3G7ZA

Ccdb dimer in complex with two c-terminal ccda domains
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
101
structure length
101
Chain Sequence
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin/toxin repressor
molecule keywords Cytotoxic protein ccdB
publication title Rejuvenation of CcdB-Poisoned Gyrase by an Intrinsically Disordered Protein Domain.
pubmed doi rcsb
source organism Escherichia coli
total genus 28
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01845 CcdB CcdB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3g7zA00
5CQXA 5CKDA 5CR2A 5HKCA 3TCJA 3G7ZA 1NE8A 4OF1A 1UB4A 3NFCA 3VUBA 5CK9A 5CKHA 5CCAA 4ELYC 5DLOA 2C06A 4VUBA 5HK0A 1VUBA 5HK3A 3JSCA 4HKEA 2KMTA 4MZTA 5CKEA 4MZPA 3JRZA 5CKBA 5CKFA 5CQYA 4ME7A 1X75C 2VUBA 4ELZC 3HPWA 4MDXA 2MF2A 5CO7A 4MZMA 1M1FA
chains in the Genus database with same CATH superfamily
1VQPQ 3GLXA 2IG0A 3QDRB 2JT4A 2RK1A 2ROLA 3G6ET 1LPLA 4HCKA 1RAEB 1ZQ1A 4M75E 1Y07A 1M90U 3M4GA 1RAGB 1Q82U 2ZPEB 3PE0A 2DK3A 3CPFA 4F7UA 5L8RE 1N27A 1JXMA 2W10A 1JJ2S 1U8RA 2DJQA 3OYEA 2K79A 2DD5A 5LJ3f 1UJ0A 3CCVA 2KRMA 3OMGA 5LJ5j 2ZPGB 1XQHA 2HDAA 3BY7A 5GAN7 1K9MU 1RAAB 3G4ST 5KYUA 4XTXA 2EJ9A 1I81A 2H3JA 2DYIA 2DZ9A 2LCCA 4IUUA 2QQRA 1SF9A 2OTLQ 5GAMe 3RKYA 1VQ8A 5CR2A 3WVDB 5GMKm 3MEWA 4WTOB 1PHTA 1VQPT 2EQIA 2RI5A 1K76A 1GBQA 5IAYA 3P8HA 2ED1A 1HJDA 1QWFA 4J7FA 2GGRA 2QTXA 1WXBA 3CCQA 2F5KA 2RO0A 2FYKA 1XJWB 3IQLA 3QBYA 2DEUA 3REBB 5KYNA 4XTYA 4CC2A 2RM4A 1M90R 1Q82R 5I21A 4A53A 1N9SA 1NM7A 4OMFB 5CKFA 3OYFA 4GBQA 1A0NB 3JCMh 4BUGA 3L1AA 2RHXA 1SHGA 3I9QA 5GANd 4E7KA 2HZYA 1AWOA 1KC8R 2ZAEA 2DXTA 1TUDA 3PVLA 1K9MR 2OTLT 2E3IA 2EGEA 2LCLA 3I56A 2KEAA 4AFZC 2HSEB 2L3SA 2A28A 5CKBA 2CUBA 2RQRA 2JJ9A 5IN1A 2CP6A 3AT1B 1X6BA 1B34B 2XD0A 2FL7A 4M75G 2WSFE 5GAOq 3JCMW 4QQ6A 1BCMA 1JRIA 2KAFA 2DETA 5CCAA 3PTAA 3FIFA 1QCOA 4EMKC 1QMCA 2RNAA 1X69A 1IZ6A 2K57A 4M78C 3KUFA 5HY6A 1E6HA 1MUZA 4F7UB 2FZGB 5DLQE 1X2QA 4AFQC 4XU2A 3OYGA 3G4SA 1QVGA 1JEGA 1S72Q 1LOJA 2D9TA 2YRCA 2DIQA 3FB9A 2E64A 5D6WA 3CC4Q 4MDXA 2JM8A 3NGPA 1UUEA 1K8AC 3CXCP 2NWMA 2GFAA 4C92F 1U06A 1T0HA 4X9DA 3THKA 1LJOA 1TSFA 4A4KA 3X28B 1Q81U 3OQ5A 2DX1A 2RI3A 3QG1A 4IUPA 2JTEA 2ZPBB 2QEXQ 3INZA 4MMLA 3UT1A 4J6XA 1WHMA 1OV3A 1BCOA 4ELZC 4PJMA 4PFOA 4Y91A 1M8MA 3VV0A 4PLLA 1IGUA 3OS2A 2DEQA 2LJ3A 3CD6Q 2GQIA 1OYXA 4IUVA 3REAB 2A08A 4XAXB 2CZ6B 2RA2A 1JB0E 1S72T 4K11A 3CXCS 1R0BG 5IHIA 5GAMd 1HXDA 4OB2B 4X9CA 2KRSA 3DLLA 3CC4T 2GF7A 1NPPA 3M0UA 2X35A 4F7UG 4LDXA 5HKCA 1VQKQ 1D1AA 2LMJA 2DL3A 1HK9A 2E6ZA 3L42A 4OMLA 1PRMC 3M9QA 1Y0MA 1I4K1 2XU8A 4HKEA 3RKXA 4C8QD 4OB1B 3HRUA 4R0KA 2KGTA 4M78E 2QEXT 2M9UA 3EHRA 3DLMA 1N6AA 2EIFA 1AZGB 2J06A 1SG5A 2DLPA 3AHUA 2C0IA 1NZ9A 2QQSA 1KQSP 1Q81R 1YWPA 4E7IA 4LUDA 1MNEA 1W6XA 1ZUYA 4HVVA 3CCJQ 2KVQG 2VXFA 2VB6A 1C6VX 2NUTB 3CD6T 5GANh 2RPNA 2ENMA 3BW1A 5IXBA 1QVFA 1UGRB 4GLMA 4EMKB 2DD4A 2E6NA 3CCUQ 1CKAA 1WI7A 4M78B 1WHJA 4FYVB 2YWWA 5FRMA 1GXIE 1NLPC 1O9SA 1I1JA 3OY9A 1VQKT 1K4US 2SRCA 4CRIA 1M2OA 3L2WA 1NEGA 2CT4A 1Q86U 1NBEB 2FZKB 1MV0B 2QA4A 2DTIA 1T0JA 1KQSS 3H9NA 3RERA 2EYZA 1ABQA 4Q5WA 3JCMV 1ACMB 2F1LA 3CC7Q 1N9RA 2EGCA 3ME9A 2JS2A 2QI2A 4BY6C 2ZPIB 4C8QA 4ESRA 3RMQA 2ATCB 4XU0A 3CBPA 3CCJT 4OGCA 2YLCA 4P5NA 1VQ7Q 3F70A 3QWYA 3C0CA 3M0RA 2MPXC 2M16A 2L89A 2RQVA 4XU3A 5A0LA 3HHTB 1S72A 5DY9A 1QVGS 3CCUT 3LWIA 1JU5C 2LT4A 2A36A 1G8XA 1M3CA 1V76A 2DTHA 1YIJA 1K73U 2JS0A 3PGGA 1X6GA 3SB2A 4LDVA 3CC4A 1UGQB 4N0AC 1AT1B 2VYTA 4JZ3A 3U23A 4WF2A 5CQYA 2RQUA 5LJ5g 4RTTA 1KG1A 2KBTA 4O5VA 2NLUA 1ZBJA 3M56A 3QJ6A 2XDDA 1KJWA 1SHFA 4OB3B 4NL3A 1FXXA 1QCNA 4M78G 3CC7T 1NE8A 4M7AF 1QKWA 2CKKA 4JRPA 1PD0A 3PIOA 3CEYA 1Q86R 2R5AA 1WIEA 3RDVA 4M7DD 3UF4A 2C0TA 1GFCA 2DL5A 3MP1A 4NL2A 2LT1A 4QQGA 1IHVA 3RMSA 1VQ7T 1FMKA 3CCLQ 2VWFA 4D6WA 2DL8A 3CBMA 2KYMA 4B9XA 3LW5E 2B86A 5GAMh 4FT2A 3FEOA 2NUPA 1I8FA 2DTOA 3DB3A 4XTZA 5KYWB 2EYQA 5GAN5 3CCRQ 1K9AA 4HCZA 4PFPA 2EJFA 4ZGEB 5FU7C 2PUOB 5FU6C 3O5ZA 3EG3A 1QVFP 1RLPC 1B07A 4N4GA 2OTJQ 1OX8A 4J9CA 1K73R 4BDYA 2FPDA 2K3YA 3P8DA 3BE3A 1VQ6Q 1GCQA 1N8RU 2QDLA 1AWXA 1TWBA 4FSXA 3P8BB 2DKGA 1WX6A 5D6YA 2A37A 5GAN2 3I5RA 4E2FB 2L3RA 1X43A 1YN8A 3OSVA 1LVKA 4AG1C 1OEBA 5LJ3g 2DF6A 3ZBDA 3V7RA 3CCLT 4M7DA 1N5ZA 4QT7A 2HBPA 1QVFS 5IHNA 5D6XA 4C92C 1PM3A 2FRWA 1NJIC 4BY6B 1AD5A 3CCSQ 3A98A 5D7UA 2I0NA 3OSSC 1PG5B 3CCRT 2GTJA 2A7YA 2V8KA 2X3XD 4XK8E 1QWEA 1EZZB 5HK0A 2PQWA 4OMPA 3FJPA 1X27A 3H0FA 2OTJT 2CYZB 2FEIA 2P0QA 1EFNA 1TTHB 1OOTA 1C1AA 2J7IA 2DVEA 1VQ6T 2X4WA 2HQXA 2O2OA 1Q95G 1YJNQ 1VIFA 2DIGA 5LJ5f 4J8OA 3VRZA 1BI2A 1YJWQ 1YNZA 1YITA 1WNLA 1IO6A 3CMAA 2RB6A 1N8RR 2OX7A 2DM1A 5I22A 4LE9A 1TS9A 2XICA 4QVCA 4J9DA 2HEQA 3CPWP 4J9HA 3M59A 3CQTA 1TUCA 2KY9A 1K1ZA 5GANj 2X4JA 2MI6A 4JRIA 3CCST 1I5OB 3OS1A 1UE9A 3MO8A 4KUDK 2PU9B 2ED0A 4X34A 3VUZA 1Y96A 3MJXA 3M4YA 3PT9A 4C5HA 3I55Q 4GLKA 1NYGA 2AHJB 2BKDN 4FT4A 3EG9B 4J83A 4FSSA 5GAOl 4FYYB 2VXEA 2L3PA 4DBFA 3JCMP 5CVIA 1G3TA 4LDUA 1WZOA 1Y57A 1BBZA 1M5Q1 3HRSA 3VKIA 5LL6S 2CH4W 3NPFA 3CPWS 5FU7B 2L0AA 1Q7YC 1YJNT 4RCCA 1IXDA 2E4HA 3M0TA 2JXBA 5GMKi 1YJWT 4HCBA 2VVKA 1M9SA 4PJOD 4HXJA 4QVDA 2P0KA 4C92E 4KH0B 4N4HA 3PMTA 5FW9A 1Y7XA 4RUGA 4O6JA 3HKSA 4J9BA 2DILA 3JCMc 3C4SA 4X1VA 3M5AA 4M7DB 2QGFB 2GBQA 2LP5A 2QYZA 4Z8AA 3I55T 2M0YA 3TU4K 1KC8U 2C06A 3R6NA 4M7AD 1U1TA 1PC0A 4E47A 4C8QF 1VQ4A 1UGVA 4J9EA 3JRZA 5EG2A 3VS2A 2OTJA 4PJLA 2EYWA 4C92B 3EHQA 2FG0A 1ZUUA 3CXCA 1R77A 4JRQA 4FYXB 2DRKA 2IPOB 2MF2A 4ANJA 2CZ1B 1VQ6A 3PNWC 2K3XA 5IXFA 4MMKA 3A8LB 2K6DA 4BE0A 2MOXA 3LH0A 3H8ZA 2KNBB 3LLRA 4RKUE 4NOYA 3L2QA 2HL5C 2AKKA 1MV3A 4RCBA 3RNJA 2XI9A 4PJOA 1YFNA 2HCKA 2LJ0A 2P4RA 4DEXA 1SEMA 1YCSB 3CCSA 3GNFB 2E1HA 3S6WA 3CCMA 5GAMj 1MGQA 3DKMA 1H3HA 1M1KC 1B7TA 3VYGA 4E7LA 4QKUA 1ZHIA 2AK5A 2RHUA 2DAQA 4IUQA 1IRXA 2MIOA 4ZGJB 2K2MA 4M7AA 5L23A 2M51A 2BE7D 5KYXA 5LJ3e 3KXTA 2M0OA 1OU8A 1XTDA 4HVWA 1VQMQ 1UGPB 1YJNA 1JQQA 2E10A 1FX7A 4F7UE 1YJWA 3VRYA 2YXYA 2LX9A 3A8HB 3G6EA 1X2KA 2DXCA 2CP2A 2K7AA 1G3SA 1KQSA 4C92G 3NTIA 4BDZA 1EIFA 2YUPA 4QW2A 4ORZA 3QSUA 3SDZA 2P0PA 1D0XA 3JCMJ 4R55A 4KULA 3TSZA 3I35A 2L3QA 4QVZA 2F2VA 3SWNA 4KRTA 4C5GA 1V29B 2DE0X 3TCJA 1GBRA 2LZ6B 1JO8A 