4OF1A

Crystal structure of toxin from staphylococcus aureus mu50
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
115
structure length
115
Chain Sequence
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIRTLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mRNA interferase MazF
publication title Structural Insights into the toxin from Staphylococcus aureus Mu50
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Toxin
total genus 33
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4of1A00
1NE8A 1UB4A 5CQXA 5HKCA 2C06A 4ELYC 4MZMA 3JSCA 3G7ZA 5CO7A 4VUBA 5HK0A 5DLOA 1VUBA 5CR2A 2KMTA 3NFCA 4OF1A 5CKDA 2MF2A 4ME7A 5CKEA 2VUBA 5CK9A 5HK3A 1M1FA 3JRZA 4MZPA 4ELZC 5CCAA 5CKHA 4HKEA 4MDXA 5CQYA 3VUBA 4MZTA 1X75C 3TCJA 3HPWA 5CKFA 5CKBA
chains in the Genus database with same CATH superfamily
1AD5A 1MGQA 2PTKA 2RH2A 1YJWA 1FWZA 3GLXA 4IUTA 4KRTA 3S6WA 2PVOB 1A0NB 1MMDA 3C0CA 2HSPA 3WXMB 1T0HA 2CZ6B 4HCZA 1NEGA 1AWJA 1E7OA 4LDWA 5KYYA 2P84A 3OYCA 2E70A 1AT1B 4WCIA 2C06A 2OTJQ 2WSFE 1C0MA 5HK0A 2HD0A 2E5KA 1YITQ 1YWPA 1LOJA 1I07A 3PVLA 2E3IA 3FEOA 2EVRA 1H3ZA 4M75G 1B7TA 2FB7A 2L8DA 3EG3A 2JUFA 4RKUE 1QMCA 1ZUUA 4NOYA 3IQLA 1FXXA 4FL6A 1EX4A 1WQ7A 2BE7D 1OQKA 1H8KA 3VU3C 4Z8AA 2FO0A 4RG2A 1IXDA 4PJJA 1K73R 1IGUA 2QQRA 3CMET 2O4XA 3BDUA 2GGRA 3GPLA 2QEXA 2PVDB 3OYDA 1G3SA 1W2BA 1VIFA 1PNJA 3A8HB 3MP1A 7AT1B 2KT1A 4RTXA 4JUVA 3EFRA 2CGHA 1GBRA 1N6AA 3GIBA 4RTZA 3RKWA 2MF2A 3OYHA 3J81E 1BCMA 2EQIA 1VQMT 2OTLT 2ROLA 3VKIA 4TVRA 5GAMd 3RMSA 4FSXA 1BB9A 2DRMA 3GNGA 3NMZC 4JJCA 4QT7A 4LDVA 1W1FA 4DQ2A 4PJOB 4F17A 3CPFA 1R77A 2YRVA 3RKYA 4JS5A 3HFNA 1YIJQ 5LL6S 3JCMf 4O6JA 1K8AR 3EFOB 4KGZB 1FYNA 2EBPA 4GLMA 4JJDA 1N5ZA 4C92G 5GAMg 2AKKA 2EAYA 4Z02A 1M2OA 1S72A 1WJQA 1NJIR 2CYZB 4M77B 4E2FB 1MNEA 4AFSC 1V29B 2GFAA 3OS5A 4KUIA 1K4US 3MKDA 2JTEA 3A98A 3QWXX 2AK5A 4KGVB 4ELYC 3JSCA 1M9SA 2MMPA 2KI7A 3OB9A 1NYGA 1D0YA 2DXTA 2Y4YA 4RTWA 1QKWA 3FLGA 2X4YA 2YUPA 2PNIA 3GF5A 3QJYA 5L23A 3M5AA 1ARKA 3VYHB 1JEGA 2DBKA 1VQ9A 2D9TA 3HFOA 1M2VB 2LVMA 2J06A 4QQ6A 3EH1A 3AT1B 4K11A 4FYYB 1N8RC 1AZGB 5CO7A 2L3PA 2HQEA 2ZAEA 2QQAA 4JLGA 5GAN3 4IUPA 3A1PA 1VYUA 2DEQA 1MMNA 1G2BA 3RKXA 5GAN8 2DTOA 3BY7A 3I55T 1UDLA 1RAFB 5M9OA 3CC7A 1I8FA 2CP2A 2K2VA 4ZN1A 3CCUT 2PVGB 3QHSA 4DA4A 2YRDA 3EGUA 4IIMA 3X20B 2E41A 4A53A 3CCST 2LQWA 1LCKA 1ABOA 2HBWA 4F7UB 2KK4A 4OMMA 5CR2A 2GCXA 3M56A 3QDFA 1KG1A 5GAOp 4M7AF 1YI2T 5GMKl 4A54A 5GMKh 3JCMQ 3MP6A 1Y96B 3RERA 1VQ4T 3PIOA 1QVPA 4C5HA 1YJ9A 3EG9B 1YCSB 3L2UA 1TWBA 3CMEQ 1SKUB 3CCLT 3HL8A 4QQGA 3THKA 3S3OA 3EGXB 5LJ5h 2P0QA 1TUDA 3AHUA 2F2VA 4EMHA 2L2PA 1Q82R 4D8KA 5A0LA 1UGVA 2XKOC 1AHJB 2JM9A 5A2QE 1WXTA 4CC2A 4LDYA 3QYHB 1W2BP 4N0AA 4CI0C 2OTLQ 2EYYA 4PNOA 6AT1B 1WX6A 1M3BA 1BI1A 1WHLA 4FYWB 1K9AA 1IHVA 1PG5B 2DL4A 2YLBA 1E6HA 1C1AA 4DBQA 4QVCA 2GQVA 2RQTA 4C8QG 2OAWA 3M0SA 1UEBA 1PSEA 2RQWA 3MP8A 5GAN4 4L6V5 2ENMA 1VQ8A 2RHZA 1VQ5A 3FB9A 4PJOD 2BE9B 5DLOA 4E7KA 1Q7YU 2E6ZA 4AG2C 1KFZA 1TUCA 5GANh 2EQJA 2CT4A 2D1XA 3ZBDA 4BI8B 2FPFA 5KCOA 1M8MA 2EYXA 5HCKA 1GCPA 2RMOA 1VQKT 4PJOE 3QBYA 2YUQA 5FWBA 2C0TA 2M51A 3CMAT 5EG2A 3SWNC 5GAN2 4OB0B 3BDLA 2LCCA 2KR3A 1XNIA 5I21A 2A3LA 1Q7YR 1ZSZB 2RI5A 2M16A 2O9SA 2XDPA 4HCKA 1Q7YC 5CQYA 1VQ7T 3PIPA 2IG0A 3HHTB 4M77E 3A5ZB 4OB1B 2W10A 1JU5C 4M78C 1GRIA 4M78B 4PJOA 1KD1U 2HCKA 4Z88A 5KH6A 3CCUQ 3EH2A 1FMWA 3BW1A 2BUDA 4OMPA 1PRMC 5LJ3j 2FHDA 3EFOA 4FT2A 4EMKC 3CCSQ 2QTVA 1J3TA 1E6GA 3WVEB 1QVFS 2F5KA 4JZ3A 1PSFA 1YI2Q 3I5SA 5C0MA 5FRNA 1UJ0A 3HKSA 1Q86U 2J7IA 3WVDB 4E47A 3X24B 1H92A 1VQ4Q 3UA6A 3H9NA 2DFUA 5CQXA 3KXTA 2G3RA 3RUXA 2E10A 5LJ3e 2K5IA 2YUOA 2RF0A 1ZLMA 4LNPA 4A4GA 1KD1C 3PGGA 1XTDA 1GFDA 4Y91A 2KROA 3CBMA 3CCJA 4QVDA 2QG9B 2DAQA 2MK5A 3OYFA 3S3MA 1KHCA 2O88A 1GXIE 2GTOA 2KBTA 1JB0E 1TUGB 3MEVA 2DZ9A 2JJ9A 4F7UE 2EQKA 1XJWB 2RM4A 2QI2A 5CAIA 1JBMA 2F1LA 1Q86C 1NLOC 4BDYA 2DL7A 2D0NA 5FU7C 1UUEA 1IO6A 3U23A 1MMAA 5GAOq 2CP6A 3R6OA 1SHFA 2AZVA 4R55A 2DIQA 1PD0A 1VQMA 2CP3A 5FROA 2OTLA 1VIEA 4OMLA 1HK9A 1TTHB 3OYLA 2M0OA 2RJDA 2HAXA 1SF9A 1VUBA 4LN2A 3QZ9B 3RBBB 3HRTA 4KH1B 3SD4A 2VGMA 1TU0B 1IRXA 1V1CA 4ORZA 1KK7A 4FYVB 4EDUA 1NPRA 2O4XB 1KQSA 2AT1B 2JMCA 2RHIA 2BIVA 1NE8A 3VRZA 1UB4A 5D6YA 4J9EA 3EG9A 4FCYA 4BI4A 3EG1A 1LPLA 1C6VX 1VQKQ 4KUDK 4XU3A 4RCBA 2YT6A 1Q81R 3VS4A 3OYBA 3TQ7P 3RESA 1D1AA 3O5ZA 5J26A 5GAMf 4IIOA 2OTJT 4FM4B 3G4ST 4J9FA 4C5IA 1VQ7Q 1WIEA 2DNUA 1YITT 4C0DB 1PM3A 3OBWA 2HQXA 1UG1A 1Y0MA 1ZA2B 4MDWA 4M75B 4OMOA 1VQNQ 3I35A 2K5LA 2GFUA 4A63B 2X9HA 1TH7A 4DEYA 1WPYA 1G83A 1BYMA 1X6BA 2EYQA 3I56T 3I55A 1K9MU 1OPLA 3CCUA 2AKLA 2RI2A 2K3BA 3EHRA 1NG2A 1OPKA 4FSSA 4ANJA 3KUFA 1I1JA 2QDLA 3SEMA 1OEBA 2GTJA 5FW9A 2CREA 4HA8A 1NLPC 3OYKA 2FRYA 4M78E 2OAUA 4GLKA 1VQ4A 2CDTA 2CZ1B 2LX9A 4XK8E 1M90R 2E6NA 3GBQA 4FW2A 4M77F 2P0KA 2EGCA 1D3BA 4C5EA 4M7DD 3JCMP 2RPNA 1RUWA 2MOXA 3UPUA 3CCLA 1K9MC 1ZSZA 3JRZA 1SSFA 1GFCA 2JW4A 2KGTA 1G3WA 1X75C 1WI7A 4M7AG 2C0OA 5KE3A 1I81A 1YIJT 4J9DA 2P0PA 2JS0A 3JCMW 4ZTJA 3M55A 1O75A 4FYXB 4C92B 4NL2A 4NL3A 1BK2A 3CCVA 1YHQQ 1GCQC 4XTVA 1D09B 2WACA 2KRMA 1RI0A 1N9SA 2KXDA 3N5BB 1VQPT 5LJ3d 5IAYA 5KYWA 9ATCB 2ABLA 1R0CB 3CD6A 3ER0A 4M7DA 3JB9I 5GAOl 3QUIA 1U1SA 4ME7A 3CCRT 4KULA 1KQSP 3OS0A 5C6SA 4QVZA 2K79A 4F7UF 3JAME 1Z9QA 3QIIA 2ESWA 3GOXA 5LJ3g 3M54A 3JCMX 2QGFB 4V2SA 2YHTA 3CEYA 1HSQA 1Y7XA 3G4SQ 4OB2B 1WYXA 1VQKA 2KSSA 3OBYA 1YWOA 1ZX6A 3CMAA 2DYBA 4E6RA 3JCMh 5GAOr 3VUZA 2DVEA 2J05A 1UTIA 2CP5A 1VQ7A 2RHUA 4II1A 2DXBA 3OA6A 2KAFA 1H641 1WQWA 3OSSC 2IVWA 1YNZA 3I56Q 3LWIA 2XD0A 3KFVA 3OW2S 2CT3A 2V26A 3FDRA 1F1BB 2F69A 1M8VA 4M75D 4C5GA 2RQVA 4XAXB 2JN0A 2NUZA 1CSKA 2QASA 3PMTA 4QQDA 2COYA 1JJ2A 2K6DA 2ZCFB 2DL3A 4PFOA 2E12A 2GF7A 4BE0A 2V8IA 3QO3A 3ME9A 4M75E 1X2QA 2JZ2A 3M0RA 3JCMV 3CC4A 4A4FA 2QK0A 2K7AA 4PJOC 4JS4A 2ROTA 1PKSA 4NS5A 2HZYA 4ZNXA 5IHKA 3QG1A 4YTLA 3TEEA 4J9BA 5IHNA 3QXEB 4C8QB 4XU2A 8ATCB 2GNCA 2E65A 4M75A 3S3NA 2ED1A 4QKUA 3CCQT 1NM7A 1N8RU 5GAN5 5IXBA 4M77C 1ZUYA 2BZYA 4Y92A 1AZEA 3M58A 2DVJA 1RACB 1IGQA 2HSEB 3V8KA 4MZMA 1EZZB 4VUBA 1D1BA 2LTOA 4OGCA 3JB9J 1VQPQ 3CXCS 2KRNA 1XOVA 2A0FB 2SRCA 2JTMA 4M78F 4C92D 3CCRQ 1VQLT 3M0UA 2EQUA 3PVQA 1QVGS 