4OF1A

Crystal structure of toxin from staphylococcus aureus mu50
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
115
structure length
115
Chain Sequence
b'MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIRTLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mRNA interferase MazF
publication title Structural Insights into the toxin from Staphylococcus aureus Mu50
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Toxin
total genus 33
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4of1A00
3NFCA 1VUBA 5DLOA 5HKCA 5CQXA 2C06A 3HPWA 4MZPA 5CCAA 5CKDA 5HK3A 4VUBA 5CO7A 4MDXA 4MZMA 5CK9A 5CQYA 1UB4A 5HK0A 1M1FA 1X75C 4MZTA 4OF1A 2MF2A 4ELZC 5CR2A 5CKBA 2VUBA 1NE8A 4ME7A 5CKEA 3JRZA 3G7ZA 3VUBA 3JSCA 5CKHA 2KMTA 4ELYC 3TCJA 5CKFA 4HKEA
chains in the Genus database with same CATH superfamily
3OB9A 2LC4A 3G4SQ 3AT1B 1TUDA 5DY9A 1WIEA 3UPUA 3MP6A 1E7OA 4DOWA 3OYYA 4ATOA 4L59A 4PJOD 1W2BP 4MMLA 4JLIA 1QKWA 2DL8A 4MZTA 4XTZA 3CC7T 1IGUA 1ZLMA 4NOYA 2CSQA 3QDRB 2DXBA 3MEAA 1ARKA 1JO8A 3G1JA 3PVLA 1KSWA 1LNXA 2ABLA 2COWA 1G3YA 2DK3A 3EG0A 1MGQA 3TVTA 3JCMQ 2EKOA 1SRLA 4HVUA 3VS2A 3E2UA 1EFNA 5FU7B 1YHQA 3QHSA 3VRYA 4Z88A 1H3ZA 4M75E 1RI9A 4PFPA 1T0JA 5FU6B 4KGVB 4ZN3A 1VQ5A 4HA8A 4II1A 2QQAA 1UGQB 5LJ5e 2M1HA 4RTUA 1H641 4WF2A 1VQKQ 4PFZA 2I0NA 2HD0A 1S72Q 5IN1A 3ASKA 3BDUA 4M75D 4M78B 2M02A 3H9NA 3CCSQ 1K9AA 2J6FA 2DD4A 1CKAA 2I2LA 3CCEA 4JJDA 5KE3A 2X4WA 1OPLA 2GFAA 5LJ3f 4A63B 2LX9A 2RQVA 4PLLA 3G6EA 2F5KA 1OX8A 3TSWA 2CZ6B 1M2VB 2M0OA 1BI3A 4JZ3A 3F70A 2XIDA 2PQWA 1ZA2B 2JTEA 2AHJB 2SRCA 2MIOA 5D6WA 4BY6B 1NEBA 1BCMA 2ZPBB 2FPDA 4C8QG 3LGLA 3J7AF 1WHLA 4M78E 2RHUA 1IB8A 4C92F 4C8QF 2JTFA 1GL5A 2DL3A 4RTWA 2HQXA 3PFSA 2QG9B 4JRQA 1WGSA 2K5LA 4LXCA 2YLBA 2AZVA 1OQKA 3MP8A 2FZCB 2F5TX 3OW2A 4E7ZA 1Z9QA 3JCMW 1JRIA 2RHYA 1KQSP 2DA9A 3EH1A 3JB9H 1I0CA 3LW5E 3OYJA 1T3SA 3PIPA 1YJWA 3EGUA 2K57A 2L5QA 2KE9A 4Y91A 5KYUA 1IO6A 1X43A 1ZQ1A 1AD5A 3H6ZA 1H3HA 1QVGP 2D0QB 5GAN3 2RH2A 2YRVA 2ZAEA 3HSBA 5CR2A 5KYYB 5GAMf 1OEBA 1VQ4A 1VQNQ 1AHJB 4RTTA 5LJ5f 3I9QA 3CC2A 1PRLC 3I5RA 2DBMA 3FEOA 4PL6A 4WCIA 2FZKB 5GAOq 3M4GA 1ZUKA 1M4ZA 4XU1A 3HPWA 1KJWA 1T3LA 2ZGWA 1YP5A 4RUGA 1GRIA 3CD6A 3H41A 3OYFA 4Q5WA 3JAME 3QYGB 3M0UA 1GCPA 2KGTA 4KGXB 1UDLA 2C0TA 2P0KA 2E5KA 3JCMf 4J9BA 4KULA 4HKEA 2FHDA 3CCJT 4ZNXA 1KIKA 4LNPA 2MK5A 1PHTA 2IIMA 3CCLA 3I56A 2EYXA 4FYVB 2CZ7B 1B07A 4E7LA 1H8KA 1Q95G 3UF4A 1AWXA 5LL6S 1Q86U 2RK1A 3UATA 1PC0A 3C4SA 3QUIA 1SSHA 4OMPA 4QT7A 1MHNA 2RJCA 3CC7Q 1TWBA 1LVKA 2LQNA 1M5Q1 1IREB 2EYWA 3SB2A 3NTIA 3GP8A 4PJOF 3L1AA 1FXXA 3A1PA 1ABOA 3A5ZB 4MDXA 5GAOp 4OMFB 5L8RE 4RTVA 1NYGA 2RB6A 4J9FA 5IXBA 1PSEA 2CKKA 1KHIA 1SHFA 5HKCA 5I22A 3EG9B 3CCRT 4LDXA 2MAMA 1W70A 5GAMd 1TUGB 3OYGA 2SEMA 2KT1A 5LJ5d 2PVDB 2CUDA 3VS7A 1X6GA 3HFOA 1WJQA 2GQIA 4J83A 2HSPA 1N8RU 5I2MA 1M1GA 1QVFA 2HSEB 4QQ6A 1RLPC 5EG2A 3X28B 3M5AA 1IHVA 3DB3A 1D3BB 4C0FA 2NUPB 1V29B 2FB7A 3JCMd 5GJWB 4M75F 3X26B 1Q81R 4JS4A 4C0DB 1NJIR 4M7DB 3QWXX 4XU0A 2DXUA 4ZN1A 1WQWA 2CDTA 2YDLA 2JJ9A 2DF6A 2E6ZA 2HEQA 2K7AA 2DZ9A 3UDCA 4RCBA 4M4ZA 4FU6A 1QCNA 2NLUA 4M77G 4M77F 2NUTA 2RI2A 4HXJA 1UEBA 4OVAA 4EMKC 4NL3A 1LCKA 1R0CB 2GBQA 5A0GA 2RQTA 4F7UE 2KVQG 1GBQA 2P4RA 2O4XA 3JB9G 2FYKA 3OS0A 3JB9F 1RABB 1VQPA 3AHUA 1SPKA 3TSZA 2KRMA 1UE9A 3VYHB 1Y96B 2DYIA 3V8LA 3NTHA 3JCMb 4M7DE 3RUXA 1M3AA 1TH7A 4ORZA 1M90R 1WHJA 3V7SA 2R5MA 4E7HA 1RAEB 1MMGA 2EFIA 2QXFA 2RHIA 2DLPA 4N0AC 3EAEA 2KQWA 3CCVT 4N4IA 2QDLA 4C5HA 4FM4B 2HBWA 4FYWB 1VQMA 4FW2A 3CMAT 1VQ6T 1ZHIA 4HVWA 2JOYA 5IXFA 1A0NB 1TOVA 1I5LA 5GAMh 2JMCA 5LJ5h 4F16A 3CD6T 1Q7YC 1QP2A 1WQ7A 1OOTA 4EMHA 2GTJA 3E1SA 3CCJQ 2F2XA 2XDBA 1P92A 1K4US 1WNLA 4EPCA 5GAOn 4J7FA 4KH0B 5KYXB 2E4HA 2O88A 3EGDA 1JEGA 3G7ZA 2DRMA 5AT1B 5FWBA 1Y71A 1D1AA 2C0IA 1WI7A 3C12A 2L89A 5C6SA 2RN8A 3JCMh 4YTLA 2LDMA 2O9SA 2V1RA 3NPFA 3ZEHA 3OYMA 1BCOA 1FMVA 3PMTA 1IXDA 3QJ6A 1RACB 2DVJA 3LLRA 4C8QB 4C92B 3SHWA 5GAMg 2K6DA 4FCYA 2XK0A 1TXQA 2DZCA 4QQGA 3TU4K 1KD1U 3QXEB 1OULA 3EG1A 2HQHA 2QYZA 2BTTA 6AT1B 1Y0MA 2NWMA 3S3MA 1SRMA 2FO0A 1G83A 4LE9A 2QTVA 1UGPB 3CCRQ 3P8HA 2EJFA 4LD6A 3M58A 3QKJA 3CMET 4M7AA 1IZ6A 2QASA 2XKOC 2L0AA 4B9WA 2VGNA 3JCMg 2L3QA 4FT2A 3RNJA 2COYA 1U5SA 3CCQT 4C8QE 2XICA 4TVRA 5GAOl 4OB1B 2HAXA 3OBYA 2G6FX 1Q82C 3SFMA 2MYSA 1VQ9T 1VQ8A 4BACA 4C8QD 4EDUA 3M0RA 9ATCB 3QYHB 2L3RA 2RJEA 4EMKA 3L2VA 1IHWA 1G3WA 2K2MA 4FL6A 4CC3A 2DFUA 3CPWP 2EQKA 5FU7C 4D8KA 1B34B 2E70A 2JNGA 5FU6C 1NZ9A 1WDXA 2XDDA 5EC7A 1PKSA 2E6NA 2QEXT 1KC8C 1YJ9A 2V8IA 1VYUA 3H0IA 2PUKB 4AG1C 4PJOB 4M78C 2EKHA 1G3TA 2FZGB 4N0AA 1MNDA 1ZUYA 3VS1A 3WXMB 1YI2T 2OAUA 2IVWA 2ED1A 2EGCA 3KBGA 1TG0A 3QBYA 2CP3A 1Q7YU 1TUCA 2DVEA 2OTJQ 5GAN8 3QZ5B 3L42A 1WXBA 1K8AU 5GANe 3OYNA 4IUVA 4ZGEB 5J26A 3N5BB 2EAYA 3META 1M1KC 4F7UF 1WYXA 2RI3A 1RUWA 1J3TA 3MEWA 2CP0A 2P0PA 3CCVQ 2X4JA 1SKUB 1UFFA 3RMQA 2YUNA 2XG8D 3JV3A 2JUFA 1K9MC 1SF9A 3CMAQ 2K3YA 1VQ6Q 1VQLT 3X25B 1WJSA 4X9CA 5FROA 3TEEA 2E12A 2KXDA 4JS5A 4Y28E 3HHTB 4PLIA 5CK9A 3CXCS 1VQ7A 4JZ4A 3JCMX 2EJ9A 1UB4A 2K9GA 1QP3A 4M75B 2FRYA 1MUZA 3M0PA 3R6NA 2L2PA 5GAMj 1PSFA 4N4HA 4J9IA 3A8HB 4GLKA 1BI0A 1GCQC 1BIAA 1YBYA 2BZXA 4KT0E 3D7SB 2MOXA 4VUBA 2BKDN 4CC4B 1U8RA 3RDVA 4FYYB 5GAN7 3R6OA 4UC4A 1WHKA 2XI9A 2DERA 1K0XA 2KRSA 4M77B 2RQUA 1KK7A 3FIFA 1G5VA 1K0SA 1E6GA 1ACMB 3QZ9B 5CKEA 4IUTA 1Q86C 2KMTA 4Z8AA 1JXMA 1PG5B 4XTYA 5GAN5 2R5AA 5FWCA 1Q82U 3QIIA 2EQIA 5GANf 3FRNA 3TREA 2MWOA 3EFOB 3A8OB 1GBRA 2YT6A 2E1HA 2D0NA 4OF1A 3CMEQ 1U06A 3OW2P 4C5IA 3JRZA 4CRIA 1BKBA 1V76A 1ZBXA 4BE1A 3I55T 2GNCA 4JUVA 2KK4A 4FT4A 4BE2A 3I5SA 4L6V5 1QVFS 4XTXA 4M77E 3LH5A 3CCQQ 1AEYA 1V1CA 2DL7A 1X69A 1X27A 3G71A 2DNUA 1M2OA 4QQDA 1EZZB 4AT1B 1KC8U 1VQOA 1KFZA 2QA4A 1Y07A 4M77D 3MHXA 1VQ9Q 5CVIA 2LP5A 2RI5A 3EFRA 4EIKA 3J81E 3JB9D 2R57A 4BI3A 1UJ0A 3C95A 2WSFE 1YIJA 2L8DA 1JBMA 1YITT 4OB2B 1N8RC 3RKWA 4M78A 3MEUA 1NG2A 2VUBA 3SD4A 2KR3A 4MDWA 3VV0A 1M1KU 2FPFA 2ROLA 1ZBJA 4J8OA 1LOJA 1MMNA 1ZSZB 1Z9ZA 2QEXQ 2ZPGB 1HD3A 4A4KA 1M2VA 2VXEA 1K9MU 2D8HA 2OTLA 2KRNA 3RKYA 3DLLA 1YWOA 2RJFA 4ZGDB 3OSSC 2MCNA 1YI2Q 1NE8A 5GMKh 5GANd 2A28A 2VV5A 3A8LB 5CKFA 4BDYA 1AT1B 3SWNB 3MO8A 2XDPA 3OQ5A 3CCMA 