1YP5A

Yeast myo5 sh3 domain, tetragonal crystal form
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
58
structure length
58
Chain Sequence
PMFEAAYDFPGSGSPSELPLKKGDVIYITREEPSGWSLGKLLDGSKEGWVPTAYMKPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein
molecule keywords Myosin-5 isoform
publication title Yeast Myo5 SH3 domain, tetragonal crystal form
rcsb
source organism Saccharomyces cerevisiae
total genus 11
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2005-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1yp5A00
2O88A 1YN8A 1G83A 2FPDA 4J9CA 3TSWA 1CKAA 1H92A 2J6OA 2CDTA 2KRNA 2OI3A 2DM1A 1E6HA 3JV3A 1X6BA 1BK2A 2KXDA 4RTWA 2JT4A 1SHGA 3TVTA 3EHRA 2DILA 2YUOA 1FYNA 1OV3A 2FO0A 3RNJA 2MIOA 2JM8A 2PZ1A 3A98A 3IQLA 1SEMA 1K1ZA 1S1NA 1X2QA 2D0NA 2DE0X 2DL3A 4LUEA 1LCKA 2L3PA 2J05A 4LUDA 2L3SA 1TUCA 5FWCA 1UFFA 2ED1A 3FJ5A 1SPKA 2AKKA 2LCSA 1WXUA 2M0YA 2JM9A 3THKA 4F16A 2V1QA 5EC7A 1ZUKA 1UGVA 1K9AA 2KYBA 2K9GA 3RBBB 3NGPA 4RTVA 2K3BA 1VYVA 1WI7A 4J9BA 1HD3A 1T3SA 1UECA 1QKXA 1MV0B 3UATA 1GFDA 5HCKA 2VWFA 1MUZA 1X6GA 2O2OA 3M0RA 2EGEA 3TSZA 1N5ZA 3CQTA 5I22A 1T3LA 1UHFA 2BZYA 4AFUC 2EBPA 4J9IA 1NG2A 2ROLA 2KR3A 2KRMA 2KT1A 2DL5A 4KRTA 2DRMA 2JW4A 2NUZA 3M0TA 2RQRA 4AFZC 1X27A 1YP5A 1UTIA 3I5SA 4CC3A 3KFVA 2CT3A 1QKWA 2BZ8A 1M30A 2DA9A 1RI9A 3U23A 1JO8A 1UDLA 1AWJA 1UG1A 3PE0A 2GTJA 4GLMA 1YWPA 2C0IA 2D8HA 5IXBA 1B3QA 2KGTA 2LX7A 1M3BA 2A37A 1WXBA 2K6DA 1GCPA 2EYWA 2FRWA 3REAB 1BU1A 1PKTA 2H8HA 3PVQA 4D8KA 1ABQA 2HBWA 2RQTA 4OMOA 1SSHA 2O9SA 2PNIA 1ABOA 2EW3A 2ENMA 2D1XA 1I07A 1Z9QA 2JS2A 3H0FA 3H0IA 1K0SA 5I11A 5FW9A 1ZBJA 1PNJA 2CSQA 2BTTA 2AK5A 1ZUYA 4JJDA 2CUDA 1K0XA 3ULRB 2I0NA 1UHCA 3VS4A 1ZUUA 1T0HA 2CSIA 2FPEA 2AZVA 2DRKA 1AZGB 2GQIA 3M0QA 2W0ZA 1HSQA 1W1FA 2W10A 2YUPA 2EYYA 4J9FA 2DL4A 1AWXA 3O5ZA 2LMJA 4RTUA 2A08A 1I1JA 4JJCA 2KROA 1VA7A 4CC2A 2J7IA 2KE9A 3VS0A 4R0KA 1OOTA 2OJ2A 4RTXA 2MOXA 1J3TA 4J9EA 1X43A 1T0JA 2SEMA 4RTYA 1CSKA 2LP5A 1AEYA 4E6RA 4RTZA 4HXJA 3UF4A 1KJWA 2C0TA 1RLPC 1K4US 1EFNA 2B86A 4GBQA 2CH4A 5L23A 1U3OA 3H0HA 2CT4A 1E7OA 3VS2A 1M3CA 2HCKA 1IO6A 4Z8AA 1I0CA 4IIMA 1SRLA 3EG0A 1M8MA 2FG0A 2KT8A 1GL5A 5IXFA 2ESWA 2LJ0A 3NHNA 4QT7A 1SHFA 1AOJA 2GBQA 4OMNA 1WLPB 2DX1A 2X3XD 1GCQC 1MV3A 1AD5A 1KIKA 3R6NA 2LJ1A 2KNBB 1G2BA 1M3AA 1AVZC 3M0SA 3SEMA 2NWMA 2YDLA 4ESRA 3H41A 2PTKA 2JXBA 3LH5A 4J9HA 4JJBA 2MCNA 2CREA 4X1VA 1JXMA 4F17A 2D8JA 2EGCA 1JXOA 1WXTA 3M0PA 2P4RA 2EPDA 1JU5C 1NYGA 2J6KA 2RF0A 2A36A 4HVUA 2RQVA 3EG2A 3EHQA 2SRCA 2ABLA 2JTEA 1SRMA 4HVWA 1XOVA 4ZNXA 4DEYA 2L0AA 2AKLA 2M51A 4J9GA 5FWBA 4FSSA 4OMPA 5IHNA 4Y92A 2JMAA 3ZL7C 4Z88A 1YCSB 1NYFA 1WDXA 2LJ3A 4ORZA 2K79A 2C0OA 2DJQA 1PRMC 2LZ6B 3EG1A 2DYBA 2RQUA 2DLPA 4AG1C 2YSQA 3EG3A 2HEQA 2GTOA 1JEGA 4OMMA 1OPKA 3GBQA 1WFWA 2JMCA 2O31A 1PWTA 1OPLA 2YT6A 3NPFA 2EYXA 2FEIA 1QCFA 2EQIA 4AFQC 1AWWA 1UJYA 2F2WA 1FMKA 2KXCA 4LNPA 4DEXA 1HJDA 2IIMA 4CC4B 2KRSA 1NLOC 2F2XA 1W6XA 2HSPA 4WCIA 2GGRA 1UJ0A 2EGAA 1VYTA 1X2KA 1VYUA 4LE9A 2RMOA 2FPFA 1WYXA 2E5KA 2KEAA 4CC7A 2ECZA 1KSWA 1WIEA 1NEBA 2YUNA 3UA7A 4LN2A 2RN8A 4RUGA 1ZLMA 4JZ3A 2LQWA 1TUDA 1CKBA 2QDLA 1X69A 3REBB 1PHTA 1Y57A 2A28A 2J06A 2EVRA 3C0CA 2RQWA 2DL8A 1NEGA 2L2PA 1V1CA 2RPNA 4A63B 1QWFA 1GBRA 2GNCA 1A0NB 2VKNA 2AZSA 4HVVA 1H3HA 2EKHA 2DF6A 2YUQA 2DMOA 4IIOA 2OAWA 2BZXA 4RTTA 1GCQA 2CUBA 3SHWA 3EGUA 1QWEA 1TG0A 3VS5A 2DNUA 2FRYA 2LQNA 3VS6A 2DBKA 1E6GA 4JZ4A 2K2MA 1QLYA 4EIKA 4HCKA 4Z89A 4F14A 4AG2C 4OMQA 5ECAA 5IHIA 1RLQC 3M0UA 2ED0A 1W70A 2G6FX 3VRZA 3I35A 3QWXX 1B07A 3VS3A 1H8KA 5IHKA 1AWOA 3VS1A 2X3WD 1UE9A 1ZX6A 1M27C 2LNHB 1NLPC 1GBQA 4AFSC 3NMZC 4M4ZA 1PKSA 2KYMA 1WX6A 1JQQA 2DBMA 3VRYA 2L3QA 2V1RA 4JPBW 1UUEA 1GRIA 1KFZA 4J9DA 2XMFA 2O9VA 2JS0A 2CH4W 5IH2A 4OMLA 1PRLC 1ZSGA 2K7AA 3QWYA 1YWOA 5GJVB 4D8DA 1RUWA 1U06A 1BB9A 2F2VA 1GFCA 2VVKA 2EYZA 2HDAA 1YNZA 1Y0MA 3UA6A 1ARKA 2DL7A 2DVJA 2ROTA 1BBZA 5GJWB 2KBTA 1U5SA 1OEBA 2RNAA 3I5RA 3VS7A 1K76A 3I9QA 1AZEA 2J6FA 4K11A 1Z9ZA 1WA7A 3PVLA 1NM7A
chains in the Genus database with same CATH superfamily
2COYA 5FLXE 5CKFA 2L3RA 3TSWA 1VQLQ 4A4EA 1QVFS 3GNGA 3CXCS 4C8QC 4RTWA 3TVTA 1H3ZA 4C92B 5FROA 3QBYA 3QDRB 4C92E 2PZ1A 3IQLA 4PJOG 3QXEB 1X2QA 4M7AG 4DBRA 1IREB 2F5TX 2JTFA 3X25B 5A0GA 4C0FA 2DL3A 2J05A 4M78C 3L1AA 2ED1A 4PJOF 2OTJQ 3MP1A 2KMTA 4M7AF 5GAOl 1TH7A 1VQ7Q 2AKKA 1VQ6Q 4FM4B 2FZCB 2COWA 2JM9A 3CCLQ 4F16A 4HCCA 1HYOA 5EC7A 1K9AA 2KYBA 4C0ZA 4FYXB 1K73U 3A8LB 3CC4A 1UECA 2X4JA 1UGPB 5GMKi 3EH1A 2O2OA 3FB9A 1Q7YC 4C8QG 3OMCA 2EGEA 4DBHA 1VQ9Q 5I21A 4PLIA 3CEYA 3EFOB 5I22A 3LYIA 5DY9A 2LQKA 1ZA2B 3BFMA 3CCEA 3RIRA 3E1SA 1NG2A 4J6XA 4E7SA 3OYGA 2HL5C 3HHTB 3QZ9B 4PJLA 2I2LA 1OX9A 2NUPB 4C92D 1VOMA 4AMCA 1N8RU 3H6ZA 3M54A 1KD1C 3I55Q 4KT0E 3OSSC 2BZ8A 2DTIA 1ZSZB 5A2QE 3U23A 1UDLA 3PE0A 4JUVA 2QI2A 2D8HA 2X9HA 5LJ5j 5KH6A 1M3BA 1JJ2P 2K6DA 3S3OA 3DLMA 2RHIA 2XDPA 2CYZB 4LD6A 3REAB 2KY9A 1BU1A 1PKTA 1KD1R 5CIUA 2HBWA 5KE2A 5CCAA 4O5VA 1D1AA 3MJXA 2D1XA 1I07A 2JS2A 3VUBA 4BDYA 1PNJA 2CSQA 1ZUYA 4YTLA 1VQKQ 3NTKA 1YHQA 3AHUA 1XTDA 2I0NA 3VS4A 4C5HA 1T0HA 2CP5A 2AZVA 4JLIA 2GQIA 1HSQA 1W1FA 2W10A 4E47A 1B34A 2DEQA 2YLBA 1W4SA 1AWXA 5LJ3h 3O5ZA 2PVDB 1D0YA 2LMJA 1YI2T 1RABB 1VQPT 2DXTA 3ER0A 2J7IA 1AT1B 4R0KA 3OYBA 2RHZA 4J7FA 5GAMg 2MOXA 1WPYA 4C8QE 3VYHB 2LDMA 4E6RA 1TOVA 1RAAB 1YITQ 4HXJA 3L2ZA 4EMGA 2ZPGB 4ATOA 7AT1B 4M77C 4N4GA 5D6YA 2QAZA 3PFSA 2B86A 3PT9A 1Y07A 4M78B 2QEXT 4P5NA 5HKCA 1M3CA 4M78E 4F7UA 9ATCB 4Z8AA 1I0CA 2O4XA 4IIMA 1SRLA 2MWPA 3QJ6A 1VUBA 2OTLA 2KT8A 3X24B 4OVAA 3NHNA 2CP2A 2M02A 1S72T 1G3SA 1OU9A 1BCMA 1YJNQ 1WHJA 1MHNA 2DX1A 4N4HA 3BE3A 1AD5A 1G2BA 5LJ5d 2YDLA 4ESRA 3X20B 2XICA 2NLUA 2JXBA 3S3MA 3OMGA 4JJBA 2MCNA 4ANJA 2CREA 3V7SA 4F17A 3QYHB 2YXYA 2EFIA 1JXOA 2MK5A 3OYNA 1NJIC 3LWHA 1WXTA 1K8AU 4FIBA 3EGXB 1NYGA 2PVGB 2AIRB 2V8IA 3CCRA 4C8QD 2YRVA 4ZN3A 3EHQA 2GFAA 1NPRA 3G7ZA 2M51A 4J9GA 3UWNA 4IUQA 3M4YA 1VQMA 2KI7A 1YI2A 2AHJB 3ZL7C 4J7IA 1VQPA 4Z88A 1NJIR 4N4IA 2K79A 4QQ6A 3EH2A 4J83A 2X4WA 2DYBA 2RHUA 3E2UA 4M78D 3A8MB 2HEQA 3Q1JA 3CCVA 1OPKA 2VXEA 1TWBA 5D7UA 1D0ZA 1WFWA 