5D7UA

Crystal structure of the c-terminal domain of mmtv integrase
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
53
structure length
53
Chain Sequence
b'ADPKPMVMWKDLLTGSWKGPDVLITAGRGYACVFPQDAESPIWVPDRFIRPFT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pr160
molecule tags Hydrolase
source organism Mouse mammary tumor virus
publication title Cryo-EM reveals a novel octameric integrase structure for betaretroviral intasome function.
pubmed doi rcsb
total genus 8
structure length 53
sequence length 53
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00552 IN_DBD_C Integrase DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.10 Mainly Beta Roll SH3 type barrels. Integrase, C-terminal domain superfamily, retroviral 5d7uA00
1C6VX 1C0MA 1IHVA 4FW2A 4FW1A 1IHWA 1QMCA 1C1AA 5D7UA 1EX4A
chains in the Genus database with same CATH superfamily
2ZPGB 3H6ZA 2X3WD 1ZA2B 2X4XA 3EG9A 5GMKe 2EVRA 2K79A 5KYYB 4DBRA 2WSFE 1WHGA 4OMLA 4XU0A 2DA9A 3VRZA 4EMKA 2XMFA 4BE1A 3H8ZA 2DO3A 4CC2A 5CCAA 1KHCA 4F7UF 2F2VA 2JM9A 2MWOA 3OS0A 2HQXA 2XDBA 2LRQA 3L2RA 4OP0A 1G2BA 2E12A 1BB9A 4M77A 2EKOA 3CBPA 4E7KA 1D1AA 5AT1B 3JCMJ 4M7DF 5CQYA 1UJ0A 2QTXA 5CO7A 1UUEA 1PCXA 4ELZC 1M2OA 3S3NA 2FVUA 4M77B 2CSIA 4II1A 4LDXA 1K73R 3JCMf 1VUBA 1XJWB 1KG1A 1WHMA 1D09B 1CKAA 4CI0C 2J6KA 4KRTA 1B34B 2H8HA 1KC8R 4E7LA 1W6XA 2KXDA 3OYAA 2E70A 2KYBA 4FW2A 1TSFA 1KD1R 2EPDA 1NLOC 5CKBA 3GNFB 1Q86U 4EMKB 1ZX6A 4GLKA 4OVAA 5LJ5j 1GCQC 2M0OA 1AOJA 3BY7A 3M0TA 3MEAA 2DJZA 2PUKB 3DKMA 4OMNA 2A37A 2FG0A 2VWFA 2KMTA 4R0KA 3S6WA 2F2XA 4ME7A 1SRMA 1IREB 4PFOA 1TH7A 1K9MC 2YRVA 3VKIA 4QQ6A 4OMFB 1QWFA 5I22A 2I0NA 1AD5A 3O5ZA 4LN2A 2VXEA 3L1AA 2F5KA 2LJ3A 4AMCA 3QZ9B 3OBYA 2P84A 2MK5A 4DOVA 3OS1A 2HL3A 1QCOA 2RQTA 4M7DB 1UHCA 3CC2Q 2QDYB 3PGGA 2E6ZA 3ULRB 4XQ3A 1WX6A 2F5TX 1YN8A 2R57A 4K11A 4L5GA 3OYJA 1KD1U 2JTEA 3U23A 3NTKA 4P5NA 2JNGA 3EH1A 3M53A 4A63B 3CXCS 2RI2A 2VGNA 2OX7A 4C8QA 2A3LA 3T9NA 2LT1A 2RA2A 1B7TA 3I56Q 4IUTA 3OYHA 4RUGA 3JCMe 4FCYA 1Q82C 1X27A 2CKKA 1IHVA 2DTIA 1HSQA 3JCMg 2O31A 5HY6A 3M57A 2QAZA 2YHTA 3M9QA 4M78A 4X34A 3OYLA 4RKUE 1YFNA 1VQPT 3EG2A 5GAN8 4Z88A 3QDRB 2PU9B 2VGMA 3HFNA 3M4GA 1TTHB 4C5HA 1QP3A 4M75A 3M0UA 4DBQA 4IUVA 4EMKC 1N5ZA 3RIRA 4MMKA 4F7UA 1VQOA 1WFWA 1BCMA 2O88A 1JQQA 3VS0A 2YUQA 3PT9A 4RTZA 2D6FA 2JJ9A 2CS7A 3LX7A 5HKCA 1X01A 1SF9A 4N4GA 4PK4A 3MP8A 1QWEA 3GIBA 4QVZA 4B6MA 5HK3A 1BCOA 3JV3A 2OTLQ 4M7DC 4FM4B 4M7AF 1RAIB 2RI3A 5A0GA 2J6OA 2CUDA 4B9XA 2E1HA 2HEQA 1KFZA 6AT1B 1K9MR 4FT4A 4MZPA 3PMIA 2FO0A 2SEMA 5CK9A 4RG8A 1BBZA 3EGDA 4EPCA 3HL8A 3I5SA 4HCCA 4OB1B 3MCAB 3CC2T 3X25B 1YI2Q 1VQ7Q 1OEBA 2LCLA 4M77C 1O75A 4E7IA 2QI2A 2AZVA 2RJFA 1I07A 4C0ZA 2X4WA 4A54A 3CXCP 4KH0B 3ZFJA 1K0XA 3UPUA 4RTYA 5FRMA 5KYWB 3MKDA 2WACA 3VYGA 5EC7A 4ZN1A 1M90R 4M75B 4J9IA 3WVEB 3GP8A 1VQ4A 2L3SA 2KBTA 1Q86R 2VXFA 3QWYA 2YSQA 4EDUA 2E64A 4HCBA 3BE3A 3OY9A 4LE9A 4HA8A 1QVPA 4MDWA 3SHWA 2DF6A 3CC7T 2GNCA 4OF1A 4Z89A 1K1ZA 3M56A 2EKHA 3EG9B 2K5IA 2EJFA 3LGLA 1VQPQ 1K9MU 1I0CA 1KK7A 3CMEA 2A0FB 2FEIA 4JLGA 2LQKA 5A0DA 2DBMA 1MHNA 1PD1A 3TSWA 1Q95G 2PUOB 1UEBA 2LQ8A 2NLUA 3A1PA 4CRIA 3SD4A 2MPXC 2ZCFB 3IQLA 1YIJA 1YJNT 3GLXA 3AT1B 1W2BS 1KQSA 2GTJA 3EGXA 1O9SA 3HTRA 3M55A 3MO8A 1YJWQ 3M0SA 1U8RA 5GAMh 3SB2A 2ABLA 3PIOA 4DEYA 4MZMA 3SFMA 1M90U 4J6YA 1GCPA 2QA4A 2ZPFB 4ZNXA 2BUDA 2L8DA 1YBYA 4CC7A 1M2VB 1VQ9Q 2ATCB 4HCKA 4C0GA 1FMVA 2LDMA 3GPLA 4N4IA 3L42A 3OSSC 2QA4T 2C06A 1B07A 2LMJA 3JCMc 1WI7A 4J6XA 3LYIA 2ZPHB 3NGPA 2QEXA 2CZ1B 4F16A 4QQGA 1MMGA 5KCHA 1YI2T 3HKSA 5L23A 1VQMA 4Y92A 3VRYA 1GRIA 4C92G 3P8DA 3QIIA 1NEGA 4KUIA 2LJ1A 2FRYA 3EG0A 1VIEA 1BIAA 3R6OA 1Y0MA 4JJBA 2ROTA 4GBQA 2RK1A 2NUTA 3V7RA 4XTXA 4DBFA 4XAXB 5LJ3f 1Z9ZA 2YRDA 3EGDB 1OYXA 2AK5A 2HNIA 2KGTA 4LXCA 2CP0A 5DY9A 3SDZA 5KYNA 1VQ8Q 3ER0A 2NUTB 2VASA 5FU6B 3MHXA 5GAOm 4JJCA 3EGXB 3META 1LOJA 3PTAA 2LT4A 1V29B 3CCVA 4HCZA 4QVCA 2BZ8A 1TUDA 3NFCA 3OYGA 2NUPA 2ECZA 2PVGB 4FYVB 2DD4A 4TVRA 2XIDA 3JCMd 3CCVQ 3V8KA 