5D7UA

Crystal structure of the c-terminal domain of mmtv integrase
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
53
structure length
53
Chain Sequence
ADPKPMVMWKDLLTGSWKGPDVLITAGRGYACVFPQDAESPIWVPDRFIRPFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pr160
publication title Cryo-EM reveals a novel octameric integrase structure for betaretroviral intasome function.
pubmed doi rcsb
source organism Mouse mammary tumor virus
molecule tags Hydrolase
total genus 8
structure length 53
sequence length 53
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00552 IN_DBD_C Integrase DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.10 Mainly Beta Roll SH3 type barrels. Integrase, C-terminal domain superfamily, retroviral 5d7uA00
1C6VX 5D7UA 1C1AA 4FW1A 4FW2A 1EX4A 1IHWA 1C0MA 1IHVA 1QMCA
chains in the Genus database with same CATH superfamily
3EHQA 4F7UE 1VQ6Q 1TOVA 4HVWA 3CCLA 4OB1B 3VRZA 1QWEA 4ELYC 4BD3A 1ABOA 5GMKm 4F7UF 3CMAA 4XU0A 1Y0MA 2MWPA 2EJFA 2MWOA 1UG1A 2BZ8A 5KE2A 3MP8A 1M9SA 1K9AA 4E7ZA 2JVVA 2NUTA 1UFFA 1QVGS 3CXCA 1VIFA 2PVGB 2P0PA 4LN2A 3A5ZB 1WDXA 5C6SA 3J80E 2E70A 3CCSQ 2VKNA 3AT1B 4FW2A 1TWBA 2EWNA 2YUPA 2KVQG 5I21A 3V7RA 3LLRA 3CC2T 4BDZA 1VQLT 4GBQA 2QGGA 3JB9I 1W2BP 4E47A 1U3OA 5LJ3f 4GY5A 2HKQB 3PE0A 2YRDA 2D1XA 4IURA 1KQSP 2VXEA 2FZKB 1K9MU 3HRSA 3VS2A 1M90U 4RTZA 5IN1A 2FYKA 3GIBA 3OYIA 2F2XA 3G6ET 4C8QB 2FO0A 4Z88A 4ZN3A 1MV0B 3F70A 1AD5A 4ZGDB 2D8HA 3E19A 4N4GA 2VV5A 3OW2S 2JM9A 3X26B 4JZ4A 2NUZA 2X3XD 2YSQA 3JCMP 1PSFA 2GNCA 1YJWQ 5ECAA 4XTVA 1WNLA 3CCQA 1D1AA 2EQJA 1EFNA 2YRCA 5GAOp 2CGHA 1VQNT 3G4SQ 1FWZA 4JJBA 4OB3B 2ZAEA 5DLQE 4XAXB 1NM7A 2VWFA 2CP7A 3SWNB 2E65A 1VQ9A 4MMLA 2FZCB 3QDFA 4ZN1A 4LDVA 1B3QA 2F5TX 4M7AB 4OF1A 2L8DA 4HCBA 2AHJB 3CCRA 1AVZC 4X34A 1K1ZA 2JMCA 3CMEA 2NLUA 2QTXA 1J3TA 1W2BA 2DIGA 2J6FA 5FU7B 3IQLA 1UEBA 1AT1B 1KQSA 2CS7A 2GTOA 1SPKA 2RJEA 4M7AA 5FROA 1QCFA 4F7UG 2XMFA 1M2OA 3UT1A 3L2UA 3M0SA 2KEAA 1E6GA 1SG5A 3HFOA 1EIFA 2O01E 1VOMA 1OPLA 3I55T 5HKCA 1JO8A 1PNJA 2E3IA 3JCMW 1AWOA 3EG3A 2IG0A 3QZ5B 4ZNXA 1U1SA 2X4WA 2FPDA 2XU8A 3QWXX 2RH2A 3SWNC 2EJ9A 2P0QA 2H3JA 1B34B 2SEMA 2RHZA 4M7AC 1WHHA 2QASA 5CKFA 4AG2C 3JB9J 2P4RA 2HBPA 5LJ5j 3LH5A 3H0FA 4N4HA 4PJOG 5FU7C 2G6FX 1I5OB 3FEOA 1FXXA 3MPUB 1Q7YC 1WX6A 1B34A 4RTYA 3CC7T 3BFMA 3CCJA 4RTWA 4DEXA 1H3HA 5EG2A 2O4XB 4AFUC 4C92G 5GMKi 2VUBA 2CUDA 1VQOA 2LT4A 1MMDA 1N6AA 3ZFJA 1X6GA 5L23A 4Z89A 2DBKA 3M4GA 1B7TA 2M1HA 2LT1A 3M0UA 4HT8A 2RK2A 4BUGA 1KC8R 4WF2A 1YCSB 2COWA 4F17A 3PGGA 4JUVA 3HTRA 2OTLA 2RHYA 3KUFA 2FRWA 5GAMf 5KYUB 1VQ4T 2KK4A 4Z8AA 2RM4A 2D0NA 1YJNA 4M7DG 1QCOA 1Q95G 1RADB 1BKBA 5GJWB 3CCQQ 1N27A 4M4ZA 3S6WA 2PTKA 1BU1A 4OB0B 2GTJA 1JBMA 3V7SA 4HVUA 2CZ7B 3I5SA 4IIOA 2F1LA 4ZGEB 3KXTA 3ASKA 3OS2A 3LGLA 2JS2A 1I1JA 5KYUA 1VQ9Q 2DZ9A 3DB4A 2RK1A 3M53A 3E9FA 5LL6S 1IRXA 3CCVT 4NS5A 3G71T 4R0KA 3WVDB 1JJ2A 1G3SA 3EGDB 3CCRQ 4FSXA 4KGZB 4QQGA 3UWNA 1PHTA 1KFZA 4M75G 4HCCA 3PFSA 1H641 5CO7A 2AZVA 5CKEA 3A8MB 4XU1A 2HD0A 3HSBA 2FEIA 3EGDA 5KCOA 2BKDN 4R55A 2C0OA 2EJGA 1RACB 3CD6T 2O9VA 2MPXC 3MEUA 3M57A 1I81A 1Q7YU 3OYLA 1YIJQ 1NZ9A 1VQ8A 3CCUT 3X28B 1TUDA 1UB4A 4LDWA 3SHWA 5GAOq 1OYXA 4ATOA 4VUBA 1X2KA 3BDUA 4L59A 2AT1B 4N0AA 5IH2A 2DZCA 2DTHA 2DE0X 3TVTA 4F7UB 2A3LA 2ZPFB 4KGXB 4QQDA 5LJ5e 3M58A 1RAIB 1RI9A 1OEBA 1TG0A 2D8JA 1SEMA 1VYTA 5IHNA 4TVRA 3RERA 2BIVA 4YTLA 1UJYA 2KGTA 3CCJQ 3H0IA 2HQEA 3REBB 1Q82C 1I8FA 2K9GA 3SEMA 2KXDA 1LPLA 5I2MA 4N0AC 1VQOQ 1EX4A 2ABLA 4RMOA 1H8KA 1WIEA 2L0AA 3A8GB 1NLPC 2KNBB 3BE3A 5GAOm 3PTAA 3VS5A 1YBYA 4M78A 2L3PA 1C1AA 2RQRA 1G5VA 1ZBXA 2P4TA 4F14A 2IPOB 1IREB 1KHIA 4PJOB 4LUEA 1SSFA 3OYEA 1VQKT 3V7CA 1MV3A 4ANJA 2HAXA 4GLKA 2GGRA 2V8IA 4BI8B 4C92B 3R6NA 1YITA 3GPLA 2HZYA 2DVEA 2J05A 5LJ3e 4M77E 3G7ZA 1VQ7A 1O75A 3EGXB 4HA8A 2HEQA 4M78C 3PT9A 1M2VA 4PJOA 2QTVA 3OSVA 2EGCA 1T0JA 3EH2A 4M77F 2ENMA 2J6KA 3JCMJ 4C0FA 2J06A 3VJPA 1NYGA 2RHIA 3BW1A 4C92A 1M3BA 3RMQA 4M7DB 1WHGA 2KE9A 5D6XA 2F2VA 1IHWA 1VIEA 