4OF1A

Crystal structure of toxin from staphylococcus aureus mu50
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
115
structure length
115
Chain Sequence
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIRTLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords mRNA interferase MazF
publication title Structural Insights into the toxin from Staphylococcus aureus Mu50
rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 33
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4of1A00
5CKBA 4MDXA 3TCJA 3HPWA 5CKFA 3VUBA 2KMTA 5CO7A 1NE8A 5CR2A 4HKEA 2VUBA 5CK9A 4MZTA 4MZPA 3JSCA 4MZMA 4ELYC 2MF2A 5DLOA 5CKHA 5CCAA 3G7ZA 1UB4A 4VUBA 3JRZA 5CQYA 4ME7A 4ELZC 5HKCA 4OF1A 5HK0A 5HK3A 1M1FA 5CKEA 1VUBA 5CKDA 2C06A 3NFCA 5CQXA 1X75C
chains in the Genus database with same CATH superfamily
2HKNA 5C6SA 3KBGA 3HFOA 4OMFB 2EBPA 1GFCA 1YI2T 1Y96B 2F5TX 1AHJB 3FDRA 3CXCP 4FYWB 2YLBA 3OYYA 3CCRA 2DIGA 1M1KU 4CI0C 2DLPA 4IKFA 1NPRA 5A0DA 5GMKj 1AWWA 4ME7A 1YCYA 2X51A 3JCMh 4M75A 1AWXA 3MEAA 1WXUA 5CR2A 3MP1A 2PTKA 1UTIA 4X34A 2Y90A 2DTOA 3SWNC 1BCOA 1KQ2A 2RJCA 1JXMA 4XU1A 1X01A 3EG3A 2KRMA 2M0YA 1PKTA 3N5BB 3A5ZB 2GF7A 2K2MA 2KBTA 2XK0A 2AK5A 3U23A 1M3CA 5GAN4 3CCEQ 2KGTA 3QIIA 1XOVA 4EMGA 4D8KA 2LRQA 4PJOC 2B8AA 2PVDB 3CPWA 2NUTA 3EG9A 4C0FA 4E7ZA 3BDUA 4M77G 1MMGA 1OYXA 3X28B 2DKGA 2FZCB 4D6WA 1SKUB 1WHLA 5FLXE 2EQIA 3QG1A 4HCKA 2EYWA 1D3BB 4LUEA 3T9NA 5CQXA 5GANg 3GLXA 3LYIA 1M1GA 1OEBA 5CVIA 3WVEB 1WLPB 4RTTA 3S3OA 1Q86U 2ROLA 3FJPA 2VUBA 3PGGA 2I0NA 4ZGEB 1K76A 1A0NB 5D6XA 2DVEA 3VYHB 1QCOA 2FYKA 3EHQA 2L3QA 2EVRA 1JJ2A 5FRNA 4HT9A 2YUQA 2L0AA 2DRMA 8ATCB 1N8RR 4OMMA 2M9UA 3NTIA 5GANj 1QVFA 4YTLA 5KYWB 5GJWB 3JB9D 3OMGA 2JNGA 5CK9A 2E3IA 1W4SA 1VQ6Q 5LJ5e 2JT4A 1D1CA 3FB9A 1YJNT 1VYVA 2EGEA 2R5MA 1XTDA 3I5SA 3L1AA 2RQWA 4OMLA 1K8AU 4E7SA 4XTZA 4MMLA 2PQWA 1IHWA 1PRLC 2QDYB 8AT1B 3LW5E 4FW1A 1RAHB 3PTAA 2EJ9A 4C92D 4MMKA 1VQ6A 5FRMA 3X24B 3GOXA 3JCMP 2RH2A 1RABB 4M75E 2KI7A 4WTOB 5GMKe 1T3LA 1LPLA 4A63B 4GLMA 5CKEA 5CKDA 1Y71A 1LOJA 4D8DA 1ZSZA 1SHGA 3OYLA 3TSZA 4J7FA 1FYNA 2LTOA 3MKDA 4C5GA 1I5OB 1UGSB 1D1BA 1YHQA 4M78C 2RQRA 4JLGA 3H8ZA 4C92A 2HAXA 4B9XA 2VASA 4DQ2A 1N27A 1GRIA 4J6XA 1RI9A 3M55A 2J6OA 1NEBA 1RAGB 1HSQA 1OZ3A 1Q81C 5GANf 4OGEA 2J6KA 2KE9A 3EH2A 1MUZA 4HVWA 4FCYA 4PJOD 3CC7T 3QXEB 1K9MU 3NFCA 3ASKA 3NPFA 1B3QA 1NG2A 2DYIA 2VC8A 3SWNA 2OTJT 1QVGS 2DA9A 4EDUA 2EQMA 1U8RA 1LCKA 2O4XB 5A0GA 1QVPA 3CC4Q 2MWPA 3A8HB 1N9SA 1K73U 1F1BB 2GCXA 2QDLA 1GCQC 1QKXA 3I35A 4XQ3A 2HCKA 3JCMJ 2RQTA 4BI8B 4C0DB 2DERA 4PJOA 2ATCB 2COZA 1MNDA 1OU8A 1Q95G 2MIOA 4HA8A 2CP2A 2FB7A 4A4GA 5GANe 5LJ3g 4UC4A 2DL3A 2DK3A 2F2WA 4NS5A 5LJ5h 1IREB 2W10A 3JV3A 1NYGA 3CC4A 1W2BP 2EYQA 1VQMT 2QEXQ 3G4SA 4XK8E 3A8LB 2CZ6B 5CKHA 4CRIA 4FSXA 4PLIA 3VS6A 2XKOC 2YHTA 1AWJA 2PVOB 5A2QE 2FHDA 1AOJA 2DVJA 1TUGB 5LJ3j 2QEXA 2L3PA 5GMKh 3X25B 1WHJA 1G2BA 2HDAA 2B86A 2LMJA 1Q7YU 3EH1A 2DL5A 1TSFA 4AFQC 1VYTA 2JTEA 3CMEQ 5IT9E 1NJIC 3INZA 5IHIA 2VB6A 1B07A 2HBPA 1QP2A 1YJ9Q 2K2VA 1IGUA 4C92E 2DXBA 3E19A 2IG0A 3REAB 3CCMT 4GBQA 3CMEA 3QJYA 3PT9A 3IQLA 1SF9A 3L2ZA 2OX7A 1ZA1B 3L2UA 3P8DA 1YJ9A 3G6ET 5DM7R 4LDWA 2DBKA 1VQ4T 3X20B 1M90R 2C0IA 3QBYA 3KFVA 4F04B 2MK5A 3OQ5A 2DFUA 1VA7A 4XU3A 5L23A 4KGZB 1G3SA 3NGPA 2O9SA 3A1PA 1X75C 5EC7A 4LN2A 4M78A 1VQLQ 2RB6A 2CREA 2E1HA 3CCJA 2GQVA 3OY9A 5LJ3f 3NTKA 5FWBA 1RUWA 4XU0A 3H0IA 4PJOE 5GANh 2RHXA 3CCLQ 2JM8A 2M02A 2DEUA 5ECAA 2EKOA 3VUBA 4JJNK 4AMCA 1VQOT 2K4YA 2RF0A 3FEOA 3M0RA 1PD1A 3RMQA 2AKKA 2WACA 1BI0A 5DLQE 3RNJA 1RAFB 1IZ6A 2P4TA 2D8JA 1VQKQ 3CPWP 1KD1U 3CCLA 3M53A 3CCQQ 1QLYA 1NZ9A 4RCCA 1PNJA 4E7JA 1JBMA 4RTWA 3OYGA 4JS4A 1YCSB 1OX9A 2F1LA 1M8VA 1TG0A 2DXUA 5IN1A 3RUXA 2JTMA 1VQKA 1GCQA 1RL2A 3M57A 1NM7A 4AFUC 5A0LA 2YXYA 3MEUA 4C5IA 3CCQA 2LJ1A 1RACB 1BK2A 3RIRA 3LX7A 5KYYB 4OP0A 1BIBA 4KULA 3Q1JA 2I2LA 2YRCA 1JJ2P 1OI1A 4RTYA 1U06A 4DOVA 2MMPA 1E6HA 1QCFA 2RI5A 4IUPA 2F2VA 4LXCA 3R6NA 1QVFP 3QWYA 2P0PA 2LQNA 4HCCA 2YUNA 1OULA 2VXFA 4J9DA 4IIOA 4M77C 4PJMA 4ELZC 1JO8A 4JRIA 4FIBA 4M7AF 4M7AG 3THKA 3TSWA 3MHXA 4J8OA 1YITT 3BW1A 4C8QF 1KK7A 2BUDA 3PE0A 1QCNA 3R6OA 1Q82R 3E9FA 1AZGB 4M78E 2RO0A 1Y96A 2AZSA 2KMTA 1MMDA 2QAZA 3TVTA 4BE1A 1M27C 4MZMA 2PVGB 5GAOl 2CZ1B 5GAN7 5CQYA 3OYHA 2M0OA 2ROTA 3CMAT 2O2OA 2HKQB 2G6FX 2DRKA 5FU7B 2LNVA 1UGVA 3CCSQ 5M9OA 4FT4A 4P5NA 5D6YA 1UGQB 4N4GA 1FXXA 1OPLA 5LJ5g 1G5VA 3M58A 5GAOr 2A08A 1RLPC 4RUGA 2EYYA 1I8FA 5LJ3h 1RAEB 3BY7A 4ZTJA 3CCSA 1NYFA 2JMAA 1JRIA 4IURA 3BFMA 2MYSA 3ER0A 2J05A 4F7UF 3EGXB 1MGQA 4F7UG 3I9QA 3PFSA 2XIDA 5J26A 1WXBA 5LJ5j 4M7DF 1D3BA 4M7DG 1D0XA 3CCET 4KGXB 4HXJA 1ACMB 3JAME 4C8QB 4HT8A 1PWTA 3A8OB 3JB9J 2DNUA 3ZFJA 1LNXA 3OW2P 1KJWA 2P4RA 3LGLA 4BUGA 3JSCA 4II1A 2DYBA 3M0TA 2CH4A 4PNOA 1Q81R 4DBRA 2MOXA 4Z89A 1UG1A 5GJVB 1RLQC 5I21A 5KYWA 4AFSC 2L8DA 2JXBA 2F5KA 1OQKA 3M4YA 1ZBJA 3OBWA 1OZ2A 2CP0A 2EKHA 2ZPGB 2RMOA 2CP3A 4M75G 1N8RU 1RAAB 2GTOA 1N5ZA 2BZXA 4XTUA 2DE0X 5DY9A 3OYCA 5HK3A 2ED0A 1I81A 3QYGB 4V2SA 4QT7A 5IXFA 1VQ6T 2MPXC 3AHUA 3I55A 4M77F 2D1XA 1HD3A 4M4ZA 1PC0A 2O9VA 3UA6A 4OB0B 1Y07A 4F7UB 3CPFA 2QQSA 2E4HA 4FT2A 4IUVA 1TUCA 2D9TA 3MP8A 4RKUE 5LJ5f 2XMFA 4WF2A 3VRZA 4K11A 4A54A 5CO7A 2X3WD 3VS1A 1I5LA 2KROA 2DEQA 3CCUA 4F17A 2BE7D 1Q82C 2RI3A 1V29B 4GY5A 3JCMW 4E6RA 1X27A 1M1KR 2HQEA 2GTJA 1KC8U 3HSBA 2X3XD 2K5IA 3A98A 2DPPB 3OYMA 1NJIR 2PNIA 3WVDB 2EQUA 1AZEA 1TOVA 2MF2A 1YN8A 1NLPC 2QQRA 2YRVA 2SEMA 2NLUA 3CQTA 2EIFA 3VU3C 1FWZA 3L2QA 3RMSA 3TCJA 1M3AA 2O4XA 4IUQA 4JRQA 2YSQA 2J7IA 2PUOB 1GBQA 4J9GA 1FMVA 3LWIA 2CUDA 1YHQQ 1BIAA 2K3BA 3SEMA 4QVDA 2GFUA 4WCIA 3URGA 1SPKA 3CD6Q 4M77B 