1YP5A

Yeast myo5 sh3 domain, tetragonal crystal form
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
58
structure length
58
Chain Sequence
b'PMFEAAYDFPGSGSPSELPLKKGDVIYITREEPSGWSLGKLLDGSKEGWVPTAYMKPH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin-5 isoform
molecule tags Contractile protein
source organism Saccharomyces cerevisiae
publication title Yeast Myo5 SH3 domain, tetragonal crystal form
rcsb
total genus 11
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2005-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1yp5A00
1AD5A 2O2OA 1K0XA 2RPNA 2M51A 1GCQC 3H0HA 2O88A 4OMLA 4J9GA 1X69A 2PTKA 2HSPA 3NGPA 2CUDA 2EYZA 1JO8A 3THKA 3EG1A 3VS1A 2MIOA 4CC7A 4AFSC 2EYXA 4JPBW 1MUZA 3PVLA 1PNJA 2RQVA 2C0IA 1RUWA 1NYGA 1UJ0A 1W6XA 2LNHB 4JJDA 4RTVA 2F2WA 1QKWA 1NM7A 1KFZA 1NLPC 2KEAA 2NWMA 1X2QA 2YT6A 4J9DA 2KE9A 1BB9A 4R0KA 5ECAA 2O9SA 3LH5A 5GJVB 4HCKA 1T3LA 4AFUC 1JU5C 2OAWA 4LNPA 3U23A 1V1CA 4OMNA 1M3BA 3EG2A 1OPLA 2DNUA 2RQUA 2LQWA 4HVWA 2K9GA 1M27C 2E5KA 2VWFA 4LUEA 3H41A 2FPEA 1K1ZA 3RBBB 2VVKA 1WDXA 2X3WD 1CSKA 1YP5A 1ZSGA 4AFQC 1K9AA 2ROTA 2I0NA 4ZNXA 2DBMA 3VS5A 1IO6A 2DYBA 1ZUKA 2GTJA 2FEIA 3VS3A 2AKKA 1K0SA 3QWXX 1OEBA 2HCKA 3EGUA 2KRNA 3TSWA 2GGRA 2DM1A 1JEGA 2J06A 3PE0A 2DL4A 1VYTA 2LMJA 2L0AA 1N5ZA 1T3SA 1WLPB 4LUDA 2DRMA 2GQIA 4RUGA 1ZUUA 2AKLA 1ZUYA 2CUBA 3VS4A 1B07A 2JTEA 4GBQA 4Z88A 1K4US 1E6GA 2EW3A 2ED0A 1T0JA 2LZ6B 1MV0B 1YNZA 2OJ2A 2DJQA 1UUEA 2A28A 4A63B 2M0YA 4IIMA 2HEQA 3JV3A 2ED1A 2MOXA 2FRYA 2F2VA 1UJYA 1FMKA 1TUDA 2D0NA 2FG0A 3VS2A 2BZ8A 2DBKA 2CSIA 4J9FA 1AOJA 1NG2A 1UHCA 3M0PA 1UTIA 5FWBA 2KYMA 2L3PA 1NLOC 2GTOA 2FPFA 2EGEA 2YSQA 2CT3A 2LJ0A 4OMOA 2D8HA 2ROLA 2J7IA 1UECA 3TSZA 2CREA 1GBRA 2C0OA 4J9EA 3EG3A 2B86A 1M3AA 2ENMA 4RTZA 3SHWA 2ECZA 3VS6A 2YUOA 3UA7A 1T0HA 5FW9A 3REBB 3CQTA 2D1XA 1AWJA 4F16A 2EYYA 5FWCA 2DA9A 4ESRA 1NYFA 2QDLA 1QWEA 2DMOA 1YCSB 2J6FA 3I5RA 1I0CA 1UG1A 2ABLA 4HVVA 4Z89A 4DEYA 3A98A 4LE9A 2SRCA 5GJWB 4M4ZA 1GL5A 3UATA 2GBQA 3ZL7C 1SEMA 1GRIA 2BZXA 1G83A 2H8HA 1UHFA 1XOVA 4WCIA 1WXTA 2KR3A 3EHRA 1PRMC 2KT8A 2AZVA 5IXBA 4RTWA 1ARKA 2X3XD 3PVQA 1SPKA 2G6FX 1CKAA 1W70A 4ORZA 2FO0A 1E6HA 1YN8A 1JQQA 2W0ZA 1Y0MA 1W1FA 2L3SA 3R6NA 1QCFA 3M0TA 3VRZA 5EC7A 4F14A 2HBWA 2DX1A 1X6BA 1JXMA 1X6GA 5IXFA 1PHTA 2V1RA 1H3HA 4CC3A 1KSWA 1ZBJA 2EVRA 4AG1C 4J9IA 1K76A 2JT4A 1UDLA 1ABOA 2C0TA 5IHKA 2J6KA 2JM9A 4RTYA 1Z9ZA 2DL8A 1E7OA 1GBQA 1PKSA 1J3TA 2NUZA 2LQNA 2L3QA 3H0FA 4KRTA 1WI7A 5I22A 3M0RA 2OI3A 1BU1A 2DVJA 1M30A 4D8DA 2EBPA 1PKTA 1ZX6A 4EIKA 4OMQA 1RLPC 2XMFA 1CKBA 4D8KA 3FJ5A 1QWFA 1RI9A 4RTTA 3UF4A 1WX6A 1I07A 2YUPA 4F17A 2DRKA 3ULRB 2SEMA 2JS2A 1SHGA 3UA6A 1ABQA 3EHQA 2JMAA 2FPDA 1HSQA 3VS7A 2RMOA 2F2XA 1EFNA 2DE0X 2KT1A 4X1VA 2DLPA 1HD3A 2IIMA 1TG0A 4HXJA 1QKXA 2RQWA 1PRLC 2RF0A 1TUCA 3M0SA 1SRLA 1M3CA 2YUQA 2AZSA 4JZ4A 1NEBA 1WFWA 2O31A 4Y92A 4QT7A 2K6DA 1OPKA 1VYUA 5L23A 1LCKA 2LJ3A 2HDAA 1YWPA 2KRSA 2DL3A 5IH2A 3SEMA 4LN2A 2BZYA 3QWYA 1HJDA 2JMCA 1U5SA 2CSQA 1I1JA 1Y57A 1S1NA 1WXBA 1B3QA 1OV3A 2RQRA 1FYNA 2A36A 1GFDA 2JS0A 3I9QA 4AG2C 1KIKA 2YDLA 4CC4B 3H0IA 2RN8A 3NHNA 1AWXA 3I5SA 2LCSA 4K11A 2VKNA 2GNCA 2A08A 5IHIA 4DEXA 4OMMA 1X43A 2RNAA 3M0QA 2A37A 4CC2A 4Z8AA 1H92A 2EGAA 2J05A 1GCQA 1A0NB 1H8KA 1AVZC 1YWOA 4JJCA 3GBQA 2PZ1A 1GCPA 2K79A 2CDTA 2BTTA 1NEGA 1WXUA 3RNJA 2LJ1A 3I35A 1UGVA 1SSHA 4FSSA 1KJWA 1GFCA 2CH4A 4J9CA 2KNBB 1AWWA 1X2KA 1SRMA 2J6OA 2EKHA 4HVUA 2EGCA 4OMPA 1MV3A 3VRYA 1Z9QA 2JXBA 2JM8A 2EQIA 3NMZC 1AWOA 1WIEA 4IIOA 2EYWA 2P4RA 2DF6A 4E6RA 2LX7A 3KFVA 1PWTA 1VA7A 1QLYA 2ESWA 2KYBA 1X27A 2KRMA 1BK2A 1RLQC 2W10A 2YUNA 5I11A 4JJBA 2KBTA 4GLMA 1SHFA 1G2BA 4JZ3A 3C0CA 3REAB 2LP5A 2K2MA 2DL5A 5IHNA 2KGTA 3O5ZA 4AFZC 5HCKA 3EG0A 3VS0A 1WA7A 2DILA 3M0UA 1AZEA 2V1QA 1BBZA 4RTXA 2AK5A 2CT4A 2D8JA 2K3BA 2L2PA 4J9HA 2DL7A 1AZGB 1AEYA 2KXDA 3NPFA 1OOTA 2K7AA 2EPDA 2RQTA 1VYVA 1U06A 2PNIA 2KROA 1WYXA 2KXCA 4RTUA 1U3OA 2O9VA 3IQLA 4J9BA 2FRWA 3TVTA 2JW4A 1ZLMA 1UFFA 2MCNA 1UE9A 2CH4W 1M8MA 1JXOA
chains in the Genus database with same CATH superfamily
1AD5A 2O2OA 4JLIA 2M51A 5FU7C 2HSPA 3CCMA 2O4XB 3L2QA 1QVGP 1Q95G 2JTMA 1JO8A 3MHXA 3QJ6A 3CC4A 2EYXA 4JPBW 3KXTA 3G7ZA 2GF7A 3RERA 3MO8A 5CKFA 4IURA 5KE2A 1W6XA 2PU9B 1IZ6A 1W2BP 2JN0A 1SKUB 3LYIA 2X51A 4RTVA 1JRIA 1VIFA 2EQJA 3INZA 1YI2A 3EAEA 3GPLA 1XNIA 4J9DA 3RKWA 2KE9A 4NS5A 1KHCA 2HSEB 2YLBA 5GJVB 3E9FA 3QYHB 3V8KA 3OS5A 3OYGA 2XKOC 3QUIA 1YHQA 3DLMA 4CRIA 5LJ3g 1VQ6Q 2QYZA 1K73R 4HVWA 4M78D 2AIRB 2P0PA 5I2MA 3CCLA 1WDXA 1Q82C 8ATCB 2X3WD 4IUPA 3HRSA 3OYKA 4QQGA 3CC4T 2DXBA 4ZNXA 2I0NA 2DBMA 2GTJA 4LDXA 1K0SA 1QW1A 1M2VB 2HCKA 4PKCC 1YIJQ 3NTKA 3CBPA 2DTHA 2LMJA 4DOWA 2IVWA 4ZN3A 4M77A 2DRMA 2GQIA 4M75G 2HZYA 1Q7YU 2V8IA 1ZUYA 2CUBA 2FYKA 3QXEB 5CQYA 5I21A 1BYMA 2QA4A 1KQ2A 5I2SA 2OTJT 4KUIA 4M77B 2OJ2A 5LJ5d 1VQMA 2DFUA 2F5TX 4E7JA 2M0YA 2HEQA 2MOXA 2E70A 5FLXE 4PJOG 2LCCA 3FB9A 2WSFE 5FROA 2CS7A 3NTIA 1UJYA 5HK3A 2EIFA 1FMKA 3VS2A 2BZ8A 1KD1R 1AOJA 1UHCA 5FWBA 4J6XA 3OYAA 2FPFA 2YSQA 3DB3A 4BB7A 4E7IA 1RL2A 1D0ZA 2ROLA 5IT9E 1UECA 2ZPFB 4V2SA 5FU7B 5GAOr 2D0QB 2A3LA 4HKEA 1O75A 5EG2A 2ENMA 3G71A 2Y4YA 3EG9A 1V29B 3UA7A 3GNGA 3OYBA 3CQTA 2K5FA 1YI2T 3A5ZB 4NL3A 1M1GA 2WSEE 3I55A 5LJ3f 3CCQA 3CCJA 1QWEA 4PJOB 2MWOA 2YHTA 3MJXA 1UG1A 2ABLA 3URGA 2MYSA 2HD0A 2SRCA 4M4ZA 2FZGB 1GL5A 3VUBA 1VQOA 3CD6T 2BZXA 2XIDA 3VUZA 1Y71A 2XG8D 2RA2A 1XOVA 4RCCA 3I55T 1WHGA 2KT8A 2AZVA 2QQBA 1ARKA 3PVQA 1SPKA 3C95A 1CKAA 1W70A 5LJ5f 3CCMT 1E6HA 2K5LA 2W0ZA 2QQAA 1V76A 1M90R 1OU8A 1AHJB 3GNFB 2COYA 1W1FA 2CH4W 2CKKA 1YCYA 5EC7A 4F14A 2LT1A 3DB4A 1XQHA 2DX1A 5GAOl 1X6BA 1X6GA 2K3YA 5IXFA 2HKNA 2V1RA 1H3HA 5GAMh 2DK3A 1YJWQ 5HK0A 4F7UA 2JT4A 3RMSA 1VQ4T 5LJ5g 2JUFA 4J5YA 2OAUA 3BDLA 3M54A 5CKHA 5GAN4 3MCAB 1C1AA 5LJ3j 3CXCS 1J3TA 2LQNA 2L3QA 3UPUA 3T9NA 1D09B 1MNDA 4D8KA 3FJ5A 3N5BB 1QWFA 3HKSA 3VU3C 2PUOB 1RI9A 5GANg 4C8QD 2YUPA 2FZCB 2X4YA 1BI0A 2M0OA 3DKMA 3R6OA 3UA6A 1ZSZA 2XDPA 2YRCA 4BE0A 2JMAA 1QVGS 4LD6A 1Q7YC 3CCVQ 4DA4A 2F2XA 3QYGB 4X1VA 2KT1A 1GXIE 4KBMB 2NUTB 4MMKA 1HD3A 1RAEB 2IIMA 3CD6A 1TG0A 2KAFA 