A 4C0DC 3G6EA 1H3ZA 1BYMA 1U1TA 3OQ5A 3MEWA 3SHWA 3OYKA 3M58A 1U06A 3HHTB 4N4IA 5D6WA 1YIJQ 4KGXB 2CUBA 1BCOA 5J39A 3OYNA 1WX6A 2GCXA 2KSSA 1QVFA 2PU9B 4Q5WA 3FB9A 1MUZA 1IB8A 1KQSP 1WQ7A 1WDXA 1ZLMA 3AT1B 1LPLA 1Y0MA 1YJ9T 4LNPA 2E6NA 1PNJA 2H8HA 3P8DA 3JB9J 4RTTA 1K9MU 4QQDA 2DX1A 2RJDA 2EYWA 1FMWA 1RI9A 1D1BA 2W10A 4PNOA 2DXTA 5GAMh 3DKMA 4CC4B 3JB9I 4XK8E 2J6KA 1AWJA 3E9GA 1BB9A 1VQLQ 2FPEA 1X27A 5FWBA 4XU3A 1MMGA 1K73C 4M75B 2AKLA 3PMTA 3CMET 4IKFA 2K9GA 1GCQA 1BK2A 1FMVA 1N9RA 2RA2A 1WIEA 3DB3A 3GPLA 2QA4A 2JTMA 1M3CA 3EG2A 2CT4A 3SWNA 2KY9A 1AZEA 3RKWA 1SRMA 3OS1A 3OYIA 1SEMA 4D8KA 1RAEB 2W0ZA 3L42A 5GAOp 3MP8A 4J6XA 2GQVA 4BD3A 2L3QA 1G83A 2J06A 1YJ9A 2CKKA 2QI2A 4M7DD 1WXBA 1PRLC 4OF1A 4JPBW 4HCKA 4J7FA 1M2VB 2GNCA 4PFPA 5D6XA 4BDZA 4BI8B 4Z02A 1RUWA 2RO0A 2MOXA 1JJ2S 1DJ7B 1VQMQ 3DLLA 3P8HA 5C0MA 3I35A 3I55Q 4IUPA 5GANf 1VYVA 3JCMg 4DOWA 1WXTA 4IUUA 3H6ZA 3M56A 3EG1A 4QKUA 4RTWA 5KYXB 4Y91A 2EFIA 2FRWA 1HSQA 3CCSQ 1TH7A 3CMEA 4J6YA 1OU9A 4C5HA 3X24B 1J3TA 3QSUA 3QIIA 4PJOD 1YN8A 2X3WD 1VQKQ 4HVVA 2L3SA 4B6MA 3MEVA 4EIKA 2EQJA 4KH0B 4QT7A 1WJSA 1YCSB 1NM7A 3A1PA 3E19A 5GANe 3CCJQ 1YWOA 4FYYB 4JUVA 2NWMA 4OMOA 3UT1A 1UFFA 5KYYA 5LJ3f 2RN8A 2MK5A 4HXJA 5GAN6 1UJYA 1BBZA 2KVQG 1R0CB 1UJ0A 3JB9G 5GAMf 2DFUA 2DD4A 4MMKA 6AT1B 3RMQA 4LD9K 2GFUA 4FIBA 4AT1B 3M9QA 4C92A 1LNXA 1IO6A 1WA7A 2FZCB 1VQLT 2P0QA 3HFOA 1E6HA 5CKBA 1AHJB 2RI2A 1M2OA 2HDAA 1N6AA 5LJ3e 5CR2A 1AT1B 3JCMc 2EJ9A 3V8LA 3OB9A 4E7SA 1HD3A 2K7AA 1ARKA 3JRZA 4C0ZA 1YIJA 4E6RA 2LJ1A 1BU1A 5GAMe 1QVPA 3I56T 1ZA1B 5ECAA 2XKOC 2L3RA 4F7UF 1VQ7T 1VOMA 1JEGA 1WFWA 3LGFA 4M7AG 5HKCA 4M7AE 1OYXA 3T9NA 2K57A 5GANj 3J80E 4OVAA 1NEBA 2K6DA 4KT0E 2A37A 1QVFS 2XICA 2F5KA 2PVOB 2FPFA 2VB6A 2XDPA 2KT1A 2EGCA 2QQ9A 4LDXA 3JSCA 2VXEA 3JV3A 9ATCB 1GRIA 4ZNXA 3I55T 1V76A 2X4JA 2CZ1B 4C0DB 5GJWB 4CC7A 1VQLA 1HK9A 4M75D 3EFOB 4FCYA 3CD6T 5AT1B 4JLGA 4F04B 4QVCA 3PVLA 1M3AA 2RI5A 2EYYA 1GBRA 4ANJA 1N8RC 3QDRB 2DEQA 3G4ST 2DBKA 3CPFA 3QO3A 3NFCA 1AEYA 2DRMA 3GF5A 2HBPA 2O88A 2DNUA 4M7AA 4ESRA 3CCUQ 4AFSC 4OP0A 1KQ2A 3LH5A 4F7UG 4F7UE 4BE1A 4LDVA 3VV0A 5LJ3j 2DIQA 1K8AR 4FYVB 2VGNA 4OB2B 3CCJT 4LDUA 4E7IA 5HK3A 3PIOA 3CCLQ 4DA4A 1TXQA 1BI3A 2ABLA 5CVIA 3M54A 1JXMA 2K5IA 5A0LA 1F1BB 1KFZA 1VQMA 2DBMA 4BACA 3R6OA 1PKSA 4XTZA 1VA7A 3FJ5A 1P92A 3I55A 2QYZA 3M55A 2EVRA 2ESWA 2V8KA 2A0FB 4FM4B 1KSWA 1I07A 2CT3A 3HFNA 2FYKA 2GF7A 3CD6A 3MEUA 4EPCA 1K1ZA 4F7UA 2CP3A 3ASKA 2O31A 4LUDA 2CSIA 1ZSZA 2YT6A 3OYMA 2DL5A 1ZUKA 1WZOA 3QZ5B 3M0RA 2R5MA 1Q82C 2D1XA 4FSXA 3S3NA 5GAOr 1M1KC 3QBYA 3H0HA 4MMLA 2KRMA 5A2QE 1VQKA 4M7AC 2C0OA 1NBEB 1OPLA 2LJ0A 4IUTA 3C95A 3VUBA 4MDXA 3L2RA 1G2BA 3O8VA 2VGMA 5D7UA 4OMFB 1GFCA 2OJ2A 1VIEA 2M16A 2LVMA 3CCJA 4XU0A 1SPKA 2E12A 3CC7Q 4M77G 1YCYA 4JDSA 1KIKA 4C0GA 4F14A 4PK4A 5CIUA 1KHIA 3O5ZA 2CDTA 1IRXA 1VQ4T 3ZL7C 2JOYA 3LLRA 1OZ2A 4O5VA 2JXBA 2ROLA 1XJWB 5IHKA 1UUEA 3N5BB 1TS9A 1GXIE 4OMPA 4CI0C 3OW2A 1I81A 2BTTA 3L2ZA 4TVRA 2DVJA 2VYTA 2X9HA 5LJ5f 1GCPA 3GIBA 1T3SA 2KYMA 4QVDA 1BKBA 2KR3A 3VS5A 1YBYA 1VQOT 4ZGDB 1UGQB 3PE0A 4RUGA 1ZSZC 1B07A 2M51A 5DM7R 3CCMQ 4N0AA 5CCAA 4M77A 5EG2A 3NTKA 3J7AF 1MV0B 3OMCA 4E7ZA 1K8AU 2YUPA 3A8MB 4JJBA 2LP5A 3H8ZA 2PVDB 1VQNQ 2XI9A 1BIAA 5LJ5e 2QG9B 2QDYB 2RQUA 5L23A 2ZZDA 1X2KA 1Q81U 3PFSA 2RB6A 4GLMA 5CKEA 3EFSA 1QVGS 2Y90A 1ZX6A 3CCLT 8ATCB 4NOYA 3VS1A 2DTIA 1Z9ZA 2LNHB 4PLIA 1KD1C 2JVVA 3PGGA 2DEUA 3QJ6A 3NHNA 1B3QA 2ECZA 4KUIA 3HP9A 2DA9A 3FLGA 2DL8A 2FPDA 1I0CA 4KULA 1VQOA 2JUFA 3BDLA 3C4SA 4XTXA 3UATA 2JNGA 4QVZA 3REAB 1MMAA 1QCOA 2NYSA 5L8RE 4N0AC 4M77C 2AT1B 3FJPA 5I2SA 2FZGB 3EGDA 5IHNA 2JMAA 2B8AA 2IVWA 4DBFA 2J05A 1M4ZA 2MIOA 2LMJA 4PL6A 4E2FB 4A54A 1ZHIA 2LCLA 3R6NA 4A4EA 2L5QA 4OB0B 5KYYB 2HKQB 3V7SA 1QCNA 3OYEA 2OI3A 2AIRB 2X35A 1UGPB 1I5LA 3CEYA 3VS7A 3CC7T 4NS5A 2YRVA 3CCLA 5LJ5j 5FU6C 4JRQA 2IIMA 3RDVA 4HCZA 1TTHB 4B9WA 1W6XA 3A8OB 2EYZA 2ZPGB 2P4TA 2I2LA 2KRNA 3ULRB 4DBHA 2R58A 4JRPA 4C0FA 2KAFA 3OYDA 3CXCP 2MMPA 5GANh 3FRNA 4Y28E 1C1AA 3VS3A 3MCAB 4K11A 1QCFA 4KUDK 2ZGWA 4EMKA 3JCMd 4MZMA 4C8QG 3HSBA 2EGEA 3GLXA 1WJRA 3VYGA 2O4XB 3E2UA 1PD0A 3TVTA 2CUDA 3QG1A 1KC8C 4A4HA 2KQWA 4FYWB 2ZCFB 5DLOA 2EQKA 4KRTA 3TEEA 1UG1A 2BE9B 2DTHA 2QA4T 1Y57A 3CCMT 4II1A 2E4HA 2X3XD 2XU8A 2DXBA 2KROA 3X26B 1WJQA 1VQ5Q 3M4GA 4GY5A 2KE9A 4XTWA 1VQ9Q 5C6SA 2Y4YA 2DYBA 1VQNT 2CH4W 2B86A 3SD4A 4DQ2A 2WACA 2RHUA 1V1CA 2P4RA 3CC7A 4J5YA 5GAN7 3OYHA 1AD5A 1SHFA 2E5KA 1JB0E 4HA8A 5KYUA 1QVGP 5LJ3h 2WSCE 4ATOA 3CBPA 4OMNA 4ZTJA 1AZGB 2KI7A 4A53A 4C8QA 1WNLA 2L0AA 3VS6A 2LQNA 2K3XA 1N27A 3UA6A 3FDRA 5CQXA 1YP5A 3MPUB 2RMOA 1T0HA 2X51A 3M4YA 1RACB 4OMMA 3M0TA 2DXUA 4EMKC 1K9MC 2GBQA 3RMSA 1M90R 3OW2S 4HCCA 2E64A 2RD1A 1K73U 4PFZA 2HNIA 4M7AB 1WI7A 2NUPA 2EJFA 4OB3B 3CCMA 2M0YA 3M59A 1G5VA 3M0SA 3IQLA 4BE2A 3OBWA 2DL7A 1GL5A 4C92F 1X01A 2BUDA 1VQNA 1WXUA 1D3BA 2XD0A 2ENMA 4F16A 1RAGB 1MV3A 5CAIA 2A7YA 3X28B 5J3BA 4BE0A 2C0IA 4JRKA 2F2XA 1G3TA 2BKDN 2JS2A 2YUNA 5FWCA 4OMQA 4Y92A 2SRCA 3QPHA 1W2BA 3CMAQ 3A98A 2MPXC 1OU8A 2FEIA 2KK4A 5CK9A 3OS2A 1EX4A 2COYA 1Y96A 1U3OA 2LC4A 5HCKA 1UHCA 4N4GA 5IT9E 2OAUA 1TUDA 1AVZC 3CPWA 2AK5A 4F7UB 5FRNA 3JB9F 1ZSZB 2QQBA 3V7RA 1YJNQ 5A0DA 3DB4A 1G8XA 1UTIA 2J6FA 1ZBJA 2MWPA 2L3PA 1GCQC 5I11A 1PM3A 5KH6A 1YWPA 2DZCA 3BFMA 4C92G 4C92E 2Y4XA 5KYWA 1UGVA 2CSQA 3SWNC 3BDUA 3QDFA 1HYOA 2K4YA 1YIJT 3S3MA 1VQ9T 1NJIU 1YITQ 3OSSC 1VIFA 3RERA 4IURA 1YI2Q 4GLKA 1BI0A 2A3LA 2CGHA 4WCIA 1R8OB 2EGAA 4MDWA 2FG0A 3A5ZB 3PVQA 1ZA2B 2L2PA 4DOVA 4WF2A 2DD5A 5GMKh 1I5OB 4LE9A 1U8RA 2LQ8A 4M7AF 1IHVA 1KK7A 4JZ4A 2RQRA 3JB9H 3OS5A 2M9UA 1S1NA 3TQ7P 2IG0A 5LL6S 1M90U 3OMGA 2M02A 3LGLA 2ZPBB 5AYFA 3CXCA 3I5SA 3NGPA 3JCMP 2D9TA 3ME9A 4OMLA 1H92A 4DEYA 1LCKA 1Q7YR 2VUBA 2H3JA 4IIOA 2R5AA 1BCMA 2QQAA 3JCMJ 