2KXDA

The structure of sh3-f2
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
73
structure length
73
Chain Sequence
MGAPPLPPYSAGGREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDSGTGKELVLALYDYQEKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords 11-mer peptide, SH3 domain of Spectrin alpha chain
publication title NMR structure and dynamics of the chimeric protein SH3-F2
pubmed doi rcsb
source organism Synthetic, gallus gallus
total genus 6
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2010-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2kxdA00
2FRWA 2DVJA 2KR3A 2GQIA 3FJ5A 4FSSA 3PVQA 4RTTA 2LX7A 1AWJA 1NLPC 1K9AA 2JM8A 2NUZA 2DX1A 3M0PA 1YCSB 2I0NA 4JZ4A 1GCQC 1SHFA 2L3PA 1AZEA 5FWCA 4LUEA 1OEBA 1MV3A 2EPDA 2HBWA 4F14A 3M0SA 2ED0A 1QLYA 3VS1A 2DL8A 2RPNA 2L2PA 2MOXA 4AFQC 5FW9A 1I1JA 2W10A 2F2VA 2GTJA 2DRKA 2LJ1A 1NYGA 1UECA 1M3CA 2DBMA 1SRMA 2MIOA 1CSKA 2KXDA 5IHIA 1Z9ZA 1J3TA 1S1NA 1H92A 2K2MA 1ZX6A 1U3OA 1HJDA 2AK5A 5IXFA 2CUDA 1OPLA 2W0ZA 1LCKA 1MUZA 1PHTA 4RTXA 2A28A 2OI3A 2JXBA 2F2XA 1I07A 3UA6A 4CC2A 1B07A 2DL5A 2GBQA 1AWOA 1NEGA 2J06A 3TSWA 2JMCA 1UFFA 2C0TA 2NWMA 2SRCA 5IXBA 1OOTA 1M3BA 2CREA 4Z8AA 2E5KA 2AKKA 1UJ0A 1RUWA 2KT8A 4J9GA 1EFNA 1WDXA 2FG0A 1WI7A 1T0JA 2LJ0A 1WIEA 2FEIA 4JJCA 2FPEA 1JQQA 2JS0A 1ZSGA 3VRYA 1GRIA 2DBKA 3EGUA 5HCKA 1GCQA 4OMQA 2RNAA 2O9SA 1WLPB 5I22A 1JO8A 1JU5C 1UJYA 3M0TA 3EG2A 3REBB 2KEAA 1UUEA 2KYMA 1YNZA 1H8KA 1GL5A 1YWOA 4M4ZA 2JTEA 2P4RA 1NYFA 2ENMA 4HXJA 2KRMA 1XOVA 2OAWA 1UGVA 1GBQA 2DRMA 1ZUUA 4CC4B 2HDAA 2EBPA 4GBQA 4RTUA 1H3HA 4LE9A 2O31A 1VA7A 1WXUA 2V1RA 4HVWA 2K79A 4KRTA 1K0XA 1T0HA 2MCNA 2LQNA 4J9EA 4J9CA 4OMMA 4HVUA 4EIKA 2EYXA 2RQVA 4DEXA 2LNHB 3I5SA 4LNPA 3REAB 1NM7A 2RMOA 2EYYA 5EC7A 2KXCA 1PRLC 2YUQA 4J9BA 3PVLA 4RUGA 4AFUC 2FPFA 4F17A 3NGPA 1SEMA 2ESWA 2GTOA 2IIMA 3U23A 2ED1A 1WFWA 3NPFA 2DMOA 2EQIA 3LH5A 4JZ3A 4K11A 2YDLA 2JS2A 3NMZC 4RTZA 3NHNA 1A0NB 2RF0A 4Y92A 1W1FA 2KT1A 2XMFA 1UG1A 2GGRA 2J6KA 1X69A 2DNUA 1AVZC 2ROTA 4JJDA 1AEYA 2CUBA 2ROLA 3SEMA 1TUCA 4F16A 2PZ1A 1NLOC 3UA7A 1K1ZA 2J7IA 3PE0A 4Z89A 4OMNA 2KNBB 1VYTA 1E7OA 1NEBA 1W70A 2V1QA 2J6FA 3IQLA 1SSHA 1BU1A 2EGEA 1Z9QA 1TUDA 1X6BA 1PKTA 2YUOA 4R0KA 1QCFA 4J9FA 2PNIA 3H0IA 3VRZA 1Y0MA 4QT7A 1AWWA 3GBQA 5IHKA 4HVVA 2AKLA 2CSQA 1OV3A 2D8JA 1TG0A 1U5SA 1BB9A 1VYUA 2DA9A 4HCKA 1ZUYA 2KYBA 1KFZA 4E6RA 3C0CA 2BZXA 3JV3A 4D8DA 1AWXA 4DEYA 1X27A 3UF4A 1GBRA 1U06A 2EKHA 4AFSC 1PRMC 1KIKA 2L3QA 2AZSA 2KROA 2DL4A 4GLMA 1FMKA 2KRSA 3RBBB 1WXTA 3VS2A 2EVRA 1NG2A 2CDTA 2A36A 1ABOA 4OMLA 4Z88A 2YUPA 2L0AA 2DJQA 1UDLA 2DL7A 1X2KA 1KJWA 4AG2C 1T3SA 2VVKA 2CH4W 3O5ZA 4CC7A 2CH4A 2ECZA 4OMOA 2PTKA 1ZLMA 2CSIA 2BZ8A 1AZGB 4LUDA 1ARKA 3UATA 3TVTA 2DILA 2FPDA 3TSZA 2O9VA 4RTWA 2DYBA 3H41A 2ABLA 2DM1A 1QKXA 1UTIA 2H8HA 1W6XA 3QWXX 1X2QA 2OJ2A 2A37A 1RI9A 4ESRA 2CT4A 3ZL7C 2B86A 2C0IA 1KSWA 3EHRA 2RQRA 3CQTA 1YP5A 2EW3A 2HEQA 2BZYA 4RTVA 2QDLA 2DF6A 2AZVA 1GFDA 1CKBA 1GCPA 3M0RA 2GNCA 2VKNA 3I9QA 3M0QA 3KFVA 2LCSA 2M0YA 2D8HA 2RQTA 3RNJA 2YT6A 1CKAA 2K7AA 4LN2A 1OPKA 4J9IA 1X43A 2D0NA 2D1XA 3SHWA 2DLPA 1K0SA 1X6GA 1RLQC 1SHGA 1N5ZA 1K76A 3VS5A 2LQWA 2VWFA 3VS6A 3EG1A 1VYVA 4RTYA 5IHNA 2KBTA 1WYXA 4IIMA 2K3BA 5GJWB 2K9GA 1HD3A 4ORZA 1M3AA 3A98A 2O2OA 4J9HA 2HCKA 5FWBA 1HSQA 5I11A 2J05A 3VS0A 1AD5A 3VS4A 1UHCA 1M30A 1M8MA 2LZ6B 3H0HA 3M0UA 5GJVB 2L3SA 2EGAA 1I0CA 4JJBA 1MV0B 1B3QA 1YN8A 1G2BA 3I5RA 1G83A 1QWFA 1SRLA 1ZBJA 2CT3A 1BBZA 2O88A 1UE9A 2C0OA 1ZUKA 2K6DA 2JM9A 1JEGA 2FRYA 1IO6A 1FYNA 1RLPC 1E6GA 2YUNA 1YWPA 2RQWA 1SPKA 3R6NA 1V1CA 2LJ3A 3VS3A 4IIOA 2LP5A 1UHFA 4WCIA 1GFCA 2BTTA 1M27C 4D8KA 1E6HA 3EG3A 2X3WD 2KE9A 2KRNA 2LMJA 3THKA 2JT4A 3EHQA 3H0FA 1K4US 2G6FX 3I35A 2M51A 1PNJA 2X3XD 5ECAA 2EGCA 2SEMA 2EYZA 2JW4A 1JXMA 2DE0X 4JPBW 1QKWA 2RN8A 5L23A 3ULRB 2RQUA 3VS7A 2FO0A 4OMPA 2YSQA 4CC3A 2DL3A 4ZNXA 3EG0A 2A08A 1QWEA 2EYWA 1WXBA 4J9DA 4AFZC 1AOJA 1ABQA 1PKSA 2HSPA 2KGTA 3QWYA 4A63B 1PWTA 2J6OA 1JXOA 1WA7A 2F2WA 1Y57A 1T3LA 1BK2A 2JMAA 5IH2A 4AG1C 1WX6A 4X1VA
chains in the Genus database with same CATH superfamily
4RTTA 2LC4A 3FJ5A 3RKXA 1NLPC 3GPLA 1K9AA 2JM8A 2NUZA 2DYIA 1GCQC 4M78F 1VIFA 1VQKQ 1QW1A 1AZEA 4BY6C 4LUEA 1MV3A 2HQEA 2HBWA 1VQMQ 5D7UA 1BI0A 4JDSA 1M5Q1 3CPWP 1QVPA 5GMKh 2DL8A 4N0AA 2ZPEB 1I1JA 3GOXA 3QO3A 2F2VA 1B34B 3RMSA 3Q1JA 2FVUA 3HL8A 2H3JA 3RDVA 1UECA 1M3CA 4Q5WA 2MIOA 3CMAQ 4E7LA 4QQDA 1S1NA 1ZX6A 1HJDA 1MNEA 5CKHA 2CUDA 4FT2A 1LNXA 2W0ZA 1VQOT 2EQUA 2F69A 4M77F 2GCXA 2OI3A 4JRPA 1M4ZA 1ACMB 4XU0A 3UA6A 4CC2A 1VQPA 1OQKA 3A8GB 4PJJA 3TSWA 1M8VA 2K4YA 2DFUA 5LJ5d 2C0TA 5IXBA 1ZQ1A 1OOTA 2RM4A 4C92D 4J9GA 3PGGA 2V8JA 2LJ0A 1WIEA 1YHQQ 1YJ9T 2FEIA 1WQWA 5GAOm 2EKOA 2XU8A 1KQSS 1ZSZA 2RHIA 2O9SA 3CCJA 1JU5C 5GANh 2YXYA 3REBB 2OTJT 4XU1A 2KYMA 4E2FB 1H8KA 4ZTFA 1GL5A 3MEWA 4AMCA 3SD4A 3CC2T 1YWOA 4M4ZA 1XNIA 2DTOA 2PVOB 2V26A 3OS1A 2A0FB 4C8QG 2K5FA 1N8RR 1ZUUA 2XICA 1R77A 1VQMT 5CKBA 3A8MB 4AT1B 5LJ5g 2HDAA 3GNGA 2C06A 4E7KA 4DBHA 4GBQA 1MMDA 4J7FA 4M78G 2O31A 4PJOC 3OSVA 3CCEQ 3QIIA 4HVWA 4KRTA 4BUGA 2MCNA 2LQNA 4J9EA 3CMAT 2K5LA 4E7ZA 3OYCA 4DEXA 3REAB 4C0FA 1NM7A 2CP3A 2EYYA 3CD6A 3CC7Q 2YUQA 3MO8A 4M7DA 4BDYA 1MHNA 2JNGA 4C5EA 3OYGA 2LCLA 3M55A 3MEUA 4F17A 5CQYA 1SEMA 1ZHIA 2ESWA 2EWNA 2GTOA 3U23A 2ED1A 3MHXA 1ZA1B 2X4YA 4M78D 3QUIA 2M0OA 3EH2A 1JJ2S 1A0NB 2P0QA 3N5BB 2ROTA 1YHQT 3M57A 1AHJB 1P92A 4F16A 2QTVA 3OYMA 3P8HA 2R57A 3UDCA 5FRNA 2E3IA 2J7IA 3OS5A 4C0GA 1SF9A 1W70A 2NUTB 2J6FA 2AT1B 5I2MA 2R58A 4HCBA 4M77D 4L5GA 1D0YA 1Y0MA 2K3XA 5GANf 1R0BG 1AWWA 5GAMj 1KC8U 3GBQA 5IHKA 2P4TA 2QGGA 2CSQA 2JN0A 5KYNA 4CRIA 5GAMe 1PD0A 1OV3A 1VQ5A 3I55A 4C8QE 1BB9A 2DA9A 4PKCC 3OMGA 1M1KU 4HCCA 3ZBDA 1MMGA 2CZ7B 3OYLA 4D8DA 2X9HA 3UF4A 1WHGA 4M78E 4AFSC 4IKFA 4PLIA 3PFSA 2DD5A 2DL4A 3GNFB 4M7AA 3MKDA 1VQKA 2VUBA 3A8OB 1TWBA 1KG1A 3MP6A 2A36A 1ABOA 3HHTB 4Z88A 4KH1B 3HP9A 2DL7A 1K8AR 2DTIA 3JB9F 1KJWA 4CC7A 4JRQA 1AZGB 2E6ZA 4LUDA 3JCMe 1WHKA 2HQXA 2MAMA 4DBQA 2DILA 4WTOB 3VUBA 5KYYB 5FU7C 4UC4A 1PCXA 3JCMQ 4RCCA 1BCOA 2C0IA 2RD1A 5CKEA 1AT1B 3CQTA 1YP5A 2EW3A 2BZYA 