1KD1C 1V1CA 3CPWS 3CEYA 1AEYA 2LX7A 3JCMh 4BY6B 4PJOC 1WQWA 1QVFS 3LWIA 2PVOB 4XTYA 2EFIA 1SRMA 2WSFE 3DKMA 5DM7R 3FJ5A 4A4HA 1YJ9Q 1M30A 4M7DA 1H3ZA 2KR3A 5LJ5h 3CCLT 4C92C 3NHNA 3CMAT 4FW1A 3P8BB 1RLPC 3C0CA 1WHKA 4M75B 1VQ8Q 2VXFA 2AZSA 2CT4A 3URGA 1AZEA 2CP6A 2D9TA 1IGUA 2LTOA 1Q82U 2OJ2A 2MOXA 4J7FA 2CP2A 1N8RC 4OB2B 1GFDA 1ZBJA 3C95A 2RD1A 4M7DC 2CP3A 4C0DB 5GANf 4J9CA 4DA4A 1K8AR 5J39A 3CXCP 3OYGA 4KBMB 2VGMA 4M75A 1Q86C 1UE9A 4PFZA 2DL3A 4AMCA 2A36A 1GXIE 1ZX6A 4BY6C 2G3RA 1IGQA 1YHQA 2DRKA 4MDXA 1TUCA 5HY6A 3INZA 2R58A 3JV3A 3RKWA 1VQMA 2PUKB 1F1BB 4PJLA 2IIMA 1SHFA 2BE7D 2YDLA 2QEXT 2R5MA 5GANd 1BIBA 4FYVB 3HFNA 5LJ3h 2CZ1B 5CKHA 3QIIA 1K76A 1D1CA 2DRMA 2CUBA 2AIRB 2EQKA 1RL2A 2C0TA 4M75C 4XQ3A 5CAIA 1T3LA 2FVUA 3REAB 2FRYA 2V1RA 1YP5A 3CCMQ 3RKYA 2QQAA 1GL5A 7AT1B 2OAWA 4C0DC 4AT1B 4PLIA 1KD1U 1VQ7Q 1SHGA 1K4US 2F2WA 3TU4K 1E6HA 1W1FA 3E9GA 1H92A 2LVMA 3NGPA 1VYUA 2K5IA 3JCMb 2HL3A 1PSEA 3QG1A 2RJFA 1PRLC 2A28A 4RTXA 1CKBA 1VQ9T 1HSQA 2ESWA 3TCJA 1QVGA 8ATCB 1LNXA 3L2WA 2RQTA 2VB6A 4C5GA 2NUPB 3I56A 2X4XA 4NL3A 3CMET 1ZSGA 5GAMe 5KCHA 4L5GA 1JXOA 3DLMA 2C0IA 3BY7A 3EG1A 1N8RU 2HSPA 4OMLA 1AHJB 1PRMC 1WHJA 5IHIA 2LZ6B 1JRIA 4K11A 3PIOA 2WSCE 1OU9A 1MGQA 4GLMA 2EIFA 4WTOB 4BB7A 3KBGA 3META 1KIKA 2NUPA 4C5IA 4DBQA 1G3WA 1Q86U 2EYZA 2OX7A 1M1FA 5HK3A 3RNJA 2JM8A 1AOJA 3JCMg 2R57A 5IAYA 1NE8A 1TXQA 3PVLA 4E7SA 1K73C 2HDAA 4RTVA 4J9BA 1W4SA 3O8VA 2OTJQ 1WZOA 4BE1A 4EMKB 3OW2A 4M78D 3UDCA 1W6XA 1PWTA 4IIMA 1D1BA 1KQ2A 2A08A 1UGRB 3A8HB 3H8ZA 1U06A 1R77A 2QAZA 3WXMB 1YHQQ 3RKXA 4C8QA 1KSWA 2RO0A 1HJDA 2ZPHB 1VQMQ 2X51A 4EMKA 3WVEB 2XD0A 2V1QA 1UUEA 2DD4A 3VUBA 2DL7A 4BI4A 5GMKl 1UGPB 1MNDA 1VQOT 4FYXB 2GQIA 1NEGA 2HQXA 2JMAA 2PU9B 1XNIA 3M4YA 1NJIR 1WA7A 2CSIA 4OMMA 4PJOD 1M1GA 2QI2A 3FDRA 2GBQA 4JS5A 3I5RA 4C8QC 2H3EB 1HYOA 2OTLT 3RDVA 1X6OA 2KYBA 2JUFA 2X4YA 3A8LB 4EMKC 1YJNT 1VQPQ 3NTKA 2RN8A 2JTEA 3SWNA 3L2ZA 1LOJA 2EKOA 1BI0A 4XTZA 5GAN2 1VYVA 5GAMh 2DYBA 2ROLA 1YN8A 5CKDA 2ED1A 1IZ6A 2FB7A 2LRQA 4KT0E 2A7YA 1I07A 2M02A 2K5LA 1BYMA 5FWBA 3CC2A 1KQSS 1YIJA 1D3BB 1WJQA 3FLGA 3ZL7C 3OMGA 3I56Q 1ZUKA 1S72T 1K73U 2NYSA 3OYCA 1B07A 1JJ2P 4EIKA 4FT4A 1M8VA 3CCET 1AZGB 4OMNA 2QXFA 4E6RA 3PIPA 4RG2A 4E7KA 1O9SA 3G6EA 1PM3A 4QW2A 4ZGJB 1Z9QA 2L3SA 1KD1R 3HHTB 4J6XA 4ESRA 2M0YA 1NG2A 3RR6A 2LJ3A 3OB9A 3JB9D 4CC7A 4KRTA 1VQ8T 2LX9A 3C4SA 3MKDA 2M16A 1ZSZB 3EFOB 4Y92A 2HQHA 4A4KA 4RKUE 1UJ0A 2LC4A 1VQNA 3PNWC 3UF4A 4JJNK 3OYMA 1D09B 2E12A 2EKHA 2M51A 2O4XA 2R5AA 2DTOA 2CSQA 3FB9A 1HK9A 1MMGA 3V8JA 5KYWB 5IT9E 2EYXA 4RCBA 1X75C 5GAN7 4KUDK 4CC4B 5HCKA 2QQRA 2HNIA 2EBPA 3EFOA 2ZPGB 1EZZB 4DEYA 3OY9A 5L8RE 2O9SA 4A53A 3JB9H 5LJ3j 4BE2A 1SF9A 2DL4A 1Q86R 5FWCA 3JCMV 3VKIA 4OVAA 1K9MR 1V76A 1K0XA 1IXDA 1BI3A 1M90R 1GCPA 2ZPIB 1ZA2B 4AFQC 4AFSC 1ZQ1A 2OI3A 3OS1A 3TSWA 4D8DA 2BZYA 5GANe 2JTFA 3EG2A 2XDDA 2F5KA 4OMFB 2L3RA 2P84A 2DXCA 4D6WA 2EYQA 3H6ZA 2XDBA 2LDMA 2KMTA 1YITT 3X25B 2ZCFB 4Z02A 3H41A 2XIDA 4HCKA 1G83A 2YUQA 3GBQA 1VQ6T 1OX8A 1YJ9A 1R8OB 4JLIA 4IUPA 2YUOA 5D6YA 4J9IA 4JPBW 3TSZA 4QQ6A 4B9XA 1JU5C 1GCQA 3N5BB 2LP5A 4E7IA 3CC2Q 4V2SA 1NEBA 1R0BG 2YT6A 2E1HA 2DETA 5GAN6 2LCCA 3QYGB 5A2QE 2AKLA 2FZGB 1Y07A 4RUGA 2E3HA 3NTIA 1UECA 4QVDA 2DVJA 3CCST 2K2MA 4E7LA 1X27A 1G2BA 4O5VA 2OAUA 3G6EQ 5KYXB 1GCQC 5AT1B 1I4K1 3CPWP 2ZPEB 4J8OA 1UHFA 2XG8D 1G3YA 1GFCA 3MEWA 2W0ZA 4UC4A 1OULA 1PKSA 2COYA 2DJQA 4C8QD 2RQVA 3NTHA 2VYTA 4F7UA 4M7AE 3ME9A 2KI7A 1Z9ZA 3VU3C 3J81E 5A0LA 5IXFA 2AKKA 2DXTA 2MAMA 2LCSA 5KYXA 1RI0A 1M5Q1 5FU6B 2DM1A 3H9NA 1TH7A 4E7HA 1QP3A 2MF2A 4M7AF 1OOTA 1BB9A 1VQNQ 3OYYA 4HVVA 1KQ1A 3D7SB 2DJZA 4PL6A 2LJ1A 4FSSA 3ZBDA 3HKSA 4XU2A 1YI2A 2DEQA 1K73R 2RJDA 1QCNA 1VA7A 4WCIA 3CCMA 4PFPA 4KUIA 3QJYA 2E5KA 3PMTA 1BCMA 3QWYA 2DERA 1PCXA 3PVQA 3SB2A 2CP0A 1YJWT 4J9HA 1YHQT 2QGFB 1WPYA 2JS0A 2DILA 3G1JA 4DBHA 4B9WA 2LQNA 1VQMT 1Y7XA 3G4ST 4FM4B 2D0QB 2FHDA 4M7AD 1RAGB 3SD4A 2CH4W 2XICA 2GF7A 3CBPA 1WGSA 3VS7A 4JS4A 5CVIA 1A0NB 3CC4A 3UATA 1SRLA 2HL5C 2CH4A 3EFSA 