3DB4A 2KT8A 4C0DC 4A4EA 4DA4A 3CCUT 4OMQA 3CC4A 2DIGA 2E5QA 1IRXA 3QSUA 2GF7A 2E41A 2GQVA 4AG2C 3REBB 4M7DC 3CQTA 5IHIA 2EW3A 2CP7A 4BDZA 5KH6A 2X35A 1UGSB 1BI1A 2VKNA 2V8KA 2V26A 4JJCA 2KDSA 1JXOA 5LJ3d 4A53A 2DTHA 4J9EA 1YJNT 2KEAA 3TCJA 1VQLQ 3HRTA 2RM4A 2DIQA 4MZPA 5CKDA 3G4SA 4FSSA 1GCQA 4N4GA 4PJNA 2LT4A 3QG1A 1NBEB 2NYSA 3CXCA 5KYYA 1OYXA 5IHNA 1N5ZA 3LWHA 2CT4A 2JW4A 4NS5A 5J39A 2DAQA 2CYZB 3EH2A 1QVFP 1FX7A 4C5GA 2PU9B 1VIFA 2O2OA 3ZFJA 2YRDA 4OGCA 1X01A 1I07A 3VYGA 4QVCA 1I81A 2K5FA 2Y90A 5A2QE 3JCMJ 5KCHA 2E3IA 2GFUA 1JJ2S 2D8JA 4PFOA 2FL7A 1NPRA 2A37A 4RTZA 2DRKA 2OAWA 2BIVA 4RKUE 2K79A 3Q1JA 4XTUA 2X9HA 2M0YA 1SG5A 1VQKA 1YHQT 1S72A 5IT9E 1NLOC 3CCSA 3E9GA 1C1AA 2ATCB 4J9GA 1VQ5T 2DL4A 3I55Q 2J06A 1SEMA 4M7AC 1KD1C 4MMKA 4F7UB 1VOMA 1C0MA 1FMWA 4D8DA 5GAOm 3MP1A 3FB9A 2AK5A 2O31A 5GANh 4PKCC 3PVQA 2PZ1A 2Y4XA 3SEMA 3CCET 3EG9A 1UTIA 4O6JA 4C92C 5HY6A 4E7IA 5KYNA 1UECA 3NFCA 3G6ET 2QDYB 4DEYA 1AZEA 1K73C 2J6OA 4F17A 2HL3A 2A36A 3H0FA 5LJ3h 3OS5A 3KXTA 1SHGA 4X34A 2QGGA 2YRCA 3ER0A 1YITQ 1D0XA 4LD9K 2LCSA 1QWFA 4JRKA 4J9CA 1D3BA 4A4HA 2Y4YA 2P84A 3V8JA 2EBPA 2NUPA 2LNHB 3RKXA 4B9XA 2DEQA 2RHZA 3L2UA 2DBKA 1R8OB 4E6RA 1GFDA 1X75C 3MKDA 4QKUA 5FRNA 1X2QA 4LDUA 4M7DA 3V8KA 1VQNA 4Z02A 3GF5A 3A98A 1YJWT 4IIOA 4AFQC 1WHHA 1QLYA 1QCFA 5HK3A 5LJ3g 1G8XA 1OV3A 1I8FA 3CCUQ 4E7JA 1VQ4T 2JXBA 3CC2T 4M78G 1GXIE 1U1TA 5GMKj 3OSVA 2GGRA 2H8HA 2J6KA 4JDSA 4RG8A 3CBPA 2QTXA 2EYZA 1YJNQ 1Y96A 3EG3A 2QQSA 3HRUA 1T0HA 1HXDA 2O9VA 1MNEA 3I35A 4DOVA 5GMKi 3C0CA 2X51A 2MMPA 1K8AC 2K3XA 4RTXA 5KYWB 4KGZB 3VUZA 1QMCA 4PJOC 3VS5A 1TS9A 3CCLT 3I56T 2E64A 5FW9A 2LX7A 4X9DA 1PCXA 3WVDB 3CC7A 2D1XA 2DTIA 2CP6A 2C06A 1FWZA 1B7TA 1M27C 2CH4W 2X3XD 4LDWA 3GNFB 2JS2A 4AFUC 3GLXA 2LMJA 2O01E 3OYLA 2CP5A 5LJ5g 5C0MA 2Z0WA 3EHQA 2L3PA 1NLPC 2RF0A 1JJ2A 1WA7A 4D6WA 1VUBA 4PJMA 2AZSA 1Y7XA 4JLGA 3ZL7C 2VYTA 3OYEA 3WVEB 3VS4A 5KYXA 3MEVA 5I21A 4XTVA 3A8GB 1I1JA 3QWYA 1XTDA 2JM8A 2AT1B 1UJYA 2EIFA 2GCXA 2RQWA 4F14A 3RMSA 1AWWA 3OYIA 4ME7A 3REAB 1YHQQ 1PD0A 3LWIA 2ZZDA 1K73U 1XJWB 4M75C 2D9TA 3PE0A 3NGPA 1VQ5Q 5D7UA 4C8QA 3BE3A 4C92A 2JM9A 2PUOB 3EGXB 4IUPA 1W2BS 1OU9A 3VRZA 2YUPA 2CREA 3J80E 2E3HA 4JJNK 3LGFA 5IAYA 1E6HA 4R56A 4QVZA 2RMOA 2NUZA 3S3NA 4M77C 3CCEQ 2VWFA 4KRTA 2LJ0A 2QQBA 2QGFB 3G6EQ 1W4SA 3QJYA 4AMCA 1Q7YR 2VASA 2RO0A 1N27A 5GAN6 8AT1B 2PNIA 1N9RA 2B86A 1M9SA 2DILA 4IURA 4LDVA 3UWNA 2KXCA 5M9OA 1G2BA 1O75A 1U1SA 3CBMA 2DMOA 3E19A 1BBZA 4E2FB 1K76A 2VXFA 1PKTA 1R77A 4KUIA 4JPBW 1RAHB 5LJ3j 4B6MA 2CS7A 1AVZC 2HCKA 2EQJA 5GAOr 2RQRA 1VQPT 3VKIA 2PTKA 2F2WA 4PJJA 3RESA 4OMLA 4KUDK 2KNBB 3V7RA 3VJPA 1YJWQ 2RK2A 1B34A 3L2WA 2LQWA 2HQEA 2DPPB 2ZPHB 3EG2A 3H8ZA 1WHMA 4KBMB 4QW2A 5AYFA 2AIRB 3GIBA 2A08A 4BY6C 1VQ4Q 3CC2Q 3GPLA 2DM1A 2F2VA 4OMMA 4HCKA 4PJLA 4OP0A 4PJOA 4LN2A 1M8MA 5FLXE 1VQMT 1QCOA 2EGAA 3CD6Q 3CCJA 2YXYA 2CT3A 4KH1B 2JZ2A 1HK9A 1ZX6A 2HKNA 3FLGA 1CSKA 5FRMA 5KE2A 3LH0A 5ECAA 2MI6A 2AKKA 1HJDA 5LJ5j 5CKHA 1X2KA 1Q82R 1KQSS 2HBPA 2ZPIB 3CCLQ 3I56Q 4C0GA 5GAN4 4ZTFA 2DO3A 2ECZA 5KCOA 2J7IA 2H3JA 5D6XA 3SWNC 1RL2A 1QVGS 2HDAA 2W0ZA 4J7IA 2CSIA 3IQLA 2RPNA 1HSQA 2DTOA 4RG2A 3OYHA 1ABQA 3ZBDA 2ROTA 3OMGA 4DBHA 2IG0A 2LQ8A 3OS1A 3OA6A 2KAFA 3L2QA 5DLOA 1KQ2A 3PNWC 3PT9A 1KC8R 4M75A 3CCRA 3M53A 4V2SA 3M0SA 3ME9A 2FPEA 1MMAA 2K3BA 4BUGA 4ELZC 2EQMA 2BZYA 1UHFA 1EIFA 2XU8A 3M0TA 5HCKA 2X4YA 4RCCA 1I4K1 1U3OA 5GAMe 5D6YA 4M77A 4RTYA 2LJ3A 1W2BA 3BFMA 2QQ9A 1M1KR 1MMDA 2HZYA 2FVUA 4DBFA 2DL5A 1AZGB 1K9MR 4J9DA 2AKLA 3JB9J 3QO3A 3EFOA 2PVOB 1I5OB 5CCAA 5I2SA 4XAXB 2M16A 5GMKl 3L2RA 3M59A 3KFVA 1VQ8T 2LNVA 1RADB 3JCMe 3KUFA 4M7AG 2DXCA 5KYUB 5J3BA 4M7AF 2FG0A 2QI2A 3L2ZA 2VC8A 1UUEA 4HCBA 2A3LA 2KYMA 1AWOA 2W10A 2X4XA 2RA2A 4C92G 1ZSGA 3GNGA 2E65A 3CXCP 5CQYA 1AWJA 1JQQA 1RAFB 4XU3A 2LCCA 1M3BA 1M30A 2JTMA 1WJRA 5CKBA 4OMNA 1WZOA 1YJ9T 5CAIA 2OTJA 1WXTA 3HKSA 2BUDA 2LZ6B 1VQPQ 4M78D 4DBQA 3P8BB 3X20B 1Q86R 2A7YA 3HL8A 2DETA 2DD5A 4OB0B 1QVPA 2DYBA 1G3SA 1VYTA 3BDLA 2V8JA 2PVGB 4DBRA 3CCVA 2CZ0B 1DJ7B 3JCMP 4E7SA 3HFNA 3S6WA 2ENMA 3CMAA 1VQ6A 1YCSB 1ZSZA 2E10A 2ZPEB 3HRSA 4ANJA 4XK8E 4E7KA 2FRWA 2G3RA 1YWPA 1IGQA 1W1FA 1Q81C 1VQMQ 3OYKA 1QWEA 2KI7A 5HK0A 1NJIC 3MPUB 2QK0A 3BW1A 4PK4A 1OZ2A 2LVMA 1QKXA 2BZ8A 2K2VA 1H92A 3SWNA 1OI1A 2LTOA 1OU8A 4X1VA 1KQSA 2DKGA 1VIEA 1VQ7T 2WSCE 1YNZA 4AFSC 2D6FA 1LJOA 4MZMA 1EX4A 1QVGA 1XOVA 3UT1A 4XU2A 2M51A 3C94A 1N8RR 4L5GA 4FYXB 3M57A 2KBTA 5CIUA 1M3CA 4FW1A 4PJOG 2YSQA 2RHXA 1UG1A 2CZ1B 4XQ3A 4EMGA 3THKA 1WFWA 5A0LA 1M90C 3INZA 4R55A 2OJ2A 1UHCA 3PIOA 2QAZA 1HYOA 2HKQB 1D1CA 3CMEA 4LDYA 1QW1A 4IKFA 1WX6A 3RR6A 2B8AA 4PNOA 3RBBB 4NL2A 3JCMV 2YLCA 2ED0A 3CCQA 2XHCA 3V7CA 1BI2A 3H0HA 1TSFA 1BU1A 4QVDA 3OYAA 3OYDA 2EGEA 2NUTB 1RI0A 1D09B 3RERA 2KSSA 3M54A 2P0QA 4C8QC 1VQ9A 3NHNA 2R58A 4RMOA 2C0OA 2O4XB 3MCAB 2A0FB 1M8VA 4IUQA 3G71T 2MWPA 4OGEA 4FSXA 1MV3A 4M75G 2K5IA 1VQOT 4LUDA 2YHTA 1B3QA 2DX1A 2QA4T 1M1FA 4LUEA 4IUUA 2LQKA 1VQ8Q 1JB0E 2JN0A 5A0DA 2KYBA 4OMOA 1D0ZA 3JSCA 3M9QA 3DLMA 8ATCB 3T9NA 4Z89A 4JJBA 3O8VA 4GLMA 1YIJT 4F7UA 3NTKA 1PD1A 4GBQA 1YN8A 1OPKA 2F1LA 5IH2A 4ZGJB 2QEXA 5GANg 4AFZC 3OYCA 3EFSA 3PGGA 3VU3C 1KHCA 1D1BA 4HCCA 2GTOA 4ZTJA 2MF2A 2RNAA 4IIMA 2H3EB 4HVVA 1YI2A 2COZA 2DE0X 4WTOB 2EPDA 1ZUUA 1YJ9Q 1Q81U 3M55A 5IHKA 2OTLT 4DEXA 1NJIU 3NMZC 3M0QA 2XMFA 3PMIA 2OTJT 2DEUA 2X3WD 3FDRA 2M9UA 1K1ZA 2CP2A 4M78F 5DLQE 3CCMT 2YWWA 3EGDB 1RAAB 2V1QA 4C5EA 3CC4T 3GOXA 1JJ2P 2EYQA 2WACA 1VQLA 4OB3B 2OX7A 3ULRB 1R0BG 4M7DD 3S3OA 5DM7R 2EJGA 3CPWS 3UA6A 1Y57A 1FMKA 4P5NA 1BIBA 1KD1R 1MV0B 3GBQA 1KQ1A 1WPYA 1LPLA 3TQ7P 1TU0B 4A4FA 1VA7A 3G4ST 1XQHA 1M90U 2CUBA 4Y92A 2LJ1A 3FJ5A 3DKMA 4K11A 4HT9A 4BE0A 3EHRA 2IPOB 3JB9I 1VQ7Q 3LX7A 3O5ZA 3A8MB 1X6OA 4BI4A 1NM7A 4A4GA 2OI3A 2LT1A 3OBWA 1BK2A 4BI8B 1K73R 1PNJA 4M7AB 2EQUA 4JRPA 1FYNA 3MJXA 2RD1A 1N9SA 3SDZA 2JS0A 5GMKe 5CO7A 3OS2A 5KYWA 1WLPB 1W6XA 4J5YA 2K4YA 4E47A 3M4YA 2DJQA 2LRQA 2HL5C 1ZA1B 3OMCA 2BE7D 2ZCFB 2XD0A 1TTHB 2YUOA 2VVKA 1PRMC 4HT8A 1BYMA 2CGHA 3I55A 2FEIA 4O5VA 4EMKB 4M7AE 3M56A 1VQKT 3JCMc 1PWTA 1S72T 1NPPA 3LYIA 2RJDA 3OYBA 2EVRA 3CCST 2P4TA 4ELYC 4FIBA 2YUQA 2KROA 4C92E 4M7AD 1AOJA 3FJPA 1NYFA 3RIRA 1XNIA 2VB6A 2EYYA 4DQ2A 1OX9A 5GANj 1PM3A 3G71Q 2JMAA 5GMKm 1N6AA 1VQOQ 1O9SA 2QA4Q 4C92D 1K8AR 1YITA 1UGVA 7AT1B 1X6BA 2KY9A 3OY9A 1OZ3A 4ESRA 1YCYA 1SSFA 1GFCA 3CPFA 1JU5C 5CQXA 3EGXA 3VS6A 2CH4A 2BE9B 5GJVB 3CEYA 1YIJQ 2L3SA 5L23A 4JRIA 1YFNA 1F1BB 3E9FA 3OW2S 3U23A 2ESWA 3PTAA 2HMAA 2ZPFB 5GAN2 4CC2A 1QQJA 4BB7A 1S1NA 1WHGA 2OTLQ 4C0ZA 1RAGB 3CCUA 1UGRB 3QPHA 1KG1A 1VQNT 1WXUA 4F04B 4J6YA 1RLQC 2JT4A 4GY5A 4R0KA 2DXTA 2MPXC 3UA7A 3QDFA 3HTRA 1VYVA 1NEGA 2HNIA 3VS3A 1BB9A 2VGMA 3VS0A 2WSEE 3CCMQ 4BD3A 3CBOA 4F7UG 1YJNA 3CC4Q 2DJZA 1C6VX 2F69A 4CI0C 3FC3A 2JVVA 3BY7A 5I11A 3CPWA 2EWNA 4J6XA 1D0YA 2QQRA 2LCLA 4CC7A 1RAIB 3P8DA 4J9HA 4XTWA 1ZSZC 1CKBA 4J6WA 3X24B 4PJOE 3HP9A 4A54A 3VUBA 3URGA 4M7DG 2J05A 4HCZA 4M7DF 5LJ3e
