2KXDA

The structure of sh3-f2
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
73
structure length
73
Chain Sequence
MGAPPLPPYSAGGREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDSGTGKELVLALYDYQEKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 11-mer peptide, SH3 domain of Spectrin alpha chain
publication title NMR structure and dynamics of the chimeric protein SH3-F2
pubmed doi rcsb
source organism Synthetic, gallus gallus
molecule tags Signaling protein
total genus 6
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2010-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2kxdA00
5HCKA 1UJYA 2ABLA 2EGAA 1A0NB 1U06A 1Y0MA 3PVLA 2KEAA 4RTTA 3EHQA 2EYZA 1GCQA 1NEBA 4RTUA 4OMPA 2M51A 2LNHB 1WI7A 2A37A 1UUEA 2HDAA 2BZXA 1PHTA 3SHWA 4AFZC 2DNUA 2J6FA 3VS0A 2K3BA 1HD3A 3UF4A 2SEMA 2EVRA 3EG3A 4J9EA 4Z8AA 4DEYA 4J9BA 1J3TA 2ECZA 3M0QA 3VS4A 4OMQA 2DILA 2O31A 2KRMA 4K11A 2EGCA 1GFCA 2EKHA 1W6XA 1SSHA 2SRCA 2FPEA 2RQUA 2HCKA 2GBQA 2EPDA 1PRMC 3VRYA 1NYFA 1S1NA 2L3PA 1QKWA 1K0XA 1WXUA 3UA6A 1FMKA 2AKKA 1X6BA 2EYYA 2X3WD 3PVQA 3I35A 1LCKA 3TVTA 2RMOA 4IIMA 1I0CA 1AWOA 3VS2A 5IHIA 2K79A 1OOTA 1WLPB 3GBQA 1G2BA 3M0TA 4F16A 2DJQA 5FW9A 1TG0A 3THKA 2RQRA 2LCSA 4R0KA 2F2VA 1UHCA 2KXDA 4RTWA 4CC2A 2FO0A 2PTKA 1KFZA 1ZSGA 2C0TA 1KJWA 2D0NA 5I11A 1AZEA 2DF6A 2DBMA 3VS5A 1WX6A 2KBTA 2D8JA 1AVZC 2DMOA 2EYXA 2M0YA 2ENMA 1RLQC 4ZNXA 2O9SA 1MUZA 2DVJA 3TSWA 4AG1C 1MV3A 1WXTA 2MCNA 2CUDA 1G83A 2B86A 1BBZA 1ZUUA 1M8MA 2MOXA 4CC3A 4OMOA 1H8KA 1OV3A 2OI3A 2VKNA 4HVUA 2FRWA 2ROTA 2DM1A 1E6HA 1JO8A 1ZUKA 2DRKA 4LUDA 4HVWA 1W1FA 2QDLA 3M0PA 3UA7A 2F2XA 2EBPA 1OEBA 4ESRA 2OJ2A 4JJCA 2FG0A 5GJWB 1GBRA 1ZUYA 3JV3A 2KXCA 2I0NA 5EC7A 3LH5A 4J9DA 4LNPA 3ULRB 1B07A 1SHFA 5IXBA 3QWYA 2DL8A 4J9GA 1ZBJA 1Y57A 2JTEA 2KE9A 2W10A 4RTVA 3VS6A 1RLPC 3H0HA 1UHFA 4CC4B 2O9VA 1QLYA 1YNZA 3EG0A 3H0IA 2CREA 1JQQA 1X6GA 1SRLA 3H41A 2DLPA 2RF0A 2EW3A 1WFWA 2V1RA 2VWFA 1TUDA 3RNJA 2J7IA 2JMAA 1NYGA 1YN8A 1GL5A 4D8KA 2VVKA 2C0IA 1XOVA 1AD5A 4RTXA 1GFDA 2BZ8A 4J9FA 2XMFA 4QT7A 1AWWA 2FPDA 2CDTA 5IHKA 1UTIA 3FJ5A 4RTYA 1TUCA 1I1JA 2H8HA 2FEIA 2NUZA 1K0SA 1W70A 1E6GA 1Z9ZA 2CH4W 1BU1A 2KT1A 1N5ZA 4A63B 4AG2C 2DL4A 1CSKA 2JXBA 1QKXA 2K2MA 3VS1A 2ED0A 1PKTA 5IXFA 1VYVA 2L2PA 2EGEA 2YUPA 1M3AA 1BB9A 3PE0A 2GTJA 1HJDA 1CKAA 2DRMA 2AKLA 1NG2A 4JZ3A 1CKBA 2W0ZA 2YT6A 2JW4A 2L0AA 2DL3A 3A98A 2KRNA 2KGTA 2DYBA 2ESWA 2LMJA 1QWFA 2J06A 4FSSA 2A36A 4OMNA 3EHRA 2CT4A 3U23A 1JU5C 4HVVA 1SPKA 1KSWA 2J05A 1M27C 1GCPA 2ROLA 2KYMA 2BTTA 2DE0X 1VYTA 1JEGA 2K9GA 2LJ0A 3VS3A 1ABQA 1UJ0A 1VYUA 4ORZA 4Y92A 2CT3A 2YUOA 3C0CA 1PWTA 1WA7A 4M4ZA 2LX7A 4WCIA 2LQNA 1FYNA 1X2KA 2D1XA 1B3QA 1AWXA 2C0OA 2MIOA 2KRSA 2ED1A 3M0RA 2NWMA 3RBBB 2KR3A 5FWCA 3I9QA 1WYXA 1JXMA 1WDXA 1H92A 3QWXX 2V1QA 3EG2A 2EYWA 2KYBA 1ZLMA 5ECAA 2G6FX 1ABOA 2P4RA 1QWEA 2FRYA 4RUGA 3IQLA 2KROA 5GJVB 2HSPA 2JS0A 1QCFA 2K7AA 1VA7A 2BZYA 1YWOA 2LJ3A 1K1ZA 3M0SA 1WIEA 3ZL7C 1AOJA 4IIOA 2O88A 2AZSA 1ZX6A 1SEMA 4AFQC 2E5KA 4GLMA 1U5SA 2YSQA 1X69A 4EIKA 1NLOC 1X43A 1T3SA 2LJ1A 2PNIA 5FWBA 4F14A 1IO6A 1JXOA 1MV0B 2YDLA 4LUEA 1K76A 2RQVA 4GBQA 5I22A 2GNCA 1E7OA 1GBQA 5L23A 1AZGB 1AWJA 1H3HA 3H0FA 1NM7A 4X1VA 4J9IA 1UFFA 2RN8A 2OAWA 2JS2A 4JPBW 1BK2A 2LP5A 2LZ6B 4OMMA 2IIMA 1M3CA 3REBB 3NMZC 2L3SA 1PNJA 3CQTA 1K9AA 3UATA 1V1CA 5IH2A 1T3LA 2L3QA 1U3OA 3I5RA 2CSQA 1GCQC 2DA9A 1YP5A 2GGRA 4CC7A 1K4US 3M0UA 2K6DA 1EFNA 4JJBA 4AFUC 2CSIA 4JJDA 2LQWA 3VS7A 4HXJA 1T0JA 1GRIA 2KNBB 4LN2A 1UE9A 2X3XD 2YUQA 2RQTA 4J9HA 1UECA 4AFSC 1SHGA 2RNAA 4F17A 2A28A 4J9CA 2EQIA 2AZVA 3O5ZA 4Z89A 1UG1A 1T0HA 1M30A 1AEYA 2F2WA 2HEQA 1I07A 4DEXA 2DX1A 2HBWA 1PKSA 1NLPC 2RPNA 4E6RA 3NGPA 1WXBA 2DL7A 4OMLA 4LE9A 3VRZA 2CUBA 2DBKA 1X2QA 1YCSB 3REAB 1M3BA 1YWPA 4KRTA 3TSZA 1RI9A 2A08A 2GTOA 1PRLC 5IHNA 1KIKA 2JT4A 2KT8A 3NPFA 4JZ4A 1HSQA 2PZ1A 1X27A 2CH4A 1ARKA 4HCKA 2JM9A 3I5SA 2D8HA 3R6NA 2YUNA 2J6KA 1UGVA 1RUWA 2FPFA 2RQWA 4Z88A 1OPKA 2GQIA 1NEGA 1UDLA 2JMCA 2JM8A 1SRMA 1OPLA 3EGUA 2O2OA 2AK5A 2DL5A 3KFVA 4RTZA 3SEMA 3EG1A 1Z9QA 3NHNA 4D8DA 2J6OA
chains in the Genus database with same CATH superfamily
1IHWA 3GP8A 1N9SA 5I2SA 1JB0E 5GAMh 3CMAQ 2EGAA 2NYSA 1U06A 3PVLA 2QK0A 5KYWB 4M77D 4RTTA 4PJOC 2EYZA 4C92B 1WJSA 5GAOl 5A0GA 1NEBA 2EQJA 1NJIU 1D3BB 1NJIR 2EAYA 3NFCA 1WHMA 4JLGA 2BUDA 2A37A 2COWA 3PGGA 2HDAA 3P8DA 2E3HA 3SHWA 4JRQA 2QAZA 4AFZC 2RD1A 2ZCFB 2J6FA 1HD3A 3UF4A 4JJNK 4DEYA 1YITT 4J9BA 1J3TA 2ECZA 3G6EA 1IREB 1VQ9Q 3QPHA 1BIAA 3TCJA 4K11A 3MEWA 4JRKA 2RQUA 2LCCA 2FB7A 1M1KU 3VRYA 1O9SA 5LL6S 1VQMQ 1S1NA 5KE2A 3SWNB 2HKQB 4DOWA 1QKWA 1K0XA 3PNWC 3UA6A 1JRIA 3D7SB 1FMKA 3DLLA 1B34A 3J81E 4FL6A 1OZ2A 1LCKA 2QDYB 1MMAA 4IIMA 4QKUA 2OTLT 2VASA 4C92G 3CCLT 2CKKA 4F04B 1Q81U 5GAN7 1OOTA 4MMKA 3HTRA 3M0TA 2DJQA 4F7UF 1TG0A 1GXIE 3TQ7P 1TU0B 4X9DA 3CCUQ 2RJEA 1QVGP 4CC2A 3PIPA 2PTKA 1ZSGA 3M5AA 1PCXA 1KJWA 1AZEA 2KSSA 4C8QE 3QG1A 1AT1B 2VV5A 3T9NA 4DBHA 1VQOQ 4OB2B 1X01A 2M0YA 4ZNXA 3CCSA 1VQOT 1WXTA 4C8QA 4KGXB 4M78E 1M1GA 2E1HA 1E6HA 1JO8A 1JBMA 2DRKA 4LUDA 3HL8A 3CC7T 1R77A 3RIRA 1W1FA 2DVEA 2F69A 5AYFA 3CCVA 4XQ3A 1K73C 4R55A 4M78A 2OJ2A 1GBRA 2DAQA 5EC7A 3LH5A 4FYYB 3MP1A 4LNPA 2RI5A 2D0QB 3OA6A 4XTZA 3QWYA 2M9UA 5KYUA 4BE1A 3M4GA 3VS6A 3CC2T 5A0DA 3EGXA 3FDRA 1QP2A 2ZGWA 1N8RR 3RKWA 1BCMA 2K4YA 1N8RC 1QW1A 1M2OA 4IURA 4XTWA 1UGSB 2DLPA 3A5ZB 5LJ5j 3LLRA 1D09B 4D8KA 2C0IA 1XOVA 3MPUB 1AD5A 4RTXA 4J9FA 2XMFA 3FLGA 1AWWA 2FPDA 4ANJA 3JB9F 1XQHA 4LDVA 3FJ5A 3LWHA 1DJ7B 4F7UB 2FEIA 4C92D 1D1BA 3URGA 5FU7C 2LCLA 2VGNA 2DO3A 1JJ2P 1VQKT 1QKXA 2DTOA 3BE3A 2Y4YA 1XJWB 3QIIA 4HA8A 1Q82C 5IXFA 2L2PA 1QVFA 2YUPA 1YIJT 1BCOA 1FMVA 2QXFA 4J6YA 2OTJT 3HFOA 2FYKA 4Y28E 2GTJA 2AKLA 4JZ3A 3G6EQ 1YFNA 3CXCA 4A4HA 4ZN1A 4DOVA 4JS5A 3X24B 3A98A 2KRNA 2FVUA 1VQ4A 5LJ3e 2ESWA 5GAOr 2J06A 1RAHB 2A36A 4OMNA 3CD6T 4OB3B 4PJOA 1WPYA 2CT4A 3U23A 4M7AG 1JU5C 4HVVA 5CO7A 4B6MA 3QXEB 3S3MA 4M7DB 1KSWA 1PSEA 3VS3A 2KDSA 2E12A 3JCMh 2CT3A 3OS1A 3C0CA 3CCET 1PWTA 1OX8A 3G71A 1NE8A 3KXTA 4WCIA 3CCRA 1TUGB 1VQNA 2D9TA 1B3QA 3G4SQ 1AWXA 4BE2A 2KRSA 2ED1A 3EG9B 3HSBA 2KMTA 