2QGGA 1PWTA 4FSXA 2FZKB 1RAFB 3FRNA 4IKFA 3PIOA 2VASA 2VXFA 1HJDA 2IIMA 4M75F 2KRSA 4OB1B 3G71Q 5KYWA 1X2KA 2RMOA 3SB2A 1W2BS 2V8KA 2MPXC 2KEAA 4XQ3A 1KSWA 1I8FA 2K5FA 1S72A 3P8DA 4QQDA 2DIGA 3S3NA 2X4XA 4A54A 2QDLA 2RJCA 1WHLA 4LDVA 4BI8B 2XDBA 3QO3A 3PNWC 3INZA 1Y57A 5CKEA 2A28A 4NL2A 4PL6A 2EVRA 3L2RA 2RQWA 4PJMA 5C0MA 1V1CA 1K9MU 2G3RA 4J5YA 3HP9A 4A63B 1KQ1A 2GNCA 1A0NB 5CK9A 5J39A 3L2QA 3JCMf 2H3JA 5GAN3 1M1KU 4M77E 2EQJA 2BZXA 1GCQA 2CUBA 2E1HA 1FX7A 1R77A 2DBKA 1E6GA 2QASA 3LX7A 4L5GA 4HCKA 4QKUA 4PNOA 4OGCA 1RLQC 3CCUT 1M1KR 3ZBDA 3HPWA 2QDYB 4UC4A 4XTVA 4Z02A 5CQXA 5GAN5 3VU3C 3HRTA 1H8KA 5IHKA 3RKYA 4DOVA 4HA8A 4M4ZA 4ZTJA 1QVGP 5I2SA 4PJOA 2V1RA 3FEOA 4M7AA 2FVUA 1Y71A 2O9VA 4JRKA 2JS0A 3C94A 4HKEA 5IH2A 4PK4A 1YWOA 1M90C 1U06A 4FW1A 1RADB 1OU8A 2EYZA 1YNZA 4NOYA 5LJ3g 2A7YA 2E70A 2QYZA 3A5ZB 4M77D 2LVMA 5HK3A 1Q82U 2PQWA 3CCMT 2RNAA 3VS7A 3I5RA 1Q81C 1QMCA 3QYGB 4CI0C 2J6FA 2HMAA 1VQLT 1Z9ZA 1WA7A 2DKGA 5GAOq 3TCJA 1UGQB 1PSFA 4X9DA 3M55A 2O88A 1YN8A 3OS0A 2QGFB 2KAFA 1CKAA 1Y96B 2CDTA 2J6OA 1WQWA 1D0XA 3A8GB 4O6JA 4JS4A 2KXDA 5GMKh 2FL7A 1VQOQ 1XNIA 2R5MA 1FYNA 3CMAQ 2L8DA 3F70A 3CCQA 3FDRA 1BI1A 3ZEHA 3V8KA 4HCBA 2OTJT 2KQWA 5KYXB 1VQ7T 1KG1A 1VQ6T 1M2VB 1I5OB 1TUCA 5FWCA 3CCSA 5GANh 2E3IA 3CCLT 1B34B 1SPKA 2DZCA 2BUDA 2LCSA 3MPUB 1WXUA 4M7DC 2M0YA 4Y91A 1UGVA 4C92G 4E7LA 2F1LA 2K9GA 2XI9A 2EJ9A 3CD6Q 1WI7A 4J9BA 1HD3A 1VQ9T 3G4SQ 2E65A 1QKXA 4L6V5 5HCKA 3JCMh 4C92F 2VWFA 1M2OA 3R6OA 1N5ZA 2DXUA 1UEBA 1UHFA 4XTYA 2V26A 4AFUC 1SKUB 2ROLA 4LDXA 2KR3A 2KRMA 4OP0A 2DL5A 2HQXA 4F7UB 4IUVA 5J26A 3I55T 2IG0A 3HKSA 3KBGA 4KRTA 4LD9K 1BIAA 4OB0B 3OS1A 1AHJB 1YP5A 1VQLA 4CC3A 3G6EA 3OYYA 4ZN1A 1M30A 2DA9A 1FMVA 3L2WA 1RI9A 3N5BB 1AWJA 4GLMA 1YWPA 3QZ5B 3NTHA 5IXBA 4E7KA 2COZA 1IZ6A 2QA4T 5GAOp 2XK0A 4GY5A 2A37A 1TTHB 1PG5B 3OSVA 2BKDN 1LPLA 2H8HA 4XTUA 1YJWQ 3CC7A 2RQTA 2GCXA 4JS5A 2PNIA 1VQKT 5FRMA 2EW3A 5CAIA 1Z9QA 3H0FA 3H0IA 3L42A 1M1GA 1HK9A 3AT1B 4OGEA 4KH0B 5I11A 3I56Q 1YIJA 2P0PA 4RMOA 1G3YA 5GAMj 5LJ3f 3TQ7P 4PLLA 2A3LA 3HRSA 2LCLA 1VQ5A 3ZFJA 2DRKA 1AZGB 2YUPA 2EJFA 1PCXA 5IT9E 1VQ8Q 2DL4A 2EWNA 1D3BA 3OW2A 3CPWP 2DXBA 4RTUA 1I1JA 2KROA 3X28B 1VA7A 2KE9A 2FZGB 1KQSP 1J3TA 3JCMV 3RUXA 1T0JA 4RTYA 3OYHA 2LP5A 1AEYA 2NYSA 4EDUA 5LJ5e 1JJ2S 3MKDA 4XK8E 1ZA1B 1K73C 1VQNT 5HY6A 1MMNA 4GBQA 3JCMQ 2E3HA 4XU1A 1QVFA 3DKMA 2CT4A 3CXCA 2ZPIB 2MI6A 1P92A 1PD0A 1LJOA 2E6NA 1YJNT 4M7DB 1M8MA 2FG0A 5IXFA 2LJ0A 4M7DE 1K73R 3CPFA 3VYGA 4QT7A 1SHFA 5C6SA 2OX7A 4OMNA 1WLPB 2QA4A 2X3XD 4B6MA 3HFOA 4C8QF 4X34A 1WJRA 4M75A 1OX8A 1ACMB 4L59A 3H41A 1N8RC 4MDWA 1U8RA 4J9HA 4M78G 2VYTA 4OMFB 1JXMA 2D8JA 1QVPA 5KYYB 5A0DA 2QQRA 5KYNA 4II1A 2HBPA 2EPDA 2XIDA 4M78F 1O9SA 4HVUA 2E5QA 1N8RR 4HVWA 5GAMd 1XOVA 4DEYA 4IURA 2FYKA 3FIFA 2L0AA 2QQAA 5IHNA 5AT1B 4Y92A 1YCSB 3CC4Q 1NYFA 2C0OA 3X26B 1PRMC 1EX4A 2LZ6B 4ZGJB 3OB9A 1KK7A 4LXCA 1OI1A 4DBQA 2YSQA 2CP6A 3EGDA 4BACA 1MNDA 1H641 3P8HA 3GP8A 2L5QA 2QTVA 4M7DD 3CCEQ 1ZQ1A 4BUGA 1OPLA 2EAYA 3ME9A 3NPFA 2EYXA 2FEIA 1QCFA 2EQIA 3QG1A 5CKBA 4AFQC 3G71T 1VQNA 2KXCA 4LNPA 1JBMA 2NUTA 4CC4B 5AYFA 3CMEQ 1W6XA 2HSPA 4WCIA 3RMQA 5GANg 1VYUA 4LE9A 1WNLA 4QQGA 4BD3A 2E5KA 4RCBA 2CZ7B 2QXFA 4CC7A 5GAN8 4FYYB 1NEBA 2Y4XA 8ATCB 4J6WA 3KUFA 5GMKm 4RUGA 1ZLMA 4JZ3A 3GF5A 2ATCB 1CKBA 2PUKB 4PFZA 1X69A 5D6WA 5I2MA 3V8LA 1VQ4T 3VUZA 3QUIA 3JCMg 2QK0A 4C0GA 2LX9A 3UPUA 1UGRB 2RI5A 2RHXA 4KGXB 2L2PA 2WACA 2K5IA 1QWFA 1WZOA 2AZSA 4HVVA 2RK1A 4XTWA 4WF2A 1YHQQ 4V2SA 2IPOB 3DB4A 3MO8A 5IAYA 3D7SB 2RH2A 1KC8U 2ZPHB 2DYIA 4ME7A 1OULA 4EMKA 4EIKA 2XDDA 3V7RA 3BDLA 4AG2C 5CKHA 2R5AA 5KYUB 4OB3B 3EFSA 1K8AC 4MZTA 3QWXX 2XG8D 2HQEA 1YCYA 1KQ2A 4M77G 5CVIA 2E6ZA 1M27C 2LNHB 3V7CA 1NLPC 1GBQA 2VB6A 4DOWA 3GOXA 3G71A 2M9UA 4A53A 4MDXA 3MCAB 1JQQA 2F5KA 1K8AR 4M77F 1N27A 1Y7XA 3JAME 4KGZB 3BDUA 2X4YA 3L2UA 1GRIA 1KFZA 2EJGA 3OBYA 2XMFA 2CH4W 5HK0A 3QPHA 4OMLA 2OTLQ 2K7AA 3V8JA 2RJDA 1RUWA 4FYVB 1GFCA 3O8VA 2VVKA 2LRQA 4C5IA 3TU4K 4E7HA 4C92A 4E7JA 1OEBA 1VQ4A 3FJPA 2DK3A 4ZTFA 1XQHA 1Q86U 5FU7C 2QEXA 1PD1A 2Z0WA 3MEWA 3JB9G 1H92A 2OI3A 8AT1B 2DM1A 1E6HA 1X6BA 1M4ZA 2JT4A 3RKWA 3OYEA 1BKBA 2DILA 2YUOA 3CCRQ 2DERA 2FO0A 3RNJA 2MIOA 2JM8A 3DB3A 1HXDA 4JDSA 1MMAA 1SEMA 1PSEA 2KK4A 3NFCA 4A4GA 5GANf 2D0NA 1MGQA 4Y28E 1QVGS 1VQMQ 1YI2Q 1R0CB 1LCKA 2RD1A 1K9MC 3OS5A 2L3SA 1UFFA 3FJ5A 2KSSA 3OY9A 4C5GA 4HCZA 2YWWA 1M1KC 3CD6T 4XU2A 3THKA 3CCVQ 3G4ST 4QVZA 1NE8A 3RBBB 4RTVA 1K9MR 1VYVA 5LL6S 1W2BA 3HSBA 1IRXA 2DTHA 2D9TA 2EIFA 4KUIA 4JRPA 5L8RE 1FWZA 3MEUA 2NUPA 4OF1A 3M0RA 5LJ3d 3WVEB 1NPPA 4CRIA 1WJQA 2JJ9A 2QQBA 3META 1T3LA 3C12A 2EBPA 4MZPA 5IN1A 1OQKA 1ZSZA 3PMIA 4FT2A 1S72Q 5J3BA 4BE1A 4A4FA 2CS7A 4VUBA 4E7ZA 2JW4A 2NUZA 4AFZC 2DO3A 1N9SA 1X27A 2HZYA 1UTIA 3I5SA 3KFVA 5CQYA 1QKWA 1WQ7A 1UG1A 4BB7A 2WSEE 2GTJA 3CCJT 4M75B 1B3QA 4MMLA 2FHDA 1YJWT 2ZPFB 4JRIA 4C0DC 1GCPA 2EYWA 2FRWA 1Q82C 4F7UG 3PVQA 4D8KA 3OA6A 2LNVA 2P84A 1SSHA 2O9SA 2ZZDA 3JCMX 3I56T 3UT1A 3JCMJ 2ENMA 1K0SA 3CBOA 2R57A 3OYAA 1BYMA 1ZBJA 2KVQG 2AK5A 3HRUA 4JJDA 1F1BB 1K0XA 1VQ8T 1Q82R 4C8QA 1KHIA 2W0ZA 2QQSA 2EYYA 3OYMA 4JLGA 3G4SA 2QTXA 2LT1A 4A4KA 2RHYA 4XTZA 1C1AA 2A08A 4JJCA 5FU7B 2DTOA 3VS0A 3G1JA 2L89A 1QQJA 5GMKl 1I5LA 3SFMA 4PJNA 4J9EA 4M78A 3CCUA 2SEMA 5CO7A 1SF9A 4QW2A 3JB9D 3KXTA 2C0TA 1RLPC 1WHMA 2E4HA 3QIIA 3VKIA 4DA4A 2HKNA 1K4US 5L23A 4Q5WA 3H0HA 4FCYA 1Q95G 3M5AA 2IVWA 1WGSA 3JCMW 1AWWA 4LDUA 3EG0A 4DQ2A 3JRZA 5GAMe 4HT8A 2ESWA 3CCJA 4D6WA 5GAN2 1SG5A 4RG8A 1GCQC 1MV3A 4RG2A 2F69A 1KIKA 3EGXA 3WVDB 1M3AA 3CPWS 3M0SA 2NWMA 2JNGA 3CCQQ 3JB9J 3MP6A 2PVOB 4F7UE 2O4XB 2PTKA 3LH5A 3CCMA 2GQVA 4X1VA 1KQSS 1BI0A 1C6VX 2EGCA 3C4SA 2VGNA 2HKQB 3CCSQ 1M1FA 4M7DG 1DJ7B 4PKCC 3M58A 2RF0A 2A36A 2RQVA 2XHCA 3EG2A 1VQ8A 2WSCE 3OYDA 2SRCA 2ABLA 2JTEA 3E9FA 1PM3A 3CBPA 5GMKj 2RK2A 4BE0A 2MYSA 1IB8A 3CC4T 2AKLA 1YJ9Q 4M7DF 5FWBA 2DVEA 3GLXA 3JCMb 3PGGA 4OMPA 4PJOC 4J8OA 1I81A 3OYKA 1D1BA 4M7AC 2LJ3A 2CP3A 2Y90A 1N9RA 2K3YA 2OTJA 2K5LA 2MF2A 3EG1A 4BY6C 1VQ7A 1VQ6A 1IGUA 3CCET 1D09B 3CC2Q 3CCLA 4C0DB 2B8AA 4DBFA 2HNIA 3EG9A 4HT9A 4OMMA 1TS9A 2EQMA 2RJFA 