3JRZA

Ccdbvfi-formii-ph5.6
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
104
structure length
99
Chain Sequence
SQFTLYKNKDKSSAKTYPYFVDVQSDLLDNLNTRLVIPLTPIELLDHLCPTIHIDEGDFIMLTQQMTSVPVKILSEPVNELSTFRNEIIAAIDFLITGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords CcdB
publication title Structural and thermodynamic characterization of vibrio fischeri CCDB
pubmed doi rcsb
source organism Vibrio fischeri
total genus 29
structure length 99
sequence length 104
ec nomenclature
pdb deposition date 2009-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01845 CcdB CcdB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jrzA00
4ELYC 3JRZA 2KMTA 1NE8A 3G7ZA 5CKFA 3VUBA 5HK0A 2C06A 5CCAA 5HKCA 1VUBA 5CKHA 1UB4A 5CQYA 5CR2A 5CO7A 1X75C 3TCJA 5DLOA 4ELZC 3JSCA 5CKBA 4VUBA 4MDXA 5CKDA 3HPWA 4MZPA 3NFCA 4HKEA 4MZMA 2VUBA 4OF1A 1M1FA 5CQXA 5CK9A 5HK3A 2MF2A 5CKEA 4MZTA 4ME7A
chains in the Genus database with same CATH superfamily
4M7DD 2DO3A 4KH0B 1M1GA 3CC4Q 4CRIA 4M78C 4M77E 3TQ7P 2DRKA 3QHSA 1BI3A 1HSQA 2BTTA 2DPPB 4RG2A 2BZ8A 4PFZA 3OBWA 2E6ZA 4C8QD 2O31A 3CCJA 5AT1B 4LUEA 3X24B 1HYOA 2QASA 2JMCA 1LCKA 3CCUA 1UB4A 3CC2Q 1UUEA 1LNXA 3QJYA 2IIMA 5LJ5h 1M2OA 1QWFA 2E3IA 2K79A 3L2WA 4HVUA 4WF2A 8ATCB 3CCSA 1CSKA 5DY9A 2PNIA 2G6FX 1TSFA 2YLBA 2DXBA 3CEYA 3M0RA 2XKOC 3LWHA 4MDWA 2WSFE 3RIRA 5FWBA 4J5YA 3TSZA 4ZNXA 5CKBA 2ECZA 4M75A 5GJWB 3QWXX 3RDVA 1KC8C 2ZPEB 3ME9A 3CCRT 4PK4A 1BIAA 3V8LA 4GLMA 1VIEA 4L6V5 4DBRA 4LDUA 1VQKT 2E5KA 2QA4A 1U5SA 1QKXA 3JCMd 4M77C 1UGRB 2E3HA 5GANg 2EKHA 2CZ7B 1TU0B 2QTVA 2MPXC 5CKDA 3M0SA 2KK4A 3MCAB 1RAEB 1ZSZA 2JMAA 3QUIA 1OZ2A 2X35A 5GAMe 1VQ7T 1HJDA 3QJ6A 2NUZA 1K1ZA 1VQ4T 4M78B 1BBZA 3HFNA 5AYFA 1H8KA 1ZUYA 1I4K1 5GAOl 1Q82U 2EQKA 3PNWC 4PJLA 1JJ2P 5I2SA 4BE2A 4QT7A 3TREA 2KXDA 2GQIA 1E7OA 5GAMd 4PFOA 1JB0E 4IUUA 4JZ3A 3P8HA 3CCRA 4Y91A 1MMNA 1WXTA 1M8MA 4LXCA 1VQ6T 1I8FA 2VGMA 3FJPA 2V1RA 1TH7A 4JZ4A 4C92F 2NYSA 4JJBA 3L2UA 2KYBA 2QQ9A 4NL2A 3N5BB 4BY6C 3EFOB 4XTWA 1VQ4Q 4KH1B 3P8BB 4FYYB 1QVFP 2W10A 2JT4A 2HL5C 3QYHB 2C0TA 3V7CA 3BFMA 1UGQB 1QVPA 2L0AA 1H92A 5KYWA 4PLLA 3E1SA 1ABQA 2F2XA 1RAAB 3CXCS 1KIKA 5CQYA 2DYBA 1Q86U 3MEAA 2ZPFB 2HAXA 2EIFA 2CT3A 1VQ6Q 2V8KA 5M9OA 2COWA 2RHZA 4RTYA 3RESA 4RTZA 3D7SB 1SRLA 2AIRB 1Q82C 1VQLT 1E6GA 4M77B 1N8RU 3JB9I 1C1AA 3MEWA 2MCNA 3QZ5B 3RMQA 4DBQA 2KROA 1Y07A 1K8AC 1I81A 4RTVA 4FW1A 2EYZA 1IXDA 1YJNA 4XU0A 1BCOA 2E41A 3META 3GNGA 4LUDA 3EGDA 3ZFJA 2FO0A 2D9TA 2DRMA 4C92A 5GAOq 2EJGA 3IQLA 2A0FB 1VQOA 1T3LA 2M9UA 1H3HA 2DL5A 3I5RA 2K3XA 3OMCA 3ZBDA 5KYYB 2DL8A 4E7LA 1VQLQ 2Z0WA 3C4SA 4R56A 3I55A 2NUTB 4HCCA 5FRNA 3MEVA 1VQ8A 2DXCA 1T3SA 3MP6A 5J3BA 4BY6B 3MJXA 4JLGA 4EDUA 3EHQA 1TG0A 5KE2A 3G71T 2K6DA 2RHIA 1ZUKA 2L8DA 3M55A 2WACA 2ESWA 3OYCA 1MV3A 1AOJA 3I35A 1UHFA 2GFAA 4OF1A 3SWNB 2XMFA 3EFSA 4HCZA 5IXFA 2AT1B 3PTAA 3HRUA 3CCMA 2K5IA 1G5VA 2A7YA 3QO3A 1K9MU 2RK1A 4FU6A 3VRYA 3GPLA 2EQIA 4LDWA 4KBMB 5I2MA 1Y57A 1M9SA 2C0OA 1Q7YU 4Q5WA 9ATCB 4M75G 1JJ2A 2M51A 3NTIA 5GAN8 1ZBXA 2P0PA 3F70A 2VASA 1W2BS 2YSQA 3G71Q 2EQJA 2EGAA 1Y96A 4QVCA 5LJ3e 1BI1A 3HP9A 5D7UA 1Z9QA 1VYUA 2CS7A 1BU1A 2KSSA 4M7AG 3NTKA 1MUZA 4EMKA 3HRSA 1ZSZC 2DXUA 1QCOA 3ASKA 2CDTA 2FPFA 2E1HA 3G6ET 5GMKe 2GTJA 2O9SA 1Q82R 1SSHA 2RQTA 2EQMA 1Q81C 1JQQA 2DJZA 4HVVA 2AZSA 4ELYC 1QVFA 1Q95G 2XG8D 5GAN7 4X9CA 2BE7D 5LJ3j 2HBWA 1D0YA 2LQ8A 2EGCA 3GBQA 4LD6A 2M16A 2V26A 1CKAA 2KDSA 1N5ZA 4JRIA 3CCQQ 4OB3B 1M1KU 3S3MA 1NM7A 2QGGA 1V76A 1GBQA 5GAOm 2D8JA 2ROTA 1X6GA 5HK0A 4E7IA 4XU3A 3KBGA 2RN8A 1EFNA 3G6EQ 3CCLT 3G1JA 1K76A 3HKSA 1N9RA 3QXEB 2HQEA 3CPWA 1M4ZA 2DBKA 4J6WA 1PG5B 4Z88A 3R6NA 3CMAT 1M8VA 4PJOE 1D3BB 2QAZA 3CCET 1QQJA 2FZGB 3CD6A 1GXIE 1GL5A 3HRTA 4HVWA 1Q86R 4RMOA 3G4ST 4CC7A 1WXUA 1YHQT 3U23A 2KRMA 1OULA 5LJ5f 1NBEB 3PE0A 3GF5A 1N8RR 2VWFA 2V1QA 1K73C 2JTMA 3CCLQ 3S3OA 1UGVA 3VS5A 1C6VX 2E10A 4HCBA 1ZSZB 3CMAQ 1OEBA 4Z89A 1VQPA 3CCEQ 3RKYA 1MGQA 1YBYA 2I2LA 1LOJA 2VXEA 4PJMA 4C92C 2QG9B 1OPLA 1X6OA 2JTFA 2FYKA 3EAEA 4MZTA 2LT4A 3CQTA 1YNZA 1AWJA 2QK0A 3EFRA 1X27A 2L3QA 4E7SA 4Z02A 2NUPB 4N4GA 1X75C 4OP0A 3TCJA 1IGUA 1KSWA 2BZYA 3OYBA 3FJ5A 2CGHA 4GLKA 3UDCA 2DK3A 4F14A 4PJOC 4A63B 3OSVA 3JB9D 2DAQA 1K9AA 2J6OA 2HCKA 5J26A 1WXBA 4OMOA 3ER0A 5DLQE 1IHWA 3VU3C 2GCXA 1VQ9T 1B34B 3L2VA 1W4SA 1NG2A 2LRQA 5KYWB 3I9QA 1P92A 3PFSA 1ZQ1A 3OQ5A 1PRMC 2CSQA 1S72T 1KG1A 1K9MR 2Y4XA 1ZLMA 2DILA 2EFIA 1MMDA 1NJIU 2X4JA 4BE1A 2L3RA 1KQ1A 1Q7YR 4P5NA 4GBQA 4CI0C 4HT8A 2HZYA 4N0AA 3OYGA 4QVDA 5LJ3g 1YJWA 2RNAA 2HKQB 5GANd 1YWPA 4C8QG 2XIDA 1K0XA 3OS2A 2FB7A 5GANh 1I0CA 1VQ5T 3CCVA 1VQ9Q 2FL7A 3WVDB 3EG3A 3S6WA 4KRTA 1OU8A 4PFPA 3JRZA 2QDYB 2QTXA 4EMKC 3MPUB 3JCMV 1ZX6A 4X9DA 2P4TA 4IUVA 1YIJT 5CVIA 1YFNA 1YITA 2CKKA 1X6BA 3E9GA 2QQBA 3SEMA 4XTZA 1ABOA 5IHIA 2DYIA 4J9HA 3C95A 3CC7A 5CKHA 4HCKA 3RBBB 1M1KR 1Z9ZA 1JBMA 1UGSB 3URGA 4PJOB 1Y0MA 4F7UF 1RI9A 2KQWA 2CSIA 3SFMA 5L23A 2O01E 1NJIC 1VQ5A 3QDRB 2PVOB 1QVGS 3JCMb 1X01A 3VKIA 5FRMA 2CZ1B 4PJOD 5L8RE 4IUTA 3EG1A 3H9NA 4AFQC 3P8DA 1X69A 1KFZA 3VS1A 1UDLA 1PD0A 1ZBJA 2A28A 5LJ5e 4M7AF 1KD1U 3TEEA 3CC4A 4UC4A 2L89A 3TSWA 1FWZA 3M0PA 3MO8A 4FSSA 4KGZB 5CKEA 3QSUA 1MNDA 1OU9A 1WHHA 2RQWA 2MOXA 5GAOp 4K11A 1O75A 5IHNA 3EGXA 4PJJA 4N4HA 1JRIA 5KYUB 4OGCA 4Y92A 5LJ5d 4GY5A 3OYAA 1TUDA 5FU6B 1G3YA 2LQWA 1NZ9A 4OMMA 4J7FA 1YJ9T 4D6WA 3CCUQ 3CC2A 1ZA2B 2RHXA 4HA8A 4EMKB 1SSFA 4L59A 2EVRA 2PQWA 3C12A 2YXYA 3CMET 2FZCB 2ABLA 2DVEA 4J9DA 4F7UA 2W0ZA 4FYVB 2RJDA 4OB2B 1TXQA 3JCMe 3LGLA 1M3CA 2QEXT 1RL2A 2C0IA 2GF7A 1K4US 1TUCA 2E65A 4DEYA 2E6NA 2PTKA 4M7AA 2MWPA 2XU8A 1YJ9Q 1QLYA 1LVKA 4MMLA 4JDSA 2GFUA 1IGQA 3CMEQ 3OYIA 2DL3A 2BE9B 1D1AA 4J9FA 2CP0A 2FRYA 3HFOA 2FHDA 5IHKA 3LLRA 2ATCB 2XDBA 1T0JA 3PVQA 3OB9A 2QEXQ 4BI4A 1PRLC 3LYIA 4XAXB 3OYEA 3X20B 3VUZA 1NJIR 4L5GA 5GMKl 4X1VA 3OSSC 4M78D 4E6RA 4E7HA 2LJ0A 4E2FB 3GP8A 1YCSB 1KQSP 1WA7A 4E7KA 3M58A 4WTOB 5GAMj 3PMIA 1VQKA 2XHCA 4FCYA 1SEMA 5A0DA 5KCHA 2GQVA 4B6MA 4E47A 2EBPA 3CBPA 3VJPA 2K4YA 2LC4A 2YDLA 2F1LA 3PMTA 1VQ7A 5GJVB 4ME7A 3A8MB 1VQ4A 2X9HA 3OS1A 3JAME 2KMTA 4Z8AA 1QWEA 1WPYA 3OY9A 4R0KA 4E7JA 1VUBA 4J83A 3QIIA 1BKBA 3JB9J 2O2OA 1SHGA 2A08A 2FEIA 2LQNA 4ESRA 2DERA 2DEUA 