2DLPA 3VRYA 5I2MA 4HT8A 4YTLA 2RJCA 1RLQC 2HZYA 1QKXA 4FU6A 1RI0A 3SB2A 1TUGB 2FO0A 4JS5A 2DMOA 1RLPC 3V7CA 1VQ5A 1VQ9A 4J83A 3JB9D 4R0KA 2MI6A 3KXTA 2E3IA 3HKSA 1NZ9A 3MKDA 4FT4A 5FU6B 3OY9A 2E1HA 1NPRA 2QQRA 1KQSA 2X4WA 1RAAB 1FWZA 3C0CA 3OSVA 1TOVA 2E3HA 4HKEA 3MJXA 1U5SA 1Q95G 1JJ2P 2K2MA 2VKNA 1VQMT 4HCBA 4O6JA 1B34A 3OYAA 1UGSB 2XDBA 4J9GA 1G3WA 5LJ5h 2PZ1A 2OTJQ 4C92C 3VYHB 1A0NB 1JQQA 1VYUA 2JT4A 3M0UA 2RJFA 1VQ8Q 4FT2A 2OTLQ 2DL3A 2O2OA 3CCST 1QLYA 2EWNA 3EGDB 3MEAA 3BE3A 4RMOA 4LDYA 4M7AD 3SEMA 2YRDA 2DE0X 1C6VX 1H3HA 4FSSA 1IREB 2FB7A 2E6ZA 1TU0B 2HD0A 3X25B 1N8RU 3LH0A 2YUQA 1VQKT 1W70A 3CCQQ 2HEQA 3WVDB 2YLCA 3KBGA 1SRLA 3F70A 1Q86U 3G71Q 2D0QB 2KRSA 2O01E 1YITT 4M75A 1RABB 1YI2T 1XOVA 2HCKA 4ZN1A 3PT9A 3JAME 4NL3A 2BZYA 3OYYA 2LZ6B 4HT9A 4M77F 3CCEQ 2RHIA 1KJWA 1GFDA 1Q81R 2V8JA 5GANg 2COWA 1ZQ1A 1X6GA 5DLQE 4CC2A 2L89A 4EMKB 2A36A 2QAZA 3HRSA 2FVUA 1W2BS 2LX9A 2VV5A 3QXEB 1Q7YU 3DLMA 2X4YA 4J9EA 1YJNA 1M1FA 3CCSA 1X6OA 5GAOl 3CPWS 3META 4XTYA 5GMKe 2DJZA 4X1VA 2MAMA 1BI2A 2FHDA 1RL2A 2HQEA 2HL5C 2O9VA 2CP2A 4V2SA 2FRYA 1FXXA 5LJ3g 1YITA 5KYUB 1YI2A 1AWXA 3QJYA 1NG2A 2RQVA 4WTOB 4M77E 2WSFE 2I0NA 4FYXB 2QXFA 4ELZC 2HQXA 3JCMV 2VC8A 3EG9A 5GAMg 1QVFP 3EGXA 4RCCA 2RK1A 3LWIA 1WYXA 2V26A 1UE9A 3Q1JA 1M9SA 3U23A 3HRUA 2G6FX 5KCHA 2CZ7B 4PKCC 3OS0A 1PCXA 5GAOq 1X43A 4JRIA 4BY6C 3MP1A 1HJDA 3NTIA 2QEXQ 1VQ8T 2NUPB 2YUOA 2OTLT 4M77D 4J9DA 5EC7A 2AKKA 2EAYA 3SWNB 4GBQA 1D09B 4JLIA 1ABOA 5GAN5 1LJOA 1D3BB 1LVKA 1U1SA 2YWWA 2HL3A 3JCMW 3WXMB 2HSEB 2E10A 4VUBA 2D0NA 3CCQT 2KDSA 5GMKj 3CCUT 5FU7C 3KFVA 3HPWA 4M78F 3NPFA 2DKGA 3M53A 1KG1A 2JM8A 1UEBA 3M57A 3QWYA 3G71T 1C0MA 1T3LA 1QP2A 2KYBA 4FL6A 2F2VA 3BW1A 3VS0A 1PHTA 2EJGA 5HK0A 2VWFA 3TU4K 3RUXA 1K8AC 4KGVB 1E6GA 3QUIA 4E7KA 2JS0A 2AZSA 2RQTA 4RCBA 3CCET 4PLLA 2BE7D 2XDDA 4QQ6A 4RTXA 2ATCB 1Q81C 1KQSS 1YJ9Q 2RHYA 1W1FA 2KGTA 2K5FA 1CKBA 1VQ8A 2OTLA 1WQWA 1X6BA 4HVUA 4C8QF 2LRQA 1SKUB 2QTVA 1X69A 2DTOA 1YHQQ 1QWFA 1MMDA 4DEXA 3V8KA 1PSEA 2F69A 1K73R 1OPKA 4M78G 5FW9A 4M78E 2YLBA 2DJQA 2LCSA 3CCQA 3CCUA 4L59A 4A63B 3JCMf 1PKTA 3OYJA 3G71A 3OYFA 3C12A 2CP7A 3C94A 1W4SA 1WHHA 4DBRA 2ED1A 4J9CA 4AG1C 1Z9QA 2RQWA 4B9XA 1T0JA 4M4ZA 3SFMA 3CCEA 4AMCA 1JU5C 3M5AA 3NMZC 4C92B 1ACMB 2BZXA 3GP8A 4E47A 1WHJA 1Y71A 2DM1A 2ZPHB 7AT1B 3I5RA 3JCMe 3TSZA 3LX7A 1EZZB 4C8QE 4M78A 3EHRA 1H641 4JZ3A 2F2WA 2QEXT 1QKWA 4Z88A 1OOTA 2CH4A 1KC8U 2NLUA 5IH2A 4Z89A 3JCMX 2KXCA 4J9BA 3MP6A 4FW1A 5CKHA 2EYXA 2A28A 2M1HA 4X34A 4L6V5 1MNDA 3D7SB 1NYGA 4KH1B 4PJJA 4M7DF 2QASA 4BB7A 3LWHA 3QKJA 1NJIR 4C8QD 2F5TX 4AG2C 1GBQA 3VS2A 1YJWQ 4J9FA 2D6FA 1B7TA 3A8HB 1MHNA 4LXCA 4D6WA 2OAWA 2JN0A 1B34B 4NL2A 2KMTA 5LJ5g 5KE2A 1JO8A 1G3SA 1M27C 3CQTA 2RI3A 2E65A 4OGCA 2LTOA 5GJVB 2MYSA 4OGEA 4M78C 4X9DA 3TSWA 1EFNA 3JCMb 1XNIA 2QEXA 4PJOF 2FZKB 1WHKA 1M8VA 4X9CA 2MF2A 3QZ9B 2QK0A 3LYIA 1YHQT 4A4FA 2NUTA 2G3RA 2K79A 2KBTA 4PFOA 1E7OA 1RADB 3EHQA 4M7DG 2PUKB 4IIMA 2YHTA 4M7DE 3EH1A 2DF6A 2J6OA 1O9SA 1PC0A 1IGUA 1R0BG 2H3EB 3H0FA 3WVEB 5FRMA 4F17A 4ZGEB 3ZBDA 4AFZC 2EIFA 4RTUA 1PWTA 2QTXA 2SEMA 3M0PA 5CKDA 1TUCA 2HSPA 4LUEA 2RHZA 5DY9A 5GAN2 1PD1A 4C8QC 3I56Q 3FC3A 3CC4Q 4FW2A 4Z8AA 4RG2A 3MHXA 1VQ7Q 2D8JA 1NE8A 3EGUA 3OA6A 4BY6B 1JXOA 1K4US 1BIBA 2X4XA 2BIVA 1VUBA 2HAXA 4PJOG 4PJOE 3PNWC 2PQWA 2C06A 4P5NA 3GNGA 4ZTFA 3MO8A 2LX7A 3RNJA 4M7DA 1CKAA 5IAYA 5FLXE 1H8KA 1WHGA 2CREA 1YHQA 1FMKA 5FU7B 3CD6Q 2CZ6B 3A8GB 2P84A 1N8RR 1VQ5T 2HMAA 2DXCA 3PTAA 1CSKA 3P8BB 3VS4A 4J9IA 1X75C 3G4SQ 3EG9B 2Z0WA 1Q86R 1M8MA 3L1AA 3EGXB 4N4HA 1M5Q1 1KQ1A 2RJEA 2EYQA 1Y7XA 1QMCA 1NJIC 3EH2A 1YJWT 4PJOA 2KEAA 3UDCA 1QW1A 2J7IA 3THKA 4C92D 1BI1A 5GANd 3UPUA 1PSFA 4RTZA 2VXFA 4IUQA 2XIDA 3CCRQ 4JJNK 4M75F 2BZ8A 2EQUA 3RIRA 2LQWA 3JCMQ 4ZN3A 3OW2P 2VASA 5CQYA 2EPDA 3H41A 4M7DC 2RNAA 1M90C 1SHGA 3VKIA 1HXDA 2IPOB 4M77B 1RAIB 1UHFA 3EFRA 1G3YA 8AT1B 3TREA 3VRZA 4BUGA 3TCJA 2DVEA 1VQPQ 1RAFB 2JTEA 5GMKl 2KNBB 2DO3A 2EQIA 1AWWA 1Q82R 3H9NA 1M1KR 4XTVA 1K0XA 1SSFA 1ZUUA 2O4XA 1D1CA 2RH2A 2YXYA 5LJ3d 3OYGA 1AOJA 1S72Q 3L2QA 4LDWA 4PJOC 1YJWA 2DZ9A 2HQHA 1NLPC 2JJ9A 2XHCA 1QVGA 3CMAT 3J81E 3CC4T 5GAMd 5IXFA 2KT8A 4M75G 3L2UA 4M75E 4EDUA 1UGRB 3CC2Q 2LT1A 1VQ4Q 3GOXA 4HVWA 4L5GA 4RG8A 1UDLA 2AZVA 3VUZA 3CCVQ 2YDLA 1YJNT 4AFUC 5A0GA 2RF0A 4IUVA 1JRIA 1D0YA 2LJ3A 1OX9A 2KXDA 2XG8D 4PJMA 4J9HA 1I1JA 4E7JA 4JJDA 2ZPFB 4RTVA 2DL4A 1KHCA 2MWOA 3RBBB 3G1JA 1PG5B 1VQOQ
chains in the Genus database with same CATH topology
3TEEA 3LW5E 2JZ2A 1LJOA 1D3BB 4J6YA 3X24B 4C5HA 1U1SA 3QSUA 1I8FA 3QIIA 3JCMW 3G7ZA 3WXMB 5GMKi 2E10A 2DTHA 2QA4T 3CCMT 4VUBA 2PUOB 4II1A 4MZTA 3CCQT 4PJOD 2KDSA 2DAQA 3CBMA 3ER0A 5GMKj 2XU8A 3CCUT 2DXBA 5FU7C 3X26B 3HPWA 4M78F 2DKGA 1NPPA 1WJQA 3M53A 1KG1A 3M4GA 4GY5A 4XTWA 1UEBA 3M57A 3MEVA 5C6SA 2Y4YA 2EQJA 3G71T 1QP2A 1WJSA 3S3OA 1VQNT 4FL6A 2E70A 3BW1A 3SD4A 3E19A 2EJGA 4DQ2A 5HK0A 4JS4A 3RUXA 3ZEHA 4BI4A 3TU4K 1Q86C 1K8AC 5GANe 2WACA 2RHXA 2RHUA 4OB1B 3CC7A 3BY7A 2L8DA 4J5YA 5GAN7 3QUIA 3CMAA 1N9SA 3OYHA 3I56A 4E7KA 3CC4A 5M9OA 1JB0E 4RCBA 4HA8A 3CCET 4JUVA 4ELYC 1FX7A 4PLLA 5LJ3h 2WSCE 1VQ7A 4ATOA 2DIGA 4R55A 3CBPA 3UT1A 4ZTJA 2XDDA 3PIPA 4M78B 4QQ6A 4A53A 1LOJA 3L2VA 4C8QA 5HY6A 5LJ3f 1Q81C 1KQSS 2K5LA 1WNLA 3CCRT 5GAMj 5GAN8 2K3XA 5GAN6 2R57A 5CO7A 2XDBA 1N27A 3FDRA 5CQXA 2KVQG 3M4YA 2RHYA 2RM4A 2K5FA 1V29B 3JB9G 5GAMf 2DD4A 2DXUA 4MMKA 4EMKC 1VQ8A 1K9MC 3RMQA 3RMSA 4LD9K 2GFUA 3OW2S 2OTLA 1WQWA 4FIBA 4HCCA 3M9QA 4C92A 3URGA 1LNXA 4C8QF 3QHSA 2LRQA 1Q7YC 3OYCA 2E64A 2RD1A 1Q82U 1VQLT 2P0QA 2DTOA 1K73U 2ZPEB 1M1KU 2HNIA 3HFOA 5CKBA 3CBOA 3V8KA 3S6WA 1AHJB 1O75A 2RI2A 4M7AB 1PSEA 2F69A 1VQPT 4M78G 2PVGB 2EJFA 4M78E 4OB3B 5KCOA 2YLBA 3JCMh 3CCMA 4BDYA 3M59A 3CCQA 1G5VA 3CCUA 1N6AA 4L59A 5LJ3e 4BE2A 5CR2A 