3JRZA

Ccdbvfi-formii-ph5.6
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
104
structure length
99
Chain Sequence
b'SQFTLYKNKDKSSAKTYPYFVDVQSDLLDNLNTRLVIPLTPIELLDHLCPTIHIDEGDFIMLTQQMTSVPVKILSEPVNELSTFRNEIIAAIDFLITGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CcdB
publication title Structural and thermodynamic characterization of vibrio fischeri CCDB
pubmed doi rcsb
source organism Vibrio fischeri
molecule tags Toxin
total genus 29
structure length 99
sequence length 104
ec nomenclature
pdb deposition date 2009-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01845 CcdB CcdB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jrzA00
3HPWA 5CCAA 2KMTA 4ME7A 5HK0A 5CKBA 4ELYC 5DLOA 5CR2A 4MDXA 4VUBA 4MZTA 4HKEA 3G7ZA 4ELZC 5CQYA 3VUBA 5HK3A 2C06A 5CKFA 3TCJA 2MF2A 5CO7A 5HKCA 5CKEA 3NFCA 2VUBA 1UB4A 1X75C 3JRZA 3JSCA 4OF1A 4MZPA 5CKDA 1NE8A 5CQXA 4MZMA 1VUBA 1M1FA 5CK9A 5CKHA
chains in the Genus database with same CATH superfamily
4QQDA 5CCAA 3QPHA 1M3AA 1ZSZC 1ZLMA 1K8AU 1QVGP 5GAN4 3M9QA 2XDDA 2PTKA 2EBPA 5DY9A 2K57A 2EQUA 3NGPA 4JJNK 4NOYA 2XDBA 2KSSA 3MEAA 4EDUA 4N0AC 1BCOA 1OX9A 3L2ZA 2EFIA 4OMLA 1WJQA 1UECA 3EG1A 7AT1B 3IQLA 1UFFA 2MAMA 2QGGA 3LGFA 2CP3A 1Z9QA 4EMGA 1ZUUA 1QVGS 4M7DA 4M7AF 5CKBA 5LJ5e 5KCOA 4ANJA 1ZBJA 2ROLA 1G2BA 2V26A 5LL6S 1AOJA 4KBMB 4OGEA 5CKEA 1XJWB 1MV0B 1IB8A 4GY5A 1FXXA 5FW9A 3PVQA 3OQ5A 3CCJQ 3V7RA 5KYNA 1TG0A 2C0OA 2IPOB 2RD1A 4F16A 3QUIA 5GMKm 1ZUKA 2C0TA 2COYA 3CBOA 3CCUT 3CC7T 2MCNA 4C8QC 4HCCA 3A8LB 1T0HA 1WHJA 4WF2A 4L6V5 4DQ2A 1RADB 2DKGA 1U1TA 1U1SA 2K6DA 4QW2A 5GAOn 5GAMg 1ZHIA 4PK4A 2FPEA 2XG8D 2ZZDA 1QLYA 4M77F 3DLLA 3V8JA 1NJIR 5GANh 2DL4A 1VQ6A 4XU1A 3QWXX 1FMVA 1NPRA 2RQVA 4ELZC 2GF7A 2DX1A 3A98A 1GCPA 3UATA 1WPYA 2MK5A 3NFCA 5FRMA 2GBQA 3EG0A 3QG1A 1KQSP 5GANj 2C0IA 3S3MA 5GAN6 3MEVA 3LYIA 3QSUA 1MGQA 4M75D 2J7IA 4ME7A 2MIOA 4X9CA 4IKFA 3SFMA 2I2LA 1BB9A 3EH2A 2RHXA 2LQKA 3ZBDA 1NLOC 2K9GA 1FWZA 2X35A 1VQ5Q 2HQEA 5GMKl 2JTEA 2FO0A 2PNIA 4E7ZA 3PVLA 1SHGA 1X6GA 2PQWA 2RN8A 2PU9B 4LNPA 4RTXA 2HNIA 1M90C 1TUCA 3PIPA 1TUDA 3HPWA 3GNGA 1HD3A 1BCMA 4LN2A 2VYTA 4DA4A 2LP5A 3RBBB 4XTWA 1CSKA 2K3XA 4RG8A 4MDWA 1X2KA 3SWNC 4ZTJA 2PVDB 4N4GA 1M4ZA 2XIDA 2KK4A 3L2UA 2PVGB 2KGTA 4D6WA 2O4XA 1X01A 2OAUA 4RUGA 2H3EB 3CCJT 3PGGA 1YHQT 5C6SA 2XI9A 2AT1B 2KXCA 2ZPBB 1UGQB 5EG2A 2GFAA 3VS3A 3OSVA 3QJ6A 1X75C 4C0FA 4XU2A 2OJ2A 1JXMA 4C92D 2LQWA 3CC4T 2ED1A 4KT0E 5GAN7 3VS6A 1X2QA 3GLXA 5D6WA 3FRNA 1VQNT 4E7KA 3M0PA 3RR6A 4A4KA 4PJJA 1SSHA 3QHSA 4QVZA 5KE3A 3CXCP 5GANd 2KRSA 4F7UA 2DEQA 2CT3A 2ZPFB 2MPXC 2RI5A 1G5VA 4MZPA 2YRDA 5I2MA 1NE8A 2WSEE 2CH4A 1UJ0A 4PJOD 4C5EA 3JCMP 1QVFA 2RF0A 4XAXB 2KQWA 3FJPA 4X34A 2FRWA 2RQUA 5GMKi 3VYGA 2JOYA 1PM3A 3QJYA 2ENMA 5GJVB 2JNGA 3CXCS 3V8KA 1AT1B 1VQ6Q 3L2RA 3VJPA 4PKCC 4E6RA 3LWHA 3E9FA 2F2WA 2Z0WA 2CKKA 3DLMA 4XQ3A 1PCXA 1IHVA 1LNXA 1Y96A 5GMKh 2QYZA 2L0AA 3LGLA 3CCQT 2JUFA 4M75G 5DLOA 1BI2A 1E6GA 3M0UA 1KD1U 2D6FA 1AWOA 2GNCA 2QEXT 2FYKA 2KR3A 3HL8A 4C5HA 4E7JA 2KYBA 5GMKj 1W2BP 2VKNA 4M7AA 3R6NA 3HRTA 3A8HB 1J3TA 2PUOB 5FLXE 2DEUA 4M4ZA 1Q86R 4PL6A 2FZCB 1HJDA 4XU0A 1YI2A 1X6BA 2J6FA 1XOVA 1JJ2S 3TVTA 1N9SA 2DBKA 2EPDA 4LDYA 1JQQA 4M75B 4M78A 4A54A 4J8OA 2Y90A 2QAZA 4C5GA 2J05A 3UF4A 1UJYA 1FYNA 1Y71A 3DB3A 1OZ3A 2BZYA 2G6FX 4ZN1A 3NTKA 1PKTA 1GBRA 1WZOA 3ASKA 4NL3A 4M77A 1N8RU 5LJ5j 2HEQA 3OYFA 1ACMB 2D1XA 1QCOA 2DYBA 1VQMA 1AWXA 3VRYA 4C92G 2X4YA 2KMTA 4J9GA 2DFUA 3VS1A 3MJXA 3G4SA 3L2WA 5L23A 2DJZA 1QMCA 2QXFA 1ZSZA 1NG2A 4XK8E 3OS0A 4J83A 4FYYB 4EMKB 1MV3A 1AZGB 1QWFA 4EMHA 2DK3A 3D7SB 2YLCA 1H3HA 1UGSB 4BI4A 1MUZA 2E64A 3JCMe 2AK5A 4DEYA 2LCLA 2HQHA 1UE9A 5GAOr 4N0AA 3E19A 2O01E 3RMSA 1UEBA 5A0LA 3CC7A 2DXUA 5IHKA 3CCUA 3I56T 2O9SA 4J6XA 5AT1B 4C92B 4WTOB 2LQNA 3SEMA 4J7IA 1KQ1A 1B07A 4KRTA 1VYVA 4XTZA 5KYUB 4RTZA 1OOTA 4EPCA 5HY6A 3HHTB 3CCMQ 1I5LA 3EGDA 4BI3A 2HCKA 3EGXA 3HP9A 1I4K1 3TCJA 1H641 3H0FA 4L5GA 1BI1A 1XNIA 3SD4A 1VA7A 5GANf 2L3RA 2CP5A 2E70A 4C8QA 4D8KA 3M0RA 5GAMe 1Y7XA 1D0ZA 1M8VA 2EJ9A 3EH1A 2HQXA 2CT4A 4J9HA 4Y91A 1ABOA 2IVWA 1RUWA 2ABLA 3A5ZB 2QQ9A 2BE7D 1YI2Q 2YUOA 2OTLA 1PSEA 4FSSA 3R6OA 2CP2A 1RI0A 5GAN5 2CSQA 2FPDA 5I21A 4FSXA 3VYHB 2L3SA 4OMQA 4XTYA 1QP3A 4CRIA 3V7CA 2G3RA 2RPNA 4KGZB 1KD1C 2QQSA 4HVWA 4O6JA 3JB9F 2LQ8A 1HYOA 3FLGA 2JM9A 2F69A 5J39A 2QI2A 5D7UA 2IIMA 4JRKA 3CPWS 3FIFA 2RHUA 2M16A 1M1GA 1OULA 4PLLA 1VQMQ 3OYEA 1WLPB 4BACA 4HT8A 2K5IA 3QBYA 3EG9B 3BDLA 3GPLA 3G4SQ 1K0SA 2LVMA 3CCRT 2J06A 1YHQA 2DTHA 2LJ1A 1M27C 4LDVA 2JXBA 2OAWA 2V1QA 2XDPA 2F2VA 1D1BA 5KYXA 2LDMA 2DAQA 1O75A 3DKMA 2EKHA 3M4YA 3CEYA 3SWNA 3ME9A 1ABQA 3FDRA 1UGRB 3VUBA 3CC4A 3LH5A 2L2PA 4OGCA 5FROA 2DTOA 1KHIA 1E7OA 1HXDA 1YJWA 1VQNA 3A8GB 3KFVA 1M90U 2E3HA 1YCSB 3CC7Q 1M1FA 3CCUQ 3OYCA 2D0NA 1ZBXA 2EYWA 1ARKA 3MP1A 1Y07A 4DOVA 2ZPEB 1K9MR 4MDXA 1Q81U 3QDFA 4A4EA 5IH2A 1U5SA 3RUXA 2E10A 1M9SA 1NYFA 1M1KR 2VUBA 4AFUC 3JRZA 2RK1A 3OBYA 4PNOA 4XU3A 2HKNA 1VQOA 1Z9ZA 2LRQA 1BU1A 4QKUA 4HA8A 3MHXA 2LTOA 3OW2S 2JMCA 3EHRA 2B8AA 3M58A 2GGRA 4IIMA 4C0GA 2RI2A 3SHWA 3CCQA 1E6HA 4RTYA 8ATCB 2QEXA 3VS5A 4E7LA 2O9VA 1Q82R 2OTLQ 2HZYA 1YNZA 2CZ7B 2XMFA 3RESA 4M75E 1NLPC 2NYSA 4JLGA 5GAN2 2YWWA 3I5SA 4IUVA 3M0QA 2QTXA 3L1AA 2LJ3A 2DXTA 2A36A 1F1BB 2J6KA 2X51A 4JJBA 1VQMT 2JMAA 4J7FA 3PMIA 3M55A 2FVUA 5DLQE 2DL8A 5FU7C 3OY9A 1LCKA 3G4ST 5HCKA 3JB9J 1OYXA 2DJQA 1TH7A 5IHNA 4JJCA 4R55A 2DPPB 2DMOA 3EFSA 3LWIA 1M2VA 3VS0A 1QCFA 2FZGB 3X20B 1G3SA 1HSQA 2RK2A 5L8RE 1B7TA 4BE0A 2DZ9A 3X26B 2E1HA 1X27A 1IZ6A 1PD1A 1WI7A 1WX6A 4ESRA 1NJIU 3BE3A 3VRZA 5I11A 1YHQQ 3JB9I 4MMLA 2M9UA 4J9CA 4M78F 1PNJA 1C6VX 3OYBA 1JRIA 1WHKA 2FRYA 4LDWA 3CC4Q 2R5MA 1LOJA 2P4RA 4OMMA 5KYWA 4C5IA 1UUEA 2MMPA 1FX7A 2PZ1A 4HCKA 4C92E 2A3LA 1D09B 4RCBA 1YJWQ 1VQNQ 2OTJT 5GANg 3L2VA 1QQJA 1W4SA 3NTIA 5A2QE 2L5QA 2DD5A 3NHNA 1G3TA 2RQTA 1BKBA 2FG0A 1X69A 3OSSC 2A7YA 2OX7A 1NEGA 4OMFB 2CSIA 1RAHB 1RAEB 1C1AA 2YDLA 3QXEB 1SG5A 2CH4W 3VS2A 3AT1B 2NUPA 3I56A 1OU8A 1OX8A 1HK9A 4PJOE 1RAGB 1SF9A 4BDZA 1B34B 2OTLT 2DLPA 3CCSA 5GAMj 2DL5A 1YBYA 1VQOQ 1RABB 3RERA 1RLPC 2MF2A 2BKDN 3M57A 2VV5A 1YWOA 1UB4A 3DB4A 1KQSS 1C0MA 2BUDA 3QYGB 2EJGA 3CCQQ 2VXEA 3MPUB 4GLMA 3V7SA 