1YI2A 1ABQA 1I1JA 2CREA 4M7AB 1KC8U 2FL7A 3JSCA 1WHKA 4C92A 1GFDA 3CCMT 4FYXB 5AYFA 3QKJA 4NL3A 2FZGB 3Q1JA 4LDUA 3OMGA 4PFZA 4ESRA 4IIMA 4N0AC 2MYSA 3RESA 4J9DA 1PC0A 2EQIA 2DD5A 1Y7XA 4AFSC 2WSCE 1X69A 1VQKT 3OYDA 1NEBA 3UDCA 1Q81U 1BKBA 2QYZA 2KXCA 1QKWA 2DMOA 3V7CA 5GAOr 1WJRA 5CKEA 1SSFA 5LJ5g 1IRXA 1YJWA 1YHQA 2L3QA 3MEUA 4Z8AA 2L2PA 4OMPA 1VQOQ 3VJPA 2A7YA 4PJOB 4RTVA 3CCUQ 1WDXA 4C92E 3G6EA 3LLRA 1VQ9A 1UGSB 1M2VA 1BK2A 3EG1A 3M0RA 2EQMA 3RMSA 2LZ6B 1ZSZA 4JJDA 2E41A 2CUBA 1OPLA 2LC4A 2AT1B 2CT4A 4BB7A 2RD1A 1S72A 2DXUA 1VQNQ 2D0QB 4BY6B 4HT8A 1ZUUA 4RG2A 1BI0A 4RTTA 1OU8A 1PRLC 2BZXA 3CQTA 1U3OA 4F04B 2J05A 4AG2C 1E7OA 4RTXA 2VB6A 3KBGA 4PJJA 3CC2A 2XHCA 3URGA 4KBMB 4RCCA 4BDYA 3HSBA 4ANJA 4M77F 2HSEB 4LD6A 2V8IA 5LJ5d 5HK0A 1PNJA 2O2OA 5GAMj 1TU0B 1M30A 4XU2A 3JCMX 3M58A 5CQXA 1OI1A 1VYVA 2HSPA 2HMAA 2QGFB 1VQMQ 4PJOA 1Q82R 1HXDA 5GAOn 4DBHA 5I2MA 3HFOA 2MAMA 1C6VX 5CAIA 1IHWA 5IH2A 1G8XA 2OTLA 2XG8D 4B9WA 2LQWA 2ZPIB 3CCLT 3ME9A 1AVZC 3CD6Q 2EIFA 1N9RA 2V1QA 1AEYA 3UWNA 2XK0A 3KXTA 3CCST 2CP3A 1VIFA 4ZN3A 4X9CA 1JJ2P 1K4US 1KQSP 4KH1B 5CKHA 4JRQA 3QJYA 1QW1A 3CCUT 2YRCA 4HT9A 2WSEE 4NOYA 5GMKi 1V1CA 4N0AA 4C8QF 1QP2A 1Q7YR 4O6JA 2P0KA 4LDVA 4E47A 2CGHA 3FRNA 3PVLA 1J3TA 1TOVA 2K3BA 4M78C 1H3HA 2JUFA 1T3LA 5GANe 3JCMQ 3L2UA 1VQLQ 1VQNT 2KR3A 4FU6A 4ELYC 2M51A 1NZ9A 3M59A 2RO0A 4PFPA 4Z02A 5KE2A 1YIJT 1YJNA 3F70A 2RHZA 3CMEQ 4BD3A 4XTYA 2KAFA 3SEMA 1RI0A 4DA4A 2X51A 2XICA 5J39A 3CCET 3CPFA 2JS0A 1VQ6A 2OTJT 2GQVA 1I5OB 2K3YA 2CT3A 3CD6A 3G4ST 3G71T 4RTUA 3E2UA 3JCMW 3OYKA 4M75D 3L2QA 2CP7A 1Y71A 4QW2A 5J3BA 1M8VA 2QG9B 1Q82U 1AHJB 1HD3A 2XKOC 3FC3A 1YITT 4X1VA 2M16A 3CC4A 5D6YA 2DNUA 2L3RA 4C92B 3I56A 3UF4A 1WXUA 1OZ3A 4J7FA 3NPFA 3UATA 1Y57A 4AG1C 3OS5A 4ZGDB 4F7UG 3VUBA 3X24B 2A36A 1VQ7T 3JAME 8AT1B 2QQBA 4OB2B 1JRIA 4C8QB 2KE9A 1M8MA 3BDLA 4HXJA 2QQRA 1OX8A 4MMLA 1AWJA 1I4K1 1PG5B 1VQ8A 1ZQ1A 4PJMA 2PQWA 4FIBA 3LWIA 3RUXA 5KYXA 1ARKA 1MMDA 3LH5A 3WXMB 3VUZA 5LJ5h 1UGPB 1C1AA 1ZA1B 2P4RA 3NTHA 1G3YA 4VUBA 1FWZA 3I35A 1LCKA 3H0IA 1M1KU 4PKCC 4C8QG 2DL5A 5CKDA 2JMAA 2O4XB 3S3MA 4OB3B 1UTIA 1WHLA 4PJOD 4FSXA 3P8HA 4JPBW 1F1BB 3JB9D 2PNIA 1VQ6Q 1G3WA 3CCJT 1K8AU 3C95A 3RR6A 1AWOA 3BDUA 3JB9H 3P8BB 1GBRA 4JZ3A 5CVIA 2D1XA 1UFFA 4M7AE 3CCRQ 2HDAA 4J9BA 4IKFA 3VS4A 5GAN6 2E10A 3WVDB 3E9GA 3CPWP 2KRSA 4M4ZA 5CIUA 1QLYA 3LWHA 5EG2A 3I55Q 3OS2A 1GFCA 1YITQ 3CCSA 4LNPA 4HVUA 3KUFA 3CCJA 3MPUB 4C92C 2KI7A 1M1KC 3TSZA 2KDSA 1X43A 1YCYA 3VS7A 4JRPA 3HRTA 4CC4B 2P0PA 3M4YA 4JS5A 3S3OA 2ZPEB 2E4HA 3UT1A 1JEGA 2M0YA 2B86A 1K0SA 3THKA 4M78B 2AIRB 3X20B 3OW2P 2E5KA 2EJ9A 5CR2A 4AFZC 1VQ4Q 2DIGA 2RH2A 5GAN2 4NS5A 5GANh 3DLLA 1FMKA 3HPWA 4J7IA 2LCSA 5GANf 5GANj 4M7AC 4BDZA 5GAMd 2OTJA 2KT1A 2AHJB 2F2WA 3QJ6A 1CSKA 1W1FA 3JCMb 4OMMA 2BTTA 3DB3A 1WJQA 2K9GA 4MZTA 1H3ZA 2QASA 2G6FX 1KHIA 1S1NA 4M77D 5I21A 3NMZC 1H8KA 3FJPA 3D7SB 5KYXB 1T0JA 2GF7A 4KGXB 5FWBA 2BZYA 2RB6A 2JN0A 4L59A 3EH2A 2JW4A 2Y4XA 2X4JA 4J9HA 2LVMA 1RABB 4OB0B 1UDLA 3NHNA 1FXXA 2DXCA 3CCUA 1WJSA 2V1RA 1ABOA 2K7AA 1OZ2A 4C5EA 2KROA 2JZ2A 2O4XA 1WQWA 1QMCA 1JXOA 1PWTA 1WIEA 3V8JA 1W2BA 1KQSS 4FL6A 1VQ9T 3C0CA 4AT1B 1VQ5Q 1RAFB 2QA4Q 4C92D 4FYYB 4Q5WA 2X4YA 2YXYA 4E7SA 4ZGEB 1LVKA 4J6WA 5GMKl 2CP6A 1VQLA 4WF2A 5GAMe 1MV0B 1ZBJA 1ZUKA 2LNHB 3MP6A 4KT0E 4JUVA 2R5MA 1N9SA 2CP5A 1UGQB 2D8HA 4JJNK 1WXBA 3RBBB 3ZEHA 5FU6C 5GAOq 5DLOA 4JZ4A 4QKUA 4RTWA 3G1JA 4XTWA 1JB0E 1D0ZA 2MWPA 3VS6A 2FHDA 1AT1B 3VS5A 1NYFA 2DL8A 1VQPA 1PKSA 2D8JA 2LP5A 5IXBA 1P92A 3C94A 1VQ8T 4PJLA 3OB9A 2CP2A 3SWNA 4MDXA 1JBMA 1XQHA 2DAQA 3QYGB 4AFQC 1TUGB 2HQHA 1MUZA 1QVGP 2DEUA 2CH4W 1SSHA 1X6BA 2VC8A 2YLBA 2GCXA 1VA7A 1WHJA 3M5AA 1ZUYA 3M0QA 4QT7A 1QVFP 1X6GA 2ED0A 1IGUA 3UA7A 1NJIU 1PKTA 4F17A 2M02A 4BACA 3RERA 4BI3A 2L5QA 2V8KA 2HL5C 1SHGA 2J7IA 4JRKA 5GAMf 3CEYA 4ZGJB 2KY9A 3J81E 2EYXA 1N27A 1NG2A 3QYHB 3CMAT 3PNWC 1OV3A 4CC3A 2LX9A 2EYWA 4M7AA 4A4GA 7AT1B 3CCEA 2DILA 2XDPA 2JT4A 1ZSZB 2EYYA 2LJ0A 2Y4YA 3EFRA 4PJOC 2XDDA 1LJOA 3LW5E 4OMQA 