2KXDA

The structure of sh3-f2
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
73
structure length
73
Chain Sequence
b'MGAPPLPPYSAGGREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDSGTGKELVLALYDYQEKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 11-mer peptide, SH3 domain of Spectrin alpha chain
molecule tags Signaling protein
source organism Synthetic, gallus gallus
publication title NMR structure and dynamics of the chimeric protein SH3-F2
pubmed doi rcsb
total genus 6
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2010-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2kxdA00
1SSHA 4D8DA 2RQUA 1TG0A 1GRIA 1HD3A 2E5KA 3U23A 4K11A 2XMFA 2PNIA 2JS0A 4RTXA 1B3QA 1T0HA 1NYGA 2LP5A 4HCKA 3PVLA 4J9BA 5GJWB 1AWOA 2CSIA 1AD5A 3VS7A 4FSSA 5EC7A 2FO0A 2LNHB 4RUGA 1AZGB 2K6DA 1CSKA 3R6NA 4J9GA 1ZSGA 3VRYA 4CC3A 4J9EA 2DF6A 1ZLMA 1GCQA 1GL5A 1Y0MA 2DL5A 2EYZA 2X3XD 1H92A 3I35A 2ENMA 2I0NA 2CREA 2EBPA 1QWEA 2L2PA 2KBTA 2ECZA 3VS3A 2DBKA 4EIKA 2L3SA 4AG2C 1NYFA 4ZNXA 5HCKA 4Y92A 1W1FA 1I07A 1JXOA 3REBB 1YNZA 1UTIA 1UG1A 2ESWA 1QKXA 1K0XA 1SPKA 2CH4A 4IIOA 4F17A 2GGRA 1WYXA 2DLPA 3REAB 2A36A 1NG2A 4JJBA 2DYBA 3M0SA 1OPKA 2EVRA 1K0SA 2MOXA 2M51A 1VYTA 2FG0A 3EHQA 2DRMA 3VS1A 4RTZA 4J9DA 2HCKA 1T3LA 4DEXA 5IXFA 1TUDA 2EYYA 1AWXA 2RPNA 1X27A 4OMOA 1ZUKA 2EGAA 4R0KA 1GBQA 1UDLA 2AZSA 2K3BA 2VVKA 4AFSC 3H0FA 2DL3A 4F14A 1ARKA 4LE9A 1Z9QA 2BZ8A 3O5ZA 3TSZA 1H8KA 1WIEA 2OJ2A 5FWCA 2PTKA 1JXMA 4Z89A 4OMNA 2RMOA 1K76A 2O9VA 1SRMA 2KYMA 2OI3A 2LQWA 1G83A 2LJ1A 2V1RA 1M8MA 1OEBA 3TVTA 1MV3A 5I22A 1OPLA 2M0YA 1QCFA 2L3QA 1GCPA 1M3AA 4M4ZA 1X2KA 4HVWA 1YCSB 2CUDA 3THKA 1AVZC 5GJVB 1VYVA 1X2QA 2HDAA 2DBMA 1PKTA 2YUQA 5IXBA 1PNJA 3H0IA 5FWBA 2QDLA 3H41A 2J6KA 1W70A 4AFQC 2J05A 3ULRB 1FYNA 2JM8A 4KRTA 2HEQA 1JEGA 1ABOA 2AK5A 1YWOA 1HJDA 2JXBA 2A28A 2NWMA 4GBQA 1K9AA 1AZEA 1WLPB 2SRCA 2LJ3A 2KRSA 4ESRA 2F2XA 2KRNA 1BK2A 2EPDA 4Z8AA 4F16A 3M0RA 4J9IA 2JTEA 1MUZA 1JU5C 1NM7A 3UA7A 5IHKA 3FJ5A 2EYXA 4GLMA 5IHNA 3A98A 1SRLA 3QWXX 1X69A 4OMQA 2F2VA 1W6XA 2KXCA 2J06A 2JM9A 2K79A 2EKHA 2V1QA 1E6HA 1GFDA 2C0OA 1ABQA 1PRLC 1UECA 1LCKA 4J9CA 1SEMA 1RLPC 2LMJA 2W10A 2DMOA 2EYWA 2G6FX 3M0TA 2VKNA 1NLPC 4HXJA 1CKBA 4JJDA 2FEIA 2IIMA 2BTTA 4RTTA 1UE9A 2A08A 1GBRA 2DM1A 1OV3A 2O88A 2KROA 2ROTA 1VA7A 2DVJA 2KXDA 2LZ6B 1GFCA 2F2WA 1G2BA 3EGUA 4LN2A 3C0CA 1T3SA 1UJYA 2LQNA 2LX7A 1KSWA 4RTYA 1K4US 1QKWA 3SHWA 2DJQA 1X43A 4LNPA 4CC2A 2RQTA 1WX6A 2FPFA 2DILA 2KEAA 3EHRA 2KGTA 1J3TA 1M27C 2KE9A 3EG3A 1WXBA 1E6GA 2K7AA 5IHIA 1QLYA 3EG2A 4OMMA 2ED0A 1WDXA 3UF4A 1Y57A 1Z9ZA 2W0ZA 4OMPA 2B86A 5IH2A 4JZ4A 2D8HA 1U5SA 2O31A 1TUCA 1RI9A 4J9HA 4LUDA 1WXUA 1ZBJA 3VS2A 2RQRA 1PKSA 3EG1A 2D1XA 1PRMC 1UUEA 1A0NB 2JS2A 1H3HA 2KYBA 2CH4W 2O2OA 2DL7A 2RQWA 2KRMA 2RNAA 4J9FA 4HVUA 2K2MA 2ROLA 2YUPA 1U3OA 1M3CA 1ZUYA 2D8JA 2LJ0A 3NMZC 4WCIA 2KT1A 3CQTA 1UHFA 1JO8A 1YP5A 1HSQA 2GTJA 1I0CA 2FPEA 3KFVA 1I1JA 2DL4A 2GQIA 1BB9A 1JQQA 4AG1C 3GBQA 2EQIA 1M3BA 1NLOC 2AZVA 4OMLA 1UJ0A 2EGEA 1E7OA 3TSWA 1SHFA 2DE0X 3RNJA 1M30A 1KJWA 1NEBA 1XOVA 3EG0A 1PHTA 3NHNA 1IO6A 1AWWA 5I11A 1WFWA 2GNCA 2J6OA 3UA6A 4IIMA 1BU1A 4QT7A 2FPDA 1X6BA 1KFZA 2EGCA 1T0JA 2YSQA 2MCNA 1FMKA 3PVQA 1YWPA 4RTWA 2CUBA 4AFZC 3I9QA 1GCQC 2NUZA 3NPFA 4JPBW 1UHCA 4E6RA 2JMAA 1UGVA 3SEMA 2JMCA 1EFNA 2J7IA 2AKLA 2DX1A 2PZ1A 1N5ZA 4ORZA 1NEGA 2K9GA 1VYUA 2LCSA 1YN8A 2KR3A 2YUNA 4CC7A 2BZYA 3VS4A 1RLQC 4RTVA 3PE0A 4JZ3A 2YUOA 2P4RA 2FRYA 2AKKA 2C0IA 4DEYA 2O9SA 3VS6A 1CKAA 1KIKA 2J6FA 3UATA 4A63B 2RF0A 1PWTA 3IQLA 4Z88A 2ABLA 2HBWA 4JJCA 1WXTA 2JT4A 2EW3A 1S1NA 1WA7A 2CT3A 1UFFA 2JW4A 1X6GA 1ZX6A 1MV0B 3RBBB 3QWYA 2DNUA 3JV3A 2C0TA 2CT4A 1OOTA 2OAWA 2BZXA 2GTOA 3M0UA 1K1ZA 2D0NA 2KT8A 1AOJA 2H8HA 2CDTA 5ECAA 3LH5A 2RQVA 4HVVA 1AWJA 3M0QA 1B07A 3I5SA 3ZL7C 2HSPA 2MIOA 2L0AA 3I5RA 2CSQA 4RTUA 1U06A 2SEMA 4CC4B 5L23A 4D8KA 2ED1A 3VRZA 1WI7A 2GBQA 3VS0A 1RUWA 1SHGA 2YDLA 2RN8A 5FW9A 2L3PA 3M0PA 2YT6A 3VS5A 1BBZA 1ZUUA 4AFUC 2VWFA 2KNBB 1QWFA 1AEYA 2DA9A 4X1VA 2DRKA 2DL8A 2A37A 2FRWA 3NGPA 3H0HA 4LUEA 1V1CA 2X3WD
chains in the Genus database with same CATH superfamily
5EG2A 2LCLA 3OA6A 1GRIA 4K11A 3C94A 4C0DC 3R6OA 1T0HA 3TREA 4M75B 2KK4A 1QVFS 3OQ5A 4OB3B 3CPWS 2LNHB 1RL2A 3RR6A 4CI0C 1AZGB 5GAOl 4BD3A 2RJDA 4E7IA 2YWWA 4C5HA 2P84A 3OSSC 4CC3A 2BIVA 1GCQA 2DL5A 2X3XD 3I35A 2ENMA 3GP8A 2CREA 1VQOA 1QWEA 2DBKA 4EIKA 3RERA 2ZPEB 1YI2T 5CKEA 5HK3A 1W1FA 1I07A 1JJ2A 2CZ0B 2EKOA 3BFMA 4ZN1A 1YJNQ 1SPKA 2CH4A 1QVFA 3SB2A 1U8RA 5CKBA 2YRCA 1NG2A 4JJBA 2X35A 4C92C 4NL2A 1QVGA 1K0SA 3JB9I 4KUDK 4JRIA 1LJOA 1QVPA 2AT1B 3EHQA 4C5IA 3GNGA 4KGVB 4JS4A 4J9DA 2HCKA 4M7DC 2DERA 2EYYA 1AWXA 4V2SA 1X27A 4C92E 2RHXA 1Q81R 4XAXB 2AZSA 3M57A 2ZZDA 2VVKA 5GANh 1N9RA 4F14A 5LJ5e 2H3EB 1Z9QA 2BZ8A 3META 4RG8A 1H8KA 4OMNA 3J80E 4M75G 1G83A 1M8MA 4M78A 1VQMT 1OEBA 2VV5A 2MPXC 4OB2B 3EGDB 4PFPA 2DD5A 3CCLQ 4M4ZA 1YCSB 4LDXA 2L5QA 4JRKA 5GJVB 4C92D 2HD0A 1BCMA 3G71A 1D1CA 2NYSA 2HDAA 4J7IA 1BKBA 2YUQA 5IXBA 4KH0B 1JBMA 2LQ8A 2J6KA 4M7DF 3PIPA 3LH0A 3OMGA 4KRTA 2L8DA 2EJ9A 4OB0B 1JEGA 1ABOA 4PJOF 2X4JA 1HJDA 2JXBA 2LQKA 4GBQA 5GAOn 4BB7A 1VQ6A 1AZEA 3HRSA 4PL6A 1TTHB 1W4SA 2WSEE 3E1SA 4M78G 2KRSA 2P0PA 1BK2A 3UT1A 4Z8AA 4F16A 4J9IA 5IN1A 3S6WA 1QVGS 1JU5C 1NM7A 5IHKA 3A98A 3QWXX 4M7AB 1QP2A 3M9QA 4M7DB 5J3BA 2F2VA 1W6XA 3E9GA 4KGZB 2K79A 5FU6B 3G4ST 3QYGB 2DETA 2C0OA 1YJWA 3JCMh 3A8GB 2DZCA 1RLPC 4QW2A 1U1TA 5CKDA 5A0LA 3GLXA 2EYWA 4EPCA 3M0TA 3JB9D 3BE3A 2DAQA 4BACA 1FMWA 2IIMA 1RI0A 1D09B 4RTTA 3CCJT 1UE9A 2QK0A 2RHZA 4DOVA 4ATOA 2DM1A 1OZ3A 1OV3A 1SKUB 2A3LA 4BDZA 4OGCA 2FZKB 3ZBDA 2DVJA 1KQSS 4JLIA 2F5TX 5LJ5j 4FM4B 4E7KA 2LX7A 4M75C 3NTKA 3CC4A 1VQ6T 4M77D 2DK3A 2DJQA 4HKEA 3G1JA 2FPFA 2KEAA 4PJMA 3JB9H 1OULA 3EG3A 1VQ4Q 2VASA 3SWNC 2DEUA 2MK5A 1QLYA 4ELZC 3OS5A 4DBQA 1WDXA 4LD6A 3PIOA 1BI1A 1D3BB 4OMPA 2E41A 1QMCA 5GAN7 4LDUA 3OSVA 2WSCE 3QSUA 1U5SA 2O31A 3QHSA 1RI9A 3QDFA 2LVMA 1WXUA 2RHYA 3OYMA 4M78F 4C0GA 5I2MA 1MNEA 1ZBJA 3OYCA 4OB1B 2XDDA 4JS5A 4RKUE 3OS1A 2KVQG 1PKSA 1G3SA 2D1XA 4C8QD 5LJ3e 1Q86C 3MKDA 2X4WA 3OYAA 2X4XA 1H3HA 