2ZGWA 2K4YA 5LJ3e 1K73R 2QEXQ 2ZPGB 2M0OA 2DA9A 2QTVA 1Q81C 2NUZA 5CKFA 2ESWA 4X9DA 4LUEA 1AWWA 1PHTA 1Q82C 3A8MB 2DIQA 1OPLA 2RJCA 2XHCA 2HMAA 4JRQA 4ATOA 3O5ZA 1AVZC 2LX7A 3I35A 4M75C 4ZTFA 5FWCA 4DBFA 1OU9A 1UHFA 1D3BB 2KNBB 4C8QF 1VQ9A 4MZTA 2P0PA 1CKAA 3GBQA 2LCCA 1RAAB 4DBQA 3UA7A 3I5RA 2DRMA 3GNFB 1M5Q1 4Q5WA 5IN1A 4MZMA 1QKWA 1SHFA 2WACA 4JJDA 4XTUA 1YJ9A 1VQLT 2E5KA 2EQMA 4DBHA 1I1JA 2EYZA 3T9NA 4DEXA 2DBMA 4BDYA 2DM1A 2KXDA 4LUDA 4E2FB 1YJWT 2RJDA 3E1SA 1TS9A 2LNHB 3CPWA 1WYXA 2EWNA 2CUDA 1OZ2A 2L8DA 2E6NA 2K79A 6AT1B 3CCET 2CP0A 3RIRA 4EMKC 3I9QA 3QKJA 1V29B 2NUTB 3CCRA 2LX9A 1YIJA 1IHWA 4L59A 4M7DD 3VU3C 2JS0A 2YUQA 9ATCB 4JUVA 2VWFA 3SB2A 1VQOT 2QQAA 1NEBA 2M1HA 4C92C 1BYMA 2FL7A 4Z88A 3Q1JA 1Q86U 5CK9A 2BE9B 1S72T 4KH0B 1NJIC 4B9WA 1I8FA 3RKYA 3N5BB 3I56Q 2EJFA 2JS2A 4B9XA 2CZ1B 2DILA 2RHIA 1TWBA 4CC4B 1KG1A 1WXTA 3CCSQ 2QGFB 2JTFA 4JS4A 4J9FA 5J3BA 2R58A 3NMZC 4OB3B 1IGUA 1DJ7B 3TSWA 1JBMA 3I55A 4E7HA 3O8VA 3QZ5B 2O31A 4BUGA 2CZ0B 3META 3G1JA 4AFZC 3P8DA 2RNAA 4A63B 1U3OA 2YLBA 5GAOq 2JW4A 3X28B 4HVUA 1N9RA 2RJEA 1W2BS 3J81E 2LMJA 3OW2A 4KUDK 3TQ7P 2LZ6B 3HTRA 3PMTA 1K73C 1BK2A 4FIBA 4IUPA 3TU4K 5KYYB 5LJ5h 4RTTA 2RH2A 5CVIA 1TTHB 2EQJA 4HKEA 4PFPA 1KC8R 4XTVA 3OS1A 4OMNA 1VQ9Q 4IUQA 3EAEA 3JB9D 2HSPA 1NYGA 3GOXA 3RDVA 1VQPT 2KYMA 1SPKA 1M3BA 2KBTA 2FHDA 4AMCA 2DERA 2DXCA 3OS5A 2HBWA 1YJ9Q 1BIAA 3GP8A 1VOMA 3G7ZA 1VQKA 2Y4XA 2FPFA 3CPFA 5GJWB 4RG2A 1UG1A 5HKCA 4J9EA 3EFOB 2AKKA 1QVGA 1GCQC 1XTDA 1QW1A 3M0TA 4B6MA 4HXJA 2QG9B 4RCCA 4PJOG 2CDTA 4CC2A 3JCMc 4E47A 4M7AE 2DTIA 3CMEA 2JZ2A 1R8OB 1IGQA 2QDLA 3M4GA 2COZA 3CCRQ 3JCMf 2KRMA 2BIVA 2VASA 2K3YA 2VB6A 2KVQG 4M7DG 5GAOp 2P84A 1YIJQ 3MP8A 2MWPA 1AZEA 3CCST 2QA4A 1GFDA 2EIFA 3QWYA 1PWTA 2DL3A 5GAN8 3MO8A 4JRIA 4Y28E 2OTJA 1Q7YR 4D8DA 1KIKA 3ER0A 3S3NA 2AIRB 4OB1B 5KCHA 3VS7A 1IO6A 5LJ3h 4PJOB 2M0YA 1M2OA 2CYZB 5FU6B 2X4WA 1NBEB 4JPBW 4FM4B 4M7DB 2W0ZA 2GTJA 5LJ5d 3VUZA 1R0CB 3L42A 3I55Q 5LJ3j 2DETA 5I2SA 2EVRA 4J9BA 3PFSA 2CZ6B 2K3BA 2CP6A 3JAME 1T0JA 4NL2A 2VC8A 1VQ9T 2E12A 3M54A 2BZ8A 3MEUA 2K2MA 2SEMA 3HKSA 2MYSA 1Q86C 4FT2A 2AZVA 5CR2A 2A28A 1MMDA 1WJRA 1EZZB 2PUKB 1VIFA 2X4XA 1N5ZA 1YJ9T 3ZL7C 2DXBA 4FL6A 2L3PA 2GTOA 4OB0B 1A0NB 1PSFA 5CKHA 1YN8A 4UC4A 2DNUA 2L3QA 4J9DA 4M7AD 1KC8C 1SEMA 2JTMA 1G83A 4P5NA 4LD6A 3JB9H 1QVFP 1CKBA 3EHQA 3QIIA 1VQKQ 1EIFA 1TXQA 2A08A 1UTIA 3H41A 4ZGEB 2D9TA 3C95A 1K9MU 1YIJT 2XD0A 4LE9A 3HFOA 3NPFA 4OMOA 3QZ9B 1R0BG 3EG3A 4QVDA 1M8MA 1ZA1B 5KE2A 4M78D 1VQLA 4Z02A 3S3OA 1M1KU 4BE1A 1QVFS 3H6ZA 2HL5C 1GL5A 4O5VA 2I0NA 2X4JA 4FT4A 4KGXB 3CMEQ 1PG5B 4M75A 4NS5A 4C0ZA 1VQ7T 2GQVA 1BI3A 4M77D 2KEAA 3HRUA 3CC2A 3OYAA 5FWBA 5LJ3d 3CCEA 4AG2C 5GAN3 1YJNA 3M0SA 1QVPA 1V76A 2QK0A 5A0GA 1UGPB 4RTVA 5C0MA 4ZNXA 1Q82U 3P8HA 2CUBA 3JSCA 3M5AA 3X25B 2OTJQ 3I55T 1D1CA 3G6ET 3CMAT 2KY9A 3VV0A 1VQ8A 1WXBA 3CXCA 2QASA 2V8IA 3EFRA 4AFQC 1K4US 4OP0A 1JU5C 4F7UG 1H3ZA 2LNVA 2KRNA 2O4XB 3MEWA 1VYUA 1M30A 5J26A 1S72A 3QYHB 4EMKA 3NTHA 3LH0A 3C0CA 1FMKA 3TEEA 1V1CA 2EAYA 4IUTA 2K5FA 3BW1A 1GRIA 3VKIA 1TSFA 3PTAA 1YFNA 3FB9A 1MHNA 3FC3A 2KROA 4IURA 1D1AA 4HT9A 1UGVA 2RI3A 4C92A 1K0XA 4JRPA 3RKXA 3THKA 1IRXA 2R57A 5KYUA 1D0XA 2LJ0A 2MOXA 3M59A 3QO3A 1UHCA 3TREA 4F7UB 2DD4A 1VQKT 2DO3A 2QQRA 2EW3A 1JJ2A 1UDLA 2M02A 3CQTA 1W2BA 2GCXA 3OYGA 2MWOA 2VXFA 1YCYA 4C8QD 4M7AG 2C06A 3CCLT 2RJFA 3BY7A 2F2XA 4PJOA 5LJ5f 1I07A 4OF1A 1SSFA 2HD0A 3JCMg 4J9IA 2VVKA 3CMET 1QCNA 1TUGB 3JCMh 2K2VA 3RNJA 1IREB 1VQPA 3VS4A 1Y96B 4DOWA 1K8AR 4M78G 1RAFB 1KSWA 2FB7A 2LT1A 5IAYA 2QA4T 1VQLQ 3H8ZA 1WHGA 4FYWB 4PJMA 4M7AB 2YT6A 4M77G 2E65A 3JCMX 4RTWA 1OV3A 4ZN3A 2NWMA 4FYXB 2DE0X 3CC2Q 2DVJA 1MMNA 2DVEA 3CCEQ 1YJNQ 1K76A 1ZQ1A 3G71T 4YTLA 4AT1B 4AG1C 4JLIA 3ZEHA 1Y57A 3E2UA 5GAMh 3JV3A 1N27A 4BY6B 1K73U 4BI8B 1KQ2A 2IG0A 1K9MC 3REBB 1VQ8Q 4M78B 3EG9A 2FEIA 1GCQA 5D6YA 1ZSGA 2MI6A 3KUFA 2EGCA 1WNLA 1M1KC 1PC0A 4OMPA 1KK7A 4M7DE 2HL3A 3JCMQ 1X6OA 3PE0A 3BFMA 1S72Q 4M77B 4XTXA 3FJ5A 1SRLA 2AZSA 3SDZA 4DBRA 4C0DB 1VQ4T 2M51A 2D8HA 2R5AA 4F17A 3L2QA 1RAIB 5LJ3f 4J6WA 2COWA 2JVVA 4KGVB 2ZCFB 1LJOA 2F5KA 2EYQA 4Z89A 4V2SA 2HSEB 5CAIA 1VUBA 2E6ZA 2VGNA 4Y92A 2SRCA 2EQKA 2YUPA 4QQ6A 2LC4A 1ZSZB 4RKUE 4TVRA 1JEGA 3OYIA 4LDXA 3JCMd 4C8QG 4BE2A 4ZGJB 4HCBA 5FU7B 2QDYB 2EQIA 2DL7A 1H92A 1WJSA 1YWPA 2E5QA 2CS7A 1G3WA 3WXMB 1NZ9A 1NM7A 1OEBA 2D8JA 3CD6A 5AYFA 4A53A 1XQHA 2ZPHB 1JB0E 2HBPA 3A8OB 2X3XD 2ROTA 4LXCA 4CC3A 3EGDB 1SRMA 1VQPQ 3EGXB 2BZXA 3CC2T 1ZX6A 3INZA 1S1NA 1AEYA 2E41A 2D0QB 1BI0A 1YJNT 4E7SA 3GF5A 3OMGA 4C8QB 5GAMd 3UDCA 1JXOA 1I0CA 1MNEA 1K8AC 2AHJB 1N6AA 4PJLA 1VYTA 1VQ8T 4JDSA 3OYNA 1G8XA 4RMOA 1YITA 4R56A 1I5OB 4RTUA 1D0YA 2O2OA 2ATCB 2X9HA 4FCYA 1AWJA 1AD5A 1MMGA 1QKXA 1VQ7A 3HSBA 1WFWA 2NLUA 2HKQB 2H8HA 4X1VA 4K11A 1VQ5T 4II1A 1PD0A 3CCMA 3PIOA 3OMCA 5IHIA 4PJOC 8AT1B 2LT4A 3U23A 4M75F 1W6XA 4CC7A 4BB7A 3C94A 2AKLA 1KC8U 3CCVA 5FU6C 2VGMA 2XK0A 5M9OA 3G6EA 3CMAA 1P92A 1ZA2B 1GXIE 4IUUA 2JT4A 1QP2A 2YRCA 4M7DC 5CO7A 1JJ2P 4PFZA 4R0KA 2ZPIB 2V8JA 5LJ5g 4BD3A 2KDSA 5A0DA 2DIGA 3UT1A 1I81A 2GQIA 1T3SA 1YP5A 4F7UE 1G3YA 2XKOC 4J6YA 3C4SA 4KULA 2LCSA 5KYXB 4GBQA 1X43A 2JN0A 3SWNB 1KD1R 4PLIA 1RACB 1WHLA 1B3QA 1R77A 2EYXA 1B34A 3E9GA 2RMOA 3V8LA 4F14A 1WDXA 2J6OA 1WA7A 2KT1A 3EGUA 1OI1A 1IXDA 2A37A 2P0QA 3CD6Q 5GAOm 3PNWC 3ULRB 4FU6A 1WHMA 1WQ7A 4C92F 1KHCA 3CCLA 4FYVB 3S6WA 2KI7A 3RMQA 1LPLA 2XU8A 2P0KA 1Q7YU 3OYYA 2EKOA 2A0FB 1TU0B 3UA6A 1TOVA 4KUIA 2X3WD 3LX7A 2F1LA 1T3LA 1N8RR 1VQ6T 3GIBA 2RO0A 1LVKA 4QQGA 4PJOF 1D3BA 3WVEB 3MCAB 1BIBA 1MMAA 3HFNA 1YITQ 1JO8A 4OB2B 2FZKB 4HCZA 4E7IA 4IIOA 3X24B 3H9NA 3M53A 4EIKA 3F70A 1U8RA 3MP6A 1PRMC 4AFSC 4M7DF 4M78E 3KBGA 3OBWA 2HAXA 1VQ7Q 2RHYA 5IT9E 4LDUA 5LJ3g 1VIEA 1O9SA 1Q95G 4N4HA 1RI9A 2WSFE 3OS2A 5GAOl 2ZAEA 4M77E 4Z8AA 2JM8A 3G71A 2PVOB 5GAMf 2O88A 2CGHA 5GANe 1W70A 3CCVQ 3BDUA 3G6EQ 3CMAQ 1EX4A 1W1FA 2QQBA 1M2VB 2OI3A 1PKSA 4JS5A 1WHHA 4WCIA 2NUTA 5CIUA 4JZ3A 1GBQA 3REAB 2P4TA 4QT7A 3MKDA 2RB6A 4ELYC 2HDAA 3JCMW 4J5YA 1KQSA 2RM4A 1EFNA 4A4HA 1BBZA 2EYYA 2B86A 2RA2A 3OYDA 3OA6A 1VQ4A 1Y0MA 2YRVA 2K7AA 2WSCE 4A4GA 3CD6T 5CKDA 3JB9G 4PFOA 3CPWP 2DRKA 1H8KA 5KYWB 4KH1B 1K1ZA 3JCMJ 5IXFA 2Y4YA 2W10A 4ORZA 3UPUA 2L89A 2CREA 5DM7R 1SKUB 1WXUA 3ZFJA 4CI0C 3P8BB 4MMKA 1MNDA 2YXYA 1PRLC 3OYKA 1KFZA 3OYLA 5IXBA 3QDRB 2GFUA 3M56A 3CBPA 4JZ4A 4ZGDB 3WVDB 4N4IA 3CCLQ 5D6XA 3JCMb 2NUPB 3OYJA 4C8QE 1YITT 1K9AA 1RLQC 2DZCA 2E4HA 3CCJA 3UWNA 4FW2A 4FW1A 2BTTA 4GLKA 2EGAA 5KYYA 5FRNA 2F5TX 3J7AF 3AHUA 3A1PA 5I22A 5ECAA 4M7AC 3CBMA 1AHJB 2E3IA 2EGEA 2QA4Q 1OPKA 3CCMT 1QWEA 3OB9A 2K5LA 1ZUYA 2YUNA 3RKWA 3TSZA 1N8RC 3H0IA 3CCVT 5CQXA 3HRSA 3OYHA 4LD9K 2JJ9A 1OQKA 4BY6C 5HK0A 5KH6A 3OW2P 1FMWA 3C12A 4M78C 2KE9A 4F04B 5HK3A 3EFOA 1GFCA 1U06A 3JCMV 3G71Q 1Q7YC 2V8KA 4A4FA 1WGSA 2RQWA 3PT9A 3URGA 2RHZA 4PJNA 1RL2A 1YI2T 2CP7A 5EC7A 4M77C 4F7UF 1M90R 2ECZA 3FEOA 4OVAA 1M3CA 4HVVA 1VQ5A 4VUBA 4C0DC 2XICA 2DYIA 3LLRA 5GMKe 2YHTA 5CQYA 4QVCA 2H3JA 1WIEA 3KXTA 2V1RA 3H0HA 1Q81R 2RQRA 3LW5E 2KT8A 2DF6A 3J80E 3OYMA 1NPPA 2ED0A 1KJWA 1WQWA 3EG2A 1VQ4Q 2YSQA 2KAFA