3CCQQ 2LCCA 1VQ7A 5DLQE 1UGVA 5IAYA 2K5FA 4LUEA 5KYYA 2PZ1A 2MIOA 2FPDA 1S72Q 1EFNA 4JLIA 4FT2A 1U5SA 3I56T 2COZA 1N8RU 4OMOA 4AFUC 2X35A 4X9DA 3CCSQ 3DLMA 1Q7YC 1UB4A 2YT6A 4ZTFA 2EYQA 2K3XA 1HK9A 1QVGA 2RN8A 1B3QA 1RACB 2VUBA 2LTOA 2HBPA 3H0HA 1BU1A 1HYOA 1G3TA 2PTKA 2NUZA 1WHHA 2V26A 3G6ET 3NTIA 2VVKA 4BI8B 4BUGA 4M7DE 1DJ7B 2RJCA 2L89A 2QDLA 2OAWA 2EGCA 1RLPC 2CH4A 4E7HA 1NPPA 1H641 2DTHA 3RDVA 2DE0X 3EHRA 2EWNA 3VYHB 1JJ2A 4M78D 4C0FA 1SPKA 4IUPA 1U06A 1X2KA 3A8HB 2QK0A 3A8OB 2AKKA 3CCEQ 5CKFA 3JB9F 4C0DC 3EFOB 1M4ZA 2OTJQ 2M9UA 1IB8A 3QG1A 4LDWA 1HJDA 1QVFA 2DIQA 1RAEB 3LH0A 1QCFA 4E6RA 2Y90A 1FYNA 4HVWA 5HCKA 2GFUA 2RJDA 2RQWA 1GBQA 3QWXX 2RQRA 1MV3A 2EAYA 4JRIA 5FROA 2G3RA 4D8KA 2HCKA 1JJ2S 1K9AA 2F69A 4IUQA 2DK3A 2RHIA 5FRNA 1MMAA 4C8QE 3H41A 1Y96B 2EQKA 3REAB 1UHFA 2SRCA 2R5AA 1R0BG 1SHFA 1KQ2A 3ASKA 4A53A 5GAMg 1V76A 2QQSA 1RAHB 1KC8C 5LJ3h 4BI4A 3VV0A 4ZTJA 1TUCA 3X26B 2K57A 2VYTA 3SWNC 1OULA 3M0PA 1H92A 4ORZA 5LJ3j 1YITA 4M7DG 3JB9I 1OPKA 2OI3A 4C5IA 3VS1A 1T3SA 1RADB 3QHSA 1VYUA 4E7JA 1UECA 4J5YA 1VYTA 3VU3C 2ZPBB 4FSSA 3G71A 1QKXA 1BI3A 3G4SA 3CC7Q 2DX1A 5KE3A 1YCSB 2CZ6B 1IZ6A 5GAN7 2A08A 4M75C 2M1HA 3X28B 1YJNQ 4M7DA 3H0FA 1D1CA 1Y96A 3DB4A 3PE0A 3BW1A 1Q81C 1YJWT 3RKXA 4WCIA 1VQLT 4PJOG 5I2SA 4PLLA 4M7AD 2DL3A 1YIJQ 2PVOB 2KT8A 2RQUA 2XD0A 2L0AA 1OX9A 2QEXT 2RJEA 2K6DA 4JDSA 3CCRA 3OBWA 3HP9A 1U1SA 1GL5A 1M27C 3OYCA 1W4SA 2MF2A 3G71Q 2JTFA 4HKEA 5IXFA 1YJ9A 1K8AC 1AZGB 1NLPC 2IG0A 3OYMA 2YLCA 3QUIA 3HRUA 3L2VA 3H9NA 3CCQA 1UE9A 1IXDA 3E9FA 4YTLA 4XTZA 4FYWB 2D0NA 1M1GA 2R58A 3CPWA 2H3JA 1M90C 1UGRB 3JRZA 1EIFA 4V2SA 1VQ5A 3EHQA 2BKDN 4PLIA 1BI1A 1N8RR 4RCBA 3J80E 4IUUA 3REBB 1PRMC 2YUNA 1D3BB 1WPYA 1GXIE 4D8DA 3OYIA 4J9FA 5ECAA 1WYXA 2QQAA 2DLPA 2GTOA 4A4HA 3RMQA 1KJWA 2K2VA 3FEOA 4R56A 3GNGA 4C92F 2BE7D 4EIKA 1UG1A 5GJVB 3LGFA 3A8MB 5FU7B 8ATCB 1I8FA 3I5RA 5IN1A 1RI9A 2H3EB 1PSEA 1WXTA 4LDYA 1NE8A 2IVWA 3RKWA 3CCMQ 2GBQA 1WGSA 2QQ9A 1ACMB 4EMGA 1WZOA 2GGRA 3JCMP 4M75E 3L2WA 3I9QA 3TU4K 4FW1A 4DOWA 2DZ9A 2IPOB 3QBYA 2EYZA 3OYBA 4KGVB 3CCVT 2PVDB 4Y91A 3EG3A 4QQDA 1M3AA 1CKBA 2DXTA 1C0MA 1VQKQ 4UC4A 3FLGA 2YUPA 2QEXQ 2I2LA 3HHTB 2EBPA 1XOVA 1X6OA 1ZBXA 2C0IA 1KIKA 3CCRT 2FZKB 5J26A 2NWMA 1NM7A 3V8LA 2RNAA 3J7AF 5GAN5 3E19A 2DRKA 2DL7A 3N5BB 1WNLA 1SRLA 3I55T 3EFOA 5D6XA 5GMKm 1WLPB 2AZSA 2L3PA 2CYZB 3OQ5A 1VQ5T 2LX7A 3UA6A 2JTMA 5GAN3 4D6WA 1AWWA 3FJ5A 5L8RE 1WA7A 2X3XD 5LJ3d 2C0TA 3QO3A 1VQOT 2JS2A 1TXQA 4XU3A 3CPWS 2P0QA 4IIOA 4M77E 4BY6C 2DEQA 3VS3A 3QPHA 2DETA 3OYYA 2DJQA 5DM7R 2O9SA 2QXFA 1EX4A 3CC7A 3MEVA 2RQVA 4ATOA 2DXBA 1YJ9T 3L2ZA 1KSWA 2BE9B 2DBKA 4PJOE 5GJWB 3QDFA 2OAUA 1JU5C 3TVTA 2FRWA 2QGGA 3OYNA 9ATCB 2RI5A 3CCMA 1T0HA 2MCNA 4GY5A 3GBQA 4DEXA 1XTDA 1OQKA 2YDLA 3JB9G 2OTLT 4XK8E 3PFSA 1VOMA 2KQWA 2FYKA 1ZSGA 3TREA 2Z0WA 1BYMA 1R0CB 3MJXA 3OYFA 4J9GA 3MP1A 1M1FA 2EQJA 1QQJA 2JM8A 2MMPA 2XI9A 4J9CA 2ZZDA 4M77G 2FZCB 1SG5A 3CXCA 2E65A 2FPFA 3CBOA 2JXBA 3JB9J 1D1BA 3C12A 4F14A 5IHIA 4XTVA 4M7DD 4LD9K 1W2BP 2ZGWA 2J06A 2EQUA 2RPNA 1MNEA 2QTVA 5GANg 2F1LA 4OGCA 5KYUA 1BIBA 2COWA 3CD6T 1SKUB 2DKGA 4JS4A 5C0MA 1VQMT 5IT9E 4M78E 2RHUA 2CZ0B 2KEAA 1FMWA 2DYIA 2X9HA 2EFIA 2FB7A 3QZ5B 5A2QE 2D9TA 2EW3A 2RF0A 2DPPB 4NL2A 1UJYA 5A0LA 1VQNA 2BIVA 1MMNA 3CCLQ 2KVQG 3CCQT 1BI2A 1LPLA 2YWWA 2HBWA 4HVVA 1MNDA 4C5GA 3TCJA 3FDRA 1W70A 1D0XA 3VS2A 2GFAA 2RHYA 4RMOA 3INZA 2E3HA 2O9VA 5LJ5f 1ZSZC 3PVQA 4PJNA 2YUOA 1ZHIA 2DM1A 1E6HA 3EGUA 1YJ9Q 1Q7YU 4N4HA 1YHQQ 3G7ZA 5FW9A 4E2FB 2ENMA 2HQEA 1N8RC 2DFUA 1NBEB 2JVVA 2O01E 3G4SQ 3CCLA 3OW2A 1Z9QA 4C0DB 1M3CA 2DZCA 1M3BA 2ROLA 1KQ1A 4DQ2A 4O5VA 3CMET 2K2MA 1K73C 1R77A 1EZZB 3FIFA 1WQ7A 1YWPA 1RAAB 1VQKA 3GOXA 1ZLMA 5FU7C 4M7AG 3OMCA 2KSSA 1YNZA 2DRMA 4WTOB 1KD1C 1D3BA 2HKQB 1YP5A 2ED1A 4XU1A 3JCMh 1X75C 2XU8A 1SEMA 3OW2S 1QVGS 1RAGB 1RUWA 4XTUA 1JXMA 2KK4A 2C0OA 5GMKj 1B34A 1QVFS 1MGQA 3OSVA 5I11A 2KRNA 3GF5A 1RL2A 3R6NA 2DTOA 3CMAQ 2KNBB 5GMKh 4M78F 2FPEA 5C6SA 1A0NB 3OA6A 3CC4Q 4KUDK 3FB9A 3A8LB 2GQIA 