1XJWB 2K3BA 2MIOA 1OX9A 3EGXA 4MDWA 5FU6C 3I55Q 2LCLA 2HMAA 4LD6A 3RBBB 3CPWA 5FRNA 2MMPA 4JLGA 3MEVA 4OMPA 3MP1A 3R6OA 3EG0A 1QVFA 3OBWA 5GAMj 3MEAA 1YWOA 2EPDA 2SRCA 3QJ6A 4OGCA 4A4EA 3OQ5A 3CCUA 1KK7A 2COZA 2RHUA 3FRNA 3TEEA 4CC2A 1AWWA 2MK5A 4PLLA 3T9NA 1SKUB 5GAOl 2QQ9A 3OSSC 5D7UA 5D6WA 3EHRA 2RMOA 2HSEB 4RCCA 2GFUA 5GAN3 3I56T 1P92A 1C6VX 3CC7Q 2OTJA 5FRMA 4MZMA 1NYFA 1KC8C 3OYBA 2DFUA 3QUIA 2QDLA 5KYYB 3VYGA 1QVGP 4LD9K 5A0GA 2PZ1A 2DBMA 1IO6A 2EGAA 3PMIA 2QYZA 1WYXA 4FIBA 4MZPA 3ZEHA 1UGVA 1QW1A 2KDSA 3JRZA 2A37A 2K7AA 1G8XA 1UTIA 2QG9B 4J6YA 3LWHA 2I0NA 1ZLMA 4IUTA 5I2SA 1QMCA 1VQ4Q 3M56A 1VQKA 3MJXA 2DMOA 2YWWA 2PUOB 4A4FA 4B6MA 2LJ0A 1Q7YR 1OI1A 1U8RA 2E41A 4ZTJA 2B8AA 3M0RA 4ME7A 2J7IA 5GAN5 1WJRA 5I22A 2JJ9A 1YI2Q 2HCKA 2YRVA 4ELZC 1OQKA 4MMKA 4PJNA 2HKNA 3OS5A 1VQPA 3QZ9B 1T0HA 3CCVQ 3OW2P 3G71Q 1ZUUA 4KGVB 4XK8E 3M59A 3CCQT 2LQWA 4N4IA 3JCMf 3A98A 4X1VA 2K79A 2WACA 2EGEA 4KH1B 4M77G 2JNGA 3M0TA 1X69A 1S1NA 1ZHIA 1NLOC 3CC4Q 1NBEB 2NUTB 1WQ7A 1D0ZA 2KRMA 3CCRT 2E4HA 2Y90A 1OZ3A 1TS9A 3JCMd 4PNOA 3CD6Q 3LGFA 4II1A 4A4GA 1MUZA 4M78E 4BDYA 3Q1JA 1ZA1B 5KYNA 1V29B 3CCUQ 5LJ5d 2DPPB 1TSFA 1M3AA 4LXCA 1KC8U 4FT2A 4M78F 2ATCB 3M5AA 2QDYB 3CXCS 1BCOA 1IHVA 3L2RA 5GMKj 3M0PA 2ROTA 3FJPA 3QXEB 2RA2A 3A8OB 4LUDA 4LNPA 2X35A 3KFVA 2Y4XA 2YHTA 3EGUA 4HXJA 4X9CA 1E7OA 1YIJT 4PJOE 3VS6A 1VQ5A 5CCAA 4QVCA 5LJ5g 4FCYA 1UGQB 2JZ2A 4PJOF 1WJSA 3RUXA 4C92E 5CK9A 3MCAB 2O31A 1VUBA 1GBRA 1CSKA 2QEXA 1JQQA 1FMWA 2KYMA 4EMGA 3VRYA 4FU6A 2FG0A 3BDLA 4C92F 2CZ0B 3S3OA 4J9DA 4PFOA 3CCJT 3CPFA 9ATCB 5LJ3d 4JRIA 4BACA 2YLBA 3X20B 1VQKQ 2KRNA 4M7DE 5J26A 1HXDA 2QA4A 2BE9B 2JN0A 5GAN4 4ZTFA 1N9RA 2RHXA 1YWPA 1JB0E 1Y71A 4M7DF 2LNHB 3OMCA 4A63B 2Z0WA 1U5SA 2DNUA 4FYYB 1Q82R 3V8LA 4C92D 4RTTA 1BIAA 3A1PA 4JJCA 5AYFA 3EH1A 5FLXE 5LJ3g 3L2VA 5GANj 4HCZA 1ACMB 1RAEB 1QLYA 3OYFA 4LDXA 1W70A 2YUNA 4JRQA 2ZPBB 3GLXA 4NOYA 3LH0A 3E2UA 1N5ZA 1XOVA 3VS4A 2BZXA 4RTUA 4KH0B 4M75E 2BTTA 5KH6A 3QYHB 4J9EA 3DB3A 3JAME 4M7DD 2K3YA 1QQJA 2CDTA 2KY9A 1GBQA 1W2BS 1M27C 2JW4A 5I11A 3MO8A 4M75F 3QSUA 4LE9A 2CT3A 3JSCA 2EQUA 1Y57A 4JJDA 1VQLA 2BUDA 3CCLQ 3J7AF 2XK0A 2DL5A 4C5EA 3JB9F 1TUGB 2KT1A 2E64A 1K0SA 1D0YA 2KQWA 1YNZA 4IKFA 2E6ZA 3CMAQ 2KRSA 4OGEA 2K6DA 4AG1C 4XTUA 4M78G 5DY9A 4M77B 2FL7A 1K8AC 2K5FA 2DLPA 4JDSA 3L2QA 4HT9A 2LQ8A 4RG8A 4JZ3A 2KT8A 4IUVA 2VASA 2RJCA 1D3BA 2JT4A 5GMKe 4R56A 1YJ9T 4M75D 4Y28E 4HKEA 4J6WA 4MZTA 3FC3A 2XI9A 4PJJA 1PD0A 1RLQC 2I2LA 2P0KA 4M77A 1FYNA 2ZGWA 4FL6A 2E10A 2HBWA 4LDYA 2V8KA 1RABB 1UDLA 2L5QA 1VQ5Q 1LJOA 5C0MA 3X24B 1M3CA 2JOYA 4C5HA 2A0FB 2KSSA 2RF0A 4DBFA 3GP8A 1KJWA 2XKOC 1M1KC 3OYKA 2VGNA 6AT1B 1WFWA 2PNIA 5CR2A 3C94A 2DD5A 1AWJA 3P8DA 4OMQA 2QEXQ 8AT1B 5IXBA 1R0CB 1XQHA 3VUZA 4A54A 2EYWA 3HP9A 3THKA 3QDRB 5CIUA 2AK5A 3OA6A 4M77C 1N8RR 4IUUA 4E2FB 1YCYA 3DLLA 2ED0A 1ZSZA 3S3MA 3GOXA 1Q81C 3ER0A 1KG1A 3QKJA 2B86A 1XTDA 4F04B 2K4YA 1WXBA 1IB8A 4CRIA 2QA4Q 3QO3A 2W10A 1CKAA 1RAHB 2EYYA 2DL8A 4JRKA 2E6NA 5KYWA 1BBZA 1U1TA 2GQVA 1TTHB 2E5QA 5KE3A 1ZUYA 4J7IA 3E1SA 3GF5A 3UA6A 3LX7A 4O6JA 2DEUA 2DKGA 1YI2T 1ZSZC 2K57A 3TQ7P 2GFAA 2EQMA 3CCMT 2K2VA 3I55A 1BI1A 3LW5E 1PC0A 1WXUA 5M9OA 4JRPA 1UHCA 3CQTA 5GAMd 2D6FA 5GAN8 2CREA 1QWFA 1OPKA 2O2OA 1C0MA 2Y4YA 1JJ2S 3L1AA 1VQ7T 4CC3A 2X9HA 1UGSB 2L3QA 3NFCA 3CMEQ 3QHSA 2QQSA 3SDZA 1K8AU 1S72A 4XU3A 2RI3A 4C8QE 4C0GA 4OMOA 3VS3A 1OZ2A 5GMKh 1WXTA 3CCEA 3CC4T 3JB9G 4J9GA 1I0CA 2DK3A 1VQLQ 5FW9A 2C06A 1PG5B 2X4JA 5GAMg 4C8QF 4DBRA 5CQYA 4L6V5 1JXMA 2YLCA 2XDPA 2YXYA 1QP2A 1HD3A 3CC7A 2RQUA 1SSHA 1WHLA 2KXCA 1OV3A 1X43A 4ORZA 1G3TA 4EPCA 1M1KU 4BE0A 2RQWA 1FMVA 3JCMQ 2H8HA 3JCMe 2JXBA 2DAQA 1WI7A 4PK4A 1QVFP 1FMKA 1M8MA 2LMJA 3SFMA 1MHNA 4C0ZA 4J9FA 1VQ4A 3GNFB 2DA9A 1LCKA 1Q81U 2V8JA 3LYIA 3NMZC 2EAYA 3MHXA 4D8KA 4M78B 1NJIC 1KHCA 2DO3A 1ABQA 1T3SA 2CKKA 2OTJT 4Q5WA 1FX7A 3OS0A 3OBYA 3JCMX 3L42A 4XTXA 2K3XA 4NL2A 3VS0A 2L89A 3HRTA 2DXUA 5GAOn 1Y96B 2PQWA 5GANh 1X2QA 3CCVA 3G71A 2ECZA 3ULRB 1WLPB 1M2VB 5CKBA 2OTLQ 