3G4ST 2VGMA 3KBGA 2K2VA 3OYHA 2V1QA 4M75C 2WSEE 3CCSQ 2P4RA 4M75F 1MMGA 1FXXA 1QWEA 2FRYA 5GAN5 5CKEA 1W2BA 2KROA 1RAAB 2XICA 2HSPA 1QCFA 3EH2A 4LD6A 1NZ9A 2LJ3A 1HK9A 3M0SA 1WIEA 4MDWA 1C0MA 4M7DG 3RERA 4IIOA 2QQRA 3PMIA 1KQSP 2O88A 3EH1A 4RG2A 2E5KA 3RUXA 2P0QA 4GLMA 3V8KA 2XDPA 1X69A 3PMTA 4PLLA 4QVZA 5CK9A 2PNIA 1MV0B 1K76A 2AIRB 2MYSA 3OYFA 1FX7A 5LJ3g 4C0DC 1Q7YR 3VJPA 1VUBA 2JS2A 5GAOm 4JPBW 4ELYC 2LP5A 2LZ6B 3E1SA 2XG8D 3REBB 1XNIA 2GFUA 2P0PA 5HK0A 2XI9A 1VQ6A 1I4K1 3N5BB 3RKXA 1TTHB 4ZGDB 4BD3A 5LJ5h 3OYGA 3CPWS 5GANg 3I5RA 2CSQA 3FRNA 2E65A 3FC3A 2F5TX 3QUIA 3E9FA 2NUTA 1EFNA 2P4TA 2CSIA 4JJDA 2FZGB 1T0JA 1M5Q1 2KNBB 1UE9A 1MMNA 2RQTA 4CRIA 3QKJA 2NUPB 1UECA 2BKDN 4AFSC 1PC0A 2X51A 4F17A 2HQHA 4J9CA 2P0KA 4KUIA 3BDUA 4PJNA 1Y07A 3OMCA 9ATCB 1UG1A 1T0HA 2HL3A 5GAOp 4E7KA 5CKDA 1I07A 4TVRA 1PKSA 2RA2A 4MDXA 5LJ5f 2A3LA 2DL7A 2LT4A 4LE9A 5GAMg 3CC4A 1M4ZA 3I56T 1YCSB 2HBPA 1BIBA 3REAB 1RI9A 5IHNA 3FEOA 5HY6A 2OAUA 2QEXA 2JT4A 4Q5WA 1OULA 3NPFA 2H3EB 3OYNA 1X27A 3S6WA 2QGFB 1VQ4Q 4XU0A 3R6NA 2J6KA 4C0GA 1X75C 1Q86U 2XDDA 2FPFA 4Z88A 4J6XA 4J8OA 4WF2A 4M7DD 2JMCA 5KYNA 2EWNA 3EGUA 2AK5A 1UGQB 4N4HA 4RTZA 1YI2T 1KHCA 1NPRA 4FW2A 3L2RA 2J6OA 4OGEA 3MCAB 4BY6B 3X20B 1M90U 2RO0A 1UGPB 2HKNA 4EDUA 4IUVA 3M53A 3C12A 1BI0A 1KC8C 2LQKA 4PJLA 4RTUA 4C8QC 2M51A 1YHQQ 2KI7A 4C8QF 1VQNQ 1PHTA 1K8AU 1AHJB 3VS0A 2FZCB 3AHUA 2AT1B 2EVRA 2SEMA 3FIFA 1MGQA 3MO8A 1QVPA 2OTLA 1VOMA 3VS4A 2EYQA 2DXUA 1IB8A 1BI1A 2O31A 1R0CB 2ZPHB 1W6XA 1SSHA 3GNGA 3EFSA 5FU6C 4M78F 1TXQA 3OSSC 2HCKA 3PIOA 2EPDA 4JUVA 3DB3A 1NYFA 2L3PA 1YJ9A 2YRCA 2HQXA 2AKKA 1BYMA 2DTHA 1QP3A 2HNIA 3V7CA 2B8AA 4FM4B 4L6V5 1YJNA 1I0CA 1AWOA 3QHSA 2K79A 3GBQA 2EQMA 5FW9A 4M75A 3BFMA 5HKCA 3THKA 2RQRA 2KXDA 1UHCA 4UC4A 3JCMW 2FO0A 4M77E 1KFZA 1G8XA 2LDMA 2D0NA 5GAN6 3ZFJA 4PJMA 5CR2A 2KBTA 1AVZC 2DMOA 4BACA 4HT8A 1RLQC 2EJ9A 2MK5A 1MUZA 3TSWA 5DLOA 2PVDB 1MV3A 2K5IA 1G83A 2B86A 2G3RA 1HYOA 2ZZDA 1VQ6Q 1ZUUA 1VQLQ 2MOXA 4OMOA 4OB1B 2RH2A 1VQLT 4KBMB 2MMPA 5D7UA 3CC2A 3OYYA 3LX7A 4QW2A 3RKYA 2CP6A 2O4XA 2QDLA 3M0PA 3CCJA 5AT1B 4C5EA 3WVEB 1OZ3A 1ZUYA 1MHNA 2PQWA 3GF5A 3L2UA 2QI2A 2I0NA 2X4XA 1SHFA 1M2VB 5GANf 1QCOA 4FT2A 2QG9B 4P5NA 4DBFA 4J9GA 1ZBJA 2JTEA 3M56A 2KE9A 4C5HA 1RLPC 5HK3A 1WHGA 3CMAT 1MMDA 2RK1A 3CC4Q 1HXDA 4PJOF 3J7AF 4CC4B 1NJIC 3OYDA 3H0IA 4M78B 3X26B 3OS0A 4E7SA 3H41A 4MZMA 4GLKA 4J6WA 2QEXQ 3L2QA 1VQKA 3MJXA 4FIBA 2QGGA 3HRSA 2QA4A 5KYUB 3R6OA 2Y90A 1VQ9T 4A4KA 3EGXB 2BZ8A 4QT7A 5GAMf 5IHKA 3OS2A 1M1KR 1UTIA 1PD1A 1N9RA 4RTYA 3JCMQ 5KYYA 3L1AA 5GMKj 2WACA 1VQMT 2F5KA 1OU9A 1E6GA 1LJOA 1Z9ZA 4ATOA 1VQPA 1N27A 1SSFA 3G7ZA 2JTMA 1CSKA 1KHIA 1LVKA 2JXBA 2ED0A 1Q81R 1VQ5A 1VYVA 5LJ5e 3JCMg 2LX9A 1D0ZA 3CPWP 3A8MB 2CP3A 4O5VA 3MKDA 2CZ6B 3M59A 3JB9J 1I5LA 1I81A 2EJFA 2XK0A 3CCUT 2YT6A 3SDZA 2JW4A 3CCEA 2DJZA 4M7AC 4QQGA 2DYBA 2LMJA 1QVFS 4FSXA 2E6ZA 3JCMc 2FHDA 5C6SA 5I2MA 3EHRA 1YJ9Q 2KVQG 3CXCS 2BIVA 5J39A 1NPPA 3JCMJ 1WHJA 1VQ7A 1IXDA 2ROLA 2KYMA 2DE0X 1VYTA 2CP2A 2FZKB 1JEGA 2K9GA 2LJ0A 1ABQA 2YWWA 1TSFA 4ORZA 3JB9H 2JJ9A 3LGFA 2COZA 4ZTJA 3ME9A 1NBEB 4C92E 2K5LA 4EMKC 3A8LB 3QZ9B 3OBYA 4PJOB 2MPXC 4RG8A 4A54A 2C0OA 1LOJA 2KR3A 3I9QA 1WYXA 2CP0A 4FYXB 2E41A 2VC8A 4C92A 2EYWA 2KYBA 1D3BA 1PG5B 1K73U 4CI0C 1WJRA 3IQLA 3VKIA 4BE0A 5I21A 1YJWA 3OW2A 2CS7A 4DBRA 5KCHA 2C06A 4E7ZA 4N0AA 4LD9K 2DXBA 1ZSZC 2JUFA 1S72A 1W2BS 2R5MA 4B9WA 2YSQA 3H6ZA 2YHTA 5LJ5g 3OB9A 1R0BG 1PSFA 4JRPA 3SWNA 2LJ1A 5A2QE 4PJOG 4ZTFA 3M55A 3CCMA 4DBQA 4LDUA 2ZPGB 4JRIA 1AWJA 2RHXA 4J5YA 1H3HA 3H0FA 2CZ1B 1O75A 4V2SA 2CP7A 4M78D 1UFFA 2RN8A 2OAWA 3M9QA 2P84A 2HL5C 3RESA 3RR6A 1BK2A 4JLIA 4RMOA 1RAEB 2XU8A 4J7FA 2IIMA 3NMZC 1KD1U 1V1CA 3X28B 5IH2A 1T3LA 2F1LA 3VUBA 4OB0B 5GMKm 3BY7A 2DA9A 1YP5A 2QA4Q 1Q82U 3G6ET 3P8BB 4ME7A 5KYXA 2MWPA 4HXJA 2X3XD 2YUQA 4J9HA 5GMKh 2JZ2A 5GAOq 3QYHB 4F7UG 3FB9A 2EQIA 2AZVA 4N4IA 2VXEA 1AEYA 1D1AA 2RHYA 4QQDA 1VQPQ 4DEXA 2DX1A 2HBWA 3NGPA 5GANe 1WXBA 3OYAA 2O01E 1UGRB 1VQ5Q 4OMLA 2A0FB 3VRZA 1X2QA 3PFSA 2LVMA 4MMLA 1YWPA 4KRTA 3RDVA 2DIGA 2GTOA 4OVAA 1TOVA 1HSQA 2CH4A 3KUFA 4HCKA 3MP6A 3JCMb 2D8HA 4BI4A 4ELZC 1OPKA 1NEGA 1UDLA 2GQIA 1OPLA 4XK8E 2O2OA 3MEUA 3VUZA 2DK3A 3JCMf 3CCST 3SEMA 4D8DA 3NHNA 5GAMe 4M7AE 3ZBDA 3UT1A 4HCBA 1QCNA 5HCKA 1UJYA 3E9GA 1A0NB 1Y0MA 4PJOD 3JCMV 3EHQA 1VQ8A 4M77C 4ZGEB 3CCVQ 3C94A 5FU7B 4OMPA 3CCQA 4M7AA 1WI7A 2MWOA 2PUOB 3CCVT 3SFMA 2K3BA 5GMKi 3EG3A 4HKEA 3QZ5B 1WGSA 3M0QA 3MEAA 1OQKA 4OMQA 4A4FA 2DILA 2XDBA 3LGLA 1Q7YC 3S3NA 2KRMA 3JCMX 4X34A 1GFCA 2EKHA 2FPEA 4BUGA 2L5QA 1YJWQ 2OX7A 2ZAEA 5CQYA 3I55A 3X25B 4EMKA 2X4JA 4LDXA 4MZTA 3SD4A 1X6BA 4PFZA 3JB9G 2X3WD 3PVQA 4M7DE 3I35A 3CMEA 4IKFA 2JNGA 2RMOA 4RCBA 8AT1B 4EMGA 3A8OB 5CCAA 2DD4A 4BI3A 3VS2A 5IHIA 1RI0A 1G2BA 4RCCA 4F16A 4ZN3A 5EG2A 3OYIA 2E6NA 1R8OB 2F2VA 2QASA 4M7DA 2K57A 3CCMQ 4E7JA 2C0TA 3FJPA 1QVFP 6AT1B 5I11A 1G3WA 2DBMA 3VS5A 4BB7A 3LYIA 2RJDA 1WX6A 1BI3A 2D8JA 3CXCP 3OQ5A 1ZSZA 2EYXA 2CGHA 2HZYA 4OGCA 2O9SA 2DVJA 4M75B 2CUDA 3GNFB 1M8MA 3UWNA 4CC3A 1V76A 1OV3A 2FRWA 2ROTA 3C4SA 2DXTA 1U8RA 3OMGA 1K9MU 2E70A 1EX4A 4NL2A 4HVWA 2CZ7B 2F2XA 1Q86R 4OP0A 1VQ4T 2EBPA 4BDZA 1RAGB 5GJWB 1YITA 3L2WA 1B07A 4II1A 5IXBA 4PKCC 1WNLA 1M90R 2QQBA 1Y57A 2W10A 2O4XB 4C0DB 1RAIB 3G71Q 1UHFA 1KQ2A 3CCRQ 2CYZB 2RB6A 3EG0A 2CREA 3EFOA 4J7IA 4M75G 3G71T 1K8AR 2DFUA 1YHQT 2L3RA 3CCRT 1W2BP 2A7YA 1VQNT 2K3YA 2V8IA 2GCXA 5GAOn 2EW3A 4ZGJB 1G3TA 3OYEA 3CCLA 1KC8U 2JMAA 5GMKl 1YN8A 1GL5A 2VVKA 3V7RA 4XTVA 1RABB 3JB9D 3HP9A 1Y96A 1GFDA 3DKMA 3LH0A 2CDTA 2QQSA 4C5IA 3J80E 1I8FA 3WVDB 3INZA 5LJ3d 4C92C 1IHVA 3UDCA 1W70A 2RK2A 4C92F 2HD0A 7AT1B 3V8LA 1VQ8Q 4A63B 3ER0A 3HRTA 3V8JA 4AG2C 3VYGA 4QQ6A 4KT0E 1VQOA 2HSEB 3CCQQ 1QVGA 3VS1A 2E10A 2IG0A 3E2UA 1IZ6A 4N0AC 2EGEA 4EPCA 2CP5A 4X9CA 4LXCA 2VYTA 3PE0A 5KYYB 3HRUA 1CKAA 1C6VX 5GANd 3CC7A 1CKBA 1B34B 1WZOA 3GIBA 2L0AA 2DL3A 4A53A 1QWFA 3SWNC 4FSSA 4A4GA 1Y71A 3OYBA 3NTKA 1LNXA 1SKUB 5DM7R 4DA4A 1Q95G 3I55Q 1MNDA 4M77A 4FYVB 1OX9A 3JCMe 3CMEQ 1GCPA 1VQ6T 2Y4XA 5GAN4 2KK4A 4DQ2A 1UJ0A 1UB4A 1VYUA 4FW1A 2K5FA 4Y92A 2YUOA 5GAMd 3QSUA 4A4EA 