1NJIC 4J83A 1I5LA 1D0YA 1TWBA 5LJ3g 4M75G 5IHNA 2DL4A 1OOTA 1AWXA 1N6AA 3A8GB 1PD0A 2B8AA 4M78G 1QCNA 3CBMA 1PM3A 3HRSA 3RKYA 2MI6A 1S72T 4A4KA 1K73U 2VKNA 2HKNA 3M54A 4QVDA 2COYA 5KYUB 4A4EA 1K76A 3C4SA 2JOYA 4KGZB 4OGEA 2RMOA 2JMCA 2DYBA 2KYMA 5D7UA 2EJGA 1Q86C 1IO6A 2IIMA 4EMHA 5D6WA 1I81A 4F7UE 3JCMV 3A98A 4GLMA 4IURA 1VQ6T 3CCJQ 1Q81R 3V7SA 1LNXA 5GAOp 3G6EQ 2LNVA 2E5QA 1YHQT 1M1KR 4C8QD 3I55A 2EGEA 4E7ZA 3PIPA 1IGQA 2E3IA 3MEWA 4BE0A 4PJOF 2HZYA 4LUDA 3TEEA 5GANd 2CZ7B 1K8AR 1JO8A 4M75F 4PNOA 4A4FA 3BFMA 5KH6A 1PHTA 1R8OB 3ZBDA 5GAOl 2W10A 2LQNA 4Y28E 1PSFA 1RLQC 2RK2A 4L6V5 2A28A 3EAEA 5M9OA 2ZAEA 1M9SA 2DVJA 2P4TA 1AZEA 4KULA 5IHKA 4C8QC 2NUPB 3ZL7C 1U1TA 3A5ZB 5FLXE 4BE2A 3EFSA 1G5VA 3E1SA 1TS9A 3PMTA 2HD0A 4J8OA 1E6GA 2RM4A 3RNJA 3TQ7P 5GAN4 5FWCA 2J6FA 3KFVA 1M5Q1 1YWOA 3CC4T 2CSQA 3O8VA 3CMAA 4PL6A 2V8JA 5LL6S 2AKLA 2K5LA 1OU9A 1NJIR 5LJ3e 3SWNB 2W0ZA 3AHUA 1FX7A 2OJ2A 2EGAA 2KRMA 4J9EA 2ESWA 2HAXA 1X2QA 1VQ4T 5LJ5e 2DVEA 5KYWA 4F7UB 4R55A 5KCOA 2E6NA 2VV5A 3QXEB 2NYSA 3OYEA 2RHXA 1XNIA 2K4YA 1G3SA 1NPRA 1TG0A 1GCQA 2MOXA 1NYGA 3QSUA 1G83A 1Y07A 2CDTA 2DERA
chains in the Genus database with same CATH topology
1C6VX 1C0MA 1IHVA 4FW2A 4FW1A 1IHWA 1QMCA 1C1AA 5D7UA 1EX4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C6V X;  1C0M A;  1IHV A;  4FW2 A;  4FW1 A;  1IHW A;  1QMC A;  1C1A A;  5D7U A;  1EX4 A; 
#chains in the Genus database with same CATH topology
 2ZPG B;  3H6Z A;  2X3W D;  1ZA2 B;  2X4X A;  3EG9 A;  5GMK e;  2EVR A;  2K79 A;  5KYY B;  4DBR A;  2WSF E;  1WHG A;  4OML A;  4XU0 A;  2DA9 A;  3VRZ A;  4EMK A;  2XMF A;  4BE1 A;  3H8Z A;  2DO3 A;  4CC2 A;  5CCA A;  1KHC A;  4F7U F;  2F2V A;  2JM9 A;  2MWO A;  3OS0 A;  2HQX A;  2XDB A;  2LRQ A;  3L2R A;  4OP0 A;  1G2B A;  2E12 A;  1BB9 A;  4M77 A;  2EKO A;  3CBP A;  4E7K A;  1D1A A;  5AT1 B;  3JCM J;  4M7D F;  5CQY A;  1UJ0 A;  2QTX A;  5CO7 A;  1UUE A;  1PCX A;  4ELZ C;  1M2O A;  3S3N A;  2FVU A;  4M77 B;  2CSI A;  4II1 A;  4LDX A;  1K73 R;  3JCM f;  1VUB A;  1XJW B;  1KG1 A;  1WHM A;  1D09 B;  1CKA A;  4CI0 C;  2J6K A;  4KRT A;  1B34 B;  2H8H A;  1KC8 R;  4E7L A;  1W6X A;  2KXD A;  3OYA A;  2E70 A;  2KYB A;  4FW2 A;  1TSF A;  1KD1 R;  2EPD A;  1NLO C;  5CKB A;  3GNF B;  1Q86 U;  4EMK B;  1ZX6 A;  4GLK A;  4OVA A;  5LJ5 j;  1GCQ C;  2M0O A;  1AOJ A;  3BY7 A;  3M0T A;  3MEA A;  2DJZ A;  2PUK B;  3DKM A;  4OMN A;  2A37 A;  2FG0 A;  2VWF A;  2KMT A;  4R0K A;  3S6W A;  2F2X A;  4ME7 A;  1SRM A;  1IRE B;  4PFO A;  1TH7 A;  1K9M C;  2YRV A;  3VKI A;  4QQ6 A;  4OMF B;  1QWF A;  5I22 A;  2I0N A;  1AD5 A;  3O5Z A;  4LN2 A;  2VXE A;  3L1A A;  2F5K A;  2LJ3 A;  4AMC A;  3QZ9 B;  3OBY A;  2P84 A;  2MK5 A;  4DOV A;  3OS1 A;  2HL3 A;  1QCO A;  2RQT A;  4M7D B;  1UHC A;  3CC2 Q;  2QDY B;  3PGG A;  2E6Z A;  3ULR B;  4XQ3 A;  1WX6 A;  2F5T X;  1YN8 A;  2R57 A;  4K11 A;  4L5G A;  3OYJ A;  1KD1 U;  2JTE A;  3U23 A;  3NTK A;  4P5N A;  2JNG A;  3EH1 A;  3M53 A;  4A63 B;  3CXC S;  2RI2 A;  2VGN A;  2OX7 A;  4C8Q A;  2A3L A;  3T9N A;  2LT1 A;  2RA2 A;  1B7T A;  3I56 Q;  4IUT A;  3OYH A;  4RUG A;  3JCM e;  4FCY A;  1Q82 C;  1X27 A;  2CKK A;  1IHV A;  2DTI A;  1HSQ A;  3JCM g;  2O31 A;  5HY6 A;  3M57 A;  2QAZ A;  2YHT A;  3M9Q A;  4M78 A;  4X34 A;  3OYL A;  4RKU E;  1YFN A;  1VQP T;  3EG2 A;  5GAN 8;  4Z88 A;  3QDR B;  2PU9 B;  2VGM A;  3HFN A;  3M4G A;  1TTH B;  4C5H A;  1QP3 A;  4M75 A;  3M0U A;  4DBQ A;  4IUV A;  4EMK C;  1N5Z A;  3RIR A;  4MMK A;  4F7U A;  1VQO A;  1WFW A;  1BCM A;  2O88 A;  1JQQ A;  3VS0 A;  2YUQ A;  3PT9 A;  4RTZ A;  2D6F A;  2JJ9 A;  2CS7 A;  3LX7 A;  5HKC A;  1X01 A;  1SF9 A;  4N4G A;  4PK4 A;  3MP8 A;  1QWE A;  3GIB A;  4QVZ A;  4B6M A;  5HK3 A;  1BCO A;  3JV3 A;  2OTL Q;  4M7D C;  4FM4 B;  4M7A F;  1RAI B;  2RI3 A;  5A0G A;  2J6O A;  2CUD A;  4B9X A;  2E1H A;  2HEQ A;  1KFZ A;  6AT1 B;  1K9M R;  4FT4 A;  4MZP A;  3PMI A;  2FO0 A;  2SEM A;  5CK9 A;  4RG8 A;  1BBZ A;  3EGD A;  4EPC A;  3HL8 A;  