2IVWA 2NWMA 3EG9B 1YJNQ 4QKUA 1QVPA 3P8HA 5DLOA 3RIRA 3JCMc 2VVKA 1Y96A 4KULA 2QQBA 2EW3A 5IHKA 1ARKA 3VYHB 5GAOr 2RI5A 3QBYA 2RPNA 1VQ6A 2RNAA 3O5ZA 2KBTA 3HL8A 4BI3A 1RAAB 3EG9A 1JEGA 1QKXA 3HRUA 4E7JA 3CD6A 1PKTA 1VQPT 1OU8A 3M54A 1WHMA 4XTWA 3TREA 1NPPA 2MCNA 2J6OA 1BK2A 1I5LA 5EC7A 4FYWB 3NPFA 4F16A 2O88A 2LQKA 3QPHA 4LDUA 4PJMA 4J83A 1BI2A 1S72Q 3AHUA 2RB6A 3CBOA 5A0DA 3UA7A 3OYNA 4C8QG 4DQ2A 3CCSA 3CCEQ 3MP6A 2CZ6B 2DIQA 2V26A 2KROA 3V8KA 3VS1A 4M77D 2KAFA 1DJ7B 2DYIA 4QT7A 1MMNA 2JTMA 3U23A 3M0QA 4Y91A 3VV0A 3C12A 3HPWA 1N9SA 5GJVB 3M55A 1NJIU 3CBMA 2X3WD 2L2PA 1PD1A 2WSEE 1X6BA 2MYSA 4PKCC 3UPUA 3GNGA 1M4ZA 2M0OA 3H0HA 2M9UA 1AWXA 3OYDA 1LVKA 2DX1A 4J5YA 5KYYA 2LNVA 4M7AG 3I9QA 2FPEA 1NPRA 4P5NA 1MNEA 4DOWA 1K9MC 1VQ5T 5CQXA 4IUQA 1TU0B 2DF6A 1M90C 1YJWA 2F69A 4OP0A 3EFRA 4X9DA 3RMSA 2EVRA 1X01A 3OYAA 3FIFA 2XHCA 2CYZB 3M9QA 3OYJA 3G4SA 1RAFB 4EDUA 2VC8A 4QVZA 4CI0C 3EAEA 4EMHA 2DXBA 5HK0A 4AFZC 1D0XA 2ZZDA 3S3NA 1M1KR 1QKWA 4DOVA 2MI6A 3I35A 1YFNA 2FPFA 3RESA 1RUWA 2QK0A 3OYHA 2QA4T 5J3BA 2EQIA 2PVDB 5LJ5f 2CP5A 2DTIA 2GCXA 1YITQ 5GANg 2RI2A 1Q81R 1MMAA 1GRIA
chains in the Genus database with same CATH topology
1C6VX 5D7UA 1C1AA 4FW1A 4FW2A 1EX4A 1IHWA 1C0MA 1IHVA 1QMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C6V X;  5D7U A;  1C1A A;  4FW1 A;  4FW2 A;  1EX4 A;  1IHW A;  1C0M A;  1IHV A;  1QMC A; 
#chains in the Genus database with same CATH topology
 3EHQ A;  4F7U E;  1VQ6 Q;  1TOV A;  4HVW A;  3CCL A;  4OB1 B;  3VRZ A;  1QWE A;  4ELY C;  4BD3 A;  1ABO A;  5GMK m;  4F7U F;  3CMA A;  4XU0 A;  1Y0M A;  2MWP A;  2EJF A;  2MWO A;  1UG1 A;  2BZ8 A;  5KE2 A;  3MP8 A;  1M9S A;  1K9A A;  4E7Z A;  2JVV A;  2NUT A;  1UFF A;  1QVG S;  3CXC A;  1VIF A;  2PVG B;  2P0P A;  4LN2 A;  3A5Z B;  1WDX A;  5C6S A;  3J80 E;  2E70 A;  3CCS Q;  2VKN A;  3AT1 B;  4FW2 A;  1TWB A;  2EWN A;  2YUP A;  2KVQ G;  5I21 A;  3V7R A;  3LLR A;  3CC2 T;  4BDZ A;  1VQL T;  4GBQ A;  2QGG A;  3JB9 I;  1W2B P;  4E47 A;  1U3O A;  5LJ3 f;  4GY5 A;  2HKQ B;  3PE0 A;  2YRD A;  2D1X A;  4IUR A;  1KQS P;  2VXE A;  2FZK B;  1K9M U;  3HRS A;  3VS2 A;  1M90 U;  4RTZ A;  5IN1 A;  2FYK A;  3GIB A;  3OYI A;  2F2X A;  3G6E T;  4C8Q B;  2FO0 A;  4Z88 A;  4ZN3 A;  1MV0 B;  3F70 A;  1AD5 A;  4ZGD B;  2D8H A;  3E19 A;  4N4G A;  2VV5 A;  3OW2 S;  2JM9 A;  3X26 B;  4JZ4 A;  2NUZ A;  2X3X D;  2YSQ A;  3JCM P;  1PSF A;  2GNC A;  1YJW Q;  5ECA A;  4XTV A;  1WNL A;  3CCQ A;  1D1A A;  2EQJ A;  1EFN A;  2YRC A;  5GAO p;  2CGH A;  1VQN T;  3G4S Q;  1FWZ A;  4JJB A;  4OB3 B;  2ZAE A;  5DLQ E;  4XAX B;  1NM7 A;  2VWF A;  2CP7 A;  3SWN B;  2E65 A;  1VQ9 A;  4MML A;  2FZC B;  3QDF A;  4ZN1 A;  4LDV A;  1B3Q A;  2F5T X;  4M7A B;  4OF1 A;  2L8D A;  4HCB A;  2AHJ B;  3CCR A;  1AVZ C;  4X34 A;  1K1Z A;  2JMC A;  3CME A;  2NLU A;  2QTX A;  1J3T A;  1W2B A;  2DIG A;  2J6F A;  5FU7 B;  3IQL A;  1UEB A;  1AT1 B;  1KQS A;  2CS7 A;  2GTO A;  1SPK A;  2RJE A;  4M7A A;  5FRO A;  1QCF A;  4F7U G;  2XMF A;  1M2O A;  3UT1 A;  3L2U A;  3M0S A;  2KEA A;  1E6G A;  1SG5 A;  3HFO A;  1EIF A;  2O01 E;  1VOM A;  1OPL A;  3I55 T;  5HKC A;  1JO8 A;  1PNJ A;  2E3I A;  3JCM W;  1AWO A;  3EG3 A;  2IG0 A;  3QZ5 B;  4ZNX A;  1U1S A;  2X4W A;  2FPD A;  2XU8 A;  3QWX X;  2RH2 A;  3SWN C;  2EJ9 A;  2P0Q A;  2H3J A;  1B34 B;  2SEM A;  2RHZ A;  4M7A C;  1WHH A;  2QAS A;  5CKF A;  4AG2 C;  3JB9 J;  2P4R A;  2HBP A;  5LJ5 j;  3LH5 A;  3H0F A;  4N4H A;  4PJO G;  5FU7 C;  2G6F X;  1I5O B;  3FEO A;  1FXX A;  3MPU B;  1Q7Y C;  1WX6 A;  1B34 A;  4RTY A;  3CC7 T;  3BFM A;  3CCJ A;  4RTW A;  4DEX A;  1H3H A;  5EG2 A;  2O4X B;  4AFU C;  4C92 G;  5GMK i;  2VUB A;  2CUD A;  1VQO A;  2LT4 A;  1MMD A;  1N6A A;  3ZFJ A;  1X6G A;  5L23 A;  4Z89 A;  2DBK A;  3M4G A;  1B7T A;  2M1H A;  2LT1 A;  3M0U A;  4HT8 A;  2RK2 A;  4BUG A;  1KC8 R;  4WF2 A;  1YCS B;  2COW A;  4F17 A;  3PGG A;  4JUV A;  3HTR A;  2OTL A;  2RHY A;  3KUF A;  2FRW A;  5GAM f;  5KYU B;  1VQ4 T;  