2KXDA

The structure of sh3-f2
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
73
structure length
73
Chain Sequence
b'MGAPPLPPYSAGGREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDSGTGKELVLALYDYQEKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 11-mer peptide, SH3 domain of Spectrin alpha chain
publication title NMR structure and dynamics of the chimeric protein SH3-F2
pubmed doi rcsb
source organism Synthetic, gallus gallus
molecule tags Signaling protein
total genus 6
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2010-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2kxdA00
1M3BA 2YSQA 1GRIA 2J6KA 2O31A 1PKSA 1AD5A 2K3BA 1WFWA 1WLPB 2O2OA 2X3WD 2C0TA 2K9GA 2MOXA 1I0CA 2GGRA 4RTYA 2ABLA 2FEIA 3TSWA 4AFZC 2NWMA 3UATA 5I11A 2PTKA 4J9IA 3EHRA 2V1QA 1U06A 3IQLA 2K6DA 3CQTA 4EIKA 2V1RA 4CC7A 2LJ0A 1M8MA 2JT4A 3PVQA 1X43A 2G6FX 1V1CA 2CUDA 3GBQA 1HSQA 1M3CA 2BZ8A 3I5RA 2J7IA 4D8DA 2K79A 1WYXA 3EG2A 2DX1A 4Z8AA 1BU1A 1Y0MA 1ARKA 1WI7A 2J06A 2KRSA 2RF0A 2YT6A 3UA6A 3VRYA 1AWXA 5HCKA 2O88A 1JXMA 1X6BA 1XOVA 4ORZA 1CKBA 1T0JA 2LCSA 2LP5A 3I9QA 1PRMC 2RQTA 3THKA 2EVRA 2VVKA 3EGUA 1N5ZA 3I35A 2DE0X 1GCQC 2O9SA 2A08A 2AKLA 1WDXA 1FYNA 2MCNA 1NLOC 1NLPC 2LQNA 3H0FA 1UHCA 4IIOA 4JPBW 2SRCA 1BK2A 1PRLC 1K1ZA 1K76A 1ZLMA 3VS0A 1ZUYA 2CSQA 1X69A 3M0SA 4DEXA 2F2XA 2GBQA 2DL7A 2RN8A 2JMAA 1QLYA 3M0TA 1AWWA 2JMCA 2M51A 2EW3A 2MIOA 1GBRA 1K0XA 4D8KA 1ABOA 1UJ0A 2RPNA 4FSSA 2HDAA 4DEYA 1WIEA 2FRYA 1X27A 4RTXA 2DRMA 1MUZA 2EYXA 2DF6A 4ESRA 2CT3A 3C0CA 5GJWB 1GFCA 1QWFA 1NYFA 1PHTA 4IIMA 2KR3A 1TUDA 2LX7A 1G83A 1B07A 2J6OA 2W0ZA 1I1JA 5EC7A 3VS6A 1JO8A 3ULRB 4OMPA 1K0SA 3EHQA 2OJ2A 1QWEA 3REAB 2GTJA 4LUDA 1JXOA 2SEMA 4J9EA 1TG0A 2ROTA 1WXTA 1VA7A 4HVWA 2KRNA 3RNJA 3M0RA 4RTZA 1W6XA 1W1FA 2BTTA 2H8HA 2ED0A 4JJBA 3SHWA 2D1XA 2HSPA 5IXFA 1X2QA 1PWTA 1YWPA 2DMOA 2RQVA 2AK5A 2AZSA 5I22A 3VS2A 1OPKA 1AZGB 1GCQA 1AVZC 2I0NA 2EPDA 1WXBA 2L0AA 4GLMA 2EBPA 2E5KA 2D8HA 2AKKA 2FO0A 4J9FA 2ECZA 2DRKA 3REBB 4AFUC 4AG2C 4J9GA 4CC4B 1AOJA 2EGAA 2RQRA 1UHFA 2KXCA 1VYUA 2LMJA 4ZNXA 1E6GA 3VS7A 1T0HA 1UFFA 3NPFA 2KROA 1UECA 1M3AA 2KRMA 1AWJA 2DYBA 1KIKA 2DILA 3VS4A 1M30A 1OPLA 3I5SA 2DBKA 2OAWA 2FG0A 2KBTA 3EG0A 2PZ1A 1H92A 1GL5A 1T3LA 1NEBA 3VS3A 2KE9A 1ZBJA 1WA7A 1UGVA 1BBZA 2DA9A 4Y92A 2L2PA 1MV3A 4HCKA 4F14A 1S1NA 2J6FA 4JJCA 4JZ3A 1QKXA 2EKHA 1SRMA 1UUEA 2J05A 2A37A 1X6GA 3EG3A 1RLPC 4Z89A 2DBMA 2CDTA 2OI3A 1YN8A 1AZEA 3QWXX 2CT4A 2YUOA 1GBQA 2NUZA 2ED1A 1RUWA 2KT1A 2YUPA 1IO6A 5IHKA 2DVJA 1A0NB 1H8KA 1UTIA 2K7AA 4RUGA 3M0UA 1E7OA 2JM8A 2C0OA 1VYVA 3PE0A 2LQWA 2EYWA 3NHNA 2JXBA 4KRTA 3SEMA 2W10A 2XMFA 2CREA 1PNJA 2F2VA 4OMLA 2O9VA 4OMNA 4J9BA 2KNBB 1HD3A 4RTTA 1QCFA 2GTOA 2EYYA 2RNAA 2VWFA 5FWCA 1QKWA 2FPDA 2L3SA 2LJ3A 3O5ZA 3VRZA 4F17A 2FRWA 1MV0B 3M0QA 2HCKA 3NMZC 1KJWA 1FMKA 1T3SA 2EGEA 2ESWA 5IH2A 5FWBA 5L23A 4F16A 2GNCA 5ECAA 1UDLA 1SPKA 4JZ4A 2AZVA 2RQUA 1NG2A 2RMOA 3TVTA 2K2MA 2DL3A 2KYMA 2D8JA 4RTUA 4CC2A 1NM7A 1VYTA 2X3XD 2L3QA 1KFZA 1M27C 3VS1A 1SRLA 4CC3A 3JV3A 3ZL7C 2DL8A 3UA7A 2LZ6B 2RQWA 2FPFA 2CSIA 4J9HA 1OV3A 5IXBA 4AFSC 1W70A 1GFDA 2KXDA 1AWOA 2JS2A 2JM9A 1E6HA 2ROLA 1I07A 1SHGA 2KT8A 2P4RA 2CH4A 4GBQA 4JJDA 3M0PA 1OEBA 2JW4A 4AG1C 1KSWA 1SEMA 1ZUKA 1JEGA 1ABQA 2ENMA 1UE9A 1G2BA 1WX6A 1Y57A 5FW9A 1H3HA 3VS5A 1LCKA 1PKTA 1TUCA 2BZYA 4HVUA 1K4US 2D0NA 1YWOA 2BZXA 3LH5A 4HVVA 4LNPA 1JU5C 1UG1A 3UF4A 2L3PA 4M4ZA 2HBWA 1J3TA 4RTVA 4A63B 1ZX6A 2DNUA 1BB9A 4OMOA 4QT7A 2DL5A 1NEGA 1YCSB 1EFNA 3FJ5A 4Z88A 2B86A 1Z9ZA 1GCPA 3EG1A 2DJQA 2A36A 2IIMA 2CUBA 2QDLA 5IHIA 1HJDA 2F2WA 1YP5A 1ZUUA 1RLQC 4E6RA 1YNZA 3PVLA 2FPEA 4X1VA 4LN2A 1CSKA 1NYGA 2M0YA 2JTEA 2GQIA 1X2KA 2EQIA 4LE9A 1SHFA 4LUEA 2KYBA 4HXJA 1K9AA 1UJYA 1AEYA 2KEAA 2HEQA 2YDLA 2JS0A 4OMMA 3H41A 2YUQA 2C0IA 2EGCA 4R0KA 2DM1A 2KGTA 1U5SA 5IHNA 3TSZA 1RI9A 4K11A 1SSHA 2VKNA 3H0IA 1CKAA 4J9DA 2LJ1A 2DLPA 2DL4A 2LNHB 3U23A 1ZSGA 2PNIA 4RTWA 2YUNA 2CH4W 3H0HA 3NGPA 3RBBB 2EYZA 5GJVB 4J9CA 3R6NA 2A28A 1Z9QA 4AFQC 3A98A 4WCIA 1B3QA 1JQQA 1U3OA 3KFVA 4OMQA 1WXUA 1OOTA 3QWYA
chains in the Genus database with same CATH superfamily
2QA4A 1VQ4A 1PKSA 1Q95G 1JRIA 2HNIA 3NTHA 3OYCA 1KQSS 2X3WD 1YI2A 4RTYA 2JVVA 1Y96A 1WPYA 4PFPA 4M75G 3EHRA 1FX7A 5GAOr 3IQLA 5GAMh 4M75B 2B8AA 2V1RA 1M8MA 5D6YA 1VQLA 2HQEA 2MAMA 2BZ8A 2DXTA 2A7YA 3MEUA 2CP0A 2K3XA 3EG2A 2DX1A 5KCOA 4M75A 4HA8A 2M1HA 3JB9J 1QMCA 3CCVQ 3CPWP 2OTLA 4OGEA 4M78D 4JLIA 2X35A 3PIOA 4R56A 1UGSB 2CGHA 2LP5A 2MMPA 1OI1A 3I9QA 1VQMT 2EVRA 1U8RA 3QIIA 2LQ8A 3JCMP 1N5ZA 5KYUB 2QQRA 5CKDA 1FYNA 3ME9A 5KYNA 4C0DB 1NLPC 2CZ1B 3HP9A 4QVDA 2E5QA 1VQ9A 3H0FA 3HHTB 1IHVA 4JPBW 1N6AA 1BK2A 2WACA 5KYUA 1EX4A 3V7SA 3FRNA 3CMAA 4DEXA 2CP3A 2F2XA 5LJ3g 1D09B 1LPLA 2DO3A 2JMAA 4XTWA 1QLYA 3M0TA 3OS0A 1K0XA 3M54A 4F7UB 1C0MA 4JLGA 1N9SA 3G71Q 1QVFS 1WIEA 3OB9A 1X27A 3ER0A 4RTXA 3CC4Q 2DRMA 1YIJQ 2QDYB 3CCJQ 4FW1A 4E7HA 1JBMA 4E7SA 4F7UA 2PUKB 1PHTA 2QGFB 3JCMh 1M1KU 1VQOA 1B07A 2J6OA 2HBPA 1QW1A 3I55A 2VUBA 2DTOA 1JO8A 3ULRB 4OMPA 1NE8A 1TWBA 1VQNA 1WQ7A 1S72Q 2DK3A 3VYGA 3EHQA 3REAB 1M90U 2SEMA 2E1HA 4OMFB 2KRNA 4RTZA 1W6XA 2MPXC 2E12A 2AT1B 3FIFA 5IXFA 1TTHB 4IKFA 2DMOA 2AZSA 3OBWA 4BY6C 5J39A 2EBPA 2QG9B 2KY9A 2FO0A 3OYNA 3MCAB 4LXCA 4J9GA 3JB9I 3ZFJA 3INZA 1AOJA 3HFOA 2QYZA 2RQRA 5LJ5f 3RKWA 1K73U 4ZNXA 3RERA 2G3RA 2NLUA 2XDPA 3NPFA 4X34A 1UECA 2KRMA 1VQPT 3L42A 1AWJA 3MEAA 2DYBA 3VS4A 3I56T 4ZN1A 2JTMA 2FHDA 5GAOq 4B6MA 2FG0A 1AT1B 2PZ1A 2OX7A 1H92A 3MPUB 3VS3A 1MMAA 2XKOC 2LDMA 4HCKA 2MWOA 4ME7A 2J6FA 2DJZA 3MP6A 1YITT 4JZ3A 2CYZB 3CCRQ 2KMTA 5GMKh 1C6VX 3A1PA 1VQ7T 1WHHA 3CCMT 3CC2A 1RLPC 4Z89A 4YTLA 5GAMg 2PU9B 3JCMV 2RI5A 2YUOA 4PFOA 1GBQA 1K8AR 4KUIA 4M75C 4HCZA 2KT1A 5KH6A 1IO6A 2CP2A 3X25B 2HZYA 4RUGA 1BI1A 1E7OA 4C0FA 4C8QG 3PE0A 1QCNA 1W4SA 1M90R 3PMTA 2W10A 4C8QB 2CREA 2BUDA 5AYFA 2RK2A 4OMLA 5CVIA 2ZPEB 2QQSA 4L5GA 3RKXA 4J9BA 4PLLA 3EAEA 4PFZA 2HAXA 1BCMA 1QCFA 3M4YA 5FWCA 3LH0A 2VWFA 4M77G 4C92G 4C8QA 1QKWA 2QQBA 4OF1A 2LJ3A 4M77B 3VRZA 4C92B 4F17A 2FRWA 1QVGA 2H3JA 1T3SA 2ESWA 3L2UA 1OZ2A 3CCET 3QG1A 2DVEA 1RAGB 4M77A 