3G7ZA

Ccdb dimer in complex with two c-terminal ccda domains
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
101
structure length
101
Chain Sequence
b'MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytotoxic protein ccdB
publication title Rejuvenation of CcdB-Poisoned Gyrase by an Intrinsically Disordered Protein Domain.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin/toxin repressor
total genus 28
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01845 CcdB CcdB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3g7zA00
5CO7A 1X75C 4OF1A 3JSCA 2MF2A 4MZPA 4VUBA 5CKHA 3TCJA 5CKDA 5DLOA 5CCAA 1VUBA 5CQYA 5CK9A 1UB4A 5HK0A 5CKFA 5HKCA 3NFCA 4HKEA 4MZMA 1NE8A 5HK3A 5CKEA 3JRZA 4MDXA 5CKBA 4ELZC 3HPWA 4ME7A 2C06A 1M1FA 3VUBA 5CQXA 4MZTA 4ELYC 5CR2A 2KMTA 2VUBA 3G7ZA
chains in the Genus database with same CATH superfamily
4M7AF 3LWIA 2EQKA 4M7AG 2E1HA 2PUKB 4A4FA 4AFSC 3WVDB 1M8MA 3SEMA 5FWBA 2DVEA 2E5QA 1VQ8Q 3CXCA 2LDMA 2HKQB 3M9QA 1HJDA 1XTDA 2RHYA 1YN8A 1M9SA 1ZBXA 2LRQA 4PJJA 2E3HA 2K79A 5LL6S 1LCKA 1VQNT 2HSEB 2KSSA 1VQ8A 5KYWB 4D8KA 3C0CA 4C0GA 1VQ6Q 4C5GA 2QK0A 3BE3A 1K73U 1GFDA 1Y0MA 2X4JA 3V7RA 5GAN4 5A0GA 3CMAQ 1VIFA 4F14A 3OBYA 3NTHA 5HCKA 2RJFA 1W1FA 2KROA 1VQ6A 4BDZA 5GAOr 1K73R 1FMKA 3VS3A 5KYUB 2PVOB 4M77E 3CMAA 2EKOA 2E12A 3HL8A 3TVTA 4MZMA 1JJ2P 2FPEA 2QYZA 3PVQA 2JTFA 1RAIB 4F17A 1HK9A 2PTKA 5GAMe 3UATA 3NTIA 3JB9H 1YI2Q 5IHNA 4RTTA 3JB9I 3NPFA 3OW2S 2CUBA 1GXIE 1HYOA 4WCIA 2A08A 3EG9B 1IZ6A 4M77C 3JRZA 4MDXA 3H9NA 3I56Q 1U1SA 4M75E 4M78B 4OMPA 1YI2A 1N8RC 4M7AA 4C5EA 1Z9QA 3PNWC 4B9XA 3I9QA 3V8JA 4DA4A 3J80E 4PJNA 2BKDN 4X34A 2KYMA 3LH5A 2QQ9A 3BFMA 3C95A 3OB9A 3U23A 4BY6B 3I56A 2K4YA 3A98A 4N4HA 1VOMA 2SEMA 3E19A 3L1AA 1H8KA 1VQ5T 2DM1A 4ORZA 4M75C 1Q7YU 1D0YA 2OTJT 1PM3A 1SRMA 1VQNQ 1K9MU 1MNEA 2MI6A 1QKXA 2M9UA 4DOVA 1DJ7B 4OGEA 2HEQA 3OYEA 1PRLC 2QQRA 1KQ1A 4JRIA 1VQNA 1ABOA 2ZAEA 3QWXX 5GAOl 2AKLA 1V29B 2XK0A 3VS2A 4B6MA 2R5MA 3M55A 2HBWA 2LMJA 3OSSC 1YCYA 3FC3A 2I2LA 2DXUA 3CCVT 2MCNA 5GANj 1OX9A 2JW4A 1ARKA 1WA7A 4E7JA 1R0BG 3LH0A 2BE9B 1G5VA 2VYTA 3OQ5A 5DLOA 4KH0B 2MWOA 1V1CA 2EKHA 2O31A 3OYFA 3RERA 2QQAA 4RTZA 3JB9J 1Q86U 2L2PA 1PG5B 1M90R 4C8QD 1WNLA 3EG3A 2X3XD 2KEAA 4E7KA 3M56A 1W70A 3KUFA 4FW2A 8AT1B 1R8OB 1YP5A 1KK7A 1Q86R 1SPKA 3MEWA 3RKWA 5LJ5j 1QVFP 2HD0A 1AD5A 1WXTA 3RR6A 3LWHA 2V8JA 1WHHA 1IGUA 1KQSS 2BZ8A 5GANg 2YHTA 4NOYA 1LJOA 4M77F 5GJVB 3JCMe 4M7AB 4M77G 1T0JA 3CQTA 1X6BA 2FO0A 2KXDA 3OYJA 4ATOA 4J9GA 2FZCB 1EIFA 2OTJQ 2V1QA 4OMLA 3L2RA 1VUBA 3M0SA 3I55Q 2PQWA 2DD5A 1RACB 4OVAA 4LUDA 1UGPB 1TTHB 5FRNA 4OB3B 2OTJA 2LNHB 1JXOA 5ECAA 3G7ZA 3I55A 1WFWA 5LJ5g 3EH1A 1J3TA 2AZVA 1SHGA 4M75F 4C92E 1SSHA 5I11A 4M75G 3VYHB 3EGDA 3RKYA 3MCAB 3CCVQ 3QYHB 3QG1A 2O2OA 4JUVA 2LX7A 2F2WA 1OPKA 2COZA 1JJ2S 2JOYA 3QUIA 4HVVA 2K3BA 4HCZA 3ZFJA 2H3EB 1OV3A 1R77A 3I5RA 3M0TA 4PL6A 3JCMV 3CCVA 5GMKe 1NPPA 2EJGA 3KXTA 3RMQA 4C92C 2HDAA 3CXCP 2J6FA 2MMPA 5L8RE 2KBTA 4ELZC 5GAMj 2DRMA 2ED0A 1GBRA 3PMTA 3R6OA 2RHIA 4A4KA 4TVRA 2WACA 2FZGB 2ZPHB 1WZOA 4FT4A 2IPOB 2LVMA 4QVDA 1OI1A 3RMSA 2YUPA 3THKA 2K5LA 1WQ7A 4FYXB 5CIUA 4M77A 2FG0A 4WTOB 3BDUA 4ZGEB 1Q81R 3M4YA 1D3BB 4A54A 4OMQA 3RBBB 3JCMc 3M54A 3QZ9B 4WF2A 3PMIA 4GLMA 3PTAA 2NWMA 4VUBA 1M30A 5GMKm 1KD1R 2QEXQ 2RJCA 1QWFA 3HP9A 2OTLT 3S3NA 1UGVA 4OP0A 5GANh 3CBOA 4M78D 2CT4A 4J6WA 2CZ6B 2DBKA 4AG2C 5GAMg 4HCKA 1QKWA 1VQKQ 4J9DA 2PZ1A 4CC4B 1E7OA 2RA2A 1ZLMA 1BCMA 2AZSA 2RF0A 2QEXA 4M75A 2J05A 1UGRB 3SWNA 4AFQC 1WGSA 1VQKA 4CC7A 4Y28E 4CC2A 2WSFE 3NMZC 2DVJA 3DB3A 4RTVA 3L2QA 5LJ5h 2DX1A 2RN8A 1M3CA 2EYXA 1ZUYA 2E70A 1KJWA 2G6FX 1VYTA 1NYFA 2L0AA 4C5IA 2VB6A 1K8AU 2DIGA 1K73C 2ESWA 1U1TA 3EGDB 3INZA 1D09B 2CP5A 4JS4A 2B86A 4IUPA 2K3XA 5A0LA 2DXBA 1K8AR 3LX7A 4BE1A 1TH7A 4Z89A 2J7IA 5LJ3f 3UPUA 3OMGA 4HT8A 3UT1A 4IUTA 1VQ7T 2JNGA 2GBQA 4J9BA 4B9WA 2KQWA 2P4RA 2HBPA 1N27A 1C6VX 1ZSGA 2COWA 2RQVA 2DE0X 4C92F 1BI2A 1RL2A 2RJEA 3F70A 4C92G 3VUBA 1NBEB 2PU9B 1TUDA 3AHUA 1BIAA 1UECA 2OTLQ 1M2VA 4JDSA 4C0ZA 4JPBW 3P8HA 4M77B 3X24B 2RJDA 4DBHA 3PT9A 4PFZA 1MUZA 4BI8B 4F04B 2D8JA 2H3JA 2VC8A 2P0QA 2OTLA 2E64A 4QT7A 4E7IA 2JN0A 5KYUA 2V8IA 2EPDA 2CYZB 4Y91A 1QVFA 3P8BB 1M3AA 1GL5A 2EQJA 5GAMh 3IQLA 4D6WA 3OYKA 3VS0A 1B07A 4J7FA 3CD6Q 1IHVA 4M7DD 1RADB 2ZPGB 2PUOB 4JJBA 1YCSB 4E2FB 3OYNA 1G3YA 4M75B 3D7SB 3HSBA 1XOVA 2RMOA 4OMNA 3RIRA 5GAOm 1KHCA 3SWNB 3CD6A 3R6NA 1X69A 5D7UA 1AHJB 3JCMg 1K9MC 3J7AF 1NEBA 1PRMC 3EAEA 2F2XA 3EG9A 1UFFA 2K7AA 1KG1A 1I5LA 1U5SA 1M4ZA 5FU7C 4ZTFA 3FIFA 4QQ6A 3CXCS 5GMKj 5J3BA 2RQRA 1WLPB 3A5ZB 4YTLA 5IN1A 1VQ7Q 1BI3A 5GAN6 2GNCA 1AZEA 3FJ5A 2RQWA 4C92A 1UG1A 1GCQC 3QO3A 1NYGA 2ROLA 3CPFA 1S72T 2C06A 2P0PA 1H3ZA 5L23A 1VQ7A 2A0FB 2DTHA 2OAWA 2FL7A 1PD1A 1M5Q1 1OZ3A 1WDXA 1X01A 4F16A 1SRLA 2EIFA 1W6XA 2D8HA 1Q86C 2DZ9A 2DRKA 3S6WA 3OYLA 2DNUA 5CAIA 2FYKA 3QWYA 5KE3A 3GBQA 1YWPA 5CQXA 5LJ5d 3TU4K 1V76A 4OMFB 3CCUT 1Y71A 2HKNA 3OMCA 4PLIA 3X26B 4QQDA 2GQIA 4CC3A 1BCOA 1QP2A 3EGXA 3FB9A 1O9SA 1PSFA 1M2VB 1HXDA 1FWZA 2RK2A 3CEYA 2X9HA 1NLPC 2QGFB 1IO6A 3E2UA 3M0UA 4KUDK 1JB0E 4L6V5 1WJQA 4PK4A 3QKJA 4J9FA 2F1LA 1QP3A 2IVWA 2Y4XA 2DXCA 3JB9D 2JJ9A 5KCOA 5KYXA 1BI1A 1W4SA 4EMKC 3QDRB 2D6FA 2LTOA 1M1GA 1M8VA 1VQOQ 4DBFA 3G4ST 1VYUA 5J26A 1ZBJA 1SSFA 4PNOA 3UWNA 2DYBA 2XHCA 1X6OA 1QCFA 3LGFA 2RI3A 3JCMX 2VWFA 4PLLA 2ED1A 5GAN3 3OY9A 4A53A 1VQOA 1WHMA 3CCQQ 2BUDA 5GAOq 3TREA 4CI0C 3MPUB 2DIQA 3UDCA 3MEUA 3ER0A 1KC8U 4EIKA 3V8KA 3HFOA 2CH4W 2ZZDA 2DKGA 3CC4T 1S72Q 4GBQA 2OAUA 4BE0A 2DL8A 5C6SA 4Q5WA 3CCQA 2K9GA 1EFNA 1KC8R 3CCET 1JO8A 2FPFA 2JM8A 1H92A 2X4YA 4RCCA 3HKSA 4J9IA 1S72A 2CP7A 2DA9A 4MMKA 5GAMd 4C92B 2R57A 2I0NA 1O75A 2KT1A 5EG2A 1K0SA 1YFNA 4LUEA 3EHRA 1T3LA 3MHXA 1M3BA 3HFNA 4ZN3A 4JRQA 3A8GB 1ZUKA 4E47A 1Q81C 3A8LB 8ATCB 3J81E 1OEBA 1FXXA 3CCUQ 3SHWA 3SWNC 1H3HA 2CZ0B 2EVRA 1VQ9T 2R58A 1X2KA 1SG5A 4FW1A 2JTMA 3QJ6A 1Q7YR 1KD1C 4XK8E 4RG2A 5D6XA 3QBYA 2DD4A 5I22A 1IGQA 2E6ZA 3CCUA 1E6GA 3GLXA 2QI2A 1K9MR 3VKIA 1LVKA 1FX7A 1Q82U 2D0QB 5D6YA 4QVCA 2OX7A 3META 3FDRA 3NFCA 3EGXB 2Z0WA 1UHFA 4XTXA 1I1JA 4RCBA 2HAXA 2BE7D 4C0DB 2E3IA 1NPRA 4OGCA 3MEVA 1BI0A 4MZTA 3OSVA 2RO0A 4KGZB 1TG0A 2CSQA 