2OX7A 3CCRQ 4IUQA 5CKDA 1CKBA 1GCPA 3M4GA 4P5NA 1D0XA 4PLLA 2RQTA 3QKJA 3RNJA 2YT6A 1Q82R 4KUIA 1VQ4T 4LN2A 1OPKA 2D0NA 2D1XA 3CCMQ 5HY6A 3G1JA 2RJCA 4E7HA 3LGLA 2LQWA 5IAYA 3ZEHA 2VWFA 2LRQA 1MMAA 3E9GA 3QHSA 2DTHA 2JOYA 4PK4A 4F7UA 4R56A 2QQSA 2QQBA 5J39A 4BD3A 2LNVA 2K9GA 3OBWA 2EJ9A 4ORZA 1M3AA 2LQ8A 3CCVA 3PT9A 4XTWA 3A98A 1RACB 5CIUA 3PNWC 2JTMA 2HSEB 3VS0A 2QEXA 1M8MA 5FU6C 4JUVA 2ATCB 3CCEA 4DOWA 2R5AA 4KUDK 1MV0B 1G2BA 4HCZA 2QYZA 1G83A 1QWFA 1SRLA 2KI7A 2QI2A 1BBZA 4OGEA 4M75A 1FX7A 1ZUKA 1ZSZB 2XDBA 2CP7A 2K6DA 3WXMB 1RAGB 1C0MA 3CXCP 3CC7A 2YUNA 1NPRA 1RAFB 1YWPA 1PC0A 4LDVA 2QA4T 3QZ5B 4XTYA 3OW2S 4Y91A 2LJ3A 4RG8A 4C92B 4JJNK 2BTTA 1NJIU 2Y90A 3EG3A 5LJ3j 1N8RC 2RJEA 3I35A 2M51A 5LJ3e 5GANd 1VQNQ 2EGCA 4OB2B 1UGSB 3JB9D 2DE0X 3A8LB 3UPUA 3VJPA 4JPBW 3CCMT 3ULRB 2XK0A 4M78C 3M56A 1QVFA 3CCSQ 4OMPA 3TCJA 3C94A 2DL3A 1Q7YU 1QMCA 2EYWA 1AOJA 4QVDA 3CC4A 4EMGA 4IUUA 3EFSA 1FMVA 3TREA 1WA7A 5GAOp 2PVDB 1Y57A 1K9MR 2FZGB 4M7DB 2L89A 2JMAA 1G8XA 1U1SA 1WX6A 4IUVA 4NS5A 2FRWA 2QQRA 2KR3A 3OA6A 2LX7A 2FB7A 2DX1A 4J83A 4Z02A 3M0PA 5CR2A 3QJYA 1VQ9A 4JZ4A 3L1AA 2CYZB 3PMTA 2XDPA 5GANg 1Q81R 5KH6A 4LDXA 1G3TA 3CCLQ 2EPDA 4F14A 1VQ7Q 2VGNA 4M77C 1UB4A 2ED0A 2COZA 3OYEA 3EFOA 3G4SQ 3M53A 4L59A 2K2VA 2W10A 1D1CA 2E4HA 2DRKA 2ZGWA 2LJ1A 1NYGA 3EAEA 1U8RA 3SDZA 4KGZB 1I8FA 1OYXA 4PFZA 1JJ2A 3QPHA 1Q86R 1OPLA 2HD0A 3GF5A 1MUZA 1PHTA 4E7IA 2IPOB 3NTKA 2RB6A 2DXCA 4II1A 1I07A 1B07A 1AWOA 9ATCB 2J06A 2LX9A 1VQNT 3BDLA 4LXCA 2LVMA 1UFFA 2NWMA 5LJ5j 3CCST 4Z8AA 3OY9A 1Y07A 2AKKA 2E5QA 1RUWA 2P84A 5LJ5e 1M90U 1WDXA 3CPWS 1M9SA 5GAN3 5GMKl 1JQQA 2JS0A 1ZSGA 3VRYA 3EG9A 3EGUA 5FRMA 1NE8A 1WLPB 4A54A 5DLQE 4M7AB 3FRNA 4LD9K 4LDUA 5GAOn 3CCRA 1VQ8T 4OMFB 2CP5A 2KEAA 2PQWA 1UUEA 5L8RE 3FC3A 2ZCFB 2JTEA 1LJOA 2LDMA 2E64A 2ENMA 2P4RA 3L2VA 2LT4A 2RI3A 2OAWA 4XTXA 4C0ZA 3CCQQ 4CC4B 3I56T 1OZ3A 2KMTA 4FM4B 1VQ7T 2JTFA 2EIFA 3JB9I 3HRTA 4E7SA 2E41A 1YJ9Q 1VA7A 8ATCB 2DKGA 1WNLA 2RK2A 2WACA 1X75C 7AT1B 3E19A 2NLUA 4QVCA 2RO0A 1Y7XA 4J9CA 1H3ZA 2RQVA 2OTJQ 4LNPA 2RMOA 3QG1A 1QCNA 4MZMA 3J81E 1PRLC 3CC2Q 2RA2A 4FSXA 3QYGB 2QTXA 4RUGA 1SG5A 4AFUC 1KQ1A 1WFWA 4IUPA 4OF1A 2O4XA 5GAN7 1Q82C 4RTZA 3P8BB 2DVEA 4Y92A 1W1FA 3BFMA 2KT1A 2XMFA 2JVVA 2CZ0B 2DNUA 4JJDA 4C92G 1ZBXA 2CUBA 2E65A 3EGXA 1TUCA 3MJXA 4F7UB 2DETA 4NOYA 1Q95G 4PL6A 1KD1R 1S72T 1K1ZA 1MMNA 4XTUA 4EMKA 3PE0A 2KK4A 4Z89A 2KNBB 3IQLA 1E7OA 1W2BA 1Z9QA 5CQXA 3CMEA 4M7AF 1TUDA 1X6BA 1K73C 1VQNA 1FXXA 1QCFA 3LX7A 3CCQT 2BKDN 3H0IA 4EMHA 3VRZA 3M59A 3CEYA 3X20B 2AKLA 4Y28E 5CKFA 4M7DG 2L5QA 2YRDA 2BE9B 3OYKA 1M1FA 4M75B 2KYBA 1KFZA 1YJWQ 1QVFS 2BZXA 4DEYA 2MWOA 1X27A 1VQLA 3DB4A 2BUDA 1HK9A 3RESA 2AZSA 2KROA 4GLMA 1FMKA 2DJZA 3RIRA 1EIFA 3RBBB 1WXTA 1QCOA 2EJFA 1YFNA 3CCLA 1VQ6A 3V8JA 3VYGA 2YUPA 4M7DD 2L0AA 2DJQA 3INZA 4LDWA 4KGVB 1WQ7A 1T3SA 2VVKA 3E9FA 3G4SA 4OGCA 2CSIA 2YRCA 1D0ZA 2BZ8A 3OB9A 3BE3A 3UATA 2FHDA 2ZAEA 1M1GA 1WPYA 3OW2A 1YI2Q 1H641 3MP1A 4BE0A 2RI2A 1D3BA 1W6XA 4RMOA 2OJ2A 2DZCA 1YITQ 1VIEA 4BI8B 2RHZA 3L2ZA 1K9MC 4C92E 3EHRA 2GFAA 3VU3C 4F7UF 1HXDA 3S6WA 1NZ9A 2HEQA 3QXEB 4J8OA 3SFMA 8AT1B 3OYYA 1IB8A 2AZVA 5KYWA 2GNCA 1Q81C 2VKNA 3I9QA 3M0QA 4M77G 3DLLA 3KFVA 2M0YA 5GAOq 3M4YA 1QP3A 4J9IA 1X43A 3V8LA 1NBEB 3T9NA 4E7JA 1BI3A 3HPWA 1YJWT 5HK0A 4QKUA 4OB1B 3RERA 1RI0A 3VS6A 1VYVA 4M75F 4RTYA 4M7DE 3X25B 1VQOA 1WYXA 2XD0A 5J26A 4C8QA 3PIPA 6AT1B 1KHCA 1M2VA 5GMKj 1Q86C 3V7SA 2PVGB 1I81A 3QZ9B 5GMKe 4J9HA 4QVZA 5FWBA 1HSQA 4M7AD 1WJRA 3NTIA 1VQ4Q 2JUFA 3RR6A 1YJ9A 1IREB 2LZ6B 3OYFA 1K73U 4ZGDB 4E47A 2L3SA 2EGAA 4JJBA 3LH0A 4MDWA 2X51A 1YJNQ 3MPUB 1YI2T 2C0OA 3ASKA 2OTJA 5CAIA 3URGA 2JM9A 2YWWA 1IO6A 1YITT 2GQVA 1FYNA 3CC2A 1E6GA 4OB3B 4N0AC 2ZPFB 1VQMA 5A0DA 4IIOA 4D8KA 2X3WD 2KE9A 2KRNA 4ZN3A 3CPWA 3H0FA 2QXFA 5ECAA 4CI0C 2SEMA 1OULA 2EYZA 2KDSA 3MCAB 1TH7A 3HTRA 5GANe 1V29B 3JRZA 3TU4K 2F5KA 3VS7A 3CMAA 3C4SA 3V7CA 4RKUE 2CS7A 4ZNXA 3EG0A 5CVIA 2A08A 4M77E 4AFZC 1ABQA 1PKSA 3HSBA 4A63B 1PWTA 2J6OA 1WGSA 2F5TX 3GP8A 2QA4Q 2F2WA 2VYTA 1PSEA 2CGHA 5KE2A 3M58A 4XQ3A 3SWNA 3RKWA 2DXBA 2DIQA 2GQIA 2FYKA 1AWJA 3OYIA 3EGDA 5D6YA 1X6OA 4FL6A 2I0NA 2WSEE 1W2BS 3G6ET 1ZSZC 2KAFA 3X24B 1FMWA 1SHFA 2L3PA 5FWCA 1YHQA 2WSFE 3VUZA 3M0SA 2AHJB 4FW1A 1R0CB 4PJOF 1O75A 1QLYA 3VS1A 2JZ2A 3S3OA 2XHCA 1YJWA 3KBGA 2L2PA 4HKEA 2MOXA 1YJNT 4C92C 2LT1A 2BE7D 5DY9A 1LOJA 3OS0A 5M9OA 3HRUA 3WVEB 4EMKB 1CSKA 4M75D 4DBFA 1KD1C 2RH2A 1J3TA 2X4JA 4V2SA 1IXDA 1B34A 1H92A 2ZPHB 3D7SB 4DBRA 5IXFA 4RTXA 2A28A 4JS5A 1KK7A 4A4FA 1KC8R 2MI6A 3CPFA 3GLXA 3UWNA 3QDRB 1I5LA 3V8KA 2K5IA 4M7DC 3JB9G 1M1KR 2EJGA 4XTVA 3JCMW 1EFNA 3LW5E 1RL2A 1WI7A 4XTZA 5KYUA 3CCUT 4JJCA 3G71T 1GRIA 2COWA 3J7AF 1GCQA 2ZPBB 2RNAA 5I22A 1JO8A 3M0TA 4A53A 4DOVA 2Z0WA 3OYBA 2QQAA 2Y4XA 4OVAA 1NYFA 4HXJA 3RKYA 5GAN5 1XOVA 5AYFA 2DRMA 3OYNA 4BE2A 4J6XA 2CP6A 3UT1A 5KCHA 3ZFJA 2EBPA 1PG5B 4RTUA 1GXIE 3HRSA 4EPCA 4B6MA 4LE9A 2HAXA 5IT9E 1WXUA 1D3BB 2V1RA 3P8DA 3SB2A 3VV0A 4BB7A 4IUTA 1OU9A 1K0XA 1T0HA 2JJ9A 4HA8A 4OMMA 1VQ8Q 2EYXA 4FYWB 2LNHB 2DXUA 3I5SA 4BACA 4KH0B 5EC7A 2KXCA 2I2LA 2HKNA 3VKIA 2FL7A 1VQ4A 1QVGP 1N9SA 2FPFA 2E1HA 3JCMV 3NTHA 2P0KA 3I56Q 3NPFA 2DMOA 4RG2A 2GFUA 3H6ZA 1OX9A 4XAXB 5FLXE 4JRIA 2XG8D 1RAEB 4K11A 2G3RA 2JS2A 4M7AC 2FZKB 1YJNA 3S3MA 2GGRA 2J6KA 1AVZC 3QJ6A 2ROLA 3HFNA 3SEMA 2NUPA 2PZ1A 3A1PA 4KULA 1NLOC 1RADB 2HZYA 3F70A 1IZ6A 4C8QB 3OYAA 3OYJA 3UA7A 1M2VB 2COYA 2RHUA 1NEBA 3JCMX 2DD4A 1SSHA 4RCBA 2EGEA 5I21A 2CZ1B 1YIJQ 4PJOA 4PFPA 5FROA 1F1BB 4C5IA 2ZPIB 2PNIA 3G7ZA 1DJ7B 3C95A 2CP2A 4IURA 4J5YA 4FYVB 2VV5A 2D8JA 1U5SA 4ZGEB 1PM3A 2QA4A 3E1SA 4E6RA 3OYDA 1AWXA 1S72Q 1RAIB 1OX8A 1GBRA 5A0GA 4C0DB 1U06A 4A4EA 2EKHA 1PRMC 2QAZA 2L3QA 2NYSA 3FDRA 2PU9B 1G3WA 1WHJA 1KHIA 2DXTA 1NJIR 4X34A 2P0PA 1K8AC 2KY9A 3CCJT 3CCMA 4OMLA 3OS2A 4OP0A 1UDLA 1G3SA 3MEAA 1V76A 3L2RA 1X2KA 5HK3A 5GAOl 4AG2C 2V8KA 2CH4A 5C6SA 2MWPA 4TVRA 1N8RU 1ZLMA 4QW2A 3DLMA 2L8DA 1Q7YR 1ARKA 5DM7R 3TVTA 1WHLA 2PUOB 2FPDA 2O9VA 4RTWA 4QQ6A 2DYBA 3H41A 2ABLA 2DM1A 1G5VA 2AIRB 1UTIA 3QWXX 1X2QA 1RI9A 1WZOA 2CT4A 3ZL7C 3SWNB 3QBYA 1KSWA 2MYSA 2M16A 