1WHLA 2RHYA 2DXBA 2X9HA 5GJWB 2EQUA 3HFNA 4M7DF 1BIBA 2RQWA 1U1SA 5FLXE 1VQMT 5KYUB 1UEBA 2YUQA 4M77D 2YDLA 1OI1A 1E6GA 3VS4A 1VQPA 3NTHA 3UA6A 1PNJA 2DYBA 3JB9F 4RMOA 3E2UA 1K73C 3E1SA 4BACA 3MHXA 4LD6A 4RTZA 4ZN3A 5LJ5d 2XKOC 2RJCA 2ROTA 2RHIA 5ECAA 3ZL7C 1YP5A 1WA7A 4QQDA 2F5TX 2AZVA 1W1FA 2ECZA 5KCOA 3CMET 2GFUA 4C0GA 2EQJA 2J6OA 2E70A 1SRMA 2D1XA 3JB9J 5GMKl 4OP0A 1VA7A 3I5SA 3PIPA 2KYBA 3O8VA 3MEVA 1SPKA 3BFMA 3MKDA 3JCMQ 1PD1A 4J9IA 3QO3A 1X75C 2OTLA 2JTMA 2RMOA 3EGXA 1WJQA 2ESWA 4M7AB 4FM4B 2WSEE 1KHCA 1PCXA 1TU0B 1I5LA 3M58A 3H6ZA 4M77A 4RTWA 4KBMB 3HSBA 2BE9B 3OYHA 5I11A 1YI2Q 3TSWA 2KDSA 3EAEA 2EWNA 2XK0A 1PKTA 2RK2A 3JCMf 3V7CA 2K5FA 2V1RA 1I0CA 1RAIB 3EFOA 2YUNA 1W2BP 2JM9A 1H641 1VQNQ 3M53A 2F69A 2MMPA 4IIOA 3ZEHA 3OS0A 3EG0A 3OYMA 5A0GA 1KQ1A 1R8OB 2V26A 2DNUA 4CC3A 1QKXA 5LJ3d 4A63B 4JUVA 2Y4XA 2KROA 1UECA 1EX4A 1VQOT 3SWNB 3LGFA 3A8OB 2JTFA 3J80E 3CCEQ 2BIVA 2YSQA 1ZSZA 1SSFA 2PZ1A 2OAWA 2HMAA 4XTUA 1YI2T 1W2BS 1UJYA 5A0DA 3MCAB 2DVJA 4C8QC 5GAN4 1SRLA 4MDWA 1KD1C 4ZNXA 4ZTJA 2DPPB 1GRIA 4AFSC 3VS3A 2PTKA 3LGLA 4M7AG 1RI9A 2DL4A 4B9WA 2CDTA 5AYFA 2M02A 3MPUB 5I2SA 2BZ8A 1KFZA 4RTVA 1VQNT 4PK4A 2QXFA 2DFUA 3A5ZB 1WJSA 2O01E 1DJ7B 3OYDA 2XHCA 4FW1A 1KK7A 1NEBA 2QG9B 1ZBXA 2C0OA 1YHQQ 1G2BA 1D3BA 2X3WD 4PJOF 4E6RA 3RESA 3CCET 1KSWA 4F16A 2L5QA 1FWZA 2ZCFB 1T3SA 1O75A 1VQ5Q 3QYGB 3QZ5B 1K8AU 3A1PA 2YT6A 3UA7A 1BB9A 4JPBW 4OGEA 1C0MA 3UDCA 1NPRA 4RG2A 3L2ZA 4JZ4A 3C95A 5CK9A 4BI8B 3CPWA 2HQHA 3VU3C 2QEXA 1RABB 2QGGA 2RF0A 2MYSA 2PNIA 2JMAA 1IGQA 3URGA 3BDLA 3A8GB 1YJ9Q 4LUEA 2KT8A 3SEMA 4LD9K 4FYWB 1H8KA 4BE1A 3CD6A 3RKWA 1GL5A 5GMKe 3LYIA 1WQWA 5GAOm 1TOVA 4A4EA 2FO0A 2CP7A 2RQTA 2VGMA 2R58A 3JB9D 2JNGA 1YHQT 1ZA2B 4JJBA 2FB7A 3VS0A 3L2RA 2G3RA 2Y90A 2R57A 4MZPA 1M1GA 2VC8A 1M90C 4E7SA 1Q82C 3ZFJA 2JN0A 3PVQA 2DBMA 3HPWA 2F2WA 1ABOA 1WHKA 2V8IA 1VQKA 2QQAA 1GCQC 4C8QE 1VQ5T 4M75D 4Y28E 2G6FX 2FZCB 1GCPA 1OPLA 3TEEA 1G83A 1VYUA 2EGAA 5GANf 3KBGA 3V8KA 3CCVQ 5FWCA 4WCIA 1KC8C 1BIAA 1M2VA 1ZSZB 8AT1B 3OBYA 1M8VA 1K9MC 4MZTA 1WYXA 1K8AR 1KIKA 1JXOA 4XTWA 4LDYA 4ZTFA 3OA6A 1YJ9T 4HT9A 2M1HA 4M7DC 3RIRA 2MK5A 2O31A 2RN8A 3CCJA 2JUFA 5LJ3h 4AT1B 2NYSA 4C8QB 4Z02A 3MEUA 4J5YA 4ATOA 1BI0A 2COZA 1V1CA 2PUKB 3CCUA 3X20B 1Z9ZA 2RJDA 1D0ZA 5IH2A 2PVOB 4OMNA 1SKUB 1QW1A 2AT1B 1UDLA 3CCQQ 1UHCA 1WHHA 3OW2P 3X25B 2K2VA 2FRYA 4LN2A 2O4XA 1WLPB 3MP8A 1D3BB 2NUZA 4PLIA 4DA4A 1IREB 3QYHB 4E7HA 3CCVT 2HAXA 4L59A 1M27C 3JB9I 4M75A 4BE2A 3VJPA 2JW4A 2I2LA 5CIUA 5GAN3 4DQ2A 4EDUA 3CC7A 4JJNK 1UGSB 3DB4A 1MNDA 4MZMA 3M54A 3MEAA 3L2UA 3G7ZA 1QP2A 1LCKA 1IB8A 2RHZA 3VYHB 1VQ7A 3QJYA 1D09B 3TREA 2X4XA 4M77F 3OYCA 4R56A 1AWWA 2P4TA 3OW2S 3FDRA 2ABLA 3A8MB 5CAIA 2LJ1A 1BU1A 2RJEA 1RI0A 1OU9A 3G1JA 1NYFA 4OMMA 3CCQT 2NUPB 3JB9H 2X51A 2HL3A 2LVMA 2D8JA 4C8QG 1IHWA 2LCSA 4KT0E 3E19A 5KE3A 2A3LA 2X4YA 4M7DE 5GAMf 1M1FA 2GNCA 3JAME 2KQWA 2XG8D 4HCCA 4FIBA 4PL6A 1YJ9A 3OYYA 1JJ2P 1M2VB 3ULRB 2HSPA 1AHJB 3CCLA 2EKHA 2EKOA 4TVRA 4E7ZA 1RLQC 1MHNA 1MMAA 1F1BB 1UHFA 2RI2A 2EPDA 3JCMX 2J05A 5LJ5e 2LC4A 1KHIA 3V7SA 3X26B 1BKBA 1OULA 2JVVA 1WHGA 2P84A 4XU1A 4OB0B 3CCRA 4IKFA 5DLOA 1NG2A 1Q81C 2EBPA 3FJ5A 2EFIA 1QP3A 3MP6A 3M0PA 4DEYA 2EVRA 2LQNA 2H3EB 2QAZA 7AT1B 1VYVA 2O4XB 3H41A 2CT3A 1ZX6A 2GQVA 1CSKA 2EYXA 2E5QA 3JSCA 2EAYA 3OS5A 2CREA 1OZ2A 2E65A 4KGZB 4M75B 4PJOC 1G5VA 2COYA 3JV3A 1W4SA 4OF1A 9ATCB 2LDMA 2CP5A 4CC4B 1PKSA 3VUBA 1UG1A 4JS4A 3FLGA 1NJIU 2O88A 2EQKA 2HQEA 1FYNA 5GAN8 3HTRA 2EYYA 3EFRA 4PFZA 4M7AC 3NTKA 4F17A 1WFWA 3OYNA 2DMOA 4FL6A 3VS6A 1Y96B 1PWTA 2MCNA 2LNVA 3C12A 4UC4A 3OYLA 4M78D 2CSIA 1ZLMA 1VOMA 4LNPA 4M7DG 2KMTA 3FC3A 4A54A 2YRDA 3ER0A 4ZN1A 3JCMg 3HP9A 2QK0A 4CC7A 2LQKA 2DJZA 1UFFA 2ZPFB 2J6FA 2O9VA 1W2BA 2HBWA 5EC7A 2LX7A 4RTUA 3JB9G 4IIMA 4KUIA 5LJ3j 1WPYA 2K4YA 4JJCA 3M0SA 3M57A 3SD4A 2DERA 1YCYA 2YHTA 1PSFA 5KYYA 2Z0WA 3H0HA 3SWNC 1Q86C 4L5GA 1LNXA 1QVPA 2QA4Q 1ZSGA 3CMEQ 3I55A 2JMCA 1FMWA 1YBYA 2IIMA 1NJIR 5CKHA 2NUTA 4J6WA 2EW3A 1VQLQ 5KCHA 2SEMA 2QASA 2KRNA 2OAUA 1M3BA 4C5IA 4EMKA 3OB9A 1VIEA 1D1BA 2E5KA 2FPFA 2W0ZA 2A0FB 2LQWA 4PJOE 4Y92A 1VQ9Q 2KK4A 2V8JA 4M78A 4II1A 1Q7YU 1P92A 5GMKh 3CBOA 2D0NA 4EPCA 4J7IA 2COWA 4C5EA 4YTLA 3G71Q 1YIJQ 3SHWA 1WDXA 3QWXX 2K5LA 2KXCA 2K5IA 4PNOA 2B8AA 4M7AE 4M75F 2O9SA 3GBQA 3V8LA 1BK2A 4PJOB 1BI3A 4RTXA 2QA4T 3WXMB 2XDPA 2VASA 2ZPHB 4JLIA 1PRLC 3QUIA 5GAN6 3R6OA 2DO3A 1VQLT 2VGNA 3EGUA 3QDFA 1VQOQ 1J3TA 4M77C 1VQ9T 2V1QA 4LDWA 3D7SB 3QIIA 1AEYA 3S3OA 5KYXB 2L2PA 3GP8A 1QLYA 3WVEB 5A2QE 4FCYA 4N4IA 1QQJA 4KGVB 3GIBA 3G71T 1YIJT 1G3WA 1H3ZA 1T3LA 4DOWA 3GOXA 1Q7YR 2ZGWA 2CZ7B 3QKJA 6AT1B 1M4ZA 4J9GA 4HT8A 3VS1A 2CH4A 2LRQA 1U5SA 4DBHA 4CI0C 3NFCA 2CUDA 1M1KU 1N8RC 1K0SA 5J39A 3META 5KYYB 4DBRA 4NS5A 2VUBA 3QXEB 2K3BA 2E41A 5KE2A 3T9NA 1BYMA 2LQ8A 1E7OA 3OYJA 1D0YA 3CC2Q 3LWHA 1XNIA 1ZSZC 2QQ9A 5GANg 4PJOG 1VQMA 3QZ9B 5KYWA 1XOVA 4D8DA 2JZ2A 4F04B 3HRTA 4C0ZA 5GAOp 3ASKA 4BD3A 2BUDA 4FW2A 4PKCC 3GF5A 3EGDA 1R0CB 4F7UF 5CQXA 3LX7A 4DOVA 5KH6A 1BI1A 1QVGP 2MAMA 2LNHB 1B3QA 2YLBA 5HK3A 4FU6A 2PVGB 3M55A 3CMEA 4V2SA 4XTVA 2J6KA 1U3OA 3JCMe 4XQ3A 4L6V5 5DM7R 3UPUA 2AIRB 4BI3A 4IURA 3S3MA 1ARKA 3OW2A 2DZCA 3JCMb 2DXUA 4M77E 5C6SA 1X01A 2EJGA 1VQLA 1M1KR 1WQ7A 5J26A 3VS7A 1YITQ 3CC2T 1RAFB 5GAOn 3CMAQ 1M30A 1VQ9A 2KXDA 1S1NA 4JS5A 3QHSA 5GAOr 3X24B 4EIKA 3UWNA 3SFMA 1OPKA 1KQ2A 3QPHA 5CO7A 2OJ2A 2CZ0B 5LJ5h 4HVUA 3EGXB 4GY5A 2D8HA 4OMQA 3G71A 1CKBA 2RD1A 4C0DC 4M77B 2CP3A 5M9OA 2YUOA 3M0QA 3OYBA 2BTTA 2KE9A 1AVZC 2R5MA 2YRVA 4EMHA 2AZSA 3OYKA 4N0AA 2KSSA 4HA8A 1H92A 2KI7A 1WXUA 4JLGA 4JDSA 4A4FA 1RUWA 1RL2A 3RR6A 3C94A 3EFOB 3S3NA 4KH1B 2K9GA 2XDBA 3KFVA 4OMOA 3RUXA 1HYOA 4BI4A 4F14A 1YITT 3EG1A 3CMAT 1VQOA 3RBBB 4PJNA 8ATCB 3OBWA 1NLOC 1K0XA 3GPLA 5GAMg 1MMGA 4EMGA 2BZYA 3J7AF 2HNIA 2D6FA 2F2XA 4C92D 2MWPA 4B6MA 1WGSA 3EG9A 1JJ2A 1YI2A 5GMKj 1VUBA 4AFUC 1HSQA 2E3HA 4OVAA 4RTYA 2KR3A 1VQ4Q 4M4ZA 1VYTA 2KT1A 2VV5A 4D8KA 4ZGDB 4RG8A 3BDUA 1TXQA 2DA9A 3EGDB 1VQNA 1RACB 4M78F 1AWJA 1Z9QA 1VQ8Q 4VUBA 4J9FA 1G3YA 5HCKA 3EH2A 2FVUA 2H8HA 2IVWA 2ZZDA 5FROA 1TG0A 3H0IA 4M77G 2GCXA 2EQMA 2CS7A 5GJVB 5IT9E 3CC2A 5IHKA 1FMVA 2RH2A 1Y71A 2CGHA 3PMIA 2BZXA 2MWOA 3N5BB 3CCEA 5J3BA 1UB4A 4Z88A 4JRKA 3NMZC 1HD3A 4M75C 3FRNA 2DBKA 2LTOA 1WXTA 2GTOA 5I2MA 3VS5A 3CCMQ 3TQ7P 2HKQB 3E9FA 1AZEA 4AMCA 4C92A 3Q1JA 3EFSA 3OMCA 2FHDA 3L2VA 1KD1U 1VQ4T 3UATA 2DRMA 3PFSA 2OI3A 1X6OA 3E9GA 2WACA 2FPEA 1SSHA 1GFDA 1TUGB 3TVTA 5GANe 1OQKA 1D1CA 3JCMd 4LXCA 1VQ8T 4Z89A 3I56Q 2CSQA 4ME7A 4C0DB 2E12A 2PVDB 1WJRA 2XMFA 4IUTA 2XIDA 1YHQA 3G6EQ 1OZ3A 3V8JA 4C0FA 5CKDA 3J81E 4E7JA 1W70A 4PJJA 5AT1B 2QTVA 3OYIA 4AG2C 3EG2A 2DL7A 5FRNA 2Y4YA 1JBMA 1VQ5A 1MMNA 5CKEA 2VKNA 4JJDA 5FWBA 1TH7A 3OYAA 1OX9A 3CCMT 5C0MA 2CP0A 2QQBA 2WSCE 1ZA1B 1MMDA 2D0QB 4A4GA 1AOJA 4BB7A 1M3AA 3EH1A 2HKNA 1RADB 3GNGA 4A4HA 4ELYC 3G4SQ 1YWOA 2JOYA 4J6YA 1RAHB 1UTIA 1KD1R 1ZUKA 3HFOA 1QCFA 3LH5A 4DBQA 2RJFA 2L8DA 1PSEA 1B34A 2AKLA 3I56T 3NHNA 2HD0A 2QDYB 5FU6B 3HL8A 4KGXB 1I07A