chains in the Genus database with same CATH topology
4QQDA 3PMTA 5CCAA 3QPHA 5I21A 1K73C 4FSXA 4FIBA 4TVRA 4IUPA 3VYHB 3TU4K 5LJ5h 2RH2A 5CVIA 3OYIA 1K8AU 5GAN4 2EQJA 3M9QA 2XDDA 4HKEA 4XTYA 4XTVA 4LDXA 3JCMd 1QP3A 4CRIA 4C8QG 3OS1A 3V7CA 4BE2A 2G3RA 5DY9A 4ZGJB 1KD1C 2QQSA 2K57A 4IUQA 4O6JA 3EAEA 4HCBA 3JB9D 3JB9F 2EQUA 4JJNK 2LQ8A 4NOYA 5FU7B 2QDYB 2XDBA 2KSSA 3FLGA 3MEAA 4EDUA 1WJSA 2F69A 4N0AC 3GOXA 2E5QA 1VQPT 5J39A 2QI2A 3L2ZA 2CS7A 2EFIA 1G3WA 4JRKA 3WXMB 3CPWS 1NZ9A 1WJQA 2FHDA 2DXCA 2RHUA 3FIFA 3OS5A 2MAMA 2M16A 3LGFA 4EMGA 1QVGS 1M1GA 3CD6A 5AYFA 4M7DA 4M7AF 5CKBA 4A53A 4PLLA 1BIAA 3GP8A 1XQHA 5LJ5e 3G7ZA 5KCOA 2ZPHB 4QQ6A 1VQKA 2Y4XA 3CPFA 3OYEA 1JB0E 2HBPA 3A8OB 4RG2A 5LL6S 4BACA 4HT8A 2K5IA 3QBYA 4KBMB 3BDLA 4OGEA 5CKEA 5HKCA 3GPLA 1QVGA 2LVMA 3CC2T 3CCRT 4GY5A 3INZA 1YHQA 1XTDA 1FXXA 2DTHA 2D0QB 1BI0A 1QW1A 2E41A 4LDVA 2XDPA 3OQ5A 3V7RA 1YJNT 4RCCA 2LDMA 2RD1A 3GF5A 3QUIA 3OMGA 5GMKm 2DAQA 1O75A 4PJOG 3CBOA 3UDCA 3DKMA 4C8QB 5GAMd 3CCUT 3CC7T 3M4YA 3JCMc 4C8QC 4E47A 4HCCA 3CEYA 3SWNA 3A8LB 1K8AC 4M7AE 2DTIA 2AHJB 3FDRA 1UGRB 3ME9A 3VUBA 3CC4A 1N6AA 3CMEA 4WF2A 2JZ2A 1R8OB 4L6V5 4DQ2A 2DKGA 3M4GA 4OGCA 5FROA 1U1TA 3JCMf 1VQ8T 1U1SA 4JDSA 4QW2A 2DTOA 1KHIA 3OYNA 2BIVA 2K3YA 2KVQG 4M7DG 5GAOn 4RMOA 5GAOp 5GAMg 1HXDA 1ZHIA 1YJWA 3MP8A 1VQNA 2MWPA 3A8GB 1YITA 2XG8D 4R56A 2ZZDA 1M90U 4M77F 1M1FA 3CCST 3DLLA 3OYCA 2QA4A 1ZBXA 3MP1A 2EIFA 3V8JA 1Y07A 4DOVA 2ZPEB 5GANh 4MDXA 1VQ6A 4XU1A 1Q81U 1VQ7A 4A4EA 1NPRA 4ELZC 5GAN8 2GF7A 3MO8A 4JRIA 4Y28E 2OTJA 3RUXA 2E10A 1M9SA 2NLUA 3HSBA 1WPYA 3ER0A 3NFCA 5FRMA 2VUBA 3S3NA 3JRZA 2RK1A 3QG1A 1VQ5T 4II1A 5GANj 3OBYA 4OB1B 3CCMA 5KCHA 4PJOB 5LJ3h 4PNOA 3PIOA 3OMCA 3S3MA 4XU3A 5GAN6 4PJOC 3MEVA 3LYIA 2LT4A 1MGQA 3QSUA 4M75F 4M75D 1VQOA 2CYZB 2LRQA 4ME7A 5FU6B 4BB7A 3C94A 1KC8U 2X4WA 3CCVA 4HA8A 3MHXA 5FU6C 2LTOA 4X9CA 2VGMA 2XK0A 3SFMA 5M9OA 3G6EA 3OW2S 2I2LA 3CMAA 4IKFA 4FM4B 2B8AA 3M58A 1P92A 2RHXA 2LQKA 1GXIE 4IUUA 4M7DB 3ZBDA 5LJ5d 3VUZA 1QP2A 3L42A 5LJ3j 4C0GA 1FWZA 2RI2A 2X35A 4M7DC 2HQEA 5CO7A 5GMKl 5I2SA 3CCQA 3PFSA 2CZ6B 2PQWA 3JAME 2PU9B 4NL2A 2VC8A 2HNIA 2QEXA 2E12A 4E7LA 3M54A 1VQ9T 2ZPIB 1M90C 3PIPA 2V8JA 3MEUA 3HKSA 2CZ7B 5LJ5g 3HPWA 4BD3A 2KDSA 3GNGA 5A0DA 1Q86C 2DIGA 3UT1A 1I81A 4F7UE 1G3YA 4FT2A 3RESA 4M75E 5CR2A 2XKOC 4J6YA 3C4SA 4KULA 4JLGA 5GAN2 1WJRA 2VYTA 4DA4A 4IUVA 2PUKB 4XTWA 1VIFA 2QTXA 3L1AA 2JN0A 2K3XA 2DXTA 4RG8A 2X4XA 4MDWA 3SWNB 1YJ9T 1VQMT 2DXBA 4PLIA 3SWNC 4FL6A 4OB0B 4J7FA 3PMIA 3M55A 2FVUA 2PVDB 4ZTJA 4N4GA 5DLQE 5FU7C 3OY9A 1M4ZA 1PSFA 1B34A 3E9GA 2XIDA 2KK4A 3G4ST 3V8LA 2PVGB 5CKHA 3L2UA 3JB9J 1OYXA 4D6WA 1TH7A 2O4XA 4UC4A 4R55A 2DPPB 1X01A 2OAUA 4M7AD 3EFSA 3LWIA 1KC8C 3CCJT 3PGGA 2JTMA 1OI1A 1YHQT 4P5NA 4LD6A 2XI9A 5C6SA 3JB9H 2P0QA 3X20B 1G3SA 2RK2A 2ZPBB 5L8RE 5GAOm 1UGQB 5EG2A 2GFAA 4BE0A 3PNWC 3QIIA 2DZ9A 3OSVA 3QJ6A 1X75C 4C0FA 4FU6A 1EIFA 4XU2A 3X26B 1WQ7A 2E1HA 1IZ6A 1KHCA 4C92F 4C92D 3CCLA 3S6WA 3CC4T 4ZGEB 2D9TA 4KT0E 5GAN7 3C95A 1K9MU 3RMQA 1YIJT 1NJIU 2XD0A 3HFOA 3GLXA 3JB9I 4MMLA 5D6WA 3QZ9B 2M9UA 4QVDA 2XU8A 5KE2A 3FRNA 2P0KA 1Q7YU 1VQNT 3OYYA 4M78F 4M78D 4E7KA 2EKOA 1VQLA 4Z02A 4A4KA 3S3OA 1M1KU 4BE1A 1QVFS 3H6ZA 3QHSA 4QVZA 5KE3A 4O5VA 2X4JA 4KUIA 5GANd 3OYBA 1JRIA 3LX7A 4LDWA 4FT4A 4F7UA 2DEQA 2R5MA 2ZPFB 2RI5A 4M75A 1G5VA 4NS5A 4MZPA 5I2MA 1LOJA 1NE8A 2WSEE 1VQ6T 3GIBA 4C0ZA 4C5IA 1VQ7T 2GQVA 2MMPA 1BI3A 1FX7A 2RO0A 4QQGA 1D3BA 4M77D 4PJOF 4C5EA 4C92E 3WVEB 3MCAB 3JCMP 1QVFA 1BYMA 2A3LA 1BIBA 2OTJT 4RCBA 3HFNA 3HRUA 4XAXB 2KQWA 3CC2A 4OB2B 5GANg 3L2VA 3FJPA 4HCZA 1W4SA 4X34A 3NTIA 3OYAA 5A2QE 3X24B 2L5QA 5LJ3d 4E7IA 2DD5A 5GMKi 3M53A 3F70A 3CCEA 1G3TA 1U8RA 5GAN3 1YJNA 3VYGA 2JOYA 3MP6A 3QJYA 1BKBA 2JNGA 3OSSC 3CXCS 1QVPA 4M7DF 2A7YA 4M78E 3V8KA 4OMFB 5A0GA 1UGPB 3KBGA 3VJPA 3OBWA 5C0MA 3L2RA 2HAXA 4PKCC 2RHYA 3QXEB 3LWHA 1Q82U 3P8HA 5IT9E 3JSCA 3M5AA 3X25B 3E9FA 4LDUA 5LJ3g 1VIEA 1O9SA 3I55T 3G6ET 3CMAT 2KY9A 3VV0A 1VQ8A 2CKKA 3DLMA 4N4HA 4XQ3A 2WSFE 3CXCA 3OS2A 5GAOl 2V8IA 3I56A 1LNXA 1Y96A 1HK9A 3EFRA 4PJOE 4M77E 5GMKh 4OP0A 3G71A 4BDZA 4F7UG 3LGLA 3CCQT 1H3ZA 1B34B 2JUFA 4M75G 5DLOA 2LNVA 2OTLT 1BI2A 3CCSA 2PVOB 2O4XB 5GAMf 5GAMj 3MEWA 1YBYA 1KD1U 2D6FA 2CGHA 5GANe 2QEXT 5J26A 3RERA 1S72A 2FYKA 2MF2A 3BDUA 2BKDN 3HL8A 3M57A 2VV5A 3QYHB 4C5HA 4EMKA 3NTHA 2QQBA 3LH0A 1UB4A 5GMKj 4E7JA 3DB4A 1KQSS 4M7AA 4JS5A 2BUDA 3HRTA 3QYGB 2EJGA 5CIUA 3TEEA 3A8HB 2EAYA 2PUOB 2P4TA 2VXEA 2K5FA 3BW1A 4IUTA 3V7SA 3VKIA 5FLXE 3PTAA 2ZGWA 2K4YA 5LJ3e 4PL6A 2RB6A 3FB9A 1MHNA 4ELYC 2ZPGB 3FC3A 2M0OA 4XU0A 1YI2A 4IURA 3JCMW 4J5YA 1KQSA 4HT9A 2RM4A 1Q81C 1XOVA 2RI3A 5CKFA 4A4HA 4C92A 4X9DA 1JJ2S 2RA2A 3OYDA 3OA6A 1VQ4A 4JRPA 3RKXA 2YRVA 1N9SA 2WSCE 2R57A 4A4GA 3CD6T 5CKDA 1Q82C 3A8MB 2DIQA 3JB9G 3M59A 3QO3A 4LDYA 2RJCA 2XHCA 3TREA 4F7UB 2DD4A 4M75B 4M78A 4JRQA 1VQKT 2DO3A 4ATOA 2QQRA 4A54A 4M75C 4ZTFA 4J8OA 1JJ2A 2Y90A 1W2BA 2GCXA 3OYGA 2MWOA 3JCMJ 1D3BB 2VXFA 1YCYA 4C8QD 4C5GA 2Y4YA 4C8QF 4MZTA 2P0PA 1VQ9A 3UPUA 4M7AG 2L89A 2LCCA 1Y71A 3DB3A 3CCLT 2RJFA 1OZ3A 5DM7R 3BY7A 4ZN1A 3NTKA 2C06A 3ZFJA 3ASKA 4NL3A 4PJOA 4M77A 1N8RU 4Q5WA 3GNFB 1M5Q1 3P8BB 4CI0C 5LJ5f 5IN1A 4MMKA 5LJ5j 3OYFA 4OF1A 3OYKA 3OYLA 4MZMA 4XTUA 1SSFA 2WACA 2HD0A 3QDRB 3JCMg 1YJ9A 2GFUA 2EQMA 1VQMA 1VQLT 4C92G 3CMET 3M56A 3CBPA 2X4YA 