1N8RR 2E3HA 2DYIA 4AFUC 4HT8A 2NYSA 1OI1A 2K9GA 4PFZA 4E7ZA 2E5QA 4C92E 3NPFA 4OMQA 2E1HA 2CH4A 5D6WA 3FIFA 1K0XA 3C4SA 2G6FX 4M4ZA 3NTKA 1X2KA 2LDMA 4RTTA 4N4IA 1KHIA 3ZL7C 2COZA 2OTJA 2VWFA 3HSBA 4ESRA 2DJQA 1UE9A 4J9HA 4C92A 5CK9A 2XU8A 1YITA 4B9WA 3TREA 3URGA 2RHXA 5FWCA 3CPWS 4RTYA 2YLCA 1SHGA 3CBPA 1I0CA 1XQHA 2O31A 1PRLC 2YUNA 2MI6A 3JB9F 3TSWA 4R56A 2D8JA 3PT9A 1M27C 2QQ9A 3FC3A 3M4GA 4JLIA 2CUBA 2MIOA 2VUBA 1M1GA 1M1KU 1BI2A 4JDSA 2EFIA 2OJ2A 2RN8A 3D7SB 1NPPA 1G3TA 5KYUB 1BCOA 3JCMb 3MO8A 2CP7A 1NBEB 1V76A 1JJ2P 2KXCA 1RAIB 2EIFA 2RHYA 4ZTFA 1KJWA 5IXFA 2F2WA 2JS2A 2VXFA 1SEMA 2X51A 2O01E 2A36A 1BU1A 2H3JA 5HK3A 1VQ6Q 2EJFA 3REBB 1M5Q1 2K3XA 4HVVA 2YRCA 3QWYA 1JRIA 3C12A 2A7YA 1M1KC 3CCQQ 2DTIA 2DK3A 5HKCA 4IKFA 3G1JA 5GMKj 1YIJA 2DLPA 3HP9A 2EKOA 2LQ8A 3LW5E 1RAHB 3SDZA 4IUUA 3PNWC 2D8HA 2ED0A 2RJCA 3EGDA 2LNHB 1YJWT 4C8QD 2JOYA 3L2WA 2HQHA 4M77G 1KC8U 4PLLA 1WHMA 5LJ5j 4JRKA 3CBOA 2HMAA 2RA2A 2V1QA 1YJNT 4R0KA 1TG0A 3MEAA 1I5LA 1VQLQ 1WFWA 1M30A 1U8RA 1OOTA 5GMKe 3EAEA 4ZGEB 2KQWA 1D3BB 1FX7A 1D0XA 1VQPA 4J83A 2KE9A 2RNAA 4DOWA 1ZSZC 1YBYA 3EG0A 4C8QE 1W70A 2F5TX 3OYYA 4HKEA 4C0ZA 3A8MB 1NEBA 4PK4A 4B6MA 5LJ5e 2M02A 5I2MA 5CIUA 2COWA 3VRYA 3FJ5A 3OMGA 5DLQE 1W4SA 1TSFA 1KC8C 1VQNT 1AWWA 1QP3A 4J9GA 1JXOA 4C8QA 1X27A 1T3LA 2AZSA 2NUTA 5HY6A 2CH4W 4O5VA 5KYWB 5GANj 2MYSA 4M7DB 4F7UG 3H8ZA 5LJ3f 1KD1R 1OX9A 4IUVA 1RLPC 3UT1A 3V8JA 4MMLA 3M59A 1UHCA 2BZ8A 2LNVA 2J6OA 5FU6C 5FU6B 2W0ZA 4FT4A 4JRIA 4BD3A 2QA4T 3H0FA 2ZGWA 5GANe 5J39A 5GAMh 1ACMB 1Q86R 3CMEA 1UECA 1LNXA 5D7UA 4E7HA 1IREB 4M7AB 2EYZA 4XTUA 1WHJA 2QYZA 1AWOA 1QWFA 1FMKA 2JT4A 3M4YA 5I11A 1BI0A 3P8HA 1R8OB 1PC0A 1WHKA 2BKDN 4FIBA 1YHQT 4N4HA 4F16A 1MV0B 2KYBA 2FZCB 2L0AA 2EJGA 2CZ7B 3VYGA 4HT9A 2DZCA 3M0TA 3NHNA 1AOJA 3M57A 3PMIA 1YJWQ 1SRLA 2XHCA 5L8RE 1ZBJA 4JJBA 1KIKA 3LGFA 2DE0X 4BY6B 1YJNQ 3NFCA 2X4XA 1VQ9T 2R5MA 1RAGB 5FLXE 2VVKA 2V8KA 2NUPB 2AHJB 1MUZA 3X26B 4DBHA 2HKNA 3OYGA 2R58A 3F70A 3EFSA 1KSWA 2YXYA 1YFNA 4HVUA 5KYUA 3VS0A 3V7CA 2QGGA 1T0JA 4AFQC 5J3BA 4C0DC 2CP0A 1VQLA 4OVAA 3GNFB 3JCMJ 1G5VA 4OMNA 2BZXA 2FG0A 3CC2T 3OYMA 4M75C 1GL5A 3A8LB 3G6ET 1QVFA 4F04B 2X4JA 4AFZC 4GY5A 2Y4XA 4PJNA 2RI3A 1JO8A 2QTXA 4M78G 4JRQA 4AT1B 2YWWA 2MCNA 1KQ2A 2K5FA 2LJ0A 5GAN7 2K2MA 3TU4K 1YJ9T 4PJOF 2RB6A 3CCSA 4WF2A 2D6FA 4UC4A 2MWPA 1S1NA 2EW3A 3ZEHA 3VJPA 1ZHIA 2QEXQ 1YI2A 2ZZDA 4PL6A 1B3QA 5AT1B 1AWXA 1NYFA 3G7ZA 2QA4Q 2LQNA 1K9MR 1Z9ZA 2ZPFB 2PQWA 3UF4A 4OGEA 3QJ6A 5CKHA 5GJVB 5FRMA 1K76A 5LJ5d 3LGLA 5I2SA 3L2VA 4BE2A 4HCCA 1D1CA 1YCYA 3OMCA 1UJYA 3VS2A 2MAMA 5CKBA 1W2BS 1DJ7B 2JXBA 3RR6A 3SWNA 2KRSA 2XK0A 3EG2A 4M7DE 1IZ6A 4X1VA 5IN1A 3JCMc 4C92C 3VS1A 1VQ8T 2O9VA 3META 5LJ5g 1VQ5T 1WJRA 4GBQA 3JB9G 2GBQA 2FZGB 1ZBXA 4C0GA 4M7AD 4CC3A 2KNBB 4LDUA 2XDBA 1WDXA 2CKKA 1OU8A 1CKAA 2H8HA 4FU6A 2PZ1A 4BE1A 4EMKA 1QLYA 4ELZC 4EMGA 1JXMA 2B86A 2FPEA 4Q5WA 1VQ9Q 5GJWB 4M7AE 2A28A 3OYIA 1X01A 3M53A 4N0AC 4X34A 5ECAA 5GANd 4AG1C 3J80E 1N9RA 1SPKA 3I9QA 2VKNA 1M3AA 4L59A 1VYTA 4LDXA 2LT1A 1I4K1 4CC7A 4FW1A 2J6FA 4MMKA 2YDLA 1RAEB 2KMTA 2LQKA 1WA7A 1YJNA 2DXUA 3PE0A 2QQSA 2GQIA 1BIBA 3OQ5A 1M3CA 2L89A 1UGSB 3CC7Q 1N27A 1FMVA 5GANg 4X9DA 3OY9A 3CC2Q 4M7AA 4ZGJB 3G71T 3G6EQ 3LH0A 3T9NA 1HXDA 3DLMA 1B07A 3CQTA 2L3SA 3J7AF 4AMCA 2ATCB 2JM8A 5A0GA 4LUEA 1QVFP 1K73U 2JTFA 1OZ2A 3E2UA 4J7FA 4PJMA 2XMFA 3EGDB 3INZA 5IHIA 3OYEA 1VQNA 2CSQA 3OYAA 1YJ9Q 2IIMA 3OS2A 1R0BG 4BB7A 4E7IA 4IURA 4XTXA 5GAOm 3CCJT 3V7SA 2DRKA 3I5RA 2NUPA 1RABB 5D6XA 3CCET 2ZPIB 1RAAB 1K73C 1QCOA 4LXCA 3TVTA 1NZ9A 1U1TA 3TSZA 2EPDA 4J7IA 1K8AU 2XDDA 1WJSA 2EWNA 4QW2A 1RADB 1VQ6T 3H6ZA 2QA4A 1X6OA 3MEUA 3O8VA 1NJIU 2HDAA 3OSVA 4HXJA 4C8QC 1UGRB 1WXUA 1WXBA 1BI3A 3MPUB 2LMJA 1VQ8Q 3X25B 1U5SA 1VQ5Q 2BTTA 2P4RA 2ZPEB 2PU9B 2NUTB 4JRPA 2YSQA 3E9FA 1VQOT 4RMOA 3JCMe 3NGPA 2RJFA 2DD4A 2V8JA 4DEXA 2Z0WA 2RO0A 1K8AC 4J9IA 2O2OA 2RQUA 3A8GB 3OYNA 1UGQB 2EYWA 2RQRA 1YHQA 1EFNA 1BBZA 1NJIC 1PD1A 2X3WD 2DILA 3DB3A 1QQJA 1HYOA 3DKMA 1ZA1B 4RTVA 2WSCE 2KT8A 2DEUA 1Y71A 5KYXB 5CCAA 1ABQA 5DM7R 2DKGA 4E7LA 4M7DF 4LD6A 3KBGA 1RLQC 2FVUA 3H0HA 2DX1A 1ZQ1A 2LC4A 5IT9E 3HRSA 1MHNA 2DM1A 3G71Q 1PWTA 2OI3A 2F2XA 3E19A 1O9SA 2HL5C 5AYFA 3UA7A 3G4SA 3L2QA 2VXEA 1PKTA 4ZGDB 1HD3A 3UATA 3OW2A 2EGAA 3CC2A 1VOMA 3QPHA 3FJPA 3G6EA 4L5GA 2DO3A 5A0DA 2R57A 5IH2A 1Q82U 2VASA 5GAOn 2X3XD 3QYGB 2HNIA 4J6XA 3I56A 3PFSA 3CCJQ 1GCQA 2D0QB 2JNGA 3LX7A 4E7JA 4A4KA 3L1AA 4KBMB 3VS6A 1UGPB 3RNJA 4X9CA 2OX7A 3NTIA 3CCEQ 1OZ3A 4DOVA 1Y57A 1ZSGA 2KY9A 1WZOA 4OP0A 2PUOB 2B8AA 3UDCA 2M9UA 4P5NA 2HBPA 4XTWA 4IUQA 1OV3A 2EKHA 2L3RA 4JPBW 3VUBA 1Q82C 2DPPB 1M1KR 3X28B 1VQMQ 2CSIA 1TS9A 2NWMA 4PJOG 2Y90A 2DL8A 4Y28E 3JB9H 4D8DA 3CCMT 3CCVT 2DTHA 2HKQB 4RCCA 3CXCA 2QDYB 3MHXA 1QW1A 8AT1B 1VQOQ 5GMKm 3QSUA 4RTUA 5LJ3h 2FEIA 2EQMA 3CD6T 1Y07A 2LZ6B 3EHQA 2WSEE 2M1HA 2HL3A 5GMKi 1SRMA 1YP5A 1D0ZA 4B9XA 2KYMA 4JJNK 1QVGA 3HRUA 1U06A 2QXFA 3C95A 4M75F 2RK1A 3BE3A 3L42A 2I0NA 4KH0B 1W6XA 3VS3A 1K1ZA 4OMFB 1KQSS 2V1RA 1H3HA 1IB8A 2KVQG 1B34B 2C0IA 3M9QA 5LJ5f 3CCRA 4J6WA 4M77D 3RDVA 1KC8R 3SWNB 1OU9A 3VS5A 4BI3A 4D6WA 5KE2A 3ZFJA 3PTAA 3P8DA 4J5YA 2XICA 2JVVA 4RUGA 2DIGA 3DLLA 1G8XA 1JQQA 4F14A 3Q1JA 3CPWA 3V8LA 1ZUKA 5KCHA 2DF6A 3P8BB 2LT4A 3I55Q 2DERA 2LCLA 1TOVA 4CRIA 4XU0A 3JCMd 2RK2A 1LJOA 3L2ZA 2EGEA 3REAB 2L3QA 3HTRA 2MPXC 4M7DC 2VB6A 3G71A 4EMKB 3OW2P 1BKBA 3R6NA 2KEAA 4ZN3A 1RI9A 2QEXT 1MNDA 2CS7A 3NTHA 4RG8A 3MEWA 4A4EA 4BUGA 3M0PA 4MZTA 4HCBA 2NLUA 2X35A 1WHGA 4M77A 2QAZA 1T3SA 4XQ3A 3JCMg 2LRQA 2ZPGB 2LJ1A 1QCFA 4C92F 1IHWA 1AEYA 1X43A 5GANf 2JMAA 2DJZA 1RL2A 3CC4T 1UHFA 1X6GA 3CCLQ 2DA9A 5KYXA 4EPCA 3H41A 4DBRA 2K57A 2R5AA 2LX7A 1P92A 2K3YA 1SSHA 4M7AC 2ZPBB 4PKCC 5EC7A 1LVKA 3M0QA 2FZKB 4J9CA 1M2VA 5KYYB 4PFPA 1CKBA 3LLRA 3CCEA 2E4HA 1MV3A 4LD9K 1S72T 4XU1A 1YN8A 2VYTA 3CCMQ 3CCVQ 3UWNA 2QQBA 1WGSA 4BDZA 2EJ9A 5FU7B 2FPDA 1VQ6A 1K0SA 3SFMA 2DBMA 3CD6Q 1WNLA 1Q81U 3CCQA 1VA7A 1HJDA 5KYNA 3CXCP 4F7UA 1TXQA 3JV3A 3ASKA 1QCNA 4BY6C 2SEMA 3QKJA 1WHHA 1M1FA 2KDSA 4E7SA 1VQOA 1Y96A 2E64A 1QVGP 5CVIA 2RJEA 2LCSA 3L2RA 5GAMj 1PHTA 2ZPHB 4KT0E 4XTYA 2XIDA 3MCAB 2L5QA 2RD1A 3QDRB 1Q95G 3EGXA 2I2LA 3CMAQ 3BFMA 4OF1A 3A8OB 2VC8A 3CC7T 1G3YA 1BIAA 2J6KA 1Q81C 1KQ1A 1VYVA 3HPWA 1WLPB 5GAMe 4BACA 2X4WA 1UFFA 1OYXA 3H0IA 2XG8D 3FRNA 1SG5A 1PCXA 4OB3B 4CC4B 2VGNA 3E1SA 4EIKA 4WTOB 3LYIA 5CKEA 3CPWP 2DXCA 3VV0A 3QZ5B 4JZ4A 2IPOB 2DETA 2A08A 4J8OA 3LWHA 1QKXA 3MJXA 4A4HA 1M90U 4M78D 2P4TA 4C8QF 4LE9A 2H3EB 2VV5A 4M7DG 2DD5A 5DY9A 3V7RA 1OX8A 1OULA 1I5OB 3E9GA 4KGXB 4PLIA 5GAN6 3CC4Q 4MZPA 4PJLA 2FYKA 2DMOA 1X69A 4C0FA 4DBFA 3DB4A 4Z89A 4N4GA 3VS7A 1B34A 3RIRA 2LJ3A 2FRWA 2K4YA 2PUKB 2XI9A 5I22A 4XTZA 1JJ2S 1MMGA 3RMQA 5CKDA 1M90C 1QP2A 1S72Q 1EIFA 4J6YA 3TCJA 3LH5A 3GP8A 3OYJA 4HVWA 4M78A 3SHWA 1QWEA 2FL7A 2CUDA 3C94A 2DL5A 2MWOA 2A37A 4LUDA 3ULRB 2CZ0B 3CCMA 2LP5A 1M4ZA 1U3OA 2M0YA 1AVZC 4MDXA 2HEQA 3OS1A 2AIRB 1GBQA 5CKFA 3JB9D 2ECZA 3SB2A 4ATOA