3EGDB 4X9DA 4A4KA 4C8QF 4M75C 1YIJT 2QASA 3QSUA 3M0RA 3CD6T 2DEQA 2EQKA 5LJ3g 3PTAA 1LVKA 2D6FA 3BDUA 1IGUA 2D8HA 4JRKA 2K7AA 1Y96A 2HQHA 4ELZC 4A4HA 1LPLA 1RLQC 1WJQA 1IGQA 1D1AA 3CXCA 1N5ZA 3BW1A 1BKBA 3VS5A 4ATOA 1X01A 2YHTA 2YRVA 5GAMh 4IIMA 2E6NA 2FZCB 2QK0A 5GJWB 4B9XA 1HD3A 5GMKm 1TU0B 3HKSA 2HCKA 3CCSA 1WHHA 1KC8C 3OSSC 2J05A 3JCMb 5KCOA 1AD5A 1UHCA 1M30A 3M54A 1M90R 5GJVB 5KYUB 1G3YA 1M1KC 1WJSA 4PJNA 1B3QA 2IG0A 2B8AA 2CT3A 1RAHB 2RJDA 2VGMA 2O88A 1UE9A 1VQ8A 1HYOA 1M2OA 3MEVA 4PJLA 2M1HA 1JEGA 1TTHB 4BY6B 2FRYA 1VQ5T 3I55T 1BCMA 3JCMh 1IHVA 4L6V5 2EYQA 4KT0E 2RQWA 1SPKA 2YLCA 4BDZA 5GAN4 2X35A 3I56A 1QVGA 3KXTA 1VQ7A 5GAN6 1UHFA 4EDUA 4KBMB 1GFCA 4O6JA 2RK1A 1M27C 2MF2A 3TQ7P 3FIFA 1K4US 2L3RA 1PNJA 2X3XD 1VQKT 4C92A 5D6WA 2JW4A 1OI1A 3CCVQ 2D9TA 1K8AU 1QKWA 2RN8A 5L23A 5DLOA 2FO0A 4CC3A 3LWIA 3L2QA 3J80E 4BE1A 3LGFA 4GLKA 2QEXQ 3H8ZA 2HL5C 3QWYA 1OZ2A 1JRIA 1C6VX 4FYXB 1JXOA 1R8OB 4LD6A 1RAAB 1T3LA 4MDXA 4LDYA 1YIJA 1C1AA 5IH2A 4AG1C 5I2SA 2DVJA 4FSSA 3PVQA 2XIDA 2O01E 4C8QD 1YCSB 2ZZDA 3EFOB 4MMKA 1UEBA 4BI4A 5GAMf 4M7AG 4XU2A 1OEBA 5GMKi 2RHXA 2X4XA 1Q82U 3JB9H 2LQKA 5CO7A 2RPNA 2EQMA 2NUPB 1S72A 4AFQC 5FW9A 1VUBA 1QP2A 1KQSP 2GTJA 5C0MA 1QVFP 3ER0A 1YCYA 2DBMA 1SRMA 2KXDA 1YBYA 2RI5A 5IHIA 1Z9ZA 1XQHA 2K2MA 4FYYB 1U3OA 3CCQA 2AK5A 5J3BA 3CC4Q 4PJOB 2XI9A 3CBPA 2YLBA 3G6EQ 1LCKA 4M78A 4C5HA 4PJMA 3E2UA 2JXBA 2F2XA 4NL2A 2DL5A 2GBQA 1NEGA 1JB0E 3JCMf 5KE3A 5A0LA 2QG9B 4FIBA 3AHUA 3CCVT 2JMCA 5KYXA 2SRCA 1KQ2A 1M3BA 2CREA 3EG9B 2HKQB 1VQ9Q 2E5KA 1TOVA 1UJ0A 1ZA2B 2KT8A 2K3YA 2FG0A 1T0JA 2QEXT 2FPEA 3V7RA 1N27A 2EFIA 3FLGA 5LJ3h 3LYIA 2BIVA 4B9WA 2DBKA 5HCKA 3CCET 2CP0A 1PD1A 4OMQA 1Y71A 2E70A 1O9SA 1UJYA 3EG2A 1YNZA 4M77A 1OU8A 1BIAA 1NJIC 3CC7T 4F7UG 2KRMA 5GANj 1JJ2P 1UGVA 1GBQA 2KSSA 4EMKC 3L2WA 4O5VA 4FT4A 1Q7YC 3CCUQ 2HBPA 1H3HA 3G71Q 4M7AE 3C12A 5GAN8 2A7YA 4NL3A 3JSCA 2K79A 2EAYA 1TSFA 3CXCS 3FB9A 3LWHA 3FEOA 2V8IA 4FU6A 5LL6S 3JCMP 4HVUA 4EIKA 1W4SA 4M75G 2MK5A 3FJPA 3CC4T 4ZN1A 1K9MU 4J9BA 3PVLA 2O4XB 3VYHB 3S3NA 2DEUA 4HT9A 2LCCA 3NGPA 3GIBA 2IIMA 3HFOA 2VXFA 2EQIA 2DERA 3LH5A 4JLGA 3L2UA 1Y96B 4JZ3A 3EGXB 2YDLA 1Q81U 3NMZC 2K57A 2HL3A 1VOMA 3NHNA 1VQ9T 2RF0A 1NPPA 1UG1A 4JLIA 4OB0B 1X69A 1AEYA 3O8VA 1MNDA 3MP8A 3LLRA 2OTLQ 4MZTA 1WHMA 5LJ5h 4OMNA 1D09B 4KGXB 1VYTA 4XK8E 2V1QA 3DKMA 1BU1A 2VXEA 4N4HA 4MMLA 3X28B 1PKTA 5FU7B 2CKKA 1Q86U 2F1LA 3TEEA 5LJ3f 1TUGB 2YUOA 4R0KA 1QVGS 4J6YA 4J9FA 1K73R 2RHYA 4QT7A 5GAMd 5HKCA 1PSFA 1YI2A 4ANJA 4HVVA 1JBMA 3META 1MGQA 1M90C 4F7UE 1YITA 2KVQG 5A2QE 3WVDB 1TG0A 1VYUA 4HCKA 1ZUYA 2DPPB 2HMAA 1D1BA 3C0CA 3JV3A 1BI2A 2RJFA 3OMCA 3QYHB 1KIKA 3H9NA 2MMPA 2DZ9A 5D6XA 4ZGJB 1I5OB 2KRSA 4ZTJA 4A4GA 2LTOA 2HNIA 2QGFB 3VS2A 1EX4A 2EVRA 2VC8A 5EG2A 1NG2A 2CDTA 4JS4A 3EFRA 5GAMg 1W2BP 3CCRT 4M75E 3JCMd 4BI3A 2CH4W 3O5ZA 4C8QC 5IN1A 2DO3A 2ECZA 4OMOA 3M5AA 2A3LA 5CK9A 2PTKA 5CCAA 3CMEQ 1VQPQ 3KUFA 4N4IA 2QDYB 5AT1B 2EQJA 3CBOA 3TSZA 1IHWA 1KQSA 4PJOG 2QQ9A 4YTLA 4J7IA 1QKXA 2H8HA 1U1TA 2A37A 2X4WA 4ESRA 2E3HA 4J6WA 2B86A 4DA4A 2OTLT 5GAOr 3NFCA 1I4K1 5FU6B 3G6EA 5KYWB 2RQRA 1N9RA 1B7TA 2XKOC 2E12A 3CCJQ 3R6OA 2DAQA 4RTVA 2QDLA 2DF6A 1VQLQ 1GFDA 4FCYA 3JB9J 3JCMg 4HT8A 4X9CA 2LCSA 4C0DC 1TS9A 4PJOD 5LJ5f 1CKAA 5GAN2 1VQ6Q 3SHWA 2DLPA 1K0SA 1SKUB 1X6GA 2WSCE 2ZPGB 3RMQA 1SHGA 2Y4YA 1RABB 1K76A 4FW2A 3PMIA 2H3EB 3EG1A 2D0QB 3A8HB 2GF7A 2XDDA 3PIOA 5IHNA 2KBTA 3L42A 3OW2P 2K3BA 4R55A 1KD1U 4M78B 4PNOA 2O2OA 3EH1A 2NUTA 1UGPB 1TXQA 3CD6Q 2M9UA 2DIGA 4MZPA 4D6WA 1BYMA 5KYXB 5I11A 2R5MA 3CCUA 1VQPT 3VS4A 3SWNC 3CMET 3A5ZB 3G71A 2M02A 3H0HA 4C92F 3M0UA 1XTDA 4PFOA 1I0CA 3JAME 4F04B 1YN8A 4C5GA 3I5RA 1ZBJA 3QDFA 2PUKB 3RUXA 1QQJA 3JCMJ 1EZZB 3X26B 1RLPC 4ELYC 1BI1A 4M77B 4PJOE 3R6NA 1FWZA 1V1CA 1BIBA 3DB3A 3VS3A 2LP5A 1VQLT 4WCIA 2KQWA 1VQOQ 2MPXC 1E6HA 1XJWB 2DK3A 5LJ3d 2IVWA 1SSFA 2LMJA 3M9QA 1IRXA 2JT4A 3OBYA 3THKA 4M7DF 3EHQA 4GY5A 2G6FX 1UGRB 2E10A 1JXMA 2OAUA 3JCMc 3CCLT 1VQ6T 2RQUA 4N4GA 1UGQB 4VUBA 3BY7A 2YSQA 4QQGA 4DQ2A 3AT1B 3OQ5A 1N6AA 1QWEA 1VQ5Q 1WXBA 4J9DA 3G4ST 4ME7A 3I55Q 2OTLA 2VB6A 2HSPA 3CBMA 2KGTA 4WF2A 5KYYA 3OYHA 3ME9A 4XU3A 2VASA 1BK2A 2CZ6B 4X1VA
chains in the Genus database with same CATH topology
2FRWA 2DVJA 2KR3A 2GQIA 3FJ5A 4FSSA 3PVQA 4RTTA 2LX7A 1AWJA 1NLPC 1K9AA 2JM8A 2NUZA 2DX1A 3M0PA 1YCSB 2I0NA 4JZ4A 1GCQC 1SHFA 2L3PA 1AZEA 5FWCA 4LUEA 1OEBA 1MV3A 2EPDA 2HBWA 4F14A 3M0SA 2ED0A 1QLYA 3VS1A 2DL8A 2RPNA 2L2PA 2MOXA 4AFQC 5FW9A 1I1JA 2W10A 2F2VA 2GTJA 2DRKA 2LJ1A 1NYGA 1UECA 1M3CA 2DBMA 1SRMA 2MIOA 1CSKA 2KXDA 5IHIA 1Z9ZA 1J3TA 1S1NA 1H92A 2K2MA 1ZX6A 1U3OA 1HJDA 2AK5A 5IXFA 2CUDA 1OPLA 2W0ZA 1LCKA 1MUZA 1PHTA 4RTXA 2A28A 2OI3A 2JXBA 2F2XA 1I07A 3UA6A 4CC2A 1B07A 2DL5A 2GBQA 1AWOA 1NEGA 2J06A 3TSWA 2JMCA 1UFFA 2C0TA 2NWMA 2SRCA 5IXBA 1OOTA 1M3BA 2CREA 4Z8AA 2E5KA 2AKKA 1UJ0A 1RUWA 2KT8A 4J9GA 1EFNA 1WDXA 2FG0A 1WI7A 1T0JA 2LJ0A 1WIEA 2FEIA 4JJCA 2FPEA 1JQQA 2JS0A 1ZSGA 3VRYA 1GRIA 2DBKA 3EGUA 5HCKA 1GCQA 4OMQA 2RNAA 2O9SA 1WLPB 5I22A 1JO8A 1JU5C 1UJYA 3M0TA 3EG2A 3REBB 2KEAA 1UUEA 2KYMA 1YNZA 1H8KA 1GL5A 1YWOA 4M4ZA 2JTEA 2P4RA 1NYFA 2ENMA 4HXJA 2KRMA 1XOVA 2OAWA 1UGVA 1GBQA 2DRMA 1ZUUA 4CC4B 2HDAA 2EBPA 4GBQA 4RTUA 1H3HA 4LE9A 2O31A 1VA7A 1WXUA 2V1RA 4HVWA 2K79A 4KRTA 1K0XA 1T0HA 2MCNA 2LQNA 4J9EA 4J9CA 4OMMA 4HVUA 4EIKA 2EYXA 2RQVA 4DEXA 2LNHB 3I5SA 4LNPA 3REAB 1NM7A 2RMOA 2EYYA 5EC7A 2KXCA 1PRLC 2YUQA 4J9BA 3PVLA 4RUGA 4AFUC 2FPFA 4F17A 3NGPA 1SEMA 2ESWA 2GTOA 2IIMA 3U23A 2ED1A 1WFWA 3NPFA 2DMOA 2EQIA 3LH5A 4JZ3A 4K11A 2YDLA 2JS2A 3NMZC 4RTZA 3NHNA 1A0NB 2RF0A 4Y92A 1W1FA 2KT1A 2XMFA 1UG1A 2GGRA 2J6KA 1X69A 2DNUA 1AVZC 2ROTA 4JJDA 1AEYA 2CUBA 2ROLA 3SEMA 1TUCA 4F16A 2PZ1A 1NLOC 3UA7A 1K1ZA 2J7IA 3PE0A 4Z89A 4OMNA 2KNBB 1VYTA 1E7OA 1NEBA 1W70A 2V1QA 2J6FA 3IQLA 1SSHA 1BU1A 2EGEA 1Z9QA 1TUDA 1X6BA 1PKTA 2YUOA 4R0KA 1QCFA 4J9FA 2PNIA 3H0IA 3VRZA 1Y0MA 4QT7A 1AWWA 3GBQA 5IHKA 4HVVA 2AKLA 2CSQA 1OV3A 2D8JA 1TG0A 1U5SA 1BB9A 1VYUA 2DA9A 4HCKA 1ZUYA 2KYBA 1KFZA 4E6RA 3C0CA 2BZXA 3JV3A 4D8DA 1AWXA 4DEYA 1X27A 3UF4A 1GBRA 1U06A 2EKHA 4AFSC 1PRMC 