3H0HA 4E7IA 2KT8A 1I4K1 4E2FB 3UF4A 2RQVA 3VS7A 4RG2A 3GP8A 4KT0E 1PCXA 2LQKA 3S3NA 2IVWA 3CC4T 1VIFA 2XDBA 2KR3A 4X9DA 3JB9G 3UATA 1PD0A 4HKEA 5I2MA 3JCMb 4FYVB 4CC4B 2XDDA 2EYZA 1MMAA 1UFFA 3LH0A 3DB3A 1IGQA 2CT3A 3CD6A 1U1TA 2OAUA 2RJFA 2E5QA 2QQBA 2C0TA 2DM1A 4KUDK 3HKSA 4PJNA 2NWMA 4MDXA 5GANd 2QEXT 2OTLQ 5J3BA 3OYIA 3VRYA 3RKXA 2QASA 2JUFA 4DEXA 5IXBA 1T0JA 1TTHB 2CZ0B 2DXTA 3EG2A 2XD0A 2YT6A 1VYUA 1C6VX 3EGDB 2CP6A 4RTUA 2FO0A 2DO3A 1EX4A 1K9AA 2LCSA 1U3OA 2HQXA 1WHKA 1K8AR 1LVKA 4OGCA 1T3SA 1WYXA 2OTLA 3QDRB 2VWFA 2JMCA 2CKKA 3M5AA 2O01E 2YLCA 2JVVA 1V76A 3CMET 5FW9A 4A4HA 5CCAA 1KQSS 5KYUB 3G4SQ 1YJNA 1VQ9Q 3MJXA 2X4XA 4X1VA 1JQQA 4JJBA 2F2XA 2DBMA 1SEMA 3PMIA 1YJ9T 3CPWS 4XAXB 5FU7C 5GAN2 2H3JA 1KG1A 2YRDA 1P92A 1NEGA 1TXQA 1U5SA 3OMCA 1SHFA 5GAOm 3EHRA 4JDSA 1VQ9A 1ZA2B 2FPEA 2KAFA 2E5KA 4ZN1A 3FC3A 1EZZB 3OYNA 3HL8A 2CP7A 4HCBA 2XU8A 1YBYA 1S72Q 2LCCA 1HJDA 1QW1A 2ZPHB 1M90U 3G71Q 1JJ2S 4M7AC 1D1AA 2FZGB 1M1KC 1X2KA 3M9QA 1HYOA 1E6GA 1D0YA 4JS5A 1AT1B 1IB8A 3V7RA 1PG5B 3I56T 2CS7A 5IHNA 4J7IA 2LZ6B 5AT1B 4BI3A 1QVFS 4B9WA 4C8QC 2X4WA 5FROA 1VQLT 3CC7Q 1YWPA 1S72A 1PHTA 3VS5A 4C0GA 1DJ7B 2DTHA 2DD4A 3EFOB 3G71A 1IHVA 3QUIA 1M2OA 2FG0A 2J06A 2DZ9A 1VQ5T 4ELYC 3CCLT 1VOMA 2PUKB 4J6YA 4R56A 1K73R 3OYDA 3PIOA 1TUDA 4NL2A 1WHHA 2ZGWA 3CC7A 4BB7A 4FYXB 4J9HA 1WXTA 2V26A 3JB9H 1ZSGA 4M78D 1N6AA 2W0ZA 2LNHB 2XHCA 2OTJA 1XNIA 1OPKA 3HRUA 1X69A 1J3TA 1UUEA 1VQKT 3QO3A 4DBQA 2QGGA 2VYTA 2CGHA 1OX8A 3CCQT 5KYYA 1VQMQ 1GCPA 1G3WA 2COYA 2KT1A 3CCJQ 1WA7A 2GQIA 3GBQA 4LDVA 4PFPA 4A4KA 2BKDN 4ZTFA 3EAEA 1BKBA 1W70A 4AT1B 1Q86C 2XDPA 5LJ3d 3QKJA 2EFIA 4E7LA 3M54A 3META 1VQMA 2QA4Q 3JCMX 2LDMA 3OB9A 3OSVA 3OYKA 2FPDA 4E7KA 3V7CA 1Q7YR 2EJGA 4KH1B 3KXTA 5AYFA 1M1FA 2C06A 3CCVQ 4CC3A 2RK1A 4OB3B 5CKBA 3DB4A 4L6V5 1YJWT 4M7DC 1MV3A 2LQWA 1GL5A 1IO6A 2D6FA 1VIEA 1GFDA 2OAWA 2DF6A 5CAIA 4PK4A 2QA4A 1IRXA 1D0ZA 5KYXB 1AVZC 1BU1A 4XTXA 5GAMg 1M2VB 4NL3A 2E64A 3CCMQ 3DLLA 1XJWB 2E41A 1K8AC 3CCVA 1GBRA 4BY6C 2DJQA 3JB9I 2R5AA 4E47A 2LP5A 2FPFA 3JCMd 2QQAA 3QJ6A 3CCMA 3C4SA 5GAMj 3O8VA 2KXCA 3OW2S 1AWOA 3HP9A 1ARKA 3CXCS 2MCNA 4BDZA 4AG1C 2FZKB 2BZYA 1B34B 1EIFA 4M75C 3HRSA 4RG8A 4MDWA 9ATCB 5IHKA 2VV5A 1XQHA 2L3RA 3KUFA 1GXIE 4PLLA 4C8QD 2L2PA 3GNGA 2VVKA 3VJPA 1VQNQ 2OJ2A 2HL5C 2DILA 3CCST 3V8KA 3PVQA 3EGXA 3E2UA 1MNEA 1NPPA 4OVAA 2QYZA 2EPDA 2L3SA 4OB2B 2K5FA 4A53A 1VQNA 3JCMc 1BI3A 4EMHA 4LE9A 4C8QA 3A8GB 1MHNA 4L5GA 1K9MC 4LNPA 4QVZA 1SRLA 1HXDA 1SSFA 5GAOp 1X6OA 3NTHA 2LT1A 5EG2A 2JS0A 1RAIB 1PRMC 2NUPB 1R77A 1H3ZA 3UDCA 3CCRT 4FSSA 3MCAB 1K73C 2HSEB 3OYAA 2LX7A 1C1AA 1X2QA 4ANJA 3NMZC 5GAMf 2PZ1A 1QWEA 2E6ZA 2YDLA 1ZUYA 2CYZB 1UDLA 1VQ7Q 2R58A 2COWA 1NBEB 4IUTA 4O6JA 2JM9A 3H6ZA 1QQJA 1Q81U 3DLMA 2RQUA 2DX1A 2A36A 2VGNA 1OU9A 2RHUA 2H8HA 2KVQG 3OYFA 1W1FA 3J80E 2EQKA 1X43A 1VQ7A 2LJ0A 2ZPIB 3L42A 2BIVA 3L2WA 5CIUA 3L2RA 2EJFA 2ZPBB 2ZPEB 2Z0WA 4M7AB 2X9HA 4F7UA 1Q7YC 1ZQ1A 3GF5A 5GAMe 1BCMA 3JRZA 4FM4B 3S6WA 1VQPQ 1O9SA 1X6BA 2RI2A 1KSWA 1KFZA 3LLRA 2E70A 3GIBA 4JJCA 2NYSA 2KQWA 4HVVA 2WSEE 1ZSZC 3LGFA 3VS0A 3C12A 3EG1A 1V1CA 5J39A 1YITA 2RHIA 3OYEA 1VQPA 3S3MA 3M0SA 1YIJQ 2QK0A 1BI1A 4QQ6A 2ZAEA 5HK0A 2DJZA 4M7AE 2BTTA 4LD9K 3M56A 3CMAQ 1R0BG 2KXDA 3RKWA 2QTVA 5HY6A 2JW4A 1YWOA 4Y92A 2AIRB 2KRNA 4JZ3A 3CC2Q 2KYBA 3EGUA 4Z8AA 3SDZA 5KE2A 1JU5C 4EMKB 4C8QE 4M77D 2LC4A 3I55Q 1YIJA 3M4GA 4M75F 2MI6A 2EGCA 1E7OA 2ED1A 2LT4A 2KRSA 2DAQA 2HL3A 1H8KA 3CMAA 1K0XA 5I22A 3RR6A 4RTVA 3CC2A 1NJIU 1WIEA 3HPWA 2GBQA 7AT1B 3P8BB 2V8IA 3REBB 3UT1A 2ENMA 1B7TA 2X4YA 3M0QA 1QVGA 3OS1A 1CSKA 3TQ7P 1VQ8Q 3CCUQ 5LJ5d 4KUIA 4M77A 4JLIA 4XU2A 1KQ1A 1KQSA 4E7HA 4LD6A 1S1NA 4J9FA 2AHJB 2ESWA 4M7DB 1CKAA 4JUVA 3VUZA 4QQDA 2K5LA 4ORZA 1YHQT 2WSFE 2RA2A 1VQ8A 4C5HA 5HCKA 4Q5WA 1YI2Q 1KD1C 4PJJA 3C95A 3CD6T 2CDTA 2V8KA 1M4ZA 3CCEA 2XICA 1W2BS 1WQ7A 2GFAA 3TREA 2JTFA 3BE3A 4BY6B 3P8HA 1D09B 3OS2A 3D7SB 1ZX6A 1TWBA 2RNAA 5I11A 4F7UE 1ZUUA 2KK4A 5GAMh 3RKYA 2RHYA 1YI2A 3EGDA 3MEWA 1I07A 2LVMA 4EIKA 3AT1B 3EFSA 4M7DE 4Y91A 1YNZA 1I0CA 4F14A 4ZGDB 2FRYA 3QHSA 2X4JA 2OTLT 5FU6B 2OI3A 4NOYA 1WJSA 2XG8D 3QYHB 2QGFB 2IPOB 4M75B 3OBYA 1BBZA 4A4EA 2RM4A 4X9CA 1TH7A 4BI4A 1WGSA 1MV0B 3CEYA 5KYUA 3MP6A 4N4HA 2GNCA 4QKUA 3PVLA 4Z88A 3V8JA 1R0CB 3V8LA 3HFNA 5KE3A 1FMWA 1MMNA 1VUBA 1TU0B 1UJYA 1PSEA 1JXOA 3EG0A 3VYGA 4RTXA 1WJRA 2CSIA 1QP3A 2X35A 3LH5A 4LDUA 2FVUA 2V8JA 3JB9F 1UHFA 2AT1B 1Q86R 3G4ST 2D8HA 4Z02A 4N0AC 1VQ9T 1M9SA 1YP5A 2NUTB 3EG9B 3V7SA 2A0FB 2DMOA 1WNLA 2GGRA 3SD4A 2E6NA 2HEQA 2DIQA 1KC8R 4DBHA 3C94A 5GAOq 2EGAA 5CKFA 4Y28E 1M5Q1 3FLGA 4M77E 4C92F 2P0KA 2QXFA 4MZTA 4C92G 5IAYA 2K3YA 1WPYA 3QZ9B 3G1JA 5DLOA 2K3XA 4O5VA 4ATOA 1K0SA 3UWNA 3JCMV 2K57A 1BYMA 4F16A 4JZ4A 2M1HA 4OMQA 1YJNQ 3UPUA 1S72T 2DL7A 1KHCA 3EFOA 2CT4A 1WQWA 4J6WA 3G71T 4LDYA 3O5ZA 2YUPA 1WI7A 1SG5A 2G3RA 3BDLA 5IH2A 3MEVA 2RJDA 4TVRA 3QWXX 4CC7A 1UECA 1LJOA 4J9IA 4FYYB 4DA4A 2JOYA 4PFZA 4ESRA 1SSHA 4QVCA 1WHGA 1H3HA 4N4IA 1ABOA 4PJOF 4BE0A 1FX7A 4PJOG 3OW2A 4OB1B 2QG9B 3CXCA 5KYNA 4BACA 4PKCC 3VKIA 1Z9QA 2YWWA 1ZSZB 4PFOA 2CSQA 3CCJT 4LDXA 4BDYA 1BB9A 5GAN6 3L2VA 1N9RA 3CBPA 4VUBA 1R8OB 4GLKA 4BE2A 1OV3A 4OF1A 4C92B 2CH4W 3RERA 4BD3A 1WJQA 2O88A 1JEGA 2FL7A 3M0PA 1SRMA 2R57A 1K9MR 5KYXA 3M59A 2QA4T 1Y7XA 1M2VA 3VS4A 1U1SA 2LX9A 1Z9ZA 1T0HA 2OTJQ 1PKSA 2RHZA 1G8XA 3F70A 2QTXA 1N8RC 3CCVT 3I5RA 1JB0E 3DKMA 2FEIA 2FRWA 3NHNA 3PIPA 3EFRA 1RADB 5KCOA 2L89A 3JCMg 3MPUB 3VV0A 2E10A 3ZEHA 4OMPA 4HCZA 2RPNA 3SWNB 1NLOC 5KCHA 4EMKC 3H0FA 3LWHA 2CZ7B 4OMNA 2CUBA 3FRNA 1B34A 4ZNXA 3WXMB 3VS3A 4DEYA 2RN8A 5GMKm 2MWOA 2JZ2A 4R55A 1PSFA 3RESA 2E3HA 3OSSC 2PU9B 