2EQKA 4QQGA 2KYBA 2JUFA 1VQ8T 2QGGA 4F7UB 2KRMA 4P5NA 2K2MA 1U3OA 4M78C 1M3CA 1YJ9A 3M54A 3A5ZB 4MZTA 2KT1A 1IGQA 3CQTA 3CC4Q 1HSQA 4M78B 1I0CA 1NJIU 4DQ2A 2VUBA 2P4TA 2DL4A 3H9NA 2QDYB 3VYGA 4AG1C 3JCMW 2M9UA 1UJ0A 1Q81C 2EGEA 2ZPHB 1SHFA 2K2VA 4Y91A 1EX4A 1M30A 2E70A 1NEBA 1LVKA 1XOVA 3CPWA 1PHTA 1N9SA 5LJ3j 5L8RE 1AWWA 5I11A 3UWNA 5I21A 1WFWA 2ZPFB 3CCJQ 2ZGWA 3UA6A 4IIMA 1X6BA 4ME7A 2KQWA 1NBEB 2YSQA 5CAIA 1YWPA 2D9TA 4AFZC 4M77F 5HK0A 4E2FB 2JMAA 2Y90A 3SEMA 1IRXA 1BIBA 2J7IA 5GAN5 1KQSP 1KD1R 1KHIA 4ORZA 4FYYB 2MYSA 3H8ZA 5GAN4 2BZYA 4EMHA 4PJJA 4ELYC 3S3MA 2RK1A 1KQ1A 3PMIA 2JNGA 4A4GA 2YUOA 3CPFA 2A0FB 1KIKA 1PWTA 2R5AA 4NL3A 2HBWA 2HQXA 2GFAA 4WTOB 2HZYA 3WXMB 3P8BB 3RKYA 2RB6A 1I5LA 5KH6A 1RAEB 2NUTA 4BDYA 3CEYA 1ZX6A 2YLBA 4PJNA 5D6YA 2CGHA 2GTOA 4OVAA 2Y4YA 2HQHA 2D0NA 4XTUA 2CDTA 5GMKm 3LH5A 4HVVA 2P0KA 5D7UA 5AYFA 3M0QA 1B07A 3EH2A 1ZA1B 1ZBXA 3FB9A 2L0AA 2HQEA 3FEOA 2CSQA 3GIBA 4RTUA 3RKXA 2E65A 2RJEA 3EH1A 2K3XA 2OTLT 4D8KA 3VRZA 2GBQA 4FCYA 3JCMg 3QZ9B 2V26A 3VUZA 5CQXA 5C0MA 1OU9A 1BYMA 1R0BG 2VC8A 1BBZA 4AFUC 4M75D 1AEYA 2JZ2A 1IB8A 2F5KA 3CCEA 1H641 2DRKA 1QQJA 1BI3A 5CVIA 1K9MR 1D3BA 3CCRA 1VQ5A 1C0MA 3M58A 1HD3A 3CCQA 4HCCA 1NYGA 4XU1A 2JVVA 1WQWA 1AWOA 2CSIA 2VGMA 2QQAA 1AD5A 1FWZA 1K73C 3OYLA 5EC7A 4E7HA 1C1AA 2FO0A 4RUGA 1D1AA 4BY6B 3HFNA 3S3NA 2E12A 4J9GA 1TSFA 1WZOA 1K8AR 3A8HB 3VRYA 4J9EA 2E6ZA 1ZLMA 3MP8A 2EYZA 2I0NA 1P92A 2KBTA 2ECZA 3VS3A 1K8AC 4N0AC 3OBWA 4M7DA 4XQ3A 4AG2C 1W2BS 4ZNXA 3OW2A 3L1AA 4XU3A 4A4EA 1WJSA 1WHGA 3WVEB 1JXOA 3VYHB 3TU4K 3CPWP 3REBB 1YNZA 1QKXA 2P0QA 4KH1B 3RMQA 1K73R 1M2VB 1F1BB 3G6EQ 4BI4A 2CZ6B 3M53A 2M51A 4IUTA 1YIJA 1SF9A 2CZ7B 4C5EA 2XICA 4DEXA 4CRIA 4OMOA 1TXQA 3F70A 2DVEA 3V7RA 3VUBA 1PSFA 2E3HA 2QAZA 3O5ZA 3CCQT 1KD1U 4LXCA 3CCLT 4O5VA 2OJ2A 5FWCA 1MMNA 1KG1A 2RMOA 1K76A 1B34A 2RHUA 4FIBA 3L2QA 3CXCS 3GF5A 2OI3A 1N8RU 2LQWA 3P8HA 4M77C 5CO7A 5GMKj 1OPLA 1QCFA 1R8OB 1M90U 5KYUB 1GCPA 1X2KA 1JJ2P 3FLGA 4QKUA 5LJ3g 3EGDA 5KYYA 5LJ5g 2EQJA 1XTDA 4A53A 1VYVA 2L3RA 1X2QA 1Q7YR 3Q1JA 3OYHA 1PNJA 1RAFB 5FWBA 3MCAB 2RK2A 1M1FA 3H41A 4AFQC 2KY9A 4M75A 1QCNA 2J05A 5CK9A 4ZN3A 2DYIA 1OI1A 1K9MC 2XHCA 3ZEHA 4F7UF 1K9AA 3G4SA 5LJ5h 4M7DE 2KRNA 2I2LA 2EPDA 5GANd 2YRDA 4RCBA 3UA7A 3MP1A 2K57A 5GAOm 1WQ7A 3EFSA 3FJ5A 2EYXA 1V76A 3CCJA 4O6JA 2QA4A 2EYQA 1X69A 3MO8A 2EIFA 4OMQA 1OX8A 2DD4A 3HRUA 2EKHA 4JRQA 2OTLA 3CCSQ 5KCOA 2FB7A 1PRLC 2HKNA 4Y28E 1YJ9Q 2LMJA 3CC4T 3TEEA 3UDCA 1VQ5Q 4HXJA 3FRNA 5FROA 3OW2P 3JB9F 2OX7A 4JUVA 2JOYA 1GBRA 4PJOD 3NTHA 2CP6A 2LZ6B 5DY9A 2F2WA 2IVWA 4GLKA 2DJZA 5CIUA 1VQKT 2ZCFB 4PLLA 3C0CA 1UGSB 4LDYA 1T3SA 1VQPA 1MHNA 4L5GA 1K4US 3SHWA 1X43A 1WX6A 2WACA 2DILA 4FU6A 2PUKB 3EHRA 2COWA 2LX9A 3I55A 1M27C 1B7TA 3P8DA 1UEBA 1WXBA 1E6GA 3LGLA 3EG2A 2KMTA 1VQOT 2RI3A 4PK4A 3UF4A 1UGPB 2AIRB 4JZ4A 4N4HA 1M2VA 1YJ9T 1TUCA 1ACMB 4ZGDB 2PVGB 1FXXA 3EFOA 2VGNA 3OYGA 1S72Q 4FL6A 2RQRA 3EG1A 4M78D 4J5YA 1LNXA 3CCMQ 1ZSZB 2JS2A 2M0OA 2LCCA 3L2ZA 3HSBA 5D6WA 1Q82U 2O2OA 3AT1B 4X9DA 2OTJT 3SWNA 1M8VA 1ZUYA 5KYXA 3NMZC 1OX9A 4II1A 3G71T 3CMET 2NUTB 1YP5A 4C92G 2GTJA 1YI2Q 1IGUA 4KGXB 4R55A 2GF7A 3GBQA 3HL8A 2EQIA 1GXIE 4OMLA 2FZCB 1WHJA 1WHLA 3CXCP 3CCUT 2RO0A 4MMLA 2DO3A 2E10A 4A4KA 1IO6A 1S72T 2GNCA 2J6OA 3JCMX 4QT7A 1VQLQ 2FPDA 1T0JA 2VXFA 1KC8C 2MCNA 4RTWA 1GCQC 2NUZA 3OYDA 2QEXT 1TH7A 1UGVA 1NZ9A 3JAME 1AHJB 2QQBA 3OYFA 1N5ZA 2LCSA 1YN8A 2YUNA 4ZTFA 1RLQC 1X01A 2DXTA 3JB9J 5CKHA 3GOXA 2K5FA 4J8OA 3QUIA 2FRYA 1UGRB 2C0IA 4AMCA 4DEYA 1M1KR 1CKAA 4MZPA 3CCLA 3PFSA 3CMAA 5GMKh 4Z88A 2JT4A 3UPUA 1S1NA 5GAOr 2LC4A 3SD4A 3OS2A 4OMFB 3SFMA 2QQSA 3L2VA 1M1KC 3EAEA 1FX7A 1MV0B 3QWYA 4C0ZA 2C0TA 4WF2A 1OOTA 2KDSA 4PJOG 3M0UA 1KC8R 3CCVQ 2H8HA 3G4SQ 2Z0WA 2ATCB 4B6MA 3CMEA 3AHUA 4D6WA 1VQ4A 3L2RA 3CCMT 3I5SA 3ZL7C 4LDWA 3ZFJA 3BDUA 3OYYA 2QG9B 3I5RA 3JSCA 3G7ZA 4PJLA 3V7SA 3BDLA 1U06A 1W2BA 5L23A 1WI7A 1Q7YU 4PJOA 5CKFA 3GNFB 2L3PA 4OF1A 3CMAT 4EMKB 3N5BB 3C12A 5GANe 1B34B 1BIAA 5DLOA 2DFUA 2KNBB 1QWFA 1WPYA 2QA4T 2QGFB 3CCVT 4X1VA 2A37A 4F04B 4E7SA 5J39A 3H0HA 2G3RA 1JB0E 2O4XA 4AT1B 2X3WD 4C8QF 4D8DA 5HKCA 2A7YA 1I8FA 2RQUA 1TG0A 3HTRA 2E5KA 1TU0B 5HY6A 2XMFA 2LDMA 2PNIA 1VQKQ 1B3QA 1Y71A 2DIGA 3MP6A 2K4YA 4HCKA 2DTOA 3PVLA 5GJWB 3VS7A 1HK9A 4FYXB 4FSSA 2E64A 1G8XA 2K6DA 1CSKA 4PKCC 4C92F 2CYZB 1VQ8Q 1VQ4T 4IUPA 5GAMg 2CP0A 1YJWQ 3EFOB 4F7UG 4E7JA 4PNOA 1YCYA 2K3YA 3CCVA 4FYVB 3J7AF 2FZGB 1TS9A 4Y92A 4A4HA 2XG8D 1UTIA 3EG9A 1VQNA 4JDSA 3VV0A 5GAN6 2PUOB 4L6V5 3CC2Q 4F17A 4EMKC 2GGRA 2XK0A 1WYXA 3X25B 4IKFA 3PT9A 1KQSA 4LD9K 3REAB 3OB9A 3G6ET 2EVRA 4F7UE 4M7AE 4PJOE 2FG0A 4M7DG 4M7AG 3VS1A 1Q86R 4RTZA 1T3LA 2RI2A 5IXFA 3M5AA 1TUDA 4BE2A 2RPNA 2FHDA 3VJPA 2GCXA 2BE7D 3EG9B 1ZUKA 1VQNQ 2E3IA 3HP9A 3X28B 3JCMV 1VQ7Q 2O01E 3HKSA 4AFSC 1IREB 4J6YA 3H0FA 1WHHA 2DL3A 4LE9A 4FW1A 1WIEA 5KYNA 2PTKA 4HCBA 2R57A 5LL6S 2O9VA 2V8IA 1SRMA 2KYMA 4X9CA 1EZZB 3L2WA 3CCUA 4LDVA 4C8QA 2L3QA 3V7CA 1V29B 1M3AA 2E6NA 3M4GA 1WHMA 4HVWA 2CUDA 5FRNA 1IXDA 1AVZC 3KUFA 5IT9E 5GANf 3RDVA 2E5QA 1PKTA 3H0IA 1YITT 3WVDB 5LJ5d 1W70A 4M75E 1BCOA 1FYNA 2HEQA 4M7AD 2AK5A 1W2BP 1BI0A 1TWBA 1YWOA 1WLPB 1VQ5T 2RJCA 2SRCA 3QIIA 3MJXA 2LJ3A 1MMGA 5LJ3h 3JCMf 4ESRA 3D7SB 2F2XA 1X75C 1RAGB 2HSEB 4XTZA 2JTEA 5GAN2 4HT9A 2Y4XA 3QXEB 3CD6A 2H3JA 5IHNA 1SSFA 3X24B 1VQLA 1ZSZA 2C06A 2CP7A 2J06A 2KXCA 2RH2A 5I2SA 5GAMf 5CQYA 3I56A 4PJOB 3OYKA 2BUDA 1SEMA 3ER0A 3JCMJ 2KAFA 3I55T 1PSEA 2W10A 4DBRA 3CC7T 5KYWA 2G6FX 2VKNA 1NLPC 3FIFA 1N6AA 3JCMP 2FEIA 5KYYB 1Y07A 3CCRT 2A08A 3CCMA 1O9SA 4M7AF 8AT1B 1EIFA 4HA8A 2ROTA 4BI8B 1VA7A 2LT4A 2QEXQ 1G2BA 4IUVA 2ZPGB 2NUPA 3EGUA 2V8KA 4EMGA 2F1LA 4ANJA 9ATCB 5M9OA 4PFOA 4J6XA 1KSWA 5KYUA 2QQ9A 4C0DB 3ME9A 2LRQA 1I4K1 1Q81U 1VOMA 4FSXA 4J6WA 4LNPA 4CC2A 1YHQQ 3DLMA 1ZA2B 2XDBA 3OBYA 1WHKA 3CXCA 3NFCA 4QVDA 1VQPQ 4F7UA 1XJWB 3RMSA 1Z9ZA 1RAHB 3G71Q 3E19A 2B86A 1VIEA 3I55Q 1UB4A 4LUDA 4J9HA 1KHCA 3CCRQ 5D6XA 5FRMA 1QP3A 2OTJQ 3M56A 2K5IA 3VS2A 2V8JA 3CMAQ 1RAIB 2CP3A 3CC7Q 1PRMC 1UUEA 2XIDA 4L59A 4FW2A 2CH4W 4KULA 2DL7A 2RQWA 4J83A 2M1HA 3GPLA 4HVUA 2FVUA 4C8QC 4C8QE 1BI2A 2F69A 