chains in the Genus database with same CATH topology
1NE8A 1YJNT 1UB4A 5D6YA 3DB3A 1MGQA 3MEAA 4BI4A 1I5LA 2RH2A 1U8RA 1YJWA 5GMKe 3DKMA 3EAEA 4ZGEB 1FWZA 3GLXA 4XU3A 4RCBA 4KUDK 4IUTA 2KQWA 1D3BB 1FX7A 1VQPA 2WSCE 3S6WA 1Y71A 4J83A 2PVOB 4DOWA 1YBYA 4HCBA 5CCAA 4C8QE 3OYBA 5DM7R 2F5TX 3OYYA 4HKEA 3WXMB 2CZ6B 2DKGA 3RESA 4HCZA 4C0ZA 4E7LA 4M7DF 3A8MB 4LD6A 3KBGA 5J26A 5GAMf 2FVUA 2OTJT 5LJ5e 4FM4B 3G4ST 1ZQ1A 4LDWA 2LC4A 5I2MA 4C5IA 5IT9E 3HRSA 5CIUA 3OYCA 2E70A 1YITT 1MHNA 2C06A 4C0DB 2WSFE 3OMGA 5DLQE 5HK0A 1W4SA 1KC8C 1VQNT 2HD0A 3OBWA 2HQXA 3E19A 1O9SA 3G4SA 5AYFA 4MDWA 3L2QA 2VXEA 1LOJA 1QP3A 4ZGDB 4M75B 3FEOA 2K5LA 2GFUA 4M75G 4C8QA 3OW2A 1H3ZA 1TH7A 2FB7A 2L8DA 1WPYA 2JUFA 4RKUE 3CC2A 3QPHA 3FJPA 4NOYA 3G6EA 5HY6A 1BYMA 4L5GA 4O5VA 2EYQA 3I56T 1FXXA 2DO3A 3I55A 5GANj 1K9MU 5A0DA 4FL6A 4M7DB 2R57A 4F7UG 3CCUA 2RI2A 3H8ZA 1WQ7A 5LJ3f 1Q82U 4IUVA 5GAOn 3KUFA 3QYGB 2HNIA 3UT1A 3V8JA 4MMLA 4J6XA 3VU3C 3M59A 3I56A 4RG2A 3PFSA 2D0QB 2JNGA 3LX7A 2QQRA 3CMET 2O4XA 2LNVA 3BDUA 4E7JA 4JRKA 4HA8A 4A4KA 3L1AA 3OYKA 4KBMB 3GPLA 5FU6C 5FU6B 1UGPB 2QEXA 4FT4A 2PVDB 2OAUA 3NTIA 4JRIA 1G3SA 4GLKA 4M78E 4X9CA 1OZ3A 1VIFA 3A8HB 2ZGWA 3MP1A 4BD3A 4DOVA 5GANe 5J39A 1VQ4A 4JUVA 2CZ1B 2LX9A 5GAMh 3EFRA 3CMEA 4XK8E 2CGHA 2KY9A 1N6AA 2E6NA 3GIBA 4OP0A 2PUOB 4M77F 3RKWA 2P0KA 4M7DD 1D3BA 4C5EA 2MF2A 2B8AA 3JCMP 3UDCA 1LNXA 3OYHA 3J81E 3UPUA 3CCLA 1K9MC 1M8VA 3JRZA 1SSFA 2M9UA 4P5NA 2HBPA 1VQMT 3VKIA 2OTLT 4TVRA 4IUQA 4XTWA 3RMSA 5GAMd 2L3RA 4FSXA 4E7HA 1IREB 1G3WA 3VUBA 1Q82C 3GNGA 4M7AB 1X75C 4M7AG 2DPPB 4LDVA 4XTUA 3X28B 5KE3A 1I81A 1YIJT 4DQ2A 4PJOB 3CPFA 4PJOG 2YRVA 2Y90A 3RKYA 2P0PA 4Y28E 3JB9H 4JS5A 3HFNA 3M4YA 5LL6S 3CCMT 3CCVT 3JCMW 4ZTJA 1BI0A 3P8HA 1R8OB 3JCMf 3M55A 4O6JA 2BKDN 4FIBA 2DTHA 1O75A 1YHQT 4N4HA 4RCCA 4C92B 3CXCA 4NL2A 2QDYB 3MHXA 4C92G 5GAMg 1QW1A 2EAYA 3QSUA 5GMKm 4NL3A 2EJGA 5LJ3h 2CZ7B 4Z02A 3CCVA 4XTVA 1S72A 2EQMA 1WJQA 3CD6T 3VYGA 2CYZB 1Y07A 4M77B 4HT9A 2DZCA 1V29B 2GFAA 2WACA 3OS5A 2WSEE 4KUIA 2M1HA 1RI0A 1VQ4T 1N9SA 3M57A 3N5BB 5GMKi 3PMIA 4B9XA 1QVGA 4JJNK 1VQPT 5LJ3d 5IAYA 3HRUA 2QXFA 3C95A 4M75F 2XHCA 2RK1A 3JSCA 5L8RE 1M9SA 3ER0A 2MMPA 4ELYC 3CD6A 3JB9I 5GAOl 4M7DA 3QUIA 3LGFA 3OB9A 4BY6B 3NFCA 2X4XA 2DXTA 1U1SA 2Y4YA 1VQ9T 3FLGA 2R5MA 2X4YA 4ME7A 5FLXE 3L42A 2V8KA 4KULA 3CCRT 2AHJB 3GF5A 3X26B 3QJYA 3OS0A 3M5AA 5C6SA 4OMFB 1KQSS 4QVZA 3VYHB 3OYGA 4F7UF 3JAME 2R58A 3F70A 1VQ9A 2D9TA 2KVQG 1B34B 3EFSA 3M9QA 3QIIA 5LJ5f 3HFOA 3CCRA 3GOXA 5LJ3g 4J6WA 2LVMA 4M77D 3M54A 3JCMX 4QQ6A 3V7CA 4V2SA 2YHTA 3SWNB 3CEYA 1N8RC 2BIVA 1Y7XA 5J3BA 5CO7A 4C0DC 1VQLA 4OVAA 2HQEA 3GNFB 4OB2B 4BI3A 4D6WA 2QQAA 3JCMJ 5KE2A 3ZFJA 4JLGA 2KSSA 3OBYA 5GAN3 3PTAA 1VQKA 1G5VA 3P8DA 3CC2T 3CMAA 4J5YA 3OYMA 2XICA 2JVVA 4IUPA 3JCMh 4M75C 2DEQA 2DIGA 3A8LB 3RKXA 5GAN8 3G6ET 3DLLA 5GAOr 1QVFA 2DTOA 3VUZA 2X4JA 3BY7A 3I55T 3Q1JA 3CPWA 5LJ5j 5M9OA 3CC7A 1I8FA 2DVEA 2K2VA 3V8LA 4ZN1A 3CCUT 4GY5A 2Y4XA 2RI3A 5KCHA 2PVGB 2QTXA 2LT4A 3P8BB 3QHSA 4M78G 2LCLA 4JRQA 4DA4A 4CRIA 4XU0A 3JCMd 2RK2A 1LJOA 3L2ZA 2E41A 2RHUA 3X20B 1VQ7A 4A53A 3CCST 4II1A 4F7UB 2DXBA 2KK4A 4M7DC 1KQ2A 5CR2A 2GCXA 3OA6A 3M56A 2K5FA 2KAFA 1H641 5GAOp 3G71A 4M7AF 4EMKB 1W2BA 1KG1A 1YI2T 1WQWA 3OSSC 2IVWA 3LWIA 5GAN7 3TU4K 2XD0A 1BKBA 5GMKl 4ZN3A 1YJ9T 4PJOF 4A54A 5GMKh 2RB6A 3JCMQ 2QEXT 3OW2S 2CS7A 3MP6A 3CCSA 1Y96B 4WF2A 2D6FA 3NTHA 4UC4A 3FDRA 2MWPA 3RERA 4RG8A 3MEWA 4A4EA 3ZEHA 4BUGA 2F69A 4MZTA 3VJPA 4M75D 2NLUA 1ZHIA 2X35A 4M77A 4XAXB 4C5GA 3PIOA 1YI2A 2ZZDA 4PL6A 4XQ3A 1QVPA 3JCMg 4C5HA 2LRQA 2JN0A 1YJ9A 2ZPGB 4C92F 3L2UA 3PMTA 5GANf 3CCLT 3HL8A 2DJZA 4QQGA 3G7ZA 1RL2A 4QQDA 3S3OA 5LJ5h 3CC4T 2P0QA 1JJ2A 3AHUA 4EMHA 2ZCFB 2E12A 2GF7A 4BE0A 2ZPFB 2PQWA 2V8IA 3QO3A 4OGEA 4EPCA 3ME9A 4M75E 2JZ2A 2K57A 2XKOC 2R5AA 3QJ6A 5CKHA 3JCMV 5A0LA 5FRMA 3CC4A 5LJ5d 1AHJB 1P92A 2K3YA 3LGLA 4A4FA 5I2SA 5A2QE 3L2VA 4BE2A 4M7AC 4LDYA 2ZPBB 3QYHB 4PKCC 4HCCA 1YCYA 3OMCA 4N0AA 4CI0C 2MAMA 4PJOC 5CKBA 4PNOA 4JS4A 1W2BS 1DJ7B 4NS5A 1BI1A 3LLRA 3CCEA 3SWNA 3OYDA 3QG1A 4LD9K 2XK0A 4M7DE 1IZ6A 5IN1A 1S72T 4YTLA 3TEEA 2YLBA 4XU1A 4QVCA 3JCMc 4C92C 2VYTA 1VQ8T 3UWNA 2QQBA 1WGSA 3QXEB 4BDZA 4C8QB 3META 2EJ9A 4XU2A 5LJ5g 1VQ5T 2E65A 5FU7B 1WJRA 2GQVA 4M75A 4C8QG 3S3NA 3CCQT 3JB9G 1UEBA 1PSEA 1VQ6A 3MP8A 5GAN4 1N8RU 5GAN5 4M77C 4L6V5 1ZBXA 4C0GA 3SFMA 1VQ8A 3M58A 4M7AD 4LDUA 2RHZA 1VQ5A 2XDBA 3FB9A 3V8KA 1WNLA 1Q81U 2CKKA 3CCQA 4PJOD 4MZMA 4F7UA 4VUBA 5DLOA 4E7KA 3ASKA 1Q7YU 2QA4T 4FU6A 2E6ZA 2LTOA 4OGCA 4BY6C 4BE1A 4EMKA 3CXCS 3JB9J 1XOVA 5GANh 3QKJA 2EQJA 2JTMA 4M78F 1M1FA 2KDSA 4EMGA 4ELZC 3ZBDA 4BI8B 4C92D 1VQOA 1Y96A 4Q5WA 5KCOA 2E64A 4M7AE 3OYIA 5CVIA 2RJEA 1VQLT 1X01A 3L2RA 5GAMj 3M53A 4N0AC 2EQUA 4X34A 5GANd 1VQKT 1QVGS 3QBYA 2ZPHB 3J80E 4PJOE 1N9RA 4KT0E 4XTYA 2XIDA 3CMAT 4L59A 3MCAB 5EG2A 4LDXA 2L5QA 2RD1A 3SWNC 2LT1A 1I4K1 3QDRB 5GAN2 4OB0B 4HT8A 3BDLA 2I2LA 2LCCA 4MMKA 1OI1A 1XNIA 2KMTA 3BFMA 4OF1A 3A8OB 2LQKA 2VC8A 1YJNA 3CC7T 2DXUA 5I21A 1G3YA 2A3LA 1BIAA 2E5QA 2QQSA 4C92E 2RI5A 1BIBA 1KQ1A 2E1HA 2M16A 3OQ5A 5D6WA 1Q81C 3FIFA 2L89A 2XDPA 1UGSB 1Q7YC 1N27A 5CQYA 3C4SA 3PIPA 1VQ7T 2IG0A 5GANg 4X9DA 3HHTB 3OY9A 4M7AA 3HPWA 4M77E 5GAMe 4ZGJB 3A5ZB 4OB1B 3G71T 4BACA 2X4WA 4M78C 4M78B 3LH0A 4PJOA 1KD1U 1OYXA 3T9NA 3NTKA 2XG8D 1HXDA 3FRNA 2LDMA 5KH6A 3DLMA 4N4IA 4OB3B 1KHIA 3J7AF 2VGNA 2OTJA 3BW1A 2BUDA 5LJ3j 3E1SA 2FHDA 5A0GA 4FT2A 3HSBA 