1KIKA 2L3QA 2AZSA 2KROA 2DL4A 4GLMA 1FMKA 2KRSA 3RBBB 1WXTA 3VS2A 2EVRA 1NG2A 2CDTA 2A36A 1ABOA 4OMLA 4Z88A 2YUPA 2L0AA 2DJQA 1UDLA 2DL7A 1X2KA 1KJWA 4AG2C 1T3SA 2VVKA 2CH4W 3O5ZA 4CC7A 2CH4A 2ECZA 4OMOA 2PTKA 1ZLMA 2CSIA 2BZ8A 1AZGB 4LUDA 1ARKA 3UATA 3TVTA 2DILA 2FPDA 3TSZA 2O9VA 4RTWA 2DYBA 3H41A 2ABLA 2DM1A 1QKXA 1UTIA 2H8HA 1W6XA 3QWXX 1X2QA 2OJ2A 2A37A 1RI9A 4ESRA 2CT4A 3ZL7C 2B86A 2C0IA 1KSWA 3EHRA 2RQRA 3CQTA 1YP5A 2EW3A 2HEQA 2BZYA 4RTVA 2QDLA 2DF6A 2AZVA 1GFDA 1CKBA 1GCPA 3M0RA 2GNCA 2VKNA 3I9QA 3M0QA 3KFVA 2LCSA 2M0YA 2D8HA 2RQTA 3RNJA 2YT6A 1CKAA 2K7AA 4LN2A 1OPKA 4J9IA 1X43A 2D0NA 2D1XA 3SHWA 2DLPA 1K0SA 1X6GA 1RLQC 1SHGA 1N5ZA 1K76A 3VS5A 2LQWA 2VWFA 3VS6A 3EG1A 1VYVA 4RTYA 5IHNA 2KBTA 1WYXA 4IIMA 2K3BA 5GJWB 2K9GA 1HD3A 4ORZA 1M3AA 3A98A 2O2OA 4J9HA 2HCKA 5FWBA 1HSQA 5I11A 2J05A 3VS0A 1AD5A 3VS4A 1UHCA 1M30A 1M8MA 2LZ6B 3H0HA 3M0UA 5GJVB 2L3SA 2EGAA 1I0CA 4JJBA 1MV0B 1B3QA 1YN8A 1G2BA 3I5RA 1G83A 1QWFA 1SRLA 1ZBJA 2CT3A 1BBZA 2O88A 1UE9A 2C0OA 1ZUKA 2K6DA 2JM9A 1JEGA 2FRYA 1IO6A 1FYNA 1RLPC 1E6GA 2YUNA 1YWPA 2RQWA 1SPKA 3R6NA 1V1CA 2LJ3A 3VS3A 4IIOA 2LP5A 1UHFA 4WCIA 1GFCA 2BTTA 1M27C 4D8KA 1E6HA 3EG3A 2X3WD 2KE9A 2KRNA 2LMJA 3THKA 2JT4A 3EHQA 3H0FA 1K4US 2G6FX 3I35A 2M51A 1PNJA 2X3XD 5ECAA 2EGCA 2SEMA 2EYZA 2JW4A 1JXMA 2DE0X 4JPBW 1QKWA 2RN8A 5L23A 3ULRB 2RQUA 3VS7A 2FO0A 4OMPA 2YSQA 4CC3A 2DL3A 4ZNXA 3EG0A 2A08A 1QWEA 2EYWA 1WXBA 4J9DA 4AFZC 1AOJA 1ABQA 1PKSA 2HSPA 2KGTA 3QWYA 4A63B 1PWTA 2J6OA 1JXOA 1WA7A 2F2WA 1Y57A 1T3LA 1BK2A 2JMAA 5IH2A 4AG1C 1WX6A 4X1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FRW A;  2DVJ A;  2KR3 A;  2GQI A;  3FJ5 A;  4FSS A;  3PVQ A;  4RTT A;  2LX7 A;  1AWJ A;  1NLP C;  1K9A A;  2JM8 A;  2NUZ A;  2DX1 A;  3M0P A;  1YCS B;  2I0N A;  4JZ4 A;  1GCQ C;  1SHF A;  2L3P A;  1AZE A;  5FWC A;  4LUE A;  1OEB A;  1MV3 A;  2EPD A;  2HBW A;  4F14 A;  3M0S A;  2ED0 A;  1QLY A;  3VS1 A;  2DL8 A;  2RPN A;  2L2P A;  2MOX A;  4AFQ C;  5FW9 A;  1I1J A;  2W10 A;  2F2V A;  2GTJ A;  2DRK A;  2LJ1 A;  1NYG A;  1UEC A;  1M3C A;  2DBM A;  1SRM A;  2MIO A;  1CSK A;  2KXD A;  5IHI A;  1Z9Z A;  1J3T A;  1S1N A;  1H92 A;  2K2M A;  1ZX6 A;  1U3O A;  1HJD A;  2AK5 A;  5IXF A;  2CUD A;  1OPL A;  2W0Z A;  1LCK A;  1MUZ A;  1PHT A;  4RTX A;  2A28 A;  2OI3 A;  2JXB A;  2F2X A;  1I07 A;  3UA6 A;  4CC2 A;  1B07 A;  2DL5 A;  2GBQ A;  1AWO A;  1NEG A;  2J06 A;  3TSW A;  2JMC A;  1UFF A;  2C0T A;  2NWM A;  2SRC A;  5IXB A;  1OOT A;  1M3B A;  2CRE A;  4Z8A A;  2E5K A;  2AKK A;  1UJ0 A;  1RUW A;  2KT8 A;  4J9G A;  1EFN A;  1WDX A;  2FG0 A;  1WI7 A;  1T0J A;  2LJ0 A;  1WIE A;  2FEI A;  4JJC A;  2FPE A;  1JQQ A;  2JS0 A;  1ZSG A;  3VRY A;  1GRI A;  2DBK A;  3EGU A;  5HCK A;  1GCQ A;  4OMQ A;  2RNA A;  2O9S A;  1WLP B;  5I22 A;  1JO8 A;  1JU5 C;  1UJY A;  3M0T A;  3EG2 A;  3REB B;  2KEA A;  1UUE A;  2KYM A;  1YNZ A;  1H8K A;  1GL5 A;  1YWO A;  4M4Z A;  2JTE A;  2P4R A;  1NYF A;  2ENM A;  4HXJ A;  2KRM A;  1XOV A;  2OAW A;  1UGV A;  1GBQ A;  2DRM A;  1ZUU A;  4CC4 B;  2HDA A;  2EBP A;  4GBQ A;  4RTU A;  1H3H A;  4LE9 A;  2O31 A;  1VA7 A;  1WXU A;  2V1R A;  4HVW A;  2K79 A;  4KRT A;  1K0X A;  1T0H A;  2MCN A;  2LQN A;  4J9E A;  4J9C A;  4OMM A;  4HVU A;  4EIK A;  2EYX A;  2RQV A;  4DEX A;  2LNH B;  3I5S A;  4LNP A;  3REA B;  1NM7 A;  2RMO A;  2EYY A;  5EC7 A;  2KXC A;  1PRL C;  2YUQ A;  4J9B A;  3PVL A;  4RUG A;  4AFU C;  2FPF A;  4F17 A;  3NGP A;  1SEM A;  2ESW A;  2GTO A;  2IIM A;  3U23 A;  2ED1 A;  1WFW A;  3NPF A;  2DMO A;  2EQI A;  3LH5 A;  4JZ3 A;  4K11 A;  2YDL A;  2JS2 A;  3NMZ C;  4RTZ A;  3NHN A;  1A0N B;  2RF0 A;  4Y92 A;  1W1F A;  2KT1 A;  2XMF A;  1UG1 A;  2GGR A;  2J6K A;  1X69 A;  2DNU A;  1AVZ C;  2ROT A;  4JJD A;  1AEY A;  2CUB A;  2ROL A;  3SEM A;  1TUC A;  4F16 A;  2PZ1 A;  1NLO C;  3UA7 A;  1K1Z A;  2J7I A;  3PE0 A;  4Z89 A;  4OMN A;  2KNB B;  1VYT A;  1E7O A;  1NEB A;  1W70 A;  2V1Q A;  2J6F A;  3IQL A;  1SSH A;  1BU1 A;  2EGE A;  1Z9Q A;  1TUD A;  1X6B A;  1PKT A;  2YUO A;  4R0K A;  1QCF A;  4J9F A;  2PNI A;  3H0I A;  3VRZ A;  1Y0M A;  4QT7 A;  1AWW A;  3GBQ A;  5IHK A;  4HVV A;  2AKL A;  2CSQ A;  1OV3 A;  2D8J A;  1TG0 A;  1U5S A;  1BB9 A;  1VYU A;  2DA9 A;  4HCK A;  1ZUY A;  2KYB A;  1KFZ A;  4E6R A;  3C0C A;  2BZX A;  3JV3 A;  4D8D A;  1AWX A;  4DEY A;  1X27 A;  3UF4 A;  1GBR A;  1U06 A;  2EKH A;  4AFS C;  1PRM C;  1KIK A;  2L3Q A;  2AZS A;  2KRO A;  2DL4 A;  4GLM A;  1FMK A;  2KRS A;  3RBB B;  1WXT A;  3VS2 A;  2EVR A;  1NG2 A;  2CDT A;  2A36 A;  1ABO A;  4OML A;  4Z88 A;  2YUP A;  2L0A A;  2DJQ A;  1UDL A;  2DL7 A;  1X2K A;  1KJW A;  4AG2 C;  1T3S A;  2VVK A;  2CH4 W;  3O5Z A;  4CC7 A;  2CH4 A;  2ECZ A;  4OMO A;  2PTK A;  1ZLM A;  2CSI A;  2BZ8 A;  1AZG B;  4LUD A;  1ARK A;  3UAT A;  3TVT A;  2DIL A;  2FPD A;  3TSZ A;  2O9V A;  4RTW A;  2DYB A;  3H41 A;  2ABL A;  2DM1 A;  1QKX A;  1UTI A;  2H8H A;  1W6X A;  3QWX X;  1X2Q A;  2OJ2 A;  2A37 A;  1RI9 A;  4ESR A;  2CT4 A;  3ZL7 C;  2B86 A;  2C0I A;  1KSW A;  3EHR A;  2RQR A;  3CQT A;  1YP5 A;  2EW3 A;  2HEQ A;  2BZY A;  4RTV A;  2QDL A;  2DF6 A;  2AZV A;  1GFD A;  1CKB A;  1GCP A;  3M0R A;  2GNC A;  2VKN A;  3I9Q A;  3M0Q A;  3KFV A;  2LCS A;  2M0Y A;  2D8H A;  2RQT A;  3RNJ A;  2YT6 A;  1CKA A;  2K7A A;  4LN2 A;  1OPK A;  4J9I A;  1X43 A;  2D0N A;  2D1X A;  3SHW A;  2DLP A;  1K0S A;  1X6G A;  1RLQ C;  1SHG A;  1N5Z A;  1K76 A;  3VS5 A;  2LQW A;  2VWF A;  3VS6 A;  3EG1 A;  1VYV A;  4RTY A;  5IHN A;  2KBT A;  1WYX A;  4IIM A;  2K3B A;  5GJW B;  2K9G A;  1HD3 A;  4ORZ A;  1M3A A;  3A98 A;  2O2O A;  4J9H A;  2HCK A;  5FWB A;  1HSQ A;  5I11 A;  2J05 A;  3VS0 A;  1AD5 A;  3VS4 A;  1UHC A;  1M30 A;  1M8M A;  2LZ6 B;  3H0H A;  3M0U A;  5GJV B;  2L3S A;  2EGA A;  1I0C A;  4JJB A;  1MV0 B;  1B3Q A;  1YN8 A;  1G2B A;  3I5R A;  1G83 A;  1QWF A;  1SRL A;  1ZBJ A;  2CT3 A;  1BBZ A;  2O88 A;  1UE9 A;  2C0O A;  1ZUK A;  2K6D A;  2JM9 A;  1JEG A;  2FRY A;  1IO6 A;  1FYN A;  1RLP C;  1E6G A;  2YUN A;  1YWP A;  2RQW A;  1SPK A;  3R6N A;  1V1C A;  2LJ3 A;  3VS3 A;  4IIO A;  2LP5 A;  1UHF A;  4WCI A;  1GFC A;  2BTT A;  1M27 C;  4D8K A;  1E6H A;  3EG3 A;  2X3W D;  2KE9 A;  2KRN A;  2LMJ A;  3THK A;  2JT4 A;  3EHQ A;  3H0F A;  1K4U S;  2G6F X;  3I35 A;  2M51 A;  1PNJ A;  2X3X D;  5ECA A;  2EGC A;  2SEM A;  2EYZ A;  2JW4 A;  1JXM A;  2DE0 X;  4JPB W;  1QKW A;  2RN8 A;  5L23 A;  3ULR B;  2RQU A;  3VS7 A;  2FO0 A;  4OMP A;  2YSQ A;  4CC3 A;  2DL3 A;  4ZNX A;  3EG0 A;  2A08 A;  1QWE A;  2EYW A;  1WXB A;  4J9D A;  4AFZ C;  1AOJ A;  1ABQ A;  1PKS A;  2HSP A;  2KGT A;  3QWY A;  4A63 B;  1PWT A;  2J6O A;  1JXO A;  1WA7 A;  2F2W A;  1Y57 A;  1T3L A;  1BK2 A;  2JMA A;  5IH2 A;  4AG1 C;  1WX6 A;  4X1V A; 