2KK4 A;  4Z8A A;  2RM4 A;  2D0N A;  1YJN A;  4M7D G;  1QCO A;  1Q95 G;  1RAD B;  1BKB A;  5GJW B;  3CCQ Q;  1N27 A;  4M4Z A;  3S6W A;  2PTK A;  1BU1 A;  4OB0 B;  2GTJ A;  1JBM A;  3V7S A;  4HVU A;  2CZ7 B;  3I5S A;  4IIO A;  2F1L A;  4ZGE B;  3KXT A;  3ASK A;  3OS2 A;  3LGL A;  2JS2 A;  1I1J A;  5KYU A;  1VQ9 Q;  2DZ9 A;  3DB4 A;  2RK1 A;  3M53 A;  3E9F A;  5LL6 S;  1IRX A;  3CCV T;  4NS5 A;  3G71 T;  4R0K A;  3WVD B;  1JJ2 A;  1G3S A;  3EGD B;  3CCR Q;  4FSX A;  4KGZ B;  4QQG A;  3UWN A;  1PHT A;  1KFZ A;  4M75 G;  4HCC A;  3PFS A;  1H64 1;  5CO7 A;  2AZV A;  5CKE A;  3A8M B;  4XU1 A;  2HD0 A;  3HSB A;  2FEI A;  3EGD A;  5KCO A;  2BKD N;  4R55 A;  2C0O A;  2EJG A;  1RAC B;  3CD6 T;  2O9V A;  2MPX C;  3MEU A;  3M57 A;  1I81 A;  1Q7Y U;  3OYL A;  1YIJ Q;  1NZ9 A;  1VQ8 A;  3CCU T;  3X28 B;  1TUD A;  1UB4 A;  4LDW A;  3SHW A;  5GAO q;  1OYX A;  4ATO A;  4VUB A;  1X2K A;  3BDU A;  4L59 A;  2AT1 B;  4N0A A;  5IH2 A;  2DZC A;  2DTH A;  2DE0 X;  3TVT A;  4F7U B;  2A3L A;  2ZPF B;  4KGX B;  4QQD A;  5LJ5 e;  3M58 A;  1RAI B;  1RI9 A;  1OEB A;  1TG0 A;  2D8J A;  1SEM A;  1VYT A;  5IHN A;  4TVR A;  3RER A;  2BIV A;  4YTL A;  1UJY A;  2KGT A;  3CCJ Q;  3H0I A;  2HQE A;  3REB B;  1Q82 C;  1I8F A;  2K9G A;  3SEM A;  2KXD A;  1LPL A;  5I2M A;  4N0A C;  1VQO Q;  1EX4 A;  2ABL A;  4RMO A;  1H8K A;  1WIE A;  2L0A A;  3A8G B;  1NLP C;  2KNB B;  3BE3 A;  5GAO m;  3PTA A;  3VS5 A;  1YBY A;  4M78 A;  2L3P A;  1C1A A;  2RQR A;  1G5V A;  1ZBX A;  2P4T A;  4F14 A;  2IPO B;  1IRE B;  1KHI A;  4PJO B;  4LUE A;  1SSF A;  3OYE A;  1VQK T;  3V7C A;  1MV3 A;  4ANJ A;  2HAX A;  4GLK A;  2GGR A;  2V8I A;  4BI8 B;  4C92 B;  3R6N A;  1YIT A;  3GPL A;  2HZY A;  2DVE A;  2J05 A;  5LJ3 e;  4M77 E;  3G7Z A;  1VQ7 A;  1O75 A;  3EGX B;  4HA8 A;  2HEQ A;  4M78 C;  3PT9 A;  1M2V A;  4PJO A;  2QTV A;  3OSV A;  2EGC A;  1T0J A;  3EH2 A;  4M77 F;  2ENM A;  2J6K A;  3JCM J;  4C0F A;  2J06 A;  3VJP A;  1NYG A;  2RHI A;  3BW1 A;  4C92 A;  1M3B A;  3RMQ A;  4M7D B;  1WHG A;  2KE9 A;  5D6X A;  2F2V A;  1IHW A;  1VIE A;  1KD1 C;  1V1C A;  3CPW S;  3CEY A;  1AEY A;  2LX7 A;  3JCM h;  4BY6 B;  4PJO C;  1WQW A;  1QVF S;  3LWI A;  2PVO B;  4XTY A;  2EFI A;  1SRM A;  2WSF E;  3DKM A;  5DM7 R;  3FJ5 A;  4A4H A;  1YJ9 Q;  1M30 A;  4M7D A;  1H3Z A;  2KR3 A;  5LJ5 h;  3CCL T;  4C92 C;  3NHN A;  3CMA T;  4FW1 A;  3P8B B;  1RLP C;  3C0C A;  1WHK A;  4M75 B;  1VQ8 Q;  2VXF A;  2AZS A;  2CT4 A;  3URG A;  1AZE A;  2CP6 A;  2D9T A;  1IGU A;  2LTO A;  1Q82 U;  2OJ2 A;  2MOX A;  4J7F A;  2CP2 A;  1N8R C;  4OB2 B;  1GFD A;  1ZBJ A;  3C95 A;  2RD1 A;  4M7D C;  2CP3 A;  4C0D B;  5GAN f;  4J9C A;  4DA4 A;  1K8A R;  5J39 A;  3CXC P;  3OYG A;  4KBM B;  2VGM A;  4M75 A;  1Q86 C;  1UE9 A;  4PFZ A;  2DL3 A;  4AMC A;  2A36 A;  1GXI E;  1ZX6 A;  4BY6 C;  2G3R A;  1IGQ A;  1YHQ A;  2DRK A;  4MDX A;  1TUC A;  5HY6 A;  3INZ A;  2R58 A;  3JV3 A;  3RKW A;  1VQM A;  2PUK B;  1F1B B;  4PJL A;  2IIM A;  1SHF A;  2BE7 D;  2YDL A;  2QEX T;  2R5M A;  5GAN d;  1BIB A;  4FYV B;  3HFN A;  5LJ3 h;  2CZ1 B;  5CKH A;  3QII A;  1K76 A;  1D1C A;  2DRM A;  2CUB A;  2AIR B;  2EQK A;  1RL2 A;  2C0T A;  4M75 C;  4XQ3 A;  5CAI A;  1T3L A;  2FVU A;  3REA B;  2FRY A;  2V1R A;  1YP5 A;  3CCM Q;  3RKY A;  2QQA A;  1GL5 A;  7AT1 B;  2OAW A;  4C0D C;  4AT1 B;  4PLI A;  1KD1 U;  1VQ7 Q;  1SHG A;  1K4U S;  2F2W A;  3TU4 K;  1E6H A;  1W1F A;  3E9G A;  1H92 A;  2LVM A;  3NGP A;  1VYU A;  2K5I A;  3JCM b;  2HL3 A;  1PSE A;  3QG1 A;  2RJF A;  1PRL C;  2A28 A;  4RTX A;  1CKB A;  1VQ9 T;  1HSQ A;  2ESW A;  3TCJ A;  1QVG A;  8ATC B;  1LNX A;  3L2W A;  2RQT A;  2VB6 A;  4C5G A;  2NUP B;  3I56 A;  2X4X A;  4NL3 A;  3CME T;  1ZSG A;  5GAM e;  5KCH A;  4L5G A;  1JXO A;  3DLM A;  2C0I A;  3BY7 A;  3EG1 A;  1N8R U;  2HSP A;  4OML A;  1AHJ B;  1PRM C;  1WHJ A;  5IHI A;  2LZ6 B;  1JRI A;  4K11 A;  3PIO A;  2WSC E;  1OU9 A;  1MGQ A;  4GLM A;  2EIF A;  4WTO B;  4BB7 A;  3KBG A;  3MET