5D7UA

Crystal structure of the c-terminal domain of mmtv integrase
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
53
structure length
53
Chain Sequence
ADPKPMVMWKDLLTGSWKGPDVLITAGRGYACVFPQDAESPIWVPDRFIRPFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Pr160
publication title Cryo-EM reveals a novel octameric integrase structure for betaretroviral intasome function.
pubmed doi rcsb
source organism Mouse mammary tumor virus
total genus 8
structure length 53
sequence length 53
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00552 IN_DBD_C Integrase DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.10 Mainly Beta Roll SH3 type barrels. Integrase, C-terminal domain superfamily, retroviral 5d7uA00
5D7UA 1QMCA 1IHWA 4FW2A 1C1AA 4FW1A 1IHVA 1C0MA 1EX4A 1C6VX
chains in the Genus database with same CATH superfamily
2DRKA 3ER0A 1QVGS 3I56A 3FRNA 4OB1B 2RQUA 1C6VX 1M90C 5FU7B 4FT4A 3PIOA 3Q1JA 3VUZA 3X25B 3QPHA 3HKSA 3E9GA 2HNIA 5D7UA 2EYWA 1VQLQ 1EIFA 3H9NA 1JRIA 2MOXA 4Y92A 3OBYA 3BW1A 2YUPA 2X4YA 4JJCA 2IVWA 2RHYA 1BIAA 1M9SA 4M77B 4TVRA 2GGRA 1Z9QA 3OS5A 1D09B 3OYHA 1V76A 5KYNA 2VASA 4M78F 3S6WA 3H0IA 1BIBA 1PM3A 4EMKC 2DA9A 4X1VA 4KGVB 2ZCFB 2ED1A 2CP6A 3JCMf 2VKNA 2VUBA 4ZN1A 1UJYA 3OMGA 1M1KC 1VIEA 1WHMA 2ABLA 4FU6A 1KC8U 4DQ2A 1U3OA 1VQ5A 1VQKA 2JT4A 4KH0B 2CYZB 2JTEA 4XU3A 1X27A 5GAN7 2JOYA 2X51A 2NUTA 4F16A 1IZ6A 2DLPA 1W6XA 3HFNA 4OF1A 1FYNA 1KJWA 3JB9G 3EG2A 3G6EQ 3S3NA 2LNHB 5LJ5d 2LNVA 1Y0MA 1KHCA 3CBMA 4ATOA 3L2RA 2M9UA 1WHGA 2QTXA 1YFNA 5KH6A 2E5QA 1W1FA 1QLYA 1WFWA 2KRMA 4N4IA 1K4US 1JU5C 3V8KA 1XJWB 5J26A 2E3HA 1M4ZA 3GF5A 1JJ2P 3O8VA 3NPFA 1T3SA 1JQQA 4BI3A 4C92C 4C5IA 3RMQA 4LUEA 2H3EB 3G7ZA 1TUCA 4EMHA 1BYMA 3M53A 3IQLA 1T0HA 2DD4A 1I4K1 1ABQA 2CZ6B 1AWWA 2RI2A 3MPUB 3QSUA 3BE3A 1HJDA 2FZGB 2L2PA 2AHJB 4GBQA 1LOJA 1BCMA 2CP7A 2DPPB 2K57A 4M7AG 5GAMd 2NUZA 1I0CA 2RMOA 2X4XA 1YNZA 8ATCB 2RJCA 4FW1A 1YIJQ 3LH0A 4XTYA 1IO6A 4A63B 1RAEB 3PFSA 4J9EA 3LW5E 5FROA 1SEMA 2SRCA 2EJFA 3OYBA 3CMAT 3RKWA 4N0AC 1XQHA 2SEMA 1QW1A 3CCST 2P84A 2DXTA 5GAOq 1C0MA 4OMNA 3A8HB 1X75C 1VQLA 2E65A 2ZPGB 4XTWA 4E2FB 3PNWC 3G1JA 2CGHA 4C8QD 1GBRA 4M75A 3TCJA 3M54A 4C0GA 5I22A 3M0QA 1RI0A 2YSQA 1Q81U 5GANg 1VQMA 2EBPA 4A4GA 2KRNA 2XICA 2JUFA 2HKQB 2RH2A 1M2VB 1U06A 2DTIA 2RHXA 3VS2A 4OMMA 4RCBA 3WXMB 5GAOp 4PLLA 2BTTA 2FG0A 2MF2A 4M7DE 2E64A 2LX9A 3GP8A 5FWCA 1IXDA 1NJIR 1OPLA 3RR6A 5KYXA 4KT0E 3EGXB 2XDBA 1GCPA 2FRYA 2F1LA 2OTJT 2FPEA 4ELYC 2NUPA 1K9MR 1JBMA 4PJNA 1IREB 5CIUA 2P4TA 4PFZA 4RTUA 1A0NB 3QYGB 1BI1A 2D9TA 1RLQC 1WXTA 2GNCA 4MMLA 1WHKA 1I1JA 3CCLA 3JCMc 4M77A 3OY9A 2I2LA 2JVVA 4FSSA 7AT1B 2EYZA 2PVDB 4C8QA 3PTAA 2CZ1B 2VC8A 4MDXA 1SRMA 1D0YA 3G6EA 3OYGA 2QEXT 1YITT 2D6FA 3S3OA 4KUDK 1OQKA 1RUWA 1T3LA 5CVIA 1QMCA 3MP8A 4A54A 4CI0C 4FYWB 4LE9A 1VQPA 2JM8A 4L5GA 1KQSS 4M7AC 1H8KA 3BDLA 3KXTA 1Q81R 2LP5A 1SPKA 4UC4A 1M2OA 1U5SA 1W2BS 3CC2T 1G83A 2COWA 2PZ1A 3OYMA 3CC7T 3QO3A 2CZ7B 3M59A 1XOVA 3EG3A 1TUGB 1RAFB 1IGQA 2BZXA 4M4ZA 1VIFA 5L8RE 4LDYA 5LJ5h 2L3PA 1D1AA 2GFAA 1W4SA 4PKCC 1WPYA 1WA7A 1WNLA 1SHGA 2GFUA 4PJOG 2JTMA 3EG9B 1NJIC 2QA4T 3URGA 5CK9A 1QVGA 3L42A 1JO8A 2OTLT 1WHHA 3VJPA 1LVKA 3CD6T 2L8DA 1PC0A 2DRMA 3D7SB 2A28A 4PFPA 3CMAQ 4RTTA 2R58A 1ZBXA 2E1HA 1S72T 3CCSQ 1I5OB 2YWWA 1TS9A 4HT8A 4KGXB 2M1HA 2H8HA 3OW2S 3PE0A 2R5AA 1PSFA 3LWHA 3OS2A 4FM4B 2QGGA 3JB9I 4PJOB 1M3BA 3OSSC 3WVEB 1OEBA 4RKUE 3ZFJA 3F70A 2MMPA 2CSIA 2CKKA 2PUKB 2E12A 4F14A 4LD6A 2RO0A 1GBQA 4WTOB 2DK3A 3ZEHA 2L0AA 1J3TA 3M58A 2VWFA 2NWMA 2ATCB 5GAMg 2LT1A 2J05A 4PJMA 5IHKA 1Q81C 2I0NA 4IIMA 3JB9H 2CH4A 2OTJQ 2K7AA 1OZ3A 5HK3A 2O9VA 4O6JA 1M8VA 4ME7A 2FB7A 4OGEA 4X9CA 4J83A 2LQNA 4RMOA 4JS5A 3THKA 4BY6B 3JCMg 2RM4A 1YI2T 1TH7A 4FL6A 4EIKA 1AWOA 4OB2B 1JEGA 4KBMB 3JSCA 5EC7A 4DEYA 1RAIB 2Y4YA 1VQOT 1X6OA 2EJ9A 2GTOA 4MDWA 4F7UE 2L3SA 2QEXQ 1YITQ 2DD5A 2LCCA 4C92F 3JCMW 4CC4B 5GAN5 2O2OA 1H3ZA 4M78A 2HQHA 2DJQA 3LGFA 5I11A 2D0QB 2AK5A 3AHUA 1MV0B 3FJ5A 5LJ5j 2NUTB 3OYFA 