4PKCC

Benzylsuccinate alpha-gamma complex
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
41
structure length
41
Chain Sequence
CANFFPVPKDADDYEAGKADCVREKEDEKGKYWLSKPIFEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TutD
publication title Structures of benzylsuccinate synthase elucidate roles of accessory subunits in glycyl radical enzyme activation and activity.
pubmed doi rcsb
source organism Thauera aromatica
molecule tags Lyase
total genus 3
structure length 41
sequence length 41
ec nomenclature ec 4.1.99.11: Benzylsuccinate synthase.
pdb deposition date 2014-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08201 BssC_TutF BssC/TutF protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1070 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4pkcC00
4PKCC
chains in the Genus database with same CATH superfamily
1GBQA 1K9MR 1AOJA 1K73C 2QEXT 1W2BP 2KI7A 1M3AA 2FPEA 2RHUA 4KBMB 2IVWA 3M59A 2DYIA 3GBQA 2DBMA 2J06A 4E7SA 2DXCA 3NPFA 5CR2A 2A28A 2L3RA 2OTJT 2CP7A 1AWXA 1NZ9A 2COWA 1RAGB 4X9DA 2RK2A 1C1AA 3EG1A 2QA4Q 2JW4A 3VS2A 2DO3A 2J6KA 5LJ5j 2LT1A 4E7JA 4OP0A 1ZUYA 3HRSA 3V7RA 4M78B 1YJ9Q 1V1CA 1KK7A 1YHQA 1NE8A 4LDVA 1YN8A 4OMNA 4AFSC 2HMAA 2ZCFB 4JS5A 2DMOA 1V29B 2DVJA 1M2VA 5LJ3j 2XIDA 4J5YA 3RKWA 2LDMA 4BI4A 2K6DA 3PFSA 4Q5WA 3EFSA 2AT1B 2E3IA 2LT4A 2EGCA 5L8RE 3MJXA 3PT9A 2JMCA 1I0CA 1YBYA 3CC2T 3PGGA 4XQ3A 1WHGA 1ZA2B 3M54A 1YI2T 2EYWA 2DK3A 1RL2A 3EHQA 1RACB 1X2QA 1JB0E 1LCKA 4AG1C 3M0RA 1M1FA 3I5RA 1QVPA 1KSWA 2BZXA 4N0AA 2VVKA 4M78G 3I9QA 3CXCS 3CCLQ 1YITQ 1IZ6A 4II1A 4OB2B 1M2VB 2JMAA 4A4EA 1SEMA 2RB6A 3BW1A 3C0CA 2YUPA 4M7DE 2VB6A 5M9OA 2QQRA 2WSEE 1UEBA 2PNIA 2EYXA 1DJ7B 1YJWA 4RTWA 1EZZB 2RQUA 3GIBA 1VA7A 5A2QE 1SSHA 4KGXB 2A0FB 2PVDB 5A0DA 5KYUB 1UJYA 2RA2A 3GNGA 1GCQA 2JJ9A 1R77A 2QK0A 3S6WA 3RERA 1VQKQ 3LGLA 5GAOn 4RTXA 2E6ZA 2BZ8A 3GP8A 4E7ZA 3CXCP 4QW2A 5DY9A 1PNJA 4RCCA 1T0HA 3CCSA 3E19A 1YIJQ 2I2LA 2W0ZA 4E2FB 1B34A 1UUEA 1N6AA 3EGDB 2KXDA 3J7AF 1UG1A 1YJ9T 4C8QB 3CCVQ 4X1VA 4ESRA 1SKUB 3KFVA 3WVDB 3OYAA 3HP9A 2XMFA 4XTWA 1TUCA 1M1KC 4C0GA 1U06A 2C0IA 4OGCA 3LGFA 4M4ZA 4A4HA 4FW1A 2MIOA 5IXFA 2O4XA 4PJOE 3S3NA 1W1FA 3CBOA 4C5GA 1QVGA 4VUBA 1GCQC 4ZGDB 3CPFA 2GTJA 1LJOA 1WHMA 2RHZA 4LXCA 1G5VA 1B34B 1SHFA 1VQLA 4FM4B 1RAEB 2K3YA 4OB0B 1OV3A 1JO8A 4BE1A 1QKXA 3C95A 1C6VX 2X3WD 3A8OB 3NTKA 3ASKA 1PSEA 4C8QG 3JCMd 2HZYA 2DERA 3QO3A 4HCZA 5CIUA 2DVEA 5IXBA 3OYGA 1G3WA 2YLBA 2R57A 1JJ2S 2DJQA 5GAMg 3EG9B 1B07A 1PHTA 1YHQQ 4LDXA 4BDYA 4N4GA 4NL3A 2VYTA 5GAN7 2ZGWA 1RAAB 2AK5A 1RI0A 4ZN1A 1OEBA 2OAWA 4C5EA 4OVAA 4ZNXA 4Z8AA 3CMAT 1RAHB 2P4RA 3L2QA 3KBGA 1VQ9Q 4M7AD 2CKKA 4ZGEB 4IUTA 1PG5B 4GLMA 1KQ2A 4RUGA 2JXBA 5GANf 1VQ6T 4DBRA 1LPLA 4PL6A 1SF9A 3REBB 3LH5A 3EG3A 5GAOr 2OTLA 3N5BB 4C92F 3F70A 2QAZA 3VS6A 4FSXA 1N9RA 3FEOA 1VUBA 1JJ2P 3EG0A 1QWFA 1YIJT 2K3BA 2DTOA 2YWWA 2AZSA 1D3BB 1Y96A 3GOXA 4ZGJB 4M77D 2JN0A 2JTMA 1VQ5T 4FT2A 4JLIA 2NUTA 2K3XA 4AT1B 1M8VA 3V8KA 1ZUUA 1Q7YC 1Y07A 4AMCA 1YJWQ 1M3BA 5KYNA 3CC4Q 2HD0A 2EKOA 5KCHA 4WTOB 2D6FA 2M9UA 1D1CA 1UB4A 2LMJA 2P4TA 3MP6A 1UHCA 2KNBB 4ME7A 3CBMA 1TU0B 5FW9A 1ZQ1A 2FZKB 4OMPA 2CH4A 1OI1A 2OAUA 2ZPIB 4HCBA 4ELYC 1ABQA 3CPWA 4C0ZA 1Y96B 5GAN3 1VIEA 2PQWA 3OSSC 3U23A 3H6ZA 3MEVA 1G83A 3QSUA 3C94A 1Y57A 3SEMA 2J6OA 3CCSQ 3QWXX 1WLPB 5FWCA 1KD1C 1N27A 4JRQA 1WXTA 2E6NA 4RTZA 2DM1A 1D0YA 4EMGA 1QVFP 3MP1A 3D7SB 3MEAA 2EIFA 4PFPA 1UGRB 2XICA 1QWEA 2EYZA 3S3OA 1X2KA 4M75D 1GFCA 2KT8A 4QQ6A 4M77A 1WX6A 3NMZC 3L42A 1VQ9T 3NTHA 1KIKA 5CKFA 3H0IA 1CKBA 1E6GA 1HD3A 5CKHA 2CZ6B 2LNHB 1NLPC 4KGZB 3VU3C 2NYSA 1X27A 4MZMA 4EPCA 4FYVB 1Y7XA 1YJNT 3CCRQ 1M2OA 1VQLQ 4MDXA 2MWOA 1KHCA 3TSZA 1SG5A 2B86A 5D7UA 3X26B 4E7LA 2F5KA 4PFOA 1EFNA 1VQOA 1AWOA 1Q81U 1K1ZA 2QGFB 1KD1U 4J8OA 2DILA 5GAN4 3A8LB 1AZEA 4M7DA 3QKJA 1S72A 1D09B 3GLXA 2ED0A 3JCMJ 4BY6B 2CP5A 2DAQA 1VOMA 1YFNA 2A37A 3G4SQ 4M77C 1YJWT 3CC4T 1QQJA 3EFOA 5GJWB 4L5GA 2NLUA 1AT1B 1K8AR 3OS0A 1MV3A 2ED1A 3OS5A 3JB9J 5GMKm 3I56A 2HEQA 1QKWA 4ORZA 2D8JA 5IN1A 4OMFB 3A8HB 1NYFA 2FPDA 1W2BA 3MKDA 2OTLQ 2NUZA 3A5ZB 2LVMA 2EQIA 1IGQA 1M5Q1 2BZYA 2DZCA 4M7DB 3M0QA 2RQVA 1CKAA 4E7IA 1UTIA 1SPKA 1Q86U 1RUWA 4OMLA 3FDRA 4PK4A 5FLXE 2HL3A 2LCSA 3URGA 3QWYA 2OJ2A 2BE9B 3PNWC 3FIFA 1WHHA 3LYIA 4PNOA 3R6OA 2PUOB 4M7DC 2KY9A 3MP8A 5KH6A 1FXXA 3EFOB 1BK2A 2HCKA 2GFAA 2XU8A 2LTOA 1BU1A 3UATA 4XAXB 1ZSZA 2K79A 2QQAA 5L23A 3QZ5B 3CCJQ 1YCYA 3VYHB 1IGUA 2KMTA 3ZEHA 3NFCA 4PJOA 1NJIR 2CGHA 1RLQC 2O31A 4QKUA 2G3RA 4M75C 1NEGA 3CBPA 5GANg 2MI6A 4XTZA 4RTVA 3L2ZA 4XU3A 3JB9F 3FLGA 4D8DA 3PIPA 3EGXB 4XTXA 3OBWA 3CCRT 3FJPA 1X01A 3CCMT 3MEUA 4F7UE 5CKEA 2EQJA 3E9FA 1VQMA 4Y92A 3HFNA 1JEGA 1NPPA 5GJVB 3JCMP 2KBTA 1VQNA 5LJ5d 1JRIA 1PD0A 4LDWA 1ZSZB 2F2VA 2ZPEB 2RJCA 3G71T 3CC7T 2PTKA 3QUIA 1TG0A 4J7FA 3SD4A 4PJOB 1ACMB 2O9VA 2DXTA 1ZSZC 2PZ1A 3I5SA 1M1GA 1WIEA 5LJ3d 1KQSP 5GAMe 3QYGB 4GBQA 4RTYA 5HY6A 3G4ST 3CCQT 4PJOC 2RI3A 2YUQA 1BI1A 2DE0X 3E9GA 2HBPA 4HA8A 1TUDA 1QCOA 2CP0A 1GCPA 1G8XA 3VV0A 1MMGA 3OSVA 4PJNA 1H3HA 4P5NA 2RJDA 4M7AE 3BY7A 4F17A 1ZUKA 2RO0A 4IUVA 4ZTFA 3L2VA 3FJ5A 4IUQA 3OW2S 1VQOQ 3R6NA 8ATCB 1HJDA 3M55A 5FU6C 4HVUA 2MMPA 3G6ET 1TS9A 1VQPT 3CXCA 3EH1A 3A98A 1S72Q 1Q82U 2DEQA 2DL3A 3VS0A 1WHLA 2RHIA 4JLGA 1M90C 2KRNA 2DETA 1BBZA 1E6HA 2GTOA 2KVQG 1KC8U 1CSKA 3CCJT 2V26A 2KK4A 1YWPA 4PLIA 4OGEA 2L3PA 4M77E 4LE9A 3MEWA 3EH2A 1WA7A 2DF6A 1D0XA 1XNIA 1VQ4A 2RMOA 4EMKA 5CCAA 2YLCA 2DRKA 1K73U 3I56Q 4FL6A 3T9NA 2HSEB 4FYYB 2ROLA 3OS2A 3VS7A 2E64A 1U1TA 3INZA 4Z89A 1K0SA 2R5MA 5IHNA 3C12A 1BCOA 3OW2P 1FWZA 4M78F 2F2XA 4CC7A 1Z9QA 5HKCA 3JCMV 1YNZA 5C0MA 3VRZA 1X6BA 2B8AA 5D6YA 5FRMA 2BIVA 2QG9B 2P0QA 1VQ7A 1BI3A 1IREB 1K8AC 2MAMA 1C0MA 2V1RA 4EMKB 3OYLA 3E1SA 2LCLA 1LNXA 5KYWA 4C92D 2BTTA 3CMEA 2DA9A 4KH0B 3X25B 1W6XA 5FU7B 4JUVA 4HXJA 3ZFJA 4EMKC 5LJ5f 1M4ZA 2ECZA 1Q81R 3SWNA 2L8DA 1P92A 2IPOB 4M75E 2EJ9A 5DLOA 2YHTA 5FU7C 3CCUA 5J39A 1W4SA 3HFOA 2EVRA 3BE3A 5GAMh 2V8IA 5LJ3f 1VQMQ 3H9NA 2LJ3A 2QA4T 4J9GA 5CAIA 1VQNQ 3UT1A 1UE9A 2F1LA 2P84A 2FRYA 4EDUA 4HVVA 1HXDA 2KYMA 1UGSB 1Y0MA 3L1AA 5KYWB 1RI9A 5CK9A 4IKFA 4A53A 5CKBA 1NJIC 1N8RR 