4E7HA 3OBWA 3JCMf 3JCMc 4M75C 2EJ9A 4C92F 1X01A 3V8LA 3OYJA 2BUDA 2XK0A 3OB9A 3HL8A 3G71A 3G4SA 4A4KA 4EMGA 5I21A 3C12A 3OYFA 1VQNA 4C8QB 3JRZA 1D3BA 4C0ZA 1YIJA 3C94A 1W4SA 2XD0A 3QYGB 1IZ6A 5CAIA 2A7YA 3OYLA 5GAMe 3X28B 1S72T 1QVPA 5J3BA 4BE0A 3I56T 3AHUA 4JRKA 4B9XA 2XKOC 1G3TA 2EQMA 2BKDN 2L3RA 4F7UF 1VQ7T 3LGFA 5GAOn 3SFMA 3CCEA 4M7AG 1ZBXA 5HKCA 4M7AE 1OYXA 2RK2A 3T9NA 3EAEA 2K57A 3QPHA 1W2BA 5GANj 3M5AA 4C92B 4OVAA 4C5IA 3J80E 3CCRA 3VU3C 4KT0E 3GP8A 3RKXA 3CC2T 4E47A 2KK4A 1QVFS 2XICA 5CK9A 1Y71A 2F5KA 2PVOB 2ZPHB 3OS2A 2OTJT 1Y96A 2XDPA 2LC4A 4R56A 5IT9E 4N4GA 1XTDA 3JCMe 1EIFA 2P0KA 2QQ9A 2OAUA 2VXEA 3JSCA 3LX7A 4LDXA 3CCVT 3PMIA 4C8QE 4M78A 3CPWA 3SDZA 4F7UB 2FL7A 5FRNA 3CXCS 1H641 3JB9F 2LNVA 2QQBA 2WSEE 3V7RA 3I55T 4MZPA 2QEXT 5A0DA 2X4JA 2CZ1B 4LD6A 4C0DB 2CYZB 3DB4A 2CS7A 3VJPA 1I4K1 4XAXB 2DPPB 1VQLA 1HK9A 2MWPA 4ME7A 2NLUA 5GMKm 1KC8U 4M75D 3E1SA 3CD6T 4JLGA 4C5EA 1M1GA 5KH6A 1VQPA 3JCMX 3OW2A 4QW2A 2DZCA 3BFMA 4QVCA 4QQGA 4C92G 4C92E 3MP6A 2RI5A 3UWNA 2Y4XA 5CKHA 3ZFJA 3OBYA 1N8RC 3FEOA 3SWNC 5GAN4 4X34A 2M1HA 3BDUA 3QDRB 4E7LA 4CRIA 4L6V5 2DEQA 3G4ST 3CPFA 3QO3A 3NFCA 3GF5A 2HBPA 5J26A 2K4YA 1YIJT 4M7AA 3S3MA 1VQ9T 1NJIU 4M7DF 4J8OA 1XQHA 4OP0A 4BB7A 3LWHA 1KQ2A 4F7UG 4F7UE 3QKJA 4BE1A 3OSSC 2EKOA 4C8QD 1VIFA 3RERA 2F5TX 4LDVA 4IURA 3VV0A 5LJ3j 2DIQA 3L2WA 4GLKA 1S72A 1BI0A 1Y96B 2A3LA 2CGHA 2DK3A 2CZ0B 1R8OB 2K3YA 3A5ZB 3INZA 2VGNA 4MDWA 2D6FA 4OB2B 3A8HB 4DOVA 1MHNA 4WF2A 4D6WA 3CCJT 2DD5A 5GMKh 4LDUA 4E7IA 2JN0A 1B34B 1OZ3A 1UB4A 2KMTA 4NL2A 5LJ5g 4UC4A 3RESA 5KE2A 1Y07A 5HK3A 1G3SA 2LCCA 5LJ5d 1VQ6T 3PIOA 1U8RA 2LQ8A 5IN1A 4DA4A 4M7AF 2M0OA 1BI3A 3GNFB 5CVIA 2LT4A 1KD1U 3CC2A 3M54A 2RI3A 4ZGJB 1JJ2A 2E65A 2OTJA 3JB9H 3OS5A 1VQ4A 4OGCA 4M7DB 2K5IA 2LTOA 2M9UA 5A0LA 2IG0A 2E5QA 5LL6S 1M90U 3OMGA 3A8LB 4OGEA 3E9FA 3LGLA 4M78C 4X9DA 1MGQA 2ZPBB 3CCVA 4BACA 1VQMA 5AYFA 3R6OA 5CKFA 4XTZA 3CXCA 1P92A 3JCMP 3I55A 4XU1A 3JCMb 1XNIA 2E41A 2D9TA 2QEXA 4PJOF 3M55A 3ME9A 4RKUE 2V8KA 4FM4B 3HFNA 1M8VA 4X9CA 2FYKA 2GF7A 3CD6A 2MF2A 2VUBA 2H3JA 4XTUA 3QZ9B 2R5AA 3LYIA 3MEUA 4XQ3A 4EPCA 2QQAA 1YHQT 3JCMJ 4A4FA 4F7UA 3ASKA 2G3RA 5I2MA 4HT8A 4YTLA 3OYMA 2RJCA 3QZ5B 3SB2A 1RI0A 2R5MA 4FU6A 5D6YA 4BI3A 3G6ET 4FSXA 1Q82C 3S3NA 2PUKB 4M7DG 2YHTA 4M7DE 5GAOr 1M1KC 3QBYA 4MMLA 5A2QE 1O9SA 1VQKA 4M7AC 4JS5A 4IUTA 3V7CA 1VQ5A 1VQ9A 4PJOB 3C95A 2P0PA 4J83A 4C5GA 3VUBA 3JB9D 4MDXA 3WVEB 5FRMA 2MI6A 3HRTA 3KXTA 3O8VA 3L2RA 2AHJB 2V8IA 4XU2A 2K2VA 2VGMA 3HKSA 3ZBDA 4ZGEB 5FROA 2EIFA 3X20B 1NZ9A 4OMFB 2QTXA 4FT4A 2LQKA 5FU6B 3OY9A 1VIEA 2JTFA 5CKDA 1OI1A 2M16A 2LVMA 3CCJA 2E1HA 1NPRA 2RHZA 4XU0A 5DY9A 2E12A 2QQRA 2GFAA 4J7IA 1YCYA 2QQSA 4JDSA 4M77G 4C8QC 3FC3A 1KQSA 1VQ6A 3RKYA 1WGSA 4C0GA 2X4WA 4M78D 4RG2A 3MHXA 5CIUA 1KHIA 1FWZA 1QP3A 1NE8A 4A4GA 3OSVA 4EMHA 1VQ4T 4HKEA 2JOYA 3LLRA 1OZ2A 4J6WA 4O5VA 3OYBA 3OA6A 4BY6B 3FIFA 2ZPIB 2LDMA 1JBMA 1BIBA 2X4XA 1VQMT 4HCBA 3N5BB 4O6JA 1B34A 3OYAA 2BIVA 1GXIE 1UGSB 1VUBA 4CI0C 4PJOG 3V8JA 1G3WA 5LJ5h 5GAOm 3KUFA 1I81A 3PNWC 2PQWA 2C06A 4PJOE 4P5NA 5KE3A 3L2ZA 4C92C 3VYHB 3QYHB 4TVRA 2VYTA 4KBMB 3GNGA 5LJ5f 3GIBA 4ZTFA 3MO8A 2RJFA 1BKBA 4QVDA 4M7DA 1WPYA 4FT2A 5IAYA 5GAN3 5FLXE 3CCST 1YBYA 2EWNA 1VQOT 3MEAA 4ZGDB 4RMOA 4LDYA 1YHQA 4M7AD 1UGQB 3NTHA 5FU7B 1IREB 2FB7A 2E6ZA 4C0DC 2HD0A 3X25B 2CZ6B 3G6EA 3LH0A 1N8RU 1H3ZA 1BYMA 5DM7R 3A8GB 1VQKT 4N0AA 5CCAA 1U1TA 3WVDB 3OQ5A 3MEWA 1VQ5T 2YLCA 3KBGA 4M77A 5EG2A 3OYKA 3NTKA 3J7AF 2DXCA 3PTAA 3F70A 3P8BB 1Q86U 3OMCA 3M58A 1K8AU 1X75C 3A8MB 2D0QB 3HHTB 4N4IA 3H8ZA 2PVDB 3L1AA 2XI9A 5D6WA 1BIAA 2O01E 1YITT 4M75A 4N4HA 5LJ5e 1YI2T 1M5Q1 5J39A 1XOVA 1KQ1A 2QDYB 2RJEA 2EYQA 3PT9A 1Y7XA 4ZN1A 3OYNA 1NJIC 3JAME 2GCXA 2ZZDA 1YJWT 4PJOA 4NL3A 2KSSA 3OYYA 1Q81U 3PFSA 1QVFA 3UDCA 4HT9A 1QW1A 2RB6A 4M77F 2RHIA 5CKEA 2PU9B 3EFSA 1QVGS 4Q5WA 3FB9A 2V8JA 4C92D 1BI1A 5GANg 2Y90A 5GANd 3UPUA 1ZQ1A 1PSFA 1WQ7A 3CCLT 2VXFA 4IUQA 4NOYA 1YJ9T 5DLQE 2XIDA 4JJNK 2E6NA 2DTIA 2L89A 4M75F 4EMKB 2EQUA 3P8DA 3RIRA 3JB9J 1K9MU 3HRSA 2FVUA 4PLIA 4QQDA 1W2BS 2LX9A 2VV5A 2RJDA 1KD1C 2JVVA 3PGGA 3JCMQ 4ZN3A 3QXEB 1Q7YU 5CQYA 3QJ6A 4KUIA 4PNOA 2DXTA 3DLMA 4M7DC 2X4YA 3HP9A 5GAMh 1M90C 3DKMA 1YJNA 3FLGA 3VKIA 1HXDA 4M77B 1M1FA 3CCSA 3JB9I 4KULA 1X6OA 4XK8E 1VQOA 3EFRA 5GAOl 3E9GA 3CPWS 3META 1G3YA 2JUFA 3BDLA 3C4SA 4XTXA 2JNGA 4XTYA 4QVZA 5GMKe 3TREA 4BUGA 4XU3A 1K73C 4M75B 2DJZA 2DVEA 3TCJA 3PMTA 5GMKl 3CMET 4IKFA 2DO3A 5L8RE 4N0AC 2MAMA 1BI2A 2FHDA 1RL2A 4M77C 3FJPA 5I2SA 2RA2A 1N9RA 2HQEA 2B8AA 2IVWA 4XTVA 3DB3A 3GPLA 1SSFA 4V2SA 1M4ZA 2QA4A 2JTMA 2O4XA 4PL6A 1FXXA 2RH2A 3SWNA 4A54A 2KY9A 1ZHIA 5LJ3d 5LJ3g 1YITA 2LCLA 3RKWA 4A4EA 3OS1A 3OYGA 3OYIA 1YI2A 3QJYA 2L5QA 4M77E 2WSFE 3L2QA 4OB0B 3L42A 4LDWA 2QXFA 5GAOp 2HAXA 3MP8A 3V7SA 1YJWA 4J6XA 4PJOC 4ELZC 2DZ9A 2GQVA 2HQXA 3JCMV 4BD3A 3OYEA 2XHCA 1QVGA 2X35A 1UGPB 1I5LA 2VC8A 3CEYA 3CC7T 3CMAT 3J81E 4NS5A 3CC4T 5GAMd 5GAMg 3L2UA 4M75G 4M75E 2YRVA 5GAN2 4EDUA 5LJ5j 3CCLA 5FU6C 4JRQA 1UGRB 2RK1A 4RCCA 1YJ9A 3LWIA 2CKKA 2QI2A 3Q1JA 4HCZA 4M7DD 4B9WA 1M9SA 4OF1A 3A8OB 2LT1A 2ZPGB 3HRUA 2P4TA 2I2LA 3GOXA 5KCHA 2R58A 4J7FA 4L5GA 5D6XA 4RG8A 4BDZA 4BI8B 2CZ7B 4JRPA 4C0FA 4PKCC 4Z02A 2KAFA 2RO0A 3OS0A 3OYDA 2MMPA 3VUZA 1JJ2S 5GANh 1DJ7B 4JRIA 5GAOq 3FRNA 4Y28E 3DLLA 1YJNT 4BY6C 3P8HA 5A0GA 5C0MA 3MCAB 3MP1A 3NTIA 4IUVA 4IUPA 1JRIA 5GANf 4KUDK 2ZGWA 1VQ8T 4DOWA 3JCMg 4EMKA 3JCMd 4MZMA 4IUUA 4C8QG 3HSBA 2OTLT 4M77D 3GLXA 2XG8D 3H6ZA 1WJRA 3M56A 3VYGA 2O4XB 4E7JA 2EAYA 3SWNB 4Y91A 2EFIA 3QG1A 2ZPFB 1KC8C 4A4HA 2KQWA 4JLIA 1KHCA 2MWOA 1TH7A 2ZCFB 3CMEA 5DLOA 2EQKA 5GAN5
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PKC C; 
#chains in the Genus database with same CATH topology