3JCMh 4ZGDB 2KMTA 3WVDB 4N4IA 3T9NA 2K2VA 5D6XA 4BDYA 1IREB 3JCMb 1VQPA 3OYJA 3G4SA 1Y96B 4DOWA 1YJWT 2RJDA 4C8QE 3L2WA 3E1SA 1YITT 3CPWA 2DJZA 4M78G 2DZCA 2EWNA 2FB7A 3CCJA 3UWNA 2QXFA 2LT1A 1OZ2A 5IAYA 2QA4T 3H8ZA 4GLKA 4XK8E 3OS0A 2L8DA 4J83A 2E6NA 4EMKB 3CCET 5FRNA 3RIRA 2F5TX 3J7AF 3AHUA 4EMKC 4EMHA 2DK3A 2YLCA 4M7AB 3QKJA 4M77G 1UGSB 2E65A 1V29B 4BI4A 3JCMX 3CCRA 2LX9A 4M7AC 3CBMA 2E64A 3JCMe 1AHJB 2LCLA 4ZN3A 1YIJA 5GAOr 4N0AA 3E19A 2O01E 4L59A 3RMSA 2DVEA 3CCMT 4M7DD 1UEBA 3OB9A 5A0LA 3VU3C 2DXUA 3CC7A 3CCUA 3I56T 4J6XA 2K5LA 4JUVA 3RKWA 3SB2A 1ZQ1A 1N8RC 1VQOT 3G71T 4YTLA 2QQAA 4C92B 3CCVT 5CQXA 2M1HA 3HRSA 4JLIA 3ZEHA 2FL7A 4C92C 5GAMh 4J7IA 3OYHA 1KQ1A 1N27A 4LD9K 3Q1JA 4BY6B 1Q86U 1K73U 5CK9A 4BI8B 1KQ2A 4XTZA 4BY6C 4EPCA 2IG0A 1S72T 5HK0A 1K9MC 1NJIC 4B9WA 5HY6A 3HHTB 5KH6A 4M78B 1I8FA 3RKYA 1I5LA 3N5BB 3C12A 4M78C 2EJFA 5D6YA 4BI3A 5HK3A 3HP9A 2MI6A 3JCMV 1I4K1 1Q7YC 3TCJA 2V8KA 1H641 3KUFA 4B9XA 4L5GA 2CZ1B 4A4FA 1WGSA 1WNLA 2RHIA 1M1KC 1BI1A 1XNIA 1KG1A 3PT9A 4M7DE 2JTFA 3SD4A 4JS4A 3JCMQ 3URGA 1X6OA 5GANf 2L3RA 2RHZA 2R58A 5J3BA 1RL2A 3BFMA 4M77B 2E70A 4XTXA 4C8QA 1YI2T 3SDZA 4M77C 4OB3B 4F7UF 5GAMe 1DJ7B 1Y7XA 1M8VA 2EJ9A 2HQXA 1JBMA 3FEOA 4OVAA 3I55A 4Y91A 4C0DB 1VQ4T 1VQ5A 4E7HA 2IVWA 3O8VA 4VUBA 4C0DC 2XICA 3LLRA 3QZ5B 2R5AA 2CZ0B 2YHTA 5CQYA 3A5ZB 3META 4BUGA 2H3JA 4QVCA 5GMKe 3KXTA 2QQ9A 3L2QA 3P8DA 5LJ3f 4J6WA 2YLBA 5GAOq 2OTLA 3LW5E 3X28B 1PSEA 2JVVA 3OYMA 1N9RA 2ZCFB 2RJEA 1LJOA 1NPPA 3J80E 3J81E 1W2BS 3R6OA 2F5KA 2EYQA 3OW2A 4KUDK 1RI0A 4V2SA 4PJOD 1WQWA 5CAIA 1VUBA 2E6ZA 2VGNA 5GAN5 2EQKA 2LC4A 2KAFA 4RKUE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HPW A;  5CCA A;  2KMT A;  4ME7 A;  5HK0 A;  5CKB A;  4ELY C;  5DLO A;  5CR2 A;  4MDX A;  4VUB A;  4MZT A;  4HKE A;  3G7Z A;  4ELZ C;  5CQY A;  3VUB A;  5HK3 A;  2C06 A;  5CKF A;  3TCJ A;  2MF2 A;  5CO7 A;  5HKC A;  5CKE A;  3NFC A;  2VUB A;  1UB4 A;  1X75 C;  3JRZ A;  3JSC A;  4OF1 A;  4MZP A;  5CKD A;  1NE8 A;  5CQX A;  4MZM A;  1VUB A;  1M1F A;  5CK9 A;  5CKH A; 
#chains in the Genus database with same CATH topology
 4QQD A;  5CCA A;  3QPH A;  1M3A A;  1ZSZ C;  1ZLM A;  1K8A U;  1QVG P;  5GAN 4;  3M9Q A;  2XDD A;  2PTK A;  2EBP A;  5DY9 A;  2K57 A;  2EQU A;  3NGP A;  4JJN K;  4NOY A;  2XDB A;  2KSS A;  3MEA A;  4EDU A;  4N0A C;  1BCO A;  1OX9 A;  3L2Z A;  2EFI A;  4OML A;  1WJQ A;  1UEC A;  3EG1 A;  7AT1 B;  3IQL A;  1UFF A;  2MAM A;  2QGG A;  3LGF A;  2CP3 A;  1Z9Q A;  4EMG A;  1ZUU A;  1QVG S;  4M7D A;  4M7A F;  5CKB A;  5LJ5 e;  5KCO A;  4ANJ A;  1ZBJ A;  2ROL A;  1G2B A;  2V26 A;  5LL6 S;  1AOJ A;  4KBM B;  4OGE A;  5CKE A;  1XJW B;  1MV0 B;  1IB8 A;  4GY5 A;  1FXX A;  5FW9 A;  3PVQ A;  3OQ5 A;  3CCJ Q;  3V7R A;  5KYN A;  1TG0 A;  2C0O A;  2IPO B;  2RD1 A;  4F16 A;  3QUI A;  5GMK m;  1ZUK A;  2C0T A;  2COY A;  3CBO A;  3CCU T;  3CC7 T;  2MCN A;  4C8Q C;  4HCC A;  3A8L B;  1T0H A;  1WHJ A;  4WF2 A;  4L6V 5;  4DQ2 A;  1RAD B;  2DKG A;  1U1T A;  1U1S A;  2K6D A;  4QW2 A;  5GAO n;  5GAM g;  1ZHI A;  4PK4 A;  2FPE A;  2XG8 D;  2ZZD A;  1QLY A;  4M77 F;  3DLL A;  3V8J A;  1NJI R;  5GAN h;  2DL4 A;  1VQ6 A;  4XU1 A;  3QWX X;  1FMV A;  1NPR A;  2RQV A;  4ELZ C;  2GF7 A;  2DX1 A;  3A98 A;  1GCP A;  3UAT A;  1WPY A;  2MK5 A;  3NFC A;  5FRM A;  2GBQ A;  3EG0 A;  3QG1 A;  1KQS P;  5GAN j;  2C0I A;  3S3M A;  5GAN 6;  3MEV A;  3LYI A;  3QSU A;  1MGQ A;  4M75 D;  2J7I A;  4ME7 A;  2MIO A;  4X9C A;  4IKF A;  3SFM A;  2I2L A;  1BB9 A;  3EH2 A;  2RHX A;  2LQK A;  3ZBD A;  1NLO C;  2K9G A;  1FWZ A;  2X35 A;  1VQ5 Q;  2HQE A;  5GMK l;  2JTE A;  2FO0 A;  2PNI A;  4E7Z A;  3PVL A;  1SHG A;  1X6G A;  2PQW A;  2RN8 A;  2PU9 B;  4LNP A;  4RTX A;  2HNI A;  1M90 C;  1TUC A;  3PIP A;  1TUD A;  3HPW A;  3GNG A;  1HD3 A;  1BCM A;  4LN2 A;  2VYT A;  4DA4 A;  2LP5 A;  3RBB B;  4XTW A;  1CSK A;  2K3X A;  4RG8 A;  4MDW A;  1X2K A;  3SWN C;  4ZTJ A;  2PVD B;  4N4G A;  1M4Z A;  2XID A;  2KK4 A;  3L2U A;  2PVG B;  2KGT A;  4D6W A;  2O4X A;  1X01 A;  2OAU A;  4RUG A;  2H3E B;  3CCJ T;  3PGG A;  1YHQ T;  5C6S A;  2XI9 A;  2AT1 B;  2KXC A;  2ZPB B;  1UGQ B;  5EG2 A;  2GFA A;  3VS3 A;  3OSV A;  3QJ6 A;  1X75 C;  4C0F A;  4XU2 A;  2OJ2 A;  1JXM A;  4C92 D;  2LQW A;  3CC4 T;  2ED1 A;  4KT0 E;  5GAN 7;  3VS6 A;  1X2Q A;  3GLX A;  5D6W A;  3FRN A;  1VQN T;  4E7K A;  3M0P A;  3RR6 A;  4A4K A;  4PJJ A;  1SSH A;  3QHS A;  4QVZ A;  5KE3 A;  3CXC P;  5GAN d;  2KRS A;  4F7U A;  2DEQ A;  2CT3 A;  2ZPF B;  2MPX C;  2RI5 A;  1G5V A;  4MZP A;  2YRD A;  5I2M A;  1NE8 A;  2WSE E;  2CH4 A;  1UJ0 A;  4PJO D;  4C5E A;  3JCM P;  1QVF A;  2RF0 A;  4XAX B;  2KQW A;  3FJP A;  4X34 A;  2FRW A;  2RQU A;  5GMK i;  3VYG A;  2JOY A;  1PM3 A;  3QJY A;  2ENM A;  5GJV B;  2JNG A;  3CXC S;  3V8K A;  1AT1 B;  1VQ6 Q;  3L2R A;  3VJP A;  4PKC C;  4E6R A;  3LWH A;  3E9F A;  2F2W A;  2Z0W A;  2CKK A;  3DLM A;  4XQ3 A;  1PCX A;  1IHV A;  1LNX A;  1Y96 A;  5GMK h;  2QYZ A;  2L0A A;  3LGL A;  3CCQ T;  2JUF A;  4M75 G;  5DLO A;  1BI2 A;  1E6G A;  3M0U A;  1KD1 U;  2D6F A;  1AWO A;  2GNC A;  2QEX T;  2FYK A;  2KR3 A;  3HL8 A;  4C5H A;  4E7J A;  2KYB A;  5GMK j;  1W2B P;  2VKN A;  4M7A A;  3R6N A;  3HRT A;  3A8H B;  1J3T A;  2PUO B;  5FLX E;  2DEU A;  4M4Z A;  1Q86 R;  4PL6 A;  2FZC B;  1HJD A;  4XU0 A;  1YI2 A;  1X6B A;  2J6F A;  1XOV A;  1JJ2 S;  3TVT A;  1N9S A;  2DBK A;  2EPD A;  4LDY A;  1JQQ A;  4M75 B;  4M78 A;  4A54 A;  4J8O A;  2Y90 A;  2QAZ A;  4C5G A;  2J05 A;  3UF4 A;  1UJY A;  1FYN A;  1Y71 A;  3DB3 A;  1OZ3 A;  2BZY A;  2G6F X;  4ZN1 A;  3NTK A;  1PKT A;  1GBR A;  1WZO A;  3ASK A;  4NL3 A;  4M77 A;  1N8R U;  5LJ5 j;  2HEQ A;  3OYF A;  1ACM B;  2D1X A;  1QCO A;  2DYB A;  1VQM A;  1AWX A;  3VRY A;  4C92 G;  2X4Y A;  2KMT A;  4J9G A;  2DFU A;  3VS1 A;  3MJX A;  3G4S A;  3L2W A;  5L23 A;  2DJZ A;  1QMC A;  2QXF A;  1ZSZ A;  1NG2 A;  4XK8 E;  3OS0 A;  4J83 A;  4FYY B;  4EMK B;  1MV3 A;  1AZG B;  1QWF A;  4EMH A;  2DK3 A;  3D7S B;  2YLC A;  1H3H A;  1UGS B;  4BI4 A;  1MUZ A;  2E64 A;  3JCM e;  2AK5 A;  4DEY A;  2LCL A;  2HQH A;  1UE9 A;  5GAO r;  4N0A A;  3E19 A;  2O01 E;  3RMS A;  1UEB A;  5A0L