chains in the Genus database with same CATH topology
3NFCA 3OB9A 3S3MA 3G6ET 3P8BB 2QDYB 3X20B 2LC4A 2A7YA 5DY9A 3HL8A 1UGPB 2DD5A 4OB0B 1QVPA 3P8HA 1G3SA 2EJFA 3MP6A 3UPUA 3BDLA 4LD6A 4DOWA 3OYYA 1K73C 3M58A 4ATOA 2V8JA 4L59A 2PVGB 4PJOD 3QKJA 4MMLA 4JLIA 5LJ3h 3CMET 2CZ0B 3CCVA 1IZ6A 1DJ7B 3OS5A 4M7AA 2XKOC 3KXTA 4X34A 4MZTA 4XTZA 3ER0A 4B9WA 3CC7T 3JCMP 3HFNA 4LD9K 3S6WA 4NOYA 2VGNA 3CMAA 1VQ6A 3JCMg 4JRKA 4FT2A 3QDRB 2DXBA 1D3BA 3MEAA 4A4HA 3CCQT 4C8QE 2E10A 2Y4YA 2ZPEB 3V8JA 2XICA 3HRSA 4TVRA 4XK8E 4E7KA 5GAOl 2G3RA 3RKXA 4B9XA 2DEQA 1LNXA 2RHZA 4OB1B 3L2UA 2HAXA 1Q81C 1R8OB 3OBYA 3OYKA 1G3YA 2DK3A 1MGQA 5HK0A 1NJIC 1X75C 3BW1A 3JCMQ 1Q82C 5FRNA 3SFMA 1OZ2A 2EKOA 4LDUA 1VQ9T 2LVMA 4BACA 4C8QD 1VQ8A 2K2VA 3V8KA 4M7DA 4EDUA 1VQNA 3SWNA 1OI1A 3GF5A 4Z02A 2LTOA 3QYHB 2L3RA 2RJEA 5FU7B 1YHQA 3QHSA 1YJWT 4EMKA 1KQSA 3L2VA 1H3ZA 4M75E 2DKGA 1G3WA 1VIEA 1VQ7T 5FU6B 2WSCE 4FL6A 4ZN3A 5HK3A 5LJ3g 1LJOA 2D6FA 1VQ5A 4MZMA 2EQKA 4HA8A 4II1A 5FU7C 1I8FA 2QQAA 1UGQB 4E7JA 1VQ4T 5LJ5e 1B34B 2E70A 2M1HA 2JNGA 1H641 4WF2A 1QVGA 4M78G 3CC2T 5FU6C 1NZ9A 1U1TA 1GXIE 1XOVA 2HD0A 3UT1A 5GMKj 4XU2A 3C94A 3OSVA 3ASKA 5IN1A 3BDUA 4M75D 4L5GA 4M78B 3M57A 2XDDA 4JDSA 5CIUA 4RG8A 3CBPA 2QTXA 2DD4A 4PJOG 2E6NA 2QEXT 2I2LA 2RHXA 1KC8C 1YJ9A 2V8IA 1Y96A 3HRUA 2CZ1B 2QQSA 4XQ3A 3CCEA 1HXDA 4EMGA 5KE3A 4DOVA 5GMKi 2PUKB 2X4WA 4PJOB 4M78C 2GFAA 5A0LA 5LJ3f 2LX9A 2MMPA 4PLLA 3G6EA 1G3TA 2F5KA 1K8AC 4N0AA 3WXMB 1M90C 2CZ6B 2K3XA 1YI2T 2OAUA 2IVWA 3INZA 2M0OA 3VUZA 4R55A 3KBGA 3PIOA 1BI3A 3QBYA 4PJOC 1Q7YU 2DVEA 3F70A 2XIDA 2PQWA 3CMEA 5GAN8 3QZ5B 4LDYA 3L42A 3I56T 1QW1A 3CCLT 2E64A 4IKFA 3CC7A 4X9DA 3WVDB 1K8AU 2B8AA 4PNOA 2AHJB 5GANe 3OYNA 4IUVA 2DTIA 5D6WA 4BY6B 4ZGEB 5J26A 3N5BB 4NL2A 2C06A 2EAYA 2ZPBB 3JCMV 2YLCA 1FWZA 3META 1M1KC 4C8QG 3LGLA 4F7UF 3CCQA 3J7AF 2RI3A 4M78E 3MEWA 2XHCA 3V7CA 2RHUA 2P0PA 4C92F 4C8QF 2JTFA 2X4JA 1BI2A 4QVDA 2HQXA 3GNFB 3PFSA 4LDWA 3RMQA 2XG8D 3OYAA 3OYDA 1WGSA 2K5LA 3GLXA 4JRQA 2YLBA 2O01E 2JUFA 3MP8A 1K9MC 3OYLA 2K3YA 2F5TX 5C0MA 5LJ5g 3OW2A 4E7IA 3JCMW 1VQLT 1JRIA 1RI0A 3RERA 2KSSA 3M54A 3X25B 1WJSA 2RHYA 2P0QA 4C8QC 1JJ2A 4D6WA 1VQ9A 1VUBA 3JB9H 2R58A 4RMOA 1Y7XA 4JLGA 2O4XB 4X9CA 3TEEA 5FROA 2E12A 2VYTA 3LW5E 3MCAB 3OYEA 4JS5A 3WVEB 3OYJA 1M8VA 4IUQA 3PIPA 3G71T 4Y28E 2MWPA 3MEVA 2K57A 4OGEA 5I21A 2L5QA 1YJWA 4FSXA 3HHTB 3A8GB 4M75G 4XTVA 4PLIA 5CK9A 4Y91A 2K5IA 3CXCS 1XTDA 1VQOT 1VQ7A 1ZQ1A 3JCMX 2EIFA 1UB4A 2EJ9A 2GCXA 2YHTA 3H6ZA 1QP3A 1M1FA 2QA4T 2D0QB 4M75B 5GAN3 3RMSA 2RH2A 2YRVA 3HSBA 4IUUA 2LQKA 5CR2A 1JB0E 5GAMf 5GAMj 1VQ4A 3OYIA 2JN0A 1AHJB 1PSFA 4N4HA 4ME7A 5LJ5f 3A8HB 5A0DA 4GLKA 3CC2A 1BI0A 3FEOA 3JSCA 3M9QA 4PL6A 3DLMA 3LWIA 2ZZDA 1BIAA 1K73U 3T9NA 4M75C 2D9TA 5GAOq 3M4GA 3O8VA 1M4ZA 1YBYA 4XU1A 1YIJT 4F7UA 4KT0E 3NTKA 3HPWA 4C8QA 4C92A 4ZGJB 4VUBA 2QEXA 2BKDN 2PUOB 2ZGWA 5GANg 5GAN7 1U8RA 3R6OA 4UC4A 3CD6A 3OYCA 3EFSA 4IUPA 3OYFA 3PGGA 3VU3C 4Q5WA 2XI9A 1W2BS 1KHCA 3JAME 4HCCA 3J80E 4ZTJA 3QYGB 4M77B 2MF2A 3FIFA 1G5VA 4JJNK 3LGFA 5IAYA 3QZ9B 5CKEA 1YI2A 4IUTA 1Q86C 4R56A 2KMTA 4QVZA 2P0KA 3JCMf 1Q81U 3S3NA 4KULA 4HKEA 4M77C 2FHDA 3CCJT 4XTYA 5GAN5 3M55A 2OTLT 2R5AA 1NJIU 3CCLA 3I56A 2QQBA 1Q82U 2CZ7B 3QIIA 4E7LA 1W4SA 3QJYA 3FRNA 5GANf 3TREA 2MWOA 5LL6S 1Q86U 2RO0A 1N27A 5GAN6 3A8OB 3PMIA 2OTJT 2RK1A 3FDRA 2E1HA 1N9RA 1M9SA 2M9UA 4OF1A 3C4SA 4IURA 3QUIA 4LDVA 4M78F 4C5IA 3UWNA 3JRZA 1MHNA 2RJCA 5DLQE 4CRIA 3CCMT 1BKBA 1ZBXA 4BE1A 3I55T 4JUVA 1M5Q1 4C5EA 1IREB 5M9OA 2KK4A 3GOXA 4FT4A 3CC4T 4BE2A 1O75A 2EYQA 2WACA 1VQLA 4L6V5 3SB2A 3NTIA 1U1SA 4OB3B 3CBMA 4XTXA 3GP8A 1QVFS 4M77E 3E19A 4PJOF 4M7DD 2VXFA 3L1AA 1FXXA 3S3OA 3A5ZB 4KUIA 5DM7R 4MDXA 5GAOp 4OMFB 2EJGA 3CPWS 5LJ3j 5L8RE 2CS7A 2EQJA 3G71A 5GAOr 2RB6A 4P5NA 1BIBA 4QQDA 1KQ1A 1KC8U 1WPYA 1VQOA 1VQPT 1PSEA 3VKIA 2QA4A 2CKKA 1Y07A 4M77D 3RESA 4KUDK 3MHXA 3V7RA 5CVIA 1KHIA 4A4FA 3G4ST 1XQHA 3VJPA 5HKCA 1M90U 2RI5A 3CCRT 4LDXA 2MAMA 3EFRA 5GAMd 3DKMA 3OYGA 3J81E 2RK2A 5LJ5d 1B34A 4HT9A 3L2WA 4BE0A 2HQEA 3JB9D 2R57A 3JB9I 2DPPB 2ZPHB 3H8ZA 4BI3A 3LX7A 3C95A 2WSFE 4KBMB 2L8DA 4QW2A 1YIJA 5AYFA 1JBMA 1X6OA 3A8MB 4OB2B 4BI4A 1YITT 1N8RC 3RKWA 4A4GA 3GIBA 4M78A 4BY6C 2LT1A 3OBWA 3MEUA 4BI8B 2PVDB 2VUBA 4M7AB 3HFOA 3GPLA 1WJQA 3SD4A 2EQUA 4JRPA 4MDWA 3VV0A 1M1KU 4J83A 4OP0A 1N8RU 5I2MA 1M1GA 2RD1A 1QVFA 4PJOA 4QQ6A 4J8OA 1N9SA 5EG2A 3SDZA 3X28B 5FLXE 3M5AA 1LOJA 1VQMT 3DB3A 1D3BB 4C0FA 2ZPGB 5GMKe 4A4KA 5CO7A 1K9MU 2VXEA 3CCJA 3OS2A 2OTLA 1V29B 2FB7A 3JCMd 2JZ2A 1HK9A 3RKYA 4J5YA 4M75F 3DLLA 2K4YA 4E47A 3X26B 3FLGA 5FRMA 3M4YA 5KE2A 2LRQA 2RJFA 4ZGDB 3OSSC 3OMCA 3LH0A 1NE8A 2ZCFB 4C0DB 4JS4A 2XD0A 5GMKh 2MI6A 5GANd 5LJ5j 2VV5A 5CKHA 4HT8A 1BYMA 3A8LB 4M7DB 5CKFA 4BDYA 2HBPA 1KQSS 4XU0A 2DXUA 2ZPIB 3MO8A 3SWNB 2XDPA 3OQ5A 4C0GA 2CGHA 1WQWA 3DB4A 4ZN1A 5GAN4 3I55A 4C0DC 3CCMA 4O5VA 4A4EA 2DO3A 4EMKB 3CCUT 4DA4A 3CC4A 2DIGA 2E5QA 4M7AE 2E6ZA 2GF7A 3QSUA 2DZ9A 3M56A 3UDCA 4RCBA 2E41A 5KCOA 4FU6A 2GQVA 2NLUA 4M77G 3JCMc 1VQKT 4M7DC 1S72T 2H3JA 5D6XA 3SWNC 1NPPA 4M77F 1RL2A 2RI2A 3LYIA 1UEBA 1QVGS 4BDZA 4OVAA 5KH6A 2RJDA 4EMKC 3OYBA 2X35A 1UGSB 1BI1A 4J7IA 3CCST 2V8KA 4NL3A 2KDSA 5A0GA 2DTOA 4RG2A 5LJ3d 4A53A 3OYHA 2DTHA 4F7UE 2KVQG 3JB9G 1YJNT 2O4XA 3ZBDA 2P4TA 2FYKA 4ELYC 3OS0A 4FIBA 3OMGA 3TCJA 3JB9F 4C92E 3HRTA 2IG0A 2RM4A 2LQ8A 3OS1A 2DIQA 3OA6A 1VQPA 3AHUA 4M7AD 2KAFA 3L2QA 5DLOA 3FJPA 1KQ2A 3RIRA 1XNIA 