2DPPB 3MEAA 2EWNA 1UHFA 1JO8A 1RADB 2BKDN 1M90R 3FDRA 2KSSA 4C8QB 1C6VX 3OW2S 2GQIA 1OU8A 1YBYA 3JCMe 4HCZA 1NLOC 1I81A 2AZVA 3TSWA 1MNDA 2DE0X 3QJYA 2MAMA 1YHQA 1KJWA 4XU2A 3EG0A 4DA4A 1IHVA 3BW1A 2QA4Q 1BU1A 3PGGA 1Y96B 3EGXA 1KFZA 1FMKA 3M55A 1OYXA 4PLIA 4JPBW 3DB4A 4E6RA 1WNLA 2JMCA 1H3ZA 2QASA 5C6SA 2DX1A 2PZ1A 2MF2A 3QJ6A 2K9GA 1O75A 3J81E 4IUQA 4DBHA 1UGQB 1VQMA 2D0QB 4JZ3A 2DXUA 4XTYA 2GQVA 1Q86U 1AT1B 4M78E 2O9SA 3VS6A 1ZHIA 2J6FA 3CCST 1WXTA 1PCXA 2EW3A 1WA7A 5IAYA 2X51A 4M77B 2CP5A 2DKGA 3KXTA 3I56Q 3V8LA 3CD6Q 4XTWA 5J26A 3RBBB 1K73U 1Y96A 2DNUA 3LYIA 1VQKA 2CT4A 5LJ3d 1NJIC 5DLQE 1JRIA 2RQVA 4JJNK 3HHTB 1AWJA 2DIQA 3OYIA 3G6EA 4RG2A 4IUUA 2MIOA 3E2UA 3M4YA 1ZSZC 1K8AU 2EQUA 1VQ8A 5A0DA 1YIJQ 1VQ9T 3L2UA 4BY6C 4CC4B 4N0AA 2CP2A 4TVRA 2OTLQ 3C4SA 2ED1A 3LWHA 3VS0A 2KI7A 2YDLA 3PMTA 4A54A 2E4HA 1YITA 5FW9A 2CKKA 3L42A 3M0PA 3JRZA 1VIFA 1ZUUA 3CD6T 4FYWB 2VWFA 2RJFA 3C95A 2PU9B 2HAXA 1R77A 2XDPA 2HMAA 1M1GA 1M5Q1 3QG1A 2DL8A 3NGPA 2EQMA 4B9XA 4KT0E 4LUEA 3QYHB 5GAOp 3CCUQ 1V1CA 1SSHA 1M4ZA 3KBGA 1R0CB 3U23A 1QVGP 1VQ6Q 3PTAA 5GMKl 2HKQB 2JS0A 4RTXA 4MDXA 4EDUA 2LP5A 3OYBA 1D0ZA 4J9BA 3TQ7P 2JTMA 4E7LA 2HL5C 4OGEA 1Q82R 3O8VA 2MWOA 4IURA 3HRTA 3R6NA 2R58A 1YIJT 1ZSGA 4YTLA 3OS0A 3X26B 1N8RC 4MZMA 2DF6A 1GL5A 1Y0MA 3SDZA 1H92A 2EBPA 1RAAB 2L2PA 1M90C 3CCEQ 2E1HA 1NE8A 2L3SA 3LW5E 1NYFA 3DB3A 5HCKA 2X9HA 2PVOB 3PNWC 3V8JA 3JCMQ 3OYEA 4ZGJB 1UG1A 2ESWA 1YJWT 1VQNT 3LWIA 1K0XA 4M7AC 3I56T 2QYZA 4IIOA 1NPRA 1K9MU 4GY5A 4ZGEB 2DLPA 4QVZA 2A36A 1QW1A 4NS5A 1KK7A 1PM3A 1PD1A 1YITQ 3T9NA 2DYBA 2COYA 1OPKA 3M0SA 2MOXA 1VYTA 5KE3A 2DRMA 4PFZA 2EGAA 4R0KA 1YJNA 1GBQA 1OZ2A 3FC3A 1UDLA 3JCMb 2K3BA 4NOYA 4XTVA 4KUIA 2DEQA 2LTOA 3A8LB 5GANj 1ARKA 3TSZA 1JXMA 4Z89A 2ZAEA 2LJ1A 3URGA 2MI6A 2V1RA 4QQDA 3TVTA 1MV3A 5I22A 2M0YA 2WSFE 3EFRA 4ZTJA 1NJIR 1VQLT 2NLUA 2ZPIB 3JCMd 3CBOA 2NUPB 3THKA 3M59A 5GAN8 2XD0A 1JJ2S 2DBMA 1WGSA 2QDLA 4A4FA 2YXYA 3ULRB 5KCHA 3V8KA 2JM8A 5LJ5f 3DKMA 2YHTA 4N4GA 1VQ9Q 2VB6A 3A8MB 3VU3C 2DXBA 1Q95G 2A28A 2NWMA 1YJNT 3A1PA 2JJ9A 5A2QE 1G5VA 2D6FA 2DTIA 4C92B 2HBPA 3RESA 3M0RA 4PJOC 4XU0A 1MUZA 2QI2A 3OMCA 3H6ZA 4MMKA 4GLMA 5FU7C 3RUXA 1SRLA 1I5OB 3BY7A 2JM9A 3MEWA 2V1QA 5CR2A 1E6HA 2EAYA 1GFDA 2GFUA 2M02A 1KD1C 2ZPBB 1ABQA 1UECA 2K5LA 1LCKA 4J9CA 4QQ6A 1D0YA 2DMOA 4JRPA 1YHQT 2FL7A 4Q5WA 3CC2A 1Q82C 4OP0A 1CKBA 2B8AA 4BI3A 5A0GA 4M7DD 4JJDA 2XKOC 4DOWA 2BTTA 5CCAA 3INZA 2O88A 3QZ5B 2KROA 1MMAA 1IHWA 2KXDA 1GFCA 3HPWA 3LX7A 4LN2A 4XTXA 5GMKi 3MEUA 1VQOQ 2FYKA 3QO3A 1UJYA 2LQNA 3NTIA 1ZQ1A 2EFIA 5DM7R 4RTYA 2OTJA 4XK8E 3RIRA 1QKWA 1MGQA 1VUBA 3FJPA 2RQTA 4C0FA 2MWPA 2O4XB 3TCJA 2XU8A 1YI2A 2KGTA 1J3TA 3CCSA 2KE9A 2YRVA 2DZ9A 2K7AA 5FU6C 1KC8U 5IHIA 2VYTA 4OMMA 2DTHA 2ED0A 1VQPT 1WJQA 1M2OA 4E7ZA 1YFNA 1Y57A 8ATCB 2W0ZA 1X6OA 1FMVA 5IH2A 2D8HA 3A8OB 1WJRA 1G3WA 2QTVA 4R56A 2RHIA 6AT1B 2QEXA 1S72A 4QVCA 3JCMc 4Z02A 2BE9B 1PD0A 1IZ6A 2OAUA 4RCCA 1A0NB 5AT1B 1VQ9A 3RKWA 5GAMd 2RNAA 5FU7B 4J9FA 3JB9G 3MPUB 2ROLA 2YUPA 1M1KU 4M77A 2D8JA 2LJ0A 4WCIA 1RACB 2RI5A 3MHXA 4BE0A 1HYOA 1XNIA 2QQRA 4EMKA 2FPEA 3KFVA 1DJ7B 1I1JA 1BB9A 1JQQA 3CC2T 5GAN3 1OQKA 5KYXB 1M3BA 1VQMQ 1N27A 2X4YA 1E7OA 2RA2A 3RNJA 5GANg 3NHNA 1SG5A 1M9SA 1NPPA 2YLCA 4KBMB 5KYWB 1Q7YC 1D0XA 1G3TA 2EGCA 3LLRA 2LT1A 1QVFP 3PVQA 4JLGA 3OYNA 1PG5B 1U1SA 2CUBA 3I9QA 1VQ7A 4M77G 3NPFA 1UHCA 2JTFA 5GMKe 2QXFA 3HFOA 4HT8A 1EFNA 2AKLA 2XI9A 4C5GA 1NEGA 4J7FA 2EJFA 2AHJB 1VYUA 2KR3A 4CC7A 3QBYA 3VS4A 1HXDA 4RTVA 4E47A 3PE0A 1Y7XA 2P4RA 2PQWA 4VUBA 2AKKA 1XQHA 2IPOB 3CC7A 3UATA 4A63B 2RF0A 2LNVA 3IQLA 2ABLA 4JJCA 2CT3A 4FT2A 1UFFA 2JW4A 3CBPA 3MEVA 4FT4A 4N4IA 1X6GA 5GAMe 3CMEQ 4C92A 3QDRB 3X20B 3CBMA 2M16A 3JV3A 2IG0A 3ASKA 4UC4A 2OAWA 2BZXA 2R5MA 3S3OA 1K1ZA 1D1BA 2KT8A 1AOJA 4B9WA 7AT1B 2MMPA 5ECAA 2L89A 2COZA 4RMOA 3E9FA 2RM4A 1TOVA 5GAMh 1LPLA 1N8RR 2EJGA 1VQ7T 2JN0A 4C8QG 4BUGA 1QCOA 2HSPA 2HNIA 4M77E 2SEMA 3OYJA 5KE2A 3OY9A 2CS7A 1RABB 1RUWA 1SHGA 2RD1A 4MDWA 5GAOq 4BE1A 4X34A 2RN8A 2VXEA 5LJ3f 1KQ2A 4M75F 3QPHA 5GAMj 2YT6A 2QTXA 4DBFA 3VS5A 3DLLA 2CZ1B 3CCQQ 1TUGB 2PVDB 2DA9A 1MMDA 1G3YA 3VKIA 4M7AA 3CCET 1LOJA 2FRWA 3EGXB 2HL3A 5FLXE 3LGFA 3SWNB 1PC0A 2DXCA 3QKJA
chains in the Genus database with same CATH topology
1SSHA 4D8DA 2RQUA 1TG0A 1GRIA 1HD3A 2E5KA 3U23A 4K11A 2XMFA 2PNIA 2JS0A 4RTXA 1B3QA 1T0HA 1NYGA 2LP5A 4HCKA 3PVLA 4J9BA 5GJWB 1AWOA 2CSIA 1AD5A 3VS7A 4FSSA 5EC7A 2FO0A 2LNHB 4RUGA 1AZGB 2K6DA 1CSKA 3R6NA 4J9GA 1ZSGA 3VRYA 4CC3A 4J9EA 2DF6A 1ZLMA 1GCQA 1GL5A 1Y0MA 2DL5A 2EYZA 2X3XD 1H92A 3I35A 2ENMA 2I0NA 2CREA 2EBPA 1QWEA 2L2PA 2KBTA 2ECZA 3VS3A 2DBKA 4EIKA 2L3SA 4AG2C 1NYFA 4ZNXA 5HCKA 4Y92A 1W1FA 1I07A 1JXOA 3REBB 1YNZA 1UTIA 1UG1A 2ESWA 1QKXA 1K0XA 1SPKA 2CH4A 4IIOA 4F17A 2GGRA 1WYXA 2DLPA 3REAB 2A36A 1NG2A 4JJBA 2DYBA 3M0SA 1OPKA 2EVRA 1K0SA 2MOXA 2M51A 1VYTA 2FG0A 3EHQA 2DRMA 3VS1A 4RTZA 4J9DA 2HCKA 1T3LA 4DEXA 5IXFA 1TUDA 2EYYA 1AWXA 2RPNA 1X27A 4OMOA 1ZUKA 2EGAA 4R0KA 1GBQA 1UDLA 2AZSA 2K3BA 2VVKA 4AFSC 3H0FA 2DL3A 4F14A 1ARKA 4LE9A 1Z9QA 2BZ8A 3O5ZA 3TSZA 1H8KA 1WIEA 2OJ2A 5FWCA 2PTKA 1JXMA 4Z89A 4OMNA 2RMOA 1K76A 2O9VA 1SRMA 2KYMA 2OI3A 2LQWA 1G83A 2LJ1A 2V1RA 1M8MA 1OEBA 3TVTA 1MV3A 5I22A 1OPLA 2M0YA 1QCFA 2L3QA 1GCPA 1M3AA 4M4ZA 1X2KA 4HVWA 1YCSB 2CUDA 3THKA 1AVZC 5GJVB 1VYVA 1X2QA 2HDAA 2DBMA 1PKTA 2YUQA 5IXBA 1PNJA 3H0IA 5FWBA 2QDLA 3H41A 2J6KA 1W70A 4AFQC 2J05A 3ULRB 1FYNA 2JM8A 4KRTA 2HEQA 1JEGA 1ABOA 2AK5A 1YWOA 1HJDA 2JXBA 2A28A 2NWMA 4GBQA 1K9AA 1AZEA 1WLPB 2SRCA 2LJ3A 2KRSA 4ESRA 2F2XA 2KRNA 1BK2A 2EPDA 4Z8AA 4F16A 3M0RA 4J9IA 2JTEA 1MUZA 1JU5C 1NM7A 3UA7A 5IHKA 3FJ5A 2EYXA 4GLMA 5IHNA 3A98A 1SRLA 3QWXX 1X69A 4OMQA 2F2VA 1W6XA 2KXCA 2J06A 2JM9A 2K79A 2EKHA 2V1QA 1E6HA 1GFDA 2C0OA 1ABQA 1PRLC 1UECA 1LCKA 4J9CA 1SEMA 1RLPC 2LMJA 2W10A 2DMOA 2EYWA 2G6FX 3M0TA 2VKNA 1NLPC 4HXJA 1CKBA 4JJDA 2FEIA 2IIMA 2BTTA 4RTTA 1UE9A 2A08A 1GBRA 2DM1A 1OV3A 2O88A 2KROA 2ROTA 1VA7A 2DVJA 2KXDA 2LZ6B 1GFCA 2F2WA 1G2BA 3EGUA 4LN2A 3C0CA 1T3SA 1UJYA 2LQNA 2LX7A 1KSWA 4RTYA 1K4US 1QKWA 3SHWA 2DJQA 1X43A 4LNPA 4CC2A 2RQTA 1WX6A 2FPFA 2DILA 2KEAA 