chains in the Genus database with same CATH topology
4BDYA 3GLXA 3LGFA 2IG0A 3QDRB 3A8OB 2K3YA 3P8DA 2RK1A 3G6ET 5CKHA 2JTFA 4J6WA 3J80E 1N8RU 1ZQ1A 2BIVA 4FSXA 4M75E 1SSFA 1Y07A 5KCHA 3P8BB 2DKGA 3M4GA 1M90U 5D6YA 1Q82U 2OAUA 2ZPEB 4EMKA 4C5IA 2DK3A 3OB9A 5GAN2 1VIEA 4XTUA 1YI2T 2L3RA 1W2BS 4PJOE 3CPFA 2KK4A 3OSVA 5L8RE 2V8JA 3MCAB 4M78A 1N27A 4II1A 4C8QC 5A0DA 5GAN4 1P92A 1Q7YU 5LJ3g 1JJ2S 4MDWA 1U8RA 1KD1C 3OYEA 4ZTJA 2DD5A 5LJ3f 3ZBDA 2DPPB 3V7RA 3CCLT 5GMKh 3CCVA 4M7DA 3CBOA 3LGLA 3OMGA 5LJ5j 4M7AG 2ZPGB 4B9WA 5AYFA 2HBPA 1XQHA 4J7IA 4EPCA 5I2SA 4C5EA 1QVFS 3BY7A 4YTLA 5GAN7 1K9MU 5D6XA 4C92C 1NJIC 4BY6B 1VQNT 3OSSC 3G4ST 2K5LA 3CCRT 2QXFA 2A7YA 2V8KA 4XTXA 2EJ9A 2K5IA 1I81A 4PNOA 3A5ZB 1WJSA 2O01E 2H3JA 2B8AA 4M7AE 1DJ7B 2DZ9A 2LCCA 4XK8E 3OYDA 4IUUA 2XHCA 4M75F 2QQRA 3V8LA 5HK0A 2PQWA 4PJOB 5GAMe 1BI3A 3RKYA 3FJPA 5CR2A 2QA4T 1VQ8A 3WVDB 5GMKm 2OTJT 2CYZB 1ZBXA 3WXMB 1D3BA 2XDPA 3MEWA 4PJOF 1VQPT 2P0QA 2ZPHB 4JLIA 3RESA 2RI5A 2DVEA 1VQ6T 5IAYA 3QUIA 3CCET 3P8HA 2L5QA 5GAN6 3R6OA 1FWZA 2X4WA 2ZCFB 2DO3A 2HQXA 1VQLT 1O75A 4J7FA 2VGNA 3QYGB 2QTXA 3QZ5B 1K8AU 3CCQA 2F5KA 1VIFA 2FYKA 2DIGA 2RO0A 5LJ5f 4J8OA 1BI2A 4OGEA 3QBYA 4M77C 1VQ9T 4LDWA 3UDCA 1NPRA 4RG2A 1YITA 1WNLA 3L2ZA 3QIIA 3CMAA 2RB6A 3S3OA 3C95A 4XTYA 5CK9A 2RM4A 4BI8B 3CPWA 2XICA 3GP8A 3VU3C 2QEXA 4QVCA 3WVEB 5A2QE 4N4IA 3URGA 3M59A 4A53A 5I21A 3BDLA 3A8GB 3GIBA 1N9SA 4OMFB 3G71T 2KY9A 1G3WA 1YIJT 5GANj 1H3ZA 2X4JA 2MI6A 4JRIA 5CKFA 4DOWA 3OYFA 3GOXA 3CCST 2ZGWA 2CZ7B 3QKJA 3OS1A 3MO8A 1M4ZA 4KUDK 4LD9K 2PU9B 3JCMh 4X34A 3VUZA 4BUGA 3L1AA 1Y96A 2RHXA 3M4YA 4BE1A 3PT9A 4HT8A 3RKWA 4C5HA 5GANd 4E7KA 3CD6A 2LRQA 3LYIA 1WQWA 5GMKe 5GAOm 4A4EA 4GLKA 4CI0C 2AHJB 2DXTA 3NFCA 2BKDN 4FT4A 2OTLT 4J83A 5GAOl 2VGMA 2VXEA 2R58A 2LCLA 3JB9D 3I56A 2JNGA 1YHQT 1M1KU 3JCMP 2FB7A 5CVIA 1G3TA 1N8RC 5J39A 3META 4LDUA 3L2RA 2G3RA 2Y90A 2R57A 4MZPA 1M1GA 2VC8A 5CKBA 1M90C 1M5Q1 3HRSA 1Q82C 3ZFJA 2JN0A 5IN1A 3VKIA 4NS5A 2VUBA 5LL6S 3HPWA 3QXEB 2HAXA 1B34B 2XD0A 2E41A 2FL7A 4M75G 5KE2A 3T9NA 2V8IA 1VQKA 1BYMA 2LQ8A 2QQAA 4C8QE 3OYJA 2WSFE 4M75D 5FU7B 3CPWS 4Y28E 1VQ5T 5GAOq 1Q7YC 1YJNT 3JCMW 3LWHA 4RCCA 4QQ6A 1XNIA 1JRIA 1YJWT 2KAFA 2QQ9A 3TEEA 5GMKi 5GANg 4HCBA 4PJOG 1VQMA 3QZ9B 5CCAA 3FIFA 3PTAA 4EMKC 5GANf 1M9SA 1XOVA 3KBGA 3V8KA 4PJOD 1KC8C 1BIAA 4QVDA 2P0KA 3OBYA 1M8VA 2JZ2A 2K57A 1IZ6A 4M78C 4MZTA 3KUFA 4C92E 1K9MC 3HRTA 4XTWA 5HY6A 4C0ZA 4LDYA 4N4HA 5GAOp 4ZTFA 3OA6A 3PMTA 1YJ9T 4HT9A 1Y7XA 3ASKA 4BD3A 2BUDA 4F7UB 2M1HA 4O6JA 4PKCC 5DLQE 4F7UA 3HKSA 4M7DC 3GF5A 4XU2A 3RIRA 3JCMc 4F7UF 5CQXA 3OYGA 3CCJA 2JUFA 3LX7A 4DOVA 3C4SA 5KH6A 5LJ3h 3G4SA 3M5AA 4M7DB 4C8QB 1QVGA 4Z02A 3MEUA 1LOJA 1BI1A 4J5YA 2D9TA 3I55T 3TU4K 1KC8U 2MAMA 2C06A 4ATOA 2DIQA 3FB9A 4M7AD 2YLBA 1U1TA 5HK3A 1BI0A 2E64A 4C8QF 4E47A 1VQ4A 4FU6A 5D6WA 2PVGB 2PUKB 3M55A 3CCUA 3CMEA 3JRZA 5EG2A 4V2SA 2OTJA 4XTVA 3X20B 2RJDA 4C92B 4XQ3A 3JCMe 4MDXA 4L6V5 5DM7R 3UPUA 3CXCA 4BI3A 2PVOB 4JRQA 4IURA 3S3MA 2MF2A 2CZ1B 1QW1A 3OW2A 2DZCA 2GFAA 1K8AC 4C92F 1VQ6A 3PNWC 3JCMb 2K3XA 4X9DA 2DXUA 2K2VA 3X25B 4M77E 1LJOA 2O4XA 4A4KA 5C6SA 1X01A 2EJGA 3MP8A 1D3BB 3A8LB 1WQ7A 4MMKA 3X28B 1Q81U 1VQLA 5J26A 3CC2T 3OQ5A 5GAOn 2RI3A 4PLIA 3QG1A 4IUPA 2ZPBB 4BE0A 3LH0A 4DA4A 1IREB 3H8ZA 3QYHB 4E7HA 3LLRA 4RKUE 3CCVT 3INZA 4L59A 1VQ9A 4MMLA 4NOYA 3QHSA 4M75A 4J6XA 3UT1A 3X24B 3JB9I 3L2QA 3VJPA 3UWNA 4BE2A 2I2LA 5CIUA 3SFMA 5GAN3 4DQ2A 4EDUA 3CC7A 4RCBA 4ELZC 4JJNK 2XI9A 4Y91A 1KQ2A 1UGSB 3DB4A 3QPHA 5CO7A 2CZ0B 3VV0A 5LJ5h 4PLLA 4MZMA 4PJOA 4GY5A 3M54A 3OS2A 2DEQA 3MEAA 3L2UA 3G71A 3G7ZA 1QP2A 2RD1A 3CCSA 3GNFB 1OYXA 2E1HA 4IUVA 3S6WA 3CCMA 5GAMj 4C0DC 4XAXB 2CZ6B 2RA2A 2RHZA 1JB0E 4M77B 3VYHB 1VQ7A 5M9OA 1MGQA 1S72T 3DKMA 3OYBA 1M1KC 3QJYA 3VYGA 3TREA 2YRVA 2R5MA 2X4XA 4M77F 3OYCA 4R56A 3CXCS 4E7LA 4EMHA 1ZHIA 2P4TA 5GAMd 3OW2S 1HXDA 3FDRA 3OYKA 3A8MB 2RHUA 4OB2B 2DAQA 4N0AA 4X9CA 5CAIA 2KSSA 4IUQA 3DLLA 4HA8A 4ZGJB 3CC4T 2GF7A 1NPPA 4M7AA 4JLGA 2X35A 4JDSA 4A4FA 4F7UG 1RL2A 4LDXA 3C94A 2RJEA 5HKCA 1RI0A 5LJ3e 3KXTA 3S3NA 2M0OA 2E6ZA 1HK9A 3CCQT 2XDBA 3L42A 3JB9H 3M9QA 2LVMA 1XTDA 1I4K1 4C8QG 3RUXA 2XU8A 4BI4A 4HKEA 3RKXA 1YITT 4C8QD 1UGPB 3CMAT 1VQOA 4KT0E 4OB1B 1YJNA 3HRUA 2E10A 1FX7A 3E19A 4F7UE 4M78E 2QEXT 1YJWA 3OBWA 2LX9A 2M9UA 3A8HB 5KE3A 3DLMA 1N6AA 2A3LA 2DXCA 2EIFA 3G6EA 2X4YA 3GPLA 5GAMg 3AHUA 1G3SA 1KQSA 4M7DE 4EMGA 4C92G 3J7AF 1NZ9A 2HNIA 1M1FA 2QQSA 5GAMf 2D6FA 4C92D 3JAME 3NTIA 2MWPA 4E7IA 1WGSA 2KQWA 2XG8D 4BDZA 1JJ2A 4HCCA 2KVQG 1EIFA 2VXFA 3OYYA 4FIBA 4PL6A 1YI2A 5GMKj 1YJ9A 1VUBA 3CD6T 4QW2A 5GANh 3QSUA 4OVAA 3SDZA 3BW1A 1QVFA 1UGRB 2P0PA 3JCMJ 1AHJB 4EMKB 4R55A 3CCLA 2VV5A 2EKOA 2DD4A 4KULA 4TVRA 2E6NA 4ZGDB 4RG8A 3BDUA 1MHNA 2RI2A 3JCMX 4M78B 5LJ5e 2LC4A 1KHIA 4QVZA 3SWNA 3V7SA 3X26B 1BKBA 2JVVA 4C5GA 1VQNA 1V29B 5FRMA 1GXIE 4M78F 1O9SA 4XU1A 3TCJA 4OB0B 3CCRA 4IKFA 3OY9A 5DLOA 1VQKT 4VUBA 2RHYA 2DXBA 1G3YA 1Q81C 4JS5A 2EQUA 3HFNA 4CRIA 1BIBA 4M7DF 2FVUA 1U1SA 3L2WA 2IVWA 2ZZDA 5FROA 1Q86U 5FLXE 4M77G 2EFIA 2QA4A 1VQMT 1UEBA 2DTIA 1QP3A 2EQMA 2GCXA 4M77D 2CS7A 3MP6A 1KQSS 1OI1A 3RERA 4Q5WA 5IT9E 3JCMV 3CC2A 2RH2A 1VQPA 3NTHA 1Y71A 2CGHA 1N9RA 3ME9A 3PMIA 4BY6C 2QI2A 2MWOA 3N5BB 3CCEA 2ZPIB 5J3BA 4C8QA 3RMQA 2O4XB 1UB4A 4RMOA 3JB9F 4JRKA 4M75C 2GQVA 1K73C 3E1SA 3FRNA 4XU0A 4BACA 3MHXA 4LD6A 2LTOA 4ZN3A 2E5QA 3JSCA 3CBPA 2EAYA 5I2MA 