 2DIL A;  2JZ2 A;  3LW5 E;  4RTY A;  3H0I A;  1I8F A;  3G7Z A;  5GMK i;  2PUO B;  4MZT A;  2DAQ A;  3CBM A;  3ER0 A;  2MCN A;  1NPP A;  2HKN A;  2NUZ A;  3S3O A;  2E70 A;  4LN2 A;  4JS4 A;  3ZEH A;  4BI4 A;  1Q86 C;  1TWB A;  2RHX A;  4OB1 B;  3BY7 A;  2L8D A;  3CMA A;  1N9S A;  3I56 A;  3CC4 A;  2YSQ A;  5IXB A;  1K9A A;  5M9O A;  2ZAE A;  1VQ6 Q;  4ELY C;  1FX7 A;  1VQ7 A;  2DIG A;  4R55 A;  1RAH B;  3PIP A;  4M78 B;  1MNE A;  1LOJ A;  3L2V A;  5HY6 A;  2K5L A;  3CCR T;  5GAM j;  5GAN 8;  1SSH A;  2R57 A;  5CO7 A;  3REB B;  1KD1 R;  2O9S A;  4PJL A;  2EW3 A;  2RM4 A;  1FYN A;  1V29 B;  2EBP A;  1IHW A;  1ZSG A;  1M2V A;  3URG A;  3QHS A;  1Q7Y C;  2D8H A;  2F1L A;  3OYC A;  1QWE A;  2COZ A;  1Q82 U;  4PJN A;  1SG5 A;  2ZPE B;  1M1K U;  3CBO A;  3S6W A;  1O75 A;  2ED0 A;  1VQP T;  1WLP B;  2PVG B;  5KCO A;  1VYT A;  3JCM h;  3G6E Q;  2V1R A;  2GGR A;  4BDY A;  5KYX A;  4E7H A;  1SF9 A;  1MMN A;  1N5Z A;  4M75 C;  1OQK A;  1OV3 A;  2XK0 A;  3HL8 A;  3G4S A;  4A4K A;  4EMG A;  5I21 A;  4C8Q B;  3QYG B;  1IZ6 A;  1M3B A;  3OYL A;  1S72 T;  5I22 A;  3AHU A;  1M30 A;  2EQM A;  5GAO n;  1D1A A;  1PRM C;  3UA7 A;  1ZBX A;  2RK2 A;  3EAE A;  4C5I A;  1ABQ A;  3VU3 C;  3CCR A;  3CC2 T;  3RKX A;  1UEC A;  2OTJ T;  4R56 A;  1XTD A;  2JMC A;  1EIF A;  2P0K A;  2QGG A;  2YRC A;  3CCV T;  2XMF A;  2A08 A;  2PTK A;  3PMI A;  3SDZ A;  1NYF A;  2FL7 A;  2NUT B;  1K76 A;  3CXC S;  2LNV A;  2WSE E;  4MZP A;  3EG0 A;  4LD6 A;  2CYZ B;  3VJP A;  2CS7 A;  1I4K 1;  4XAX B;  2DPP B;  4ME7 A;  5GMK m;  3I9Q A;  3E1S A;  1NLO C;  4C5E A;  1KC8 R;  1M1G A;  1X2Q A;  1VQP A;  4QW2 A;  3RR6 A;  4QQG A;  3UWN A;  3ZFJ A;  3OBY A;  3FEO A;  5GAN 4;  4E7L A;  4CRI A;  1YFN A;  1WHM A;  5J26 A;  2QA4 Q;  4J8O A;  1XQH A;  1AWO A;  2EKO A;  4AFQ C;  2ROT A;  3L2W A;  1S72 A;  1R77 A;  1Y96 B;  2DK3 A;  2CZ0 B;  2K3Y A;  3INZ A;  2CP6 A;  1UB4 A;  1OZ3 A;  5LJ5 d;  4UC4 A;  3RES A;  4JJC A;  1Y07 A;  1VQ6 T;  1IGQ A;  2LCC A;  2CP0 A;  2EKH A;  4KGZ B;  5IN1 A;  2M0O A;  3GNF B;  2LT4 A;  1KD1 U;  3CC2 A;  2GQI A;  4ZGJ B;  1JJ2 A;  2OTJ A;  1W2B P;  2DER A;  1VQ4 A;  4M7D B;  4D8D A;  2E5Q A;  3A8L B;  4CC3 A;  1OEB A;  3E9F A;  3CCV A;  2GTO A;  1MGQ A;  2CP5 A;  5CKF A;  5KYW B;  2DET A;  2V1Q A;  4XU1 A;  2E41 A;  1K9M R;  3CPW P;  4RKU E;  1OUL A;  4XTU A;  5IHI A;  4XQ3 A;  3CME Q;  1D0X A;  4DBQ A;  1TG0 A;  3G6E T;  5D6Y A;  4BI3 A;  2QDL A;  5KYN A;  2QGF B;  2JW4 A;  3EFO A;  1ZUY A;  4PJO B;  4C5G A;  2P0P A;  2DRK A;  3HRT A;  3M0Q A;  1YNZ A;  2AHJ B;  2GTJ A;  2V8I A;  4XU2 A;  2K2V A;  5FRO A;  3X20 B;  4ORZ A;  2LQK A;  2JTF A;  1OI1 A;  2DYI A;  2VVK A;  1QQJ A;  4J7I A;  2GFA A;  2QQS A;  1VQ6 A;  3RKY A;  1WGS A;  1IXD A;  4M78 D;  1QP3 A;  2HBW A;  4A4G A;  4EMH A;  2JM9 A;  2PNI A;  3OYB A;  4J6W A;  3FIF A;  2ZPI B;  2LDM A;  1JBM A;  3HTR A;  3V8J A;  2RPN A;  5GAO m;  3KUF A;  5KE3 A;  3EG3 A;  3QYH B;  4KBM B;  3GBQ A;  1K0S A;  1WHL A;  1WPY A;  2OX7 A;  5GAN 3;  1NEG A;  1OX8 A;  1D0Z A;  1TSF A;  2K3B A;  3QWX X;  2C0T A;  3NTH A;  3UF4 A;  4C0D C;  3G6E A;  1H3Z A;  1BYM A;  1U1T A;  3OQ5 A;  3MEW A;  3SHW A;  3OYK A;  3M58 A;  1U06 A;  3HHT B;  4N4I A;  5D6W A;  1YIJ Q;  4KGX B;  2CUB A;  1BCO A;  5J39 A;  3OYN A;  1WX6 A;  2GCX A;  2KSS A;  1QVF A;  2PU9 B;  4Q5W A;  3FB9 A;  1MUZ A;  1IB8 A;  1KQS P;  1WQ7 A;  1WDX A;  1ZLM A;  3AT1 B;  1LPL A;  1Y0M A;  1YJ9 T;  4LNP A;  2E6N A;  1PNJ A;  2H8H A;  3P8D A;  3JB9 J;  4RTT A;  1K9M U;  4QQD A;  2DX1 A;  2RJD A;  2EYW A;  1FMW A;  1RI9 A;  1D1B A;  2W10 A;  4PNO A;  2DXT A;  5GAM h;  3DKM A;  4CC4 B;  3JB9 I;  4XK8 E;  2J6K A;  1AWJ A;  3E9G A;  1BB9 A;  1VQL Q;  2FPE A;  1X27 A;  5FWB A;  4XU3 A;  1MMG A;  1K73 C;  4M75 B;  2AKL A;  3PMT A;  3CME T;  4IKF A;  2K9G A;  1GCQ A;  1BK2 A;  1FMV A;  1N9R A;  2RA2 A;  1WIE A;  3DB3 A;  3GPL A;  2QA4 A;  2JTM A;  1M3C A;  3EG2 A;  2CT4 A;  3SWN A;  2KY9 A;  1AZE A;  3RKW A;  1SRM A;  3OS1 A;  3OYI A;  1SEM A;  4D8K A;  1RAE B;  2W0Z A;  3L42 A;  5GAO p;  3MP8 A;  4J6X A;  2GQV A;  4BD3 A;  2L3Q A;  1G83 A;  2J06 A;  1YJ9 A;  2CKK A;  2QI2 A;  4M7D D;  1WXB A;  1PRL C;  4OF1 A;  4JPB W;  4HCK A;  4J7F A;  1M2V B;  2GNC A;  4PFP A;  5D6X A;  4BDZ A;  4BI8 B;  4Z02 A;  1RUW A;  2RO0 A;  2MOX A;  1JJ2 S;  1DJ7 B;  1VQM Q;  3DLL A;  3P8H A;  5C0M A;  3I35 A;  3I55 Q;  4IUP A;  5GAN f;  1VYV A;  3JCM g;  4DOW A;  1WXT A;  4IUU A;  3H6Z A;  3M56 A;  3EG1 A;  4QKU A;  4RTW A;  5KYX B;  4Y91 A;  2EFI A;  2FRW A;  1HSQ A;  3CCS Q;  1TH7 A;  3CME A;  4J6Y A;  1OU9 A;  4C5H A;  3X24 B;  1J3T A;  3QSU A;  3QII A;  4PJO D;  1YN8 A;  2X3W D;  1VQK Q;  4HVV A;  2L3S A;  4B6M A;  3MEV A;  4EIK A;  2EQJ A;  4KH0 B;  4QT7 A;  1WJS A;  1YCS B;  1NM7 A;  3A1P A;  3E19 A;  5GAN e;  3CCJ Q;  1YWO A;  4FYY B;  4JUV A;  2NWM A;  4OMO A;  3UT1 A;  1UFF A;  5KYY A;  5LJ3 f;  2RN8 A;  2MK5 A;  4HXJ A;  5GAN 6;  1UJY A;  1BBZ A;  2KVQ G;  1R0C B;  1UJ0 A;  3JB9 G;  5GAM f;  2DFU A;  2DD4 A;  4MMK A;  6AT1 B;  3RMQ A;  4LD9 K;  2GFU A;  4FIB A;  4AT1 B;  3M9Q A;  4C92 A;  1LNX A;  1IO6 A;  1WA7 A;  2FZC B;  1VQL T;  2P0Q A;  3HFO A;  1E6H A;  5CKB A;  1AHJ B;  2RI2 A;  1M2O A;  2HDA A;  1N6A A;  5LJ3 e;  5CR2 A;  1AT1 B;  3JCM c;  2EJ9 A;  3V8L A;  3OB9 A;  4E7S A;  1HD3 A;  2K7A A;  1ARK A;  3JRZ A;  4C0Z A;  1YIJ A;  4E6R A;  2LJ1 A;  1BU1 A;  5GAM e;  1QVP A;  3I56 T;  1ZA1 B;  5ECA A;  2XKO C;  2L3R A;  4F7U F;  1VQ7 T;  1VOM A;  1JEG A;  1WFW A;  3LGF A;  4M7A G;  5HKC A;  4M7A E;  1OYX A;  3T9N A;  2K57 A;  5GAN j;  3J80 E;  4OVA A;  1NEB A;  2K6D A;  4KT0 E;  2A37 A;  1QVF S;  2XIC A;  2F5K A;  2PVO B;  2FPF A;  2VB6 A;  2XDP A;  2KT1 A;  2EGC A;  2QQ9 A;  4LDX A;  3JSC