2DD5A 2ZZDA 4JRPA 3MO8A 2E12A 3OS5A 2RJEA 4N0AA 4PJOB 3PNWC 3M0UA 1QMCA 4KGVB 3GNFB 4J83A 1X6GA 3RBBB 3TEEA 2YUOA 1UB4A 4OMOA 2WSCE 2HNIA 1KC8C 1PM3A 1QWFA 2DZCA 3I56Q 2AKLA 2E65A 4AG2C 1W6XA 3SHWA 2KYMA 4M78F 1I1JA 4M78G 1CKBA 1AEYA 3TU4K 1IXDA 3CBMA 1UGPB 2KEAA 2LQ8A 3JCMQ 3RDVA 3ZL7C 1VQNT 2NUZA 2EAYA 4J9EA 1VQ5Q 3I56A 2P84A 1QVGP 1K4US 3GPLA 2EYXA 2DXCA 2O31A 2NUPA 1ZBXA 1VQLA 2ECZA 4FL6A 4PJLA 1KQSP 2ZCFB 5FWCA 3FIFA 2Y4YA 3G6EQ 1EFNA 1VQ5A 1Q82U 4JJDA 2DETA 3X26B 1VQ4Q 4EPCA 2BE9B 2ABLA 1C0MA 1KIKA 4LUDA 2AZVA 2K79A 4XTWA 5FU6C 2P0QA 1UGRB 3J81E 1ZLMA 4M7AD 1KHIA 3ULRB 1O75A 1UJ0A 5LJ3e 3E1SA 2LCLA 2LJ3A 3G6EA 4QW2A 1K1ZA 3J7AF 1WDXA 4ZGJB 2HZYA 2HQHA 2K7AA 2Y4XA 1VQ4A 2J6FA 6AT1B 3JCMf 1QKWA 3QSUA 1RI0A 4XTYA 3SFMA 2K9GA 4R0KA 2CP5A 4XTVA 2M51A 3QDFA 5GAN3 1VQ7T 1G83A 2HBWA 3HRTA 4KBMB 4M7AA 2DL4A 2EQJA 1YJWQ 4J9BA 1WHMA 1M3BA 3A8MB 4RCBA 4A4FA 1VQOQ 2H3EB 3E9GA 4M78B 5C0MA 1YFNA 1BI2A 2MAMA 2V1RA 2DTIA 4KRTA 2JN0A 1KD1R 3CBOA 3ME9A 5GMKi 5GMKl 3SB2A 2HSPA 2DL8A 2VGMA 1WFWA 1YJWA 2A37A 3OYBA 3JCMe 1NE8A 4C0ZA 5KH6A 2IIMA 1VQOA 2M16A 3HTRA 2QQ9A 3OYJA 1VQPT 2L5QA 4C8QG 3OS0A 5GAMd 1G3TA 3VS2A 5GAOn 3H9NA 3ZBDA 4JPBW 1UHCA 3PMTA 2C0OA 3H41A 1W2BA 1FMKA 2KSSA 4DBFA 1UE9A 1WZOA 4EMKA 4FW2A 4IIMA 4DOWA 2JJ9A 1YIJT 4MZPA 2BZ8A 1WX6A 1UEBA 2QI2A 5LL6S 1M8MA 4M7DD 2XI9A 4JRKA 2K6DA 5HKCA 2KDSA 4RMOA 4FU6A 3CC2T 4IUUA 2A28A 1ABQA 3FJ5A 1G3YA 2F69A 2D0NA 1OOTA 3I55T 2ZPFB 1M90C 2HD0A 2D0QB 4J9CA 4CC2A 4PL6A 1H641 3G7ZA 2SRCA 4QQGA 1YITQ 2JS2A 5L8RE 2HMAA 2VKNA 1Y57A 2A7YA 4C0DC 1Y0MA 4KH0B 4M7DA 5GAN5 3HHTB 1M30A 4B6MA 3OA6A 3QZ5B 4C5EA 5D6WA 5D7UA 2RD1A 1AD5A 4HVUA 1VQ8T 2EWNA 3UA7A 3CCUT 2V1QA 4L59A 2A3LA 4J5YA 5GAN8 4ZN3A 5I2SA 2KY9A 2KNBB 3C0CA 3QPHA 3CCRQ 2EW3A 4M75D 2RK2A 4RTZA 1TS9A 4C92C 4AFZC 2VXEA 1H92A 1ZUKA 1ZHIA 1HK9A
chains in the Genus database with same CATH topology
5C6SA 1OI1A 3KBGA 3VYGA 1S72A 3HFOA 1WJRA 4C0GA 1DJ7B 2DTHA 4OMFB 1QP3A 2MMPA 2X35A 4LDUA 2DD4A 4DOVA 3G71A 3QUIA 1YI2T 2FVUA 2V8JA 1Y96B 2RI5A 4IUPA 2F5TX 1AHJB 3JB9F 3FDRA 2DZ9A 3G4ST 2YLBA 3OYYA 4Z02A 4N0AC 1VQ9T 3CCRA 1VQ5T 1M9SA 2DIGA 4ELYC 2P0PA 4CI0C 3CCLT 1M1KU 4IKFA 4HCCA 2PUKB 4J6YA 3V7SA 1NPRA 4R56A 1WNLA 2VXFA 5A0DA 3SD4A 5GMKj 3OYDA 2E6NA 3PIOA 4M77C 2DIQA 4ME7A 4NL2A 4ELZC 1YCYA 2ZGWA 3JCMh 3CC7A 4JRIA 4M75A 5FROA 4FIBA 4BB7A 3C94A 5GAOq 4M7AF 4M7AG 3MEAA 3JB9H 4M78D 1N6AA 5CKFA 3MHXA 2XHCA 4Y28E 1M5Q1 1XNIA 2OTJA 4J8OA 5CR2A 3FLGA 3HRUA 3MP1A 4X34A 2Y90A 2DTOA 3SWNC 3QO3A 1VQKT 2VYTA 4M77E 4C92F 2P0KA 2QXFA 3BW1A 4MZTA 4C92G 5IAYA 1YITT 1KQ2A 2RJCA 2CGHA 2K3YA 4XU1A 4C8QF 1WPYA 3QZ9B 3CCQT 5DLOA 2BUDA 1X01A 2K3XA 4O5VA 3R6OA 1G3WA 3E9FA 4ATOA 3UWNA 3JCMV 2K57A 3A5ZB 2GF7A 3N5BB 1BYMA 2XK0A 4LDVA 2M1HA 4A4KA 3UPUA 1S72T 2BKDN 1KHCA 5GAN4 4ZTFA 4M78E 2RO0A 1Y96A 3QIIA 1XOVA 3EAEA 4EMGA 1WQWA 1BKBA 4J6WA 3G71T 2KMTA 4LDYA 2LRQA 1Q86C 2XDPA 4PJOC 2B8AA 2PVDB 5LJ3d 4BE1A 3QKJA 2EFIA 4E7LA 3CPWA 3M54A 4C0FA 3META 3BDUA 4M77G 1VQMA 1OYXA 4MZMA 3X28B 2PVGB 2LDMA 3JCMX 2DKGA 5GAOl 2CZ1B 3OB9A 5GAN7 3OSVA 3OYKA 4D6WA 5CQYA 4E7KA 2G3RA 3BDLA 3V7CA 3OYHA 2M0OA 2EJGA 3CMAT 5FLXE 3MEVA 3QG1A 3KXTA 5AYFA 1M1FA 1D3BB 2RJDA 3T9NA 2C06A 5CQXA 5GANg 3GLXA 3LYIA 2RK1A 1M1GA 4OB3B 3DB4A 4L6V5 4TVRA 5CKBA 5FU7B 5CVIA 3WVEB 1YJWT 4M7DC 1LJOA 2LNVA 2D6FA 1VIEA 3S3OA 4DA4A 1Q86U 5CAIA 5M9OA 2JOYA 5GAMe 4FT4A 2QA4A 3FJPA 2VUBA 4P5NA 3PGGA 4ZGEB 5D6YA 1UGQB 4N4GA 5D6XA 4XTXA 1FXXA 2DVEA 3VYHB 5LJ5g 5GAMg 1G5VA 2FYKA 3M58A 4NL3A 4QVCA 2E64A 5GAOr 1JJ2A 5FRNA 4N4IA 3DLLA 4HT9A 2E41A 4PJOF 4BE0A 1K8AC 1FX7A 4PJOG 3CCVA 4BY6C 3OW2A 4OB1B 1I8FA 5LJ3h 3BY7A 3JB9I 2M9UA 3CXCA 3NTIA 4ZTJA 5GANj 3CCSA 4BACA 2R5AA 4E47A 1QVFA 1JRIA 4IURA 4PKCC 4YTLA 3BFMA 3VKIA 3JCMd 3ER0A 4F7UF 2QQAA 1MGQA 4F7UG 3JB9D 3PFSA 3OMGA 2JNGA 2XIDA 5CK9A 3CCJT 3QJ6A 5J26A 1W4SA 3CCMA 3C4SA 4LDXA 4BDYA 5GAN6 3L2VA 5LJ5e 5GAMj 1N9RA 3O8VA 3CBPA 3FB9A 4VUBA 5LJ5j 1YJNT 1D3BA 3OW2S 4M7DF 1R8OB 3HP9A 3CCET 2R5MA 4M7DG 1XTDA 3L1AA 4GLKA 3CXCS 4BE2A 4BDZA 4OF1A 4C92B 3JAME 1K8AU 3RERA 4BD3A 1WJQA 4XTZA 1B34B 4C8QB 1EIFA 2FL7A 4MMLA 4HT8A 2PQWA 2R57A 3A8OB 4M75C 3JB9J 3HRSA 3M59A 4RG8A 4MDWA 3ZFJA 1Y7XA 2QDYB 2QA4T 2VV5A 1LNXA 1U1SA 1XQHA 3LW5E 2L3RA 3PTAA 3KUFA 2LX9A 1GXIE 3LGLA 2EJ9A 4C92D 4MMKA 4PLLA 3JSCA 2RHZA 4II1A 4BUGA 5FRMA 1VQ6A 4C8QD 4PNOA 3X24B 3GOXA 3JCMP 3F70A 2QTXA 2RH2A 1N8RC 3GNGA 4M75E 3VJPA 3CCVT 1JB0E 5GMKe 3DKMA 3PIPA 5CKEA 5CKDA 3EFRA 1Y71A 1LOJA 5I21A 5KCOA 3CCST 3V8KA 2L8DA 2L89A 3JCMg 3VV0A 2E10A 3ZEHA 1NPPA 2F5KA 3OYLA 4J7FA 3M4YA 4OVAA 2LTOA 4HCZA 3OBWA 1OZ2A 4C5GA 3SWNB 5KCHA 1UGSB 4EMKC 2ZPGB 3LWHA 1YHQA 4M78C 4OB2B 2CZ7B 4JLGA 2K5FA 3H8ZA 4A53A 1VQNA 3JCMc 4C92A 3FRNA 1BI3A 4M75G 4EMHA 1N8RU 1B34A 3WXMB 4C8QA 3A8GB 1MHNA 4XTUA 4L5GA 2HAXA 4B9XA 1K9MC 4DQ2A 5DY9A 2MWOA 2JZ2A 5GMKm 5HK3A 3OYCA 4R55A 1PSFA 4QVZA 1N27A 3RESA 4J6XA 3OSSC 1HXDA 2PU9B 2DD5A 1I81A 1SSFA 2ZZDA 5GAOp 4JRPA 1X6OA 3MO8A 2E12A 2LT1A 3NTHA 3OS5A 2RJEA 3QYGB 5EG2A 4V2SA 3M55A 4N0AA 4PJOB 3PNWC 1VQ6T 1H3ZA 3AHUA 3I55A 3UDCA 1OZ3A 3CCRT 1Q81C 3GNFB 4M77F 4J83A 5GANf 4OGEA 3MCAB 3TEEA 1K73C 3OYAA 1UB4A 4OB0B 2WSCE 2HNIA 1KC8C 1Y07A 4F7UB 3CPFA 2QQSA 3CC7T 4PJOD 2DZCA 3QXEB 4FT2A 4IUVA 2E65A 1K9MU 2D9TA 3NFCA 3ASKA 3MP8A 4RKUE 5GAMf 5LJ5f 4M78F 4WF2A 4M78G 2E6ZA 2VC8A 2CYZB 3SWNA 2OTJT 3TU4K 1QVGS 2R58A 3CBMA 1UGPB 5CO7A 4A54A 4EDUA 2LQ8A 4IUTA 1I5LA 3JCMQ 2DEQA 2EQMA 4O6JA 1U8RA 3H6ZA 2O4XB 3CCUA 5A0GA 1QVPA 1VQNT 1Q82C 1Q81U 2RI3A 3DLMA 1V29B 4GY5A 2MWPA 3A8HB 1N9SA 3JCMW 1K73U 2GCXA 2EAYA 2HQEA 2VGNA 3I56A 4XQ3A 1KC8U 3JCMJ 2RHUA 3HSBA 2KVQG 3OYFA 4C0DB 4BI8B 