2JMCA 2O31A 1BI3A 2YT6A 1UJYA 3CMET 2DFUA 1TU0B 3H8ZA 1OZ3A 1IHWA 4DEXA 2QQ9A 1XJWB 1VQ9A 1NLOC 1TSFA 2P4TA 3G6EQ 3SDZA 2FPFA 2PUOB 3JCMP 5LJ5h 1YITT 3PIPA 2ECZA 1WIEA 2YLCA 2YUNA 2RN8A 4AT1B 2EQUA 1SSFA 2LQWA 2HQHA 1TUDA 2RI2A 5KYWB 4M77A 1G3TA 1VIEA 1PHTA 3CC7Q 3I55A 3GPLA 1NBEB 1YHQT 1NEGA 2DPPB 2HL3A 3TREA 2RPNA 3OW2P 5FRNA 1YIJQ 4KGVB 2MMPA 2DF6A 4A4HA 4GLKA 4IIOA 1OZ2A 4E2FB 2OAWA 4E7IA 1VQ5Q 2BE9B 5EG2A 1QWEA 3VS5A 2DNUA 2FRYA 2LQNA 4LDWA 3VS6A 1UB4A 4JZ4A 2K2MA 2GFUA 1QLYA 2E64A 4FL6A 3QJYA 2RM4A 4OMQA 5GAN6 5ECAA 5IHIA 3M0UA 3OYCA 1JJ2A 1VQKA 1Q7YU 4C5EA 2G6FX 3OS2A 3I35A 1QVFP 4FW2A 3S6WA 3CXCP 3A8HB 3VS1A 4WTOB 1UE9A 2P0KA 1ZX6A 1WHHA 3QHSA 2EKOA 5GANd 2V8JA 1Q7YR 3CMEA 2LT4A 2CP0A 4ZGEB 1UGSB 2DBMA 3VRYA 1RAHB 4BI4A 2L3QA 4JPBW 1UUEA 2OTLT 1KD1U 1G5VA 4J9DA 5KCHA 1RACB 1BI2A 5CKDA 3QWYA 5GJVB 3JCMd 1YITA 1BB9A 3HTRA 2K57A 4KULA 2MAMA 3JB9H 1RI0A 1Y96A 4R56A 1Y0MA 2QA4Q 4PJOB 1ARKA 5GAN4 3HFNA 2MWOA 4B9WA 2DL7A 4EMHA 2DVJA 4M7AB 2ROTA 4PJOE 3NTIA 5GJWB 1U5SA 4PFOA 4M7AE 2HD0A 2M1HA 1K76A 4BY6B 1NM7A 2E12A 1G83A 2FPDA 4J9CA 3CCRT 5KYXA 2KRNA 1JB0E 1M8VA 1M2VA 3LWIA 3JV3A 2D6FA 1YFNA 2DIQA 1YJNA 1BK2A 1SHGA 2CGHA 3EHRA 1OV3A 3VJPA 1VQMT 1RAIB 3A98A 3DLLA 1LVKA 1K1ZA 1S1NA 1TUGB 5LJ3e 2C06A 2DE0X 5KCOA 3MEVA 4N0AA 2XU8A 4LUEA 2L3PA 4C8QB 4LUDA 6AT1B 2O01E 3CCVT 1R0BG 1IXDA 2DZ9A 1X75C 2DD5A 1LNXA 2V1QA 1QP3A 1C0MA 1V76A 1ZUKA 1KC8C 2ZGWA 4XU0A 4FYWB 4OB2B 3A1PA 2JN0A 3NGPA 2K3BA 3PTAA 4JJNK 1ZHIA 1VQNQ 1T3SA 1EZZB 3UATA 1MV0B 4IUPA 4PFPA 1GFDA 3OYJA 4PJOD 2JUFA 1MUZA 4M7AD 1X6GA 3MHXA 2VGMA 3TSZA 1FMWA 1OYXA 3CQTA 1KC8R 2K3XA 3M9QA 2BZYA 3RERA 3JB9I 4J9IA 2AT1B 1YBYA 2KT1A 4RCCA 5GAOn 4JRQA 4M75C 4IUUA 1GXIE 2EQKA 2XD0A 2QG9B 2DRMA 3M0TA 2RQRA 3BY7A 3RMSA 3SWNA 5LJ3j 4FT4A 2CT3A 2JZ2A 2VC8A 1JO8A 3JSCA 1NJIU 2CKKA 4KUDK 2C0IA 1JRIA 2KGTA 1PC0A 4R55A 5KE3A 2LX7A 2R58A 1WXBA 2K4YA 2JTMA 4BDZA 3RDVA 1V29B 4QVDA 3JCMc 1ABQA 3C95A 2A0FB 4OMOA 3LGFA 1ABOA 3J81E 1RAGB 1Q86C 3LGLA 3RESA 5FW9A 2GF7A 1FXXA 2BTTA 2CZ0B 3VV0A 2CUDA 3BW1A 5LJ5g 1VQOT 2CZ1B 5GAN7 3FC3A 3ULRB 3LLRA 3CMAT 1UHCA 2BE7D 1ZUUA 4M75G 2CSIA 2FPEA 3M0QA 4XAXB 4J9FA 4KH1B 1IGQA 1Q86R 3JB9F 2DJZA 3URGA 4CC2A 2E10A 3EG9B 2CZ6B 4NL3A 1OOTA 2OJ2A 4QVCA 5GAOr 4RTXA 1VQPQ 2YRDA 3M53A 4F04B 3UDCA 1X43A 3EFRA 1CSKA 2ZCFB 1D3BB 5CR2A 4RTZA 4M7DA 2WSFE 3UF4A 2VUBA 1KJWA 3EFOA 1EFNA 2RO0A 3M4GA 4N0AC 5GAMf 5GAOm 2E41A 2CH4A 1U3OA 2X35A 1E7OA 5A0LA 1VQ4Q 5FU6C 1VIFA 3VS2A 2HCKA 1IO6A 2PU9B 2QEXQ 1GL5A 1O75A 4M77B 3WXMB 2LCCA 1AOJA 2GBQA 1QVGA 3MEAA 5KYYA 1IHVA 3CCQT 3M57A 3R6NA 2LJ1A 2LTOA 2KNBB 4MMKA 1AVZC 1EIFA 3OYIA 4FU6A 1MMGA 3SEMA 4EMKC 1QW1A 1M5Q1 4EPCA 3CCST 2M16A 2DETA 5DM7R 5DLOA 3EAEA 3FLGA 2P0QA 2HAXA 3M0PA 3RR6A 2P4RA 1W2BP 1JU5C 1VQOA 1YJ9T 1G3WA 2J6KA 3CMAA 3QDFA 4NS5A 4M75E 3L2VA 1SRMA 4ZNXA 3OBWA 4MZMA 1QCNA 3SWNC 4FSSA 1N6AA 2RB6A 2JMAA 1WDXA 2VV5A 2DD4A 3ASKA 4ORZA 3CC2T 1BCOA 3QSUA 2DJQA 3J80E 4TVRA 2X51A 3A8OB 3P8BB 2RQUA 2DLPA 4AG1C 3E19A 4F7UF 3EG3A 2OAUA 4X9CA 3M56A 2M0OA 2GTOA 1JEGA 4XTXA 2DAQA 3GBQA 1M90U 1WJSA 2YRCA 3CBMA 2D0QB 3CD6A 4C92C 3LW5E 3HL8A 2F2WA 1FMKA 2JVVA 3G6ET 4XU3A 1QCOA 3EGDB 5LJ5f 1Q81U 1M90R 2F2XA 2GGRA 1UJ0A 2EGAA 1VYTA 1WYXA 4KBMB 3MP8A 4PJJA 4ZGDB 3OYFA 1I4K1 1Q81R 5GMKe 3UA7A 4LN2A 3CC7T 2LQ8A 2H3EB 2NUTB 2XKOC 2JOYA 4M75D 2RA2A 4ELZC 3REBB 4IUTA 2Y4YA 3E9GA 5D6XA 2J06A 3C0CA 4B9XA 1YIJT 2DL8A 5GAMh 1WHKA 1GBRA 2VKNA 1QP2A 4LDYA 1LOJA 5GANe 1VQ5T 1H3HA 2EKHA 2DEUA 1X01A 1YJ9A 2YUQA 5KYUA 2DMOA 2LC4A 3GIBA 1RL2A 1BIBA 3RKXA 4RTTA 3TEEA 1YJWA 2CP7A 3SHWA 3EGUA 2HSEB 1WHGA 1TG0A 4ELYC 5FU6B 1G8XA 2BIVA 3PMTA 3QKJA 1M9SA 4Z89A 4F14A 1TXQA 1NZ9A 3JCMe 3I56A 2RJEA 3CC2A 2ED0A 1MMDA 1W70A 1U1SA 3VRZA 2FB7A 2K2VA 4BE2A 1B07A 3CCUQ 3VS3A 1ZSZC 4BI3A 2DXCA 1AWOA 2X3WD 4EMKB 1ZBXA 4AFSC 3SD4A 3NMZC 2ZPEB 1PKSA 2KYMA 1WX6A 1B7TA 2EYQA 3H9NA 3M59A 3GNFB 5DLQE 2RI3A 3OW2S 3CPWA 3LH0A 3OQ5A 1PRLC 1X6OA 1ZSGA 4D8DA 3OYLA 5GANj 2F2VA 3CCJQ 1KHCA 2YHTA 3SWNB 2HDAA 3T9NA 1R8OB 1MNEA 1KQSA 5M9OA 3UA6A 1U1TA 4J6YA 2KDSA 1D1CA 1BBZA 1RAEB 2KBTA 3J7AF 3I9QA 1AZEA 2ZAEA 4K11A 2ZPBB 4RKUE 3PVLA 3CCMQ
chains in the Genus database with same CATH topology
2O88A 1YN8A 1G83A 2FPDA 4J9CA 3TSWA 1CKAA 1H92A 2J6OA 2CDTA 2KRNA 2OI3A 2DM1A 1E6HA 3JV3A 1X6BA 1BK2A 2KXDA 4RTWA 2JT4A 1SHGA 3TVTA 3EHRA 2DILA 2YUOA 1FYNA 1OV3A 2FO0A 3RNJA 2MIOA 2JM8A 2PZ1A 3A98A 3IQLA 1SEMA 1K1ZA 1S1NA 1X2QA 2D0NA 2DE0X 2DL3A 4LUEA 1LCKA 2L3PA 2J05A 4LUDA 2L3SA 1TUCA 5FWCA 1UFFA 2ED1A 3FJ5A 1SPKA 2AKKA 2LCSA 1WXUA 2M0YA 2JM9A 3THKA 4F16A 2V1QA 5EC7A 1ZUKA 1UGVA 1K9AA 2KYBA 2K9GA 3RBBB 3NGPA 4RTVA 2K3BA 1VYVA 1WI7A 4J9BA 1HD3A 1T3SA 1UECA 1QKXA 1MV0B 3UATA 1GFDA 5HCKA 2VWFA 1MUZA 1X6GA 2O2OA 3M0RA 2EGEA 3TSZA 1N5ZA 3CQTA 5I22A 1T3LA 1UHFA 2BZYA 4AFUC 2EBPA 4J9IA 1NG2A 2ROLA 2KR3A 2KRMA 2KT1A 2DL5A 4KRTA 2DRMA 2JW4A 2NUZA 3M0TA 2RQRA 4AFZC 1X27A 1YP5A 1UTIA 3I5SA 4CC3A 3KFVA 2CT3A 1QKWA 2BZ8A 1M30A 2DA9A 1RI9A 3U23A 1JO8A 1UDLA 1AWJA 1UG1A 3PE0A 2GTJA 4GLMA 1YWPA 2C0IA 2D8HA 5IXBA 1B3QA 2KGTA 2LX7A 1M3BA 2A37A 1WXBA 2K6DA 1GCPA 2EYWA 2FRWA 3REAB 1BU1A 1PKTA 2H8HA 3PVQA 4D8KA 1ABQA 2HBWA 2RQTA 4OMOA 1SSHA 2O9SA 2PNIA 1ABOA 2EW3A 2ENMA 2D1XA 1I07A 1Z9QA 2JS2A 3H0FA 3H0IA 1K0SA 5I11A 5FW9A 1ZBJA 1PNJA 2CSQA 2BTTA 2AK5A 1ZUYA 4JJDA 2CUDA 1K0XA 3ULRB 2I0NA 1UHCA 3VS4A 1ZUUA 1T0HA 2CSIA 2FPEA 2AZVA 2DRKA 1AZGB 2GQIA 3M0QA 2W0ZA 1HSQA 1W1FA 2W10A 2YUPA 2EYYA 4J9FA 2DL4A 1AWXA 3O5ZA 2LMJA 4RTUA 2A08A 1I1JA 4JJCA 2KROA 1VA7A 4CC2A 2J7IA 2KE9A 3VS0A 4R0KA 1OOTA 2OJ2A 4RTXA 2MOXA 1J3TA 4J9EA 1X43A 1T0JA 2SEMA 4RTYA 1CSKA 2LP5A 1AEYA 4E6RA 4RTZA 4HXJA 3UF4A 1KJWA 2C0TA 1RLPC 1K4US 1EFNA 2B86A 4GBQA 2CH4A 5L23A 1U3OA 3H0HA 2CT4A 1E7OA 3VS2A 1M3CA 2HCKA 1IO6A 4Z8AA 1I0CA 4IIMA 1SRLA 3EG0A 1M8MA 2FG0A 2KT8A 1GL5A 5IXFA 2ESWA 2LJ0A 3NHNA 4QT7A 1SHFA 1AOJA 2GBQA 4OMNA 1WLPB 2DX1A 2X3XD 1GCQC 1MV3A 1AD5A 1KIKA 3R6NA 2LJ1A 2KNBB 1G2BA 1M3AA 1AVZC 3M0SA 3SEMA 2NWMA 2YDLA 4ESRA 3H41A 2PTKA 2JXBA 3LH5A 4J9HA 4JJBA 2MCNA 2CREA 4X1VA 1JXMA 4F17A 2D8JA 2EGCA 1JXOA 1WXTA 3M0PA 2P4RA 2EPDA 