A;  1KIK A;  2NUP A;  4C5I A;  4DBQ A;  1G3W A;  1Q86 U;  2EYZ A;  2OX7 A;  1M1F A;  5HK3 A;  3RNJ A;  2JM8 A;  1AOJ A;  3JCM g;  2R57 A;  5IAY A;  1NE8 A;  1TXQ A;  3PVL A;  4E7S A;  1K73 C;  2HDA A;  4RTV A;  4J9B A;  1W4S A;  3O8V A;  2OTJ Q;  1WZO A;  4BE1 A;  4EMK B;  3OW2 A;  4M78 D;  3UDC A;  1W6X A;  1PWT A;  4IIM A;  1D1B A;  1KQ2 A;  2A08 A;  1UGR B;  3A8H B;  3H8Z A;  1U06 A;  1R77 A;  2QAZ A;  3WXM B;  1YHQ Q;  3RKX A;  4C8Q A;  1KSW A;  2RO0 A;  1HJD A;  2ZPH B;  1VQM Q;  2X51 A;  4EMK A;  3WVE B;  2XD0 A;  2V1Q A;  1UUE A;  2DD4 A;  3VUB A;  2DL7 A;  4BI4 A;  5GMK l;  1UGP B;  1MND A;  1VQO T;  4FYX B;  2GQI A;  1NEG A;  2HQX A;  2JMA A;  2PU9 B;  1XNI A;  3M4Y A;  1NJI R;  1WA7 A;  2CSI A;  4OMM A;  4PJO D;  1M1G A;  2QI2 A;  3FDR A;  2GBQ A;  4JS5 A;  3I5R A;  4C8Q C;  2H3E B;  1HYO A;  2OTL T;  3RDV A;  1X6O A;  2KYB A;  2JUF A;  2X4Y A;  3A8L B;  4EMK C;  1YJN T;  1VQP Q;  3NTK A;  2RN8 A;  2JTE A;  3SWN A;  3L2Z A;  1LOJ A;  2EKO A;  1BI0 A;  4XTZ A;  5GAN 2;  1VYV A;  5GAM h;  2DYB A;  2ROL A;  1YN8 A;  5CKD A;  2ED1 A;  1IZ6 A;  2FB7 A;  2LRQ A;  4KT0 E;  2A7Y A;  1I07 A;  2M02 A;  2K5L A;  1BYM A;  5FWB A;  3CC2 A;  1KQS S;  1YIJ A;  1D3B B;  1WJQ A;  3FLG A;  3ZL7 C;  3OMG A;  3I56 Q;  1ZUK A;  1S72 T;  1K73 U;  2NYS A;  3OYC A;  1B07 A;  1JJ2 P;  4EIK A;  4FT4 A;  1M8V A;  3CCE T;  1AZG B;  4OMN A;  2QXF A;  4E6R A;  3PIP A;  4RG2 A;  4E7K A;  1O9S A;  3G6E A;  1PM3 A;  4QW2 A;  4ZGJ B;  1Z9Q A;  2L3S A;  1KD1 R;  3HHT B;  4J6X A;  4ESR A;  2M0Y A;  1NG2 A;  3RR6 A;  2LJ3 A;  3OB9 A;  3JB9 D;  4CC7 A;  4KRT A;  1VQ8 T;  2LX9 A;  3C4S A;  3MKD A;  2M16 A;  1ZSZ B;  3EFO B;  4Y92 A;  2HQH A;  4A4K A;  4RKU E;  1UJ0 A;  2LC4 A;  1VQN A;  3PNW C;  3UF4 A;  4JJN K;  3OYM A;  1D09 B;  2E12 A;  2EKH A;  2M51 A;  2O4X A;  2R5A A;  2DTO A;  2CSQ A;  3FB9 A;  1HK9 A;  1MMG A;  3V8J A;  5KYW B;  5IT9 E;  2EYX A;  4RCB A;  1X75 C;  5GAN 7;  4KUD K;  4CC4 B;  5HCK A;  2QQR A;  2HNI A;  2EBP A;  3EFO A;  2ZPG B;  1EZZ B;  4DEY A;  3OY9 A;  5L8R E;  2O9S A;  4A53 A;  3JB9 H;  5LJ3 j;  4BE2 A;  1SF9 A;  2DL4 A;  1Q86 R;  5FWC A;  3JCM V;  3VKI A;  4OVA A;  1K9M R;  1V76 A;  1K0X A;  1IXD A;  1BI3 A;  1M90 R;  1GCP A;  2ZPI B;  1ZA2 B;  4AFQ C;  4AFS C;  1ZQ1 A;  2OI3 A;  3OS1 A;  3TSW A;  4D8D A;  2BZY A;  5GAN e;  2JTF A;  3EG2 A;  2XDD A;  2F5K A;  4OMF B;  2L3R A;  2P84 A;  2DXC A;  4D6W A;  2EYQ A;  3H6Z A;  2XDB A;  2LDM A;  2KMT A;  1YIT T;  3X25 B;  2ZCF B;  4Z02 A;  3H41 A;  2XID A;  4HCK A;  1G83 A;  2YUQ A;  3GBQ A;  1VQ6 T;  1OX8 A;  1YJ9 A;  1R8O B;  4JLI A;  4IUP A;  2YUO A;  5D6Y A;  4J9I A;  4JPB W;  3TSZ A;  4QQ6 A;  4B9X A;  1JU5 C;  1GCQ A;  3N5B B;  2LP5 A;  4E7I A;  3CC2 Q;  4V2S A;  1NEB A;  1R0B G;  2YT6 A;  2E1H A;  2DET A;  5GAN 6;  2LCC A;  3QYG B;  5A2Q E;  2AKL A;  2FZG B;  1Y07 A;  4RUG A;  2E3H A;  3NTI A;  1UEC A;  4QVD A;  2DVJ A;  3CCS T;  2K2M A;  4E7L A;  1X27 A;  1G2B A;  4O5V A;  2OAU A;  3G6E Q;  5KYX B;  1GCQ C;  5AT1 B;  1I4K 1;  3CPW P;  2ZPE B;  4J8O A;  1UHF A;  2XG8 D;  1G3Y A;  1GFC A;  3MEW A;  2W0Z A;  4UC4 A;  1OUL A;  1PKS A;  2COY A;  2DJQ A;  4C8Q D;  2RQV A;  3NTH A;  2VYT A;  4F7U A;  4M7A E;  3ME9 A;  2KI7 A;  1Z9Z A;  3VU3 C;  3J81 E;  5A0L A;  5IXF A;  2AKK A;  2DXT A;  2MAM A;  2LCS A;  5KYX A;  1RI0 A;  1M5Q 1;  5FU6 B;  2DM1 A;  3H9N A;  1TH7 A;  4E7H A;  1QP3 A;  2MF2 A;  4M7A F;  1OOT A;  1BB9 A;  1VQN Q;  3OYY A;  4HVV A;  1KQ1 A;  3D7S B;  2DJZ A;  4PL6 A;  2LJ1 A;  4FSS A;  3ZBD A;  3HKS A;  4XU2 A;  1YI2 A;  2DEQ A;  1K73 R;  2RJD A;  1QCN A;  1VA7 A;  4WCI A;  3CCM A;  4PFP A;  4KUI A;  3QJY A;  2E5K A;  3PMT A;  1BCM A;  3QWY A;  2DER A;  1PCX A;  3PVQ A;  3SB2 A;  2CP0 A;  1YJW T;  4J9H A;  1YHQ T;  2QGF B;  1WPY A;  2JS0 A;  2DIL A;  3G1J A;  4DBH A;  4B9W A;  2LQN A;  1VQM T;  1Y7X A;  3G4S T;  4FM4 B;  2D0Q B;  2FHD A;  4M7A D;  1RAG B;  3SD4 A;  2CH4 W;  2XIC A;  2GF7 A;  3CBP A;  1WGS