3L2RA 4OMOA 2KXCA 1UECA 1JJ2A 1ARKA 1OZ3A 1NBEB 2D0QB 2EJGA 3SWNC 4HT9A 3H0FA 4KUIA 4C5IA 2CZ7B 3I56T 1WHJA 4BD3A 1WZOA 2RK1A 4C92A 4KRTA 2YUOA 2M02A 2DRMA 2YT6A 3RR6A 4A4GA 1VQ8A 1ZLMA 5GAN5 1NLOC 2RQWA 5GMKe 1SHGA 3G7ZA 3QJ6A 4C8QF 4LUEA 1AEYA 2VKNA 4Z88A 3CCLT 1YITT 1PRMC 1H641 2M51A 1K9MC 4FYWB 4DEXA 1MMNA 2QQ9A 2O4XB 3OA6A 5EC7A 1WPYA 4MMLA 2VASA 3CQTA 2GF7A 3QIIA 3CD6A 2CP6A 3J81E 4JJCA 3THKA 3VUBA 2F2WA 3GNFB 5ECAA 1OU8A 2CP2A 1M1KU 4TVRA 2CSIA 1VQ4Q 2LQNA 3VRYA 4E47A 5HK0A 2A3LA 4C0DC 2RPNA 4KULA 4C92C 2QDLA 2JNGA 2X35A 3CCEA 4QVZA 2IG0A 2EBPA 2O01E 2M1HA 3TSWA 1I1JA 1VQKT 2QEXA 2GCXA 2RHXA 1WHKA 2CP3A 2FHDA 5GANe 5D6XA 1OZ2A 4F7UA 2HBWA 2Y4YA 2RI2A 2L2PA 2EGAA 1WGSA 1RABB 2KE9A 3O5ZA 1WI7A 4OMMA 2FZGB 1AZGB 1OYXA 1WJSA 4LN2A 2OTJA 2DNUA 3DB4A 1IO6A 3OQ5A 3CCVT 1VQ7Q 1D1AA 3X20B 3RMQA 5I22A 4FIBA 1K9MU 1KG1A 1T3SA 1ABOA 1QVFS 2K5LA 1M8MA 3CMEQ 2XDBA 1B3QA 1HYOA 1LVKA 2K5FA 1PKSA 1QP2A 1PD1A 1T3LA 2EWNA 3L2WA 4N4IA 3SHWA 4F7UB 2I0NA 2GNCA 4RG2A 1B7TA 5GAOq 2D9TA 2RQRA 5CQYA 2KGTA 1ZA1B 4ZTJA 3CCUQ 1RAFB 4BI8B 1H92A 1Q82R 2RD1A 4M7AA 4Y91A 4J6WA 1UGVA 1M3CA 1OPLA 1KC8R 2HQHA 4IUUA 1K0XA 1FMKA 3HRTA 2CSQA 2BUDA 2DL8A 1R0BG 3VUZA 2NUTB 3PE0A 2C06A 3LW5E 3M53A 3CC2A 1K9AA 3OYNA 1ZBXA 1Y71A 1K73R 1YI2A 2K2VA 3EHRA 1PCXA 4MMKA 1UFFA 4A4FA 4BE0A 1YHQT 3RNJA 2K4YA 2XDDA 2DYBA 4PFZA 3JB9D 3VS1A 1KFZA 3RKXA 4J9BA 5GMKl 8AT1B 4B9XA 1E7OA 4PKCC 2PUKB 1OULA 2RI5A 4J9FA 1OX8A 1X6GA 3ZBDA 1GL5A 2MPXC 4M7AB 1XOVA 3OYKA 1Q7YU 5LJ5g 3JCMf 5IHKA 2LX7A 2MWPA 2X51A 4M7AC 1VQ8Q 2DZ9A 1WNLA 2SEMA 4J83A 3OYYA 5I11A 2JOYA 4BDZA 2FG0A 5LJ3g 2LQ8A 1BI0A 1HK9A 2QQSA 1D0ZA 3PTAA 1TUGB 3EG2A 2KDSA 5I21A 3V7CA 9ATCB 3FRNA 2EQUA 5GAOl 1M30A 4M77B 3OYFA 2YRDA 1IXDA 5GANh 2BE7D 4JDSA 3A8MB 3CD6Q 2XDPA 4J9CA 2KEAA 1QP3A 2L89A 1I4K1 1YJ9A 4XU0A 3UWNA 2HNIA 4ZN3A 5KCOA 2KROA 1KHIA 2E10A 5FROA 1EX4A 2QI2A 1JQQA 2K2MA 4M75A 3HSBA 3M0SA 4C92E 1ZSGA 1KQSA 4IUPA 3P8BB 4DA4A 2XK0A 2ZPFB 3HHTB 2RJEA 3JAME 4JJDA 1V76A 4CC4B 4E6RA 1R0CB 2ZPBB 2COZA 2PVGB 2QDYB 2EQKA 1AD5A 4M77F 3CCST 1RLPC 1WXBA 2JZ2A 3QZ9B 4M77G 1BB9A 5GAMj 4DBFA 3FB9A 3WVEB 4J7IA 2JTEA 2OTJQ 2VGMA 3X28B 4KUDK 4X9CA 2E3HA 2JM8A 4M75B 2E4HA 2BKDN 3OYCA 1PKTA 3HKSA 4M78D 2EYQA 1XTDA 2VXFA 5GAN2 3QHSA 5J26A 1KQSS 5FWBA 2MCNA 4O5VA 3LX7A 3RDVA 4PLLA 3MHXA 3PIOA 2LQKA 4M7DF 2AKLA 3H0HA 3CMAA 4M7DG 2OI3A 2ZZDA 1VQLT 3OMCA 4JRPA 1QLYA 2DL4A 3AHUA 1G3SA 2DIGA 4FT4A 1VQ6A 3NHNA 2C0OA 1QW1A 5I2SA 1QCNA 1VYTA 4LDYA 5HK3A 2D1XA 4JJNK 4QVCA 4L6V5 2E12A 1AHJB 4M75G 4FU6A 2E41A 1BI2A 3CEYA 3M0PA 3OW2A 2G6FX 1RAIB 4DOVA 3OYIA 3MPUB 2YDLA 4JRKA 1BCMA 2LC4A 4R56A 1YIJA 2L0AA 2LRQA 4EMHA 2GQVA 2C0TA 4RCBA 1WQWA 3ER0A 4MZTA 2JUFA 1VQ5A 1A0NB 2QXFA 1MHNA 1VYUA 1U8RA 4AG2C 3X24B 2ZPHB 2DD5A 3IQLA 2L5QA 4C0FA 1TOVA 3ZL7C 4M78A 3M9QA 2EGEA 3OYMA 2OTLT 1OX9A 5FU6B 4AFQC 2KRMA 2E65A 2QGGA 4BI3A 3JCMX 2HKQB 4PJOF 1MNDA 1SRLA 4CI0C 2LZ6B 1SRMA 4A63B 4PJOG 4DBHA 3QYHB 1IB8A 1R8OB 4JS4A 4XTVA 3EAEA 4LUDA 2EW3A 4XU2A 5C6SA 4RTUA 3JCMQ 5I2MA 3UA7A 2L3QA 1QMCA 5DLQE 4C8QD 3L2UA 1GXIE 1U3OA 3WXMB 2VV5A 2VC8A 3JCMg 3JCMW 4KH1B 4QVDA 2JS2A 3I55A 3DKMA 2RM4A 1SSFA 3QBYA 1H8KA 4M78C 4OB3B 1WJRA 1VQ9A 4B6MA 1NYGA 3HL8A 3GPLA 1UHFA 1WDXA 1I5OB 2LCCA 1Q7YR 2XD0A 2AKKA 1YJNA 2HL5C 2EYYA 2JVVA 5J3BA 2LJ1A 5KYUA 1O9SA 2ZAEA 2Y90A 3V8JA 2KAFA 4HCKA 1OQKA 2PVOB 2V1QA 5KYYA 1ZBJA 1FMWA 4RG8A 3BFMA 3ULRB 2X4XA 5GANd 1WYXA 2XI9A 3OY9A 1X75C 2RNAA 2Y4XA 3DLMA 5GMKj 1M90U 2DFUA 3QJYA 1F1BB 5GMKi 2CREA 2CZ1B 3JCMc 1KD1R 2NUPA 2FZCB 3M5AA 5LJ5e 4QQDA 3EGDA 2MYSA 3CC4A 3CMAQ 5KE3A 4C8QA 3MCAB 1WXUA 1MNEA 2CS7A 4RTTA 3FC3A 2DD4A 4HKEA 2KQWA 5A0GA 2DLPA 3VS3A 1VQ6Q 1HSQA 2SRCA 4D6WA 4ANJA 2E5KA 4IIOA 1OU9A 5KYYB 2RF0A 1VQOT 1JU5C 5LJ3e 1ZHIA 4MZPA 5IT9E 2PU9B 2X3XD 1GBRA 4J9HA 1S72T 2W10A 2RH2A 4E7KA 4N0AC 2DBKA 3SWNB 4B9WA 3TEEA 4HT8A 3QPHA 2R5AA 4LDUA 2A36A 1K8AU 2NUPB 1Q86R 5GANj 4DBQA 1MMDA 2A7YA 2P0PA 2LQWA 1VQ5Q 1ZX6A 2WSCE 1X69A 2YRVA 2GGRA 2M0OA 1OOTA 3DB3A 4HVWA 1FMVA 2P0KA 2YXYA 3M58A 1JXOA 1N9SA 2RN8A 4C8QC 2X9HA 2ENMA 2HQXA 3EG9A 4LNPA 3J80E 2K5IA 2YRCA 1G2BA 2DPPB 2H3EB 2RHYA 5CO7A 1M27C 3M0TA 1NEBA 3RMSA 4F04B 4OF1A 3CCRA 4Y28E 1VIFA 3CCMA 3A1PA 3EGUA 3M0UA 1MV0B 7AT1B 4MDWA 2V8JA 3S3MA 2LX9A 3V7SA 2IIMA 2OX7A 5CKDA 1QCFA 3JB9I 2FRWA 4C0DB 1NJIU 1NG2A 1PC0A 4C92B 4XTYA 3QDRB 3G71A 3CC7A 1M9SA 5GAN8 2LP5A 2QYZA 4JZ3A 1QVFA 2HSPA 3LLRA 1XJWB 2H3JA 2QQBA 4NOYA 4PJJA 4KT0E 2LJ0A 3PVLA 2GBQA 4J9DA 4PJLA 3M56A 2ABLA 3A8GB 1I07A 1D3BA 3I55Q 1BKBA 4ELZC 2XHCA 2FEIA 5AT1B 1QVGS 3G4SA 3CCQA 4M78E 3TCJA 1UGQB 2FVUA 3SB2A 2WACA 1I5LA 5EG2A 4JJBA 2J05A 1VQMT 3RESA 4DQ2A 1VYVA 2FO0A 3KXTA 4RMOA 2LNVA 1VQNT 3OYEA 1MUZA 4PJMA 1JXMA 2YUNA 2GQIA 4V2SA 4J9EA 3UF4A 2CUBA 1YJNQ 3Q1JA 5LJ5h 5DM7R 1KJWA 4C92G 3NTIA 3H41A 1AWJA 5CVIA 2XG8D 2M0YA 3VKIA 1BIAA 3PMTA 2O9SA 2DXUA 1PRLC 2K57A 4BACA 2EFIA 4HCCA 1PWTA 5IHIA 1IHWA 3G6EA 1VQPA 3EFRA 3MO8A 5LJ3h 1QVGP 4RKUE 4FW2A 1I81A 3V8LA 4DOWA 2K9GA 2KSSA 1AWWA 5IAYA 4QT7A 4X34A 1NM7A 2EJFA 3REAB 4LD6A 3CCJA 1GRIA 3E2UA 4EIKA 1TTHB 2DJZA 2DL7A 1K76A 3P8DA 1TWBA 2XKOC 1Q95G 4WF2A 2E5QA 1K4US 4JPBW 2ESWA 4CC2A 3DLLA 2VXEA 3HTRA 2GFUA 2CYZB 5LL6S 2CUDA 5D6WA 2MOXA 3OMGA 3OYBA 1MGQA 3META 2VWFA 1U5SA 3OYHA 3ME9A 2HKNA 1PSFA 2EKHA 4FSSA 4R55A 5IH2A 1G3YA 1BYMA 2CT4A 4WCIA 2E70A 4M7DD 2F69A 1Q81C 5GAOp 4NS5A 4CC3A 1G3TA 3JSCA 1O75A 3P8HA 3UA6A 5GMKh 1X43A 2RJFA 4J9IA 3UDCA 4F7UF 4F7UG 4FCYA 3JCMb 1RADB 3TREA 3RBBB 4GLKA 4A4KA 3QDFA 2O2OA 1VQ4T 1N5ZA 3VS4A 4BE2A 1JBMA 2FPFA 3I55T 1W70A 3BDLA 1MMAA 2QTXA 2WSFE 4C8QE 3JCMe 3TVTA 2L3SA 3TQ7P 1WQ7A 2ZPGB 2EPDA 4XTUA 1YP5A 1BIBA 3CPWS 1N8RC 2R58A 1WFWA 4Z02A 5AYFA 5GAMd 4LD9K 1UDLA 1M90R 2X4JA 1GFDA 3TU4K 2X4YA 2COYA 3QXEB 5FRNA 1EIFA 4NL2A 2KT1A 1Q86C 3CCMQ 5HCKA 2HAXA 1VQ7T 1UGPB 2A08A 2QA4A 3VJPA 1T0JA 2JS0A 4QQGA 5GAN6 3QG1A 4M7AF 4XU1A 3OYDA 4L59A 4J6YA 4M7AG 3CMET 2CZ0B 1KQ1A 3KUFA 2FL7A 3G71Q 3CC7Q 2Z0WA 1S1NA 4KGVB 4PJOD 2X4WA 4N4HA 5CQXA 2J7IA 2HQEA 2JT4A 4OB1B 2EQMA 4R0KA 2V8KA 2QTVA 4IIMA 1NPRA 3CCEQ 3H8ZA 3CCUT 3CPWP 4YTLA 3G1JA 3CCQQ 2M16A 2DEUA 2NWMA 3OB9A 5KE2A 2QEXQ 3NGPA 3SFMA 4AFZC 1TSFA 1U1SA 4BY6C 1H3ZA 2D8HA 1Z9ZA 2FYKA 2VUBA 2KRSA 2KR3A 3PVQA 2CDTA 1PM3A 4IURA 2DTIA 2DX1A 3HPWA 3SDZA 2RQTA 3LWIA 1N8RU 1YCSB 2HDAA 3LWHA 1I8FA 2QASA 4F14A 2DL5A 1XQHA 1IHVA 2E1HA 2MK5A 4D8KA 3CCLA 2DTHA 1YITA 4ATOA 3RUXA 3OYJA 3EGXA 5KYXA 3O8VA 2AHJB 4GY5A 3VYGA 3BDUA 4AFUC 2H8HA 2MF2A 3G6EQ 1VQPQ 4J6XA 2CT3A 1YWOA 4A54A 1UJ0A 2O88A 2J6FA 1TXQA 2JTFA 4K11A 3UPUA 1IRXA 5GAOm 3JV3A 4CRIA 4UC4A 1VQ8T 2D0NA 4JRIA 3M4GA 2AZVA 4F16A 4JZ4A 3PMIA 1TH7A 3VS5A 1M1KR 2YSQA 1W2BS 1D1BA 2ROTA 3M4YA 4BB7A 1LOJA 3CC2Q 2K7AA 1VQKA 4O6JA 2JM9A 2AIRB 5KYXB 3JB9G 4M75F 3C4SA 1YI2Q 2DXBA 3JRZA 2F5TX 3AT1B 1FYNA 3JB9H 3JCMh 2ATCB 4C5HA 2EAYA 3HRUA 3RIRA 3CD6T 2CH4W 2VGNA 4DEYA 1OPKA 2DIQA 3M57A 1FX7A 1WJQA 1X6OA 1AVZC 2FB7A 1Q82C 3OBYA 3RKYA 5A0LA 3CCVA 5GAMf 3GF5A 3OS1A 1KC8C 2KYBA 1J3TA 4FYXB 3LH0A 4XK8E 4BUGA 3I35A 4OMQA 4E7HA 3CCET 2DKGA 6AT1B