1K73U 3LYIA 4EMKC 2JTFA 5CKEA 4C92A 5CK9A 1OZ2A 2XU8A 1YITA 4B9WA 3TREA 3URGA 2DXCA 3VV0A 3WVEB 1QVFS 2F5KA 4J7FA 2RHXA 3QZ5B 1PSFA 3INZA 3CPWS 3OYEA 1VQNA 2YLCA 5C0MA 5FRNA 3CBPA 3OYAA 4J8OA 3LWHA 3HKSA 3OS2A 1Q86U 4E47A 3WVDB 3X24B 4A4HA 1M90U 3KXTA 5CQXA 4M78D 1XQHA 4BB7A 2P4TA 4C8QF 2G3RA 3RUXA 2VV5A 4M7DG 2E10A 2MI6A 4E7IA 3JB9F 2DD5A 4R56A 4IURA 4XTXA 5DY9A 3V7RA 5LJ3e 5GAOm 3CCJT 2K5IA 3PT9A 3V7SA 2QQ9A 3FC3A 3M4GA 4JLIA 4A4GA 1KD1C 3PGGA 1XTDA 3E9GA 2VUBA 4PLIA 1M1GA 5GAN6 4Y91A 1M1KU 4MZPA 1BI2A 2FYKA 4JDSA 2EFIA 5D6XA 3CBMA 3CCET 4C0FA 2ZPIB 3DB4A 4QVDA 3CCJA 1NPPA 2DAQA 1G3TA 1K73C 3OYFA 4N4GA 1NZ9A 3S3MA 1U1TA 1B34A 1KHCA 3JCMb 3MO8A 3RIRA 2K4YA 4J7IA 1GXIE 1K8AU 2PUKB 1JB0E 2XDDA 2XI9A 1WJSA 2EIFA 2RHYA 3MEVA 2DZ9A 2EWNA 4XTZA 4F7UE 2EQKA 1JJ2S 4QW2A 4ZTFA 2RM4A 2QI2A 5CAIA 1JBMA 1Q86C 1VQ6T 3RMQA 2VXFA 5CKDA 3H6ZA 2QA4A 1M90C 2O01E 1X6OA 3MEUA 3O8VA 2H3JA 5HK3A 4BDYA 1NJIU 1QP2A 3OSVA 4C8QC 1UGRB 2EJFA 5FU7C 1M5Q1 2K3XA 1BI3A 1EIFA 4J6YA 5GAOq 3TCJA 3R6OA 3X25B 4R55A 3GP8A 1JRIA 2DIQA 3C12A 2A7YA 2ZPEB 2PU9B 4M78A 3OYJA 4JRPA 1VQMA 5FROA 1M1KC 1VIEA 2OTLA 2DTIA 1HK9A 2DK3A 3OYLA 2M0OA 5HKCA 2FL7A 4IKFA 2RJDA 3E9FA 3C94A 1VQOT 4RMOA 5GMKj 3JCMe 1VUBA 1YIJA 2HAXA 3QZ9B 3HP9A 2RJFA 2EKOA 2LQ8A 2MWOA 3HRTA 2DD4A 3LW5E 3SDZA 2V8JA 4IUUA 3PNWC 2RO0A 3SD4A 1K8AC 2VGMA 2CZ0B 3CCMA 3A8GB 1M4ZA 3OYNA 2RJCA 1UGQB 4MDXA 4EDUA 1NPRA 2O4XB 3OS1A 1YJWT 1YHQA 4C8QD 2JOYA 3L2WA 1KQSA 4M77G 5CKFA 1KC8U 3JB9D 4PLLA 1NJIC 2RHIA 3SB2A 3CBOA 4ATOA 2RA2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NE8 A;  1UB4 A;  5CQX A;  5HKC A;  2C06 A;  4ELY C;  4MZM A;  3JSC A;  3G7Z A;  5CO7 A;  4VUB A;  5HK0 A;  5DLO A;  1VUB A;  5CR2 A;  2KMT A;  3NFC A;  4OF1 A;  5CKD A;  2MF2 A;  4ME7 A;  5CKE A;  2VUB A;  5CK9 A;  5HK3 A;  1M1F A;  3JRZ A;  4MZP A;  4ELZ C;  5CCA A;  5CKH A;  4HKE A;  4MDX A;  5CQY A;  3VUB A;  4MZT A;  1X75 C;  3TCJ A;  3HPW A;  5CKF A;  5CKB A; 
#chains in the Genus database with same CATH topology
 1AD5 A;  1MGQ A;  2PTK A;  2RH2 A;  1YJW A;  1FWZ A;  3GLX A;  4IUT A;  4KRT A;  3S6W A;  2PVO B;  1A0N B;  1MMD A;  3C0C A;  2HSP A;  3WXM B;  1T0H A;  2CZ6 B;  4HCZ A;  1NEG A;  1AWJ A;  1E7O A;  4LDW A;  5KYY A;  2P84 A;  3OYC A;  2E70 A;  1AT1 B;  4WCI A;  2C06 A;  2OTJ Q;  2WSF E;  1C0M A;  5HK0 A;  2HD0 A;  2E5K A;  1YIT Q;  1YWP A;  1LOJ A;  1I07 A;  3PVL A;  2E3I A;  3FEO A;  2EVR A;  1H3Z A;  4M75 G;  1B7T A;  2FB7 A;  2L8D A;  3EG3 A;  2JUF A;  4RKU E;  1QMC A;  1ZUU A;  4NOY A;  3IQL A;  1FXX A;  4FL6 A;  1EX4 A;  1WQ7 A;  2BE7 D;  1OQK A;  1H8K A;  3VU3 C;  4Z8A A;  2FO0 A;  4RG2 A;  1IXD A;  4PJJ A;  1K73 R;  1IGU A;  2QQR A;  3CME T;  2O4X A;  3BDU A;  2GGR A;  3GPL A;  2QEX A;  2PVD B;  3OYD A;  1G3S A;  1W2B A;  1VIF A;  1PNJ A;  3A8H B;  3MP1 A;  7AT1 B;  2KT1 A;  4RTX A;  4JUV A;  3EFR A;  2CGH A;  1GBR A;  1N6A A;  3GIB A;  4RTZ A;  3RKW A;  2MF2 A;  3OYH A;  3J81 E;  1BCM A;  2EQI A;  1VQM T;  2OTL T;  2ROL A;  3VKI A;  4TVR A;  5GAM d;  3RMS A;  4FSX A;  1BB9 A;  2DRM A;  3GNG A;  3NMZ C;  4JJC A;  4QT7 A;  4LDV A;  1W1F A;  4DQ2 A;  4PJO B;  4F17 A;  3CPF A;  1R77 A;  2YRV A;  3RKY A;  4JS5 A;  3HFN A;  1YIJ Q;  5LL6 S;  3JCM f;  4O6J A;  1K8A R;  3EFO B;  4KGZ B;  1FYN A;  2EBP A;  4GLM A;  4JJD A;  1N5Z A;  4C92 G;  5GAM g;  2AKK A;  2EAY A;  4Z02 A;  1M2O A;  1S72 A;  1WJQ A;  1NJI R;  2CYZ B;  4M77 B;  4E2F B;  1MNE A;  4AFS C;  1V29 B;  2GFA A;  3OS5 A;  4KUI A;  1K4U S;  3MKD A;  2JTE A;  3A98 A;  3QWX X;  2AK5 A;  4KGV B;  4ELY C;  3JSC A;  1M9S A;  2MMP A;  2KI7 A;  3OB9 A;  1NYG A;  1D0Y A;  2DXT A;  2Y4Y A;  4RTW A;  1QKW A;  3FLG A;  2X4Y A;  2YUP A;  2PNI A;  3GF5 A;  3QJY A;  5L23 A;  3M5A A;  1ARK A;  3VYH B;  1JEG A;  2DBK A;  1VQ9 A;  2D9T A;  3HFO A;  1M2V B;  2LVM A;  2J06 A;  4QQ6 A;  3EH1 A;  3AT1 B;  4K11 A;  4FYY B;  1N8R C;  1AZG B;  5CO7 A;  2L3P A;  2HQE A;  2ZAE A;  2QQA A;  4JLG A;  5GAN 3;  4IUP A;  3A1P A;  1VYU A;  2DEQ A;  1MMN A;  1G2B A;  3RKX A;  5GAN 8;  2DTO A;  3BY7 A;  3I55 T;  1UDL A;  1RAF B;  5M9O A;  3CC7 A;  1I8F A;  2CP2 A;  2K2V A;  4ZN1 A;  3CCU T;  2PVG B;  3QHS A;  4DA4 A;  2YRD A;  3EGU A;  4IIM A;  3X20 B;  2E41 A;  4A53 A;  3CCS T;  2LQW A;  1LCK A;  1ABO A;  2HBW A;  4F7U B;  2KK4 A;  4OMM A;  5CR2 A;  2GCX A;  3M56 A;  3QDF A;  1KG1 A;  5GAO p;  4M7A F;  1YI2 T;  5GMK l;  4A54 A;  5GMK h;  3JCM Q;  3MP6 A;  1Y96 B;  3RER A;  1VQ4 T;  3PIO A;  1QVP A;  4C5H A;  1YJ9 A;  3EG9 B;  1YCS B;  3L2U A;  1TWB A;  3CME Q;  1SKU B;  3CCL T;  3HL8 A;  4QQG A;  3THK A;  3S3O A;  3EGX B;  5LJ5 h;  2P0Q A;  1TUD A;  3AHU A;  2F2V A;  4EMH A;  2L2P A;  1Q82 R;  4D8K A;  5A0L A;  1UGV A;  2XKO C;  1AHJ B;  2JM9 A;  5A2Q E;  1WXT A;  4CC2 A;  4LDY A;  3QYH B;  1W2B P;  4N0A A;  4CI0 C;  2OTL Q;  2EYY A;  4PNO A;  6AT1 B;  1WX6 A;  1M3B A;  1BI1 A;  1WHL A;  4FYW B;  1K9A A;  1IHV A;  1PG5 B;  2DL4 A;  2YLB A;  1E6H A;  1C1A A;  4DBQ A;  4QVC A;  2GQV A;  2RQT A;  4C8Q G;  2OAW A;  3M0S A;  1UEB A;  1PSE A;  2RQW A;  3MP8 A;  5GAN 4;  4L6V 5;  2ENM A;  1VQ8 A;  2RHZ A;  1VQ5 A;  3FB9 A;  4PJO D;  2BE9 B;  5DLO A;  4E7K A;  1Q7Y U;  2E6Z A;  4AG2 C;  1KFZ A;  1TUC A;  5GAN h;  2EQJ A;  2CT4 A;  2D1X A;  3ZBD A;  4BI8 B;  2FPF A;  5KCO A;  1M8M A;  2EYX A;  5HCK A;  1GCP A;  2RMO A;  1VQK T;  4PJO E;  3QBY A;  2YUQ A;  5FWB A;  2C0T A;  2M51 A;  3CMA T;  5EG2 A;  3SWN C;  5GAN 2;  4OB0 B;  3BDL A;  2LCC A;  2KR3 A;  1XNI A;  5I21 A;  2A3L A;  1Q7Y R;  1ZSZ B;  2RI5 A;  2M16 A;  2O9S A;  2XDP A;  4HCK A;  1Q7Y C;  5CQY A;  1VQ7 T;  3PIP A;  2IG0 A;  3HHT B;  4M77 E;  3A5Z B;  4OB1 B;  2W10 A;  1JU5 C;  4M78 C;  1GRI A;  4M78 B;  4PJO A;  1KD1 U;  2HCK A;  4Z88 A;  5KH6 A;  3CCU Q;  3EH2 A;  1FMW A;  3BW1 A;  2BUD A;  4OMP A;  1PRM C;  5LJ3 j;  2FHD A;  3EFO A;  4FT2 A;  4EMK C;  3CCS Q;  2QTV A;  1J3T A;  1E6G A;  3WVE B;  1QVF S;  2F5K A;  4JZ3 A;  1PSF A;  1YI2 Q;  3I5S A;  5C0M A;  5FRN A;  1UJ0 A;  3HKS A;  1Q86 U;  2J7I A;  3WVD B;  4E47 A;  3X24 B;  1H92 A;  1VQ4 Q;  3UA6 A;  3H9N A;  2DFU A;  5CQX A;  3KXT A;  2G3R A;  3RUX