3JCMV 2CZ7B 1HXDA 4RG8A 3M59A 1SRLA 5CQXA 3UWNA 1M3CA 3CCLT 4JZ4A 3EGDA 3OYCA 2QQSA 1VYUA 4M78C 3CCJT 3SWNC 1LCKA 1RACB 2LJ3A 2HDAA 3CPWA 2K4YA 3OYMA 2KRSA 3JCMf 1PG5B 4LN2A 4FU6A 3OYYA 1YJ9Q 2JMCA 1U5SA 2CSQA 5DM7R 3G71T 5J26A 4JLGA 3LWHA 2M16A 2A36A 1JJ2A 4L5GA 4ME7A 3PIOA 3AT1B 1AWXA 4QKUA 3L42A 3FRNA 4RCBA 1TUGB 2E64A 4OMMA 2RNAA 4J7FA 1FMVA 5GANj 1KHIA 2F69A 4M7AF 2VASA 3PIPA 3GOXA 3LWIA 1H8KA 2E6ZA 1Q86R 4C92G 4LDUA 2QA4Q 1VQOT 2QG9B 1ZBXA 2PZ1A 1QCNA 2K79A 2QEXT 1WXUA 1PD1A 3OYFA 4A53A 4M75E 2COZA 4FSSA 2D9TA 2MF2A 3OW2A 4M78F 2CH4A 5CO7A 3CCQT 1TH7A 2JNGA 1SRMA 2EKHA 5GAMe 1MV3A 2JXBA 4UC4A 5GMKe 1ZA2B 4IIOA 2EYWA 3OYIA 2ZCFB 4E6RA 3KFVA 2RHUA 5KH6A 1VQ7A 3EGDB 4B9XA 2KMTA 1QLYA 1QVGA 3H6ZA 1KQSA 1K8AC 3FC3A 1YITA 4GLMA 4JZ3A 4JRKA 4BI8B 1NPRA 2DL5A 3JCMh 4XK8E 3X24B 3O5ZA 3E2UA 1VQ5A 4BDYA 3M0UA 3RUXA 1FX7A 1WHJA 5GAOm 2LX9A 2D8JA 1M8VA 2K3BA 2L2PA 1IRXA 1QP2A 3F70A 3A8LB 1AZGB 4LD9K 2VXFA 1AEYA 1C0MA 4LDYA 5LL6S 1OOTA 2QEXQ 1M2OA 2KSSA 1U06A 2K3XA 2MI6A 3H9NA 3CCRA 4EDUA 2OTJA 1XTDA 1WYXA 4E7HA 2CP6A 2KXCA 2V8JA 2WSCE 4BACA 2O9VA 3IQLA 1RABB 2VGNA 4C92D 2FRWA 2QI2A 2P4TA 1WHKA 1K0XA 4O5VA 3H0HA 4J9GA 2JOYA 1W4SA 2RJCA 2FVUA 2CP5A 1RAIB 4FM4B 2KY9A 3LX7A 1N8RC 3THKA 3O8VA 2VYTA 4A54A 3EGXA 4FT2A 1WHMA 3M57A 1U1TA 1N9RA 2DKGA 1LNXA 1MUZA 2HL3A 1YJ9T 3PVLA 4KUDK 1PNJA 1VQ8A 4C8QE 5GAN3 2E3HA 4JDSA 1RUWA 1UJ0A 2E6NA 2EJFA 5C6SA 3PMTA 5KE3A 4M77E 1TU0B 5DY9A 1NLPC 2NWMA 2M02A 4PJLA 4KGZB 2GQVA 4JRPA 1BB9A 2EQKA 2X4XA 1BI2A 5GAMf 1QVPA 3JCMQ 1VQKQ 3CCVT 1M90U 3I55Q 1JU5C 1BKBA 3OMGA 4C5HA 1KC8C 3OA6A 3ZFJA 3A8GB 2LQWA 2RHXA 1D3BB 4F7UF 3RBBB 5A0LA 1I4K1 3WVDB 4C92A 2HQHA 3GLXA 4EMKA 3A8HB 3TCJA 5HY6A 3HP9A 3OYDA 5J39A 2E4HA 1W2BA 1ZUKA 2FEIA 2YXYA 5CK9A 4M75B 1QCOA 4PK4A 1ZQ1A 2J06A 4QVZA 4J6YA 2DL4A 3MEVA 1N5ZA 1IHWA 1WLPB 4LUDA 4RUGA 1TWBA 1WJQA 1M4ZA 5KCHA 3MEWA 3EFRA 4XTWA 1Q81R 1B07A 5KYUB 2CZ1B 4Z88A 1M90C 1E6GA 4FYWB 1KQSP 2EFIA 5AT1B 2E10A 4HT9A 2DTIA 1MV0B 2RJEA 4BD3A 4NL2A 2LDMA 4BE2A 2DJQA 1UUEA 2LQKA 1VIEA 3CCMQ 3HTRA 1K8AU 2A28A 3D7SB 4OGEA 4F7UG 3RIRA 4RG2A 2F2VA 1UGRB 1VQ4A 3L1AA 5C0MA 1B34A 1MGQA 2D0NA 1DJ7B 2DBKA 2CP2A 4XU0A 4E7KA 3M0PA 1UTIA 3MEAA 4DOVA 3I56T 4OGCA 4FIBA 4A4HA 2KYMA 2L3PA 1NLOC 1VQ9T 1QMCA 2LJ0A 4JS4A 4M7DE 1SG5A 3C94A 2FL7A 4C8QB 1MMAA 1WHLA 2BIVA 4PJMA 1GBRA 4J9EA 3CMAQ 4PFPA 1M3AA 1TTHB 2YUOA 1T0HA 4PLLA 4OMFB 5FW9A 4HCCA 2DZ9A 5IAYA 1ZSZC 2DA9A 5FWCA 5GAOq 2QDLA 1O9SA 3M4GA 2L8DA 3CMEQ 4LE9A 1JJ2P 5GJWB 4M7DA 3J7AF 1Q7YR 2WACA 3ZL7C 4JJNK 4MMLA 3OBWA 1OX9A 5KCOA 1YJNQ 4WCIA 1WXTA 2KR3A 3CMEA 5IXBA 1OYXA 2KDSA 5GAMd 4M77G 3G4SQ 2VC8A 1YN8A 2OTLQ 4GLKA 1Y0MA 5A2QE 5IN1A 3HL8A 2OTJQ 3VRZA 3V7CA 3RKXA 1JXMA 1VQNT 1PHTA 2V26A 4R56A 3S3OA 4B9WA 2EVRA 3OS0A 1G3TA 4AT1B 2DD5A 1UDLA 1ABOA 2RHZA 3PTAA 5IHKA 1Z9ZA 4C92C 1G5VA 1WQWA 1GBQA 3JAME 1VQMT 3CBOA 4KRTA 3CC4Q 2Z0WA 1U1SA 3A8OB 1M30A 1IXDA 2JJ9A 2QA4T 2E3IA 5D6WA 4L59A 3PFSA 3CC7T 3HPWA 4RTTA 3UF4A 1X01A 4ATOA 2MK5A 5CKDA 2JVVA 1VQLT 3TEEA 2CP3A 1MMGA 2HNIA 2JS2A 1SHGA 4M78A 3EHQA 5CCAA 4OB1B 3CD6Q 2HAXA 4A4GA 5M9OA 4B6MA 4Q5WA 3VKIA 3CCEA 4FW1A 3S6WA 1D0YA 1EFNA 2I2LA 1AT1B 1I5LA 1OU9A 3VYHB 1OQKA 4MZPA 1D3BA 1YJNA 5KYYB 1RADB 2YUQA 3JB9I 1WFWA 4Y92A 3CPFA 1OX8A 1MHNA 5L23A 3CCUT 4J8OA 1YWPA 3WVEB 3SEMA 4TVRA 3QWYA 5LJ5j 3G6ET 2BE7D 1S1NA 3ZEHA 1WXBA 1FYNA 1WHHA 3JB9G 3PNWC 3J80E 5DLOA 4AG2C 2MWPA 3H0IA 2XU8A 2RN8A 3QDFA 3NHNA 3I5SA 1P92A 2LCSA 5IHIA 2M1HA 5KYUA 1ACMB 4QVDA 4JRIA 3META 2RHIA 3NFCA 1H92A 2EGAA 1GCQA 2COWA 3QPHA 4OF1A 1A0NB 2DYIA 2XICA 1YWOA 1PM3A 4FW2A 3G4ST 4BE1A 3L2WA 4ZTJA 3GBQA 4M77C 4N4HA 3OSVA 4AMCA 3OYLA 4M75C 1YJNT 3I35A 1UGVA 1GFCA 2KNBB 1FWZA 1B7TA 3LGLA 3G1JA 5LJ5h 1X2KA 2ZAEA 1YIJT 2XK0A 2NUTA 4EMKB 4HVUA 1VQ7Q 3VRYA 1Z9QA 3LH0A 4DBFA 1Y96B 1EIFA 4FT4A 4MDWA 2EQIA 3NMZC 1M5Q1 2XI9A 5A0GA 3JCMd 4KGVB 5L8RE 2PUKB 2JTFA 3CCUQ 1YITQ 3CC2Q 4BI4A 1VA7A 2XDDA 2W10A 5GAN5 3QZ5B 1UGQB 3HFOA 5LJ3h 2O01E 1UB4A 1S72T 1VQ6T 5HCKA 4PJJA 2DILA 1AZEA 1BBZA 2RI5A 4RTXA 1M1KR 4J9HA 1VQPT 4M77F 4XU2A 2KXDA 1BCMA 3NTHA 4C0DC 2EPDA 1S72Q 3JRZA 5FRNA 4VUBA 3EH2A 4M7AB 3MKDA 3GF5A 3UT1A 1M1KU 4J9BA 1YJWA 3JCMe 1ZLMA 1UFFA 3OY9A 4D6WA 1KC8U 2QQRA 4E47A 1M8MA 2ZZDA 2RPNA 4LDWA 1GCQC 2O88A 2BE9B 4OMLA 4KULA 2HBPA 1LPLA 3NGPA 4JUVA 1QVFA 5GMKm 3VS1A 7AT1B 1Y7XA 1R0CB 2MIOA 2KVQG 3A8MB 2L89A 1Q81C 3ASKA 2CP7A 2IG0A 1VQNQ 1K73U 4ELZC 1NYGA 2GCXA 1D1BA 4PLIA 2LNHB 2M9UA 4JJDA 2IPOB 2F2WA 1QKWA 1NM7A 2ZPEB 1KFZA 2LC4A 1JBMA 1X2QA 2YT6A 4OP0A 1EZZB 1X75C 2CGHA 5KYYA 4PJOE 5ECAA 2X4JA 2O9SA 4M7DD 5GAMg 2OAWA 3OQ5A 1TS9A 1RAAB 4LNPA 3CPWP 1V1CA 4OMNA 1M3BA 3CMAA 3M53A 5D6XA 3EG2A 2R5AA 3CC2A 1NZ9A 2K9GA 2VWFA 2E5KA 4C92F 3H41A 2XD0A 5FRMA 1IB8A 1K1ZA 3CCEQ 3MPUB 3CC7Q 2VVKA 4RKUE 3EH1A 1D1CA 2AHJB 1NE8A 1CSKA 1YP5A 1G3WA 1ZSGA 4AFQC 4X9DA 4IUTA 4OVAA 3VS5A 2DYBA 3TREA 2QAZA 1UGPB 1H641 1OEBA 3EGUA 2KRNA 3TSWA 2GFAA 2GGRA 3BFMA 1JEGA 3BE3A 3PGGA 2L0AA 2ZPIB 1T3SA 2DZCA 4FCYA 1ZUUA 2AKLA 1YIJA 2JTEA 5KYWB 4R55A 2EW3A 3JCMP 2ED0A 2KK4A 4KH1B 1T0JA 3CXCP 3P8BB 4A4FA 4IIMA 1BI1A 2JZ2A 2K57A 3JV3A 2ED1A 3H8ZA 3M9QA 1M2VA 4C0DB 1TUDA 2VUBA 4N4IA 1TXQA 6AT1B 4M7AC 3P8HA 3C12A 2EGEA 2HKQB 2EJ9A 4OMOA 4OB3B 4XTVA 2D8HA 3RKYA 3E19A 5LJ3d 2J7IA 4M7DC 3TSZA 2CREA 5D6YA 4FYYB 3OW2S 3GIBA 4RTZA 2ZPGB 3VS6A 1LVKA 3REBB 2D1XA 5FU6B 3HRUA 1R77A 1IREB 1NYFA 2RJFA 1YCSB 2J6FA 4IUUA 4HVVA 3A98A 1VQ8T 3CCQQ 2GBQA 1YJ9A 5GMKj 1GRIA 4E2FB 1G83A 2H8HA 1RAGB 3SFMA 3EHRA 1PRMC 1Y96A 2DVEA 2DJZA 2QGGA 4IUQA 2EQUA 2X3XD 2RK2A 1VQOQ 2G6FX 1LOJA 2FO0A 2DXCA 4C5GA 1NJIU 2DXTA 1WNLA 2MMPA 1KC8R 2FHDA 3SDZA 2L3SA 3M0TA 2CP0A 1F1BB 4XTYA 1OZ2A 4PJOD 5HKCA 2LCLA 2RH2A 2RHYA 1VQMQ 2DERA 4CC3A 1KSWA 2MPXC 3CPWS 1PSFA 3EGXB 4J9IA 4AG1C 2LVMA 4J7IA 4BI3A 4EMGA 2RI3A 1VQ9Q 2J6KA 1RAHB 4EPCA 4PNOA 2DL8A 1I5OB 1E7OA 1RI0A 4M7AA 3SWNB 4PJOC 3SD4A 1PKSA 5I22A 3CCSA 2OI3A 1BU1A 3HSBA 3FLGA 4D8DA 2EBPA 5GAN8 4OMQA 1RAFB 1CKBA 1VQKA 3JCMJ 2EJGA 3HRTA 2BUDA 5DLQE 2C06A 1KQ1A 4J6WA 2SEMA 1ABQA 1IGQA 1HSQA 2LNVA 3VS7A 3QBYA 2RMOA 4F7UE 1K9MR 4F04B 3CMET 2DE0X 4E7SA 3CXCA 1QKXA 