chains in the Genus database with same CATH topology
2KQWA 1OYXA 1WJSA 5A0GA 3GLXA 2OTJA 3DB4A 4D6WA 1K73C 2QEXT 3JCMJ 3OQ5A 4BY6B 3CCVT 2RHUA 2DAQA 3X20B 1VQOT 4KBMB 2IVWA 4M77C 3RMQA 5LJ3e 4FIBA 1YJWT 1ZHIA 3CC4T 3M59A 1K9MU 1KG1A 4MZPA 4L5GA 5IT9E 2PU9B 1QVFS 2NLUA 2K5LA 2XDBA 1S72T 3OS0A 2RH2A 2DXCA 4E7KA 5CR2A 3OS5A 3JB9J 2L3RA 4N0AC 5GMKm 3I56A 2OTJT 2K5FA 1NZ9A 3SWNB 4B9WA 1QP2A 4X9DA 3TEEA 4HT8A 3QPHA 2EWNA 3L2WA 4N4IA 2R5AA 4LDUA 2RK2A 5IN1A 4F7UB 4OMFB 3A8HB 1K8AU 4RG2A 5GANj 5GAOq 2D9TA 1W2BA 2DO3A 2A7YA 2P0PA 5CQYA 4ZTJA 3A5ZB 2LVMA 4BI8B 2LT1A 5LJ5j 4E7JA 1M5Q1 2DZCA 2RD1A 4OP0A 4M7DB 4M7AA 4Y91A 3HRSA 4J6WA 3V7RA 4E7IA 2WSCE 2YRVA 4M78B 1Q86U 5FLXE 3FDRA 2M0OA 3DB3A 1YHQA 1NE8A 2P0KA 4IUUA 4LDVA 3URGA 3M58A 1N9SA 4C8QC 3HRTA 2BUDA 3PNWC 3VUZA 3FIFA 2HQXA 3LYIA 4PNOA 3R6OA 2ZCFB 2PUOB 3J80E 2KY9A 3MP8A 2K5IA 1FXXA 5KH6A 3LW5E 4JS5A 3M53A 1V29B 3CC2A 3OYNA 1ZBXA 2GFAA 5LJ3j 2XU8A 1Y71A 2XIDA 2DPPB 2LTOA 1YI2A 2K2VA 4J5YA 3RKWA 2RHYA 2LDMA 5CO7A 4MMKA 4XAXB 4A4FA 2QQAA 4BI4A 3RMSA 3QZ5B 4BE0A 1YHQT 3PFSA 4OF1A 4Q5WA 2K4YA 1YCYA 3EFSA 3VYHB 2XDDA 3JB9D 2LT4A 2KMTA 3RKXA 3ZEHA 3CCRA 5L8RE 3NFCA 4PJOA 5GMKl 4Y28E 1VIFA 2CGHA 3PT9A 3CCMA 4B9XA 1YBYA 4MDWA 3CC2T 2V8JA 3PGGA 4XQ3A 2G3RA 4M75C 4PKCC 3S3MA 2PUKB 2LX9A 3V7SA 3M54A 2RI5A 3CBPA 5CKDA 2MI6A 5GANg 4XTZA 1YI2T 3JB9I 3ZBDA 2DK3A 1RL2A 4M7AB 1XOVA 4C0DB 3OYKA 1NJIU 1Q7YU 5LJ5g 3L2ZA 4XU3A 3JB9F 1JB0E 4C92B 4XTYA 3FLGA 3QDRB 3JCMf 3PIPA 3G71A 3CC7A 1M1FA 4XTXA 2MWPA 3OBWA 1QVPA 3CCRT 1M9SA 3FJPA 4N0AA 5GAN8 4M78G 1QVFA 1X01A 3CCMT 3LLRA 3MEUA 4F7UE 2H3JA 2EQJA 2QQBA 3E9FA 5CKEA 4NOYA 1IZ6A 4II1A 3CXCS 1VQMA 3HFNA 1NPPA 4KT0E 4M7AC 4OB2B 3JCMP 2DZ9A 1VQNA 3M56A 3A8GB 1WNLA 5LJ5d 1D3BA 4J83A 3OYYA 4A4EA 1BKBA 1JRIA 2JOYA 2RB6A 3BW1A 2XHCA 4LDWA 4ELZC 4BDZA 4M7DE 5LJ3g 3G4SA 3CCQA 2ZPEB 1QVGS 2RJCA 2LQ8A 3G71T 3CC7T 4M78E 1BI0A 1HK9A 3TCJA 5M9OA 2QQRA 2QQSA 1UGQB 3PTAA 2FVUA 2WSEE 3SB2A 1UEBA 3QUIA 2WACA 2KDSA 5I21A 3V7CA 4J7FA 5EG2A 3SD4A 3FRNA 1I5LA 4PJOB 2EQUA 1VQMT 1DJ7B 5GAOl 3RESA 4DQ2A 1YJWA 3KXTA 2DXTA 4RMOA 3GIBA 2LNVA 1VQNT 5A2QE 3OYEA 4M77B 1M1GA 5LJ3d 5GAMe 3QYGB 2PVDB 5HY6A 5A0DA 3OYFA 4V2SA 3G4ST 3CCQT 2RA2A 3GNGA 5GANh 4PJOC 2RI3A 4JDSA 3A8MB 1BI1A 2XDPA 3E9GA 2HBPA 3Q1JA 5LJ5h 4HA8A 3S6WA 5DM7R 4C92G 3NTIA 1QP3A 3RERA 4M7DC 3LGLA 5CVIA 5GAOn 2XG8D 3VKIA 2E6ZA 2L89A 1I4K1 1YJ9A 4XU0A 1BIAA 3PMTA 3UWNA 2HNIA 4ZN3A 3GP8A 3VV0A 2DXUA 5KCOA 1KHIA 2K57A 4QW2A 2EFIA 5DY9A 2E10A 3OSVA 5FROA 4BACA 4HCCA 2QI2A 4P5NA 2RJDA 4RCCA 4M75A 3CCSA 2C06A 3G6EA 4M7AE 3E19A 3HSBA 1VQPA 3EFRA 4C92E 2I2LA 3BY7A 1KQSA 1B34A 3MO8A 4IUPA 5LJ3h 3P8BB 4RKUE 1I81A 4DA4A 3V8LA 4DOWA 2RO0A 2XK0A 4IUVA 2KSSA 4ZTFA 3L2VA 1N6AA 5IAYA 2ZPFB 3J7AF 3HHTB 2RJEA 4C8QB 1YJ9T 4X34A 3JAME 2EJFA 4LD6A 3WVDB 4IUQA 3OYAA 3CCJA 3OW2S 2ZPBB 2PVGB 2QDYB 2DJZA 3HP9A 2EQKA 3M55A 5FU6C 4M77F 4XTWA 2MMPA 3P8DA 3CCST 3G6ET 2XKOC 1M1KC 2JZ2A 3QZ9B 4WF2A 1VQPT 4M77G 4C0GA 5GAMj 2E5QA 3CXCA 4OGCA 3DLLA 1Q82U 2VXEA 3FB9A 2GFUA 3LGFA 3WVEB 4J7IA 2DEQA 2CYZB 4A4HA 5LL6S 2O4XA 5D6WA 4JLGA 2RHIA 4PJOE 3OMGA 3OYBA 1M90C 1MGQA 3S3NA 3META 2KVQG 1KC8U 3CBOA 2VGMA 4C5GA 3X28B 3OYHA 3CCJT 1QVGA 4VUBA 2KK4A 4KUDK 3ME9A 4PLIA 4OGEA 4X9CA 4M77E 4ZGDB 1PSFA 3CPFA 3MEWA 4R55A 1G3YA 4M75B 1LJOA 2RHZA 1XNIA 1BYMA 1VQ4A 4EMKA 2E70A 2BKDN 1G5VA 3OYCA 4M7DD 2F69A 1Q81C 5CCAA 4NS5A 2YLCA 5GAOp 1B34B 3HKSA 1G3TA 3JSCA 1O75A 2EYQA 1XTDA 3P8HA 2VXFA 4M78D 2RJFA 5GMKh 4FL6A 5GAN2 1VQLA 4FM4B 3QHSA 3UDCA 5J26A 3T9NA 4F7UF 1KQSS 2K3YA 4OB0B 3OS2A 4F7UG 3JCMb 4BE1A 3C95A 4O5VA 3TREA 3LX7A 3A8OB 3MHXA 4PLLA 2E64A 3NTKA 4GLKA 3PIOA 3ASKA 1PSEA 1U1TA 2LQKA 3INZA 4A4KA 4C8QG 4M7DF 2R5MA 3JCMd 3C12A 1VQ4T 1FWZA 3QO3A 4M78F 3CMAA 4M7DG 4HCZA 5CIUA 2DVEA 2ZZDA 3OYGA 4BE2A 1G3WA 2YLBA 2R57A 1VQLT 1JJ2S 3OMCA 1JBMA 5HKCA 3JCMV 5GAMg 3I55T 4JRPA 3BDLA 5C0MA 3AHUA 4LDXA 1G3SA 2DIGA 4N4GA 4BDYA 4FT4A 4NL3A 2QTXA 1VQ6A 2B8AA 2WSFE 4C8QE 2VYTA 3JCMe 5D6YA 5FRMA 2BIVA 5GAN7 2ZGWA 1QW1A 5I2SA 2P0QA 1VQ7A 1WQ7A 2ZPGB 1RI0A 4XTUA 1BI3A 4LDYA 1BIBA 4ZN1A 1IREB 5HK3A 3CPWS 2R58A 4C5EA 4OVAA 1N8RC 1K8AC 2MAMA 4EMKB 3OYLA 4Z02A 5AYFA 5GAMd 4QVCA 3L2QA 4JJNK 3E1SA 3KBGA 4LD9K 4M7AD 4L6V5 2CKKA 2LCLA 1LNXA 2X4JA 2E12A 1AHJB 4M75G 4FU6A 4ZGEB 4IUTA 4C92D 3CMEA 3TU4K 2E41A 1BI2A 2X4YA 3CEYA 1KQ2A 3OW2A 3QXEB 3X25B 4DOVA 5FRNA 3OYIA 5GANf 1EIFA 5FU7B 1VQ6T 4JRKA 2LC4A 4NL2A 4JUVA 4R56A 3ZFJA 4PL6A 1YIJA 1Q86C 2LRQA 4EMKC 5LJ5f 1M4ZA 2GQVA 1UGPB 4EMHA 1VQ7T 2HAXA 2OTLA 4RCBA 1WQWA 2QA4A 3VJPA 4QQGA 3ER0A 2L8DA 1P92A 3QG1A 3SWNA 5GAN6 4M7AF 4M75E 4XU1A 3OYDA 4MZTA 2JUFA 5GAOr 1VQ5A 2QXFA 1MHNA 2EJ9A 3N5BB 4J6YA 3F70A 4L59A 4C92F 2YHTA 5FU7C 5DLOA 5J39A 3CCUA 1U8RA 4M7AG 3CMET 4FSXA 3X24B 1W4SA 2CZ0B 1KQ1A 2ZPHB 2FL7A 3HFOA 3KUFA 1N9RA 2DD5A 3FEOA 1VUBA 2L5QA 5GAMh 4C0FA 1YIJT 4PJOD 2DTOA 1D3BB 2V8IA 1Y96A 5LJ3f 2X4WA 4N4HA 5CQXA 4OB1B 2HQEA 3GOXA 2QA4T 4M78A 5CAIA 3M9QA 2EQMA 2V8KA 4ZGJB 4M77D 3UT1A 2JN0A 2JTMA 3OYMA 1NPRA 1VQ5T 2OTLT 3H8ZA 5FU6B 4FT2A 1HXDA 4EDUA 3CCUT 1UGSB 3L1AA 4JLIA 4YTLA 2E65A 2M16A 4BI3A 2K3XA 1M8VA 5CK9A 3OB9A 5KE2A 3JCMX 4IKFA 4PJOF 4CI0C 4A53A 3SFMA 5CKBA 3V8KA 1NJIC 3CMAT 4PJOG 1Q7YC 1Y07A 3QYHB 1U1SA 1H3ZA 4BY6C 3L2RA 2HD0A 2EKOA 