A;  2E10 A;  5LJ3 e;  2K5I A;  2YUO A;  2RF0 A;  1ZLM A;  4LNP A;  4A4G A;  1KD1 C;  3PGG A;  1XTD A;  1GFD A;  4Y91 A;  2KRO A;  3CBM A;  3CCJ A;  4QVD A;  2QG9 B;  2DAQ A;  2MK5 A;  3OYF A;  3S3M A;  1KHC A;  2O88 A;  1GXI E;  2GTO A;  2KBT A;  1JB0 E;  1TUG B;  3MEV A;  2DZ9 A;  2JJ9 A;  4F7U E;  2EQK A;  1XJW B;  2RM4 A;  2QI2 A;  5CAI A;  1JBM A;  2F1L A;  1Q86 C;  1NLO C;  4BDY A;  2DL7 A;  2D0N A;  5FU7 C;  1UUE A;  1IO6 A;  3U23 A;  1MMA A;  5GAO q;  2CP6 A;  3R6O A;  1SHF A;  2AZV A;  4R55 A;  2DIQ A;  1PD0 A;  1VQM A;  2CP3 A;  5FRO A;  2OTL A;  1VIE A;  4OML A;  1HK9 A;  1TTH B;  3OYL A;  2M0O A;  2RJD A;  2HAX A;  1SF9 A;  1VUB A;  4LN2 A;  3QZ9 B;  3RBB B;  3HRT A;  4KH1 B;  3SD4 A;  2VGM A;  1TU0 B;  1IRX A;  1V1C A;  4ORZ A;  1KK7 A;  4FYV B;  4EDU A;  1NPR A;  2O4X B;  1KQS A;  2AT1 B;  2JMC A;  2RHI A;  2BIV A;  1NE8 A;  3VRZ A;  1UB4 A;  5D6Y A;  4J9E A;  3EG9 A;  4FCY A;  4BI4 A;  3EG1 A;  1LPL A;  1C6V X;  1VQK Q;  4KUD K;  4XU3 A;  4RCB A;  2YT6 A;  1Q81 R;  3VS4 A;  3OYB A;  3TQ7 P;  3RES A;  1D1A A;  3O5Z A;  5J26 A;  5GAM f;  4IIO A;  2OTJ T;  4FM4 B;  3G4S T;  4J9F A;  4C5I A;  1VQ7 Q;  1WIE A;  2DNU A;  1YIT T;  4C0D B;  1PM3 A;  3OBW A;  2HQX A;  1UG1 A;  1Y0M A;  1ZA2 B;  4MDW A;  4M75 B;  4OMO A;  1VQN Q;  3I35 A;  2K5L A;  2GFU A;  4A63 B;  2X9H A;  1TH7 A;  4DEY A;  1WPY A;  1G83 A;  1BYM A;  1X6B A;  2EYQ A;  3I56 T;  3I55 A;  1K9M U;  1OPL A;  3CCU A;  2AKL A;  2RI2 A;  2K3B A;  3EHR A;  1NG2 A;  1OPK A;  4FSS A;  4ANJ A;  3KUF A;  1I1J A;  2QDL A;  3SEM A;  1OEB A;  2GTJ A;  5FW9 A;  2CRE A;  4HA8 A;  1NLP C;  3OYK A;  2FRY A;  4M78 E;  2OAU A;  4GLK A;  1VQ4 A;  2CDT A;  2CZ1 B;  2LX9 A;  4XK8 E;  1M90 R;  2E6N A;  3GBQ A;  4FW2 A;  4M77 F;  2P0K A;  2EGC A;  1D3B A;  4C5E A;  4M7D D;  3JCM P;  2RPN A;  1RUW A;  2MOX A;  3UPU A;  3CCL A;  1K9M C;  1ZSZ A;  3JRZ A;  1SSF A;  1GFC A;  2JW4 A;  2KGT A;  1G3W A;  1X75 C;  1WI7 A;  4M7A G;  2C0O A;  5KE3 A;  1I81 A;  1YIJ T;  4J9D A;  2P0P A;  2JS0 A;  3JCM W;  4ZTJ A;  3M55 A;  1O75 A;  4FYX B;  4C92 B;  4NL2 A;  4NL3 A;  1BK2 A;  3CCV A;  1YHQ Q;  1GCQ C;  4XTV A;  1D09 B;  2WAC A;  2KRM A;  1RI0 A;  1N9S A;  2KXD A;  3N5B B;  1VQP T;  5LJ3 d;  5IAY A;  5KYW A;  9ATC B;  2ABL A;  1R0C B;  3CD6 A;  3ER0 A;  4M7D A;  3JB9 I;  5GAO l;  3QUI A;  1U1S A;  4ME7 A;  3CCR T;  4KUL A;  1KQS P;  3OS0 A;  5C6S A;  4QVZ A;  2K79 A;  4F7U F;  3JAM E;  1Z9Q A;  3QII A;  2ESW A;  3GOX A;  5LJ3 g;  3M54 A;  3JCM X;  2QGF B;  4V2S A;  2YHT A;  3CEY A;  1HSQ A;  1Y7X A;  3G4S Q;  4OB2 B;  1WYX A;  1VQK A;  2KSS A;  3OBY A;  1YWO A;  1ZX6 A;  3CMA A;  2DYB A;  4E6R A;  3JCM h;  5GAO r;  3VUZ A;  2DVE A;  2J05 A;  1UTI A;  2CP5 A;  1VQ7 A;  2RHU A;  4II1 A;  2DXB A;  3OA6 A;  2KAF A;  1H64 1;  1WQW A;  3OSS C;  2IVW A;  1YNZ A;  3I56 Q;  3LWI A;  2XD0 A;  3KFV A;  3OW2 S;  2CT3 A;  2V26 A;  3FDR A;  1F1B B;  2F69 A;  1M8V A;  4M75 D;  4C5G A;  2RQV A;  4XAX B;  2JN0 A;  2NUZ A;  1CSK A;  2QAS A;  3PMT A;  4QQD A;  2COY A;  1JJ2 A;  2K6D A;  2ZCF B;  2DL3 A;  4PFO A;  2E12 A;  2GF7 A;  4BE0 A;  2V8I A;  3QO3 A;  3ME9 A;  4M75 E;  1X2Q A;  2JZ2 A;  3M0R A;  3JCM V;  3CC4 A;  4A4F A;  2QK0 A;  2K7A A;  4PJO C;  4JS4 A;  2ROT A;  1PKS A;  4NS5 A;  2HZY A;  4ZNX A;  5IHK A;  3QG1 A;  4YTL A;  3TEE A;  4J9B A;  5IHN A;  3QXE B;  4C8Q B;  4XU2 A;  8ATC B;  2GNC A;  2E65 A;  4M75 A;  3S3N A;  2ED1 A;  4QKU A;  3CCQ T;  1NM7 A;  1N8R U;  5GAN 5;  5IXB A;  4M77 C;  1ZUY A;  2BZY A;  4Y92 A;  1AZE A;  3M58 A;  2DVJ A;  1RAC B;  1IGQ A;  2HSE B;  3V8K A;  4MZM A;  1EZZ B;  4VUB A;  1D1B A;  2LTO A;  4OGC A;  3JB9 J;  1VQP Q;  3CXC S;  2KRN A;  1XOV A;  2A0F B;  2SRC A;  2JTM A;  4M78 F;  4C92 D;  3CCR Q;  1VQL T;  3M0U A;  2EQU A;  3PVQ A;  1QVG S;  1N8R R;  2E3H A;  2DYI A;  4AFU C;  4HT8 A;  2NYS A;  1OI1 A;  2K9G A;  4PFZ A;  4E7Z A;  2E5Q A;  4C92 E;  3NPF A;  4OMQ A;  2E1H A;  2CH4 A;  5D6W A;  3FIF A;  1K0X A;  3C4S A;  2G6F X;  4M4Z A;  3NTK A;  1X2K A;  2LDM A;  4RTT A;  4N4I A;  1KHI A;  3ZL7 C;  2COZ A;  2OTJ A;  2VWF A;  3HSB A;  4ESR A;  2DJQ A;  1UE9 A;  4J9H A;  4C92 A;  5CK9 A;  2XU8 A;  1YIT A;  4B9W A;  3TRE A;  3URG A;  2RHX A;  5FWC A;  3CPW S;  4RTY A;  2YLC A;  1SHG A;  3CBP A;  1I0C A;  1XQH A;  2O31 A;  1PRL C;  2YUN A;  2MI6 A;  3JB9 F;  3TSW A;  4R56 A;  2D8J A;  3PT9 A;  1M27 C;  2QQ9 A;  3FC3 A;  3M4G A;  4JLI A;  2CUB A;  2MIO A;  2VUB A;  1M1G A;  1M1K U;  1BI2 A;  4JDS A;  2EFI A;  2OJ2 A;  2RN8 A;  3D7S B;  1NPP A;  1G3T A;  5KYU B;  1BCO A;  3JCM b;  3MO8 A;  2CP7 A;  1NBE B;  1V76 A;  1JJ2 P;  2KXC A;  1RAI B;  2EIF A;  2RHY A;  4ZTF A;  1KJW A;  5IXF A;  2F2W A;  2JS2 A;  2VXF A;  1SEM A;  2X51 A;  2O01 E;  2A36 A;  1BU1 A;  2H3J A;  5HK3 A;  1VQ6 Q;  2EJF A;  3REB B;  1M5Q 1;  2K3X A;  4HVV A;  2YRC A;  3QWY A;  1JRI A;  3C12 A;  2A7Y A;  1M1K C;  3CCQ Q;  2DTI A;  2DK3 A;  5HKC A;  4IKF A;  3G1J A;  5GMK j;  1YIJ A;  2DLP A;  3HP9 A;  2EKO A;  2LQ8 A;  3LW5 E;  1RAH B;  3SDZ A;  4IUU A;  3PNW C;  2D8H A;  2ED0 A;  2RJC A;  3EGD A;  2LNH B;  1YJW T;  4C8Q D;  2JOY A;  3L2W A;  2HQH A;  4M77 G;  1KC8 U;  4PLL A;  1WHM A;  5LJ5 j;  4JRK A;  3CBO A;  2HMA A;  2RA2 A;  2V1Q A;  1YJN T;  4R0K A;  1TG0 A;  3MEA A;  1I5L A;  1VQL Q;  1WFW A;  1M30 A;  1U8R A;  1OOT A;  5GMK e;  3EAE A;  4ZGE B;  2KQW A;  1D3B B;  1FX7 A;  1D0X A;  1VQP A;  4J83 A;  2KE9 A;  2RNA A;  4DOW A;  1ZSZ C;  1YBY A;  3EG0 A;  4C8Q E;  1W70 A;  2F5T X;  3OYY A;  4HKE A;  4C0Z A;  3A8M B;  1NEB A;  4PK4 A;  4B6M A;  5LJ5 e;  2M02 A;  5I2M A;  5CIU A;  2COW A;  3VRY A;  3FJ5 A;  3OMG A;  5DLQ E;  1W4S A;  1TSF A;  1KC8 C;  1VQN T;  1AWW A;  1QP3 A;  4J9G A;  1JXO A;  4C8Q A;  1X27 A;  1T3L A;  2AZS A;  2NUT A;  5HY6 A;  2CH4 W;  4O5V A;  5KYW B;  5GAN j;  2MYS A;  4M7D B;  4F7U G;  3H8Z A;  5LJ3 f;  1KD1 R;  1OX9 A;  4IUV A;  1RLP C;  3UT1 A;  3V8J A;  4MML A;  3M59 A;  1UHC A;  2BZ8 A;  2LNV A;  2J6O A;  5FU6 C;  5FU6 B;  2W0Z A;  4FT4 A;  4JRI A;  4BD3 A;  2QA4 T;  3H0F A;  2ZGW A;  5GAN e;  5J39 A;  5GAM h;  1ACM B;  1Q86 R;  3CME A;  