A;  3VS7 A;  4JS4 A;  5CVI A;  1A0N B;  3CC4 A;  3UAT A;  1SRL A;  2HL5 C;  2CH4 A;  3EFS A;  1XJW B;  2K3B A;  2MIO A;  1OX9 A;  3EGX A;  4MDW A;  5FU6 C;  3I55 Q;  2LCL A;  2HMA A;  4LD6 A;  3RBB B;  3CPW A;  5FRN A;  2MMP A;  4JLG A;  3MEV A;  4OMP A;  3MP1 A;  3R6O A;  3EG0 A;  1QVF A;  3OBW A;  5GAM j;  3MEA A;  1YWO A;  2EPD A;  2SRC A;  3QJ6 A;  4OGC A;  4A4E A;  3OQ5 A;  3CCU A;  1KK7 A;  2COZ A;  2RHU A;  3FRN A;  3TEE A;  4CC2 A;  1AWW A;  2MK5 A;  4PLL A;  3T9N A;  1SKU B;  5GAO l;  2QQ9 A;  3OSS C;  5D7U A;  5D6W A;  3EHR A;  2RMO A;  2HSE B;  4RCC A;  2GFU A;  5GAN 3;  3I56 T;  1P92 A;  1C6V X;  3CC7 Q;  2OTJ A;  5FRM A;  4MZM A;  1NYF A;  1KC8 C;  3OYB A;  2DFU A;  3QUI A;  2QDL A;  5KYY B;  3VYG A;  1QVG P;  4LD9 K;  5A0G A;  2PZ1 A;  2DBM A;  1IO6 A;  2EGA A;  3PMI A;  2QYZ A;  1WYX A;  4FIB A;  4MZP A;  3ZEH A;  1UGV A;  1QW1 A;  2KDS A;  3JRZ A;  2A37 A;  2K7A A;  1G8X A;  1UTI A;  2QG9 B;  4J6Y A;  3LWH A;  2I0N A;  1ZLM A;  4IUT A;  5I2S A;  1QMC A;  1VQ4 Q;  3M56 A;  1VQK A;  3MJX A;  2DMO A;  2YWW A;  2PUO B;  4A4F A;  4B6M A;  2LJ0 A;  1Q7Y R;  1OI1 A;  1U8R A;  2E41 A;  4ZTJ A;  2B8A A;  3M0R A;  4ME7 A;  2J7I A;  5GAN 5;  1WJR A;  5I22 A;  2JJ9 A;  1YI2 Q;  2HCK A;  2YRV A;  4ELZ C;  1OQK A;  4MMK A;  4PJN A;  2HKN A;  3OS5 A;  1VQP A;  3QZ9 B;  1T0H A;  3CCV Q;  3OW2 P;  3G71 Q;  1ZUU A;  4KGV B;  4XK8 E;  3M59 A;  3CCQ T;  2LQW A;  4N4I A;  3JCM f;  3A98 A;  4X1V A;  2K79 A;  2WAC A;  2EGE A;  4KH1 B;  4M77 G;  2JNG A;  3M0T A;  1X69 A;  1S1N A;  1ZHI A;  1NLO C;  3CC4 Q;  1NBE B;  2NUT B;  1WQ7 A;  1D0Z A;  2KRM A;  3CCR T;  2E4H A;  2Y90 A;  1OZ3 A;  1TS9 A;  3JCM d;  4PNO A;  3CD6 Q;  3LGF A;  4II1 A;  4A4G A;  1MUZ A;  4M78 E;  4BDY A;  3Q1J A;  1ZA1 B;  5KYN A;  1V29 B;  3CCU Q;  5LJ5 d;  2DPP B;  1TSF A;  1M3A A;  4LXC A;  1KC8 U;  4FT2 A;  4M78 F;  2ATC B;  3M5A A;  2QDY B;  3CXC S;  1BCO A;  1IHV A;  3L2R A;  5GMK j;  3M0P A;  2ROT A;  3FJP A;  3QXE B;  2RA2 A;  3A8O B;  4LUD A;  4LNP A;  2X35 A;  3KFV A;  2Y4X A;  2YHT A;  3EGU A;  4HXJ A;  4X9C A;  1E7O A;  1YIJ T;  4PJO E;  3VS6 A;  1VQ5 A;  5CCA A;  4QVC A;  5LJ5 g;  4FCY A;  1UGQ B;  2JZ2 A;  4PJO F;  1WJS A;  3RUX A;  4C92 E;  5CK9 A;  3MCA B;  2O31 A;  1VUB A;  1GBR A;  1CSK A;  2QEX A;  1JQQ A;  1FMW A;  2KYM A;  4EMG A;  3VRY A;  4FU6 A;  2FG0 A;  3BDL A;  4C92 F;  2CZ0 B;  3S3O A;  4J9D A;  4PFO A;  3CCJ T;  3CPF A;  9ATC B;  5LJ3 d;  4JRI A;  4BAC A;  2YLB A;  3X20 B;  1VQK Q;  2KRN A;  4M7D E;  5J26 A;  1HXD A;  2QA4 A;  2BE9 B;  2JN0 A;  5GAN 4;  4ZTF A;  1N9R A;  2RHX A;  1YWP A;  1JB0 E;  1Y71 A;  4M7D F;  2LNH B;  3OMC A;  4A63 B;  2Z0W A;  1U5S A;  2DNU A;  4FYY B;  1Q82 R;  3V8L A;  4C92 D;  4RTT A;  1BIA A;  3A1P A;  4JJC A;  5AYF A;  3EH1 A;  5FLX E;  5LJ3 g;  3L2V A;  5GAN j;  4HCZ A;  1ACM B;  1RAE B;  1QLY A;  3OYF A;  4LDX A;  1W70 A;  2YUN A;  4JRQ A;  2ZPB B;  3GLX A;  4NOY A;  3LH0 A;  3E2U A;  1N5Z A;  1XOV A;  3VS4 A;  2BZX A;  4RTU A;  4KH0 B;  4M75 E;  2BTT A;  5KH6 A;  3QYH B;  4J9E A;  3DB3 A;  3JAM E;  4M7D D;  2K3Y A;  1QQJ A;  2CDT A;  2KY9 A;  1GBQ A;  1W2B S;  1M27 C;  2JW4 A;  5I11 A;  3MO8 A;  4M75 F;  3QSU A;  4LE9 A;  2CT3 A;  3JSC A;  2EQU A;  1Y57 A;  4JJD A;  1VQL A;  2BUD A;  3CCL Q;  3J7A F;  2XK0 A;  2DL5 A;  4C5E A;  3JB9 F;  1TUG B;  2KT1 A;  2E64 A;  1K0S A;  1D0Y A;  2KQW A;  1YNZ A;  4IKF A;  2E6Z A;  3CMA Q;  2KRS A;  4OGE A;  2K6D A;  4AG1 C;  4XTU A;  4M78 G;  5DY9 A;  4M77 B;  2FL7 A;  1K8A C;  2K5F A;  2DLP A;  4JDS A;  3L2Q A;  4HT9 A;  2LQ8 A;  4RG8 A;  4JZ3 A;  2KT8 A;  4IUV A;  2VAS A;  2RJC A;  1D3B A;  2JT4 A;  5GMK e;  4R56 A;  1YJ9 T;  4M75 D;  4Y28 E;  4HKE A;  4J6W A;  4MZT A;  3FC3 A;  2XI9 A;  4PJJ A;  1PD0 A;  1RLQ C;  2I2L A;  2P0K A;  4M77 A;  1FYN A;  2ZGW A;  4FL6 A;  2E10 A;  2HBW A;  4LDY A;  2V8K A;  1RAB B;  1UDL A;  2L5Q A;  1VQ5 Q;  1LJO A;  5C0M A;  3X24 B;  1M3C A;  2JOY A;  4C5H A;  2A0F B;  