2FYKA 1R8OB 5KCHA 2D6FA 4JS4A 2M9UA 2VUBA 4XTVA 1JJ2A 1OZ3A 3EAEA 1UB4A 4IURA 2DTIA 2P4TA 3MP6A 4ME7A 3HPWA 3SDZA 3LWIA 1N8RU 3CBMA 4M7DA 4XU2A 3LWHA 5C6SA 3JCMQ 1I8FA 1ZQ1A 1OI1A 2D0QB 2EJGA 2OAUA 5I2MA 2ZPIB 1XQHA 3SWNC 4HCBA 4ELYC 3CPWA 4HT9A 4KUIA 4C0ZA 4C5IA 2E1HA 1Y96B 5GAN3 1VIEA 2CZ7B 2PQWA 3OSSC 5DLQE 3I56T 4C8QD 4BD3A 2RK1A 4C92A 3H6ZA 3CCLA 2DTHA 3L2UA 1YITA 3RUXA 3OYJA 3WXMB 4A4GA 4ATOA 1GXIE 2VV5A 3MEVA 3O8VA 2AHJB 1VQ8A 4GY5A 2VC8A 3VYGA 3JCMg 3QSUA 3C94A 3JCMW 3BDUA 5GAN5 4QVDA 2MF2A 3I55A 1KD1C 3DKMA 1N27A 2RM4A 4J6XA 4JRQA 1SSFA 5GMKe 3QBYA 3G7ZA 3QJ6A 4M78C 4A54A 2E6NA 4OB3B 1WJRA 4C8QF 2JTFA 1VQ9A 4EMGA 3UPUA 3MP1A 3HL8A 2EIFA 3MEAA 3CCLT 5GAOm 1YITT 1H641 4CRIA 3GPLA 4UC4A 1VQ8T 1UGRB 2XICA 4JRIA 1K9MC 3S3OA 3M4GA 4M75D 2LCCA 2QQ9A 2XD0A 2O4XB 3PMIA 3OA6A 1TH7A 1WPYA 4MMLA 2GF7A 3QIIA 4QQ6A 1YJNA 4M77A 3L42A 1VQ9T 1W2BS 2JVVA 3NTHA 3CD6A 5CKFA 5J3BA 3M4YA 3J81E 4BB7A 1O9SA 1LOJA 3VUBA 5CKHA 2Y90A 3V8JA 2KAFA 1VQKA 4O6JA 1K73U 2CZ6B 3JB9G 4M75F 3C4SA 3VU3C 2DXBA 2PVOB 3JRZA 3GNFB 2F5TX 1M1KU 4RG8A 3BFMA 4TVRA 2X4XA 4MZMA 5GANd 3JB9H 4E47A 4EPCA 3JCMh 2XI9A 2EAYA 4C5HA 1X75C 2A3LA 4C0DC 1Y7XA 2Y4XA 5HK0A 4KULA 3HRUA 3OY9A 4C92C 1YJNT 3DLMA 2JNGA 2X35A 3RIRA 5GMKj 2VGNA 1M90U 3CCEA 3QJYA 4QVZA 3CD6T 4MDXA 2IG0A 2MWOA 5GMKi 2DIQA 2O01E 2M1HA 1KHCA 1FX7A 1WJQA 1X6OA 2CZ1B 2FB7A 3M57A 3OBYA 3JCMc 1Q82C 1VQKT 2QEXA 3RKYA 3X26B 2GCXA 2RHXA 2FHDA 5GANe 5GAMf 5A0LA 3CCVA 2F5KA 5D6XA 1OZ2A 4F7UA 4E7LA 3GF5A 3OS1A 2Y4YA 1VQOA 3M5AA 1KC8C 5LJ5e 2RI2A 4QQDA 1Q81U 3CC4A 1WGSA 5KE3A 4C8QA 3LH0A 3MCAB 4XK8E 4BUGA 1KD1U 2CS7A 4J8OA 3FC3A 4E7HA 2DD4A 2DKGA 3A8LB 5GAN4 3CCET 4HKEA 3QKJA 1S72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PKC C; 
#chains in the Genus database with same CATH topology
 1GBQ A;  1K9M R;  1AOJ A;  1K73 C;  2QEX T;  1W2B P;  2KI7 A;  1M3A A;  2FPE A;  2RHU A;  4KBM B;  2IVW A;  3M59 A;  2DYI A;  3GBQ A;  2DBM A;  2J06 A;  4E7S A;  2DXC A;  3NPF A;  5CR2 A;  2A28 A;  2L3R A;  2OTJ T;  2CP7 A;  1AWX A;  1NZ9 A;  2COW A;  1RAG B;  4X9D A;  2RK2 A;  1C1A A;  3EG1 A;  2QA4 Q;  2JW4 A;  3VS2 A;  2DO3 A;  2J6K A;  5LJ5 j;  2LT1 A;  4E7J A;  4OP0 A;  1ZUY A;  3HRS A;  3V7R A;  4M78 B;  1YJ9 Q;  1V1C A;  1KK7 A;  1YHQ A;  1NE8 A;  4LDV A;  1YN8 A;  4OMN A;  4AFS C;  2HMA A;  2ZCF B;  4JS5 A;  2DMO A;  1V29 B;  2DVJ A;  1M2V A;  5LJ3 j;  2XID A;  4J5Y A;  3RKW A;  2LDM A;  4BI4 A;  2K6D A;  3PFS A;  4Q5W A;  3EFS A;  2AT1 B;  2E3I A;  2LT4 A;  2EGC A;  5L8R E;  3MJX A;  3PT9 A;  2JMC A;  1I0C A;  1YBY A;  3CC2 T;  3PGG A;  4XQ3 A;  1WHG A;  1ZA2 B;  3M54 A;  1YI2 T;  2EYW A;  2DK3 A;  1RL2 A;  3EHQ A;  1RAC B;  1X2Q A;  1JB0 E;  1LCK A;  4AG1 C;  3M0R A;  1M1F A;  3I5R A;  1QVP A;  1KSW A;  2BZX A;  4N0A A;  2VVK A;  4M78 G;  3I9Q A;  3CXC S;  3CCL Q;  1YIT Q;  1IZ6 A;  4II1 A;  4OB2 B;  1M2V B;  2JMA A;  4A4E A;  1SEM A;  2RB6 A;  3BW1 A;  3C0C A;  2YUP A;  4M7D E;  2VB6 A;  5M9O A;  2QQR A;  2WSE E;  1UEB A;  2PNI A;  2EYX A;  1DJ7 B;  1YJW A;  4RTW A;  1EZZ B;  2RQU A;  3GIB A;  1VA7 A;  5A2Q E;  1SSH A;  4KGX B;  2A0F B;  2PVD B;  5A0D A;  5KYU B;  1UJY A;  2RA2 A;  3GNG A;  1GCQ A;  2JJ9 A;  1R77 A;  2QK0 A;  3S6W A;  3RER A;  1VQK Q;  3LGL A;  5GAO n;  4RTX A;  2E6Z A;  2BZ8 A;  3GP8 A;  4E7Z A;  3CXC P;  4QW2 A;  5DY9 A;  1PNJ A;  4RCC A;  1T0H A;  3CCS A;  3E19 A;  1YIJ Q;  2I2L A;  2W0Z A;  4E2F B;  1B34 A;  1UUE A;  1N6A A;  3EGD B;  2KXD A;  3J7A F;  1UG1 A;  1YJ9 T;  4C8Q B;  3CCV Q;  4X1V A;  4ESR A;  1SKU B;  3KFV A;  3WVD B;  3OYA A;  3HP9 A;  2XMF A;  4XTW A;  1TUC A;  1M1K C;  4C0G A;  1U06 A;  2C0I A;  4OGC A;  3LGF A;  4M4Z A;  4A4H A;  4FW1 A;  2MIO A;  5IXF A;  2O4X A;  4PJO E;  3S3N A;  1W1F A;  3CBO A;  4C5G A;  1QVG A;  4VUB A;  1GCQ C;  4ZGD B;  3CPF A;  2GTJ A;  1LJO A;  1WHM A;  2RHZ A;  4LXC A;  1G5V A;  1B34 B;  1SHF A;  1VQL A;  4FM4 B;  1RAE B;  2K3Y A;  4OB0 B;  1OV3 A;  1JO8 A;  4BE1 A;  1QKX A;  3C95 A;  1C6V X;  2X3W D;  3A8O B;  3NTK A;  3ASK A;  1PSE A;  4C8Q G;  3JCM d;  2HZY A;  2DER A;  3QO3 A;  4HCZ A;  5CIU A;  2DVE A;  5IXB A;  3OYG A;  1G3W A;  2YLB A;  2R57 A;  1JJ2 S;  2DJQ A;  5GAM g;  3EG9 B;  1B07 A;  1PHT A;  1YHQ Q;  4LDX A;  4BDY A;  4N4G A;  4NL3 A;  2VYT A;  5GAN 7;  2ZGW A;  1RAA B;  2AK5 A;  1RI0 A;  4ZN1 A;  1OEB A;  2OAW A;  4C5E A;  4OVA A;  4ZNX A;  4Z8A A;  3CMA T;  1RAH B;  2P4R A;  3L2Q A;  3KBG A;  1VQ9 Q;  4M7A D;  2CKK A;  4ZGE B;  4IUT A;  1PG5 B;  4GLM A;  1KQ2 A;  4RUG A;  2JXB A;  5GAN f;  1VQ6 T;  4DBR A;  1LPL A;  4PL6 A;  1SF9 A;  3REB B;  3LH5 A;  3EG3 A;  5GAO r;  2OTL A;  3N5B B;  4C92 F;  3F70 A;  2QAZ A;  3VS6 A;  4FSX A;  1N9R A;  3FEO A;  1VUB A;  1JJ2 P;  3EG0 A;  1QWF A;  1YIJ T;  2K3B A;  2DTO A;  2YWW A;  2AZS A;  1D3B B;  1Y96 A;  3GOX A;  4ZGJ B;  4M77 D;  2JN0 A;  2JTM A;  1VQ5 T;  4FT2 A;  4JLI A;  2NUT A;  2K3X A;  4AT1 B;  1M8V A;  3V8K A;  1ZUU A;  1Q7Y C;  1Y07 A;  4AMC A;  1YJW Q;  1M3B A;  5KYN A;  3CC4 Q;  2HD0 A;  2EKO A;  5KCH A;  4WTO B;  2D6F A;  2M9U A;  1D1C A;  1UB4 A;  2LMJ A;  2P4T A;  3MP6 A;  1UHC A;  2KNB B;  4ME7 A;  3CBM A;  1TU0 B;  5FW9 A;  1ZQ1 A;  2FZK B;  4OMP A;  2CH4 A;  1OI1 A;  2OAU A;  2ZPI B;  4HCB A;  4ELY C;  1ABQ A;  3CPW A;  4C0Z A;  1Y96 B;  5GAN 3;  1VIE A;  2PQW A;  3OSS C;  3U23 A;  3H6Z A;  3MEV A;  1G83 A;  3QSU A;  3C94 A;  1Y57 A;  3SEM A;  2J6O A;  3CCS Q;  3QWX X;  1WLP B;  5FWC A;  1KD1 C;  1N27 A;  4JRQ A;  1WXT A;  2E6N A;  4RTZ A;  2DM1 A;  1D0Y A;  4EMG A;  1QVF P;  3MP1 A;  3D7S B;  3MEA A;  2EIF A;  4PFP A;  1UGR B;  2XIC A;  1QWE A;  2EYZ A;  3S3O A;  1X2K A;  4M75 D;  1GFC A;  2KT8 A;  4QQ6 A;  4M77 A;  1WX6 A;  3NMZ C;  3L42 A;  1VQ9 T;  3NTH A;  1KIK A;  5CKF A;  3H0I A;  1CKB A;  1E6G A;  1HD3 A;  5CKH A;  2CZ6 B;  2LNH B;  1NLP C;  4KGZ B;  3VU3 C;  2NYS A;  1X27 A;  4MZM A;  4EPC A;  4FYV B;  1Y7X A;  1YJN T;  3CCR Q;  1M2O A;  1VQL Q;  4MDX A;  2MWO A;  1KHC A;  3TSZ A;  1SG5 A;  2B86 A;  5D7U A;  3X26 B;  4E7L A;  2F5K A;  4PFO A;  1EFN A;  1VQO A;  1AWO A;  1Q81 U;  1K1Z