1UEC A;  1LNX A;  5D7U A;  4E7H A;  1IRE B;  4M7A B;  2EYZ A;  4XTU A;  1WHJ A;  2QYZ A;  1AWO A;  1QWF A;  1FMK A;  2JT4 A;  3M4Y A;  5I11 A;  1BI0 A;  3P8H A;  1R8O B;  1PC0 A;  1WHK A;  2BKD N;  4FIB A;  1YHQ T;  4N4H A;  4F16 A;  1MV0 B;  2KYB A;  2FZC B;  2L0A A;  2EJG A;  2CZ7 B;  3VYG A;  4HT9 A;  2DZC A;  3M0T A;  3NHN A;  1AOJ A;  3M57 A;  3PMI A;  1YJW Q;  1SRL A;  2XHC A;  5L8R E;  1ZBJ A;  4JJB A;  1KIK A;  3LGF A;  2DE0 X;  4BY6 B;  1YJN Q;  3NFC A;  2X4X A;  1VQ9 T;  2R5M A;  1RAG B;  5FLX E;  2VVK A;  2V8K A;  2NUP B;  2AHJ B;  1MUZ A;  3X26 B;  4DBH A;  2HKN A;  3OYG A;  2R58 A;  3F70 A;  3EFS A;  1KSW A;  2YXY A;  1YFN A;  4HVU A;  5KYU A;  3VS0 A;  3V7C A;  2QGG A;  1T0J A;  4AFQ C;  5J3B A;  4C0D C;  2CP0 A;  1VQL A;  4OVA A;  3GNF B;  3JCM J;  1G5V A;  4OMN A;  2BZX A;  2FG0 A;  3CC2 T;  3OYM A;  4M75 C;  1GL5 A;  3A8L B;  3G6E T;  1QVF A;  4F04 B;  2X4J A;  4AFZ C;  4GY5 A;  2Y4X A;  4PJN A;  2RI3 A;  1JO8 A;  2QTX A;  4M78 G;  4JRQ A;  4AT1 B;  2YWW A;  2MCN A;  1KQ2 A;  2K5F A;  2LJ0 A;  5GAN 7;  2K2M A;  3TU4 K;  1YJ9 T;  4PJO F;  2RB6 A;  3CCS A;  4WF2 A;  2D6F A;  4UC4 A;  2MWP A;  1S1N A;  2EW3 A;  3ZEH A;  3VJP A;  1ZHI A;  2QEX Q;  1YI2 A;  2ZZD A;  4PL6 A;  1B3Q A;  5AT1 B;  1AWX A;  1NYF A;  3G7Z A;  2QA4 Q;  2LQN A;  1K9M R;  1Z9Z A;  2ZPF B;  2PQW A;  3UF4 A;  4OGE A;  3QJ6 A;  5CKH A;  5GJV B;  5FRM A;  1K76 A;  5LJ5 d;  3LGL A;  5I2S A;  3L2V A;  4BE2 A;  4HCC A;  1D1C A;  1YCY A;  3OMC A;  1UJY A;  3VS2 A;  2MAM A;  5CKB A;  1W2B S;  1DJ7 B;  2JXB A;  3RR6 A;  3SWN A;  2KRS A;  2XK0 A;  3EG2 A;  4M7D E;  1IZ6 A;  4X1V A;  5IN1 A;  3JCM c;  4C92 C;  3VS1 A;  1VQ8 T;  2O9V A;  3MET A;  5LJ5 g;  1VQ5 T;  1WJR A;  4GBQ A;  3JB9 G;  2GBQ A;  2FZG B;  1ZBX A;  4C0G A;  4M7A D;  4CC3 A;  2KNB B;  4LDU A;  2XDB A;  1WDX A;  2CKK A;  1OU8 A;  1CKA A;  2H8H A;  4FU6 A;  2PZ1 A;  4BE1 A;  4EMK A;  1QLY A;  4ELZ C;  4EMG A;  1JXM A;  2B86 A;  2FPE A;  4Q5W A;  1VQ9 Q;  5GJW B;  4M7A E;  2A28 A;  3OYI A;  1X01 A;  3M53 A;  4N0A C;  4X34 A;  5ECA A;  5GAN d;  4AG1 C;  3J80 E;  1N9R A;  1SPK A;  3I9Q A;  2VKN A;  1M3A A;  4L59 A;  1VYT A;  4LDX A;  2LT1 A;  1I4K 1;  4CC7 A;  4FW1 A;  2J6F A;  4MMK A;  2YDL A;  1RAE B;  2KMT A;  2LQK A;  1WA7 A;  1YJN A;  2DXU A;  3PE0 A;  2QQS A;  2GQI A;  1BIB A;  3OQ5 A;  1M3C A;  2L89 A;  1UGS B;  3CC7 Q;  1N27 A;  1FMV A;  5GAN g;  4X9D A;  3OY9 A;  3CC2 Q;  4M7A A;  4ZGJ B;  3G71 T;  3G6E Q;  3LH0 A;  3T9N A;  1HXD A;  3DLM A;  1B07 A;  3CQT A;  2L3S A;  3J7A F;  4AMC A;  2ATC B;  2JM8 A;  5A0G A;  4LUE A;  1QVF P;  1K73 U;  2JTF A;  1OZ2 A;  3E2U A;  4J7F A;  4PJM A;  2XMF A;  3EGD B;  3INZ A;  5IHI A;  3OYE A;  1VQN A;  2CSQ A;  3OYA A;  1YJ9 Q;  2IIM A;  3OS2 A;  1R0B G;  4BB7 A;  4E7I A;  4IUR A;  4XTX A;  5GAO m;  3CCJ T;  3V7S A;  2DRK A;  3I5R A;  2NUP A;  1RAB B;  5D6X A;  3CCE T;  2ZPI B;  1RAA B;  1K73 C;  1QCO A;  4LXC A;  3TVT A;  1NZ9 A;  1U1T A;  3TSZ A;  2EPD A;  4J7I A;  1K8A U;  2XDD A;  1WJS A;  2EWN A;  4QW2 A;  1RAD B;  1VQ6 T;  3H6Z A;  2QA4 A;  1X6O A;  3MEU A;  3O8V A;  1NJI U;  2HDA A;  3OSV A;  4HXJ A;  4C8Q C;  1UGR B;  1WXU A;  1WXB A;  1BI3 A;  3MPU B;  2LMJ A;  1VQ8 Q;  3X25 B;  1U5S A;  1VQ5 Q;  2BTT A;  2P4R A;  2ZPE B;  2PU9 B;  2NUT B;  4JRP A;  2YSQ A;  3E9F A;  1VQO T;  4RMO A;  3JCM e;  3NGP A;  2RJF A;  2DD4 A;  2V8J A;  4DEX A;  2Z0W A;  2RO0 A;  1K8A C;  4J9I A;  2O2O A;  2RQU A;  3A8G B;  3OYN A;  1UGQ B;  2EYW A;  2RQR A;  1YHQ A;  1EFN A;  1BBZ A;  1NJI C;  1PD1 A;  2X3W D;  2DIL A;  3DB3 A;  1QQJ A;  1HYO A;  3DKM A;  1ZA1 B;  4RTV A;  2WSC E;  2KT8 A;  2DEU A;  1Y71 A;  5KYX B;  5CCA A;  1ABQ A;  5DM7 R;  2DKG A;  4E7L A;  4M7D F;  4LD6 A;  3KBG A;  1RLQ C;  2FVU A;  3H0H A;  2DX1 A;  1ZQ1 A;  2LC4 A;  5IT9 E;  3HRS A;  1MHN A;  2DM1 A;  3G71 Q;  1PWT A;  2OI3 A;  2F2X A;  3E19 A;  1O9S A;  2HL5 C;  5AYF A;  3UA7 A;  3G4S A;  3L2Q A;  2VXE A;  1PKT A;  4ZGD B;  1HD3 A;  3UAT A;  3OW2 A;  2EGA A;  3CC2 A;  1VOM A;  3QPH A;  3FJP A;  3G6E A;  4L5G A;  2DO3 A;  5A0D A;  2R57 A;  5IH2 A;  1Q82 U;  2VAS A;  5GAO n;  2X3X D;  3QYG B;  2HNI A;  4J6X A;  3I56 A;  3PFS A;  3CCJ Q;  1GCQ A;  2D0Q B;  2JNG A;  3LX7 A;  4E7J A;  4A4K A;  3L1A A;  4KBM B;  3VS6 A;  1UGP B;  3RNJ A;  4X9C A;  2OX7 A;  3NTI A;  3CCE Q;  1OZ3 A;  4DOV A;  1Y57 A;  1ZSG A;  2KY9 A;  1WZO A;  4OP0 A;  2PUO B;  2B8A A;  3UDC A;  2M9U A;  4P5N A;  2HBP A;  4XTW A;  4IUQ A;  1OV3 A;  2EKH A;  2L3R A;  4JPB W;  3VUB A;  1Q82 C;  2DPP B;  1M1K R;  3X28 B;  1VQM Q;  2CSI A;  1TS9 A;  2NWM A;  4PJO G;  2Y90 A;  2DL8 A;  4Y28 E;  3JB9 H;  4D8D A;  3CCM T;  3CCV T;  2DTH A;  2HKQ B;  4RCC A;  3CXC A;  2QDY B;  3MHX A;  1QW1 A;  8AT1 B;  1VQO Q;  5GMK m;  3QSU A;  4RTU A;  5LJ3 h;  2FEI A;  2EQM A;  3CD6 T;  1Y07 A;  2LZ6 B;  3EHQ A;  2WSE E;  2M1H A;  2HL3 A;  5GMK i;  1SRM A;  1YP5 A;  1D0Z A;  4B9X A;  2KYM A;  4JJN K;  1QVG A;  3HRU A;  1U06 A;  2QXF A;  3C95 A;  4M75 F;  2RK1 A;  3BE3 A;  3L42 A;  2I0N A;  4KH0 B;  1W6X A;  3VS3 A;  1K1Z A;  4OMF B;  1KQS S;  2V1R A;  1H3H A;  1IB8 A;  2KVQ G;  1B34 B;  2C0I A;  3M9Q A;  5LJ5 f;  3CCR A;  4J6W A;  4M77 D;  3RDV A;  1KC8 R;  3SWN B;  1OU9 A;  3VS5 A;  4BI3 A;  4D6W A;  5KE2 A;  3ZFJ A;  3PTA A;  3P8D A;  4J5Y A;  2XIC A;  2JVV A;  4RUG A;  2DIG A;  3DLL A;  1G8X A;  1JQQ A;  4F14 A;  3Q1J A;  3CPW A;  3V8L A;  1ZUK A;  5KCH A;  2DF6 A;  3P8B B;  2LT4 A;  3I55 Q;  2DER A;  2LCL A;  1TOV A;  4CRI A;  4XU0 A;  3JCM d;  2RK2 A;  1LJO A;  3L2Z A;  2EGE A;  3REA B;  2L3Q A;  3HTR A;  2MPX C;  4M7D C;  2VB6 A;  3G71 A;  4EMK B;  3OW2 P;  1BKB A;  3R6N A;  2KEA A;  4ZN3 A;  1RI9 A;  2QEX T;  1MND A;  2CS7 A;  3NTH A;  4RG8 A;  3MEW A;  4A4E A;  4BUG A;  3M0P A;  4MZT A;  4HCB A;  2NLU A;  2X35 A;  1WHG A;  4M77 A;  2QAZ A;  1T3S A;  4XQ3 A;  3JCM g;  2LRQ A;  2ZPG B;  2LJ1 A;  1QCF A;  4C92 F;  1IHW A;  1AEY A;  1X43 A;  5GAN f;  2JMA A;  2DJZ A;  1RL2 A;  3CC4 T;  1UHF A;  1X6G A;  3CCL Q;  2DA9 A;  5KYX A;  4EPC A;  3H41 A;  4DBR A;  2K57 A;  2R5A A;  2LX7 A;  1P92 A;  2K3Y A;  