1JU5C 1NYGA 2J6KA 2RF0A 2A36A 4HVUA 2RQVA 3EG2A 3EHQA 2SRCA 2ABLA 2JTEA 1SRMA 4HVWA 1XOVA 4ZNXA 4DEYA 2L0AA 2AKLA 2M51A 4J9GA 5FWBA 4FSSA 4OMPA 5IHNA 4Y92A 2JMAA 3ZL7C 4Z88A 1YCSB 1NYFA 1WDXA 2LJ3A 4ORZA 2K79A 2C0OA 2DJQA 1PRMC 2LZ6B 3EG1A 2DYBA 2RQUA 2DLPA 4AG1C 2YSQA 3EG3A 2HEQA 2GTOA 1JEGA 4OMMA 1OPKA 3GBQA 1WFWA 2JMCA 2O31A 1PWTA 1OPLA 2YT6A 3NPFA 2EYXA 2FEIA 1QCFA 2EQIA 4AFQC 1AWWA 1UJYA 2F2WA 1FMKA 2KXCA 4LNPA 4DEXA 1HJDA 2IIMA 4CC4B 2KRSA 1NLOC 2F2XA 1W6XA 2HSPA 4WCIA 2GGRA 1UJ0A 2EGAA 1VYTA 1X2KA 1VYUA 4LE9A 2RMOA 2FPFA 1WYXA 2E5KA 2KEAA 4CC7A 2ECZA 1KSWA 1WIEA 1NEBA 2YUNA 3UA7A 4LN2A 2RN8A 4RUGA 1ZLMA 4JZ3A 2LQWA 1TUDA 1CKBA 2QDLA 1X69A 3REBB 1PHTA 1Y57A 2A28A 2J06A 2EVRA 3C0CA 2RQWA 2DL8A 1NEGA 2L2PA 1V1CA 2RPNA 4A63B 1QWFA 1GBRA 2GNCA 1A0NB 2VKNA 2AZSA 4HVVA 1H3HA 2EKHA 2DF6A 2YUQA 2DMOA 4IIOA 2OAWA 2BZXA 4RTTA 1GCQA 2CUBA 3SHWA 3EGUA 1QWEA 1TG0A 3VS5A 2DNUA 2FRYA 2LQNA 3VS6A 2DBKA 1E6GA 4JZ4A 2K2MA 1QLYA 4EIKA 4HCKA 4Z89A 4F14A 4AG2C 4OMQA 5ECAA 5IHIA 1RLQC 3M0UA 2ED0A 1W70A 2G6FX 3VRZA 3I35A 3QWXX 1B07A 3VS3A 1H8KA 5IHKA 1AWOA 3VS1A 2X3WD 1UE9A 1ZX6A 1M27C 2LNHB 1NLPC 1GBQA 4AFSC 3NMZC 4M4ZA 1PKSA 2KYMA 1WX6A 1JQQA 2DBMA 3VRYA 2L3QA 2V1RA 4JPBW 1UUEA 1GRIA 1KFZA 4J9DA 2XMFA 2O9VA 2JS0A 2CH4W 5IH2A 4OMLA 1PRLC 1ZSGA 2K7AA 3QWYA 1YWOA 5GJVB 4D8DA 1RUWA 1U06A 1BB9A 2F2VA 1GFCA 2VVKA 2EYZA 2HDAA 1YNZA 1Y0MA 3UA6A 1ARKA 2DL7A 2DVJA 2ROTA 1BBZA 5GJWB 2KBTA 1U5SA 1OEBA 2RNAA 3I5RA 3VS7A 1K76A 3I9QA 1AZEA 2J6FA 4K11A 1Z9ZA 1WA7A 3PVLA 1NM7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O88 A;  1YN8 A;  1G83 A;  2FPD A;  4J9C A;  3TSW A;  1CKA A;  1H92 A;  2J6O A;  2CDT A;  2KRN A;  2OI3 A;  2DM1 A;  1E6H A;  3JV3 A;  1X6B A;  1BK2 A;  2KXD A;  4RTW A;  2JT4 A;  1SHG A;  3TVT A;  3EHR A;  2DIL A;  2YUO A;  1FYN A;  1OV3 A;  2FO0 A;  3RNJ A;  2MIO A;  2JM8 A;  2PZ1 A;  3A98 A;  3IQL A;  1SEM A;  1K1Z A;  1S1N A;  1X2Q A;  2D0N A;  2DE0 X;  2DL3 A;  4LUE A;  1LCK A;  2L3P A;  2J05 A;  4LUD A;  2L3S A;  1TUC A;  5FWC A;  1UFF A;  2ED1 A;  3FJ5 A;  1SPK A;  2AKK A;  2LCS A;  1WXU A;  2M0Y A;  2JM9 A;  3THK A;  4F16 A;  2V1Q A;  5EC7 A;  1ZUK A;  1UGV A;  1K9A A;  2KYB A;  2K9G A;  3RBB B;  3NGP A;  4RTV A;  2K3B A;  1VYV A;  1WI7 A;  4J9B A;  1HD3 A;  1T3S A;  1UEC A;  1QKX A;  1MV0 B;  3UAT A;  1GFD A;  5HCK A;  2VWF A;  1MUZ A;  1X6G A;  2O2O A;  3M0R A;  2EGE A;  3TSZ A;  1N5Z A;  3CQT A;  5I22 A;  1T3L A;  1UHF A;  2BZY A;  4AFU C;  2EBP A;  4J9I A;  1NG2 A;  2ROL A;  2KR3 A;  2KRM A;  2KT1 A;  2DL5 A;  4KRT A;  2DRM A;  2JW4 A;  2NUZ A;  3M0T A;  2RQR A;  4AFZ C;  1X27 A;  1YP5 A;  1UTI A;  3I5S A;  4CC3 A;  3KFV A;  2CT3 A;  1QKW A;  2BZ8 A;  1M30 A;  2DA9 A;  1RI9 A;  3U23 A;  1JO8 A;  1UDL A;  1AWJ A;  1UG1 A;  3PE0 A;  2GTJ A;  4GLM A;  1YWP A;  2C0I A;  2D8H A;  5IXB A;  1B3Q A;  2KGT A;  2LX7 A;  1M3B A;  2A37 A;  1WXB A;  2K6D A;  1GCP A;  2EYW A;  2FRW A;  3REA B;  1BU1 A;  1PKT A;  2H8H A;  3PVQ A;  4D8K A;  1ABQ A;  2HBW A;  2RQT A;  4OMO A;  1SSH A;  2O9S A;  2PNI A;  1ABO A;  2EW3 A;  2ENM A;  2D1X A;  1I07 A;  1Z9Q A;  2JS2 A;  3H0F A;  3H0I A;  1K0S A;  5I11 A;  5FW9 A;  1ZBJ A;  1PNJ A;  2CSQ A;  2BTT A;  2AK5 A;  1ZUY A;  4JJD A;  2CUD A;  1K0X A;  3ULR B;  2I0N A;  1UHC A;  3VS4 A;  1ZUU A;  1T0H A;  2CSI A;  2FPE A;  2AZV A;  2DRK A;  1AZG B;  2GQI A;  3M0Q A;  2W0Z A;  1HSQ A;  1W1F A;  2W10 A;  2YUP A;  2EYY A;  4J9F A;  2DL4 A;  1AWX A;  3O5Z A;  2LMJ A;  4RTU A;  2A08 A;  1I1J A;  4JJC A;  2KRO A;  1VA7 A;  4CC2 A;  2J7I A;  2KE9 A;  3VS0 A;  4R0K A;  1OOT A;  2OJ2 A;  4RTX A;  2MOX A;  1J3T A;  4J9E A;  1X43 A;  1T0J A;  2SEM A;  4RTY A;  1CSK A;  2LP5 A;  1AEY A;  4E6R A;  4RTZ A;  4HXJ A;  3UF4 A;  1KJW A;  2C0T A;  1RLP C;  1K4U S;  1EFN A;  2B86 A;  4GBQ A;  2CH4 A;  5L23 A;  1U3O A;  3H0H A;  2CT4 A;  1E7O A;  3VS2 A;  1M3C A;  2HCK A;  1IO6 A;  4Z8A A;  1I0C A;  4IIM A;  1SRL A;  3EG0 A;  1M8M A;  2FG0 A;  2KT8 A;  1GL5 A;  5IXF A;  2ESW A;  2LJ0 A;  3NHN A;  4QT7 A;  1SHF A;  1AOJ A;  2GBQ A;  4OMN A;  1WLP B;  2DX1 A;  2X3X D;  1GCQ C;  1MV3 A;  1AD5 A;  1KIK A;  3R6N A;  2LJ1 A;  2KNB B;  1G2B A;  1M3A A;  1AVZ C;  3M0S A;  3SEM A;  2NWM A;  2YDL A;  4ESR A;  3H41 A;  2PTK A;  2JXB A;  3LH5 A;  4J9H A;  4JJB A;  2MCN A;  2CRE A;  4X1V A;  1JXM A;  4F17 A;  2D8J A;  2EGC A;  1JXO A;  1WXT A;  3M0P A;  2P4R A;  2EPD A;  1JU5 C;  1NYG A;  2J6K A;  2RF0 A;  2A36 A;  4HVU A;  2RQV A;  3EG2 A;  3EHQ A;  2SRC A;  2ABL A;  2JTE A;  1SRM A;  4HVW A;  1XOV A;  4ZNX A;  4DEY A;  2L0A A;  2AKL A;  2M51 A;  4J9G A;  5FWB A;  4FSS A;  4OMP A;  5IHN A;  4Y92 A;  2JMA A;  3ZL7 C;  4Z88 A;  1YCS B;  1NYF A;  1WDX A;  2LJ3 A;  4ORZ A;  2K79 A;  2C0O A;  2DJQ A;  1PRM C;  2LZ6 B;  3EG1 A;  2DYB A;  2RQU A;  2DLP A;  4AG1 C;  2YSQ A;  3EG3 A;  2HEQ A;  2GTO A;  1JEG A;  4OMM A;  1OPK A;  3GBQ A;  1WFW A;  2JMC A;  2O31 A;  1PWT A;  1OPL A;  2YT6 A;  3NPF A;  2EYX A;  2FEI A;  1QCF A;  2EQI A;  4AFQ C;  1AWW A;  1UJY A;  2F2W A;  1FMK A;  2KXC A;  4LNP A;  4DEX A;  1HJD A;  2IIM A;  4CC4 B;  2KRS A;  1NLO C;  2F2X A;  1W6X A;  2HSP A;  4WCI A;  2GGR A;  1UJ0 A;  2EGA A;  1VYT A;  1X2K A;  1VYU A;  4LE9 A;  2RMO A;  2FPF A;  1WYX A;  2E5K A;  2KEA A;  4CC7 A;  2ECZ A;  1KSW A;  1WIE A;  1NEB A;  2YUN A;  3UA7 A;  4LN2 A;  2RN8 A;  4RUG A;  1ZLM A;  4JZ3 A;  2LQW A;  1TUD A;  1CKB A;  2QDL A;  1X69 A;  3REB B;  1PHT A;  1Y57 A;  2A28 A;  2J06 A;  2EVR A;  3C0C A;  2RQW A;  2DL8 A;  1NEG A;  2L2P A;  1V1C A;  2RPN A;  4A63 B;  1QWF A;  1GBR A;  2GNC A;  1A0N B;  2VKN A;  2AZS A;  4HVV A;  1H3H A;  2EKH A;  2DF6 A;  2YUQ A;  2DMO A;  4IIO A;  2OAW A;  2BZX A;  4RTT A;  1GCQ A;  2CUB A;  3SHW A;  3EGU A;  1QWE A;  1TG0 A;  3VS5 A;  2DNU A;  2FRY A;  2LQN A;  3VS6 A;  2DBK A;  1E6G A;  4JZ4 A;  2K2M A;  1QLY A;  4EIK A;  4HCK A;  4Z89 A;  4F14 A;  4AG2 C;  4OMQ A;  5ECA A;  5IHI A;  1RLQ C;  3M0U A;  2ED0 A;  1W70 A;  2G6F X;  3VRZ A;  3I35 A;  3QWX X;  1B07 A;  3VS3 A;  1H8K A;  5IHK A;  1AWO A;  3VS1 A;  2X3W D;  1UE9 A;  1ZX6 A;  1M27 C;  2LNH B;  1NLP C;  1GBQ A;  4AFS C;  3NMZ C;  4M4Z A;  1PKS A;  2KYM A;  1WX6 A;  1JQQ A;  2DBM A;  3VRY A;  2L3Q A;  2V1R A;  4JPB W;  1UUE A;  1GRI A;  1KFZ A;  4J9D A;  2XMF A;  2O9V A;  2JS0 A;  2CH4 W;  5IH2 A;  4OML A;  1PRL C;  1ZSG A;  2K7A A;  3QWY A;  1YWO A;  5GJV B;  4D8D A;  1RUW A;  1U06 A;  1BB9 A;  2F2V A;  1GFC A;  2VVK A;  2EYZ A;  2HDA A;  1YNZ A;  1Y0M A;  3UA6 A;  1ARK A;  2DL7 A;  2DVJ A;  2ROT A;  1BBZ A;  5GJW B;  2KBT A;  1U5S A;  1OEB A;  2RNA A;  3I5R A;  3VS7 A;  1K76 A;  3I9Q A;  1AZE A;  2J6F A;  4K11 A;  1Z9Z A;  1WA7 A;  3PVL A;  1NM7 A; 