4EMHA 1PRLC 4E7LA 3CCST 3SB2A 2VGMA 3CEYA 1NEBA 2O31A 4IKFA 4DBRA 3CMAT 4M7AD 2DL3A 5IH2A 2DD4A 3MP6A 4C5EA 1HJDA 2PQWA 1YFNA 1SF9A 4NOYA 5GMKl 1Y57A 2AT1B 3JCMW 4HA8A 1B3QA 1OV3A 2RQRA 2P0QA 4A4EA 2MAMA 1GFDA 4BY6C 3L2VA 3Q1JA 3I9QA 2PVDB 1KIKA 2YDLA 4CC4B 5FU6C 4GY5A 5KYWA 3X20B 1YBYA 3M55A 4BY6B 4ZN1A 2GNCA 2A08A 3G6EA 4DEXA 3VV0A 1WZOA 2DETA 2ATCB 1M1KC 3M0QA 3JB9H 2F1LA 4CC2A 4Z8AA 3OMCA 2H3EB 3CCSQ 2EWNA 3QJYA 1AVZC 1SSFA 4JJCA 2FZKB 2DIGA 2BTTA 1Q86U 1NEGA 5CKEA 3RNJA 1WGSA 5CKBA 2O4XA 1KJWA 1H3ZA 3QKJA 1VOMA 5CVIA 5D7UA 2GFUA 3LW5E 4XU3A 1Q82R 2J6OA 5GANf 3MEUA 2EGCA 4M78G 3ZBDA 2KQWA 2E1HA 1AWOA 1WIEA 1WPYA 2P4RA 4M7AE 2DF6A 2LX7A 5AYFA 3EFOA 1PWTA 5GMKh 4ZTFA 2KRMA 3OBYA 3OS1A 3EG9B 4A4KA 1RLQC 1QVFP 3CCLQ 2CYZB 4JJBA 5GAOn 3I56A 2ZPBB 1G2BA 4X9CA 3C0CA 5LJ5e 3REAB 2LP5A 4XTXA 3AHUA 3L2RA 2E12A 1R8OB 2KGTA 1VQ6A 4AFZC 3EG0A 1S72A 3VS0A 4WF2A 2AK5A 1BI3A 4FYVB 2NYSA 4Y28E 4C8QA 3QG1A 2NUPA 3KBGA 2RQTA 1VYVA 5KYNA 1PC0A 2PNIA 2KROA 3JB9F 2LTOA 5GANe 2QK0A 2E41A 4DBQA 3TVTA 4E7ZA 5GAN7 2JW4A 4C92E 1JXOA 4QQ6A 2X4WA 3V7SA 1X69A 3PMIA 3E9GA 2PTKA 5A0DA 2ZGWA 1D0XA 4HCBA 2CUDA 2XDBA 2L3RA 2EYZA 2EAYA 9ATCB 3EG1A 3V7RA 4CC7A 4F7UB 1VQ4Q 1K9MU 4II1A 4AFSC 2QGFB 2XHCA 4L6V5 2RQVA 3HHTB 2C0IA 1YI2Q 3UDCA 1PD0A 4JRQA 2QTXA 1NBEB 4PJOF 4Y91A 4C92B 1Q82U 1FMWA 3QSUA 3ER0A 4M77D 2KEAA 4XTZA 4M75A 2VV5A 3CBMA 5KYXB 1NJIC 2HMAA 4R0KA 1K8AR 3CCVA 4HCKA 4QQDA 1T3LA 4AFUC 1M9SA 2PVGB 4C0GA 2YWWA 3U23A 3MP1A 4C5IA 3S3MA 1OPLA 2DNUA 2RQUA 1G3YA 1M27C 4LUEA 2FPEA 1D1AA 3JB9D 4KH0B 2EYQA 2LQ8A 2Y4XA 3RR6A 1WJSA 4QW2A 1MMNA 1K9AA 3S3NA 1ZA1B 5CAIA 4MDXA 2DXUA 2ROTA 2PVOB 1QP3A 1IO6A 3VS3A 3OS2A 2AKKA 3QWXX 4M78B 1TSFA 2QTVA 1FXXA 4P5NA 1EX4A 1G8XA 2DM1A 4QVCA 4XQ3A 3PE0A 2OX7A 3G6EQ 1VYTA 2V8KA 2VXEA 4RMOA 1VQKT 3VS4A 4GBQA 5GAMj 1BIAA 3JCMg 4C0ZA 1K4US 2ZPHB 4PJNA 2CZ6B 3JCMb 2LZ6B 1YNZA 4XTUA 5GAN2 1X6OA 2CZ0B 2DEQA 4WTOB 4A63B 1VQPA 2RI2A 3LLRA 2HQEA 2FRYA 1Y07A 3A1PA 1N27A 2FG0A 3FEOA 3OYNA 2E65A 2P84A 3L2UA 3VYGA 3PT9A 2CSIA 4J9FA 1NG2A 3OYEA 2DPPB 4BDZA 1OZ3A 2RO0A 1VQ8Q 2GTOA 1NPPA 2CT3A 1K9MC 2LRQA 2RJDA 2NUPB 2D6FA 4M75F 5CIUA 1HK9A 2RK1A 3JSCA 5LJ3e 2C0OA 3V8JA 3DLLA 3EG3A 2B86A 3SHWA 2ECZA 3CCJQ 1W2BS 3TQ7P 3QHSA 4FL6A 2K5IA 1I81A 1NJIR 4KT0E 3E1SA 1AWJA 4F16A 4M7AG 2DAQA 1XJWB 2EYYA 3CCUA 4ESRA 1HYOA 2DMOA 2LT4A 3I5RA 1I0CA 4Z89A 1MMDA 3JB9J 4PL6A 2EKOA 4DEYA 4JS5A 2QEXA 2YRDA 1WQ7A 4M7DG 3UATA 3CCRQ 4N0AC 2K2VA 1SEMA 4J83A 4HT8A 1R0BG 1K73C 4M75D 3G4SA 3JCMX 3M56A 1UHFA 1KG1A 5GAN6 4M7DF 1G3SA 3EFOB 3EFSA 4RTWA 1KD1U 4ORZA 3KUFA 1M1FA 1JQQA 1MNEA 1VQLA 4ZGEB 3R6NA 1QCFA 2DO3A 2HBWA 2P0KA 2A7YA 3JCMc 3FJPA 2OTLA 3OW2P 3OB9A 4OB2B 1PCXA 3M58A 4LXCA 1ZBJA 2F5KA 3CCRT 1K76A 3RESA 2C0TA 2JM9A 3OSSC 4RTYA 2QQ9A 3HFNA 1C6VX 2NUZA 3H0FA 1WI7A 5GMKi 3M0RA 3J81E 2DVJA 1PKTA 1ZX6A 4EIKA 3QIIA 1RLPC 1YITT 2Y90A 1Q86C 5GANh 3BW1A 2XMFA 2YRVA 3P8DA 4X34A 1VQNA 2R57A 1Q81U 3CCET 1N9SA 1WX6A 1I07A 4F17A 2DRKA 3FIFA 3ULRB 1VQ7T 1KD1C 3BDUA 2NLUA 3X28B 4PFZA 3VJPA 3C4SA 2FPDA 2R58A 2RM4A 4YTLA 4XAXB 2DTOA 3CC7A 2VB6A 2BKDN 2DLPA 2DEUA 3RMQA 3G71Q 3L2ZA 4N0AA 4HXJA 1I8FA 4XU1A 2RQWA 2RF0A 1TUCA 3M0SA 3X26B 2QASA 2L5QA 4BUGA 3QZ9B 4FYXB 2AZSA 2HL5C 4MZMA 4DBHA 3OYHA 4QT7A 1KK7A 1OPKA 2K6DA 3CC2T 4M78E 1QQJA 2X9HA 3X25B 4EMKC 4IUVA 2BZYA 1I1JA 2R5MA 4C8QG 4ZGJB 2FB7A 4N4GA 3GP8A 5GANd 2H3JA 5J3BA 1VUBA 1OI1A 2JS0A 1BIBA 3OYJA 4C8QF 3M4YA 4FSXA 2YLCA 1VQ9A 4K11A 3SWNA 2VKNA 1U8RA 2HQXA 1X43A 2A37A 4KGXB 4PFOA 1UEBA 2J05A 3QO3A 3FDRA 1GCPA 2QXFA 2CDTA 2X35A 2G3RA 2E5QA 2QDYB 1N8RR 2LJ1A 1VQPQ 1SSHA 3QDRB 1JB0E 4J9CA 1UGSB 3TU4K 2DIQA 4C0FA 4O6JA 1AWWA 1JJ2S 4DQ2A 4M7DB 4LDVA 4OMPA 1IHVA 1PSEA 3ME9A 2JM8A 1YJWT 1IGUA 2B8AA 3WXMB 1N8RU 4ELYC 4ZGDB 1ZSZB 2EQMA 1ZHIA 2RB6A 3MP8A 1LJOA 4C8QC 2KYBA 2ESWA 1TOVA 1X27A 1BK2A 1N6AA 2YUNA 5I11A 5KYXA 3LGFA 2KBTA 3RDVA 1SHFA 5GAOp 2RD1A 1BCOA 2K2MA 1YHQQ 4MZTA 4CI0C 5IHNA 1VQ5T 4PJOA 4OB0B 1WA7A 3I56Q 2V1QA 3V8LA 2CT4A 3M5AA 2DL7A 1QVFS 3NPFA 2K7AA 1B34B 1VQ5Q 2A0FB 8AT1B 1VQLQ 2KI7A 3BY7A 1YHQT 4ANJA 4HCZA 4RTUA 2OTLT 1U3OA 1WJRA 5CR2A 2MCNA 1OULA 4Z02A 1UE9A 1KQSS 3LH5A
chains in the Genus database with same CATH topology
1AD5A 2O2OA 1K0XA 2RPNA 2M51A 1GCQC 3H0HA 2O88A 4OMLA 4J9GA 1X69A 2PTKA 2HSPA 3NGPA 2CUDA 2EYZA 1JO8A 3THKA 3EG1A 3VS1A 2MIOA 4CC7A 4AFSC 2EYXA 4JPBW 1MUZA 3PVLA 1PNJA 2RQVA 2C0IA 1RUWA 1NYGA 1UJ0A 1W6XA 2LNHB 4JJDA 4RTVA 2F2WA 1QKWA 1NM7A 1KFZA 1NLPC 2KEAA 2NWMA 1X2QA 2YT6A 4J9DA 2KE9A 1BB9A 4R0KA 5ECAA 2O9SA 3LH5A 5GJVB 4HCKA 1T3LA 4AFUC 1JU5C 2OAWA 4LNPA 3U23A 1V1CA 4OMNA 1M3BA 3EG2A 1OPLA 2DNUA 2RQUA 2LQWA 4HVWA 2K9GA 1M27C 2E5KA 2VWFA 4LUEA 3H41A 2FPEA 1K1ZA 3RBBB 2VVKA 1WDXA 2X3WD 1CSKA 1YP5A 1ZSGA 4AFQC 1K9AA 2ROTA 2I0NA 4ZNXA 2DBMA 3VS5A 1IO6A 2DYBA 1ZUKA 2GTJA 2FEIA 3VS3A 2AKKA 1K0SA 3QWXX 1OEBA 2HCKA 3EGUA 2KRNA 3TSWA 2GGRA 2DM1A 1JEGA 2J06A 3PE0A 2DL4A 1VYTA 2LMJA 2L0AA 1N5ZA 1T3SA 1WLPB 4LUDA 2DRMA 2GQIA 4RUGA 1ZUUA 2AKLA 1ZUYA 2CUBA 3VS4A 1B07A 2JTEA 4GBQA 4Z88A 1K4US 1E6GA 2EW3A 2ED0A 1T0JA 2LZ6B 1MV0B 1YNZA 2OJ2A 2DJQA 1UUEA 2A28A 4A63B 2M0YA 4IIMA 2HEQA 3JV3A 2ED1A 2MOXA 2FRYA 2F2VA 1UJYA 1FMKA 1TUDA 2D0NA 2FG0A 3VS2A 2BZ8A 2DBKA 2CSIA 4J9FA 1AOJA 1NG2A 1UHCA 3M0PA 1UTIA 5FWBA 2KYMA 2L3PA 1NLOC 2GTOA 2FPFA 2EGEA 2YSQA 2CT3A 2LJ0A 4OMOA 2D8HA 2ROLA 2J7IA 1UECA 3TSZA 2CREA 1GBRA 2C0OA 4J9EA 3EG3A 2B86A 1M3AA 2ENMA 4RTZA 3SHWA 2ECZA 3VS6A 2YUOA 3UA7A 1T0HA 5FW9A 3REBB 3CQTA 2D1XA 1AWJA 4F16A 2EYYA 5FWCA 2DA9A 4ESRA 1NYFA 2QDLA 1QWEA 2DMOA 1YCSB 2J6FA 3I5RA 1I0CA 1UG1A 2ABLA 4HVVA 4Z89A 4DEYA 3A98A 4LE9A 2SRCA 5GJWB 4M4ZA 1GL5A 3UATA 2GBQA 3ZL7C 1SEMA 1GRIA 2BZXA 1G83A 2H8HA 1UHFA 1XOVA 4WCIA 1WXTA 2KR3A 3EHRA 1PRMC 2KT8A 2AZVA 5IXBA 4RTWA 1ARKA 2X3XD 3PVQA 1SPKA 2G6FX 1CKAA 1W70A 4ORZA 2FO0A 1E6HA 1YN8A 1JQQA 2W0ZA 1Y0MA 1W1FA 2L3SA 3R6NA 1QCFA 3M0TA 3VRZA 5EC7A 4F14A 2HBWA 2DX1A 1X6BA 1JXMA 1X6GA 5IXFA 1PHTA 2V1RA 1H3HA 4CC3A 1KSWA 1ZBJA 2EVRA 4AG1C 4J9IA 1K76A 2JT4A 1UDLA 1ABOA 2C0TA 5IHKA 2J6KA 2JM9A 4RTYA 1Z9ZA 2DL8A 1E7OA 1GBQA 1PKSA 1J3TA 2NUZA 2LQNA 2L3QA 