3I5S A;  4HCC A;  4OB1 B;  3MCA B;  3CC2 T;  3X25 B;  1YI2 Q;  1VQ7 Q;  1OEB A;  2LCL A;  4M77 C;  1O75 A;  4E7I A;  2QI2 A;  2AZV A;  2RJF A;  1I07 A;  4C0Z A;  2X4W A;  4A54 A;  3CXC P;  4KH0 B;  3ZFJ A;  1K0X A;  3UPU A;  4RTY A;  5FRM A;  5KYW B;  3MKD A;  2WAC A;  3VYG A;  5EC7 A;  4ZN1 A;  1M90 R;  4M75 B;  4J9I A;  3WVE B;  3GP8 A;  1VQ4 A;  2L3S A;  2KBT A;  1Q86 R;  2VXF A;  3QWY A;  2YSQ A;  4EDU A;  2E64 A;  4HCB A;  3BE3 A;  3OY9 A;  4LE9 A;  4HA8 A;  1QVP A;  4MDW A;  3SHW A;  2DF6 A;  3CC7 T;  2GNC A;  4OF1 A;  4Z89 A;  1K1Z A;  3M56 A;  2EKH A;  3EG9 B;  2K5I A;  2EJF A;  3LGL A;  1VQP Q;  1K9M U;  1I0C A;  1KK7 A;  3CME A;  2A0F B;  2FEI A;  4JLG A;  2LQK A;  5A0D A;  2DBM A;  1MHN A;  1PD1 A;  3TSW A;  1Q95 G;  2PUO B;  1UEB A;  2LQ8 A;  2NLU A;  3A1P A;  4CRI A;  3SD4 A;  2MPX C;  2ZCF B;  3IQL A;  1YIJ A;  1YJN T;  3GLX A;  3AT1 B;  1W2B S;  1KQS A;  2GTJ A;  3EGX A;  1O9S A;  3HTR A;  3M55 A;  3MO8 A;  1YJW Q;  3M0S A;  1U8R A;  5GAM h;  3SB2 A;  2ABL A;  3PIO A;  4DEY A;  4MZM A;  3SFM A;  1M90 U;  4J6Y A;  1GCP A;  2QA4 A;  2ZPF B;  4ZNX A;  2BUD A;  2L8D A;  1YBY A;  4CC7 A;  1M2V B;  1VQ9 Q;  2ATC B;  4HCK A;  4C0G A;  1FMV A;  2LDM A;  3GPL A;  4N4I A;  3L42 A;  3OSS C;  2QA4 T;  2C06 A;  1B07 A;  2LMJ A;  3JCM c;  1WI7 A;  4J6X A;  3LYI A;  2ZPH B;  3NGP A;  2QEX A;  2CZ1 B;  4F16 A;  4QQG A;  1MMG A;  5KCH A;  1YI2 T;  3HKS A;  5L23 A;  1VQM A;  4Y92 A;  3VRY A;  1GRI A;  4C92 G;  3P8D A;  3QII A;  1NEG A;  4KUI A;  2LJ1 A;  2FRY A;  3EG0 A;  1VIE A;  1BIA A;  3R6O A;  1Y0M A;  4JJB A;  2ROT A;  4GBQ A;  2RK1 A;  2NUT A;  3V7R A;  4XTX A;  4DBF A;  4XAX B;  5LJ3 f;  1Z9Z A;  2YRD A;  3EGD B;  1OYX A;  2AK5 A;  2HNI A;  2KGT A;  4LXC A;  2CP0 A;  5DY9 A;  3SDZ A;  5KYN A;  1VQ8 Q;  3ER0 A;  2NUT B;  2VAS A;  5FU6 B;  3MHX A;  5GAO m;  4JJC A;  3EGX B;  3MET A;  1LOJ A;  3PTA A;  2LT4 A;  1V29 B;  3CCV A;  4HCZ A;  4QVC A;  2BZ8 A;  1TUD A;  3NFC A;  3OYG A;  2NUP A;  2ECZ A;  2PVG B;  4FYV B;  2DD4 A;  4TVR A;  2XID A;  3JCM d;  3CCV Q;  3V8K A;  1YI2 A;  1ABQ A;  1I1J A;  2CRE A;  4M7A B;  1KC8 U;  2FL7 A;  3JSC A;  1WHK A;  4C92 A;  1GFD A;  3CCM T;  4FYX B;  5AYF A;  3QKJ A;  4NL3 A;  2FZG B;  3Q1J A;  4LDU A;  3OMG A;  4PFZ A;  4ESR A;  4IIM A;  4N0A C;  2MYS A;  3RES A;  4J9D A;  1PC0 A;  2EQI A;  2DD5 A;  1Y7X A;  4AFS C;  2WSC E;  1X69 A;  1VQK T;  3OYD A;  1NEB A;  3UDC A;  1Q81 U;  1BKB A;  2QYZ A;  2KXC A;  1QKW A;  2DMO A;  3V7C A;  5GAO r;  1WJR A;  5CKE A;  1SSF A;  5LJ5 g;  1IRX A;  1YJW A;  1YHQ A;  2L3Q A;  3MEU A;  4Z8A A;  2L2P A;  4OMP A;  1VQO Q;  3VJP A;  2A7Y A;  4PJO B;  4RTV A;  3CCU Q;  1WDX A;  4C92 E;  3G6E A;  3LLR A;  1VQ9 A;  1UGS B;  1M2V A;  1BK2 A;  3EG1 A;  3M0R A;  2EQM A;  3RMS A;  2LZ6 B;  1ZSZ A;  4JJD A;  2E41 A;  2CUB A;  1OPL A;  2LC4 A;  2AT1 B;  2CT4 A;  4BB7 A;  2RD1 A;  1S72 A;  2DXU A;  1VQN Q;  2D0Q B;  4BY6 B;  4HT8 A;  1ZUU A;  4RG2 A;  1BI0 A;  4RTT A;  1OU8 A;  1PRL C;  2BZX A;  3CQT A;  1U3O A;  4F04 B;  2J05 A;  4AG2 C;  1E7O A;  4RTX A;  2VB6 A;  3KBG A;  4PJJ A;  3CC2 A;  2XHC A;  3URG A;  4KBM B;  4RCC A;  4BDY A;  3HSB A;  4ANJ A;  4M77 F;  2HSE B;  4LD6 A;  2V8I A;  5LJ5 d;  5HK0 A;  1PNJ A;  2O2O A;  5GAM j;  1TU0 B;  1M30 A;  4XU2 A;  3JCM X;  3M58 A;  5CQX A;  1OI1 A;  1VYV A;  2HSP A;  2HMA A;  2QGF B;  1VQM Q;  4PJO A;  1Q82 R;  1HXD A;  5GAO n;  4DBH A;  5I2M A;  3HFO A;  2MAM A;  1C6V X;  5CAI A;  1IHW A;  5IH2 A;  1G8X A;  2OTL A;  2XG8 D;  4B9W A;  2LQW A;  2ZPI B;  3CCL T;  3ME9 A;  1AVZ C;  3CD6 Q;  2EIF A;  1N9R A;  2V1Q A;  1AEY A;  3UWN A;  2XK0 A;  3KXT A;  3CCS T;  2CP3 A;  1VIF A;  4ZN3 A;  4X9C A;  1JJ2 P;  1K4U S;  1KQS P;  4KH1 B;  5CKH A;  4JRQ A;  3QJY A;  1QW1 A;  3CCU T;  2YRC A;  4HT9 A;  2WSE E;  4NOY A;  5GMK i;  1V1C A;  4N0A A;  4C8Q F;  1QP2 A;  1Q7Y R;  4O6J A;  2P0K A;  4LDV A;  4E47 A;  2CGH A;  3FRN A;  3PVL A;  1J3T A;  1TOV A;  2K3B A;  4M78 