#chains in the Genus database with same CATH topology
 2COY A;  5FLX E;  5CKF A;  2L3R A;  3TSW A;  1VQL Q;  4A4E A;  1QVF S;  3GNG A;  3CXC S;  4C8Q C;  4RTW A;  3TVT A;  1H3Z A;  4C92 B;  5FRO A;  3QBY A;  3QDR B;  4C92 E;  2PZ1 A;  3IQL A;  4PJO G;  3QXE B;  1X2Q A;  4M7A G;  4DBR A;  1IRE B;  2F5T X;  2JTF A;  3X25 B;  5A0G A;  4C0F A;  2DL3 A;  2J05 A;  4M78 C;  3L1A A;  2ED1 A;  4PJO F;  2OTJ Q;  3MP1 A;  2KMT A;  4M7A F;  5GAO l;  1TH7 A;  1VQ7 Q;  2AKK A;  1VQ6 Q;  4FM4 B;  2FZC B;  2COW A;  2JM9 A;  3CCL Q;  4F16 A;  4HCC A;  1HYO A;  5EC7 A;  1K9A A;  2KYB A;  4C0Z A;  4FYX B;  1K73 U;  3A8L B;  3CC4 A;  1UEC A;  2X4J A;  1UGP B;  5GMK i;  3EH1 A;  2O2O A;  3FB9 A;  1Q7Y C;  4C8Q G;  3OMC A;  2EGE A;  4DBH A;  1VQ9 Q;  5I21 A;  4PLI A;  3CEY A;  3EFO B;  5I22 A;  3LYI A;  5DY9 A;  2LQK A;  1ZA2 B;  3BFM A;  3CCE A;  3RIR A;  3E1S A;  1NG2 A;  4J6X A;  4E7S A;  3OYG A;  2HL5 C;  3HHT B;  3QZ9 B;  4PJL A;  2I2L A;  1OX9 A;  2NUP B;  4C92 D;  1VOM A;  4AMC A;  1N8R U;  3H6Z A;  3M54 A;  1KD1 C;  3I55 Q;  4KT0 E;  3OSS C;  2BZ8 A;  2DTI A;  1ZSZ B;  5A2Q E;  3U23 A;  1UDL A;  3PE0 A;  4JUV A;  2QI2 A;  2D8H A;  2X9H A;  5LJ5 j;  5KH6 A;  1M3B A;  1JJ2 P;  2K6D A;  3S3O A;  3DLM A;  2RHI A;  2XDP A;  2CYZ B;  4LD6 A;  3REA B;  2KY9 A;  1BU1 A;  1PKT A;  1KD1 R;  5CIU A;  2HBW A;  5KE2 A;  5CCA A;  4O5V A;  1D1A A;  3MJX A;  2D1X A;  1I07 A;  2JS2 A;  3VUB A;  4BDY A;  1PNJ A;  2CSQ A;  1ZUY A;  4YTL A;  1VQK Q;  3NTK A;  1YHQ A;  3AHU A;  1XTD A;  2I0N A;  3VS4 A;  4C5H A;  1T0H A;  2CP5 A;  2AZV A;  4JLI A;  2GQI A;  1HSQ A;  1W1F A;  2W10 A;  4E47 A;  1B34 A;  2DEQ A;  2YLB A;  1W4S A;  1AWX A;  5LJ3 h;  3O5Z A;  2PVD B;  1D0Y A;  2LMJ A;  1YI2 T;  1RAB B;  1VQP T;  2DXT A;  3ER0 A;  2J7I A;  1AT1 B;  4R0K A;  3OYB A;  2RHZ A;  4J7F A;  5GAM g;  2MOX A;  1WPY A;  4C8Q E;  3VYH B;  2LDM A;  4E6R A;  1TOV A;  1RAA B;  1YIT Q;  4HXJ A;  3L2Z A;  4EMG A;  2ZPG B;  4ATO A;  7AT1 B;  4M77 C;  4N4G A;  5D6Y A;  2QAZ A;  3PFS A;  2B86 A;  3PT9 A;  1Y07 A;  4M78 B;  2QEX T;  4P5N A;  5HKC A;  1M3C A;  4M78 E;  4F7U A;  9ATC B;  4Z8A A;  1I0C A;  2O4X A;  4IIM A;  1SRL A;  2MWP A;  3QJ6 A;  1VUB A;  2OTL A;  2KT8 A;  3X24 B;  4OVA A;  3NHN A;  2CP2 A;  2M02 A;  1S72 T;  1G3S A;  1OU9 A;  1BCM A;  1YJN Q;  1WHJ A;  1MHN A;  2DX1 A;  4N4H A;  3BE3 A;  1AD5 A;  1G2B A;  5LJ5 d;  2YDL A;  4ESR A;  3X20 B;  2XIC A;  2NLU A;  2JXB A;  3S3M A;  3OMG A;  4JJB A;  2MCN A;  4ANJ A;  2CRE A;  3V7S A;  4F17 A;  3QYH B;  2YXY A;  2EFI A;  1JXO A;  2MK5 A;  3OYN A;  1NJI C;  3LWH A;  1WXT A;  1K8A U;  4FIB A;  3EGX B;  1NYG A;  2PVG B;  2AIR B;  2V8I A;  3CCR A;  4C8Q D;  2YRV A;  4ZN3 A;  3EHQ A;  2GFA A;  1NPR A;  3G7Z A;  2M51 A;  4J9G A;  3UWN A;  4IUQ A;  3M4Y A;  1VQM A;  2KI7 A;  1YI2 A;  2AHJ B;  3ZL7 C;  4J7I A;  1VQP A;  4Z88 A;  1NJI R;  4N4I A;  2K79 A;  4QQ6 A;  3EH2 A;  4J83 A;  2X4W A;  2DYB A;  2RHU A;  3E2U A;  4M78 D;  3A8M B;  2HEQ A;  3Q1J A;  3CCV A;  1OPK A;  2VXE A;  1TWB A;  5D7U A;  1D0Z A;  1WFW A;  2QGG A;  1PWT A;  4FSX A;  2FZK B;  1RAF B;  3FRN A;  4IKF A;  3PIO A;  2VAS A;  2VXF A;  1HJD A;  2IIM A;  4M75 F;  2KRS A;  4OB1 B;  3G71 Q;  5KYW A;  1X2K A;  2RMO A;  3SB2 A;  1W2B S;  2V8K A;  2MPX C;  2KEA A;  4XQ3 A;  1KSW A;  1I8F A;  2K5F A;  1S72 A;  3P8D A;  4QQD A;  2DIG A;  3S3N A;  2X4X A;  4A54 A;  2QDL A;  2RJC A;  1WHL A;  4LDV A;  4BI8 B;  2XDB A;  3QO3 A;  3PNW C;  3INZ A;  1Y57 A;  5CKE A;  2A28 A;  4NL2 A;  4PL6 A;  2EVR A;  3L2R A;  2RQW A;  4PJM A;  5C0M A;  1V1C A;  1K9M U;  2G3R A;  4J5Y A;  3HP9 A;  4A63 B;  1KQ1 A;  2GNC A;  1A0N B;  5CK9 A;  5J39 A;  3L2Q A;  3JCM f;  2H3J A;  5GAN 3;  1M1K U;  4M77 E;  2EQJ A;  2BZX A;  1GCQ A;  2CUB A;  2E1H A;  1FX7 A;  1R77 A;  2DBK A;  1E6G A;  2QAS A;  3LX7 A;  4L5G A;  4HCK A;  4QKU A;  4PNO A;  4OGC A;  1RLQ C;  3CCU T;  1M1K R;  3ZBD A;  3HPW A;  2QDY B;  4UC4 A;  4XTV A;  4Z02 A;  5CQX A;  5GAN 5;  3VU3 C;  3HRT A;  1H8K A;  5IHK A;  3RKY A;  4DOV A;  4HA8 A;  4M4Z A;  4ZTJ A;  1QVG P;  5I2S A;  4PJO A;  2V1R A;  3FEO A;  4M7A A;  2FVU A;  1Y71 A;  2O9V A;  4JRK A;  2JS0 A;  3C94 A;  4HKE A;  5IH2 A;  4PK4 A;  1YWO A;  1M90 C;  1U06 A;  4FW1 A;  1RAD B;  1OU8 A;  2EYZ A;  1YNZ A;  4NOY A;  5LJ3 g;  2A7Y A;  2E70 A;  2QYZ A;  3A5Z B;  4M77 D;  2LVM A;  5HK3 A;  1Q82 U;  2PQW A;  3CCM T;  2RNA A;  3VS7 A;  3I5R A;  1Q81 C;  1QMC A;  3QYG B;  4CI0 C;  2J6F A;  2HMA A;  1VQL T;  1Z9Z A;  1WA7 A;  2DKG A;  5GAO q;  3TCJ A;  1UGQ B;  1PSF A;  4X9D A;  3M55 A;  2O88 A;  1YN8 A;  3OS0 A;  2QGF B;  2KAF A;  1CKA A;  1Y96 B;  2CDT A;  2J6O A;  1WQW A;  1D0X A;  3A8G B;  4O6J A;  4JS4 A;  2KXD A;  5GMK h;  2FL7 A;  1VQO Q;  1XNI A;  2R5M A;  1FYN A;  3CMA Q;  2L8D A;  3F70 A;  3CCQ A;  3FDR A;  1BI1 A;  3ZEH A;  3V8K A;  4HCB A;  2OTJ T;  2KQW A;  5KYX B;  1VQ7 T;  1KG1 A;  1VQ6 T;  1M2V B;  1I5O B;  1TUC A;  5FWC A;  3CCS A;  5GAN h;  2E3I A;  3CCL T;  1B34 B;  1SPK A;  2DZC A;  2BUD A;  2LCS A;  3MPU B;  1WXU A;  4M7D C;  2M0Y A;  4Y91 A;  1UGV A;  4C92 G;  4E7L A;  2F1L A;  2K9G A;  2XI9 A;  2EJ9 A;  3CD6 Q;  1WI7 A;  4J9B A;  1HD3 A;  1VQ9 T;  3G4S Q;  2E65 A;  1QKX A;  4L6V 5;  5HCK A;  3JCM h;  4C92 F;  2VWF A;  1M2O A;  3R6O A;  1N5Z A;  2DXU A;  1UEB A;  1UHF A;  4XTY A;  2V26 A;  4AFU C;  1SKU B;  2ROL A;  4LDX A;  2KR3 A;  