3URGA 4RTXA 3EG0A 3BW1A 4J7IA 4IKFA 5KYXB 3C4SA 2EW3A 2GF7A 3LW5E 3OYAA 3EFOA 4DEXA 2K57A 4LXCA 5J39A 3HTRA 2E65A 2KAFA 1ZA2B 4J9EA 2LJ3A 3CC4Q 4E6RA 4DOWA 1D3BA 1RAFB 1YBYA 2QDYB 2DJQA 2RB6A 4IIMA 4A63B 4BUGA 2HSPA 1FMWA 4AT1B 4F7UE 1XNIA 1X27A 3OYCA 4FYVB 3S3MA 3WXMB 3VJPA 4XTZA 3CC4A 1GCQA 2CREA 1K8AC 1AEYA 2DJZA 4PJOD 1NM7A 3M0QA 5GMKi 2BIVA 1VQ5Q 1VQ4T 2DPPB 2CP3A 3WVEB 1IB8A 3PVLA 4XTWA 4AFUC 3EFRA 2JMCA 2ZPFB 2GTJA 1VQ5A 5CKEA 4LDXA 4JJDA 4KT0E 1RAEB 2M16A 4X9CA 2YRVA 1OU8A 2AIRB 1WYXA 2PVDB 1ZUUA 2MK5A 3M0RA 2JTEA 2YUQA 2MOXA 3A8HB 4E7SA 2CP2A 1OULA 2A7YA 2ECZA 1A0NB 3V7SA 1WHLA 4FIBA 1D0XA 3OS0A 2EYZA 2BTTA 3G1JA 2LP5A 1M1FA 2M0OA 2ABLA 4C8QF 5GJWB 4C8QG 2QTXA 4IUQA 2LQNA 3E1SA 1RI9A 5FWCA 3C94A 4EMKA 1ZSZC 2O01E 1AWXA 2XD0A 2RD1A 1ZQ1A 3CCJT 4XTUA 5GAN7 2KY9A 2EYQA 1PNJA 1BBZA 5IXFA 4ELYC 1U06A 3G6ET 4NS5A 5CO7A 1BB9A 3RNJA 2O88A 4RTWA 2M02A 3HRTA 2ZCFB 1GFCA 2K5IA 4J9CA 3ZL7C 2GQVA 1X2QA 3EFOB 3VV0A 4EDUA 1KFZA 4PJMA 3LGLA 5FW9A 5FU7B 2BZYA 1I81A 2KNBB 4E7HA 3L2ZA 3UA6A 3O5ZA 3CMET 1VQ4Q 4OF1A 4MZPA 3M5AA 3BDLA 1UJYA 3UF4A 2VVKA 1M1KU 2AK5A 1YJNT 4A4HA 1T0HA 1JEGA 4ANJA 5LJ3e 2H8HA 5A0DA 2XDDA 4HKEA 1G2BA 2JMAA 1QWEA 2E10A 4O6JA 1VQ4A 2YUNA 1MV3A 4FM4B 4C0DC 3M0PA 5FLXE 2YLCA 1OPLA 4XAXB 1AWJA 4V2SA 4QVZA 3M57A 2MAMA 2QQBA 1KHIA 3OA6A 2MWPA 1QVGA 4F7UF 4FYWB 2RPNA 4F7UG 4ME7A 4Z8AA 1MNDA 4C8QA 2QDLA 3LLRA 2HQEA 1AWOA 4A4GA 1G3TA 1JQQA 2MF2A 2KVQG 4DBRA 1YJ9T 5FROA 4J6XA 2AHJB 1IHWA 1LOJA 1Y57A 2DFUA 3CCJQ 3AT1B 4N4GA 4HVUA 2CSIA 3G6EQ 2CDTA 2JZ2A 2D0NA 4MMLA 4FYYB 3CCLT 1LNXA 2G3RA 3L2UA 3CCJA 1VIEA 2JXBA 4EMKB 2A36A 2GFUA 2LZ6B 4ZGDB 1NE8A 2C0OA 2EBPA 2LQ8A 2NUZA 4KH1B 3CCST 1QVFS 3VU3C 3G6EA 3O8VA 4M78F 2KMTA 1VYVA 1TUGB 3CMEQ 2YWWA 1ZA1B 1JBMA 5CKDA 2HZYA 2J6OA 3OS1A 4RKUE 3QXEB 2DLPA 1PC0A 2XICA 2X51A 1YJNQ 1MMGA 4Y92A 2F5KA 4OB1B 4Z88A 4LDYA 1W2BA 1KC8C 4C5HA 2XIDA 3M59A 3CMEA 3I35A 2RQUA 1SF9A 1Y7XA 3A8MB 5KH6A 2XDPA 1X75C 1QQJA 1D1AA 3JSCA 1ZX6A 1YJNA 1QVPA 4D8DA 4JZ3A 1B34A 2LJ0A 2FHDA 4OMMA 4F7UA 2W0ZA 3QJYA 3QSUA 5FU6B 1H641 4BDYA 4M7AD 2L3PA 3DKMA 2O4XA 2NYSA 4ZGJB 1EZZB 3V8LA 1F1BB 3QHSA 3VS5A 3CC7T 2EAYA 1OYXA 1WIEA 1Q7YC 2V26A 1YJ9Q 4DBQA 2XU8A 2L89A 3OYIA 1UJ0A 2QA4T 3HRSA 2AKKA 2L3QA 4C8QB 1YJ9A 1FMVA 2Y4YA 5I21A 2JS2A 2GGRA 4PJLA 2JUFA 2DF6A 3E9FA 3CCLQ 1Q82C 3VYGA 2QASA 1UB4A 2IIMA 5FRMA 1ZSZA 2K2MA 3MJXA 3VRYA 5GANd 4KRTA 2NUTB 1KQ2A 3CCSQ 1OQKA 3CBPA 2KGTA 2E41A 3EG1A 3EFSA 4FT2A 3CPWA 3M4GA 3CCLA 3G71T 2ZPBB 1M27C 3C12A 1BIBA 5IXBA 2DL3A 4BD3A 1VQPT 3MEAA 3X28B 1WHGA 3CCSA 2WSEE 2LCLA 3JCMJ 4II1A 4K11A 4R0KA 2RI5A 2PNIA 2VXFA 3L2WA 3JCMQ 3A1PA 1M2OA 2J06A 2XMFA 1PWTA 4M7DF 1KQSP 3P8DA 5GMKl 2SRCA 4M7DG 5LJ3j 2QG9B 4IUUA 1YITT 1UEBA 4BACA 2XKOC 2YDLA 4QKUA 4LDWA 2FRYA 1IREB 5GANf 3H0HA 3H0IA 2M1HA 4RG8A 1K1ZA 1Q95G 3CC2T 4PFPA 2EYYA 2RI2A 1MMAA 3CC7Q 3VS6A 3TCJA 2MIOA 1B34B 3DLLA 4F7UB 2QTVA 3RKXA 3TQ7P 2QA4Q 1BU1A 2VXEA 1QW1A 2O4XB 3CC7A 1Y07A 4BI3A 3H41A 3LYIA 4Z02A 1ABQA 2XG8D 2DK3A 5LJ5f 3FEOA 5LJ3g 1Y96A 4AMCA 2VGMA 1G8XA 2RM4A 3JCMh 2QA4A 4KGXB 4LDUA 2ZPIB 2QQSA 1PSEA 2MYSA 1WI7A 1AT1B 2JVVA 5HK3A 1TUCA 1QLYA 2P4TA 1E6HA 2EGAA 2KR3A 2EFIA 3NGPA 3FLGA 1PKTA 3RESA 3OBWA 3TSZA 2CT3A 1X6GA 5IT9E 3NHNA 1WPYA 3OYGA 1I5OB 2R5AA 3G71Q 5GAOn 2DXTA 4JZ4A 3DLMA 1VQPQ 1N6AA 4RUGA 2HNIA 1RABB 2FPDA 1QVGP 2JS0A 1ZSZB 1NG2A 1SEMA 5CVIA 1NJIU 5FU6C 4C8QE 4L5GA 3G71A 3VS1A 1IXDA 3OYHA 2KI7A 3GNGA 2FEIA 4M7DA 2NUPA 5GAN2 1YHQT 1UGSB 4UC4A 1VQPA 3KFVA 2KK4A 3VRZA 1K76A 3QPHA 2E4HA 1NJIR 2X4WA 3QDFA 1PHTA 1YITQ 1TU0B 4JS5A 4XU0A 4JJNK 5HKCA 4N4IA 1HD3A 1GRIA 3JB9F 4PJOE 5CKBA 3OS5A 3PE0A 2O9VA 3JB9G 2K6DA 2ZGWA 1D0ZA 5GMKh 2HL3A 4C8QC 2DMOA 3EG2A 1YITA 5IHKA 3MKDA 5IHIA 3OW2A 3CC2Q 5D6WA 3ZBDA 1YIJT 1S1NA 1UTIA 3I55T 1JRIA 2LQWA 1M1KC 3VS7A 2F2VA 4M77D 2C0IA 4J83A 1N9SA 1K9AA 2A28A 1B3QA 1CSKA 5GAMf 3FRNA 4JLGA 2CS7A 3CC2A 1BKBA 1FYNA 2DAQA 3G4SQ 5C0MA 4RMOA 3L2VA 1Q82R 4PJOC 1GCPA 2E5KA 4XQ3A 1TXQA 3GNFB 2CH4A 4FSSA 4HT9A 4J8OA 1PKSA 3CBMA 4E7LA 1WX6A 1I8FA 1OX8A 2B8AA 3QYGB 2OI3A 3G4SA 1IRXA 1W2BP 2KYBA 6AT1B 3RDVA 2CZ1B 2K5FA 1VQLT 2Y90A 4M75D 4N0AA 5LJ3h 1M90U 2EGCA 1JU5C 5I2SA 2ATCB 1Y96B 5CCAA 3Q1JA 5GAN8 1RLQC 2X4XA 4LNPA 2C0TA 1U8RA 3CCEQ 2E6NA 5GAOp 3EGUA 2P84A 1WJSA 2DILA 2D9TA 2EGEA 2EQIA 2J6KA 2VV5A 1YJWT 2EJ9A 1SHFA 3CCEA 1YHQQ 4CRIA 3JV3A 1WJRA 2KRNA 2PVGB 1NEGA 1VQMT 3TEEA 2K3YA 3GIBA 4FSXA 1VQ9Q 2OJ2A 1YHQA 3OYYA 1WHKA 4A4EA 3QIIA 4M4ZA 4O5VA 4M7DB 2NUPB 3T9NA 4R55A 1GBQA 2P0KA 1XJWB 3L42A 1NLOC 2ZPEB 3I5SA 2QEXT 1MGQA 1YIJQ 1VQ9A 2KRMA 2FB7A 2GTOA 3JCMd 1D1CA 2A3LA 5CKFA 2KT8A 1AVZC 1XQHA 3MP1A 1NZ9A 2CUDA 4M78E 4X1VA 2VKNA 1VQKT 4KULA 4HCBA 5AT1B 3CPWP 3RUXA 2XI9A 2DEQA 1YIJA 2YSQA 3ME9A 2YUOA 4EMGA 1B7TA 3HRUA 1N9RA 1SKUB 2X3WD 1KQSA 2RHUA 5KYYA 2QXFA 2CP0A 1RAGB 2YRCA 4LN2A 2JM9A 4HCCA 2F69A 3KBGA 1TOVA 1KSWA 1RI0A 1BYMA 1WXUA 1N8RU 1MMDA 3HHTB 3UA7A 4M78C 1VQLQ 1C0MA 5CR2A 1G83A 4MDWA 3H6ZA 4PJOF 4BB7A 4EPCA 2KE9A 4PJOG 1OU9A 4DQ2A 3OS2A 4IURA 1N5ZA 1N8RR 5AYFA 9ATCB 3JCMP 2GCXA 3JCMf 1QCNA 4JRPA 4QW2A 4BY6C 1VQLA 3OYMA 1CKBA 4E7ZA 5DM7R 1YJWQ 3E9GA 2O9SA 4GY5A 1QVGS 2AT1B 2LQKA 1BK2A 4KGVB 1Q81U 2F5TX 3VUZA 4FL6A 2W10A 4RTUA 5CKHA 1K0XA 1LPLA 1TS9A 1C1AA 4XU2A 4KBMB 1VQMQ 3BY7A 1WHJA 1YJWA 2DL5A 3MP8A 4LDVA 2CP6A 1UGQB 4EMHA 1KD1U 4NL3A 1JJ2A 3ULRB 3JCMb 1M1KR 2DZCA 2EJFA 2LX9A 2QAZA 3PIOA 2FVUA 1P92A 2VUBA 3S3OA 4PFOA 1VQMA 5KCHA 1RAHB 2DEUA 3QZ5B 1U3OA 4C92D 1KIKA 1AWWA 1CKAA 2IG0A 1EX4A 1T3SA 4XU3A 4L59A 2LT4A 3X25B 3V7CA 1ACMB 1RAAB 3REBB 3PGGA 1UHCA 5LJ3d 5A2QE 1X43A 2L3RA 2DL4A 2LNVA 1R0CB 2RK1A 2V1RA 2DYIA 3REAB 5CK9A 1HSQA 3SD4A 3JAME 1UE9A 2RHZA 3DB4A 3CD6T 2M0YA 4M7AE 2NUTA 4M7DE 1MHNA 1TWBA 1G3SA 4QQGA 4PJOA 4KUIA 1ZHIA 4DEYA 4XTVA 3A8OB 2LC4A 1W2BS 2KXCA 3N5BB 2L5QA 4P5NA 3PFSA 1I4K1 4RTYA 2LCSA 5KYNA 5KYYB 3CCRT 1OZ2A 4OMOA 4IUVA 4BE2A 2EWNA 2K2VA 2YXYA 2D1XA 4NL2A 1TSFA 1RUWA 4JJCA 2HMAA 3SB2A 2KDSA 2COYA 3MP6A 4ZNXA 4M7AC 4M7DC 3OW2P 2HCKA 2EYWA 4J9HA 4JRKA 4M78G 3CCMT 4BI4A 2DBMA 1WXBA 5M9OA 4AFZC 2DTOA 2LJ1A 2YRDA 1AOJA 2DTIA 1MMNA 3GP8A 2CZ7B 3SFMA 4FCYA 3FJPA 3EHQA 4J5YA 3GOXA 1AZGB 1MV0B 2BZXA 4HVWA 2KRSA 4GLKA 5EC7A 1UUEA 2VGNA 1Z9ZA 4OB0B 5KYWA 2MPXC 2LCCA 5DLQE 1D1BA 2A37A 5I2MA 1K4US 1VQ8T 1OOTA 3GF5A 1NJIC 5GAN5 1JXMA 5IH2A 1PCXA 4HA8A 4XU1A 2HQHA 4PKCC 2WSCE 1I07A 3MO8A 4FU6A 3CPWS 4X9DA 5CQYA 1VQ6T 4JLIA 4C0FA 2RQTA 2ENMA 2VASA 2HL5C 5KE2A 3CMAT 3M58A 3ZEHA 1RLPC 2V8KA 2RNAA 1YNZA 2YT6A 2DERA 2CKKA 2X35A 1WQWA 2EQUA 7AT1B 2RH2A 5GANe 4N0AC 1VA7A 4OB2B 3JCMW 1PD0A 2ROTA 1I0CA 3OYBA 3H0FA 4IIOA 4ESRA 2HQXA 3PIPA 5HK0A 2DL7A 4HXJA 3CCRQ 1QMCA 3TSWA 2EQMA 2RHXA 3EH2A 1VQOT 2LT1A 1YWOA 3HPWA 2DO3A 3OYDA 4M78A 2L8DA 4PJOB 4AG1C 5HY6A 1YI2T 3NTKA 3GPLA 3CCRA 2FRWA 2YLBA 2XDBA 3CCMQ 2L3SA 2CGHA 1G3WA 3CCQT 4LD6A 2JT4A 5DY9A 5LJ5e 3H8ZA 2GFAA 2FZKB 4R56A 3SDZA 3M53A 3I56T 1QCOA 2M51A 3VS4A 4ZN1A 4ZTJA 2DETA 4XTYA 5IAYA 4LE9A 3ASKA 4J6YA 3CCMA 4LD9K 3X20B 2NLUA 2QGGA 1M90C 1UDLA