4MZPA 5CKDA 3G4SA 3PNWC 3VYHB 4N4GA 1Y96B 3PT9A 4M75A 2LT4A 3M53A 3V8LA 4DQ2A 3CCRA 3QG1A 4V2SA 3CXCA 5GANj 3NTHA 3ME9A 1OYXA 5GMKm 3JCMb 4M7DE 1N6AA 4BUGA 4ELZC 1O9SA 3RUXA 4C92D 1TH7A 1YITA 3LWHA 2EQMA 4NS5A 3V7SA 2R5MA 5J39A 1EIFA 4E7HA 2DAQA 2XU8A 2KY9A 3OY9A 1OZ3A 2CYZB 2EFIA 1YCYA 2QXFA 2RHIA 1SSFA 1FX7A 2X4YA 4N0AC 3CPFA 4C5GA 2PU9B 3EAEA 1VIFA 5CQXA 4RCCA 2KQWA 1I4K1 3CCVT 5GAMe 3CEYA 4N4IA 5D6YA 4M77A 4FM4B 4C5HA 3ZFJA 1VQMA 1W2BA 4OGCA 1X01A 3BFMA 3CMAT 2QQ9A 1VQ6T 1ZHIA 2FVUA 3VYGA 2JOYA 4JRIA 4QVCA 3E9FA 3OW2S 1I81A 3PTAA 2ZPFB 2K5FA 2Y90A 1I5LA 5GAN2 5GAMh 5A2QE 3JCMJ 5LJ5h 5KCHA 2GFUA 1JJ2S 3CD6T 3JB9J 4BB7A 1Q7YC 1QP2A 1WQ7A 2FL7A 1NPRA 3QO3A 4EMHA 2PVOB 5CCAA 3E1SA 2XDBA 1P92A 5I2SA 4XAXB 2M16A 5GMKl 3L2RA 1WNLA 2BIVA 3M59A 4RKUE 4EPCA 5GAOn 4J7FA 4C0ZA 1VQ8T 3Q1JA 3CCUA 1UGRB 2LNVA 4XTUA 3QPHA 1KG1A 1VQNT 3JCMe 3KUFA 4M7AG 2DXCA 4J6YA 1VQKA 1YHQT 5J3BA 4GY5A 4M7AF 2DXTA 2QI2A 1S72A 3L2ZA 3G7ZA 2VC8A 4ZTFA 1Y71A 5IT9E 3C12A 4HCBA 2A3LA 2HNIA 3CCSA 2L89A 2VGMA 5C6SA 3E9GA 2WSEE 1VQ5T 2X4XA 4BD3A 3JCMh 3CBOA 4F7UG 1YJNA 4YTLA 2LDMA 3ZEHA 2RA2A 2DJZA 4M7AC 2F69A 4C92G 3OYMA 4CI0C 3FC3A 1KD1C 2JVVA 3BY7A 4MMKA 3CPWA 3GNGA 2EWNA 2E65A 2QQRA 3PMTA 2LCLA 4J6XA 4F7UB 5GAOm 3MP1A 3QJ6A 5CQYA 3LLRA 4C8QB 3FB9A 4C92B 5GANh 4PKCC 4XU3A 5GAMg 2LCCA 3P8DA 4XTWA 2JTMA 1WJRA 2DZCA 2XK0A 4J6WA 4QQGA 5CKBA 3X24B 3HP9A 4PJOE 4A54A 2Y4XA 1YJ9T 3VUBA 3URGA 5CAIA 3TU4K 3HKSA 1KD1U 2BUDA 3CCET 4M7DG 3QXEB 2OTJA 4HCZA 4O6JA 4C92C 4M7DF 5LJ3e 5HY6A 4M78D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NFC A;  1VUB A;  5DLO A;  5HKC A;  5CQX A;  2C06 A;  3HPW A;  4MZP A;  5CCA A;  5CKD A;  5HK3 A;  4VUB A;  5CO7 A;  4MDX A;  4MZM A;  5CK9 A;  5CQY A;  1UB4 A;  5HK0 A;  1M1F A;  1X75 C;  4MZT A;  4OF1 A;  2MF2 A;  4ELZ C;  5CR2 A;  5CKB A;  2VUB A;  1NE8 A;  4ME7 A;  5CKE A;  3JRZ A;  3G7Z A;  3VUB A;  3JSC A;  5CKH A;  2KMT A;  4ELY C;  3TCJ A;  5CKF A;  4HKE A; 
#chains in the Genus database with same CATH topology
 3OB9 A;  2LC4 A;  3G4S Q;  3AT1 B;  1TUD A;  5DY9 A;  1WIE A;  3UPU A;  3MP6 A;  1E7O A;  4DOW A;  3OYY A;  4ATO A;  4L59 A;  4PJO D;  1W2B P;  4MML A;  4JLI A;  1QKW A;  2DL8 A;  4MZT A;  4XTZ A;  3CC7 T;  1IGU A;  1ZLM A;  4NOY A;  2CSQ A;  3QDR B;  2DXB A;  3MEA A;  1ARK A;  1JO8 A;  3G1J A;  3PVL A;  1KSW A;  1LNX A;  2ABL A;  2COW A;  1G3Y A;  2DK3 A;  3EG0 A;  1MGQ A;  3TVT A;  3JCM Q;  2EKO A;  1SRL A;  4HVU A;  3VS2 A;  3E2U A;  1EFN A;  5FU7 B;  1YHQ A;  3QHS A;  3VRY A;  4Z88 A;  1H3Z A;  4M75 E;  1RI9 A;  4PFP A;  1T0J A;  5FU6 B;  4KGV B;  4ZN3 A;  1VQ5 A;  4HA8 A;  4II1 A;  2QQA A;  1UGQ B;  5LJ5 e;  2M1H A;  4RTU A;  1H64 1;  4WF2 A;  1VQK Q;  4PFZ A;  2I0N A;  2HD0 A;  1S72 Q;  5IN1 A;  3ASK A;  3BDU A;  4M75 D;  4M78 B;  2M02 A;  3H9N A;  3CCS Q;  1K9A A;  2J6F A;  2DD4 A;  1CKA A;  2I2L A;  3CCE A;  4JJD A;  5KE3 A;  2X4W A;  1OPL A;  2GFA A;  5LJ3 f;  4A63 B;  2LX9 A;  2RQV A;  4PLL A;  3G6E A;  2F5K A;  1OX8 A;  3TSW A;  2CZ6 B;  1M2V B;  2M0O A;  1BI3 A;  4JZ3 A;  3F70 A;  2XID A;  2PQW A;  1ZA2 B;  2JTE A;  2AHJ B;  2SRC A;  2MIO A;  5D6W A;  4BY6 B;  1NEB A;  1BCM A;  2ZPB B;  2FPD A;  4C8Q G;  3LGL A;  3J7A F;  1WHL A;  4M78 E;  2RHU A;  1IB8 A;  4C92 F;  4C8Q F;  2JTF A;  1GL5 A;  2DL3 A;  4RTW A;  2HQX A;  3PFS A;  2QG9 B;  4JRQ A;  1WGS A;  2K5L A;  4LXC A;  2YLB A;  2AZV A;  1OQK A;  3MP8 A;  2FZC B;  2F5T X;  3OW2 A;  4E7Z A;  1Z9Q A;  3JCM W;  1JRI A;  2RHY A;  1KQS P;  2DA9 A;  3EH1 A;  3JB9 H;  1I0C A;  3LW5 E;  3OYJ A;  1T3S A;  3PIP A;  1YJW A;  3EGU A;  2K57 A;  2L5Q A;  2KE9 A;  4Y91 A;  5KYU A;  1IO6 A;  1X43 A;  1ZQ1 A;  1AD5 A;  3H6Z A;  1H3H A;  1QVG P;  2D0Q B;  5GAN 3;  2RH2 A;  2YRV A;  2ZAE A;  3HSB A;  5CR2 A;  5KYY B;  5GAM f;  1OEB A;  1VQ4 A;  1VQN Q;  1AHJ B;  4RTT A;  5LJ5 f;  3I9Q A;  3CC2 A;  1PRL C;  3I5R A;  2DBM A;  3FEO A;  4PL6 A;  4WCI A;  2FZK B;  5GAO q;  3M4G A;  1ZUK A;  1M4Z A;  4XU1 A;  3HPW A;  1KJW A;  1T3L A;  2ZGW A;  1YP5 A;  4RUG A;  1GRI A;  3CD6 A;  3H41 A;  3OYF A;  4Q5W A;  3JAM E;  3QYG B;  3M0U A;  1GCP A;  2KGT A;  4KGX B;  1UDL A;  2C0T A;  2P0K A;  2E5K A;  3JCM f;  4J9B A;  4KUL A;  4HKE A;  2FHD A;  3CCJ T;  4ZNX A;  1KIK A;  4LNP A;  2MK5 A;  1PHT A;  2IIM A;  3CCL A;  3I56 A;  2EYX A;  4FYV B;  2CZ7 B;  1B07 A;  4E7L A;  1H8K A;  1Q95 G;  3UF4 A;  1AWX A;  5LL6 S;  1Q86 U;  2RK1 A;  3UAT A;  1PC0 A;  3C4S A;  3QUI A;  1SSH A;  4OMP A;  4QT7 A;  1MHN A;  2RJC A;  3CC7 Q;  1TWB A;  1LVK A;  2LQN A;  1M5Q 1;  1IRE B;  2EYW A;  3SB2 A;  3NTI A;  3GP8 A;  4PJO F;  3L1A A;  1FXX A;  3A1P A;  1ABO A;  3A5Z B;  4MDX A;  5GAO p;  4OMF B;  5L8R E;  4RTV A;  1NYG A;  2RB6 A;  4J9F A;  5IXB A;  1PSE A;  2CKK A;  1KHI A;  1SHF A;  5HKC A;  5I22 A;  3EG9 B;  3CCR T;  4LDX A;  2MAM A;  1W70 A;  5GAM d;  1TUG B;  3OYG A;  2SEM A;  2KT1 A;  5LJ5 d;  2PVD B;  2CUD A;  3VS7 A;  1X6G A;  3HFO A;  1WJQ A;  2GQI A;  4J83 A;  2HSP A;  1N8R U;  5I2M A;  1M1G A;  1QVF A;  2HSE B;  4QQ6 A;  1RLP C;  5EG2 A;  3X28 B;  3M5A A;  1IHV A;  3DB3 A;  1D3B B;  4C0F A;  2NUP B;  1V29 B;  2FB7 A;  3JCM d;  5GJW B;  4M75 F;  3X26 B;  1Q81 R;  4JS4 A;  4C0D B;  1NJI R;  4M7D B;  3QWX X;  4XU0 A;  2DXU A;  4ZN1 A;  1WQW A;  2CDT A;  2YDL A;  2JJ9 A;  2DF6 A;  2E6Z A;  2HEQ A;  2K7A A;  2DZ9 A;  3UDC A;  4RCB A;  4M4Z A;  4FU6 A;  1QCN A;  2NLU A;  4M77 G;  4M77 F;  2NUT A;  2RI2 A;  4HXJ A;  1UEB A;  4OVA A;  4EMK C;  4NL3 A;  1LCK A;  1R0C B;  2GBQ A;  5A0G A;  2RQT A;  4F7U E;  2KVQ G;  1GBQ A;  2P4R A;  2O4X A;  3JB9 G;  2FYK A;  3OS0 A;  3JB9 F;  1RAB B;  1VQP A;  3AHU A;  1SPK A;  3TSZ A;  2KRM A;  1UE9 A;  3VYH B;  1Y96 B;  2DYI A;  3V8L A;  3NTH A;  3JCM b;  4M7D E;  3RUX A;  1M3A A;  1TH7 A;  4ORZ A;  1M90 R;  1WHJ A;  3V7S A;  2R5M A;  4E7H A;  1RAE B;  1MMG A;  2EFI A;  2QXF A;  2RHI A;  2DLP A;  4N0A C;  3EAE A;  2KQW A;  3CCV T;  4N4I A;  2QDL A;  4C5H A;  4FM4 B;  2HBW A;  4FYW B;  1VQM A;  4FW2 A;  3CMA T;  1VQ6 T;  1ZHI A;  4HVW A;  2JOY A;  5IXF A;  1A0N B;  1TOV A;  1I5L A;  5GAM h;  2JMC A;  5LJ5 h;  4F16 A;  3CD6 T;  1Q7Y