5I22A 3EG9A 2PVGB 4FW2A 3DLMA 3Q1JA 1QP3A 1FMWA 1VQ6A 3A98A 1E6HA 5C6SA 4BDZA 1LPLA 4QQDA 4M7DF 1NPPA 1NYGA 3CPWP 2DIGA 2JVVA 1VQMT 1KK7A 5I21A 4M75E 1QVFS 2V8JA 3GOXA 2MYSA 4E7ZA 2O88A 5HCKA 1FXXA 4M77D 1AZEA 2KNBB 2OAWA 2IPOB 3QPHA 4C8QF 3NHNA 2AZVA 4OMQA 1KD1R 2IVWA 1VIFA 3PIOA 4FM4B 4PNOA 4ELZC 4ZGDB 4XQ3A 1BCMA 2R5MA 4IURA 2EGEA 3L1AA 5KYXA 2CP7A 2PZ1A 1VQMQ 3V7RA 1ZHIA 1VQLA 2LMJA 1TTHB 5HKCA 2O4XB 1Q86C 4QVZA 4J6YA 2DTIA 2O9VA 4X34A 2F5KA 1RLQC 4M4ZA 3OYMA 3I5SA 2BZXA 1WZOA 3PT9A 2DXTA 1M30A 4AMCA 1WYXA 1OZ3A 2RMOA 1N8RC 3GNFB 1OYXA 3JCMg 3KFVA 3QDFA 3ZEHA 2JN0A 4F7UG 2YUNA 3TU4K 4M75C 1G3TA 2X3WD 2COYA 3MP1A 4MDXA 2SRCA 5HY6A 4C8QA 5GANf 3M54A 4QQGA 1AWOA 2KYMA 3HHTB 2RJFA 5FLXE 1NYFA 2KI7A 1PSFA 4M7AC 1WJSA 3H8ZA 3CCQT 1NLOC 2LX7A 2QQSA 2F2VA 4JRPA 3M4GA 1YI2T 1KQSA 3G71A 5GAMg 1GCQA 3M59A 2ZGWA 1T0HA 1WQWA 4C0ZA 1PKTA 2RQRA 1V29B 2M1HA 2RI3A 4ZGEB 2J7IA 4RCBA 2DMOA 3OA6A 4ZN1A 2OTLT 1WQ7A 1WHGA 3NGPA 2OJ2A 5I11A 3SHWA 1FYNA 4J9IA 2BUDA 1I07A 5KCOA 3OW2P 1ZA1B 3FEOA 4J9GA 4YTLA 3RKXA 2Y90A 4C92E 2ZCFB 1YI2Q 2F2WA 2GGRA 5LJ3h 1VQNT 3RR6A 1K9MC 2DM1A 5GMKj 3CCQA 3J81E 1S1NA 4JJDA 2BIVA 2RPNA 3AHUA 3UA6A 5GMKm 1Q7YC 3VS2A 2DA9A 1N6AA 2LCLA 2OTLQ 3UT1A 1FX7A 3HSBA 2JM9A 4BE0A 2DVJA 4IUQA 3G6EA 3JB9G 5FU7C 1WNLA 1UJ0A 1WHJA 2H3JA 4FSXA 1BB9A 3SDZA 1SF9A 1FMKA 1U1TA 2YLCA 4EMHA 1IZ6A 1I5LA 1VYVA 4XU1A 4QW2A 1WFWA 2ED0A 4M75B 2RI2A 2MI6A 1QW1A 3JCMc 2K3BA 1H641 2L5QA 2COZA 4RKUE 4BACA 3CD6Q 1VQNQ 2CZ6B 3INZA 1EZZB 2QGFB 3A5ZB 4M75D 1XJWB 4M77F 4M7AB 4J6XA 2D0NA 3UPUA 2RHYA 3JCMX 2A36A 3J80E 2NWMA 1VYTA 3A8GB 3CBMA 4RTUA 4ORZA 5A2QE 3LH5A 2LNVA 3CCLA 4OMFB 4C8QE 1WLPB 5KH6A 4QKUA 4FT4A 1M1KC 3NFCA 3CPFA 3CMAA 2LZ6B 3FIFA 3THKA 2RO0A 1TWBA 4AFUC 3CCEA 1WHKA 2DTHA 2X4YA 3EFOA 2YUOA 2KXCA 2LCSA 2DBMA 3C0CA 4A53A 3I56Q 4KULA 2ED1A 3G4SA 4A4GA 7AT1B 2K5LA 1YHQA 1UE9A 4JRQA 1RLPC 2EKOA 1M5Q1 5LL6S 2M02A 4DBHA 3BW1A 3VS3A 2AHJB 2KAFA 4OB1B 3FB9A 5GAN2 3V8JA 2I0NA 2FVUA 2EJ9A 1UFFA 2EAYA 2CH4A 4ZTFA 2RM4A 3O8VA 2DETA 2LX9A 1AWXA 1RI0A 3X28B 1GRIA 2OTJT 2F5TX 2AKKA 3PIPA 5D6XA 5GAN5 1AEYA 3R6OA 4EMGA 2OI3A 2QI2A 1RACB 5FU7B 4AT1B 1JEGA 2RJEA 4MZMA 1M1FA 2MK5A 5GANe 1BIBA 3PGGA 2RQUA 4JLIA 4M7DG 2EQUA 3G7ZA 4LDXA 2K2MA 2NLUA 4MMKA 4J7IA 1U06A 1AD5A 4DQ2A 4JJNK 1GCPA 1KHCA 4C5EA 2FG0A 4C8QC 2E12A 2HNIA 4C5IA 3JCMQ 1YCYA 2GBQA 4FYXB 4KT0E 4PJNA 1QMCA 2OTJQ 3OW2A 5KYYA 3NMZC 1M90U 5GANj 1DJ7B 4XU2A 4NOYA 4NS5A 1VQ9A 2DNUA 2X51A 5ECAA 1GCQC 1JXMA 3H41A 3EGDB 1WI7A 2MAMA 3L2ZA 4RUGA 4C92B 3QKJA 1WJQA 2CUDA 1Y7XA 5A0LA 1PCXA 3JCMJ 1S72A 2EPDA 4FIBA 5GAN4 4DA4A 3A8OB 4PKCC 2AKLA 1QCFA 1M3BA 1WJRA 2R5AA 2DEQA 2KE9A 4C92D 4DEXA 2DZCA 4LE9A 1QVGP 1W6XA 3AT1B 2HEQA 3UWNA 3SWNA 4KGXB 3HL8A 5GAOr 2YT6A 1AWWA 1J3TA 2L3SA 1HK9A 1R77A 3LX7A 4KUDK 4FYWB 2MF2A 3CCJT 1OX9A 4F16A 3QYGB 3ZL7C 2L3PA 1VA7A 3OBYA 1BYMA 2HKNA 3OYLA 3OYHA 3CCUT 2RHUA 4II1A 2ZPGB 1MHNA 2YUPA 1YIJA 2CUBA 1ACMB 1W70A 1PSEA 3M4YA 3JB9H 4A4KA 2VV5A 2ZZDA 1HD3A 4B9WA 2DX1A 1KC8U 3H0FA 3CCST 2DFUA 3LH0A 3E19A 4A54A 2DKGA 4OVAA 4C8QB 3RERA 2X4XA 4CC4B 3E2UA 2G3RA 2QYZA 3CCJQ 4M78G 4VUBA 5IAYA 2RF0A 1Y96B 3DKMA 4ANJA 6AT1B 2VC8A 1K0SA 1FMVA 2M0YA 3WXMB 2KBTA 5LJ5j 1D1BA 5C0MA 3DB4A 4XK8E 2CP5A 3QZ9B 2QA4T 4C0GA 2LVMA 1YWOA 3CCSQ 1WIEA 2CYZB 4OGEA 2D6FA 2LP5A 1UECA 3L2QA 2CZ0B 4D8KA 4Y28E 4JPBW 1PD1A 1IREB 2HDAA 3JB9F 2H8HA 2EYXA 2XDPA 2MMPA 5EG2A 4BD3A 3DLLA 1MV0B 1D3BA 2HMAA 2EW3A 3SD4A 1KQ2A 1PWTA 1KD1C 3EH1A 1M2VA 3HPWA 1G83A 2V8IA 1NEBA 1YJ9A 2QA4Q 5CK9A 4LN2A 4RTWA 3TVTA 2PU9B 3EG0A 3CMEA 2YUQA 3FDRA 1MMGA 2E5QA 2WSEE 4C0DC 3M56A 3JCMh 1AHJB 3JSCA 3VYGA 4M77G 2KR3A 3M53A 1OOTA 2FPDA 1OPKA 2QEXA 1HXDA 5LJ3f 1X2KA 1UG1A 5D6YA 1AT1B 2K9GA 2EYYA 2C06A 1TUGB 2A3LA 1W1FA 3VYHB 1UEBA 4N0AC 4C0FA 3H6ZA 2OAUA 2L2PA 2XK0A 2MWOA 3LW5E 5CIUA 1RADB 3M0QA 3CCRQ 3X26B 4ZTJA 4BI8B 1K8AU 1QVGA 1U8RA 2DD4A 5D6WA 3CXCP 1M90R 1WGSA 1VQKQ 2JUFA 1YP5A 1D0XA 2JNGA 5GAMh 2JTEA 2NUPA 1XQHA 2PUKB 3EGUA 4CC2A 2VVKA 2KY9A 2QQAA 3EH2A 4OMNA 3MEUA 4A4HA 3OYYA 1JJ2S 2B86A 5FW9A 3A8LB 5CAIA 1GFDA 2D0QB 4C5HA 1PKSA 3EHRA 1VQ7Q 3S3NA 1O9SA 1Y71A 1M3AA 1N27A 4RTTA 2DE0X 3M57A 5KE3A 1KQSS 1YJNT 4J8OA 5IXBA 2X3XD 3H0HA 1B34A 2KRSA 3A1PA 3SWNC 5EC7A 1VQOT 3OMGA 4F7UE 2DD5A 3VS6A 3E9FA 4PJOF 2RB6A 5GAN3 3BDUA 2BKDN 4CC3A 2JXBA 4RTXA 4AG1C 3I55T 4DOWA 3CBOA 2RQVA 1VQ8T 2P0QA 2QQRA 2X4WA 4RG8A 4C0DB 3OYFA 3M0UA 1SG5A 1R0CB 4M7AE 1YJNQ 5LJ5g 4LNPA 2OX7A 1G3WA 5IT9E 1KC8R 1UTIA 2H3EB 1AVZC 1SKUB 1KJWA 1VQOQ 4HKEA 2LDMA 2RI5A 2FZKB 2R57A 3CCMT 3C94A 3CPWS 1B3QA 4EIKA 2M0OA 2VXFA 1M27C 2FRWA 2KRNA 2KVQG 4IUPA 1G3SA 3I55Q 3UF4A 3VS4A 1VQMA 2B8AA 4AG2C 1VQ8Q 1U1SA 4XTVA 2EWNA 1PNJA 2CP2A 3KXTA 1SHFA 2DJQA 1ZUUA 4M7DA 4PJOA 3LWIA 1Q81U 1YN8A 5A0GA 1W2BP 2CP3A 1F1BB 2HL3A 3RUXA 1UHCA 2JZ2A 4ZGJB 2DL4A 3BY7A 2YRVA 2J6KA 1OI1A 3CCMQ 1X43A 4MZPA 4LDVA 3OYKA 4BI3A 2DTOA 4FT2A 1OQKA 3V7SA 1XNIA 2F69A 4AFSC 2CH4W 2LNHB 2P4RA 2JOYA 1TOVA 1AZGB 4ZN3A 1RAHB 3L42A 1GFCA 4C5GA 2K7AA 2EYQA 4NL3A 2EYWA 1IRXA 4M78F 4J9EA 5KYUA 2P0KA 3DB3A 3CXCA 4KGVB 3REBB 2RJCA 2KT8A 1A0NB 4KUIA 2LTOA 3SB2A 4XTYA 2XDDA 2GTOA 3VRZA 1TS9A 3MKDA 3QWYA 4JS5A 5J39A 3M0TA 5IN1A 4D8DA 8AT1B 3JCMP 4JUVA 4DOVA 2E4HA 1WHMA 4BUGA 1BI2A 2VB6A 5LJ3d 3EGXB 4ATOA 4AFZC 1MMAA 1K73U 3CD6T 3RNJA 4DBFA 1K8AR 1KHIA 1EIFA 2P84A 3JCMW 1YI2A 1WDXA 5CR2A 5CO7A 2SEMA 3RMSA 2JS0A 2CREA 3M9QA 3OS0A 1ARKA 4O6JA 5GMKh 4IKFA 2EJFA 3JV3A 3MHXA 1D0ZA 2RA2A 2ROLA 4J9BA 5CQXA 3REAB 1QCNA 4F7UB 4LD9K 3L2RA 2DF6A 2OTLA 2VYTA 4FL6A 1G8XA 1BK2A 2E70A 1NPRA 3T9NA 1IB8A 2ZPIB 3GLXA 4J9CA 2DIQA 2LCCA 3NTHA 3OW2S 2XD0A 4RCCA 1VQPT 1ZSGA 2XI9A 1MNEA 2JM8A 2KGTA 4M78A 3I56T 4OB0B 4F17A 4M7DE 1IHVA 2YRCA 2JW4A 2ZPBB 4OMLA 4IIOA 1VQNA 1UJYA 2RD1A 2LJ3A 4A4FA 2VGNA 1M2VB 2HSEB 1XOVA 3VUBA 4JJCA 2YHTA 3GIBA 1C0MA 2QDLA 5KYNA 4XTUA 1IO6A 1R8OB 4M7AD 2E64A 1I1JA 5IH2A 4JS4A 1BI0A 1VOMA 2GNCA 2KT1A 2D1XA 2XICA 5HK3A 1VQPQ 2K2VA 3VV0A 2PVDB 4TVRA 1V1CA 2D8HA 4BB7A 2LQKA 2HBPA 3QG1A 2A37A 3ULRB 2LJ1A 2JJ9A 1EX4A 1RAIB 3I56A 1W2BA 3LGFA 2DLPA 2K57A 2R58A 3VS7A 3G4SQ 3RKWA 3V8KA 1XTDA 1YHQQ 3MP8A 3BDLA 2ENMA 3X25B 4C92G 2ZPHB 5GMKi 1LJOA 1OV3A 3WVEB 2YWWA 1H3ZA 1U3OA 3JCMf 2QXFA 4N4IA 2HQHA 4M77A 4HXJA 1YJWT 2J05A 5DM7R 1Q81R 1R0BG 4M7DC 3H0IA 1UGPB 2DZ9A 4EPCA 3CCVT 1GBRA 3QBYA 1WX6A 2CP6A 5FROA 2J6FA 4PJOG 2RK2A 1PC0A 2HQXA 5CCAA 4WCIA 3A8HB 1RABB 4XTXA 1D1CA 5GAOn 2J06A 3EG9B 3O5ZA 4QQ6A 4O5VA 1YITT 1B07A 2JS2A 2HD0A 5GAMf 3BE3A 3OS5A 3UATA 3NPFA 4JRKA 4LDYA 4PL6A 2WSCE 1RAGB 3OYJA 1SPKA 1YJWQ 1X2QA 3OYNA 2OTJA 5GAN6 3FLGA 2NUTA 4M78E 3CC7T 2ZAEA 3KUFA 1I5OB 3CCVQ 4F04B 1SRMA 1JO8A 2O4XA 4HT9A 3FRNA 1PM3A 5FU6C 4IIMA 1OX8A 4R55A 2Y4YA 1NE8A 3VS0A 5CKFA 1YITQ 4A4EA 1S72Q 5KYXB 2IG0A 1NLPC 1JXOA 2RH2A 1NEGA 2YRDA 2PUOB 2DL7A 5DLOA 3PVLA 1K73R 1WHLA 5FWCA 4PLIA 3CC4T 1JU5C 3FC3A 2FPEA 4B9XA 1G2BA 2KEAA 3CC7Q 1QP2A 1RAFB 1D09B 1RUWA 2K3YA 3OYDA 1CKBA 1B7TA 4OMPA 3HTRA 2LT1A 2HSPA 3J7AF 2VKNA 1VQ5Q 2K5FA 1N9SA 2MIOA 4M7DB 3EG2A 3UA7A 4BDYA 1PHTA 4V2SA 2AK5A 2CT4A 2VUBA 1QKWA 1M90C 3M5AA 3CC2T 4M75F 1YIJQ