4C92A 1IZ6A 2E70A 3RKYA 8ATCB 1SRLA 5LJ5d 2F69A 2D9TA 3ZL7C 1ZSZC 2FPFA 2R57A 3JB9F 2CSIA 2YLBA 3L1AA 4J9HA 2FZGB 4FYWB 2RJCA 1KG1A 3EFOB 2DEQA 3MJXA 1AWOA 1KC8R 1G8XA 2FVUA 2JS2A 3DB3A 1I07A 4E2FB 2L5QA 4M7AE 4GY5A 2P4RA 2XDBA 2XIDA 1SSFA 1UB4A 3EH1A 1PD1A 3EFOA 4EMHA 3JB9D 1ABQA 5GAOn 1VQPQ 2ENMA 3T9NA 5LJ5g 3I56Q 5FW9A 1WJQA 1VQ8T 1TUCA 2BZYA 1Q7YC 2OTJA 2BZXA 3LH5A 4HVVA 3E9FA 3S3OA 1MMNA 4LNPA 9ATCB 4M4ZA 1J3TA 4N4IA 5A0GA 4M7AD 4PL6A 3RMQA 1NEGA 2BKDN 1SKUB 2DJQA 4HCBA 4XU0A 3VV0A 2A36A 4QQDA 2CUBA 2QDLA 1NBEB 2IPOB 4XU2A 1VQ7Q 4J8OA 1ZUUA 4E6RA 5GMKi 2DAQA 1ZQ1A 4X1VA 1CSKA 3S3NA 3M59A 1D3BB 4NL3A 1SHFA 2KYBA 1K9AA 3HSBA 4OMMA 3H41A 3CC7A 5D6WA 2YUQA 1YHQT 3UWNA 1OZ3A 2DD5A 4J83A 1U5SA 2OAUA 3PT9A 2RHYA 1D3BA 2O4XB 3CCQA 4LDXA 2LNHB 2QI2A 3U23A 2R5AA 2HSEB 4XTXA 2PNIA 2FL7A 2AHJB 2DXCA 4ZGDB 1IREB 3TEEA 2ZCFB 5GJVB 2O4XA 4J9CA 3MEVA 3A98A 1IRXA 3CCLA 2ZZDA 3NTIA 3KFVA 2V8IA 2YSQA 1GRIA 3OQ5A 2QQAA 1AD5A 4D6WA 3BE3A 4FSXA 1ZHIA 1EIFA 2K9GA 2Y4YA 3EFRA 1I0CA 3MEWA 3PTAA 3A5ZB 2YXYA 3UATA 2M0OA 4J9IA 6AT1B 2V1QA 3QYGB 1U06A 4EIKA 1HK9A 3GBQA 4M7DG 3CCVT 3V7CA 3A8MB 4RKUE 4FT2A 5HK3A 2MK5A 1Y71A 2AIRB 2D6FA 1BU1A 2R58A 1ARKA 1G3TA 4EDUA 1OU8A 4PJJA 1JJ2A 4C8QC 1AWXA 1FMVA 4JJNK 2LCLA 4XU3A 1VQMA 4II1A 4M7DA 2EYQA 2KQWA 4ORZA 5LL6S 1CKBA 2ZGWA 3M56A 4FU6A 4FYVB 5LJ3f 4L59A 4J5YA 2LT4A 4QKUA 3EGUA 2VXEA 3LLRA 3I35A 2DE0X 1VQ8Q 4AMCA 1GCQC 2AKLA 2RI2A 4M77C 2RJEA 1K9MC 2MCNA 5KCHA 3OYKA 3TU4K 2ZPFB 1MNEA 4BB7A 3EG9B 1OU9A 4C5EA 1KHIA 1K76A 3QKJA 3CC4T 4ZN3A 2DL7A 1YIJT 3M4GA 3QSUA 1AWWA 2JMCA 2M51A 2EW3A 3EG9A 1UJ0A 4A4KA 1I5OB 2RPNA 4PNOA 1VQ5A 1UEBA 1YCYA 4BI3A 2HMAA 2DF6A 4PJOE 3C0CA 1PG5B 1X75C 1Q86C 1LJOA 2XG8D 2WSEE 4M78B 1YHQQ 1S72T 3CCST 5GAN4 3GF5A 3OYMA 2LX7A 4PJOF 2W0ZA 4MMKA 4J6XA 3G6ET 3KBGA 2DZ9A 2KVQG 3VS6A 1YJWQ 2KK4A 4M78A 1K0SA 3P8HA 2EQUA 3V8JA 1QWEA 1Q7YU 2GTJA 2DEUA 1JXOA 4EMKB 1VQ6A 4PJLA 4BDYA 1VA7A 4HVWA 4XK8E 3RNJA 3M0RA 1W1FA 2H8HA 4ELYC 5C6SA 4DA4A 4N0AA 2COWA 2HL5C 2LC4A 4JJBA 1I8FA 2QEXQ 3N5BB 4EMKA 1OPKA 1AZGB 2L0AA 3G7ZA 2P84A 2EPDA 3LWHA 3F70A 4GLMA 2CP5A 4MZPA 2E5KA 2D8HA 3RUXA 4PKCC 4AFUC 1UGQB 2ECZA 2V26A 4AG2C 2RD1A 4BACA 4ZTFA 1UHFA 4BDZA 1KQ1A 5GAN2 1YJ9Q 2JN0A 2COYA 1VQPA 2EIFA 1D0XA 1Q81U 3A8HB 2GFUA 2M16A 2DTIA 3VKIA 4HT8A 4E47A 3E2UA 1W2BA 1M1GA 3L2RA 5LJ3d 1RABB 3CD6Q 3I5SA 5DY9A 2EQMA 2DBKA 3P8BB 2QK0A 2BIVA 1MNDA 3FEOA 3EG0A 1GXIE 1M4ZA 1W2BS 1GL5A 3CCRT 1T3LA 5GMKl 3X20B 5GAMf 1ZBJA 3OS5A 2E6ZA 4J6WA 4E7LA 1BBZA 1YITA 4WF2A 3SWNB 2L2PA 2X4YA 1QKXA 4M75E 1PSEA 4PLIA 2MF2A 3CCMA 1QVFA 3L2ZA 3EGXA 3SWNA 3CEYA 1VUBA 3CCUA 4RG2A 3EG3A 4M75F 1WJRA 3QWXX 4QQ6A 3VJPA 4BUGA 4IUTA 3QJYA 2NUZA 2ED1A 3EFSA 1BIBA 1RUWA 3QDFA 3JCMX 3ZEHA 1BI3A 5IHKA 3OA6A 3VUBA 3PFSA 1YBYA 1VQKA 2K7AA 4HKEA 3M0UA 2JM8A 1VYVA 2EYWA 5GAOl 3BY7A 1HXDA 2JXBA 2KI7A 2PVOB 5DLQE 3UPUA 4KT0E 4OMNA 4EMGA 3CCSQ 8AT1B 2KNBB 4PJOC 4RTTA 1BI2A 2EYYA 1WGSA 2DD4A 3G6EQ 3QPHA 1WNLA 3O5ZA 4XAXB 3M0QA 2HCKA 3NMZC 3CCEA 5IH2A 5AT1B 4F16A 2E4HA 5FU6B 4F7UE 4FM4B 1K9MU 3LGLA 4QQGA 3JSCA 5GAN6 1QVGP 1KK7A 1NG2A 1YFNA 1D0YA 4KGVB 3A8LB 2KYMA 2D8JA 2E65A 1RACB 2FZCB 4FT4A 3A8GB 1VYTA 2DKGA 1Q81R 3JCMf 3VS1A 4F7UF 3LX7A 4CC3A 3QYHB 3JV3A 2QA4T 4NL2A 1V76A 1W70A 1GFDA 2VV5A 3ASKA 4OB3B 1YI2T 2JM9A 1E6HA 4ANJA 4AT1B 2RA2A 5GANj 4JJDA 3GNGA 4OGCA 2DXUA 3M5AA 1VQLT 2K57A 3NFCA 4JDSA 1Q86U 2XK0A 1UE9A 4M78C 1I81A 5GAMd 4CRIA 4FW2A 1M1FA 1LCKA 1PKTA 3CPWS 3OYYA 1RADB 2RJDA 4FYYB 3C94A 1QQJA 2RH2A 3CMEA 5IN1A 1NZ9A 4KH0B 4O5VA 4RTVA 3S6WA 3JCMb 4A63B 2DNUA 3OS1A 4QT7A 1YCSB 1EFNA 2E41A 4Z88A 2K5LA 1WHKA 1Z9ZA 3EG1A 2PUOB 4JRQA 1BYMA 1R0BG 5IHIA 2F2WA 1N8RC 4ELZC 4A4GA 5GAN7 3J80E 2L3RA 4BE2A 1M1KR 1MMGA 2CZ6B 4LN2A 5IAYA 5LJ5e 3A8OB 1FMWA 1M5Q1 3TQ7P 4HXJA 4Z02A 5CO7A 1AEYA 2KEAA 2HEQA 3JB9G 2C0IA 3HRUA 5IHNA 3OMGA 4K11A 2VKNA 3PGGA 4BI8B 4DBRA 2DLPA 2DL4A 4J6YA 4QVCA 4DBFA 1D1BA 4WTOB 2RK1A 1N27A 3RBBB 2E3IA 4M7AG 2GF7A 4QW2A 2RJFA 3V7RA 1PCXA 4M7AB 2A28A 1Z9QA 4WCIA 3I55T 2A0FB 4C0DC 3SWNC 4HCCA 1OOTA 3JCMd 1K73R 5DM7R 1M3BA 3EGDB 3JCMW 3DLMA 4M7AA 4IUVA 5FLXE 5GANh 2K3BA 2YHTA 1YJNQ 1WFWA 1BIAA 1V29B 1WLPB 2O2OA 3P8DA 2Y4XA 2FEIA 1WHLA 5FRNA 5I11A 2ZPHB 1OYXA 3EGDA 1RAEB 4C8QE 3TCJA 3CQTA 2FZKB 1H641 3CCVA 2LJ0A 2QA4Q 1X43A 2G6FX 1MMDA 1VQ4Q 2CUDA 2F1LA 1IHWA 5CQXA 1QP2A 1HSQA 3OYEA 2K4YA 3C4SA 4C8QF 3I5RA 2K2VA 1YI2Q 3JCMg 2QASA 4M77E 2HD0A 4C92E 4Z8AA 1Y0MA 1WI7A 3VYHB 3G1JA 1I5LA 2BE7D 5CIUA 3UA6A 3VRYA 5HCKA 3DLLA 2O88A 1VQLQ 1JXMA 1X6BA 1XOVA 2XHCA 2X9HA 1XTDA 5LJ3j 2LCSA 4M77F 4C92F 2DFUA 1PRMC 2RQTA 3THKA 3RR6A 3CXCP 1JJ2P 4C5IA 5IT9E 3OW2P 2YLCA 2R5MA 2A08A 3QUIA 1WDXA 4ZGJB 2LVMA 2OTLQ 4QVZA 3M58A 1SF9A 1D1CA 4OB0B 2LQNA 5FU6C 3G71A 1UHCA 2QQ9A 4IIOA 2NUTB 2SRCA 3M55A 1M8VA 2CP6A 1PRLC 1ZLMA 3CC4A 3J7AF 1YIJA 1ZUYA 2CSQA 1X69A 3M0SA 3TREA 4B9XA 3CCJA 3JCMc 2GFAA 4PJNA 3G4ST 1GBRA 2NUTA 4D8KA 1VQ9Q 4E7ZA 4FL6A 2HDAA 4DEYA 1ACMB 3GLXA 2A3LA 3FLGA 1TXQA 3CMAQ 4ESRA 1WJSA 5GANe 2CT3A 1S72A 5GJWB 1YJWT 1QWFA 4GLKA 4IIMA 1RI0A 2KR3A 2QXFA 1M9SA 3O8VA 4OVAA 1RAFB 4ZGEB 3HL8A 2QEXT 4LUDA 5M9OA 3HPWA 4J9EA 7AT1B 1TG0A 1ZA1B 2ROTA 1XNIA 3HKSA 1PC0A 3E19A 1TU0B 3C95A 3I55Q 1KQSP 2D1XA 2HSPA 1X2QA 1YWPA 2RHXA 2RB6A 1VQNQ 2AK5A 3VS2A 4HT9A 2GQVA 2I0NA 1AVZC 1YJ9T 1WXBA 2E64A 2VC8A 1P92A 3QXEB 2PVDB 4N4GA 1WZOA 3REBB 2DRKA 1N8RU 1WHGA 4CC4B 2EKOA 2EGAA 2KAFA 4M7DB 2KXCA 4J7IA 1VYUA 2LMJA 3CD6T 3VS7A 2E6NA 2F5TX 5A2QE 5GMKm 1KIKA 2LNVA 2DILA 1WQWA 4LDUA 1M30A 4X9CA 5KE2A 4XTYA 2EAYA 1K8AC 2VYTA 3OYAA 3CCRA 4IURA 1FWZA 5I2MA 3RMSA 5A0LA 2DYIA 4LDWA 3X26B 1NEBA 1F1BB 4C92C 2KE9A 1G3SA 1UGVA 1QP3A 2Z0WA 2EJGA 2MYSA 2XICA 3D7SB 3RESA 5L8RE 5GAOp 1MV3A 1X6OA 4DBQA 3CBMA 1SRMA 4OP0A 4PK4A 4DQ2A 1UUEA 2J05A 1X6GA 1O9SA 3MP8A 4E7IA 4V2SA 1EZZB 2CS7A 1M2VB 2KSSA 2CZ7B 5I21A 1ZBXA 3OS2A 1AZEA 1QVFP 3QO3A 3MO8A 2HQXA 3URGA 2M9UA 3L2WA 1QVPA 1BI0A 1M2VA 3G4SQ 3JB9H 3PMIA 1XJWB 3OMCA 1H8KA 4C5HA 3CC2Q 4LD6A 3X28B 4KH1B 2C0OA 4KGZB 3NHNA 4KRTA 4C0GA 1KD1C 2DPPB 3CC7T 2O9VA 4E7KA 3GOXA 1KC8C 2X4XA 5CKEA 2VXFA 1HD3A 2JTFA 3JCMJ 4ATOA 5LJ3e 2GTOA 2EJ9A 