3CCRT 5AYFA 4OB0B 4CC2A 3G71T 1MNEA 2HQXA 3VYGA 4JJBA 3CC2Q 1Z9ZA 1GFDA 1EFNA 1SKUB 2JN0A 3CC7Q 5FU6B 3J7AF 5LL6S 1S1NA 2DVEA 2YT6A 4M7DD 3P8HA 5GAMe 4HA8A 4BI4A 1K0XA 3I5RA 3VS1A 1B7TA 5GAN4 2EQIA 3S3MA 1HK9A 4A4HA 1QVFS 5KYYA 4Q5WA 1GRIA 2IPOB 2QA4Q 2KBTA 1TU0B 1ZBJA 4LDWA 1UGSB 1KFZA 4DBQA 2BE7D 2OTLQ 3V7CA 3CMAA 1ZLMA 3H41A 2K5FA 3CD6Q 4C92E 4IURA 3L2VA 5HK0A 3M55A 1QVGP 3M0SA 4M75G 1UHCA 2BE9B 3DB3A 1WJRA 3EH2A 1YJ9T 1S72Q 1YJWT 1K76A 2EQUA 2DM1A 1WDXA 3R6OA 1NZ9A 4D6WA 3FC3A 2EQJA 2L5QA 5GANd 2H3JA 4NL3A 4P5NA 1F1BB 3PT9A 2MK5A 1M1FA 3GNGA 1PKSA 3A8OB 3JB9F 1HSQA 1OOTA 2DIGA 3L2WA 4DOVA 1QWEA 3M0PA 2XDDA 3DLLA 4J8OA 4HKEA 4C0FA 2RK1A 3EGUA 1XNIA 2DNUA 3H0FA 1TUDA 4LUDA 3OA6A 2K3YA 4ESRA 3FJPA 4HCZA 2KI7A 3I55T 1W70A 2DFUA 2J6OA 2LX7A 2OTJA 4M75B 4FYXB 3NMZC 4OVAA 1E7OA 5GJVB 3FB9A 2VGNA 4M77G 4OMOA 2ROLA 1PRLC 1QKXA 1ZX6A 5AT1B 3L2UA 3QYHB 5IH2A 1OU8A 2FVUA 1UJ0A 2FRWA 8AT1B 4FW2A 3QKJA 5LJ3f 4QVZA 4HCCA 2DL7A 1OU9A 3C12A 5LJ5f 1Y7XA 2X9HA 5KYXB 3LLRA 1YI2Q 4NL2A 4DBHA 2NUPB 1ZSZA 3OYYA 1KIKA 1YITA 2ZAEA 3R6NA 3JAME 1VUBA 1VQOQ 2C0OA 2KT8A 1KQSA 3UT1A 2L89A 1HXDA 1VQ7A 2LJ1A 2QQSA 3J81E 1YP5A 1WQ7A 2XI9A 2OAWA 4E47A 1QVPA 3CBOA 3CCVT 1G3SA 1W2BA 4C8QB 1AZEA 1UDLA 1TOVA 3CCUT 6AT1B 4JRIA 3CCRQ 3VS5A 5GMKi 5A0DA 2VGMA 4JLGA 3QZ9B 3G71Q 3MO8A 2D8JA 1K1ZA 1VQ8T 2QI2A 2E10A 2QK0A 3JCMX 3SB2A 3ASKA 1M3CA 4A53A 2ZPBB 1ACMB 1V29B 3RESA 2V1QA 5I21A 1WHJA 2FEIA 2EAYA 3OYCA 1VYUA 2YUOA 4CC3A 4NOYA 1K8AR 2OTLA 5IN1A 5KYUA 2EIFA 2LT4A 2V8JA 4M7AE 3EHQA 5IT9E 2DL4A 3C4SA 4IUVA 3CD6A 5FU7C 4LDVA 4OP0A 3OW2A 4E7KA 1P92A 5J39A 4BI8B 3TQ7P 2ECZA 2JM9A 1YJ9Q 2XU8A 2ZGWA 1M8MA 2CP5A 2HBWA 3RIRA 3HL8A 1YJWQ 2ED0A 2XG8D 1AWJA 4M77C 2YUNA 4J7FA 1NJIU 1AHJB 2DXBA 1YHQT 5D6WA 4M7DF 2KVQG 3MEAA 2DZ9A 1K9MU 2DMOA 4BE2A 2OI3A 3AT1B 4OMQA 1RABB 4HVUA 2DAQA 3EFRA 1SSHA 4A4EA 1ZUKA 5HY6A 3I55Q 2RF0A 2BKDN 3OYAA 3BFMA 4BDZA 2DL8A 2KT1A 3CCJT 5HCKA 2RB6A 3ULRB 2GQIA 2W0ZA 5CKHA 4XQ3A 3JCMd 2JJ9A 4BDYA 4OMFB 5GANh 1YI2A 4D8KA 1QCFA 3SWNB 2EYXA 3ZBDA 4C0DB 1RI9A 2CT4A 4RTZA 5C6SA 4HVWA 1OPKA 2COYA 3QBYA 3LH5A 1VQOA 4M78G 3GBQA 2EQMA 2D1XA 4C5GA 4EMKA 5D6YA 3MEWA 4AG1C 4C92D 5GAOm 1D3BB 2G6FX 3L1AA 3CCET 3FIFA 3MCAB 3H8ZA 2V1RA 3ZL7C 2GTJA 2VV5A 4RG8A 2RHZA 5ECAA 1YJNT 2QASA 1HD3A 1KQSP 3CCVQ 5KYWB 2F2XA 1RAHB 1D1CA 3CQTA 2A0FB 3CCMT 4JJNK 1UEBA 1WQWA 3CCUQ 4V2SA 3V7SA 2J6FA 5J3BA 1AZGB 3OYNA 4NS5A 3G71A 1B34A 2KROA 2YRDA 3UATA 1W2BP 1UFFA 2X4WA 3PIPA 4N4HA 1X01A 2HEQA 1G8XA 3OYJA 1VQ8Q 5GAN8 3VUBA 5CR2A 4M78B 4DBRA 2DZCA 1NPRA 2QAZA 1FX7A 1RL2A 4QVDA 1QVFA 2A36A 5GAOl 2LC4A 2C0TA 3HP9A 2RQRA 3SHWA 4ZGJB 1PKTA 4JRPA 1QKWA 2KNBB 1KQ2A 2FZCB 2EWNA 1WXUA 3I56T 2BZ8A 1X43A 3V8LA 4PJOE 2JMCA 3LX7A 4J9IA 5IXBA 2YRVA 2QQRA 1OULA 1YCYA 2E6NA 3G4ST 2JS0A 2WSFE 5GAOn 2YDLA 2KSSA 3GNFB 4MZTA 1CSKA 3QG1A 1YJWA 2LJ0A 3TU4K 3GLXA 5GANe 2RK2A 2BUDA 2O88A 4XAXB 1PRMC 3A8MB 3MP1A 3OW2P 2CSQA 5KYYB 3TSWA 4ELZC 2FL7A 3J80E 1NLOC 3A8LB 2DXUA 3JCMb 2VXFA 3JB9D 1YHQQ 1RAAB 3EFOB 2D8HA 4BD3A 3RERA 3M57A 4ZN3A 5GANj 2LJ3A 4N0AA 4JRQA 4A4KA 1M5Q1 1RLPC 4JUVA 3UA6A 3I55A 1SF9A 4PFOA 2ZPEB 2ROTA 1YIJA 3LYIA 1FWZA 4C5HA 1SHFA 3CXCS 2KY9A 4KULA 1VQ6T 2EGCA 4M7DB 1NEBA 1AOJA 4K11A 2Z0WA 1K9MC 2CT3A 3CCJQ 2HSEB 1VQ5T 1VQKT 3EH1A 1TTHB 1AT1B 1YWPA 2CH4W 3JCMQ 3T9NA 1NPPA 5DY9A 1GFCA 4KH1B 5I2MA 2HAXA 3QDFA 1LNXA 3H0HA 2EYQA 4F7UF 1NYFA 5LJ3g 2JS2A 1RACB 4M7AD 2KE9A 4Z8AA 2A3LA 4XTXA 1I81A 4BE0A 5GAMh 5FRNA 4X34A 2GCXA 4OMPA 3CCEQ 1WX6A 3CCVA 4JLIA 1M27C 1N9RA 2O9SA 4X9DA 1G3YA 3CCUA 3SWNA 1YJNQ 1OYXA 1ZA2B 9ATCB 1NEGA 2QDYB 3CCMQ 3JCMh 1ZSZB 2F5TX 2IG0A 2RJFA 1H3HA 3VS7A 2FYKA 1O75A 2COZA 2ZPFB 1VQ8A 3QUIA 1D1BA 2VXEA 1D3BA 5GMKm 4B9XA 2KXDA 1G3WA 2OJ2A 3TVTA 3UF4A 4HT9A 2EPDA 3OQ5A 4RG2A 1BI3A 3M5AA 2XKOC 3FEOA 2MCNA 2F2VA 2PUOB 5KYWA 3UDCA 1ABOA 2PTKA 2AZVA 4IIOA 3I35A 2HMAA 5A0GA 4F17A 3C95A 1QVFP 2MAMA 3QXEB 1BB9A 4LNPA 2X4JA 1LCKA 2F69A 3VU3C 3I56Q 1R77A 1ARKA 3X24B 3E19A 4Z88A 5LJ3e 1N6AA 1H92A 1NE8A 3G4SQ 2YHTA 