chains in the Genus database with same CATH topology
2KY9A 2QQAA 4M7DD 2DO3A 4M7AC 3MEUA 4A4HA 1WJSA 3H8ZA 3OYYA 3CCQT 1JJ2S 3EFRA 4EMHA 2QQSA 3A8LB 4JRPA 3M4GA 1M1GA 1YI2T 5CAIA 1KQSA 2D0QB 4C5HA 4CRIA 4M78C 3G71A 4M77E 4Z02A 4N4GA 1X75C 1O9SA 1Y71A 4OP0A 1N27A 3QHSA 3TCJA 5GAMg 3S3NA 1BI3A 3M59A 3OYBA 3M57A 5KE3A 1KQSS 1YJNT 2ZGWA 2DPPB 4J8OA 4RG2A 2CGHA 4GLKA 1WQWA 4C0ZA 3OBWA 1B34A 1V29B 2DK3A 2M1HA 2RI3A 4RCBA 3UDCA 2E6ZA 4ZGEB 4PJOC 4C8QD 3OSVA 3OA6A 3CCJA 3JB9D 4ZN1A 2DAQA 2OTLT 5J26A 3SWNC 1WQ7A 1VQOT 3X24B 3OMGA 4F7UE 3ER0A 2DD5A 3E9FA 5DLQE 3VU3C 3CCUA 4PJOF 2RB6A 2GCXA 1VQ9T 5GAN3 1B34B 1UB4A 3BDUA 2BUDA 3L2VA 1W4SA 2BKDN 2LRQA 1LNXA 5KCOA 3QJYA 1P92A 3PFSA 3FEOA 5LJ5h 1ZQ1A 3OQ5A 4YTLA 3RKXA 3I55T 1S72T 3L2WA 2Y90A 4WF2A 1KG1A 2Y4XA 4C92E 2ZCFB 4DOWA 3CBOA 1VQ8T 2P0QA 3CCSA 2EFIA 2QQRA 5LJ3h 2X4WA 5DY9A 1VQNT 4RG8A 4C0DB 1NJIU 1K9MC 3OYFA 2X4JA 4BE1A 2L3RA 2YLBA 5GMKj 2DXBA 3CCQA 3CEYA 1KQ1A 4M7AE 4P5NA 3J81E 4CI0C 2BIVA 2XKOC 5LJ5g 3LWHA 4MDWA 3AHUA 2WSFE 3RIRA 4HT8A 1G3WA 5GMKm 1Q7YC 4J5YA 4N0AA 3OYGA 5IT9E 4QVDA 1N6AA 5CKBA 2LCLA 5LJ3g 3UT1A 1FX7A 1YJWA 3HSBA 4M75A 5GANd 4HKEA 4BE0A 4C8QG 2XIDA 4IUQA 1KC8C 2ZPEB 3G6EA 3OS2A 3JB9G 2LDMA 2FB7A 5FU7C 1WNLA 5GANh 2RI5A 3ME9A 2R57A 3CCRT 1VQ5T 3CCVA 2H3JA 4FSXA 2FL7A 3WVDB 3SDZA 3CCMT 1BIAA 3S6WA 1U1TA 2YLCA 3C94A 3V8LA 1VIEA 2M0OA 2VXFA 1IZ6A 2QDYB 3JRZA 4L6V5 4LDUA 2QTXA 4QW2A 4XU1A 1I5LA 2XD0A 1VQKT 4M75B 2QA4A 4EMKC 3JCMV 2RI2A 2KVQG 4IUPA 1G3SA 4X9DA 2P4TA 2MI6A 1VQMA 1QW1A 3JCMd 2B8AA 4M77C 1UGRB 3JCMc 4IUVA 1H641 5GANg 2L5QA 1U1SA 2CZ7B 1YIJT 4RKUE 4BACA 5CVIA 2CZ6B 4XTVA 5CKDA 2EWNA 1YITA 2CKKA 3INZA 3KXTA 2KK4A 3MCAB 3A5ZB 3E9GA 3QUIA 4M75D 1OZ2A 2X35A 4M77F 4M7AB 5GAMe 1VQ7T 4J6XA 2QQBA 4M7DA 4XTZA 3UPUA 3QJ6A 4PJOA 2RHYA 1VQ4T 4M78B 3JCMX 3LWIA 1Q81U 5A0GA 3J80E 3HFNA 5AYFA 3A8GB 1I4K1 5GAOl 1Q82U 3CBMA 3RUXA 2EQKA 3C95A 3PNWC 5A2QE 5CKHA 3CC7A 2JZ2A 4ZGJB 2LNVA 3BY7A 5I2SA 4BE2A 3CCLA 4OMFB 1JBMA 3TREA 4C8QE 2YRVA 1UGSB 1OI1A 5KH6A 3URGA 4PJOB 4FT4A 1M1KC 4F7UF 4MZPA 4LDVA 3OYKA 2KQWA 3CPFA 3NFCA 4BI3A 5GAMd 3CMAA 3FIFA 2DTOA 3SFMA 1JB0E 2RO0A 2O01E 4FT2A 4IUUA 3P8HA 3CCRA 1NJIC 4Y91A 3CCEA 1VQ5A 2DTHA 2X4YA 3QDRB 2PVOB 1QVGS 1VQ6T 3JCMb 1I8FA 2VGMA 4A53A 4KULA 1X01A 3FJPA 3V7SA 1XNIA 3VKIA 3G4SA 2F69A 4A4GA 2CZ1B 5FRMA 2K5LA 4PJOD 1YHQA 5L8RE 1TH7A 4IUTA 4C92F 4JRQA 2JOYA 3P8DA 2EKOA 1M5Q1 3L2UA 2QQ9A 4NL2A 3N5BB 4BY6C 5LL6S 4ZN3A 4XTWA 3L42A 3BW1A 2AHJB 2KAFA 4OB1B 4C5GA 5LJ5e 1N8RU 3FB9A 2EYQA 3P8BB 4UC4A 2L89A 3TEEA 4NL3A 1KD1U 3CC4A 1FWZA 3V8JA 5GAN2 2FVUA 2EJ9A 3MO8A 4M78F 3QYHB 2EAYA 2P0KA 3DB3A 3V7CA 3BFMA 1UGQB 3CXCA 5CKEA 1QVPA 4PLLA 4ZTFA 2RJCA 2RM4A 3E1SA 3O8VA 2LX9A 3QSUA 1RI0A 3X28B 5GAOp 4KUIA 2OTJT 2F5TX 1O75A 2LTOA 3SB2A 4XTYA 2XDDA 3CXCS 3PIPA 4N4HA 5CQYA 5D6XA 5GAN5 1JRIA 3R6OA 4EMGA 1Q86U 2QI2A 4JS5A 4OGCA 5J39A 3MEAA 2ZPFB 5FU7B 5LJ5d 3CPWS 4GY5A 3OYAA 2HAXA 2EIFA 5IN1A 5FU6B 3JCMP 2V8KA 5M9OA 1G3YA 4JUVA 4DOVA 1NZ9A 2RJEA 4MZMA 2RHZA 4J7FA 1YJ9T 1M1FA 3RESA 4D6WA 1BIBA 1BI2A 5LJ3d 4BUGA 5GANe 3CC2A 3PGGA 2RHXA 4ATOA 4JLIA 4HA8A 2EQUA 4EMKB 4M7DG 1SSFA 1K73U 3CD6T 1Q82C 1VQLT 4L59A 4M77B 2PQWA 3C12A 3G7ZA 1KHIA 1EIFA 3JB9I 3CMET 2NLUA 3MEWA 4MMKA 4J7IA 3JCMW 3RMQA 3QZ5B 1YI2A 2DVEA 4DQ2A 1Y07A 4JJNK 4F7UA 1K8AC 1KHCA 4C5EA 5CR2A 2RJDA 1I81A 5CO7A 4OB2B 3RMSA 4C8QC 2E12A 2HNIA 3JCMe 4C5IA 3JCMQ 1YCYA 1YJNA 4KT0E 4XU0A 3M9QA 3OS0A 2E41A 3LGLA 3META 3GNGA 4O6JA 5GMKh 2QEXT 4IKFA 2EJFA 3MHXA 2RA2A 1RL2A 5CQXA 4F7UB 3OW2A 3ZFJA 2D9TA 4LD9K 5GAOq 4C92A 3L2RA 2OTLA 1M90U 2VYTA 2EJGA 4FL6A 5GANj 1VQOA 1DJ7B 2E70A 1NPRA 2GF7A 3T9NA 2M9UA 2ZPIB 2E65A 3GLXA 4XU2A 2E6NA 2DIQA 2LCCA 3NTHA 2K3XA 4NOYA 4NS5A 3OW2S 4RCCA 1VQPT 1VQ9A 2XI9A 2MWPA 2XU8A 3OMCA 4M7AA 3ZBDA 2MAMA 4MMLA 3L2ZA 4M78A 4C92B 3I56T 3QKJA 4OB0B 1WJQA 4E7LA 4JDSA 3C4SA 1Y7XA 4R56A 5A0LA 2GFUA 3JCMJ 4M7DE 3OYIA 3I55A 1S72A 4LDXA 4HCCA 2ZPBB 4FIBA 3MEVA 5GAN4 4DA4A 1VQ8A 5FRNA 3A8OB 4PKCC 2DXCA 3HFOA 1VQNA 2RD1A 2FHDA 3LLRA 4A4FA 2XDBA 1WJRA 2VGNA 2R5AA 3MP6A 1XOVA 2DEQA 5J3BA 3VUBA 4C92D 2DZCA 4BY6B 4JLGA 2YHTA 3OB9A 4EDUA 3GIBA 3UWNA 3SWNA 4XTUA 5KE2A 3G71T 4BI4A 2RHIA 3HL8A 5GAOr 3LYIA 4XAXB 2L8DA 1R8OB 3OYEA 4M7AD 3M55A 3X20B 2E64A 2WACA 3VUZA 1HK9A 4L5GA 5GMKl 3OYCA 4JS4A 1BI0A 3OSSC 4M78D 4E7HA 3LX7A 4KUDK 2GFAA 4OF1A 3GP8A 3SWNB 2XICA 3EFSA 4HCZA 3PTAA 5HK3A 2K2VA 2MF2A 3VV0A 2PVDB 3CCJT 3QYGB 3HRUA 3CCMA 2K5IA 4TVRA 4BB7A 2LQKA 4E7KA 3M58A 1G5VA 2HBPA 2A7YA 5GAMj 3QO3A 3OBYA 3PMIA 1VQKA 3QG1A 1K9MU 2RK1A 4FU6A 1BYMA 2XHCA 3OYLA 3OYHA 3GPLA 3CCUT 5A0DA 4LDWA 5KCHA 2RHUA 4II1A 2ZPGB 1MHNA 4KBMB 2GQVA 5I2MA 3I56A 4E47A 1YIJA 1W2BA 1M9SA 3CBPA 3LGFA 1Q7YU 3VJPA 2K4YA 2K57A 2R58A 2LC4A 1PSEA 3M4YA 3JB9H 4Q5WA 3RKWA 4M75G 4A4KA 1JJ2A 3V8KA 1XTDA 2VV5A 3MP8A 1ZBXA 2ZZDA 3BDLA 3NTIA 2P0PA 5GAN8 3F70A 4B9WA 3X25B 3PMTA 1VQ7A 1KC8U 1W2BS 3CCST 2EQJA 4C92G 2ZPHB 4ME7A 3A8MB 3LH0A 1VQ4A 1Y96A 4QVCA 5LJ3e 5GMKi 1BI1A 3OS1A 3E19A 2KMTA 3JAME 3HP9A 1LJOA 3WVEB 4A54A 2DKGA 1WPYA 4OVAA 3OY9A 4C8QB 4E7JA 2CS7A 1VUBA 3RERA 4J83A 2KSSA 2X4XA 4M7AG 1H3ZA 3NTKA 3JCMf 3QIIA 1BKBA 4EMKA 2G3RA 3HRSA 3JB9J 2QXFA 2DXUA 4M78G 3ASKA 4N4IA 4VUBA 5IAYA 1Y96B 4M77A 1YJWT 3DKMA 5DM7R 2E1HA 2VC8A 4M7DC 3G6ET 5GMKe 1UGPB 3WXMB 2DZ9A 4EPCA 2EQMA 2PVGB 5LJ5j 3DLMA 3CCVT 1Q81C 