5LJ5d 3CCJT 3OS5A 4OGCA 1OZ2A 2YLCA 2E65A 2XKOC 2RJCA 4M75B 4P5NA 2RHIA 4PJOC 3E9FA 3F70A 4C92A 1G5VA 3Q1JA 3EFSA 4QQDA 3OMCA 2FHDA 3L2VA 2F5TX 2M16A 2L89A 4XU3A 1VQ4T 1KD1U 1W4SA 3PFSA 5A0LA 5KCOA 3HHTB 1S72A 4OF1A 5DY9A 3CCUT 1QVGS 3CMET 3LWIA 1X6OA 2LDMA 3E9GA 2WACA 2GFUA 2LT4A 2DTHA 4C0GA 2EQJA 1YIJA 1K73U 3VUBA 2E70A 3JB9J 5GMKl 4JS4A 3FLGA 4OP0A 1NJIU 3PGGA 2EQKA 2HQEA 5GANe 3SB2A 5GAN8 3PIPA 4LDVA 3JCMd 3CC4A 1UGQB 4N0AC 3O8VA 2VYTA 1VQ8T 3MEVA 3BFMA 3JCMQ 3EFRA 4WF2A 5CQYA 4ME7A 4C0DB 4M7AC 5LJ5g 1KG1A 3QO3A 3NTKA 4O5VA 2E12A 1X75C 3OYNA 2PVDB 2NLUA 2OTLA 1WJRA 3M56A 4IUTA 3QJ6A 2JTMA 4FL6A 2XDDA 1WJQA 1Y96B 2XIDA 1YHQA 1OZ3A 4M7AB 4OB3B 2LNVA 4NL3A 1FXXA 3V8JA 3C12A 4C0FA 5CKDA 3J81E 4M78G 4FM4B 2WSEE 4UC4A 4E7JA 3CC7T 1NE8A 3OYLA 4M78D 4M7AF 1KHCA 2CKKA 3OYIA 4JRPA 1I5LA 3M58A 3H6ZA 4M77A 4KBMB 3PIOA 3CEYA 3HSBA 2R5AA 3OYHA 4M7DG 2KMTA 5FRNA 2Y4YA 1JBMA 3FC3A 2KDSA 1VQ5A 4M7DD 5CKEA 4A54A 1TH7A 3EAEA 3ER0A 3OYAA 4ZN1A 3JCMg 2EWNA 3CCMT 5C0MA 2XK0A 3HP9A 3MP1A 2QQBA 4NL2A 2LT1A 2WSCE 2RK2A 4QQGA 3JCMf 3V7CA 2LQKA 2K5FA 3RMSA 1VQ7T 4D6WA 3CBMA 2DJZA 2ZPFB 4B9XA 1W2BA 2D0QB 3LW5E 4A4GA 5GAMh 4FT2A 4BB7A 3FEOA 1H641 3JB9G 1I8FA 2DTOA 3DB3A 3GNGA 4A4HA 4XTZA 4ELYC 3M53A 2F69A 2MMPA 2EYQA 4KUIA 5LJ3j 5GAN5 3ZEHA 1WPYA 2JOYA 4HCZA 2K4YA 3OS0A 4J6YA 3OYMA 3M57A 3SD4A 5A0GA 1KQ1A 5GAOr 1R8OB 1YCYA 2EJFA 2YHTA 1PSFA 4ZGEB 5FU7C 2PUOB 5FU6C 3SWNC 3HFOA 5LJ3d 1Q86C 2RJFA 2Y4XA 2L8DA 4JUVA 4L5GA 1PSEA 1B34A 3I56T 1LNXA 1QVPA 4N4GA 3I55A 2HD0A 2QDYB 1YBYA 5FU6B 3HL8A 1VQOT 3SWNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CQX A;  5CKD A;  5CR2 A;  5HKC A;  3TCJ A;  3G7Z A;  1NE8 A;  4OF1 A;  1UB4 A;  3NFC A;  3VUB A;  5CK9 A;  5CKH A;  5CCA A;  4ELY C;  5DLO A;  2C06 A;  4VUB A;  5HK0 A;  1VUB A;  5HK3 A;  3JSC A;  4HKE A;  2KMT A;  4MZT A;  5CKE A;  4MZP A;  3JRZ A;  5CKB A;  5CKF A;  5CQY A;  4ME7 A;  1X75 C;  2VUB A;  4ELZ C;  3HPW A;  4MDX A;  2MF2 A;  5CO7 A;  4MZM A;  1M1F A; 
#chains in the Genus database with same CATH topology
 1VQP Q;  3GLX A;  2IG0 A;  3QDR B;  2JT4 A;  2RK1 A;  2ROL A;  3G6E T;  1LPL A;  4HCK A;  1RAE B;  1ZQ1 A;  4M75 E;  1Y07 A;  1M90 U;  3M4G A;  1RAG B;  1Q82 U;  2ZPE B;  3PE0 A;  2DK3 A;  3CPF A;  4F7U A;  5L8R E;  1N27 A;  1JXM A;  2W10 A;  1JJ2 S;  1U8R A;  2DJQ A;  3OYE A;  2K79 A;  2DD5 A;  5LJ3 f;  1UJ0 A;  3CCV A;  2KRM A;  3OMG A;  5LJ5 j;  2ZPG B;  1XQH A;  2HDA A;  3BY7 A;  5GAN 7;  1K9M U;  1RAA B;  3G4S T;  5KYU A;  4XTX A;  2EJ9 A;  1I81 A;  2H3J A;  2DYI A;  2DZ9 A;  2LCC A;  4IUU A;  2QQR A;  1SF9 A;  2OTL Q;  5GAM e;  3RKY A;  1VQ8 A;  5CR2 A;  3WVD B;  5GMK m;  3MEW A;  4WTO B;  1PHT A;  1VQP T;  2EQI A;  2RI5 A;  1K76 A;  1GBQ A;  5IAY A;  3P8H A;  2ED1 A;  1HJD A;  1QWF A;  4J7F A;  2GGR A;  2QTX A;  1WXB A;  3CCQ A;  2F5K A;  2RO0 A;  2FYK A;  1XJW B;  3IQL A;  3QBY A;  2DEU A;  3REB B;  5KYN A;  4XTY A;  4CC2 A;  2RM4 A;  1M90 R;  1Q82 R;  5I21 A;  4A53 A;  1N9S A;  1NM7 A;  4OMF B;  5CKF A;  3OYF A;  4GBQ A;  1A0N B;  3JCM h;  4BUG A;  3L1A A;  2RHX A;  1SHG A;  3I9Q A;  5GAN d;  4E7K A;  2HZY A;  1AWO A;  1KC8 R;  2ZAE A;  2DXT A;  1TUD A;  3PVL A;  1K9M R;  2OTL T;  2E3I A;  2EGE A;  2LCL A;  3I56 A;  2KEA A;  4AFZ C;  2HSE B;  2L3S A;  2A28 A;  5CKB A;  2CUB A;  2RQR A;  2JJ9 A;  5IN1 A;  2CP6 A;  3AT1 B;  1X6B A;  1B34 B;  2XD0 A;  2FL7 A;  4M75 G;  2WSF E;  5GAO q;  3JCM W;  4QQ6 A;  1BCM A;  1JRI A;  2KAF A;  2DET A;  5CCA A;  3PTA A;  3FIF A;  1QCO A;  4EMK C;  1QMC A;  2RNA A;  1X69 A;  1IZ6 A;  2K57 A;  4M78 C;  3KUF A;  5HY6 A;  1E6H A;  1MUZ A;  4F7U B;  2FZG B;  5DLQ E;  1X2Q A;  4AFQ C;  4XU2 A;  3OYG A;  3G4S A;  1QVG A;  1JEG A;  1S72 Q;  1LOJ A;  2D9T A;  2YRC A;  2DIQ A;  3FB9 A;  2E64 A;  5D6W A;  3CC4 Q;  4MDX A;  2JM8 A;  3NGP A;  1UUE A;  1K8A C;  3CXC P;  2NWM A;  2GFA A;  4C92 F;  1U06 A;  1T0H A;  4X9D A;  3THK A;  1LJO A;  1TSF A;  4A4K A;  3X28 B;  1Q81 U;  3OQ5 A;  2DX1 A;  2RI3 A;  3QG1 A;  4IUP A;  2JTE A;  2ZPB B;  2QEX Q;  3INZ A;  4MML A;  3UT1 A;  4J6X A;  1WHM A;  1OV3 A;  1BCO A;  4ELZ C;  4PJM A;  4PFO A;  4Y91 A;  1M8M A;  3VV0 A;  4PLL A;  1IGU A;  3OS2 A;  2DEQ A;  2LJ3 A;  3CD6 Q;  2GQI A;  1OYX A;  4IUV A;  3REA B;  2A08 A;  4XAX B;  2CZ6 B;  2RA2 A;  1JB0 E;  1S72 T;  4K11 A;  3CXC S;  1R0B G;  5IHI A;  5GAM d;  1HXD A;  4OB2 B;  4X9C A;  2KRS A;  3DLL A;  3CC4 T;  2GF7 A;  1NPP A;  3M0U A;  2X35 A;  4F7U G;  4LDX A;  5HKC A;  1VQK Q;  1D1A A;  2LMJ A;  2DL3 A;  1HK9 A;  2E6Z A;  3L42 A;  4OML A;  1PRM C;  3M9Q A;  1Y0M A;  1I4K 1;  2XU8 A;  4HKE A;  3RKX A;  4C8Q D;  4OB1 B;  3HRU A;  4R0K A;  2KGT A;  4M78 E;  2QEX T;  2M9U A;  3EHR A;  3DLM A;  1N6A A;  2EIF A;  1AZG B;  2J06 A;  1SG5 A;  2DLP A;  3AHU A;  2C0I A;  1NZ9 A;  2QQS A;  1KQS P;  1Q81 R;  1YWP A;  4E7I A;  4LUD A;  1MNE A;  1W6X A;  1ZUY A;  4HVV A;  3CCJ Q;  2KVQ G;  2VXF A;  2VB6 A;  1C6V X;  2NUT B;  3CD6 T;  5GAN h;  2RPN A;  2ENM A;  3BW1 A;  5IXB A;  1QVF A;  1UGR B;  4GLM A;  4EMK B;  2DD4 A;  2E6N A;  3CCU Q;  1CKA A;  1WI7 A;  4M78 B;  1WHJ A;  4FYV B;  2YWW A;  5FRM A;  1GXI E;  1NLP C;  1O9S A;  1I1J A;  3OY9 A;  1VQK T;  1K4U S;  2SRC A;  4CRI A;  1M2O A;  3L2W A;  1NEG A;  2CT4 A;  1Q86 U;  1NBE B;  2FZK B;  1MV0 B;  2QA4 A;  2DTI A;  1T0J A;  1KQS S;  3H9N A;  3RER A;  2EYZ A;  1ABQ A;  4Q5W A;  3JCM V;  1ACM B;  2F1L A;  3CC7 Q;  1N9R A;  2EGC A;  3ME9 A;  2JS2 A;  2QI2 A;  4BY6 C;  2ZPI B;  4C8Q A;  4ESR A;  3RMQ A;  2ATC B;  4XU0 A;  3CBP A;  3CCJ T;  4OGC A;  2YLC A;  4P5N A;  1VQ7 Q;  3F70 A;  3QWY A;  3C0C A;  3M0R A;  2MPX C;  2M16 A;  2L89 A;  2RQV A;  4XU3 A;  5A0L A;  3HHT B;  1S72 A;  5DY9 A;  1QVG S;  3CCU T;  3LWI A;  1JU5 C;  2LT4 A;  2A36 A;  1G8X A;  1M3C A;  1V76 A;  2DTH A;  1YIJ A;  1K73 U;  2JS0 A;  3PGG A;  1X6G A;  3SB2 A;  4LDV A;  3CC4 A;  1UGQ B;  4N0A C;  1AT1 B;  2VYT A;  4JZ3 A;  3U23 A;  4WF2 A;  5CQY A;  2RQU A;  5LJ5 g;  4RTT A;  1KG1 A;  2KBT A;  4O5V A;  2NLU A;  1ZBJ A;  3M56 A;  3QJ6 A;  2XDD A;  1KJW A;  1SHF A;  4OB3 B;  4NL3 A;  1FXX A;  1QCN A;  4M78 G;  3CC7 T;  1NE8 A;  4M7A