A;  2QGF B;  1KD1 U;  4J8O A;  2DIL A;  5GAN 4;  3A8L B;  1AZE A;  4M7D A;  3QKJ A;  1S72 A;  1D09 B;  3GLX A;  2ED0 A;  3JCM J;  4BY6 B;  2CP5 A;  2DAQ A;  1VOM A;  1YFN A;  2A37 A;  3G4S Q;  4M77 C;  1YJW T;  3CC4 T;  1QQJ A;  3EFO A;  5GJW B;  4L5G A;  2NLU A;  1AT1 B;  1K8A R;  3OS0 A;  1MV3 A;  2ED1 A;  3OS5 A;  3JB9 J;  5GMK m;  3I56 A;  2HEQ A;  1QKW A;  4ORZ A;  2D8J A;  5IN1 A;  4OMF B;  3A8H B;  1NYF A;  2FPD A;  1W2B A;  3MKD A;  2OTL Q;  2NUZ A;  3A5Z B;  2LVM A;  2EQI A;  1IGQ A;  1M5Q 1;  2BZY A;  2DZC A;  4M7D B;  3M0Q A;  2RQV A;  1CKA A;  4E7I A;  1UTI A;  1SPK A;  1Q86 U;  1RUW A;  4OML A;  3FDR A;  4PK4 A;  5FLX E;  2HL3 A;  2LCS A;  3URG A;  3QWY A;  2OJ2 A;  2BE9 B;  3PNW C;  3FIF A;  1WHH A;  3LYI A;  4PNO A;  3R6O A;  2PUO B;  4M7D C;  2KY9 A;  3MP8 A;  5KH6 A;  1FXX A;  3EFO B;  1BK2 A;  2HCK A;  2GFA A;  2XU8 A;  2LTO A;  1BU1 A;  3UAT A;  4XAX B;  1ZSZ A;  2K79 A;  2QQA A;  5L23 A;  3QZ5 B;  3CCJ Q;  1YCY A;  3VYH B;  1IGU A;  2KMT A;  3ZEH A;  3NFC A;  4PJO A;  1NJI R;  2CGH A;  1RLQ C;  2O31 A;  4QKU A;  2G3R A;  4M75 C;  1NEG A;  3CBP A;  5GAN g;  2MI6 A;  4XTZ A;  4RTV A;  3L2Z A;  4XU3 A;  3JB9 F;  3FLG A;  4D8D A;  3PIP A;  3EGX B;  4XTX A;  3OBW A;  3CCR T;  3FJP A;  1X01 A;  3CCM T;  3MEU A;  4F7U E;  5CKE A;  2EQJ A;  3E9F A;  1VQM A;  4Y92 A;  3HFN A;  1JEG A;  1NPP A;  5GJV B;  3JCM P;  2KBT A;  1VQN A;  5LJ5 d;  1JRI A;  1PD0 A;  4LDW A;  1ZSZ B;  2F2V A;  2ZPE B;  2RJC A;  3G71 T;  3CC7 T;  2PTK A;  3QUI A;  1TG0 A;  4J7F A;  3SD4 A;  4PJO B;  1ACM B;  2O9V A;  2DXT A;  1ZSZ C;  2PZ1 A;  3I5S A;  1M1G A;  1WIE A;  5LJ3 d;  1KQS P;  5GAM e;  3QYG B;  4GBQ A;  4RTY A;  5HY6 A;  3G4S T;  3CCQ T;  4PJO C;  2RI3 A;  2YUQ A;  1BI1 A;  2DE0 X;  3E9G A;  2HBP A;  4HA8 A;  1TUD A;  1QCO A;  2CP0 A;  1GCP A;  1G8X A;  3VV0 A;  1MMG A;  3OSV A;  4PJN A;  1H3H A;  4P5N A;  2RJD A;  4M7A E;  3BY7 A;  4F17 A;  1ZUK A;  2RO0 A;  4IUV A;  4ZTF A;  3L2V A;  3FJ5 A;  4IUQ A;  3OW2 S;  1VQO Q;  3R6N A;  8ATC B;  1HJD A;  3M55 A;  5FU6 C;  4HVU A;  2MMP A;  3G6E T;  1TS9 A;  1VQP T;  3CXC A;  3EH1 A;  3A98 A;  1S72 Q;  1Q82 U;  2DEQ A;  2DL3 A;  3VS0 A;  1WHL A;  2RHI A;  4JLG A;  1M90 C;  2KRN A;  2DET A;  1BBZ A;  1E6H A;  2GTO A;  2KVQ G;  1KC8 U;  1CSK A;  3CCJ T;  2V26 A;  2KK4 A;  1YWP A;  4PLI A;  4OGE A;  2L3P A;  4M77 E;  4LE9 A;  3MEW A;  3EH2 A;  1WA7 A;  2DF6 A;  1D0X A;  1XNI A;  1VQ4 A;  2RMO A;  4EMK A;  5CCA A;  2YLC A;  2DRK A;  1K73 U;  3I56 Q;  4FL6 A;  3T9N A;  2HSE B;  4FYY B;  2ROL A;  3OS2 A;  3VS7 A;  2E64 A;  1U1T A;  3INZ A;  4Z89 A;  1K0S A;  2R5M A;  5IHN A;  3C12 A;  1BCO A;  3OW2 P;  1FWZ A;  4M78 F;  2F2X A;  4CC7 A;  1Z9Q A;  5HKC A;  3JCM V;  1YNZ A;  5C0M A;  3VRZ A;  1X6B A;  2B8A A;  5D6Y A;  5FRM A;  2BIV A;  2QG9 B;  2P0Q A;  1VQ7 A;  1BI3 A;  1IRE B;  1K8A C;  2MAM A;  1C0M A;  2V1R A;  4EMK B;  3OYL A;  3E1S A;  2LCL A;  1LNX A;  5KYW A;  4C92 D;  2BTT A;  3CME A;  2DA9 A;  4KH0 B;  3X25 B;  1W6X A;  5FU7 B;  4JUV A;  4HXJ A;  3ZFJ A;  4EMK C;  5LJ5 f;  1M4Z A;  2ECZ A;  1Q81 R;  3SWN A;  2L8D A;  1P92 A;  2IPO B;  4M75 E;  2EJ9 A;  5DLO A;  2YHT A;  5FU7 C;  3CCU A;  5J39 A;  1W4S A;  3HFO A;  2EVR A;  3BE3 A;  5GAM h;  2V8I A;  5LJ3 f;  1VQM Q;  3H9N A;  2LJ3 A;  2QA4 T;  4J9G A;  5CAI A;  1VQN Q;  3UT1 A;  1UE9 A;  2F1L A;  2P84 A;  2FRY A;  4EDU A;  4HVV A;  1HXD A;  2KYM A;  1UGS B;  1Y0M A;  3L1A A;  5KYW B;  1RI9 A;  5CK9 A;  4IKF A;  4A53 A;  5CKB A;  1NJI C;  1N8R R;  3L2R A;  4OMO A;  2KXC A;  1UEC A;  1JJ2 A;  1ARK A;  1OZ3 A;  1NBE B;  2D0Q B;  2EJG A;  3SWN C;  4HT9 A;  3H0F A;  4KUI A;  4C5I A;  2CZ7 B;  3I56 T;  1WHJ A;  4BD3 A;  1WZO A;  2RK1 A;  4C92 A;  4KRT A;  2YUO A;  2M02 A;  2DRM A;  2YT6 A;  3RR6 A;  4A4G A;  1VQ8 A;  1ZLM A;  5GAN 5;  1NLO C;  2RQW A;  5GMK e;  1SHG A;  3G7Z A;  3QJ6 A;  4C8Q F;  4LUE A;  1AEY A;  2VKN A;  4Z88 A;  3CCL T;  1YIT T;  1PRM C;  1H64 1;  2M51 A;  1K9M C;  4FYW B;  4DEX A;  1MMN A;  2QQ9 A;  2O4X B;  3OA6 A;  5EC7 A;  1WPY A;  4MML A;  2VAS A;  3CQT A;  2GF7 A;  3QII A;  3CD6 A;  2CP6 A;  3J81 E;  4JJC A;  3THK A;  3VUB A;  2F2W A;  3GNF B;  5ECA A;  1OU8 A;  2CP2 A;  1M1K U;  4TVR A;  2CSI A;  1VQ4 Q;  2LQN A;  3VRY A;  4E47 A;  5HK0 A;  2A3L A;  4C0D C;  2RPN A;  4KUL A;  4C92 C;  2QDL A;  2JNG A;  2X35 A;  3CCE A;  4QVZ A;  2IG0 A;  2EBP A;  2O01 E;  2M1H A;  3TSW A;  1I1J A;  1VQK T;  2QEX A;  2GCX A;  2RHX A;  1WHK A;  2CP3 A;  2FHD A;  5GAN e;  5D6X A;  1OZ2 A;  4F7U A;  2HBW A;  2Y4Y A;  2RI2 A;  2L2P A;  2EGA A;  1WGS A;  1RAB B;  2KE9 A;  3O5Z A;  1WI7 A;  4OMM A;  2FZG B;  1AZG B;  1OYX A;  1WJS A;  4LN2 A;  2OTJ A;  2DNU A;  3DB4 A;  1IO6 A;  3OQ5 A;  3CCV T;  1VQ7 Q;  1D1A A;  3X20 B;  3RMQ A;  5I22 A;  4FIB A;  1K9M U;  1KG1 A;  1T3S A;  1ABO A;  1QVF S;  2K5L A;  1M8M A;  3CME Q;  2XDB A;  1B3Q A;  1HYO A;  1LVK A;  2K5F A;  1PKS A;  1QP2 A;  1PD1 A;  1T3L A;  2EWN A;  3L2W A;  4N4I A;  3SHW A;  4F7U B;  2I0N A;  2GNC A;  4RG2 A;  1B7T A;  5GAO q;  2D9T A;  2RQR A;  5CQY A;  2KGT A;  1ZA1 B;  4ZTJ A;  3CCU Q;  1RAF B;  4BI8 B;  1H92 A;  1Q82 R;  2RD1 A;  4M7A A;  4Y91 A;  4J6W A;  1UGV A;  1M3C A;  1OPL A;  1KC8 R;  2HQH A;  4IUU A;  1K0X A;  1FMK A;  3HRT A;  2CSQ A;  2BUD A;  2DL8 A;  1R0B G;  3VUZ A;  2NUT B;  3PE0 A;  2C06 A;  3LW5 E;  3M53 A;  3CC2 A;  1K9A A;  3OYN A;  1ZBX A;  1Y71 A;  1K73 R;  1YI2 A;  2K2V A;  3EHR A;  1PCX A;  4MMK A;  1UFF A;  4A4F A;  4BE0 A;  1YHQ T;  3RNJ A;  2K4Y A;  2XDD A;  2DYB A;  4PFZ A;  3JB9 D;  3VS1 A;  1KFZ A;  3RKX A;  4J9B A;  5GMK l;  8AT1 B;  4B9X A;  1E7O A;  4PKC C;  2PUK B;  1OUL A;  2RI5 A;  4J9F A;  1OX8 A;  1X6G A;  3ZBD A;  1GL5 A;  2MPX C;  4M7A B;  1XOV A;  3OYK A;  1Q7Y U;  5LJ5 g;  3JCM f;  5IHK A;  2LX7 A;  2MWP A;  2X51 A;  4M7A C;  1VQ8 Q;  2DZ9 A;  1WNL A;  2SEM A;  4J83 A;  3OYY A;  5I11 A;  2JOY A;  4BDZ A;  2FG0 A;  5LJ3 g;  2LQ8 A;  1BI0 A;  1HK9 A;  2QQS A;  1D0Z A;  3PTA A;  1TUG B;  3EG2 A;  2KDS A;  5I21 A;  3V7C A;  9ATC B;  3FRN A;  2EQU A;  5GAO l;  1M30 