4M4ZA 4C0ZA 2LQNA 1F1BB 5DLQE 1X2KA 2D1XA 4JDSA 3OBWA 2NWMA 4C8QB 5FWCA 1JXMA 3LWIA 1WDXA 3EG2A 4NS5A 3EGDA 4M75D 1ZLMA 4OF1A 2G6FX 5ECAA 1ABOA 4QVDA 1RAFB 4RUGA 1BI2A 3JAME 4R56A 2WSCE 1M1FA 2BZYA 1YWOA 3CC4T 5FU6B 5CIUA 1K1ZA 1AOJA 4XTYA 4B9XA 3O8VA 2KAFA 2AZSA 1ZX6A 4AFQC 2QEXT 3JCMP 2EFIA 2PVGB 2EIFA 1KQSS 3JB9I 3OW2S 2DXCA 1YIJA 5D6YA 1NLOC 1X43A 1T3SA 2K3XA 2OTJA 2DERA 2LNVA 5FWBA 1YITQ 4FT4A 1IO6A 2ZPFB 3M57A 4LUEA 2RJFA 4GBQA 5I22A 1M1KC 1E7OA 1GBQA 2V8JA 5L23A 3JSCA 2HAXA 4C8QG 1JJ2A 8ATCB 3META 1N6AA 4YTLA 3M4YA 1VIEA 4IUUA 4X1VA 4KH1B 3OY9A 3CD6A 5CKHA 4E7HA 1OI1A 2EQUA 1KG1A 2EQKA 5CKBA 1WHLA 2HQEA 4OMMA 1M3CA 2DTIA 2LT1A 4KULA 1Q81C 1Y7XA 1K9AA 3UATA 3NTHA 5FROA 4M78G 3V7SA 3A8GB 2PVOB 2L3QA 2OTLQ 1RACB 3HKSA 3CCLQ 1I5OB 4CC7A 1K4US 3M0UA 4M7AF 3L2ZA 4JJBA 1YCYA 2LQWA 3VS7A 1M9SA 1GRIA 4LN2A 2ZPBB 3G4SA 2ZPEB 1SHGA 2QQAA 2A28A 1YJ9T 3O5ZA 4LDWA 2XIDA 1FWZA 4Z89A 4E7IA 1M30A 2F2WA 2HEQA 2LQ8A 3F70A 1XTDA 4RKUE 2R57A 3H9NA 4E6RA 3MEVA 1YJNQ 1QQJA 2QQ9A 1IGQA 2BE9B 2DBKA 5IN1A 5KYXB 1YJNT 4EMHA 1C1AA 2A08A 3CC7Q 1M2VA 3AT1B 3RMQA 4JZ4A 3GOXA 2PZ1A 1ARKA 5C0MA 4NL3A 3I5SA 5KYWA 1UGVA 1RUWA 4E47A 1K73R 2R5AA 3MP8A 2JM8A 4M7DC 1SRMA 5CKFA 1WHHA 4M7DF 2DL5A 4JS4A 2ATCB 3KFVA 1SF9A 1KQSA 2COYA 2XD0A 3EG1A 1Z9QA 5KH6A 4VUBA 1MNEA 3HPWA 3CC2Q 4FCYA 2ABLA 4PFPA 2HMAA 3CPFA 2KEAA 3A8HB 2YLCA 3CCJQ 1GCQA 3CBMA 1VIFA 1N8RU 4C8QD 2ZPIB 4PK4A 4FU6A 1RL2A 2LNHB 4NOYA 2DYIA 3CCJT 1UUEA 3GLXA 2BZXA 5CVIA 2DNUA 1YBYA 4J9EA 4Z8AA 4Y91A 3S3OA 2DPPB 2CZ0B 2MI6A 3CBPA 3H8ZA 2EGCA 3QBYA 2SRCA 1B7TA 2GBQA 5J3BA 4M7AB 1WQ7A 1PRMC 4LDYA 2DD5A 1WXUA 1KD1R 3JRZA 2XKOC 1KD1C 2EYYA 2MAMA 1VQKQ 3TVTA 1YIJQ 1Q82R 3TREA 3I56A 3OSVA 2OTJQ 1OYXA 1G3SA 1WLPB 3JCMd 4E7LA 2QA4T 3ASKA 1RADB 2LCSA 4R0KA 1WQWA 4KGVB 4RTWA 4XTXA 4PJOE 4EMKB 1ACMB 4Z02A 2E5QA 2RHZA 2DZCA 2DF6A 3CD6Q 3QYGB 5J26A 3A1PA 3QDFA 2QTVA 2QYZA 2NUTB 4BI8B 2ENMA 5GAN3 1VQPT 3SB2A 4AG1C 1YI2A 2MCNA 1BBZA 2YLBA 4XTUA 1VQ5T 1G3YA 1H8KA 2OI3A 2VKNA 4HVUA 2DM1A 3C95A 3EFRA 1ZUKA 2YRVA 3CCEQ 1PM3A 4KH0B 3BDLA 2DIQA 4AMCA 3UA7A 3DLMA 1U1TA 1WJQA 1ZSZB 2JOYA 1OEBA 2RM4A 4ESRA 1YHQA 3VV0A 2LTOA 4JJCA 2FG0A 2VXFA 3JV3A 2KXCA 1D0YA 1VQ7Q 4J9DA 3ULRB 5FRMA 2X9HA 4F7UE 2MF2A 3MHXA 1VQ7T 4D6WA 2DL8A 4C0FA 4WTOB 4RTVA 4M77F 1P92A 3H0HA 5FRNA 2DEQA 2QTXA 2O9VA 1QLYA 1YNZA 5IAYA 1JQQA 1X6GA 1SRLA 4F7UA 3HFNA 2VB6A 5L8RE 4HT9A 2RF0A 3OW2P 4KUDK 1WFWA 2NLUA 2V1RA 1TUDA 2VWFA 2J7IA 4XAXB 3RNJA 3WXMB 1NYGA 5LJ5d 2GQVA 1D1CA 3QJ6A 3OYMA 2IPOB 2RI3A 2X35A 4HCCA 3P8HA 4BY6C 1TUCA 3EFOB 1LPLA 2H3JA 1I1JA 2H8HA 5LJ3j 3Q1JA 1YJWT 2NUZA 1K0SA 2RI2A 1IRXA 1D0XA 1Q7YU 1S72Q 1EIFA 2LRQA 1H641 2CH4W 1BKBA 1OU8A 1BU1A 2KT1A 1N5ZA 2JVVA 2DL4A 5D6XA 1S72T 1M8VA 2E3IA 2K2MA 2RHIA 1Y96B 1PKTA 3OYCA 4QVCA 4E2FB 2Z0WA 3G1JA 1M3AA 1BB9A 3GPLA 1VQLA 5GANj 1HJDA 2DRMA 1X6OA 1NG2A 2RHUA 5CAIA 2DETA 4BDYA 2W0ZA 1QVGS 3CCMT 4M7AD 2YRDA 2DKGA 1ZA2B 2GFAA 2KGTA 4O6JA 4PNOA 5KE3A 3CEYA 3EG9A 1SPKA 2M1HA 2J05A 1M27C 3UPUA 5GAN8 3VU3C 5M9OA 2BTTA 1K9MR 3CMAA 1FMWA 5GAMj 1K9MC 3I56Q 2V26A 3BW1A 1EZZB 4HCZA 2DZ9A 2DEUA 1WA7A 4L5GA 2LX7A 2FL7A 1Q86C 1FYNA 4M77B 3ZEHA 1TS9A 2JN0A 2BE7D 4FYWB 2MIOA 3M0RA 1ZQ1A 3RBBB 5KCOA 1H92A 3QWXX 4MZPA 2KQWA 1VQ9A 1M90C 3OYJA 1KQ1A 3L42A 1YI2Q 5GJVB 2JS0A 5D6WA 2K7AA 1VA7A 1VQMA 2X4WA 3ZL7C 1K8AC 3QDRB 2M16A 1SEMA 3PTAA 1U5SA 1W4SA 3EGDB 1KC8R 2YXYA 4XU3A 2KY9A 4EIKA 1PD0A 3NTIA 2E4HA 2JTFA 4IUPA 4F14A 1JXOA 2YDLA 2RQVA 3OYLA 4M77G 1TH7A 2GNCA 5GAN2 3CCUA 1AZGB 3M58A 1ZA1B 2L8DA 1U1SA 4OMFB 1NM7A 2LC4A 3CBOA 4J9IA 4J83A 5DY9A 4M78C 3CPWA 2V8KA 4GY5A 3QO3A 1VQ8T 5FLXE 1JJ2S 2VUBA 2L3SA 2IVWA 1PNJA 2PUKB 3CQTA 3CCQT 2NUPA 1SG5A 4XU1A 3M54A 4M75E 1U3OA 1GCQC 3EAEA 3TU4K 4IUQA 2L89A 3LW5E 2GGRA 2AHJB 4XU2A 2K6DA 2X4YA 1QMCA 4PJJA 4AFUC 5GMKe 3RMSA 2RJCA 2I2LA 3VYHB 5LJ3h 2GF7A 5A0LA 4IUTA 3TEEA 1V29B 2RNAA 1IGUA 3I55T 1ZBXA 2WSFE 4L59A 2M0OA 3OS5A 2M02A 2PU9B 1NLPC 2RPNA 3CMET 1TWBA 2R58A 2XHCA 1G5VA 2CUBA 5GANh 1WHKA 4C5GA 4N4GA 1M3BA 4PFOA 3TSZA 4PL6A 1ZHIA 1PRLC 1KIKA 3HHTB 4AT1B 1UEBA 2KT8A 5LJ3f 5IT9E 4KGZB 2EKOA 3DB4A 2JM9A 3L2VA 2YUNA 3E19A 3QJYA 2RQWA 3OYKA 2E64A 2D6FA 1KK7A 3PT9A 1H3ZA 5CQXA 2EJGA 4PLIA
chains in the Genus database with same CATH topology
5HCKA 1UJYA 2ABLA 2EGAA 1A0NB 1U06A 1Y0MA 3PVLA 2KEAA 4RTTA 3EHQA 2EYZA 1GCQA 1NEBA 4RTUA 4OMPA 2M51A 2LNHB 1WI7A 2A37A 1UUEA 2HDAA 2BZXA 1PHTA 3SHWA 4AFZC 2DNUA 2J6FA 3VS0A 2K3BA 1HD3A 3UF4A 2SEMA 2EVRA 3EG3A 4J9EA 4Z8AA 4DEYA 4J9BA 1J3TA 2ECZA 3M0QA 3VS4A 4OMQA 2DILA 2O31A 2KRMA 4K11A 2EGCA 1GFCA 2EKHA 1W6XA 1SSHA 2SRCA 2FPEA 2RQUA 2HCKA 2GBQA 2EPDA 1PRMC 3VRYA 1NYFA 1S1NA 2L3PA 1QKWA 1K0XA 1WXUA 3UA6A 1FMKA 2AKKA 1X6BA 2EYYA 2X3WD 3PVQA 3I35A 1LCKA 3TVTA 2RMOA 4IIMA 1I0CA 1AWOA 3VS2A 5IHIA 2K79A 1OOTA 1WLPB 3GBQA 1G2BA 3M0TA 4F16A 2DJQA 5FW9A 1TG0A 3THKA 2RQRA 2LCSA 4R0KA 2F2VA 1UHCA 2KXDA 4RTWA 4CC2A 2FO0A 2PTKA 1KFZA 1ZSGA 2C0TA 1KJWA 2D0NA 5I11A 1AZEA 2DF6A 2DBMA 3VS5A 1WX6A 2KBTA 2D8JA 1AVZC 2DMOA 2EYXA 2M0YA 2ENMA 1RLQC 4ZNXA 2O9SA 1MUZA 2DVJA 3TSWA 4AG1C 1MV3A 1WXTA 2MCNA 2CUDA 1G83A 2B86A 1BBZA 1ZUUA 1M8MA 2MOXA 4CC3A 4OMOA 1H8KA 1OV3A 2OI3A 2VKNA 4HVUA 2FRWA 2ROTA 2DM1A 1E6HA 1JO8A 1ZUKA 2DRKA 4LUDA 4HVWA 1W1FA 2QDLA 3M0PA 3UA7A 2F2XA 2EBPA 1OEBA 4ESRA 2OJ2A 4JJCA 2FG0A 5GJWB 1GBRA 1ZUYA 3JV3A 2KXCA 2I0NA 5EC7A 3LH5A 4J9DA 4LNPA 3ULRB 1B07A 1SHFA 5IXBA 3QWYA 2DL8A 4J9GA 1ZBJA 1Y57A 2JTEA 2KE9A 2W10A 4RTVA 3VS6A 1RLPC 3H0HA 1UHFA 4CC4B 2O9VA 1QLYA 1YNZA 3EG0A 3H0IA 2CREA 1JQQA 1X6GA 1SRLA 3H41A 2DLPA 2RF0A 2EW3A 1WFWA 2V1RA 2VWFA 1TUDA 3RNJA 2J7IA 2JMAA 1NYGA 1YN8A 1GL5A 4D8KA 2VVKA 2C0IA 1XOVA 1AD5A 4RTXA 1GFDA 2BZ8A 4J9FA 2XMFA 4QT7A 1AWWA 2FPDA 2CDTA 5IHKA 1UTIA 3FJ5A 4RTYA 1TUCA 1I1JA 2H8HA 2FEIA 2NUZA 1K0SA 1W70A 1E6GA 1Z9ZA 2CH4W 1BU1A 2KT1A 1N5ZA 4A63B 4AG2C 2DL4A 1CSKA 2JXBA 1QKXA 2K2MA 3VS1A 2ED0A 1PKTA 5IXFA 1VYVA 2L2PA 2EGEA 2YUPA 1M3AA 1BB9A 3PE0A 2GTJA 1HJDA 1CKAA 2DRMA 2AKLA 1NG2A 4JZ3A 1CKBA 2W0ZA 2YT6A 2JW4A 2L0AA 2DL3A 3A98A 2KRNA 2KGTA 2DYBA 2ESWA 2LMJA 1QWFA 2J06A 4FSSA 2A36A 4OMNA 3EHRA 2CT4A 3U23A 1JU5C 4HVVA 