1IGUA 1WIEA 4PJOC 5L23A 1GL5A 5GMKl 5CO7A 4J9DA 3LGLA 2HKNA 4GLKA 1VQMT 5CKFA 3VS6A 4J6YA 2XHCA 3OMCA 4M75E 5KYUB 2R57A 1R8OB 5CQXA 3OBWA 2XMFA 4R56A 2JXBA 1GCQA 3V7RA 2QDLA 1PD0A 3BDUA 1VQNT 1VQ4T 3RNJA 2RJDA 2M0OA 1UG1A 5KE2A 2EKHA 2MWOA 3CEYA 3M56A 4J9HA 1VQ9T 3META 4HCBA 3RKXA 4HCKA 2CUDA 1DJ7B 2YLBA 3TSZA 4BE1A 4BY6C 3HSBA 2KMTA 3CCLT 1NG2A 1VQ6Q 2NYSA 2CUBA 2EYYA 3JCMe 5GAMj 3QWXX 1UGPB 4JDSA 2BZYA 2B86A 2A37A 3CPWS 5DLOA 3EFOA 1VQ5Q 1VQKQ 3CCSA 4QW2A 4FIBA 5I2SA 2DEUA 4QVCA 2PVGB 3PMTA 1WZOA 4FT2A 4M77E 4ZNXA 2PVOB 2HSPA 2RPNA 2VVKA 1ZUYA 1K0SA 1X6GA 3E1SA 1AEYA 5CKDA 4M7DA 3I9QA 2RHUA 4PJOD 4O5VA 1VQPT 1GXIE 1MV3A 1UGQB 2O01E 3CCEA 2DXCA 2D0NA 1PCXA 4AFSC 3HRSA 2O4XB 2OX7A 1ZA1B 1YCSB 2HCKA 1KQ1A 1BCOA 3EAEA 1Q82U 4AT1B 3CCMA 1LPLA 4RTYA 5FU6C 4L59A 3O5ZA 2F2WA 4KUIA 4EMKB 3VS3A 2LQ8A 3HHTB 4D8DA 2FPDA 5IXFA 5FRMA 1VYTA 4DBFA 3JRZA 4C8QG 3EG1A 4DOWA 1I07A 1N8RU 2DKGA 1C1AA 3CCQT 1K8AU 1PNJA 1G2BA 1X69A 2E3IA 3V8JA 1ZUUA 1UB4A 3P8DA 3EGDA 4E7HA 2LZ6B 3QWYA 3PVQA 4BACA 4M7AF 4J9BA 1B34B 3CMET 1MNDA 2QEXA 3DB4A 5IHNA 2DIQA 1MMNA 1I5LA 3P8BB 4J6WA 1VA7A 2P0QA 2JZ2A 3G4SA 4JZ3A 2K2MA 1IB8A 5GAN3 1AVZC 3KUFA 4QQDA 3VRYA 2ESWA 4A4FA 2RJEA 2WSEE 2HBPA 1BI2A 2RI3A 3VV0A 2VB6A 4E7LA 4C92B 3CC2A 1WJSA 2XDPA 3OYLA 4XU1A 5CKBA 2E70A 1PG5B 3CC7A 4BB7A 1VQMQ 3E9FA 5GAMf 1TXQA 1Q82R 4RTXA 2KQWA 4QQ6A 1AD5A 1OI1A 4M75C 2PQWA 2PU9B 3DKMA 2ZZDA 1WLPB 2KAFA 1EZZB 3CXCA 1QP3A 1VQNQ 1VQ4Q 1OX9A 1Q7YU 4HVVA 1K73U 2X3WD 1Y07A 2HL3A 3A98A 2QG9B 2QA4A 1VQ9Q 4GY5A 4Y28E 2YXYA 1N8RR 3PGGA 1VQ6A 3VS4A 2RQVA 3CCLQ 3PMIA 3OYKA 2DERA 1SSFA 3SDZA 1S72A 2B8AA 3MP6A 4LXCA 3NTIA 1YWOA 5LJ3d 4E7ZA 2LRQA 2LMJA 3JCMP 2JNGA 4AG2C 2AZSA 4WCIA 3NTKA 1M30A 2KR3A 3VRZA 4R0KA 4C8QC 2EGAA 2Y90A 3H6ZA 1T0JA 3GIBA 3HRTA 4N4GA 1VQPQ 2MI6A 1M3AA 4AFUC 4J9FA 1QP2A 3MEUA 2Y4XA 2LVMA 1ZHIA 4M78E 2KK4A 1NLPC 2LCSA 2QTVA 2KYMA 1X2QA 4M75D 1M1GA 2K79A 3A5ZB 1TWBA 3RDVA 1KHIA 4J6XA 1UE9A 2EW3A 3A1PA 2M16A 4QKUA 5A0LA 2HZYA 4XU0A 2K3BA 1SG5A 1FMVA 4XTVA 1JB0E 1Q7YR 2AKLA 3MHXA 1VOMA 2DL5A 2O4XA 4II1A 1Q82C 1K73R 3QJ6A 1KD1U 1U1TA 3CCQQ 2DF6A 4F7UA 1IHWA 4OMLA 1WJQA 1KC8R 2J06A 2JTFA 4FYYB 1Y96A 3INZA 3A8GB 3OYDA 3M4YA 3QZ5B 1UUEA 3CMEQ 1TG0A 3UPUA 4PJOF 2FPFA 1JXOA 3HFOA 3L2ZA 2JW4A 3RKYA 1N8RC 1WXBA 1K8AC 1JJ2S 4MZMA 2XK0A 4M77D 2DETA 1PD1A 1MGQA 1UTIA 2GF7A 4L6V5 3TEEA 4J9GA 4XTUA 4M7AB 1IRXA 2AKKA 3M0RA 5CQYA 2X35A 3CCRA 2K3XA 2P0KA 2P4RA 2FZKB 2QXFA 1LJOA 2V26A 2DX1A 1HYOA 2EJGA 4LD9K 2WACA 1U8RA 4JZ4A 2FO0A 3OYEA 1R0BG 2RN8A 3RMSA 1Y57A 2WSCE 3PVLA 5GJWB 3HTRA 3RBBB 3CC4T 2KDSA 1VQNA 1VQ4A 3X28B 1PWTA 3QJYA 2EFIA 3X26B 3RUXA 1I8FA 4JRKA 3X20B 3I5SA 2DE0X 3OYIA 1VQ9A 4AFZC 2J7IA 3UA7A 5CAIA 3DLMA 1WGSA 1X2KA 4C92A 3CPWA 2MYSA 3MEVA 2CP0A 3CXCP 4PL6A 1N27A 1UGVA 1KD1R 3N5BB 2RD1A 3UWNA 2CS7A 3SWNC 4C0ZA 4C0DC 4LDUA 2DBKA 2MWPA 2FHDA 2DYBA 5IAYA 1YJ9A 1Q7YC 4ZTFA 4FCYA 4VUBA 1K73C 2LQKA 2DO3A 3LWIA 3MKDA 4RCCA 4M7DG 1IHVA 1G5VA 2K6DA 3OSVA 1KC8C 1VQ7T 3FLGA 4MMKA 2YLCA 2W10A 3OB9A 5CKEA 3VS0A 2EKOA 2YUQA 1B3QA 2KEAA 3OS1A 1UGRB 5EG2A 2M02A 1BKBA 2C0IA 4Z89A 2MPXC 2QQAA 2E5KA 2RNAA 2E41A 1YN8A 1U1SA 2NLUA 4M78C 1RAGB 1OV3A 3HRUA 4QT7A 3JB9J 5FLXE 3REBB 1NYGA 5C0MA 5DM7R 1D0XA 4E7JA 5LJ3h 4EPCA 1D0ZA 1SRLA 2A7YA 3C0CA 4AMCA 4BUGA 3MJXA 3CCQA 2MIOA 4IUUA 3SEMA 2CZ0B 2HD0A 2HL5C 1V1CA 5M9OA 3JCMV 4WF2A 3CMEA 1GCQC 2RI5A 4ANJA 2XD0A 1K9AA 2LTOA 1Q86U 1WYXA 4HXJA 5LJ5g 1N9SA 4RUGA 1BI0A 1Y71A 4RTVA 5IHIA 4Y91A 1KD1C 1TSFA 3QHSA 1CKBA 1PHTA 2ZPHB 3REAB 1NM7A 5KCHA 1WHLA 5HKCA 4PLIA 3EGDB 4M75F 2YRCA 5GAN2 2RHIA 1ZSGA 4ORZA 2KGTA 2K4YA 5GMKh 3SD4A 1PSEA 3EHRA 4IUPA 5D6XA 3M0UA 2M0YA 3E2UA 2KXCA 1MMAA 4M78D 3NGPA 1UECA 4IKFA 2G3RA 3GOXA 2CP3A 3WVDB 4DEXA 1MUZA 2HQEA 1KK7A 1M90U 5GAN6 2M51A 3CC4Q 4FSXA 5DLQE 4CRIA 4M7DC 4XK8E 4OB3B 3OS0A 3VYHB 4M7AA 2EVRA 2DBMA 2DTOA 1MMGA 2LCLA 4ZGDB 3EFSA 4B9WA 1YBYA 2JMAA 2DYIA 1B07A 1OX8A 4MZPA 1M2VA 2OAUA 2QQ9A 3L2QA 4PJLA 4IUTA 4YTLA 5KCOA 4M77F 2E4HA 4E7SA 5FW9A 2BIVA 4CC7A 