3H0FA 4KRTA 1WI7A 5I22A 3M0RA 2OI3A 1BU1A 2DVJA 1M30A 4D8DA 2EBPA 1PKTA 1ZX6A 4EIKA 4OMQA 1RLPC 2XMFA 1CKBA 4D8KA 3FJ5A 1QWFA 1RI9A 4RTTA 3UF4A 1WX6A 1I07A 2YUPA 4F17A 2DRKA 3ULRB 2SEMA 2JS2A 1SHGA 3UA6A 1ABQA 3EHQA 2JMAA 2FPDA 1HSQA 3VS7A 2RMOA 2F2XA 1EFNA 2DE0X 2KT1A 4X1VA 2DLPA 1HD3A 2IIMA 1TG0A 4HXJA 1QKXA 2RQWA 1PRLC 2RF0A 1TUCA 3M0SA 1SRLA 1M3CA 2YUQA 2AZSA 4JZ4A 1NEBA 1WFWA 2O31A 4Y92A 4QT7A 2K6DA 1OPKA 1VYUA 5L23A 1LCKA 2LJ3A 2HDAA 1YWPA 2KRSA 2DL3A 5IH2A 3SEMA 4LN2A 2BZYA 3QWYA 1HJDA 2JMCA 1U5SA 2CSQA 1I1JA 1Y57A 1S1NA 1WXBA 1B3QA 1OV3A 2RQRA 1FYNA 2A36A 1GFDA 2JS0A 3I9QA 4AG2C 1KIKA 2YDLA 4CC4B 3H0IA 2RN8A 3NHNA 1AWXA 3I5SA 2LCSA 4K11A 2VKNA 2GNCA 2A08A 5IHIA 4DEXA 4OMMA 1X43A 2RNAA 3M0QA 2A37A 4CC2A 4Z8AA 1H92A 2EGAA 2J05A 1GCQA 1A0NB 1H8KA 1AVZC 1YWOA 4JJCA 3GBQA 2PZ1A 1GCPA 2K79A 2CDTA 2BTTA 1NEGA 1WXUA 3RNJA 2LJ1A 3I35A 1UGVA 1SSHA 4FSSA 1KJWA 1GFCA 2CH4A 4J9CA 2KNBB 1AWWA 1X2KA 1SRMA 2J6OA 2EKHA 4HVUA 2EGCA 4OMPA 1MV3A 3VRYA 1Z9QA 2JXBA 2JM8A 2EQIA 3NMZC 1AWOA 1WIEA 4IIOA 2EYWA 2P4RA 2DF6A 4E6RA 2LX7A 3KFVA 1PWTA 1VA7A 1QLYA 2ESWA 2KYBA 1X27A 2KRMA 1BK2A 1RLQC 2W10A 2YUNA 5I11A 4JJBA 2KBTA 4GLMA 1SHFA 1G2BA 4JZ3A 3C0CA 3REAB 2LP5A 2K2MA 2DL5A 5IHNA 2KGTA 3O5ZA 4AFZC 5HCKA 3EG0A 3VS0A 1WA7A 2DILA 3M0UA 1AZEA 2V1QA 1BBZA 4RTXA 2AK5A 2CT4A 2D8JA 2K3BA 2L2PA 4J9HA 2DL7A 1AZGB 1AEYA 2KXDA 3NPFA 1OOTA 2K7AA 2EPDA 2RQTA 1VYVA 1U06A 2PNIA 2KROA 1WYXA 2KXCA 4RTUA 1U3OA 2O9VA 3IQLA 4J9BA 2FRWA 3TVTA 2JW4A 1ZLMA 1UFFA 2MCNA 1UE9A 2CH4W 1M8MA 1JXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AD5 A;  2O2O A;  1K0X A;  2RPN A;  2M51 A;  1GCQ C;  3H0H A;  2O88 A;  4OML A;  4J9G A;  1X69 A;  2PTK A;  2HSP A;  3NGP A;  2CUD A;  2EYZ A;  1JO8 A;  3THK A;  3EG1 A;  3VS1 A;  2MIO A;  4CC7 A;  4AFS C;  2EYX A;  4JPB W;  1MUZ A;  3PVL A;  1PNJ A;  2RQV A;  2C0I A;  1RUW A;  1NYG A;  1UJ0 A;  1W6X A;  2LNH B;  4JJD A;  4RTV A;  2F2W A;  1QKW A;  1NM7 A;  1KFZ A;  1NLP C;  2KEA A;  2NWM A;  1X2Q A;  2YT6 A;  4J9D A;  2KE9 A;  1BB9 A;  4R0K A;  5ECA A;  2O9S A;  3LH5 A;  5GJV B;  4HCK A;  1T3L A;  4AFU C;  1JU5 C;  2OAW A;  4LNP A;  3U23 A;  1V1C A;  4OMN A;  1M3B A;  3EG2 A;  1OPL A;  2DNU A;  2RQU A;  2LQW A;  4HVW A;  2K9G A;  1M27 C;  2E5K A;  2VWF A;  4LUE A;  3H41 A;  2FPE A;  1K1Z A;  3RBB B;  2VVK A;  1WDX A;  2X3W D;  1CSK A;  1YP5 A;  1ZSG A;  4AFQ C;  1K9A A;  2ROT A;  2I0N A;  4ZNX A;  2DBM A;  3VS5 A;  1IO6 A;  2DYB A;  1ZUK A;  2GTJ A;  2FEI A;  3VS3 A;  2AKK A;  1K0S A;  3QWX X;  1OEB A;  2HCK A;  3EGU A;  2KRN A;  3TSW A;  2GGR A;  2DM1 A;  1JEG A;  2J06 A;  3PE0 A;  2DL4 A;  1VYT A;  2LMJ A;  2L0A A;  1N5Z A;  1T3S A;  1WLP B;  4LUD A;  2DRM A;  2GQI A;  4RUG A;  1ZUU A;  2AKL A;  1ZUY A;  2CUB A;  3VS4 A;  1B07 A;  2JTE A;  4GBQ A;  4Z88 A;  1K4U S;  1E6G A;  2EW3 A;  2ED0 A;  1T0J A;  2LZ6 B;  1MV0 B;  1YNZ A;  2OJ2 A;  2DJQ A;  1UUE A;  2A28 A;  4A63 B;  2M0Y A;  4IIM A;  2HEQ A;  3JV3 A;  2ED1 A;  2MOX A;  2FRY A;  2F2V A;  1UJY A;  1FMK A;  1TUD A;  2D0N A;  2FG0 A;  3VS2 A;  2BZ8 A;  2DBK A;  2CSI A;  4J9F A;  1AOJ A;  1NG2 A;  1UHC A;  3M0P A;  1UTI A;  5FWB A;  2KYM A;  2L3P A;  1NLO C;  2GTO A;  2FPF A;  2EGE A;  2YSQ A;  2CT3 A;  2LJ0 A;  4OMO A;  2D8H A;  2ROL A;  2J7I A;  1UEC A;  3TSZ A;  2CRE A;  1GBR A;  2C0O A;  4J9E A;  3EG3 A;  2B86 A;  1M3A A;  2ENM A;  4RTZ A;  3SHW A;  2ECZ A;  3VS6 A;  2YUO A;  3UA7 A;  1T0H A;  5FW9 A;  3REB B;  3CQT A;  2D1X A;  1AWJ A;  4F16 A;  2EYY A;  5FWC A;  2DA9 A;  4ESR A;  1NYF A;  2QDL A;  1QWE A;  2DMO A;  1YCS B;  2J6F A;  3I5R A;  1I0C A;  1UG1 A;  2ABL A;  4HVV A;  4Z89 A;  4DEY A;  3A98 A;  4LE9 A;  2SRC A;  5GJW B;  4M4Z A;  1GL5 A;  3UAT A;  2GBQ A;  3ZL7 C;  1SEM A;  1GRI A;  2BZX A;  1G83 A;  2H8H A;  1UHF A;  1XOV A;  4WCI A;  1WXT A;  2KR3 A;  3EHR A;  1PRM C;  2KT8 A;  2AZV A;  5IXB A;  4RTW A;  1ARK A;  2X3X D;  3PVQ A;  1SPK A;  2G6F X;  1CKA A;  1W70 A;  4ORZ A;  2FO0 A;  1E6H A;  1YN8 A;  1JQQ A;  2W0Z A;  1Y0M A;  1W1F A;  2L3S A;  3R6N A;  1QCF A;  3M0T A;  3VRZ A;  5EC7 A;  4F14 A;  2HBW A;  2DX1 A;  1X6B A;  1JXM A;  1X6G A;  5IXF A;  1PHT A;  2V1R A;  1H3H A;  4CC3 A;  1KSW A;  1ZBJ A;  2EVR A;  4AG1 C;  4J9I A;  1K76 A;  2JT4 A;  1UDL A;  1ABO A;  2C0T A;  5IHK A;  2J6K A;  2JM9 A;  4RTY A;  1Z9Z A;  2DL8 A;  1E7O A;  1GBQ A;  1PKS A;  1J3T A;  2NUZ A;  2LQN A;  2L3Q A;  3H0F A;  4KRT A;  1WI7 A;  5I22 A;  3M0R A;  2OI3 A;  1BU1 A;  2DVJ A;  1M30 A;  4D8D A;  2EBP A;  1PKT A;  1ZX6 A;  4EIK A;  4OMQ A;  1RLP C;  2XMF A;  1CKB A;  4D8K A;  3FJ5 A;  1QWF A;  1RI9 A;  4RTT A;  3UF4 A;  1WX6 A;  1I07 A;  2YUP A;  4F17 A;  2DRK A;  3ULR B;  2SEM A;  2JS2 A;  1SHG A;  3UA6 A;  1ABQ A;  3EHQ A;  2JMA A;  2FPD A;  1HSQ A;  3VS7 A;  2RMO A;  2F2X A;  1EFN A;  2DE0 X;  2KT1 A;  4X1V A;  2DLP A;  1HD3 A;  2IIM A;  1TG0 A;  4HXJ A;  1QKX A;  2RQW A;  1PRL C;  2RF0 A;  1TUC A;  3M0S A;  1SRL A;  1M3C A;  2YUQ A;  2AZS A;  4JZ4 A;  1NEB A;  1WFW A;  2O31 A;  4Y92 A;  4QT7 A;  2K6D A;  1OPK A;  1VYU A;  5L23 A;  1LCK A;  2LJ3 A;  2HDA A;  1YWP A;  2KRS A;  2DL3 A;  5IH2 A;  3SEM A;  4LN2 A;  2BZY A;  3QWY A;  1HJD A;  2JMC A;  1U5S A;  2CSQ A;  1I1J A;  1Y57 A;  1S1N A;  1WXB A;  1B3Q A;  1OV3 A;  2RQR A;  1FYN A;  2A36 A;  1GFD A;  2JS0 A;  3I9Q A;  4AG2 C;  1KIK A;  2YDL A;  4CC4 B;  3H0I A;  2RN8 A;  3NHN A;  1AWX A;  3I5S A;  2LCS A;  4K11 A;  2VKN A;  2GNC A;  2A08 A;  5IHI A;  4DEX A;  4OMM A;  1X43 A;  2RNA A;  3M0Q A;  2A37 A;  4CC2 A;  4Z8A A;  1H92 A;  2EGA A;  2J05 A;  1GCQ A;  1A0N B;  1H8K A;  1AVZ C;  1YWO A;  4JJC A;  3GBQ A;  2PZ1 A;  1GCP A;  2K79 A;  2CDT A;  2BTT A;  1NEG A;  1WXU A;  3RNJ A;  2LJ1 A;  3I35 A;  1UGV A;  1SSH A;  4FSS A;  1KJW A;  1GFC A;  2CH4 A;  4J9C A;  2KNB B;  1AWW A;  1X2K A;  1SRM A;  2J6O A;  2EKH A;  4HVU A;  2EGC A;  4OMP A;  1MV3 A;  3VRY A;  1Z9Q A;  2JXB A;  2JM8 A;  2EQI A;  3NMZ C;  1AWO A;  1WIE A;  4IIO A;  2EYW A;  2P4R A;  2DF6 A;  4E6R A;  2LX7 A;  3KFV A;  1PWT A;  1VA7 A;  1QLY A;  2ESW A;  2KYB A;  1X27 A;  2KRM A;  1BK2 A;  1RLQ C;  2W10 A;  2YUN A;  5I11 A;  4JJB A;  2KBT A;  4GLM A;  1SHF A;  1G2B A;  4JZ3 A;  3C0C A;  3REA B;  2LP5 A;  2K2M A;  2DL5 A;  5IHN A;  2KGT A;  3O5Z A;  4AFZ C;  5HCK A;  3EG0 A;  3VS0 A;  1WA7 A;  2DIL A;  3M0U A;  1AZE A;  2V1Q A;  1BBZ A;  4RTX A;  2AK5 A;  2CT4 A;  2D8J A;  2K3B A;  2L2P A;  4J9H A;  2DL7 A;  1AZG B;  1AEY A;  2KXD A;  3NPF A;  1OOT A;  2K7A A;  2EPD A;  2RQT A;  1VYV A;  1U06 A;  2PNI A;  2KRO A;  1WYX A;  2KXC A;  4RTU A;  1U3O A;  2O9V A;  3IQL A;  4J9B A;  2FRW A;  3TVT A;  2JW4 A;  1ZLM A;  1UFF A;  2MCN A;  1UE9 A;  2CH4 W;  1M8M A;  1JXO A; 