1SPKA 1KSWA 2J05A 1M27C 1GCPA 2ROLA 2KYMA 2BTTA 2DE0X 1VYTA 1JEGA 2K9GA 2LJ0A 3VS3A 1ABQA 1UJ0A 1VYUA 4ORZA 4Y92A 2CT3A 2YUOA 3C0CA 1PWTA 1WA7A 4M4ZA 2LX7A 4WCIA 2LQNA 1FYNA 1X2KA 2D1XA 1B3QA 1AWXA 2C0OA 2MIOA 2KRSA 2ED1A 3M0RA 2NWMA 3RBBB 2KR3A 5FWCA 3I9QA 1WYXA 1JXMA 1WDXA 1H92A 3QWXX 2V1QA 3EG2A 2EYWA 2KYBA 1ZLMA 5ECAA 2G6FX 1ABOA 2P4RA 1QWEA 2FRYA 4RUGA 3IQLA 2KROA 5GJVB 2HSPA 2JS0A 1QCFA 2K7AA 1VA7A 2BZYA 1YWOA 2LJ3A 1K1ZA 3M0SA 1WIEA 3ZL7C 1AOJA 4IIOA 2O88A 2AZSA 1ZX6A 1SEMA 4AFQC 2E5KA 4GLMA 1U5SA 2YSQA 1X69A 4EIKA 1NLOC 1X43A 1T3SA 2LJ1A 2PNIA 5FWBA 4F14A 1IO6A 1JXOA 1MV0B 2YDLA 4LUEA 1K76A 2RQVA 4GBQA 5I22A 2GNCA 1E7OA 1GBQA 5L23A 1AZGB 1AWJA 1H3HA 3H0FA 1NM7A 4X1VA 4J9IA 1UFFA 2RN8A 2OAWA 2JS2A 4JPBW 1BK2A 2LP5A 2LZ6B 4OMMA 2IIMA 1M3CA 3REBB 3NMZC 2L3SA 1PNJA 3CQTA 1K9AA 3UATA 1V1CA 5IH2A 1T3LA 2L3QA 1U3OA 3I5RA 2CSQA 1GCQC 2DA9A 1YP5A 2GGRA 4CC7A 1K4US 3M0UA 2K6DA 1EFNA 4JJBA 4AFUC 2CSIA 4JJDA 2LQWA 3VS7A 4HXJA 1T0JA 1GRIA 2KNBB 4LN2A 1UE9A 2X3XD 2YUQA 2RQTA 4J9HA 1UECA 4AFSC 1SHGA 2RNAA 4F17A 2A28A 4J9CA 2EQIA 2AZVA 3O5ZA 4Z89A 1UG1A 1T0HA 1M30A 1AEYA 2F2WA 2HEQA 1I07A 4DEXA 2DX1A 2HBWA 1PKSA 1NLPC 2RPNA 4E6RA 3NGPA 1WXBA 2DL7A 4OMLA 4LE9A 3VRZA 2CUBA 2DBKA 1X2QA 1YCSB 3REAB 1M3BA 1YWPA 4KRTA 3TSZA 1RI9A 2A08A 2GTOA 1PRLC 5IHNA 1KIKA 2JT4A 2KT8A 3NPFA 4JZ4A 1HSQA 2PZ1A 1X27A 2CH4A 1ARKA 4HCKA 2JM9A 3I5SA 2D8HA 3R6NA 2YUNA 2J6KA 1UGVA 1RUWA 2FPFA 2RQWA 4Z88A 1OPKA 2GQIA 1NEGA 1UDLA 2JMCA 2JM8A 1SRMA 1OPLA 3EGUA 2O2OA 2AK5A 2DL5A 3KFVA 4RTZA 3SEMA 3EG1A 1Z9QA 3NHNA 4D8DA 2J6OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HCK A;  1UJY A;  2ABL A;  2EGA A;  1A0N B;  1U06 A;  1Y0M A;  3PVL A;  2KEA A;  4RTT A;  3EHQ A;  2EYZ A;  1GCQ A;  1NEB A;  4RTU A;  4OMP A;  2M51 A;  2LNH B;  1WI7 A;  2A37 A;  1UUE A;  2HDA A;  2BZX A;  1PHT A;  3SHW A;  4AFZ C;  2DNU A;  2J6F A;  3VS0 A;  2K3B A;  1HD3 A;  3UF4 A;  2SEM A;  2EVR A;  3EG3 A;  4J9E A;  4Z8A A;  4DEY A;  4J9B A;  1J3T A;  2ECZ A;  3M0Q A;  3VS4 A;  4OMQ A;  2DIL A;  2O31 A;  2KRM A;  4K11 A;  2EGC A;  1GFC A;  2EKH A;  1W6X A;  1SSH A;  2SRC A;  2FPE A;  2RQU A;  2HCK A;  2GBQ A;  2EPD A;  1PRM C;  3VRY A;  1NYF A;  1S1N A;  2L3P A;  1QKW A;  1K0X A;  1WXU A;  3UA6 A;  1FMK A;  2AKK A;  1X6B A;  2EYY A;  2X3W D;  3PVQ A;  3I35 A;  1LCK A;  3TVT A;  2RMO A;  4IIM A;  1I0C A;  1AWO A;  3VS2 A;  5IHI A;  2K79 A;  1OOT A;  1WLP B;  3GBQ A;  1G2B A;  3M0T A;  4F16 A;  2DJQ A;  5FW9 A;  1TG0 A;  3THK A;  2RQR A;  2LCS A;  4R0K A;  2F2V A;  1UHC A;  2KXD A;  4RTW A;  4CC2 A;  2FO0 A;  2PTK A;  1KFZ A;  1ZSG A;  2C0T A;  1KJW A;  2D0N A;  5I11 A;  1AZE A;  2DF6 A;  2DBM A;  3VS5 A;  1WX6 A;  2KBT A;  2D8J A;  1AVZ C;  2DMO A;  2EYX A;  2M0Y A;  2ENM A;  1RLQ C;  4ZNX A;  2O9S A;  1MUZ A;  2DVJ A;  3TSW A;  4AG1 C;  1MV3 A;  1WXT A;  2MCN A;  2CUD A;  1G83 A;  2B86 A;  1BBZ A;  1ZUU A;  1M8M A;  2MOX A;  4CC3 A;  4OMO A;  1H8K A;  1OV3 A;  2OI3 A;  2VKN A;  4HVU A;  2FRW A;  2ROT A;  2DM1 A;  1E6H A;  1JO8 A;  1ZUK A;  2DRK A;  4LUD A;  4HVW A;  1W1F A;  2QDL A;  3M0P A;  3UA7 A;  2F2X A;  2EBP A;  1OEB A;  4ESR A;  2OJ2 A;  4JJC A;  2FG0 A;  5GJW B;  1GBR A;  1ZUY A;  3JV3 A;  2KXC A;  2I0N A;  5EC7 A;  3LH5 A;  4J9D A;  4LNP A;  3ULR B;  1B07 A;  1SHF A;  5IXB A;  3QWY A;  2DL8 A;  4J9G A;  1ZBJ A;  1Y57 A;  2JTE A;  2KE9 A;  2W10 A;  4RTV A;  3VS6 A;  1RLP C;  3H0H A;  1UHF A;  4CC4 B;  2O9V A;  1QLY A;  1YNZ A;  3EG0 A;  3H0I A;  2CRE A;  1JQQ A;  1X6G A;  1SRL A;  3H41 A;  2DLP A;  2RF0 A;  2EW3 A;  1WFW A;  2V1R A;  2VWF A;  1TUD A;  3RNJ A;  2J7I A;  2JMA A;  1NYG A;  1YN8 A;  1GL5 A;  4D8K A;  2VVK A;  2C0I A;  1XOV A;  1AD5 A;  4RTX A;  1GFD A;  2BZ8 A;  4J9F A;  2XMF A;  4QT7 A;  1AWW A;  2FPD A;  2CDT A;  5IHK A;  1UTI A;  3FJ5 A;  4RTY A;  1TUC A;  1I1J A;  2H8H A;  2FEI A;  2NUZ A;  1K0S A;  1W70 A;  1E6G A;  1Z9Z A;  2CH4 W;  1BU1 A;  2KT1 A;  1N5Z A;  4A63 B;  4AG2 C;  2DL4 A;  1CSK A;  2JXB A;  1QKX A;  2K2M A;  3VS1 A;  2ED0 A;  1PKT A;  5IXF A;  1VYV A;  2L2P A;  2EGE A;  2YUP A;  1M3A A;  1BB9 A;  3PE0 A;  2GTJ A;  1HJD A;  1CKA A;  2DRM A;  2AKL A;  1NG2 A;  4JZ3 A;  1CKB A;  2W0Z A;  2YT6 A;  2JW4 A;  2L0A A;  2DL3 A;  3A98 A;  2KRN A;  2KGT A;  2DYB A;  2ESW A;  2LMJ A;  1QWF A;  2J06 A;  4FSS A;  2A36 A;  4OMN A;  3EHR A;  2CT4 A;  3U23 A;  1JU5 C;  4HVV A;  1SPK A;  1KSW A;  2J05 A;  1M27 C;  1GCP A;  2ROL A;  2KYM A;  2BTT A;  2DE0 X;  1VYT A;  1JEG A;  2K9G A;  2LJ0 A;  3VS3 A;  1ABQ A;  1UJ0 A;  1VYU A;  4ORZ A;  4Y92 A;  2CT3 A;  2YUO A;  3C0C A;  1PWT A;  1WA7 A;  4M4Z A;  2LX7 A;  4WCI A;  2LQN A;  1FYN A;  1X2K A;  2D1X A;  1B3Q A;  1AWX A;  2C0O A;  2MIO A;  2KRS A;  2ED1 A;  3M0R A;  2NWM A;  3RBB B;  2KR3 A;  5FWC A;  3I9Q A;  1WYX A;  1JXM A;  1WDX A;  1H92 A;  3QWX X;  2V1Q A;  3EG2 A;  2EYW A;  2KYB A;  1ZLM A;  5ECA A;  2G6F X;  1ABO A;  2P4R A;  1QWE A;  2FRY A;  4RUG A;  3IQL A;  2KRO A;  5GJV B;  2HSP A;  2JS0 A;  1QCF A;  2K7A A;  1VA7 A;  2BZY A;  1YWO A;  2LJ3 A;  1K1Z A;  3M0S A;  1WIE A;  3ZL7 C;  1AOJ A;  4IIO A;  2O88 A;  2AZS A;  1ZX6 A;  1SEM A;  4AFQ C;  2E5K A;  4GLM A;  1U5S A;  2YSQ A;  1X69 A;  4EIK A;  1NLO C;  1X43 A;  1T3S A;  2LJ1 A;  2PNI A;  5FWB A;  4F14 A;  1IO6 A;  1JXO A;  1MV0 B;  2YDL A;  4LUE A;  1K76 A;  2RQV A;  4GBQ A;  5I22 A;  2GNC A;  1E7O A;  1GBQ A;  5L23 A;  1AZG B;  1AWJ A;  1H3H A;  3H0F A;  1NM7 A;  4X1V A;  4J9I A;  1UFF A;  2RN8 A;  2OAW A;  2JS2 A;  4JPB W;  1BK2 A;  2LP5 A;  2LZ6 B;  4OMM A;  2IIM A;  1M3C A;  3REB B;  3NMZ C;  2L3S A;  1PNJ A;  3CQT A;  1K9A A;  3UAT A;  1V1C A;  5IH2 A;  1T3L A;  2L3Q A;  1U3O A;  3I5R A;  2CSQ A;  1GCQ C;  2DA9 A;  1YP5 A;  2GGR A;  4CC7 A;  1K4U S;  3M0U A;  2K6D A;  1EFN A;  4JJB A;  4AFU C;  2CSI A;  4JJD A;  2LQW A;  3VS7 A;  4HXJ A;  1T0J A;  1GRI A;  2KNB B;  4LN2 A;  1UE9 A;  2X3X D;  2YUQ A;  2RQT A;  4J9H A;  1UEC A;  4AFS C;  1SHG A;  2RNA A;  4F17 A;  2A28 A;  4J9C A;  2EQI A;  2AZV A;  3O5Z A;  4Z89 A;  1UG1 A;  1T0H A;  1M30 A;  1AEY A;  2F2W A;  2HEQ A;  1I07 A;  4DEX A;  2DX1 A;  2HBW A;  1PKS A;  1NLP C;  2RPN A;  4E6R A;  3NGP A;  1WXB A;  2DL7 A;  4OML A;  4LE9 A;  3VRZ A;  2CUB A;  2DBK A;  1X2Q A;  1YCS B;  3REA B;  1M3B A;  1YWP A;  4KRT A;  3TSZ A;  1RI9 A;  2A08 A;  2GTO A;  1PRL C;  5IHN A;  1KIK A;  2JT4 A;  2KT8 A;  3NPF A;  4JZ4 A;  1HSQ A;  2PZ1 A;  1X27 A;  2CH4 A;  1ARK A;  4HCK A;  2JM9 A;  3I5S A;  2D8H A;  3R6N A;  2YUN A;  2J6K A;  1UGV A;  1RUW A;  2FPF A;  2RQW A;  4Z88 A;  1OPK A;  2GQI A;  1NEG A;  1UDL A;  2JMC A;  2JM8 A;  1SRM A;  1OPL A;  3EGU A;  2O2O A;  2AK5 A;  2DL5 A;  3KFV A;  4RTZ A;  3SEM A;  3EG1 A;  1Z9Q A;  3NHN A;  4D8D A;  2J6O A; 