A;  3CC7 A;  2DXU A;  5IHK A;  3CCU A;  3I56 T;  2O9S A;  4J6X A;  5AT1 B;  4C92 B;  4WTO B;  2LQN A;  3SEM A;  4J7I A;  1KQ1 A;  1B07 A;  4KRT A;  1VYV A;  4XTZ A;  5KYU B;  4RTZ A;  1OOT A;  4EPC A;  5HY6 A;  3HHT B;  3CCM Q;  1I5L A;  3EGD A;  4BI3 A;  2HCK A;  3EGX A;  3HP9 A;  1I4K 1;  3TCJ A;  1H64 1;  3H0F A;  4L5G A;  1BI1 A;  1XNI A;  3SD4 A;  1VA7 A;  5GAN f;  2L3R A;  2CP5 A;  2E70 A;  4C8Q A;  4D8K A;  3M0R A;  5GAM e;  1Y7X A;  1D0Z A;  1M8V A;  2EJ9 A;  3EH1 A;  2HQX A;  2CT4 A;  4J9H A;  4Y91 A;  1ABO A;  2IVW A;  1RUW A;  2ABL A;  3A5Z B;  2QQ9 A;  2BE7 D;  1YI2 Q;  2YUO A;  2OTL A;  1PSE A;  4FSS A;  3R6O A;  2CP2 A;  1RI0 A;  5GAN 5;  2CSQ A;  2FPD A;  5I21 A;  4FSX A;  3VYH B;  2L3S A;  4OMQ A;  4XTY A;  1QP3 A;  4CRI A;  3V7C A;  2G3R A;  2RPN A;  4KGZ B;  1KD1 C;  2QQS A;  4HVW A;  4O6J A;  3JB9 F;  2LQ8 A;  1HYO A;  3FLG A;  2JM9 A;  2F69 A;  5J39 A;  2QI2 A;  5D7U A;  2IIM A;  4JRK A;  3CPW S;  3FIF A;  2RHU A;  2M16 A;  1M1G A;  1OUL A;  4PLL A;  1VQM Q;  3OYE A;  1WLP B;  4BAC A;  4HT8 A;  2K5I A;  3QBY A;  3EG9 B;  3BDL A;  3GPL A;  3G4S Q;  1K0S A;  2LVM A;  3CCR T;  2J06 A;  1YHQ A;  2DTH A;  2LJ1 A;  1M27 C;  4LDV A;  2JXB A;  2OAW A;  2V1Q A;  2XDP A;  2F2V A;  1D1B A;  5KYX A;  2LDM A;  2DAQ A;  1O75 A;  3DKM A;  2EKH A;  3M4Y A;  3CEY A;  3SWN A;  3ME9 A;  1ABQ A;  3FDR A;  1UGR B;  3VUB A;  3CC4 A;  3LH5 A;  2L2P A;  4OGC A;  5FRO A;  2DTO A;  1KHI A;  1E7O A;  1HXD A;  1YJW A;  1VQN A;  3A8G B;  3KFV A;  1M90 U;  2E3H A;  1YCS B;  3CC7 Q;  1M1F A;  3CCU Q;  3OYC A;  2D0N A;  1ZBX A;  2EYW A;  1ARK A;  3MP1 A;  1Y07 A;  4DOV A;  2ZPE B;  1K9M R;  4MDX A;  1Q81 U;  3QDF A;  4A4E A;  5IH2 A;  1U5S A;  3RUX A;  2E10 A;  1M9S A;  1NYF A;  1M1K R;  2VUB A;  4AFU C;  3JRZ A;  2RK1 A;  3OBY A;  4PNO A;  4XU3 A;  2HKN A;  1VQO A;  1Z9Z A;  2LRQ A;  1BU1 A;  4QKU A;  4HA8 A;  3MHX A;  2LTO A;  3OW2 S;  2JMC A;  3EHR A;  2B8A A;  3M58 A;  2GGR A;  4IIM A;  4C0G A;  2RI2 A;  3SHW A;  3CCQ A;  1E6H A;  4RTY A;  8ATC B;  2QEX A;  3VS5 A;  4E7L A;  2O9V A;  1Q82 R;  2OTL Q;  2HZY A;  1YNZ A;  2CZ7 B;  2XMF A;  3RES A;  4M75 E;  1NLP C;  2NYS A;  4JLG A;  5GAN 2;  2YWW A;  3I5S A;  4IUV A;  3M0Q A;  2QTX A;  3L1A A;  2LJ3 A;  2DXT A;  2A36 A;  1F1B B;  2J6K A;  2X51 A;  4JJB A;  1VQM T;  2JMA A;  4J7F A;  3PMI A;  3M55 A;  2FVU A;  5DLQ E;  2DL8 A;  5FU7 C;  3OY9 A;  1LCK A;  3G4S T;  5HCK A;  3JB9 J;  1OYX A;  2DJQ A;  1TH7 A;  5IHN A;  4JJC A;  4R55 A;  2DPP B;  2DMO A;  3EFS A;  3LWI A;  1M2V A;  3VS0 A;  1QCF A;  2FZG B;  3X20 B;  1G3S A;  1HSQ A;  2RK2 A;  5L8R E;  1B7T A;  4BE0 A;  2DZ9 A;  3X26 B;  2E1H A;  1X27 A;  1IZ6 A;  1PD1 A;  1WI7 A;  1WX6 A;  4ESR A;  1NJI U;  3BE3 A;  3VRZ A;  5I11 A;  1YHQ Q;  3JB9 I;  4MML A;  2M9U A;  4J9C A;  4M78 F;  1PNJ A;  1C6V X;  3OYB A;  1JRI A;  1WHK A;  2FRY A;  4LDW A;  3CC4 Q;  2R5M A;  1LOJ A;  2P4R A;  4OMM A;  5KYW A;  4C5I A;  1UUE A;  2MMP A;  1FX7 A;  2PZ1 A;  4HCK A;  4C92 E;  2A3L A;  1D09 B;  4RCB A;  1YJW Q;  1VQN Q;  2OTJ T;  5GAN g;  3L2V A;  1QQJ A;  1W4S A;  3NTI A;  5A2Q E;  2L5Q A;  2DD5 A;  3NHN A;  1G3T A;  2RQT A;  1BKB A;  2FG0 A;  1X69 A;  3OSS C;  2A7Y A;  2OX7 A;  1NEG A;  4OMF B;  2CSI A;  1RAH B;  1RAE B;  1C1A A;  2YDL A;  3QXE B;  1SG5 A;  2CH4 W;  3VS2 A;  3AT1 B;  2NUP A;  3I56 A;  1OU8 A;  1OX8 A;  1HK9 A;  4PJO E;  1RAG B;  1SF9 A;  4BDZ A;  1B34 B;  2OTL T;  2DLP A;  3CCS A;  5GAM j;  2DL5 A;  1YBY A;  1VQO Q;  1RAB B;  3RER A;  1RLP C;  2MF2 A;  2BKD N;  3M57 A;  2VV5 A;  1YWO A;  1UB4 A;  3DB4 A;  1KQS S;  1C0M A;  2BUD A;  3QYG B;  2EJG A;  3CCQ Q;  2VXE A;  3MPU B;  4GLM A;  3V7S A;  2ZGW A;  2K4Y A;  5LJ3 e;  1K73 R;  2QEX Q;  2ZPG B;  2M0O A;  2DA9 A;  2QTV A;  1Q81 C;  2NUZ A;  5CKF A;  2ESW A;  4X9D A;  4LUE A;  1AWW A;  1PHT A;  1Q82 C;  3A8M B;  2DIQ A;  1OPL A;  2RJC A;  2XHC A;  2HMA A;  4JRQ A;  4ATO A;  3O5Z A;  1AVZ C;  2LX7 A;  3I35 A;  4M75 C;  4ZTF A;  5FWC A;  4DBF A;  1OU9 A;  1UHF A;  1D3B B;  2KNB B;  4C8Q F;  1VQ9 A;  4MZT A;  2P0P A;  1CKA A;  3GBQ A;  2LCC A;  1RAA B;  4DBQ A;  3UA7 A;  3I5R A;  2DRM A;  3GNF B;  1M5Q 1;  4Q5W A;  5IN1 A;  4MZM A;  1QKW A;  1SHF A;  2WAC A;  4JJD A;  4XTU A;  1YJ9 A;  1VQL T;  2E5K A;  2EQM A;  4DBH A;  1I1J A;  2EYZ A;  3T9N A;  4DEX A;  2DBM A;  4BDY A;  2DM1 A;  2KXD A;  4LUD A;  4E2F B;  1YJW T;  2RJD A;  3E1S A;  1TS9 A;  2LNH B;  3CPW A;  1WYX A;  2EWN A;  2CUD A;  1OZ2 A;  2L8D A;  2E6N A;  2K79 A;  6AT1 B;  3CCE T;  2CP0 A;  3RIR A;  4EMK C;  3I9Q A;  3QKJ A;  1V29 B;  2NUT B;  3CCR A;  2LX9 A;  1YIJ A;  1IHW A;  4L59 A;  4M7D D;  3VU3 C;  2JS0 A;  2YUQ A;  9ATC B;  4JUV A;  2VWF A;  3SB2 A;  1VQO T;  2QQA A;  1NEB A;  2M1H A;  4C92 C;  1BYM A;  2FL7 A;  4Z88 A;  3Q1J A;  1Q86 U;  5CK9 A;  2BE9 B;  1S72 T;  4KH0 B;  1NJI C;  4B9W A;  1I8F A;  3RKY A;  3N5B B;  3I56 Q;  2EJF A;  2JS2 A;  4B9X A;  2CZ1 B;  2DIL A;  2RHI A;  1TWB A;  4CC4 B;  1KG1 A;  1WXT A;  3CCS Q;  2QGF B;  2JTF A;  4JS4 A;  4J9F A;  5J3B A;  2R58 A;  3NMZ C;  4OB3 B;  1IGU A;  1DJ7 B;  3TSW A;  1JBM A;  3I55 A;  4E7H A;  3O8V A;  3QZ5 B;  2O31 A;  4BUG A;  2CZ0 B;  3MET A;  3G1J A;  4AFZ C;  3P8D A;  2RNA A;  4A63 B;  1U3O A;  2YLB A;  5GAO q;  2JW4 A;  3X28 B;  4HVU A;  1N9R A;  2RJE A;  1W2B S;  3J81 E;  2LMJ A;  3OW2 A;  4KUD K;  3TQ7 P;  2LZ6 B;  3HTR A;  3PMT A;  1K73 C;  1BK2 A;  4FIB A;  4IUP A;  3TU4 K;  5KYY B;  5LJ5 h;  4RTT A;  2RH2 A;  5CVI A;  1TTH B;  2EQJ A;  4HKE A;  4PFP A;  1KC8 R;  4XTV A;  3OS1 A;  4OMN A;  1VQ9 Q;  4IUQ A;  3EAE A;  3JB9 D;  2HSP A;  1NYG A;  3GOX A;  3RDV A;  1VQP T;  2KYM A;  1SPK A;  1M3B A;  2KBT A;  2FHD A;  4AMC A;  2DER A;  2DXC A;  3OS5 A;  2HBW A;  1YJ9 Q;  1BIA A;  3GP8 A;  1VOM A;  3G7Z A;  1VQK A;  2Y4X A;  2FPF A;  3CPF A;  5GJW B;  4RG2 A;  1UG1 A;  5HKC A;  4J9E A;  3EFO B;  2AKK A;  1QVG A;  1GCQ C;  1XTD A;  1QW1 A;  3M0T A;  4B6M A;  4HXJ A;  2QG9 B;  4RCC A;  4PJO G;  2CDT A;  4CC2 A;  3JCM c;  4E47 A;  4M7A E;  2DTI A;  3CME A;  2JZ2 A;  1R8O B;  1IGQ A;  2QDL A;  3M4G A;  2COZ A;  3CCR Q;  3JCM f;  2KRM A;  2BIV A;  