3EHRA 2KGTA 1J3TA 1M27C 2KE9A 3EG3A 1WXBA 1E6GA 2K7AA 5IHIA 1QLYA 3EG2A 4OMMA 2ED0A 1WDXA 3UF4A 1Y57A 1Z9ZA 2W0ZA 4OMPA 2B86A 5IH2A 4JZ4A 2D8HA 1U5SA 2O31A 1TUCA 1RI9A 4J9HA 4LUDA 1WXUA 1ZBJA 3VS2A 2RQRA 1PKSA 3EG1A 2D1XA 1PRMC 1UUEA 1A0NB 2JS2A 1H3HA 2KYBA 2CH4W 2O2OA 2DL7A 2RQWA 2KRMA 2RNAA 4J9FA 4HVUA 2K2MA 2ROLA 2YUPA 1U3OA 1M3CA 1ZUYA 2D8JA 2LJ0A 3NMZC 4WCIA 2KT1A 3CQTA 1UHFA 1JO8A 1YP5A 1HSQA 2GTJA 1I0CA 2FPEA 3KFVA 1I1JA 2DL4A 2GQIA 1BB9A 1JQQA 4AG1C 3GBQA 2EQIA 1M3BA 1NLOC 2AZVA 4OMLA 1UJ0A 2EGEA 1E7OA 3TSWA 1SHFA 2DE0X 3RNJA 1M30A 1KJWA 1NEBA 1XOVA 3EG0A 1PHTA 3NHNA 1IO6A 1AWWA 5I11A 1WFWA 2GNCA 2J6OA 3UA6A 4IIMA 1BU1A 4QT7A 2FPDA 1X6BA 1KFZA 2EGCA 1T0JA 2YSQA 2MCNA 1FMKA 3PVQA 1YWPA 4RTWA 2CUBA 4AFZC 3I9QA 1GCQC 2NUZA 3NPFA 4JPBW 1UHCA 4E6RA 2JMAA 1UGVA 3SEMA 2JMCA 1EFNA 2J7IA 2AKLA 2DX1A 2PZ1A 1N5ZA 4ORZA 1NEGA 2K9GA 1VYUA 2LCSA 1YN8A 2KR3A 2YUNA 4CC7A 2BZYA 3VS4A 1RLQC 4RTVA 3PE0A 4JZ3A 2YUOA 2P4RA 2FRYA 2AKKA 2C0IA 4DEYA 2O9SA 3VS6A 1CKAA 1KIKA 2J6FA 3UATA 4A63B 2RF0A 1PWTA 3IQLA 4Z88A 2ABLA 2HBWA 4JJCA 1WXTA 2JT4A 2EW3A 1S1NA 1WA7A 2CT3A 1UFFA 2JW4A 1X6GA 1ZX6A 1MV0B 3RBBB 3QWYA 2DNUA 3JV3A 2C0TA 2CT4A 1OOTA 2OAWA 2BZXA 2GTOA 3M0UA 1K1ZA 2D0NA 2KT8A 1AOJA 2H8HA 2CDTA 5ECAA 3LH5A 2RQVA 4HVVA 1AWJA 3M0QA 1B07A 3I5SA 3ZL7C 2HSPA 2MIOA 2L0AA 3I5RA 2CSQA 4RTUA 1U06A 2SEMA 4CC4B 5L23A 4D8KA 2ED1A 3VRZA 1WI7A 2GBQA 3VS0A 1RUWA 1SHGA 2YDLA 2RN8A 5FW9A 2L3PA 3M0PA 2YT6A 3VS5A 1BBZA 1ZUUA 4AFUC 2VWFA 2KNBB 1QWFA 1AEYA 2DA9A 4X1VA 2DRKA 2DL8A 2A37A 2FRWA 3NGPA 3H0HA 4LUEA 1V1CA 2X3WD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SSH A;  4D8D A;  2RQU A;  1TG0 A;  1GRI A;  1HD3 A;  2E5K A;  3U23 A;  4K11 A;  2XMF A;  2PNI A;  2JS0 A;  4RTX A;  1B3Q A;  1T0H A;  1NYG A;  2LP5 A;  4HCK A;  3PVL A;  4J9B A;  5GJW B;  1AWO A;  2CSI A;  1AD5 A;  3VS7 A;  4FSS A;  5EC7 A;  2FO0 A;  2LNH B;  4RUG A;  1AZG B;  2K6D A;  1CSK A;  3R6N A;  4J9G A;  1ZSG A;  3VRY A;  4CC3 A;  4J9E A;  2DF6 A;  1ZLM A;  1GCQ A;  1GL5 A;  1Y0M A;  2DL5 A;  2EYZ A;  2X3X D;  1H92 A;  3I35 A;  2ENM A;  2I0N A;  2CRE A;  2EBP A;  1QWE A;  2L2P A;  2KBT A;  2ECZ A;  3VS3 A;  2DBK A;  4EIK A;  2L3S A;  4AG2 C;  1NYF A;  4ZNX A;  5HCK A;  4Y92 A;  1W1F A;  1I07 A;  1JXO A;  3REB B;  1YNZ A;  1UTI A;  1UG1 A;  2ESW A;  1QKX A;  1K0X A;  1SPK A;  2CH4 A;  4IIO A;  4F17 A;  2GGR A;  1WYX A;  2DLP A;  3REA B;  2A36 A;  1NG2 A;  4JJB A;  2DYB A;  3M0S A;  1OPK A;  2EVR A;  1K0S A;  2MOX A;  2M51 A;  1VYT A;  2FG0 A;  3EHQ A;  2DRM A;  3VS1 A;  4RTZ A;  4J9D A;  2HCK A;  1T3L A;  4DEX A;  5IXF A;  1TUD A;  2EYY A;  1AWX A;  2RPN A;  1X27 A;  4OMO A;  1ZUK A;  2EGA A;  4R0K A;  1GBQ A;  1UDL A;  2AZS A;  2K3B A;  2VVK A;  4AFS C;  3H0F A;  2DL3 A;  4F14 A;  1ARK A;  4LE9 A;  1Z9Q A;  2BZ8 A;  3O5Z A;  3TSZ A;  1H8K A;  1WIE A;  2OJ2 A;  5FWC A;  2PTK A;  1JXM A;  4Z89 A;  4OMN A;  2RMO A;  1K76 A;  2O9V A;  1SRM A;  2KYM A;  2OI3 A;  2LQW A;  1G83 A;  2LJ1 A;  2V1R A;  1M8M A;  1OEB A;  3TVT A;  1MV3 A;  5I22 A;  1OPL A;  2M0Y A;  1QCF A;  2L3Q A;  1GCP A;  1M3A A;  4M4Z A;  1X2K A;  4HVW A;  1YCS B;  2CUD A;  3THK A;  1AVZ C;  5GJV B;  1VYV A;  1X2Q A;  2HDA A;  2DBM A;  1PKT A;  2YUQ A;  5IXB A;  1PNJ A;  3H0I A;  5FWB A;  2QDL A;  3H41 A;  2J6K A;  1W70 A;  4AFQ C;  2J05 A;  3ULR B;  1FYN A;  2JM8 A;  4KRT A;  2HEQ A;  1JEG A;  1ABO A;  2AK5 A;  1YWO A;  1HJD A;  2JXB A;  2A28 A;  2NWM A;  4GBQ A;  1K9A A;  1AZE A;  1WLP B;  2SRC A;  2LJ3 A;  2KRS A;  4ESR A;  2F2X A;  2KRN A;  1BK2 A;  2EPD A;  4Z8A A;  4F16 A;  3M0R A;  4J9I A;  2JTE A;  1MUZ A;  1JU5 C;  1NM7 A;  3UA7 A;  5IHK A;  3FJ5 A;  2EYX A;  4GLM A;  5IHN A;  3A98 A;  1SRL A;  3QWX X;  1X69 A;  4OMQ A;  2F2V A;  1W6X A;  2KXC A;  2J06 A;  2JM9 A;  2K79 A;  2EKH A;  2V1Q A;  1E6H A;  1GFD A;  2C0O A;  1ABQ A;  1PRL C;  1UEC A;  1LCK A;  4J9C A;  1SEM A;  1RLP C;  2LMJ A;  2W10 A;  2DMO A;  2EYW A;  2G6F X;  3M0T A;  2VKN A;  1NLP C;  4HXJ A;  1CKB A;  4JJD A;  2FEI A;  2IIM A;  2BTT A;  4RTT A;  1UE9 A;  2A08 A;  1GBR A;  2DM1 A;  1OV3 A;  2O88 A;  2KRO A;  2ROT A;  1VA7 A;  2DVJ A;  2KXD A;  2LZ6 B;  1GFC A;  2F2W A;  1G2B A;  3EGU A;  4LN2 A;  3C0C A;  1T3S A;  1UJY A;  2LQN A;  2LX7 A;  1KSW A;  4RTY A;  1K4U S;  1QKW A;  3SHW A;  2DJQ A;  1X43 A;  4LNP A;  4CC2 A;  2RQT A;  1WX6 A;  2FPF A;  2DIL A;  2KEA A;  3EHR A;  2KGT A;  1J3T A;  1M27 C;  2KE9 A;  3EG3 A;  1WXB A;  1E6G A;  2K7A A;  5IHI A;  1QLY A;  3EG2 A;  4OMM A;  2ED0 A;  1WDX A;  3UF4 A;  1Y57 A;  1Z9Z A;  2W0Z A;  4OMP A;  2B86 A;  5IH2 A;  4JZ4 A;  2D8H A;  1U5S A;  2O31 A;  1TUC A;  1RI9 A;  4J9H A;  4LUD A;  1WXU A;  1ZBJ A;  3VS2 A;  2RQR A;  1PKS A;  3EG1 A;  2D1X A;  1PRM C;  1UUE A;  1A0N B;  2JS2 A;  1H3H A;  2KYB A;  2CH4 W;  2O2O A;  2DL7 A;  2RQW A;  2KRM A;  2RNA A;  4J9F A;  4HVU A;  2K2M A;  2ROL A;  2YUP A;  1U3O A;  1M3C A;  1ZUY A;  2D8J A;  2LJ0 A;  3NMZ C;  4WCI A;  2KT1 A;  3CQT A;  1UHF A;  1JO8 A;  1YP5 A;  1HSQ A;  2GTJ A;  1I0C A;  2FPE A;  3KFV A;  1I1J A;  2DL4 A;  2GQI A;  1BB9 A;  1JQQ A;  4AG1 C;  3GBQ A;  2EQI A;  1M3B A;  1NLO C;  2AZV A;  4OML A;  1UJ0 A;  2EGE A;  1E7O A;  3TSW A;  1SHF A;  2DE0 X;  3RNJ A;  1M30 A;  1KJW A;  1NEB A;  1XOV A;  3EG0 A;  1PHT A;  3NHN A;  1IO6 A;  1AWW A;  5I11 A;  1WFW A;  2GNC A;  2J6O A;  3UA6 A;  4IIM A;  1BU1 A;  4QT7 A;  2FPD A;  1X6B A;  1KFZ A;  2EGC A;  1T0J A;  2YSQ A;  2MCN A;  1FMK A;  3PVQ A;  1YWP A;  4RTW A;  2CUB A;  4AFZ C;  3I9Q A;  1GCQ C;  2NUZ A;  3NPF A;  4JPB W;  1UHC A;  4E6R A;  2JMA A;  1UGV A;  3SEM A;  2JMC A;  1EFN A;  2J7I A;  2AKL A;  2DX1 A;  2PZ1 A;  1N5Z A;  4ORZ A;  1NEG A;  2K9G A;  1VYU A;  2LCS A;  1YN8 A;  2KR3 A;  2YUN A;  4CC7 A;  2BZY A;  3VS4 A;  1RLQ C;  4RTV A;  3PE0 A;  4JZ3 A;  2YUO A;  2P4R A;  2FRY A;  2AKK A;  2C0I A;  4DEY A;  2O9S A;  3VS6 A;  1CKA A;  1KIK A;  2J6F A;  3UAT A;  4A63 B;  2RF0 A;  1PWT A;  3IQL A;  4Z88 A;  2ABL A;  2HBW A;  4JJC A;  1WXT A;  2JT4 A;  2EW3 A;  1S1N A;  1WA7 A;  2CT3 A;  1UFF A;  2JW4 A;  1X6G A;  1ZX6 A;  1MV0 B;  3RBB B;  3QWY A;  2DNU A;  3JV3 A;  2C0T A;  2CT4 A;  1OOT A;  2OAW A;  2BZX A;  2GTO A;  3M0U A;  1K1Z A;  2D0N A;  2KT8 A;  1AOJ A;  2H8H A;  2CDT A;  5ECA A;  3LH5 A;  2RQV A;  4HVV A;  1AWJ A;  3M0Q A;  1B07 A;  3I5S A;  3ZL7 C;  2HSP A;  2MIO A;  2L0A A;  3I5R A;  2CSQ A;  4RTU A;  1U06 A;  2SEM A;  4CC4 B;  5L23 A;  4D8K A;  2ED1 A;  3VRZ A;  1WI7 A;  2GBQ A;  3VS0 A;  1RUW A;  1SHG A;  2YDL A;  2RN8 A;  5FW9 A;  2L3P A;  3M0P A;  2YT6 A;  3VS5 A;  1BBZ A;  1ZUU A;  4AFU C;  2VWF A;  2KNB B;  1QWF A;  1AEY A;  2DA9 A;  4X1V A;  2DRK A;  2DL8 A;  2A37 A;  2FRW A;  3NGP A;  3H0H A;  4LUE A;  1V1C A;  2X3W D; 