3Q1JA 1QP3A 2DJZA 3QBYA 5C0MA 3DB4A 5FROA 1VQ6A 4XK8E 4ELYC 4PJOG 5C6SA 4BDZA 1QVFA 2RK2A 2XG8D 4QQDA 5GAN7 2HQXA 4X9CA 5CCAA 4M7DF 3QZ9B 2QA4T 1NPPA 5LJ3j 2DIGA 2JVVA 3A8HB 1VQMT 4C0GA 2LQ8A 2LVMA 5I21A 4XTXA 5GAOn 4M75E 1QVFS 4QQ6A 2V8JA 3GOXA 2CYZB 4LD6A 4OGEA 2D6FA 2M16A 2KDSA 4O5VA 1YITT 3L2QA 2CZ0B 4JRIA 2HD0A 4OB3B 5GAMf 1FXXA 4Y28E 4M7AF 4M77D 1M1KU 3OS5A 3S3MA 3QPHA 1IREB 5GAOm 4JRKA 4LDYA 4PL6A 4C8QF 3JB9F 2XDPA 2WSCE 5HK0A 2MMPA 4XU3A 4E7IA 3KBGA 5EG2A 4BD3A 3OYJA 3OYNA 3DLLA 2OTJA 5GAN6 3FLGA 1D3BA 4M78E 3CC7T 2IVWA 1VIFA 3KUFA 3PIOA 3CCLT 4FM4B 3SD4A 3HKSA 4PNOA 4ELZC 1KQ2A 1KD1C 1N9RA 3QXEB 2HQEA 3CPWA 1M4ZA 3HPWA 4ZGDB 4XQ3A 2V8IA 4J6WA 2R5MA 4IURA 2O4XA 3L1AA 3CMAT 4HT9A 3FRNA 1M8VA 1YJ9A 5FU6C 4PJOE 1D3BB 3CCET 5CK9A 4R55A 3V7RA 1ZHIA 3CD6A 1VQLA 1GXIE 3HRTA 2Y4YA 4RMOA 1NE8A 2PU9B 3CMEA 5CKFA 3G4ST 5HKCA 1YHQT 2O4XB 3FDRA 4A4EA 2E5QA 2WSEE 4C0DC 2IG0A 2RH2A 3M56A 4QVZA 4J6YA 2DTIA 4X34A 1Q86C 2F5KA 2PUOB 3JCMh 3OYMA 5DLOA 1AHJB 3JSCA 5LJ5f 3VYGA 4M77G 3GF5A 3M53A 4PLIA 3CC4T 3FC3A 2QEXA 3PT9A 4B9XA 1HXDA 1K73C 2DXTA 5LJ3f 1OZ3A 1QP2A 2JTMA 1N8RC 3GNFB 5D6YA 3S3OA 1OYXA 2K3YA 3JCMg 3OYDA 4M7DB 2C06A 2A3LA 3VYHB 2E10A 1UEBA 4N0AC 4C0FA 2LT1A 4HCBA 3H6ZA 2OAUA 3ZEHA 3J7AF 2XK0A 2MWOA 3LW5E 1VQPA 2JN0A 4F7UG 5CIUA 2K5FA 3X26B 3TU4K 1N9SA 4M75C 4ZTJA 3RKYA 1MGQA 4BI8B 1G3TA 1YBYA 1U8RA 4BDYA 3MP1A 2I2LA 1QVGA 2DD4A 1K8AU 1LOJA 5D6WA 4MDXA 4V2SA 5HY6A 1WGSA 2VXEA 2JUFA 4C8QA 5GANf 2JNGA 2VUBA 3M54A 4C92C 4QQGA 5GAMh 1M90C 1X6OA 3M5AA 3CC2T 2JTFA 2FYKA 1XQHA 2PUKB 3EAEA 3HHTB 2RJFA 4M75F 4MZTA 5FLXE 1PSFA 2LT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ELY C;  3JRZ A;  2KMT A;  1NE8 A;  3G7Z A;  5CKF A;  3VUB A;  5HK0 A;  2C06 A;  5CCA A;  5HKC A;  1VUB A;  5CKH A;  1UB4 A;  5CQY A;  5CR2 A;  5CO7 A;  1X75 C;  3TCJ A;  5DLO A;  4ELZ C;  3JSC A;  5CKB A;  4VUB A;  4MDX A;  5CKD A;  3HPW A;  4MZP A;  3NFC A;  4HKE A;  4MZM A;  2VUB A;  4OF1 A;  1M1F A;  5CQX A;  5CK9 A;  5HK3 A;  2MF2 A;  5CKE A;  4MZT A;  4ME7 A; 
#chains in the Genus database with same CATH topology
 4M7D D;  2DO3 A;  4KH0 B;  1M1G A;  3CC4 Q;  4CRI A;  4M78 C;  4M77 E;  3TQ7 P;  2DRK A;  3QHS A;  1BI3 A;  1HSQ A;  2BTT A;  2DPP B;  4RG2 A;  2BZ8 A;  4PFZ A;  3OBW A;  2E6Z A;  4C8Q D;  2O31 A;  3CCJ A;  5AT1 B;  4LUE A;  3X24 B;  1HYO A;  2QAS A;  2JMC A;  1LCK A;  3CCU A;  1UB4 A;  3CC2 Q;  1UUE A;  1LNX A;  3QJY A;  2IIM A;  5LJ5 h;  1M2O A;  1QWF A;  2E3I A;  2K79 A;  3L2W A;  4HVU A;  4WF2 A;  8ATC B;  3CCS A;  1CSK A;  5DY9 A;  2PNI A;  2G6F X;  1TSF A;  2YLB A;  2DXB A;  3CEY A;  3M0R A;  2XKO C;  3LWH A;  4MDW A;  2WSF E;  3RIR A;  5FWB A;  4J5Y A;  3TSZ A;  4ZNX A;  5CKB A;  2ECZ A;  4M75 A;  5GJW B;  3QWX X;  3RDV A;  1KC8 C;  2ZPE B;  3ME9 A;  3CCR T;  4PK4 A;  1BIA A;  3V8L A;  4GLM A;  1VIE A;  4L6V 5;  4DBR A;  4LDU A;  1VQK T;  2E5K A;  2QA4 A;  1U5S A;  1QKX A;  3JCM d;  4M77 C;  1UGR B;  2E3H A;  5GAN g;  2EKH A;  2CZ7 B;  1TU0 B;  2QTV A;  2MPX C;  5CKD A;  3M0S A;  2KK4 A;  3MCA B;  1RAE B;  1ZSZ A;  2JMA A;  3QUI A;  1OZ2 A;  2X35 A;  5GAM e;  1VQ7 T;  1HJD A;  3QJ6 A;  2NUZ A;  1K1Z A;  1VQ4 T;  4M78 B;  1BBZ A;  3HFN A;  5AYF A;  1H8K A;  1ZUY A;  1I4K 1;  5GAO l;  1Q82 U;  2EQK A;  3PNW C;  4PJL A;  1JJ2 P;  5I2S A;  4BE2 A;  4QT7 A;  3TRE A;  2KXD A;  2GQI A;  1E7O A;  5GAM d;  4PFO A;  1JB0 E;  4IUU A;  4JZ3 A;  3P8H A;  3CCR A;  4Y91 A;  1MMN A;  1WXT A;  1M8M A;  4LXC A;  1VQ6 T;  1I8F A;  2VGM A;  3FJP A;  2V1R A;  1TH7 A;  4JZ4 A;  4C92 F;  2NYS A;  4JJB A;  3L2U A;  2KYB A;  2QQ9 A;  4NL2 A;  3N5B B;  4BY6 C;  3EFO B;  4XTW A;  1VQ4 Q;  4KH1 B;  3P8B B;  4FYY B;  1QVF P;  2W10 A;  2JT4 A;  2HL5 C;  3QYH B;  2C0T A;  3V7C A;  3BFM A;  1UGQ B;  1QVP A;  2L0A A;  1H92 A;  5KYW A;  4PLL A;  3E1S A;  1ABQ A;  2F2X A;  1RAA B;  3CXC S;  1KIK A;  5CQY A;  2DYB A;  1Q86 U;  3MEA A;  2ZPF B;  2HAX A;  2EIF A;  2CT3 A;  1VQ6 Q;  2V8K A;  5M9O A;  2COW A;  2RHZ A;  4RTY A;  3RES A;  4RTZ A;  3D7S B;  1SRL A;  2AIR B;  1Q82 C;  1VQL T;  1E6G A;  4M77 B;  1N8R U;  3JB9 I;  1C1A A;  3MEW A;  2MCN A;  3QZ5 B;  3RMQ A;  4DBQ A;  2KRO A;  1Y07 A;  1K8A C;  1I81 A;  4RTV A;  4FW1 A;  2EYZ A;  1IXD A;  1YJN A;  4XU0 A;  1BCO A;  2E41 A;  3MET A;  3GNG A;  4LUD A;  3EGD A;  3ZFJ A;  2FO0 A;  2D9T A;  2DRM A;  4C92 A;  5GAO q;  2EJG A;  3IQL A;  2A0F B;  1VQO A;  1T3L A;  2M9U A;  1H3H A;  2DL5 A;  3I5R A;  2K3X A;  3OMC A;  3ZBD A;  5KYY B;  2DL8 A;  4E7L A;  1VQL Q;  2Z0W A;  3C4S A;  4R56 A;  3I55 A;  2NUT B;  4HCC A;  5FRN A;  3MEV A;  1VQ8 A;  2DXC A;  1T3S A;  3MP6 A;  5J3B A;  4BY6 B;  3MJX A;  4JLG A;  4EDU A;  3EHQ A;  1TG0 A;  5KE2 A;  3G71 T;  2K6D A;  2RHI A;  1ZUK A;  2L8D A;  3M55 A;  2WAC A;  2ESW A;  3OYC A;  1MV3 A;  1AOJ A;  3I35 A;  1UHF A;  2GFA A;  4OF1 A;  3SWN B;  2XMF A;  3EFS A;  4HCZ A;  5IXF A;  2AT1 B;  3PTA A;  3HRU A;  3CCM A;  2K5I A;  1G5V A;  2A7Y A;  3QO3 A;  1K9M U;  2RK1 A;  4FU6 A;  3VRY A;  3GPL A;  2EQI A;  4LDW A;  4KBM B;  5I2M A;  1Y57 A;  1M9S A;  2C0O A;  1Q7Y U;  4Q5W A;  9ATC B;  4M75 G;  1JJ2 A;  2M51 A;  3NTI A;  5GAN 8;  1ZBX A;  2P0P A;  3F70 A;  2VAS A;  1W2B S;  2YSQ A;  3G71 Q;  2EQJ A;  2EGA A;  1Y96 A;  4QVC A;  5LJ3 e;  1BI1 A;  3HP9 A;  5D7U A;  1Z9Q A;  1VYU A;  2CS7 A;  1BU1 A;  2KSS A;  4M7A G;  3NTK A;  1MUZ A;  4EMK A;  3HRS A;  1ZSZ C;  2DXU A;  1QCO A;  3ASK A;  2CDT A;  2FPF A;  2E1H A;  3G6E T;  5GMK e;  2GTJ A;  2O9S A;  1Q82 R;  1SSH A;  2RQT A;  2EQM A;  1Q81 C;  1JQQ A;  2DJZ A;  4HVV A;  2AZS A;  4ELY C;  1QVF A;  1Q95 G;  2XG8 D;  5GAN 7;  4X9C A;  2BE7 D;  5LJ3 j;  2HBW A;  1D0Y A;  2LQ8 A;  2EGC A;  3GBQ A;  4LD6 A;  2M16 A;  2V26 A;  1CKA A;  2KDS A;  1N5Z A;  4JRI A;  3CCQ Q;  4OB3 B;  1M1K U;  3S3M A;  1NM7 A;  2QGG A;  1V76 A;  1GBQ A;  5GAO m;  2D8J A;  2ROT A;  1X6G A;  5HK0 A;  4E7I A;  4XU3 A;  3KBG A;  2RN8 A;  1EFN A;  3G6E Q;  3CCL T;  3G1J A;  1K76 A;  3HKS A;  1N9R A;  3QXE B;  2HQE A;  3CPW A;  1M4Z A;  2DBK A;  4J6W A;  1PG5 B;  4Z88 A;  3R6N A;  3CMA T;  1M8V A;  4PJO E;  1D3B B;  2QAZ A;  3CCE T;  1QQJ A;  2FZG B;  3CD6 