chains in the Genus database with same CATH topology
4M7AF 3LX7A 4BE1A 1TH7A 5D6WA 5LJ3f 2EQKA 4C8QG 3OMGA 3ZBDA 3LWIA 2QTXA 3UPUA 1YIJT 2E1HA 2PUKB 4IUTA 4IUQA 3UT1A 4A4FA 2JNGA 1JRIA 3I55T 1VQ7T 1M1KC 3WVDB 4B9WA 3E1SA 4M77D 2KQWA 3C94A 4J83A 4EMKA 2HBPA 1N27A 1N9SA 2O01E 2XD0A 2RD1A 2DVEA 2E5QA 5GAMf 3FRNA 1ZQ1A 3CXCA 4JLGA 2LDMA 4XTUA 4C92F 5GAN7 3CCJT 2CS7A 2KY9A 3CC2A 1BI2A 1BKBA 1RL2A 2DAQA 2EYQA 2RJEA 3F70A 4C92G 3M9QA 5C0MA 4RMOA 1XTDA 2RHYA 3L2VA 4PJOC 3VUBA 1M9SA 1ZBXA 4ELYC 2LRQA 4XQ3A 3G6ET 4NS5A 2PU9B 3GNFB 5CO7A 4HT9A 4J8OA 3HRTA 3AHUA 2ZCFB 2K5IA 5LL6S 1VQNT 3CBMA 4E7LA 2KSSA 1I8FA 1VQ8A 1BIAA 2GQVA 4C0GA 4C5GA 2B8AA 3QYGB 3G4SA 4JDSA 4C0ZA 1K73U 3P8HA 4M77B 2CZ1B 3VV0A 4EDUA 2X4JA 3V7RA 5GAN4 5A0GA 2K5FA 3X24B 1VIFA 2RJDA 3OBYA 1VQLT 3LGLA 3PT9A 2Y90A 5FU7B 4M75D 1I81A 4E7HA 3NTHA 3L2ZA 4N0AA 5LJ3h 1M90U 3CMET 2RJFA 1VQ6A 4BDZA 4BI8B 5I2SA 5GAOr 4OF1A 4MZPA 2H3JA 2VC8A 1Y96B 3M5AA 2P0QA 2OTLA 3BDLA 2E64A 4E7IA 5CCAA 3Q1JA 5GAN8 2X4XA 1M1KU 1U8RA 2JN0A 2V8IA 2CYZB 2PVOB 2E6NA 4M77E 4Y91A 3P8BB 4A4HA 3CMAA 1YJNT 1QVFA 2EKOA 2E12A 2EQJA 5GAMh 4D6WA 5GAOp 3OYKA 5LJ3e 3HL8A 5A0DA 2XDDA 1WJSA 4HKEA 4MZMA 2D9TA 4J7FA 2E10A 4O6JA 2VV5A 4M7DD 2ZPGB 2PUOB 1VQ4A 1YJWT 2EJ9A 2JTFA 4FM4B 4C0DC 3OYNA 1HK9A 3CCEA 1G3YA 2YLCA 5FLXE 5GAMe 4CRIA 3NTIA 4M75B 3JB9H 4XAXB 3HSBA 4HT8A 1WJRA 1XOVA 3RIRA 4V2SA 4QVZA 5GAOm 3M57A 2MAMA 1KHCA 2PVGB 3SWNB 3JB9I 3CD6A 2QQBA 1KHIA 3OA6A 3OW2S 3TEEA 2MWPA 1VQMT 2K3YA 1AHJB 3JCMg 3GIBA 1K9MC 4FSXA 1QVGA 1GXIE 3J7AF 3EAEA 1IZ6A 4F7UF 4M77C 3JRZA 4MDXA 1YHQA 1KG1A 3OYYA 4F7UG 4ME7A 1U1SA 4M75E 4A4EA 4M78B 3QIIA 3LLRA 4O5VA 1M4ZA 5FU7C 4C8QA 1YI2A 1N8RC 2HQEA 3T9NA 4M7AA 4M7DB 4ZTFA 4C5EA 4R55A 3FIFA 4A4GA 4QQ6A 1G3TA 3PNWC 4B9XA 3CXCS 5GMKj 5J3BA 2P0KA 2MF2A 2KVQG 3L42A 3A5ZB 2ZPEB 4YTLA 3V8JA 4DA4A 3J80E 1MGQA 2QEXT 1YJ9T 1VQ9A 5IN1A 2FB7A 1BI3A 5FROA 2BKDN 5GAN6 3JCMd 2A3LA 4X34A 5CKFA 2QQ9A 4J6XA 1XQHA 3BFMA 3C95A 3MP1A 3OB9A 1NZ9A 4BY6B 3I56A 4C92A 2AHJB 2K4YA 4N4HA 1LOJA 4M78E 1VQKT 4HCBA 4KULA 3QO3A 3CPFA 3E19A 1S72T 3L1AA 2C06A 2P0PA 1VQ5T 3RUXA 1H3ZA 4N4GA 2XI9A 2DEQA 1YIJA 3ME9A 1VQ7A 2DTHA 4EMGA 3HRUA 2FL7A 4M75C 1Q7YU 1N9RA 2JZ2A 2OTJT 4MMLA 1KQSA 1YITA 1M5Q1 2RHUA 1OZ3A 3CCLT 1LNXA 2G3RA 2QXFA 1X01A 3L2UA 2EIFA 3CCJA 1K9MU 1VIEA 4EMKB 2GFUA 1Q86C 2DZ9A 4ZGDB 1NE8A 2MI6A 4HCCA 2F69A 2LQ8A 3KBGA 3CCST 3S6WA 2M9UA 1QVFS 3VU3C 4DOVA 1DJ7B 3G6EA 1RI0A 4OGEA 3OYLA 1BYMA 5CAIA 2FYKA 3HHTB 1N8RU 4M78C 3OYEA 5KE3A 2QQRA 1KQ1A 5CQXA 4JRIA 5LJ5d 3TU4K 3O8VA 4M78F 5CR2A 2KMTA 1VQNA 4MDWA 3H6ZA 4OMFB 5GAOl 4PJOF 1V29B 2XK0A 4BB7A 4EPCA 4PJOG 1JBMA 5CKDA 2R5MA 3M55A 3CCUT 1Y71A 3OS1A 3OMCA 4RKUE 3QXEB 4PLIA 2XICA 4DQ2A 3OS2A 4IURA 3X26B 4QQDA 5AYFA 3JCMP 1QP2A 2GCXA 3JCMf 4JRPA 2F5KA 3FB9A 1O9SA 3OSSC 4OB1B 1PSFA 4QW2A 1YCYA 4BY6C 3FC3A 1HXDA 1FWZA 2RK2A 4LDYA 1W2BA 1VQLA 2I2LA 3CEYA 2DXUA 3OYMA 4C5HA 3CCVT 1KC8C 2XIDA 5GANj 3M59A 3CMEA 5DM7R 4KUDK 3E9GA 4GY5A 1QVGS 1Y7XA 1JB0E 2LQKA 4E7JA 3A8MB 1WJQA 4L6V5 3LH0A 3QKJA 1G5VA 5KH6A 2XDPA 1QP3A 1X75C 1Q81U 2IVWA 2F5TX 2VYTA 3JSCA 1QVPA 4FL6A 3OQ5A 3VUZA 1YJNA 2Y4XA 5CKHA 2DXCA 5DLOA 3JB9D 2MWOA 1B34A 3OYFA 4XU2A 4KBMB 5KCOA 3RERA 2FHDA 2QQAA 1BI1A 4F7UA 1I5LA 3QJYA 1W4SA 3BY7A 3QSUA 4EMKC 1YJWA 3QDRB 3JB9J 1Q86U 2D6FA 3MP8A 5FU6B 2LTOA 4LDVA 1H641 1M1GA 1UGQB 4C8QD 4EMHA 4BDYA 1M8VA 1WNLA 1KD1U 3G4ST 4M7AD 4NL3A 1JJ2A 3DKMA 4E7KA 5J26A 2O4XA 3JCMb 1SSFA 4PNOA 3M56A 3UWNA 2DZCA 3KUFA 4ZGJB 3V8LA 2EJFA 2LX9A 1R8OB 3PIOA 3QHSA 2XHCA 1X6OA 2FVUA 2VUBA 1P92A 3S3OA 3CC7T 2EAYA 3MEWA 3RKWA 3LGFA 5LJ5j 2RI3A 1OYXA 4PLLA 5KCHA 3JCMX 5GAN3 3OY9A 1VQMA 1Q7YC 3QZ5B 2HD0A 4A53A 4C92D 1VQOA 2XU8A 3LWHA 2IG0A 2V8JA 2BUDA 2L89A 5GAOq 3TREA 4CI0C 3OYIA 2DIQA 3UDCA 1KQSS 3MEUA 3ER0A 1KC8U 2QA4T 3V8KA 3HRSA 3HFOA 5GANg 2YHTA 2ZZDA 2DKGA 1LJOA 4NOYA 4XU3A 3CC4T 4M77F 4L59A 2LT4A 3X25B 4C8QB 3V7CA 3JCMe 4M7AB 2OAUA 4M77G 4BE0A 3PGGA 5LJ3d 1YJ9A 5A2QE 2Y4YA 5C6SA 3OYJA 4Q5WA 2L3RA 5I21A 4ATOA 3CCQA 2LNVA 2JUFA 3CCET 1EIFA 2RK1A 3E9FA 1VUBA 3L2RA 1Q82C 3VYGA 5CK9A 1UB4A 2X4YA 4RCCA 3HKSA 3SD4A 2PQWA 2DD5A 5FRMA 3JAME 1S72A 4MMKA 2RHZA 3DB4A 5GAMd 4C92B 4OVAA 2R57A 3CD6T 1UGPB 5GANd 1O75A 4M7AE 5EG2A 1KQ2A 4M7DE 5FRNA 1MHNA 3CBPA 3MHXA 2E41A 1G3SA 3EFSA 4QQGA 4PJOA 4FT2A 4KUIA 1ZHIA 4OB3B 3CPWA 4XTVA 2OTJA 3A8OB 2LC4A 3M4GA 3HFNA 1W2BS 3CCLA 4ZN3A 3G71T 2ZPBB 3G7ZA 2L5QA 3A8GB 3N5BB 3I55A 4JRQA 4P5NA 5LJ5g 3C12A 1BIBA 3PFSA 1I4K1 4E47A 1Q81C 3A8LB 3J81E 4BD3A 4M75F 1VQPT 1FXXA 4C92E 3SWNC 4M75G 3VYHB 3MEAA 3X28B 2CZ0B 3CCRT 1OZ2A 3CCSA 1VQ9T 4IUVA 4BE2A 2EWNA 2K2VA 2R58A 2WSEE 2LCLA 4NL2A 3JCMJ 4II1A 3RKYA 3MCAB 2JTMA 3QJ6A 3QYHB 3QG1A 3SB2A 4JUVA 1KD1C 2KDSA 2RI5A 4RG2A 4XK8E 5D6XA 2VXFA 3L2WA 3JCMQ 3MP6A 3QBYA 2DD4A 4M7AC 4M7DC 2E6ZA 3CCUA 3GLXA 2QI2A 1JJ2S 4M7DF 3P8DA 5GMKl 2JOYA 4JRKA 3QUIA 4M78G 3CCMT 4M7DG 5LJ3j 4HCZA 4IUUA 3VKIA 3ZFJA 4BI4A 1FX7A 1YITT 1Q82U 5M9OA 4PL6A 3JCMV 1UEBA 4BACA 3CCVA 2D0QB 2DTOA 5D6YA 4QVCA 1NPPA 2EJGA 5GMKe 2XKOC 3FDRA 3META 3NFCA 3KXTA 3RMQA 4XTXA 2DTIA 4C92C 4LDWA 4RCBA 3GP8A 2CZ7B 2MMPA 1IREB 5L8RE 4ELZC 5GAMj 5GANf 4C0DB 3SFMA 2HAXA 1NPRA 3PMTA 4OGCA 3FJPA 2M1HA 3MEVA 3R6OA 4J5YA 2RHIA 4RG8A 4A4KA 1BI0A 3GOXA 4TVRA 2WACA 4MZTA 3CC2T 2ZPHB 3OSVA 2RO0A 4FT4A 2RI2A 4GLKA 2LVMA 3TCJA 4QVDA 1OI1A 2VGNA 3RMSA 3URGA 1B34B 3BW1A 4OB0B 4J7IA 3DLLA 4IKFA 2K5LA 