3M9QA 1G5VA 1MV0B 4PJOD 1TS9A 5FWBA 1N8RR 5ECAA 1UDLA 5FU7B 2AZVA 3LYIA 2RQUA 3TVTA 2K2MA 3CBOA 4TVRA 1NM7A 4CC2A 2X3XD 4NOYA 1M27C 1Y7XA 5LJ5j 2HL3A 3H6ZA 2DL8A 1B34B 2LZ6B 3UA7A 4M78E 4MDWA 4O6JA 2XU8A 2KDSA 1R77A 4AFSC 2NUPB 5GAN8 3I56A 4JRKA 1SHGA 1NJIC 3UT1A 3GPLA 2KT8A 4M78F 3CPFA 1B34A 2QGGA 3M0PA 4XTUA 2MWPA 4AG1C 1KSWA 1ZA2B 2NUPA 3VUZA 1ZUKA 2PQWA 3KUFA 4C0ZA 4A4EA 2P4TA 3LW5E 1G3YA 4Y28E 5C0MA 3BDUA 4KULA 1Y57A 1H3HA 2X51A 3QZ9B 2NYSA 1H3ZA 4FYXB 2L8DA 3EGXB 1B7TA 1D0ZA 4HVUA 2MI6A 1DJ7B 3FJPA 1Q82C 4A4HA 3BFMA 1JU5C 1VQ7A 2L3PA 3MHXA 2HBWA 3ZBDA 1RAHB 3OSSC 4IUPA 2LX9A 1BB9A 4OMOA 4JS4A 2DL5A 2DETA 2B86A 5CKHA 3PNWC 3EH2A 1IXDA 2YRCA 2OTJQ 1U1SA 2O01E 2IIMA 4OB1B 1HJDA 1YP5A 2IG0A 2DIGA 5D7UA 2FPEA 4A4FA 3QHSA 1NYGA 1ZSZB 2M0YA 2GQIA 1AHJB 2EQIA 1N9RA 3C12A 4LE9A 4F7UG 4LUEA 4M75D 5KYWB 4DOVA 4M7DC 4JRIA 5CQYA 2GCXA 2JS0A 1Q7YR 5CKBA 2M02A 3RIRA 5GMKj 2QAZA 5D6XA 2DM1A 2KGTA 1ZSZA 3TSZA 5J26A 1NPPA 1SSHA 2ZAEA 3RDVA 1CKAA 4J9DA 1VQ5T 2QTVA 5KYWA 2LTOA 3J81E 2VB6A 4RTWA 2YUNA 1K8AU 2RM4A 2XDDA 3NGPA 3CC7Q 2V8JA 5GAMe 1Y07A 2EYZA 5LJ5h 2LQKA 3R6NA 2H3EB 1YJNT 3CCQQ 2CZ0B 1WXUA 4XTZA 2J6KA 2RI3A 2O31A 2XD0A 1VQ6T 3V8KA 3MKDA 1LOJA 4N4HA 3OYHA 1VQ4T 1O75A 2C0TA 2MOXA 3L2QA 2HQHA 2GGRA 2ABLA 2Y90A 3TSWA 3CCLQ 2JJ9A 4AFZC 2NWMA 3JRZA 2PVGB 2ATCB 2PTKA 2WSFE 2K6DA 3QZ5B 4CC7A 3PVQA 2JT4A 5KYXB 1V1CA 4LDVA 2ZPGB 3OBYA 2IVWA 3UDCA 1M3CA 2CKKA 2QTXA 3CPWA 2J7IA 4D8DA 1R8OB 2K79A 4DOWA 1WYXA 1VQ8A 2JZ2A 5KYXA 2J06A 2KRSA 3FC3A 2RF0A 2YT6A 4KBMB 5CK9A 3WXMB 1KD1U 1T0JA 4N0AC 2OTLT 4Q5WA 1KC8U 2VVKA 4EMKC 1TSFA 1OX8A 2O9SA 3SFMA 3M53A 2JUFA 1NLOC 2P0KA 1VQMQ 5KYYB 5J3BA 5FU7C 2ZPIB 3WVEB 3HTRA 1VQ9T 1K1ZA 3VS0A 3JCMe 1UGRB 3G4SA 1M2OA 2GBQA 2RN8A 5CAIA 4X9DA 5KYYA 3CMAT 1YHQA 3OYGA 1C1AA 2MIOA 4BE1A 1ABOA 3DB4A 2C06A 3CCUT 1MHNA 4FSSA 2FRYA 3H8ZA 3KXTA 1MUZA 2EYXA 2K5FA 2V8KA 1YJWA 1NJIU 4ZTJA 1WHJA 1GFCA 4MZTA 4CI0C 1K9MR 1NYFA 2LRQA 4LD9K 3OYLA 1TUGB 5CCAA 1TUDA 1G83A 1VQKT 1I1JA 1VQ5Q 4RCCA 1JB0E 5EC7A 2I2LA 3R6OA 2QEXA 4IUUA 2L89A 1VQOT 1TH7A 2OJ2A 3OYBA 3E9GA 3GNFB 1VQNT 1Q82U 1WXTA 3S3MA 4RG8A 2BTTA 2ED0A 2P0PA 2X4WA 3SHWA 1PD0A 1YJ9A 1PWTA 2RQVA 2RHIA 5I22A 2FYKA 2DXBA 1VOMA 1GCQA 1MGQA 4XTVA 1QVGS 1OULA 1VQ6Q 1Q86R 2WSCE 2AKKA 5HKCA 4J9FA 3CD6A 1KD1R 1E6GA 4C5GA 1T0HA 2COZA 1UFFA 4DBHA 2KROA 1M3AA 2VGMA 5GMKe 1IGQA 1RL2A 1PSFA 5GANf 2EWNA 1OPLA 5DLOA 3X24B 4RCBA 4C8QD 4OB2B 2OAWA 1HYOA 2KBTA 4M7AF 3HRSA 2HKNA 1R0CB 2EQKA 3VU3C 4BD3A 1WA7A 2XI9A 3V8LA 4KGXB 2DA9A 4Y92A 4F14A 1S1NA 2EJFA 1UGPB 4JJCA 4M77D 4C92D 4NS5A 2DZCA 2EKHA 3WVDB 3AT1B 3GIBA 2A37A 3CMET 2P0QA 4F04B 5HK0A 1YITQ 1NJIR 2DBMA 1VIFA 2CDTA 2OI3A 1YN8A 3BW1A 3CC2T 1G3WA 3OY9A 2CT4A 2CP7A 2RO0A 3QDRB 2RHUA 3Q1JA 3CCMQ 2YUPA 3CCSA 2X4JA 2YRDA 2DVJA 1A0NB 5CR2A 1UTIA 3CCUQ 4MZMA 4XQ3A 1Q81C 4A53A 1KHCA 2YWWA 3META 1RAAB 3G6EA 1BKBA 2LQWA 3L2VA 3SEMA 2XMFA 5FRMA 1Q82R 1PNJA 2F2VA 2VGNA 3LGFA 1IB8A 2LT1A 4B9WA 2VASA 4A54A 1VQKQ 3FDRA 2RNAA 1OX9A 3SDZA 3LWIA 2FPDA 2L3SA 1VQOQ 3AHUA 1KJWA 4P5NA 1FMKA 2EGEA 5L23A 2GNCA 1D1AA 1SPKA 4JZ4A 5HY6A 2RMOA 2EQJA 2DL3A 2BE9B 4RTUA 1VIEA 2JNGA 3OYJA 2L3QA 1KFZA 3OYFA 3DKMA 3CCEQ 2RQWA 5LJ3h 5A0DA 1I4K1 1OV3A 2FB7A 5IXBA 3MP1A 2KXDA 4IUQA 2ROLA 5FROA 2CH4A 4GBQA 5GANd 2E3HA 1OEBA 2JW4A 4JUVA 1SEMA 2DERA 5KE3A 1M1KC 4XU1A 1JEGA 2DIQA 1W2BP 5GAMj 1G2BA 1OQKA 1WX6A 5GAN3 3SD4A 3VS5A 3CXCA 4PJOG 1TOVA 3OYDA 3OW2A 1K4US 4PJOB 1M90C 2K3YA 4M7AC 2D0NA 1YWOA 5GAN5 5CKFA 2LCCA 2OTJT 1UG1A 3UF4A 3CXCS 1JJ2S 1RAIB 4VUBA 4LDYA 4FIBA 5GANg 3OW2S 1ZX6A 3E1SA 4PJOA 3FJ5A 3M57A 4M7DE 4RMOA 4BE0A 3JCMQ 1GCPA 3OSVA 4BY6B 1QCOA 3NTKA 2K5IA 5EG2A 5GAOm 1FXXA 2DTHA 3FB9A 4L6V5 3JAME 3CMEQ 2F5KA 1RLQC 4M7DF 1BCOA 1XQHA 1YNZA 2JOYA 2RHZA 3G71T 3PVLA 1SG5A 3HRTA 2JTEA 4MMLA 1LNXA 1X2KA 4MDXA 4EPCA 1K73C 4JRPA 3BDLA 3CCJT 2HKQB 3SB2A 1UJYA 2YDLA 3HFNA 2YRVA 4Y91A 2EGCA 3GP8A 4E7JA 4R0KA 5I2SA 3H9NA 3PIPA 4M7DD 3OYIA 1RI9A 3QJ6A 4JS5A 3H0IA 2D0QB 2LJ1A 4M78G 4FCYA 1ZSGA 2E10A 3CCQT 1LVKA 2CH4W 3H0HA 4UC4A 1U1TA 1IGUA 4PJMA 4R55A 1YJNA 4BI4A 1KQ2A 4AFQC 4KUDK 3QBYA 4J7FA 1NPRA 1B3QA 2ZPBB 1JQQA 1KQSA 2EFIA 1WHMA 1U3OA 4OMQA 3CBPA 1X01A 3CCLT 1Y96B 3QWYA 1PM3A
chains in the Genus database with same CATH topology
1M3BA 2YSQA 1GRIA 2J6KA 2O31A 1PKSA 1AD5A 2K3BA 1WFWA 1WLPB 2O2OA 2X3WD 2C0TA 2K9GA 2MOXA 1I0CA 2GGRA 4RTYA 2ABLA 2FEIA 3TSWA 4AFZC 2NWMA 3UATA 5I11A 2PTKA 4J9IA 3EHRA 2V1QA 1U06A 3IQLA 2K6DA 3CQTA 4EIKA 2V1RA 4CC7A 2LJ0A 1M8MA 2JT4A 3PVQA 1X43A 2G6FX 1V1CA 2CUDA 3GBQA 1HSQA 1M3CA 2BZ8A 3I5RA 2J7IA 4D8DA 2K79A 1WYXA 3EG2A 2DX1A 4Z8AA 1BU1A 1Y0MA 1ARKA 1WI7A 2J06A 2KRSA 2RF0A 2YT6A 3UA6A 3VRYA 1AWXA 5HCKA 2O88A 1JXMA 1X6BA 1XOVA 4ORZA 1CKBA 1T0JA 2LCSA 2LP5A 3I9QA 1PRMC 2RQTA 3THKA 2EVRA 2VVKA 3EGUA 1N5ZA 3I35A 2DE0X 1GCQC 2O9SA 2A08A 2AKLA 1WDXA 1FYNA 2MCNA 1NLOC 1NLPC 2LQNA 3H0FA 1UHCA 4IIOA 4JPBW 2SRCA 1BK2A 1PRLC 1K1ZA 1K76A 1ZLMA 3VS0A 1ZUYA 2CSQA 1X69A 3M0SA 4DEXA 2F2XA 2GBQA 2DL7A 2RN8A 2JMAA 1QLYA 3M0TA 1AWWA 2JMCA 2M51A 2EW3A 2MIOA 1GBRA 1K0XA 4D8KA 1ABOA 1UJ0A 2RPNA 4FSSA 2HDAA 4DEYA 1WIEA 2FRYA 1X27A 4RTXA 2DRMA 1MUZA 2EYXA 2DF6A 4ESRA 2CT3A 3C0CA 5GJWB 1GFCA 1QWFA 1NYFA 1PHTA 4IIMA 2KR3A 1TUDA 2LX7A 1G83A 1B07A 2J6OA 2W0ZA 1I1JA 5EC7A 3VS6A 1JO8A 3ULRB 4OMPA 1K0SA 3EHQA 2OJ2A 1QWEA 3REAB 2GTJA 4LUDA 1JXOA 2SEMA 4J9EA 1TG0A 2ROTA 1WXTA 1VA7A 4HVWA 2KRNA 3RNJA 3M0RA 4RTZA 1W6XA 1W1FA 2BTTA 2H8HA 2ED0A 4JJBA 3SHWA 2D1XA 2HSPA 5IXFA 1X2QA 1PWTA 1YWPA 2DMOA 2RQVA 2AK5A 2AZSA 5I22A 3VS2A 1OPKA 1AZGB 1GCQA 1AVZC 2I0NA 2EPDA 1WXBA 2L0AA 4GLMA 2EBPA 2E5KA 2D8HA 2AKKA 2FO0A 4J9FA 2ECZA 2DRKA 3REBB 4AFUC 4AG2C 4J9GA 4CC4B 1AOJA 2EGAA 2RQRA 1UHFA 2KXCA 1VYUA 2LMJA 4ZNXA 1E6GA 3VS7A 1T0HA 1UFFA 3NPFA 2KROA 1UECA 1M3AA 2KRMA 1AWJA 2DYBA 1KIKA 2DILA 3VS4A 1M30A 1OPLA 3I5SA 2DBKA 2OAWA 2FG0A 2KBTA 3EG0A 2PZ1A 1H92A 1GL5A 1T3LA 1NEBA 3VS3A 2KE9A 1ZBJA 1WA7A 1UGVA 1BBZA 2DA9A 4Y92A 2L2PA 1MV3A 4HCKA 4F14A 1S1NA 2J6FA 4JJCA 4JZ3A 1QKXA 2EKHA 1SRMA 1UUEA 2J05A 2A37A 1X6GA 3EG3A 1RLPC 4Z89A 2DBMA 2CDTA 2OI3A 1YN8A 1AZEA 3QWXX 2CT4A 2YUOA 1GBQA 