A;  1GXI E;  1GL5 A;  3HRT A;  4HVW A;  1Q86 R;  4RMO A;  3G4S T;  4CC7 A;  1WXU A;  1YHQ T;  3U23 A;  2KRM A;  1OUL A;  5LJ5 f;  1NBE B;  3PE0 A;  3GF5 A;  1N8R R;  2VWF A;  2V1Q A;  1K73 C;  2JTM A;  3CCL Q;  3S3O A;  1UGV A;  3VS5 A;  1C6V X;  2E10 A;  4HCB A;  1ZSZ B;  3CMA Q;  1OEB A;  4Z89 A;  1VQP A;  3CCE Q;  3RKY A;  1MGQ A;  1YBY A;  2I2L A;  1LOJ A;  2VXE A;  4PJM A;  4C92 C;  2QG9 B;  1OPL A;  1X6O A;  2JTF A;  2FYK A;  3EAE A;  4MZT A;  2LT4 A;  3CQT A;  1YNZ A;  1AWJ A;  2QK0 A;  3EFR A;  1X27 A;  2L3Q A;  4E7S A;  4Z02 A;  2NUP B;  4N4G A;  1X75 C;  4OP0 A;  3TCJ A;  1IGU A;  1KSW A;  2BZY A;  3OYB A;  3FJ5 A;  2CGH A;  4GLK A;  3UDC A;  2DK3 A;  4F14 A;  4PJO C;  4A63 B;  3OSV A;  3JB9 D;  2DAQ A;  1K9A A;  2J6O A;  2HCK A;  5J26 A;  1WXB A;  4OMO A;  3ER0 A;  5DLQ E;  1IHW A;  3VU3 C;  2GCX A;  1VQ9 T;  1B34 B;  3L2V A;  1W4S A;  1NG2 A;  2LRQ A;  5KYW B;  3I9Q A;  1P92 A;  3PFS A;  1ZQ1 A;  3OQ5 A;  1PRM C;  2CSQ A;  1S72 T;  1KG1 A;  1K9M R;  2Y4X A;  1ZLM A;  2DIL A;  2EFI A;  1MMD A;  1NJI U;  2X4J A;  4BE1 A;  2L3R A;  1KQ1 A;  1Q7Y R;  4P5N A;  4GBQ A;  4CI0 C;  4HT8 A;  2HZY A;  4N0A A;  3OYG A;  4QVD A;  5LJ3 g;  1YJW A;  2RNA A;  2HKQ B;  5GAN d;  1YWP A;  4C8Q G;  2XID A;  1K0X A;  3OS2 A;  2FB7 A;  5GAN h;  1I0C A;  1VQ5 T;  3CCV A;  1VQ9 Q;  2FL7 A;  3WVD B;  3EG3 A;  3S6W A;  4KRT A;  1OU8 A;  4PFP A;  3JRZ A;  2QDY B;  2QTX A;  4EMK C;  3MPU B;  3JCM V;  1ZX6 A;  4X9D A;  2P4T A;  4IUV A;  1YIJ T;  5CVI A;  1YFN A;  1YIT A;  2CKK A;  1X6B A;  3E9G A;  2QQB A;  3SEM A;  4XTZ A;  1ABO A;  5IHI A;  2DYI A;  4J9H A;  3C95 A;  3CC7 A;  5CKH A;  4HCK A;  3RBB B;  1M1K R;  1Z9Z A;  1JBM A;  1UGS B;  3URG A;  4PJO B;  1Y0M A;  4F7U F;  1RI9 A;  2KQW A;  2CSI A;  3SFM A;  5L23 A;  2O01 E;  1NJI C;  1VQ5 A;  3QDR B;  2PVO B;  1QVG S;  3JCM b;  1X01 A;  3VKI A;  5FRM A;  2CZ1 B;  4PJO D;  5L8R E;  4IUT A;  3EG1 A;  3H9N A;  4AFQ C;  3P8D A;  1X69 A;  1KFZ A;  3VS1 A;  1UDL A;  1PD0 A;  1ZBJ A;  2A28 A;  5LJ5 e;  4M7A F;  1KD1 U;  3TEE A;  3CC4 A;  4UC4 A;  2L89 A;  3TSW A;  1FWZ A;  3M0P A;  3MO8 A;  4FSS A;  4KGZ B;  5CKE A;  3QSU A;  1MND A;  1OU9 A;  1WHH A;  2RQW A;  2MOX A;  5GAO p;  4K11 A;  1O75 A;  5IHN A;  3EGX A;  4PJJ A;  4N4H A;  1JRI A;  5KYU B;  4OGC A;  4Y92 A;  5LJ5 d;  4GY5 A;  3OYA A;  1TUD A;  5FU6 B;  1G3Y A;  2LQW A;  1NZ9 A;  4OMM A;  4J7F A;  1YJ9 T;  4D6W A;  3CCU Q;  3CC2 A;  1ZA2 B;  2RHX A;  4HA8 A;  4EMK B;  1SSF A;  4L59 A;  2EVR A;  2PQW A;  3C12 A;  2YXY A;  3CME T;  2FZC B;  2ABL A;  2DVE A;  4J9D A;  4F7U A;  2W0Z A;  4FYV B;  2RJD A;  4OB2 B;  1TXQ A;  3JCM e;  3LGL A;  1M3C A;  2QEX T;  1RL2 A;  2C0I A;  2GF7 A;  1K4U S;  1TUC A;  2E65 A;  4DEY A;  2E6N A;  2PTK A;  4M7A A;  2MWP A;  2XU8 A;  1YJ9 Q;  1QLY A;  1LVK A;  4MML A;  4JDS A;  2GFU A;  1IGQ A;  3CME Q;  3OYI A;  2DL3 A;  2BE9 B;  1D1A A;  4J9F A;  2CP0 A;  2FRY A;  3HFO A;  2FHD A;  5IHK A;  3LLR A;  2ATC B;  2XDB A;  1T0J A;  3PVQ A;  3OB9 A;  2QEX Q;  4BI4 A;  1PRL C;  3LYI A;  4XAX B;  3OYE A;  3X20 B;  3VUZ A;  1NJI R;  4L5G A;  5GMK l;  4X1V A;  3OSS C;  4M78 D;  4E6R A;  4E7H A;  2LJ0 A;  4E2F B;  3GP8 A;  1YCS B;  1KQS P;  1WA7 A;  4E7K A;  3M58 A;  4WTO B;  5GAM j;  3PMI A;  1VQK A;  2XHC A;  4FCY A;  1SEM A;  5A0D A;  5KCH A;  2GQV A;  4B6M A;  4E47 A;  2EBP A;  3CBP A;  3VJP A;  2K4Y A;  2LC4 A;  2YDL A;  2F1L A;  3PMT A;  1VQ7 A;  5GJV B;  4ME7 A;  3A8M B;  1VQ4 A;  2X9H A;  3OS1 A;  3JAM E;  2KMT A;  4Z8A A;  1QWE A;  1WPY A;  3OY9 A;  4R0K A;  4E7J A;  1VUB A;  4J83 A;  3QII A;  1BKB A;  3JB9 J;  2O2O A;  1SHG A;  2A08 A;  2FEI A;  2LQN A;  4ESR A;  2DER A;  2DEU A;  5I22 A;  3EG9 A;  2PVG B;  4FW2 A;  3DLM A;  3Q1J A;  1QP3 A;  1FMW A;  1VQ6 A;  3A98 A;  1E6H A;  5C6S A;  4BDZ A;  1LPL A;  4QQD A;  4M7D F;  1NPP A;  1NYG A;  3CPW P;  2DIG A;  2JVV A;  1VQM T;  1KK7 A;  5I21 A;  4M75 E;  1QVF S;  2V8J A;  3GOX A;  2MYS A;  4E7Z A;  2O88 A;  5HCK A;  1FXX A;  4M77 D;  1AZE A;  2KNB B;  2OAW A;  2IPO B;  3QPH A;  4C8Q F;  3NHN A;  2AZV A;  4OMQ A;  1KD1 R;  2IVW A;  1VIF A;  3PIO A;  4FM4 B;  4PNO A;  4ELZ C;  4ZGD B;  4XQ3 A;  1BCM A;  2R5M A;  4IUR A;  2EGE A;  3L1A A;  5KYX A;  2CP7 A;  2PZ1 A;  1VQM Q;  3V7R A;  1ZHI A;  1VQL A;  2LMJ A;  1TTH B;  5HKC A;  2O4X B;  1Q86 C;  4QVZ A;  4J6Y A;  2DTI A;  2O9V A;  4X34 A;  2F5K A;  1RLQ C;  4M4Z A;  3OYM A;  3I5S A;  2BZX A;  1WZO A;  3PT9 A;  2DXT A;  1M30 A;  4AMC A;  1WYX A;  1OZ3 A;  2RMO A;  1N8R C;  3GNF B;  1OYX A;  3JCM g;  3KFV A;  3QDF A;  3ZEH A;  2JN0 A;  4F7U G;  2YUN A;  3TU4 K;  4M75 C;  1G3T A;  2X3W D;  2COY A;  3MP1 A;  4MDX A;  2SRC A;  5HY6 A;  4C8Q A;  5GAN f;  3M54 A;  4QQG A;  1AWO A;  2KYM A;  3HHT B;  2RJF A;  5FLX E;  1NYF A;  2KI7 A;  1PSF A;  4M7A C;  1WJS A;  3H8Z A;  3CCQ T;  1NLO C;  2LX7 A;  2QQS A;  2F2V A;  4JRP A;  3M4G A;  1YI2 T;  1KQS A;  3G71 A;  5GAM g;  1GCQ A;  3M59 A;  2ZGW A;  1T0H A;  1WQW A;  4C0Z A;  1PKT A;  2RQR A;  1V29 B;  2M1H A;  2RI3 A;  4ZGE B;  2J7I A;  4RCB A;  2DMO A;  3OA6 A;  4ZN1 A;  2OTL T;  1WQ7 A;  1WHG A;  3NGP A;  2OJ2 A;  5I11 A;  3SHW A;  1FYN A;  4J9I A;  2BUD A;  1I07 A;  5KCO A;  3OW2 P;  1ZA1 B;  3FEO A;  4J9G A;  4YTL A;  3RKX A;  2Y90 A;  4C92 E;  2ZCF B;  1YI2 Q;  2F2W A;  2GGR A;  5LJ3 h;  1VQN T;  3RR6 A;  1K9M C;  2DM1 A;  5GMK j;  3CCQ A;  3J81 E;  1S1N A;  4JJD A;  2BIV A;  2RPN A;  3AHU A;  3UA6 A;  5GMK m;  1Q7Y C;  3VS2 A;  2DA9 A;  1N6A A;  2LCL A;  2OTL Q;  3UT1 A;  1FX7 A;  3HSB A;  2JM9 A;  4BE0 A;  2DVJ A;  4IUQ A;  3G6E A;  3JB9 G;  5FU7 C;  1WNL A;  1UJ0 A;  1WHJ A;  2H3J A;  4FSX A;  1BB9 A;  3SDZ A;  1SF9 A;  1FMK A;  1U1T A;  2YLC A;  4EMH A;  1IZ6 A;  1I5L A;  1VYV A;  4XU1 A;  4QW2 A;  1WFW A;  2ED0 A;  4M75 B;  2RI2 A;  2MI6 A;  1QW1 A;  3JCM c;  2K3B A;  1H64 1;  2L5Q A;  2COZ A;  4RKU E;  4BAC A;  3CD6 Q;  1VQN Q;  2CZ6 B;  3INZ A;  1EZZ B;  2QGF B;  3A5Z B;  4M75 D;  1XJW B;  4M77 F;  4M7A B;  4J6X A;  2D0N A;  3UPU A;  2RHY A;  3JCM X;  2A36 A;  3J80 E;  2NWM A;  1VYT A;  3A8G B;  3CBM A;  4RTU A;  4ORZ A;  5A2Q E;  3LH5 A;  2LNV