#chains in the Genus database with same CATH topology
 1AD5 A;  2O2O A;  4JLI A;  2M51 A;  5FU7 C;  2HSP A;  3CCM A;  2O4X B;  3L2Q A;  1QVG P;  1Q95 G;  2JTM A;  1JO8 A;  3MHX A;  3QJ6 A;  3CC4 A;  2EYX A;  4JPB W;  3KXT A;  3G7Z A;  2GF7 A;  3RER A;  3MO8 A;  5CKF A;  4IUR A;  5KE2 A;  1W6X A;  2PU9 B;  1IZ6 A;  1W2B P;  2JN0 A;  1SKU B;  3LYI A;  2X51 A;  4RTV A;  1JRI A;  1VIF A;  2EQJ A;  3INZ A;  1YI2 A;  3EAE A;  3GPL A;  1XNI A;  4J9D A;  3RKW A;  2KE9 A;  4NS5 A;  1KHC A;  2HSE B;  2YLB A;  5GJV B;  3E9F A;  3QYH B;  3V8K A;  3OS5 A;  3OYG A;  2XKO C;  3QUI A;  1YHQ A;  3DLM A;  4CRI A;  5LJ3 g;  1VQ6 Q;  2QYZ A;  1K73 R;  4HVW A;  4M78 D;  2AIR B;  2P0P A;  5I2M A;  3CCL A;  1WDX A;  1Q82 C;  8ATC B;  2X3W D;  4IUP A;  3HRS A;  3OYK A;  4QQG A;  3CC4 T;  2DXB A;  4ZNX A;  2I0N A;  2DBM A;  2GTJ A;  4LDX A;  1K0S A;  1QW1 A;  1M2V B;  2HCK A;  4PKC C;  1YIJ Q;  3NTK A;  3CBP A;  2DTH A;  2LMJ A;  4DOW A;  2IVW A;  4ZN3 A;  4M77 A;  2DRM A;  2GQI A;  4M75 G;  2HZY A;  1Q7Y U;  2V8I A;  1ZUY A;  2CUB A;  2FYK A;  3QXE B;  5CQY A;  5I21 A;  1BYM A;  2QA4 A;  1KQ2 A;  5I2S A;  2OTJ T;  4KUI A;  4M77 B;  2OJ2 A;  5LJ5 d;  1VQM A;  2DFU A;  2F5T X;  4E7J A;  2M0Y A;  2HEQ A;  2MOX A;  2E70 A;  5FLX E;  4PJO G;  2LCC A;  3FB9 A;  2WSF E;  5FRO A;  2CS7 A;  3NTI A;  1UJY A;  5HK3 A;  2EIF A;  1FMK A;  3VS2 A;  2BZ8 A;  1KD1 R;  1AOJ A;  1UHC A;  5FWB A;  4J6X A;  3OYA A;  2FPF A;  2YSQ A;  3DB3 A;  4BB7 A;  4E7I A;  1RL2 A;  1D0Z A;  2ROL A;  5IT9 E;  1UEC A;  2ZPF B;  4V2S A;  5FU7 B;  5GAO r;  2D0Q B;  2A3L A;  4HKE A;  1O75 A;  5EG2 A;  2ENM A;  3G71 A;  2Y4Y A;  3EG9 A;  1V29 B;  3UA7 A;  3GNG A;  3OYB A;  3CQT A;  2K5F A;  1YI2 T;  3A5Z B;  4NL3 A;  1M1G A;  2WSE E;  3I55 A;  5LJ3 f;  3CCQ A;  3CCJ A;  1QWE A;  4PJO B;  2MWO A;  2YHT A;  3MJX A;  1UG1 A;  2ABL A;  3URG A;  2MYS A;  2HD0 A;  2SRC A;  4M4Z A;  2FZG B;  1GL5 A;  3VUB A;  1VQO A;  3CD6 T;  2BZX A;  2XID A;  3VUZ A;  1Y71 A;  2XG8 D;  2RA2 A;  1XOV A;  4RCC A;  3I55 T;  1WHG A;  2KT8 A;  2AZV A;  2QQB A;  1ARK A;  3PVQ A;  1SPK A;  3C95 A;  1CKA A;  1W70 A;  5LJ5 f;  3CCM T;  1E6H A;  2K5L A;  2W0Z A;  2QQA A;  1V76 A;  1M90 R;  1OU8 A;  1AHJ B;  3GNF B;  2COY A;  1W1F A;  2CH4 W;  2CKK A;  1YCY A;  5EC7 A;  4F14 A;  2LT1 A;  3DB4 A;  1XQH A;  2DX1 A;  5GAO l;  1X6B A;  1X6G A;  2K3Y A;  5IXF A;  2HKN A;  2V1R A;  1H3H A;  5GAM h;  2DK3 A;  1YJW Q;  5HK0 A;  4F7U A;  2JT4 A;  3RMS A;  1VQ4 T;  5LJ5 g;  2JUF A;  4J5Y A;  2OAU A;  3BDL A;  3M54 A;  5CKH A;  5GAN 4;  3MCA B;  1C1A A;  5LJ3 j;  3CXC S;  1J3T A;  2LQN A;  2L3Q A;  3UPU A;  3T9N A;  1D09 B;  1MND A;  4D8K A;  3FJ5 A;  3N5B B;  1QWF A;  3HKS A;  3VU3 C;  2PUO B;  1RI9 A;  5GAN g;  4C8Q D;  2YUP A;  2FZC B;  2X4Y A;  1BI0 A;  2M0O A;  3DKM A;  3R6O A;  3UA6 A;  1ZSZ A;  2XDP A;  2YRC A;  4BE0 A;  2JMA A;  1QVG S;  4LD6 A;  1Q7Y C;  3CCV Q;  4DA4 A;  2F2X A;  3QYG B;  4X1V A;  2KT1 A;  1GXI E;  4KBM B;  2NUT B;  4MMK A;  1HD3 A;  1RAE B;  2IIM A;  3CD6 A;  1TG0 A;  2KAF A;  3JCM V;  2CZ7 B;  1HXD A;  4RG8 A;  3M59 A;  1SRL A;  5CQX A;  3UWN A;  1M3C A;  3CCL T;  4JZ4 A;  3EGD A;  3OYC A;  2QQS A;  1VYU A;  4M78 C;  3CCJ T;  3SWN C;  1LCK A;  1RAC B;  2LJ3 A;  2HDA A;  3CPW A;  2K4Y A;  3OYM A;  2KRS A;  3JCM f;  1PG5 B;  4LN2 A;  4FU6 A;  3OYY A;  1YJ9 Q;  2JMC A;  1U5S A;  2CSQ A;  5DM7 R;  3G71 T;  5J26 A;  4JLG A;  3LWH A;  2M16 A;  2A36 A;  1JJ2 A;  4L5G A;  4ME7 A;  3PIO A;  3AT1 B;  1AWX A;  4QKU A;  3L42 A;  3FRN A;  4RCB A;  1TUG B;  2E64 A;  4OMM A;  2RNA A;  4J7F A;  1FMV A;  5GAN j;  1KHI A;  2F69 A;  4M7A F;  2VAS A;  3PIP A;  3GOX A;  3LWI A;  1H8K A;  2E6Z A;  1Q86 R;  4C92 G;  4LDU A;  2QA4 Q;  1VQO T;  2QG9 B;  1ZBX A;  2PZ1 A;  1QCN A;  2K79 A;  2QEX T;  1WXU A;  1PD1 A;  3OYF A;  4A53 A;  4M75 E;  2COZ A;  4FSS A;  2D9T A;  2MF2 A;  3OW2 A;  4M78 F;  2CH4 A;  5CO7 A;  3CCQ T;  1TH7 A;  2JNG A;  1SRM A;  2EKH A;  5GAM e;  1MV3 A;  2JXB A;  4UC4 A;  5GMK e;  1ZA2 B;  4IIO A;  2EYW A;  3OYI A;  2ZCF B;  4E6R A;  3KFV A;  2RHU A;  5KH6 A;  1VQ7 A;  3EGD B;  4B9X A;  2KMT A;  1QLY A;  1QVG A;  3H6Z A;  1KQS A;  1K8A C;  3FC3 A;  1YIT A;  4GLM A;  4JZ3 A;  4JRK A;  4BI8 B;  1NPR A;  2DL5 A;  3JCM h;  4XK8 E;  3X24 B;  3O5Z A;  3E2U A;  1VQ5 A;  4BDY A;  3M0U A;  3RUX A;  1FX7 A;  1WHJ A;  5GAO m;  2LX9 A;  2D8J A;  1M8V A;  2K3B A;  2L2P A;  1IRX A;  1QP2 A;  3F70 A;  3A8L B;  1AZG B;  4LD9 K;  2VXF A;  1AEY A;  1C0M A;  4LDY A;  5LL6 S;  1OOT A;  2QEX Q;  1M2O A;  2KSS A;  1U06 A;  2K3X A;  2MI6 A;  3H9N A;  3CCR A;  4EDU A;  2OTJ A;  1XTD A;  1WYX A;  4E7H A;  2CP6 A;  2KXC A;  2V8J A;  2WSC E;  4BAC A;  2O9V A;  3IQL A;  1RAB B;  2VGN A;  4C92 D;  2FRW A;  2QI2 A;  2P4T A;  1WHK A;  1K0X A;  4O5V A;  3H0H A;  4J9G A;  2JOY A;  1W4S A;  2RJC A;  2FVU A;  2CP5 A;  1RAI B;  4FM4 B;  2KY9 A;  3LX7 A;  1N8R C;  3THK A;  3O8V A;  2VYT A;  4A54 A;  3EGX A;  4FT2 A;  1WHM A;  3M57 A;  1U1T A;  1N9R A;  2DKG A;  1LNX A;  1MUZ A;  2HL3 A;  1YJ9 T;  3PVL A;  4KUD K;  1PNJ A;  1VQ8 A;  4C8Q E;  5GAN 3;  2E3H A;  4JDS A;  1RUW A;  1UJ0 A;  2E6N A;  2EJF A;  5C6S A;  3PMT A;  5KE3 A;  4M77 E;  1TU0 B;  5DY9 A;  1NLP C;  2NWM A;  2M02 A;  4PJL A;  4KGZ B;  2GQV A;  4JRP A;  1BB9 A;  2EQK A;  2X4X A;  1BI2 A;  5GAM f;  1QVP A;  3JCM Q;  1VQK Q;  3CCV T;  1M90 U;  3I55 