3J80E 2EQKA 3GPLA 2DXCA 4PJOA 4A4GA 1ZBXA 4HA8A 2FB7A 1VQ7A 1VQLA 5GANe 3L42A 2ZPIB 2K5IA 4FL6A 5LJ3g 4UC4A 2DPPB 2BIVA 3OYMA 3L2WA 2DK3A 4NS5A 5CIUA 3WVDB 1IREB 5LJ5h 2EQUA 3L2RA 2ZCFB 3CC4A 2EJFA 2EYQA 1VQMT 2ZPBB 3FIFA 2Y4YA 2ZPEB 3G4SA 4XK8E 4M7AB 4F7UA 2MF2A 3A8LB 1VQ5A 1Q82U 1Q7YC 2QQRA 1ZQ1A 2CZ6B 5CKHA 3GF5A 4CRIA 2YRVA 3X26B 3JRZA 4FM4B 4FSXA 2NLUA 4PLIA 3S6WA 2EIFA 3VU3C 4EPCA 1O9SA 1FWZA 2RI2A 2XKOC 3L2QA 2YHTA 4XTWA 5FU6C 2P0QA 1UGRB 3LLRA 2E70A 3J81E 2PVOB 3GIBA 3RMSA 5A2QE 2FHDA 4M7AD 3TCJA 1KHIA 2O4XA 4IUQA 2KQWA 1O75A 5LJ3e 4JRQA 3E1SA 2WSEE 5LJ3j 2LCLA 3LGFA 2QEXA 2PUOB 3G6EA 4QW2A 3C12A 3J7AF 4ZGJB 5J39A 3X25B 5GMKh 1YITA 2RHIA 2Y4XA 3OYEA 3LWIA 1VQ4A 3JCMf 1VQPA 3QSUA 1RI0A 3S3MA 1Q7YU 4XTYA 1BIAA 1BI1A 3SFMA 4QQ6A 4QVDA 2GFUA 4XTVA 3URGA 5HK0A 2DJZA 4M77B 5GAN3 1VQ7T 4E7IA 5IT9E 4M7AE 1I4K1 4LD9K 3M56A 1NJIC 4RG2A 3INZA 3RKWA 3GP8A 4KT0E 3HRTA 5HY6A 2LQKA 2HBPA 3S3NA 1QP2A 2IVWA 4KBMB 3CC4T 1VIFA 2XDBA 2EQJA 4M7AA 4X9DA 3JB9G 5KE2A 3SDZA 2K2VA 4C92E 4HKEA 2DXBA 3E19A 2IG0A 5I2MA 3A8MB 4RCBA 3JCMb 3CCMT 4A4FA 4EMKB 4C8QE 3E9GA 4M77D 4M78B 5C0MA 2XDDA 2LC4A 1YIJA 3LH0A 1BI2A 3DB3A 3CMEA 2MAMA 3M4GA 3QJYA 4M75F 2DTIA 3CD6A 2JN0A 2MI6A 1U1TA 2OAUA 2LT4A 2RJFA 2DAQA 2E5QA 3CBOA 3ME9A 2QQBA 3PT9A 5GMKi 5GMKl 3CMAA 3SB2A 3L2ZA 4KUDK 3HKSA 3L2UA 4MDXA 3CC2A 2VGMA 5GANd 1NJIU 3HPWA 3P8DA 1YJWA 2QEXT 1YJ9A 3OYBA 5J3BA 3OYIA 3JCMe 5DM7R 3G6ET 3P8BB 4LDWA 1NE8A 2V8IA 3RKXA 3UT1A 4C0ZA 5KH6A 1VQOA 2JUFA 2M16A 2X4YA 1VQ4T 3X20B 2QQ9A 1QVGA 3OYJA 1VQPT 2CZ0B 2DXTA 2L5QA 4C8QG 3OS0A 3OS1A 2XD0A 5GAMd 5LJ5d 1G3TA 5GAOn 4KUIA 3QBYA 4M77A 4JLIA 4XU2A 3OQ5A 2DO3A 3ZBDA 4XU3A 1G3SA 1KQ1A 1KQSA 3PMTA 2HQXA 4E7HA 1X75C 1W2BA 4OGCA 2OTLA 4LD6A 2KSSA 2AHJB 3QDRB 4M7DB 4EMKA 4JUVA 2CKKA 4M78A 3VUZA 3M5AA 4QQDA 2K5LA 4DOWA 2O01E 2RB6A 1YHQT 2WSFE 2RA2A 1VQ8A 1YIJT 4MZPA 4C5HA 2YLCA 2JVVA 2E1HA 3CCJA 4Q5WA 3CMET 2GQVA 1UEBA 2QI2A 1KD1C 3OY9A 5LJ3f 3C95A 3NTKA 5LL6S 4A4HA 5CCAA 1KQSS 3CD6T 1YJNA 4M7DD 2V8KA 4XU0A 2XI9A 4JRKA 2X4XA 1M4ZA 5GANh 2RHXA 2XICA 3CCEA 1W2BS 1WQ7A 4PJOE 5HKCA 2KDSA 2GFAA 3TREA 4RMOA 2JTFA 4FU6A 3CC2T 4IUUA 4BY6B 3PMIA 3P8HA 1YJ9T 3CPWS 4XAXB 5FU7C 5GAN2 2H3JA 1KG1A 2EKOA 1G3YA 2F69A 3OS2A 3VUBA 4JJNK 1VQOT 4F7UE 2K4YA 1P92A 3FEOA 3I55T 2KK4A 2ZPFB 3RKYA 3RMQA 5GAMh 2RHYA 2WACA 1M90C 1BI0A 2HD0A 3OMCA 1YI2A 5DLQE 2D0QB 3MEWA 2LVMA 5GAOm 4JDSA 3EFSA 1IZ6A 2P4TA 4PL6A 1VQ9A 1H641 4M7DE 4Y91A 3G7ZA 1KD1U 3CCLA 4QQGA 3M53A 5L8RE 4ZGDB 2KAFA 2A7YA 3QHSA 4C0DC 4ZN1A 2X4JA 3FC3A 1NZ9A 4RCCA 2OTLT 4M7DA 5FU6B 5GAN5 3OYNA 4E7JA 3HHTB 1JBMA 3HL8A 4NOYA 3OA6A 1WJSA 2XG8D 3QZ5B 3QYHB 3OYGA 4C5EA 4JS4A 4HCBA 2XU8A 4M75B 3OBYA 1YBYA 5D6WA 1M8VA 2LCCA 2DXUA 2RD1A 4A4EA 1VQ8T 1QW1A 5IN1A 2EWNA 2RM4A 1TH7A 4X9CA 4BI4A 3CCUT 2ZPHB 1WGSA 3RUXA 3CEYA 1M90U 1JJ2S 4M7AC 4L59A 2A3LA 2JTMA 4J5YA 3MP6A 1M1KC 1VQKA 4N4HA 5GAN8 3M9QA 4ZN3A 1RL2A 3M57A 2KY9A 5I2SA 5A0LA 3MEUA 3QPHA 3V8JA 4C5IA 3V7RA 3I56T 3V8LA 4JS5A 3HFNA 5KE3A 3CCQA 4M75D 2CS7A 4J7IA 2RK2A 3RIRA 3LX7A 4BI3A 4C92C 4OP0A 1BIBA 1QVFS 4KULA 1VUBA 4B9WA 4C8QC 2VXEA 2X4WA 3Q1JA 2I2LA 1ZHIA 1HK9A 1PSEA 1VQLT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CKB A;  4MDX A;  3TCJ A;  3HPW A;  5CKF A;  3VUB A;  2KMT A;  5CO7 A;  1NE8 A;  5CR2 A;  4HKE A;  2VUB A;  5CK9 A;  4MZT A;  4MZP A;  3JSC A;  4MZM A;  4ELY C;  2MF2 A;  5DLO A;  5CKH A;  5CCA A;  3G7Z A;  1UB4 A;  4VUB A;  3JRZ A;  5CQY A;  4ME7 A;  4ELZ C;  5HKC A;  4OF1 A;  5HK0 A;  5HK3 A;  1M1F A;  5CKE A;  1VUB A;  5CKD A;  2C06 A;  3NFC A;  5CQX A;  1X75 C; 
#chains in the Genus database with same CATH topology
 2HKN A;  5C6S A;  3KBG A;  3HFO A;  4OMF B;  2EBP A;  1GFC A;  1YI2 T;  1Y96 B;  2F5T X;  1AHJ B;  3FDR A;  3CXC P;  4FYW B;  2YLB A;  3OYY A;  3CCR A;  2DIG A;  1M1K U;  4CI0 C;  2DLP A;  4IKF A;  1NPR A;  5A0D A;  5GMK j;  1AWW A;  4ME7 A;  1YCY A;  2X51 A;  3JCM h;  4M75 A;  1AWX A;  3MEA A;  1WXU A;  5CR2 A;  3MP1 A;  2PTK A;  1UTI A;  4X34 A;  2Y90 A;  2DTO A;  3SWN C;  1BCO A;  1KQ2 A;  2RJC A;  1JXM A;  4XU1 A;  1X01 A;  3EG3 A;  2KRM A;  2M0Y A;  1PKT A;  3N5B B;  3A5Z B;  2GF7 A;  2K2M A;  2KBT A;  2XK0 A;  2AK5 A;  3U23 A;  1M3C A;  5GAN 4;  3CCE Q;  2KGT A;  3QII A;  1XOV A;  4EMG A;  4D8K A;  2LRQ A;  4PJO C;  2B8A A;  2PVD B;  3CPW A;  2NUT A;  3EG9 A;  4C0F A;  4E7Z A;  3BDU A;  4M77 G;  1MMG A;  1OYX A;  3X28 B;  2DKG A;  2FZC B;  4D6W A;  1SKU B;  1WHL A;  5FLX E;  2EQI A;  3QG1 A;  4HCK A;  2EYW A;  1D3B B;  4LUE A;  3T9N A;  5CQX A;  5GAN g;  3GLX A;  3LYI A;  1M1G A;  1OEB A;  5CVI A;  3WVE B;  1WLP B;  4RTT A;  3S3O A;  1Q86 U;  2ROL A;  3FJP A;  2VUB A;  3PGG A;  2I0N A;  4ZGE B;  1K76 A;  1A0N B;  5D6X A;  2DVE A;  3VYH B;  1QCO A;  2FYK A;  3EHQ A;  2L3Q A;  2EVR A;  1JJ2 A;  5FRN A;  4HT9 A;  2YUQ A;  2L0A A;  2DRM A;  8ATC B;  1N8R R;  4OMM A;  2M9U A;  3NTI A;  5GAN j;  1QVF A;  4YTL A;  5KYW B;  5GJW B;  3JB9 D;  3OMG A;  2JNG A;  5CK9 A;  2E3I A;  1W4S A;  1VQ6 Q;  5LJ5 e;  2JT4 A;  1D1C A;  3FB9 A;  1YJN T;  1VYV A;  2EGE A;  2R5M A;  1XTD A;  3I5S A;  3L1A A;  2RQW A;  4OML A;  1K8A U;  4E7S A;  4XTZ A;  4MML A;  2PQW A;  1IHW A;  1PRL C;  2QDY B;  8AT1 B;  3LW5 E;  4FW1 A;  1RAH B;  3PTA A;  2EJ9 A;  4C92 D;  4MMK A;  1VQ6 A;  5FRM A;  3X24 B;  3GOX A;  3JCM P;  2RH2 A;  1RAB B;  4M75 E;  2KI7 A;  4WTO B;  5GMK e;  1T3L A;  1LPL A;  4A63 B;  4GLM A;  5CKE A;  5CKD A;  1Y71 A;  1LOJ A;  4D8D A;  1ZSZ A;  1SHG A;  3OYL A;  3TSZ A;  4J7F A;  1FYN A;  2LTO A;  3MKD A;  4C5G A;  1I5O B;  1UGS B;  1D1B A;  1YHQ A;  4M78 C;  2RQR A;  