#chains in the Genus database with same CATH topology
 1IHW A;  3GP8 A;  1N9S A;  5I2S A;  1JB0 E;  5GAM h;  3CMA Q;  2EGA A;  2NYS A;  1U06 A;  3PVL A;  2QK0 A;  5KYW B;  4M77 D;  4RTT A;  4PJO C;  2EYZ A;  4C92 B;  1WJS A;  5GAO l;  5A0G A;  1NEB A;  2EQJ A;  1NJI U;  1D3B B;  1NJI R;  2EAY A;  3NFC A;  1WHM A;  4JLG A;  2BUD A;  2A37 A;  2COW A;  3PGG A;  2HDA A;  3P8D A;  2E3H A;  3SHW A;  4JRQ A;  2QAZ A;  4AFZ C;  2RD1 A;  2ZCF B;  2J6F A;  1HD3 A;  3UF4 A;  4JJN K;  4DEY A;  1YIT T;  4J9B A;  1J3T A;  2ECZ A;  3G6E A;  1IRE B;  1VQ9 Q;  3QPH A;  1BIA A;  3TCJ A;  4K11 A;  3MEW A;  4JRK A;  2RQU A;  2LCC A;  2FB7 A;  1M1K U;  3VRY A;  1O9S A;  5LL6 S;  1VQM Q;  1S1N A;  5KE2 A;  3SWN B;  2HKQ B;  4DOW A;  1QKW A;  1K0X A;  3PNW C;  3UA6 A;  1JRI A;  3D7S B;  1FMK A;  3DLL A;  1B34 A;  3J81 E;  4FL6 A;  1OZ2 A;  1LCK A;  2QDY B;  1MMA A;  4IIM A;  4QKU A;  2OTL T;  2VAS A;  4C92 G;  3CCL T;  2CKK A;  4F04 B;  1Q81 U;  5GAN 7;  1OOT A;  4MMK A;  3HTR A;  3M0T A;  2DJQ A;  4F7U F;  1TG0 A;  1GXI E;  3TQ7 P;  1TU0 B;  4X9D A;  3CCU Q;  2RJE A;  1QVG P;  4CC2 A;  3PIP A;  2PTK A;  1ZSG A;  3M5A A;  1PCX A;  1KJW A;  1AZE A;  2KSS A;  4C8Q E;  3QG1 A;  1AT1 B;  2VV5 A;  3T9N A;  4DBH A;  1VQO Q;  4OB2 B;  1X01 A;  2M0Y A;  4ZNX A;  3CCS A;  1VQO T;  1WXT A;  4C8Q A;  4KGX B;  4M78 E;  1M1G A;  2E1H A;  1E6H A;  1JO8 A;  1JBM A;  2DRK A;  4LUD A;  3HL8 A;  3CC7 T;  1R77 A;  3RIR A;  1W1F A;  2DVE A;  2F69 A;  5AYF A;  3CCV A;  4XQ3 A;  1K73 C;  4R55 A;  4M78 A;  2OJ2 A;  1GBR A;  2DAQ A;  5EC7 A;  3LH5 A;  4FYY B;  3MP1 A;  4LNP A;  2RI5 A;  2D0Q B;  3OA6 A;  4XTZ A;  3QWY A;  2M9U A;  5KYU A;  4BE1 A;  3M4G A;  3VS6 A;  3CC2 T;  5A0D A;  3EGX A;  3FDR A;  1QP2 A;  2ZGW A;  1N8R R;  3RKW A;  1BCM A;  2K4Y A;  1N8R C;  1QW1 A;  1M2O A;  4IUR A;  4XTW A;  1UGS B;  2DLP A;  3A5Z B;  5LJ5 j;  3LLR A;  1D09 B;  4D8K A;  2C0I A;  1XOV A;  3MPU B;  1AD5 A;  4RTX A;  4J9F A;  2XMF A;  3FLG A;  1AWW A;  2FPD A;  4ANJ A;  3JB9 F;  1XQH A;  4LDV A;  3FJ5 A;  3LWH A;  1DJ7 B;  4F7U B;  2FEI A;  4C92 D;  1D1B A;  3URG A;  5FU7 C;  2LCL A;  2VGN A;  2DO3 A;  1JJ2 P;  1VQK T;  1QKX A;  2DTO A;  3BE3 A;  2Y4Y A;  1XJW B;  3QII A;  4HA8 A;  1Q82 C;  5IXF A;  2L2P A;  1QVF A;  2YUP A;  1YIJ T;  1BCO A;  1FMV A;  2QXF A;  4J6Y A;  2OTJ T;  3HFO A;  2FYK A;  4Y28 E;  2GTJ A;  2AKL A;  4JZ3 A;  3G6E Q;  1YFN A;  3CXC A;  4A4H A;  4ZN1 A;  4DOV A;  4JS5 A;  3X24 B;  3A98 A;  2KRN A;  2FVU A;  1VQ4 A;  5LJ3 e;  2ESW A;  5GAO r;  2J06 A;  1RAH B;  2A36 A;  4OMN A;  3CD6 T;  4OB3 B;  4PJO A;  1WPY A;  2CT4 A;  3U23 A;  4M7A G;  1JU5 C;  4HVV A;  5CO7 A;  4B6M A;  3QXE B;  3S3M A;  4M7D B;  1KSW A;  1PSE A;  3VS3 A;  2KDS A;  2E12 A;  3JCM h;  2CT3 A;  3OS1 A;  3C0C A;  3CCE T;  1PWT A;  1OX8 A;  3G71 A;  1NE8 A;  3KXT A;  4WCI A;  3CCR A;  1TUG B;  1VQN A;  2D9T A;  1B3Q A;  3G4S Q;  1AWX A;  4BE2 A;  2KRS A;  2ED1 A;  3EG9 B;  3HSB A;  2KMT A;  3G4S T;  2VGM A;  3KBG A;  2K2V A;  3OYH A;  2V1Q A;  4M75 C;  2WSE E;  3CCS Q;  2P4R A;  4M75 F;  1MMG A;  1FXX A;  1QWE A;  2FRY A;  5GAN 5;  5CKE A;  1W2B A;  2KRO A;  1RAA B;  2XIC A;  2HSP A;  1QCF A;  3EH2 A;  4LD6 A;  1NZ9 A;  2LJ3 A;  1HK9 A;  3M0S A;  1WIE A;  4MDW A;  1C0M A;  4M7D G;  3RER A;  4IIO A;  2QQR A;  3PMI A;  1KQS P;  2O88 A;  3EH1 A;  4RG2 A;  2E5K A;  3RUX A;  2P0Q A;  4GLM A;  3V8K A;  2XDP A;  1X69 A;  3PMT A;  4PLL A;  4QVZ A;  5CK9 A;  2PNI A;  1MV0 B;  1K76 A;  2AIR B;  2MYS A;  3OYF A;  1FX7 A;  5LJ3 g;  4C0D C;  1Q7Y R;  3VJP A;  1VUB A;  2JS2 A;  5GAO m;  4JPB W;  4ELY C;  2LP5 A;  2LZ6 B;  3E1S A;  2XG8 D;  3REB B;  1XNI A;  2GFU A;  2P0P A;  5HK0 A;  2XI9 A;  1VQ6 A;  1I4K 1;  3N5B B;  3RKX A;  1TTH B;  4ZGD B;  4BD3 A;  5LJ5 h;  3OYG A;  3CPW S;  5GAN g;  3I5R A;  2CSQ A;  3FRN A;  2E65 A;  3FC3 A;  2F5T X;  3QUI A;  3E9F A;  2NUT A;  1EFN A;  2P4T A;  2CSI A;  4JJD A;  2FZG B;  1T0J A;  1M5Q 1;  2KNB B;  1UE9 A;  1MMN A;  2RQT A;  4CRI A;  3QKJ A;  2NUP B;  1UEC A;  2BKD N;  4AFS C;  1PC0 A;  2X51 A;  4F17 A;  2HQH A;  4J9C A;  2P0K A;  4KUI A;  3BDU A;  4PJN A;  1Y07 A;  3OMC A;  9ATC B;  1UG1 A;  1T0H A;  2HL3 A;  5GAO p;  4E7K A;  5CKD A;  1I07 A;  4TVR A;  1PKS A;  2RA2 A;  4MDX A;  5LJ5 f;  2A3L A;  2DL7 A;  2LT4 A;  4LE9 A;  5GAM g;  3CC4 A;  1M4Z A;  3I56 T;  1YCS B;  2HBP A;  1BIB A;  3REA B;  1RI9 A;  5IHN A;  3FEO A;  5HY6 A;  2OAU A;  2QEX A;  2JT4 A;  4Q5W A;  1OUL A;  3NPF A;  2H3E B;  3OYN A;  1X27 A;  3S6W A;  2QGF B;  1VQ4 Q;  4XU0 A;  3R6N A;  2J6K A;  4C0G A;  1X75 C;  1Q86 U;  2XDD A;  2FPF A;  4Z88 A;  4J6X A;  4J8O A;  4WF2 A;  4M7D D;  2JMC A;  5KYN A;  2EWN A;  3EGU A;  2AK5 A;  1UGQ B;  4N4H A;  4RTZ A;  1YI2 T;  1KHC A;  1NPR A;  4FW2 A;  3L2R A;  2J6O A;  4OGE A;  3MCA B;  4BY6 B;  3X20 B;  1M90 U;  2RO0 A;  1UGP B;  2HKN A;  4EDU A;  4IUV A;  3M53 A;  3C12 A;  1BI0 A;  1KC8 C;  2LQK A;  4PJL A;  4RTU A;  4C8Q C;  2M51 A;  1YHQ Q;  2KI7 A;  4C8Q F;  1VQN Q;  1PHT A;  1K8A U;  1AHJ B;  3VS0 A;  2FZC B;  3AHU A;  2AT1 B;  2EVR A;  2SEM A;  3FIF A;  1MGQ A;  3MO8 A;  1QVP A;  2OTL A;  1VOM A;  3VS4 A;  2EYQ A;  2DXU A;  1IB8 A;  1BI1 A;  2O31 A;  1R0C B;  2ZPH B;  1W6X A;  1SSH A;  3GNG A;  3EFS A;  5FU6 C;  4M78 F;  1TXQ A;  3OSS C;  2HCK A;  3PIO A;  2EPD A;  4JUV A;  3DB3 A;  1NYF A;  2L3P A;  