#chains in the Genus database with same CATH topology
 4RTT A;  2LC4 A;  3FJ5 A;  3RKX A;  1NLP C;  3GPL A;  1K9A A;  2JM8 A;  2NUZ A;  2DYI A;  1GCQ C;  4M78 F;  1VIF A;  1VQK Q;  1QW1 A;  1AZE A;  4BY6 C;  4LUE A;  1MV3 A;  2HQE A;  2HBW A;  1VQM Q;  5D7U A;  1BI0 A;  4JDS A;  1M5Q 1;  3CPW P;  1QVP A;  5GMK h;  2DL8 A;  4N0A A;  2ZPE B;  1I1J A;  3GOX A;  3QO3 A;  2F2V A;  1B34 B;  3RMS A;  3Q1J A;  2FVU A;  3HL8 A;  2H3J A;  3RDV A;  1UEC A;  1M3C A;  4Q5W A;  2MIO A;  3CMA Q;  4E7L A;  4QQD A;  1S1N A;  1ZX6 A;  1HJD A;  1MNE A;  5CKH A;  2CUD A;  4FT2 A;  1LNX A;  2W0Z A;  1VQO T;  2EQU A;  2F69 A;  4M77 F;  2GCX A;  2OI3 A;  4JRP A;  1M4Z A;  1ACM B;  4XU0 A;  3UA6 A;  4CC2 A;  1VQP A;  1OQK A;  3A8G B;  4PJJ A;  3TSW A;  1M8V A;  2K4Y A;  2DFU A;  5LJ5 d;  2C0T A;  5IXB A;  1ZQ1 A;  1OOT A;  2RM4 A;  4C92 D;  4J9G A;  3PGG A;  2V8J A;  2LJ0 A;  1WIE A;  1YHQ Q;  1YJ9 T;  2FEI A;  1WQW A;  5GAO m;  2EKO A;  2XU8 A;  1KQS S;  1ZSZ A;  2RHI A;  2O9S A;  3CCJ A;  1JU5 C;  5GAN h;  2YXY A;  3REB B;  2OTJ T;  4XU1 A;  2KYM A;  4E2F B;  1H8K A;  4ZTF A;  1GL5 A;  3MEW A;  4AMC A;  3SD4 A;  3CC2 T;  1YWO A;  4M4Z A;  1XNI A;  2DTO A;  2PVO B;  2V26 A;  3OS1 A;  2A0F B;  4C8Q G;  2K5F A;  1N8R R;  1ZUU A;  2XIC A;  1R77 A;  1VQM T;  5CKB A;  3A8M B;  4AT1 B;  5LJ5 g;  2HDA A;  3GNG A;  2C06 A;  4E7K A;  4DBH A;  4GBQ A;  1MMD A;  4J7F A;  4M78 G;  2O31 A;  4PJO C;  3OSV A;  3CCE Q;  3QII A;  4HVW A;  4KRT A;  4BUG A;  2MCN A;  2LQN A;  4J9E A;  3CMA T;  2K5L A;  4E7Z A;  3OYC A;  4DEX A;  3REA B;  4C0F A;  1NM7 A;  2CP3 A;  2EYY A;  3CD6 A;  3CC7 Q;  2YUQ A;  3MO8 A;  4M7D A;  4BDY A;  1MHN A;  2JNG A;  4C5E A;  3OYG A;  2LCL A;  3M55 A;  3MEU A;  4F17 A;  5CQY A;  1SEM A;  1ZHI A;  2ESW A;  2EWN A;  2GTO A;  3U23 A;  2ED1 A;  3MHX A;  1ZA1 B;  2X4Y A;  4M78 D;  3QUI A;  2M0O A;  3EH2 A;  1JJ2 S;  1A0N B;  2P0Q A;  3N5B B;  2ROT A;  1YHQ T;  3M57 A;  1AHJ B;  1P92 A;  4F16 A;  2QTV A;  3OYM A;  3P8H A;  2R57 A;  3UDC A;  5FRN A;  2E3I A;  2J7I A;  3OS5 A;  4C0G A;  1SF9 A;  1W70 A;  2NUT B;  2J6F A;  2AT1 B;  5I2M A;  2R58 A;  4HCB A;  4M77 D;  4L5G A;  1D0Y A;  1Y0M A;  2K3X A;  5GAN f;  1R0B G;  1AWW A;  5GAM j;  1KC8 U;  3GBQ A;  5IHK A;  2P4T A;  2QGG A;  2CSQ A;  2JN0 A;  5KYN A;  4CRI A;  5GAM e;  1PD0 A;  1OV3 A;  1VQ5 A;  3I55 A;  4C8Q E;  1BB9 A;  2DA9 A;  4PKC C;  3OMG A;  1M1K U;  4HCC A;  3ZBD A;  1MMG A;  2CZ7 B;  3OYL A;  4D8D A;  2X9H A;  3UF4 A;  1WHG A;  4M78 E;  4AFS C;  4IKF A;  4PLI A;  3PFS A;  2DD5 A;  2DL4 A;  3GNF B;  4M7A A;  3MKD A;  1VQK A;  2VUB A;  3A8O B;  1TWB A;  1KG1 A;  3MP6 A;  2A36 A;  1ABO A;  3HHT B;  4Z88 A;  4KH1 B;  3HP9 A;  2DL7 A;  1K8A R;  2DTI A;  3JB9 F;  1KJW A;  4CC7 A;  4JRQ A;  1AZG B;  2E6Z A;  4LUD A;  3JCM e;  1WHK A;  2HQX A;  2MAM A;  4DBQ A;  2DIL A;  4WTO B;  3VUB A;  5KYY B;  5FU7 C;  4UC4 A;  1PCX A;  3JCM Q;  4RCC A;  1BCO A;  2C0I A;  2RD1 A;  5CKE A;  1AT1 B;  3CQT A;  1YP5 A;  2EW3 A;  2BZY A;  2OX7 A;  3CCR Q;  4IUQ A;  5CKD A;  1CKB A;  1GCP A;  3M4G A;  4P5N A;  1D0X A;  4PLL A;  2RQT A;  3QKJ A;  3RNJ A;  2YT6 A;  1Q82 R;  4KUI A;  1VQ4 T;  4LN2 A;  1OPK A;  2D0N A;  2D1X A;  3CCM Q;  5HY6 A;  3G1J A;  2RJC A;  4E7H A;  3LGL A;  2LQW A;  5IAY A;  3ZEH A;  2VWF A;  2LRQ A;  1MMA A;  3E9G A;  3QHS A;  2DTH A;  2JOY A;  4PK4 A;  4F7U A;  4R56 A;  2QQS A;  2QQB A;  5J39 A;  4BD3 A;  2LNV A;  2K9G A;  3OBW A;  2EJ9 A;  4ORZ A;  1M3A A;  2LQ8 A;  3CCV A;  3PT9 A;  4XTW A;  3A98 A;  1RAC B;  5CIU A;  3PNW C;  2JTM A;  2HSE B;  3VS0 A;  2QEX A;  1M8M A;  5FU6 C;  4JUV A;  2ATC B;  3CCE A;  4DOW A;  2R5A A;  4KUD K;  1MV0 B;  1G2B A;  4HCZ A;  2QYZ A;  1G83 A;  1QWF A;  1SRL A;  2KI7 A;  2QI2 A;  1BBZ A;  4OGE A;  4M75 A;  1FX7 A;  1ZUK A;  1ZSZ B;  2XDB A;  2CP7 A;  2K6D A;  3WXM B;  1RAG B;  1C0M A;  3CXC P;  3CC7 A;  2YUN A;  1NPR A;  1RAF B;  1YWP A;  1PC0 A;  4LDV A;  2QA4 T;  3QZ5 B;  4XTY A;  3OW2 S;  4Y91 A;  2LJ3 A;  4RG8 A;  4C92 B;  4JJN K;  2BTT A;  1NJI U;  2Y90 A;  3EG3 A;  5LJ3 j;  1N8R C;  2RJE A;  3I35 A;  2M51 A;  5LJ3 e;  5GAN d;  1VQN Q;  2EGC A;  4OB2 B;  1UGS B;  3JB9 D;  2DE0 X;  3A8L B;  3UPU A;  3VJP A;  4JPB W;  3CCM T;  3ULR B;  2XK0 A;  4M78 C;  3M56 A;  1QVF A;  3CCS Q;  4OMP A;  3TCJ A;  3C94 A;  2DL3 A;  1Q7Y U;  1QMC A;  2EYW A;  1AOJ A;  4QVD A;  3CC4 A;  4EMG A;  4IUU A;  3EFS A;  1FMV A;  3TRE A;  1WA7 A;  5GAO p;  2PVD B;  1Y57 A;  1K9M R;  2FZG B;  4M7D B;  2L89 A;  2JMA A;  1G8X A;  1U1S A;  1WX6 A;  4IUV A;  4NS5 A;  2FRW A;  2QQR A;  2KR3 A;  3OA6 A;  2LX7 A;  2FB7 A;  2DX1 A;  4J83 A;  4Z02 A;  3M0P A;  5CR2 A;  3QJY A;  1VQ9 A;  4JZ4 A;  3L1A A;  2CYZ B;  3PMT A;  2XDP A;  5GAN g;  1Q81 R;  5KH6 A;  4LDX A;  1G3T A;  3CCL Q;  2EPD A;  4F14 A;  1VQ7 Q;  2VGN A;  4M77 C;  1UB4 A;  2ED0 A;  2COZ A;  3OYE A;  3EFO A;  3G4S Q;  3M53 A;  4L59 A;  2K2V A;  2W10 A;  1D1C A;  2E4H A;  2DRK A;  2ZGW A;  2LJ1 A;  1NYG A;  3EAE A;  1U8R A;  3SDZ A;  4KGZ B;  1I8F A;  1OYX A;  4PFZ A;  1JJ2 A;  3QPH A;  1Q86 R;  1OPL A;  2HD0 A;  3GF5 A;  1MUZ A;  1PHT A;  4E7I A;  2IPO B;  3NTK A;  2RB6 A;  2DXC A;  4II1 A;  1I07 A;  1B07 A;  1AWO A;  9ATC B;  2J06 A;  2LX9 A;  1VQN T;  3BDL A;  4LXC A;  2LVM A;  1UFF A;  2NWM A;  5LJ5 j;  3CCS T;  4Z8A A;  3OY9 A;  1Y07 A;  2AKK A;  2E5Q A;  1RUW A;  2P84 A;  5LJ5 