4JLG A;  3H8Z A;  4C92 A;  2HAX A;  4B9X A;  2VAS A;  4DQ2 A;  1N27 A;  1GRI A;  4J6X A;  1RI9 A;  3M55 A;  2J6O A;  1NEB A;  1RAG B;  1HSQ A;  1OZ3 A;  1Q81 C;  5GAN f;  4OGE A;  2J6K A;  2KE9 A;  3EH2 A;  1MUZ A;  4HVW A;  4FCY A;  4PJO D;  3CC7 T;  3QXE B;  1K9M U;  3NFC A;  3ASK A;  3NPF A;  1B3Q A;  1NG2 A;  2DYI A;  2VC8 A;  3SWN A;  2OTJ T;  1QVG S;  2DA9 A;  4EDU A;  2EQM A;  1U8R A;  1LCK A;  2O4X B;  5A0G A;  1QVP A;  3CC4 Q;  2MWP A;  3A8H B;  1N9S A;  1K73 U;  1F1B B;  2GCX A;  2QDL A;  1GCQ C;  1QKX A;  3I35 A;  4XQ3 A;  2HCK A;  3JCM J;  2RQT A;  4BI8 B;  4C0D B;  2DER A;  4PJO A;  2ATC B;  2COZ A;  1MND A;  1OU8 A;  1Q95 G;  2MIO A;  4HA8 A;  2CP2 A;  2FB7 A;  4A4G A;  5GAN e;  5LJ3 g;  4UC4 A;  2DL3 A;  2DK3 A;  2F2W A;  4NS5 A;  5LJ5 h;  1IRE B;  2W10 A;  3JV3 A;  1NYG A;  3CC4 A;  1W2B P;  2EYQ A;  1VQM T;  2QEX Q;  3G4S A;  4XK8 E;  3A8L B;  2CZ6 B;  5CKH A;  4CRI A;  4FSX A;  4PLI A;  3VS6 A;  2XKO C;  2YHT A;  1AWJ A;  2PVO B;  5A2Q E;  2FHD A;  1AOJ A;  2DVJ A;  1TUG B;  5LJ3 j;  2QEX A;  2L3P A;  5GMK h;  3X25 B;  1WHJ A;  1G2B A;  2HDA A;  2B86 A;  2LMJ A;  1Q7Y U;  3EH1 A;  2DL5 A;  1TSF A;  4AFQ C;  1VYT A;  2JTE A;  3CME Q;  5IT9 E;  1NJI C;  3INZ A;  5IHI A;  2VB6 A;  1B07 A;  2HBP A;  1QP2 A;  1YJ9 Q;  2K2V A;  1IGU A;  4C92 E;  2DXB A;  3E19 A;  2IG0 A;  3REA B;  3CCM T;  4GBQ A;  3CME A;  3QJY A;  3PT9 A;  3IQL A;  1SF9 A;  3L2Z A;  2OX7 A;  1ZA1 B;  3L2U A;  3P8D A;  1YJ9 A;  3G6E T;  5DM7 R;  4LDW A;  2DBK A;  1VQ4 T;  3X20 B;  1M90 R;  2C0I A;  3QBY A;  3KFV A;  4F04 B;  2MK5 A;  3OQ5 A;  2DFU A;  1VA7 A;  4XU3 A;  5L23 A;  4KGZ B;  1G3S A;  3NGP A;  2O9S A;  3A1P A;  1X75 C;  5EC7 A;  4LN2 A;  4M78 A;  1VQL Q;  2RB6 A;  2CRE A;  2E1H A;  3CCJ A;  2GQV A;  3OY9 A;  5LJ3 f;  3NTK A;  5FWB A;  1RUW A;  4XU0 A;  3H0I A;  4PJO E;  5GAN h;  2RHX A;  3CCL Q;  2JM8 A;  2M02 A;  2DEU A;  5ECA A;  2EKO A;  3VUB A;  4JJN K;  4AMC A;  1VQO T;  2K4Y A;  2RF0 A;  3FEO A;  3M0R A;  1PD1 A;  3RMQ A;  2AKK A;  2WAC A;  1BI0 A;  5DLQ E;  3RNJ A;  1RAF B;  1IZ6 A;  2P4T A;  2D8J A;  1VQK Q;  3CPW P;  1KD1 U;  3CCL A;  3M53 A;  3CCQ Q;  1QLY A;  1NZ9 A;  4RCC A;  1PNJ A;  4E7J A;  1JBM A;  4RTW A;  3OYG A;  4JS4 A;  1YCS B;  1OX9 A;  2F1L A;  1M8V A;  1TG0 A;  2DXU A;  5IN1 A;  3RUX A;  2JTM A;  1VQK A;  1GCQ A;  1RL2 A;  3M57 A;  1NM7 A;  4AFU C;  5A0L A;  2YXY A;  3MEU A;  4C5I A;  3CCQ A;  2LJ1 A;  1RAC B;  1BK2 A;  3RIR A;  3LX7 A;  5KYY B;  4OP0 A;  1BIB A;  4KUL A;  3Q1J A;  2I2L A;  2YRC A;  1JJ2 P;  1OI1 A;  4RTY A;  1U06 A;  4DOV A;  2MMP A;  1E6H A;  1QCF A;  2RI5 A;  4IUP A;  2F2V A;  4LXC A;  3R6N A;  1QVF P;  3QWY A;  2P0P A;  2LQN A;  4HCC A;  2YUN A;  1OUL A;  2VXF A;  4J9D A;  4IIO A;  4M77 C;  4PJM A;  4ELZ C;  1JO8 A;  4JRI A;  4FIB A;  4M7A F;  4M7A G;  3THK A;  3TSW A;  3MHX A;  4J8O A;  1YIT T;  3BW1 A;  4C8Q F;  1KK7 A;  2BUD A;  3PE0 A;  1QCN A;  3R6O A;  1Q82 R;  3E9F A;  1AZG B;  4M78 E;  2RO0 A;  1Y96 A;  2AZS A;  2KMT A;  1MMD A;  2QAZ A;  3TVT A;  4BE1 A;  1M27 C;  4MZM A;  2PVG B;  5GAO l;  2CZ1 B;  5GAN 7;  5CQY A;  3OYH A;  2M0O A;  2ROT A;  3CMA T;  2O2O A;  2HKQ B;  2G6F X;  2DRK A;  5FU7 B;  2LNV A;  1UGV A;  3CCS Q;  5M9O A;  4FT4 A;  4P5N A;  5D6Y A;  1UGQ B;  4N4G A;  1FXX A;  1OPL A;  5LJ5 g;  1G5V A;  3M58 A;  5GAO r;  2A08 A;  1RLP C;  4RUG A;  2EYY A;  1I8F A;  5LJ3 h;  1RAE B;  3BY7 A;  4ZTJ A;  3CCS A;  1NYF A;  2JMA A;  1JRI A;  4IUR A;  3BFM A;  2MYS A;  3ER0 A;  2J05 A;  4F7U F;  3EGX B;  1MGQ A;  4F7U G;  3I9Q A;  3PFS A;  2XID A;  5J26 A;  1WXB A;  5LJ5 j;  4M7D F;  1D3B A;  4M7D G;  1D0X A;  3CCE T;  4KGX B;  4HXJ A;  1ACM B;  3JAM E;  4C8Q B;  4HT8 A;  1PWT A;  3A8O B;  3JB9 J;  2DNU A;  3ZFJ A;  1LNX A;  3OW2 P;  1KJW A;  2P4R A;  3LGL A;  4BUG A;  3JSC A;  4II1 A;  2DYB A;  3M0T A;  2CH4 A;  4PNO A;  1Q81 R;  4DBR A;  2MOX A;  4Z89 A;  1UG1 A;  5GJV B;  1RLQ C;  5I21 A;  5KYW A;  4AFS C;  2L8D A;  2JXB A;  2F5K A;  1OQK A;  3M4Y A;  1ZBJ A;  3OBW A;  1OZ2 A;  2CP0 A;  2EKH A;  2ZPG B;  2RMO A;  2CP3 A;  4M75 G;  1N8R U;  1RAA B;  2GTO A;  1N5Z A;  2BZX A;  4XTU A;  2DE0 X;  5DY9 A;  3OYC A;  5HK3 A;  2ED0 A;  1I81 A;  3QYG B;  4V2S A;  4QT7 A;  5IXF A;  1VQ6 T;  2MPX C;  3AHU A;  3I55 A;  4M77 F;  2D1X A;  1HD3 A;  4M4Z A;  1PC0 A;  2O9V A;  3UA6 A;  4OB0 B;  1Y07 A;  4F7U B;  3CPF A;  2QQS A;  2E4H A;  4FT2 A;  4IUV A;  1TUC A;  2D9T A;  3MP8 A;  4RKU E;  5LJ5 f;  2XMF A;  4WF2 A;  3VRZ A;  4K11 A;  4A54 A;  5CO7 A;  2X3W D;  3VS1 A;  1I5L A;  2KRO A;  2DEQ A;  3CCU A;  4F17 A;  2BE7 D;  1Q82 C;  2RI3 A;  1V29 B;  4GY5 A;  3JCM W;  4E6R A;  1X27 A;  1M1K R;  2HQE A;  2GTJ A;  1KC8 U;  3HSB A;  2X3X D;  2K5I A;  3A98 A;  2DPP B;  3OYM A;  1NJI R;  2PNI A;  3WVD B;  2EQU A;  1AZE A;  1TOV A;  2MF2 A;  1YN8 A;  1NLP C;  2QQR A;  2YRV A;  2SEM A;  2NLU A;  3CQT A;  2EIF A;  3VU3 C;  1FWZ A;  3L2Q A;  3RMS A;  3TCJ A;  1M3A A;  2O4X A;  4IUQ A;  4JRQ A;  2YSQ A;  2J7I A;  2PUO B;  1GBQ A;  4J9G A;  1FMV A;  3LWI A;  2CUD A;  1YHQ Q;  1BIA A;  2K3B A;  3SEM A;  4QVD A;  2GFU A;  4WCI A;  3URG A;  1SPK A;  3CD6 Q;  4M77 B;  3H0H A;  4E7I A;  2KT8 A;  1I4K 1;  4E2F B;  3UF4 A;  2RQV A;  3VS7 A;  4RG2 A;  3GP8 A;  4KT0 E;  1PCX A;  2LQK A;  3S3N A;  2IVW A;  3CC4 T;  1VIF A;  2XDB A;  2KR3 A;  4X9D A;  3JB9 G;  3UAT A;  1PD0 A;  4HKE A;  5I2M A;  3JCM b;  4FYV B;  4CC4 B;  2XDD A;  2EYZ A;  1MMA A;  1UFF A;  3LH0 A;  3DB3 A;  1IGQ A;  2CT3 A;  3CD6 A;  1U1T A;  2OAU A;  2RJF A;  2E5Q A;  2QQB A;  2C0T A;  2DM1 A;  4KUD