3CPWP 3KBGA 5CCAA 1VQLT 1QCOA 4C8QF 3EGXA 1BU1A 3SFMA 3CPFA 5GANf 1JXMA 1Q86R 2RQTA 4RTWA 1E6HA 2DJZA 2VYTA 1UHFA 3NFCA 2KRSA 5LJ5e 2LQWA 2AT1B 2CREA 2K2VA 4AFQC 4LN2A 2LDMA 1NBEB 1VQ7Q 4J5YA 3M4GA 1BBZA 5LJ3j 1YHQA 4B6MA 1G3TA 1M1KU 3JCMJ 3NHNA 4XTZA 1ZSZC 1MMDA 2K9GA 2QGFB 2E6ZA 4JJDA 4EDUA 1KG1A 5FWBA 5KE3A 2ZPIB 2P0PA 3GPLA 3TREA 4FYVB 3CCJA 1M90R 1MHNA 4DA4A 2GQVA 3KFVA 3QDRB 4F7UG 5GAOr 2C06A 3C94A 1O9SA 5GMKe 1XTDA 4PJJA 1H641 2K5LA 2XIDA 5A2QE 4JPBW 3G6ET 2DEQA 1FMKA 1EX4A 3BY7A 4ZGEB 3M9QA 4C8QE 2ENMA 4E6RA 1JJ2A 2RQWA 4IUQA 4GLMA 5GMKj 3NTHA 3CBPA 2DILA 2L3RA 2QQBA 2IIMA 4PNOA 3FDRA 2DTHA 3EG0A 2QYZA 2AIRB 3QIIA 4KGZB 2X3XD 1Q95G 1CKAA 4Z02A 2DL3A 1YJNA 2HDAA 2V8IA 3EG9A 4F7UB 3U23A 4JS4A 1BK2A 1N5ZA 1QQJA 2F5KA 2O31A 4J9CA 2DVJA 3VKIA 1Y96B 2A08A 2R5MA 1Q86C 1AWXA 2J6KA 2GBQA 1M1KR 4EMGA 3HPWA 4R55A 4OGCA 3ME9A 4XU2A 1QWFA 2V8KA 2KYBA 1FMWA 2EGEA 4PK4A 2CP2A 2RA2A 1KSWA 4QQGA 4LDXA 4E7IA 1ZQ1A 1E6GA 3CC4A 1OZ2A 2EQKA 2K5IA 1FXXA 1WI7A 1QCNA 4C92G 1YIJT 2L3QA 2PNIA 1X6BA 1RADB 3M0TA 4KRTA 4C5EA 4J7IA 4PJOA 3JV3A 1R0CB 4F04B 2CDTA 4ZTJA 1VYVA
chains in the Genus database with same CATH topology
5D7UA 1QMCA 1IHWA 4FW2A 1C1AA 4FW1A 1IHVA 1C0MA 1EX4A 1C6VX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D7U A;  1QMC A;  1IHW A;  4FW2 A;  1C1A A;  4FW1 A;  1IHV A;  1C0M A;  1EX4 A;  1C6V X; 
#chains in the Genus database with same CATH topology
 2DRK A;  3ER0 A;  1QVG S;  3I56 A;  3FRN A;  4OB1 B;  2RQU A;  1C6V X;  1M90 C;  5FU7 B;  4FT4 A;  3PIO A;  3Q1J A;  3VUZ A;  3X25 B;  3QPH A;  3HKS A;  3E9G A;  2HNI A;  5D7U A;  2EYW A;  1VQL Q;  1EIF A;  3H9N A;  1JRI A;  2MOX A;  4Y92 A;  3OBY A;  3BW1 A;  2YUP A;  2X4Y A;  4JJC A;  2IVW A;  2RHY A;  1BIA A;  1M9S A;  4M77 B;  4TVR A;  2GGR A;  1Z9Q A;  3OS5 A;  1D09 B;  3OYH A;  1V76 A;  5KYN A;  2VAS A;  4M78 F;  3S6W A;  3H0I A;  1BIB A;  1PM3 A;  4EMK C;  2DA9 A;  4X1V A;  4KGV B;  2ZCF B;  2ED1 A;  2CP6 A;  3JCM f;  2VKN A;  2VUB A;  4ZN1 A;  1UJY A;  3OMG A;  1M1K C;  1VIE A;  1WHM A;  2ABL A;  4FU6 A;  1KC8 U;  4DQ2 A;  1U3O A;  1VQ5 A;  1VQK A;  2JT4 A;  4KH0 B;  2CYZ B;  2JTE A;  4XU3 A;  1X27 A;  5GAN 7;  2JOY A;  2X51 A;  2NUT A;  4F16 A;  1IZ6 A;  2DLP A;  1W6X A;  3HFN A;  4OF1 A;  1FYN A;  1KJW A;  3JB9 G;  3EG2 A;  3G6E Q;  3S3N A;  2LNH B;  5LJ5 d;  2LNV A;  1Y0M A;  1KHC A;  3CBM A;  4ATO A;  3L2R A;  2M9U A;  1WHG A;  2QTX A;  1YFN A;  5KH6 A;  2E5Q A;  1W1F A;  1QLY A;  1WFW A;  2KRM A;  4N4I A;  1K4U S;  1JU5 C;  3V8K A;  1XJW B;  5J26 A;  2E3H A;  1M4Z A;  3GF5 A;  1JJ2 P;  3O8V A;  3NPF A;  1T3S A;  1JQQ A;  4BI3 A;  4C92 C;  4C5I A;  3RMQ A;  4LUE A;  2H3E B;  3G7Z A;  1TUC A;  4EMH A;  1BYM A;  3M53 A;  3IQL A;  1T0H A;  2DD4 A;  1I4K 1;  1ABQ A;  2CZ6 B;  1AWW A;  2RI2 A;  3MPU B;  3QSU A;  3BE3 A;  1HJD A;  2FZG B;  2L2P A;  2AHJ B;  4GBQ A;  1LOJ A;  1BCM A;  2CP7 A;  2DPP B;  2K57 A;  4M7A G;  5GAM d;  2NUZ A;  1I0C A;  2RMO A;  2X4X A;  1YNZ A;  8ATC B;  2RJC A;  4FW1 A;  1YIJ Q;  3LH0 A;  4XTY A;  1IO6 A;  4A63 B;  1RAE B;  3PFS A;  4J9E A;  3LW5 E;  5FRO A;  1SEM A;  2SRC A;  2EJF A;  3OYB A;  3CMA T;  3RKW A;  4N0A C;  1XQH A;  2SEM A;  1QW1 A;  3CCS T;  2P84 A;  2DXT A;  5GAO q;  1C0M A;  4OMN A;  3A8H B;  1X75 C;  1VQL A;  2E65 A;  2ZPG B;  4XTW A;  4E2F B;  3PNW C;  3G1J A;  2CGH A;  4C8Q D;  1GBR A;  4M75 A;  3TCJ A;  3M54 A;  4C0G A;  5I22 A;  3M0Q A;  1RI0 A;  2YSQ A;  1Q81 U;  5GAN g;  1VQM A;  2EBP A;  4A4G A;  2KRN A;  2XIC A;  2JUF A;  2HKQ B;  2RH2 A;  1M2V B;  1U06 A;  2DTI A;  2RHX A;  3VS2 A;  4OMM A;  4RCB A;  3WXM B;  5GAO p;  4PLL A;  2BTT A;  2FG0 A;  2MF2 A;  4M7D E;  2E64 A;  2LX9 A;  3GP8 A;  5FWC A;  1IXD A;  1NJI R;  1OPL A;  3RR6 A;  5KYX A;  4KT0 E;  3EGX B;  2XDB A;  1GCP A;  2FRY A;  2F1L A;  2OTJ T;  2FPE A;  4ELY C;  2NUP A;  1K9M R;  1JBM A;  4PJN A;  1IRE B;  5CIU A;  2P4T A;  4PFZ A;  4RTU A;  1A0N B;  3QYG B;  1BI1 A;  2D9T A;  1RLQ C;  1WXT A;  2GNC A;  4MML A;  1WHK A;  1I1J A;  3CCL A;  3JCM c;  4M77 A;  3OY9 A;  2I2L A;  2JVV A;  4FSS A;  7AT1 B;  2EYZ A;  2PVD B;  4C8Q A;  3PTA A;  2CZ1 B;  2VC8 A;  4MDX A;  1SRM A;  1D0Y A;  3G6E A;  3OYG A;  2QEX T;  1YIT T;  2D6F A;  3S3O A;  4KUD K;  1OQK A;  1RUW A;  1T3L A;  5CVI A;  1QMC A;  3MP8 A;  4A54 A;  4CI0 C;  4FYW B;  4LE9 A;  1VQP A;  2JM8 A;  4L5G A;  1KQS S;  4M7A C;  1H8K A;  3BDL A;  3KXT A;  1Q81 R;  2LP5 A;  1SPK A;  4UC4 A;  1M2O A;  1U5S A;  1W2B S;  3CC2 T;  1G83 A;  2COW A;  2PZ1 A;  3OYM A;  3CC7 T;  3QO3 A;  2CZ7 B;  3M59 A;  1XOV A;  3EG3 A;  1TUG B;  1RAF B;  1IGQ A;  2BZX A;  4M4Z A;  1VIF A;  5L8R E;  4LDY A;  5LJ5 h;  2L3P A;  1D1A A;  2GFA A;  1W4S A;  4PKC C;  1WPY A;  1WA7 A;  1WNL A;  1SHG A;  2GFU A;  4PJO G;  2JTM A;  3EG9 B;  1NJI C;  2QA4 T;  3URG A;  5CK9 A;  1QVG A;  3L42 A;  1JO8 A;  2OTL T;  1WHH A;  3VJP A;  1LVK A;  3CD6 T;  2L8D A;  1PC0 A;  2DRM A;  3D7S B;  2A28 A;  4PFP A;  3CMA Q;  4RTT A;  2R58 A;  1ZBX A;  2E1H A;  1S72 T;  3CCS Q;  1I5O B;  2YWW A;  1TS9 A;  4HT8 A;  4KGX B;  2M1H A;  2H8H A;  3OW2 S;  3PE0 A;  2R5A A;  1PSF A;  3LWH A;  3OS2 A;  4FM4 B;  2QGG A;  3JB9 I;  4PJO B;  1M3B A;  3OSS C;  3WVE B;  1OEB A;  4RKU E;  3ZFJ A;  3F70 A;  2MMP A;  2CSI A;  2CKK A;  2PUK B;  2E12 A;  4F14 A;  4LD6 A;  2RO0 A;  1GBQ A;  4WTO B;  2DK3 A;  3ZEH A;  2L0A A;  1J3T A;  3M58 A;  2VWF A;  2NWM A;  2ATC B;  5GAM g;  2LT1 A;  2J05 A;  4PJM A;  5IHK A;  1Q81 C;  2I0N A;  4IIM A;  3JB9 H;  2CH4 A;  2OTJ Q;  2K7A A;  1OZ3 A;  5HK3 A;  2O9V A;  4O6J A;  1M8V A;  4ME7 A;  2FB7 A;  4OGE A;  4X9C A;  4J83 A;  2LQN A;  4RMO A;  4JS5 A;  3THK A;  4BY6 B;  3JCM g;  2RM4 A;  1YI2 T;  1TH7 A;  4FL6 A;  4EIK A;  1AWO A;  4OB2 B;  1JEG A;  4KBM B;  3JSC A;  5EC7 A;  4DEY A;  1RAI B;  2Y4Y A;  1VQO T;  1X6O A;  2EJ9 A;  2GTO A;  4MDW A;  4F7U E;  2L3S A;  2QEX Q;  1YIT Q;  2DD5 A;  2LCC A;  4C92 F;  3JCM W;  4CC4 B;  5GAN 5;  2O2O A;  1H3Z A;  4M78 A;  2HQH A;  2DJQ A;  3LGF A;  5I11 A;  2D0Q B;  2AK5 A;  3AHU A;  1MV0 B;  3FJ5 A;  5LJ5 j;  2NUT B;  3OYF A;  3CCR T;  5AYF A;  4OB0 B;  4CC2 A;  3G71 T;  1MNE A;  2HQX A;  3VYG A;  4JJB A;  3CC2 Q;  1Z9Z A;  1GFD A;  1EFN A;  1SKU B;  2JN0 A;  3CC7 Q;  5FU6 B;  3J7A F;  5LL6 S;  1S1N A;  2DVE A;  2YT6 A;  4M7D D;  3P8H A;  5GAM e;  4HA8 A;  4BI4 A;  1K0X A;  3I5R A;  3VS1 A;  1B7T A;  5GAN 4;  2EQI A;  3S3M A;  1HK9 A;  4A4H A;  1QVF S;  5KYY A;  4Q5W A;  1GRI A;  2IPO B;  2QA4 Q;  2KBT A;  1TU0 B;  1ZBJ A;  4LDW A;  1UGS B;  1KFZ A;  4DBQ A;  2BE7 D;  2OTL Q;  3V7C A;  3CMA A;  1ZLM A;  3H41 A;  2K5F A;  3CD6 Q;  4C92 E;  4IUR A;  3L2V A;  5HK0 A;  3M55 A;  1QVG P;  3M0S A;  4M75 G;  1UHC A;  2BE9 B;  3DB3 A;  1WJR A;  3EH2 A;  1YJ9 T;  1S72 Q;  1YJW T;  1K76 A;  2EQU A;  2DM1 A;  1WDX A;  3R6O A;  1NZ9 A;  4D6W A;  3FC3 A;  2EQJ A;  2L5Q A;  5GAN d;  2H3J A;  4NL3 A;  4P5N A;  1F1B B;  3PT9 A;  2MK5 A;  1M1F A;  3GNG A;  1PKS A;  3A8O B;  3JB9 F;  1HSQ A;  1OOT A;  2DIG A;  3L2W A;  4DOV A;  1QWE A;  3M0P A;  2XDD A;  3DLL A;  4J8O A;  4HKE A;  4C0F A;  2RK1 A;  3EGU A;  1XNI A;  2DNU A;  3H0F A;  1TUD A;  4LUD A;  3OA6 A;  2K3Y A;  4ESR A;  3FJP A;  4HCZ A;  2KI7 A;  3I55 T;  1W70 A;  2DFU A;  2J6O A;  2LX7 A;  2OTJ A;  4M75 B;  4FYX B;  3NMZ C;  4OVA A;  1E7O A;  5GJV B;  3FB9 A;  2VGN A;  4M77 G;  4OMO A;  2ROL A;  1PRL C;  1QKX A;  1ZX6 A;  5AT1 B;  3L2U A;  3QYH B;  5IH2 A;  1OU8 A;  2FVU A;  1UJ0 A;  2FRW A;  8AT1 B;  4FW2 A;  3QKJ A;  5LJ3 f;  4QVZ A;  4HCC A;  2DL7 A;  1OU9 A;  3C12 A;  5LJ5 f;  1Y7X A;  2X9H A;  5KYX B;  3LLR A;  1YI2 Q;  4NL2 A;  4DBH A;  2NUP B;  1ZSZ A;  3OYY A;  1KIK A;  1YIT A;  2ZAE A;  3R6N A;  3JAM E;  1VUB A;  1VQO Q;  2C0O A;  2KT8 A;  1KQS A;  3UT1 A;  2L89 A;  1HXD A;  1VQ7 A;  2LJ1 A;  2QQS A;  3J81 E;  1YP5 A;  1WQ7 A;  2XI9 A;  2OAW A;  4E47 A;  1QVP A;  3CBO A;  3CCV T;  1G3S A;  1W2B A;  4C8Q B;  1AZE A;  1UDL A;  1TOV A;  3CCU T;  