2LCCA 1WQ7A 5DLQE 3C4SA 4F7UB 2GF7A 3LW5E 3OYAA 5I2MA 3RKXA 5CIUA 2K57A 4M77A 1VQ8T 5J39A 3GF5A 2E65A 2KAFA 3BDUA 1NJIC 5GAN5 4ZGEB 2VXEA 3M4YA 1QW1A 2O4XB 3CC7A 1Y07A 4BI3A 1D3BB 4DOWA 4A54A 1D3BA 1YBYA 3JCMc 3M54A 3QZ9B 4WF2A 3PMIA 2QDYB 3LYIA 4Z02A 2RB6A 3PTAA 4HA8A 2XG8D 4XU1A 4BUGA 2DK3A 4PKCC 3FEOA 2WSCE 5LJ3g 1Y96A 4VUBA 5LJ5f 3MO8A 4F7UE 1XNIA 4FU6A 3CPWS 4X9DA 5GMKm 2VGMA 5CQYA 3OYCA 3S3MA 1VQ6T 2RM4A 3JCMh 2RJCA 2QA4A 4JLIA 4LDUA 2ZPIB 3VJPA 3WXMB 2QQSA 1PSEA 3HP9A 4C0FA 3S3NA 4OP0A 4XTZA 2OTLT 5GANh 3CC4A 3CBOA 1K8AC 4M78D 2CZ6B 2JVVA 4J6WA 5KE2A 5HK3A 5GAMg 2P4TA 3CMAT 2DJZA 4PJOD 3M58A 2EFIA 3ZEHA 3FLGA 2V8KA 5GMKi 2BIVA 3RESA 3OBWA 2CKKA 2X35A 5IT9E 2RA2A 1WQWA 1VQ4T 1WPYA 2EQUA 3OYGA 2RH2A 2QEXA 4M75A 4N0AC 2R5AA 4OB2B 5GANe 3JCMW 2DPPB 3OYBA 3WVEB 5GAOn 2DXTA 1UGRB 3SWNA 3DLMA 1N6AA 2HNIA 2HQXA 4XTWA 1WGSA 5HK0A 3PIPA 1VQKA 3EFRA 4Y28E 2EQMA 2RHXA 2ZPFB 1VQOT 2WSFE 5CVIA 1NJIU 2LT1A 1VQ5A 5CKEA 5FU6C 4C8QE 4M7AG 4LDXA 4L5GA 3HPWA 2DO3A 3OYDA 3DB3A 4KT0E 3G71A 4M78A 3OYHA 3GNGA 3L2QA 2L8DA 4M7DA 4PJOB 2M16A 4X9CA 5GAN2 2YRVA 5LJ5h 1YHQT 1UGSB 4UC4A 1VQPA 5HY6A 2PVDB 2KK4A 1YI2T 3NTKA 3GPLA 3CCRA 3QPHA 2YLBA 2XDBA 2X4WA 2CGHA 2E70A 1G3WA 3CCQT 3A8HB 4JS5A 4LD6A 4XU0A 4JJNK 5HKCA 2A7YA 5DY9A 5LJ5e 3H8ZA 4N4IA 4C5IA 1K8AU 2GFAA 2DIGA 3V7SA 4R56A 1K73C 3JB9F 4PJOE 1U1TA 5CKBA 4FIBA 3OS0A 3OS5A 3SDZA 3M53A 3INZA 3I56T 4JS4A 3JB9G 2ZGWA 4ZN1A 4ZTJA 4IUPA 4XTYA 5IAYA 3ASKA 4J6YA 3CCMA 1M1FA 5GMKh 2K3XA 2M0OA 3X20B 4C8QC 5A0LA 2DXBA 4LD9K 2NLUA 1M90C 4C8QF 3OW2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CO7 A;  1X75 C;  4OF1 A;  3JSC A;  2MF2 A;  4MZP A;  4VUB A;  5CKH A;  3TCJ A;  5CKD A;  5DLO A;  5CCA A;  1VUB A;  5CQY A;  5CK9 A;  1UB4 A;  5HK0 A;  5CKF A;  5HKC A;  3NFC A;  4HKE A;  4MZM A;  1NE8 A;  5HK3 A;  5CKE A;  3JRZ A;  4MDX A;  5CKB A;  4ELZ C;  3HPW A;  4ME7 A;  2C06 A;  1M1F A;  3VUB A;  5CQX A;  4MZT A;  4ELY C;  5CR2 A;  2KMT A;  2VUB A;  3G7Z A; 
#chains in the Genus database with same CATH topology
 4M7A F;  3LWI A;  2EQK A;  4M7A G;  2E1H A;  2PUK B;  4A4F A;  4AFS C;  3WVD B;  1M8M A;  3SEM A;  5FWB A;  2DVE A;  2E5Q A;  1VQ8 Q;  3CXC A;  2LDM A;  2HKQ B;  3M9Q A;  1HJD A;  1XTD A;  2RHY A;  1YN8 A;  1M9S A;  1ZBX A;  2LRQ A;  4PJJ A;  2E3H A;  2K79 A;  5LL6 S;  1LCK A;  1VQN T;  2HSE B;  2KSS A;  1VQ8 A;  5KYW B;  4D8K A;  3C0C A;  4C0G A;  1VQ6 Q;  4C5G A;  2QK0 A;  3BE3 A;  1K73 U;  1GFD A;  1Y0M A;  2X4J A;  3V7R A;  5GAN 4;  5A0G A;  3CMA Q;  1VIF A;  4F14 A;  3OBY A;  3NTH A;  5HCK A;  2RJF A;  1W1F A;  2KRO A;  1VQ6 A;  4BDZ A;  5GAO r;  1K73 R;  1FMK A;  3VS3 A;  5KYU B;  2PVO B;  4M77 E;  3CMA A;  2EKO A;  2E12 A;  3HL8 A;  3TVT A;  4MZM A;  1JJ2 P;  2FPE A;  2QYZ A;  3PVQ A;  2JTF A;  1RAI B;  4F17 A;  1HK9 A;  2PTK A;  5GAM e;  3UAT A;  3NTI A;  3JB9 H;  1YI2 Q;  5IHN A;  4RTT A;  3JB9 I;  3NPF A;  3OW2 S;  2CUB A;  1GXI E;  1HYO A;  4WCI A;  2A08 A;  3EG9 B;  1IZ6 A;  4M77 C;  3JRZ A;  4MDX A;  3H9N A;  3I56 Q;  1U1S A;  4M75 E;  4M78 B;  4OMP A;  1YI2 A;  1N8R C;  4M7A A;  4C5E A;  1Z9Q A;  3PNW C;  4B9X A;  3I9Q A;  3V8J A;  4DA4 A;  3J80 E;  4PJN A;  2BKD N;  4X34 A;  2KYM A;  3LH5 A;  2QQ9 A;  3BFM A;  3C95 A;  3OB9 A;  3U23 A;  4BY6 B;  3I56 A;  2K4Y A;  3A98 A;  4N4H A;  1VOM A;  2SEM A;  3E19 A;  3L1A A;  1H8K A;  1VQ5 T;  2DM1 A;  4ORZ A;  4M75 C;  1Q7Y U;  1D0Y A;  2OTJ T;  1PM3 A;  1SRM A;  1VQN Q;  1K9M U;  1MNE A;  2MI6 A;  1QKX A;  2M9U A;  4DOV A;  1DJ7 B;  4OGE A;  2HEQ A;  3OYE A;  1PRL C;  2QQR A;  1KQ1 A;  4JRI A;  1VQN A;  1ABO A;  2ZAE A;  3QWX X;  5GAO l;  2AKL A;  1V29 B;  2XK0 A;  3VS2 A;  4B6M A;  2R5M A;  3M55 A;  2HBW A;  2LMJ A;  3OSS C;  1YCY A;  3FC3 A;  2I2L A;  2DXU A;  3CCV T;  2MCN A;  5GAN j;  1OX9 A;  2JW4 A;  1ARK A;  1WA7 A;  4E7J A;  1R0B G;  3LH0 A;  2BE9 B;  1G5V A;  2VYT A;  3OQ5 A;  5DLO A;  4KH0 B;  2MWO A;  1V1C A;  2EKH A;  2O31 A;  3OYF A;  3RER A;  2QQA A;  4RTZ A;  3JB9 J;  1Q86 U;  2L2P A;  1PG5 B;  1M90 R;  4C8Q D;  1WNL A;  3EG3 A;  2X3X D;  2KEA A;  4E7K A;  3M56 A;  1W70 A;  3KUF A;  4FW2 A;  8AT1 B;  1R8O B;  1YP5 A;  1KK7 A;  1Q86 R;  1SPK A;  3MEW A;  3RKW A;  5LJ5 j;  1QVF P;  2HD0 A;  1AD5 A;  1WXT A;  3RR6 A;  3LWH A;  2V8J A;  1WHH A;  1IGU A;  1KQS S;  2BZ8 A;  5GAN g;  2YHT A;  4NOY A;  1LJO A;  4M77 F;  5GJV B;  3JCM e;  4M7A B;  4M77 G;  1T0J A;  3CQT A;  1X6B A;  2FO0 A;  2KXD A;  3OYJ A;  4ATO A;  4J9G A;  2FZC B;  1EIF A;  2OTJ Q;  2V1Q A;  4OML A;  3L2R A;  1VUB A;  3M0S A;  3I55 Q;  2PQW A;  2DD5 A;  1RAC B;  4OVA A;  4LUD A;  1UGP B;  1TTH B;  5FRN A;  4OB3 B;  2OTJ A;  2LNH B;  1JXO A;  5ECA A;  3G7Z A;  3I55 A;  1WFW A;  5LJ5 g;  3EH1 A;  1J3T A;  2AZV A;  1SHG A;  4M75 F;  4C92 E;  1SSH A;  5I11 A;  4M75 G;  3VYH B;  3EGD A;  3RKY A;  3MCA B;  3CCV Q;  3QYH B;  3QG1 A;  2O2O A;  4JUV A;  2LX7 A;  2F2W A;  1OPK A;  2COZ A;  1JJ2 S;  2JOY A;  3QUI A;  4HVV A;  2K3B A;  4HCZ A;  3ZFJ A;  2H3E B;  1OV3 A;  1R77 A;  3I5R A;  3M0T A;  4PL6 A;  3JCM V;  3CCV A;  5GMK e;  1NPP A;  2EJG A;  3KXT A;  3RMQ A;  4C92 C;  2HDA A;  3CXC P;  2J6F A;  2MMP A;  5L8R E;  2KBT A;  4ELZ C;  5GAM j;  2DRM A;  2ED0 A;  1GBR A;  3PMT A;  3R6O A;  2RHI A;  4A4K A;  4TVR A;  2WAC A;  2FZG B;  2ZPH B;  1WZO A;  4FT4 A;  2IPO B;  2LVM A;  4QVD A;  1OI1 A;  3RMS A;  2YUP A;  3THK A;  2K5L A;  1WQ7 A;  4FYX B;  5CIU A;  4M77 A;  2FG0 A;  4WTO B;  3BDU A;  4ZGE B;  1Q81 R;  3M4Y A;  1D3B B;  4A54 A;  4OMQ A;  3RBB B;  3JCM c;  3M54 A;  3QZ9 B;  4WF2 A;  3PMI A;  4GLM A;  3PTA A;  2NWM A;  4VUB A;  1M30 A;  5GMK m;  1KD1 R;  2QEX Q;  2RJC A;  1QWF A;  3HP9 A;  2OTL T;  3S3N A;  1UGV A;  4OP0 A;  5GAN h;  3CBO A;  4M78 D;  2CT4 A;  4J6W A;  2CZ6 B;  2DBK A;  4AG2 C;  5GAM g;  4HCK A;  1QKW A;  1VQK Q;  4J9D A;  2PZ1 A;  4CC4 B;  1E7O A;  2RA2 A;  1ZLM A;  1BCM A;  2AZS A;  2RF0 A;  2QEX A;  4M75 A;  2J05 A;  1UGR B;  3SWN A;  4AFQ C;  1WGS A;  1VQK A;  4CC7 A;  4Y28 E;  4CC2 A;  2WSF E;  3NMZ C;  2DVJ A;  3DB3 A;  4RTV A;  3L2Q A;  5LJ5 h;  2DX1 A;  2RN8 A;  1M3C A;  2EYX A;  1ZUY A;  2E70 A;  1KJW A;  2G6F