K;  3HKS A;  4PJN A;  2NWM A;  4MDX A;  5GAN d;  2QEX T;  2OTL Q;  5J3B A;  3OYI A;  3VRY A;  3RKX A;  2QAS A;  2JUF A;  4DEX A;  5IXB A;  1T0J A;  1TTH B;  2CZ0 B;  2DXT A;  3EG2 A;  2XD0 A;  2YT6 A;  1VYU A;  1C6V X;  3EGD B;  2CP6 A;  4RTU A;  2FO0 A;  2DO3 A;  1EX4 A;  1K9A A;  2LCS A;  1U3O A;  2HQX A;  1WHK A;  1K8A R;  1LVK A;  4OGC A;  1T3S A;  1WYX A;  2OTL A;  3QDR B;  2VWF A;  2JMC A;  2CKK A;  3M5A A;  2O01 E;  2YLC A;  2JVV A;  1V76 A;  3CME T;  5FW9 A;  4A4H A;  5CCA A;  1KQS S;  5KYU B;  3G4S Q;  1YJN A;  1VQ9 Q;  3MJX A;  2X4X A;  4X1V A;  1JQQ A;  4JJB A;  2F2X A;  2DBM A;  1SEM A;  3PMI A;  1YJ9 T;  3CPW S;  4XAX B;  5FU7 C;  5GAN 2;  2H3J A;  1KG1 A;  2YRD A;  1P92 A;  1NEG A;  1TXQ A;  1U5S A;  3OMC A;  1SHF A;  5GAO m;  3EHR A;  4JDS A;  1VQ9 A;  1ZA2 B;  2FPE A;  2KAF A;  2E5K A;  4ZN1 A;  3FC3 A;  1EZZ B;  3OYN A;  3HL8 A;  2CP7 A;  4HCB A;  2XU8 A;  1YBY A;  1S72 Q;  2LCC A;  1HJD A;  1QW1 A;  2ZPH B;  1M90 U;  3G71 Q;  1JJ2 S;  4M7A C;  1D1A A;  2FZG B;  1M1K C;  1X2K A;  3M9Q A;  1HYO A;  1E6G A;  1D0Y A;  4JS5 A;  1AT1 B;  1IB8 A;  3V7R A;  1PG5 B;  3I56 T;  2CS7 A;  5IHN A;  4J7I A;  2LZ6 B;  5AT1 B;  4BI3 A;  1QVF S;  4B9W A;  4C8Q C;  2X4W A;  5FRO A;  1VQL T;  3CC7 Q;  1YWP A;  1S72 A;  1PHT A;  3VS5 A;  4C0G A;  1DJ7 B;  2DTH A;  2DD4 A;  3EFO B;  3G71 A;  1IHV A;  3QUI A;  1M2O A;  2FG0 A;  2J06 A;  2DZ9 A;  1VQ5 T;  4ELY C;  3CCL T;  1VOM A;  2PUK B;  4J6Y A;  4R56 A;  1K73 R;  3OYD A;  3PIO A;  1TUD A;  4NL2 A;  1WHH A;  2ZGW A;  3CC7 A;  4BB7 A;  4FYX B;  4J9H A;  1WXT A;  2V26 A;  3JB9 H;  1ZSG A;  4M78 D;  1N6A A;  2W0Z A;  2LNH B;  2XHC A;  2OTJ A;  1XNI A;  1OPK A;  3HRU A;  1X69 A;  1J3T A;  1UUE A;  1VQK T;  3QO3 A;  4DBQ A;  2QGG A;  2VYT A;  2CGH A;  1OX8 A;  3CCQ T;  5KYY A;  1VQM Q;  1GCP A;  1G3W A;  2COY A;  2KT1 A;  3CCJ Q;  1WA7 A;  2GQI A;  3GBQ A;  4LDV A;  4PFP A;  4A4K A;  2BKD N;  4ZTF A;  3EAE A;  1BKB A;  1W70 A;  4AT1 B;  1Q86 C;  2XDP A;  5LJ3 d;  3QKJ A;  2EFI A;  4E7L A;  3M54 A;  3MET A;  1VQM A;  2QA4 Q;  3JCM X;  2LDM A;  3OB9 A;  3OSV A;  3OYK A;  2FPD A;  4E7K A;  3V7C A;  1Q7Y R;  2EJG A;  4KH1 B;  3KXT A;  5AYF A;  1M1F A;  2C06 A;  3CCV Q;  4CC3 A;  2RK1 A;  4OB3 B;  5CKB A;  3DB4 A;  4L6V 5;  1YJW T;  4M7D C;  1MV3 A;  2LQW A;  1GL5 A;  1IO6 A;  2D6F A;  1VIE A;  1GFD A;  2OAW A;  2DF6 A;  5CAI A;  4PK4 A;  2QA4 A;  1IRX A;  1D0Z A;  5KYX B;  1AVZ C;  1BU1 A;  4XTX A;  5GAM g;  1M2V B;  4NL3 A;  2E64 A;  3CCM Q;  3DLL A;  1XJW B;  2E41 A;  1K8A C;  3CCV A;  1GBR A;  4BY6 C;  2DJQ A;  3JB9 I;  2R5A A;  4E47 A;  2LP5 A;  2FPF A;  3JCM d;  2QQA A;  3QJ6 A;  3CCM A;  3C4S A;  5GAM j;  3O8V A;  2KXC A;  3OW2 S;  1AWO A;  3HP9 A;  1ARK A;  3CXC S;  2MCN A;  4BDZ A;  4AG1 C;  2FZK B;  2BZY A;  1B34 B;  1EIF A;  4M75 C;  3HRS A;  4RG8 A;  4MDW A;  9ATC B;  5IHK A;  2VV5 A;  1XQH A;  2L3R A;  3KUF A;  1GXI E;  4PLL A;  4C8Q D;  2L2P A;  3GNG A;  2VVK A;  3VJP A;  1VQN Q;  2OJ2 A;  2HL5 C;  2DIL A;  3CCS T;  3V8K A;  3PVQ A;  3EGX A;  3E2U A;  1MNE A;  1NPP A;  4OVA A;  2QYZ A;  2EPD A;  2L3S A;  4OB2 B;  2K5F A;  4A53 A;  1VQN A;  3JCM c;  1BI3 A;  4EMH A;  4LE9 A;  4C8Q A;  3A8G B;  1MHN A;  4L5G A;  1K9M C;  4LNP A;  4QVZ A;  1SRL A;  1HXD A;  1SSF A;  5GAO p;  1X6O A;  3NTH A;  2LT1 A;  5EG2 A;  2JS0 A;  1RAI B;  1PRM C;  2NUP B;  1R77 A;  1H3Z A;  3UDC A;  3CCR T;  4FSS A;  3MCA B;  1K73 C;  2HSE B;  3OYA A;  2LX7 A;  1C1A A;  1X2Q A;  4ANJ A;  3NMZ C;  5GAM f;  2PZ1 A;  1QWE A;  2E6Z A;  2YDL A;  1ZUY A;  2CYZ B;  1UDL A;  1VQ7 Q;  2R58 A;  2COW A;  1NBE B;  4IUT A;  4O6J A;  2JM9 A;  3H6Z A;  1QQJ A;  1Q81 U;  3DLM A;  2RQU A;  2DX1 A;  2A36 A;  2VGN A;  1OU9 A;  2RHU A;  2H8H A;  2KVQ G;  3OYF A;  1W1F A;  3J80 E;  2EQK A;  1X43 A;  1VQ7 A;  2LJ0 A;  2ZPI B;  3L42 A;  2BIV A;  3L2W A;  5CIU A;  3L2R A;  2EJF A;  2ZPB B;  2ZPE B;  2Z0W A;  4M7A B;  2X9H A;  4F7U A;  1Q7Y C;  1ZQ1 A;  3GF5 A;  5GAM e;  1BCM A;  3JRZ A;  4FM4 B;  3S6W A;  1VQP Q;  1O9S A;  1X6B A;  2RI2 A;  1KSW A;  1KFZ A;  3LLR A;  2E70 A;  3GIB A;  4JJC A;  2NYS A;  2KQW A;  4HVV A;  2WSE E;  1ZSZ C;  3LGF A;  3VS0 A;  3C12 A;  3EG1 A;  1V1C A;  5J39 A;  1YIT A;  2RHI A;  3OYE A;  1VQP A;  3S3M A;  3M0S A;  1YIJ Q;  2QK0 A;  1BI1 A;  4QQ6 A;  2ZAE A;  5HK0 A;  2DJZ A;  4M7A E;  2BTT A;  4LD9 K;  3M56 A;  3CMA Q;  1R0B G;  2KXD A;  3RKW A;  2QTV A;  5HY6 A;  2JW4 A;  1YWO A;  4Y92 A;  2AIR B;  2KRN A;  4JZ3 A;  3CC2 Q;  2KYB A;  3EGU A;  4Z8A A;  3SDZ A;  5KE2 A;  1JU5 C;  4EMK B;  4C8Q E;  4M77 D;  2LC4 A;  3I55 Q;  1YIJ A;  3M4G A;  4M75 F;  2MI6 A;  2EGC A;  1E7O A;  2ED1 A;  2LT4 A;  2KRS A;  2DAQ A;  2HL3 A;  1H8K A;  3CMA A;  1K0X A;  5I22 A;  3RR6 A;  4RTV A;  3CC2 A;  1NJI U;  1WIE A;  3HPW A;  2GBQ A;  7AT1 B;  3P8B B;  2V8I A;  3REB B;  3UT1 A;  2ENM A;  1B7T A;  2X4Y A;  3M0Q A;  1QVG A;  3OS1 A;  1CSK A;  3TQ7 P;  1VQ8 Q;  3CCU Q;  5LJ5 d;  4KUI A;  4M77 A;  4JLI A;  4XU2 A;  1KQ1 A;  1KQS A;  4E7H A;  4LD6 A;  1S1N A;  4J9F A;  2AHJ B;  2ESW A;  4M7D B;  1CKA A;  4JUV A;  3VUZ A;  4QQD A;  2K5L A;  4ORZ A;  1YHQ T;  2WSF E;  2RA2 A;  1VQ8 A;  4C5H A;  5HCK A;  4Q5W A;  1YI2 Q;  1KD1 C;  4PJJ A;  3C95 A;  3CD6 T;  2CDT A;  2V8K A;  1M4Z A;  3CCE A;  2XIC A;  1W2B S;  1WQ7 A;  2GFA A;  3TRE A;  2JTF A;  3BE3 A;  4BY6 B;  3P8H A;  1D09 B;  3OS2 A;  3D7S B;  1ZX6 A;  1TWB A;  2RNA A;  5I11 A;  4F7U E;  1ZUU A;  2KK4 A;  5GAM h;  3RKY A;  2RHY A;  1YI2 A;  3EGD A;  3MEW A;  1I07 A;  2LVM A;  4EIK A;  3AT1 B;  3EFS A;  4M7D E;  4Y91 A;  1YNZ A;  1I0C A;  4F14 A;  4ZGD B;  2FRY A;  3QHS A;  2X4J A;  2OTL T;  5FU6 B;  2OI3 A;  4NOY A;  1WJS A;  2XG8 D;  3QYH B;  2QGF B;  2IPO B;  4M75 B;  3OBY A;  1BBZ A;  4A4E A;  2RM4 A;  4X9C A;  1TH7 A;  4BI4 A;  1WGS A;  1MV0 B;  3CEY A;  5KYU A;  3MP6 A;  4N4H A;  2GNC A;  4QKU A;  3PVL A;  4Z88 A;  3V8J A;  1R0C B;  3V8L A;  3HFN A;  5KE3 A;  1FMW A;  1MMN A;  1VUB A;  1TU0 B;  1UJY A;  1PSE A;  1JXO A;  3EG0 A;  3VYG A;  4RTX A;  1WJR A;  2CSI A;  1QP3 A;  2X35 A;  3LH5 A;  4LDU A;  2FVU A;  2V8J A;  3JB9 F;  1UHF A;  2AT1 B;  1Q86 R;  3G4S T;  2D8H A;  4Z02 A;  4N0A C;  1VQ9 T;  1M9S A;  1YP5 A;  2NUT B;  3EG9 B;  3V7S A;  2A0F B;  2DMO A;  1WNL A;  2GGR A;  3SD4 A;  2E6N A;  2HEQ A;  2DIQ A;  1KC8 R;  4DBH A;  3C94 A;  5GAO q;  2EGA A;  5CKF A;  4Y28 E;  1M5Q 1;  3FLG A;  4M77 E;  4C92 F;  2P0K A;  2QXF A;  4MZT A;  4C92 G;  5IAY A;  2K3Y A;  1WPY A;  3QZ9 B;  3G1J A;  5DLO A;  2K3X A;  4O5V A;  4ATO A;  1K0S A;  3UWN A;  3JCM V;  2K57 A;  1BYM A;  4F16 A;  4JZ4 A;  2M1H A;  4OMQ A;  1YJN Q;  3UPU A;  1S72 T;  2DL7 A;  1KHC A;  3EFO A;  2CT4 A;  1WQW A;  4J6W A;  3G71 T;  4LDY A;  3O5Z A;  2YUP A;  1WI7 A;  1SG5 A;  2G3R A;  3BDL A;  5IH2 A;  3MEV A;  2RJD A;  4TVR A;  3QWX X;  4CC7 A;  1UEC A;  1LJO A;  4J9I A;  4FYY B;  4DA4 A;  2JOY A;  4PFZ A;  4ESR A;  1SSH A;  4QVC A;  1WHG A;  1H3H A;  4N4I A;  1ABO A;  4PJO F;  4BE0 A;  1FX7 A;  4PJO G;  3OW2 A;  4OB1 B;  2QG9 B;  3CXC A;  5KYN A;  4BAC A;  4PKC C;  3VKI A;  1Z9Q A;  2YWW A;  1ZSZ B;  4PFO A;  2CSQ A;  3CCJ T;  4LDX A;  4BDY A;  1BB9 A;  5GAN 6;  3L2V A;  1N9R A;  3CBP A;  4VUB A;  1R8O B;  4GLK A;  4BE2 A;  1OV3 A;  4OF1 A;  4C92 B;  2CH4 W;  3RER A;  4BD3 A;  1WJQ A;  2O88 A;  1JEG A;  2FL7 A;  3M0P A;  1SRM A;  2R57 A;  1K9M R;  5KYX A;  3M59 A;  2QA4 T;  1Y7X A;  1M2V A;  3VS4 A;  1U1S A;  2LX9 A;  1Z9Z A;  1T0H A;  2OTJ Q;  1PKS A;  2RHZ A;  1G8X A;  3F70 A;  2QTX A;  1N8R C;  3CCV T;  3I5R A;  1JB0 E;  3DKM A;  2FEI A;  2FRW A;  3NHN A;  3PIP A;  3EFR A;  1RAD B;  5KCO A;  2L89 A;  3JCM g;  3MPU B;  3VV0 A;  2E10 A;  3ZEH A;  4OMP A;  4HCZ A;  2RPN A;  3SWN B;  1NLO C;  5KCH A;  4EMK C;  3H0F A;  3LWH A;  2CZ7 B;  4OMN A;  2CUB A;  3FRN A;  1B34 A;  4ZNX A;  3WXM B;  3VS3 A;  4DEY A;  2RN8 A;  5GMK m;  2MWO A;  2JZ2 A;  4R55 A;  1PSF A;  3RES A;  2E3H A;  3OSS C;  2PU9 B;  2DD5 A;  2ZZD A;  4JRP A;  3MO8 A;  2E12 A;  3OS5 A;  2RJE A;  4N0A A;  4PJO B;  3PNW C;  3M0U A;  1QMC A;  4KGV B;  3GNF B;  4J83 A;  1X6G A;  3RBB B;  3TEE A;  2YUO A;  1UB4 A;  4OMO A;  2WSC E;  2HNI A;  1KC8 C;  1PM3 A;  1QWF A;  2DZC A;  3I56 Q;  2AKL A;  2E65 A;  4AG2 C;  1W6X A;  3SHW A;  2KYM A;  4M78 F;  1I1J A;  4M78 G;  1CKB A;  1AEY A;  3TU4 K;  1IXD A;  3CBM A;  1UGP B;  2KEA A;  2LQ8 A;  3JCM Q;  3RDV A;  3ZL7 C;  1VQN T;  2NUZ A;  2EAY A;  4J9E A;  1VQ5 Q;  3I56 A;  2P84 A;  1QVG P;  1K4U S;  3GPL A;  2EYX A;  2DXC A;  2O31 A;  2NUP A;  1ZBX A;  1VQL A;  2ECZ A;  4FL6 A;  4PJL A;  1KQS P;  2ZCF B;  5FWC A;  3FIF A;  2Y4Y A;  3G6E Q;  1EFN A;  1VQ5 A;  1Q82 U;  4JJD A;  2DET A;  3X26 B;  1VQ4 Q;  4EPC A;  2BE9 B;  2ABL A;  1C0M A;  1KIK A;  4LUD A;  2AZV A;  2K79 A;  4XTW A;  5FU6 C;  2P0Q A;  1UGR B;  3J81 E;  1ZLM A;  4M7A D;  1KHI A;  3ULR B;  1O75 A;  1UJ0 A;  5LJ3 e;  3E1S A;  2LCL A;  2LJ3 A;  3G6E A;  4QW2 A;  1K1Z A;  3J7A F;  1WDX A;  4ZGJ B;  2HZY A;  2HQH A;  2K7A A;  2Y4X A;  1VQ4 A;  2J6F A;  6AT1 B;  3JCM f;  1QKW A;  3QSU A;  1RI0 A;  4XTY A;  3SFM A;  2K9G A;  4R0K A;  2CP5 A;  4XTV A;  2M51 A;  3QDF A;  5GAN 3;  1VQ7 T;  1G83 A;  2HBW A;  3HRT A;  4KBM B;  4M7A A;  2DL4 A;  2EQJ A;  1YJW Q;  4J9B A;  1WHM A;  1M3B A;  3A8M B;  4RCB A;  4A4F A;  1VQO Q;  2H3E B;  3E9G A;  4M78 B;  5C0M A;  1YFN A;  1BI2 A;  2MAM A;  2V1R A;  2DTI A;  4KRT A;  2JN0 A;  1KD1 R;  3CBO A;  3ME9 A;  5GMK i;  5GMK l;  3SB2 A;  2HSP A;  2DL8 A;  2VGM A;  1WFW A;  1YJW A;  2A37 A;  3OYB A;  3JCM e;  1NE8 A;  4C0Z A;  5KH6 A;  2IIM A;  1VQO A;  2M16 A;  3HTR A;  2QQ9 A;  3OYJ A;  1VQP T;  2L5Q A;  4C8Q G;  3OS0 A;  5GAM d;  1G3T A;  3VS2 A;  5GAO n;  3H9N A;  3ZBD A;  4JPB W;  1UHC A;  3PMT A;  2C0O A;  3H41 A;  1W2B A;  1FMK A;  2KSS A;  4DBF A;  1UE9 A;  1WZO A;  4EMK A;  4FW2 A;  4IIM A;  4DOW A;  2JJ9 A;  1YIJ T;  4MZP A;  2BZ8 A;  1WX6 A;  1UEB A;  2QI2 A;  5LL6 S;  1M8M A;  4M7D D;  2XI9 A;  4JRK A;  2K6D A;  5HKC A;  2KDS A;  4RMO A;  4FU6 A;  3CC2 T;  4IUU A;  2A28 A;  1ABQ A;  3FJ5 A;  1G3Y A;  2F69 A;  2D0N A;  1OOT A;  3I55 T;  2ZPF B;  1M90 C;  2HD0 A;  2D0Q B;  4J9C A;  4CC2 A;  4PL6 A;  1H64 1;  3G7Z A;  2SRC A;  4QQG A;  1YIT Q;  2JS2 A;  5L8R E;  2HMA A;  2VKN A;  1Y57 A;  2A7Y A;  4C0D C;  1Y0M A;  4KH0 B;  4M7D A;  5GAN 5;  3HHT B;  1M30 A;  4B6M A;  3OA6 A;  3QZ5 B;  4C5E A;  5D6W A;  5D7U A;  2RD1 A;  1AD5 A;  4HVU A;  1VQ8 T;  2EWN A;  3UA7 A;  3CCU T;  2V1Q A;  4L59 A;  2A3L A;  4J5Y A;  5GAN 8;  4ZN3 A;  5I2S A;  2KY9 A;  2KNB B;  3C0C A;  3QPH A;  3CCR Q;  2EW3 A;  4M75 D;  2RK2 A;  4RTZ A;  1TS9 A;  4C92 C;  4AFZ C;  2VXE A;  1H92 A;  1ZUK A;  1ZHI A;  1HK9 A; 
#chains in the Genus database with same CATH homology