6AT1 B;  4JRI A;  3CCR Q;  3VS5 A;  5GMK i;  5A0D A;  2VGM A;  4JLG A;  3QZ9 B;  3G71 Q;  3MO8 A;  2D8J A;  1K1Z A;  1VQ8 T;  2QI2 A;  2E10 A;  2QK0 A;  3JCM X;  3SB2 A;  3ASK A;  1M3C A;  4A53 A;  2ZPB B;  1ACM B;  1V29 B;  3RES A;  2V1Q A;  5I21 A;  1WHJ A;  2FEI A;  2EAY A;  3OYC A;  1VYU A;  2YUO A;  4CC3 A;  4NOY A;  1K8A R;  2OTL A;  5IN1 A;  5KYU A;  2EIF A;  2LT4 A;  2V8J A;  4M7A E;  3EHQ A;  5IT9 E;  2DL4 A;  3C4S A;  4IUV A;  3CD6 A;  5FU7 C;  4LDV A;  4OP0 A;  3OW2 A;  4E7K A;  1P92 A;  5J39 A;  4BI8 B;  3TQ7 P;  2ECZ A;  2JM9 A;  1YJ9 Q;  2XU8 A;  2ZGW A;  1M8M A;  2CP5 A;  2HBW A;  3RIR A;  3HL8 A;  1YJW Q;  2ED0 A;  2XG8 D;  1AWJ A;  4M77 C;  2YUN A;  4J7F A;  1NJI U;  1AHJ B;  2DXB A;  1YHQ T;  5D6W A;  4M7D F;  2KVQ G;  3MEA A;  2DZ9 A;  1K9M U;  2DMO A;  4BE2 A;  2OI3 A;  3AT1 B;  4OMQ A;  1RAB B;  4HVU A;  2DAQ A;  3EFR A;  1SSH A;  4A4E A;  1ZUK A;  5HY6 A;  3I55 Q;  2RF0 A;  2BKD N;  3OYA A;  3BFM A;  4BDZ A;  2DL8 A;  2KT1 A;  3CCJ T;  5HCK A;  2RB6 A;  3ULR B;  2GQI A;  2W0Z A;  5CKH A;  4XQ3 A;  3JCM d;  2JJ9 A;  4BDY A;  4OMF B;  5GAN h;  1YI2 A;  4D8K A;  1QCF A;  3SWN B;  2EYX A;  3ZBD A;  4C0D B;  1RI9 A;  2CT4 A;  4RTZ A;  5C6S A;  4HVW A;  1OPK A;  2COY A;  3QBY A;  3LH5 A;  1VQO A;  4M78 G;  3GBQ A;  2EQM A;  2D1X A;  4C5G A;  4EMK A;  5D6Y A;  3MEW A;  4AG1 C;  4C92 D;  5GAO m;  1D3B B;  2G6F X;  3L1A A;  3CCE T;  3FIF A;  3MCA B;  3H8Z A;  2V1R A;  3ZL7 C;  2GTJ A;  2VV5 A;  4RG8 A;  2RHZ A;  5ECA A;  1YJN T;  2QAS A;  1HD3 A;  1KQS P;  3CCV Q;  5KYW B;  2F2X A;  1RAH B;  1D1C A;  3CQT A;  2A0F B;  3CCM T;  4JJN K;  1UEB A;  1WQW A;  3CCU Q;  4V2S A;  3V7S A;  2J6F A;  5J3B A;  1AZG B;  3OYN A;  4NS5 A;  3G71 A;  1B34 A;  2KRO A;  2YRD A;  3UAT A;  1W2B P;  1UFF A;  2X4W A;  3PIP A;  4N4H A;  1X01 A;  2HEQ A;  1G8X A;  3OYJ A;  1VQ8 Q;  5GAN 8;  3VUB A;  5CR2 A;  4M78 B;  4DBR A;  2DZC A;  1NPR A;  2QAZ A;  1FX7 A;  1RL2 A;  4QVD A;  1QVF A;  2A36 A;  5GAO l;  2LC4 A;  2C0T A;  3HP9 A;  2RQR A;  3SHW A;  4ZGJ B;  1PKT A;  4JRP A;  1QKW A;  2KNB B;  1KQ2 A;  2FZC B;  2EWN A;  1WXU A;  3I56 T;  2BZ8 A;  1X43 A;  3V8L A;  4PJO E;  2JMC A;  3LX7 A;  4J9I A;  5IXB A;  2YRV A;  2QQR A;  1OUL A;  1YCY A;  2E6N A;  3G4S T;  2JS0 A;  2WSF E;  5GAO n;  2YDL A;  2KSS A;  3GNF B;  4MZT A;  1CSK A;  3QG1 A;  1YJW A;  2LJ0 A;  3TU4 K;  3GLX A;  5GAN e;  2RK2 A;  2BUD A;  2O88 A;  4XAX B;  1PRM C;  3A8M B;  3MP1 A;  3OW2 P;  2CSQ A;  5KYY B;  3TSW A;  4ELZ C;  2FL7 A;  3J80 E;  1NLO C;  3A8L B;  2DXU A;  3JCM b;  2VXF A;  3JB9 D;  1YHQ Q;  1RAA B;  3EFO B;  2D8H A;  4BD3 A;  3RER A;  3M57 A;  4ZN3 A;  5GAN j;  2LJ3 A;  4N0A A;  4JRQ A;  4A4K A;  1M5Q 1;  1RLP C;  4JUV A;  3UA6 A;  3I55 A;  1SF9 A;  4PFO A;  2ZPE B;  2ROT A;  1YIJ A;  3LYI A;  1FWZ A;  4C5H A;  1SHF A;  3CXC S;  2KY9 A;  4KUL A;  1VQ6 T;  2EGC A;  4M7D B;  1NEB A;  1AOJ A;  4K11 A;  2Z0W A;  1K9M C;  2CT3 A;  3CCJ Q;  2HSE B;  1VQ5 T;  1VQK T;  3EH1 A;  1TTH B;  1AT1 B;  1YWP A;  2CH4 W;  3JCM Q;  3T9N A;  1NPP A;  5DY9 A;  1GFC A;  4KH1 B;  5I2M A;  2HAX A;  3QDF A;  1LNX A;  3H0H A;  2EYQ A;  4F7U F;  1NYF A;  5LJ3 g;  2JS2 A;  1RAC B;  4M7A D;  2KE9 A;  4Z8A A;  2A3L A;  4XTX A;  1I81 A;  4BE0 A;  5GAM h;  5FRN A;  4X34 A;  2GCX A;  4OMP A;  3CCE Q;  1WX6 A;  3CCV A;  4JLI A;  1M27 C;  1N9R A;  2O9S A;  4X9D A;  1G3Y A;  3CCU A;  3SWN A;  1YJN Q;  1OYX A;  1ZA2 B;  9ATC B;  1NEG A;  2QDY B;  3CCM Q;  3JCM h;  1ZSZ B;  2F5T X;  2IG0 A;  2RJF A;  1H3H A;  3VS7 A;  2FYK A;  1O75 A;  2COZ A;  2ZPF B;  1VQ8 A;  3QUI A;  1D1B A;  2VXE A;  1D3B A;  5GMK m;  4B9X A;  2KXD A;  1G3W A;  2OJ2 A;  3TVT A;  3UF4 A;  4HT9 A;  2EPD A;  3OQ5 A;  4RG2 A;  1BI3 A;  3M5A A;  2XKO C;  3FEO A;  2MCN A;  2F2V A;  2PUO B;  5KYW A;  3UDC A;  1ABO A;  2PTK A;  2AZV A;  4IIO A;  3I35 A;  2HMA A;  5A0G A;  4F17 A;  3C95 A;  1QVF P;  2MAM A;  3QXE B;  1BB9 A;  4LNP A;  2X4J A;  1LCK A;  2F69 A;  