2NUZA 2ED1A 1RUWA 2KT1A 2YUPA 1IO6A 5IHKA 2DVJA 1A0NB 1H8KA 1UTIA 2K7AA 4RUGA 3M0UA 1E7OA 2JM8A 2C0OA 1VYVA 3PE0A 2LQWA 2EYWA 3NHNA 2JXBA 4KRTA 3SEMA 2W10A 2XMFA 2CREA 1PNJA 2F2VA 4OMLA 2O9VA 4OMNA 4J9BA 2KNBB 1HD3A 4RTTA 1QCFA 2GTOA 2EYYA 2RNAA 2VWFA 5FWCA 1QKWA 2FPDA 2L3SA 2LJ3A 3O5ZA 3VRZA 4F17A 2FRWA 1MV0B 3M0QA 2HCKA 3NMZC 1KJWA 1FMKA 1T3SA 2EGEA 2ESWA 5IH2A 5FWBA 5L23A 4F16A 2GNCA 5ECAA 1UDLA 1SPKA 4JZ4A 2AZVA 2RQUA 1NG2A 2RMOA 3TVTA 2K2MA 2DL3A 2KYMA 2D8JA 4RTUA 4CC2A 1NM7A 1VYTA 2X3XD 2L3QA 1KFZA 1M27C 3VS1A 1SRLA 4CC3A 3JV3A 3ZL7C 2DL8A 3UA7A 2LZ6B 2RQWA 2FPFA 2CSIA 4J9HA 1OV3A 5IXBA 4AFSC 1W70A 1GFDA 2KXDA 1AWOA 2JS2A 2JM9A 1E6HA 2ROLA 1I07A 1SHGA 2KT8A 2P4RA 2CH4A 4GBQA 4JJDA 3M0PA 1OEBA 2JW4A 4AG1C 1KSWA 1SEMA 1ZUKA 1JEGA 1ABQA 2ENMA 1UE9A 1G2BA 1WX6A 1Y57A 5FW9A 1H3HA 3VS5A 1LCKA 1PKTA 1TUCA 2BZYA 4HVUA 1K4US 2D0NA 1YWOA 2BZXA 3LH5A 4HVVA 4LNPA 1JU5C 1UG1A 3UF4A 2L3PA 4M4ZA 2HBWA 1J3TA 4RTVA 4A63B 1ZX6A 2DNUA 1BB9A 4OMOA 4QT7A 2DL5A 1NEGA 1YCSB 1EFNA 3FJ5A 4Z88A 2B86A 1Z9ZA 1GCPA 3EG1A 2DJQA 2A36A 2IIMA 2CUBA 2QDLA 5IHIA 1HJDA 2F2WA 1YP5A 1ZUUA 1RLQC 4E6RA 1YNZA 3PVLA 2FPEA 4X1VA 4LN2A 1CSKA 1NYGA 2M0YA 2JTEA 2GQIA 1X2KA 2EQIA 4LE9A 1SHFA 4LUEA 2KYBA 4HXJA 1K9AA 1UJYA 1AEYA 2KEAA 2HEQA 2YDLA 2JS0A 4OMMA 3H41A 2YUQA 2C0IA 2EGCA 4R0KA 2DM1A 2KGTA 1U5SA 5IHNA 3TSZA 1RI9A 4K11A 1SSHA 2VKNA 3H0IA 1CKAA 4J9DA 2LJ1A 2DLPA 2DL4A 2LNHB 3U23A 1ZSGA 2PNIA 4RTWA 2YUNA 2CH4W 3H0HA 3NGPA 3RBBB 2EYZA 5GJVB 4J9CA 3R6NA 2A28A 1Z9QA 4AFQC 3A98A 4WCIA 1B3QA 1JQQA 1U3OA 3KFVA 4OMQA 1WXUA 1OOTA 3QWYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M3B A;  2YSQ A;  1GRI A;  2J6K A;  2O31 A;  1PKS A;  1AD5 A;  2K3B A;  1WFW A;  1WLP B;  2O2O A;  2X3W D;  2C0T A;  2K9G A;  2MOX A;  1I0C A;  2GGR A;  4RTY A;  2ABL A;  2FEI A;  3TSW A;  4AFZ C;  2NWM A;  3UAT A;  5I11 A;  2PTK A;  4J9I A;  3EHR A;  2V1Q A;  1U06 A;  3IQL A;  2K6D A;  3CQT A;  4EIK A;  2V1R A;  4CC7 A;  2LJ0 A;  1M8M A;  2JT4 A;  3PVQ A;  1X43 A;  2G6F X;  1V1C A;  2CUD A;  3GBQ A;  1HSQ A;  1M3C A;  2BZ8 A;  3I5R A;  2J7I A;  4D8D A;  2K79 A;  1WYX A;  3EG2 A;  2DX1 A;  4Z8A A;  1BU1 A;  1Y0M A;  1ARK A;  1WI7 A;  2J06 A;  2KRS A;  2RF0 A;  2YT6 A;  3UA6 A;  3VRY A;  1AWX A;  5HCK A;  2O88 A;  1JXM A;  1X6B A;  1XOV A;  4ORZ A;  1CKB A;  1T0J A;  2LCS A;  2LP5 A;  3I9Q A;  1PRM C;  2RQT A;  3THK A;  2EVR A;  2VVK A;  3EGU A;  1N5Z A;  3I35 A;  2DE0 X;  1GCQ C;  2O9S A;  2A08 A;  2AKL A;  1WDX A;  1FYN A;  2MCN A;  1NLO C;  1NLP C;  2LQN A;  3H0F A;  1UHC A;  4IIO A;  4JPB W;  2SRC A;  1BK2 A;  1PRL C;  1K1Z A;  1K76 A;  1ZLM A;  3VS0 A;  1ZUY A;  2CSQ A;  1X69 A;  3M0S A;  4DEX A;  2F2X A;  2GBQ A;  2DL7 A;  2RN8 A;  2JMA A;  1QLY A;  3M0T A;  1AWW A;  2JMC A;  2M51 A;  2EW3 A;  2MIO A;  1GBR A;  1K0X A;  4D8K A;  1ABO A;  1UJ0 A;  2RPN A;  4FSS A;  2HDA A;  4DEY A;  1WIE A;  2FRY A;  1X27 A;  4RTX A;  2DRM A;  1MUZ A;  2EYX A;  2DF6 A;  4ESR A;  2CT3 A;  3C0C A;  5GJW B;  1GFC A;  1QWF A;  1NYF A;  1PHT A;  4IIM A;  2KR3 A;  1TUD A;  2LX7 A;  1G83 A;  1B07 A;  2J6O A;  2W0Z A;  1I1J A;  5EC7 A;  3VS6 A;  1JO8 A;  3ULR B;  4OMP A;  1K0S A;  3EHQ A;  2OJ2 A;  1QWE A;  3REA B;  2GTJ A;  4LUD A;  1JXO A;  2SEM A;  4J9E A;  1TG0 A;  2ROT A;  1WXT A;  1VA7 A;  4HVW A;  2KRN A;  3RNJ A;  3M0R A;  4RTZ A;  1W6X A;  1W1F A;  2BTT A;  2H8H A;  2ED0 A;  4JJB A;  3SHW A;  2D1X A;  2HSP A;  5IXF A;  1X2Q A;  1PWT A;  1YWP A;  2DMO A;  2RQV A;  2AK5 A;  2AZS A;  5I22 A;  3VS2 A;  1OPK A;  1AZG B;  1GCQ A;  1AVZ C;  2I0N A;  2EPD A;  1WXB A;  2L0A A;  4GLM A;  2EBP A;  2E5K A;  2D8H A;  2AKK A;  2FO0 A;  4J9F A;  2ECZ A;  2DRK A;  3REB B;  4AFU C;  4AG2 C;  4J9G A;  4CC4 B;  1AOJ A;  2EGA A;  2RQR A;  1UHF A;  2KXC A;  1VYU A;  2LMJ A;  4ZNX A;  1E6G A;  3VS7 A;  1T0H A;  1UFF A;  3NPF A;  2KRO A;  1UEC A;  1M3A A;  2KRM A;  1AWJ A;  2DYB A;  1KIK A;  2DIL A;  3VS4 A;  1M30 A;  1OPL A;  3I5S A;  2DBK A;  2OAW A;  2FG0 A;  2KBT A;  3EG0 A;  2PZ1 A;  1H92 A;  1GL5 A;  1T3L A;  1NEB A;  3VS3 A;  2KE9 A;  1ZBJ A;  1WA7 A;  1UGV A;  1BBZ A;  2DA9 A;  4Y92 A;  2L2P A;  1MV3 A;  4HCK A;  4F14 A;  1S1N A;  2J6F A;  4JJC A;  4JZ3 A;  1QKX A;  2EKH A;  1SRM A;  1UUE A;  2J05 A;  2A37 A;  1X6G A;  3EG3 A;  1RLP C;  4Z89 A;  2DBM A;  2CDT A;  2OI3 A;  1YN8 A;  1AZE A;  3QWX X;  2CT4 A;  2YUO A;  1GBQ A;  2NUZ A;  2ED1 A;  1RUW A;  2KT1 A;  2YUP A;  1IO6 A;  5IHK A;  2DVJ A;  1A0N B;  1H8K A;  1UTI A;  2K7A A;  4RUG A;  3M0U A;  1E7O A;  2JM8 A;  2C0O A;  1VYV A;  3PE0 A;  2LQW A;  2EYW A;  3NHN A;  2JXB A;  4KRT A;  3SEM A;  2W10 A;  2XMF A;  2CRE A;  1PNJ A;  2F2V A;  4OML A;  2O9V A;  4OMN A;  4J9B A;  2KNB B;  1HD3 A;  4RTT A;  1QCF A;  2GTO A;  2EYY A;  2RNA A;  2VWF A;  5FWC A;  1QKW A;  2FPD A;  2L3S A;  2LJ3 A;  3O5Z A;  3VRZ A;  4F17 A;  2FRW A;  1MV0 B;  3M0Q A;  2HCK A;  3NMZ C;  1KJW A;  1FMK A;  1T3S A;  2EGE A;  2ESW A;  5IH2 A;  5FWB A;  5L23 A;  4F16 A;  2GNC A;  5ECA A;  1UDL A;  1SPK A;  4JZ4 A;  2AZV A;  2RQU A;  1NG2 A;  2RMO A;  3TVT A;  2K2M A;  2DL3 A;  2KYM A;  2D8J A;  4RTU A;  4CC2 A;  1NM7 A;  1VYT A;  2X3X D;  2L3Q A;  1KFZ A;  1M27 C;  3VS1 A;  1SRL A;  4CC3 A;  3JV3 A;  3ZL7 C;  2DL8 A;  3UA7 A;  2LZ6 B;  2RQW A;  2FPF A;  2CSI A;  4J9H A;  1OV3 A;  5IXB A;  4AFS C;  1W70 A;  1GFD A;  2KXD A;  1AWO A;  2JS2 A;  2JM9 A;  1E6H A;  2ROL A;  1I07 A;  1SHG A;  2KT8 A;  2P4R A;  2CH4 A;  4GBQ A;  4JJD A;  3M0P A;  1OEB A;  2JW4 A;  4AG1 C;  1KSW A;  1SEM A;  1ZUK A;  1JEG A;  1ABQ A;  2ENM A;  1UE9 A;  1G2B A;  1WX6 A;  1Y57 A;  5FW9 A;  1H3H A;  3VS5 A;  1LCK A;  1PKT A;  1TUC A;  2BZY A;  4HVU A;  1K4U S;  2D0N A;  1YWO A;  2BZX A;  3LH5 A;  4HVV A;  4LNP A;  1JU5 C;  1UG1 A;  3UF4 A;  2L3P A;  4M4Z A;  2HBW A;  1J3T A;  4RTV A;  4A63 B;  1ZX6 A;  2DNU A;  1BB9 A;  4OMO A;  4QT7 A;  2DL5 A;  1NEG A;  1YCS B;  1EFN A;  3FJ5 A;  4Z88 A;  2B86 A;  1Z9Z A;  1GCP A;  3EG1 A;  2DJQ A;  2A36 A;  2IIM A;  2CUB A;  2QDL A;  5IHI A;  1HJD A;  2F2W A;  1YP5 A;  1ZUU A;  1RLQ C;  4E6R A;  1YNZ A;  3PVL A;  2FPE A;  4X1V A;  4LN2 A;  1CSK A;  1NYG A;  2M0Y A;  2JTE A;  2GQI A;  1X2K A;  2EQI A;  4LE9 A;  1SHF A;  4LUE A;  2KYB A;  4HXJ A;  1K9A A;  1UJY A;  1AEY A;  2KEA A;  2HEQ A;  2YDL A;  2JS0 A;  4OMM A;  3H41 A;  2YUQ A;  2C0I A;  2EGC A;  4R0K A;  2DM1 A;  2KGT A;  1U5S A;  5IHN A;  3TSZ A;  1RI9 A;  4K11 A;  1SSH A;  2VKN A;  3H0I A;  1CKA A;  4J9D A;  2LJ1 A;  2DLP A;  2DL4 A;  2LNH B;  3U23 A;  1ZSG A;  2PNI A;  4RTW A;  2YUN A;  2CH4 W;  3H0H A;  3NGP A;  3RBB B;  2EYZ A;  5GJV B;  4J9C A;  3R6N A;  2A28 A;  1Z9Q A;  4AFQ C;  3A98 A;  4WCI A;  1B3Q A;  1JQQ A;  1U3O A;  3KFV A;  4OMQ A;  1WXU A;  1OOT A;  3QWY A; 