A;  4M77 B;  3OYF A;  2YRD A;  1IXD A;  5GAN h;  2BE7 D;  4JDS A;  3A8M B;  3CD6 Q;  2XDP A;  4J9C A;  2KEA A;  1QP3 A;  2L89 A;  1I4K 1;  1YJ9 A;  4XU0 A;  3UWN A;  2HNI A;  4ZN3 A;  5KCO A;  2KRO A;  1KHI A;  2E10 A;  5FRO A;  1EX4 A;  2QI2 A;  1JQQ A;  2K2M A;  4M75 A;  3HSB A;  3M0S A;  4C92 E;  1ZSG A;  1KQS A;  4IUP A;  3P8B B;  4DA4 A;  2XK0 A;  2ZPF B;  3HHT B;  2RJE A;  3JAM E;  4JJD A;  1V76 A;  4CC4 B;  4E6R A;  1R0C B;  2ZPB B;  2COZ A;  2PVG B;  2QDY B;  2EQK A;  1AD5 A;  4M77 F;  3CCS T;  1RLP C;  1WXB A;  2JZ2 A;  3QZ9 B;  4M77 G;  1BB9 A;  5GAM j;  4DBF A;  3FB9 A;  3WVE B;  4J7I A;  2JTE A;  2OTJ Q;  2VGM A;  3X28 B;  4KUD K;  4X9C A;  2E3H A;  2JM8 A;  4M75 B;  2E4H A;  2BKD N;  3OYC A;  1PKT A;  3HKS A;  4M78 D;  2EYQ A;  1XTD A;  2VXF A;  5GAN 2;  3QHS A;  5J26 A;  1KQS S;  5FWB A;  2MCN A;  4O5V A;  3LX7 A;  3RDV A;  4PLL A;  3MHX A;  3PIO A;  2LQK A;  4M7D F;  2AKL A;  3H0H A;  3CMA A;  4M7D G;  2OI3 A;  2ZZD A;  1VQL T;  3OMC A;  4JRP A;  1QLY A;  2DL4 A;  3AHU A;  1G3S A;  2DIG A;  4FT4 A;  1VQ6 A;  3NHN A;  2C0O A;  1QW1 A;  5I2S A;  1QCN A;  1VYT A;  4LDY A;  5HK3 A;  2D1X A;  4JJN K;  4QVC A;  4L6V 5;  2E12 A;  1AHJ B;  4M75 G;  4FU6 A;  2E41 A;  1BI2 A;  3CEY A;  3M0P A;  3OW2 A;  2G6F X;  1RAI B;  4DOV A;  3OYI A;  3MPU B;  2YDL A;  4JRK A;  1BCM A;  2LC4 A;  4R56 A;  1YIJ A;  2L0A A;  2LRQ A;  4EMH A;  2GQV A;  2C0T A;  4RCB A;  1WQW A;  3ER0 A;  4MZT A;  2JUF A;  1VQ5 A;  1A0N B;  2QXF A;  1MHN A;  1VYU A;  1U8R A;  4AG2 C;  3X24 B;  2ZPH B;  2DD5 A;  3IQL A;  2L5Q A;  4C0F A;  1TOV A;  3ZL7 C;  4M78 A;  3M9Q A;  2EGE A;  3OYM A;  2OTL T;  1OX9 A;  5FU6 B;  4AFQ C;  2KRM A;  2E65 A;  2QGG A;  4BI3 A;  3JCM X;  2HKQ B;  4PJO F;  1MND A;  1SRL A;  4CI0 C;  2LZ6 B;  1SRM A;  4A63 B;  4PJO G;  4DBH A;  3QYH B;  1IB8 A;  1R8O B;  4JS4 A;  4XTV A;  3EAE A;  4LUD A;  2EW3 A;  4XU2 A;  5C6S A;  4RTU A;  3JCM Q;  5I2M A;  3UA7 A;  2L3Q A;  1QMC A;  5DLQ E;  4C8Q D;  3L2U A;  1GXI E;  1U3O A;  3WXM B;  2VV5 A;  2VC8 A;  3JCM g;  3JCM W;  4KH1 B;  4QVD A;  2JS2 A;  3I55 A;  3DKM A;  2RM4 A;  1SSF A;  3QBY A;  1H8K A;  4M78 C;  4OB3 B;  1WJR A;  1VQ9 A;  4B6M A;  1NYG A;  3HL8 A;  3GPL A;  1UHF A;  1WDX A;  1I5O B;  2LCC A;  1Q7Y R;  2XD0 A;  2AKK A;  1YJN A;  2HL5 C;  2EYY A;  2JVV A;  5J3B A;  2LJ1 A;  5KYU A;  1O9S A;  2ZAE A;  2Y90 A;  3V8J A;  2KAF A;  4HCK A;  1OQK A;  2PVO B;  2V1Q A;  5KYY A;  1ZBJ A;  1FMW A;  4RG8 A;  3BFM A;  3ULR B;  2X4X A;  5GAN d;  1WYX A;  2XI9 A;  3OY9 A;  1X75 C;  2RNA A;  2Y4X A;  3DLM A;  5GMK j;  1M90 U;  2DFU A;  3QJY A;  1F1B B;  5GMK i;  2CRE A;  2CZ1 B;  3JCM c;  1KD1 R;  2NUP A;  2FZC B;  3M5A A;  5LJ5 e;  4QQD A;  3EGD A;  2MYS A;  3CC4 A;  3CMA Q;  5KE3 A;  4C8Q A;  3MCA B;  1WXU A;  1MNE A;  2CS7 A;  4RTT A;  3FC3 A;  2DD4 A;  4HKE A;  2KQW A;  5A0G A;  2DLP A;  3VS3 A;  1VQ6 Q;  1HSQ A;  2SRC A;  4D6W A;  4ANJ A;  2E5K A;  4IIO A;  1OU9 A;  5KYY B;  2RF0 A;  1VQO T;  1JU5 C;  5LJ3 e;  1ZHI A;  4MZP A;  5IT9 E;  2PU9 B;  2X3X D;  1GBR A;  4J9H A;  1S72 T;  2W10 A;  2RH2 A;  4E7K A;  4N0A C;  2DBK A;  3SWN B;  4B9W A;  3TEE A;  4HT8 A;  3QPH A;  2R5A A;  4LDU A;  2A36 A;  1K8A U;  2NUP B;  1Q86 R;  5GAN j;  4DBQ A;  1MMD A;  2A7Y A;  2P0P A;  2LQW A;  1VQ5 Q;  1ZX6 A;  2WSC E;  1X69 A;  2YRV A;  2GGR A;  2M0O A;  1OOT A;  3DB3 A;  4HVW A;  1FMV A;  2P0K A;  2YXY A;  3M58 A;  1JXO A;  1N9S A;  2RN8 A;  4C8Q C;  2X9H A;  2ENM A;  2HQX A;  3EG9 A;  4LNP A;  3J80 E;  2K5I A;  2YRC A;  1G2B A;  2DPP B;  2H3E B;  2RHY A;  5CO7 A;  1M27 C;  3M0T A;  1NEB A;  3RMS A;  4F04 B;  4OF1 A;  3CCR A;  4Y28 E;  1VIF A;  3CCM A;  3A1P A;  3EGU A;  3M0U A;  1MV0 B;  7AT1 B;  4MDW A;  2V8J A;  3S3M A;  2LX9 A;  3V7S A;  2IIM A;  2OX7 A;  5CKD A;  1QCF A;  3JB9 I;  2FRW A;  4C0D B;  1NJI U;  1NG2 A;  1PC0 A;  4C92 B;  4XTY A;  3QDR B;  3G71 A;  3CC7 A;  1M9S A;  5GAN 8;  2LP5 A;  2QYZ A;  4JZ3 A;  1QVF A;  2HSP A;  3LLR A;  1XJW B;  2H3J A;  2QQB A;  4NOY A;  4PJJ A;  4KT0 E;  2LJ0 A;  3PVL A;  2GBQ A;  4J9D A;  4PJL A;  3M56 A;  2ABL A;  3A8G B;  1I07 A;  1D3B A;  3I55 Q;  1BKB A;  4ELZ C;  2XHC A;  2FEI A;  5AT1 B;  1QVG S;  3G4S A;  3CCQ A;  4M78 E;  3TCJ A;  1UGQ B;  2FVU A;  3SB2 A;  2WAC A;  1I5L A;  5EG2 A;  4JJB A;  2J05 A;  1VQM T;  3RES A;  4DQ2 A;  1VYV A;  2FO0 A;  3KXT A;  4RMO A;  2LNV A;  1VQN T;  3OYE A;  1MUZ A;  4PJM A;  1JXM A;  2YUN A;  2GQI A;  4V2S A;  4J9E A;  3UF4 A;  2CUB A;  1YJN Q;  3Q1J A;  5LJ5 h;  5DM7 R;  1KJW A;  4C92 G;  3NTI A;  3H41 A;  1AWJ A;  5CVI A;  2XG8 D;  2M0Y A;  3VKI A;  1BIA A;  3PMT A;  2O9S A;  2DXU A;  1PRL C;  2K57 A;  4BAC A;  2EFI A;  4HCC A;  1PWT A;  5IHI A;  1IHW A;  3G6E A;  1VQP A;  3EFR A;  3MO8 A;  5LJ3 h;  1QVG P;  4RKU E;  4FW2 A;  1I81 A;  3V8L A;  4DOW A;  2K9G A;  2KSS A;  1AWW A;  5IAY A;  4QT7 A;  4X34 A;  1NM7 A;  2EJF A;  3REA B;  4LD6 A;  3CCJ A;  1GRI A;  3E2U A;  4EIK A;  1TTH B;  2DJZ A;  2DL7 A;  1K76 A;  3P8D A;  1TWB A;  2XKO C;  1Q95 G;  4WF2 A;  2E5Q A;  1K4U S;  4JPB W;  2ESW A;  4CC2 A;  3DLL A;  2VXE A;  3HTR A;  2GFU A;  2CYZ B;  5LL6 S;  2CUD A;  5D6W A;  2MOX A;  3OMG A;  3OYB A;  1MGQ A;  3MET A;  2VWF A;  1U5S A;  3OYH A;  3ME9 A;  2HKN A;  1PSF A;  2EKH A;  4FSS A;  4R55 A;  5IH2 A;  1G3Y A;  1BYM A;  2CT4 A;  4WCI A;  2E70 A;  4M7D D;  2F69 A;  1Q81 C;  5GAO p;  4NS5 A;  4CC3 A;  1G3T A;  3JSC A;  1O75 A;  3P8H A;  3UA6 A;  5GMK h;  1X43 A;  2RJF A;  4J9I A;  3UDC A;  4F7U F;  4F7U G;  4FCY A;  3JCM b;  1RAD B;  3TRE A;  3RBB B;  4GLK A;  4A4K A;  3QDF A;  2O2O A;  1VQ4 T;  1N5Z A;  3VS4 A;  4BE2 A;  1JBM A;  2FPF A;  3I55 T;  1W70 A;  3BDL A;  1MMA A;  2QTX A;  2WSF E;  4C8Q E;  3JCM e;  3TVT A;  2L3S A;  3TQ7 P;  1WQ7 A;  2ZPG B;  2EPD A;  4XTU A;  1YP5 A;  1BIB A;  3CPW S;  1N8R C;  2R58 A;  1WFW A;  4Z02 A;  5AYF A;  5GAM d;  4LD9 K;  1UDL A;  1M90 R;  2X4J A;  1GFD A;  3TU4 K;  2X4Y A;  2COY A;  3QXE B;  5FRN A;  1EIF A;  4NL2 A;  2KT1 A;  1Q86 C;  3CCM Q;  5HCK A;  2HAX A;  1VQ7 T;  1UGP B;  2A08 A;  2QA4 A;  