A;  2VXE A;  3JV3 A;  9ATC B;  1GRI A;  4ZNX A;  3I55 T;  1V76 A;  2X4J A;  2CZ1 B;  4C0D B;  5GJW B;  4CC7 A;  1VQL A;  1HK9 A;  4M75 D;  3EFO B;  4FCY A;  3CD6 T;  5AT1 B;  4JLG A;  4F04 B;  4QVC A;  3PVL A;  1M3A A;  2RI5 A;  2EYY A;  1GBR A;  4ANJ A;  1N8R C;  3QDR B;  2DEQ A;  3G4S T;  2DBK A;  3CPF A;  3QO3 A;  3NFC A;  1AEY A;  2DRM A;  3GF5 A;  2HBP A;  2O88 A;  2DNU A;  4M7A A;  4ESR A;  3CCU Q;  4AFS C;  4OP0 A;  1KQ2 A;  3LH5 A;  4F7U G;  4F7U E;  4BE1 A;  4LDV A;  3VV0 A;  5LJ3 j;  2DIQ A;  1K8A R;  4FYV B;  2VGN A;  4OB2 B;  3CCJ T;  4LDU A;  4E7I A;  5HK3 A;  3PIO A;  3CCL Q;  4DA4 A;  1TXQ A;  1BI3 A;  2ABL A;  5CVI A;  3M54 A;  1JXM A;  2K5I A;  5A0L A;  1F1B B;  1KFZ A;  1VQM A;  2DBM A;  4BAC A;  3R6O A;  1PKS A;  4XTZ A;  1VA7 A;  3FJ5 A;  1P92 A;  3I55 A;  2QYZ A;  3M55 A;  2EVR A;  2ESW A;  2V8K A;  2A0F B;  4FM4 B;  1KSW A;  1I07 A;  2CT3 A;  3HFN A;  2FYK A;  2GF7 A;  3CD6 A;  3MEU A;  4EPC A;  1K1Z A;  4F7U A;  2CP3 A;  3ASK A;  2O31 A;  4LUD A;  2CSI A;  1ZSZ A;  2YT6 A;  3OYM A;  2DL5 A;  1ZUK A;  1WZO A;  3QZ5 B;  3M0R A;  2R5M A;  1Q82 C;  2D1X A;  4FSX A;  3S3N A;  5GAO r;  1M1K C;  3QBY A;  3H0H A;  4MML A;  2KRM A;  5A2Q E;  1VQK A;  4M7A C;  2C0O A;  1NBE B;  1OPL A;  2LJ0 A;  4IUT A;  3C95 A;  3VUB A;  4MDX A;  3L2R A;  1G2B A;  3O8V A;  2VGM A;  5D7U A;  4OMF B;  1GFC A;  2OJ2 A;  1VIE A;  2M16 A;  2LVM A;  3CCJ A;  4XU0 A;  1SPK A;  2E12 A;  3CC7 Q;  4M77 G;  1YCY A;  4JDS A;  1KIK A;  4C0G A;  4F14 A;  4PK4 A;  5CIU A;  1KHI A;  3O5Z A;  2CDT A;  1IRX A;  1VQ4 T;  3ZL7 C;  2JOY A;  3LLR A;  1OZ2 A;  4O5V A;  2JXB A;  2ROL A;  1XJW B;  5IHK A;  1UUE A;  3N5B B;  1TS9 A;  1GXI E;  4OMP A;  4CI0 C;  3OW2 A;  1I81 A;  2BTT A;  3L2Z A;  4TVR A;  2DVJ A;  2VYT A;  2X9H A;  5LJ5 f;  1GCP A;  3GIB A;  1T3S A;  2KYM A;  4QVD A;  1BKB A;  2KR3 A;  3VS5 A;  1YBY A;  1VQO T;  4ZGD B;  1UGQ B;  3PE0 A;  4RUG A;  1ZSZ C;  1B07 A;  2M51 A;  5DM7 R;  3CCM Q;  4N0A A;  5CCA A;  4M77 A;  5EG2 A;  3NTK A;  3J7A F;  1MV0 B;  3OMC A;  4E7Z A;  1K8A U;  2YUP A;  3A8M B;  4JJB A;  2LP5 A;  3H8Z A;  2PVD B;  1VQN Q;  2XI9 A;  1BIA A;  5LJ5 e;  2QG9 B;  2QDY B;  2RQU A;  5L23 A;  2ZZD A;  1X2K A;  1Q81 U;  3PFS A;  2RB6 A;  4GLM A;  5CKE A;  3EFS A;  1QVG S;  2Y90 A;  1ZX6 A;  3CCL T;  8ATC B;  4NOY A;  3VS1 A;  2DTI A;  1Z9Z A;  2LNH B;  4PLI A;  1KD1 C;  2JVV A;  3PGG A;  2DEU A;  3QJ6 A;  3NHN A;  1B3Q A;  2ECZ A;  4KUI A;  3HP9 A;  2DA9 A;  3FLG A;  2DL8 A;  2FPD A;  1I0C A;  4KUL A;  1VQO A;  2JUF A;  3BDL A;  3C4S A;  4XTX A;  3UAT A;  2JNG A;  4QVZ A;  3REA B;  1MMA A;  1QCO A;  2NYS A;  5L8R E;  4N0A C;  4M77 C;  2AT1 B;  3FJP A;  5I2S A;  2FZG B;  3EGD A;  5IHN A;  2JMA A;  2B8A A;  2IVW A;  4DBF A;  2J05 A;  1M4Z A;  2MIO A;  2LMJ A;  4PL6 A;  4E2F B;  4A54 A;  1ZHI A;  2LCL A;  3R6N A;  4A4E A;  2L5Q A;  4OB0 B;  5KYY B;  2HKQ B;  3V7S A;  1QCN A;  3OYE A;  2OI3 A;  2AIR B;  2X35 A;  1UGP B;  1I5L A;  3CEY A;  3VS7 A;  3CC7 T;  4NS5 A;  2YRV A;  3CCL A;  5LJ5 j;  5FU6 C;  4JRQ A;  2IIM A;  3RDV A;  4HCZ A;  1TTH B;  4B9W A;  1W6X A;  3A8O B;  2EYZ A;  2ZPG B;  2P4T A;  2I2L A;  2KRN A;  3ULR B;  4DBH A;  2R58 A;  4JRP A;  4C0F A;  2KAF A;  3OYD A;  3CXC P;  2MMP A;  5GAN h;  3FRN A;  4Y28 E;  1C1A A;  3VS3 A;  3MCA B;  4K11 A;  1QCF A;  4KUD K;  2ZGW A;  4EMK A;  3JCM d;  4MZM A;  4C8Q G;  3HSB A;  2EGE A;  3GLX A;  1WJR A;  3VYG A;  2O4X B;  3E2U A;  1PD0 A;  3TVT A;  2CUD A;  3QG1 A;  1KC8 C;  4A4H A;  2KQW A;  4FYW B;  2ZCF B;  5DLO A;  2EQK A;  4KRT A;  3TEE A;  1UG1 A;  2BE9 B;  2DTH A;  2QA4 T;  1Y57 A;  3CCM T;  4II1 A;  2E4H A;  2X3X D;  2XU8 A;  2DXB A;  2KRO A;  3X26 B;  1WJQ A;  1VQ5 Q;  3M4G A;  4GY5 A;  2KE9 A;  4XTW A;  1VQ9 Q;  5C6S A;  2Y4Y A;  2DYB A;  1VQN T;  2CH4 W;  2B86 A;  3SD4 A;  4DQ2 A;  2WAC A;  2RHU A;  1V1C A;  2P4R A;  3CC7 A;  4J5Y A;  5GAN 7;  3OYH A;  1AD5 A;  1SHF A;  2E5K A;  1JB0 E;  4HA8 A;  5KYU A;  1QVG P;  5LJ3 h;  2WSC E;  4ATO A;  3CBP A;  4OMN A;  4ZTJ A;  1AZG B;  2KI7 A;  4A53 A;  4C8Q A;  1WNL A;  2L0A A;  3VS6 A;  2LQN A;  2K3X A;  1N27 A;  3UA6 A;  3FDR A;  5CQX A;  1YP5 A;  3MPU B;  2RMO A;  1T0H A;  2X51 A;  3M4Y A;  1RAC B;  4OMM A;  3M0T A;  2DXU A;  4EMK C;  1K9M C;  2GBQ A;  3RMS A;  1M90 R;  3OW2 S;  4HCC A;  2E64 A;  2RD1 A;  1K73 U;  4PFZ A;  2HNI A;  4M7A B;  1WI7 A;  2NUP A;  2EJF A;  4OB3 B;  3CCM A;  2M0Y A;  3M59 A;  1G5V A;  3M0S A;  3IQL A;  4BE2 A;  3OBW A;  2DL7 A;  1GL5 A;  4C92 F;  1X01 A;  2BUD A;  1VQN A;  1WXU A;  1D3B A;  2XD0 A;  2ENM A;  4F16 A;  1RAG B;  1MV3 A;  5CAI A;  2A7Y A;  3X28 B;  5J3B A;  4BE0 A;  2C0I A;  4JRK A;  2F2X A;  1G3T A;  2BKD N;  2JS2 A;  2YUN A;  5FWC A;  4OMQ A;  4Y92 A;  2SRC A;  3QPH A;  1W2B A;  3CMA Q;  3A98 A;  2MPX C;  1OU8 A;  2FEI A;  2KK4 A;  5CK9 A;  3OS2 A;  1EX4 A;  2COY A;  1Y96 A;  1U3O A;  2LC4 A;  5HCK A;  1UHC A;  4N4G A;  5IT9 E;  2OAU A;  1TUD A;  1AVZ C;  3CPW A;  2AK5 A;  4F7U B;  5FRN A;  3JB9 F;  1ZSZ B;  2QQB A;  3V7R A;  1YJN Q;  5A0D A;  3DB4 A;  1G8X A;  1UTI A;  2J6F A;  1ZBJ A;  2MWP A;  2L3P A;  1GCQ C;  5I11 A;  1PM3 A;  5KH6 A;  1YWP A;  2DZC A;  3BFM A;  4C92 G;  4C92 E;  2Y4X A;  5KYW A;  1UGV A;  2CSQ A;  3SWN C;  3BDU A;  3QDF A;  1HYO A;  2K4Y A;  1YIJ T;  3S3M A;  1VQ9 T;  1NJI U;  1YIT Q;  3OSS C;  1VIF A;  3RER A;  4IUR A;  1YI2 Q;  4GLK A;  1BI0 A;  2A3L A;  2CGH A;  4WCI A;  1R8O B;  2EGA A;  4MDW A;  2FG0 A;  3A5Z B;  3PVQ A;  1ZA2 B;  2L2P A;  4DOV A;  4WF2 A;  2DD5 A;  5GMK h;  1I5O B;  4LE9 A;  1U8R A;  2LQ8 A;  4M7A F;  1IHV A;  1KK7 A;  4JZ4 A;  2RQR A;  3JB9 H;  3OS5 A;  2M9U A;  1S1N A;  3TQ7 P;  2IG0 A;  5LL6 S;  1M90 U;  3OMG A;  