#chains in the Genus database with same CATH topology
 5EG2 A;  2LCL A;  3OA6 A;  1GRI A;  4K11 A;  3C94 A;  4C0D C;  3R6O A;  1T0H A;  3TRE A;  4M75 B;  2KK4 A;  1QVF S;  3OQ5 A;  4OB3 B;  3CPW S;  2LNH B;  1RL2 A;  3RR6 A;  4CI0 C;  1AZG B;  5GAO l;  4BD3 A;  2RJD A;  4E7I A;  2YWW A;  4C5H A;  2P84 A;  3OSS C;  4CC3 A;  2BIV A;  1GCQ A;  2DL5 A;  2X3X D;  3I35 A;  2ENM A;  3GP8 A;  2CRE A;  1VQO A;  1QWE A;  2DBK A;  4EIK A;  3RER A;  2ZPE B;  1YI2 T;  5CKE A;  5HK3 A;  1W1F A;  1I07 A;  1JJ2 A;  2CZ0 B;  2EKO A;  3BFM A;  4ZN1 A;  1YJN Q;  1SPK A;  2CH4 A;  1QVF A;  3SB2 A;  1U8R A;  5CKB A;  2YRC A;  1NG2 A;  4JJB A;  2X35 A;  4C92 C;  4NL2 A;  1QVG A;  1K0S A;  3JB9 I;  4KUD K;  4JRI A;  1LJO A;  1QVP A;  2AT1 B;  3EHQ A;  4C5I A;  3GNG A;  4KGV B;  4JS4 A;  4J9D A;  2HCK A;  4M7D C;  2DER A;  2EYY A;  1AWX A;  4V2S A;  1X27 A;  4C92 E;  2RHX A;  1Q81 R;  4XAX B;  2AZS A;  3M57 A;  2ZZD A;  2VVK A;  5GAN h;  1N9R A;  4F14 A;  5LJ5 e;  2H3E B;  1Z9Q A;  2BZ8 A;  3MET A;  4RG8 A;  1H8K A;  4OMN A;  3J80 E;  4M75 G;  1G83 A;  1M8M A;  4M78 A;  1VQM T;  1OEB A;  2VV5 A;  2MPX C;  4OB2 B;  3EGD B;  4PFP A;  2DD5 A;  3CCL Q;  4M4Z A;  1YCS B;  4LDX A;  2L5Q A;  4JRK A;  5GJV B;  4C92 D;  2HD0 A;  1BCM A;  3G71 A;  1D1C A;  2NYS A;  2HDA A;  4J7I A;  1BKB A;  2YUQ A;  5IXB A;  4KH0 B;  1JBM A;  2LQ8 A;  2J6K A;  4M7D F;  3PIP A;  3LH0 A;  3OMG A;  4KRT A;  2L8D A;  2EJ9 A;  4OB0 B;  1JEG A;  1ABO A;  4PJO F;  2X4J A;  1HJD A;  2JXB A;  2LQK A;  4GBQ A;  5GAO n;  4BB7 A;  1VQ6 A;  1AZE A;  3HRS A;  4PL6 A;  1TTH B;  1W4S A;  2WSE E;  3E1S A;  4M78 G;  2KRS A;  2P0P A;  1BK2 A;  3UT1 A;  4Z8A A;  4F16 A;  4J9I A;  5IN1 A;  3S6W A;  1QVG S;  1JU5 C;  1NM7 A;  5IHK A;  3A98 A;  3QWX X;  4M7A B;  1QP2 A;  3M9Q A;  4M7D B;  5J3B A;  2F2V A;  1W6X A;  3E9G A;  4KGZ B;  2K79 A;  5FU6 B;  3G4S T;  3QYG B;  2DET A;  2C0O A;  1YJW A;  3JCM h;  3A8G B;  2DZC A;  1RLP C;  4QW2 A;  1U1T A;  5CKD A;  5A0L A;  3GLX A;  2EYW A;  4EPC A;  3M0T A;  3JB9 D;  3BE3 A;  2DAQ A;  4BAC A;  1FMW A;  2IIM A;  1RI0 A;  1D09 B;  4RTT A;  3CCJ T;  1UE9 A;  2QK0 A;  2RHZ A;  4DOV A;  4ATO A;  2DM1 A;  1OZ3 A;  1OV3 A;  1SKU B;  2A3L A;  4BDZ A;  4OGC A;  2FZK B;  3ZBD A;  2DVJ A;  1KQS S;  4JLI A;  2F5T X;  5LJ5 j;  4FM4 B;  4E7K A;  2LX7 A;  4M75 C;  3NTK A;  3CC4 A;  1VQ6 T;  4M77 D;  2DK3 A;  2DJQ A;  4HKE A;  3G1J A;  2FPF A;  2KEA A;  4PJM A;  3JB9 H;  1OUL A;  3EG3 A;  1VQ4 Q;  2VAS A;  3SWN C;  2DEU A;  2MK5 A;  1QLY A;  4ELZ C;  3OS5 A;  4DBQ A;  1WDX A;  4LD6 A;  3PIO A;  1BI1 A;  1D3B B;  4OMP A;  2E41 A;  1QMC A;  5GAN 7;  4LDU A;  3OSV A;  2WSC E;  3QSU A;  1U5S A;  2O31 A;  3QHS A;  1RI9 A;  3QDF A;  2LVM A;  1WXU A;  2RHY A;  3OYM A;  4M78 F;  4C0G A;  5I2M A;  1MNE A;  1ZBJ A;  3OYC A;  4OB1 B;  2XDD A;  4JS5 A;  4RKU E;  3OS1 A;  2KVQ G;  1PKS A;  1G3S A;  2D1X A;  4C8Q D;  5LJ3 e;  1Q86 C;  3MKD A;  2X4W A;  3OYA A;  2X4X A;  1H3H A;  2EQK A;  4QQG A;  2KYB A;  2JUF A;  1VQ8 T;  2QGG A;  4F7U B;  2KRM A;  4P5N A;  2K2M A;  1U3O A;  4M78 C;  1M3C A;  1YJ9 A;  3M54 A;  3A5Z B;  4MZT A;  2KT1 A;  1IGQ A;  3CQT A;  3CC4 Q;  1HSQ A;  4M78 B;  1I0C A;  1NJI U;  4DQ2 A;  2VUB A;  2P4T A;  2DL4 A;  3H9N A;  2QDY B;  3VYG A;  4AG1 C;  3JCM W;  2M9U A;  1UJ0 A;  1Q81 C;  2EGE A;  2ZPH B;  1SHF A;  2K2V A;  4Y91 A;  1EX4 A;  1M30 A;  2E70 A;  1NEB A;  1LVK A;  1XOV A;  3CPW A;  1PHT A;  1N9S A;  5LJ3 j;  5L8R E;  1AWW A;  5I11 A;  3UWN A;  5I21 A;  1WFW A;  2ZPF B;  3CCJ Q;  2ZGW A;  3UA6 A;  4IIM A;  1X6B A;  4ME7 A;  2KQW A;  1NBE B;  2YSQ A;  5CAI A;  1YWP A;  2D9T A;  4AFZ C;  4M77 F;  5HK0 A;  4E2F B;  2JMA A;  2Y90 A;  3SEM A;  1IRX A;  1BIB A;  2J7I A;  5GAN 5;  1KQS P;  1KD1 R;  1KHI A;  4ORZ A;  4FYY B;  2MYS A;  3H8Z A;  5GAN 4;  2BZY A;  4EMH A;  4PJJ A;  4ELY C;  3S3M A;  2RK1 A;  1KQ1 A;  3PMI A;  2JNG A;  4A4G A;  2YUO A;  3CPF A;  2A0F B;  1KIK A;  1PWT A;  2R5A A;  4NL3 A;  2HBW A;  2HQX A;  2GFA A;  4WTO B;  2HZY A;  3WXM B;  3P8B B;  3RKY A;  2RB6 A;  1I5L A;  5KH6 A;  1RAE B;  2NUT A;  4BDY A;  3CEY A;  1ZX6 A;  2YLB A;  4PJN A;  5D6Y A;  2CGH A;  2GTO A;  4OVA A;  2Y4Y A;  2HQH A;  2D0N A;  4XTU A;  2CDT A;  5GMK m;  3LH5 A;  4HVV A;  2P0K A;  5D7U A;  5AYF A;  3M0Q A;  1B07 A;  3EH2 A;  1ZA1 B;  1ZBX A;  3FB9 A;  2L0A A;  2HQE A;  3FEO A;  2CSQ A;  3GIB A;  4RTU A;  3RKX A;  2E65 A;  2RJE A;  3EH1 A;  2K3X A;  2OTL T;  4D8K A;  3VRZ A;  2GBQ A;  4FCY A;  3JCM g;  3QZ9 B;  2V26 A;  3VUZ A;  5CQX A;  5C0M A;  1OU9 A;  1BYM A;  1R0B G;  2VC8 A;  1BBZ A;  4AFU C;  4M75 D;  1AEY A;  2JZ2 A;  1IB8 A;  2F5K A;  3CCE A;  1H64 1;  2DRK A;  1QQJ A;  1BI3 A;  5CVI A;  1K9M R;  1D3B A;  3CCR A;  1VQ5 A;  1C0M A;  3M58 A;  1HD3 A;  3CCQ A;  4HCC A;  1NYG A;  4XU1 A;  2JVV A;  1WQW A;  1AWO A;  2CSI A;  2VGM A;  2QQA A;  1AD5 A;  1FWZ A;  1K73 C;  3OYL A;  5EC7 A;  4E7H A;  1C1A A;  2FO0 A;  4RUG A;  1D1A A;  4BY6 B;  3HFN A;  3S3N A;  2E12 A;  4J9G A;  1TSF A;  1WZO A;  1K8A R;  3A8H B;  3VRY A;  4J9E A;  2E6Z A;  1ZLM A;  3MP8 A;  2EYZ A;  2I0N A;  1P92 A;  2KBT A;  2ECZ A;  3VS3 A;  1K8A C;  4N0A C;  3OBW A;  4M7D A;  4XQ3 A;  4AG2 C;  1W2B S;  4ZNX A;  3OW2 A;  3L1A A;  4XU3 A;  4A4E A;  1WJS A;  1WHG A;  3WVE B;  1JXO A;  3VYH B;  3TU4 K;  3CPW P;  3REB B;  1YNZ A;  1QKX A;  2P0Q A;  