X;  1VYT A;  1NYF A;  2L0A A;  4C5I A;  2VB6 A;  1K8A U;  2DIG A;  1K73 C;  2ESW A;  1U1T A;  3EGD B;  3INZ A;  1D09 B;  2CP5 A;  4JS4 A;  2B86 A;  4IUP A;  2K3X A;  5A0L A;  2DXB A;  1K8A R;  3LX7 A;  4BE1 A;  1TH7 A;  4Z89 A;  2J7I A;  5LJ3 f;  3UPU A;  3OMG A;  4HT8 A;  3UT1 A;  4IUT A;  1VQ7 T;  2JNG A;  2GBQ A;  4J9B A;  4B9W A;  2KQW A;  2P4R A;  2HBP A;  1N27 A;  1C6V X;  1ZSG A;  2COW A;  2RQV A;  2DE0 X;  4C92 F;  1BI2 A;  1RL2 A;  2RJE A;  3F70 A;  4C92 G;  3VUB A;  1NBE B;  2PU9 B;  1TUD A;  3AHU A;  1BIA A;  1UEC A;  2OTL Q;  1M2V A;  4JDS A;  4C0Z A;  4JPB W;  3P8H A;  4M77 B;  3X24 B;  2RJD A;  4DBH A;  3PT9 A;  4PFZ A;  1MUZ A;  4BI8 B;  4F04 B;  2D8J A;  2H3J A;  2VC8 A;  2P0Q A;  2OTL A;  2E64 A;  4QT7 A;  4E7I A;  2JN0 A;  5KYU A;  2V8I A;  2EPD A;  2CYZ B;  4Y91 A;  1QVF A;  3P8B B;  1M3A A;  1GL5 A;  2EQJ A;  5GAM h;  3IQL A;  4D6W A;  3OYK A;  3VS0 A;  1B07 A;  4J7F A;  3CD6 Q;  1IHV A;  4M7D D;  1RAD B;  2ZPG B;  2PUO B;  4JJB A;  1YCS B;  4E2F B;  3OYN A;  1G3Y A;  4M75 B;  3D7S B;  3HSB A;  1XOV A;  2RMO A;  4OMN A;  3RIR A;  5GAO m;  1KHC A;  3SWN B;  3CD6 A;  3R6N A;  1X69 A;  5D7U A;  1AHJ B;  3JCM g;  1K9M C;  3J7A F;  1NEB A;  1PRM C;  3EAE A;  2F2X A;  3EG9 A;  1UFF A;  2K7A A;  1KG1 A;  1I5L A;  1U5S A;  1M4Z A;  5FU7 C;  4ZTF A;  3FIF A;  4QQ6 A;  3CXC S;  5GMK j;  5J3B A;  2RQR A;  1WLP B;  3A5Z B;  4YTL A;  5IN1 A;  1VQ7 Q;  1BI3 A;  5GAN 6;  2GNC A;  1AZE A;  3FJ5 A;  2RQW A;  4C92 A;  1UG1 A;  1GCQ C;  3QO3 A;  1NYG A;  2ROL A;  3CPF A;  1S72 T;  2C06 A;  2P0P A;  1H3Z A;  5L23 A;  1VQ7 A;  2A0F B;  2DTH A;  2OAW A;  2FL7 A;  1PD1 A;  1M5Q 1;  1OZ3 A;  1WDX A;  1X01 A;  4F16 A;  1SRL A;  2EIF A;  1W6X A;  2D8H A;  1Q86 C;  2DZ9 A;  2DRK A;  3S6W A;  3OYL A;  2DNU A;  5CAI A;  2FYK A;  3QWY A;  5KE3 A;  3GBQ A;  1YWP A;  5CQX A;  5LJ5 d;  3TU4 K;  1V76 A;  4OMF B;  3CCU T;  1Y71 A;  2HKN A;  3OMC A;  4PLI A;  3X26 B;  4QQD A;  2GQI A;  4CC3 A;  1BCO A;  1QP2 A;  3EGX A;  3FB9 A;  1O9S A;  1PSF A;  1M2V B;  1HXD A;  1FWZ A;  2RK2 A;  3CEY A;  2X9H A;  1NLP C;  2QGF B;  1IO6 A;  3E2U A;  3M0U A;  4KUD K;  1JB0 E;  4L6V 5;  1WJQ A;  4PK4 A;  3QKJ A;  4J9F A;  2F1L A;  1QP3 A;  2IVW A;  2Y4X A;  2DXC A;  3JB9 D;  2JJ9 A;  5KCO A;  5KYX A;  1BI1 A;  1W4S A;  4EMK C;  3QDR B;  2D6F A;  2LTO A;  1M1G A;  1M8V A;  1VQO Q;  4DBF A;  3G4S T;  1VYU A;  5J26 A;  1ZBJ A;  1SSF A;  4PNO A;  3UWN A;  2DYB A;  2XHC A;  1X6O A;  1QCF A;  3LGF A;  2RI3 A;  3JCM X;  2VWF A;  4PLL A;  2ED1 A;  5GAN 3;  3OY9 A;  4A53 A;  1VQO A;  1WHM A;  3CCQ Q;  2BUD A;  5GAO q;  3TRE A;  4CI0 C;  3MPU B;  2DIQ A;  3UDC A;  3MEU A;  3ER0 A;  1KC8 U;  4EIK A;  3V8K A;  3HFO A;  2CH4 W;  2ZZD A;  2DKG A;  3CC4 T;  1S72 Q;  4GBQ A;  2OAU A;  4BE0 A;  2DL8 A;  5C6S A;  4Q5W A;  3CCQ A;  2K9G A;  1EFN A;  1KC8 R;  3CCE T;  1JO8 A;  2FPF A;  2JM8 A;  1H92 A;  2X4Y A;  4RCC A;  3HKS A;  4J9I A;  1S72 A;  2CP7 A;  2DA9 A;  4MMK A;  5GAM d;  4C92 B;  2R57 A;  2I0N A;  1O75 A;  2KT1 A;  5EG2 A;  1K0S A;  1YFN A;  4LUE A;  3EHR A;  1T3L A;  3MHX A;  1M3B A;  3HFN A;  4ZN3 A;  4JRQ A;  3A8G B;  1ZUK A;  4E47 A;  1Q81 C;  3A8L B;  8ATC B;  3J81 E;  1OEB A;  1FXX A;  3CCU Q;  3SHW A;  3SWN C;  1H3H A;  2CZ0 B;  2EVR A;  1VQ9 T;  2R58 A;  1X2K A;  1SG5 A;  4FW1 A;  2JTM A;  3QJ6 A;  1Q7Y R;  1KD1 C;  4XK8 E;  4RG2 A;  5D6X A;  3QBY A;  2DD4 A;  5I22 A;  1IGQ A;  2E6Z A;  3CCU A;  1E6G A;  3GLX A;  2QI2 A;  1K9M R;  3VKI A;  1LVK A;  1FX7 A;  1Q82 U;  2D0Q B;  5D6Y A;  4QVC A;  2OX7 A;  3MET A;  3FDR A;  3NFC A;  3EGX B;  2Z0W A;  1UHF A;  4XTX A;  1I1J A;  4RCB A;  2HAX A;  2BE7 D;  4C0D B;  2E3I A;  1NPR A;  4OGC A;  3MEV A;  1BI0 A;  4MZT A;  3OSV A;  2RO0 A;  4KGZ B;  1TG0 A;  2CSQ A;  3URG A;  4RTX A;  3EG0 A;  3BW1 A;  4J7I A;  4IKF A;  5KYX B;  3C4S A;  2EW3 A;  2GF7 A;  3LW5 E;  3OYA A;  3EFO A;  4DEX A;  2K57 A;  4LXC A;  5J39 A;  3HTR A;  2E65 A;  2KAF A;  1ZA2 B;  4J9E A;  2LJ3 A;  3CC4 Q;  4E6R A;  4DOW A;  1D3B A;  1RAF B;  1YBY A;  2QDY B;  2DJQ A;  2RB6 A;  4IIM A;  4A63 B;  4BUG A;  2HSP A;  1FMW A;  4AT1 B;  4F7U E;  1XNI A;  1X27 A;  3OYC A;  4FYV B;  3S3M A;  3WXM B;  3VJP A;  4XTZ A;  3CC4 A;  1GCQ A;  2CRE A;  1K8A C;  1AEY A;  2DJZ A;  4PJO D;  1NM7 A;  3M0Q A;  5GMK i;  2BIV A;  1VQ5 Q;  1VQ4 T;  2DPP B;  2CP3 A;  3WVE B;  1IB8 A;  3PVL A;  4XTW A;  4AFU C;  3EFR A;  2JMC A;  2ZPF B;  2GTJ A;  1VQ5 A;  5CKE A;  4LDX A;  4JJD A;  4KT0 E;  1RAE B;  2M16 A;  4X9C A;  2YRV A;  1OU8 A;  2AIR B;  1WYX A;  2PVD B;  1ZUU A;  2MK5 A;  3M0R A;  2JTE A;  2YUQ A;  2MOX A;  3A8H B;  4E7S A;  2CP2 A;  1OUL A;  2A7Y A;  2ECZ A;  1A0N B;  3V7S A;  1WHL A;  4FIB A;  1D0X A;  3OS0 A;  2EYZ A;  2BTT A;  3G1J A;  2LP5 A;  1M1F A;  2M0O A;  2ABL A;  4C8Q F;  5GJW B;  4C8Q G;  2QTX A;  4IUQ A;  2LQN A;  3E1S A;  1RI9 A;  5FWC A;  3C94 A;  4EMK A;  1ZSZ C;  2O01 E;  1AWX A;  2XD0 A;  2RD1 A;  1ZQ1 A;  3CCJ T;  4XTU A;  5GAN 7;  2KY9 A;  2EYQ A;  1PNJ A;  1BBZ A;  5IXF A;  4ELY C;  1U06 A;  3G6E T;  4NS5 A;  5CO7 A;  1BB9 A;  3RNJ A;  2O88 A;  4RTW A;  2M02 A;  3HRT A;  2ZCF B;  1GFC A;  2K5I A;  4J9C A;  3ZL7 C;  2GQV A;  1X2Q A;  3EFO B;  3VV0 A;  4EDU A;  1KFZ A;  4PJM A;  3LGL A;  5FW9 A;  5FU7 B;  2BZY A;  1I81 A;  2KNB B;  4E7H A;  3L2Z A;  3UA6 A;  3O5Z A;  3CME T;  1VQ4 Q;  4OF1 A;  4MZP A;  3M5A A;  3BDL A;  1UJY A;  3UF4 A;  2VVK A;  1M1K U;  2AK5 A;  1YJN T;  4A4H A;  1T0H A;  1JEG A;  4ANJ A;  5LJ3 e;  2H8H A;  5A0D A;  2XDD A;  4HKE A;  1G2B A;  2JMA A;  1QWE A;  2E10 A;  4O6J A;  1VQ4 A;  2YUN A;  1MV3 A;  4FM4 B;  4C0D C;  3M0P A;  5FLX E;  2YLC A;  1OPL A;  4XAX B;  1AWJ A;  4V2S A;  4QVZ A;  3M57 A;  2MAM A;  2QQB A;  1KHI A;  3OA6 A;  2MWP A;  1QVG A;  4F7U F;  4FYW B;  2RPN A;  4F7U G;  4ME7 A;  4Z8A A;  1MND A;  4C8Q A;  2QDL A;  3LLR A;  2HQE A;  1AWO A;  4A4G A;  1G3T A;  1JQQ A;  2MF2 A;  2KVQ G;  4DBR A;  1YJ9 T;  5FRO A;  4J6X A;  2AHJ B;  1IHW A;  1LOJ A;  1Y57 A;  2DFU A;  3CCJ Q;  3AT1 B;  4N4G A;  4HVU A;  2CSI A;  3G6E Q;  2CDT A;  2JZ2 A;  2D0N A;  4MML A;  4FYY B;  3CCL T;  