3VU3 C;  3I56 Q;  1R77 A;  1ARK A;  3X24 B;  3E19 A;  4Z88 A;  5LJ3 e;  1N6A A;  1H92 A;  1NE8 A;  3G4S Q;  2YHT A;  1IGU A;  1WIE A;  4PJO C;  5L23 A;  1GL5 A;  5GMK l;  5CO7 A;  4J9D A;  3LGL A;  2HKN A;  4GLK A;  1VQM T;  5CKF A;  3VS6 A;  4J6Y A;  2XHC A;  3OMC A;  4M75 E;  5KYU B;  2R57 A;  1R8O B;  5CQX A;  3OBW A;  2XMF A;  4R56 A;  2JXB A;  1GCQ A;  3V7R A;  2QDL A;  1PD0 A;  3BDU A;  1VQN T;  1VQ4 T;  3RNJ A;  2RJD A;  2M0O A;  1UG1 A;  5KE2 A;  2EKH A;  2MWO A;  3CEY A;  3M56 A;  4J9H A;  1VQ9 T;  3MET A;  4HCB A;  3RKX A;  4HCK A;  2CUD A;  1DJ7 B;  2YLB A;  3TSZ A;  4BE1 A;  4BY6 C;  3HSB A;  2KMT A;  3CCL T;  1NG2 A;  1VQ6 Q;  2NYS A;  2CUB A;  2EYY A;  3JCM e;  5GAM j;  3QWX X;  1UGP B;  4JDS A;  2BZY A;  2B86 A;  2A37 A;  3CPW S;  5DLO A;  3EFO A;  1VQ5 Q;  1VQK Q;  3CCS A;  4QW2 A;  4FIB A;  5I2S A;  2DEU A;  4QVC A;  2PVG B;  3PMT A;  1WZO A;  4FT2 A;  4M77 E;  4ZNX A;  2PVO B;  2HSP A;  2RPN A;  2VVK A;  1ZUY A;  1K0S A;  1X6G A;  3E1S A;  1AEY A;  5CKD A;  4M7D A;  3I9Q A;  2RHU A;  4PJO D;  4O5V A;  1VQP T;  1GXI E;  1MV3 A;  1UGQ B;  2O01 E;  3CCE A;  2DXC A;  2D0N A;  1PCX A;  4AFS C;  3HRS A;  2O4X B;  2OX7 A;  1ZA1 B;  1YCS B;  2HCK A;  1KQ1 A;  1BCO A;  3EAE A;  1Q82 U;  4AT1 B;  3CCM A;  1LPL A;  4RTY A;  5FU6 C;  4L59 A;  3O5Z A;  2F2W A;  4KUI A;  4EMK B;  3VS3 A;  2LQ8 A;  3HHT B;  4D8D A;  2FPD A;  5IXF A;  5FRM A;  1VYT A;  4DBF A;  3JRZ A;  4C8Q G;  3EG1 A;  4DOW A;  1I07 A;  1N8R U;  2DKG A;  1C1A A;  3CCQ T;  1K8A U;  1PNJ A;  1G2B A;  1X69 A;  2E3I A;  3V8J A;  1ZUU A;  1UB4 A;  3P8D A;  3EGD A;  4E7H A;  2LZ6 B;  3QWY A;  3PVQ A;  4BAC A;  4M7A F;  4J9B A;  1B34 B;  3CME T;  1MND A;  2QEX A;  3DB4 A;  5IHN A;  2DIQ A;  1MMN A;  1I5L A;  3P8B B;  4J6W A;  1VA7 A;  2P0Q A;  2JZ2 A;  3G4S A;  4JZ3 A;  2K2M A;  1IB8 A;  5GAN 3;  1AVZ C;  3KUF A;  4QQD A;  3VRY A;  2ESW A;  4A4F A;  2RJE A;  2WSE E;  2HBP A;  1BI2 A;  2RI3 A;  3VV0 A;  2VB6 A;  4E7L A;  4C92 B;  3CC2 A;  1WJS A;  2XDP A;  3OYL A;  4XU1 A;  5CKB A;  2E70 A;  1PG5 B;  3CC7 A;  4BB7 A;  1VQM Q;  3E9F A;  5GAM f;  1TXQ A;  1Q82 R;  4RTX A;  2KQW A;  4QQ6 A;  1AD5 A;  1OI1 A;  4M75 C;  2PQW A;  2PU9 B;  3DKM A;  2ZZD A;  1WLP B;  2KAF A;  1EZZ B;  3CXC A;  1QP3 A;  1VQN Q;  1VQ4 Q;  1OX9 A;  1Q7Y U;  4HVV A;  1K73 U;  2X3W D;  1Y07 A;  2HL3 A;  3A98 A;  2QG9 B;  2QA4 A;  1VQ9 Q;  4GY5 A;  4Y28 E;  2YXY A;  1N8R R;  3PGG A;  1VQ6 A;  3VS4 A;  2RQV A;  3CCL Q;  3PMI A;  3OYK A;  2DER A;  1SSF A;  3SDZ A;  1S72 A;  2B8A A;  3MP6 A;  4LXC A;  3NTI A;  1YWO A;  5LJ3 d;  4E7Z A;  2LRQ A;  2LMJ A;  3JCM P;  2JNG A;  4AG2 C;  2AZS A;  4WCI A;  3NTK A;  1M30 A;  2KR3 A;  3VRZ A;  4R0K A;  4C8Q C;  2EGA A;  2Y90 A;  3H6Z A;  1T0J A;  3GIB A;  3HRT A;  4N4G A;  1VQP Q;  2MI6 A;  1M3A A;  4AFU C;  4J9F A;  1QP2 A;  3MEU A;  2Y4X A;  2LVM A;  1ZHI A;  4M78 E;  2KK4 A;  1NLP C;  2LCS A;  2QTV A;  2KYM A;  1X2Q A;  4M75 D;  1M1G A;  2K79 A;  3A5Z B;  1TWB A;  3RDV A;  1KHI A;  4J6X A;  1UE9 A;  2EW3 A;  3A1P A;  2M16 A;  4QKU A;  5A0L A;  2HZY A;  4XU0 A;  2K3B A;  1SG5 A;  1FMV A;  4XTV A;  1JB0 E;  1Q7Y R;  2AKL A;  3MHX A;  1VOM A;  2DL5 A;  2O4X A;  4II1 A;  1Q82 C;  1K73 R;  3QJ6 A;  1KD1 U;  1U1T A;  3CCQ Q;  2DF6 A;  4F7U A;  1IHW A;  4OML A;  1WJQ A;  1KC8 R;  2J06 A;  2JTF A;  4FYY B;  1Y96 A;  3INZ A;  3A8G B;  3OYD A;  3M4Y A;  3QZ5 B;  1UUE A;  3CME Q;  1TG0 A;  3UPU A;  4PJO F;  2FPF A;  1JXO A;  3HFO A;  3L2Z A;  2JW4 A;  3RKY A;  1N8R C;  1WXB A;  1K8A C;  1JJ2 S;  4MZM A;  2XK0 A;  4M77 D;  2DET A;  1PD1 A;  1MGQ A;  1UTI A;  2GF7 A;  4L6V 5;  3TEE A;  4J9G A;  4XTU A;  4M7A B;  1IRX A;  2AKK A;  3M0R A;  5CQY A;  2X35 A;  3CCR A;  2K3X A;  2P0K A;  2P4R A;  2FZK B;  2QXF A;  1LJO A;  2V26 A;  2DX1 A;  1HYO A;  2EJG A;  4LD9 K;  2WAC A;  1U8R A;  4JZ4 A;  2FO0 A;  3OYE A;  1R0B G;  2RN8 A;  3RMS A;  1Y57 A;  2WSC E;  3PVL A;  5GJW B;  3HTR A;  3RBB B;  3CC4 T;  2KDS