C;  1QP2 A;  1WQ7 A;  1OOT A;  4EMH A;  2GTJ A;  3E1S A;  3CCJ Q;  2F2X A;  2XDB A;  1P92 A;  1K4U S;  1WNL A;  4EPC A;  5GAO n;  4J7F A;  4KH0 B;  5KYX B;  2E4H A;  2O88 A;  3EGD A;  1JEG A;  3G7Z A;  2DRM A;  5AT1 B;  5FWB A;  1Y71 A;  1D1A A;  2C0I A;  1WI7 A;  3C12 A;  2L89 A;  5C6S A;  2RN8 A;  3JCM h;  4YTL A;  2LDM A;  2O9S A;  2V1R A;  3NPF A;  3ZEH A;  3OYM A;  1BCO A;  1FMV A;  3PMT A;  1IXD A;  3QJ6 A;  1RAC B;  2DVJ A;  3LLR A;  4C8Q B;  4C92 B;  3SHW A;  5GAM g;  2K6D A;  4FCY A;  2XK0 A;  1TXQ A;  2DZC A;  4QQG A;  3TU4 K;  1KD1 U;  3QXE B;  1OUL A;  3EG1 A;  2HQH A;  2QYZ A;  2BTT A;  6AT1 B;  1Y0M A;  2NWM A;  3S3M A;  1SRM A;  2FO0 A;  1G83 A;  4LE9 A;  2QTV A;  1UGP B;  3CCR Q;  3P8H A;  2EJF A;  4LD6 A;  3M58 A;  3QKJ A;  3CME T;  4M7A A;  1IZ6 A;  2QAS A;  2XKO C;  2L0A A;  4B9W A;  2VGN A;  3JCM g;  2L3Q A;  4FT2 A;  3RNJ A;  2COY A;  1U5S A;  3CCQ T;  4C8Q E;  2XIC A;  4TVR A;  5GAO l;  4OB1 B;  2HAX A;  3OBY A;  2G6F X;  1Q82 C;  3SFM A;  2MYS A;  1VQ9 T;  1VQ8 A;  4BAC A;  4C8Q D;  4EDU A;  3M0R A;  9ATC B;  3QYH B;  2L3R A;  2RJE A;  4EMK A;  3L2V A;  1IHW A;  1G3W A;  2K2M A;  4FL6 A;  4CC3 A;  2DFU A;  3CPW P;  2EQK A;  5FU7 C;  4D8K A;  1B34 B;  2E70 A;  2JNG A;  5FU6 C;  1NZ9 A;  1WDX A;  2XDD A;  5EC7 A;  1PKS A;  2E6N A;  2QEX T;  1KC8 C;  1YJ9 A;  2V8I A;  1VYU A;  3H0I A;  2PUK B;  4AG1 C;  4PJO B;  4M78 C;  2EKH A;  1G3T A;  2FZG B;  4N0A A;  1MND A;  1ZUY A;  3VS1 A;  3WXM B;  1YI2 T;  2OAU A;  2IVW A;  2ED1 A;  2EGC A;  3KBG A;  1TG0 A;  3QBY A;  2CP3 A;  1Q7Y U;  1TUC A;  2DVE A;  2OTJ Q;  5GAN 8;  3QZ5 B;  3L42 A;  1WXB A;  1K8A U;  5GAN e;  3OYN A;  4IUV A;  4ZGE B;  5J26 A;  3N5B B;  2EAY A;  3MET A;  1M1K C;  4F7U F;  1WYX A;  2RI3 A;  1RUW A;  1J3T A;  3MEW A;  2CP0 A;  2P0P A;  3CCV Q;  2X4J A;  1SKU B;  1UFF A;  3RMQ A;  2YUN A;  2XG8 D;  3JV3 A;  2JUF A;  1K9M C;  1SF9 A;  3CMA Q;  2K3Y A;  1VQ6 Q;  1VQL T;  3X25 B;  1WJS A;  4X9C A;  5FRO A;  3TEE A;  2E12 A;  2KXD A;  4JS5 A;  4Y28 E;  3HHT B;  4PLI A;  5CK9 A;  3CXC S;  1VQ7 A;  4JZ4 A;  3JCM X;  2EJ9 A;  1UB4 A;  2K9G A;  1QP3 A;  4M75 B;  2FRY A;  1MUZ A;  3M0P A;  3R6N A;  2L2P A;  5GAM j;  1PSF A;  4N4H A;  4J9I A;  3A8H B;  4GLK A;  1BI0 A;  1GCQ C;  1BIA A;  1YBY A;  2BZX A;  4KT0 E;  3D7S B;  2MOX A;  4VUB A;  2BKD N;  4CC4 B;  1U8R A;  3RDV A;  4FYY B;  5GAN 7;  3R6O A;  4UC4 A;  1WHK A;  2XI9 A;  2DER A;  1K0X A;  2KRS A;  4M77 B;  2RQU A;  1KK7 A;  3FIF A;  1G5V A;  1K0S A;  1E6G A;  1ACM B;  3QZ9 B;  5CKE A;  4IUT A;  1Q86 C;  2KMT A;  4Z8A A;  1JXM A;  1PG5 B;  4XTY A;  5GAN 5;  2R5A A;  5FWC A;  1Q82 U;  3QII A;  2EQI A;  5GAN f;  3FRN A;  3TRE A;  2MWO A;  3EFO B;  3A8O B;  1GBR A;  2YT6 A;  2E1H A;  2D0N A;  4OF1 A;  3CME Q;  1U06 A;  3OW2 P;  4C5I A;  3JRZ A;  4CRI A;  1BKB A;  1V76 A;  1ZBX A;  4BE1 A;  3I55 T;  2GNC A;  4JUV A;  2KK4 A;  4FT4 A;  4BE2 A;  3I5S A;  4L6V 5;  1QVF S;  4XTX A;  4M77 E;  3LH5 A;  3CCQ Q;  1AEY A;  1V1C A;  2DL7 A;  1X69 A;  1X27 A;  3G71 A;  2DNU A;  1M2O A;  4QQD A;  1EZZ B;  4AT1 B;  1KC8 U;  1VQO A;  1KFZ A;  2QA4 A;  1Y07 A;  4M77 D;  3MHX A;  1VQ9 Q;  5CVI A;  2LP5 A;  2RI5 A;  3EFR A;  4EIK A;  3J81 E;  3JB9 D;  2R57 A;  4BI3 A;  1UJ0 A;  3C95 A;  2WSF E;  1YIJ A;  2L8D A;  1JBM A;  1YIT T;  4OB2 B;  1N8R C;  3RKW A;  4M78 A;  3MEU A;  1NG2 A;  2VUB A;  3SD4 A;  2KR3 A;  4MDW A;  3VV0 A;  1M1K U;  2FPF A;  2ROL A;  1ZBJ A;  4J8O A;  1LOJ A;  1MMN A;  1ZSZ B;  1Z9Z A;  2QEX Q;  2ZPG B;  1HD3 A;  4A4K A;  1M2V A;  2VXE A;  1K9M U;  2D8H A;  2OTL A;  2KRN A;  3RKY A;  3DLL A;  1YWO A;  2RJF A;  4ZGD B;  3OSS C;  2MCN A;  1YI2 Q;  1NE8 A;  5GMK h;  5GAN d;  2A28 A;  2VV5 A;  3A8L B;  5CKF A;  4BDY A;  1AT1 B;  3SWN B;  3MO8 A;  2XDP A;  3OQ5 A;  3CCM A;  3DB4 A;  2KT8 A;  4C0D C;  4A4E A;  4DA4 A;  3CCU T;  4OMQ A;  3CC4 A;  2DIG A;  2E5Q A;  1IRX A;  3QSU A;  2GF7 A;  2E41 A;  2GQV A;  4AG2 C;  3REB B;  4M7D C;  3CQT A;  5IHI A;  2EW3 A;  2CP7 A;  4BDZ A;  5KH6 A;  2X35 A;  1UGS B;  1BI1 A;  2VKN A;  2V8K A;  2V26 A;  4JJC A;  2KDS A;  1JXO A;  5LJ3 d;  4A53 A;  2DTH A;  4J9E A;  1YJN T;  2KEA A;  3TCJ A;  1VQL Q;  3HRT A;  2RM4 A;  2DIQ A;  4MZP A;  5CKD A;  3G4S A;  4FSS A;  1GCQ A;  4N4G A;  4PJN A;  2LT4 A;  3QG1 A;  1NBE B;  2NYS A;  3CXC A;  5KYY A;  1OYX A;  5IHN A;  1N5Z A;  3LWH A;  2CT4 A;  2JW4 A;  4NS5 A;  5J39 A;  2DAQ A;  2CYZ B;  3EH2 A;  1QVF P;  1FX7 A;  4C5G A;  2PU9 B;  1VIF A;  2O2O A;  3ZFJ A;  2YRD A;  4OGC A;  1X01 A;  1I07 A;  3VYG A;  4QVC A;  1I81 A;  2K5F A;  2Y90 A;  5A2Q E;  3JCM J;  5KCH A;  2E3I A;  2GFU A;  1JJ2 S;  2D8J A;  4PFO A;  2FL7 A;  1NPR A;  2A37 A;  4RTZ A;  2DRK A;  2OAW A;  2BIV A;  4RKU E;  2K79 A;  3Q1J A;  4XTU A;  2X9H A;  2M0Y A;  1SG5 A;  1VQK A;  1YHQ T;  1S72 A;  5IT9 E;  1NLO C;  3CCS A;  3E9G A;  1C1A A;  2ATC B;  4J9G A;  1VQ5 T;  2DL4 A;  3I55 Q;  2J06 A;  1SEM A;  4M7A C;  1KD1 C;  4MMK A;  4F7U B;  1VOM A;  1C0M A;  1FMW A;  4D8D A;  5GAO m;  3MP1 A;  3FB9 A;  2AK5 A;  2O31 A;  5GAN h;  4PKC C;  3PVQ A;  2PZ1 A;  2Y4X A;  3SEM A;  3CCE T;  3EG9 A;  1UTI A;  4O6J A;  4C92 C;  5HY6 A;  4E7I A;  5KYN A;  1UEC A;  3NFC A;  3G6E T;  2QDY B;  4DEY A;  1AZE A;  1K73 C;  2J6O A;  4F17 A;  2HL3 A;  2A36 A;  3H0F A;  5LJ3 h;  3OS5 A;  3KXT A;  1SHG A;  4X34 A;  2QGG A;  2YRC A;  3ER0 A;  1YIT Q;  1D0X A;  4LD9 K;  2LCS A;  1QWF A;  4JRK A;  4J9C A;  1D3B A;  4A4H A;  2Y4Y A;  2P84 A;  3V8J A;  2EBP A;  2NUP A;  2LNH B;  3RKX A;  4B9X A;  2DEQ A;  2RHZ A;  3L2U A;  2DBK A;  1R8O B;  4E6R A;  1GFD A;  1X75 C;  3MKD A;  4QKU A;  5FRN A;  1X2Q A;  4LDU A;  4M7D A;  3V8K A;  1VQN A;  4Z02 A;  3GF5 A;  3A98 A;  1YJW T;  4IIO A;  4AFQ C;  1WHH A;  1QLY A;  1QCF A;  5HK3 A;  5LJ3 g;  1G8X A;  1OV3 A;  1I8F A;  3CCU Q;  4E7J A;  1VQ4 T;  2JXB A;  3CC2 T;  4M78 G;  1GXI E;  1U1T A;  5GMK j;  3OSV A;  2GGR A;  2H8H A;  2J6K A;  4JDS A;  4RG8 A;  3CBP A;  2QTX A;  2EYZ A;  1YJN Q;  1Y96 A;  3EG3 A;  2QQS A;  3HRU A;  1T0H A;  1HXD A;  2O9V A;  1MNE A;  3I35 A;  4DOV A;  5GMK i;  3C0C A;  2X51 A;  2MMP