C;  1H3H A;  2JUF A;  1T3L A;  5GAN e;  3JCM Q;  3L2U A;  1VQL Q;  1VQN T;  2KR3 A;  4FU6 A;  4ELY C;  2M51 A;  1NZ9 A;  3M59 A;  2RO0 A;  4PFP A;  4Z02 A;  5KE2 A;  1YIJ T;  1YJN A;  3F70 A;  2RHZ A;  3CME Q;  4BD3 A;  4XTY A;  2KAF A;  3SEM A;  1RI0 A;  4DA4 A;  2X51 A;  2XIC A;  5J39 A;  3CCE T;  3CPF A;  2JS0 A;  1VQ6 A;  2OTJ T;  2GQV A;  1I5O B;  2K3Y A;  2CT3 A;  3CD6 A;  3G4S T;  3G71 T;  4RTU A;  3E2U A;  3JCM W;  3OYK A;  4M75 D;  3L2Q A;  2CP7 A;  1Y71 A;  4QW2 A;  5J3B A;  1M8V A;  2QG9 B;  1Q82 U;  1AHJ B;  1HD3 A;  2XKO C;  3FC3 A;  1YIT T;  4X1V A;  2M16 A;  3CC4 A;  5D6Y A;  2DNU A;  2L3R A;  4C92 B;  3I56 A;  3UF4 A;  1WXU A;  1OZ3 A;  4J7F A;  3NPF A;  3UAT A;  1Y57 A;  4AG1 C;  3OS5 A;  4ZGD B;  4F7U G;  3VUB A;  3X24 B;  2A36 A;  1VQ7 T;  3JAM E;  8AT1 B;  2QQB A;  4OB2 B;  1JRI A;  4C8Q B;  2KE9 A;  1M8M A;  3BDL A;  4HXJ A;  2QQR A;  1OX8 A;  4MML A;  1AWJ A;  1I4K 1;  1PG5 B;  1VQ8 A;  1ZQ1 A;  4PJM A;  2PQW A;  4FIB A;  3LWI A;  3RUX A;  5KYX A;  1ARK A;  1MMD A;  3LH5 A;  3WXM B;  3VUZ A;  5LJ5 h;  1UGP B;  1C1A A;  1ZA1 B;  2P4R A;  3NTH A;  1G3Y A;  4VUB A;  1FWZ A;  3I35 A;  1LCK A;  3H0I A;  1M1K U;  4PKC C;  4C8Q G;  2DL5 A;  5CKD A;  2JMA A;  2O4X B;  3S3M A;  4OB3 B;  1UTI A;  1WHL A;  4PJO D;  4FSX A;  3P8H A;  4JPB W;  1F1B B;  3JB9 D;  2PNI A;  1VQ6 Q;  1G3W A;  3CCJ T;  1K8A U;  3C95 A;  3RR6 A;  1AWO A;  3BDU A;  3JB9 H;  3P8B B;  1GBR A;  4JZ3 A;  5CVI A;  2D1X A;  1UFF A;  4M7A E;  3CCR Q;  2HDA A;  4J9B A;  4IKF A;  3VS4 A;  5GAN 6;  2E10 A;  3WVD B;  3E9G A;  3CPW P;  2KRS A;  4M4Z A;  5CIU A;  1QLY A;  3LWH A;  5EG2 A;  3I55 Q;  3OS2 A;  1GFC A;  1YIT Q;  3CCS A;  4LNP A;  4HVU A;  3KUF A;  3CCJ A;  3MPU B;  4C92 C;  2KI7 A;  1M1K C;  3TSZ A;  2KDS A;  1X43 A;  1YCY A;  3VS7 A;  4JRP A;  3HRT A;  4CC4 B;  2P0P A;  3M4Y A;  4JS5 A;  3S3O A;  2ZPE B;  2E4H A;  3UT1 A;  1JEG A;  2M0Y A;  2B86 A;  1K0S A;  3THK A;  4M78 B;  2AIR B;  3X20 B;  3OW2 P;  2E5K A;  2EJ9 A;  5CR2 A;  4AFZ C;  1VQ4 Q;  2DIG A;  2RH2 A;  5GAN 2;  4NS5 A;  5GAN h;  3DLL A;  1FMK A;  3HPW A;  4J7I A;  2LCS A;  5GAN f;  5GAN j;  4M7A C;  4BDZ A;  5GAM d;  2OTJ A;  2KT1 A;  2AHJ B;  2F2W A;  3QJ6 A;  1CSK A;  1W1F A;  3JCM b;  4OMM A;  2BTT A;  3DB3 A;  1WJQ A;  2K9G A;  4MZT A;  1H3Z A;  2QAS A;  2G6F X;  1KHI A;  1S1N A;  4M77 D;  5I21 A;  3NMZ C;  1H8K A;  3FJP A;  3D7S B;  5KYX B;  1T0J A;  2GF7 A;  4KGX B;  5FWB A;  2BZY A;  2RB6 A;  2JN0 A;  4L59 A;  3EH2 A;  2JW4 A;  2Y4X A;  2X4J A;  4J9H A;  2LVM A;  1RAB B;  4OB0 B;  1UDL A;  3NHN A;  1FXX A;  2DXC A;  3CCU A;  1WJS A;  2V1R A;  1ABO A;  2K7A A;  1OZ2 A;  4C5E A;  2KRO A;  2JZ2 A;  2O4X A;  1WQW A;  1QMC A;  1JXO A;  1PWT A;  1WIE A;  3V8J A;  1W2B A;  1KQS S;  4FL6 A;  1VQ9 T;  3C0C A;  4AT1 B;  1VQ5 Q;  1RAF B;  2QA4 Q;  4C92 D;  4FYY B;  4Q5W A;  2X4Y A;  2YXY A;  4E7S A;  4ZGE B;  1LVK A;  4J6W A;  5GMK l;  2CP6 A;  1VQL A;  4WF2 A;  5GAM e;  1MV0 B;  1ZBJ A;  1ZUK A;  2LNH B;  3MP6 A;  4KT0 E;  4JUV A;  2R5M A;  1N9S A;  2CP5 A;  1UGQ B;  2D8H A;  4JJN K;  1WXB A;  3RBB B;  3ZEH A;  5FU6 C;  5GAO q;  5DLO A;  4JZ4 A;  4QKU A;  4RTW A;  3G1J A;  4XTW A;  1JB0 E;  1D0Z A;  2MWP A;  3VS6 A;  2FHD A;  1AT1 B;  3VS5 A;  1NYF A;  2DL8 A;  1VQP A;  1PKS A;  2D8J A;  2LP5 A;  5IXB A;  1P92 A;  3C94 A;  1VQ8 T;  4PJL A;  3OB9 A;  2CP2 A;  3SWN A;  4MDX A;  1JBM A;  1XQH A;  2DAQ A;  3QYG B;  4AFQ C;  1TUG B;  2HQH A;  1MUZ A;  1QVG P;  2DEU A;  2CH4 W;  1SSH A;  1X6B A;  2VC8 A;  2YLB A;  2GCX A;  1VA7 A;  1WHJ A;  3M5A A;  1ZUY A;  3M0Q A;  4QT7 A;  1QVF P;  1X6G A;  2ED0 A;  1IGU A;  3UA7 A;  1NJI U;  1PKT A;  4F17 A;  2M02 A;  4BAC A;  3RER A;  4BI3 A;  2L5Q A;  2V8K A;  2HL5 C;  1SHG A;  2J7I A;  4JRK A;  5GAM f;  3CEY A;  4ZGJ B;  2KY9 A;  3J81 E;  2EYX A;  1N27 A;  1NG2 A;  3QYH B;  3CMA T;  3PNW C;  1OV3 A;  4CC3 A;  2LX9 A;  2EYW A;  4M7A A;  4A4G A;  7AT1 B;  3CCE A;  2DIL A;  2XDP A;  2JT4 