2KRM A;  4OP0 A;  2DL5 A;  2HQX A;  4F7U B;  4IUV A;  5J26 A;  3I55 T;  2IG0 A;  3HKS A;  3KBG A;  4KRT A;  4LD9 K;  1BIA A;  4OB0 B;  3OS1 A;  1AHJ B;  1YP5 A;  1VQL A;  4CC3 A;  3G6E A;  3OYY A;  4ZN1 A;  1M30 A;  2DA9 A;  1FMV A;  3L2W A;  1RI9 A;  3N5B B;  1AWJ A;  4GLM A;  1YWP A;  3QZ5 B;  3NTH A;  5IXB A;  4E7K A;  2COZ A;  1IZ6 A;  2QA4 T;  5GAO p;  2XK0 A;  4GY5 A;  2A37 A;  1TTH B;  1PG5 B;  3OSV A;  2BKD N;  1LPL A;  2H8H A;  4XTU A;  1YJW Q;  3CC7 A;  2RQT A;  2GCX A;  4JS5 A;  2PNI A;  1VQK T;  5FRM A;  2EW3 A;  5CAI A;  1Z9Q A;  3H0F A;  3H0I A;  3L42 A;  1M1G A;  1HK9 A;  3AT1 B;  4OGE A;  4KH0 B;  5I11 A;  3I56 Q;  1YIJ A;  2P0P A;  4RMO A;  1G3Y A;  5GAM j;  5LJ3 f;  3TQ7 P;  4PLL A;  2A3L A;  3HRS A;  2LCL A;  1VQ5 A;  3ZFJ A;  2DRK A;  1AZG B;  2YUP A;  2EJF A;  1PCX A;  5IT9 E;  1VQ8 Q;  2DL4 A;  2EWN A;  1D3B A;  3OW2 A;  3CPW P;  2DXB A;  4RTU A;  1I1J A;  2KRO A;  3X28 B;  1VA7 A;  2KE9 A;  2FZG B;  1KQS P;  1J3T A;  3JCM V;  3RUX A;  1T0J A;  4RTY A;  3OYH A;  2LP5 A;  1AEY A;  2NYS A;  4EDU A;  5LJ5 e;  1JJ2 S;  3MKD A;  4XK8 E;  1ZA1 B;  1K73 C;  1VQN T;  5HY6 A;  1MMN A;  4GBQ A;  3JCM Q;  2E3H A;  4XU1 A;  1QVF A;  3DKM A;  2CT4 A;  3CXC A;  2ZPI B;  2MI6 A;  1P92 A;  1PD0 A;  1LJO A;  2E6N A;  1YJN T;  4M7D B;  1M8M A;  2FG0 A;  5IXF A;  2LJ0 A;  4M7D E;  1K73 R;  3CPF A;  3VYG A;  4QT7 A;  1SHF A;  5C6S A;  2OX7 A;  4OMN A;  1WLP B;  2QA4 A;  2X3X D;  4B6M A;  3HFO A;  4C8Q F;  4X34 A;  1WJR A;  4M75 A;  1OX8 A;  1ACM B;  4L59 A;  3H41 A;  1N8R C;  4MDW A;  1U8R A;  4J9H A;  4M78 G;  2VYT A;  4OMF B;  1JXM A;  2D8J A;  1QVP A;  5KYY B;  5A0D A;  2QQR A;  5KYN A;  4II1 A;  2HBP A;  2EPD A;  2XID A;  4M78 F;  1O9S A;  4HVU A;  2E5Q A;  1N8R R;  4HVW A;  5GAM d;  1XOV A;  4DEY A;  4IUR A;  2FYK A;  3FIF A;  2L0A A;  2QQA A;  5IHN A;  5AT1 B;  4Y92 A;  1YCS B;  3CC4 Q;  1NYF A;  2C0O A;  3X26 B;  1PRM C;  1EX4 A;  2LZ6 B;  4ZGJ B;  3OB9 A;  1KK7 A;  4LXC A;  1OI1 A;  4DBQ A;  2YSQ A;  2CP6 A;  3EGD A;  4BAC A;  1MND A;  1H64 1;  3P8H A;  3GP8 A;  2L5Q A;  2QTV A;  4M7D D;  3CCE Q;  1ZQ1 A;  4BUG A;  1OPL A;  2EAY A;  3ME9 A;  3NPF A;  2EYX A;  2FEI A;  1QCF A;  2EQI A;  3QG1 A;  5CKB A;  4AFQ C;  3G71 T;  1VQN A;  2KXC A;  4LNP A;  1JBM A;  2NUT A;  4CC4 B;  5AYF A;  3CME Q;  1W6X A;  2HSP A;  4WCI A;  3RMQ A;  5GAN g;  1VYU A;  4LE9 A;  1WNL A;  4QQG A;  4BD3 A;  2E5K A;  4RCB A;  2CZ7 B;  2QXF A;  4CC7 A;  5GAN 8;  4FYY B;  1NEB A;  2Y4X A;  8ATC B;  4J6W A;  3KUF A;  5GMK m;  4RUG A;  1ZLM A;  4JZ3 A;  3GF5 A;  2ATC B;  1CKB A;  2PUK B;  4PFZ A;  1X69 A;  5D6W A;  5I2M A;  3V8L A;  1VQ4 T;  3VUZ A;  3QUI A;  3JCM g;  2QK0 A;  4C0G A;  2LX9 A;  3UPU A;  1UGR B;  2RI5 A;  2RHX A;  4KGX B;  2L2P A;  2WAC A;  2K5I A;  1QWF A;  1WZO A;  2AZS A;  4HVV A;  2RK1 A;  4XTW A;  4WF2 A;  1YHQ Q;  4V2S A;  2IPO B;  3DB4 A;  3MO8 A;  5IAY A;  3D7S B;  2RH2 A;  1KC8 U;  2ZPH B;  2DYI A;  4ME7 A;  1OUL A;  4EMK A;  4EIK A;  2XDD A;  3V7R A;  3BDL A;  4AG2 C;  5CKH A;  2R5A A;  5KYU B;  4OB3 B;  3EFS A;  1K8A C;  4MZT A;  3QWX X;  2XG8 D;  2HQE A;  1YCY A;  1KQ2 A;  4M77 G;  5CVI A;  2E6Z A;  1M27 C;  2LNH B;  3V7C A;  1NLP C;  1GBQ A;  2VB6 A;  4DOW A;  3GOX A;  3G71 A;  2M9U A;  4A53 A;  4MDX A;  3MCA B;  1JQQ A;  2F5K A;  1K8A R;  4M77 F;  1N27 A;  1Y7X A;  3JAM E;  4KGZ B;  3BDU A;  2X4Y A;  3L2U A;  1GRI A;  1KFZ A;  2EJG A;  3OBY A;  2XMF A;  2CH4 W;  5HK0 A;  3QPH A;  4OML A;  2OTL Q;  2K7A A;  3V8J A;  2RJD A;  1RUW A;  4FYV B;  1GFC A;  3O8V A;  2VVK A;  2LRQ A;  4C5I A;  3TU4 K;  4E7H A;  4C92 A;  4E7J A;  1OEB A;  1VQ4 A;  3FJP A;  2DK3 A;  4ZTF A;  1XQH A;  1Q86 U;  5FU7 C;  2QEX A;  1PD1 A;  2Z0W A;  3MEW A;  3JB9 G;  1H92 A;  2OI3 A;  8AT1 B;  2DM1 A;  1E6H A;  1X6B A;  1M4Z A;  2JT4 A;  3RKW A;  3OYE A;  1BKB A;  2DIL A;  2YUO A;  3CCR Q;  2DER A;  2FO0 A;  3RNJ A;  2MIO A;  2JM8 A;  3DB3 A;  1HXD A;  4JDS A;  1MMA A;  1SEM A;  1PSE A;  2KK4 A;  3NFC A;  4A4G A;  5GAN f;  2D0N A;  1MGQ A;  4Y28 E;  1QVG S;  1VQM Q;  1YI2 Q;  1R0C B;  1LCK A;  2RD1 A;  1K9M C;  3OS5 A;  2L3S A;  1UFF A;  3FJ5 A;  2KSS A;  3OY9 A;  4C5G A;  4HCZ A;  2YWW A;  1M1K C;  3CD6 T;  4XU2 A;  3THK A;  3CCV Q;  3G4S T;  4QVZ A;  1NE8 A;  3RBB B;  4RTV A;  1K9M R;  1VYV A;  5LL6 S;  1W2B A;  3HSB A;  1IRX A;  2DTH A;  2D9T A;  2EIF A;  4KUI A;  4JRP A;  5L8R E;  1FWZ A;  3MEU A;  2NUP A;  4OF1 A;  3M0R A;  5LJ3 d;  3WVE B;  1NPP A;  4CRI A;  1WJQ A;  2JJ9 A;  2QQB A;  3MET A;  1T3L A;  3C12 A;  2EBP A;  4MZP A;  5IN1 A;  1OQK A;  1ZSZ A;  3PMI A;  4FT2 A;  1S72 Q;  5J3B A;  4BE1 A;  4A4F A;  2CS7 A;  4VUB A;  4E7Z A;  2JW4 A;  2NUZ A;  4AFZ C;  2DO3 A;  1N9S A;  1X27 A;  2HZY A;  1UTI A;  3I5S A;  3KFV A;  5CQY A;  1QKW A;  1WQ7 A;  1UG1 A;  4BB7 A;  2WSE E;  2GTJ A;  3CCJ T;  4M75 B;  1B3Q A;  4MML A;  2FHD A;  1YJW T;  2ZPF B;  4JRI A;  4C0D C;  1GCP A;  2EYW A;  2FRW A;  1Q82 C;  4F7U G;  3PVQ A;  4D8K A;  3OA6 A;  2LNV A;  2P84 A;  1SSH A;  2O9S A;  2ZZD A;  3JCM X;  3I56 T;  3UT1 A;  3JCM J;  2ENM A;  1K0S A;  3CBO A;  2R57 A;  3OYA A;  1BYM A;  1ZBJ A;  2KVQ G;  2AK5 A;  3HRU A;  4JJD A;  1F1B B;  1K0X A;  1VQ8 T;  1Q82 R;  4C8Q A;  1KHI A;  2W0Z A;  2QQS A;  2EYY A;  3OYM A;  4JLG A;  3G4S A;  2QTX A;  2LT1 A;  4A4K A;  2RHY A;  4XTZ A;  1C1A A;  2A08 A;  4JJC A;  5FU7 B;  2DTO A;  3VS0 A;  3G1J A;  2L89 A;  1QQJ A;  5GMK l;  1I5L A;  3SFM A;  4PJN A;  4J9E A;  4M78 A;  3CCU A;  2SEM A;  5CO7 A;  1SF9 A;  4QW2 A;  3JB9 D;  3KXT A;  2C0T A;  1RLP C;  1WHM A;  2E4H A;  3QII A;  3VKI A;  4DA4 A;  2HKN A;  1K4U S;  5L23 A;  4Q5W A;  3H0H A;  4FCY A;  1Q95 G;  3M5A A;  2IVW A;  1WGS A;  3JCM W;  1AWW A;  4LDU A;  3EG0 A;  4DQ2 A;  3JRZ A;  5GAM e;  4HT8 A;  2ESW A;  3CCJ A;  4D6W A;  5GAN 2;  1SG5 A;  4RG8 A;  1GCQ C;  1MV3 A;  4RG2 A;  2F69 A;  1KIK A;  3EGX A;  3WVD B;  1M3A A;  3CPW S;  3M0S A;  2NWM A;  2JNG A;  3CCQ Q;  3JB9 J;  3MP6 A;  2PVO B;  4F7U E;  2O4X B;  2PTK A;  3LH5 A;  3CCM A;  2GQV A;  4X1V