Q;  1JU5 C;  1BKB A;  3OMG A;  4C5H A;  1KC8 C;  3OA6 A;  3ZFJ A;  3A8G B;  2LQW A;  2RHX A;  1D3B B;  4F7U F;  3RBB B;  5A0L A;  1I4K 1;  3WVD B;  4C92 A;  2HQH A;  3GLX A;  4EMK A;  3A8H B;  3TCJ A;  5HY6 A;  3HP9 A;  3OYD A;  5J39 A;  2E4H A;  1W2B A;  1ZUK A;  2FEI A;  2YXY A;  5CK9 A;  4M75 B;  1QCO A;  4PK4 A;  1ZQ1 A;  2J06 A;  4QVZ A;  4J6Y A;  2DL4 A;  3MEV A;  1N5Z A;  1IHW A;  1WLP B;  4LUD A;  4RUG A;  1TWB A;  1WJQ A;  1M4Z A;  5KCH A;  3MEW A;  3EFR A;  4XTW A;  1Q81 R;  1B07 A;  5KYU B;  2CZ1 B;  4Z88 A;  1M90 C;  1E6G A;  4FYW B;  1KQS P;  2EFI A;  5AT1 B;  2E10 A;  4HT9 A;  2DTI A;  1MV0 B;  2RJE A;  4BD3 A;  4NL2 A;  2LDM A;  4BE2 A;  2DJQ A;  1UUE A;  2LQK A;  1VIE A;  3CCM Q;  3HTR A;  1K8A U;  2A28 A;  3D7S B;  4OGE A;  4F7U G;  3RIR A;  4RG2 A;  2F2V A;  1UGR B;  1VQ4 A;  3L1A A;  5C0M A;  1B34 A;  1MGQ A;  2D0N A;  1DJ7 B;  2DBK A;  2CP2 A;  4XU0 A;  4E7K A;  3M0P A;  1UTI A;  3MEA A;  4DOV A;  3I56 T;  4OGC A;  4FIB A;  4A4H A;  2KYM A;  2L3P A;  1NLO C;  1VQ9 T;  1QMC A;  2LJ0 A;  4JS4 A;  4M7D E;  1SG5 A;  3C94 A;  2FL7 A;  4C8Q B;  1MMA A;  1WHL A;  2BIV A;  4PJM A;  1GBR A;  4J9E A;  3CMA Q;  4PFP A;  1M3A A;  1TTH B;  2YUO A;  1T0H A;  4PLL A;  4OMF B;  5FW9 A;  4HCC A;  2DZ9 A;  5IAY A;  1ZSZ C;  2DA9 A;  5FWC A;  5GAO q;  2QDL A;  1O9S A;  3M4G A;  2L8D A;  3CME Q;  4LE9 A;  1JJ2 P;  5GJW B;  4M7D A;  3J7A F;  1Q7Y R;  2WAC A;  3ZL7 C;  4JJN K;  4MML A;  3OBW A;  1OX9 A;  5KCO A;  1YJN Q;  4WCI A;  1WXT A;  2KR3 A;  3CME A;  5IXB A;  1OYX A;  2KDS A;  5GAM d;  4M77 G;  3G4S Q;  2VC8 A;  1YN8 A;  2OTL Q;  4GLK A;  1Y0M A;  5A2Q E;  5IN1 A;  3HL8 A;  2OTJ Q;  3VRZ A;  3V7C A;  3RKX A;  1JXM A;  1VQN T;  1PHT A;  2V26 A;  4R56 A;  3S3O A;  4B9W A;  2EVR A;  3OS0 A;  1G3T A;  4AT1 B;  2DD5 A;  1UDL A;  1ABO A;  2RHZ A;  3PTA A;  5IHK A;  1Z9Z A;  4C92 C;  1G5V A;  1WQW A;  1GBQ A;  3JAM E;  1VQM T;  3CBO A;  4KRT A;  3CC4 Q;  2Z0W A;  1U1S A;  3A8O B;  1M30 A;  1IXD A;  2JJ9 A;  2QA4 T;  2E3I A;  5D6W A;  4L59 A;  3PFS A;  3CC7 T;  3HPW A;  4RTT A;  3UF4 A;  1X01 A;  4ATO A;  2MK5 A;  5CKD A;  2JVV A;  1VQL T;  3TEE A;  2CP3 A;  1MMG A;  2HNI A;  2JS2 A;  1SHG A;  4M78 A;  3EHQ A;  5CCA A;  4OB1 B;  3CD6 Q;  2HAX A;  4A4G A;  5M9O A;  4B6M A;  4Q5W A;  3VKI A;  3CCE A;  4FW1 A;  3S6W A;  1D0Y A;  1EFN A;  2I2L A;  1AT1 B;  1I5L A;  1OU9 A;  3VYH B;  1OQK A;  4MZP A;  1D3B A;  1YJN A;  5KYY B;  1RAD B;  2YUQ A;  3JB9 I;  1WFW A;  4Y92 A;  3CPF A;  1OX8 A;  1MHN A;  5L23 A;  3CCU T;  4J8O A;  1YWP A;  3WVE B;  3SEM A;  4TVR A;  3QWY A;  5LJ5 j;  3G6E T;  2BE7 D;  1S1N A;  3ZEH A;  1WXB A;  1FYN A;  1WHH A;  3JB9 G;  3PNW C;  3J80 E;  5DLO A;  4AG2 C;  2MWP A;  3H0I A;  2XU8 A;  2RN8 A;  3QDF A;  3NHN A;  3I5S A;  1P92 A;  2LCS A;  5IHI A;  2M1H A;  5KYU A;  1ACM B;  4QVD A;  4JRI A;  3MET A;  2RHI A;  3NFC A;  1H92 A;  2EGA A;  1GCQ A;  2COW A;  3QPH A;  4OF1 A;  1A0N B;  2DYI A;  2XIC A;  1YWO A;  1PM3 A;  4FW2 A;  3G4S T;  4BE1 A;  3L2W A;  4ZTJ A;  3GBQ A;  4M77 C;  4N4H A;  3OSV A;  4AMC A;  3OYL A;  4M75 C;  1YJN T;  3I35 A;  1UGV A;  1GFC A;  2KNB B;  1FWZ A;  1B7T A;  3LGL A;  3G1J A;  5LJ5 h;  1X2K A;  2ZAE A;  1YIJ T;  2XK0 A;  2NUT A;  4EMK B;  4HVU A;  1VQ7 Q;  3VRY A;  1Z9Q A;  3LH0 A;  4DBF A;  1Y96 B;  1EIF A;  4FT4 A;  4MDW A;  2EQI A;  3NMZ C;  1M5Q 1;  2XI9 A;  5A0G A;  3JCM d;  4KGV B;  5L8R E;  2PUK B;  2JTF A;  3CCU Q;  1YIT Q;  3CC2 Q;  4BI4 A;  1VA7 A;  2XDD A;  2W10 A;  5GAN 5;  3QZ5 B;  1UGQ B;  3HFO A;  5LJ3 h;  2O01 E;  1UB4 A;  1S72 T;  1VQ6 T;  5HCK A;  4PJJ A;  2DIL A;  1AZE A;  1BBZ A;  2RI5 A;  4RTX A;  1M1K R;  4J9H A;  1VQP T;  4M77 F;  4XU2 A;  2KXD A;  1BCM A;  3NTH A;  4C0D C;  2EPD A;  1S72 Q;  3JRZ A;  5FRN A;  4VUB A;  3EH2 A;  4M7A B;  3MKD A;  3GF5 A;  3UT1 A;  1M1K U;  4J9B A;  1YJW A;  3JCM e;  1ZLM A;  1UFF A;  3OY9 A;  4D6W A;  1KC8 U;  2QQR A;  4E47 A;  1M8M A;  2ZZD A;  2RPN A;  4LDW A;  1GCQ C;  2O88 A;  2BE9 B;  4OML A;  4KUL A;  2HBP A;  1LPL A;  3NGP A;  4JUV A;  1QVF A;  5GMK m;  3VS1 A;  7AT1 B;  1Y7X A;  1R0C B;  2MIO A;  2KVQ G;  3A8M B;  2L89 A;  1Q81 C;  3ASK A;  2CP7 A;  2IG0 A;  1VQN Q;  1K73 U;  4ELZ C;  1NYG A;  2GCX A;  1D1B A;  4PLI A;  2LNH B;  2M9U A;  4JJD A;  2IPO B;  2F2W A;  1QKW A;  1NM7 A;  2ZPE B;  1KFZ A;  2LC4 A;  1JBM A;  1X2Q A;  2YT6 A;  4OP0 A;  1EZZ B;  1X75 C;  2CGH A;  5KYY A;  4PJO E;  5ECA A;  2X4J A;  2O9S A;  4M7D D;  5GAM g;  2OAW A;  3OQ5 A;  1TS9 A;  1RAA B;  4LNP A;  3CPW P;  1V1C A;  4OMN A;  1M3B A;  3CMA A;  3M53 A;  5D6X A;  3EG2 A;  2R5A A;  3CC2 A;  1NZ9 A;  2K9G A;  2VWF A;  2E5K A;  4C92 F;  3H41 A;  2XD0 A;  5FRM A;  1IB8 A;  1K1Z A;  3CCE Q;  3MPU B;  3CC7 Q;  2VVK A;  4RKU E;  3EH1 A;  1D1C A;  2AHJ B;  1NE8 A;  1CSK A;  1YP5 A;  1G3W A;  1ZSG A;  4AFQ C;  4X9D A;  4IUT A;  4OVA A;  3VS5 A;  2DYB A;  3TRE A;  2QAZ A;  1UGP B;  1H64 1;  1OEB A;  3EGU A;  2KRN A;  3TSW A;  2GFA A;  2GGR A;  3BFM A;  1JEG A;  3BE3 A;  3PGG A;  2L0A A;  2ZPI B;  1T3S A;  2DZC A;  4FCY A;  1ZUU A;  2AKL A;  1YIJ A;  2JTE A;  5KYW B;  4R55 A;  2EW3 A;  3JCM P;  2ED0 A;  2KK4 A;  4KH1 B;  1T0J A;  3CXC P;  3P8B B;  4A4F A;  4IIM A;  1BI1 A;  2JZ2 A;  2K57 A;  3JV3 A;  2ED1 A;  3H8Z A;  3M9Q A;  1M2V A;  4C0D B;  1TUD A;  2VUB A;  4N4I A;  1TXQ A;  6AT1 B;  4M7A C;  3P8H A;  3C12 A;  2EGE A;  2HKQ B;  2EJ9 A;  4OMO A;  4OB3 B;  4XTV A;  2D8H A;  3RKY A;  3E19 A;  5LJ3 d;  2J7I A;  4M7D C;  3TSZ A;  2CRE A;  5D6Y A;  4FYY B;  3OW2 S;  3GIB A;  4RTZ A;  2ZPG B;  3VS6 A;  1LVK A;  3REB B;  2D1X A;  5FU6 B;  3HRU A;  1R77 A;  1IRE B;  1NYF A;  2RJF A;  1YCS B;  2J6F A;  4IUU A;  4HVV A;  3A98 A;  1VQ8 T;  3CCQ Q;  2GBQ A;  1YJ9 A;  5GMK j;  1GRI A;  4E2F B;  1G83 A;  2H8H A;  1RAG B;  3SFM A;  3EHR A;  1PRM C;  1Y96 A;  2DVE A;  2DJZ A;  2QGG A;  4IUQ A;  2EQU A;  2X3X D;  2RK2 A;  1VQO Q;  2G6F X;  1LOJ A;  2FO0 A;  2DXC A;  4C5G A;  1NJI U;  2DXT A;  1WNL A;  2MMP A;  1KC8 R;  2FHD A;  3SDZ A;  2L3S A;  3M0T A;  2CP0 