4KH1 B;  3RMQ A;  1K73 R;  1M2V B;  1F1B B;  3G6E Q;  4BI4 A;  2CZ6 B;  3M53 A;  2M51 A;  4IUT A;  1YIJ A;  1SF9 A;  2CZ7 B;  4C5E A;  2XIC A;  4DEX A;  4CRI A;  4OMO A;  1TXQ A;  3F70 A;  2DVE A;  3V7R A;  3VUB A;  1PSF A;  2E3H A;  2QAZ A;  3O5Z A;  3CCQ T;  1KD1 U;  4LXC A;  3CCL T;  4O5V A;  2OJ2 A;  5FWC A;  1MMN A;  1KG1 A;  2RMO A;  1K76 A;  1B34 A;  2RHU A;  4FIB A;  3L2Q A;  3CXC S;  3GF5 A;  2OI3 A;  1N8R U;  2LQW A;  3P8H A;  4M77 C;  5CO7 A;  5GMK j;  1OPL A;  1QCF A;  1R8O B;  1M90 U;  5KYU B;  1GCP A;  1X2K A;  1JJ2 P;  3FLG A;  4QKU A;  5LJ3 g;  3EGD A;  5KYY A;  5LJ5 g;  2EQJ A;  1XTD A;  4A53 A;  1VYV A;  2L3R A;  1X2Q A;  1Q7Y R;  3Q1J A;  3OYH A;  1PNJ A;  1RAF B;  5FWB A;  3MCA B;  2RK2 A;  1M1F A;  3H41 A;  4AFQ C;  2KY9 A;  4M75 A;  1QCN A;  2J05 A;  5CK9 A;  4ZN3 A;  2DYI A;  1OI1 A;  1K9M C;  2XHC A;  3ZEH A;  4F7U F;  1K9A A;  3G4S A;  5LJ5 h;  4M7D E;  2KRN A;  2I2L A;  2EPD A;  5GAN d;  2YRD A;  4RCB A;  3UA7 A;  3MP1 A;  2K57 A;  5GAO m;  1WQ7 A;  3EFS A;  3FJ5 A;  2EYX A;  1V76 A;  3CCJ A;  4O6J A;  2QA4 A;  2EYQ A;  1X69 A;  3MO8 A;  2EIF A;  4OMQ A;  1OX8 A;  2DD4 A;  3HRU A;  2EKH A;  4JRQ A;  2OTL A;  3CCS Q;  5KCO A;  2FB7 A;  1PRL C;  2HKN A;  4Y28 E;  1YJ9 Q;  2LMJ A;  3CC4 T;  3TEE A;  3UDC A;  1VQ5 Q;  4HXJ A;  3FRN A;  5FRO A;  3OW2 P;  3JB9 F;  2OX7 A;  4JUV A;  2JOY A;  1GBR A;  4PJO D;  3NTH A;  2CP6 A;  2LZ6 B;  5DY9 A;  2F2W A;  2IVW A;  4GLK A;  2DJZ A;  5CIU A;  1VQK T;  2ZCF B;  4PLL A;  3C0C A;  1UGS B;  4LDY A;  1T3S A;  1VQP A;  1MHN A;  4L5G A;  1K4U S;  3SHW A;  1X43 A;  1WX6 A;  2WAC A;  2DIL A;  4FU6 A;  2PUK B;  3EHR A;  2COW A;  2LX9 A;  3I55 A;  1M27 C;  1B7T A;  3P8D A;  1UEB A;  1WXB A;  1E6G A;  3LGL A;  3EG2 A;  2KMT A;  1VQO T;  2RI3 A;  4PK4 A;  3UF4 A;  1UGP B;  2AIR B;  4JZ4 A;  4N4H A;  1M2V A;  1YJ9 T;  1TUC A;  1ACM B;  4ZGD B;  2PVG B;  1FXX A;  3EFO A;  2VGN A;  3OYG A;  1S72 Q;  4FL6 A;  2RQR A;  3EG1 A;  4M78 D;  4J5Y A;  1LNX A;  3CCM Q;  1ZSZ B;  2JS2 A;  2M0O A;  2LCC A;  3L2Z A;  3HSB A;  5D6W A;  1Q82 U;  2O2O A;  3AT1 B;  4X9D A;  2OTJ T;  3SWN A;  1M8V A;  1ZUY A;  5KYX A;  3NMZ C;  1OX9 A;  4II1 A;  3G71 T;  3CME T;  2NUT B;  1YP5 A;  4C92 G;  2GTJ A;  1YI2 Q;  1IGU A;  4KGX B;  4R55 A;  2GF7 A;  3GBQ A;  3HL8 A;  2EQI A;  1GXI E;  4OML A;  2FZC B;  1WHJ A;  1WHL A;  3CXC P;  3CCU T;  2RO0 A;  4MML A;  2DO3 A;  2E10 A;  4A4K A;  1IO6 A;  1S72 T;  2GNC A;  2J6O A;  3JCM X;  4QT7 A;  1VQL Q;  2FPD A;  1T0J A;  2VXF A;  1KC8 C;  2MCN A;  4RTW A;  1GCQ C;  2NUZ A;  3OYD A;  2QEX T;  1TH7 A;  1UGV A;  1NZ9 A;  3JAM E;  1AHJ B;  2QQB A;  3OYF A;  1N5Z A;  2LCS A;  1YN8 A;  2YUN A;  4ZTF A;  1RLQ C;  1X01 A;  2DXT A;  3JB9 J;  5CKH A;  3GOX A;  2K5F A;  4J8O A;  3QUI A;  2FRY A;  1UGR B;  2C0I A;  4AMC A;  4DEY A;  1M1K R;  1CKA A;  4MZP A;  3CCL A;  3PFS A;  3CMA A;  5GMK h;  4Z88 A;  2JT4 A;  3UPU A;  1S1N A;  5GAO r;  2LC4 A;  3SD4 A;  3OS2 A;  4OMF B;  3SFM A;  2QQS A;  3L2V A;  1M1K C;  3EAE A;  1FX7 A;  1MV0 B;  3QWY A;  4C0Z A;  2C0T A;  4WF2 A;  1OOT A;  2KDS A;  4PJO G;  3M0U A;  1KC8 R;  3CCV Q;  2H8H A;  3G4S Q;  2Z0W A;  2ATC B;  4B6M A;  3CME A;  3AHU A;  4D6W A;  1VQ4 A;  3L2R A;  3CCM T;  3I5S A;  3ZL7 C;  4LDW A;  3ZFJ A;  3BDU A;  3OYY A;  2QG9 B;  3I5R A;  3JSC A;  3G7Z A;  4PJL A;  3V7S A;  3BDL A;  1U06 A;  1W2B A;  5L23 A;  1WI7 A;  1Q7Y U;  4PJO A;  5CKF A;  3GNF B;  2L3P A;  4OF1 A;  3CMA T;  4EMK B;  3N5B B;  3C12 A;  5GAN e;  1B34 B;  1BIA A;  5DLO A;  2DFU A;  2KNB B;  1QWF A;  1WPY A;  2QA4 T;  2QGF B;  3CCV T;  4X1V A;  2A37 A;  4F04 B;  4E7S A;  5J39 A;  3H0H A;  2G3R A;  1JB0 E;  2O4X A;  4AT1 B;  2X3W D;  4C8Q F;  4D8D A;  5HKC A;  2A7Y A;  1I8F A;  2RQU A;  1TG0 A;  3HTR A;  2E5K A;  1TU0 B;  5HY6 A;  2XMF A;  2LDM A;  2PNI A;  1VQK Q;  1B3Q A;  1Y71 A;  2DIG A;  3MP6 A;  2K4Y A;  4HCK A;  2DTO A;  3PVL A;  5GJW B;  3VS7 A;  1HK9 A;  4FYX B;  4FSS A;  2E64 A;  1G8X A;  2K6D A;  1CSK A;  4PKC C;  4C92 F;  2CYZ B;  1VQ8 Q;  1VQ4 T;  4IUP A;  5GAM g;  2CP0 A;  1YJW Q;  3EFO B;  4F7U G;  4E7J A;  4PNO A;  1YCY A;  2K3Y A;  3CCV A;  4FYV B;  3J7A F;  2FZG B;  1TS9 A;  4Y92 A;  4A4H A;  2XG8 D;  1UTI A;  3EG9 A;  1VQN A;  4JDS A;  3VV0 A;  5GAN 6;  2PUO B;  4L6V 5;  3CC2 Q;  4F17 A;  4EMK C;  2GGR A;  2XK0 A;  1WYX A;  3X25 B;  4IKF A;  3PT9 A;  1KQS A;  4LD9 K;  3REA B;  3OB9 A;  3G6E T;  2EVR A;  4F7U E;  4M7A E;  4PJO E;  2FG0 A;  4M7D G;  4M7A G;  3VS1 A;  1Q86 R;  4RTZ A;  1T3L A;  2RI2 A;  5IXF A;  3M5A A;  1TUD A;  4BE2 A;  2RPN A;  2FHD A;  3VJP A;  2GCX A;  2BE7 D;  3EG9 B;  1ZUK A;  1VQN Q;  2E3I A;  3HP9 A;  3X28 B;  3JCM V;  1VQ7 Q;  2O01 E;  3HKS A;  4AFS C;  1IRE B;  4J6Y A;  3H0F A;  1WHH A;  2DL3 A;  4LE9 A;  4FW1 A;  1WIE A;  5KYN A;  2PTK A;  4HCB A;  2R57 A;  5LL6 S;  2O9V A;  2V8I A;  1SRM A;  2KYM A;  4X9C A;  1EZZ B;  3L2W A;  3CCU A;  4LDV A;  4C8Q A;  2L3Q A;  3V7C A;  1V29 B;  1M3A A;  2E6N A;  3M4G A;  1WHM A;  4HVW A;  2CUD A;  5FRN A;  1IXD A;  1AVZ C;  3KUF A;  5IT9 E;  5GAN f;  3RDV A;  2E5Q A;  1PKT A;  3H0I A;  1YIT T;  3WVD B;  5LJ5 d;  1W70 A;  4M75 E;  1BCO A;  1FYN A;  2HEQ A;  4M7A D;  2AK5 A;  1W2B P;  1BI0 A;  1TWB A;  1YWO A;  1WLP B;  1VQ5 T;  2RJC A;  2SRC A;  3QII A;  3MJX A;  2LJ3 A;  1MMG A;  5LJ3 h;  3JCM f;  4ESR A;  3D7S B;  2F2X A;  1X75 C;  1RAG B;  2HSE B;  4XTZ A;  2JTE A;  5GAN 2;  4HT9 A;  2Y4X A;  3QXE B;  3CD6 A;  2H3J A;  5IHN A;  1SSF A;  3X24 B;  1VQL A;  1ZSZ A;  2C06 A;  2CP7 A;  2J06 A;  2KXC A;  2RH2 A;  5I2S A;  5GAM f;  5CQY A;  3I56 A;  4PJO B;  3OYK A;  2BUD A;  1SEM A;  3ER0 A;  3JCM J;  2KAF A;  3I55 T;  1PSE A;  2W10 A;  4DBR A;  3CC7 T;  5KYW A;  2G6F X;  2VKN A;  1NLP C;  3FIF A;  1N6A A;  3JCM P;  2FEI A;  5KYY B;  1Y07 A;  3CCR T;  2A08 A;  3CCM A;  1O9S A;  4M7A F;  8AT1 B;  1EIF A;  4HA8 A;  2ROT A;  4BI8 B;  1VA7 A;  2LT4 A;  2QEX Q;  1G2B A;  4IUV A;  2ZPG B;  2NUP A;  3EGU A;  2V8K A;  4EMG A;  2F1L A;  4ANJ A;  9ATC B;  5M9O A;  4PFO A;  4J6X A;  