A;  1ZSZ B;  2EYY A;  2LJ0 A;  2Y4Y A;  3EFR A;  4PJO C;  2XDD A;  1LJO A;  3LW5 E;  4OMQ A;  3CCQ Q;  2LCC A;  1VQ7 A;  5DLQ E;  1UGV A;  5IAY A;  2K5F A;  4LUE A;  5KYY A;  2PZ1 A;  2MIO A;  2FPD A;  1S72 Q;  1EFN A;  4JLI A;  4FT2 A;  1U5S A;  3I56 T;  2COZ A;  1N8R U;  4OMO A;  4AFU C;  2X35 A;  4X9D A;  3CCS Q;  3DLM A;  1Q7Y C;  1UB4 A;  2YT6 A;  4ZTF A;  2EYQ A;  2K3X A;  1HK9 A;  1QVG A;  2RN8 A;  1B3Q A;  1RAC B;  2VUB A;  2LTO A;  2HBP A;  3H0H A;  1BU1 A;  1HYO A;  1G3T A;  2PTK A;  2NUZ A;  1WHH A;  2V26 A;  3G6E T;  3NTI A;  2VVK A;  4BI8 B;  4BUG A;  4M7D E;  1DJ7 B;  2RJC A;  2L89 A;  2QDL A;  2OAW A;  2EGC A;  1RLP C;  2CH4 A;  4E7H A;  1NPP A;  1H64 1;  2DTH A;  3RDV A;  2DE0 X;  3EHR A;  2EWN A;  3VYH B;  1JJ2 A;  4M78 D;  4C0F A;  1SPK A;  4IUP A;  1U06 A;  1X2K A;  3A8H B;  2QK0 A;  3A8O B;  2AKK A;  3CCE Q;  5CKF A;  3JB9 F;  4C0D C;  3EFO B;  1M4Z A;  2OTJ Q;  2M9U A;  1IB8 A;  3QG1 A;  4LDW A;  1HJD A;  1QVF A;  2DIQ A;  1RAE B;  3LH0 A;  1QCF A;  4E6R A;  2Y90 A;  1FYN A;  4HVW A;  5HCK A;  2GFU A;  2RJD A;  2RQW A;  1GBQ A;  3QWX X;  2RQR A;  1MV3 A;  2EAY A;  4JRI A;  5FRO A;  2G3R A;  4D8K A;  2HCK A;  1JJ2 S;  1K9A A;  2F69 A;  4IUQ A;  2DK3 A;  2RHI A;  5FRN A;  1MMA A;  4C8Q E;  3H41 A;  1Y96 B;  2EQK A;  3REA B;  1UHF A;  2SRC A;  2R5A A;  1R0B G;  1SHF A;  1KQ2 A;  3ASK A;  4A53 A;  5GAM g;  1V76 A;  2QQS A;  1RAH B;  1KC8 C;  5LJ3 h;  4BI4 A;  3VV0 A;  4ZTJ A;  1TUC A;  3X26 B;  2K57 A;  2VYT A;  3SWN C;  1OUL A;  3M0P A;  1H92 A;  4ORZ A;  5LJ3 j;  1YIT A;  4M7D G;  3JB9 I;  1OPK A;  2OI3 A;  4C5I A;  3VS1 A;  1T3S A;  1RAD B;  3QHS A;  1VYU A;  4E7J A;  1UEC A;  4J5Y A;  1VYT A;  3VU3 C;  2ZPB B;  4FSS A;  3G71 A;  1QKX A;  1BI3 A;  3G4S A;  3CC7 Q;  2DX1 A;  5KE3 A;  1YCS B;  2CZ6 B;  1IZ6 A;  5GAN 7;  2A08 A;  4M75 C;  2M1H A;  3X28 B;  1YJN Q;  4M7D A;  3H0F A;  1D1C A;  1Y96 A;  3DB4 A;  3PE0 A;  3BW1 A;  1Q81 C;  1YJW T;  3RKX A;  4WCI A;  1VQL T;  4PJO G;  5I2S A;  4PLL A;  4M7A D;  2DL3 A;  1YIJ Q;  2PVO B;  2KT8 A;  2RQU A;  2XD0 A;  2L0A A;  1OX9 A;  2QEX T;  2RJE A;  2K6D A;  4JDS A;  3CCR A;  3OBW A;  3HP9 A;  1U1S A;  1GL5 A;  1M27 C;  3OYC A;  1W4S A;  2MF2 A;  3G71 Q;  2JTF A;  4HKE A;  5IXF A;  1YJ9 A;  1K8A C;  1AZG B;  1NLP C;  2IG0 A;  3OYM A;  2YLC A;  3QUI A;  3HRU A;  3L2V A;  3H9N A;  3CCQ A;  1UE9 A;  1IXD A;  3E9F A;  4YTL A;  4XTZ A;  4FYW B;  2D0N A;  1M1G A;  2R58 A;  3CPW A;  2H3J A;  1M90 C;  1UGR B;  3JRZ A;  1EIF A;  4V2S A;  1VQ5 A;  3EHQ A;  2BKD N;  4PLI A;  1BI1 A;  1N8R R;  4RCB A;  3J80 E;  4IUU A;  3REB B;  1PRM C;  2YUN A;  1D3B B;  1WPY A;  1GXI E;  4D8D A;  3OYI A;  4J9F A;  5ECA A;  1WYX A;  2QQA A;  2DLP A;  2GTO A;  4A4H A;  3RMQ A;  1KJW A;  2K2V A;  3FEO A;  4R56 A;  3GNG A;  4C92 F;  2BE7 D;  4EIK A;  1UG1 A;  5GJV B;  3LGF A;  3A8M B;  5FU7 B;  8ATC B;  1I8F A;  3I5R A;  5IN1 A;  1RI9 A;  2H3E B;  1PSE A;  1WXT A;  4LDY A;  1NE8 A;  2IVW A;  3RKW A;  3CCM Q;  2GBQ A;  1WGS A;  2QQ9 A;  1ACM B;  4EMG A;  1WZO A;  2GGR A;  3JCM P;  4M75 E;  3L2W A;  3I9Q A;  3TU4 K;  4FW1 A;  4DOW A;  2DZ9 A;  2IPO B;  3QBY A;  2EYZ A;  3OYB A;  4KGV B;  3CCV T;  2PVD B;  4Y91 A;  3EG3 A;  4QQD A;  1M3A A;  1CKB A;  2DXT A;  1C0M A;  1VQK Q;  4UC4 A;  3FLG A;  2YUP A;  2QEX Q;  2I2L A;  3HHT B;  2EBP A;  1XOV A;  1X6O A;  1ZBX A;  2C0I A;  1KIK A;  3CCR T;  2FZK B;  5J26 A;  2NWM A;  1NM7 A;  3V8L A;  2RNA A;  3J7A F;  5GAN 5;  3E19 A;  2DRK A;  2DL7 A;  3N5B B;  1WNL A;  1SRL A;  3I55 T;  3EFO A;  5D6X A;  5GMK m;  1WLP B;  2AZS A;  2L3P A;  2CYZ B;  3OQ5 A;  1VQ5 T;  2LX7 A;  3UA6 A;  2JTM A;  5GAN 3;  4D6W A;  1AWW A;  3FJ5 A;  5L8R E;  1WA7 A;  2X3X D;  5LJ3 d;  2C0T A;  3QO3 A;  1VQO T;  2JS2 A;  1TXQ A;  4XU3 A;  3CPW S;  2P0Q A;  4IIO A;  4M77 E;  4BY6 C;  2DEQ A;  3VS3 A;  3QPH A;  2DET A;  3OYY A;  2DJQ A;  5DM7 R;  2O9S A;  2QXF A;  1EX4 A;  3CC7 A;  3MEV A;  2RQV A;  4ATO A;  2DXB A;  