e;  1M90 U;  1WDX A;  3CPW S;  1M9S A;  5GAN 3;  5GMK l;  1JQQ A;  2JS0 A;  1ZSG A;  3VRY A;  3EG9 A;  3EGU A;  5FRM A;  1NE8 A;  1WLP B;  4A54 A;  5DLQ E;  4M7A B;  3FRN A;  4LD9 K;  4LDU A;  5GAO n;  3CCR A;  1VQ8 T;  4OMF B;  2CP5 A;  2KEA A;  2PQW A;  1UUE A;  5L8R E;  3FC3 A;  2ZCF B;  2JTE A;  1LJO A;  2LDM A;  2E64 A;  2ENM A;  2P4R A;  3L2V A;  2LT4 A;  2RI3 A;  2OAW A;  4XTX A;  4C0Z A;  3CCQ Q;  4CC4 B;  3I56 T;  1OZ3 A;  2KMT A;  4FM4 B;  1VQ7 T;  2JTF A;  2EIF A;  3JB9 I;  3HRT A;  4E7S A;  2E41 A;  1YJ9 Q;  1VA7 A;  8ATC B;  2DKG A;  1WNL A;  2RK2 A;  2WAC A;  1X75 C;  7AT1 B;  3E19 A;  2NLU A;  4QVC A;  2RO0 A;  1Y7X A;  4J9C A;  1H3Z A;  2RQV A;  2OTJ Q;  4LNP A;  2RMO A;  3QG1 A;  1QCN A;  4MZM A;  3J81 E;  1PRL C;  3CC2 Q;  2RA2 A;  4FSX A;  3QYG B;  2QTX A;  4RUG A;  1SG5 A;  4AFU C;  1KQ1 A;  1WFW A;  4IUP A;  4OF1 A;  2O4X A;  5GAN 7;  1Q82 C;  4RTZ A;  3P8B B;  2DVE A;  4Y92 A;  1W1F A;  3BFM A;  2KT1 A;  2XMF A;  2JVV A;  2CZ0 B;  2DNU A;  4JJD A;  4C92 G;  1ZBX A;  2CUB A;  2E65 A;  3EGX A;  1TUC A;  3MJX A;  4F7U B;  2DET A;  4NOY A;  1Q95 G;  4PL6 A;  1KD1 R;  1S72 T;  1K1Z A;  1MMN A;  4XTU A;  4EMK A;  3PE0 A;  2KK4 A;  4Z89 A;  2KNB B;  3IQL A;  1E7O A;  1W2B A;  1Z9Q A;  5CQX A;  3CME A;  4M7A F;  1TUD A;  1X6B A;  1K73 C;  1VQN A;  1FXX A;  1QCF A;  3LX7 A;  3CCQ T;  2BKD N;  3H0I A;  4EMH A;  3VRZ A;  3M59 A;  3CEY A;  3X20 B;  2AKL A;  4Y28 E;  5CKF A;  4M7D G;  2L5Q A;  2YRD A;  2BE9 B;  3OYK A;  1M1F A;  4M75 B;  2KYB A;  1KFZ A;  1YJW Q;  1QVF S;  2BZX A;  4DEY A;  2MWO A;  1X27 A;  1VQL A;  3DB4 A;  2BUD A;  1HK9 A;  3RES A;  2AZS A;  2KRO A;  4GLM A;  1FMK A;  2DJZ A;  3RIR A;  1EIF A;  3RBB B;  1WXT A;  1QCO A;  2EJF A;  1YFN A;  3CCL A;  1VQ6 A;  3V8J A;  3VYG A;  2YUP A;  4M7D D;  2L0A A;  2DJQ A;  3INZ A;  4LDW A;  4KGV B;  1WQ7 A;  1T3S A;  2VVK A;  3E9F A;  3G4S A;  4OGC A;  2CSI A;  2YRC A;  1D0Z A;  2BZ8 A;  3OB9 A;  3BE3 A;  3UAT A;  2FHD A;  2ZAE A;  1M1G A;  1WPY A;  3OW2 A;  1YI2 Q;  1H64 1;  3MP1 A;  4BE0 A;  2RI2 A;  1D3B A;  1W6X A;  4RMO A;  2OJ2 A;  2DZC A;  1YIT Q;  1VIE A;  4BI8 B;  2RHZ A;  3L2Z A;  1K9M C;  4C92 E;  3EHR A;  2GFA A;  3VU3 C;  4F7U F;  1HXD A;  3S6W A;  1NZ9 A;  2HEQ A;  3QXE B;  4J8O A;  3SFM A;  8AT1 B;  3OYY A;  1IB8 A;  2AZV A;  5KYW A;  2GNC A;  1Q81 C;  2VKN A;  3I9Q A;  3M0Q A;  4M77 G;  3DLL A;  3KFV A;  2M0Y A;  5GAO q;  3M4Y A;  1QP3 A;  4J9I A;  1X43 A;  3V8L A;  1NBE B;  3T9N A;  4E7J A;  1BI3 A;  3HPW A;  1YJW T;  5HK0 A;  4QKU A;  4OB1 B;  3RER A;  1RI0 A;  3VS6 A;  1VYV A;  4M75 F;  4RTY A;  4M7D E;  3X25 B;  1VQO A;  1WYX A;  2XD0 A;  5J26 A;  4C8Q A;  3PIP A;  6AT1 B;  1KHC A;  1M2V A;  5GMK j;  1Q86 C;  3V7S A;  2PVG B;  1I81 A;  3QZ9 B;  5GMK e;  4J9H A;  4QVZ A;  5FWB A;  1HSQ A;  4M7A D;  1WJR A;  3NTI A;  1VQ4 Q;  2JUF A;  3RR6 A;  1YJ9 A;  1IRE B;  2LZ6 B;  3OYF A;  1K73 U;  4ZGD B;  4E47 A;  2L3S A;  2EGA A;  4JJB A;  3LH0 A;  4MDW A;  2X51 A;  1YJN Q;  3MPU B;  1YI2 T;  2C0O A;  3ASK A;  2OTJ A;  5CAI A;  3URG A;  2JM9 A;  2YWW A;  1IO6 A;  1YIT T;  2GQV A;  1FYN A;  3CC2 A;  1E6G A;  4OB3 B;  4N0A C;  2ZPF B;  1VQM A;  5A0D A;  4IIO A;  4D8K A;  2X3W D;  2KE9 A;  2KRN A;  4ZN3 A;  3CPW A;  3H0F A;  2QXF A;  5ECA A;  4CI0 C;  2SEM A;  1OUL A;  2EYZ A;  2KDS A;  3MCA B;  1TH7 A;  3HTR A;  5GAN e;  1V29 B;  3JRZ A;  3TU4 K;  2F5K A;  3VS7 A;  3CMA A;  3C4S A;  3V7C A;  4RKU E;  2CS7 A;  4ZNX A;  3EG0 A;  5CVI A;  2A08 A;  4M77 E;  4AFZ C;  1ABQ A;  1PKS A;  3HSB A;  4A63 B;  1PWT A;  2J6O A;  1WGS A;  2F5T X;  3GP8 A;  2QA4 Q;  2F2W A;  2VYT A;  1PSE A;  2CGH A;  5KE2 A;  3M58 A;  4XQ3 A;  3SWN A;  3RKW A;  2DXB A;  2DIQ A;  2GQI A;  2FYK A;  1AWJ A;  3OYI A;  3EGD A;  5D6Y A;  1X6O A;  4FL6 A;  2I0N A;  2WSE E;  1W2B S;  3G6E T;  1ZSZ C;  2KAF A;  3X24 B;  1FMW A;  1SHF A;  2L3P A;  5FWC A;  1YHQ A;  2WSF E;  3VUZ A;  3M0S A;  2AHJ B;  4FW1 A;  1R0C B;  4PJO F;  1O75 A;  1QLY A;  3VS1 A;  2JZ2 A;  3S3O A;  2XHC A;  1YJW A;  3KBG A;  2L2P A;  4HKE A;  2MOX A;  1YJN T;  4C92 C;  2LT1 A;  2BE7 D;  5DY9 A;  1LOJ A;  3OS0 A;  5M9O A;  3HRU A;  3WVE B;  4EMK B;  1CSK A;  4M75 D;  4DBF A;  1KD1 C;  2RH2 A;  1J3T A;  2X4J A;  4V2S A;  1IXD A;  1B34 A;  1H92 A;  2ZPH B;  3D7S B;  4DBR A;  5IXF A;  4RTX A;  2A28 A;  4JS5 A;  1KK7 A;  4A4F A;  1KC8 R;  2MI6 A;  3CPF A;  3GLX A;  3UWN A;  3QDR B;  1I5L A;  3V8K A;  2K5I A;  4M7D C;  3JB9 G;  1M1K R;  2EJG A;  4XTV A;  3JCM W;  1EFN A;  3LW5 E;  1RL2 A;  1WI7 A;  4XTZ A;  5KYU A;  3CCU T;  4JJC A;  3G71 T;  1GRI A;  2COW A;  3J7A F;  1GCQ A;  2ZPB B;  2RNA A;  5I22 A;  1JO8 A;  3M0T A;  4A53 A;  4DOV A;  2Z0W A;  3OYB A;  2QQA A;  2Y4X A;  4OVA A;  1NYF A;  4HXJ A;  3RKY A;  5GAN 5;  1XOV A;  5AYF A;  2DRM A;  3OYN A;  4BE2 A;  4J6X A;  2CP6 A;  3UT1 A;  5KCH A;  3ZFJ A;  2EBP A;  1PG5 B;  4RTU A;  1GXI E;  3HRS A;  4EPC A;  4B6M A;  4LE9 A;  2HAX A;  5IT9 E;  1WXU A;  1D3B B;  2V1R A;  3P8D A;  3SB2 A;  3VV0 A;  4BB7 A;  4IUT A;  1OU9 A;  1K0X A;  1T0H A;  2JJ9 A;  4HA8 A;  4OMM A;  1VQ8 Q;  2EYX A;  4FYW B;  2LNH B;  2DXU A;  3I5S A;  4BAC A;  4KH0 B;  5EC7 A;  2KXC A;  2I2L A;  2HKN A;  3VKI A;  2FL7 A;  1VQ4 A;  1QVG P;  1N9S A;  2FPF A;  2E1H A;  3JCM V;  3NTH A;  2P0K A;  3I56 Q;  3NPF A;  2DMO A;  4RG2 A;  2GFU A;  3H6Z A;  1OX9 A;  4XAX B;  5FLX E;  4JRI A;  2XG8 D;  1RAE B;  4K11 A;  2G3R A;  2JS2 A;  4M7A C;  2FZK B;  1YJN A;  3S3M A;  2GGR A;  2J6K A;  1AVZ C;  3QJ6 A;  2ROL A;  3HFN A;  3SEM A;  2NUP A;  2PZ1 A;  3A1P A;  4KUL A;  1NLO C;  1RAD B;  2HZY A;  3F70 A;  1IZ6 A;  4C8Q B;  3OYA A;  3OYJ A;  3UA7 A;  1M2V B;  2COY A;  2RHU A;  1NEB A;  3JCM X;  2DD4 A;  1SSH A;  4RCB A;  2EGE A;  5I21 A;  2CZ1 B;  1YIJ Q;  4PJO A;  4PFP A;  5FRO A;  1F1B B;  4C5I A;  2ZPI B;  2PNI A;  3G7Z A;  1DJ7 B;  3C95 A;  2CP2 A;  4IUR A;  4J5Y A;  4FYV B;  2VV5 A;  2D8J A;  1U5S A;  4ZGE B;  1PM3 A;  2QA4 A;  3E1S A;  4E6R A;  3OYD A;  1AWX A;  1S72 Q;  1RAI B;  1OX8 A;  1GBR A;  5A0G