1KSW A;  5KYU A;  2QQ9 A;  4C0D B;  3ME9 A;  2LRQ A;  1I4K 1;  1Q81 U;  1VOM A;  4FSX A;  4J6W A;  4LNP A;  4CC2 A;  1YHQ Q;  3DLM A;  1ZA2 B;  2XDB A;  3OBY A;  1WHK A;  3CXC A;  3NFC A;  4QVD A;  1VQP Q;  4F7U A;  1XJW B;  3RMS A;  1Z9Z A;  1RAH B;  3G71 Q;  3E19 A;  2B86 A;  1VIE A;  3I55 Q;  1UB4 A;  4LUD A;  4J9H A;  1KHC A;  3CCR Q;  5D6X A;  5FRM A;  1QP3 A;  2OTJ Q;  3M56 A;  2K5I A;  3VS2 A;  2V8J A;  3CMA Q;  1RAI B;  2CP3 A;  3CC7 Q;  1PRM C;  1UUE A;  2XID A;  4L59 A;  4FW2 A;  2CH4 W;  4KUL A;  2DL7 A;  2RQW A;  4J83 A;  2M1H A;  3GPL A;  4HVU A;  2FVU A;  4C8Q C;  4C8Q E;  1BI2 A;  2F69 A;  2DPP B;  3MEA A;  2EWN A;  1UHF A;  1JO8 A;  1RAD B;  2BKD N;  1M90 R;  3FDR A;  2KSS A;  4C8Q B;  1C6V X;  3OW2 S;  2GQI A;  1OU8 A;  1YBY A;  3JCM e;  4HCZ A;  1NLO C;  1I81 A;  2AZV A;  3TSW A;  1MND A;  2DE0 X;  3QJY A;  2MAM A;  1YHQ A;  1KJW A;  4XU2 A;  3EG0 A;  4DA4 A;  1IHV A;  3BW1 A;  2QA4 Q;  1BU1 A;  3PGG A;  1Y96 B;  3EGX A;  1KFZ A;  1FMK A;  3M55 A;  1OYX A;  4PLI A;  4JPB W;  3DB4 A;  4E6R A;  1WNL A;  2JMC A;  1H3Z A;  2QAS A;  5C6S A;  2DX1 A;  2PZ1 A;  2MF2 A;  3QJ6 A;  2K9G A;  1O75 A;  3J81 E;  4IUQ A;  4DBH A;  1UGQ B;  1VQM A;  2D0Q B;  4JZ3 A;  2DXU A;  4XTY A;  2GQV A;  1Q86 U;  1AT1 B;  4M78 E;  2O9S A;  3VS6 A;  1ZHI A;  2J6F A;  3CCS T;  1WXT A;  1PCX A;  2EW3 A;  1WA7 A;  5IAY A;  2X51 A;  4M77 B;  2CP5 A;  2DKG A;  3KXT A;  3I56 Q;  3V8L A;  3CD6 Q;  4XTW A;  5J26 A;  3RBB B;  1K73 U;  1Y96 A;  2DNU A;  3LYI A;  1VQK A;  2CT4 A;  5LJ3 d;  1NJI C;  5DLQ E;  1JRI A;  2RQV A;  4JJN K;  3HHT B;  1AWJ A;  2DIQ A;  3OYI A;  3G6E A;  4RG2 A;  4IUU A;  2MIO A;  3E2U A;  3M4Y A;  1ZSZ C;  1K8A U;  2EQU A;  1VQ8 A;  5A0D A;  1YIJ Q;  1VQ9 T;  3L2U A;  4BY6 C;  4CC4 B;  4N0A A;  2CP2 A;  4TVR A;  2OTL Q;  3C4S A;  2ED1 A;  3LWH A;  3VS0 A;  2KI7 A;  2YDL A;  3PMT A;  4A54 A;  2E4H A;  1YIT A;  5FW9 A;  2CKK A;  3L42 A;  3M0P A;  3JRZ A;  1VIF A;  1ZUU A;  3CD6 T;  4FYW B;  2VWF A;  2RJF A;  3C95 A;  2PU9 B;  2HAX A;  1R77 A;  2XDP A;  2HMA A;  1M1G A;  1M5Q 1;  3QG1 A;  2DL8 A;  3NGP A;  2EQM A;  4B9X A;  4KT0 E;  4LUE A;  3QYH B;  5GAO p;  3CCU Q;  1V1C A;  1SSH A;  1M4Z A;  3KBG A;  1R0C B;  3U23 A;  1QVG P;  1VQ6 Q;  3PTA A;  5GMK l;  2HKQ B;  2JS0 A;  4RTX A;  4MDX A;  4EDU A;  2LP5 A;  3OYB A;  1D0Z A;  4J9B A;  3TQ7 P;  2JTM A;  4E7L A;  2HL5 C;  4OGE A;  1Q82 R;  3O8V A;  2MWO A;  4IUR A;  3HRT A;  3R6N A;  2R58 A;  1YIJ T;  1ZSG A;  4YTL A;  3OS0 A;  3X26 B;  1N8R C;  4MZM A;  2DF6 A;  1GL5 A;  1Y0M A;  3SDZ A;  1H92 A;  2EBP A;  1RAA B;  2L2P A;  1M90 C;  3CCE Q;  2E1H A;  1NE8 A;  2L3S A;  3LW5 E;  1NYF A;  3DB3 A;  5HCK A;  2X9H A;  2PVO B;  3PNW C;  3V8J A;  3JCM Q;  3OYE A;  4ZGJ B;  1UG1 A;  2ESW A;  1YJW T;  1VQN T;  3LWI A;  1K0X A;  4M7A C;  3I56 T;  2QYZ A;  4IIO A;  1NPR A;  1K9M U;  4GY5 A;  4ZGE B;  2DLP A;  4QVZ A;  2A36 A;  1QW1 A;  4NS5 A;  1KK7 A;  1PM3 A;  1PD1 A;  1YIT Q;  3T9N A;  2DYB A;  2COY A;  1OPK A;  3M0S A;  2MOX A;  1VYT A;  5KE3 A;  2DRM A;  4PFZ A;  2EGA A;  4R0K A;  1YJN A;  1GBQ A;  1OZ2 A;  3FC3 A;  1UDL A;  3JCM b;  2K3B A;  4NOY A;  4XTV A;  4KUI A;  2DEQ A;  2LTO A;  3A8L B;  5GAN j;  1ARK A;  3TSZ A;  1JXM A;  4Z89 A;  2ZAE A;  2LJ1 A;  3URG A;  2MI6 A;  2V1R A;  4QQD A;  3TVT A;  1MV3 A;  5I22 A;  2M0Y A;  2WSF E;  3EFR A;  4ZTJ A;  1NJI R;  1VQL T;  2NLU A;  2ZPI B;  3JCM d;  3CBO A;  2NUP B;  3THK A;  3M59 A;  5GAN 8;  2XD0 A;  1JJ2 S;  2DBM A;  1WGS A;  2QDL A;  4A4F A;  2YXY A;  3ULR B;  5KCH A;  3V8K A;  2JM8 A;  5LJ5 f;  3DKM A;  2YHT A;  4N4G A;  1VQ9 Q;  2VB6 A;  3A8M B;  3VU3 C;  2DXB A;  1Q95 G;  2A28 A;  2NWM A;  1YJN T;  3A1P A;  2JJ9 A;  5A2Q E;  1G5V A;  2D6F A;  2DTI A;  4C92 B;  2HBP A;  3RES A;  3M0R A;  4PJO C;  4XU0 A;  1MUZ A;  2QI2 A;  3OMC A;  3H6Z A;  4MMK A;  4GLM A;  5FU7 C;  3RUX A;  1SRL A;  1I5O B;  3BY7 A;  2JM9 A;  3MEW A;  2V1Q A;  5CR2 A;  1E6H A;  2EAY A;  1GFD A;  2GFU A;  2M02 A;  1KD1 C;  2ZPB B;  1ABQ A;  1UEC A;  2K5L A;  1LCK A;  4J9C A;  4QQ6 A;  1D0Y A;  2DMO A;  4JRP A;  1YHQ T;  2FL7 A;  4Q5W A;  3CC2 A;  1Q82 C;  4OP0 A;  1CKB A;  2B8A A;  4BI3 A;  5A0G A;  4M7D D;  4JJD A;  2XKO C;  4DOW A;  2BTT A;  5CCA A;  3INZ A;  2O88 A;  3QZ5 B;  2KRO A;  1MMA A;  1IHW A;  2KXD A;  1GFC A;  3HPW A;  3LX7 A;  4LN2 A;  4XTX A;  5GMK i;  3MEU A;  1VQO Q;  2FYK A;  3QO3 A;  1UJY A;  2LQN A;  3NTI A;  1ZQ1 A;  2EFI A;  5DM7 R;  4RTY A;  2OTJ A;  4XK8 E;  3RIR A;  1QKW A;  1MGQ A;  1VUB A;  3FJP A;  2RQT A;  4C0F A;  2MWP A;  2O4X B;  3TCJ A;  2XU8 A;  1YI2 A;  2KGT A;  1J3T A;  3CCS A;  2KE9 A;  2YRV A;  2DZ9 A;  2K7A A;  5FU6 C;  1KC8 U;  5IHI A;  2VYT A;  4OMM A;  2DTH A;  2ED0 A;  1VQP T;  1WJQ A;  1M2O A;  4E7Z A;  1YFN A;  1Y57 A;  8ATC B;  2W0Z A;  1X6O A;  1FMV A;  5IH2 A;  2D8H A;  3A8O B;  1WJR A;  1G3W A;  2QTV A;  4R56 A;  2RHI A;  6AT1 B;  2QEX A;  1S72 A;  4QVC A;  3JCM c;  4Z02 A;  2BE9 B;  1PD0 A;  1IZ6 A;  2OAU A;  4RCC A;  1A0N B;  5AT1 B;  1VQ9 A;  3RKW A;  5GAM d;  2RNA A;  5FU7 B;  4J9F A;  3JB9 G;  3MPU B;  2ROL A;  2YUP A;  1M1K U;  4M77 A;  2D8J A;  2LJ0 A;  4WCI A;  1RAC B;  2RI5 A;  3MHX A;  4BE0 A;  1HYO A;  1XNI A;  2QQR A;  4EMK A;  2FPE A;  3KFV A;  1DJ7 B;  1I1J A;  1BB9 A;  1JQQ A;  3CC2 T;  5GAN 3;  1OQK A;  5KYX B;  1M3B A;  1VQM Q;  1N27 A;  2X4Y A;  1E7O A;  2RA2 A;  3RNJ A;  5GAN g;  3NHN A;  1SG5 A;  1M9S A;  1NPP A;  2YLC A;  4KBM B;  5KYW B;  1Q7Y C;  1D0X A;  1G3T A;  2EGC A;  3LLR A;  2LT1 A;  1QVF P;  3PVQ A;  4JLG A;  3OYN A;  1PG5 B;  1U1S A;  2CUB A;  3I9Q A;  1VQ7 A;  4M77 G;  3NPF A;  1UHC A;  2JTF A;  5GMK e;  2QXF A;  3HFO A;  4HT8 A;  1EFN A;  2AKL A;  2XI9 A;  4C5G A;  1NEG A;  4J7F A;  2EJF A;  2AHJ B;  1VYU A;  2KR3 A;  4CC7 A;  3QBY A;  3VS4 A;  1HXD A;  4RTV A;  4E47 A;  3PE0 A;  1Y7X A;  2P4R A;  2PQW A;  4VUB A;  2AKK A;  1XQH A;  2IPO B;  3CC7 A;  3UAT A;  4A63 B;  2RF0 A;  2LNV A;  3IQL A;  2ABL A;  4JJC A;  2CT3 A;  4FT2 A;  1UFF A;  2JW4 A;  3CBP A;  3MEV A;  4FT4 A;  4N4I A;  1X6G A;  5GAM e;  3CME Q;  4C92 A;  3QDR B;  3X20 B;  3CBM A;  2M16 A;  3JV3 A;  2IG0 A;  3ASK A;  4UC4 A;  2OAW A;  2BZX A;  2R5M A;  3S3O A;  1K1Z A;  1D1B A;  2KT8 A;  1AOJ A;  4B9W A;  7AT1 B;  2MMP A;  5ECA A;  2L89 A;  2COZ A;  4RMO A;  3E9F A;  2RM4 A;  1TOV A;  5GAM h;  1LPL A;  1N8R R;  2EJG A;  1VQ7 T;  2JN0 A;  4C8Q G;  4BUG A;  1QCO A;  2HSP A;  2HNI A;  4M77 E;  2SEM A;  3OYJ A;  5KE2 A;  3OY9 A;  2CS7 A;  1RAB B;  1RUW A;  1SHG A;  2RD1 A;  4MDW A;  5GAO q;  4BE1 A;  4X34 A;  2RN8 A;  2VXE A;  5LJ3 f;  1KQ2 A;  4M75 F;  3QPH A;  5GAM j;  2YT6 A;  2QTX A;  4DBF A;  3VS5 A;  3DLL A;  2CZ1 B;  3CCQ Q;  1TUG B;  2PVD B;  2DA9 A;  1MMD A;  1G3Y A;  3VKI A;  4M7A A;  3CCE T;  1LOJ A;  2FRW A;  3EGX B;  2HL3 A;  5FLX E;  3LGF A;  3SWN B;  1PC0 A;  2DXC A;  3QKJ A; 