2VAS A;  2K3Y A;  2VB6 A;  2KVQ G;  4M7D G;  5GAO p;  2P84 A;  1YIJ Q;  3MP8 A;  2MWP A;  1AZE A;  3CCS T;  2QA4 A;  1GFD A;  2EIF A;  3QWY A;  1PWT A;  2DL3 A;  5GAN 8;  3MO8 A;  4JRI A;  4Y28 E;  2OTJ A;  1Q7Y R;  4D8D A;  1KIK A;  3ER0 A;  3S3N A;  2AIR B;  4OB1 B;  5KCH A;  3VS7 A;  1IO6 A;  5LJ3 h;  4PJO B;  2M0Y A;  1M2O A;  2CYZ B;  5FU6 B;  2X4W A;  1NBE B;  4JPB W;  4FM4 B;  4M7D B;  2W0Z A;  2GTJ A;  5LJ5 d;  3VUZ A;  1R0C B;  3L42 A;  3I55 Q;  5LJ3 j;  2DET A;  5I2S A;  2EVR A;  4J9B A;  3PFS A;  2CZ6 B;  2K3B A;  2CP6 A;  3JAM E;  1T0J A;  4NL2 A;  2VC8 A;  1VQ9 T;  2E12 A;  3M54 A;  2BZ8 A;  3MEU A;  2K2M A;  2SEM A;  3HKS A;  2MYS A;  1Q86 C;  4FT2 A;  2AZV A;  5CR2 A;  2A28 A;  1MMD A;  1WJR A;  1EZZ B;  2PUK B;  1VIF A;  2X4X A;  1N5Z A;  1YJ9 T;  3ZL7 C;  2DXB A;  4FL6 A;  2L3P A;  2GTO A;  4OB0 B;  1A0N B;  1PSF A;  5CKH A;  1YN8 A;  4UC4 A;  2DNU A;  2L3Q A;  4J9D A;  4M7A D;  1KC8 C;  1SEM A;  2JTM A;  1G83 A;  4P5N A;  4LD6 A;  3JB9 H;  1QVF P;  1CKB A;  3EHQ A;  3QII A;  1VQK Q;  1EIF A;  1TXQ A;  2A08 A;  1UTI A;  3H41 A;  4ZGE B;  2D9T A;  3C95 A;  1K9M U;  1YIJ T;  2XD0 A;  4LE9 A;  3HFO A;  3NPF A;  4OMO A;  3QZ9 B;  1R0B G;  3EG3 A;  4QVD A;  1M8M A;  1ZA1 B;  5KE2 A;  4M78 D;  1VQL A;  4Z02 A;  3S3O A;  1M1K U;  4BE1 A;  1QVF S;  3H6Z A;  2HL5 C;  1GL5 A;  4O5V A;  2I0N A;  2X4J A;  4FT4 A;  4KGX B;  3CME Q;  1PG5 B;  4M75 A;  4NS5 A;  4C0Z A;  1VQ7 T;  2GQV A;  1BI3 A;  4M77 D;  2KEA A;  3HRU A;  3CC2 A;  3OYA A;  5FWB A;  5LJ3 d;  3CCE A;  4AG2 C;  5GAN 3;  1YJN A;  3M0S A;  1QVP A;  1V76 A;  2QK0 A;  5A0G A;  1UGP B;  4RTV A;  5C0M A;  4ZNX A;  1Q82 U;  3P8H A;  2CUB A;  3JSC A;  3M5A A;  3X25 B;  2OTJ Q;  3I55 T;  1D1C A;  3G6E T;  3CMA T;  2KY9 A;  3VV0 A;  1VQ8 A;  1WXB A;  3CXC A;  2QAS A;  2V8I A;  3EFR A;  4AFQ C;  1K4U S;  4OP0 A;  1JU5 C;  4F7U G;  1H3Z A;  2LNV A;  2KRN A;  2O4X B;  3MEW A;  1VYU A;  1M30 A;  5J26 A;  1S72 A;  3QYH B;  4EMK A;  3NTH A;  3LH0 A;  3C0C A;  1FMK A;  3TEE A;  1V1C A;  2EAY A;  4IUT A;  2K5F A;  3BW1 A;  1GRI A;  3VKI A;  1TSF A;  3PTA A;  1YFN A;  3FB9 A;  1MHN A;  3FC3 A;  2KRO A;  4IUR A;  1D1A A;  4HT9 A;  1UGV A;  2RI3 A;  4C92 A;  1K0X A;  4JRP A;  3RKX A;  3THK A;  1IRX A;  2R57 A;  5KYU A;  1D0X A;  2LJ0 A;  2MOX A;  3M59 A;  3QO3 A;  1UHC A;  3TRE A;  4F7U B;  2DD4 A;  1VQK T;  2DO3 A;  2QQR A;  2EW3 A;  1JJ2 A;  1UDL A;  2M02 A;  3CQT A;  1W2B A;  2GCX A;  3OYG A;  2MWO A;  2VXF A;  1YCY A;  4C8Q D;  4M7A G;  2C06 A;  3CCL T;  2RJF A;  3BY7 A;  2F2X A;  4PJO A;  5LJ5 f;  1I07 A;  4OF1 A;  1SSF A;  2HD0 A;  3JCM g;  4J9I A;  2VVK A;  3CME T;  1QCN A;  1TUG B;  3JCM h;  2K2V A;  3RNJ A;  1IRE B;  1VQP A;  3VS4 A;  1Y96 B;  4DOW A;  1K8A R;  4M78 G;  1RAF B;  1KSW A;  2FB7 A;  2LT1 A;  5IAY A;  2QA4 T;  1VQL Q;  3H8Z A;  1WHG A;  4FYW B;  4PJM A;  4M7A B;  2YT6 A;  4M77 G;  2E65 A;  3JCM X;  4RTW A;  1OV3 A;  4ZN3 A;  2NWM A;  4FYX B;  2DE0 X;  3CC2 Q;  2DVJ A;  1MMN A;  2DVE A;  3CCE Q;  1YJN Q;  1K76 A;  1ZQ1 A;  3G71 T;  4YTL A;  4AT1 B;  4AG1 C;  4JLI A;  3ZEH A;  1Y57 A;  3E2U A;  5GAM h;  3JV3 A;  1N27 A;  4BY6 B;  1K73 U;  4BI8 B;  1KQ2 A;  2IG0 A;  1K9M C;  3REB B;  1VQ8 Q;  4M78 B;  3EG9 A;  2FEI A;  1GCQ A;  5D6Y A;  1ZSG A;  2MI6 A;  3KUF A;  2EGC A;  1WNL A;  1M1K C;  1PC0 A;  4OMP A;  1KK7 A;  4M7D E;  2HL3 A;  3JCM Q;  1X6O A;  3PE0 A;  3BFM A;  1S72 Q;  4M77 B;  4XTX A;  3FJ5 A;  1SRL A;  2AZS A;  3SDZ A;  4DBR A;  4C0D B;  1VQ4 T;  2M51 A;  2D8H A;  2R5A A;  4F17 A;  3L2Q A;  1RAI B;  5LJ3 f;  4J6W A;  2COW A;  2JVV A;  4KGV B;  2ZCF B;  1LJO A;  2F5K A;  2EYQ A;  4Z89 A;  4V2S A;  2HSE B;  5CAI A;  1VUB A;  2E6Z A;  2VGN A;  4Y92 A;  2SRC A;  2EQK A;  2YUP A;  4QQ6 A;  2LC4 A;  1ZSZ B;  4RKU E;  4TVR A;  1JEG A;  3OYI A;  4LDX A;  3JCM d;  4C8Q G;  4BE2 A;  4ZGJ B;  4HCB A;  5FU7 B;  2QDY B;  2EQI A;  2DL7 A;  1H92 A;  1WJS A;  1YWP A;  2E5Q A;  2CS7 A;  1G3W A;  3WXM B;  1NZ9 A;  1NM7 A;  1OEB A;  2D8J A;  3CD6 A;  5AYF A;  4A53 A;  1XQH A;  2ZPH B;  1JB0 E;  2HBP A;  3A8O B;  2X3X D;  2ROT A;  4LXC A;  4CC3 A;  3EGD B;  1SRM A;  1VQP Q;  3EGX B;  2BZX A;  3CC2 T;  1ZX6 A;  3INZ A;  1S1N A;  1AEY A;  2E41 A;  2D0Q B;  1BI0 A;  1YJN T;  4E7S A;  3GF5 A;  3OMG A;  4C8Q B;  5GAM d;  3UDC A;  1JXO A;  1I0C A;  1MNE A;  1K8A C;  2AHJ B;  1N6A A;  4PJL A;  1VYT A;  1VQ8 T;  4JDS A;  3OYN A;  1G8X A;  4RMO A;  1YIT A;  4R56 A;  1I5O B;  4RTU A;  1D0Y A;  2O2O A;  2ATC B;  2X9H A;  4FCY A;  1AWJ A;  1AD5 A;  1MMG A;  1QKX A;  1VQ7 A;  3HSB A;  1WFW A;  2NLU A;  2HKQ B;  2H8H A;  4X1V A;  4K11 A;  1VQ5 T;  4II1 A;  1PD0 A;  3CCM A;  3PIO A;  3OMC A;  5IHI A;  4PJO C;  8AT1 B;  2LT4 A;  3U23 A;  4M75 F;  1W6X A;  4CC7 A;  4BB7 A;  3C94 A;  2AKL A;  1KC8 U;  3CCV A;  5FU6 C;  2VGM A;  2XK0 A;  5M9O A;  3G6E A;  3CMA A;  1P92 A;  1ZA2 B;  1GXI E;  4IUU A;  2JT4 A;  1QP2 A;  2YRC A;  4M7D C;  5CO7 A;  1JJ2 P;  4PFZ A;  4R0K A;  2ZPI B;  2V8J A;  5LJ5 g;  4BD3 A;  2KDS A;  5A0D A;  2DIG A;  3UT1 A;  1I81 A;  2GQI A;  1T3S A;  1YP5 A;  4F7U E;  1G3Y A;  2XKO C;  4J6Y A;  3C4S A;  4KUL A;  2LCS A;  5KYX B;  4GBQ A;  1X43 A;  2JN0 A;  3SWN B;  1KD1 R;  4PLI A;  1RAC B;  1WHL A;  1B3Q A;  1R77 A;  2EYX A;  1B34 A;  3E9G A;  2RMO A;  3V8L A;  4F14 A;  1WDX A;  2J6O A;  1WA7 A;  2KT1 A;  3EGU A;  1OI1 A;  1IXD A;  2A37 A;  2P0Q A;  3CD6 Q;  5GAO m;  3PNW C;  3ULR B;  4FU6 A;  1WHM A;  1WQ7 A;  4C92 F;  1KHC A;  3CCL A;  4FYV B;  3S6W A;  2KI7 A;  3RMQ A;  1LPL A;  2XU8 A;  2P0K A;  1Q7Y U;  3OYY A;  2EKO A;  2A0F B;  1TU0 B;  3UA6 A;  1TOV A;  4KUI A;  2X3W D;  3LX7 A;  2F1L A;  1T3L A;  1N8R R;  1VQ6 T;  3GIB A;  2RO0 A;  1LVK A;  4QQG A;  4PJO F;  1D3B A;  3WVE B;  3MCA B;  1BIB A;  1MMA A;  3HFN A;  1YIT Q;  1JO8 A;  4OB2 B;  2FZK B;  4HCZ A;  4E7I A;  4IIO A;  3X24 B;  3H9N A;  3M53 A;  4EIK A;  3F70 A;  1U8R A;  3MP6 A;  1PRM C;  4AFS C;  4M7D F;  4M78 E;  3KBG A;  3OBW A;  2HAX A;  1VQ7 Q;  2RHY A;  5IT9 E;  4LDU A;  5LJ3 g;  1VIE A;  1O9S A;  1Q95 G;  4N4H A;  1RI9 A;  2WSF E;  3OS2 A;  5GAO l;  2ZAE A;  4M77 E;  4Z8A A;  