2M02 A;  3LGL A;  2ZPB B;  5AYF A;  3CXC A;  3I5S A;  3NGP A;  3JCM P;  2D9T A;  3ME9 A;  4OML A;  1H92 A;  4DEY A;  1LCK A;  1Q7Y R;  2VUB A;  2H3J A;  4IIO A;  2R5A A;  1BCM A;  2QQA A;  3JCM J;  2DLP A;  3VRY A;  5I2M A;  4HT8 A;  4YTL A;  2RJC A;  1RLQ C;  2HZY A;  1QKX A;  4FU6 A;  1RI0 A;  3SB2 A;  1TUG B;  2FO0 A;  4JS5 A;  2DMO A;  1RLP C;  3V7C A;  1VQ5 A;  1VQ9 A;  4J83 A;  3JB9 D;  4R0K A;  2MI6 A;  3KXT A;  2E3I A;  3HKS A;  1NZ9 A;  3MKD A;  4FT4 A;  5FU6 B;  3OY9 A;  2E1H A;  1NPR A;  2QQR A;  1KQS A;  2X4W A;  1RAA B;  1FWZ A;  3C0C A;  3OSV A;  1TOV A;  2E3H A;  4HKE A;  3MJX A;  1U5S A;  1Q95 G;  1JJ2 P;  2K2M A;  2VKN A;  1VQM T;  4HCB A;  4O6J A;  1B34 A;  3OYA A;  1UGS B;  2XDB A;  4J9G A;  1G3W A;  5LJ5 h;  2PZ1 A;  2OTJ Q;  4C92 C;  3VYH B;  1A0N B;  1JQQ A;  1VYU A;  2JT4 A;  3M0U A;  2RJF A;  1VQ8 Q;  4FT2 A;  2OTL Q;  2DL3 A;  2O2O A;  3CCS T;  1QLY A;  2EWN A;  3EGD B;  3MEA A;  3BE3 A;  4RMO A;  4LDY A;  4M7A D;  3SEM A;  2YRD A;  2DE0 X;  1C6V X;  1H3H A;  4FSS A;  1IRE B;  2FB7 A;  2E6Z A;  1TU0 B;  2HD0 A;  3X25 B;  1N8R U;  3LH0 A;  2YUQ A;  1VQK T;  1W70 A;  3CCQ Q;  2HEQ A;  3WVD B;  2YLC A;  3KBG A;  1SRL A;  3F70 A;  1Q86 U;  3G71 Q;  2D0Q B;  2KRS A;  2O01 E;  1YIT T;  4M75 A;  1RAB B;  1YI2 T;  1XOV A;  2HCK A;  4ZN1 A;  3PT9 A;  3JAM E;  4NL3 A;  2BZY A;  3OYY A;  2LZ6 B;  4HT9 A;  4M77 F;  3CCE Q;  2RHI A;  1KJW A;  1GFD A;  1Q81 R;  2V8J A;  5GAN g;  2COW A;  1ZQ1 A;  1X6G A;  5DLQ E;  4CC2 A;  2L89 A;  4EMK B;  2A36 A;  2QAZ A;  3HRS A;  2FVU A;  1W2B S;  2LX9 A;  2VV5 A;  3QXE B;  1Q7Y U;  3DLM A;  2X4Y A;  4J9E A;  1YJN A;  1M1F A;  3CCS A;  1X6O A;  5GAO l;  3CPW S;  3MET A;  4XTY A;  5GMK e;  2DJZ A;  4X1V A;  2MAM A;  1BI2 A;  2FHD A;  1RL2 A;  2HQE A;  2HL5 C;  2O9V A;  2CP2 A;  4V2S A;  2FRY A;  1FXX A;  5LJ3 g;  1YIT A;  5KYU B;  1YI2 A;  1AWX A;  3QJY A;  1NG2 A;  2RQV A;  4WTO B;  4M77 E;  2WSF E;  2I0N A;  4FYX B;  2QXF A;  4ELZ C;  2HQX A;  3JCM V;  2VC8 A;  3EG9 A;  5GAM g;  1QVF P;  3EGX A;  4RCC A;  2RK1 A;  3LWI A;  1WYX A;  2V26 A;  1UE9 A;  3Q1J A;  1M9S A;  3U23 A;  3HRU A;  2G6F X;  5KCH A;  2CZ7 B;  4PKC C;  3OS0 A;  1PCX A;  5GAO q;  1X43 A;  4JRI A;  4BY6 C;  3MP1 A;  1HJD A;  3NTI A;  2QEX Q;  1VQ8 T;  2NUP B;  2YUO A;  2OTL T;  4M77 D;  4J9D A;  5EC7 A;  2AKK A;  2EAY A;  3SWN B;  4GBQ A;  1D09 B;  4JLI A;  1ABO A;  5GAN 5;  1LJO A;  1D3B B;  1LVK A;  1U1S A;  2YWW A;  2HL3 A;  3JCM W;  3WXM B;  2HSE B;  2E10 A;  4VUB A;  2D0N A;  3CCQ T;  2KDS A;  5GMK j;  3CCU T;  5FU7 C;  3KFV A;  3HPW A;  4M78 F;  3NPF A;  2DKG A;  3M53 A;  1KG1 A;  2JM8 A;  1UEB A;  3M57 A;  3QWY A;  3G71 T;  1C0M A;  1T3L A;  1QP2 A;  2KYB A;  4FL6 A;  2F2V A;  3BW1 A;  3VS0 A;  1PHT A;  2EJG A;  5HK0 A;  2VWF A;  3TU4 K;  3RUX A;  1K8A C;  4KGV B;  1E6G A;  3QUI A;  4E7K A;  2JS0 A;  2AZS A;  2RQT A;  4RCB A;  3CCE T;  4PLL A;  2BE7 D;  2XDD A;  4QQ6 A;  4RTX A;  2ATC B;  1Q81 C;  1KQS S;  1YJ9 Q;  2RHY A;  1W1F A;  2KGT A;  2K5F A;  1CKB A;  1VQ8 A;  2OTL A;  1WQW A;  1X6B A;  4HVU A;  4C8Q F;  2LRQ A;  1SKU B;  2QTV A;  1X69 A;  2DTO A;  1YHQ Q;  1QWF A;  1MMD A;  4DEX A;  3V8K A;  1PSE A;  2F69 A;  1K73 R;  1OPK A;  4M78 G;  5FW9 A;  4M78 E;  2YLB A;  2DJQ A;  2LCS A;  3CCQ A;  3CCU A;  4L59 A;  4A63 B;  3JCM f;  1PKT A;  3OYJ A;  3G71 A;  3OYF A;  3C12 A;  2CP7 A;  3C94 A;  1W4S A;  1WHH A;  4DBR A;  2ED1 A;  4J9C A;  4AG1 C;  1Z9Q A;  2RQW A;  4B9X A;  1T0J A;  4M4Z A;  3SFM A;  3CCE A;  4AMC A;  1JU5 C;  3M5A A;  3NMZ C;  4C92 B;  1ACM B;  2BZX A;  3GP8 A;  4E47 A;  1WHJ A;  1Y71 A;  2DM1 A;  2ZPH B;  7AT1 B;  3I5R A;  3JCM e;  3TSZ A;  3LX7 A;  1EZZ B;  4C8Q E;  4M78 A;  3EHR A;  1H64 1;  4JZ3 A;  2F2W A;  2QEX T;  1QKW A;  4Z88 A;  1OOT A;  2CH4 A;  1KC8 U;  2NLU A;  5IH2 A;  4Z89 A;  3JCM X;  2KXC A;  4J9B A;  3MP6 A;  4FW1 A;  5CKH A;  2EYX A;  2A28 A;  2M1H A;  4X34 A;  4L6V 5;  1MND A;  3D7S B;  1NYG A;  4KH1 B;  4PJJ A;  4M7D F;  2QAS A;  4BB7 A;  3LWH A;  3QKJ A;  1NJI R;  4C8Q D;  2F5T X;  4AG2 C;  1GBQ A;  3VS2 A;  1YJW Q;  4J9F A;  2D6F A;  1B7T A;  3A8H B;  1MHN A;  4LXC A;  4D6W A;  2OAW A;  2JN0 A;  1B34 B;  4NL2 A;  2KMT A;  5LJ5 g;  5KE2 A;  1JO8 A;  1G3S A;  1M27 C;  3CQT A;  2RI3 A;  2E65 A;  4OGC A;  2LTO A;  5GJV B;  2MYS A;  4OGE A;  4M78 C;  4X9D A;  3TSW A;  1EFN A;  3JCM b;  1XNI A;  2QEX A;  4PJO F;  2FZK B;  1WHK A;  1M8V A;  4X9C A;  2MF2 A;  3QZ9 B;  2QK0 A;  3LYI A;  1YHQ T;  4A4F A;  2NUT A;  2G3R A;  2K79 A;  2KBT A;  4PFO A;  1E7O A;  1RAD B;  3EHQ A;  4M7D G;  2PUK B;  4IIM A;  2YHT A;  4M7D E;  3EH1 A;  2DF6 A;  2J6O A;  1O9S A;  1PC0 A;  1IGU A;  1R0B G;  2H3E B;  3H0F A;  3WVE B;  5FRM A;  4F17 A;  4ZGE B;  3ZBD A;  4AFZ C;  2EIF A;  4RTU A;  1PWT A;  2QTX A;  2SEM A;  3M0P A;  5CKD A;  1TUC A;  2HSP A;  4LUE A;  2RHZ A;  5DY9 A;  5GAN 2;  1PD1 A;  4C8Q C;  3I56 Q;  3FC3 A;  3CC4 Q;  4FW2 A;  4Z8A A;  4RG2 A;  3MHX A;  1VQ7 Q;  2D8J A;  1NE8 A;  3EGU A;  3OA6 A;  4BY6 B;  1JXO A;  1K4U S;  1BIB A;  2X4X A;  2BIV A;  1VUB A;  2HAX A;  4PJO G;  4PJO E;  3PNW C;  2PQW A;  2C06 A;  4P5N A;  3GNG A;  4ZTF A;  3MO8 A;  2LX7 A;  3RNJ A;  4M7D A;  1CKA A;  5IAY A;  5FLX E;  1H8K A;  1WHG A;  2CRE A;  1YHQ A;  1FMK A;  5FU7 B;  3CD6 Q;  2CZ6 B;  3A8G B;  2P84 A;  1N8R R;  1VQ5 T;  2HMA A;  2DXC A;  3PTA A;  1CSK A;  3P8B B;  3VS4 A;  4J9I A;  1X75 C;  3G4S Q;  3EG9 B;  2Z0W A;  1Q86 R;  1M8M A;  3L1A A;  3EGX B;  4N4H A;  1M5Q 1;  1KQ1 A;  2RJE A;  2EYQ A;  1Y7X A;  1QMC A;  1NJI C;  3EH2 A;  1YJW T;  4PJO A;  2KEA A;  3UDC A;  1QW1 A;  2J7I A;  3THK A;  4C92 D;  1BI1 A;  5GAN d;  3UPU A;  1PSF A;  4RTZ A;  2VXF A;  4IUQ A;  