1SSH A;  4M7A C;  2ZPB B;  4PKC C;  5EC7 A;  1LVK A;  3M0Q A;  2FZK B;  4J9C A;  1M2V A;  5KYY B;  4PFP A;  1CKB A;  3LLR A;  3CCE A;  2E4H A;  1MV3 A;  4LD9 K;  1S72 T;  4XU1 A;  1YN8 A;  2VYT A;  3CCM Q;  3CCV Q;  3UWN A;  2QQB A;  1WGS A;  4BDZ A;  2EJ9 A;  5FU7 B;  2FPD A;  1VQ6 A;  1K0S A;  3SFM A;  2DBM A;  3CD6 Q;  1WNL A;  1Q81 U;  3CCQ A;  1VA7 A;  1HJD A;  5KYN A;  3CXC P;  4F7U A;  1TXQ A;  3JV3 A;  3ASK A;  1QCN A;  4BY6 C;  2SEM A;  3QKJ A;  1WHH A;  1M1F A;  2KDS A;  4E7S A;  1VQO A;  1Y96 A;  2E64 A;  1QVG P;  5CVI A;  2RJE A;  2LCS A;  3L2R A;  5GAM j;  1PHT A;  2ZPH B;  4KT0 E;  4XTY A;  2XID A;  3MCA B;  2L5Q A;  2RD1 A;  3QDR B;  1Q95 G;  3EGX A;  2I2L A;  3CMA Q;  3BFM A;  4OF1 A;  3A8O B;  2VC8 A;  3CC7 T;  1G3Y A;  1BIA A;  2J6K A;  1Q81 C;  1KQ1 A;  1VYV A;  3HPW A;  1WLP B;  5GAM e;  4BAC A;  2X4W A;  1UFF A;  1OYX A;  3H0I A;  2XG8 D;  3FRN A;  1SG5 A;  1PCX A;  4OB3 B;  4CC4 B;  2VGN A;  3E1S A;  4EIK A;  4WTO B;  3LYI A;  5CKE A;  3CPW P;  2DXC A;  3VV0 A;  3QZ5 B;  4JZ4 A;  2IPO B;  2DET A;  2A08 A;  4J8O A;  3LWH A;  1QKX A;  3MJX A;  4A4H A;  1M90 U;  4M78 D;  2P4T A;  4C8Q F;  4LE9 A;  2H3E B;  2VV5 A;  4M7D G;  2DD5 A;  5DY9 A;  3V7R A;  1OX8 A;  1OUL A;  1I5O B;  3E9G A;  4KGX B;  4PLI A;  5GAN 6;  3CC4 Q;  4MZP A;  4PJL A;  2FYK A;  2DMO A;  1X69 A;  4C0F A;  4DBF A;  3DB4 A;  4Z89 A;  4N4G A;  3VS7 A;  1B34 A;  3RIR A;  2LJ3 A;  2FRW A;  2K4Y A;  2PUK B;  2XI9 A;  5I22 A;  4XTZ A;  1JJ2 S;  1MMG A;  3RMQ A;  5CKD A;  1M90 C;  1QP2 A;  1S72 Q;  1EIF A;  4J6Y A;  3TCJ A;  3LH5 A;  3GP8 A;  3OYJ A;  4HVW A;  4M78 A;  3SHW A;  1QWE A;  2FL7 A;  2CUD A;  3C94 A;  2DL5 A;  2MWO A;  2A37 A;  4LUD A;  3ULR B;  2CZ0 B;  3CCM A;  2LP5 A;  1M4Z A;  1U3O A;  2M0Y A;  1AVZ C;  4MDX A;  2HEQ A;  3OS1 A;  2AIR B;  1GBQ A;  5CKF A;  3JB9 D;  2ECZ A;  3SB2 A;  4ATO A; 
#chains in the Genus database with same CATH homology
 1NE8 A;  1YJN T;  1UB4 A;  5D6Y A;  3DB3 A;  1MGQ A;  3MEA A;  4BI4 A;  1I5L A;  2RH2 A;  1U8R A;  1YJW A;  5GMK e;  3DKM A;  3EAE A;  4ZGE B;  1FWZ A;  3GLX A;  4XU3 A;  4RCB A;  4KUD K;  4IUT A;  2KQW A;  1D3B B;  1FX7 A;  1VQP A;  2WSC E;  3S6W A;  1Y71 A;  4J83 A;  2PVO B;  4DOW A;  1YBY A;  4HCB A;  5CCA A;  4C8Q E;  3OYB A;  5DM7 R;  2F5T X;  3OYY A;  4HKE A;  3WXM B;  2CZ6 B;  2DKG A;  3RES A;  4HCZ A;  4C0Z A;  4E7L A;  4M7D F;  3A8M B;  4LD6 A;  3KBG A;  5J26 A;  5GAM f;  2FVU A;  2OTJ T;  5LJ5 e;  4FM4 B;  3G4S T;  1ZQ1 A;  4LDW A;  2LC4 A;  5I2M A;  4C5I A;  5IT9 E;  3HRS A;  5CIU A;  3OYC A;  2E70 A;  1YIT T;  1MHN A;  2C06 A;  4C0D B;  2WSF E;  3OMG A;  5DLQ E;  5HK0 A;  1W4S A;  1KC8 C;  1VQN T;  2HD0 A;  3OBW A;  2HQX A;  3E19 A;  1O9S A;  3G4S A;  5AYF A;  4MDW A;  3L2Q A;  2VXE A;  1LOJ A;  1QP3 A;  4ZGD B;  4M75 B;  3FEO A;  2K5L A;  2GFU A;  4M75 G;  4C8Q A;  3OW2 A;  1H3Z A;  1TH7 A;  2FB7 A;  2L8D A;  1WPY A;  2JUF A;  4RKU E;  3CC2 A;  3QPH A;  3FJP A;  4NOY A;  3G6E A;  5HY6 A;  1BYM A;  4L5G A;  4O5V A;  2EYQ A;  3I56 T;  1FXX A;  2DO3 A;  3I55 A;  5GAN j;  1K9M U;  5A0D A;  4FL6 A;  4M7D B;  2R57 A;  4F7U G;  3CCU A;  2RI2 A;  3H8Z A;  1WQ7 A;  5LJ3 f;  1Q82 U;  4IUV A;  5GAO n;  3KUF A;  3QYG B;  2HNI A;  3UT1 A;  3V8J A;  4MML A;  4J6X A;  3VU3 C;  3M59 A;  3I56 A;  4RG2 A;  3PFS A;  2D0Q B;  2JNG A;  3LX7 A;  2QQR A;  3CME T;  2O4X A;  2LNV A;  3BDU A;  4E7J A;  4JRK A;  4HA8 A;  4A4K A;  3L1A A;  3OYK A;  4KBM B;  3GPL A;  5FU6 C;  5FU6 B;  1UGP B;  2QEX A;  4FT4 A;  2PVD B;  2OAU A;  3NTI A;  4JRI A;  1G3S A;  4GLK A;  4M78 E;  4X9C A;  1OZ3 A;  1VIF A;  3A8H B;  2ZGW A;  3MP1 A;  4BD3 A;  4DOV A;  5GAN e;  5J39 A;  1VQ4 A;  4JUV A;  2CZ1 B;  2LX9 A;  5GAM h;  3EFR A;  3CME A;  4XK8 E;  2CGH A;  2KY9 A;  1N6A A;  2E6N A;  3GIB A;  4OP0 A;  2PUO B;  4M77 F;  3RKW A;  2P0K A;  4M7D D;  1D3B A;  4C5E A;  2MF2 A;  2B8A A;  3JCM P;  3UDC A;  1LNX A;  3OYH A;  3J81 E;  3UPU A;  3CCL A;  1K9M C;  1M8V A;  3JRZ A;  1SSF A;  2M9U A;  4P5N A;  2HBP A;  1VQM T;  3VKI A;  2OTL T;  4TVR A;  4IUQ A;  4XTW A;  3RMS A;  5GAM d;  2L3R A;  4FSX A;  4E7H A;  1IRE B;  1G3W A;  3VUB A;  1Q82 C;  3GNG A;  4M7A B;  1X75 C;  4M7A G;  2DPP B;  4LDV A;  4XTU A;  3X28 B;  5KE3 A;  1I81 A;  1YIJ T;  4DQ2 A;  4PJO B;  3CPF A;  4PJO G;  2YRV A;  2Y90 A;  3RKY A;  2P0P A;  4Y28 E;  3JB9 H;  4JS5 A;  3HFN A;  3M4Y A;  5LL6 S;  3CCM T;  3CCV T;  3JCM W;  4ZTJ A;  1BI0 A;  3P8H A;  1R8O B;  3JCM f;  3M55 A;  4O6J A;  2BKD N;  4FIB A;  2DTH A;  1O75 A;  1YHQ T;  4N4H A;  4RCC A;  4C92 B;  3CXC A;  4NL2 A;  2QDY B;  3MHX A;  4C92 G;  5GAM g;  1QW1 A;  2EAY A;  3QSU A;  5GMK m;  4NL3 A;  2EJG A;  5LJ3 h;  2CZ7 B;  4Z02 A;  3CCV A;  4XTV A;  1S72 A;  2EQM A;  1WJQ A;  3CD6 T;  3VYG A;  2CYZ B;  1Y07 A;  4M77 B;  4HT9 A;  2DZC A;  1V29 B;  2GFA A;  2WAC A;  3OS5 A;  2WSE E;  4KUI A;  2M1H A;  1RI0 A;  1VQ4 T;  1N9S A;  3M57 A;  3N5B B;  5GMK i;  3PMI A;  4B9X A;  1QVG A;  4JJN K;  1VQP T;  5LJ3 d;  5IAY A;  3HRU A;  2QXF A;  3C95 A;  4M75 F;  2XHC A;  2RK1 A;  3JSC A;  5L8R E;  1M9S A;  3ER0 A;  2MMP A;  4ELY C;  3CD6 A;  3JB9 I;  5GAO l;  4M7D A;  3QUI A;  3LGF A;  3OB9 A;  4BY6 B;  3NFC A;  2X4X A;  2DXT A;  1U1S A;  2Y4Y A;  1VQ9 T;  3FLG A;  2R5M A;  2X4Y A;  4ME7 A;  5FLX E;  3L42 A;  2V8K A;  4KUL A;  3CCR T;  2AHJ B;  3GF5 A;  3X26 B;  3QJY A;  3OS0 A;  3M5A A;  5C6S A;  4OMF B;  1KQS S;  4QVZ A;  3VYH B;  3OYG A;  4F7U F;  3JAM E;  2R58 A;  3F70 A;  1VQ9 A;  2D9T A;  2KVQ G;  1B34 B;  3EFS A;  3M9Q A;  3QII A;  5LJ5 f;  3HFO A;  3CCR A;  3GOX A;  5LJ3 g;  4J6W A;  2LVM A;  4M77 D;  3M54 A;  3JCM X;  4QQ6 A;  3V7C A;  4V2S A;  2YHT A;  3SWN B;  3CEY A;  1N8R C;  2BIV A;  1Y7X A;  5J3B A;  5CO7 A;  4C0D C;  1VQL A;  4OVA A;  2HQE A;  3GNF B;  4OB2 B;  4BI3 A;  4D6W A;  2QQA A;  3JCM J;  5KE2 A;  3ZFJ A;  4JLG A;  2KSS A;  3OBY A;  5GAN 3;  3PTA A;  1VQK A;  1G5V A;  3P8D A;  3CC2 T;  3CMA A;  4J5Y A;  3OYM A;  2XIC A;  2JVV A;  4IUP A;  3JCM h;  4M75 C;  2DEQ A;  2DIG A;  3A8L B;  3RKX A;  5GAN 8;  3G6E T;  3DLL A;  5GAO r;  1QVF A;  2DTO A;  3VUZ A;  2X4J