2JM8 A;  3G71 A;  2PVO B;  5GAM f;  2O88 A;  2CGH A;  5GAN e;  1W70 A;  3CCV Q;  3BDU A;  3G6E Q;  3CMA Q;  1EX4 A;  1W1F A;  2QQB A;  1M2V B;  2OI3 A;  1PKS A;  4JS5 A;  1WHH A;  4WCI A;  2NUT A;  5CIU A;  4JZ3 A;  1GBQ A;  3REA B;  2P4T A;  4QT7 A;  3MKD A;  2RB6 A;  4ELY C;  2HDA A;  3JCM W;  4J5Y A;  1KQS A;  2RM4 A;  1EFN A;  4A4H A;  1BBZ A;  2EYY A;  2B86 A;  2RA2 A;  3OYD A;  3OA6 A;  1VQ4 A;  1Y0M A;  2YRV A;  2K7A A;  2WSC E;  4A4G A;  3CD6 T;  5CKD A;  3JB9 G;  4PFO A;  3CPW P;  2DRK A;  1H8K A;  5KYW B;  4KH1 B;  1K1Z A;  3JCM J;  5IXF A;  2Y4Y A;  2W10 A;  4ORZ A;  3UPU A;  2L89 A;  2CRE A;  5DM7 R;  1SKU B;  1WXU A;  3ZFJ A;  4CI0 C;  3P8B B;  4MMK A;  1MND A;  2YXY A;  1PRL C;  3OYK A;  1KFZ A;  3OYL A;  5IXB A;  3QDR B;  2GFU A;  3M56 A;  3CBP A;  4JZ4 A;  4ZGD B;  3WVD B;  4N4I A;  3CCL Q;  5D6X A;  3JCM b;  2NUP B;  3OYJ A;  4C8Q E;  1YIT T;  1K9A A;  1RLQ C;  2DZC A;  2E4H A;  3CCJ A;  3UWN A;  4FW2 A;  4FW1 A;  2BTT A;  4GLK A;  2EGA A;  5KYY A;  5FRN A;  2F5T X;  3J7A F;  3AHU A;  3A1P A;  5I22 A;  5ECA A;  4M7A C;  3CBM A;  1AHJ B;  2E3I A;  2EGE A;  2QA4 Q;  1OPK A;  3CCM T;  1QWE A;  3OB9 A;  2K5L A;  1ZUY A;  2YUN A;  3RKW A;  3TSZ A;  1N8R C;  3H0I A;  3CCV T;  5CQX A;  3HRS A;  3OYH A;  4LD9 K;  2JJ9 A;  1OQK A;  4BY6 C;  5HK0 A;  5KH6 A;  3OW2 P;  1FMW A;  3C12 A;  4M78 C;  2KE9 A;  4F04 B;  5HK3 A;  3EFO A;  1GFC A;  1U06 A;  3JCM V;  3G71 Q;  1Q7Y C;  2V8K A;  4A4F A;  1WGS A;  2RQW A;  3PT9 A;  3URG A;  2RHZ A;  4PJN A;  1RL2 A;  1YI2 T;  2CP7 A;  5EC7 A;  4M77 C;  4F7U F;  1M90 R;  2ECZ A;  3FEO A;  4OVA A;  1M3C A;  4HVV A;  1VQ5 A;  4VUB A;  4C0D C;  2XIC A;  2DYI A;  3LLR A;  5GMK e;  2YHT A;  5CQY A;  4QVC A;  2H3J A;  1WIE A;  3KXT A;  2V1R A;  3H0H A;  1Q81 R;  2RQR A;  3LW5 E;  2KT8 A;  2DF6 A;  3J80 E;  3OYM A;  1NPP A;  2ED0 A;  1KJW A;  1WQW A;  3EG2 A;  1VQ4 Q;  2YSQ A;  2KAF A; 
#chains in the Genus database with same CATH homology
 4QQD A;  3PMT A;  5CCA A;  3QPH A;  5I21 A;  1K73 C;  4FSX A;  4FIB A;  4TVR A;  4IUP A;  3VYH B;  3TU4 K;  5LJ5 h;  2RH2 A;  5CVI A;  3OYI A;  1K8A U;  5GAN 4;  2EQJ A;  3M9Q A;  2XDD A;  4HKE A;  4XTY A;  4XTV A;  4LDX A;  3JCM d;  1QP3 A;  4CRI A;  4C8Q G;  3OS1 A;  3V7C A;  4BE2 A;  2G3R A;  5DY9 A;  4ZGJ B;  1KD1 C;  2QQS A;  2K57 A;  4IUQ A;  4O6J A;  3EAE A;  4HCB A;  3JB9 D;  3JB9 F;  2EQU A;  4JJN K;  2LQ8 A;  4NOY A;  5FU7 B;  2QDY B;  2XDB A;  2KSS A;  3FLG A;  3MEA A;  4EDU A;  1WJS A;  2F69 A;  4N0A C;  3GOX A;  2E5Q A;  1VQP T;  5J39 A;  2QI2 A;  3L2Z A;  2CS7 A;  2EFI A;  1G3W A;  4JRK A;  3WXM B;  3CPW S;  1NZ9 A;  1WJQ A;  2FHD A;  2DXC A;  2RHU A;  3FIF A;  3OS5 A;  2MAM A;  2M16 A;  3LGF A;  4EMG A;  1QVG S;  1M1G A;  3CD6 A;  5AYF A;  4M7D A;  4M7A F;  5CKB A;  4A53 A;  4PLL A;  1BIA A;  3GP8 A;  1XQH A;  5LJ5 e;  3G7Z A;  5KCO A;  2ZPH B;  4QQ6 A;  1VQK A;  2Y4X A;  3CPF A;  3OYE A;  1JB0 E;  2HBP A;  3A8O B;  4RG2 A;  5LL6 S;  4BAC A;  4HT8 A;  2K5I A;  3QBY A;  4KBM B;  3BDL A;  4OGE A;  5CKE A;  5HKC A;  3GPL A;  1QVG A;  2LVM A;  3CC2 T;  3CCR T;  4GY5 A;  3INZ A;  1YHQ A;  1XTD A;  1FXX A;  2DTH A;  2D0Q B;  1BI0 A;  1QW1 A;  2E41 A;  4LDV A;  2XDP A;  3OQ5 A;  3V7R A;  1YJN T;  4RCC A;  2LDM A;  2RD1 A;  3GF5 A;  3QUI A;  3OMG A;  5GMK m;  2DAQ A;  1O75 A;  4PJO G;  3CBO A;  3UDC A;  3DKM A;  4C8Q B;  5GAM d;  3CCU T;  3CC7 T;  3M4Y A;  3JCM c;  4C8Q C;  4E47 A;  4HCC A;  3CEY A;  3SWN A;  3A8L B;  1K8A C;  4M7A E;  2DTI A;  2AHJ B;  3FDR A;  1UGR B;  3ME9 A;  3VUB A;  3CC4 A;  1N6A A;  3CME A;  4WF2 A;  2JZ2 A;  1R8O B;  4L6V 5;  4DQ2 A;  2DKG A;  3M4G A;  4OGC A;  5FRO A;  1U1T A;  3JCM f;  1VQ8 T;  1U1S A;  4JDS A;  4QW2 A;  2DTO A;  1KHI A;  3OYN A;  2BIV A;  2K3Y A;  2KVQ G;  4M7D G;  5GAO n;  4RMO A;  5GAO p;  5GAM g;  1HXD A;  1ZHI A;  1YJW A;  3MP8 A;  1VQN A;  2MWP A;  3A8G B;  1YIT A;  2XG8 D;  4R56 A;  2ZZD A;  1M90 U;  4M77 F;  1M1F A;  3CCS T;  3DLL A;  3OYC A;  2QA4 A;  1ZBX A;  3MP1 A;  2EIF A;  3V8J A;  1Y07 A;  4DOV A;  2ZPE B;  5GAN h;  4MDX A;  1VQ6 A;  4XU1 A;  1Q81 U;  1VQ7 A;  4A4E A;  1NPR A;  4ELZ C;  5GAN 8;  2GF7 A;  3MO8 A;  4JRI A;  4Y28 E;  2OTJ A;  3RUX A;  2E10 A;  1M9S A;  2NLU A;  3HSB A;  1WPY A;  3ER0 A;  3NFC A;  5FRM A;  2VUB A;  3S3N A;  3JRZ A;  2RK1 A;  3QG1 A;  1VQ5 T;  4II1 A;  5GAN j;  3OBY A;  4OB1 B;  3CCM A;  5KCH A;  4PJO B;  5LJ3 h;  4PNO A;  3PIO A;  3OMC A;  3S3M A;  4XU3 A;  5GAN 6;  4PJO C;  3MEV A;  3LYI A;  2LT4 A;  1MGQ A;  3QSU A;  4M75 F;  4M75 D;  1VQO A;  2CYZ B;  2LRQ A;  4ME7 A;  5FU6 B;  4BB7 A;  3C94 A;  1KC8 U;  2X4W A;  3CCV A;  4HA8 A;  3MHX A;  5FU6 C;  2LTO A;  4X9C A;  2VGM A;  2XK0 A;  3SFM A;  5M9O A;  3G6E A;  3OW2 S;  2I2L A;  3CMA A;  4IKF A;  4FM4 B;  2B8A A;  3M58 A;  1P92 A;  2RHX A;  2LQK A;  1GXI E;  4IUU A;  4M7D B;  3ZBD A;  5LJ5 d;  3VUZ A;  1QP2 A;  3L42 A;  5LJ3 j;  4C0G A;  1FWZ A;  2RI2 A;  2X35 A;  4M7D C;  2HQE A;  5CO7 A;  5GMK l;  5I2S A;  3CCQ A;  3PFS A;  2CZ6 B;  2PQW A;  3JAM E;  2PU9 B;  4NL2 A;  2VC8 A;  2HNI A;  2QEX A;  2E12 A;  4E7L A;  3M54 A;  1VQ9 T;  2ZPI B;  1M90 C;  3PIP A;  2V8J A;  3MEU A;  3HKS A;  2CZ7 B;  5LJ5 g;  3HPW A;  4BD3 A;  2KDS A;  3GNG A;  5A0D A;  1Q86 C;  2DIG A;  3UT1 A;  1I81 A;  4F7U E;  1G3Y A;  4FT2 A;  3RES A;  4M75 E;  5CR2 A;  2XKO C;  4J6Y A;  3C4S A;  4KUL A;  4JLG A;  5GAN 2;  1WJR A;  2VYT A;  4DA4 A;  4IUV A;  2PUK B;  4XTW A;  1VIF A;  2QTX A;  3L1A A;  2JN0 A;  2K3X A;  2DXT A;  4RG8 A;  2X4X A;  4MDW A;  3SWN B;  1YJ9 T;  1VQM T;  2DXB A;  4PLI A;  3SWN C;  4FL6 A;  4OB0 B;  4J7F A;  3PMI A;  3M55 A;  2FVU A;  2PVD B;  4ZTJ A;  4N4G A;  5DLQ E;  5FU7 C;  3OY9 A;  1M4Z A;  1PSF A;  1B34 A;  3E9G A;  2XID A;  2KK4 A;  3G4S T;  3V8L A;  2PVG B;  5CKH A;  3L2U A;  3JB9 J;  1OYX A;  4D6W A;  1TH7 A;  2O4X A;  4UC4 A;  4R55 A;  2DPP B;  1X01 A;  2OAU A;  4M7A D;  3EFS A;  3LWI A;  1KC8 C;  3CCJ T;  3PGG A;  2JTM A;  1OI1 A;  1YHQ T;  4P5N A;  4LD6 A;  2XI9 A;  5C6S A;  3JB9 H;  2P0Q A;  3X20 B;  1G3S A;  2RK2 A;  2ZPB B;  5L8R E;  5GAO m;  1UGQ B;  5EG2 A;  2GFA A;  4BE0 A;  3PNW