2XID A;  3CCR Q;  4JJN K;  4M75 F;  2BZ8 A;  2EQU A;  3RIR A;  2LQW A;  3JCM Q;  4ZN3 A;  3OW2 P;  2VAS A;  5CQY A;  2EPD A;  3H41 A;  4M7D C;  2RNA A;  1M90 C;  1SHG A;  3VKI A;  1HXD A;  2IPO B;  4M77 B;  1RAI B;  1UHF A;  3EFR A;  1G3Y A;  8AT1 B;  3TRE A;  3VRZ A;  4BUG A;  3TCJ A;  2DVE A;  1VQP Q;  1RAF B;  2JTE A;  5GMK l;  2KNB B;  2DO3 A;  2EQI A;  1AWW A;  1Q82 R;  3H9N A;  1M1K R;  4XTV A;  1K0X A;  1SSF A;  1ZUU A;  2O4X A;  1D1C A;  2RH2 A;  2YXY A;  5LJ3 d;  3OYG A;  1AOJ A;  1S72 Q;  3L2Q A;  4LDW A;  4PJO C;  1YJW A;  2DZ9 A;  2HQH A;  1NLP C;  2JJ9 A;  2XHC A;  1QVG A;  3CMA T;  3J81 E;  3CC4 T;  5GAM d;  5IXF A;  2KT8 A;  4M75 G;  3L2U A;  4M75 E;  4EDU A;  1UGR B;  3CC2 Q;  2LT1 A;  1VQ4 Q;  3GOX A;  4HVW A;  4L5G A;  4RG8 A;  1UDL A;  2AZV A;  3VUZ A;  3CCV Q;  2YDL A;  1YJN T;  4AFU C;  5A0G A;  2RF0 A;  4IUV A;  1JRI A;  1D0Y A;  2LJ3 A;  1OX9 A;  2KXD A;  2XG8 D;  4PJM A;  4J9H A;  1I1J A;  4E7J A;  4JJD A;  2ZPF B;  4RTV A;  2DL4 A;  1KHC A;  2MWO A;  3RBB B;  3G1J A;  1PG5 B;  1VQO Q; 
#chains in the Genus database with same CATH homology
 3TEE A;  3LW5 E;  2JZ2 A;  1LJO A;  1D3B B;  4J6Y A;  3X24 B;  4C5H A;  1U1S A;  3QSU A;  1I8F A;  3QII A;  3JCM W;  3G7Z A;  3WXM B;  5GMK i;  2E10 A;  2DTH A;  2QA4 T;  3CCM T;  4VUB A;  2PUO B;  4II1 A;  4MZT A;  3CCQ T;  4PJO D;  2KDS A;  2DAQ A;  3CBM A;  3ER0 A;  5GMK j;  2XU8 A;  3CCU T;  2DXB A;  5FU7 C;  3X26 B;  3HPW A;  4M78 F;  2DKG A;  1NPP A;  1WJQ A;  3M53 A;  1KG1 A;  3M4G A;  4GY5 A;  4XTW A;  1UEB A;  3M57 A;  3MEV A;  5C6S A;  2Y4Y A;  2EQJ A;  3G71 T;  1QP2 A;  1WJS A;  3S3O A;  1VQN T;  4FL6 A;  2E70 A;  3BW1 A;  3SD4 A;  3E19 A;  2EJG A;  4DQ2 A;  5HK0 A;  4JS4 A;  3RUX A;  3ZEH A;  4BI4 A;  3TU4 K;  1Q86 C;  1K8A C;  5GAN e;  2WAC A;  2RHX A;  2RHU A;  4OB1 B;  3CC7 A;  3BY7 A;  2L8D A;  4J5Y A;  5GAN 7;  3QUI A;  3CMA A;  1N9S A;  3OYH A;  3I56 A;  4E7K A;  3CC4 A;  5M9O A;  1JB0 E;  4RCB A;  4HA8 A;  3CCE T;  4JUV A;  4ELY C;  1FX7 A;  4PLL A;  5LJ3 h;  2WSC E;  1VQ7 A;  4ATO A;  2DIG A;  4R55 A;  3CBP A;  3UT1 A;  4ZTJ A;  2XDD A;  3PIP A;  4M78 B;  4QQ6 A;  4A53 A;  1LOJ A;  3L2V A;  4C8Q A;  5HY6 A;  5LJ3 f;  1Q81 C;  1KQS S;  2K5L A;  1WNL A;  3CCR T;  5GAM j;  5GAN 8;  2K3X A;  5GAN 6;  2R57 A;  5CO7 A;  2XDB A;  1N27 A;  3FDR A;  5CQX A;  2KVQ G;  3M4Y A;  2RHY A;  2RM4 A;  2K5F A;  1V29 B;  3JB9 G;  5GAM f;  2DD4 A;  2DXU A;  4MMK A;  4EMK C;  1VQ8 A;  1K9M C;  3RMQ A;  3RMS A;  4LD9 K;  2GFU A;  3OW2 S;  2OTL A;  1WQW A;  4FIB A;  4HCC A;  3M9Q A;  4C92 A;  3URG A;  1LNX A;  4C8Q F;  3QHS A;  2LRQ A;  1Q7Y C;  3OYC A;  2E64 A;  2RD1 A;  1Q82 U;  1VQL T;  2P0Q A;  2DTO A;  1K73 U;  2ZPE B;  1M1K U;  2HNI A;  3HFO A;  5CKB A;  3CBO A;  3V8K A;  3S6W A;  1AHJ B;  1O75 A;  2RI2 A;  4M7A B;  1PSE A;  2F69 A;  1VQP T;  4M78 G;  2PVG B;  2EJF A;  4M78 E;  4OB3 B;  5KCO A;  2YLB A;  3JCM h;  3CCM A;  4BDY A;  3M59 A;  3CCQ A;  1G5V A;  3CCU A;  1N6A A;  4L59 A;  5LJ3 e;  4BE2 A;  5CR2 A;  4E7H A;  3OBW A;  3JCM f;  3JCM c;  4M75 C;  2EJ9 A;  4C92 F;  1X01 A;  3V8L A;  3OYJ A;  2BUD A;  2XK0 A;  3OB9 A;  3HL8 A;  3G71 A;  3G4S A;  4A4K A;  4EMG A;  5I21 A;  3C12 A;  3OYF A;  1VQN A;  4C8Q B;  3JRZ A;  1D3B A;  4C0Z A;  1YIJ A;  3C94 A;  1W4S A;  2XD0 A;  3QYG B;  1IZ6 A;  5CAI A;  2A7Y A;  3OYL A;  5GAM e;  3X28 B;  1S72 T;  1QVP A;  5J3B A;  4BE0 A;  3I56 T;  3AHU A;  4JRK A;  4B9X A;  2XKO C;  1G3T A;  2EQM A;  2BKD N;  2L3R A;  4F7U F;  1VQ7 T;  3LGF A;  5GAO n;  3SFM A;  3CCE A;  4M7A G;  1ZBX A;  5HKC A;  4M7A E;  1OYX A;  2RK2 A;  3T9N A;  3EAE A;  2K57 A;  3QPH A;  1W2B A;  5GAN j;  3M5A A;  4C92 B;  4OVA A;  4C5I A;  3J80 E;  3CCR A;  3VU3 C;  4KT0 E;  3GP8 A;  3RKX A;  3CC2 T;  4E47 A;  2KK4 A;  1QVF S;  2XIC A;  5CK9 A;  1Y71 A;  2F5K A;  2PVO B;  2ZPH B;  3OS2 A;  2OTJ T;  1Y96 A;  2XDP A;  2LC4 A;  4R56 A;  5IT9 E;  4N4G A;  1XTD A;  3JCM e;  1EIF A;  2P0K A;  2QQ9 A;  2OAU A;  2VXE A;  3JSC A;  3LX7 A;  4LDX A;  3CCV T;  3PMI A;  4C8Q E;  4M78 A;  3CPW A;  3SDZ A;  4F7U B;  2FL7 A;  5FRN A;  3CXC S;  1H64 1;  3JB9 F;  2LNV A;  2QQB A;  2WSE E;  3V7R A;  3I55 T;  4MZP A;  2QEX T;  5A0D A;  2X4J A;  2CZ1 B;  4LD6 A;  4C0D B;  2CYZ B;  3DB4 A;  2CS7 A;  3VJP A;  1I4K 1;  4XAX B;  2DPP B;  1VQL A;  1HK9 A;  2MWP A;  4ME7 A;  2NLU A;  5GMK m;  1KC8 U;  4M75 D;  3E1S A;  3CD6 T;  4JLG A;  4C5E A;  1M1G A;  5KH6 A;  1VQP A;  3JCM X;  3OW2 A;  4QW2 A;  2DZC A;  3BFM A;  4QVC A;  4QQG A;  4C92 G;  4C92 E;  3MP6 A;  2RI5 A;  3UWN A;  2Y4X A;  5CKH A;  3ZFJ A;  3OBY A;  1N8R C;  3FEO A;  3SWN C;  5GAN 4;  4X34 A;  2M1H A;  3BDU A;  3QDR B;  4E7L A;  4CRI A;  4L6V 5;  2DEQ A;  3G4S T;  3CPF A;  3QO3 A;  3NFC A;  3GF5 A;  2HBP A;  5J26 A;  2K4Y A;  1YIJ T;  4M7A A;  3S3M A;  1VQ9 T;  1NJI U;  4M7D F;  4J8O A;  1XQH A;  4OP0 A;  4BB7 A;  3LWH A;  1KQ2 A;  4F7U G;  4F7U E;  3QKJ A;  4BE1 A;  3OSS C;  2EKO A;  4C8Q D;  1VIF A;  3RER A;  2F5T X;  4LDV A;  4IUR A;  3VV0 A;  5LJ3 j;  2DIQ A;  3L2W A;  4GLK A;  1S72 A;  1BI0 A;  1Y96 B;  2A3L A;  2CGH A;  2DK3 A;  2CZ0 B;  1R8O B;  2K3Y A;  3A5Z B;  3INZ A;  2VGN A;  4MDW A;  2D6F A;  4OB2 B;  3A8H B;  4DOV A;  1MHN A;  4WF2 A;  4D6W A;  3CCJ T;  2DD5 A;  5GMK h;  4LDU A;  4E7I A;  2JN0 A;  1B34 B;  1OZ3 A;  1UB4 A;  2KMT A;  4NL2 A;  5LJ5 g;  4UC4 A;  3RES A;  5KE2 A;  1Y07 A;  5HK3 A;  1G3S A;  2LCC A;  5LJ5 d;  1VQ6 T;  3PIO A;  1U8R A;  2LQ8 A;  5IN1 A;  4DA4 A;  4M7A F;  2M0O A;  1BI3 A;  3GNF B;  5CVI A;  2LT4 A;  1KD1 U;  3CC2 A;  3M54 A;  2RI3 A;  4ZGJ B;  1JJ2 A;  2E65 A;  2OTJ A;  3JB9 H;  3OS5 A;  1VQ4 A;  4OGC A;  4M7D B;  2K5I A;  2LTO A;  2M9U A;  5A0L A;  2IG0 