1YJ9 A;  2YRC A;  2HQX A;  2AKK A;  1BYM A;  2DTH A;  1QP3 A;  2HNI A;  3V7C A;  2B8A A;  4FM4 B;  4L6V 5;  1YJN A;  1I0C A;  1AWO A;  3QHS A;  2K79 A;  3GBQ A;  2EQM A;  5FW9 A;  4M75 A;  3BFM A;  5HKC A;  3THK A;  2RQR A;  2KXD A;  1UHC A;  4UC4 A;  3JCM W;  2FO0 A;  4M77 E;  1KFZ A;  1G8X A;  2LDM A;  2D0N A;  5GAN 6;  3ZFJ A;  4PJM A;  5CR2 A;  2KBT A;  1AVZ C;  2DMO A;  4BAC A;  4HT8 A;  1RLQ C;  2EJ9 A;  2MK5 A;  1MUZ A;  3TSW A;  5DLO A;  2PVD B;  1MV3 A;  2K5I A;  1G83 A;  2B86 A;  2G3R A;  1HYO A;  2ZZD A;  1VQ6 Q;  1ZUU A;  1VQL Q;  2MOX A;  4OMO A;  4OB1 B;  2RH2 A;  1VQL T;  4KBM B;  2MMP A;  5D7U A;  3CC2 A;  3OYY A;  3LX7 A;  4QW2 A;  3RKY A;  2CP6 A;  2O4X A;  2QDL A;  3M0P A;  3CCJ A;  5AT1 B;  4C5E A;  3WVE B;  1OZ3 A;  1ZUY A;  1MHN A;  2PQW A;  3GF5 A;  3L2U A;  2QI2 A;  2I0N A;  2X4X A;  1SHF A;  1M2V B;  5GAN f;  1QCO A;  4FT2 A;  2QG9 B;  4P5N A;  4DBF A;  4J9G A;  1ZBJ A;  2JTE A;  3M56 A;  2KE9 A;  4C5H A;  1RLP C;  5HK3 A;  1WHG A;  3CMA T;  1MMD A;  2RK1 A;  3CC4 Q;  1HXD A;  4PJO F;  3J7A F;  4CC4 B;  1NJI C;  3OYD A;  3H0I A;  4M78 B;  3X26 B;  3OS0 A;  4E7S A;  3H41 A;  4MZM A;  4GLK A;  4J6W A;  2QEX Q;  3L2Q A;  1VQK A;  3MJX A;  4FIB A;  2QGG A;  3HRS A;  2QA4 A;  5KYU B;  3R6O A;  2Y90 A;  1VQ9 T;  4A4K A;  3EGX B;  2BZ8 A;  4QT7 A;  5GAM f;  5IHK A;  3OS2 A;  1M1K R;  1UTI A;  1PD1 A;  1N9R A;  4RTY A;  3JCM Q;  5KYY A;  3L1A A;  5GMK j;  2WAC A;  1VQM T;  2F5K A;  1OU9 A;  1E6G A;  1LJO A;  1Z9Z A;  4ATO A;  1VQP A;  1N27 A;  1SSF A;  3G7Z A;  2JTM A;  1CSK A;  1KHI A;  1LVK A;  2JXB A;  2ED0 A;  1Q81 R;  1VQ5 A;  1VYV A;  5LJ5 e;  3JCM g;  2LX9 A;  1D0Z A;  3CPW P;  3A8M B;  2CP3 A;  4O5V A;  3MKD A;  2CZ6 B;  3M59 A;  3JB9 J;  1I5L A;  1I81 A;  2EJF A;  2XK0 A;  3CCU T;  2YT6 A;  3SDZ A;  2JW4 A;  3CCE A;  2DJZ A;  4M7A C;  4QQG A;  2DYB A;  2LMJ A;  1QVF S;  4FSX A;  2E6Z A;  3JCM c;  2FHD A;  5C6S A;  5I2M A;  3EHR A;  1YJ9 Q;  2KVQ G;  3CXC S;  2BIV A;  5J39 A;  1NPP A;  3JCM J;  1WHJ A;  1VQ7 A;  1IXD A;  2ROL A;  2KYM A;  2DE0 X;  1VYT A;  2CP2 A;  2FZK B;  1JEG A;  2K9G A;  2LJ0 A;  1ABQ A;  2YWW A;  1TSF A;  4ORZ A;  3JB9 H;  2JJ9 A;  3LGF A;  2COZ A;  4ZTJ A;  3ME9 A;  1NBE B;  4C92 E;  2K5L A;  4EMK C;  3A8L B;  3QZ9 B;  3OBY A;  4PJO B;  2MPX C;  4RG8 A;  4A54 A;  2C0O A;  1LOJ A;  2KR3 A;  3I9Q A;  1WYX A;  2CP0 A;  4FYX B;  2E41 A;  2VC8 A;  4C92 A;  2EYW A;  2KYB A;  1D3B A;  1PG5 B;  1K73 U;  4CI0 C;  1WJR A;  3IQL A;  3VKI A;  4BE0 A;  5I21 A;  1YJW A;  3OW2 A;  2CS7 A;  4DBR A;  5KCH A;  2C06 A;  4E7Z A;  4N0A A;  4LD9 K;  2DXB A;  1ZSZ C;  2JUF A;  1S72 A;  1W2B S;  2R5M A;  4B9W A;  2YSQ A;  3H6Z A;  2YHT A;  5LJ5 g;  3OB9 A;  1R0B G;  1PSF A;  4JRP A;  3SWN A;  2LJ1 A;  5A2Q E;  4PJO G;  4ZTF A;  3M55 A;  3CCM A;  4DBQ A;  4LDU A;  2ZPG B;  4JRI A;  1AWJ A;  2RHX A;  4J5Y A;  1H3H A;  3H0F A;  2CZ1 B;  1O75 A;  4V2S A;  2CP7 A;  4M78 D;  1UFF A;  2RN8 A;  2OAW A;  3M9Q A;  2P84 A;  2HL5 C;  3RES A;  3RR6 A;  1BK2 A;  4JLI A;  4RMO A;  1RAE B;  2XU8 A;  4J7F A;  2IIM A;  3NMZ C;  1KD1 U;  1V1C A;  3X28 B;  5IH2 A;  1T3L A;  2F1L A;  3VUB A;  4OB0 B;  5GMK m;  3BY7 A;  2DA9 A;  1YP5 A;  2QA4 Q;  1Q82 U;  3G6E T;  3P8B B;  4ME7 A;  5KYX A;  2MWP A;  4HXJ A;  2X3X D;  2YUQ A;  4J9H A;  5GMK h;  2JZ2 A;  5GAO q;  3QYH B;  4F7U G;  3FB9 A;  2EQI A;  2AZV A;  4N4I A;  2VXE A;  1AEY A;  1D1A A;  2RHY A;  4QQD A;  1VQP Q;  4DEX A;  2DX1 A;  2HBW A;  3NGP A;  5GAN e;  1WXB A;  3OYA A;  2O01 E;  1UGR B;  1VQ5 Q;  4OML A;  2A0F B;  3VRZ A;  1X2Q A;  3PFS A;  2LVM A;  4MML A;  1YWP A;  4KRT A;  3RDV A;  2DIG A;  2GTO A;  4OVA A;  1TOV A;  1HSQ A;  2CH4 A;  3KUF A;  4HCK A;  3MP6 A;  3JCM b;  2D8H A;  4BI4 A;  4ELZ C;  1OPK A;  1NEG A;  1UDL A;  2GQI A;  1OPL A;  4XK8 E;  2O2O A;  3MEU A;  3VUZ A;  2DK3 A;  3JCM f;  3CCS T;  3SEM A;  4D8D A;  3NHN A;  5GAM e;  4M7A E;  3ZBD A;  3UT1 A;  4HCB A;  1QCN A;  5HCK A;  1UJY A;  3E9G A;  1A0N B;  1Y0M A;  4PJO D;  3JCM V;  3EHQ A;  1VQ8 A;  4M77 C;  4ZGE B;  3CCV Q;  3C94 A;  5FU7 B;  4OMP A;  3CCQ A;  4M7A A;  1WI7 A;  2MWO A;  2PUO B;  3CCV T;  3SFM A;  2K3B A;  5GMK i;  3EG3 A;  4HKE A;  3QZ5 B;  1WGS A;  3M0Q A;  3MEA A;  1OQK A;  4OMQ A;  4A4F A;  2DIL A;  2XDB A;  3LGL A;  1Q7Y C;  3S3N A;  2KRM A;  3JCM X;  4X34 A;  1GFC A;  2EKH A;  2FPE A;  4BUG A;  2L5Q A;  1YJW Q;  2OX7 A;  2ZAE A;  5CQY A;  3I55 A;  3X25 B;  4EMK A;  2X4J A;  4LDX A;  4MZT A;  3SD4 A;  1X6B A;  4PFZ A;  3JB9 G;  2X3W D;  3PVQ A;  4M7D E;  3I35 A;  3CME A;  4IKF A;  2JNG A;  2RMO A;  4RCB A;  8AT1 B;  4EMG A;  3A8O B;  5CCA A;  2DD4 A;  4BI3 A;  3VS2 A;  5IHI A;  1RI0 A;  1G2B A;  4RCC A;  4F16 A;  4ZN3 A;  5EG2 A;  3OYI A;  2E6N A;  1R8O B;  2F2V A;  2QAS A;  4M7D A;  2K57 A;  3CCM Q;  4E7J A;  2C0T A;  3FJP A;  1QVF P;  6AT1 B;  5I11 A;  1G3W A;  2DBM A;  3VS5 A;  4BB7 A;  3LYI A;  2RJD A;  1WX6 A;  1BI3 A;  2D8J A;  3CXC P;  3OQ5 A;  1ZSZ A;  2EYX A;  2CGH A;  2HZY A;  4OGC A;  2O9S A;  2DVJ A;  4M75 B;  2CUD A;  3GNF B;  1M8M A;  3UWN A;  4CC3 A;  1V76 A;  1OV3 A;  2FRW A;  2ROT A;  3C4S A;  2DXT A;  1U8R A;  3OMG A;  1K9M U;  2E70 A;  1EX4 A;  4NL2 A;  4HVW A;  2CZ7 B;  2F2X A;  1Q86 R;  4OP0 A;  1VQ4 T;  2EBP A;  4BDZ A;  1RAG B;  5GJW B;  1YIT A;  3L2W A;  1B07 A;  4II1 A;  5IXB A;  4PKC C;  1WNL A;  1M90 R;  2QQB A;  1Y57 A;  2W10 A;  2O4X B;  4C0D B;  1RAI B;  3G71 Q;  1UHF A;  1KQ2 A;  3CCR Q;  2CYZ B;  2RB6 A;  3EG0 A;  2CRE A;  3EFO A;  4J7I A;  4M75 G;  3G71 T;  1K8A R;  2DFU A;  1YHQ T;  2L3R A;  3CCR T;  1W2B P;  2A7Y A;  1VQN T;  2K3Y A;  2V8I A;  2GCX A;  5GAO n;  2EW3 A;  4ZGJ B;  1G3T A;  3OYE A;  3CCL A;  1KC8 U;  2JMA A;  5GMK l;  1YN8 A;  1GL5 A;  2VVK A;  3V7R A;  4XTV A;  1RAB B;  3JB9 D;  3HP9 A;  1Y96 A;  1GFD A;  3DKM A;  3LH0 A;  2CDT A;  2QQS A;  4C5I A;  3J80 E;  1I8F A;  3WVD B;  3INZ A;  5LJ3 d;  4C92 C;  1IHV A;  3UDC A;  1W70 A;  2RK2 A;  4C92 F;  2HD0 A;  7AT1 B;  3V8L A;  1VQ8 Q;  4A63 B;  3ER0 A;  3HRT A;  3V8J A;  4AG2 