1LNX A;  2G3R A;  3L2U A;  3CCJ A;  1VIE A;  2JXB A;  4EMK B;  2A36 A;  2GFU A;  2LZ6 B;  4ZGD B;  1NE8 A;  2C0O A;  2EBP A;  2LQ8 A;  2NUZ A;  4KH1 B;  3CCS T;  1QVF S;  3VU3 C;  3G6E A;  3O8V A;  4M78 F;  2KMT A;  1VYV A;  1TUG B;  3CME Q;  2YWW A;  1ZA1 B;  1JBM A;  5CKD A;  2HZY A;  2J6O A;  3OS1 A;  4RKU E;  3QXE B;  2DLP A;  1PC0 A;  2XIC A;  2X51 A;  1YJN Q;  1MMG A;  4Y92 A;  2F5K A;  4OB1 B;  4Z88 A;  4LDY A;  1W2B A;  1KC8 C;  4C5H A;  2XID A;  3M59 A;  3CME A;  3I35 A;  2RQU A;  1SF9 A;  1Y7X A;  3A8M B;  5KH6 A;  2XDP A;  1X75 C;  1QQJ A;  1D1A A;  3JSC A;  1ZX6 A;  1YJN A;  1QVP A;  4D8D A;  4JZ3 A;  1B34 A;  2LJ0 A;  2FHD A;  4OMM A;  4F7U A;  2W0Z A;  3QJY A;  3QSU A;  5FU6 B;  1H64 1;  4BDY A;  4M7A D;  2L3P A;  3DKM A;  2O4X A;  2NYS A;  4ZGJ B;  1EZZ B;  3V8L A;  1F1B B;  3QHS A;  3VS5 A;  3CC7 T;  2EAY A;  1OYX A;  1WIE A;  1Q7Y C;  2V26 A;  1YJ9 Q;  4DBQ A;  2XU8 A;  2L89 A;  3OYI A;  1UJ0 A;  2QA4 T;  3HRS A;  2AKK A;  2L3Q A;  4C8Q B;  1YJ9 A;  1FMV A;  2Y4Y A;  5I21 A;  2JS2 A;  2GGR A;  4PJL A;  2JUF A;  2DF6 A;  3E9F A;  3CCL Q;  1Q82 C;  3VYG A;  2QAS A;  1UB4 A;  2IIM A;  5FRM A;  1ZSZ A;  2K2M A;  3MJX A;  3VRY A;  5GAN d;  4KRT A;  2NUT B;  1KQ2 A;  3CCS Q;  1OQK A;  3CBP A;  2KGT A;  2E41 A;  3EG1 A;  3EFS A;  4FT2 A;  3CPW A;  3M4G A;  3CCL A;  3G71 T;  2ZPB B;  1M27 C;  3C12 A;  1BIB A;  5IXB A;  2DL3 A;  4BD3 A;  1VQP T;  3MEA A;  3X28 B;  1WHG A;  3CCS A;  2WSE E;  2LCL A;  3JCM J;  4II1 A;  4K11 A;  4R0K A;  2RI5 A;  2PNI A;  2VXF A;  3L2W A;  3JCM Q;  3A1P A;  1M2O A;  2J06 A;  2XMF A;  1PWT A;  4M7D F;  1KQS P;  3P8D A;  5GMK l;  2SRC A;  4M7D G;  5LJ3 j;  2QG9 B;  4IUU A;  1YIT T;  1UEB A;  4BAC A;  2XKO C;  2YDL A;  4QKU A;  4LDW A;  2FRY A;  1IRE B;  5GAN f;  3H0H A;  3H0I A;  2M1H A;  4RG8 A;  1K1Z A;  1Q95 G;  3CC2 T;  4PFP A;  2EYY A;  2RI2 A;  1MMA A;  3CC7 Q;  3VS6 A;  3TCJ A;  2MIO A;  1B34 B;  3DLL A;  4F7U B;  2QTV A;  3RKX A;  3TQ7 P;  2QA4 Q;  1BU1 A;  2VXE A;  1QW1 A;  2O4X B;  3CC7 A;  1Y07 A;  4BI3 A;  3H41 A;  3LYI A;  4Z02 A;  1ABQ A;  2XG8 D;  2DK3 A;  5LJ5 f;  3FEO A;  5LJ3 g;  1Y96 A;  4AMC A;  2VGM A;  1G8X A;  2RM4 A;  3JCM h;  2QA4 A;  4KGX B;  4LDU A;  2ZPI B;  2QQS A;  1PSE A;  2MYS A;  1WI7 A;  1AT1 B;  2JVV A;  5HK3 A;  1TUC A;  1QLY A;  2P4T A;  1E6H A;  2EGA A;  2KR3 A;  2EFI A;  3NGP A;  3FLG A;  1PKT A;  3RES A;  3OBW A;  3TSZ A;  2CT3 A;  1X6G A;  5IT9 E;  3NHN A;  1WPY A;  3OYG A;  1I5O B;  2R5A A;  3G71 Q;  5GAO n;  2DXT A;  4JZ4 A;  3DLM A;  1VQP Q;  1N6A A;  4RUG A;  2HNI A;  1RAB B;  2FPD A;  1QVG P;  2JS0 A;  1ZSZ B;  1NG2 A;  1SEM A;  5CVI A;  1NJI U;  5FU6 C;  4C8Q E;  4L5G A;  3G71 A;  3VS1 A;  1IXD A;  3OYH A;  2KI7 A;  3GNG A;  2FEI A;  4M7D A;  2NUP A;  5GAN 2;  1YHQ T;  1UGS B;  4UC4 A;  1VQP A;  3KFV A;  2KK4 A;  3VRZ A;  1K76 A;  3QPH A;  2E4H A;  1NJI R;  2X4W A;  3QDF A;  1PHT A;  1YIT Q;  1TU0 B;  4JS5 A;  4XU0 A;  4JJN K;  5HKC A;  4N4I A;  1HD3 A;  1GRI A;  3JB9 F;  4PJO E;  5CKB A;  3OS5 A;  3PE0 A;  2O9V A;  3JB9 G;  2K6D A;  2ZGW A;  1D0Z A;  5GMK h;  2HL3 A;  4C8Q C;  2DMO A;  3EG2 A;  1YIT A;  5IHK A;  3MKD A;  5IHI A;  3OW2 A;  3CC2 Q;  5D6W A;  3ZBD A;  1YIJ T;  1S1N A;  1UTI A;  3I55 T;  1JRI A;  2LQW A;  1M1K C;  3VS7 A;  2F2V A;  4M77 D;  2C0I A;  4J83 A;  1N9S A;  1K9A A;  2A28 A;  1B3Q A;  1CSK A;  5GAM f;  3FRN A;  4JLG A;  2CS7 A;  3CC2 A;  1BKB A;  1FYN A;  2DAQ A;  3G4S Q;  5C0M A;  4RMO A;  3L2V A;  1Q82 R;  4PJO C;  1GCP A;  2E5K A;  4XQ3 A;  1TXQ A;  3GNF B;  2CH4 A;  4FSS A;  4HT9 A;  4J8O A;  1PKS A;  3CBM A;  4E7L A;  1WX6 A;  1I8F A;  1OX8 A;  2B8A A;  3QYG B;  2OI3 A;  3G4S A;  1IRX A;  1W2B P;  2KYB A;  6AT1 B;  3RDV A;  2CZ1 B;  2K5F A;  1VQL T;  2Y90 A;  4M75 D;  4N0A A;  5LJ3 h;  1M90 U;  2EGC A;  1JU5 C;  5I2S A;  2ATC B;  1Y96 B;  5CCA A;  3Q1J A;  5GAN 8;  1RLQ C;  2X4X A;  4LNP A;  2C0T A;  1U8R A;  3CCE Q;  2E6N A;  5GAO p;  3EGU A;  2P84 A;  1WJS A;  2DIL A;  2D9T A;  2EGE A;  2EQI A;  2J6K A;  2VV5 A;  1YJW T;  2EJ9 A;  1SHF A;  3CCE A;  1YHQ Q;  4CRI A;  3JV3 A;  1WJR A;  2KRN A;  2PVG B;  1NEG A;  1VQM T;  3TEE A;  2K3Y A;  3GIB A;  4FSX A;  1VQ9 Q;  2OJ2 A;  1YHQ A;  3OYY A;  1WHK A;  4A4E A;  3QII A;  4M4Z A;  4O5V A;  4M7D B;  2NUP B;  3T9N A;  4R55 A;  1GBQ A;  2P0K A;  1XJW B;  3L42 A;  1NLO C;  2ZPE B;  3I5S A;  2QEX T;  1MGQ A;  1YIJ Q;  1VQ9 A;  2KRM A;  2FB7 A;  2GTO A;  3JCM d;  1D1C A;  2A3L A;  5CKF A;  2KT8 A;  1AVZ C;  1XQH A;  3MP1 A;  1NZ9 A;  2CUD A;  4M78 E;  4X1V A;  2VKN A;  1VQK T;  4KUL A;  4HCB A;  5AT1 B;  3CPW P;  3RUX A;  2XI9 A;  2DEQ A;  1YIJ A;  2YSQ A;  3ME9 A;  2YUO A;  4EMG A;  1B7T A;  3HRU A;  1N9R A;  1SKU B;  2X3W D;  1KQS A;  2RHU A;  5KYY A;  2QXF A;  2CP0 A;  1RAG B;  2YRC A;  4LN2 A;  2JM9 A;  4HCC A;  2F69 A;  3KBG A;  1TOV A;  1KSW A;  1RI0 A;  1BYM A;  1WXU A;  1N8R U;  1MMD A;  3HHT B;  3UA7 A;  4M78 C;  1VQL Q;  1C0M A;  5CR2 A;  1G83 A;  4MDW A;  3H6Z A;  4PJO F;  4BB7 A;  4EPC A;  2KE9 A;  4PJO G;  1OU9 A;  4DQ2 A;  3OS2 A;  4IUR A;  1N5Z A;  1N8R R;  5AYF A;  9ATC B;  3JCM P;  2GCX A;  3JCM f;  1QCN A;  4JRP A;  4QW2 A;  4BY6 C;  1VQL A;  3OYM A;  1CKB A;  4E7Z A;  5DM7 R;  1YJW Q;  3E9G A;  2O9S A;  4GY5 A;  1QVG S;  2AT1 B;  2LQK A;  1BK2 A;  4KGV B;  1Q81 U;  2F5T X;  3VUZ A;  4FL6 A;  2W10 A;  4RTU A;  5CKH A;  1K0X A;  1LPL A;  1TS9 A;  1C1A A;  4XU2 A;  4KBM B;  1VQM Q;  3BY7 A;  1WHJ A;  1YJW A;  2DL5 A;  3MP8 A;  4LDV A;  2CP6 A;  1UGQ B;  4EMH A;  1KD1 U;  4NL3 A;  1JJ2 A;  3ULR B;  3JCM b;  1M1K R;  2DZC A;  2EJF A;  2LX9 A;  2QAZ A;  3PIO A;  2FVU A;  1P92 A;  2VUB A;  3S3O A;  4PFO A;  1VQM A;  5KCH A;  1RAH B;  2DEU A;  3QZ5 B;  1U3O A;  4C92 D;  1KIK A;  1AWW A;  1CKA A;  2IG0 A;  1EX4 A;  1T3S A;  4XU3 A;  4L59 A;  2LT4 A;  3X25 B;  3V7C A;  1ACM B;  1RAA B;  3REB B;  3PGG A;  1UHC A;  5LJ3 d;  5A2Q E;  1X43 A;  2L3R A;  2DL4 A;  2LNV A;  1R0C B;  2RK1 A;  2V1R A;  2DYI A;  3REA B;  5CK9 A;  1HSQ A;  3SD4 A;  3JAM E;  1UE9 A;  2RHZ A;  3DB4 A;  3CD6 T;  2M0Y A;  4M7A E;  2NUT A;  4M7D E;  1MHN A;  1TWB A;  