2KSS A;  2RF0 A;  4DBF A;  3GP8 A;  1KJW A;  2XKO C;  1M1K C;  3OYK A;  2VGN A;  6AT1 B;  1WFW A;  2PNI A;  5CR2 A;  3C94 A;  2DD5 A;  1AWJ A;  3P8D A;  4OMQ A;  2QEX Q;  8AT1 B;  5IXB A;  1R0C B;  1XQH A;  3VUZ A;  4A54 A;  2EYW A;  3HP9 A;  3THK A;  3QDR B;  5CIU A;  2AK5 A;  3OA6 A;  4M77 C;  1N8R R;  4IUU A;  4E2F B;  1YCY A;  3DLL A;  2ED0 A;  1ZSZ A;  3S3M A;  3GOX A;  1Q81 C;  3ER0 A;  1KG1 A;  3QKJ A;  2B86 A;  1XTD A;  4F04 B;  2K4Y A;  1WXB A;  1IB8 A;  4CRI A;  2QA4 Q;  3QO3 A;  2W10 A;  1CKA A;  1RAH B;  2EYY A;  2DL8 A;  4JRK A;  2E6N A;  5KYW A;  1BBZ A;  1U1T A;  2GQV A;  1TTH B;  2E5Q A;  5KE3 A;  1ZUY A;  4J7I A;  3E1S A;  3GF5 A;  3UA6 A;  3LX7 A;  4O6J A;  2DEU A;  2DKG A;  1YI2 T;  1ZSZ C;  2K57 A;  3TQ7 P;  2GFA A;  2EQM A;  3CCM T;  2K2V A;  3I55 A;  1BI1 A;  3LW5 E;  1PC0 A;  1WXU A;  5M9O A;  4JRP A;  1UHC A;  3CQT A;  5GAM d;  2D6F A;  5GAN 8;  2CRE A;  1QWF A;  1OPK A;  2O2O A;  1C0M A;  2Y4Y A;  1JJ2 S;  3L1A A;  1VQ7 T;  4CC3 A;  2X9H A;  1UGS B;  2L3Q A;  3NFC A;  3CME Q;  3QHS A;  2QQS A;  3SDZ A;  1K8A U;  1S72 A;  4XU3 A;  2RI3 A;  4C8Q E;  4C0G A;  4OMO A;  3VS3 A;  1OZ2 A;  5GMK h;  1WXT A;  3CCE A;  3CC4 T;  3JB9 G;  4J9G A;  1I0C A;  2DK3 A;  1VQL Q;  5FW9 A;  2C06 A;  1PG5 B;  2X4J A;  5GAM g;  4C8Q F;  4DBR A;  5CQY A;  4L6V 5;  1JXM A;  2YLC A;  2XDP A;  2YXY A;  1QP2 A;  1HD3 A;  3CC7 A;  2RQU A;  1SSH A;  1WHL A;  2KXC A;  1OV3 A;  1X43 A;  4ORZ A;  1G3T A;  4EPC A;  1M1K U;  4BE0 A;  2RQW A;  1FMV A;  3JCM Q;  2H8H A;  3JCM e;  2JXB A;  2DAQ A;  1WI7 A;  4PK4 A;  1QVF P;  1FMK A;  1M8M A;  2LMJ A;  3SFM A;  1MHN A;  4C0Z A;  4J9F A;  1VQ4 A;  3GNF B;  2DA9 A;  1LCK A;  1Q81 U;  2V8J A;  3LYI A;  3NMZ C;  2EAY A;  3MHX A;  4D8K A;  4M78 B;  1NJI C;  1KHC A;  2DO3 A;  1ABQ A;  1T3S A;  2CKK A;  2OTJ T;  4Q5W A;  1FX7 A;  3OS0 A;  3OBY A;  3JCM X;  3L42 A;  4XTX A;  2K3X A;  4NL2 A;  3VS0 A;  2L89 A;  3HRT A;  2DXU A;  5GAO n;  1Y96 B;  2PQW A;  5GAN h;  1X2Q A;  3CCV A;  3G71 A;  2ECZ A;  3ULR B;  1WLP B;  1M2V B;  5CKB A;  2OTL Q;  2IVW A;  2NWM A;  3EG9 B;  1YJN Q;  4QKU A;  1QVP A;  3P8H A;  5DLO A;  3RIR A;  3JCM c;  2VVK A;  1Y96 A;  4KUL A;  2QQB A;  2EW3 A;  5IHK A;  1ARK A;  3VYH B;  5GAO r;  2RI5 A;  3QBY A;  2RPN A;  1VQ6 A;  2RNA A;  3O5Z A;  2KBT A;  3HL8 A;  4BI3 A;  1RAA B;  3EG9 A;  1JEG A;  1QKX A;  3HRU A;  4E7J A;  3CD6 A;  1PKT A;  1VQP T;  1OU8 A;  3M54 A;  1WHM A;  4XTW A;  3TRE A;  1NPP A;  2MCN A;  2J6O A;  1BK2 A;  1I5L A;  5EC7 A;  4FYW B;  3NPF A;  4F16 A;  2O88 A;  2LQK A;  3QPH A;  4LDU A;  4PJM A;  4J83 A;  1BI2 A;  1S72 Q;  3AHU A;  2RB6 A;  3CBO A;  5A0D A;  3UA7 A;  3OYN A;  4C8Q G;  4DQ2 A;  3CCS A;  3CCE Q;  3MP6 A;  2CZ6 B;  2DIQ A;  2V26 A;  2KRO A;  3V8K A;  3VS1 A;  4M77 D;  2KAF A;  1DJ7 B;  2DYI A;  4QT7 A;  1MMN A;  2JTM A;  3U23 A;  3M0Q A;  4Y91 A;  3VV0 A;  3C12 A;  3HPW A;  1N9S A;  5GJV B;  3M55 A;  1NJI U;  3CBM A;  2X3W D;  2L2P A;  1PD1 A;  2WSE E;  1X6B A;  2MYS A;  4PKC C;  3UPU A;  3GNG A;  1M4Z A;  2M0O A;  3H0H A;  2M9U A;  1AWX A;  3OYD A;  1LVK A;  2DX1 A;  4J5Y A;  5KYY A;  2LNV A;  4M7A G;  3I9Q A;  2FPE A;  1NPR A;  4P5N A;  1MNE A;  4DOW A;  1K9M C;  1VQ5 T;  5CQX A;  4IUQ A;  1TU0 B;  2DF6 A;  1M90 C;  1YJW A;  2F69 A;  4OP0 A;  3EFR A;  4X9D A;  3RMS A;  2EVR A;  1X01 A;  3OYA A;  3FIF A;  2XHC A;  2CYZ B;  3M9Q A;  3OYJ A;  3G4S A;  1RAF B;  4EDU A;  2VC8 A;  4QVZ A;  4CI0 C;  3EAE A;  4EMH A;  2DXB A;  5HK0 A;  4AFZ C;  1D0X A;  2ZZD A;  3S3N A;  1M1K R;  1QKW A;  4DOV A;  2MI6 A;  3I35 A;  1YFN A;  2FPF A;  3RES A;  1RUW A;  2QK0 A;  3OYH A;  2QA4 T;  5J3B A;  2EQI A;  2PVD B;  5LJ5 f;  2CP5 A;  2DTI A;  2GCX A;  1YIT Q;  5GAN g;  2RI2 A;  1Q81 R;  1MMA A;  1GRI A; 
#chains in the Genus database with same CATH homology
 1C6V X;  5D7U A;  1C1A A;  4FW1 A;  4FW2 A;  1EX4 A;  1IHW A;  1C0M A;  1IHV A;  1QMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...