A;  3CCL A;  4OMF B;  4C8Q E;  1WLP B;  5KH6 A;  4QKU A;  4FT4 A;  1M1K C;  3NFC A;  3CPF A;  3CMA A;  2LZ6 B;  3FIF A;  3THK A;  2RO0 A;  1TWB A;  4AFU C;  3CCE A;  1WHK A;  2DTH A;  2X4Y A;  3EFO A;  2YUO A;  2KXC A;  2LCS A;  2DBM A;  3C0C A;  4A53 A;  3I56 Q;  4KUL A;  2ED1 A;  3G4S A;  4A4G A;  7AT1 B;  2K5L A;  1YHQ A;  1UE9 A;  4JRQ A;  1RLP C;  2EKO A;  1M5Q 1;  5LL6 S;  2M02 A;  4DBH A;  3BW1 A;  3VS3 A;  2AHJ B;  2KAF A;  4OB1 B;  3FB9 A;  5GAN 2;  3V8J A;  2I0N A;  2FVU A;  2EJ9 A;  1UFF A;  2EAY A;  2CH4 A;  4ZTF A;  2RM4 A;  3O8V A;  2DET A;  2LX9 A;  1AWX A;  1RI0 A;  3X28 B;  1GRI A;  2OTJ T;  2F5T X;  2AKK A;  3PIP A;  5D6X A;  5GAN 5;  1AEY A;  3R6O A;  4EMG A;  2OI3 A;  2QI2 A;  1RAC B;  5FU7 B;  4AT1 B;  1JEG A;  2RJE A;  4MZM A;  1M1F A;  2MK5 A;  5GAN e;  1BIB A;  3PGG A;  2RQU A;  4JLI A;  4M7D G;  2EQU A;  3G7Z A;  4LDX A;  2K2M A;  2NLU A;  4MMK A;  4J7I A;  1U06 A;  1AD5 A;  4DQ2 A;  4JJN K;  1GCP A;  1KHC A;  4C5E A;  2FG0 A;  4C8Q C;  2E12 A;  2HNI A;  4C5I A;  3JCM Q;  1YCY A;  2GBQ A;  4FYX B;  4KT0 E;  4PJN A;  1QMC A;  2OTJ Q;  3OW2 A;  5KYY A;  3NMZ C;  1M90 U;  5GAN j;  1DJ7 B;  4XU2 A;  4NOY A;  4NS5 A;  1VQ9 A;  2DNU A;  2X51 A;  5ECA A;  1GCQ C;  1JXM A;  3H41 A;  3EGD B;  1WI7 A;  2MAM A;  3L2Z A;  4RUG A;  4C92 B;  3QKJ A;  1WJQ A;  2CUD A;  1Y7X A;  5A0L A;  1PCX A;  3JCM J;  1S72 A;  2EPD A;  4FIB A;  5GAN 4;  4DA4 A;  3A8O B;  4PKC C;  2AKL A;  1QCF A;  1M3B A;  1WJR A;  2R5A A;  2DEQ A;  2KE9 A;  4C92 D;  4DEX A;  2DZC A;  4LE9 A;  1QVG P;  1W6X A;  3AT1 B;  2HEQ A;  3UWN A;  3SWN A;  4KGX B;  3HL8 A;  5GAO r;  2YT6 A;  1AWW A;  1J3T A;  2L3S A;  1HK9 A;  1R77 A;  3LX7 A;  4KUD K;  4FYW B;  2MF2 A;  3CCJ T;  1OX9 A;  4F16 A;  3QYG B;  3ZL7 C;  2L3P A;  1VA7 A;  3OBY A;  1BYM A;  2HKN A;  3OYL A;  3OYH A;  3CCU T;  2RHU A;  4II1 A;  2ZPG B;  1MHN A;  2YUP A;  1YIJ A;  2CUB A;  1ACM B;  1W70 A;  1PSE A;  3M4Y A;  3JB9 H;  4A4K A;  2VV5 A;  2ZZD A;  1HD3 A;  4B9W A;  2DX1 A;  1KC8 U;  3H0F A;  3CCS T;  2DFU A;  3LH0 A;  3E19 A;  4A54 A;  2DKG A;  4OVA A;  4C8Q B;  3RER A;  2X4X A;  4CC4 B;  3E2U A;  2G3R A;  2QYZ A;  3CCJ Q;  4M78 G;  4VUB A;  5IAY A;  2RF0 A;  1Y96 B;  3DKM A;  4ANJ A;  6AT1 B;  2VC8 A;  1K0S A;  1FMV A;  2M0Y A;  3WXM B;  2KBT A;  5LJ5 j;  1D1B A;  5C0M A;  3DB4 A;  4XK8 E;  2CP5 A;  3QZ9 B;  2QA4 T;  4C0G A;  2LVM A;  1YWO A;  3CCS Q;  1WIE A;  2CYZ B;  4OGE A;  2D6F A;  2LP5 A;  1UEC A;  3L2Q A;  2CZ0 B;  4D8K A;  4Y28 E;  4JPB W;  1PD1 A;  1IRE B;  2HDA A;  3JB9 F;  2H8H A;  2EYX A;  2XDP A;  2MMP A;  5EG2 A;  4BD3 A;  3DLL A;  1MV0 B;  1D3B A;  2HMA A;  2EW3 A;  3SD4 A;  1KQ2 A;  1PWT A;  1KD1 C;  3EH1 A;  1M2V A;  3HPW A;  1G83 A;  2V8I A;  1NEB A;  1YJ9 A;  2QA4 Q;  5CK9 A;  4LN2 A;  4RTW A;  3TVT A;  2PU9 B;  3EG0 A;  3CME A;  2YUQ A;  3FDR A;  1MMG A;  2E5Q A;  2WSE E;  4C0D C;  3M56 A;  3JCM h;  1AHJ B;  3JSC A;  3VYG A;  4M77 G;  2KR3 A;  3M53 A;  1OOT A;  2FPD A;  1OPK A;  2QEX A;  1HXD A;  5LJ3 f;  1X2K A;  1UG1 A;  5D6Y A;  1AT1 B;  2K9G A;  2EYY A;  2C06 A;  1TUG B;  2A3L A;  1W1F A;  3VYH B;  1UEB A;  4N0A C;  4C0F A;  3H6Z A;  2OAU A;  2L2P A;  2XK0 A;  2MWO A;  3LW5 E;  5CIU A;  1RAD B;  3M0Q A;  3CCR Q;  3X26 B;  4ZTJ A;  4BI8 B;  1K8A U;  1QVG A;  1U8R A;  2DD4 A;  5D6W A;  3CXC P;  1M90 R;  1WGS A;  1VQK Q;  2JUF A;  1YP5 A;  1D0X A;  2JNG A;  5GAM h;  2JTE A;  2NUP A;  1XQH A;  2PUK B;  3EGU A;  4CC2 A;  2VVK A;  2KY9 A;  2QQA A;  3EH2 A;  4OMN A;  3MEU A;  4A4H A;  3OYY A;  1JJ2 S;  2B86 A;  5FW9 A;  3A8L B;  5CAI A;  1GFD A;  2D0Q B;  4C5H A;  1PKS A;  3EHR A;  1VQ7 Q;  3S3N A;  1O9S A;  1Y71 A;  1M3A A;  1N27 A;  4RTT A;  2DE0 X;  3M57 A;  5KE3 A;  1KQS S;  1YJN T;  4J8O A;  5IXB A;  2X3X D;  3H0H A;  1B34 A;  2KRS A;  3A1P A;  3SWN C;  5EC7 A;  1VQO T;  3OMG A;  4F7U E;  2DD5 A;  3VS6 A;  3E9F A;  4PJO F;  2RB6 A;  5GAN 3;  3BDU A;  2BKD N;  4CC3 A;  2JXB A;  4RTX A;  4AG1 C;  3I55 T;  4DOW A;  3CBO A;  2RQV A;  1VQ8 T;  2P0Q A;  2QQR A;  2X4W A;  4RG8 A;  4C0D B;  3OYF A;  3M0U A;  1SG5 A;  1R0C B;  4M7A E;  1YJN Q;  5LJ5 g;  4LNP A;  2OX7 A;  1G3W A;  5IT9 E;  1KC8 R;  1UTI A;  2H3E B;  1AVZ C;  1SKU B;  1KJW A;  1VQO Q;  4HKE A;  2LDM A;  2RI5 A;  2FZK B;  2R57 A;  3CCM T;  3C94 A;  3CPW S;  1B3Q A;  4EIK A;  2M0O A;  2VXF A;  1M27 C;  2FRW A;  2KRN A;  2KVQ G;  4IUP A;  1G3S A;  3I55 Q;  3UF4 A;  3VS4 A;  1VQM A;  2B8A A;  4AG2 C;  1VQ8 Q;  1U1S A;  4XTV A;  2EWN A;  1PNJ A;  2CP2 A;  3KXT A;  1SHF A;  2DJQ A;  1ZUU A;  4M7D A;  4PJO A;  3LWI A;  1Q81 U;  1YN8 A;  5A0G A;  1W2B P;  2CP3 A;  1F1B B;  2HL3 A;  3RUX A;  1UHC A;  2JZ2 A;  4ZGJ B;  2DL4 A;  3BY7 A;  2YRV A;  2J6K A;  1OI1 A;  3CCM Q;  1X43 A;  4MZP A;  4LDV A;  3OYK A;  4BI3 A;  2DTO A;  4FT2 A;  1OQK A;  3V7S A;  1XNI A;  2F69 A;  4AFS C;  2CH4 W;  2LNH B;  2P4R A;  2JOY A;  1TOV A;  1AZG B;  4ZN3 A;  1RAH B;  3L42 A;  1GFC A;  4C5G A;  2K7A A;  2EYQ A;  4NL3 A;  2EYW A;  1IRX A;  4M78 F;  4J9E A;  5KYU A;  2P0K A;  3DB3 A;  3CXC A;  4KGV B;  3REB B;  2RJC A;  2KT8 A;  1A0N B;  4KUI A;  2LTO A;  3SB2 A;  4XTY A;  2XDD A;  2GTO A;  3VRZ A;  1TS9 A;  3MKD A;  3QWY A;  4JS5 A;  5J39 A;  3M0T A;  5IN1 A;  4D8D A;  8AT1 B;  3JCM P;  4JUV A;  4DOV A;  2E4H A;  1WHM A;  4BUG A;  1BI2 A;  2VB6 A;  5LJ3 d;  3EGX B;  4ATO A;  4AFZ C;  1MMA A;  1K73 U;  3CD6 T;  3RNJ A;  4DBF A;  1K8A R;  1KHI A;  1EIF A;  2P84 A;  3JCM W;  1YI2 A;  1WDX A;  5CR2 A;  5CO7 A;  2SEM A;  3RMS A;  2JS0 A;  2CRE A;  3M9Q A;  3OS0 A;  1ARK A;  4O6J A;  5GMK h;  4IKF A;  2EJF A;  3JV3 A;  3MHX A;  1D0Z A;  2RA2 A;  2ROL A;  4J9B A;  5CQX A;  3REA B;  1QCN A;  4F7U B;  4LD9 K;  3L2R A;  2DF6 A;  2OTL A;  2VYT A;  4FL6 A;  1G8X A;  1BK2 A;  2E70 A;  1NPR A;  3T9N A;  1IB8 A;  2ZPI B;  3GLX A;  4J9C A;  2DIQ A;  2LCC A;  3NTH A;  3OW2 S;  2XD0 A;  4RCC A;  1VQP T;  1ZSG A;  2XI9 A;  1MNE A;  2JM8 A;  2KGT A;  4M78 A;  3I56 T;  4OB0 B;  4F17 A;  4M7D E;  1IHV A;  2YRC A;  2JW4 A;  2ZPB B;  4OML A;  4IIO A;  1VQN A;  1UJY A;  2RD1 A;  2LJ3 A;  4A4F A;  2VGN A;  1M2V B;  2HSE B;  1XOV A;  3VUB