A;  1F1B B;  4XTY A;  1OZ2 A;  4PJO D;  5HKC A;  2LCL A;  2RH2 A;  2RHY A;  1VQM Q;  2DER A;  4CC3 A;  1KSW A;  2MPX C;  3CPW S;  1PSF A;  3EGX B;  4J9I A;  4AG1 C;  2LVM A;  4J7I A;  4BI3 A;  4EMG A;  2RI3 A;  1VQ9 Q;  2J6K A;  1RAH B;  4EPC A;  4PNO A;  2DL8 A;  1I5O B;  1E7O A;  1RI0 A;  4M7A A;  3SWN B;  4PJO C;  3SD4 A;  1PKS A;  5I22 A;  3CCS A;  2OI3 A;  1BU1 A;  3HSB A;  3FLG A;  4D8D A;  2EBP A;  5GAN 8;  4OMQ A;  1RAF B;  1CKB A;  1VQK A;  3JCM J;  2EJG A;  3HRT A;  2BUD A;  5DLQ E;  2C06 A;  1KQ1 A;  4J6W A;  2SEM A;  1ABQ A;  1IGQ A;  1HSQ A;  2LNV A;  3VS7 A;  3QBY A;  2RMO A;  4F7U E;  1K9M R;  4F04 B;  3CME T;  2DE0 X;  4E7S A;  3CXC A;  1QKX A;  4EMH A;  1PRL C;  4E7L A;  3CCS T;  3SB2 A;  2VGM A;  3CEY A;  1NEB A;  2O31 A;  4IKF A;  4DBR A;  3CMA T;  4M7A D;  2DL3 A;  5IH2 A;  2DD4 A;  3MP6 A;  4C5E A;  1HJD A;  2PQW A;  1YFN A;  1SF9 A;  4NOY A;  5GMK l;  1Y57 A;  2AT1 B;  3JCM W;  4HA8 A;  1B3Q A;  1OV3 A;  2RQR A;  2P0Q A;  4A4E A;  2MAM A;  1GFD A;  4BY6 C;  3L2V A;  3Q1J A;  3I9Q A;  2PVD B;  1KIK A;  2YDL A;  4CC4 B;  5FU6 C;  4GY5 A;  5KYW A;  3X20 B;  1YBY A;  3M55 A;  4BY6 B;  4ZN1 A;  2GNC A;  2A08 A;  3G6E A;  4DEX A;  3VV0 A;  1WZO A;  2DET A;  2ATC B;  1M1K C;  3M0Q A;  3JB9 H;  2F1L A;  4CC2 A;  4Z8A A;  3OMC A;  2H3E B;  3CCS Q;  2EWN A;  3QJY A;  1AVZ C;  1SSF A;  4JJC A;  2FZK B;  2DIG A;  2BTT A;  1Q86 U;  1NEG A;  5CKE A;  3RNJ A;  1WGS A;  5CKB A;  2O4X A;  1KJW A;  1H3Z A;  3QKJ A;  1VOM A;  5CVI A;  5D7U A;  2GFU A;  3LW5 E;  4XU3 A;  1Q82 R;  2J6O A;  5GAN f;  3MEU A;  2EGC A;  4M78 G;  3ZBD A;  2KQW A;  2E1H A;  1AWO A;  1WIE A;  1WPY A;  2P4R A;  4M7A E;  2DF6 A;  2LX7 A;  5AYF A;  3EFO A;  1PWT A;  5GMK h;  4ZTF A;  2KRM A;  3OBY A;  3OS1 A;  3EG9 B;  4A4K A;  1RLQ C;  1QVF P;  3CCL Q;  2CYZ B;  4JJB A;  5GAO n;  3I56 A;  2ZPB B;  1G2B A;  4X9C A;  3C0C A;  5LJ5 e;  3REA B;  2LP5 A;  4XTX A;  3AHU A;  3L2R A;  2E12 A;  1R8O B;  2KGT A;  1VQ6 A;  4AFZ C;  3EG0 A;  1S72 A;  3VS0 A;  4WF2 A;  2AK5 A;  1BI3 A;  4FYV B;  2NYS A;  4Y28 E;  4C8Q A;  3QG1 A;  2NUP A;  3KBG A;  2RQT A;  1VYV A;  5KYN A;  1PC0 A;  2PNI A;  2KRO A;  3JB9 F;  2LTO A;  5GAN e;  2QK0 A;  2E41 A;  4DBQ A;  3TVT A;  4E7Z A;  5GAN 7;  2JW4 A;  4C92 E;  1JXO A;  4QQ6 A;  2X4W A;  3V7S A;  1X69 A;  3PMI A;  3E9G A;  2PTK A;  5A0D A;  2ZGW A;  1D0X A;  4HCB A;  2CUD A;  2XDB A;  2L3R A;  2EYZ A;  2EAY A;  9ATC B;  3EG1 A;  3V7R A;  4CC7 A;  4F7U B;  1VQ4 Q;  1K9M U;  4II1 A;  4AFS C;  2QGF B;  2XHC A;  4L6V 5;  2RQV A;  3HHT B;  2C0I A;  1YI2 Q;  3UDC A;  1PD0 A;  4JRQ A;  2QTX A;  1NBE B;  4PJO F;  4Y91 A;  4C92 B;  1Q82 U;  1FMW A;  3QSU A;  3ER0 A;  4M77 D;  2KEA A;  4XTZ A;  4M75 A;  2VV5 A;  3CBM A;  5KYX B;  1NJI C;  2HMA A;  4R0K A;  1K8A R;  3CCV A;  4HCK A;  4QQD A;  1T3L A;  4AFU C;  1M9S A;  2PVG B;  4C0G A;  2YWW A;  3U23 A;  3MP1 A;  4C5I A;  3S3M A;  1OPL A;  2DNU A;  2RQU A;  1G3Y A;  1M27 C;  4LUE A;  2FPE A;  1D1A A;  3JB9 D;  4KH0 B;  2EYQ A;  2LQ8 A;  2Y4X A;  3RR6 A;  1WJS A;  4QW2 A;  1MMN A;  1K9A A;  3S3N A;  1ZA1 B;  5CAI A;  4MDX A;  2DXU A;  2ROT A;  2PVO B;  1QP3 A;  1IO6 A;  3VS3 A;  3OS2 A;  2AKK A;  3QWX X;  4M78 B;  1TSF A;  2QTV A;  1FXX A;  4P5N A;  1EX4 A;  1G8X A;  2DM1 A;  4QVC A;  4XQ3 A;  3PE0 A;  2OX7 A;  3G6E Q;  1VYT A;  2V8K A;  2VXE A;  4RMO A;  1VQK T;  3VS4 A;  4GBQ A;  5GAM j;  1BIA A;  3JCM g;  4C0Z A;  1K4U S;  2ZPH B;  4PJN A;  2CZ6 B;  3JCM b;  2LZ6 B;  1YNZ A;  4XTU A;  5GAN 2;  1X6O A;  2CZ0 B;  2DEQ A;  4WTO B;  4A63 B;  1VQP A;  2RI2 A;  3LLR A;  2HQE A;  2FRY A;  1Y07 A;  3A1P A;  1N27 A;  2FG0 A;  3FEO A;  3OYN A;  2E65 A;  2P84 A;  3L2U A;  3VYG A;  3PT9 A;  2CSI A;  4J9F A;  1NG2 A;  3OYE A;  2DPP B;  4BDZ A;  1OZ3 A;  2RO0 A;  1VQ8 Q;  2GTO A;  1NPP A;  2CT3 A;  1K9M C;  2LRQ A;  2RJD A;  2NUP B;  2D6F A;  4M75 F;  5CIU A;  1HK9 A;  2RK1 A;  3JSC A;  5LJ3 e;  2C0O A;  3V8J A;  3DLL A;  3EG3 A;  2B86 A;  3SHW A;  2ECZ A;  3CCJ Q;  1W2B S;  3TQ7 P;  3QHS A;  4FL6 A;  2K5I A;  1I81 A;  1NJI R;  4KT0 E;  3E1S A;  1AWJ A;  4F16 A;  4M7A G;  2DAQ A;  1XJW B;  2EYY A;  3CCU A;  4ESR A;  1HYO A;  2DMO A;  2LT4 A;  3I5R A;  1I0C A;  4Z89 A;  1MMD A;  3JB9 J;  4PL6 A;  2EKO A;  4DEY A;  4JS5 A;  2QEX A;  2YRD A;  1WQ7 A;  4M7D G;  3UAT A;  3CCR Q;  4N0A C;  2K2V A;  1SEM A;  4J83 A;  4HT8 A;  1R0B G;  1K73 C;  4M75 D;  3G4S A;  3JCM X;  3M56 A;  1UHF A;  1KG1 A;  5GAN 6;  4M7D F;  1G3S A;  3EFO B;  3EFS A;  4RTW A;  1KD1 U;  4ORZ A;  3KUF A;  1M1F A;  1JQQ A;  1MNE A;  1VQL A;  4ZGE B;  3R6N A;  1QCF A;  2DO3 A;  2HBW A;  2P0K A;  2A7Y A;  3JCM c;  3FJP A;  2OTL A;  3OW2 P;  3OB9 A;  4OB2 B;  1PCX A;  3M58 A;  4LXC A;  1ZBJ A;  2F5K A;  3CCR T;  1K76 A;  3RES A;  2C0T A;  2JM9 A;  3OSS C;  4RTY A;  2QQ9 A;  3HFN A;  1C6V X;  2NUZ A;  3H0F A;  1WI7 A;  5GMK i;  3M0R A;  3J81 E;  2DVJ A;  1PKT A;  1ZX6 A;  4EIK A;  3QII A;  1RLP C;  1YIT T;  2Y90 A;  1Q86 C;  5GAN h;  3BW1 A;  2XMF A;  2YRV A;  3P8D A;  4X34 A;  1VQN A;  2R57 A;  1Q81 U;  3CCE T;  1N9S A;  1WX6 A;  1I07 A;  4F17 A;  2DRK A;  3FIF A;  3ULR B;  1VQ7 T;  1KD1 C;  3BDU A;  2NLU A;  3X28 B;  4PFZ A;  3VJP A;  3C4S A;  2FPD A;  2R58 A;  2RM4 A;  4YTL A;  4XAX B;  2DTO A;  3CC7 A;  2VB6 A;  2BKD N;  2DLP A;  2DEU A;  3RMQ A;  3G71 Q;  3L2Z A;  4N0A A;  4HXJ A;  1I8F A;  4XU1 A;  2RQW A;  2RF0 A;  1TUC A;  3M0S A;  3X26 B;  2QAS A;  2L5Q A;  4BUG A;  3QZ9 B;  4FYX B;  2AZS A;  2HL5 C;  4MZM A;  4DBH A;  3OYH A;  4QT7 A;  1KK7 A;  1OPK A;  2K6D A;  3CC2 T;  4M78 E;  1QQJ A;  2X9H A;  3X25 B;  4EMK C;  4IUV A;  2BZY A;  1I1J A;  2R5M A;  4C8Q G;  4ZGJ B;  2FB7 A;  4N4G A;  3GP8 A;  5GAN d;  2H3J A;  5J3B A;  1VUB A;  1OI1 A;  2JS0 A;  1BIB A;  3OYJ A;  4C8Q F;  3M4Y A;  4FSX A;  2YLC A;  1VQ9 A;  4K11 A;  3SWN A;  2VKN A;  1U8R A;  2HQX A;  1X43 A;  2A37 A;  4KGX B;  4PFO A;  1UEB A;  2J05 A;  3QO3 A;  3FDR A;  1GCP A;  2QXF A;  2CDT A;  2X35 A;  2G3R A;  2E5Q A;  2QDY B;  1N8R R;  2LJ1 A;  1VQP Q;  1SSH A;  3QDR B;  1JB0 E;  4J9C A;  1UGS B;  3TU4 K;  2DIQ A;  4C0F A;  4O6J A;  1AWW A;  1JJ2 S;  4DQ2 A;  4M7D B;  4LDV A;  4OMP A;  1IHV A;  1PSE A;  3ME9 A;  2JM8 A;  1YJW T;  1IGU A;  2B8A A;  3WXM B;  1N8R U;  4ELY C;  4ZGD B;  1ZSZ B;  2EQM A;  1ZHI A;  2RB6 A;  3MP8 A;  1LJO A;  4C8Q C;  2KYB A;  2ESW A;  1TOV A;  1X27 A;  1BK2 A;  1N6A A;  2YUN A;  5I11 A;  5KYX A;  3LGF A;  2KBT A;  3RDV A;  1SHF A;  5GAO p;  2RD1 A;  1BCO A;  2K2M A;  1YHQ Q;  4MZT A;  4CI0 C;  5IHN A;  1VQ5 T;  4PJO A;  4OB0 B;  1WA7 A;  3I56 Q;  2V1Q A;  3V8L A;  2CT4 A;  3M5A A;  2DL7 A;  1QVF S;  3NPF A;  2K7A A;  1B34 B;  1VQ5 Q;  2A0F B;  8AT1 B;  1VQL Q;  2KI7 A;  3BY7 A;  1YHQ T;  4ANJ A;  4HCZ A;  4RTU A;  2OTL T;  1U3O A;  1WJR A;  5CR2 A;  2MCN A;  1OUL A;  4Z02 A;  1UE9 A;  1KQS S;  3LH5 A; 