A;  1K8A C;  2K3X A;  4RTX A;  5KYW B;  4KGZ B;  3VUZ A;  1QMC A;  4PJO C;  3VS5 A;  1TS9 A;  3CCL T;  3I56 T;  2E64 A;  5FW9 A;  2LX7 A;  4X9D A;  1PCX A;  3WVD B;  3CC7 A;  2D1X A;  2DTI A;  2CP6 A;  2C06 A;  1FWZ A;  1B7T A;  1M27 C;  2CH4 W;  2X3X D;  4LDW A;  3GNF B;  2JS2 A;  4AFU C;  3GLX A;  2LMJ A;  2O01 E;  3OYL A;  2CP5 A;  5LJ5 g;  5C0M A;  2Z0W A;  3EHQ A;  2L3P A;  1NLP C;  2RF0 A;  1JJ2 A;  1WA7 A;  4D6W A;  1VUB A;  4PJM A;  2AZS A;  1Y7X A;  4JLG A;  3ZL7 C;  2VYT A;  3OYE A;  3WVE B;  3VS4 A;  5KYX A;  3MEV A;  5I21 A;  4XTV A;  3A8G B;  1I1J A;  3QWY A;  1XTD A;  2JM8 A;  2AT1 B;  1UJY A;  2EIF A;  2GCX A;  2RQW A;  4F14 A;  3RMS A;  1AWW A;  3OYI A;  4ME7 A;  3REA B;  1YHQ Q;  1PD0 A;  3LWI A;  2ZZD A;  1K73 U;  1XJW B;  4M75 C;  2D9T A;  3PE0 A;  3NGP A;  1VQ5 Q;  5D7U A;  4C8Q A;  3BE3 A;  4C92 A;  2JM9 A;  2PUO B;  3EGX B;  4IUP A;  1W2B S;  1OU9 A;  3VRZ A;  2YUP A;  2CRE A;  3J80 E;  2E3H A;  4JJN K;  3LGF A;  5IAY A;  1E6H A;  4R56 A;  4QVZ A;  2RMO A;  2NUZ A;  3S3N A;  4M77 C;  3CCE Q;  2VWF A;  4KRT A;  2LJ0 A;  2QQB A;  2QGF B;  3G6E Q;  1W4S A;  3QJY A;  4AMC A;  1Q7Y R;  2VAS A;  2RO0 A;  1N27 A;  5GAN 6;  8AT1 B;  2PNI A;  1N9R A;  2B86 A;  1M9S A;  2DIL A;  4IUR A;  4LDV A;  3UWN A;  2KXC A;  5M9O A;  1G2B A;  1O75 A;  1U1S A;  3CBM A;  2DMO A;  3E19 A;  1BBZ A;  4E2F B;  1K76 A;  2VXF A;  1PKT A;  1R77 A;  4KUI A;  4JPB W;  1RAH B;  5LJ3 j;  4B6M A;  2CS7 A;  1AVZ C;  2HCK A;  2EQJ A;  5GAO r;  2RQR A;  1VQP T;  3VKI A;  2PTK A;  2F2W A;  4PJJ A;  3RES A;  4OML A;  4KUD K;  2KNB B;  3V7R A;  3VJP A;  1YJW Q;  2RK2 A;  1B34 A;  3L2W A;  2LQW A;  2HQE A;  2DPP B;  2ZPH B;  3EG2 A;  3H8Z A;  1WHM A;  4KBM B;  4QW2 A;  5AYF A;  2AIR B;  3GIB A;  2A08 A;  4BY6 C;  1VQ4 Q;  3CC2 Q;  3GPL A;  2DM1 A;  2F2V A;  4OMM A;  4HCK A;  4PJL A;  4OP0 A;  4PJO A;  4LN2 A;  1M8M A;  5FLX E;  1VQM T;  1QCO A;  2EGA A;  3CD6 Q;  3CCJ A;  2YXY A;  2CT3 A;  4KH1 B;  2JZ2 A;  1HK9 A;  1ZX6 A;  2HKN A;  3FLG A;  1CSK A;  5FRM A;  5KE2 A;  3LH0 A;  5ECA A;  2MI6 A;  2AKK A;  1HJD A;  5LJ5 j;  5CKH A;  1X2K A;  1Q82 R;  1KQS S;  2HBP A;  2ZPI B;  3CCL Q;  3I56 Q;  4C0G A;  5GAN 4;  4ZTF A;  2DO3 A;  2ECZ A;  5KCO A;  2J7I A;  2H3J A;  5D6X A;  3SWN C;  1RL2 A;  1QVG S;  2HDA A;  2W0Z A;  4J7I A;  2CSI A;  3IQL A;  2RPN A;  1HSQ A;  2DTO A;  4RG2 A;  3OYH A;  1ABQ A;  3ZBD A;  2ROT A;  3OMG A;  4DBH A;  2IG0 A;  2LQ8 A;  3OS1 A;  3OA6 A;  2KAF A;  3L2Q A;  5DLO A;  1KQ2 A;  3PNW C;  3PT9 A;  1KC8 R;  4M75 A;  3CCR A;  3M53 A;  4V2S A;  3M0S A;  3ME9 A;  2FPE A;  1MMA A;  2K3B A;  4BUG A;  4ELZ C;  2EQM A;  2BZY A;  1UHF A;  1EIF A;  2XU8 A;  3M0T A;  5HCK A;  2X4Y A;  4RCC A;  1I4K 1;  1U3O A;  5GAM e;  5D6Y A;  4M77 A;  4RTY A;  2LJ3 A;  1W2B A;  3BFM A;  2QQ9 A;  1M1K R;  1MMD A;  2HZY A;  2FVU A;  4DBF A;  2DL5 A;  1AZG B;  1K9M R;  4J9D A;  2AKL A;  3JB9 J;  3QO3 A;  3EFO A;  2PVO B;  1I5O B;  5CCA A;  5I2S A;  4XAX B;  2M16 A;  5GMK l;  3L2R A;  3M59 A;  3KFV A;  1VQ8 T;  2LNV A;  1RAD B;  3JCM e;  3KUF A;  4M7A G;  2DXC A;  5KYU B;  5J3B A;  4M7A F;  2FG0 A;  2QI2 A;  3L2Z A;  2VC8 A;  1UUE A;  4HCB A;  2A3L A;  2KYM A;  1AWO A;  2W10 A;  2X4X A;  2RA2 A;  4C92 G;  1ZSG A;  3GNG A;  2E65 A;  3CXC P;  5CQY A;  1AWJ A;  1JQQ A;  1RAF B;  4XU3 A;  2LCC A;  1M3B A;  1M30 A;  2JTM A;  1WJR A;  5CKB A;  4OMN A;  1WZO A;  1YJ9 T;  5CAI A;  2OTJ A;  1WXT A;  3HKS A;  2BUD A;  2LZ6 B;  1VQP Q;  4M78 D;  4DBQ A;  3P8B B;  3X20 B;  1Q86 R;  2A7Y A;  3HL8 A;  2DET A;  2DD5 A;  4OB0 B;  1QVP A;  2DYB A;  1G3S A;  1VYT A;  3BDL A;  2V8J A;  2PVG B;  4DBR A;  3CCV A;  2CZ0 B;  1DJ7 B;  3JCM P;  4E7S A;  3HFN A;  3S6W A;  2ENM A;  3CMA A;  1VQ6 A;  1YCS B;  1ZSZ A;  2E10 A;  2ZPE B;  3HRS A;  4ANJ A;  4XK8 E;  4E7K A;  2FRW A;  2G3R A;  1YWP A;  1IGQ A;  1W1F A;  1Q81 C;  1VQM Q;  3OYK A;  1QWE A;  2KI7 A;  5HK0 A;  1NJI C;  3MPU B;  2QK0 A;  3BW1 A;  4PK4 A;  1OZ2 A;  2LVM A;  1QKX A;  2BZ8 A;  2K2V A;  1H92 A;  3SWN A;  1OI1 A;  2LTO A;  1OU8 A;  4X1V A;  1KQS A;  2DKG A;  1VIE A;  1VQ7 T;  2WSC E;  1YNZ A;  4AFS C;  2D6F A;  1LJO A;  4MZM A;  1EX4 A;  1QVG A;  1XOV A;  3UT1 A;  4XU2 A;  2M51 A;  3C94 A;  1N8R R;  4L5G A;  4FYX B;  3M57 A;  2KBT A;  5CIU A;  1M3C A;  4FW1 A;  4PJO G;  2YSQ A;  2RHX A;  1UG1 A;  2CZ1 B;  4XQ3 A;  4EMG A;  3THK A;  1WFW A;  5A0L A;  1M90 C;  3INZ A;  4R55 A;  2OJ2 A;  1UHC A;  3PIO A;  2QAZ A;  1HYO A;  2HKQ B;  1D1C A;  3CME A;  4LDY A;  1QW1 A;  4IKF A;  1WX6 A;  3RR6 A;  2B8A A;  4PNO A;  3RBB B;  4NL2 A;  3JCM V;  2YLC A;  2ED0 A;  3CCQ A;  2XHC A;  3V7C A;  1BI2 A;  3H0H A;  1TSF A;  1BU1 A;  4QVD A;  3OYA A;  3OYD A;  2EGE A;  2NUT B;  1RI0 A;  1D09 B;  3RER A;  2KSS A;  3M54 A;  2P0Q A;  4C8Q C;  1VQ9 A;  3NHN A;  2R58 A;  4RMO A;  2C0O A;  2O4X B;  3MCA B;  2A0F B;  1M8V A;  4IUQ A;  3G71 T;  2MWP A;  4OGE A;  4FSX A;  1MV3 A;  4M75 G;  2K5I A;  1VQO T;  4LUD A;  2YHT A;  1B3Q A;  2DX1 A;  2QA4 T;  1M1F A;  4LUE A;  4IUU A;  2LQK A;  1VQ8 Q;  1JB0 E;  2JN0 A;  5A0D A;  2KYB A;  4OMO A;  1D0Z A;  3JSC A;  3M9Q A;  3DLM A;  8ATC B;  3T9N A;  4Z89 A;  4JJB A;  3O8V A;  4GLM A;  1YIJ T;  4F7U A;  3NTK A;  1PD1 A;  4GBQ A;  1YN8 A;  1OPK A;  2F1L A;  5IH2 A;  4ZGJ B;  2QEX A;  5GAN g;  4AFZ C;  3OYC A;  3EFS A;  3PGG A;  3VU3 C;  1KHC A;  1D1B A;  4HCC A;  2GTO A;  4ZTJ A;  2MF2 A;  2RNA A;  4IIM A;  2H3E B;  4HVV A;  1YI2 A;  2COZ A;  2DE0 X;  4WTO B;  2EPD A;  1ZUU A;  1YJ9 Q;  1Q81 U;  3M55 A;  5IHK A;  2OTL T;  4DEX A;  1NJI U;  3NMZ C;  3M0Q A;  2XMF A;  3PMI A;  2OTJ T;  2DEU A;  2X3W D;  3FDR A;  2M9U A;  1K1Z A;  2CP2 A;  4M78 F;  5DLQ E;  3CCM T;  2YWW A;  3EGD B;  1RAA B;  2V1Q A;  4C5E A;  3CC4 T;  3GOX A;  1JJ2 P;  2EYQ A;  2WAC A;  1VQL A;  4OB3 B;  2OX7 A;  3ULR B;  1R0B G;  4M7D D;  3S3O A;  5DM7 R;  2EJG A;  3CPW S;  3UA6 A;  1Y57 A;  1FMK A;  4P5N A;  1BIB A;  1KD1 R;  1MV0 B;  3GBQ A;  1KQ1 A;  1WPY A;  1LPL A;  3TQ7 P;  1TU0 B;  4A4F A;  1VA7 A;  3G4S T;  1XQH A;  1M90 U;  2CUB A;  4Y92 A;  2LJ1 A;  3FJ5 A;  3DKM A;  4K11 A;  4HT9 A;  