A;  4JJC A;  2YHT A;  3GIB A;  1C0M A;  2QDL A;  5KYN A;  4XTU A;  1IO6 A;  1R8O B;  4M7A D;  2E64 A;  1I1J A;  5IH2 A;  4JS4 A;  1BI0 A;  1VOM A;  2GNC A;  2KT1 A;  2D1X A;  2XIC A;  5HK3 A;  1VQP Q;  2K2V A;  3VV0 A;  2PVD B;  4TVR A;  1V1C A;  2D8H A;  4BB7 A;  2LQK A;  2HBP A;  3QG1 A;  2A37 A;  3ULR B;  2LJ1 A;  2JJ9 A;  1EX4 A;  1RAI B;  3I56 A;  1W2B A;  3LGF A;  2DLP A;  2K57 A;  2R58 A;  3VS7 A;  3G4S Q;  3RKW A;  3V8K A;  1XTD A;  1YHQ Q;  3MP8 A;  3BDL A;  2ENM A;  3X25 B;  4C92 G;  2ZPH B;  5GMK i;  1LJO A;  1OV3 A;  3WVE B;  2YWW A;  1H3Z A;  1U3O A;  3JCM f;  2QXF A;  4N4I A;  2HQH A;  4M77 A;  4HXJ A;  1YJW T;  2J05 A;  5DM7 R;  1Q81 R;  1R0B G;  4M7D C;  3H0I A;  1UGP B;  2DZ9 A;  4EPC A;  3CCV T;  1GBR A;  3QBY A;  1WX6 A;  2CP6 A;  5FRO A;  2J6F A;  4PJO G;  2RK2 A;  1PC0 A;  2HQX A;  5CCA A;  4WCI A;  3A8H B;  1RAB B;  4XTX A;  1D1C A;  5GAO n;  2J06 A;  3EG9 B;  3O5Z A;  4QQ6 A;  4O5V A;  1YIT T;  1B07 A;  2JS2 A;  2HD0 A;  5GAM f;  3BE3 A;  3OS5 A;  3UAT A;  3NPF A;  4JRK A;  4LDY A;  4PL6 A;  2WSC E;  1RAG B;  3OYJ A;  1SPK A;  1YJW Q;  1X2Q A;  3OYN A;  2OTJ A;  5GAN 6;  3FLG A;  2NUT A;  4M78 E;  3CC7 T;  2ZAE A;  3KUF A;  1I5O B;  3CCV Q;  4F04 B;  1SRM A;  1JO8 A;  2O4X A;  4HT9 A;  3FRN A;  1PM3 A;  5FU6 C;  4IIM A;  1OX8 A;  4R55 A;  2Y4Y A;  1NE8 A;  3VS0 A;  5CKF A;  1YIT Q;  4A4E A;  1S72 Q;  5KYX B;  2IG0 A;  1NLP C;  1JXO A;  2RH2 A;  1NEG A;  2YRD A;  2PUO B;  2DL7 A;  5DLO A;  3PVL A;  1K73 R;  1WHL A;  5FWC A;  4PLI A;  3CC4 T;  1JU5 C;  3FC3 A;  2FPE A;  4B9X A;  1G2B A;  2KEA A;  3CC7 Q;  1QP2 A;  1RAF B;  1D09 B;  1RUW A;  2K3Y A;  3OYD A;  1CKB A;  1B7T A;  4OMP A;  3HTR A;  2LT1 A;  2HSP A;  3J7A F;  2VKN A;  1VQ5 Q;  2K5F A;  1N9S A;  2MIO A;  4M7D B;  3EG2 A;  3UA7 A;  4BDY A;  1PHT A;  4V2S A;  2AK5 A;  2CT4 A;  2VUB A;  1QKW A;  1M90 C;  3M5A A;  3CC2 T;  4M75 F;  1YIJ Q; 
#chains in the Genus database with same CATH homology
 2KY9 A;  2QQA A;  4M7D D;  2DO3 A;  4M7A C;  3MEU A;  4A4H A;  1WJS A;  3H8Z A;  3OYY A;  3CCQ T;  1JJ2 S;  3EFR A;  4EMH A;  2QQS A;  3A8L B;  4JRP A;  3M4G A;  1M1G A;  1YI2 T;  5CAI A;  1KQS A;  2D0Q B;  4C5H A;  4CRI A;  4M78 C;  3G71 A;  4M77 E;  4Z02 A;  4N4G A;  1X75 C;  1O9S A;  1Y71 A;  4OP0 A;  1N27 A;  3QHS A;  3TCJ A;  5GAM g;  3S3N A;  1BI3 A;  3M59 A;  3OYB A;  3M57 A;  5KE3 A;  1KQS S;  1YJN T;  2ZGW A;  2DPP B;  4J8O A;  4RG2 A;  2CGH A;  4GLK A;  1WQW A;  4C0Z A;  3OBW A;  1B34 A;  1V29 B;  2DK3 A;  2M1H A;  2RI3 A;  4RCB A;  3UDC A;  2E6Z A;  4ZGE B;  4PJO C;  4C8Q D;  3OSV A;  3OA6 A;  3CCJ A;  3JB9 D;  4ZN1 A;  2DAQ A;  2OTL T;  5J26 A;  3SWN C;  1WQ7 A;  1VQO T;  3X24 B;  3OMG A;  4F7U E;  3ER0 A;  2DD5 A;  3E9F A;  5DLQ E;  3VU3 C;  3CCU A;  4PJO F;  2RB6 A;  2GCX A;  1VQ9 T;  5GAN 3;  1B34 B;  1UB4 A;  3BDU A;  2BUD A;  3L2V A;  1W4S A;  2BKD N;  2LRQ A;  1LNX A;  5KCO A;  3QJY A;  1P92 A;  3PFS A;  3FEO A;  5LJ5 h;  1ZQ1 A;  3OQ5 A;  4YTL A;  3RKX A;  3I55 T;  1S72 T;  3L2W A;  2Y90 A;  4WF2 A;  1KG1 A;  2Y4X A;  4C92 E;  2ZCF B;  4DOW A;  3CBO A;  1VQ8 T;  2P0Q A;  3CCS A;  2EFI A;  2QQR A;  5LJ3 h;  2X4W A;  5DY9 A;  1VQN T;  4RG8 A;  4C0D B;  1NJI U;  1K9M C;  3OYF A;  2X4J A;  4BE1 A;  2L3R A;  2YLB A;  5GMK j;  2DXB A;  3CCQ A;  3CEY A;  1KQ1 A;  4M7A E;  4P5N A;  3J81 E;  4CI0 C;  2BIV A;  2XKO C;  5LJ5 g;  3LWH A;  4MDW A;  3AHU A;  2WSF E;  3RIR A;  4HT8 A;  1G3W A;  5GMK m;  1Q7Y C;  4J5Y A;  4N0A A;  3OYG A;  5IT9 E;  4QVD A;  1N6A A;  5CKB A;  2LCL A;  5LJ3 g;  3UT1 A;  1FX7 A;  1YJW A;  3HSB A;  4M75 A;  5GAN d;  4HKE A;  4BE0 A;  4C8Q G;  2XID A;  4IUQ A;  1KC8 C;  2ZPE B;  3G6E A;  3OS2 A;  3JB9 G;  2LDM A;  2FB7 A;  5FU7 C;  1WNL A;  5GAN h;  2RI5 A;  3ME9 A;  2R57 A;  3CCR T;  1VQ5 T;  3CCV A;  2H3J A;  4FSX A;  2FL7 A;  3WVD B;  3SDZ A;  3CCM T;  1BIA A;  3S6W A;  1U1T A;  2YLC A;  3C94 A;  3V8L A;  1VIE A;  2M0O A;  2VXF A;  1IZ6 A;  2QDY B;  3JRZ A;  4L6V 5;  4LDU A;  2QTX A;  4QW2 A;  4XU1 A;  1I5L A;  2XD0 A;  1VQK T;  4M75 B;  2QA4 A;  4EMK C;  3JCM V;  2RI2 A;  2KVQ G;  4IUP A;  1G3S A;  4X9D A;  2P4T A;  2MI6 A;  1VQM A;  1QW1 A;  3JCM d;  2B8A A;  4M77 C;  1UGR B;  3JCM c;  4IUV A;  1H64 1;  5GAN g;  2L5Q A;  1U1S A;  2CZ7 B;  1YIJ T;  4RKU E;  4BAC A;  5CVI A;  2CZ6 B;  4XTV A;  5CKD A;  2EWN A;  1YIT A;  2CKK A;  3INZ A;  3KXT A;  2KK4 A;  3MCA B;  3A5Z B;  3E9G A;  3QUI A;  4M75 D;  1OZ2 A;  2X35 A;  4M77 F;  4M7A B;  5GAM e;  1VQ7 T;  4J6X A;  2QQB A;  4M7D A;  4XTZ A;  3UPU A;  3QJ6 A;  4PJO A;  2RHY A;  1VQ4 T;  4M78 B;  3JCM X;  3LWI A;  1Q81 U;  5A0G A;  3J80 E;  3HFN A;  5AYF A;  3A8G B;  1I4K 1;  5GAO l;  1Q82 U;  3CBM A;  3RUX A;  2EQK A;  3C95 A;  3PNW C;  5A2Q E;  5CKH A;  3CC7 A;  2JZ2 A;  4ZGJ B;  2LNV A;  3BY7 A;  5I2S A;  4BE2 A;  3CCL A;  4OMF B;  1JBM A;  3TRE A;  4C8Q E;  2YRV A;  1UGS B;  1OI1 A;  5KH6 A;  3URG A;  4PJO B;  4FT4 A;  1M1K C;  4F7U F;  4MZP A;  4LDV A;  3OYK A;  2KQW A;  3CPF A;  3NFC A;  4BI3 A;  5GAM d;  3CMA A;  3FIF A;  2DTO A;  3SFM A;  1JB0 E;  2RO0 A;  2O01 E;  4FT2 A;  4IUU A;  3P8H A;  3CCR A;  1NJI C;  4Y91 A;  3CCE A;  1VQ5 A;  2DTH A;  2X4Y A;  3QDR B;  2PVO B;  1QVG S;  1VQ6 T;  3JCM b;  1I8F A;  2VGM A;  4A53 A;  4KUL A;  1X01 A;  3FJP A;  3V7S A;  1XNI A;  3VKI A;  3G4S A;  2F69 A;  4A4G A;  2CZ1 B;  5FRM A;  2K5L A;  4PJO D;  1YHQ A;  5L8R E;  1TH7 A;  4IUT A;  4C92 F;  4JRQ A;  2JOY A;  3P8D A;  2EKO A;  1M5Q 1;  3L2U A;  2QQ9 A;  4NL2 A;  3N5B B;  4BY6 C;  5LL6 S;  4ZN3 A;  4XTW A;  3L42 A;  3BW1 A;  2AHJ B;  2KAF A;  4OB1 B;  4C5G A;  5LJ5 e;  1N8R U;  3FB9 A;  2EYQ A;  3P8B B;  4UC4 A;  2L89 A;  3TEE A;  4NL3 A;  1KD1 U;  3CC4 A;  1FWZ A;  3V8J A;  5GAN 2;  2FVU A;  2EJ9 A;  3MO8 A;  4M78 F;  3QYH B;  2EAY A;  2P0K A;  3DB3 A;  3V7C A;  3BFM A;  1UGQ B;  3CXC A;  5CKE A;  1QVP A;  4PLL A;  4ZTF A;  2RJC A;  2RM4 A;  3E1S A;  3O8V A;  2LX9 A;  3QSU A;  1RI0 A;  3X28 B;  5GAO p;  4KUI A;  2OTJ T;  2F5T X;  1O75 A;  2LTO A;  3SB2 A;  4XTY A;  2XDD A;  3CXC S;  3PIP A;  4N4H A;  5CQY A;  5D6X A;  5GAN 5;  1JRI A;  3R6O A;  4EMG A;  1Q86 