#chains in the Genus database with same CATH homology
 1AD5 A;  2O2O A;  1K0X A;  2RPN A;  2M51 A;  1GCQ C;  3H0H A;  2O88 A;  4OML A;  4J9G A;  1X69 A;  2PTK A;  2HSP A;  3NGP A;  2CUD A;  2EYZ A;  1JO8 A;  3THK A;  3EG1 A;  3VS1 A;  2MIO A;  4CC7 A;  4AFS C;  2EYX A;  4JPB W;  1MUZ A;  3PVL A;  1PNJ A;  2RQV A;  2C0I A;  1RUW A;  1NYG A;  1UJ0 A;  1W6X A;  2LNH B;  4JJD A;  4RTV A;  2F2W A;  1QKW A;  1NM7 A;  1KFZ A;  1NLP C;  2KEA A;  2NWM A;  1X2Q A;  2YT6 A;  4J9D A;  2KE9 A;  1BB9 A;  4R0K A;  5ECA A;  2O9S A;  3LH5 A;  5GJV B;  4HCK A;  1T3L A;  4AFU C;  1JU5 C;  2OAW A;  4LNP A;  3U23 A;  1V1C A;  4OMN A;  1M3B A;  3EG2 A;  1OPL A;  2DNU A;  2RQU A;  2LQW A;  4HVW A;  2K9G A;  1M27 C;  2E5K A;  2VWF A;  4LUE A;  3H41 A;  2FPE A;  1K1Z A;  3RBB B;  2VVK A;  1WDX A;  2X3W D;  1CSK A;  1YP5 A;  1ZSG A;  4AFQ C;  1K9A A;  2ROT A;  2I0N A;  4ZNX A;  2DBM A;  3VS5 A;  1IO6 A;  2DYB A;  1ZUK A;  2GTJ A;  2FEI A;  3VS3 A;  2AKK A;  1K0S A;  3QWX X;  1OEB A;  2HCK A;  3EGU A;  2KRN A;  3TSW A;  2GGR A;  2DM1 A;  1JEG A;  2J06 A;  3PE0 A;  2DL4 A;  1VYT A;  2LMJ A;  2L0A A;  1N5Z A;  1T3S A;  1WLP B;  4LUD A;  2DRM A;  2GQI A;  4RUG A;  1ZUU A;  2AKL A;  1ZUY A;  2CUB A;  3VS4 A;  1B07 A;  2JTE A;  4GBQ A;  4Z88 A;  1K4U S;  1E6G A;  2EW3 A;  2ED0 A;  1T0J A;  2LZ6 B;  1MV0 B;  1YNZ A;  2OJ2 A;  2DJQ A;  1UUE A;  2A28 A;  4A63 B;  2M0Y A;  4IIM A;  2HEQ A;  3JV3 A;  2ED1 A;  2MOX A;  2FRY A;  2F2V A;  1UJY A;  1FMK A;  1TUD A;  2D0N A;  2FG0 A;  3VS2 A;  2BZ8 A;  2DBK A;  2CSI A;  4J9F A;  1AOJ A;  1NG2 A;  1UHC A;  3M0P A;  1UTI A;  5FWB A;  2KYM A;  2L3P A;  1NLO C;  2GTO A;  2FPF A;  2EGE A;  2YSQ A;  2CT3 A;  2LJ0 A;  4OMO A;  2D8H A;  2ROL A;  2J7I A;  1UEC A;  3TSZ A;  2CRE A;  1GBR A;  2C0O A;  4J9E A;  3EG3 A;  2B86 A;  1M3A A;  2ENM A;  4RTZ A;  3SHW A;  2ECZ A;  3VS6 A;  2YUO A;  3UA7 A;  1T0H A;  5FW9 A;  3REB B;  3CQT A;  2D1X A;  1AWJ A;  4F16 A;  2EYY A;  5FWC A;  2DA9 A;  4ESR A;  1NYF A;  2QDL A;  1QWE A;  2DMO A;  1YCS B;  2J6F A;  3I5R A;  1I0C A;  1UG1 A;  2ABL A;  4HVV A;  4Z89 A;  4DEY A;  3A98 A;  4LE9 A;  2SRC A;  5GJW B;  4M4Z A;  1GL5 A;  3UAT A;  2GBQ A;  3ZL7 C;  1SEM A;  1GRI A;  2BZX A;  1G83 A;  2H8H A;  1UHF A;  1XOV A;  4WCI A;  1WXT A;  2KR3 A;  3EHR A;  1PRM C;  2KT8 A;  2AZV A;  5IXB A;  4RTW A;  1ARK A;  2X3X D;  3PVQ A;  1SPK A;  2G6F X;  1CKA A;  1W70 A;  4ORZ A;  2FO0 A;  1E6H A;  1YN8 A;  1JQQ A;  2W0Z A;  1Y0M A;  1W1F A;  2L3S A;  3R6N A;  1QCF A;  3M0T A;  3VRZ A;  5EC7 A;  4F14 A;  2HBW A;  2DX1 A;  1X6B A;  1JXM A;  1X6G A;  5IXF A;  1PHT A;  2V1R A;  1H3H A;  4CC3 A;  1KSW A;  1ZBJ A;  2EVR A;  4AG1 C;  4J9I A;  1K76 A;  2JT4 A;  1UDL A;  1ABO A;  2C0T A;  5IHK A;  2J6K A;  2JM9 A;  4RTY A;  1Z9Z A;  2DL8 A;  1E7O A;  1GBQ A;  1PKS A;  1J3T A;  2NUZ A;  2LQN A;  2L3Q A;  3H0F A;  4KRT A;  1WI7 A;  5I22 A;  3M0R A;  2OI3 A;  1BU1 A;  2DVJ A;  1M30 A;  4D8D A;  2EBP A;  1PKT A;  1ZX6 A;  4EIK A;  4OMQ A;  1RLP C;  2XMF A;  1CKB A;  4D8K A;  3FJ5 A;  1QWF A;  1RI9 A;  4RTT A;  3UF4 A;  1WX6 A;  1I07 A;  2YUP A;  4F17 A;  2DRK A;  3ULR B;  2SEM A;  2JS2 A;  1SHG A;  3UA6 A;  1ABQ A;  3EHQ A;  2JMA A;  2FPD A;  1HSQ A;  3VS7 A;  2RMO A;  2F2X A;  1EFN A;  2DE0 X;  2KT1 A;  4X1V A;  2DLP A;  1HD3 A;  2IIM A;  1TG0 A;  4HXJ A;  1QKX A;  2RQW A;  1PRL C;  2RF0 A;  1TUC A;  3M0S A;  1SRL A;  1M3C A;  2YUQ A;  2AZS A;  4JZ4 A;  1NEB A;  1WFW A;  2O31 A;  4Y92 A;  4QT7 A;  2K6D A;  1OPK A;  1VYU A;  5L23 A;  1LCK A;  2LJ3 A;  2HDA A;  1YWP A;  2KRS A;  2DL3 A;  5IH2 A;  3SEM A;  4LN2 A;  2BZY A;  3QWY A;  1HJD A;  2JMC A;  1U5S A;  2CSQ A;  1I1J A;  1Y57 A;  1S1N A;  1WXB A;  1B3Q A;  1OV3 A;  2RQR A;  1FYN A;  2A36 A;  1GFD A;  2JS0 A;  3I9Q A;  4AG2 C;  1KIK A;  2YDL A;  4CC4 B;  3H0I A;  2RN8 A;  3NHN A;  1AWX A;  3I5S A;  2LCS A;  4K11 A;  2VKN A;  2GNC A;  2A08 A;  5IHI A;  4DEX A;  4OMM A;  1X43 A;  2RNA A;  3M0Q A;  2A37 A;  4CC2 A;  4Z8A A;  1H92 A;  2EGA A;  2J05 A;  1GCQ A;  1A0N B;  1H8K A;  1AVZ C;  1YWO A;  4JJC A;  3GBQ A;  2PZ1 A;  1GCP A;  2K79 A;  2CDT A;  2BTT A;  1NEG A;  1WXU A;  3RNJ A;  2LJ1 A;  3I35 A;  1UGV A;  1SSH A;  4FSS A;  1KJW A;  1GFC A;  2CH4 A;  4J9C A;  2KNB B;  1AWW A;  1X2K A;  1SRM A;  2J6O A;  2EKH A;  4HVU A;  2EGC A;  4OMP A;  1MV3 A;  3VRY A;  1Z9Q A;  2JXB A;  2JM8 A;  2EQI A;  3NMZ C;  1AWO A;  1WIE A;  4IIO A;  2EYW A;  2P4R A;  2DF6 A;  4E6R A;  2LX7 A;  3KFV A;  1PWT A;  1VA7 A;  1QLY A;  2ESW A;  2KYB A;  1X27 A;  2KRM A;  1BK2 A;  1RLQ C;  2W10 A;  2YUN A;  5I11 A;  4JJB A;  2KBT A;  4GLM A;  1SHF A;  1G2B A;  4JZ3 A;  3C0C A;  3REA B;  2LP5 A;  2K2M A;  2DL5 A;  5IHN A;  2KGT A;  3O5Z A;  4AFZ C;  5HCK A;  3EG0 A;  3VS0 A;  1WA7 A;  2DIL A;  3M0U A;  1AZE A;  2V1Q A;  1BBZ A;  4RTX A;  2AK5 A;  2CT4 A;  2D8J A;  2K3B A;  2L2P A;  4J9H A;  2DL7 A;  1AZG B;  1AEY A;  2KXD A;  3NPF A;  1OOT A;  2K7A A;  2EPD A;  2RQT A;  1VYV A;  1U06 A;  2PNI A;  2KRO A;  1WYX A;  2KXC A;  4RTU A;  1U3O A;  2O9V A;  3IQL A;  4J9B A;  2FRW A;  3TVT A;  2JW4 A;  1ZLM A;  1UFF A;  2MCN A;  1UE9 A;  2CH4 W;  1M8M A;  1JXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...