A;  2E5Q A;  5LL6 S;  1M90 U;  3OMG A;  3A8L B;  4OGE A;  3E9F A;  3LGL A;  4M78 C;  4X9D A;  1MGQ A;  2ZPB B;  3CCV A;  4BAC A;  1VQM A;  5AYF A;  3R6O A;  5CKF A;  4XTZ A;  3CXC A;  1P92 A;  3JCM P;  3I55 A;  4XU1 A;  3JCM b;  1XNI A;  2E41 A;  2D9T A;  2QEX A;  4PJO F;  3M55 A;  3ME9 A;  4RKU E;  2V8K A;  4FM4 B;  3HFN A;  1M8V A;  4X9C A;  2FYK A;  2GF7 A;  3CD6 A;  2MF2 A;  2VUB A;  2H3J A;  4XTU A;  3QZ9 B;  2R5A A;  3LYI A;  3MEU A;  4XQ3 A;  4EPC A;  2QQA A;  1YHQ T;  3JCM J;  4A4F A;  4F7U A;  3ASK A;  2G3R A;  5I2M A;  4HT8 A;  4YTL A;  3OYM A;  2RJC A;  3QZ5 B;  3SB2 A;  1RI0 A;  2R5M A;  4FU6 A;  5D6Y A;  4BI3 A;  3G6E T;  4FSX A;  1Q82 C;  3S3N A;  2PUK B;  4M7D G;  2YHT A;  4M7D E;  5GAO r;  1M1K C;  3QBY A;  4MML A;  5A2Q E;  1O9S A;  1VQK A;  4M7A C;  4JS5 A;  4IUT A;  3V7C A;  1VQ5 A;  1VQ9 A;  4PJO B;  3C95 A;  2P0P A;  4J83 A;  4C5G A;  3VUB A;  3JB9 D;  4MDX A;  3WVE B;  5FRM A;  2MI6 A;  3HRT A;  3KXT A;  3O8V A;  3L2R A;  2AHJ B;  2V8I A;  4XU2 A;  2K2V A;  2VGM A;  3HKS A;  3ZBD A;  4ZGE B;  5FRO A;  2EIF A;  3X20 B;  1NZ9 A;  4OMF B;  2QTX A;  4FT4 A;  2LQK A;  5FU6 B;  3OY9 A;  1VIE A;  2JTF A;  5CKD A;  1OI1 A;  2M16 A;  2LVM A;  3CCJ A;  2E1H A;  1NPR A;  2RHZ A;  4XU0 A;  5DY9 A;  2E12 A;  2QQR A;  2GFA A;  4J7I A;  1YCY A;  2QQS A;  4JDS A;  4M77 G;  4C8Q C;  3FC3 A;  1KQS A;  1VQ6 A;  3RKY A;  1WGS A;  4C0G A;  2X4W A;  4M78 D;  4RG2 A;  3MHX A;  5CIU A;  1KHI A;  1FWZ A;  1QP3 A;  1NE8 A;  4A4G A;  3OSV A;  4EMH A;  1VQ4 T;  4HKE A;  2JOY A;  3LLR A;  1OZ2 A;  4J6W A;  4O5V A;  3OYB A;  3OA6 A;  4BY6 B;  3FIF A;  2ZPI B;  2LDM A;  1JBM A;  1BIB A;  2X4X A;  1VQM T;  4HCB A;  3N5B B;  4O6J A;  1B34 A;  3OYA A;  2BIV A;  1GXI E;  1UGS B;  1VUB A;  4CI0 C;  4PJO G;  3V8J A;  1G3W A;  5LJ5 h;  5GAO m;  3KUF A;  1I81 A;  3PNW C;  2PQW A;  2C06 A;  4PJO E;  4P5N A;  5KE3 A;  3L2Z A;  4C92 C;  3VYH B;  3QYH B;  4TVR A;  2VYT A;  4KBM B;  3GNG A;  5LJ5 f;  3GIB A;  4ZTF A;  3MO8 A;  2RJF A;  1BKB A;  4QVD A;  4M7D A;  1WPY A;  4FT2 A;  5IAY A;  5GAN 3;  5FLX E;  3CCS T;  1YBY A;  2EWN A;  1VQO T;  3MEA A;  4ZGD B;  4RMO A;  4LDY A;  1YHQ A;  4M7A D;  1UGQ B;  3NTH A;  5FU7 B;  1IRE B;  2FB7 A;  2E6Z A;  4C0D C;  2HD0 A;  3X25 B;  2CZ6 B;  3G6E A;  3LH0 A;  1N8R U;  1H3Z A;  1BYM A;  5DM7 R;  3A8G B;  1VQK T;  4N0A A;  5CCA A;  1U1T A;  3WVD B;  3OQ5 A;  3MEW A;  1VQ5 T;  2YLC A;  3KBG A;  4M77 A;  5EG2 A;  3OYK A;  3NTK A;  3J7A F;  2DXC A;  3PTA A;  3F70 A;  3P8B B;  1Q86 U;  3OMC A;  3M58 A;  1K8A U;  1X75 C;  3A8M B;  2D0Q B;  3HHT B;  4N4I A;  3H8Z A;  2PVD B;  3L1A A;  2XI9 A;  5D6W A;  1BIA A;  2O01 E;  1YIT T;  4M75 A;  4N4H A;  5LJ5 e;  1YI2 T;  1M5Q 1;  5J39 A;  1XOV A;  1KQ1 A;  2QDY B;  2RJE A;  2EYQ A;  3PT9 A;  1Y7X A;  4ZN1 A;  3OYN A;  1NJI C;  3JAM E;  2GCX A;  2ZZD A;  1YJW T;  4PJO A;  4NL3 A;  2KSS A;  3OYY A;  1Q81 U;  3PFS A;  1QVF A;  3UDC A;  4HT9 A;  1QW1 A;  2RB6 A;  4M77 F;  2RHI A;  5CKE A;  2PU9 B;  3EFS A;  1QVG S;  4Q5W A;  3FB9 A;  2V8J A;  4C92 D;  1BI1 A;  5GAN g;  2Y90 A;  5GAN d;  3UPU A;  1ZQ1 A;  1PSF A;  1WQ7 A;  3CCL T;  2VXF A;  4IUQ A;  4NOY A;  1YJ9 T;  5DLQ E;  2XID A;  4JJN K;  2E6N A;  2DTI A;  2L89 A;  4M75 F;  4EMK B;  2EQU A;  3P8D A;  3RIR A;  3JB9 J;  1K9M U;  3HRS A;  2FVU A;  4PLI A;  4QQD A;  1W2B S;  2LX9 A;  2VV5 A;  2RJD A;  1KD1 C;  2JVV A;  3PGG A;  3JCM Q;  4ZN3 A;  3QXE B;  1Q7Y U;  5CQY A;  3QJ6 A;  4KUI A;  4PNO A;  2DXT A;  3DLM A;  4M7D C;  2X4Y A;  3HP9 A;  5GAM h;  1M90 C;  3DKM A;  1YJN A;  3FLG A;  3VKI A;  1HXD A;  4M77 B;  1M1F A;  3CCS A;  3JB9 I;  4KUL A;  1X6O A;  4XK8 E;  1VQO A;  3EFR A;  5GAO l;  3E9G A;  3CPW S;  3MET A;  1G3Y A;  2JUF A;  3BDL A;  3C4S A;  4XTX A;  2JNG A;  4XTY A;  4QVZ A;  5GMK e;  3TRE A;  4BUG A;  4XU3 A;  1K73 C;  4M75 B;  2DJZ A;  2DVE A;  3TCJ A;  3PMT A;  5GMK l;  3CME T;  4IKF A;  2DO3 A;  5L8R E;  4N0A C;  2MAM A;  1BI2 A;  2FHD A;  1RL2 A;  4M77 C;  3FJP A;  5I2S A;  2RA2 A;  1N9R A;  2HQE A;  2B8A A;  2IVW A;  4XTV A;  3DB3 A;  3GPL A;  1SSF A;  4V2S A;  1M4Z A;  2QA4 A;  2JTM A;  2O4X A;  4PL6 A;  1FXX A;  2RH2 A;  3SWN A;  4A54 A;  2KY9 A;  1ZHI A;  5LJ3 d;  5LJ3 g;  1YIT A;  2LCL A;  3RKW A;  4A4E A;  3OS1 A;  3OYG A;  3OYI A;  1YI2 A;  3QJY A;  2L5Q A;  4M77 E;  2WSF E;  3L2Q A;  4OB0 B;  3L42 A;  4LDW A;  2QXF A;  5GAO p;  2HAX A;  3MP8 A;  3V7S A;  1YJW A;  4J6X A;  4PJO C;  4ELZ C;  2DZ9 A;  2GQV A;  2HQX A;  3JCM V;  4BD3 A;  3OYE A;  2XHC A;  1QVG A;  2X35 A;  1UGP B;  1I5L A;  2VC8 A;  3CEY A;  3CC7 T;  3CMA T;  3J81 E;  4NS5 A;  3CC4 T;  5GAM d;  5GAM g;  3L2U A;  4M75 G;  4M75 E;  2YRV A;  5GAN 2;  4EDU A;  5LJ5 j;  3CCL A;  5FU6 C;  4JRQ A;  1UGR B;  2RK1 A;  4RCC A;  1YJ9 A;  3LWI A;  2CKK A;  2QI2 A;  3Q1J A;  4HCZ A;  4M7D D;  4B9W A;  1M9S A;  4OF1 A;  3A8O B;  2LT1 A;  2ZPG B;  3HRU A;  2P4T A;  2I2L A;  3GOX A;  5KCH A;  2R58 A;  4J7F A;  4L5G A;  5D6X A;  4RG8 A;  4BDZ A;  4BI8 B;  2CZ7 B;  4JRP A;  4C0F A;  4PKC C;  4Z02 A;  2KAF A;  2RO0 A;  3OS0 A;  3OYD A;  2MMP A;  3VUZ A;  1JJ2 S;  5GAN h;  1DJ7 B;  4JRI A;  5GAO q;  3FRN A;  4Y28 E;  3DLL A;  1YJN T;  4BY6 C;  3P8H A;  5A0G A;  5C0M A;  3MCA B;  3MP1 A;  3NTI A;  4IUV A;  4IUP A;  1JRI A;  5GAN f;  4KUD K;  2ZGW A;  1VQ8 T;  4DOW A;  3JCM g;  4EMK A;  3JCM d;  4MZM A;  4IUU A;  4C8Q G;  3HSB A;  2OTL T;  4M77 D;  3GLX A;  2XG8 D;  3H6Z A;  1WJR A;  3M56 A;  3VYG A;  2O4X B;  4E7J A;  2EAY A;  3SWN B;  4Y91 A;  2EFI A;  3QG1 A;  2ZPF B;  1KC8 C;  4A4H A;  2KQW A;  4JLI A;  1KHC A;  2MWO A;  1TH7 A;  2ZCF B;  3CME A;  5DLO A;  2EQK A;  5GAN 5; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...