#chains in the Genus database with same CATH topology
 2QA4 A;  1VQ4 A;  1PKS A;  1Q95 G;  1JRI A;  2HNI A;  3NTH A;  3OYC A;  1KQS S;  2X3W D;  1YI2 A;  4RTY A;  2JVV A;  1Y96 A;  1WPY A;  4PFP A;  4M75 G;  3EHR A;  1FX7 A;  5GAO r;  3IQL A;  5GAM h;  4M75 B;  2B8A A;  2V1R A;  1M8M A;  5D6Y A;  1VQL A;  2HQE A;  2MAM A;  2BZ8 A;  2DXT A;  2A7Y A;  3MEU A;  2CP0 A;  2K3X A;  3EG2 A;  2DX1 A;  5KCO A;  4M75 A;  4HA8 A;  2M1H A;  3JB9 J;  1QMC A;  3CCV Q;  3CPW P;  2OTL A;  4OGE A;  4M78 D;  4JLI A;  2X35 A;  3PIO A;  4R56 A;  1UGS B;  2CGH A;  2LP5 A;  2MMP A;  1OI1 A;  3I9Q A;  1VQM T;  2EVR A;  1U8R A;  3QII A;  2LQ8 A;  3JCM P;  1N5Z A;  5KYU B;  2QQR A;  5CKD A;  1FYN A;  3ME9 A;  5KYN A;  4C0D B;  1NLP C;  2CZ1 B;  3HP9 A;  4QVD A;  2E5Q A;  1VQ9 A;  3H0F A;  3HHT B;  1IHV A;  4JPB W;  1N6A A;  1BK2 A;  2WAC A;  5KYU A;  1EX4 A;  3V7S A;  3FRN A;  3CMA A;  4DEX A;  2CP3 A;  2F2X A;  5LJ3 g;  1D09 B;  1LPL A;  2DO3 A;  2JMA A;  4XTW A;  1QLY A;  3M0T A;  3OS0 A;  1K0X A;  3M54 A;  4F7U B;  1C0M A;  4JLG A;  1N9S A;  3G71 Q;  1QVF S;  1WIE A;  3OB9 A;  1X27 A;  3ER0 A;  4RTX A;  3CC4 Q;  2DRM A;  1YIJ Q;  2QDY B;  3CCJ Q;  4FW1 A;  4E7H A;  1JBM A;  4E7S A;  4F7U A;  2PUK B;  1PHT A;  2QGF B;  3JCM h;  1M1K U;  1VQO A;  1B07 A;  2J6O A;  2HBP A;  1QW1 A;  3I55 A;  2VUB A;  2DTO A;  1JO8 A;  3ULR B;  4OMP A;  1NE8 A;  1TWB A;  1VQN A;  1WQ7 A;  1S72 Q;  2DK3 A;  3VYG A;  3EHQ A;  3REA B;  1M90 U;  2SEM A;  2E1H A;  4OMF B;  2KRN A;  4RTZ A;  1W6X A;  2MPX C;  2E12 A;  2AT1 B;  3FIF A;  5IXF A;  1TTH B;  4IKF A;  2DMO A;  2AZS A;  3OBW A;  4BY6 C;  5J39 A;  2EBP A;  2QG9 B;  2KY9 A;  2FO0 A;  3OYN A;  3MCA B;  4LXC A;  4J9G A;  3JB9 I;  3ZFJ A;  3INZ A;  1AOJ A;  3HFO A;  2QYZ A;  2RQR A;  5LJ5 f;  3RKW A;  1K73 U;  4ZNX A;  3RER A;  2G3R A;  2NLU A;  2XDP A;  3NPF A;  4X34 A;  1UEC A;  2KRM A;  1VQP T;  3L42 A;  1AWJ A;  3MEA A;  2DYB A;  3VS4 A;  3I56 T;  4ZN1 A;  2JTM A;  2FHD A;  5GAO q;  4B6M A;  2FG0 A;  1AT1 B;  2PZ1 A;  2OX7 A;  1H92 A;  3MPU B;  3VS3 A;  1MMA A;  2XKO C;  2LDM A;  4HCK A;  2MWO A;  4ME7 A;  2J6F A;  2DJZ A;  3MP6 A;  1YIT T;  4JZ3 A;  2CYZ B;  3CCR Q;  2KMT A;  5GMK h;  1C6V X;  3A1P A;  1VQ7 T;  1WHH A;  3CCM T;  3CC2 A;  1RLP C;  4Z89 A;  4YTL A;  5GAM g;  2PU9 B;  3JCM V;  2RI5 A;  2YUO A;  4PFO A;  1GBQ A;  1K8A R;  4KUI A;  4M75 C;  4HCZ A;  2KT1 A;  5KH6 A;  1IO6 A;  2CP2 A;  3X25 B;  2HZY A;  4RUG A;  1BI1 A;  1E7O A;  4C0F A;  4C8Q G;  3PE0 A;  1QCN A;  1W4S A;  1M90 R;  3PMT A;  2W10 A;  4C8Q B;  2CRE A;  2BUD A;  5AYF A;  2RK2 A;  4OML A;  5CVI A;  2ZPE B;  2QQS A;  4L5G A;  3RKX A;  4J9B A;  4PLL A;  3EAE A;  4PFZ A;  2HAX A;  1BCM A;  1QCF A;  3M4Y A;  5FWC A;  3LH0 A;  2VWF A;  4M77 G;  4C92 G;  4C8Q A;  1QKW A;  2QQB A;  4OF1 A;  2LJ3 A;  4M77 B;  3VRZ A;  4C92 B;  4F17 A;  2FRW A;  1QVG A;  2H3J A;  1T3S A;  2ESW A;  3L2U A;  1OZ2 A;  3CCE T;  3QG1 A;  2DVE A;  1RAG B;  4M77 A;  4C92 A;  1IZ6 A;  2E70 A;  3RKY A;  8ATC B;  1SRL A;  5LJ5 d;  2F69 A;  2D9T A;  3ZL7 C;  1ZSZ C;  2FPF A;  2R57 A;  3JB9 F;  2CSI A;  2YLB A;  3L1A A;  4J9H A;  2FZG B;  4FYW B;  2RJC A;  1KG1 A;  3EFO B;  2DEQ A;  3MJX A;  1AWO A;  1KC8 R;  1G8X A;  2FVU A;  2JS2 A;  3DB3 A;  1I07 A;  4E2F B;  2L5Q A;  4M7A E;  4GY5 A;  2P4R A;  2XDB A;  2XID A;  1SSF A;  1UB4 A;  3EH1 A;  1PD1 A;  3EFO A;  4EMH A;  3JB9 D;  1ABQ A;  5GAO n;  1VQP Q;  2ENM A;  3T9N A;  5LJ5 g;  3I56 Q;  5FW9 A;  1WJQ A;  1VQ8 T;  1TUC A;  2BZY A;  1Q7Y C;  2OTJ A;  2BZX A;  3LH5 A;  4HVV A;  3E9F A;  3S3O A;  1MMN A;  4LNP A;  9ATC B;  4M4Z A;  1J3T A;  4N4I A;  5A0G A;  4M7A D;  4PL6 A;  3RMQ A;  1NEG A;  2BKD N;  1SKU B;  2DJQ A;  4HCB A;  4XU0 A;  3VV0 A;  2A36 A;  4QQD A;  2CUB A;  2QDL A;  1NBE B;  2IPO B;  4XU2 A;  1VQ7 Q;  4J8O A;  1ZUU A;  4E6R A;  5GMK i;  2DAQ A;  1ZQ1 A;  4X1V A;  1CSK A;  3S3N A;  3M59 A;  1D3B B;  4NL3 A;  1SHF A;  2KYB A;  1K9A A;  3HSB A;  4OMM A;  3H41 A;  3CC7 A;  5D6W A;  2YUQ A;  1YHQ T;  3UWN A;  1OZ3 A;  2DD5 A;  4J83 A;  1U5S A;  2OAU A;  3PT9 A;  2RHY A;  1D3B A;  2O4X B;  3CCQ A;  4LDX A;  2LNH B;  2QI2 A;  3U23 A;  2R5A A;  2HSE B;  4XTX A;  2PNI A;  2FL7 A;  2AHJ B;  2DXC A;  4ZGD B;  1IRE B;  3TEE A;  2ZCF B;  5GJV B;  2O4X A;  4J9C A;  3MEV A;  3A98 A;  1IRX A;  3CCL A;  2ZZD A;  3NTI A;  3KFV A;  2V8I A;  2YSQ A;  1GRI A;  3OQ5 A;  2QQA A;  1AD5 A;  4D6W A;  3BE3 A;  4FSX A;  1ZHI A;  1EIF A;  2K9G A;  2Y4Y A;  3EFR A;  1I0C A;  3MEW A;  3PTA A;  3A5Z B;  2YXY A;  3UAT A;  2M0O A;  4J9I A;  6AT1 B;  2V1Q A;  3QYG B;  1U06 A;  4EIK A;  1HK9 A;  3GBQ A;  4M7D G;  3CCV T;  3V7C A;  3A8M B;  4RKU E;  4FT2 A;  5HK3 A;  2MK5 A;  1Y71 A;  2AIR B;  2D6F A;  1BU1 A;  2R58 A;  1ARK A;  1G3T A;  4EDU A;  1OU8 A;  4PJJ A;  1JJ2 A;  4C8Q C;  1AWX A;  1FMV A;  4JJN K;  2LCL A;  4XU3 A;  1VQM A;  4II1 A;  4M7D A;  2EYQ A;  2KQW A;  4ORZ A;  5LL6 S;  1CKB A;  2ZGW A;  3M56 A;  4FU6 A;  4FYV B;  5LJ3 f;  4L59 A;  4J5Y A;  2LT4 A;  4QKU A;  3EGU A;  2VXE A;  3LLR A;  3I35 A;  2DE0 X;  1VQ8 Q;  4AMC A;  1GCQ C;  2AKL A;  2RI2 A;  4M77 C;  2RJE A;  1K9M C;  2MCN A;  5KCH A;  3OYK A;  3TU4 K;  2ZPF B;  1MNE A;  4BB7 A;  3EG9 B;  1OU9 A;  4C5E A;  1KHI A;  1K76 A;  3QKJ A;  3CC4 T;  4ZN3 A;  2DL7 A;  1YIJ T;  3M4G A;  3QSU A;  1AWW A;  2JMC A;  2M51 A;  2EW3 A;  