C;  3QII A;  2DZ9 A;  3OSV A;  3QJ6 A;  1X75 C;  4C0F A;  4FU6 A;  1EIF A;  4XU2 A;  3X26 B;  1WQ7 A;  2E1H A;  1IZ6 A;  1KHC A;  4C92 F;  4C92 D;  3CCL A;  3S6W A;  3CC4 T;  4ZGE B;  2D9T A;  4KT0 E;  5GAN 7;  3C95 A;  1K9M U;  3RMQ A;  1YIJ T;  1NJI U;  2XD0 A;  3HFO A;  3GLX A;  3JB9 I;  4MML A;  5D6W A;  3QZ9 B;  2M9U A;  4QVD A;  2XU8 A;  5KE2 A;  3FRN A;  2P0K A;  1Q7Y U;  1VQN T;  3OYY A;  4M78 F;  4M78 D;  4E7K A;  2EKO A;  1VQL A;  4Z02 A;  4A4K A;  3S3O A;  1M1K U;  4BE1 A;  1QVF S;  3H6Z A;  3QHS A;  4QVZ A;  5KE3 A;  4O5V A;  2X4J A;  4KUI A;  5GAN d;  3OYB A;  1JRI A;  3LX7 A;  4LDW A;  4FT4 A;  4F7U A;  2DEQ A;  2R5M A;  2ZPF B;  2RI5 A;  4M75 A;  1G5V A;  4NS5 A;  4MZP A;  5I2M A;  1LOJ A;  1NE8 A;  2WSE E;  1VQ6 T;  3GIB A;  4C0Z A;  4C5I A;  1VQ7 T;  2GQV A;  2MMP A;  1BI3 A;  1FX7 A;  2RO0 A;  4QQG A;  1D3B A;  4M77 D;  4PJO F;  4C5E A;  4C92 E;  3WVE B;  3MCA B;  3JCM P;  1QVF A;  1BYM A;  2A3L A;  1BIB A;  2OTJ T;  4RCB A;  3HFN A;  3HRU A;  4XAX B;  2KQW A;  3CC2 A;  4OB2 B;  5GAN g;  3L2V A;  3FJP A;  4HCZ A;  1W4S A;  4X34 A;  3NTI A;  3OYA A;  5A2Q E;  3X24 B;  2L5Q A;  5LJ3 d;  4E7I A;  2DD5 A;  5GMK i;  3M53 A;  3F70 A;  3CCE A;  1G3T A;  1U8R A;  5GAN 3;  1YJN A;  3VYG A;  2JOY A;  3MP6 A;  3QJY A;  1BKB A;  2JNG A;  3OSS C;  3CXC S;  1QVP A;  4M7D F;  2A7Y A;  4M78 E;  3V8K A;  4OMF B;  5A0G A;  1UGP B;  3KBG A;  3VJP A;  3OBW A;  5C0M A;  3L2R A;  2HAX A;  4PKC C;  2RHY A;  3QXE B;  3LWH A;  1Q82 U;  3P8H A;  5IT9 E;  3JSC A;  3M5A A;  3X25 B;  3E9F A;  4LDU A;  5LJ3 g;  1VIE A;  1O9S A;  3I55 T;  3G6E T;  3CMA T;  2KY9 A;  3VV0 A;  1VQ8 A;  2CKK A;  3DLM A;  4N4H A;  4XQ3 A;  2WSF E;  3CXC A;  3OS2 A;  5GAO l;  2V8I A;  3I56 A;  1LNX A;  1Y96 A;  1HK9 A;  3EFR A;  4PJO E;  4M77 E;  5GMK h;  4OP0 A;  3G71 A;  4BDZ A;  4F7U G;  3LGL A;  3CCQ T;  1H3Z A;  1B34 B;  2JUF A;  4M75 G;  5DLO A;  2LNV A;  2OTL T;  1BI2 A;  3CCS A;  2PVO B;  2O4X B;  5GAM f;  5GAM j;  3MEW A;  1YBY A;  1KD1 U;  2D6F A;  2CGH A;  5GAN e;  2QEX T;  5J26 A;  3RER A;  1S72 A;  2FYK A;  2MF2 A;  3BDU A;  2BKD N;  3HL8 A;  3M57 A;  2VV5 A;  3QYH B;  4C5H A;  4EMK A;  3NTH A;  2QQB A;  3LH0 A;  1UB4 A;  5GMK j;  4E7J A;  3DB4 A;  1KQS S;  4M7A A;  4JS5 A;  2BUD A;  3HRT A;  3QYG B;  2EJG A;  5CIU A;  3TEE A;  3A8H B;  2EAY A;  2PUO B;  2P4T A;  2VXE A;  2K5F A;  3BW1 A;  4IUT A;  3V7S A;  3VKI A;  5FLX E;  3PTA A;  2ZGW A;  2K4Y A;  5LJ3 e;  4PL6 A;  2RB6 A;  3FB9 A;  1MHN A;  4ELY C;  2ZPG B;  3FC3 A;  2M0O A;  4XU0 A;  1YI2 A;  4IUR A;  3JCM W;  4J5Y A;  1KQS A;  4HT9 A;  2RM4 A;  1Q81 C;  1XOV A;  2RI3 A;  5CKF A;  4A4H A;  4C92 A;  4X9D A;  1JJ2 S;  2RA2 A;  3OYD A;  3OA6 A;  1VQ4 A;  4JRP A;  3RKX A;  2YRV A;  1N9S A;  2WSC E;  2R57 A;  4A4G A;  3CD6 T;  5CKD A;  1Q82 C;  3A8M B;  2DIQ A;  3JB9 G;  3M59 A;  3QO3 A;  4LDY A;  2RJC A;  2XHC A;  3TRE A;  4F7U B;  2DD4 A;  4M75 B;  4M78 A;  4JRQ A;  1VQK T;  2DO3 A;  4ATO A;  2QQR A;  4A54 A;  4M75 C;  4ZTF A;  4J8O A;  1JJ2 A;  2Y90 A;  1W2B A;  2GCX A;  3OYG A;  2MWO A;  3JCM J;  1D3B B;  2VXF A;  1YCY A;  4C8Q D;  4C5G A;  2Y4Y A;  4C8Q F;  4MZT A;  2P0P A;  1VQ9 A;  3UPU A;  4M7A G;  2L89 A;  2LCC A;  1Y71 A;  3DB3 A;  3CCL T;  2RJF A;  1OZ3 A;  5DM7 R;  3BY7 A;  4ZN1 A;  3NTK A;  2C06 A;  3ZFJ A;  3ASK A;  4NL3 A;  4PJO A;  4M77 A;  1N8R U;  4Q5W A;  3GNF B;  1M5Q 1;  3P8B B;  4CI0 C;  5LJ5 f;  5IN1 A;  4MMK A;  5LJ5 j;  3OYF A;  4OF1 A;  3OYK A;  3OYL A;  4MZM A;  4XTU A;  1SSF A;  2WAC A;  2HD0 A;  3QDR B;  3JCM g;  1YJ9 A;  2GFU A;  2EQM A;  1VQM A;  1VQL T;  4C92 G;  3CME T;  3M56 A;  3CBP A;  2X4Y A;  3JCM h;  4ZGD B;  2KMT A;  3WVD B;  4N4I A;  3T9N A;  2K2V A;  5D6X A;  4BDY A;  1IRE B;  3JCM b;  1VQP A;  3OYJ A;  3G4S A;  1Y96 B;  4DOW A;  1YJW T;  2RJD A;  4C8Q E;  3L2W A;  3E1S A;  1YIT T;  3CPW A;  2DJZ A;  4M78 G;  2DZC A;  2EWN A;  2FB7 A;  3CCJ A;  3UWN A;  2QXF A;  2LT1 A;  1OZ2 A;  5IAY A;  2QA4 T;  3H8Z A;  4GLK A;  4XK8 E;  3OS0 A;  2L8D A;  4J83 A;  2E6N A;  4EMK B;  3CCE T;  5FRN A;  3RIR A;  2F5T X;  3J7A F;  3AHU A;  4EMK C;  4EMH A;  2DK3 A;  2YLC A;  4M7A B;  3QKJ A;  4M77 G;  1UGS B;  2E65 A;  1V29 B;  4BI4 A;  3JCM X;  3CCR A;  2LX9 A;  4M7A C;  3CBM A;  2E64 A;  3JCM e;  1AHJ B;  2LCL A;  4ZN3 A;  1YIJ A;  5GAO r;  4N0A A;  3E19 A;  2O01 E;  4L59 A;  3RMS A;  2DVE A;  3CCM T;  4M7D D;  1UEB A;  3OB9 A;  5A0L A;  3VU3 C;  2DXU A;  3CC7 A;  3CCU A;  3I56 T;  4J6X A;  2K5L A;  4JUV A;  3RKW A;  3SB2 A;  1ZQ1 A;  1N8R C;  1VQO T;  3G71 T;  4YTL A;  2QQA A;  4C92 B;  3CCV T;  5CQX A;  2M1H A;  3HRS A;  4JLI A;  3ZEH A;  2FL7 A;  4C92 C;  5GAM h;  4J7I A;  3OYH A;  1KQ1 A;  1N27 A;  4LD9 K;  3Q1J A;  4BY6 B;  1Q86 U;  1K73 U;  5CK9 A;  4BI8 B;  1KQ2 A;  4XTZ A;  4BY6 C;  4EPC A;  2IG0 A;  1S72 T;  5HK0 A;  1K9M C;  1NJI C;  4B9W A;  5HY6 A;  3HHT B;  5KH6 A;  4M78 B;  1I8F A;  3RKY A;  1I5L A;  3N5B B;  3C12 A;  4M78 C;  2EJF A;  5D6Y A;  4BI3 A;  5HK3 A;  3HP9 A;  2MI6 A;  3JCM V;  1I4K 1;  1Q7Y C;  3TCJ A;  2V8K A;  1H64 1;  3KUF A;  4B9X A;  4L5G A;  2CZ1 B;  4A4F A;  1WGS A;  1WNL A;  2RHI A;  1M1K C;  1BI1 A;  1XNI A;  1KG1 A;  3PT9 A;  4M7D E;  2JTF A;  3SD4 A;  4JS4 A;  3JCM Q;  3URG A;  1X6O A;  5GAN f;  2L3R A;  2RHZ A;  2R58 A;  5J3B A;  1RL2 A;  3BFM A;  4M77 B;  2E70 A;  4XTX A;  4C8Q A;  1YI2 T;  3SDZ A;  4M77 C;  4OB3 B;  4F7U F;  5GAM e;  1DJ7 B;  1Y7X A;  1M8V A;  2EJ9 A;  2HQX A;  1JBM A;  3FEO A;  4OVA A;  3I55 A;  4Y91 A;  4C0D B;  1VQ4 T;  1VQ5 A;  4E7H A;  2IVW A;  3O8V A;  4VUB A;  4C0D C;  2XIC A;  3LLR A;  3QZ5 B;  2R5A A;  2CZ0 B;  2YHT A;  5CQY A;  3A5Z B;  3MET A;  4BUG A;  2H3J A;  4QVC A;  5GMK e;  3KXT A;  2QQ9 A;  3L2Q A;  3P8D A;  5LJ3 f;  4J6W A;  2YLB A;  5GAO q;  2OTL A;  3LW5 E;  3X28 B;  1PSE A;  2JVV A;  3OYM A;  1N9R A;  2ZCF B;  2RJE A;  1LJO A;  1NPP A;  3J80 E;  3J81 E;  1W2B S;  3R6O A;  2F5K A;  2EYQ A;  3OW2 A;  4KUD K;  1RI0 A;  4V2S A;  4PJO D;  1WQW A;  5CAI A;  1VUB A;  2E6Z A;  2VGN A;  5GAN 5;  2EQK A;  2LC4 A;  2KAF A;  4RKU E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...