A;  4C0D B;  1U06 A;  4A4E A;  2EKH A;  1PRM C;  2QAZ A;  2L3Q A;  2NYS A;  3FDR A;  2PU9 B;  1G3W A;  1WHJ A;  1KHI A;  2DXT A;  1NJI R;  4X34 A;  2P0P A;  1K8A C;  2KY9 A;  3CCJ T;  3CCM A;  4OML A;  3OS2 A;  4OP0 A;  1UDL A;  1G3S A;  3MEA A;  1V76 A;  3L2R A;  1X2K A;  5HK3 A;  5GAO l;  4AG2 C;  2V8K A;  2CH4 A;  5C6S A;  2MWP A;  4TVR A;  1N8R U;  1ZLM A;  4QW2 A;  3DLM A;  2L8D A;  1Q7Y R;  1ARK A;  5DM7 R;  3TVT A;  1WHL A;  2PUO B;  2FPD A;  2O9V A;  4RTW A;  4QQ6 A;  2DYB A;  3H41 A;  2ABL A;  2DM1 A;  1G5V A;  2AIR B;  1UTI A;  3QWX X;  1X2Q A;  1RI9 A;  1WZO A;  2CT4 A;  3ZL7 C;  3SWN B;  3QBY A;  1KSW A;  2MYS A;  2M16 A;  3EGD B;  4X9D A;  4A4K A;  4C8Q F;  4M75 C;  1YIJ T;  2QAS A;  3QSU A;  3M0R A;  3CD6 T;  2DEQ A;  2EQK A;  5LJ3 g;  3PTA A;  1LVK A;  2D6F A;  3BDU A;  1IGU A;  2D8H A;  4JRK A;  2K7A A;  1Y96 A;  2HQH A;  4ELZ C;  4A4H A;  1LPL A;  1RLQ C;  1WJQ A;  1IGQ A;  1D1A A;  3CXC A;  1N5Z A;  3BW1 A;  1BKB A;  3VS5 A;  4ATO A;  1X01 A;  2YHT A;  2YRV A;  5GAM h;  4IIM A;  2E6N A;  2FZC B;  2QK0 A;  5GJW B;  4B9X A;  1HD3 A;  5GMK m;  1TU0 B;  3HKS A;  2HCK A;  3CCS A;  1WHH A;  1KC8 C;  3OSS C;  2J05 A;  3JCM b;  5KCO A;  1AD5 A;  1UHC A;  1M30 A;  3M54 A;  1M90 R;  5GJV B;  5KYU B;  1G3Y A;  1M1K C;  1WJS A;  4PJN A;  1B3Q A;  2IG0 A;  2B8A A;  2CT3 A;  1RAH B;  2RJD A;  2VGM A;  2O88 A;  1UE9 A;  1VQ8 A;  1HYO A;  1M2O A;  3MEV A;  4PJL A;  2M1H A;  1JEG A;  1TTH B;  4BY6 B;  2FRY A;  1VQ5 T;  3I55 T;  1BCM A;  3JCM h;  1IHV A;  4L6V 5;  2EYQ A;  4KT0 E;  2RQW A;  1SPK A;  2YLC A;  4BDZ A;  5GAN 4;  2X35 A;  3I56 A;  1QVG A;  3KXT A;  1VQ7 A;  5GAN 6;  1UHF A;  4EDU A;  4KBM B;  1GFC A;  4O6J A;  2RK1 A;  1M27 C;  2MF2 A;  3TQ7 P;  3FIF A;  1K4U S;  2L3R A;  1PNJ A;  2X3X D;  1VQK T;  4C92 A;  5D6W A;  2JW4 A;  1OI1 A;  3CCV Q;  2D9T A;  1K8A U;  1QKW A;  2RN8 A;  5L23 A;  5DLO A;  2FO0 A;  4CC3 A;  3LWI A;  3L2Q A;  3J80 E;  4BE1 A;  3LGF A;  4GLK A;  2QEX Q;  3H8Z A;  2HL5 C;  3QWY A;  1OZ2 A;  1JRI A;  1C6V X;  4FYX B;  1JXO A;  1R8O B;  4LD6 A;  1RAA B;  1T3L A;  4MDX A;  4LDY A;  1YIJ A;  1C1A A;  5IH2 A;  4AG1 C;  5I2S A;  2DVJ A;  4FSS A;  3PVQ A;  2XID A;  2O01 E;  4C8Q D;  1YCS B;  2ZZD A;  3EFO B;  4MMK A;  1UEB A;  4BI4 A;  5GAM f;  4M7A G;  4XU2 A;  1OEB A;  5GMK i;  2RHX A;  2X4X A;  1Q82 U;  3JB9 H;  2LQK A;  5CO7 A;  2RPN A;  2EQM A;  2NUP B;  1S72 A;  4AFQ C;  5FW9 A;  1VUB A;  1QP2 A;  1KQS P;  2GTJ A;  5C0M A;  1QVF P;  3ER0 A;  1YCY A;  2DBM A;  1SRM A;  2KXD A;  1YBY A;  2RI5 A;  5IHI A;  1Z9Z A;  1XQH A;  2K2M A;  4FYY B;  1U3O A;  3CCQ A;  2AK5 A;  5J3B A;  3CC4 Q;  4PJO B;  2XI9 A;  3CBP A;  2YLB A;  3G6E Q;  1LCK A;  4M78 A;  4C5H A;  4PJM A;  3E2U A;  2JXB A;  2F2X A;  4NL2 A;  2DL5 A;  2GBQ A;  1NEG A;  1JB0 E;  3JCM f;  5KE3 A;  5A0L A;  2QG9 B;  4FIB A;  3AHU A;  3CCV T;  2JMC A;  5KYX A;  2SRC A;  1KQ2 A;  1M3B A;  2CRE A;  3EG9 B;  2HKQ B;  1VQ9 Q;  2E5K A;  1TOV A;  1UJ0 A;  1ZA2 B;  2KT8 A;  2K3Y A;  2FG0 A;  1T0J A;  2QEX T;  2FPE A;  3V7R A;  1N27 A;  2EFI A;  3FLG A;  5LJ3 h;  3LYI A;  2BIV A;  4B9W A;  2DBK A;  5HCK A;  3CCE T;  2CP0 A;  1PD1 A;  4OMQ A;  1Y71 A;  2E70 A;  1O9S A;  1UJY A;  3EG2 A;  1YNZ A;  4M77 A;  1OU8 A;  1BIA A;  1NJI C;  3CC7 T;  4F7U G;  2KRM A;  5GAN j;  1JJ2 P;  1UGV A;  1GBQ A;  2KSS A;  4EMK C;  3L2W A;  4O5V A;  4FT4 A;  1Q7Y C;  3CCU Q;  2HBP A;  1H3H A;  3G71 Q;  4M7A E;  3C12 A;  5GAN 8;  2A7Y A;  4NL3 A;  3JSC A;  2K79 A;  2EAY A;  1TSF A;  3CXC S;  3FB9 A;  3LWH A;  3FEO A;  2V8I A;  4FU6 A;  5LL6 S;  3JCM P;  4HVU A;  4EIK A;  1W4S A;  4M75 G;  2MK5 A;  3FJP A;  3CC4 T;  4ZN1 A;  1K9M U;  4J9B A;  3PVL A;  2O4X B;  3VYH B;  3S3N A;  2DEU A;  4HT9 A;  2LCC A;  3NGP A;  3GIB A;  2IIM A;  3HFO A;  2VXF A;  2EQI A;  2DER A;  3LH5 A;  4JLG A;  3L2U A;  1Y96 B;  4JZ3 A;  3EGX B;  2YDL A;  1Q81 U;  3NMZ C;  2K57 A;  2HL3 A;  1VOM A;  3NHN A;  1VQ9 T;  2RF0 A;  1NPP A;  1UG1 A;  4JLI A;  4OB0 B;  1X69 A;  1AEY A;  3O8V A;  1MND A;  3MP8 A;  3LLR A;  2OTL Q;  4MZT A;  1WHM A;  5LJ5 h;  4OMN A;  1D09 B;  4KGX B;  1VYT A;  4XK8 E;  2V1Q A;  3DKM A;  1BU1 A;  2VXE A;  4N4H A;  4MML A;  3X28 B;  1PKT A;  5FU7 B;  2CKK A;  1Q86 U;  2F1L A;  3TEE A;  5LJ3 f;  1TUG B;  2YUO A;  4R0K A;  1QVG S;  4J6Y A;  4J9F A;  1K73 R;  2RHY A;  4QT7 A;  5GAM d;  5HKC A;  1PSF A;  1YI2 A;  4ANJ A;  4HVV A;  1JBM A;  3MET A;  1MGQ A;  1M90 C;  4F7U E;  1YIT A;  2KVQ G;  5A2Q E;  3WVD B;  1TG0 A;  1VYU A;  4HCK A;  1ZUY A;  2DPP B;  2HMA A;  1D1B A;  3C0C A;  3JV3 A;  1BI2 A;  2RJF A;  3OMC A;  3QYH B;  1KIK A;  3H9N A;  2MMP A;  2DZ9 A;  5D6X A;  4ZGJ B;  1I5O B;  2KRS A;  4ZTJ A;  4A4G A;  2LTO A;  2HNI A;  2QGF B;  3VS2 A;  1EX4 A;  2EVR A;  2VC8 A;  5EG2 A;  1NG2 A;  2CDT A;  4JS4 A;  3EFR A;  5GAM g;  1W2B P;  3CCR T;  4M75 E;  3JCM d;  4BI3 A;  2CH4 W;  3O5Z A;  4C8Q C;  5IN1 A;  2DO3 A;  2ECZ A;  4OMO A;  3M5A A;  2A3L A;  5CK9 A;  2PTK A;  5CCA A;  3CME Q;  1VQP Q;  3KUF A;  4N4I A;  2QDY B;  5AT1 B;  2EQJ A;  3CBO A;  3TSZ A;  1IHW A;  1KQS A;  4PJO G;  2QQ9 A;  4YTL A;  4J7I A;  1QKX A;  2H8H A;  1U1T A;  2A37 A;  2X4W A;  4ESR A;  2E3H A;  4J6W A;  2B86 A;  4DA4 A;  2OTL T;  5GAO r;  3NFC A;  1I4K 1;  5FU6 B;  3G6E A;  5KYW B;  2RQR A;  1N9R A;  1B7T A;  2XKO C;  2E12 A;  3CCJ Q;  3R6O A;  2DAQ A;  4RTV A;  2QDL A;  2DF6 A;  1VQL Q;  1GFD A;  4FCY A;  3JB9 J;  3JCM g;  4HT8 A;  4X9C A;  2LCS A;  4C0D C;  1TS9 A;  4PJO D;  5LJ5 f;  1CKA A;  5GAN 2;  1VQ6 Q;  3SHW A;  2DLP A;  1K0S A;  1SKU B;  1X6G A;  2WSC E;  2ZPG B;  3RMQ A;  1SHG A;  2Y4Y A;  1RAB B;  1K76 A;  4FW2 A;  3PMI A;  2H3E B;  3EG1 A;  2D0Q B;  3A8H B;  2GF7 A;  2XDD A;  3PIO A;  5IHN A;  2KBT A;  3L42 A;  3OW2 P;  2K3B A;  4R55 A;  1KD1 U;  4M78 B;  4PNO A;  2O2O A;  3EH1 A;  2NUT A;  1UGP B;  1TXQ A;  3CD6 Q;  2M9U A;  2DIG A;  4MZP A;  4D6W A;  1BYM A;  5KYX B;  5I11 A;  2R5M A;  3CCU A;  1VQP T;  3VS4 A;  3SWN C;  3CME T;  3A5Z B;  3G71 A;  2M02 A;  3H0H A;  4C92 F;  3M0U A;  1XTD A;  4PFO A;  1I0C A;  3JAM E;  4F04 B;  1YN8 A;  4C5G A;  3I5R A;  1ZBJ A;  3QDF A;  2PUK B;  3RUX A;  1QQJ A;  3JCM J;  1EZZ B;  3X26 B;  1RLP C;  4ELY C;  1BI1 A;  4M77 B;  4PJO E;  3R6N A;  1FWZ A;  1V1C A;  1BIB A;  3DB3 A;  3VS3 A;  2LP5 A;  1VQL T;  4WCI A;  2KQW A;  1VQO Q;  2MPX C;  1E6H A;  1XJW B;  2DK3 A;  5LJ3 d;  2IVW A;  1SSF A;  2LMJ A;  3M9Q A;  1IRX A;  2JT4 A;  3OBY A;  3THK A;  4M7D F;  3EHQ A;  4GY5 A;  2G6F X;  1UGR B;  2E10 A;  1JXM A;  2OAU A;  3JCM c;  3CCL T;  1VQ6 T;  2RQU A;  4N4G A;  1UGQ B;  4VUB A;  3BY7 A;  2YSQ A;  4QQG A;  4DQ2 A;  3AT1 B;  3OQ5 A;  1N6A A;  1QWE A;  1VQ5 Q;  1WXB A;  4J9D A;  3G4S T;  4ME7 A;  3I55 Q;  2OTL A;  2VB6 A;  2HSP A;  3CBM A;  2KGT A;  4WF2 A;  5KYY A;  3OYH A;  3ME9 A;  4XU3 A;  2VAS A;  1BK2 A;  2CZ6 B;  4X1V A; 