3VJP A;  1T0J A;  2JS0 A;  4QQG A;  5GAN 6;  3QG1 A;  4M7A F;  4XU1 A;  3OYD A;  4L59 A;  4J6Y A;  4M7A G;  3CME T;  2CZ0 B;  1KQ1 A;  3KUF A;  2FL7 A;  3G71 Q;  3CC7 Q;  2Z0W A;  1S1N A;  4KGV B;  4PJO D;  2X4W A;  4N4H A;  5CQX A;  2J7I A;  2HQE A;  2JT4 A;  4OB1 B;  2EQM A;  4R0K A;  2V8K A;  2QTV A;  4IIM A;  1NPR A;  3CCE Q;  3H8Z A;  3CCU T;  3CPW P;  4YTL A;  3G1J A;  3CCQ Q;  2M16 A;  2DEU A;  2NWM A;  3OB9 A;  5KE2 A;  2QEX Q;  3NGP A;  3SFM A;  4AFZ C;  1TSF A;  1U1S A;  4BY6 C;  1H3Z A;  2D8H A;  1Z9Z A;  2FYK A;  2VUB A;  2KRS A;  2KR3 A;  3PVQ A;  2CDT A;  1PM3 A;  4IUR A;  2DTI A;  2DX1 A;  3HPW A;  3SDZ A;  2RQT A;  3LWI A;  1N8R U;  1YCS B;  2HDA A;  3LWH A;  1I8F A;  2QAS A;  4F14 A;  2DL5 A;  1XQH A;  1IHV A;  2E1H A;  2MK5 A;  4D8K A;  3CCL A;  2DTH A;  1YIT A;  4ATO A;  3RUX A;  3OYJ A;  3EGX A;  5KYX A;  3O8V A;  2AHJ B;  4GY5 A;  3VYG A;  3BDU A;  4AFU C;  2H8H A;  2MF2 A;  3G6E Q;  1VQP Q;  4J6X A;  2CT3 A;  1YWO A;  4A54 A;  1UJ0 A;  2O88 A;  2J6F A;  1TXQ A;  2JTF A;  4K11 A;  3UPU A;  1IRX A;  5GAO m;  3JV3 A;  4CRI A;  4UC4 A;  1VQ8 T;  2D0N A;  4JRI A;  3M4G A;  2AZV A;  4F16 A;  4JZ4 A;  3PMI A;  1TH7 A;  3VS5 A;  1M1K R;  2YSQ A;  1W2B S;  1D1B A;  2ROT A;  3M4Y A;  4BB7 A;  1LOJ A;  3CC2 Q;  2K7A A;  1VQK A;  4O6J A;  2JM9 A;  2AIR B;  5KYX B;  3JB9 G;  4M75 F;  3C4S A;  1YI2 Q;  2DXB A;  3JRZ A;  2F5T X;  3AT1 B;  1FYN A;  3JB9 H;  3JCM h;  2ATC B;  4C5H A;  2EAY A;  3HRU A;  3RIR A;  3CD6 T;  2CH4 W;  2VGN A;  4DEY A;  1OPK A;  2DIQ A;  3M57 A;  1FX7 A;  1WJQ A;  1X6O A;  1AVZ C;  2FB7 A;  1Q82 C;  3OBY A;  3RKY A;  5A0L A;  3CCV A;  5GAM f;  3GF5 A;  3OS1 A;  1KC8 C;  2KYB A;  1J3T A;  4FYX B;  3LH0 A;  4XK8 E;  4BUG A;  3I35 A;  4OMQ A;  4E7H A;  3CCE T;  2DKG A;  6AT1 B; 
#chains in the Genus database with same CATH homology
 2KQW A;  1OYX A;  1WJS A;  5A0G A;  3GLX A;  2OTJ A;  3DB4 A;  4D6W A;  1K73 C;  2QEX T;  3JCM J;  3OQ5 A;  4BY6 B;  3CCV T;  2RHU A;  2DAQ A;  3X20 B;  1VQO T;  4KBM B;  2IVW A;  4M77 C;  3RMQ A;  5LJ3 e;  4FIB A;  1YJW T;  1ZHI A;  3CC4 T;  3M59 A;  1K9M U;  1KG1 A;  4MZP A;  4L5G A;  5IT9 E;  2PU9 B;  1QVF S;  2NLU A;  2K5L A;  2XDB A;  1S72 T;  3OS0 A;  2RH2 A;  2DXC A;  4E7K A;  5CR2 A;  3OS5 A;  3JB9 J;  2L3R A;  4N0A C;  5GMK m;  3I56 A;  2OTJ T;  2K5F A;  1NZ9 A;  3SWN B;  4B9W A;  1QP2 A;  4X9D A;  3TEE A;  4HT8 A;  3QPH A;  2EWN A;  3L2W A;  4N4I A;  2R5A A;  4LDU A;  2RK2 A;  5IN1 A;  4F7U B;  4OMF B;  3A8H B;  1K8A U;  4RG2 A;  5GAN j;  5GAO q;  2D9T A;  1W2B A;  2DO3 A;  2A7Y A;  2P0P A;  5CQY A;  4ZTJ A;  3A5Z B;  2LVM A;  4BI8 B;  2LT1 A;  5LJ5 j;  4E7J A;  1M5Q 1;  2DZC A;  2RD1 A;  4OP0 A;  4M7D B;  4M7A A;  4Y91 A;  3HRS A;  4J6W A;  3V7R A;  4E7I A;  2WSC E;  2YRV A;  4M78 B;  1Q86 U;  5FLX E;  3FDR A;  2M0O A;  3DB3 A;  1YHQ A;  1NE8 A;  2P0K A;  4IUU A;  4LDV A;  3URG A;  3M58 A;  1N9S A;  4C8Q C;  3HRT A;  2BUD A;  3PNW C;  3VUZ A;  3FIF A;  2HQX A;  3LYI A;  4PNO A;  3R6O A;  2ZCF B;  2PUO B;  3J80 E;  2KY9 A;  3MP8 A;  2K5I A;  1FXX A;  5KH6 A;  3LW5 E;  4JS5 A;  3M53 A;  1V29 B;  3CC2 A;  3OYN A;  1ZBX A;  2GFA A;  5LJ3 j;  2XU8 A;  1Y71 A;  2XID A;  2DPP B;  2LTO A;  1YI2 A;  2K2V A;  4J5Y A;  3RKW A;  2RHY A;  2LDM A;  5CO7 A;  4MMK A;  4XAX B;  4A4F A;  2QQA A;  4BI4 A;  3RMS A;  3QZ5 B;  4BE0 A;  1YHQ T;  3PFS A;  4OF1 A;  4Q5W A;  2K4Y A;  1YCY A;  3EFS A;  3VYH B;  2XDD A;  3JB9 D;  2LT4 A;  2KMT A;  3RKX A;  3ZEH A;  3CCR A;  5L8R E;  3NFC A;  4PJO A;  5GMK l;  4Y28 E;  1VIF A;  2CGH A;  3PT9 A;  3CCM A;  4B9X A;  1YBY A;  4MDW A;  3CC2 T;  2V8J A;  3PGG A;  4XQ3 A;  2G3R A;  4M75 C;  4PKC C;  3S3M A;  2PUK B;  2LX9 A;  3V7S A;  3M54 A;  2RI5 A;  3CBP A;  5CKD A;  2MI6 A;  5GAN g;  4XTZ A;  1YI2 T;  3JB9 I;  3ZBD A;  2DK3 A;  1RL2 A;  4M7A B;  1XOV A;  4C0D B;  3OYK A;  1NJI U;  1Q7Y U;  5LJ5 g;  3L2Z A;  4XU3 A;  3JB9 F;  1JB0 E;  4C92 B;  4XTY A;  3FLG A;  3QDR B;  3JCM f;  3PIP A;  3G71 A;  3CC7 A;  1M1F A;  4XTX A;  2MWP A;  3OBW A;  1QVP A;  3CCR T;  1M9S A;  3FJP A;  4N0A A;  5GAN 8;  4M78 G;  1QVF A;  1X01 A;  3CCM T;  3LLR A;  3MEU A;  4F7U E;  2H3J A;  2EQJ A;  2QQB A;  3E9F A;  5CKE A;  4NOY A;  1IZ6 A;  4II1 A;  3CXC S;  1VQM A;  3HFN A;  1NPP A;  4KT0 E;  4M7A C;  4OB2 B;  3JCM P;  2DZ9 A;  1VQN A;  3M56 A;  3A8G B;  1WNL A;  5LJ5 d;  1D3B A;  4J83 A;  3OYY A;  4A4E A;  1BKB A;  1JRI A;  2JOY A;  2RB6 A;  3BW1 A;  2XHC A;  4LDW A;  4ELZ C;  4BDZ A;  4M7D E;  5LJ3 g;  3G4S A;  3CCQ A;  2ZPE B;  1QVG S;  2RJC A;  2LQ8 A;  3G71 T;  3CC7 T;  4M78 E;  1BI0 A;  1HK9 A;  3TCJ A;  5M9O A;  2QQR A;  2QQS A;  1UGQ B;  3PTA A;  2FVU A;  2WSE E;  3SB2 A;  1UEB A;  3QUI A;  2WAC A;  2KDS A;  5I21 A;  3V7C A;  4J7F A;  5EG2 A;  3SD4 A;  3FRN A;  1I5L A;  4PJO B;  2EQU A;  1VQM T;  1DJ7 B;  5GAO l;  3RES A;  4DQ2 A;  1YJW A;  3KXT A;  2DXT A;  4RMO A;  3GIB A;  2LNV A;  1VQN T;  5A2Q E;  3OYE A;  4M77 B;  1M1G A;  5LJ3 d;  5GAM e;  3QYG B;  2PVD B;  5HY6 A;  5A0D A;  3OYF A;  4V2S A;  3G4S T;  3CCQ T;  2RA2 A;  3GNG A;  5GAN h;  4PJO C;  2RI3 A;  4JDS A;  3A8M B;  1BI1 A;  2XDP A;  3E9G A;  2HBP A;  3Q1J A;  5LJ5 h;  4HA8 A;  3S6W A;  5DM7 R;  4C92 G;  3NTI A;  1QP3 A;  3RER A;  4M7D C;  3LGL A;  5CVI A;  5GAO n;  2XG8 D;  3VKI A;  2E6Z A;  2L89 A;  1I4K 1;  1YJ9 A;  4XU0 A;  1BIA A;  3PMT A;  3UWN A;  2HNI A;  4ZN3 A;  3GP8 A;  3VV0 A;  2DXU A;  5KCO A;  1KHI A;  2K57 A;  4QW2 A;  2EFI A;  5DY9 A;  2E10 A;  3OSV A;  5FRO A;  4BAC A;  4HCC A;  2QI2 A;  4P5N A;  2RJD A;  4RCC A;  4M75 A;  3CCS A;  2C06 A;  3G6E A;  4M7A E;  3E19 A;  3HSB A;  1VQP A;  3EFR A;  4C92 E;  2I2L A;  3BY7 A;  1KQS A;  1B34 A;  3MO8 A;  4IUP A;  5LJ3 h;  3P8B B;  4RKU E;  1I81 A;  4DA4 A;  3V8L A;  4DOW A;  2RO0 A;  2XK0 A;  4IUV A;  2KSS A;  4ZTF A;  3L2V A;  1N6A A;  5IAY A;  2ZPF B;  3J7A F;  3HHT B;  2RJE A;  4C8Q B;  1YJ9 T;  4X34 A;  3JAM E;  2EJF A;  4LD6 A;  3WVD B;  4IUQ A;  3OYA A;  3CCJ A;  3OW2 S;  2ZPB B;  2PVG B;  2QDY B;  2DJZ A;  3HP9 A;  2EQK A;  3M55 A;  5FU6 C;  4M77 F;  