F;  1QKW A;  2CKK A;  4JRP A;  1PD0 A;  3PIO A;  3CEY A;  1Q86 R;  2R5A A;  1WIE A;  3RDV A;  4M7D D;  3UF4 A;  2C0T A;  1GFC A;  2DL5 A;  3MP1 A;  4NL2 A;  2LT1 A;  4QQG A;  1IHV A;  3RMS A;  1VQ7 T;  1FMK A;  3CCL Q;  2VWF A;  4D6W A;  2DL8 A;  3CBM A;  2KYM A;  4B9X A;  3LW5 E;  2B86 A;  5GAM h;  4FT2 A;  3FEO A;  2NUP A;  1I8F A;  2DTO A;  3DB3 A;  4XTZ A;  5KYW B;  2EYQ A;  5GAN 5;  3CCR Q;  1K9A A;  4HCZ A;  4PFP A;  2EJF A;  4ZGE B;  5FU7 C;  2PUO B;  5FU6 C;  3O5Z A;  3EG3 A;  1QVF P;  1RLP C;  1B07 A;  4N4G A;  2OTJ Q;  1OX8 A;  4J9C A;  1K73 R;  4BDY A;  2FPD A;  2K3Y A;  3P8D A;  3BE3 A;  1VQ6 Q;  1GCQ A;  1N8R U;  2QDL A;  1AWX A;  1TWB A;  4FSX A;  3P8B B;  2DKG A;  1WX6 A;  5D6Y A;  2A37 A;  5GAN 2;  3I5R A;  4E2F B;  2L3R A;  1X43 A;  1YN8 A;  3OSV A;  1LVK A;  4AG1 C;  1OEB A;  5LJ3 g;  2DF6 A;  3ZBD A;  3V7R A;  3CCL T;  4M7D A;  1N5Z A;  4QT7 A;  2HBP A;  1QVF S;  5IHN A;  5D6X A;  4C92 C;  1PM3 A;  2FRW A;  1NJI C;  4BY6 B;  1AD5 A;  3CCS Q;  3A98 A;  5D7U A;  2I0N A;  3OSS C;  1PG5 B;  3CCR T;  2GTJ A;  2A7Y A;  2V8K A;  2X3X D;  4XK8 E;  1QWE A;  1EZZ B;  5HK0 A;  2PQW A;  4OMP A;  3FJP A;  1X27 A;  3H0F A;  2OTJ T;  2CYZ B;  2FEI A;  2P0Q A;  1EFN A;  1TTH B;  1OOT A;  1C1A A;  2J7I A;  2DVE A;  1VQ6 T;  2X4W A;  2HQX A;  2O2O A;  1Q95 G;  1YJN Q;  1VIF A;  2DIG A;  5LJ5 f;  4J8O A;  3VRZ A;  1BI2 A;  1YJW Q;  1YNZ A;  1YIT A;  1WNL A;  1IO6 A;  3CMA A;  2RB6 A;  1N8R R;  2OX7 A;  2DM1 A;  5I22 A;  4LE9 A;  1TS9 A;  2XIC A;  4QVC A;  4J9D A;  2HEQ A;  3CPW P;  4J9H A;  3M59 A;  3CQT A;  1TUC A;  2KY9 A;  1K1Z A;  5GAN j;  2X4J A;  2MI6 A;  4JRI A;  3CCS T;  1I5O B;  3OS1 A;  1UE9 A;  3MO8 A;  4KUD K;  2PU9 B;  2ED0 A;  4X34 A;  3VUZ A;  1Y96 A;  3MJX A;  3M4Y A;  3PT9 A;  4C5H A;  3I55 Q;  4GLK A;  1NYG A;  2AHJ B;  2BKD N;  4FT4 A;  3EG9 B;  4J83 A;  4FSS A;  5GAO l;  4FYY B;  2VXE A;  2L3P A;  4DBF A;  3JCM P;  5CVI A;  1G3T A;  4LDU A;  1WZO A;  1Y57 A;  1BBZ A;  1M5Q 1;  3HRS A;  3VKI A;  5LL6 S;  2CH4 W;  3NPF A;  3CPW S;  5FU7 B;  2L0A A;  1Q7Y C;  1YJN T;  4RCC A;  1IXD A;  2E4H A;  3M0T A;  2JXB A;  5GMK i;  1YJW T;  4HCB A;  2VVK A;  1M9S A;  4PJO D;  4HXJ A;  4QVD A;  2P0K A;  4C92 E;  4KH0 B;  4N4H A;  3PMT A;  5FW9 A;  1Y7X A;  4RUG A;  4O6J A;  3HKS A;  4J9B A;  2DIL A;  3JCM c;  3C4S A;  4X1V A;  3M5A A;  4M7D B;  2QGF B;  2GBQ A;  2LP5 A;  2QYZ A;  4Z8A A;  3I55 T;  2M0Y A;  3TU4 K;  1KC8 U;  2C06 A;  3R6N A;  4M7A D;  1U1T A;  1PC0 A;  4E47 A;  4C8Q F;  1VQ4 A;  1UGV A;  4J9E A;  3JRZ A;  5EG2 A;  3VS2 A;  2OTJ A;  4PJL A;  2EYW A;  4C92 B;  3EHQ A;  2FG0 A;  1ZUU A;  3CXC A;  1R77 A;  4JRQ A;  4FYX B;  2DRK A;  2IPO B;  2MF2 A;  4ANJ A;  2CZ1 B;  1VQ6 A;  3PNW C;  2K3X A;  5IXF A;  4MMK A;  3A8L B;  2K6D A;  4BE0 A;  2MOX A;  3LH0 A;  3H8Z A;  2KNB B;  3LLR A;  4RKU E;  4NOY A;  3L2Q A;  2HL5 C;  2AKK A;  1MV3 A;  4RCB A;  3RNJ A;  2XI9 A;  4PJO A;  1YFN A;  2HCK A;  2LJ0 A;  2P4R A;  4DEX A;  1SEM A;  1YCS B;  3CCS A;  3GNF B;  2E1H A;  3S6W A;  3CCM A;  5GAM j;  1MGQ A;  3DKM A;  1H3H A;  1M1K C;  1B7T A;  3VYG A;  4E7L A;  4QKU A;  1ZHI A;  2AK5 A;  2RHU A;  2DAQ A;  4IUQ A;  1IRX A;  2MIO A;  4ZGJ B;  2K2M A;  4M7A A;  5L23 A;  2M51 A;  2BE7 D;  5KYX A;  5LJ3 e;  3KXT A;  2M0O A;  1OU8 A;  1XTD A;  4HVW A;  1VQM Q;  1UGP B;  1YJN A;  1JQQ A;  2E10 A;  1FX7 A;  4F7U E;  1YJW A;  3VRY A;  2YXY A;  2LX9 A;  3A8H B;  3G6E A;  1X2K A;  2DXC A;  2CP2 A;  2K7A A;  1G3S A;  1KQS A;  4C92 G;  3NTI A;  4BDZ A;  1EIF A;  2YUP A;  4QW2 A;  4ORZ A;  3QSU A;  3SDZ A;  2P0P A;  1D0X A;  3JCM J;  4R55 A;  4KUL A;  3TSZ A;  3I35 A;  2L3Q A;  4QVZ A;  2F2V A;  3SWN A;  4KRT A;  4C5G A;  1V29 B;  2DE0 X;  3TCJ A;  1GBR A;  2LZ6 B;  1JO8 A;  1WHL A;  2RHY A;  2DXB A;  2X9H A;  5GJW B;  2EQU A;  3HFN A;  4M7D F;  1BIB A;  2RQW A;  1U1S A;  5FLX E;  1VQM T;  5KYU B;  1UEB A;  2YUQ A;  4M77 D;  2YDL A;  1OI1 A;  1E6G A;  3VS4 A;  1VQP A;  3NTH A;  3UA6 A;  1PNJ A;  2DYB A;  3JB9 F;  4RMO A;  3E2U A;  1K73 C;  3E1S A;  4BAC A;  3MHX A;  4LD6 A;  4RTZ A;  4ZN3 A;  5LJ5 d;  2XKO C;  2RJC A;  2ROT A;  2RHI A;  5ECA A;  3ZL7 C;  1YP5 A;  1WA7 A;  4QQD A;  2F5T X;  2AZV A;  1W1F A;  2ECZ A;  5KCO A;  3CME T;  2GFU A;  4C0G A;  2EQJ A;  2J6O A;  2E70 A;  1SRM A;  2D1X A;  3JB9 J;  5GMK l;  4OP0 A;  1VA7 A;  3I5S A;  3PIP A;  2KYB A;  3O8V A;  3MEV A;  1SPK A;  3BFM A;  3MKD A;  3JCM Q;  1PD1 A;  4J9I A;  3QO3 A;  1X75 C;  2OTL A;  2JTM A;  2RMO A;  3EGX A;  1WJQ A;  2ESW A;  4M7A B;  4FM4 B;  2WSE E;  1KHC A;  1PCX A;  1TU0 B;  1I5L A;  3M58 A;  3H6Z A;  4M77 A;  4RTW A;  4KBM B;  3HSB A;  2BE9 B;  3OYH A;  5I11 A;  1YI2 Q;  3TSW A;  2KDS A;  3EAE A;  2EWN A;  2XK0 A;  1PKT A;  2RK2 A;  3JCM f;  3V7C A;  2K5F A;  2V1R A;  1I0C A;  1RAI B;  3EFO A;  2YUN A;  1W2B P;  2JM9 A;  1H64 1;  1VQN Q;  3M53 A;  2F69 A;  2MMP A;  4IIO A;  3ZEH A;  3OS0 A;  3EG0 A;  3OYM A;  5A0G A;  1KQ1 A;  1R8O B;  2V26 A;  2DNU A;  4CC3 A;  1QKX A;  5LJ3 d;  4A63 B;  4JUV A;  2Y4X A;  2KRO A;  1UEC A;  1EX4 A;  1VQO T;  3SWN B;  3LGF A;  3A8O B;  2JTF A;  3J80 E;  3CCE Q;  2BIV A;  2YSQ A;  1ZSZ A;  1SSF A;  2PZ1 A;  2OAW A;  2HMA A;  4XTU A;  1YI2 T;  1W2B S;  1UJY A;  5A0D A;  3MCA B;  2DVJ A;  4C8Q C;  5GAN 4;  1SRL A;  4MDW A;  1KD1 C;  4ZNX A;  4ZTJ A;  2DPP B;  1GRI A;  4AFS C;  3VS3 A;  2PTK A;  3LGL A;  4M7A G;  1RI9 A;  2DL4 A;  4B9W A;  2CDT A;  5AYF A;  2M02 A;  3MPU B;  5I2S A;  2BZ8 A;  1KFZ A;  4RTV A;  1VQN T;  4PK4 A;  2QXF A;  2DFU A;  3A5Z B;  1WJS A;  2O01 E;  1DJ7 B;  3OYD A;  2XHC A;  4FW1 A;  1KK7 A;  1NEB A;  2QG9 B;  1ZBX A;  2C0O A;  1YHQ Q;  1G2B A;  1D3B A;  2X3W D;  4PJO F;  4E6R A;  3RES A;  3CCE T;  1KSW A;  4F16 A;  2L5Q A;  1FWZ A;  2ZCF B;  1T3S A;  1O75 A;  1VQ5 Q;  3QYG B;  3QZ5 B;  1K8A U;  3A1P A;  2YT6 A;  3UA7 A;  1BB9 A;  4JPB W;  4OGE A;  1C0M A;  3UDC A;  1NPR A;  4RG2 A;  3L2Z A;  4JZ4 A;  3C95 A;  5CK9 A;  4BI8 B;  3CPW A;  2HQH A;  3VU3 C;  2QEX A;  1RAB B;  2QGG A;  2RF0 A;  2MYS A;  2PNI A;  2JMA A;  1IGQ A;  3URG A;  3BDL A;  3A8G B;  1YJ9 Q;  4LUE A;  2KT8 