U;  2QI2 A;  4JS5 A;  4OGC A;  5J39 A;  3MEA A;  2ZPF B;  5FU7 B;  5LJ5 d;  3CPW S;  4GY5 A;  3OYA A;  2HAX A;  2EIF A;  5IN1 A;  5FU6 B;  3JCM P;  2V8K A;  5M9O A;  1G3Y A;  4JUV A;  4DOV A;  1NZ9 A;  2RJE A;  4MZM A;  2RHZ A;  4J7F A;  1YJ9 T;  1M1F A;  3RES A;  4D6W A;  1BIB A;  1BI2 A;  5LJ3 d;  4BUG A;  5GAN e;  3CC2 A;  3PGG A;  2RHX A;  4ATO A;  4JLI A;  4HA8 A;  2EQU A;  4EMK B;  4M7D G;  1SSF A;  1K73 U;  3CD6 T;  1Q82 C;  1VQL T;  4L59 A;  4M77 B;  2PQW A;  3C12 A;  3G7Z A;  1KHI A;  1EIF A;  3JB9 I;  3CME T;  2NLU A;  3MEW A;  4MMK A;  4J7I A;  3JCM W;  3RMQ A;  3QZ5 B;  1YI2 A;  2DVE A;  4DQ2 A;  1Y07 A;  4JJN K;  4F7U A;  1K8A C;  1KHC A;  4C5E A;  5CR2 A;  2RJD A;  1I81 A;  5CO7 A;  4OB2 B;  3RMS A;  4C8Q C;  2E12 A;  2HNI A;  3JCM e;  4C5I A;  3JCM Q;  1YCY A;  1YJN A;  4KT0 E;  4XU0 A;  3M9Q A;  3OS0 A;  2E41 A;  3LGL A;  3MET A;  3GNG A;  4O6J A;  5GMK h;  2QEX T;  4IKF A;  2EJF A;  3MHX A;  2RA2 A;  1RL2 A;  5CQX A;  4F7U B;  3OW2 A;  3ZFJ A;  2D9T A;  4LD9 K;  5GAO q;  4C92 A;  3L2R A;  2OTL A;  1M90 U;  2VYT A;  2EJG A;  4FL6 A;  5GAN j;  1VQO A;  1DJ7 B;  2E70 A;  1NPR A;  2GF7 A;  3T9N A;  2M9U A;  2ZPI B;  2E65 A;  3GLX A;  4XU2 A;  2E6N A;  2DIQ A;  2LCC A;  3NTH A;  2K3X A;  4NOY A;  4NS5 A;  3OW2 S;  4RCC A;  1VQP T;  1VQ9 A;  2XI9 A;  2MWP A;  2XU8 A;  3OMC A;  4M7A A;  3ZBD A;  2MAM A;  4MML A;  3L2Z A;  4M78 A;  4C92 B;  3I56 T;  3QKJ A;  4OB0 B;  1WJQ A;  4E7L A;  4JDS A;  3C4S A;  1Y7X A;  4R56 A;  5A0L A;  2GFU A;  3JCM J;  4M7D E;  3OYI A;  3I55 A;  1S72 A;  4LDX A;  4HCC A;  2ZPB B;  4FIB A;  3MEV A;  5GAN 4;  4DA4 A;  1VQ8 A;  5FRN A;  3A8O B;  4PKC C;  2DXC A;  3HFO A;  1VQN A;  2RD1 A;  2FHD A;  3LLR A;  4A4F A;  2XDB A;  1WJR A;  2VGN A;  2R5A A;  3MP6 A;  1XOV A;  2DEQ A;  5J3B A;  3VUB A;  4C92 D;  2DZC A;  4BY6 B;  4JLG A;  2YHT A;  3OB9 A;  4EDU A;  3GIB A;  3UWN A;  3SWN A;  4XTU A;  5KE2 A;  3G71 T;  4BI4 A;  2RHI A;  3HL8 A;  5GAO r;  3LYI A;  4XAX B;  2L8D A;  1R8O B;  3OYE A;  4M7A D;  3M55 A;  3X20 B;  2E64 A;  2WAC A;  3VUZ A;  1HK9 A;  4L5G A;  5GMK l;  3OYC A;  4JS4 A;  1BI0 A;  3OSS C;  4M78 D;  4E7H A;  3LX7 A;  4KUD K;  2GFA A;  4OF1 A;  3GP8 A;  3SWN B;  2XIC A;  3EFS A;  4HCZ A;  3PTA A;  5HK3 A;  2K2V A;  2MF2 A;  3VV0 A;  2PVD B;  3CCJ T;  3QYG B;  3HRU A;  3CCM A;  2K5I A;  4TVR A;  4BB7 A;  2LQK A;  4E7K A;  3M58 A;  1G5V A;  2HBP A;  2A7Y A;  5GAM j;  3QO3 A;  3OBY A;  3PMI A;  1VQK A;  3QG1 A;  1K9M U;  2RK1 A;  4FU6 A;  1BYM A;  2XHC A;  3OYL A;  3OYH A;  3GPL A;  3CCU T;  5A0D A;  4LDW A;  5KCH A;  2RHU A;  4II1 A;  2ZPG B;  1MHN A;  4KBM B;  2GQV A;  5I2M A;  3I56 A;  4E47 A;  1YIJ A;  1W2B A;  1M9S A;  3CBP A;  3LGF A;  1Q7Y U;  3VJP A;  2K4Y A;  2K57 A;  2R58 A;  2LC4 A;  1PSE A;  3M4Y A;  3JB9 H;  4Q5W A;  3RKW A;  4M75 G;  4A4K A;  1JJ2 A;  3V8K A;  1XTD A;  2VV5 A;  3MP8 A;  1ZBX A;  2ZZD A;  3BDL A;  3NTI A;  2P0P A;  5GAN 8;  3F70 A;  4B9W A;  3X25 B;  3PMT A;  1VQ7 A;  1KC8 U;  1W2B S;  3CCS T;  2EQJ A;  4C92 G;  2ZPH B;  4ME7 A;  3A8M B;  3LH0 A;  1VQ4 A;  1Y96 A;  4QVC A;  5LJ3 e;  5GMK i;  1BI1 A;  3OS1 A;  3E19 A;  2KMT A;  3JAM E;  3HP9 A;  1LJO A;  3WVE B;  4A54 A;  2DKG A;  1WPY A;  4OVA A;  3OY9 A;  4C8Q B;  4E7J A;  2CS7 A;  1VUB A;  3RER A;  4J83 A;  2KSS A;  2X4X A;  4M7A G;  1H3Z A;  3NTK A;  3JCM f;  3QII A;  1BKB A;  4EMK A;  2G3R A;  3HRS A;  3JB9 J;  2QXF A;  2DXU A;  4M78 G;  3ASK A;  4N4I A;  4VUB A;  5IAY A;  1Y96 B;  4M77 A;  1YJW T;  3DKM A;  5DM7 R;  2E1H A;  2VC8 A;  4M7D C;  3G6E T;  5GMK e;  1UGP B;  3WXM B;  2DZ9 A;  4EPC A;  2EQM A;  2PVG B;  5LJ5 j;  3DLM A;  3CCV T;  1Q81 C;  3Q1J A;  1QP3 A;  2DJZ A;  3QBY A;  5C0M A;  3DB4 A;  5FRO A;  1VQ6 A;  4XK8 E;  4ELY C;  4PJO G;  5C6S A;  4BDZ A;  1QVF A;  2RK2 A;  2XG8 D;  4QQD A;  5GAN 7;  2HQX A;  4X9C A;  5CCA A;  4M7D F;  3QZ9 B;  2QA4 T;  1NPP A;  5LJ3 j;  2DIG A;  2JVV A;  3A8H B;  1VQM T;  4C0G A;  2LQ8 A;  2LVM A;  5I21 A;  4XTX A;  5GAO n;  4M75 E;  1QVF S;  4QQ6 A;  2V8J A;  3GOX A;  2CYZ B;  4LD6 A;  4OGE A;  2D6F A;  2M16 A;  2KDS A;  4O5V A;  1YIT T;  3L2Q A;  2CZ0 B;  4JRI A;  2HD0 A;  4OB3 B;  5GAM f;  1FXX A;  4Y28 E;  4M7A F;  4M77 D;  1M1K U;  3OS5 A;  3S3M A;  3QPH A;  1IRE B;  5GAO m;  4JRK A;  4LDY A;  4PL6 A;  4C8Q F;  3JB9 F;  2XDP A;  2WSC E;  5HK0 A;  2MMP A;  4XU3 A;  4E7I A;  3KBG A;  5EG2 A;  4BD3 A;  3OYJ A;  3OYN A;  3DLL A;  2OTJ A;  5GAN 6;  3FLG A;  1D3B A;  4M78 E;  3CC7 T;  2IVW A;  1VIF A;  3KUF A;  3PIO A;  3CCL T;  4FM4 B;  3SD4 A;  3HKS A;  4PNO A;  4ELZ C;  1KQ2 A;  1KD1 C;  1N9R A;  3QXE B;  2HQE A;  3CPW A;  1M4Z A;  3HPW A;  4ZGD B;  4XQ3 A;  2V8I A;  4J6W A;  2R5M A;  4IUR A;  2O4X A;  3L1A A;  3CMA T;  4HT9 A;  3FRN A;  1M8V A;  1YJ9 A;  5FU6 C;  4PJO E;  1D3B B;  3CCE T;  5CK9 A;  4R55 A;  3V7R A;  1ZHI A;  3CD6 A;  1VQL A;  1GXI E;  3HRT A;  2Y4Y A;  4RMO A;  1NE8 A;  2PU9 B;  3CME A;  5CKF A;  3G4S T;  5HKC A;  1YHQ T;  2O4X B;  3FDR A;  4A4E A;  2E5Q A;  2WSE E;  4C0D C;  2IG0 A;  2RH2 A;  3M56 A;  4QVZ A;  4J6Y A;  2DTI A;  4X34 A;  1Q86 C;  2F5K A;  2PUO B;  3JCM h;  3OYM A;  5DLO A;  1AHJ B;  3JSC A;  5LJ5 f;  3VYG A;  4M77 G;  3GF5 A;  3M53 A;  4PLI A;  3CC4 T;  3FC3 A;  2QEX A;  3PT9 A;  4B9X A;  1HXD A;  1K73 C;  2DXT A;  5LJ3 f;  1OZ3 A;  1QP2 A;  2JTM A;  1N8R C;  3GNF B;  5D6Y A;  3S3O A;  1OYX A;  2K3Y A;  3JCM g;  3OYD A;  4M7D B;  2C06 A;  2A3L A;  3VYH B;  2E10 A;  1UEB A;  4N0A C;  4C0F A;  2LT1 A;  4HCB A;  3H6Z A;  2OAU A;  3ZEH A;  3J7A F;  2XK0 A;  2MWO A;  3LW5 E;  1VQP A;  2JN0 A;  4F7U G;  5CIU A;  2K5F A;  3X26 B;  3TU4 K;  1N9S A;  4M75 C;  4ZTJ A;  3RKY A;  1MGQ A;  4BI8 B;  1G3T A;  1YBY A;  1U8R A;  4BDY A;  3MP1 A;  2I2L A;  1QVG A;  2DD4 A;  1K8A U;  1LOJ A;  5D6W A;  4MDX A;  4V2S A;  5HY6 A;  1WGS A;  2VXE A;  2JUF A;  4C8Q A;  5GAN f;  2JNG A;  2VUB A;  3M54 A;  4C92 C;  4QQG A;  5GAM h;  1M90 C;  1X6O A;  3M5A A;  3CC2 T;  2JTF A;  2FYK A;  1XQH A;  2PUK B;  3EAE A;  3HHT B;  2RJF A;  4M75 F;  4MZT A;  5FLX E;  1PSF A;  2LT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...