3EG9 A;  1UJ0 A;  4A4K A;  1I5O B;  2RPN A;  4PNO A;  1VQ5 A;  1UEB A;  1YCY A;  4BI3 A;  2HMA A;  2DF6 A;  4PJO E;  3C0C A;  1PG5 B;  1X75 C;  1Q86 C;  1LJO A;  2XG8 D;  2WSE E;  4M78 B;  1YHQ Q;  1S72 T;  3CCS T;  5GAN 4;  3GF5 A;  3OYM A;  2LX7 A;  4PJO F;  2W0Z A;  4MMK A;  4J6X A;  3G6E T;  3KBG A;  2DZ9 A;  2KVQ G;  3VS6 A;  1YJW Q;  2KK4 A;  4M78 A;  1K0S A;  3P8H A;  2EQU A;  3V8J A;  1QWE A;  1Q7Y U;  2GTJ A;  2DEU A;  1JXO A;  4EMK B;  1VQ6 A;  4PJL A;  4BDY A;  1VA7 A;  4HVW A;  4XK8 E;  3RNJ A;  3M0R A;  1W1F A;  2H8H A;  4ELY C;  5C6S A;  4DA4 A;  4N0A A;  2COW A;  2HL5 C;  2LC4 A;  4JJB A;  1I8F A;  2QEX Q;  3N5B B;  4EMK A;  1OPK A;  1AZG B;  2L0A A;  3G7Z A;  2P84 A;  2EPD A;  3LWH A;  3F70 A;  4GLM A;  2CP5 A;  4MZP A;  2E5K A;  2D8H A;  3RUX A;  4PKC C;  4AFU C;  1UGQ B;  2ECZ A;  2V26 A;  4AG2 C;  2RD1 A;  4BAC A;  4ZTF A;  1UHF A;  4BDZ A;  1KQ1 A;  5GAN 2;  1YJ9 Q;  2JN0 A;  2COY A;  1VQP A;  2EIF A;  1D0X A;  1Q81 U;  3A8H B;  2GFU A;  2M16 A;  2DTI A;  3VKI A;  4HT8 A;  4E47 A;  3E2U A;  1W2B A;  1M1G A;  3L2R A;  5LJ3 d;  1RAB B;  3CD6 Q;  3I5S A;  5DY9 A;  2EQM A;  2DBK A;  3P8B B;  2QK0 A;  2BIV A;  1MND A;  3FEO A;  3EG0 A;  1GXI E;  1M4Z A;  1W2B S;  1GL5 A;  3CCR T;  1T3L A;  5GMK l;  3X20 B;  5GAM f;  1ZBJ A;  3OS5 A;  2E6Z A;  4J6W A;  4E7L A;  1BBZ A;  1YIT A;  4WF2 A;  3SWN B;  2L2P A;  2X4Y A;  1QKX A;  4M75 E;  1PSE A;  4PLI A;  2MF2 A;  3CCM A;  1QVF A;  3L2Z A;  3EGX A;  3SWN A;  3CEY A;  1VUB A;  3CCU A;  4RG2 A;  3EG3 A;  4M75 F;  1WJR A;  3QWX X;  4QQ6 A;  3VJP A;  4BUG A;  4IUT A;  3QJY A;  2NUZ A;  2ED1 A;  3EFS A;  1BIB A;  1RUW A;  3QDF A;  3JCM X;  3ZEH A;  1BI3 A;  5IHK A;  3OA6 A;  3VUB A;  3PFS A;  1YBY A;  1VQK A;  2K7A A;  4HKE A;  3M0U A;  2JM8 A;  1VYV A;  2EYW A;  5GAO l;  3BY7 A;  1HXD A;  2JXB A;  2KI7 A;  2PVO B;  5DLQ E;  3UPU A;  4KT0 E;  4OMN A;  4EMG A;  3CCS Q;  8AT1 B;  2KNB B;  4PJO C;  4RTT A;  1BI2 A;  2EYY A;  1WGS A;  2DD4 A;  3G6E Q;  3QPH A;  1WNL A;  3O5Z A;  4XAX B;  3M0Q A;  2HCK A;  3NMZ C;  3CCE A;  5IH2 A;  5AT1 B;  4F16 A;  2E4H A;  5FU6 B;  4F7U E;  4FM4 B;  1K9M U;  3LGL A;  4QQG A;  3JSC A;  5GAN 6;  1QVG P;  1KK7 A;  1NG2 A;  1YFN A;  1D0Y A;  4KGV B;  3A8L B;  2KYM A;  2D8J A;  2E65 A;  1RAC B;  2FZC B;  4FT4 A;  3A8G B;  1VYT A;  2DKG A;  1Q81 R;  3JCM f;  3VS1 A;  4F7U F;  3LX7 A;  4CC3 A;  3QYH B;  3JV3 A;  2QA4 T;  4NL2 A;  1V76 A;  1W70 A;  1GFD A;  2VV5 A;  3ASK A;  4OB3 B;  1YI2 T;  2JM9 A;  1E6H A;  4ANJ A;  4AT1 B;  2RA2 A;  5GAN j;  4JJD A;  3GNG A;  4OGC A;  2DXU A;  3M5A A;  1VQL T;  2K57 A;  3NFC A;  4JDS A;  1Q86 U;  2XK0 A;  1UE9 A;  4M78 C;  1I81 A;  5GAM d;  4CRI A;  4FW2 A;  1M1F A;  1LCK A;  1PKT A;  3CPW S;  3OYY A;  1RAD B;  2RJD A;  4FYY B;  3C94 A;  1QQJ A;  2RH2 A;  3CME A;  5IN1 A;  1NZ9 A;  4KH0 B;  4O5V A;  4RTV A;  3S6W A;  3JCM b;  4A63 B;  2DNU A;  3OS1 A;  4QT7 A;  1YCS B;  1EFN A;  2E41 A;  4Z88 A;  2K5L A;  1WHK A;  1Z9Z A;  3EG1 A;  2PUO B;  4JRQ A;  1BYM A;  1R0B G;  5IHI A;  2F2W A;  1N8R C;  4ELZ C;  4A4G A;  5GAN 7;  3J80 E;  2L3R A;  4BE2 A;  1M1K R;  1MMG A;  2CZ6 B;  4LN2 A;  5IAY A;  5LJ5 e;  3A8O B;  1FMW A;  1M5Q 1;  3TQ7 P;  4HXJ A;  4Z02 A;  5CO7 A;  1AEY A;  2KEA A;  2HEQ A;  3JB9 G;  2C0I A;  3HRU A;  5IHN A;  3OMG A;  4K11 A;  2VKN A;  3PGG A;  4BI8 B;  4DBR A;  2DLP A;  2DL4 A;  4J6Y A;  4QVC A;  4DBF A;  1D1B A;  4WTO B;  2RK1 A;  1N27 A;  3RBB B;  2E3I A;  4M7A G;  2GF7 A;  4QW2 A;  2RJF A;  3V7R A;  1PCX A;  4M7A B;  2A28 A;  1Z9Q A;  4WCI A;  3I55 T;  2A0F B;  4C0D C;  3SWN C;  4HCC A;  1OOT A;  3JCM d;  1K73 R;  5DM7 R;  1M3B A;  3EGD B;  3JCM W;  3DLM A;  4M7A A;  4IUV A;  5FLX E;  5GAN h;  2K3B A;  2YHT A;  1YJN Q;  1WFW A;  1BIA A;  1V29 B;  1WLP B;  2O2O A;  3P8D A;  2Y4X A;  2FEI A;  1WHL A;  5FRN A;  5I11 A;  2ZPH B;  1OYX A;  3EGD A;  1RAE B;  4C8Q E;  3TCJ A;  3CQT A;  2FZK B;  1H64 1;  3CCV A;  2LJ0 A;  2QA4 Q;  1X43 A;  2G6F X;  1MMD A;  1VQ4 Q;  2CUD A;  2F1L A;  1IHW A;  5CQX A;  1QP2 A;  1HSQ A;  3OYE A;  2K4Y A;  3C4S A;  4C8Q F;  3I5R A;  2K2V A;  1YI2 Q;  3JCM g;  2QAS A;  4M77 E;  2HD0 A;  4C92 E;  4Z8A A;  1Y0M A;  1WI7 A;  3VYH B;  3G1J A;  1I5L A;  2BE7 D;  5CIU A;  3UA6 A;  3VRY A;  5HCK A;  3DLL A;  2O88 A;  1VQL Q;  1JXM A;  1X6B A;  1XOV A;  2XHC A;  2X9H A;  1XTD A;  5LJ3 j;  2LCS A;  4M77 F;  4C92 F;  2DFU A;  1PRM C;  2RQT A;  3THK A;  3RR6 A;  3CXC P;  1JJ2 P;  4C5I A;  5IT9 E;  3OW2 P;  2YLC A;  2R5M A;  2A08 A;  3QUI A;  1WDX A;  4ZGJ B;  2LVM A;  2OTL Q;  4QVZ A;  3M58 A;  1SF9 A;  1D1C A;  4OB0 B;  2LQN A;  5FU6 C;  3G71 A;  1UHC A;  2QQ9 A;  4IIO A;  2NUT B;  2SRC A;  3M55 A;  1M8V A;  2CP6 A;  1PRL C;  1ZLM A;  3CC4 A;  3J7A F;  1YIJ A;  1ZUY A;  2CSQ A;  1X69 A;  3M0S A;  3TRE A;  4B9X A;  3CCJ A;  3JCM c;  2GFA A;  4PJN A;  3G4S T;  1GBR A;  2NUT A;  4D8K A;  1VQ9 Q;  4E7Z A;  4FL6 A;  2HDA A;  4DEY A;  1ACM B;  3GLX A;  2A3L A;  3FLG A;  1TXQ A;  3CMA Q;  4ESR A;  1WJS A;  5GAN e;  2CT3 A;  1S72 A;  5GJW B;  1YJW T;  1QWF A;  4GLK A;  4IIM A;  1RI0 A;  2KR3 A;  2QXF A;  1M9S A;  3O8V A;  4OVA A;  1RAF B;  4ZGE B;  3HL8 A;  2QEX T;  4LUD A;  5M9O A;  3HPW A;  4J9E A;  7AT1 B;  1TG0 A;  1ZA1 B;  2ROT A;  1XNI A;  3HKS A;  1PC0 A;  3E19 A;  1TU0 B;  3C95 A;  3I55 Q;  1KQS P;  2D1X A;  2HSP A;  1X2Q A;  1YWP A;  2RHX A;  2RB6 A;  1VQN Q;  2AK5 A;  3VS2 A;  4HT9 A;  2GQV A;  2I0N A;  1AVZ C;  1YJ9 T;  1WXB A;  2E64 A;  2VC8 A;  1P92 A;  3QXE B;  2PVD B;  4N4G A;  1WZO A;  3REB B;  2DRK A;  1N8R U;  1WHG A;  4CC4 B;  2EKO A;  2EGA A;  2KAF A;  4M7D B;  2KXC A;  4J7I A;  1VYU A;  2LMJ A;  3CD6 T;  3VS7 A;  2E6N A;  2F5T X;  5A2Q E;  5GMK m;  1KIK A;  2LNV A;  2DIL A;  1WQW A;  4LDU A;  1M30 A;  4X9C A;  5KE2 A;  4XTY A;  2EAY A;  1K8A C;  2VYT A;  3OYA A;  3CCR A;  4IUR A;  1FWZ A;  5I2M A;  3RMS A;  5A0L A;  2DYI A;  4LDW A;  3X26 B;  1NEB A;  1F1B B;  4C92 C;  2KE9 A;  1G3S A;  1UGV A;  1QP3 A;  2Z0W A;  2EJG A;  2MYS A;  2XIC A;  3D7S B;  3RES A;  5L8R