A;  3SEM A;  4LD9 K;  4FYW B;  1H8K A;  4BE1 A;  3CD6 A;  3RKW A;  1GL5 A;  5GMK e;  3LYI A;  1WQW A;  5GAO m;  1TOV A;  4A4E A;  2FO0 A;  2CP7 A;  2RQT A;  2VGM A;  2R58 A;  3JB9 D;  2JNG A;  1YHQ T;  1ZA2 B;  4JJB A;  2FB7 A;  3VS0 A;  3L2R A;  2G3R A;  2Y90 A;  2R57 A;  4MZP A;  1M1G A;  2VC8 A;  1M90 C;  4E7S A;  1Q82 C;  3ZFJ A;  2JN0 A;  3PVQ A;  2DBM A;  3HPW A;  2F2W A;  1ABO A;  1WHK A;  2V8I A;  1VQK A;  2QQA A;  1GCQ C;  4C8Q E;  1VQ5 T;  4M75 D;  4Y28 E;  2G6F X;  2FZC B;  1GCP A;  1OPL A;  3TEE A;  1G83 A;  1VYU A;  2EGA A;  5GAN f;  3KBG A;  3V8K A;  3CCV Q;  5FWC A;  4WCI A;  1KC8 C;  1BIA A;  1M2V A;  1ZSZ B;  8AT1 B;  3OBY A;  1M8V A;  1K9M C;  4MZT A;  1WYX A;  1K8A R;  1KIK A;  1JXO A;  4XTW A;  4LDY A;  4ZTF A;  3OA6 A;  1YJ9 T;  4HT9 A;  2M1H A;  4M7D C;  3RIR A;  2MK5 A;  2O31 A;  2RN8 A;  3CCJ A;  2JUF A;  5LJ3 h;  4AT1 B;  2NYS A;  4C8Q B;  4Z02 A;  3MEU A;  4J5Y A;  4ATO A;  1BI0 A;  2COZ A;  1V1C A;  2PUK B;  3CCU A;  3X20 B;  1Z9Z A;  2RJD A;  1D0Z A;  5IH2 A;  2PVO B;  4OMN A;  1SKU B;  1QW1 A;  2AT1 B;  1UDL A;  3CCQ Q;  1UHC A;  1WHH A;  3OW2 P;  3X25 B;  2K2V A;  2FRY A;  4LN2 A;  2O4X A;  1WLP B;  3MP8 A;  1D3B B;  2NUZ A;  4PLI A;  4DA4 A;  1IRE B;  3QYH B;  4E7H A;  3CCV T;  2HAX A;  4L59 A;  1M27 C;  3JB9 I;  4M75 A;  4BE2 A;  3VJP A;  2JW4 A;  2I2L A;  5CIU A;  5GAN 3;  4DQ2 A;  4EDU A;  3CC7 A;  4JJN K;  1UGS B;  3DB4 A;  1MND A;  4MZM A;  3M54 A;  3MEA A;  3L2U A;  3G7Z A;  1QP2 A;  1LCK A;  1IB8 A;  2RHZ A;  3VYH B;  1VQ7 A;  3QJY A;  1D09 B;  3TRE A;  2X4X A;  4M77 F;  3OYC A;  4R56 A;  1AWW A;  2P4T A;  3OW2 S;  3FDR A;  2ABL A;  3A8M B;  5CAI A;  2LJ1 A;  1BU1 A;  2RJE A;  1RI0 A;  1OU9 A;  3G1J A;  1NYF A;  4OMM A;  3CCQ T;  2NUP B;  3JB9 H;  2X51 A;  2HL3 A;  2LVM A;  2D8J A;  4C8Q G;  1IHW A;  2LCS A;  4KT0 E;  3E19 A;  5KE3 A;  2A3L A;  2X4Y A;  4M7D E;  5GAM f;  1M1F A;  2GNC A;  3JAM E;  2KQW A;  2XG8 D;  4HCC A;  4FIB A;  4PL6 A;  1YJ9 A;  3OYY A;  1JJ2 P;  1M2V B;  3ULR B;  2HSP A;  1AHJ B;  3CCL A;  2EKH A;  2EKO A;  4TVR A;  4E7Z A;  1RLQ C;  1MHN A;  1MMA A;  1F1B B;  1UHF A;  2RI2 A;  2EPD A;  3JCM X;  2J05 A;  5LJ5 e;  2LC4 A;  1KHI A;  3V7S A;  3X26 B;  1BKB A;  1OUL A;  2JVV A;  1WHG A;  2P84 A;  4XU1 A;  4OB0 B;  3CCR A;  4IKF A;  5DLO A;  1NG2 A;  1Q81 C;  2EBP A;  3FJ5 A;  2EFI A;  1QP3 A;  3MP6 A;  3M0P A;  4DEY A;  2EVR A;  2LQN A;  2H3E B;  2QAZ A;  7AT1 B;  1VYV A;  2O4X B;  3H41 A;  2CT3 A;  1ZX6 A;  2GQV A;  1CSK A;  2EYX A;  2E5Q A;  3JSC A;  2EAY A;  3OS5 A;  2CRE A;  1OZ2 A;  2E65 A;  4KGZ B;  4M75 B;  4PJO C;  1G5V A;  2COY A;  3JV3 A;  1W4S A;  4OF1 A;  9ATC B;  2LDM A;  2CP5 A;  4CC4 B;  1PKS A;  3VUB A;  1UG1 A;  4JS4 A;  3FLG A;  1NJI U;  2O88 A;  2EQK A;  2HQE A;  1FYN A;  5GAN 8;  3HTR A;  2EYY A;  3EFR A;  4PFZ A;  4M7A C;  3NTK A;  4F17 A;  1WFW A;  3OYN A;  2DMO A;  4FL6 A;  3VS6 A;  1Y96 B;  1PWT A;  2MCN A;  2LNV A;  3C12 A;  4UC4 A;  3OYL A;  4M78 D;  2CSI A;  1ZLM A;  1VOM A;  4LNP A;  4M7D G;  2KMT A;  3FC3 A;  4A54 A;  2YRD A;  3ER0 A;  4ZN1 A;  3JCM g;  3HP9 A;  2QK0 A;  4CC7 A;  2LQK A;  2DJZ A;  1UFF A;  2ZPF B;  2J6F A;  2O9V A;  1W2B A;  2HBW A;  5EC7 A;  2LX7 A;  4RTU A;  3JB9 G;  4IIM A;  4KUI A;  5LJ3 j;  1WPY A;  2K4Y A;  4JJC A;  3M0S A;  3M57 A;  3SD4 A;  2DER A;  1YCY A;  2YHT A;  1PSF A;  5KYY A;  2Z0W A;  3H0H A;  3SWN C;  1Q86 C;  4L5G A;  1LNX A;  1QVP A;  2QA4 Q;  1ZSG A;  3CME Q;  3I55 A;  2JMC A;  1FMW A;  1YBY A;  2IIM A;  1NJI R;  5CKH A;  2NUT A;  4J6W A;  2EW3 A;  1VQL Q;  5KCH A;  2SEM A;  2QAS A;  2KRN A;  2OAU A;  1M3B A;  4C5I A;  4EMK A;  3OB9 A;  1VIE A;  1D1B A;  2E5K A;  2FPF A;  2W0Z A;  2A0F B;  2LQW A;  4PJO E;  4Y92 A;  1VQ9 Q;  2KK4 A;  2V8J A;  4M78 A;  4II1 A;  1Q7Y U;  1P92 A;  5GMK h;  3CBO A;  2D0N A;  4EPC A;  4J7I A;  2COW A;  4C5E A;  4YTL A;  3G71 Q;  1YIJ Q;  3SHW A;  1WDX A;  3QWX X;  2K5L A;  2KXC A;  2K5I A;  4PNO A;  2B8A A;  4M7A E;  4M75 F;  2O9S A;  3GBQ A;  3V8L A;  1BK2 A;  4PJO B;  1BI3 A;  4RTX A;  2QA4 T;  3WXM B;  2XDP A;  2VAS A;  2ZPH B;  4JLI A;  1PRL C;  3QUI A;  5GAN 6;  3R6O A;  2DO3 A;  1VQL T;  2VGN A;  3EGU A;  3QDF A;  1VQO Q;  1J3T A;  4M77 C;  1VQ9 T;  2V1Q A;  4LDW A;  3D7S B;  3QII A;  1AEY A;  3S3O A;  5KYX B;  2L2P A;  3GP8 A;  1QLY A;  3WVE B;  5A2Q E;  4FCY A;  4N4I A;  1QQJ A;  4KGV B;  3GIB A;  3G71 T;  1YIJ T;  1G3W A;  1H3Z A;  1T3L A;  4DOW A;  3GOX A;  1Q7Y R;  2ZGW A;  2CZ7 B;  3QKJ A;  6AT1 B;  1M4Z A;  4J9G A;  4HT8 A;  3VS1 A;  2CH4 A;  2LRQ A;  1U5S A;  4DBH A;  4CI0 C;  3NFC A;  2CUD A;  1M1K U;  1N8R C;  1K0S A;  5J39 A;  3MET A;  5KYY B;  4DBR A;  4NS5 A;  2VUB A;  3QXE B;  2K3B A;  2E41 A;  5KE2 A;  3T9N A;  1BYM A;  2LQ8 A;  1E7O A;  3OYJ A;  1D0Y A;  3CC2 Q;  3LWH A;  1XNI A;  1ZSZ C;  2QQ9 A;  5GAN g;  4PJO G;  1VQM A;  3QZ9 B;  5KYW A;  1XOV A;  4D8D A;  2JZ2 A;  4F04 B;  3HRT A;  4C0Z A;  5GAO p;  3ASK A;  4BD3 A;  2BUD A;  4FW2 A;  4PKC C;  3GF5 A;  3EGD A;  1R0C B;  4F7U F;  5CQX A;  3LX7 A;  4DOV A;  5KH6 A;  1BI1 A;  1QVG P;  2MAM A;  2LNH B;  1B3Q A;  2YLB A;  5HK3 A;  4FU6 A;  2PVG B;  3M55 A;  3CME A;  4V2S A;  4XTV A;  2J6K A;  1U3O A;  3JCM e;  4XQ3 A;  4L6V 5;  5DM7 R;  3UPU A;  2AIR B;  4BI3 A;  4IUR A;  3S3M A;  1ARK A;  3OW2 A;  2DZC A;  3JCM b;  2DXU A;  4M77 E;  5C6S A;  1X01 A;  2EJG A;  1VQL A;  1M1K R;  1WQ7 A;  5J26 A;  3VS7 A;  1YIT Q;  3CC2 T;  1RAF B;  5GAO n;  3CMA Q;  1M30 A;  1VQ9 A;  2KXD A;  1S1N A;  4JS5 A;  3QHS A;  5GAO r;  3X24 B;  4EIK A;  3UWN A;  3SFM A;  1OPK A;  1KQ2 A;  3QPH A;  5CO7 A;  2OJ2 A;  2CZ0 B;  5LJ5 h;  4HVU A;  3EGX B;  4GY5 A;  2D8H A;  4OMQ A;  3G71 A;  1CKB A;  2RD1 A;  4C0D C;  4M77 B;  2CP3 A;  5M9O A;  2YUO A;  3M0Q A;  3OYB A;  2BTT A;  2KE9 A;  1AVZ C;  2R5M A;  2YRV A;  4EMH A;  2AZS A;  3OYK A;  4N0A A;  2KSS A;  4HA8 A;  1H92 A;  2KI7 A;  1WXU A;  4JLG A;  4JDS A;  4A4F A;  1RUW A;  1RL2 A;  3RR6 A;  3C94 A;  3EFO B;  3S3N A;  4KH1 B;  2K9G A;  2XDB A;  3KFV A;  4OMO A;  3RUX A;  1HYO A;  4BI4 A;  4F14 A;  1YIT T;  3EG1 A;  3CMA T;  1VQO A;  3RBB B;  4PJN