4XTW A;  2MMP A;  3P8D A;  3CCS T;  3G6E T;  2XKO C;  1M1K C;  2JZ2 A;  3QZ9 B;  4WF2 A;  1VQP T;  4M77 G;  4C0G A;  5GAM j;  2E5Q A;  3CXC A;  4OGC A;  3DLL A;  1Q82 U;  2VXE A;  3FB9 A;  2GFU A;  3LGF A;  3WVE B;  4J7I A;  2DEQ A;  2CYZ B;  4A4H A;  5LL6 S;  2O4X A;  5D6W A;  4JLG A;  2RHI A;  4PJO E;  3OMG A;  3OYB A;  1M90 C;  1MGQ A;  3S3N A;  3MET A;  2KVQ G;  1KC8 U;  3CBO A;  2VGM A;  4C5G A;  3X28 B;  3OYH A;  3CCJ T;  1QVG A;  4VUB A;  2KK4 A;  4KUD K;  3ME9 A;  4PLI A;  4OGE A;  4X9C A;  4M77 E;  4ZGD B;  1PSF A;  3CPF A;  3MEW A;  4R55 A;  1G3Y A;  4M75 B;  1LJO A;  2RHZ A;  1XNI A;  1BYM A;  1VQ4 A;  4EMK A;  2E70 A;  2BKD N;  1G5V A;  3OYC A;  4M7D D;  2F69 A;  1Q81 C;  5CCA A;  4NS5 A;  2YLC A;  5GAO p;  1B34 B;  3HKS A;  1G3T A;  3JSC A;  1O75 A;  2EYQ A;  1XTD A;  3P8H A;  2VXF A;  4M78 D;  2RJF A;  5GMK h;  4FL6 A;  5GAN 2;  1VQL A;  4FM4 B;  3QHS A;  3UDC A;  5J26 A;  3T9N A;  4F7U F;  1KQS S;  2K3Y A;  4OB0 B;  3OS2 A;  4F7U G;  3JCM b;  4BE1 A;  3C95 A;  4O5V A;  3TRE A;  3LX7 A;  3A8O B;  3MHX A;  4PLL A;  2E64 A;  3NTK A;  4GLK A;  3PIO A;  3ASK A;  1PSE A;  1U1T A;  2LQK A;  3INZ A;  4A4K A;  4C8Q G;  4M7D F;  2R5M A;  3JCM d;  3C12 A;  1VQ4 T;  1FWZ A;  3QO3 A;  4M78 F;  3CMA A;  4M7D G;  4HCZ A;  5CIU A;  2DVE A;  2ZZD A;  3OYG A;  4BE2 A;  1G3W A;  2YLB A;  2R57 A;  1VQL T;  1JJ2 S;  3OMC A;  1JBM A;  5HKC A;  3JCM V;  5GAM g;  3I55 T;  4JRP A;  3BDL A;  5C0M A;  3AHU A;  4LDX A;  1G3S A;  2DIG A;  4N4G A;  4BDY A;  4FT4 A;  4NL3 A;  2QTX A;  1VQ6 A;  2B8A A;  2WSF E;  4C8Q E;  2VYT A;  3JCM e;  5D6Y A;  5FRM A;  2BIV A;  5GAN 7;  2ZGW A;  1QW1 A;  5I2S A;  2P0Q A;  1VQ7 A;  1WQ7 A;  2ZPG B;  1RI0 A;  4XTU A;  1BI3 A;  4LDY A;  1BIB A;  4ZN1 A;  1IRE B;  5HK3 A;  3CPW S;  2R58 A;  4C5E A;  4OVA A;  1N8R C;  1K8A C;  2MAM A;  4EMK B;  3OYL A;  4Z02 A;  5AYF A;  5GAM d;  4QVC A;  3L2Q A;  4JJN K;  3E1S A;  3KBG A;  4LD9 K;  4M7A D;  4L6V 5;  2CKK A;  2LCL A;  1LNX A;  2X4J A;  2E12 A;  1AHJ B;  4M75 G;  4FU6 A;  4ZGE B;  4IUT A;  4C92 D;  3CME A;  3TU4 K;  2E41 A;  1BI2 A;  2X4Y A;  3CEY A;  1KQ2 A;  3OW2 A;  3QXE B;  3X25 B;  4DOV A;  5FRN A;  3OYI A;  5GAN f;  1EIF A;  5FU7 B;  1VQ6 T;  4JRK A;  2LC4 A;  4NL2 A;  4JUV A;  4R56 A;  3ZFJ A;  4PL6 A;  1YIJ A;  1Q86 C;  2LRQ A;  4EMK C;  5LJ5 f;  1M4Z A;  2GQV A;  1UGP B;  4EMH A;  1VQ7 T;  2HAX A;  2OTL A;  4RCB A;  1WQW A;  2QA4 A;  3VJP A;  4QQG A;  3ER0 A;  2L8D A;  1P92 A;  3QG1 A;  3SWN A;  5GAN 6;  4M7A F;  4M75 E;  4XU1 A;  3OYD A;  4MZT A;  2JUF A;  5GAO r;  1VQ5 A;  2QXF A;  1MHN A;  2EJ9 A;  3N5B B;  4J6Y A;  3F70 A;  4L59 A;  4C92 F;  2YHT A;  5FU7 C;  5DLO A;  5J39 A;  3CCU A;  1U8R A;  4M7A G;  3CME T;  4FSX A;  3X24 B;  1W4S A;  2CZ0 B;  1KQ1 A;  2ZPH B;  2FL7 A;  3HFO A;  3KUF A;  1N9R A;  2DD5 A;  3FEO A;  1VUB A;  2L5Q A;  5GAM h;  4C0F A;  1YIJ T;  4PJO D;  2DTO A;  1D3B B;  2V8I A;  1Y96 A;  5LJ3 f;  2X4W A;  4N4H A;  5CQX A;  4OB1 B;  2HQE A;  3GOX A;  2QA4 T;  4M78 A;  5CAI A;  3M9Q A;  2EQM A;  2V8K A;  4ZGJ B;  4M77 D;  3UT1 A;  2JN0 A;  2JTM A;  3OYM A;  1NPR A;  1VQ5 T;  2OTL T;  3H8Z A;  5FU6 B;  4FT2 A;  1HXD A;  4EDU A;  3CCU T;  1UGS B;  3L1A A;  4JLI A;  4YTL A;  2E65 A;  2M16 A;  4BI3 A;  2K3X A;  1M8V A;  5CK9 A;  3OB9 A;  5KE2 A;  3JCM X;  4IKF A;  4PJO F;  4CI0 C;  4A53 A;  3SFM A;  5CKB A;  3V8K A;  1NJI C;  3CMA T;  4PJO G;  1Q7Y C;  1Y07 A;  3QYH B;  1U1S A;  1H3Z A;  4BY6 C;  3L2R A;  2HD0 A;  2EKO A;  2FYK A;  1R8O B;  5KCH A;  2D6F A;  4JS4 A;  2M9U A;  2VUB A;  4XTV A;  1JJ2 A;  1OZ3 A;  3EAE A;  1UB4 A;  4IUR A;  2DTI A;  2P4T A;  3MP6 A;  4ME7 A;  3HPW A;  3SDZ A;  3LWI A;  1N8R U;  3CBM A;  4M7D A;  4XU2 A;  3LWH A;  5C6S A;  3JCM Q;  1I8F A;  1ZQ1 A;  1OI1 A;  2D0Q B;  2EJG A;  2OAU A;  5I2M A;  2ZPI B;  1XQH A;  3SWN C;  4HCB A;  4ELY C;  3CPW A;  4HT9 A;  4KUI A;  4C0Z A;  4C5I A;  2E1H A;  1Y96 B;  5GAN 3;  1VIE A;  2CZ7 B;  2PQW A;  3OSS C;  5DLQ E;  3I56 T;  4C8Q D;  4BD3 A;  2RK1 A;  4C92 A;  3H6Z A;  3CCL A;  2DTH A;  3L2U A;  1YIT A;  3RUX A;  3OYJ A;  3WXM B;  4A4G A;  4ATO A;  1GXI E;  2VV5 A;  3MEV A;  3O8V A;  2AHJ B;  1VQ8 A;  4GY5 A;  2VC8 A;  3VYG A;  3JCM g;  3QSU A;  3C94 A;  3JCM W;  3BDU A;  5GAN 5;  4QVD A;  2MF2 A;  3I55 A;  1KD1 C;  3DKM A;  1N27 A;  2RM4 A;  4J6X A;  4JRQ A;  1SSF A;  5GMK e;  3QBY A;  3G7Z A;  3QJ6 A;  4M78 C;  4A54 A;  2E6N A;  4OB3 B;  1WJR A;  4C8Q F;  2JTF A;  1VQ9 A;  4EMG A;  3UPU A;  3MP1 A;  3HL8 A;  2EIF A;  3MEA A;  3CCL T;  5GAO m;  1YIT T;  1H64 1;  4CRI A;  3GPL A;  4UC4 A;  1VQ8 T;  1UGR B;  2XIC A;  4JRI A;  1K9M C;  3S3O A;  3M4G A;  4M75 D;  2LCC A;  2QQ9 A;  2XD0 A;  2O4X B;  3PMI A;  3OA6 A;  1TH7 A;  1WPY A;  4MML A;  2GF7 A;  3QII A;  4QQ6 A;  1YJN A;  4M77 A;  3L42 A;  1VQ9 T;  1W2B S;  2JVV A;  3NTH A;  3CD6 A;  5CKF A;  5J3B A;  3M4Y A;  3J81 E;  4BB7 A;  1O9S A;  1LOJ A;  3VUB A;  5CKH A;  2Y90 A;  3V8J A;  2KAF A;  1VQK A;  4O6J A;  1K73 U;  2CZ6 B;  3JB9 G;  4M75 F;  3C4S A;  3VU3 C;  2DXB A;  2PVO B;  3JRZ A;  3GNF B;  2F5T X;  1M1K U;  4RG8 A;  3BFM A;  4TVR A;  2X4X A;  4MZM A;  5GAN d;  3JB9 H;  4E47 A;  4EPC A;  3JCM h;  2XI9 A;  2EAY A;  4C5H A;  1X75 C;  2A3L A;  4C0D C;  1Y7X A;  2Y4X A;  5HK0 A;  4KUL A;  3HRU A;  3OY9 A;  4C92 C;  1YJN T;  3DLM A;  2JNG A;  2X35 A;  3RIR A;  5GMK j;  2VGN A;  1M90 U;  3CCE A;  3QJY A;  4QVZ A;  3CD6 T;  4MDX A;  2IG0 A;  2MWO A;  5GMK i;  2DIQ A;  2O01 E;  2M1H A;  1KHC A;  1FX7 A;  1WJQ A;  1X6O A;  2CZ1 B;  2FB7 A;  3M57 A;  3OBY A;  3JCM c;  1Q82 C;  1VQK T;  2QEX A;  3RKY A;  3X26 B;  2GCX A;  2RHX A;  2FHD A;  5GAN e;  5GAM f;  5A0L A;  3CCV A;  2F5K A;  5D6X A;  1OZ2 A;  4F7U A;  4E7L A;  3GF5 A;  3OS1 A;  2Y4Y A;  1VQO A;  3M5A A;  1KC8 C;  5LJ5 e;  2RI2 A;  4QQD A;  1Q81 U;  3CC4 A;  1WGS A;  5KE3 A;  4C8Q A;  3LH0 A;  3MCA B;  4XK8 E;  4BUG A;  1KD1 U;  2CS7 A;  4J8O A;  3FC3 A;  4E7H A;  2DD4 A;  2DKG A;  3A8L B;  5GAN 4;  3CCE T;  4HKE A;  3QKJ A;  1S72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...