#chains in the Genus database with same CATH homology
 1SSH A;  4D8D A;  2RQU A;  1TG0 A;  1GRI A;  1HD3 A;  2E5K A;  3U23 A;  4K11 A;  2XMF A;  2PNI A;  2JS0 A;  4RTX A;  1B3Q A;  1T0H A;  1NYG A;  2LP5 A;  4HCK A;  3PVL A;  4J9B A;  5GJW B;  1AWO A;  2CSI A;  1AD5 A;  3VS7 A;  4FSS A;  5EC7 A;  2FO0 A;  2LNH B;  4RUG A;  1AZG B;  2K6D A;  1CSK A;  3R6N A;  4J9G A;  1ZSG A;  3VRY A;  4CC3 A;  4J9E A;  2DF6 A;  1ZLM A;  1GCQ A;  1GL5 A;  1Y0M A;  2DL5 A;  2EYZ A;  2X3X D;  1H92 A;  3I35 A;  2ENM A;  2I0N A;  2CRE A;  2EBP A;  1QWE A;  2L2P A;  2KBT A;  2ECZ A;  3VS3 A;  2DBK A;  4EIK A;  2L3S A;  4AG2 C;  1NYF A;  4ZNX A;  5HCK A;  4Y92 A;  1W1F A;  1I07 A;  1JXO A;  3REB B;  1YNZ A;  1UTI A;  1UG1 A;  2ESW A;  1QKX A;  1K0X A;  1SPK A;  2CH4 A;  4IIO A;  4F17 A;  2GGR A;  1WYX A;  2DLP A;  3REA B;  2A36 A;  1NG2 A;  4JJB A;  2DYB A;  3M0S A;  1OPK A;  2EVR A;  1K0S A;  2MOX A;  2M51 A;  1VYT A;  2FG0 A;  3EHQ A;  2DRM A;  3VS1 A;  4RTZ A;  4J9D A;  2HCK A;  1T3L A;  4DEX A;  5IXF A;  1TUD A;  2EYY A;  1AWX A;  2RPN A;  1X27 A;  4OMO A;  1ZUK A;  2EGA A;  4R0K A;  1GBQ A;  1UDL A;  2AZS A;  2K3B A;  2VVK A;  4AFS C;  3H0F A;  2DL3 A;  4F14 A;  1ARK A;  4LE9 A;  1Z9Q A;  2BZ8 A;  3O5Z A;  3TSZ A;  1H8K A;  1WIE A;  2OJ2 A;  5FWC A;  2PTK A;  1JXM A;  4Z89 A;  4OMN A;  2RMO A;  1K76 A;  2O9V A;  1SRM A;  2KYM A;  2OI3 A;  2LQW A;  1G83 A;  2LJ1 A;  2V1R A;  1M8M A;  1OEB A;  3TVT A;  1MV3 A;  5I22 A;  1OPL A;  2M0Y A;  1QCF A;  2L3Q A;  1GCP A;  1M3A A;  4M4Z A;  1X2K A;  4HVW A;  1YCS B;  2CUD A;  3THK A;  1AVZ C;  5GJV B;  1VYV A;  1X2Q A;  2HDA A;  2DBM A;  1PKT A;  2YUQ A;  5IXB A;  1PNJ A;  3H0I A;  5FWB A;  2QDL A;  3H41 A;  2J6K A;  1W70 A;  4AFQ C;  2J05 A;  3ULR B;  1FYN A;  2JM8 A;  4KRT A;  2HEQ A;  1JEG A;  1ABO A;  2AK5 A;  1YWO A;  1HJD A;  2JXB A;  2A28 A;  2NWM A;  4GBQ A;  1K9A A;  1AZE A;  1WLP B;  2SRC A;  2LJ3 A;  2KRS A;  4ESR A;  2F2X A;  2KRN A;  1BK2 A;  2EPD A;  4Z8A A;  4F16 A;  3M0R A;  4J9I A;  2JTE A;  1MUZ A;  1JU5 C;  1NM7 A;  3UA7 A;  5IHK A;  3FJ5 A;  2EYX A;  4GLM A;  5IHN A;  3A98 A;  1SRL A;  3QWX X;  1X69 A;  4OMQ A;  2F2V A;  1W6X A;  2KXC A;  2J06 A;  2JM9 A;  2K79 A;  2EKH A;  2V1Q A;  1E6H A;  1GFD A;  2C0O A;  1ABQ A;  1PRL C;  1UEC A;  1LCK A;  4J9C A;  1SEM A;  1RLP C;  2LMJ A;  2W10 A;  2DMO A;  2EYW A;  2G6F X;  3M0T A;  2VKN A;  1NLP C;  4HXJ A;  1CKB A;  4JJD A;  2FEI A;  2IIM A;  2BTT A;  4RTT A;  1UE9 A;  2A08 A;  1GBR A;  2DM1 A;  1OV3 A;  2O88 A;  2KRO A;  2ROT A;  1VA7 A;  2DVJ A;  2KXD A;  2LZ6 B;  1GFC A;  2F2W A;  1G2B A;  3EGU A;  4LN2 A;  3C0C A;  1T3S A;  1UJY A;  2LQN A;  2LX7 A;  1KSW A;  4RTY A;  1K4U S;  1QKW A;  3SHW A;  2DJQ A;  1X43 A;  4LNP A;  4CC2 A;  2RQT A;  1WX6 A;  2FPF A;  2DIL A;  2KEA A;  3EHR A;  2KGT A;  1J3T A;  1M27 C;  2KE9 A;  3EG3 A;  1WXB A;  1E6G A;  2K7A A;  5IHI A;  1QLY A;  3EG2 A;  4OMM A;  2ED0 A;  1WDX A;  3UF4 A;  1Y57 A;  1Z9Z A;  2W0Z A;  4OMP A;  2B86 A;  5IH2 A;  4JZ4 A;  2D8H A;  1U5S A;  2O31 A;  1TUC A;  1RI9 A;  4J9H A;  4LUD A;  1WXU A;  1ZBJ A;  3VS2 A;  2RQR A;  1PKS A;  3EG1 A;  2D1X A;  1PRM C;  1UUE A;  1A0N B;  2JS2 A;  1H3H A;  2KYB A;  2CH4 W;  2O2O A;  2DL7 A;  2RQW A;  2KRM A;  2RNA A;  4J9F A;  4HVU A;  2K2M A;  2ROL A;  2YUP A;  1U3O A;  1M3C A;  1ZUY A;  2D8J A;  2LJ0 A;  3NMZ C;  4WCI A;  2KT1 A;  3CQT A;  1UHF A;  1JO8 A;  1YP5 A;  1HSQ A;  2GTJ A;  1I0C A;  2FPE A;  3KFV A;  1I1J A;  2DL4 A;  2GQI A;  1BB9 A;  1JQQ A;  4AG1 C;  3GBQ A;  2EQI A;  1M3B A;  1NLO C;  2AZV A;  4OML A;  1UJ0 A;  2EGE A;  1E7O A;  3TSW A;  1SHF A;  2DE0 X;  3RNJ A;  1M30 A;  1KJW A;  1NEB A;  1XOV A;  3EG0 A;  1PHT A;  3NHN A;  1IO6 A;  1AWW A;  5I11 A;  1WFW A;  2GNC A;  2J6O A;  3UA6 A;  4IIM A;  1BU1 A;  4QT7 A;  2FPD A;  1X6B A;  1KFZ A;  2EGC A;  1T0J A;  2YSQ A;  2MCN A;  1FMK A;  3PVQ A;  1YWP A;  4RTW A;  2CUB A;  4AFZ C;  3I9Q A;  1GCQ C;  2NUZ A;  3NPF A;  4JPB W;  1UHC A;  4E6R A;  2JMA A;  1UGV A;  3SEM A;  2JMC A;  1EFN A;  2J7I A;  2AKL A;  2DX1 A;  2PZ1 A;  1N5Z A;  4ORZ A;  1NEG A;  2K9G A;  1VYU A;  2LCS A;  1YN8 A;  2KR3 A;  2YUN A;  4CC7 A;  2BZY A;  3VS4 A;  1RLQ C;  4RTV A;  3PE0 A;  4JZ3 A;  2YUO A;  2P4R A;  2FRY A;  2AKK A;  2C0I A;  4DEY A;  2O9S A;  3VS6 A;  1CKA A;  1KIK A;  2J6F A;  3UAT A;  4A63 B;  2RF0 A;  1PWT A;  3IQL A;  4Z88 A;  2ABL A;  2HBW A;  4JJC A;  1WXT A;  2JT4 A;  2EW3 A;  1S1N A;  1WA7 A;  2CT3 A;  1UFF A;  2JW4 A;  1X6G A;  1ZX6 A;  1MV0 B;  3RBB B;  3QWY A;  2DNU A;  3JV3 A;  2C0T A;  2CT4 A;  1OOT A;  2OAW A;  2BZX A;  2GTO A;  3M0U A;  1K1Z A;  2D0N A;  2KT8 A;  1AOJ A;  2H8H A;  2CDT A;  5ECA A;  3LH5 A;  2RQV A;  4HVV A;  1AWJ A;  3M0Q A;  1B07 A;  3I5S A;  3ZL7 C;  2HSP A;  2MIO A;  2L0A A;  3I5R A;  2CSQ A;  4RTU A;  1U06 A;  2SEM A;  4CC4 B;  5L23 A;  4D8K A;  2ED1 A;  3VRZ A;  1WI7 A;  2GBQ A;  3VS0 A;  1RUW A;  1SHG A;  2YDL A;  2RN8 A;  5FW9 A;  2L3P A;  3M0P A;  2YT6 A;  3VS5 A;  1BBZ A;  1ZUU A;  4AFU C;  2VWF A;  2KNB B;  1QWF A;  1AEY A;  2DA9 A;  4X1V A;  2DRK A;  2DL8 A;  2A37 A;  2FRW A;  3NGP A;  3H0H A;  4LUE A;  1V1C A;  2X3W D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...