A;  8ATC B;  3OBW A;  1NLO C;  1K0X A;  3GPL A;  5GAM g;  1MMG A;  4EMG A;  2BZY A;  3J7A F;  2HNI A;  2D6F A;  2F2X A;  4C92 D;  2MWP A;  4B6M A;  1WGS A;  3EG9 A;  1JJ2 A;  1YI2 A;  5GMK j;  1VUB A;  4AFU C;  1HSQ A;  2E3H A;  4OVA A;  4RTY A;  2KR3 A;  1VQ4 Q;  4M4Z A;  1VYT A;  2KT1 A;  2VV5 A;  4D8K A;  4ZGD B;  4RG8 A;  3BDU A;  1TXQ A;  2DA9 A;  3EGD B;  1VQN A;  1RAC B;  4M78 F;  1AWJ A;  1Z9Q A;  1VQ8 Q;  4VUB A;  4J9F A;  1G3Y A;  5HCK A;  3EH2 A;  2FVU A;  2H8H A;  2IVW A;  2ZZD A;  5FRO A;  1TG0 A;  3H0I A;  4M77 G;  2GCX A;  2EQM A;  2CS7 A;  5GJV B;  5IT9 E;  3CC2 A;  5IHK A;  1FMV A;  2RH2 A;  1Y71 A;  2CGH A;  3PMI A;  2BZX A;  2MWO A;  3N5B B;  3CCE A;  5J3B A;  1UB4 A;  4Z88 A;  4JRK A;  3NMZ C;  1HD3 A;  4M75 C;  3FRN A;  2DBK A;  2LTO A;  1WXT A;  2GTO A;  5I2M A;  3VS5 A;  3CCM Q;  3TQ7 P;  2HKQ B;  3E9F A;  1AZE A;  4AMC A;  4C92 A;  3Q1J A;  3EFS A;  3OMC A;  2FHD A;  3L2V A;  1KD1 U;  1VQ4 T;  3UAT A;  2DRM A;  3PFS A;  2OI3 A;  1X6O A;  3E9G A;  2WAC A;  2FPE A;  1SSH A;  1GFD A;  1TUG B;  3TVT A;  5GAN e;  1OQK A;  1D1C A;  3JCM d;  4LXC A;  1VQ8 T;  4Z89 A;  3I56 Q;  2CSQ A;  4ME7 A;  4C0D B;  2E12 A;  2PVD B;  1WJR A;  2XMF A;  4IUT A;  2XID A;  1YHQ A;  3G6E Q;  1OZ3 A;  3V8J A;  4C0F A;  5CKD A;  3J81 E;  4E7J A;  1W70 A;  4PJJ A;  5AT1 B;  2QTV A;  3OYI A;  4AG2 C;  3EG2 A;  2DL7 A;  5FRN A;  2Y4Y A;  1JBM A;  1VQ5 A;  1MMN A;  5CKE A;  2VKN A;  4JJD A;  5FWB A;  1TH7 A;  3OYA A;  1OX9 A;  3CCM T;  5C0M A;  2CP0 A;  2QQB A;  2WSC E;  1ZA1 B;  1MMD A;  2D0Q B;  4A4G A;  1AOJ A;  4BB7 A;  1M3A A;  3EH1 A;  2HKN A;  1RAD B;  3GNG A;  4A4H A;  4ELY C;  3G4S Q;  1YWO A;  2JOY A;  4J6Y A;  1RAH B;  1UTI A;  1KD1 R;  1ZUK A;  3HFO A;  1QCF A;  3LH5 A;  4DBQ A;  2RJF A;  2L8D A;  1PSE A;  1B34 A;  2AKL A;  3I56 T;  3NHN A;  2HD0 A;  2QDY B;  5FU6 B;  3HL8 A;  4KGX B;  1I07 A; 
#chains in the Genus database with same CATH homology
 4BDY A;  3GLX A;  3LGF A;  2IG0 A;  3QDR B;  3A8O B;  2K3Y A;  3P8D A;  2RK1 A;  3G6E T;  5CKH A;  2JTF A;  4J6W A;  3J80 E;  1N8R U;  1ZQ1 A;  2BIV A;  4FSX A;  4M75 E;  1SSF A;  1Y07 A;  5KCH A;  3P8B B;  2DKG A;  3M4G A;  1M90 U;  5D6Y A;  1Q82 U;  2OAU A;  2ZPE B;  4EMK A;  4C5I A;  2DK3 A;  3OB9 A;  5GAN 2;  1VIE A;  4XTU A;  1YI2 T;  2L3R A;  1W2B S;  4PJO E;  3CPF A;  2KK4 A;  3OSV A;  5L8R E;  2V8J A;  3MCA B;  4M78 A;  1N27 A;  4II1 A;  4C8Q C;  5A0D A;  5GAN 4;  1P92 A;  1Q7Y U;  5LJ3 g;  1JJ2 S;  4MDW A;  1U8R A;  1KD1 C;  3OYE A;  4ZTJ A;  2DD5 A;  5LJ3 f;  3ZBD A;  2DPP B;  3V7R A;  3CCL T;  5GMK h;  3CCV A;  4M7D A;  3CBO A;  3LGL A;  3OMG A;  5LJ5 j;  4M7A G;  2ZPG B;  4B9W A;  5AYF A;  2HBP A;  1XQH A;  4J7I A;  4EPC A;  5I2S A;  4C5E A;  1QVF S;  3BY7 A;  4YTL A;  5GAN 7;  1K9M U;  5D6X A;  4C92 C;  1NJI C;  4BY6 B;  1VQN T;  3OSS C;  3G4S T;  2K5L A;  3CCR T;  2QXF A;  2A7Y A;  2V8K A;  4XTX A;  2EJ9 A;  2K5I A;  1I81 A;  4PNO A;  3A5Z B;  1WJS A;  2O01 E;  2H3J A;  2B8A A;  4M7A E;  1DJ7 B;  2DZ9 A;  2LCC A;  4XK8 E;  3OYD A;  4IUU A;  2XHC A;  4M75 F;  2QQR A;  3V8L A;  5HK0 A;  2PQW A;  4PJO B;  5GAM e;  1BI3 A;  3RKY A;  3FJP A;  5CR2 A;  2QA4 T;  1VQ8 A;  3WVD B;  5GMK m;  2OTJ T;  2CYZ B;  1ZBX A;  3WXM B;  1D3B A;  2XDP A;  3MEW A;  4PJO F;  1VQP T;  2P0Q A;  2ZPH B;  4JLI A;  3RES A;  2RI5 A;  2DVE A;  1VQ6 T;  5IAY A;  3QUI A;  3CCE T;  3P8H A;  2L5Q A;  5GAN 6;  3R6O A;  1FWZ A;  2X4W A;  2ZCF B;  2DO3 A;  2HQX A;  1VQL T;  1O75 A;  4J7F A;  2VGN A;  3QYG B;  2QTX A;  3QZ5 B;  1K8A U;  3CCQ A;  2F5K A;  1VIF A;  2FYK A;  2DIG A;  2RO0 A;  5LJ5 f;  4J8O A;  1BI2 A;  4OGE A;  3QBY A;  4M77 C;  1VQ9 T;  4LDW A;  3UDC A;  1NPR A;  4RG2 A;  1YIT A;  1WNL A;  3L2Z A;  3QII A;  3CMA A;  2RB6 A;  3S3O A;  3C95 A;  4XTY A;  5CK9 A;  2RM4 A;  4BI8 B;  3CPW A;  2XIC A;  3GP8 A;  3VU3 C;  2QEX A;  4QVC A;  3WVE B;  5A2Q E;  4N4I A;  3URG A;  3M59 A;  4A53 A;  5I21 A;  3BDL A;  3A8G B;  3GIB A;  1N9S A;  4OMF B;  3G71 T;  2KY9 A;  1G3W A;  1YIJ T;  5GAN j;  1H3Z A;  2X4J A;  2MI6 A;  4JRI A;  5CKF A;  4DOW A;  3OYF A;  3GOX A;  3CCS T;  2ZGW A;  2CZ7 B;  3QKJ A;  3OS1 A;  3MO8 A;  1M4Z A;  4KUD K;  4LD9 K;  2PU9 B;  3JCM h;  4X34 A;  3VUZ A;  4BUG A;  3L1A A;  1Y96 A;  2RHX A;  3M4Y A;  4BE1 A;  3PT9 A;  4HT8 A;  3RKW A;  4C5H A;  5GAN d;  4E7K A;  3CD6 A;  2LRQ A;  3LYI A;  1WQW A;  5GMK e;  5GAO m;  4A4E A;  4GLK A;  4CI0 C;  2AHJ B;  2DXT A;  3NFC A;  2BKD N;  4FT4 A;  2OTL T;  4J83 A;  5GAO l;  2VGM A;  2VXE A;  2R58 A;  2LCL A;  3JB9 D;  3I56 A;  2JNG A;  1YHQ T;  1M1K U;  3JCM P;  2FB7 A;  5CVI A;  1G3T A;  1N8R C;  5J39 A;  3MET A;  4LDU A;  3L2R A;  2G3R A;  2Y90 A;  2R57 A;  4MZP A;  1M1G A;  2VC8 A;  5CKB A;  1M90 C;  1M5Q 1;  3HRS A;  1Q82 C;  3ZFJ A;  2JN0 A;  5IN1 A;  3VKI A;  4NS5 A;  2VUB A;  5LL6 S;  3HPW A;  3QXE B;  2HAX A;  1B34 B;  2XD0 A;  2E41 A;  2FL7 A;  4M75 G;  5KE2 A;  3T9N A;  2V8I A;  1VQK A;  1BYM A;  2LQ8 A;  2QQA A;  4C8Q E;  3OYJ A;  2WSF E;  4M75 D;  5FU7 B;  3CPW S;  4Y28 E;  1VQ5 T;  5GAO q;  1Q7Y C;  1YJN T;  3JCM W;  3LWH A;  4RCC A;  4QQ6 A;  1XNI A;  1JRI A;  1YJW T;  2KAF A;  2QQ9 A;  3TEE A;  5GMK i;  5GAN g;  4HCB A;  4PJO G;  1VQM A;  3QZ9 B;  5CCA A;  3FIF A;  3PTA A;  4EMK C;  5GAN f;  1M9S A;  1XOV A;  3KBG A;  3V8K A;  4PJO D;  1KC8 C;  1BIA A;  4QVD A;  2P0K A;  3OBY A;  1M8V A;  2JZ2 A;  2K57 A;  1IZ6 A;  4M78 C;  4MZT A;  3KUF A;  4C92 E;  1K9M C;  3HRT A;  4XTW A;  5HY6 A;  4C0Z A;  4LDY A;  4N4H A;  5GAO p;  4ZTF A;  3OA6 A;  3PMT A;  1YJ9 T;  4HT9 A;  1Y7X A;  3ASK A;  4BD3 A;  2BUD A;  4F7U B;  2M1H A;  4O6J A;  4PKC C;  5DLQ E;  4F7U A;  3HKS A;  4M7D C;  3GF5 A;  4XU2 A;  3RIR A;  3JCM c;  4F7U F;  5CQX A;  3OYG A;  3CCJ A;  2JUF A;  3LX7 A;  4DOV A;  3C4S A;  5KH6 A;  5LJ3 h;  3G4S A;  3M5A A;  4M7D B;  4C8Q B;  1QVG A;  4Z02 A;  3MEU A;  1LOJ A;  1BI1 A;  4J5Y A;  2D9T A;  3I55 T;  3TU4 K;  1KC8 U;  2MAM A;  2C06 A;  4ATO A;  2DIQ A;  3FB9 A;  4M7A D;  2YLB A;  1U1T A;  5HK3 A;  1BI0 A;  2E64 A;  4C8Q F;  4E47 A;  1VQ4 A;  4FU6 A;  5D6W A;  2PVG B;  2PUK B;  3M55 A;  3CCU