4BE0 A;  3EHR A;  2IPO B;  3JB9 I;  1VQ7 Q;  3LX7 A;  3O5Z A;  3A8M B;  1X6O A;  4BI4 A;  1NM7 A;  4A4G A;  2OI3 A;  2LT1 A;  3OBW A;  1BK2 A;  4BI8 B;  1K73 R;  1PNJ A;  4M7A B;  2EQU A;  4JRP A;  1FYN A;  3MJX A;  2RD1 A;  1N9S A;  3SDZ A;  2JS0 A;  5GMK e;  5CO7 A;  3OS2 A;  5KYW A;  1WLP B;  1W6X A;  4J5Y A;  2K4Y A;  4E47 A;  3M4Y A;  2DJQ A;  2LRQ A;  2HL5 C;  1ZA1 B;  3OMC A;  2BE7 D;  2ZCF B;  2XD0 A;  1TTH B;  2YUO A;  2VVK A;  1PRM C;  4HT8 A;  1BYM A;  2CGH A;  3I55 A;  2FEI A;  4O5V A;  4EMK B;  4M7A E;  3M56 A;  1VQK T;  3JCM c;  1PWT A;  1S72 T;  1NPP A;  3LYI A;  2RJD A;  3OYB A;  2EVR A;  3CCS T;  2P4T A;  4ELY C;  4FIB A;  2YUQ A;  2KRO A;  4C92 E;  4M7A D;  1AOJ A;  3FJP A;  1NYF A;  3RIR A;  1XNI A;  2VB6 A;  2EYY A;  4DQ2 A;  1OX9 A;  5GAN j;  1PM3 A;  3G71 Q;  2JMA A;  5GMK m;  1N6A A;  1VQO Q;  1O9S A;  2QA4 Q;  4C92 D;  1K8A R;  1YIT A;  1UGV A;  7AT1 B;  1X6B A;  2KY9 A;  3OY9 A;  1OZ3 A;  4ESR A;  1YCY A;  1SSF A;  1GFC A;  3CPF A;  1JU5 C;  5CQX A;  3EGX A;  3VS6 A;  2CH4 A;  2BE9 B;  5GJV B;  3CEY A;  1YIJ Q;  2L3S A;  5L23 A;  4JRI A;  1YFN A;  1F1B B;  3E9F A;  3OW2 S;  3U23 A;  2ESW A;  3PTA A;  2HMA A;  2ZPF B;  5GAN 2;  4CC2 A;  1QQJ A;  4BB7 A;  1S1N A;  1WHG A;  2OTL Q;  4C0Z A;  1RAG B;  3CCU A;  1UGR B;  3QPH A;  1KG1 A;  1VQN T;  1WXU A;  4F04 B;  4J6Y A;  1RLQ C;  2JT4 A;  4GY5 A;  4R0K A;  2DXT A;  2MPX C;  3UA7 A;  3QDF A;  3HTR A;  1VYV A;  1NEG A;  2HNI A;  3VS3 A;  1BB9 A;  2VGM A;  3VS0 A;  2WSE E;  3CCM Q;  4BD3 A;  3CBO A;  4F7U G;  1YJN A;  3CC4 Q;  2DJZ A;  1C6V X;  2F69 A;  4CI0 C;  3FC3 A;  2JVV A;  3BY7 A;  5I11 A;  3CPW A;  2EWN A;  4J6X A;  1D0Y A;  2QQR A;  2LCL A;  4CC7 A;  1RAI B;  3P8D A;  4J9H A;  4XTW A;  1ZSZ C;  1CKB A;  4J6W A;  3X24 B;  4PJO E;  3HP9 A;  4A54 A;  3VUB A;  3URG A;  4M7D G;  2J05 A;  4HCZ A;  4M7D F;  5LJ3 e; 
#chains in the Genus database with same CATH homology
 3NFC A;  3OB9 A;  3S3M A;  3G6E T;  3P8B B;  2QDY B;  3X20 B;  2LC4 A;  2A7Y A;  5DY9 A;  3HL8 A;  1UGP B;  2DD5 A;  4OB0 B;  1QVP A;  3P8H A;  1G3S A;  2EJF A;  3MP6 A;  3UPU A;  3BDL A;  4LD6 A;  4DOW A;  3OYY A;  1K73 C;  3M58 A;  4ATO A;  2V8J A;  4L59 A;  2PVG B;  4PJO D;  3QKJ A;  4MML A;  4JLI A;  5LJ3 h;  3CME T;  2CZ0 B;  3CCV A;  1IZ6 A;  1DJ7 B;  3OS5 A;  4M7A A;  2XKO C;  3KXT A;  4X34 A;  4MZT A;  4XTZ A;  3ER0 A;  4B9W A;  3CC7 T;  3JCM P;  3HFN A;  4LD9 K;  3S6W A;  4NOY A;  2VGN A;  3CMA A;  1VQ6 A;  3JCM g;  4JRK A;  4FT2 A;  3QDR B;  2DXB A;  1D3B A;  3MEA A;  4A4H A;  3CCQ T;  4C8Q E;  2E10 A;  2Y4Y A;  2ZPE B;  3V8J A;  2XIC A;  3HRS A;  4TVR A;  4XK8 E;  4E7K A;  5GAO l;  2G3R A;  3RKX A;  4B9X A;  2DEQ A;  1LNX A;  2RHZ A;  4OB1 B;  3L2U A;  2HAX A;  1Q81 C;  1R8O B;  3OBY A;  3OYK A;  1G3Y A;  2DK3 A;  1MGQ A;  5HK0 A;  1NJI C;  1X75 C;  3BW1 A;  3JCM Q;  1Q82 C;  5FRN A;  3SFM A;  1OZ2 A;  2EKO A;  4LDU A;  1VQ9 T;  2LVM A;  4BAC A;  4C8Q D;  1VQ8 A;  2K2V A;  3V8K A;  4M7D A;  4EDU A;  1VQN A;  3SWN A;  1OI1 A;  3GF5 A;  4Z02 A;  2LTO A;  3QYH B;  2L3R A;  2RJE A;  5FU7 B;  1YHQ A;  3QHS A;  1YJW T;  4EMK A;  1KQS A;  3L2V A;  1H3Z A;  4M75 E;  2DKG A;  1G3W A;  1VIE A;  1VQ7 T;  5FU6 B;  2WSC E;  4FL6 A;  4ZN3 A;  5HK3 A;  5LJ3 g;  1LJO A;  2D6F A;  1VQ5 A;  4MZM A;  2EQK A;  4HA8 A;  4II1 A;  5FU7 C;  1I8F A;  2QQA A;  1UGQ B;  4E7J A;  1VQ4 T;  5LJ5 e;  1B34 B;  2E70 A;  2M1H A;  2JNG A;  1H64 1;  4WF2 A;  1QVG A;  4M78 G;  3CC2 T;  5FU6 C;  1NZ9 A;  1U1T A;  1GXI E;  1XOV A;  2HD0 A;  3UT1 A;  5GMK j;  4XU2 A;  3C94 A;  3OSV A;  3ASK A;  5IN1 A;  3BDU A;  4M75 D;  4L5G A;  4M78 B;  3M57 A;  2XDD A;  4JDS A;  5CIU A;  4RG8 A;  3CBP A;  2QTX A;  2DD4 A;  4PJO G;  2E6N A;  2QEX T;  2I2L A;  2RHX A;  1KC8 C;  1YJ9 A;  2V8I A;  1Y96 A;  3HRU A;  2CZ1 B;  2QQS A;  4XQ3 A;  3CCE A;  1HXD A;  4EMG A;  5KE3 A;  4DOV A;  5GMK i;  2PUK B;  2X4W A;  4PJO B;  4M78 C;  2GFA A;  5A0L A;  5LJ3 f;  2LX9 A;  2MMP A;  4PLL A;  3G6E A;  1G3T A;  2F5K A;  1K8A C;  4N0A A;  3WXM B;  1M90 C;  2CZ6 B;  2K3X A;  1YI2 T;  2OAU A;  2IVW A;  3INZ A;  2M0O A;  3VUZ A;  4R55 A;  3KBG A;  3PIO A;  1BI3 A;  3QBY A;  4PJO C;  1Q7Y U;  2DVE A;  3F70 A;  2XID A;  2PQW A;  3CME A;  5GAN 8;  3QZ5 B;  4LDY A;  3L42 A;  3I56 T;  1QW1 A;  3CCL T;  2E64 A;  4IKF A;  3CC7 A;  4X9D A;  3WVD B;  1K8A U;  2B8A A;  4PNO A;  2AHJ B;  5GAN e;  3OYN A;  4IUV A;  2DTI A;  5D6W A;  4BY6 B;  4ZGE B;  5J26 A;  3N5B B;  4NL2 A;  2C06 A;  2EAY A;  2ZPB B;  3JCM V;  2YLC A;  1FWZ A;  3MET A;  1M1K C;  4C8Q G;  3LGL A;  4F7U F;  3CCQ A;  3J7A F;  2RI3 A;  4M78 E;  3MEW A;  2XHC A;  3V7C A;  2RHU A;  2P0P A;  4C92 F;  4C8Q F;  2JTF A;  2X4J A;  1BI2 A;  4QVD A;  2HQX A;  3GNF B;  3PFS A;  4LDW A;  3RMQ A;  2XG8 D;  3OYA A;  3OYD A;  1WGS A;  2K5L A;  3GLX A;  4JRQ A;  2YLB A;  2O01 E;  2JUF A;  3MP8 A;  1K9M C;  3OYL A;  2K3Y A;  2F5T X;  5C0M A;  5LJ5 g;  3OW2 A;  4E7I A;  3JCM W;  1VQL T;  1JRI A;  1RI0 A;  3RER A;  2KSS A;  3M54 A;  3X25 B;  1WJS A;  2RHY A;  2P0Q A;  4C8Q C;  1JJ2 A;  4D6W A;  1VQ9 A;  1VUB A;  3JB9 H;  2R58 A;  4RMO A;  1Y7X A;  4JLG A;  2O4X B;  4X9C A;  3TEE A;  5FRO A;  2E12 A;  2VYT A;  3LW5 E;  3MCA B;  3OYE A;  4JS5 A;  3WVE B;  3OYJ A;  1M8V A;  4IUQ A;  3PIP A;  3G71 T;  4Y28 E;  2MWP A;  3MEV A;  2K57 A;  4OGE A;  5I21 A;  2L5Q A;  1YJW A;  4FSX A;  3HHT B;  3A8G B;  4M75 G;  4XTV A;  4PLI A;  5CK9 A;  4Y91 A;  2K5I A;  3CXC S;  1XTD A;  1VQO T;  1VQ7 A;  1ZQ1 A;  3JCM X;  2EIF A;  1UB4 A;  2EJ9 A;  2GCX A;  2YHT A;  3H6Z A;  1QP3 A;  1M1F A;  2QA4 T;  2D0Q B;  4M75 B;  5GAN 3;  3RMS A;  2RH2 A;  2YRV A;  3HSB A;  4IUU A;  2LQK A;  5CR2 A;  1JB0 E;  5GAM f;  5GAM j;  1VQ4 A;  3OYI A;  2JN0 A;  1AHJ B;  1PSF A;  4N4H A;  4ME7 A;  5LJ5 f;  3A8H B;  5A0D A;  4GLK A;  3CC2 A;  1BI0 A;  3FEO A;  3JSC A;  3M9Q A;  4PL6 A;  3DLM A;  3LWI A;  2ZZD A;  1BIA A;  1K73 U;  3T9N A;  4M75 C;  2D9T A;  5GAO q;  3M4G A;  3O8V A;  1M4Z A;  1YBY A;  4XU1 A;  1YIJ T;  4F7U A;  4KT0 E;  3NTK A;  3HPW A;  4C8Q A;  4C92 A;  4ZGJ B;  4VUB A;  2QEX A;  2BKD N;  2PUO B;  2ZGW