A;  1KQS S;  1BI0 A;  1C6V X;  2EGC A;  3C4S A;  2VGN A;  2HKQ B;  3CCS Q;  1M1F A;  4M7D G;  1DJ7 B;  4PKC C;  3M58 A;  2RF0 A;  2A36 A;  2RQV A;  2XHC A;  3EG2 A;  1VQ8 A;  2WSC E;  3OYD A;  2SRC A;  2ABL A;  2JTE A;  3E9F A;  1PM3 A;  3CBP A;  5GMK j;  2RK2 A;  4BE0 A;  2MYS A;  1IB8 A;  3CC4 T;  2AKL A;  1YJ9 Q;  4M7D F;  5FWB A;  2DVE A;  3GLX A;  3JCM b;  3PGG A;  4OMP A;  4PJO C;  4J8O A;  1I81 A;  3OYK A;  1D1B A;  4M7A C;  2LJ3 A;  2CP3 A;  2Y90 A;  1N9R A;  2K3Y A;  2OTJ A;  2K5L A;  2MF2 A;  3EG1 A;  4BY6 C;  1VQ7 A;  1VQ6 A;  1IGU A;  3CCE T;  1D09 B;  3CC2 Q;  3CCL A;  4C0D B;  2B8A A;  4DBF A;  2HNI A;  3EG9 A;  4HT9 A;  4OMM A;  1TS9 A;  2EQM A;  2RJF A;  2JMC A;  2O31 A;  1BI3 A;  2YT6 A;  1UJY A;  3CME T;  2DFU A;  1TU0 B;  3H8Z A;  1OZ3 A;  1IHW A;  4DEX A;  2QQ9 A;  1XJW B;  1VQ9 A;  1NLO C;  1TSF A;  2P4T A;  3G6E Q;  3SDZ A;  2FPF A;  2PUO B;  3JCM P;  5LJ5 h;  1YIT T;  3PIP A;  2ECZ A;  1WIE A;  2YLC A;  2YUN A;  2RN8 A;  4AT1 B;  2EQU A;  1SSF A;  2LQW A;  2HQH A;  1TUD A;  2RI2 A;  5KYW B;  4M77 A;  1G3T A;  1VIE A;  1PHT A;  3CC7 Q;  3I55 A;  3GPL A;  1NBE B;  1YHQ T;  1NEG A;  2DPP B;  2HL3 A;  3TRE A;  2RPN A;  3OW2 P;  5FRN A;  1YIJ Q;  4KGV B;  2MMP A;  2DF6 A;  4A4H A;  4GLK A;  4IIO A;  1OZ2 A;  4E2F B;  2OAW A;  4E7I A;  1VQ5 Q;  2BE9 B;  5EG2 A;  1QWE A;  3VS5 A;  2DNU A;  2FRY A;  2LQN A;  4LDW A;  3VS6 A;  1UB4 A;  4JZ4 A;  2K2M A;  2GFU A;  1QLY A;  2E64 A;  4FL6 A;  3QJY A;  2RM4 A;  4OMQ A;  5GAN 6;  5ECA A;  5IHI A;  3M0U A;  3OYC A;  1JJ2 A;  1VQK A;  1Q7Y U;  4C5E A;  2G6F X;  3OS2 A;  3I35 A;  1QVF P;  4FW2 A;  3S6W A;  3CXC P;  3A8H B;  3VS1 A;  4WTO B;  1UE9 A;  2P0K A;  1ZX6 A;  1WHH A;  3QHS A;  2EKO A;  5GAN d;  2V8J A;  1Q7Y R;  3CME A;  2LT4 A;  2CP0 A;  4ZGE B;  1UGS B;  2DBM A;  3VRY A;  1RAH B;  4BI4 A;  2L3Q A;  4JPB W;  1UUE A;  2OTL T;  1KD1 U;  1G5V A;  4J9D A;  5KCH A;  1RAC B;  1BI2 A;  5CKD A;  3QWY A;  5GJV B;  3JCM d;  1YIT A;  1BB9 A;  3HTR A;  2K57 A;  4KUL A;  2MAM A;  3JB9 H;  1RI0 A;  1Y96 A;  4R56 A;  1Y0M A;  2QA4 Q;  4PJO B;  1ARK A;  5GAN 4;  3HFN A;  2MWO A;  4B9W A;  2DL7 A;  4EMH A;  2DVJ A;  4M7A B;  2ROT A;  4PJO E;  3NTI A;  5GJW B;  1U5S A;  4PFO A;  4M7A E;  2HD0 A;  2M1H A;  1K76 A;  4BY6 B;  1NM7 A;  2E12 A;  1G83 A;  2FPD A;  4J9C A;  3CCR T;  5KYX A;  2KRN A;  1JB0 E;  1M8V A;  1M2V A;  3LWI A;  3JV3 A;  2D6F A;  1YFN A;  2DIQ A;  1YJN A;  1BK2 A;  1SHG A;  2CGH A;  3EHR A;  1OV3 A;  3VJP A;  1VQM T;  1RAI B;  3A98 A;  3DLL A;  1LVK A;  1K1Z A;  1S1N A;  1TUG B;  5LJ3 e;  2C06 A;  2DE0 X;  5KCO A;  3MEV A;  4N0A A;  2XU8 A;  4LUE A;  2L3P A;  4C8Q B;  4LUD A;  6AT1 B;  2O01 E;  3CCV T;  1R0B G;  1IXD A;  2DZ9 A;  1X75 C;  2DD5 A;  1LNX A;  2V1Q A;  1QP3 A;  1C0M A;  1V76 A;  1ZUK A;  1KC8 C;  2ZGW A;  4XU0 A;  4FYW B;  4OB2 B;  3A1P A;  2JN0 A;  3NGP A;  2K3B A;  3PTA A;  4JJN K;  1ZHI A;  1VQN Q;  1T3S A;  1EZZ B;  3UAT A;  1MV0 B;  4IUP A;  4PFP A;  1GFD A;  3OYJ A;  4PJO D;  2JUF A;  1MUZ A;  4M7A D;  1X6G A;  3MHX A;  2VGM A;  3TSZ A;  1FMW A;  1OYX A;  3CQT A;  1KC8 R;  2K3X A;  3M9Q A;  2BZY A;  3RER A;  3JB9 I;  4J9I A;  2AT1 B;  1YBY A;  2KT1 A;  4RCC A;  5GAO n;  4JRQ A;  4M75 C;  4IUU A;  1GXI E;  2EQK A;  2XD0 A;  2QG9 B;  2DRM A;  3M0T A;  2RQR A;  3BY7 A;  3RMS A;  3SWN A;  5LJ3 j;  4FT4 A;  2CT3 A;  2JZ2 A;  2VC8 A;  1JO8 A;  3JSC A;  1NJI U;  2CKK A;  4KUD K;  2C0I A;  1JRI A;  2KGT A;  1PC0 A;  4R55 A;  5KE3 A;  2LX7 A;  2R58 A;  1WXB A;  2K4Y A;  2JTM A;  4BDZ A;  3RDV A;  1V29 B;  4QVD A;  3JCM c;  1ABQ A;  3C95 A;  2A0F B;  4OMO A;  3LGF A;  1ABO A;  3J81 E;  1RAG B;  1Q86 C;  3LGL A;  3RES A;  5FW9 A;  2GF7 A;  1FXX A;  2BTT A;  2CZ0 B;  3VV0 A;  2CUD A;  3BW1 A;  5LJ5 g;  1VQO T;  2CZ1 B;  5GAN 7;  3FC3 A;  3ULR B;  3LLR A;  3CMA T;  1UHC A;  2BE7 D;  1ZUU A;  4M75 G;  2CSI A;  2FPE A;  3M0Q A;  4XAX B;  4J9F A;  4KH1 B;  1IGQ A;  1Q86 R;  3JB9 F;  2DJZ A;  3URG A;  4CC2 A;  2E10 A;  3EG9 B;  2CZ6 B;  4NL3 A;  1OOT A;  2OJ2 A;  4QVC A;  5GAO r;  4RTX A;  1VQP Q;  2YRD A;  3M53 A;  4F04 B;  3UDC A;  1X43 A;  3EFR A;  1CSK A;  2ZCF B;  1D3B B;  5CR2 A;  4RTZ A;  4M7D A;  2WSF E;  3UF4 A;  2VUB A;  1KJW A;  3EFO A;  1EFN A;  2RO0 A;  3M4G A;  4N0A C;  5GAM f;  5GAO m;  2E41 A;  2CH4 A;  1U3O A;  2X35 A;  1E7O A;  5A0L A;  1VQ4 Q;  5FU6 C;  1VIF A;  3VS2 A;  2HCK A;  1IO6 A;  2PU9 B;  2QEX Q;  1GL5 A;  1O75 A;  4M77 B;  3WXM B;  2LCC A;  1AOJ A;  2GBQ A;  1QVG A;  3MEA A;  5KYY A;  1IHV A;  3CCQ T;  3M57 A;  3R6N A;  2LJ1 A;  2LTO A;  2KNB B;  4MMK A;  1AVZ C;  1EIF A;  3OYI A;  4FU6 A;  1MMG A;  3SEM A;  4EMK C;  1QW1 A;  1M5Q 1;  4EPC A;  3CCS T;  2M16 A;  2DET A;  5DM7 R;  5DLO A;  3EAE A;  3FLG A;  2P0Q A;  2HAX A;  3M0P A;  3RR6 A;  2P4R A;  1W2B P;  1JU5 C;  1VQO A;  1YJ9 T;  1G3W A;  2J6K A;  3CMA A;  3QDF A;  4NS5 A;  4M75 E;  3L2V A;  1SRM A;  4ZNX A;  3OBW A;  4MZM A;  1QCN A;  3SWN C;  4FSS A;  1N6A A;  2RB6 A;  2JMA A;  1WDX A;  2VV5 A;  2DD4 A;  3ASK A;  4ORZ A;  3CC2 T;  1BCO A;  3QSU A;  2DJQ A;  3J80 E;  4TVR A;  2X51 A;  3A8O B;  3P8B B;  2RQU A;  2DLP A;  4AG1 C;  3E19 A;  4F7U F;  3EG3 A;  2OAU A;  4X9C A;  3M56 A;  2M0O A;  2GTO A;  1JEG A;  4XTX A;  2DAQ A;  3GBQ A;  1M90 U;  1WJS A;  2YRC A;  3CBM A;  2D0Q B;  3CD6 A;  4C92 C;  3LW5 E;  3HL8 A;  2F2W A;  1FMK A;  2JVV A;  3G6E T;  4XU3 A;  1QCO A;  3EGD B;  5LJ5 f;  1Q81 U;  1M90 R;  2F2X A;  2GGR A;  1UJ0 A;  2EGA A;  1VYT A;  1WYX A;  4KBM B;  3MP8 A;  4PJJ A;  4ZGD B;  3OYF A;  1I4K 1;  1Q81 R;  5GMK e;  3UA7 A;  4LN2 A;  3CC7 T;  2LQ8 A;  2H3E B;  2NUT B;  2XKO C;  2JOY A;  4M75 D;  2RA2 A;  4ELZ C;  3REB B;  4IUT A;  2Y4Y A;  3E9G A;  5D6X A;  2J06 A;  3C0C A;  4B9X A;  1YIJ T;  2DL8 A;  5GAM h;  1WHK A;  1GBR A;  2VKN A;  1QP2 A;  4LDY A;  1LOJ A;  5GAN e;  1VQ5 T;  1H3H A;  2EKH A;  2DEU A;  1X01 A;  1YJ9 A;  2YUQ A;  5KYU A;  2DMO A;  2LC4 A;  3GIB A;  1RL2 A;  1BIB A;  3RKX A;  4RTT A;  3TEE A;  1YJW A;  2CP7 A;  3SHW A;  3EGU A;  2HSE B;  1WHG A;  1TG0 A;  4ELY C;  5FU6 B;  1G8X A;  2BIV A;  3PMT A;  3QKJ A;  1M9S A;  4Z89 A;  4F14 A;  1TXQ A;  1NZ9 A;  3JCM e;  3I56 A;  2RJE A;  3CC2 A;  2ED0 A;  1MMD A;  1W70 A;  1U1S A;  3VRZ A;  2FB7 A;  2K2V A;  4BE2 A;  1B07 A;  3CCU Q;  3VS3 A;  1ZSZ C;  4BI3 A;  2DXC A;  1AWO A;  2X3W D;  4EMK B;  1ZBX A;  4AFS C;  3SD4 A;  3NMZ C;  2ZPE B;  1PKS A;  2KYM A;  1WX6 A;  1B7T A;  2EYQ A;  3H9N A;  3M59 A;  3GNF B;  5DLQ E;  2RI3 A;  3OW2 S;  3CPW A;  3LH0 A;  3OQ5 A;  1PRL C;  1X6O A;  1ZSG A;  4D8D A;  3OYL A;  5GAN j;  2F2V A;  3CCJ Q;  1KHC A;  2YHT A;  3SWN B;  2HDA A;  3T9N A;  1R8O B;  1MNE A;  1KQS A;  5M9O A;  3UA6 A;  1U1T A;  4J6Y A;  2KDS A;  1D1C A;  1BBZ A;  1RAE B;  2KBT A;  3J7A F;  3I9Q A;  1AZE A;  2ZAE A;  4K11 A;  2ZPB B;  4RKU E;  3PVL A;  3CCM Q; 