C;  3VYG A;  4QQ6 A;  4KT0 E;  1VQO A;  2HSE B;  3CCQ Q;  1QVG A;  3VS1 A;  2E10 A;  2IG0 A;  3E2U A;  1IZ6 A;  4N0A C;  2EGE A;  4EPC A;  2CP5 A;  4X9C A;  4LXC A;  2VYT A;  3PE0 A;  5KYY B;  3HRU A;  1CKA A;  1C6V X;  5GAN d;  3CC7 A;  1CKB A;  1B34 B;  1WZO A;  3GIB A;  2L0A A;  2DL3 A;  4A53 A;  1QWF A;  3SWN C;  4FSS A;  4A4G A;  1Y71 A;  3OYB A;  3NTK A;  1LNX A;  1SKU B;  5DM7 R;  4DA4 A;  1Q95 G;  3I55 Q;  1MND A;  4M77 A;  4FYV B;  1OX9 A;  3JCM e;  3CME Q;  1GCP A;  1VQ6 T;  2Y4X A;  5GAN 4;  2KK4 A;  4DQ2 A;  1UJ0 A;  1UB4 A;  1VYU A;  4FW1 A;  2K5F A;  4Y92 A;  2YUO A;  5GAM d;  3QSU A;  4A4E A;  4M4Z A;  4C0Z A;  2LQN A;  1F1B B;  5DLQ E;  1X2K A;  2D1X A;  4JDS A;  3OBW A;  2NWM A;  4C8Q B;  5FWC A;  1JXM A;  3LWI A;  1WDX A;  3EG2 A;  4NS5 A;  3EGD A;  4M75 D;  1ZLM A;  4OF1 A;  2G6F X;  5ECA A;  1ABO A;  4QVD A;  1RAF B;  4RUG A;  1BI2 A;  3JAM E;  4R56 A;  2WSC E;  1M1F A;  2BZY A;  1YWO A;  3CC4 T;  5FU6 B;  5CIU A;  1K1Z A;  1AOJ A;  4XTY A;  4B9X A;  3O8V A;  2KAF A;  2AZS A;  1ZX6 A;  4AFQ C;  2QEX T;  3JCM P;  2EFI A;  2PVG B;  2EIF A;  1KQS S;  3JB9 I;  3OW2 S;  2DXC A;  1YIJ A;  5D6Y A;  1NLO C;  1X43 A;  1T3S A;  2K3X A;  2OTJ A;  2DER A;  2LNV A;  5FWB A;  1YIT Q;  4FT4 A;  1IO6 A;  2ZPF B;  3M57 A;  4LUE A;  2RJF A;  4GBQ A;  5I22 A;  1M1K C;  1E7O A;  1GBQ A;  2V8J A;  5L23 A;  3JSC A;  2HAX A;  4C8Q G;  1JJ2 A;  8ATC B;  3MET A;  1N6A A;  4YTL A;  3M4Y A;  1VIE A;  4IUU A;  4X1V A;  4KH1 B;  3OY9 A;  3CD6 A;  5CKH A;  4E7H A;  1OI1 A;  2EQU A;  1KG1 A;  2EQK A;  5CKB A;  1WHL A;  2HQE A;  4OMM A;  1M3C A;  2DTI A;  2LT1 A;  4KUL A;  1Q81 C;  1Y7X A;  1K9A A;  3UAT A;  3NTH A;  5FRO A;  4M78 G;  3V7S A;  3A8G B;  2PVO B;  2L3Q A;  2OTL Q;  1RAC B;  3HKS A;  3CCL Q;  1I5O B;  4CC7 A;  1K4U S;  3M0U A;  4M7A F;  3L2Z A;  4JJB A;  1YCY A;  2LQW A;  3VS7 A;  1M9S A;  1GRI A;  4LN2 A;  2ZPB B;  3G4S A;  2ZPE B;  1SHG A;  2QQA A;  2A28 A;  1YJ9 T;  3O5Z A;  4LDW A;  2XID A;  1FWZ A;  4Z89 A;  4E7I A;  1M30 A;  2F2W A;  2HEQ A;  2LQ8 A;  3F70 A;  1XTD A;  4RKU E;  2R57 A;  3H9N A;  4E6R A;  3MEV A;  1YJN Q;  1QQJ A;  2QQ9 A;  1IGQ A;  2BE9 B;  2DBK A;  5IN1 A;  5KYX B;  1YJN T;  4EMH A;  1C1A A;  2A08 A;  3CC7 Q;  1M2V A;  3AT1 B;  3RMQ A;  4JZ4 A;  3GOX A;  2PZ1 A;  1ARK A;  5C0M A;  4NL3 A;  3I5S A;  5KYW A;  1UGV A;  1RUW A;  4E47 A;  1K73 R;  2R5A A;  3MP8 A;  2JM8 A;  4M7D C;  1SRM A;  5CKF A;  1WHH A;  4M7D F;  2DL5 A;  4JS4 A;  2ATC B;  3KFV A;  1SF9 A;  1KQS A;  2COY A;  2XD0 A;  3EG1 A;  1Z9Q A;  5KH6 A;  4VUB A;  1MNE A;  3HPW A;  3CC2 Q;  4FCY A;  2ABL A;  4PFP A;  2HMA A;  3CPF A;  2KEA A;  3A8H B;  2YLC A;  3CCJ Q;  1GCQ A;  3CBM A;  1VIF A;  1N8R U;  4C8Q D;  2ZPI B;  4PK4 A;  4FU6 A;  1RL2 A;  2LNH B;  4NOY A;  2DYI A;  3CCJ T;  1UUE A;  3GLX A;  2BZX A;  5CVI A;  2DNU A;  1YBY A;  4J9E A;  4Z8A A;  4Y91 A;  3S3O A;  2DPP B;  2CZ0 B;  2MI6 A;  3CBP A;  3H8Z A;  2EGC A;  3QBY A;  2SRC A;  1B7T A;  2GBQ A;  5J3B A;  4M7A B;  1WQ7 A;  1PRM C;  4LDY A;  2DD5 A;  1WXU A;  1KD1 R;  3JRZ A;  2XKO C;  1KD1 C;  2EYY A;  2MAM A;  1VQK Q;  3TVT A;  1YIJ Q;  1Q82 R;  3TRE A;  3I56 A;  3OSV A;  2OTJ Q;  1OYX A;  1G3S A;  1WLP B;  3JCM d;  4E7L A;  2QA4 T;  3ASK A;  1RAD B;  2LCS A;  4R0K A;  1WQW A;  4KGV B;  4RTW A;  4XTX A;  4PJO E;  4EMK B;  1ACM B;  4Z02 A;  2E5Q A;  2RHZ A;  2DZC A;  2DF6 A;  3CD6 Q;  3QYG B;  5J26 A;  3A1P A;  3QDF A;  2QTV A;  2QYZ A;  2NUT B;  4BI8 B;  2ENM A;  5GAN 3;  1VQP T;  3SB2 A;  4AG1 C;  1YI2 A;  2MCN A;  1BBZ A;  2YLB A;  4XTU A;  1VQ5 T;  1G3Y A;  1H8K A;  2OI3 A;  2VKN A;  4HVU A;  2DM1 A;  3C95 A;  3EFR A;  1ZUK A;  2YRV A;  3CCE Q;  1PM3 A;  4KH0 B;  3BDL A;  2DIQ A;  4AMC A;  3UA7 A;  3DLM A;  1U1T A;  1WJQ A;  1ZSZ B;  2JOY A;  1OEB A;  2RM4 A;  4ESR A;  1YHQ A;  3VV0 A;  2LTO A;  4JJC A;  2FG0 A;  2VXF A;  3JV3 A;  2KXC A;  1D0Y A;  1VQ7 Q;  4J9D A;  3ULR B;  5FRM A;  2X9H A;  4F7U E;  2MF2 A;  3MHX A;  1VQ7 T;  4D6W A;  2DL8 A;  4C0F A;  4WTO B;  4RTV A;  4M77 F;  1P92 A;  3H0H A;  5FRN A;  2DEQ A;  2QTX A;  2O9V A;  1QLY A;  1YNZ A;  5IAY A;  1JQQ A;  1X6G A;  1SRL A;  4F7U A;  3HFN A;  2VB6 A;  5L8R E;  4HT9 A;  2RF0 A;  3OW2 P;  4KUD K;  1WFW A;  2NLU A;  2V1R A;  1TUD A;  2VWF A;  2J7I A;  4XAX B;  3RNJ A;  3WXM B;  1NYG A;  5LJ5 d;  2GQV A;  1D1C A;  3QJ6 A;  3OYM A;  2IPO B;  2RI3 A;  2X35 A;  4HCC A;  3P8H A;  4BY6 C;  1TUC A;  3EFO B;  1LPL A;  2H3J A;  1I1J A;  2H8H A;  5LJ3 j;  3Q1J A;  1YJW T;  2NUZ A;  1K0S A;  2RI2 A;  1IRX A;  1D0X A;  1Q7Y U;  1S72 Q;  1EIF A;  2LRQ A;  1H64 1;  2CH4 W;  1BKB A;  1OU8 A;  1BU1 A;  2KT1 A;  1N5Z A;  2JVV A;  2DL4 A;  5D6X A;  1S72 T;  1M8V A;  2E3I A;  2K2M A;  2RHI A;  1Y96 B;  1PKT A;  3OYC A;  4QVC A;  4E2F B;  2Z0W A;  3G1J A;  1M3A A;  1BB9 A;  3GPL A;  1VQL A;  5GAN j;  1HJD A;  2DRM A;  1X6O A;  1NG2 A;  2RHU A;  5CAI A;  2DET A;  4BDY A;  2W0Z A;  1QVG S;  3CCM T;  4M7A D;  2YRD A;  2DKG A;  1ZA2 B;  2GFA A;  2KGT A;  4O6J A;  4PNO A;  5KE3 A;  3CEY A;  3EG9 A;  1SPK A;  2M1H A;  2J05 A;  1M27 C;  3UPU A;  5GAN 8;  3VU3 C;  5M9O A;  2BTT A;  1K9M R;  3CMA A;  1FMW A;  5GAM j;  1K9M C;  3I56 Q;  2V26 A;  3BW1 A;  1EZZ B;  4HCZ A;  2DZ9 A;  2DEU A;  1WA7 A;  4L5G A;  2LX7 A;  2FL7 A;  1Q86 C;  1FYN A;  4M77 B;  3ZEH A;  1TS9 A;  2JN0 A;  2BE7 D;  4FYW B;  2MIO A;  3M0R A;  1ZQ1 A;  3RBB B;  5KCO A;  1H92 A;  3QWX X;  4MZP A;  2KQW A;  1VQ9 A;  1M90 C;  3OYJ A;  1KQ1 A;  3L42 A;  1YI2 Q;  5GJV B;  2JS0 A;  5D6W A;  2K7A A;  1VA7 A;  1VQM A;  2X4W A;  3ZL7 C;  1K8A C;  3QDR B;  2M16 A;  1SEM A;  3PTA A;  1U5S A;  1W4S A;  3EGD B;  1KC8 R;  2YXY A;  4XU3 A;  2KY9 A;  4EIK A;  1PD0 A;  3NTI A;  2E4H A;  2JTF A;  4IUP A;  4F14 A;  1JXO A;  2YDL A;  2RQV A;  3OYL A;  4M77 G;  1TH7 A;  2GNC A;  5GAN 2;  3CCU A;  1AZG B;  3M58 A;  1ZA1 B;  2L8D A;  1U1S A;  4OMF B;  1NM7 A;  2LC4 A;  3CBO A;  4J9I A;  4J83 A;  5DY9 A;  4M78 C;  3CPW A;  2V8K A;  4GY5 A;  3QO3 A;  1VQ8 T;  5FLX E;  1JJ2 S;  2VUB A;  2L3S A;  2IVW A;  1PNJ A;  2PUK B;  3CQT A;  3CCQ T;  2NUP A;  1SG5 A;  4XU1 A;  3M54 A;  4M75 E;  1U3O A;  1GCQ C;  3EAE A;  3TU4 K;  4IUQ A;  2L89 A;  3LW5 E;  2GGR A;  2AHJ B;  4XU2 A;  2K6D A;  2X4Y A;  1QMC A;  4PJJ A;  4AFU C;  5GMK e;  3RMS A;  2RJC A;  2I2L A;  3VYH B;  5LJ3 h;  2GF7 A;  5A0L A;  4IUT A;  3TEE A;  1V29 B;  2RNA A;  1IGU A;  3I55 T;  1ZBX A;  2WSF E;  4L59 A;  2M0O A;  3OS5 A;  2M02 A;  2PU9 B;  1NLP C;  2RPN A;  3CME T;  1TWB A;  2R58 A;  2XHC A;  1G5V A;  2CUB A;  5GAN h;  1WHK A;  4C5G A;  4N4G A;  1M3B A;  4PFO A;  3TSZ A;  4PL6 A;  1ZHI A;  1PRL C;  1KIK A;  3HHT B;  4AT1 B;  1UEB A;  2KT8 A;  5LJ3 f;  5IT9 E;  4KGZ B;  2EKO A;  3DB4 A;  2JM9 A;  3L2V A;  2YUN A;  3E19 A;  3QJY A;  2RQW A;  3OYK A;  2E64 A;  2D6F A;  1KK7 A;  3PT9 A;  1H3Z A;  5CQX A;  2EJG A;  4PLI A; 