1G3S A;  4QQG A;  4PJO A;  4KUI A;  1ZHI A;  4DEY A;  4XTV A;  3A8O B;  2LC4 A;  1W2B S;  2KXC A;  3N5B B;  2L5Q A;  4P5N A;  3PFS A;  1I4K 1;  4RTY A;  2LCS A;  5KYN A;  5KYY B;  3CCR T;  1OZ2 A;  4OMO A;  4IUV A;  4BE2 A;  2EWN A;  2K2V A;  2YXY A;  2D1X A;  4NL2 A;  1TSF A;  1RUW A;  4JJC A;  2HMA A;  3SB2 A;  2KDS A;  2COY A;  3MP6 A;  4ZNX A;  4M7A C;  4M7D C;  3OW2 P;  2HCK A;  2EYW A;  4J9H A;  4JRK A;  4M78 G;  3CCM T;  4BI4 A;  2DBM A;  1WXB A;  5M9O A;  4AFZ C;  2DTO A;  2LJ1 A;  2YRD A;  1AOJ A;  2DTI A;  1MMN A;  3GP8 A;  2CZ7 B;  3SFM A;  4FCY A;  3FJP A;  3EHQ A;  4J5Y A;  3GOX A;  1AZG B;  1MV0 B;  2BZX A;  4HVW A;  2KRS A;  4GLK A;  5EC7 A;  1UUE A;  2VGN A;  1Z9Z A;  4OB0 B;  5KYW A;  2MPX C;  2LCC A;  5DLQ E;  1D1B A;  2A37 A;  5I2M A;  1K4U S;  1VQ8 T;  1OOT A;  3GF5 A;  1NJI C;  5GAN 5;  1JXM A;  5IH2 A;  1PCX A;  4HA8 A;  4XU1 A;  2HQH A;  4PKC C;  2WSC E;  1I07 A;  3MO8 A;  4FU6 A;  3CPW S;  4X9D A;  5CQY A;  1VQ6 T;  4JLI A;  4C0F A;  2RQT A;  2ENM A;  2VAS A;  2HL5 C;  5KE2 A;  3CMA T;  3M58 A;  3ZEH A;  1RLP C;  2V8K A;  2RNA A;  1YNZ A;  2YT6 A;  2DER A;  2CKK A;  2X35 A;  1WQW A;  2EQU A;  7AT1 B;  2RH2 A;  5GAN e;  4N0A C;  1VA7 A;  4OB2 B;  3JCM W;  1PD0 A;  2ROT A;  1I0C A;  3OYB A;  3H0F A;  4IIO A;  4ESR A;  2HQX A;  3PIP A;  5HK0 A;  2DL7 A;  4HXJ A;  3CCR Q;  1QMC A;  3TSW A;  2EQM A;  2RHX A;  3EH2 A;  1VQO T;  2LT1 A;  1YWO A;  3HPW A;  2DO3 A;  3OYD A;  4M78 A;  2L8D A;  4PJO B;  4AG1 C;  5HY6 A;  1YI2 T;  3NTK A;  3GPL A;  3CCR A;  2FRW A;  2YLB A;  2XDB A;  3CCM Q;  2L3S A;  2CGH A;  1G3W A;  3CCQ T;  4LD6 A;  2JT4 A;  5DY9 A;  5LJ5 e;  3H8Z A;  2GFA A;  2FZK B;  4R56 A;  3SDZ A;  3M53 A;  3I56 T;  1QCO A;  2M51 A;  3VS4 A;  4ZN1 A;  4ZTJ A;  2DET A;  4XTY A;  5IAY A;  4LE9 A;  3ASK A;  4J6Y A;  3CCM A;  4LD9 K;  3X20 B;  2NLU A;  2QGG A;  1M90 C;  1UDL A; 
#chains in the Genus database with same CATH homology
 4M7A F;  3LX7 A;  4BE1 A;  1TH7 A;  5D6W A;  5LJ3 f;  2EQK A;  4C8Q G;  3OMG A;  3ZBD A;  3LWI A;  2QTX A;  3UPU A;  1YIJ T;  2E1H A;  2PUK B;  4IUT A;  4IUQ A;  3UT1 A;  4A4F A;  2JNG A;  1JRI A;  3I55 T;  1VQ7 T;  1M1K C;  3WVD B;  4B9W A;  3E1S A;  4M77 D;  2KQW A;  3C94 A;  4J83 A;  4EMK A;  2HBP A;  1N27 A;  1N9S A;  2O01 E;  2XD0 A;  2RD1 A;  2DVE A;  2E5Q A;  5GAM f;  3FRN A;  1ZQ1 A;  3CXC A;  4JLG A;  2LDM A;  4XTU A;  4C92 F;  5GAN 7;  3CCJ T;  2CS7 A;  2KY9 A;  3CC2 A;  1BI2 A;  1BKB A;  1RL2 A;  2DAQ A;  2EYQ A;  2RJE A;  3F70 A;  4C92 G;  3M9Q A;  5C0M A;  4RMO A;  1XTD A;  2RHY A;  3L2V A;  4PJO C;  3VUB A;  1M9S A;  1ZBX A;  4ELY C;  2LRQ A;  4XQ3 A;  3G6E T;  4NS5 A;  2PU9 B;  3GNF B;  5CO7 A;  4HT9 A;  4J8O A;  3HRT A;  3AHU A;  2ZCF B;  2K5I A;  5LL6 S;  1VQN T;  3CBM A;  4E7L A;  2KSS A;  1I8F A;  1VQ8 A;  1BIA A;  2GQV A;  4C0G A;  4C5G A;  2B8A A;  3QYG B;  3G4S A;  4JDS A;  4C0Z A;  1K73 U;  3P8H A;  4M77 B;  2CZ1 B;  3VV0 A;  4EDU A;  2X4J A;  3V7R A;  5GAN 4;  5A0G A;  2K5F A;  3X24 B;  1VIF A;  2RJD A;  3OBY A;  1VQL T;  3LGL A;  3PT9 A;  2Y90 A;  5FU7 B;  4M75 D;  1I81 A;  4E7H A;  3NTH A;  3L2Z A;  4N0A A;  5LJ3 h;  1M90 U;  3CME T;  2RJF A;  1VQ6 A;  4BDZ A;  4BI8 B;  5I2S A;  5GAO r;  4OF1 A;  4MZP A;  2H3J A;  2VC8 A;  1Y96 B;  3M5A A;  2P0Q A;  2OTL A;  3BDL A;  2E64 A;  4E7I A;  5CCA A;  3Q1J A;  5GAN 8;  2X4X A;  1M1K U;  1U8R A;  2JN0 A;  2V8I A;  2CYZ B;  2PVO B;  2E6N A;  4M77 E;  4Y91 A;  3P8B B;  4A4H A;  3CMA A;  1YJN T;  1QVF A;  2EKO A;  2E12 A;  2EQJ A;  5GAM h;  4D6W A;  5GAO p;  3OYK A;  5LJ3 e;  3HL8 A;  5A0D A;  2XDD A;  1WJS A;  4HKE A;  4MZM A;  2D9T A;  4J7F A;  2E10 A;  4O6J A;  2VV5 A;  4M7D D;  2ZPG B;  2PUO B;  1VQ4 A;  1YJW T;  2EJ9 A;  2JTF A;  4FM4 B;  4C0D C;  3OYN A;  1HK9 A;  3CCE A;  1G3Y A;  2YLC A;  5FLX E;  5GAM e;  4CRI A;  3NTI A;  4M75 B;  3JB9 H;  4XAX B;  3HSB A;  4HT8 A;  1WJR A;  1XOV A;  3RIR A;  4V2S A;  4QVZ A;  5GAO m;  3M57 A;  2MAM A;  1KHC A;  2PVG B;  3SWN B;  3JB9 I;  3CD6 A;  2QQB A;  1KHI A;  3OA6 A;  3OW2 S;  3TEE A;  2MWP A;  1VQM T;  2K3Y A;  1AHJ B;  3JCM g;  3GIB A;  1K9M C;  4FSX A;  1QVG A;  1GXI E;  3J7A F;  3EAE A;  1IZ6 A;  4F7U F;  4M77 C;  3JRZ A;  4MDX A;  1YHQ A;  1KG1 A;  3OYY A;  4F7U G;  4ME7 A;  1U1S A;  4M75 E;  4A4E A;  4M78 B;  3QII A;  3LLR A;  4O5V A;  1M4Z A;  5FU7 C;  4C8Q A;  1YI2 A;  1N8R C;  2HQE A;  3T9N A;  4M7A A;  4M7D B;  4ZTF A;  4C5E A;  4R55 A;  3FIF A;  4A4G A;  4QQ6 A;  1G3T A;  3PNW C;  4B9X A;  3CXC S;  5GMK j;  5J3B A;  2P0K A;  2MF2 A;  2KVQ G;  3L42 A;  3A5Z B;  2ZPE B;  4YTL A;  3V8J A;  4DA4 A;  3J80 E;  1MGQ A;  2QEX T;  1YJ9 T;  1VQ9 A;  5IN1 A;  2FB7 A;  1BI3 A;  5FRO A;  2BKD N;  5GAN 6;  3JCM d;  2A3L A;  4X34 A;  5CKF A;  2QQ9 A;  4J6X A;  1XQH A;  3BFM A;  3C95 A;  3MP1 A;  3OB9 A;  1NZ9 A;  4BY6 B;  3I56 A;  4C92 A;  2AHJ B;  2K4Y A;  4N4H A;  1LOJ A;  4M78 E;  1VQK T;  4HCB A;  4KUL A;  3QO3 A;  3CPF A;  3E19 A;  1S72 T;  3L1A A;  2C06 A;  2P0P A;  1VQ5 T;  3RUX A;  1H3Z A;  4N4G A;  2XI9 A;  2DEQ A;  1YIJ A;  3ME9 A;  1VQ7 A;  2DTH A;  4EMG A;  3HRU A;  2FL7 A;  4M75 C;  1Q7Y U;  1N9R A;  2JZ2 A;  2OTJ T;  4MML A;  1KQS A;  1YIT A;  1M5Q 1;  2RHU A;  1OZ3 A;  3CCL T;  1LNX A;  2G3R A;  2QXF A;  1X01 A;  3L2U A;  2EIF A;  3CCJ A;  1K9M U;  1VIE A;  4EMK B;  2GFU A;  1Q86 C;  2DZ9 A;  4ZGD B;  1NE8 A;  2MI6 A;  4HCC A;  2F69 A;  2LQ8 A;  3KBG A;  3CCS T;  3S6W A;  2M9U A;  1QVF S;  3VU3 C;  4DOV A;  1DJ7 B;  3G6E A;  1RI0 A;  4OGE A;  3OYL A;  1BYM A;  5CAI A;  2FYK A;  3HHT B;  1N8R U;  4M78 C;  3OYE A;  5KE3 A;  2QQR A;  1KQ1 A;  5CQX A;  4JRI A;  5LJ5 d;  3TU4 K;  3O8V A;  4M78 F;  5CR2 A;  2KMT A;  1VQN A;  4MDW A;  3H6Z A;  4OMF B;  5GAO l;  4PJO F;  1V29 B;  2XK0 A;  4BB7 A;  4EPC A;  4PJO G;  1JBM A;  5CKD A;  2R5M A;  3M55 A;  3CCU T;  1Y71 A;  3OS1 A;  3OMC A;  4RKU E;  3QXE B;  4PLI A;  2XIC A;  4DQ2 A;  3OS2 A;  4IUR A;  3X26 B;  4QQD A;  5AYF A;  3JCM P;  1QP2 A;  2GCX A;  3JCM f;  4JRP A;  2F5K A;  3FB9 A;  1O9S A;  3OSS C;  4OB1 B;  1PSF A;  4QW2 A;  1YCY A;  4BY6 C;  3FC3 A;  1HXD A;  1FWZ A;  2RK2 A;  