#chains in the Genus database with same CATH homology
 2O88 A;  1YN8 A;  1G83 A;  2FPD A;  4J9C A;  3TSW A;  1CKA A;  1H92 A;  2J6O A;  2CDT A;  2KRN A;  2OI3 A;  2DM1 A;  1E6H A;  3JV3 A;  1X6B A;  1BK2 A;  2KXD A;  4RTW A;  2JT4 A;  1SHG A;  3TVT A;  3EHR A;  2DIL A;  2YUO A;  1FYN A;  1OV3 A;  2FO0 A;  3RNJ A;  2MIO A;  2JM8 A;  2PZ1 A;  3A98 A;  3IQL A;  1SEM A;  1K1Z A;  1S1N A;  1X2Q A;  2D0N A;  2DE0 X;  2DL3 A;  4LUE A;  1LCK A;  2L3P A;  2J05 A;  4LUD A;  2L3S A;  1TUC A;  5FWC A;  1UFF A;  2ED1 A;  3FJ5 A;  1SPK A;  2AKK A;  2LCS A;  1WXU A;  2M0Y A;  2JM9 A;  3THK A;  4F16 A;  2V1Q A;  5EC7 A;  1ZUK A;  1UGV A;  1K9A A;  2KYB A;  2K9G A;  3RBB B;  3NGP A;  4RTV A;  2K3B A;  1VYV A;  1WI7 A;  4J9B A;  1HD3 A;  1T3S A;  1UEC A;  1QKX A;  1MV0 B;  3UAT A;  1GFD A;  5HCK A;  2VWF A;  1MUZ A;  1X6G A;  2O2O A;  3M0R A;  2EGE A;  3TSZ A;  1N5Z A;  3CQT A;  5I22 A;  1T3L A;  1UHF A;  2BZY A;  4AFU C;  2EBP A;  4J9I A;  1NG2 A;  2ROL A;  2KR3 A;  2KRM A;  2KT1 A;  2DL5 A;  4KRT A;  2DRM A;  2JW4 A;  2NUZ A;  3M0T A;  2RQR A;  4AFZ C;  1X27 A;  1YP5 A;  1UTI A;  3I5S A;  4CC3 A;  3KFV A;  2CT3 A;  1QKW A;  2BZ8 A;  1M30 A;  2DA9 A;  1RI9 A;  3U23 A;  1JO8 A;  1UDL A;  1AWJ A;  1UG1 A;  3PE0 A;  2GTJ A;  4GLM A;  1YWP A;  2C0I A;  2D8H A;  5IXB A;  1B3Q A;  2KGT A;  2LX7 A;  1M3B A;  2A37 A;  1WXB A;  2K6D A;  1GCP A;  2EYW A;  2FRW A;  3REA B;  1BU1 A;  1PKT A;  2H8H A;  3PVQ A;  4D8K A;  1ABQ A;  2HBW A;  2RQT A;  4OMO A;  1SSH A;  2O9S A;  2PNI A;  1ABO A;  2EW3 A;  2ENM A;  2D1X A;  1I07 A;  1Z9Q A;  2JS2 A;  3H0F A;  3H0I A;  1K0S A;  5I11 A;  5FW9 A;  1ZBJ A;  1PNJ A;  2CSQ A;  2BTT A;  2AK5 A;  1ZUY A;  4JJD A;  2CUD A;  1K0X A;  3ULR B;  2I0N A;  1UHC A;  3VS4 A;  1ZUU A;  1T0H A;  2CSI A;  2FPE A;  2AZV A;  2DRK A;  1AZG B;  2GQI A;  3M0Q A;  2W0Z A;  1HSQ A;  1W1F A;  2W10 A;  2YUP A;  2EYY A;  4J9F A;  2DL4 A;  1AWX A;  3O5Z A;  2LMJ A;  4RTU A;  2A08 A;  1I1J A;  4JJC A;  2KRO A;  1VA7 A;  4CC2 A;  2J7I A;  2KE9 A;  3VS0 A;  4R0K A;  1OOT A;  2OJ2 A;  4RTX A;  2MOX A;  1J3T A;  4J9E A;  1X43 A;  1T0J A;  2SEM A;  4RTY A;  1CSK A;  2LP5 A;  1AEY A;  4E6R A;  4RTZ A;  4HXJ A;  3UF4 A;  1KJW A;  2C0T A;  1RLP C;  1K4U S;  1EFN A;  2B86 A;  4GBQ A;  2CH4 A;  5L23 A;  1U3O A;  3H0H A;  2CT4 A;  1E7O A;  3VS2 A;  1M3C A;  2HCK A;  1IO6 A;  4Z8A A;  1I0C A;  4IIM A;  1SRL A;  3EG0 A;  1M8M A;  2FG0 A;  2KT8 A;  1GL5 A;  5IXF A;  2ESW A;  2LJ0 A;  3NHN A;  4QT7 A;  1SHF A;  1AOJ A;  2GBQ A;  4OMN A;  1WLP B;  2DX1 A;  2X3X D;  1GCQ C;  1MV3 A;  1AD5 A;  1KIK A;  3R6N A;  2LJ1 A;  2KNB B;  1G2B A;  1M3A A;  1AVZ C;  3M0S A;  3SEM A;  2NWM A;  2YDL A;  4ESR A;  3H41 A;  2PTK A;  2JXB A;  3LH5 A;  4J9H A;  4JJB A;  2MCN A;  2CRE A;  4X1V A;  1JXM A;  4F17 A;  2D8J A;  2EGC A;  1JXO A;  1WXT A;  3M0P A;  2P4R A;  2EPD A;  1JU5 C;  1NYG A;  2J6K A;  2RF0 A;  2A36 A;  4HVU A;  2RQV A;  3EG2 A;  3EHQ A;  2SRC A;  2ABL A;  2JTE A;  1SRM A;  4HVW A;  1XOV A;  4ZNX A;  4DEY A;  2L0A A;  2AKL A;  2M51 A;  4J9G A;  5FWB A;  4FSS A;  4OMP A;  5IHN A;  4Y92 A;  2JMA A;  3ZL7 C;  4Z88 A;  1YCS B;  1NYF A;  1WDX A;  2LJ3 A;  4ORZ A;  2K79 A;  2C0O A;  2DJQ A;  1PRM C;  2LZ6 B;  3EG1 A;  2DYB A;  2RQU A;  2DLP A;  4AG1 C;  2YSQ A;  3EG3 A;  2HEQ A;  2GTO A;  1JEG A;  4OMM A;  1OPK A;  3GBQ A;  1WFW A;  2JMC A;  2O31 A;  1PWT A;  1OPL A;  2YT6 A;  3NPF A;  2EYX A;  2FEI A;  1QCF A;  2EQI A;  4AFQ C;  1AWW A;  1UJY A;  2F2W A;  1FMK A;  2KXC A;  4LNP A;  4DEX A;  1HJD A;  2IIM A;  4CC4 B;  2KRS A;  1NLO C;  2F2X A;  1W6X A;  2HSP A;  4WCI A;  2GGR A;  1UJ0 A;  2EGA A;  1VYT A;  1X2K A;  1VYU A;  4LE9 A;  2RMO A;  2FPF A;  1WYX A;  2E5K A;  2KEA A;  4CC7 A;  2ECZ A;  1KSW A;  1WIE A;  1NEB A;  2YUN A;  3UA7 A;  4LN2 A;  2RN8 A;  4RUG A;  1ZLM A;  4JZ3 A;  2LQW A;  1TUD A;  1CKB A;  2QDL A;  1X69 A;  3REB B;  1PHT A;  1Y57 A;  2A28 A;  2J06 A;  2EVR A;  3C0C A;  2RQW A;  2DL8 A;  1NEG A;  2L2P A;  1V1C A;  2RPN A;  4A63 B;  1QWF A;  1GBR A;  2GNC A;  1A0N B;  2VKN A;  2AZS A;  4HVV A;  1H3H A;  2EKH A;  2DF6 A;  2YUQ A;  2DMO A;  4IIO A;  2OAW A;  2BZX A;  4RTT A;  1GCQ A;  2CUB A;  3SHW A;  3EGU A;  1QWE A;  1TG0 A;  3VS5 A;  2DNU A;  2FRY A;  2LQN A;  3VS6 A;  2DBK A;  1E6G A;  4JZ4 A;  2K2M A;  1QLY A;  4EIK A;  4HCK A;  4Z89 A;  4F14 A;  4AG2 C;  4OMQ A;  5ECA A;  5IHI A;  1RLQ C;  3M0U A;  2ED0 A;  1W70 A;  2G6F X;  3VRZ A;  3I35 A;  3QWX X;  1B07 A;  3VS3 A;  1H8K A;  5IHK A;  1AWO A;  3VS1 A;  2X3W D;  1UE9 A;  1ZX6 A;  1M27 C;  2LNH B;  1NLP C;  1GBQ A;  4AFS C;  3NMZ C;  4M4Z A;  1PKS A;  2KYM A;  1WX6 A;  1JQQ A;  2DBM A;  3VRY A;  2L3Q A;  2V1R A;  4JPB W;  1UUE A;  1GRI A;  1KFZ A;  4J9D A;  2XMF A;  2O9V A;  2JS0 A;  2CH4 W;  5IH2 A;  4OML A;  1PRL C;  1ZSG A;  2K7A A;  3QWY A;  1YWO A;  5GJV B;  4D8D A;  1RUW A;  1U06 A;  1BB9 A;  2F2V A;  1GFC A;  2VVK A;  2EYZ A;  2HDA A;  1YNZ A;  1Y0M A;  3UA6 A;  1ARK A;  2DL7 A;  2DVJ A;  2ROT A;  1BBZ A;  5GJW B;  2KBT A;  1U5S A;  1OEB A;  2RNA A;  3I5R A;  3VS7 A;  1K76 A;  3I9Q A;  1AZE A;  2J6F A;  4K11 A;  1Z9Z A;  1WA7 A;  3PVL A;  1NM7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...