A;  3CME A;  3JRZ A;  5EG2 A;  4V2S A;  2OTJ A;  4XTV A;  3X20 B;  2RJD A;  4C92 B;  4XQ3 A;  3JCM e;  4MDX A;  4L6V 5;  5DM7 R;  3UPU A;  3CXC A;  4BI3 A;  2PVO B;  4JRQ A;  4IUR A;  3S3M A;  2MF2 A;  2CZ1 B;  1QW1 A;  3OW2 A;  2DZC A;  2GFA A;  1K8A C;  4C92 F;  1VQ6 A;  3PNW C;  3JCM b;  2K3X A;  4X9D A;  2DXU A;  2K2V A;  3X25 B;  4M77 E;  1LJO A;  2O4X A;  4A4K A;  5C6S A;  1X01 A;  2EJG A;  3MP8 A;  1D3B B;  3A8L B;  1WQ7 A;  4MMK A;  3X28 B;  1Q81 U;  1VQL A;  5J26 A;  3CC2 T;  3OQ5 A;  5GAO n;  2RI3 A;  4PLI A;  3QG1 A;  4IUP A;  2ZPB B;  4BE0 A;  3LH0 A;  4DA4 A;  1IRE B;  3H8Z A;  3QYH B;  4E7H A;  3LLR A;  4RKU E;  3CCV T;  3INZ A;  4L59 A;  1VQ9 A;  4MML A;  4NOY A;  3QHS A;  4M75 A;  4J6X A;  3UT1 A;  3X24 B;  3JB9 I;  3L2Q A;  3VJP A;  3UWN A;  4BE2 A;  2I2L A;  5CIU A;  3SFM A;  5GAN 3;  4DQ2 A;  4EDU A;  3CC7 A;  4RCB A;  4ELZ C;  4JJN K;  2XI9 A;  4Y91 A;  1KQ2 A;  1UGS B;  3DB4 A;  3QPH A;  5CO7 A;  2CZ0 B;  3VV0 A;  5LJ5 h;  4PLL A;  4MZM A;  4PJO A;  4GY5 A;  3M54 A;  3OS2 A;  2DEQ A;  3MEA A;  3L2U A;  3G71 A;  3G7Z A;  1QP2 A;  2RD1 A;  3CCS A;  3GNF B;  1OYX A;  2E1H A;  4IUV A;  3S6W A;  3CCM A;  5GAM j;  4C0D C;  4XAX B;  2CZ6 B;  2RA2 A;  2RHZ A;  1JB0 E;  4M77 B;  3VYH B;  1VQ7 A;  5M9O A;  1MGQ A;  1S72 T;  3DKM A;  3OYB A;  1M1K C;  3QJY A;  3VYG A;  3TRE A;  2YRV A;  2R5M A;  2X4X A;  4M77 F;  3OYC A;  4R56 A;  3CXC S;  4E7L A;  4EMH A;  1ZHI A;  2P4T A;  5GAM d;  3OW2 S;  1HXD A;  3FDR A;  3OYK A;  3A8M B;  2RHU A;  4OB2 B;  2DAQ A;  4N0A A;  4X9C A;  5CAI A;  2KSS A;  4IUQ A;  3DLL A;  4HA8 A;  4ZGJ B;  3CC4 T;  2GF7 A;  1NPP A;  4M7A A;  4JLG A;  2X35 A;  4JDS A;  4A4F A;  4F7U G;  1RL2 A;  4LDX A;  3C94 A;  2RJE A;  5HKC A;  1RI0 A;  5LJ3 e;  3KXT A;  3S3N A;  2M0O A;  2E6Z A;  1HK9 A;  3CCQ T;  2XDB A;  3L42 A;  3JB9 H;  3M9Q A;  2LVM A;  1XTD A;  1I4K 1;  4C8Q G;  3RUX A;  2XU8 A;  4BI4 A;  4HKE A;  3RKX A;  1YIT T;  4C8Q D;  1UGP B;  3CMA T;  1VQO A;  4KT0 E;  4OB1 B;  1YJN A;  3HRU A;  2E10 A;  1FX7 A;  3E19 A;  4F7U E;  4M78 E;  2QEX T;  1YJW A;  3OBW A;  2LX9 A;  2M9U A;  3A8H B;  5KE3 A;  3DLM A;  1N6A A;  2A3L A;  2DXC A;  2EIF A;  3G6E A;  2X4Y A;  3GPL A;  5GAM g;  3AHU A;  1G3S A;  1KQS A;  4M7D E;  4EMG A;  4C92 G;  3J7A F;  1NZ9 A;  2HNI A;  1M1F A;  2QQS A;  5GAM f;  2D6F A;  4C92 D;  3JAM E;  3NTI A;  2MWP A;  4E7I A;  1WGS A;  2KQW A;  2XG8 D;  4BDZ A;  1JJ2 A;  4HCC A;  2KVQ G;  1EIF A;  2VXF A;  3OYY A;  4FIB A;  4PL6 A;  1YI2 A;  5GMK j;  1YJ9 A;  1VUB A;  3CD6 T;  4QW2 A;  5GAN h;  3QSU A;  4OVA A;  3SDZ A;  3BW1 A;  1QVF A;  1UGR B;  2P0P A;  3JCM J;  1AHJ B;  4EMK B;  4R55 A;  3CCL A;  2VV5 A;  2EKO A;  2DD4 A;  4KUL A;  4TVR A;  2E6N A;  4ZGD B;  4RG8 A;  3BDU A;  1MHN A;  2RI2 A;  3JCM X;  4M78 B;  5LJ5 e;  2LC4 A;  1KHI A;  4QVZ A;  3SWN A;  3V7S A;  3X26 B;  1BKB A;  2JVV A;  4C5G A;  1VQN A;  1V29 B;  5FRM A;  1GXI E;  4M78 F;  1O9S A;  4XU1 A;  3TCJ A;  4OB0 B;  3CCR A;  4IKF A;  3OY9 A;  5DLO A;  1VQK T;  4VUB A;  2RHY A;  2DXB A;  1G3Y A;  1Q81 C;  4JS5 A;  2EQU A;  3HFN A;  4CRI A;  1BIB A;  4M7D F;  2FVU A;  1U1S A;  3L2W A;  2IVW A;  2ZZD A;  5FRO A;  1Q86 U;  5FLX E;  4M77 G;  2EFI A;  2QA4 A;  1VQM T;  1UEB A;  2DTI A;  1QP3 A;  2EQM A;  2GCX A;  4M77 D;  2CS7 A;  3MP6 A;  1KQS S;  1OI1 A;  3RER A;  4Q5W A;  5IT9 E;  3JCM V;  3CC2 A;  2RH2 A;  1VQP A;  3NTH A;  1Y71 A;  2CGH A;  1N9R A;  3ME9 A;  3PMI A;  4BY6 C;  2QI2 A;  2MWO A;  3N5B B;  3CCE A;  2ZPI B;  5J3B A;  4C8Q A;  3RMQ A;  2O4X B;  1UB4 A;  4RMO A;  3JB9 F;  4JRK A;  4M75 C;  2GQV A;  1K73 C;  3E1S A;  3FRN A;  4XU0 A;  4BAC A;  3MHX A;  4LD6 A;  2LTO A;  4ZN3 A;  2E5Q A;  3JSC A;  3CBP A;  2EAY A;  5I2M A;  5LJ5 d;  3CCJ T;  3OS5 A;  4OGC A;  1OZ2 A;  2YLC A;  2E65 A;  2XKO C;  2RJC A;  4M75 B;  4P5N A;  2RHI A;  4PJO C;  3E9F A;  3F70 A;  4C92 A;  1G5V A;  3Q1J A;  3EFS A;  4QQD A;  3OMC A;  2FHD A;  3L2V A;  2F5T X;  2M16 A;  2L89 A;  4XU3 A;  1VQ4 T;  1KD1 U;  1W4S A;  3PFS A;  5A0L A;  5KCO A;  3HHT B;  1S72 A;  4OF1 A;  5DY9 A;  3CCU T;  1QVG S;  3CME T;  3LWI A;  1X6O A;  2LDM A;  3E9G A;  2WAC A;  2GFU A;  2LT4 A;  2DTH A;  4C0G A;  2EQJ A;  1YIJ A;  1K73 U;  3VUB A;  2E70 A;  3JB9 J;  5GMK l;  4JS4 A;  3FLG A;  4OP0 A;  1NJI U;  3PGG A;  2EQK A;  2HQE A;  5GAN e;  3SB2 A;  5GAN 8;  3PIP A;  4LDV A;  3JCM d;  3CC4 A;  1UGQ B;  4N0A C;  3O8V A;  2VYT A;  1VQ8 T;  3MEV A;  3BFM A;  3JCM Q;  3EFR A;  4WF2 A;  5CQY A;  4ME7 A;  4C0D B;  4M7A C;  5LJ5 g;  1KG1 A;  3QO3 A;  3NTK A;  4O5V A;  2E12 A;  1X75 C;  3OYN A;  2PVD B;  2NLU A;  2OTL A;  1WJR A;  3M56 A;  4IUT A;  3QJ6 A;  2JTM A;  4FL6 A;  2XDD A;  1WJQ A;  1Y96 B;  2XID A;  1YHQ A;  1OZ3 A;  4M7A B;  4OB3 B;  2LNV A;  4NL3 A;  1FXX A;  3V8J A;  3C12 A;  4C0F A;  5CKD A;  3J81 E;  4M78 G;  4FM4 B;  2WSE E;  4UC4 A;  4E7J A;  3CC7 T;  1NE8 A;  3OYL A;  4M78 D;  4M7A F;  1KHC A;  2CKK A;  3OYI A;  4JRP A;  1I5L A;  3M58 A;  3H6Z A;  4M77 A;  4KBM B;  3PIO A;  3CEY A;  3HSB A;  2R5A A;  3OYH A;  4M7D G;  2KMT A;  5FRN A;  2Y4Y A;  1JBM A;  3FC3 A;  2KDS A;  1VQ5 A;  4M7D D;  5CKE A;  4A54 A;  1TH7 A;  3EAE A;  3ER0 A;  3OYA A;  4ZN1 A;  3JCM g;  2EWN A;  3CCM T;  5C0M A;  2XK0 A;  3HP9 A;  3MP1 A;  2QQB A;  4NL2 A;  2LT1 A;  2WSC E;  2RK2 A;  4QQG A;  3JCM f;  3V7C A;  2LQK A;  2K5F A;  3RMS A;  1VQ7 T;  4D6W A;  3CBM A;  2DJZ A;  2ZPF B;  4B9X A;  1W2B A;  2D0Q B;  3LW5 E;  4A4G A;  5GAM h;  4FT2 A;  4BB7 A;  3FEO A;  1H64 1;  3JB9 G;  1I8F A;  2DTO A;  3DB3 A;  3GNG A;  4A4H A;  4XTZ A;  4ELY C;  3M53 A;  2F69 A;  2MMP A;  2EYQ A;  4KUI A;  5LJ3 j;  5GAN 5;  3ZEH A;  1WPY A;  2JOY A;  4HCZ A;  2K4Y A;  3OS0 A;  4J6Y A;  3OYM A;  3M57 A;  3SD4 A;  5A0G A;  1KQ1 A;  5GAO r;  1R8O B;  1YCY A;  2EJF A;  2YHT A;  1PSF A;  4ZGE B;  5FU7 C;  2PUO B;  5FU6 C;  3SWN C;  3HFO A;  5LJ3 d;  1Q86 C;  2RJF A;  2Y4X A;  2L8D A;  4JUV A;  4L5G A;  1PSE A;  1B34 A;  3I56 T;  1LNX A;  1QVP A;  4N4G A;  3I55 A;  2HD0 A;  2QDY B;  1YBY A;  5FU6 B;  3HL8 A;  1VQO T;  3SWN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...