#chains in the Genus database with same CATH homology
 5HCK A;  1UJY A;  2ABL A;  2EGA A;  1A0N B;  1U06 A;  1Y0M A;  3PVL A;  2KEA A;  4RTT A;  3EHQ A;  2EYZ A;  1GCQ A;  1NEB A;  4RTU A;  4OMP A;  2M51 A;  2LNH B;  1WI7 A;  2A37 A;  1UUE A;  2HDA A;  2BZX A;  1PHT A;  3SHW A;  4AFZ C;  2DNU A;  2J6F A;  3VS0 A;  2K3B A;  1HD3 A;  3UF4 A;  2SEM A;  2EVR A;  3EG3 A;  4J9E A;  4Z8A A;  4DEY A;  4J9B A;  1J3T A;  2ECZ A;  3M0Q A;  3VS4 A;  4OMQ A;  2DIL A;  2O31 A;  2KRM A;  4K11 A;  2EGC A;  1GFC A;  2EKH A;  1W6X A;  1SSH A;  2SRC A;  2FPE A;  2RQU A;  2HCK A;  2GBQ A;  2EPD A;  1PRM C;  3VRY A;  1NYF A;  1S1N A;  2L3P A;  1QKW A;  1K0X A;  1WXU A;  3UA6 A;  1FMK A;  2AKK A;  1X6B A;  2EYY A;  2X3W D;  3PVQ A;  3I35 A;  1LCK A;  3TVT A;  2RMO A;  4IIM A;  1I0C A;  1AWO A;  3VS2 A;  5IHI A;  2K79 A;  1OOT A;  1WLP B;  3GBQ A;  1G2B A;  3M0T A;  4F16 A;  2DJQ A;  5FW9 A;  1TG0 A;  3THK A;  2RQR A;  2LCS A;  4R0K A;  2F2V A;  1UHC A;  2KXD A;  4RTW A;  4CC2 A;  2FO0 A;  2PTK A;  1KFZ A;  1ZSG A;  2C0T A;  1KJW A;  2D0N A;  5I11 A;  1AZE A;  2DF6 A;  2DBM A;  3VS5 A;  1WX6 A;  2KBT A;  2D8J A;  1AVZ C;  2DMO A;  2EYX A;  2M0Y A;  2ENM A;  1RLQ C;  4ZNX A;  2O9S A;  1MUZ A;  2DVJ A;  3TSW A;  4AG1 C;  1MV3 A;  1WXT A;  2MCN A;  2CUD A;  1G83 A;  2B86 A;  1BBZ A;  1ZUU A;  1M8M A;  2MOX A;  4CC3 A;  4OMO A;  1H8K A;  1OV3 A;  2OI3 A;  2VKN A;  4HVU A;  2FRW A;  2ROT A;  2DM1 A;  1E6H A;  1JO8 A;  1ZUK A;  2DRK A;  4LUD A;  4HVW A;  1W1F A;  2QDL A;  3M0P A;  3UA7 A;  2F2X A;  2EBP A;  1OEB A;  4ESR A;  2OJ2 A;  4JJC A;  2FG0 A;  5GJW B;  1GBR A;  1ZUY A;  3JV3 A;  2KXC A;  2I0N A;  5EC7 A;  3LH5 A;  4J9D A;  4LNP A;  3ULR B;  1B07 A;  1SHF A;  5IXB A;  3QWY A;  2DL8 A;  4J9G A;  1ZBJ A;  1Y57 A;  2JTE A;  2KE9 A;  2W10 A;  4RTV A;  3VS6 A;  1RLP C;  3H0H A;  1UHF A;  4CC4 B;  2O9V A;  1QLY A;  1YNZ A;  3EG0 A;  3H0I A;  2CRE A;  1JQQ A;  1X6G A;  1SRL A;  3H41 A;  2DLP A;  2RF0 A;  2EW3 A;  1WFW A;  2V1R A;  2VWF A;  1TUD A;  3RNJ A;  2J7I A;  2JMA A;  1NYG A;  1YN8 A;  1GL5 A;  4D8K A;  2VVK A;  2C0I A;  1XOV A;  1AD5 A;  4RTX A;  1GFD A;  2BZ8 A;  4J9F A;  2XMF A;  4QT7 A;  1AWW A;  2FPD A;  2CDT A;  5IHK A;  1UTI A;  3FJ5 A;  4RTY A;  1TUC A;  1I1J A;  2H8H A;  2FEI A;  2NUZ A;  1K0S A;  1W70 A;  1E6G A;  1Z9Z A;  2CH4 W;  1BU1 A;  2KT1 A;  1N5Z A;  4A63 B;  4AG2 C;  2DL4 A;  1CSK A;  2JXB A;  1QKX A;  2K2M A;  3VS1 A;  2ED0 A;  1PKT A;  5IXF A;  1VYV A;  2L2P A;  2EGE A;  2YUP A;  1M3A A;  1BB9 A;  3PE0 A;  2GTJ A;  1HJD A;  1CKA A;  2DRM A;  2AKL A;  1NG2 A;  4JZ3 A;  1CKB A;  2W0Z A;  2YT6 A;  2JW4 A;  2L0A A;  2DL3 A;  3A98 A;  2KRN A;  2KGT A;  2DYB A;  2ESW A;  2LMJ A;  1QWF A;  2J06 A;  4FSS A;  2A36 A;  4OMN A;  3EHR A;  2CT4 A;  3U23 A;  1JU5 C;  4HVV A;  1SPK A;  1KSW A;  2J05 A;  1M27 C;  1GCP A;  2ROL A;  2KYM A;  2BTT A;  2DE0 X;  1VYT A;  1JEG A;  2K9G A;  2LJ0 A;  3VS3 A;  1ABQ A;  1UJ0 A;  1VYU A;  4ORZ A;  4Y92 A;  2CT3 A;  2YUO A;  3C0C A;  1PWT A;  1WA7 A;  4M4Z A;  2LX7 A;  4WCI A;  2LQN A;  1FYN A;  1X2K A;  2D1X A;  1B3Q A;  1AWX A;  2C0O A;  2MIO A;  2KRS A;  2ED1 A;  3M0R A;  2NWM A;  3RBB B;  2KR3 A;  5FWC A;  3I9Q A;  1WYX A;  1JXM A;  1WDX A;  1H92 A;  3QWX X;  2V1Q A;  3EG2 A;  2EYW A;  2KYB A;  1ZLM A;  5ECA A;  2G6F X;  1ABO A;  2P4R A;  1QWE A;  2FRY A;  4RUG A;  3IQL A;  2KRO A;  5GJV B;  2HSP A;  2JS0 A;  1QCF A;  2K7A A;  1VA7 A;  2BZY A;  1YWO A;  2LJ3 A;  1K1Z A;  3M0S A;  1WIE A;  3ZL7 C;  1AOJ A;  4IIO A;  2O88 A;  2AZS A;  1ZX6 A;  1SEM A;  4AFQ C;  2E5K A;  4GLM A;  1U5S A;  2YSQ A;  1X69 A;  4EIK A;  1NLO C;  1X43 A;  1T3S A;  2LJ1 A;  2PNI A;  5FWB A;  4F14 A;  1IO6 A;  1JXO A;  1MV0 B;  2YDL A;  4LUE A;  1K76 A;  2RQV A;  4GBQ A;  5I22 A;  2GNC A;  1E7O A;  1GBQ A;  5L23 A;  1AZG B;  1AWJ A;  1H3H A;  3H0F A;  1NM7 A;  4X1V A;  4J9I A;  1UFF A;  2RN8 A;  2OAW A;  2JS2 A;  4JPB W;  1BK2 A;  2LP5 A;  2LZ6 B;  4OMM A;  2IIM A;  1M3C A;  3REB B;  3NMZ C;  2L3S A;  1PNJ A;  3CQT A;  1K9A A;  3UAT A;  1V1C A;  5IH2 A;  1T3L A;  2L3Q A;  1U3O A;  3I5R A;  2CSQ A;  1GCQ C;  2DA9 A;  1YP5 A;  2GGR A;  4CC7 A;  1K4U S;  3M0U A;  2K6D A;  1EFN A;  4JJB A;  4AFU C;  2CSI A;  4JJD A;  2LQW A;  3VS7 A;  4HXJ A;  1T0J A;  1GRI A;  2KNB B;  4LN2 A;  1UE9 A;  2X3X D;  2YUQ A;  2RQT A;  4J9H A;  1UEC A;  4AFS C;  1SHG A;  2RNA A;  4F17 A;  2A28 A;  4J9C A;  2EQI A;  2AZV A;  3O5Z A;  4Z89 A;  1UG1 A;  1T0H A;  1M30 A;  1AEY A;  2F2W A;  2HEQ A;  1I07 A;  4DEX A;  2DX1 A;  2HBW A;  1PKS A;  1NLP C;  2RPN A;  4E6R A;  3NGP A;  1WXB A;  2DL7 A;  4OML A;  4LE9 A;  3VRZ A;  2CUB A;  2DBK A;  1X2Q A;  1YCS B;  3REA B;  1M3B A;  1YWP A;  4KRT A;  3TSZ A;  1RI9 A;  2A08 A;  2GTO A;  1PRL C;  5IHN A;  1KIK A;  2JT4 A;  2KT8 A;  3NPF A;  4JZ4 A;  1HSQ A;  2PZ1 A;  1X27 A;  2CH4 A;  1ARK A;  4HCK A;  2JM9 A;  3I5S A;  2D8H A;  3R6N A;  2YUN A;  2J6K A;  1UGV A;  1RUW A;  2FPF A;  2RQW A;  4Z88 A;  1OPK A;  2GQI A;  1NEG A;  1UDL A;  2JMC A;  2JM8 A;  1SRM A;  1OPL A;  3EGU A;  2O2O A;  2AK5 A;  2DL5 A;  3KFV A;  4RTZ A;  3SEM A;  3EG1 A;  1Z9Q A;  3NHN A;  4D8D A;  2J6O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...