4LDY A;  1W2B A;  1VQL A;  2I2L A;  3CEY A;  2DXU A;  3OYM A;  4C5H A;  3CCV T;  1KC8 C;  2XID A;  5GAN j;  3M59 A;  3CME A;  5DM7 R;  4KUD K;  3E9G A;  4GY5 A;  1QVG S;  1Y7X A;  1JB0 E;  2LQK A;  4E7J A;  3A8M B;  1WJQ A;  4L6V 5;  3LH0 A;  3QKJ A;  1G5V A;  5KH6 A;  2XDP A;  1QP3 A;  1X75 C;  1Q81 U;  2IVW A;  2F5T X;  2VYT A;  3JSC A;  1QVP A;  4FL6 A;  3OQ5 A;  3VUZ A;  1YJN A;  2Y4X A;  5CKH A;  2DXC A;  5DLO A;  3JB9 D;  2MWO A;  1B34 A;  3OYF A;  4XU2 A;  4KBM B;  5KCO A;  3RER A;  2FHD A;  2QQA A;  1BI1 A;  4F7U A;  1I5L A;  3QJY A;  1W4S A;  3BY7 A;  3QSU A;  4EMK C;  1YJW A;  3QDR B;  3JB9 J;  1Q86 U;  2D6F A;  3MP8 A;  5FU6 B;  2LTO A;  4LDV A;  1H64 1;  1M1G A;  1UGQ B;  4C8Q D;  4EMH A;  4BDY A;  1M8V A;  1WNL A;  1KD1 U;  3G4S T;  4M7A D;  4NL3 A;  1JJ2 A;  3DKM A;  4E7K A;  5J26 A;  2O4X A;  3JCM b;  1SSF A;  4PNO A;  3M56 A;  3UWN A;  2DZC A;  3KUF A;  4ZGJ B;  3V8L A;  2EJF A;  2LX9 A;  1R8O B;  3PIO A;  3QHS A;  2XHC A;  1X6O A;  2FVU A;  2VUB A;  1P92 A;  3S3O A;  3CC7 T;  2EAY A;  3MEW A;  3RKW A;  3LGF A;  5LJ5 j;  2RI3 A;  1OYX A;  4PLL A;  5KCH A;  3JCM X;  5GAN 3;  3OY9 A;  1VQM A;  1Q7Y C;  3QZ5 B;  2HD0 A;  4A53 A;  4C92 D;  1VQO A;  2XU8 A;  3LWH A;  2IG0 A;  2V8J A;  2BUD A;  2L89 A;  5GAO q;  3TRE A;  4CI0 C;  3OYI A;  2DIQ A;  3UDC A;  1KQS S;  3MEU A;  3ER0 A;  1KC8 U;  2QA4 T;  3V8K A;  3HRS A;  3HFO A;  5GAN g;  2YHT A;  2ZZD A;  2DKG A;  1LJO A;  4NOY A;  4XU3 A;  3CC4 T;  4M77 F;  4L59 A;  2LT4 A;  3X25 B;  4C8Q B;  3V7C A;  3JCM e;  4M7A B;  2OAU A;  4M77 G;  4BE0 A;  3PGG A;  5LJ3 d;  1YJ9 A;  5A2Q E;  2Y4Y A;  5C6S A;  3OYJ A;  4Q5W A;  2L3R A;  5I21 A;  4ATO A;  3CCQ A;  2LNV A;  2JUF A;  3CCE T;  1EIF A;  2RK1 A;  3E9F A;  1VUB A;  3L2R A;  1Q82 C;  3VYG A;  5CK9 A;  1UB4 A;  2X4Y A;  4RCC A;  3HKS A;  3SD4 A;  2PQW A;  2DD5 A;  5FRM A;  3JAM E;  1S72 A;  4MMK A;  2RHZ A;  3DB4 A;  5GAM d;  4C92 B;  4OVA A;  2R57 A;  3CD6 T;  1UGP B;  5GAN d;  1O75 A;  4M7A E;  5EG2 A;  1KQ2 A;  4M7D E;  5FRN A;  1MHN A;  3CBP A;  3MHX A;  2E41 A;  1G3S A;  3EFS A;  4QQG A;  4PJO A;  4FT2 A;  4KUI A;  1ZHI A;  4OB3 B;  3CPW A;  4XTV A;  2OTJ A;  3A8O B;  2LC4 A;  3M4G A;  3HFN A;  1W2B S;  3CCL A;  4ZN3 A;  3G71 T;  2ZPB B;  3G7Z A;  2L5Q A;  3A8G B;  3N5B B;  3I55 A;  4JRQ A;  4P5N A;  5LJ5 g;  3C12 A;  1BIB A;  3PFS A;  1I4K 1;  4E47 A;  1Q81 C;  3A8L B;  3J81 E;  4BD3 A;  4M75 F;  1VQP T;  1FXX A;  4C92 E;  3SWN C;  4M75 G;  3VYH B;  3MEA A;  3X28 B;  2CZ0 B;  3CCR T;  1OZ2 A;  3CCS A;  1VQ9 T;  4IUV A;  4BE2 A;  2EWN A;  2K2V A;  2R58 A;  2WSE E;  2LCL A;  4NL2 A;  3JCM J;  4II1 A;  3RKY A;  3MCA B;  2JTM A;  3QJ6 A;  3QYH B;  3QG1 A;  3SB2 A;  4JUV A;  1KD1 C;  2KDS A;  2RI5 A;  4RG2 A;  4XK8 E;  5D6X A;  2VXF A;  3L2W A;  3JCM Q;  3MP6 A;  3QBY A;  2DD4 A;  4M7A C;  4M7D C;  2E6Z A;  3CCU A;  3GLX A;  2QI2 A;  1JJ2 S;  4M7D F;  3P8D A;  5GMK l;  2JOY A;  4JRK A;  3QUI A;  4M78 G;  3CCM T;  4M7D G;  5LJ3 j;  4HCZ A;  4IUU A;  3VKI A;  3ZFJ A;  4BI4 A;  1FX7 A;  1YIT T;  1Q82 U;  5M9O A;  4PL6 A;  3JCM V;  1UEB A;  4BAC A;  3CCV A;  2D0Q B;  2DTO A;  5D6Y A;  4QVC A;  1NPP A;  2EJG A;  5GMK e;  2XKO C;  3FDR A;  3MET A;  3NFC A;  3KXT A;  3RMQ A;  4XTX A;  2DTI A;  4C92 C;  4LDW A;  4RCB A;  3GP8 A;  2CZ7 B;  2MMP A;  1IRE B;  5L8R E;  4ELZ C;  5GAM j;  5GAN f;  4C0D B;  3SFM A;  2HAX A;  1NPR A;  3PMT A;  4OGC A;  3FJP A;  2M1H A;  3MEV A;  3R6O A;  4J5Y A;  2RHI A;  4RG8 A;  4A4K A;  1BI0 A;  3GOX A;  4TVR A;  2WAC A;  4MZT A;  3CC2 T;  2ZPH B;  3OSV A;  2RO0 A;  4FT4 A;  2RI2 A;  4GLK A;  2LVM A;  3TCJ A;  4QVD A;  1OI1 A;  2VGN A;  3RMS A;  3URG A;  1B34 B;  3BW1 A;  4OB0 B;  4J7I A;  3DLL A;  4IKF A;  2K5L A;  2LCC A;  1WQ7 A;  5DLQ E;  3C4S A;  4F7U B;  2GF7 A;  3LW5 E;  3OYA A;  5I2M A;  3RKX A;  5CIU A;  2K57 A;  4M77 A;  1VQ8 T;  5J39 A;  3GF5 A;  2E65 A;  2KAF A;  3BDU A;  1NJI C;  5GAN 5;  4ZGE B;  2VXE A;  3M4Y A;  1QW1 A;  2O4X B;  3CC7 A;  1Y07 A;  4BI3 A;  1D3B B;  4DOW A;  4A54 A;  1D3B A;  1YBY A;  3JCM c;  3M54 A;  3QZ9 B;  4WF2 A;  3PMI A;  2QDY B;  3LYI A;  4Z02 A;  2RB6 A;  3PTA A;  4HA8 A;  2XG8 D;  4XU1 A;  4BUG A;  2DK3 A;  4PKC C;  3FEO A;  2WSC E;  5LJ3 g;  1Y96 A;  4VUB A;  5LJ5 f;  3MO8 A;  4F7U E;  1XNI A;  4FU6 A;  3CPW S;  4X9D A;  5GMK m;  2VGM A;  5CQY A;  3OYC A;  3S3M A;  1VQ6 T;  2RM4 A;  3JCM h;  2RJC A;  2QA4 A;  4JLI A;  4LDU A;  2ZPI B;  3VJP A;  3WXM B;  2QQS A;  1PSE A;  3HP9 A;  4C0F A;  3S3N A;  4OP0 A;  4XTZ A;  2OTL T;  5GAN h;  3CC4 A;  3CBO A;  1K8A C;  4M78 D;  2CZ6 B;  2JVV A;  4J6W A;  5KE2 A;  5HK3 A;  5GAM g;  2P4T A;  3CMA T;  2DJZ A;  4PJO D;  3M58 A;  2EFI A;  3ZEH A;  3FLG A;  2V8K A;  5GMK i;  2BIV A;  3RES A;  3OBW A;  2CKK A;  2X35 A;  5IT9 E;  2RA2 A;  1WQW A;  1VQ4 T;  1WPY A;  2EQU A;  3OYG A;  2RH2 A;  2QEX A;  4M75 A;  4N0A C;  2R5A A;  4OB2 B;  5GAN e;  3JCM W;  2DPP B;  3OYB A;  3WVE B;  5GAO n;  2DXT A;  1UGR B;  3SWN A;  3DLM A;  1N6A A;  2HNI A;  2HQX A;  4XTW A;  1WGS A;  5HK0 A;  3PIP A;  1VQK A;  3EFR A;  4Y28 E;  2EQM A;  2RHX A;  2ZPF B;  1VQO T;  2WSF E;  5CVI A;  1NJI U;  2LT1 A;  1VQ5 A;  5CKE A;  5FU6 C;  4C8Q E;  4M7A G;  4LDX A;  4L5G A;  3HPW A;  2DO3 A;  3OYD A;  3DB3 A;  4KT0 E;  3G71 A;  4M78 A;  3OYH A;  3GNG A;  3L2Q A;  2L8D A;  4M7D A;  4PJO B;  2M16 A;  4X9C A;  5GAN 2;  2YRV A;  5LJ5 h;  1YHQ T;  1UGS B;  4UC4 A;  1VQP A;  5HY6 A;  2PVD B;  2KK4 A;  1YI2 T;  3NTK A;  3GPL A;  3CCR A;  3QPH A;  2YLB A;  2XDB A;  2X4W A;  2CGH A;  2E70 A;  1G3W A;  3CCQ T;  3A8H B;  4JS5 A;  4LD6 A;  4XU0 A;  4JJN K;  5HKC A;  2A7Y A;  5DY9 A;  5LJ5 e;  3H8Z A;  4N4I A;  4C5I A;  1K8A U;  2GFA A;  2DIG A;  3V7S A;  4R56 A;  1K73 C;  3JB9 F;  4PJO E;  1U1T A;  5CKB A;  4FIB A;  3OS0 A;  3OS5 A;  3SDZ A;  3M53 A;  3INZ A;  3I56 T;  4JS4 A;  3JB9 G;  2ZGW A;  4ZN1 A;  4ZTJ A;  4IUP A;  4XTY A;  5IAY A;  3ASK A;  4J6Y A;  3CCM A;  1M1F A;  5GMK h;  2K3X A;  2M0O A;  3X20 B;  4C8Q C;  5A0L A;  2DXB A;  4LD9 K;  2NLU A;  1M90 C;  4C8Q F;  3OW2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...