E;  5GAO p;  1MV3 A;  1X6O A;  4DBQ A;  3CBM A;  1SRM A;  4OP0 A;  4PK4 A;  4DQ2 A;  1UUE A;  2J05 A;  1X6G A;  1O9S A;  3MP8 A;  4E7I A;  4V2S A;  1EZZ B;  2CS7 A;  1M2V B;  2KSS A;  2CZ7 B;  5I21 A;  1ZBX A;  3OS2 A;  1AZE A;  1QVF P;  3QO3 A;  3MO8 A;  2HQX A;  3URG A;  2M9U A;  3L2W A;  1QVP A;  1BI0 A;  1M2V A;  3G4S Q;  3JB9 H;  3PMI A;  1XJW B;  3OMC A;  1H8K A;  4C5H A;  3CC2 Q;  4LD6 A;  3X28 B;  4KH1 B;  2C0O A;  4KGZ B;  3NHN A;  4KRT A;  4C0G A;  1KD1 C;  2DPP B;  3CC7 T;  2O9V A;  4E7K A;  3GOX A;  1KC8 C;  2X4X A;  5CKE A;  2VXF A;  1HD3 A;  2JTF A;  3JCM J;  4ATO A;  5LJ3 e;  2GTO A;  2EJ9 A;  3M9Q A;  1G5V A;  1MV0 B;  4PJO D;  1TS9 A;  5FWB A;  1N8R R;  5ECA A;  1UDL A;  5FU7 B;  2AZV A;  3LYI A;  2RQU A;  3TVT A;  2K2M A;  3CBO A;  4TVR A;  1NM7 A;  4CC2 A;  2X3X D;  4NOY A;  1M27 C;  1Y7X A;  5LJ5 j;  2HL3 A;  3H6Z A;  2DL8 A;  1B34 B;  2LZ6 B;  3UA7 A;  4M78 E;  4MDW A;  4O6J A;  2XU8 A;  2KDS A;  1R77 A;  4AFS C;  2NUP B;  5GAN 8;  3I56 A;  4JRK A;  1SHG A;  1NJI C;  3UT1 A;  3GPL A;  2KT8 A;  4M78 F;  3CPF A;  1B34 A;  2QGG A;  3M0P A;  4XTU A;  2MWP A;  4AG1 C;  1KSW A;  1ZA2 B;  2NUP A;  3VUZ A;  1ZUK A;  2PQW A;  3KUF A;  4C0Z A;  4A4E A;  2P4T A;  3LW5 E;  1G3Y A;  4Y28 E;  5C0M A;  3BDU A;  4KUL A;  1Y57 A;  1H3H A;  2X51 A;  3QZ9 B;  2NYS A;  1H3Z A;  4FYX B;  2L8D A;  3EGX B;  1B7T A;  1D0Z A;  4HVU A;  2MI6 A;  1DJ7 B;  3FJP A;  1Q82 C;  4A4H A;  3BFM A;  1JU5 C;  1VQ7 A;  2L3P A;  3MHX A;  2HBW A;  3ZBD A;  1RAH B;  3OSS C;  4IUP A;  2LX9 A;  1BB9 A;  4OMO A;  4JS4 A;  2DL5 A;  2DET A;  2B86 A;  5CKH A;  3PNW C;  3EH2 A;  1IXD A;  2YRC A;  2OTJ Q;  1U1S A;  2O01 E;  2IIM A;  4OB1 B;  1HJD A;  1YP5 A;  2IG0 A;  2DIG A;  5D7U A;  2FPE A;  4A4F A;  3QHS A;  1NYG A;  1ZSZ B;  2M0Y A;  2GQI A;  1AHJ B;  2EQI A;  1N9R A;  3C12 A;  4LE9 A;  4F7U G;  4LUE A;  4M75 D;  5KYW B;  4DOV A;  4M7D C;  4JRI A;  5CQY A;  2GCX A;  2JS0 A;  1Q7Y R;  5CKB A;  2M02 A;  3RIR A;  5GMK j;  2QAZ A;  5D6X A;  2DM1 A;  2KGT A;  1ZSZ A;  3TSZ A;  5J26 A;  1NPP A;  1SSH A;  2ZAE A;  3RDV A;  1CKA A;  4J9D A;  1VQ5 T;  2QTV A;  5KYW A;  2LTO A;  3J81 E;  2VB6 A;  4RTW A;  2YUN A;  1K8A U;  2RM4 A;  2XDD A;  3NGP A;  3CC7 Q;  2V8J A;  5GAM e;  1Y07 A;  2EYZ A;  5LJ5 h;  2LQK A;  3R6N A;  2H3E B;  1YJN T;  3CCQ Q;  2CZ0 B;  1WXU A;  4XTZ A;  2J6K A;  2RI3 A;  2O31 A;  2XD0 A;  1VQ6 T;  3V8K A;  3MKD A;  1LOJ A;  4N4H A;  3OYH A;  1VQ4 T;  1O75 A;  2C0T A;  2MOX A;  3L2Q A;  2HQH A;  2GGR A;  2ABL A;  2Y90 A;  3TSW A;  3CCL Q;  2JJ9 A;  4AFZ C;  2NWM A;  3JRZ A;  2PVG B;  2ATC B;  2PTK A;  2WSF E;  2K6D A;  3QZ5 B;  4CC7 A;  3PVQ A;  2JT4 A;  5KYX B;  1V1C A;  4LDV A;  2ZPG B;  3OBY A;  2IVW A;  3UDC A;  1M3C A;  2CKK A;  2QTX A;  3CPW A;  2J7I A;  4D8D A;  1R8O B;  2K79 A;  4DOW A;  1WYX A;  1VQ8 A;  2JZ2 A;  5KYX A;  2J06 A;  2KRS A;  3FC3 A;  2RF0 A;  2YT6 A;  4KBM B;  5CK9 A;  3WXM B;  1KD1 U;  1T0J A;  4N0A C;  2OTL T;  4Q5W A;  1KC8 U;  2VVK A;  4EMK C;  1TSF A;  1OX8 A;  2O9S A;  3SFM A;  3M53 A;  2JUF A;  1NLO C;  2P0K A;  1VQM Q;  5KYY B;  5J3B A;  5FU7 C;  2ZPI B;  3WVE B;  3HTR A;  1VQ9 T;  1K1Z A;  3VS0 A;  3JCM e;  1UGR B;  3G4S A;  1M2O A;  2GBQ A;  2RN8 A;  5CAI A;  4X9D A;  5KYY A;  3CMA T;  1YHQ A;  3OYG A;  1C1A A;  2MIO A;  4BE1 A;  1ABO A;  3DB4 A;  2C06 A;  3CCU T;  1MHN A;  4FSS A;  2FRY A;  3H8Z A;  3KXT A;  1MUZ A;  2EYX A;  2K5F A;  2V8K A;  1YJW A;  1NJI U;  4ZTJ A;  1WHJ A;  1GFC A;  4MZT A;  4CI0 C;  1K9M R;  1NYF A;  2LRQ A;  4LD9 K;  3OYL A;  1TUG B;  5CCA A;  1TUD A;  1G83 A;  1VQK T;  1I1J A;  1VQ5 Q;  4RCC A;  1JB0 E;  5EC7 A;  2I2L A;  3R6O A;  2QEX A;  4IUU A;  2L89 A;  1VQO T;  1TH7 A;  2OJ2 A;  3OYB A;  3E9G A;  3GNF B;  1VQN T;  1Q82 U;  1WXT A;  3S3M A;  4RG8 A;  2BTT A;  2ED0 A;  2P0P A;  2X4W A;  3SHW A;  1PD0 A;  1YJ9 A;  1PWT A;  2RQV A;  2RHI A;  5I22 A;  2FYK A;  2DXB A;  1VOM A;  1GCQ A;  1MGQ A;  4XTV A;  1QVG S;  1OUL A;  1VQ6 Q;  1Q86 R;  2WSC E;  2AKK A;  5HKC A;  4J9F A;  3CD6 A;  1KD1 R;  1E6G A;  4C5G A;  1T0H A;  2COZ A;  1UFF A;  4DBH A;  2KRO A;  1M3A A;  2VGM A;  5GMK e;  1IGQ A;  1RL2 A;  1PSF A;  5GAN f;  2EWN A;  1OPL A;  5DLO A;  3X24 B;  4RCB A;  4C8Q D;  4OB2 B;  2OAW A;  1HYO A;  2KBT A;  4M7A F;  3HRS A;  2HKN A;  1R0C B;  2EQK A;  3VU3 C;  4BD3 A;  1WA7 A;  2XI9 A;  3V8L A;  4KGX B;  2DA9 A;  4Y92 A;  4F14 A;  1S1N A;  2EJF A;  1UGP B;  4JJC A;  4M77 D;  4C92 D;  4NS5 A;  2DZC A;  2EKH A;  3WVD B;  3AT1 B;  3GIB A;  2A37 A;  3CME T;  2P0Q A;  4F04 B;  5HK0 A;  1YIT Q;  1NJI R;  2DBM A;  1VIF A;  2CDT A;  2OI3 A;  1YN8 A;  3BW1 A;  3CC2 T;  1G3W A;  3OY9 A;  2CT4 A;  2CP7 A;  2RO0 A;  3QDR B;  2RHU A;  3Q1J A;  3CCM Q;  2YUP A;  3CCS A;  2X4J A;  2YRD A;  2DVJ A;  1A0N B;  5CR2 A;  1UTI A;  3CCU Q;  4MZM A;  4XQ3 A;  1Q81 C;  4A53 A;  1KHC A;  2YWW A;  3MET A;  1RAA B;  3G6E A;  1BKB A;  2LQW A;  3L2V A;  3SEM A;  2XMF A;  5FRM A;  1Q82 R;  1PNJ A;  2F2V A;  2VGN A;  3LGF A;  1IB8 A;  2LT1 A;  4B9W A;  2VAS A;  4A54 A;  1VQK Q;  3FDR A;  2RNA A;  1OX9 A;  3SDZ A;  3LWI A;  2FPD A;  2L3S A;  1VQO Q;  3AHU A;  1KJW A;  4P5N A;  1FMK A;  2EGE A;  5L23 A;  2GNC A;  1D1A A;  1SPK A;  4JZ4 A;  5HY6 A;  2RMO A;  2EQJ A;  2DL3 A;  2BE9 B;  4RTU A;  1VIE A;  2JNG A;  3OYJ A;  2L3Q A;  1KFZ A;  3OYF A;  3DKM A;  3CCE Q;  2RQW A;  5LJ3 h;  5A0D A;  1I4K 1;  1OV3 A;  2FB7 A;  5IXB A;  3MP1 A;  2KXD A;  4IUQ A;  2ROL A;  5FRO A;  2CH4 A;  4GBQ A;  5GAN d;  2E3H A;  1OEB A;  2JW4 A;  4JUV A;  1SEM A;  2DER A;  5KE3 A;  1M1K C;  4XU1 A;  1JEG A;  2DIQ A;  1W2B P;  5GAM j;  1G2B A;  1OQK A;  1WX6 A;  5GAN 3;  3SD4 A;  3VS5 A;  3CXC A;  4PJO G;  1TOV A;  3OYD A;  3OW2 A;  1K4U S;  4PJO B;  1M90 C;  2K3Y A;  4M7A C;  2D0N A;  1YWO A;  5GAN 5;  5CKF A;  2LCC A;  2OTJ T;  1UG1 A;  3UF4 A;  3CXC S;  1JJ2 S;  1RAI B;  4VUB A;  4LDY A;  4FIB A;  5GAN g;  3OW2 S;  1ZX6 A;  3E1S A;  4PJO A;  3FJ5 A;  3M57 A;  4M7D E;  4RMO A;  4BE0 A;  3JCM Q;  1GCP A;  3OSV A;  4BY6 B;  1QCO A;  3NTK A;  2K5I A;  5EG2 A;  5GAO m;  1FXX A;  2DTH A;  3FB9 A;  4L6V 5;  3JAM E;  3CME Q;  2F5K A;  1RLQ C;  4M7D F;  1BCO A;  1XQH A;  1YNZ A;  2JOY A;  2RHZ A;  3G71 T;  3PVL A;  1SG5 A;  3HRT A;  2JTE A;  4MML A;  1LNX A;  1X2K A;  4MDX A;  4EPC A;  1K73 C;  4JRP A;  3BDL A;  3CCJ T;  2HKQ B;  3SB2 A;  1UJY A;  2YDL A;  3HFN A;  2YRV A;  4Y91 A;  2EGC A;  3GP8 A;  4E7J A;  4R0K A;  5I2S A;  3H9N A;  3PIP A;  4M7D D;  3OYI A;  1RI9 A;  3QJ6 A;  4JS5 A;  3H0I A;  2D0Q B;  2LJ1 A;  4M78 G;  4FCY A;  1ZSG A;  2E10 A;  3CCQ T;  1LVK A;  2CH4 W;  3H0H A;  4UC4 A;  1U1T A;  1IGU A;  4PJM A;  4R55 A;  1YJN A;  4BI4 A;  1KQ2 A;  4AFQ C;  4KUD K;  3QBY A;  4J7F A;  1NPR A;  1B3Q A;  2ZPB B;  1JQQ A;  1KQS A;  2EFI A;  1WHM A;  1U3O A;  4OMQ A;  3CBP A;  1X01 A;  3CCL T;  1Y96 B;  3QWY A;  1PM3 A; 