A;  5GAN g;  5GAN 7;  1U8R A;  3R6O A;  4UC4 A;  3CD6 A;  3OYC A;  3EFS A;  4IUP A;  3OYF A;  3PGG A;  3VU3 C;  4Q5W A;  2XI9 A;  1W2B S;  1KHC A;  3JAM E;  4HCC A;  3J80 E;  4ZTJ A;  3QYG B;  4M77 B;  2MF2 A;  3FIF A;  1G5V A;  4JJN K;  3LGF A;  5IAY A;  3QZ9 B;  5CKE A;  1YI2 A;  4IUT A;  1Q86 C;  4R56 A;  2KMT A;  4QVZ A;  2P0K A;  3JCM f;  1Q81 U;  3S3N A;  4KUL A;  4HKE A;  4M77 C;  2FHD A;  3CCJ T;  4XTY A;  5GAN 5;  3M55 A;  2OTL T;  2R5A A;  1NJI U;  3CCL A;  3I56 A;  2QQB A;  1Q82 U;  2CZ7 B;  3QII A;  4E7L A;  1W4S A;  3QJY A;  3FRN A;  5GAN f;  3TRE A;  2MWO A;  5LL6 S;  1Q86 U;  2RO0 A;  1N27 A;  5GAN 6;  3A8O B;  3PMI A;  2OTJ T;  2RK1 A;  3FDR A;  2E1H A;  1N9R A;  1M9S A;  2M9U A;  4OF1 A;  3C4S A;  4IUR A;  3QUI A;  4LDV A;  4M78 F;  4C5I A;  3UWN A;  3JRZ A;  1MHN A;  2RJC A;  5DLQ E;  4CRI A;  3CCM T;  1BKB A;  1ZBX A;  4BE1 A;  3I55 T;  4JUV A;  1M5Q 1;  4C5E A;  1IRE B;  5M9O A;  2KK4 A;  3GOX A;  4FT4 A;  3CC4 T;  4BE2 A;  1O75 A;  2EYQ A;  2WAC A;  1VQL A;  4L6V 5;  3SB2 A;  3NTI A;  1U1S A;  4OB3 B;  3CBM A;  4XTX A;  3GP8 A;  1QVF S;  4M77 E;  3E19 A;  4PJO F;  4M7D D;  2VXF A;  3L1A A;  1FXX A;  3S3O A;  3A5Z B;  4KUI A;  5DM7 R;  4MDX A;  5GAO p;  4OMF B;  2EJG A;  3CPW S;  5LJ3 j;  5L8R E;  2CS7 A;  2EQJ A;  3G71 A;  5GAO r;  2RB6 A;  4P5N A;  1BIB A;  4QQD A;  1KQ1 A;  1KC8 U;  1WPY A;  1VQO A;  1VQP T;  1PSE A;  3VKI A;  2QA4 A;  2CKK A;  1Y07 A;  4M77 D;  3RES A;  4KUD K;  3MHX A;  3V7R A;  5CVI A;  1KHI A;  4A4F A;  3G4S T;  1XQH A;  3VJP A;  5HKC A;  1M90 U;  2RI5 A;  3CCR T;  4LDX A;  2MAM A;  3EFR A;  5GAM d;  3DKM A;  3OYG A;  3J81 E;  2RK2 A;  5LJ5 d;  1B34 A;  4HT9 A;  3L2W A;  4BE0 A;  2HQE A;  3JB9 D;  2R57 A;  3JB9 I;  2DPP B;  2ZPH B;  3H8Z A;  4BI3 A;  3LX7 A;  3C95 A;  2WSF E;  4KBM B;  2L8D A;  4QW2 A;  1YIJ A;  5AYF A;  1JBM A;  1X6O A;  3A8M B;  4OB2 B;  4BI4 A;  1YIT T;  1N8R C;  3RKW A;  4A4G A;  3GIB A;  4M78 A;  4BY6 C;  2LT1 A;  3OBW A;  3MEU A;  4BI8 B;  2PVD B;  2VUB A;  4M7A B;  3HFO A;  3GPL A;  1WJQ A;  3SD4 A;  2EQU A;  4JRP A;  4MDW A;  3VV0 A;  1M1K U;  4J83 A;  4OP0 A;  1N8R U;  5I2M A;  1M1G A;  2RD1 A;  1QVF A;  4PJO A;  4QQ6 A;  4J8O A;  1N9S A;  5EG2 A;  3SDZ A;  3X28 B;  5FLX E;  3M5A A;  1LOJ A;  1VQM T;  3DB3 A;  1D3B B;  4C0F A;  2ZPG B;  5GMK e;  4A4K A;  5CO7 A;  1K9M U;  2VXE A;  3CCJ A;  3OS2 A;  2OTL A;  1V29 B;  2FB7 A;  3JCM d;  2JZ2 A;  1HK9 A;  3RKY A;  4J5Y A;  4M75 F;  3DLL A;  2K4Y A;  4E47 A;  3X26 B;  3FLG A;  5FRM A;  3M4Y A;  5KE2 A;  2LRQ A;  2RJF A;  4ZGD B;  3OSS C;  3OMC A;  3LH0 A;  1NE8 A;  2ZCF B;  4C0D B;  4JS4 A;  2XD0 A;  5GMK h;  2MI6 A;  5GAN d;  5LJ5 j;  2VV5 A;  5CKH A;  4HT8 A;  1BYM A;  3A8L B;  4M7D B;  5CKF A;  4BDY A;  2HBP A;  1KQS S;  4XU0 A;  2DXU A;  2ZPI B;  3MO8 A;  3SWN B;  2XDP A;  3OQ5 A;  4C0G A;  2CGH A;  1WQW A;  3DB4 A;  4ZN1 A;  5GAN 4;  3I55 A;  4C0D C;  3CCM A;  4O5V A;  4A4E A;  2DO3 A;  4EMK B;  3CCU T;  4DA4 A;  3CC4 A;  2DIG A;  2E5Q A;  4M7A E;  2E6Z A;  2GF7 A;  3QSU A;  2DZ9 A;  3M56 A;  3UDC A;  4RCB A;  2E41 A;  5KCO A;  4FU6 A;  2GQV A;  2NLU A;  4M77 G;  3JCM c;  1VQK T;  4M7D C;  1S72 T;  2H3J A;  5D6X A;  3SWN C;  1NPP A;  4M77 F;  1RL2 A;  2RI2 A;  3LYI A;  1UEB A;  1QVG S;  4BDZ A;  4OVA A;  5KH6 A;  2RJD A;  4EMK C;  3OYB A;  2X35 A;  1UGS B;  1BI1 A;  4J7I A;  3CCS T;  2V8K A;  4NL3 A;  2KDS A;  5A0G A;  2DTO A;  4RG2 A;  5LJ3 d;  4A53 A;  3OYH A;  2DTH A;  4F7U E;  2KVQ G;  3JB9 G;  1YJN T;  2O4X A;  3ZBD A;  2P4T A;  2FYK A;  4ELY C;  3OS0 A;  4FIB A;  3OMG A;  3TCJ A;  3JB9 F;  4C92 E;  3HRT A;  2IG0 A;  2RM4 A;  2LQ8 A;  3OS1 A;  2DIQ A;  3OA6 A;  1VQP A;  3AHU A;  4M7A D;  2KAF A;  3L2Q A;  5DLO A;  3FJP A;  1KQ2 A;  3RIR A;  1XNI A;  4MZP A;  5CKD A;  3G4S A;  3PNW C;  3VYH B;  4N4G A;  1Y96 B;  3PT9 A;  4M75 A;  2LT4 A;  3M53 A;  3V8L A;  4DQ2 A;  3CCR A;  3QG1 A;  4V2S A;  3CXC A;  5GAN j;  3NTH A;  3ME9 A;  1OYX A;  5GMK m;  3JCM b;  4M7D E;  1N6A A;  4BUG A;  4ELZ C;  1O9S A;  3RUX A;  4C92 D;  1TH7 A;  1YIT A;  3LWH A;  2EQM A;  4NS5 A;  3V7S A;  2R5M A;  5J39 A;  1EIF A;  4E7H A;  2DAQ A;  2XU8 A;  2KY9 A;  3OY9 A;  1OZ3 A;  2CYZ B;  2EFI A;  1YCY A;  2QXF A;  2RHI A;  1SSF A;  1FX7 A;  2X4Y A;  4N0A C;  3CPF A;  4C5G A;  2PU9 B;  3EAE A;  1VIF A;  5CQX A;  4RCC A;  2KQW A;  1I4K 1;  3CCV T;  5GAM e;  3CEY A;  4N4I A;  5D6Y A;  4M77 A;  4FM4 B;  4C5H A;  3ZFJ A;  1VQM A;  1W2B A;  4OGC A;  1X01 A;  3BFM A;  3CMA T;  2QQ9 A;  1VQ6 T;  1ZHI A;  2FVU A;  3VYG A;  2JOY A;  4JRI A;  4QVC A;  3E9F A;  3OW2 S;  1I81 A;  3PTA A;  2ZPF B;  2K5F A;  2Y90 A;  1I5L A;  5GAN 2;  5GAM h;  5A2Q E;  3JCM J;  5LJ5 h;  5KCH A;  2GFU A;  1JJ2 S;  3CD6 T;  3JB9 J;  4BB7 A;  1Q7Y C;  1QP2 A;  1WQ7 A;  2FL7 A;  1NPR A;  3QO3 A;  4EMH A;  2PVO B;  5CCA A;  3E1S A;  2XDB A;  1P92 A;  5I2S A;  4XAX B;  2M16 A;  5GMK l;  3L2R A;  1WNL A;  2BIV A;  3M59 A;  4RKU E;  4EPC A;  5GAO n;  4J7F A;  4C0Z A;  1VQ8 T;  3Q1J A;  3CCU A;  1UGR B;  2LNV A;  4XTU A;  3QPH A;  1KG1 A;  1VQN T;  3JCM e;  3KUF A;  4M7A G;  2DXC A;  4J6Y A;  1VQK A;  1YHQ T;  5J3B A;  4GY5 A;  4M7A F;  2DXT A;  2QI2 A;  1S72 A;  3L2Z A;  3G7Z A;  2VC8 A;  4ZTF A;  1Y71 A;  5IT9 E;  3C12 A;  4HCB A;  2A3L A;  2HNI A;  3CCS A;  2L89 A;  2VGM A;  5C6S A;  3E9G A;  2WSE E;  1VQ5 T;  2X4X A;  4BD3 A;  3JCM h;  3CBO A;  4F7U G;  1YJN A;  4YTL A;  2LDM A;  3ZEH A;  2RA2 A;  2DJZ A;  4M7A C;  2F69 A;  4C92 G;  3OYM A;  4CI0 C;  3FC3 A;  1KD1 C;  2JVV A;  3BY7 A;  4MMK A;  3CPW A;  3GNG A;  2EWN A;  2E65 A;  2QQR A;  3PMT A;  2LCL A;  4J6X A;  4F7U B;  5GAO m;  3MP1 A;  3QJ6 A;  5CQY A;  3LLR A;  4C8Q B;  3FB9 A;  4C92 B;  5GAN h;  4PKC C;  4XU3 A;  5GAM g;  2LCC A;  3P8D A;  4XTW A;  2JTM A;  1WJR A;  2DZC A;  2XK0 A;  4J6W A;  4QQG A;  5CKB A;  3X24 B;  3HP9 A;  4PJO E;  4A54 A;  2Y4X A;  1YJ9 T;  3VUB A;  3URG A;  5CAI A;  3TU4 K;  3HKS A;  1KD1 U;  2BUD A;  3CCE T;  4M7D G;  3QXE B;  2OTJ A;  4HCZ A;  4O6J A;  4C92 C;  4M7D F;  5LJ3 e;  5HY6 A;  4M78 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...