1YJ9 T;  3L2Z A;  1KSW A;  2BE9 B;  2DBK A;  4PJO E;  5GJW B;  3QDF A;  2OAU A;  1JU5 C;  3TVT A;  2FRW A;  2QGG A;  3OYN A;  9ATC B;  2RI5 A;  3CCM A;  1T0H A;  2MCN A;  4GY5 A;  3GBQ A;  4DEX A;  1XTD A;  1OQK A;  2YDL A;  3JB9 G;  2OTL T;  4XK8 E;  3PFS A;  1VOM A;  2KQW A;  2FYK A;  1ZSG A;  3TRE A;  2Z0W A;  1BYM A;  1R0C B;  3MJX A;  3OYF A;  4J9G A;  3MP1 A;  1M1F A;  2EQJ A;  1QQJ A;  2JM8 A;  2MMP A;  2XI9 A;  4J9C A;  2ZZD A;  4M77 G;  2FZC B;  1SG5 A;  3CXC A;  2E65 A;  2FPF A;  3CBO A;  2JXB A;  3JB9 J;  1D1B A;  3C12 A;  4F14 A;  5IHI A;  4XTV A;  4M7D D;  4LD9 K;  1W2B P;  2ZGW A;  2J06 A;  2EQU A;  2RPN A;  1MNE A;  2QTV A;  5GAN g;  2F1L A;  4OGC A;  5KYU A;  1BIB A;  2COW A;  3CD6 T;  1SKU B;  2DKG A;  4JS4 A;  5C0M A;  1VQM T;  5IT9 E;  4M78 E;  2RHU A;  2CZ0 B;  2KEA A;  1FMW A;  2DYI A;  2X9H A;  2EFI A;  2FB7 A;  3QZ5 B;  5A2Q E;  2D9T A;  2EW3 A;  2RF0 A;  2DPP B;  4NL2 A;  1UJY A;  5A0L A;  1VQN A;  2BIV A;  1MMN A;  3CCL Q;  2KVQ G;  3CCQ T;  1BI2 A;  1LPL A;  2YWW A;  2HBW A;  4HVV A;  1MND A;  4C5G A;  3TCJ A;  3FDR A;  1W70 A;  1D0X A;  3VS2 A;  2GFA A;  2RHY A;  4RMO A;  3INZ A;  2E3H A;  2O9V A;  5LJ5 f;  1ZSZ C;  3PVQ A;  4PJN A;  2YUO A;  1ZHI A;  2DM1 A;  1E6H A;  3EGU A;  1YJ9 Q;  1Q7Y U;  4N4H A;  1YHQ Q;  3G7Z A;  5FW9 A;  4E2F B;  2ENM A;  2HQE A;  1N8R C;  2DFU A;  1NBE B;  2JVV A;  2O01 E;  3G4S Q;  3CCL A;  3OW2 A;  1Z9Q A;  4C0D B;  1M3C A;  2DZC A;  1M3B A;  2ROL A;  1KQ1 A;  4DQ2 A;  4O5V A;  3CME T;  2K2M A;  1K73 C;  1R77 A;  1EZZ B;  3FIF A;  1WQ7 A;  1YWP A;  1RAA B;  1VQK A;  3GOX A;  1ZLM A;  5FU7 C;  4M7A G;  3OMC A;  2KSS A;  1YNZ A;  2DRM A;  4WTO B;  1KD1 C;  1D3B A;  2HKQ B;  1YP5 A;  2ED1 A;  4XU1 A;  3JCM h;  1X75 C;  2XU8 A;  1SEM A;  3OW2 S;  1QVG S;  1RAG B;  1RUW A;  4XTU A;  1JXM A;  2KK4 A;  2C0O A;  5GMK j;  1B34 A;  1QVF S;  1MGQ A;  3OSV A;  5I11 A;  2KRN A;  3GF5 A;  1RL2 A;  3R6N A;  2DTO A;  3CMA Q;  2KNB B;  5GMK h;  4M78 F;  2FPE A;  5C6S A;  1A0N B;  3OA6 A;  3CC4 Q;  4KUD K;  3FB9 A;  3A8L B;  2GQI A;  1NJI C;  4J83 A;  1I5L A;  1D0Y A;  1TWB A;  5LJ3 g;  4M75 G;  5IHN A;  2DL4 A;  1OOT A;  1AWX A;  1N6A A;  3A8G B;  1PD0 A;  2B8A A;  4M78 G;  1QCN A;  3CBM A;  1PM3 A;  3HRS A;  3RKY A;  2MI6 A;  1S72 T;  4A4K A;  1K73 U;  2VKN A;  2HKN A;  3M54 A;  4QVD A;  2COY A;  5KYU B;  4A4E A;  1K76 A;  3C4S A;  2JOY A;  4KGZ B;  4OGE A;  2RMO A;  2JMC A;  2DYB A;  2KYM A;  5D7U A;  2EJG A;  1Q86 C;  1IO6 A;  2IIM A;  4EMH A;  5D6W A;  1I81 A;  4F7U E;  3JCM V;  3A98 A;  4GLM A;  4IUR A;  1VQ6 T;  3CCJ Q;  1Q81 R;  3V7S A;  1LNX A;  5GAO p;  3G6E Q;  2LNV A;  2E5Q A;  1YHQ T;  1M1K R;  4C8Q D;  3I55 A;  2EGE A;  4E7Z A;  3PIP A;  1IGQ A;  2E3I A;  3MEW A;  4BE0 A;  4PJO F;  2HZY A;  4LUD A;  3TEE A;  5GAN d;  2CZ7 B;  1K8A R;  1JO8 A;  4M75 F;  4PNO A;  4A4F A;  3BFM A;  5KH6 A;  1PHT A;  1R8O B;  3ZBD A;  5GAO l;  2W10 A;  2LQN A;  4Y28 E;  1PSF A;  1RLQ C;  2RK2 A;  4L6V 5;  2A28 A;  3EAE A;  5M9O A;  2ZAE A;  1M9S A;  2DVJ A;  2P4T A;  1AZE A;  4KUL A;  5IHK A;  4C8Q C;  2NUP B;  3ZL7 C;  1U1T A;  3A5Z B;  5FLX E;  4BE2 A;  3EFS A;  1G5V A;  3E1S A;  1TS9 A;  3PMT A;  2HD0 A;  4J8O A;  1E6G A;  2RM4 A;  3RNJ A;  3TQ7 P;  5GAN 4;  5FWC A;  2J6F A;  3KFV A;  1M5Q 1;  1YWO A;  3CC4 T;  2CSQ A;  3O8V A;  3CMA A;  4PL6 A;  2V8J A;  5LL6 S;  2AKL A;  2K5L A;  1OU9 A;  1NJI R;  5LJ3 e;  3SWN B;  2W0Z A;  3AHU A;  1FX7 A;  2OJ2 A;  2EGA A;  2KRM A;  4J9E A;  2ESW A;  2HAX A;  1X2Q A;  1VQ4 T;  5LJ5 e;  2DVE A;  5KYW A;  4F7U B;  4R55 A;  5KCO A;  2E6N A;  2VV5 A;  3QXE B;  2NYS A;  3OYE A;  2RHX A;  1XNI A;  2K4Y A;  1G3S A;  1NPR A;  1TG0 A;  1GCQ A;  2MOX A;  1NYG A;  3QSU A;  1G83 A;  1Y07 A;  2CDT A;  2DER A; 
#chains in the Genus database with same CATH homology
 1C6V X;  1C0M A;  1IHV A;  4FW2 A;  4FW1 A;  1IHW A;  1QMC A;  1C1A A;  5D7U A;  1EX4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...