A;  1VQN A;  1VQ4 A;  3X28 B;  1PWT A;  3QJY A;  2EFI A;  3X26 B;  3RUX A;  1I8F A;  4JRK A;  3X20 B;  3I5S A;  2DE0 X;  3OYI A;  1VQ9 A;  4AFZ C;  2J7I A;  3UA7 A;  5CAI A;  3DLM A;  1WGS A;  1X2K A;  4C92 A;  3CPW A;  2MYS A;  3MEV A;  2CP0 A;  3CXC P;  4PL6 A;  1N27 A;  1UGV A;  1KD1 R;  3N5B B;  2RD1 A;  3UWN A;  2CS7 A;  3SWN C;  4C0Z A;  4C0D C;  4LDU A;  2DBK A;  2MWP A;  2FHD A;  2DYB A;  5IAY A;  1YJ9 A;  1Q7Y C;  4ZTF A;  4FCY A;  4VUB A;  1K73 C;  2LQK A;  2DO3 A;  3LWI A;  3MKD A;  4RCC A;  4M7D G;  1IHV A;  1G5V A;  2K6D A;  3OSV A;  1KC8 C;  1VQ7 T;  3FLG A;  4MMK A;  2YLC A;  2W10 A;  3OB9 A;  5CKE A;  3VS0 A;  2EKO A;  2YUQ A;  1B3Q A;  2KEA A;  3OS1 A;  1UGR B;  5EG2 A;  2M02 A;  1BKB A;  2C0I A;  4Z89 A;  2MPX C;  2QQA A;  2E5K A;  2RNA A;  2E41 A;  1YN8 A;  1U1S A;  2NLU A;  4M78 C;  1RAG B;  1OV3 A;  3HRU A;  4QT7 A;  3JB9 J;  5FLX E;  3REB B;  1NYG A;  5C0M A;  5DM7 R;  1D0X A;  4E7J A;  5LJ3 h;  4EPC A;  1D0Z A;  1SRL A;  2A7Y A;  3C0C A;  4AMC A;  4BUG A;  3MJX A;  3CCQ A;  2MIO A;  4IUU A;  3SEM A;  2CZ0 B;  2HD0 A;  2HL5 C;  1V1C A;  5M9O A;  3JCM V;  4WF2 A;  3CME A;  1GCQ C;  2RI5 A;  4ANJ A;  2XD0 A;  1K9A A;  2LTO A;  1Q86 U;  1WYX A;  4HXJ A;  5LJ5 g;  1N9S A;  4RUG A;  1BI0 A;  1Y71 A;  4RTV A;  5IHI A;  4Y91 A;  1KD1 C;  1TSF A;  3QHS A;  1CKB A;  1PHT A;  2ZPH B;  3REA B;  1NM7 A;  5KCH A;  1WHL A;  5HKC A;  4PLI A;  3EGD B;  4M75 F;  2YRC A;  5GAN 2;  2RHI A;  1ZSG A;  4ORZ A;  2KGT A;  2K4Y A;  5GMK h;  3SD4 A;  1PSE A;  3EHR A;  4IUP A;  5D6X A;  3M0U A;  2M0Y A;  3E2U A;  2KXC A;  1MMA A;  4M78 D;  3NGP A;  1UEC A;  4IKF A;  2G3R A;  3GOX A;  2CP3 A;  3WVD B;  4DEX A;  1MUZ A;  2HQE A;  1KK7 A;  1M90 U;  5GAN 6;  2M51 A;  3CC4 Q;  4FSX A;  5DLQ E;  4CRI A;  4M7D C;  4XK8 E;  4OB3 B;  3OS0 A;  3VYH B;  4M7A A;  2EVR A;  2DBM A;  2DTO A;  1MMG A;  2LCL A;  4ZGD B;  3EFS A;  4B9W A;  1YBY A;  2JMA A;  2DYI A;  1B07 A;  1OX8 A;  4MZP A;  1M2V A;  2OAU A;  2QQ9 A;  3L2Q A;  4PJL A;  4IUT A;  4YTL A;  5KCO A;  4M77 F;  2E4H A;  4E7S A;  5FW9 A;  2BIV A;  4CC7 A;  3CPW P;  3KBG A;  5CCA A;  1VQL T;  1QCO A;  4C8Q F;  3EGX A;  1BU1 A;  3SFM A;  3CPF A;  5GAN f;  1JXM A;  1Q86 R;  2RQT A;  4RTW A;  1E6H A;  2DJZ A;  2VYT A;  1UHF A;  3NFC A;  2KRS A;  5LJ5 e;  2LQW A;  2AT1 B;  2CRE A;  2K2V A;  4AFQ C;  4LN2 A;  2LDM A;  1NBE B;  1VQ7 Q;  4J5Y A;  3M4G A;  1BBZ A;  5LJ3 j;  1YHQ A;  4B6M A;  1G3T A;  1M1K U;  3JCM J;  3NHN A;  4XTZ A;  1ZSZ C;  1MMD A;  2K9G A;  2QGF B;  2E6Z A;  4JJD A;  4EDU A;  1KG1 A;  5FWB A;  5KE3 A;  2ZPI B;  2P0P A;  3GPL A;  3TRE A;  4FYV B;  3CCJ A;  1M90 R;  1MHN A;  4DA4 A;  2GQV A;  3KFV A;  3QDR B;  4F7U G;  5GAO r;  2C06 A;  3C94 A;  1O9S A;  5GMK e;  1XTD A;  4PJJ A;  1H64 1;  2K5L A;  2XID A;  5A2Q E;  4JPB W;  3G6E T;  2DEQ A;  1FMK A;  1EX4 A;  3BY7 A;  4ZGE B;  3M9Q A;  4C8Q E;  2ENM A;  4E6R A;  1JJ2 A;  2RQW A;  4IUQ A;  4GLM A;  5GMK j;  3NTH A;  3CBP A;  2DIL A;  2L3R A;  2QQB A;  2IIM A;  4PNO A;  3FDR A;  2DTH A;  3EG0 A;  2QYZ A;  2AIR B;  3QII A;  4KGZ B;  2X3X D;  1Q95 G;  1CKA A;  4Z02 A;  2DL3 A;  1YJN A;  2HDA A;  2V8I A;  3EG9 A;  4F7U B;  3U23 A;  4JS4 A;  1BK2 A;  1N5Z A;  1QQJ A;  2F5K A;  2O31 A;  4J9C A;  2DVJ A;  3VKI A;  1Y96 B;  2A08 A;  2R5M A;  1Q86 C;  1AWX A;  2J6K A;  2GBQ A;  1M1K R;  4EMG A;  3HPW A;  4R55 A;  4OGC A;  3ME9 A;  4XU2 A;  1QWF A;  2V8K A;  2KYB A;  1FMW A;  2EGE A;  4PK4 A;  2CP2 A;  2RA2 A;  1KSW A;  4QQG A;  4LDX A;  4E7I A;  1ZQ1 A;  1E6G A;  3CC4 A;  1OZ2 A;  2EQK A;  2K5I A;  1FXX A;  1WI7 A;  1QCN A;  4C92 G;  1YIJ T;  2L3Q A;  2PNI A;  1X6B A;  1RAD B;  3M0T A;  4KRT A;  4C5E A;  4J7I A;  4PJO A;  3JV3 A;  1R0C B;  4F04 B;  2CDT A;  4ZTJ A;  1VYV A; 
#chains in the Genus database with same CATH homology
 5D7U A;  1QMC A;  1IHW A;  4FW2 A;  1C1A A;  4FW1 A;  1IHV A;  1C0M A;  1EX4 A;  1C6V X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...