A;  3BY7 A;  3I55 T;  3Q1J A;  3CPW A;  5LJ5 j;  5M9O A;  3CC7 A;  1I8F A;  2DVE A;  2K2V A;  3V8L A;  4ZN1 A;  3CCU T;  4GY5 A;  2Y4X A;  2RI3 A;  5KCH A;  2PVG B;  2QTX A;  2LT4 A;  3P8B B;  3QHS A;  4M78 G;  2LCL A;  4JRQ A;  4DA4 A;  4CRI A;  4XU0 A;  3JCM d;  2RK2 A;  1LJO A;  3L2Z A;  2E41 A;  2RHU A;  3X20 B;  1VQ7 A;  4A53 A;  3CCS T;  4II1 A;  4F7U B;  2DXB A;  2KK4 A;  4M7D C;  1KQ2 A;  5CR2 A;  2GCX A;  3OA6 A;  3M56 A;  2K5F A;  2KAF A;  1H64 1;  5GAO p;  3G71 A;  4M7A F;  4EMK B;  1W2B A;  1KG1 A;  1YI2 T;  1WQW A;  3OSS C;  2IVW A;  3LWI A;  5GAN 7;  3TU4 K;  2XD0 A;  1BKB A;  5GMK l;  4ZN3 A;  1YJ9 T;  4PJO F;  4A54 A;  5GMK h;  2RB6 A;  3JCM Q;  2QEX T;  3OW2 S;  2CS7 A;  3MP6 A;  3CCS A;  1Y96 B;  4WF2 A;  2D6F A;  3NTH A;  4UC4 A;  3FDR A;  2MWP A;  3RER A;  4RG8 A;  3MEW A;  4A4E A;  3ZEH A;  4BUG A;  2F69 A;  4MZT A;  3VJP A;  4M75 D;  2NLU A;  1ZHI A;  2X35 A;  4M77 A;  4XAX B;  4C5G A;  3PIO A;  1YI2 A;  2ZZD A;  4PL6 A;  4XQ3 A;  1QVP A;  3JCM g;  4C5H A;  2LRQ A;  2JN0 A;  1YJ9 A;  2ZPG B;  4C92 F;  3L2U A;  3PMT A;  5GAN f;  3CCL T;  3HL8 A;  2DJZ A;  4QQG A;  3G7Z A;  1RL2 A;  4QQD A;  3S3O A;  5LJ5 h;  3CC4 T;  2P0Q A;  1JJ2 A;  3AHU A;  4EMH A;  2ZCF B;  2E12 A;  2GF7 A;  4BE0 A;  2ZPF B;  2PQW A;  2V8I A;  3QO3 A;  4OGE A;  4EPC A;  3ME9 A;  4M75 E;  2JZ2 A;  2K57 A;  2XKO C;  2R5A A;  3QJ6 A;  5CKH A;  3JCM V;  5A0L A;  5FRM A;  3CC4 A;  5LJ5 d;  1AHJ B;  1P92 A;  2K3Y A;  3LGL A;  4A4F A;  5I2S A;  5A2Q E;  3L2V A;  4BE2 A;  4M7A C;  4LDY A;  2ZPB B;  3QYH B;  4PKC C;  4HCC A;  1YCY A;  3OMC A;  4N0A A;  4CI0 C;  2MAM A;  4PJO C;  5CKB A;  4PNO A;  4JS4 A;  1W2B S;  1DJ7 B;  4NS5 A;  1BI1 A;  3LLR A;  3CCE A;  3SWN A;  3OYD A;  3QG1 A;  4LD9 K;  2XK0 A;  4M7D E;  1IZ6 A;  5IN1 A;  1S72 T;  4YTL A;  3TEE A;  2YLB A;  4XU1 A;  4QVC A;  3JCM c;  4C92 C;  2VYT A;  1VQ8 T;  3UWN A;  2QQB A;  1WGS A;  3QXE B;  4BDZ A;  4C8Q B;  3MET A;  2EJ9 A;  4XU2 A;  5LJ5 g;  1VQ5 T;  2E65 A;  5FU7 B;  1WJR A;  2GQV A;  4M75 A;  4C8Q G;  3S3N A;  3CCQ T;  3JB9 G;  1UEB A;  1PSE A;  1VQ6 A;  3MP8 A;  5GAN 4;  1N8R U;  5GAN 5;  4M77 C;  4L6V 5;  1ZBX A;  4C0G A;  3SFM A;  1VQ8 A;  3M58 A;  4M7A D;  4LDU A;  2RHZ A;  1VQ5 A;  2XDB A;  3FB9 A;  3V8K A;  1WNL A;  1Q81 U;  2CKK A;  3CCQ A;  4PJO D;  4MZM A;  4F7U A;  4VUB A;  5DLO A;  4E7K A;  3ASK A;  1Q7Y U;  2QA4 T;  4FU6 A;  2E6Z A;  2LTO A;  4OGC A;  4BY6 C;  4BE1 A;  4EMK A;  3CXC S;  3JB9 J;  1XOV A;  5GAN h;  3QKJ A;  2EQJ A;  2JTM A;  4M78 F;  1M1F A;  2KDS A;  4EMG A;  4ELZ C;  3ZBD A;  4BI8 B;  4C92 D;  1VQO A;  1Y96 A;  4Q5W A;  5KCO A;  2E64 A;  4M7A E;  3OYI A;  5CVI A;  2RJE A;  1VQL T;  1X01 A;  3L2R A;  5GAM j;  3M53 A;  4N0A C;  2EQU A;  4X34 A;  5GAN d;  1VQK T;  1QVG S;  3QBY A;  2ZPH B;  3J80 E;  4PJO E;  1N9R A;  4KT0 E;  4XTY A;  2XID A;  3CMA T;  4L59 A;  3MCA B;  5EG2 A;  4LDX A;  2L5Q A;  2RD1 A;  3SWN C;  2LT1 A;  1I4K 1;  3QDR B;  5GAN 2;  4OB0 B;  4HT8 A;  3BDL A;  2I2L A;  2LCC A;  4MMK A;  1OI1 A;  1XNI A;  2KMT A;  3BFM A;  4OF1 A;  3A8O B;  2LQK A;  2VC8 A;  1YJN A;  3CC7 T;  2DXU A;  5I21 A;  1G3Y A;  2A3L A;  1BIA A;  2E5Q A;  2QQS A;  4C92 E;  2RI5 A;  1BIB A;  1KQ1 A;  2E1H A;  2M16 A;  3OQ5 A;  5D6W A;  1Q81 C;  3FIF A;  2L89 A;  2XDP A;  1UGS B;  1Q7Y C;  1N27 A;  5CQY A;  3C4S A;  3PIP A;  1VQ7 T;  2IG0 A;  5GAN g;  4X9D A;  3HHT B;  3OY9 A;  4M7A A;  3HPW A;  4M77 E;  5GAM e;  4ZGJ B;  3A5Z B;  4OB1 B;  3G71 T;  4BAC A;  2X4W A;  4M78 C;  4M78 B;  3LH0 A;  4PJO A;  1KD1 U;  1OYX A;  3T9N A;  3NTK A;  2XG8 D;  1HXD A;  3FRN A;  2LDM A;  5KH6 A;  3DLM A;  4N4I A;  4OB3 B;  1KHI A;  3J7A F;  2VGN A;  2OTJ A;  3BW1 A;  2BUD A;  5LJ3 j;  3E1S A;  2FHD A;  5A0G A;  4FT2 A;  3HSB A;  1K73 U;  3LYI A;  4EMK C;  2JTF A;  5CKE A;  4C92 A;  5CK9 A;  1OZ2 A;  2XU8 A;  1YIT A;  4B9W A;  3TRE A;  3URG A;  2DXC A;  3VV0 A;  3WVE B;  1QVF S;  2F5K A;  4J7F A;  2RHX A;  3QZ5 B;  1PSF A;  3INZ A;  3CPW S;  3OYE A;  1VQN A;  2YLC A;  5C0M A;  5FRN A;  3CBP A;  3OYA A;  4J8O A;  3LWH A;  3HKS A;  3OS2 A;  1Q86 U;  4E47 A;  3WVD B;  3X24 B;  4A4H A;  1M90 U;  3KXT A;  5CQX A;  4M78 D;  1XQH A;  4BB7 A;  2P4T A;  4C8Q F;  2G3R A;  3RUX A;  2VV5 A;  4M7D G;  2E10 A;  2MI6 A;  4E7I A;  3JB9 F;  2DD5 A;  4R56 A;  4IUR A;  4XTX A;  5DY9 A;  3V7R A;  5LJ3 e;  5GAO m;  3CCJ T;  2K5I A;  3PT9 A;  3V7S A;  2QQ9 A;  3FC3 A;  3M4G A;  4JLI A;  4A4G A;  1KD1 C;  3PGG A;  1XTD A;  3E9G A;  2VUB A;  4PLI A;  1M1G A;  5GAN 6;  4Y91 A;  1M1K U;  4MZP A;  1BI2 A;  2FYK A;  4JDS A;  2EFI A;  5D6X A;  3CBM A;  3CCE T;  4C0F A;  2ZPI B;  3DB4 A;  4QVD A;  3CCJ A;  1NPP A;  2DAQ A;  1G3T A;  1K73 C;  3OYF A;  4N4G A;  1NZ9 A;  3S3M A;  1U1T A;  1B34 A;  1KHC A;  3JCM b;  3MO8 A;  3RIR A;  2K4Y A;  4J7I A;  1GXI E;  1K8A U;  2PUK B;  1JB0 E;  2XDD A;  2XI9 A;  1WJS A;  2EIF A;  2RHY A;  3MEV A;  2DZ9 A;  2EWN A;  4XTZ A;  4F7U E;  2EQK A;  1JJ2 S;  4QW2 A;  4ZTF A;  2RM4 A;  2QI2 A;  5CAI A;  1JBM A;  1Q86 C;  1VQ6 T;  3RMQ A;  2VXF A;  5CKD A;  3H6Z A;  2QA4 A;  1M90 C;  2O01 E;  1X6O A;  3MEU A;  3O8V A;  2H3J A;  5HK3 A;  4BDY A;  1NJI U;  1QP2 A;  3OSV A;  4C8Q C;  1UGR B;  2EJF A;  5FU7 C;  1M5Q 1;  2K3X A;  1BI3 A;  1EIF A;  4J6Y A;  5GAO q;  3TCJ A;  3R6O A;  3X25 B;  4R55 A;  3GP8 A;  1JRI A;  2DIQ A;  3C12 A;  2A7Y A;  2ZPE B;  2PU9 B;  4M78 A;  3OYJ A;  4JRP A;  1VQM A;  5FRO A;  1M1K C;  1VIE A;  2OTL A;  2DTI A;  1HK9 A;  2DK3 A;  3OYL A;  2M0O A;  5HKC A;  2FL7 A;  4IKF A;  2RJD A;  3E9F A;  3C94 A;  1VQO T;  4RMO A;  5GMK j;  3JCM e;  1VUB A;  1YIJ A;  2HAX A;  3QZ9 B;  3HP9 A;  2RJF A;  2EKO A;  2LQ8 A;  2MWO A;  3HRT A;  2DD4 A;  3LW5 E;  3SDZ A;  2V8J A;  4IUU A;  3PNW C;  2RO0 A;  3SD4 A;  1K8A C;  2VGM A;  2CZ0 B;  3CCM A;  3A8G B;  1M4Z A;  3OYN A;  2RJC A;  1UGQ B;  4MDX A;  4EDU A;  1NPR A;  2O4X B;  3OS1 A;  1YJW T;  1YHQ A;  4C8Q D;  2JOY A;  3L2W A;  1KQS A;  4M77 G;  5CKF A;  1KC8 U;  3JB9 D;  4PLL A;  1NJI C;  2RHI A;  3SB2 A;  3CBO A;  4ATO A;  2RA2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...