#chains in the Genus database with same CATH homology
 1M3B A;  2YSQ A;  1GRI A;  2J6K A;  2O31 A;  1PKS A;  1AD5 A;  2K3B A;  1WFW A;  1WLP B;  2O2O A;  2X3W D;  2C0T A;  2K9G A;  2MOX A;  1I0C A;  2GGR A;  4RTY A;  2ABL A;  2FEI A;  3TSW A;  4AFZ C;  2NWM A;  3UAT A;  5I11 A;  2PTK A;  4J9I A;  3EHR A;  2V1Q A;  1U06 A;  3IQL A;  2K6D A;  3CQT A;  4EIK A;  2V1R A;  4CC7 A;  2LJ0 A;  1M8M A;  2JT4 A;  3PVQ A;  1X43 A;  2G6F X;  1V1C A;  2CUD A;  3GBQ A;  1HSQ A;  1M3C A;  2BZ8 A;  3I5R A;  2J7I A;  4D8D A;  2K79 A;  1WYX A;  3EG2 A;  2DX1 A;  4Z8A A;  1BU1 A;  1Y0M A;  1ARK A;  1WI7 A;  2J06 A;  2KRS A;  2RF0 A;  2YT6 A;  3UA6 A;  3VRY A;  1AWX A;  5HCK A;  2O88 A;  1JXM A;  1X6B A;  1XOV A;  4ORZ A;  1CKB A;  1T0J A;  2LCS A;  2LP5 A;  3I9Q A;  1PRM C;  2RQT A;  3THK A;  2EVR A;  2VVK A;  3EGU A;  1N5Z A;  3I35 A;  2DE0 X;  1GCQ C;  2O9S A;  2A08 A;  2AKL A;  1WDX A;  1FYN A;  2MCN A;  1NLO C;  1NLP C;  2LQN A;  3H0F A;  1UHC A;  4IIO A;  4JPB W;  2SRC A;  1BK2 A;  1PRL C;  1K1Z A;  1K76 A;  1ZLM A;  3VS0 A;  1ZUY A;  2CSQ A;  1X69 A;  3M0S A;  4DEX A;  2F2X A;  2GBQ A;  2DL7 A;  2RN8 A;  2JMA A;  1QLY A;  3M0T A;  1AWW A;  2JMC A;  2M51 A;  2EW3 A;  2MIO A;  1GBR A;  1K0X A;  4D8K A;  1ABO A;  1UJ0 A;  2RPN A;  4FSS A;  2HDA A;  4DEY A;  1WIE A;  2FRY A;  1X27 A;  4RTX A;  2DRM A;  1MUZ A;  2EYX A;  2DF6 A;  4ESR A;  2CT3 A;  3C0C A;  5GJW B;  1GFC A;  1QWF A;  1NYF A;  1PHT A;  4IIM A;  2KR3 A;  1TUD A;  2LX7 A;  1G83 A;  1B07 A;  2J6O A;  2W0Z A;  1I1J A;  5EC7 A;  3VS6 A;  1JO8 A;  3ULR B;  4OMP A;  1K0S A;  3EHQ A;  2OJ2 A;  1QWE A;  3REA B;  2GTJ A;  4LUD A;  1JXO A;  2SEM A;  4J9E A;  1TG0 A;  2ROT A;  1WXT A;  1VA7 A;  4HVW A;  2KRN A;  3RNJ A;  3M0R A;  4RTZ A;  1W6X A;  1W1F A;  2BTT A;  2H8H A;  2ED0 A;  4JJB A;  3SHW A;  2D1X A;  2HSP A;  5IXF A;  1X2Q A;  1PWT A;  1YWP A;  2DMO A;  2RQV A;  2AK5 A;  2AZS A;  5I22 A;  3VS2 A;  1OPK A;  1AZG B;  1GCQ A;  1AVZ C;  2I0N A;  2EPD A;  1WXB A;  2L0A A;  4GLM A;  2EBP A;  2E5K A;  2D8H A;  2AKK A;  2FO0 A;  4J9F A;  2ECZ A;  2DRK A;  3REB B;  4AFU C;  4AG2 C;  4J9G A;  4CC4 B;  1AOJ A;  2EGA A;  2RQR A;  1UHF A;  2KXC A;  1VYU A;  2LMJ A;  4ZNX A;  1E6G A;  3VS7 A;  1T0H A;  1UFF A;  3NPF A;  2KRO A;  1UEC A;  1M3A A;  2KRM A;  1AWJ A;  2DYB A;  1KIK A;  2DIL A;  3VS4 A;  1M30 A;  1OPL A;  3I5S A;  2DBK A;  2OAW A;  2FG0 A;  2KBT A;  3EG0 A;  2PZ1 A;  1H92 A;  1GL5 A;  1T3L A;  1NEB A;  3VS3 A;  2KE9 A;  1ZBJ A;  1WA7 A;  1UGV A;  1BBZ A;  2DA9 A;  4Y92 A;  2L2P A;  1MV3 A;  4HCK A;  4F14 A;  1S1N A;  2J6F A;  4JJC A;  4JZ3 A;  1QKX A;  2EKH A;  1SRM A;  1UUE A;  2J05 A;  2A37 A;  1X6G A;  3EG3 A;  1RLP C;  4Z89 A;  2DBM A;  2CDT A;  2OI3 A;  1YN8 A;  1AZE A;  3QWX X;  2CT4 A;  2YUO A;  1GBQ A;  2NUZ A;  2ED1 A;  1RUW A;  2KT1 A;  2YUP A;  1IO6 A;  5IHK A;  2DVJ A;  1A0N B;  1H8K A;  1UTI A;  2K7A A;  4RUG A;  3M0U A;  1E7O A;  2JM8 A;  2C0O A;  1VYV A;  3PE0 A;  2LQW A;  2EYW A;  3NHN A;  2JXB A;  4KRT A;  3SEM A;  2W10 A;  2XMF A;  2CRE A;  1PNJ A;  2F2V A;  4OML A;  2O9V A;  4OMN A;  4J9B A;  2KNB B;  1HD3 A;  4RTT A;  1QCF A;  2GTO A;  2EYY A;  2RNA A;  2VWF A;  5FWC A;  1QKW A;  2FPD A;  2L3S A;  2LJ3 A;  3O5Z A;  3VRZ A;  4F17 A;  2FRW A;  1MV0 B;  3M0Q A;  2HCK A;  3NMZ C;  1KJW A;  1FMK A;  1T3S A;  2EGE A;  2ESW A;  5IH2 A;  5FWB A;  5L23 A;  4F16 A;  2GNC A;  5ECA A;  1UDL A;  1SPK A;  4JZ4 A;  2AZV A;  2RQU A;  1NG2 A;  2RMO A;  3TVT A;  2K2M A;  2DL3 A;  2KYM A;  2D8J A;  4RTU A;  4CC2 A;  1NM7 A;  1VYT A;  2X3X D;  2L3Q A;  1KFZ A;  1M27 C;  3VS1 A;  1SRL A;  4CC3 A;  3JV3 A;  3ZL7 C;  2DL8 A;  3UA7 A;  2LZ6 B;  2RQW A;  2FPF A;  2CSI A;  4J9H A;  1OV3 A;  5IXB A;  4AFS C;  1W70 A;  1GFD A;  2KXD A;  1AWO A;  2JS2 A;  2JM9 A;  1E6H A;  2ROL A;  1I07 A;  1SHG A;  2KT8 A;  2P4R A;  2CH4 A;  4GBQ A;  4JJD A;  3M0P A;  1OEB A;  2JW4 A;  4AG1 C;  1KSW A;  1SEM A;  1ZUK A;  1JEG A;  1ABQ A;  2ENM A;  1UE9 A;  1G2B A;  1WX6 A;  1Y57 A;  5FW9 A;  1H3H A;  3VS5 A;  1LCK A;  1PKT A;  1TUC A;  2BZY A;  4HVU A;  1K4U S;  2D0N A;  1YWO A;  2BZX A;  3LH5 A;  4HVV A;  4LNP A;  1JU5 C;  1UG1 A;  3UF4 A;  2L3P A;  4M4Z A;  2HBW A;  1J3T A;  4RTV A;  4A63 B;  1ZX6 A;  2DNU A;  1BB9 A;  4OMO A;  4QT7 A;  2DL5 A;  1NEG A;  1YCS B;  1EFN A;  3FJ5 A;  4Z88 A;  2B86 A;  1Z9Z A;  1GCP A;  3EG1 A;  2DJQ A;  2A36 A;  2IIM A;  2CUB A;  2QDL A;  5IHI A;  1HJD A;  2F2W A;  1YP5 A;  1ZUU A;  1RLQ C;  4E6R A;  1YNZ A;  3PVL A;  2FPE A;  4X1V A;  4LN2 A;  1CSK A;  1NYG A;  2M0Y A;  2JTE A;  2GQI A;  1X2K A;  2EQI A;  4LE9 A;  1SHF A;  4LUE A;  2KYB A;  4HXJ A;  1K9A A;  1UJY A;  1AEY A;  2KEA A;  2HEQ A;  2YDL A;  2JS0 A;  4OMM A;  3H41 A;  2YUQ A;  2C0I A;  2EGC A;  4R0K A;  2DM1 A;  2KGT A;  1U5S A;  5IHN A;  3TSZ A;  1RI9 A;  4K11 A;  1SSH A;  2VKN A;  3H0I A;  1CKA A;  4J9D A;  2LJ1 A;  2DLP A;  2DL4 A;  2LNH B;  3U23 A;  1ZSG A;  2PNI A;  4RTW A;  2YUN A;  2CH4 W;  3H0H A;  3NGP A;  3RBB B;  2EYZ A;  5GJV B;  4J9C A;  3R6N A;  2A28 A;  1Z9Q A;  4AFQ C;  3A98 A;  4WCI A;  1B3Q A;  1JQQ A;  1U3O A;  3KFV A;  4OMQ A;  1WXU A;  1OOT A;  3QWY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...