#chains in the Genus database with same CATH homology
 2FRW A;  2DVJ A;  2KR3 A;  2GQI A;  3FJ5 A;  4FSS A;  3PVQ A;  4RTT A;  2LX7 A;  1AWJ A;  1NLP C;  1K9A A;  2JM8 A;  2NUZ A;  2DX1 A;  3M0P A;  1YCS B;  2I0N A;  4JZ4 A;  1GCQ C;  1SHF A;  2L3P A;  1AZE A;  5FWC A;  4LUE A;  1OEB A;  1MV3 A;  2EPD A;  2HBW A;  4F14 A;  3M0S A;  2ED0 A;  1QLY A;  3VS1 A;  2DL8 A;  2RPN A;  2L2P A;  2MOX A;  4AFQ C;  5FW9 A;  1I1J A;  2W10 A;  2F2V A;  2GTJ A;  2DRK A;  2LJ1 A;  1NYG A;  1UEC A;  1M3C A;  2DBM A;  1SRM A;  2MIO A;  1CSK A;  2KXD A;  5IHI A;  1Z9Z A;  1J3T A;  1S1N A;  1H92 A;  2K2M A;  1ZX6 A;  1U3O A;  1HJD A;  2AK5 A;  5IXF A;  2CUD A;  1OPL A;  2W0Z A;  1LCK A;  1MUZ A;  1PHT A;  4RTX A;  2A28 A;  2OI3 A;  2JXB A;  2F2X A;  1I07 A;  3UA6 A;  4CC2 A;  1B07 A;  2DL5 A;  2GBQ A;  1AWO A;  1NEG A;  2J06 A;  3TSW A;  2JMC A;  1UFF A;  2C0T A;  2NWM A;  2SRC A;  5IXB A;  1OOT A;  1M3B A;  2CRE A;  4Z8A A;  2E5K A;  2AKK A;  1UJ0 A;  1RUW A;  2KT8 A;  4J9G A;  1EFN A;  1WDX A;  2FG0 A;  1WI7 A;  1T0J A;  2LJ0 A;  1WIE A;  2FEI A;  4JJC A;  2FPE A;  1JQQ A;  2JS0 A;  1ZSG A;  3VRY A;  1GRI A;  2DBK A;  3EGU A;  5HCK A;  1GCQ A;  4OMQ A;  2RNA A;  2O9S A;  1WLP B;  5I22 A;  1JO8 A;  1JU5 C;  1UJY A;  3M0T A;  3EG2 A;  3REB B;  2KEA A;  1UUE A;  2KYM A;  1YNZ A;  1H8K A;  1GL5 A;  1YWO A;  4M4Z A;  2JTE A;  2P4R A;  1NYF A;  2ENM A;  4HXJ A;  2KRM A;  1XOV A;  2OAW A;  1UGV A;  1GBQ A;  2DRM A;  1ZUU A;  4CC4 B;  2HDA A;  2EBP A;  4GBQ A;  4RTU A;  1H3H A;  4LE9 A;  2O31 A;  1VA7 A;  1WXU A;  2V1R A;  4HVW A;  2K79 A;  4KRT A;  1K0X A;  1T0H A;  2MCN A;  2LQN A;  4J9E A;  4J9C A;  4OMM A;  4HVU A;  4EIK A;  2EYX A;  2RQV A;  4DEX A;  2LNH B;  3I5S A;  4LNP A;  3REA B;  1NM7 A;  2RMO A;  2EYY A;  5EC7 A;  2KXC A;  1PRL C;  2YUQ A;  4J9B A;  3PVL A;  4RUG A;  4AFU C;  2FPF A;  4F17 A;  3NGP A;  1SEM A;  2ESW A;  2GTO A;  2IIM A;  3U23 A;  2ED1 A;  1WFW A;  3NPF A;  2DMO A;  2EQI A;  3LH5 A;  4JZ3 A;  4K11 A;  2YDL A;  2JS2 A;  3NMZ C;  4RTZ A;  3NHN A;  1A0N B;  2RF0 A;  4Y92 A;  1W1F A;  2KT1 A;  2XMF A;  1UG1 A;  2GGR A;  2J6K A;  1X69 A;  2DNU A;  1AVZ C;  2ROT A;  4JJD A;  1AEY A;  2CUB A;  2ROL A;  3SEM A;  1TUC A;  4F16 A;  2PZ1 A;  1NLO C;  3UA7 A;  1K1Z A;  2J7I A;  3PE0 A;  4Z89 A;  4OMN A;  2KNB B;  1VYT A;  1E7O A;  1NEB A;  1W70 A;  2V1Q A;  2J6F A;  3IQL A;  1SSH A;  1BU1 A;  2EGE A;  1Z9Q A;  1TUD A;  1X6B A;  1PKT A;  2YUO A;  4R0K A;  1QCF A;  4J9F A;  2PNI A;  3H0I A;  3VRZ A;  1Y0M A;  4QT7 A;  1AWW A;  3GBQ A;  5IHK A;  4HVV A;  2AKL A;  2CSQ A;  1OV3 A;  2D8J A;  1TG0 A;  1U5S A;  1BB9 A;  1VYU A;  2DA9 A;  4HCK A;  1ZUY A;  2KYB A;  1KFZ A;  4E6R A;  3C0C A;  2BZX A;  3JV3 A;  4D8D A;  1AWX A;  4DEY A;  1X27 A;  3UF4 A;  1GBR A;  1U06 A;  2EKH A;  4AFS C;  1PRM C;  1KIK A;  2L3Q A;  2AZS A;  2KRO A;  2DL4 A;  4GLM A;  1FMK A;  2KRS A;  3RBB B;  1WXT A;  3VS2 A;  2EVR A;  1NG2 A;  2CDT A;  2A36 A;  1ABO A;  4OML A;  4Z88 A;  2YUP A;  2L0A A;  2DJQ A;  1UDL A;  2DL7 A;  1X2K A;  1KJW A;  4AG2 C;  1T3S A;  2VVK A;  2CH4 W;  3O5Z A;  4CC7 A;  2CH4 A;  2ECZ A;  4OMO A;  2PTK A;  1ZLM A;  2CSI A;  2BZ8 A;  1AZG B;  4LUD A;  1ARK A;  3UAT A;  3TVT A;  2DIL A;  2FPD A;  3TSZ A;  2O9V A;  4RTW A;  2DYB A;  3H41 A;  2ABL A;  2DM1 A;  1QKX A;  1UTI A;  2H8H A;  1W6X A;  3QWX X;  1X2Q A;  2OJ2 A;  2A37 A;  1RI9 A;  4ESR A;  2CT4 A;  3ZL7 C;  2B86 A;  2C0I A;  1KSW A;  3EHR A;  2RQR A;  3CQT A;  1YP5 A;  2EW3 A;  2HEQ A;  2BZY A;  4RTV A;  2QDL A;  2DF6 A;  2AZV A;  1GFD A;  1CKB A;  1GCP A;  3M0R A;  2GNC A;  2VKN A;  3I9Q A;  3M0Q A;  3KFV A;  2LCS A;  2M0Y A;  2D8H A;  2RQT A;  3RNJ A;  2YT6 A;  1CKA A;  2K7A A;  4LN2 A;  1OPK A;  4J9I A;  1X43 A;  2D0N A;  2D1X A;  3SHW A;  2DLP A;  1K0S A;  1X6G A;  1RLQ C;  1SHG A;  1N5Z A;  1K76 A;  3VS5 A;  2LQW A;  2VWF A;  3VS6 A;  3EG1 A;  1VYV A;  4RTY A;  5IHN A;  2KBT A;  1WYX A;  4IIM A;  2K3B A;  5GJW B;  2K9G A;  1HD3 A;  4ORZ A;  1M3A A;  3A98 A;  2O2O A;  4J9H A;  2HCK A;  5FWB A;  1HSQ A;  5I11 A;  2J05 A;  3VS0 A;  1AD5 A;  3VS4 A;  1UHC A;  1M30 A;  1M8M A;  2LZ6 B;  3H0H A;  3M0U A;  5GJV B;  2L3S A;  2EGA A;  1I0C A;  4JJB A;  1MV0 B;  1B3Q A;  1YN8 A;  1G2B A;  3I5R A;  1G83 A;  1QWF A;  1SRL A;  1ZBJ A;  2CT3 A;  1BBZ A;  2O88 A;  1UE9 A;  2C0O A;  1ZUK A;  2K6D A;  2JM9 A;  1JEG A;  2FRY A;  1IO6 A;  1FYN A;  1RLP C;  1E6G A;  2YUN A;  1YWP A;  2RQW A;  1SPK A;  3R6N A;  1V1C A;  2LJ3 A;  3VS3 A;  4IIO A;  2LP5 A;  1UHF A;  4WCI A;  1GFC A;  2BTT A;  1M27 C;  4D8K A;  1E6H A;  3EG3 A;  2X3W D;  2KE9 A;  2KRN A;  2LMJ A;  3THK A;  2JT4 A;  3EHQ A;  3H0F A;  1K4U S;  2G6F X;  3I35 A;  2M51 A;  1PNJ A;  2X3X D;  5ECA A;  2EGC A;  2SEM A;  2EYZ A;  2JW4 A;  1JXM A;  2DE0 X;  4JPB W;  1QKW A;  2RN8 A;  5L23 A;  3ULR B;  2RQU A;  3VS7 A;  2FO0 A;  4OMP A;  2YSQ A;  4CC3 A;  2DL3 A;  4ZNX A;  3EG0 A;  2A08 A;  1QWE A;  2EYW A;  1WXB A;  4J9D A;  4AFZ C;  1AOJ A;  1ABQ A;  1PKS A;  2HSP A;  2KGT A;  3QWY A;  4A63 B;  1PWT A;  2J6O A;  1JXO A;  1WA7 A;  2F2W A;  1Y57 A;  1T3L A;  1BK2 A;  2JMA A;  5IH2 A;  4AG1 C;  1WX6 A;  4X1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...