 5C6S A;  1OI1 A;  3KBG A;  3VYG A;  1S72 A;  3HFO A;  1WJR A;  4C0G A;  1DJ7 B;  2DTH A;  4OMF B;  1QP3 A;  2MMP A;  2X35 A;  4LDU A;  2DD4 A;  4DOV A;  3G71 A;  3QUI A;  1YI2 T;  2FVU A;  2V8J A;  1Y96 B;  2RI5 A;  4IUP A;  2F5T X;  1AHJ B;  3JB9 F;  3FDR A;  2DZ9 A;  3G4S T;  2YLB A;  3OYY A;  4Z02 A;  4N0A C;  1VQ9 T;  3CCR A;  1VQ5 T;  1M9S A;  2DIG A;  4ELY C;  2P0P A;  4CI0 C;  3CCL T;  1M1K U;  4IKF A;  4HCC A;  2PUK B;  4J6Y A;  3V7S A;  1NPR A;  4R56 A;  1WNL A;  2VXF A;  5A0D A;  3SD4 A;  5GMK j;  3OYD A;  2E6N A;  3PIO A;  4M77 C;  2DIQ A;  4ME7 A;  4NL2 A;  4ELZ C;  1YCY A;  2ZGW A;  3JCM h;  3CC7 A;  4JRI A;  4M75 A;  5FRO A;  4FIB A;  4BB7 A;  3C94 A;  5GAO q;  4M7A F;  4M7A G;  3MEA A;  3JB9 H;  4M78 D;  1N6A A;  5CKF A;  3MHX A;  2XHC A;  4Y28 E;  1M5Q 1;  1XNI A;  2OTJ A;  4J8O A;  5CR2 A;  3FLG A;  3HRU A;  3MP1 A;  4X34 A;  2Y90 A;  2DTO A;  3SWN C;  3QO3 A;  1VQK T;  2VYT A;  4M77 E;  4C92 F;  2P0K A;  2QXF A;  3BW1 A;  4MZT A;  4C92 G;  5IAY A;  1YIT T;  1KQ2 A;  2RJC A;  2CGH A;  2K3Y A;  4XU1 A;  4C8Q F;  1WPY A;  3QZ9 B;  3CCQ T;  5DLO A;  2BUD A;  1X01 A;  2K3X A;  4O5V A;  3R6O A;  1G3W A;  3E9F A;  4ATO A;  3UWN A;  3JCM V;  2K57 A;  3A5Z B;  2GF7 A;  3N5B B;  1BYM A;  2XK0 A;  4LDV A;  2M1H A;  4A4K A;  3UPU A;  1S72 T;  2BKD N;  1KHC A;  5GAN 4;  4ZTF A;  4M78 E;  2RO0 A;  1Y96 A;  3QII A;  1XOV A;  3EAE A;  4EMG A;  1WQW A;  1BKB A;  4J6W A;  3G71 T;  2KMT A;  4LDY A;  2LRQ A;  1Q86 C;  2XDP A;  4PJO C;  2B8A A;  2PVD B;  5LJ3 d;  4BE1 A;  3QKJ A;  2EFI A;  4E7L A;  3CPW A;  3M54 A;  4C0F A;  3MET A;  3BDU A;  4M77 G;  1VQM A;  1OYX A;  4MZM A;  3X28 B;  2PVG B;  2LDM A;  3JCM X;  2DKG A;  5GAO l;  2CZ1 B;  3OB9 A;  5GAN 7;  3OSV A;  3OYK A;  4D6W A;  5CQY A;  4E7K A;  2G3R A;  3BDL A;  3V7C A;  3OYH A;  2M0O A;  2EJG A;  3CMA T;  5FLX E;  3MEV A;  3QG1 A;  3KXT A;  5AYF A;  1M1F A;  1D3B B;  2RJD A;  3T9N A;  2C06 A;  5CQX A;  5GAN g;  3GLX A;  3LYI A;  2RK1 A;  1M1G A;  4OB3 B;  3DB4 A;  4L6V 5;  4TVR A;  5CKB A;  5FU7 B;  5CVI A;  3WVE B;  1YJW T;  4M7D C;  1LJO A;  2LNV A;  2D6F A;  1VIE A;  3S3O A;  4DA4 A;  1Q86 U;  5CAI A;  5M9O A;  2JOY A;  5GAM e;  4FT4 A;  2QA4 A;  3FJP A;  2VUB A;  4P5N A;  3PGG A;  4ZGE B;  5D6Y A;  1UGQ B;  4N4G A;  5D6X A;  4XTX A;  1FXX A;  2DVE A;  3VYH B;  5LJ5 g;  5GAM g;  1G5V A;  2FYK A;  3M58 A;  4NL3 A;  4QVC A;  2E64 A;  5GAO r;  1JJ2 A;  5FRN A;  4N4I A;  3DLL A;  4HT9 A;  2E41 A;  4PJO F;  4BE0 A;  1K8A C;  1FX7 A;  4PJO G;  3CCV A;  4BY6 C;  3OW2 A;  4OB1 B;  1I8F A;  5LJ3 h;  3BY7 A;  3JB9 I;  2M9U A;  3CXC A;  3NTI A;  4ZTJ A;  5GAN j;  3CCS A;  4BAC A;  2R5A A;  4E47 A;  1QVF A;  1JRI A;  4IUR A;  4PKC C;  4YTL A;  3BFM A;  3VKI A;  3JCM d;  3ER0 A;  4F7U F;  2QQA A;  1MGQ A;  4F7U G;  3JB9 D;  3PFS A;  3OMG A;  2JNG A;  2XID A;  5CK9 A;  3CCJ T;  3QJ6 A;  5J26 A;  1W4S A;  3CCM A;  3C4S A;  4LDX A;  4BDY A;  5GAN 6;  3L2V A;  5LJ5 e;  5GAM j;  1N9R A;  3O8V A;  3CBP A;  3FB9 A;  4VUB A;  5LJ5 j;  1YJN T;  1D3B A;  3OW2 S;  4M7D F;  1R8O B;  3HP9 A;  3CCE T;  2R5M A;  4M7D G;  1XTD A;  3L1A A;  4GLK A;  3CXC S;  4BE2 A;  4BDZ A;  4OF1 A;  4C92 B;  3JAM E;  1K8A U;  3RER A;  4BD3 A;  1WJQ A;  4XTZ A;  1B34 B;  4C8Q B;  1EIF A;  2FL7 A;  4MML A;  4HT8 A;  2PQW A;  2R57 A;  3A8O B;  4M75 C;  3JB9 J;  3HRS A;  3M59 A;  4RG8 A;  4MDW A;  3ZFJ A;  1Y7X A;  2QDY B;  2QA4 T;  2VV5 A;  1LNX A;  1U1S A;  1XQH A;  3LW5 E;  2L3R A;  3PTA A;  3KUF A;  2LX9 A;  1GXI E;  3LGL A;  2EJ9 A;  4C92 D;  4MMK A;  4PLL A;  3JSC A;  2RHZ A;  4II1 A;  4BUG A;  5FRM A;  1VQ6 A;  4C8Q D;  4PNO A;  3X24 B;  3GOX A;  3JCM P;  3F70 A;  2QTX A;  2RH2 A;  1N8R C;  3GNG A;  4M75 E;  3VJP A;  3CCV T;  1JB0 E;  5GMK e;  3DKM A;  3PIP A;  5CKE A;  5CKD A;  3EFR A;  1Y71 A;  1LOJ A;  5I21 A;  5KCO A;  3CCS T;  3V8K A;  2L8D A;  2L89 A;  3JCM g;  3VV0 A;  2E10 A;  3ZEH A;  1NPP A;  2F5K A;  3OYL A;  4J7F A;  3M4Y A;  4OVA A;  2LTO A;  4HCZ A;  3OBW A;  1OZ2 A;  4C5G A;  3SWN B;  5KCH A;  1UGS B;  4EMK C;  2ZPG B;  3LWH A;  1YHQ A;  4M78 C;  4OB2 B;  2CZ7 B;  4JLG A;  2K5F A;  3H8Z A;  4A53 A;  1VQN A;  3JCM c;  4C92 A;  3FRN A;  1BI3 A;  4M75 G;  4EMH A;  1N8R U;  1B34 A;  3WXM B;  4C8Q A;  3A8G B;  1MHN A;  4XTU A;  4L5G A;  2HAX A;  4B9X A;  1K9M C;  4DQ2 A;  5DY9 A;  2MWO A;  2JZ2 A;  5GMK m;  5HK3 A;  3OYC A;  4R55 A;  1PSF A;  4QVZ A;  1N27 A;  3RES A;  4J6X A;  3OSS C;  1HXD A;  2PU9 B;  2DD5 A;  1I81 A;  1SSF A;  2ZZD A;  5GAO p;  4JRP A;  1X6O A;  3MO8 A;  2E12 A;  2LT1 A;  3NTH A;  3OS5 A;  2RJE A;  3QYG B;  5EG2 A;  4V2S A;  3M55 A;  4N0A A;  4PJO B;  3PNW C;  1VQ6 T;  1H3Z A;  3AHU A;  3I55 A;  3UDC A;  1OZ3 A;  3CCR T;  1Q81 C;  3GNF B;  4M77 F;  4J83 A;  5GAN f;  4OGE A;  3MCA B;  3TEE A;  1K73 C;  3OYA A;  1UB4 A;  4OB0 B;  2WSC E;  2HNI A;  1KC8 C;  1Y07 A;  4F7U B;  3CPF A;  2QQS A;  3CC7 T;  4PJO D;  2DZC A;  3QXE B;  4FT2 A;  4IUV A;  2E65 A;  1K9M U;  2D9T A;  3NFC A;  3ASK A;  3MP8 A;  4RKU E;  5GAM f;  5LJ5 f;  4M78 F;  4WF2 A;  4M78 G;  2E6Z A;  2VC8 A;  2CYZ B;  3SWN A;  2OTJ T;  3TU4 K;  1QVG S;  2R58 A;  3CBM A;  1UGP B;  5CO7 A;  4A54 A;  4EDU A;  2LQ8 A;  4IUT A;  1I5L A;  3JCM Q;  2DEQ A;  2EQM A;  4O6J A;  1U8R A;  3H6Z A;  2O4X B;  3CCU A;  5A0G A;  1QVP A;  1VQN T;  1Q82 C;  1Q81 U;  2RI3 A;  3DLM A;  1V29 B;  4GY5 A;  2MWP A;  3A8H B;  1N9S A;  3JCM W;  1K73 U;  2GCX A;  2EAY A;  2HQE A;  2VGN A;  3I56 A;  4XQ3 A;  1KC8 U;  3JCM J;  2RHU A;  3HSB A;  2KVQ G;  3OYF A;  4C0D B;  4BI8 B;  3J80 E;  2EQK A;  3GPL A;  2DXC A;  4PJO A;  4A4G A;  1ZBX A;  4HA8 A;  2FB7 A;  1VQ7 A;  1VQL A;  5GAN e;  3L42 A;  2ZPI B;  2K5I A;  4FL6 A;  5LJ3 g;  4UC4 A;  2DPP B;  2BIV A;  3OYM A;  3L2W A;  2DK3 A;  4NS5 A;  5CIU A;  3WVD B;  1IRE B;  5LJ5 h;  2EQU A;  3L2R A;  2ZCF B;  3CC4 A;  2EJF A;  2EYQ A;  1VQM T;  2ZPB B;  3FIF A;  2Y4Y A;  2ZPE B;  3G4S A;  4XK8 E;  4M7A B;  4F7U A;  2MF2 A;  3A8L B;  1VQ5 A;  1Q82 U;  1Q7Y C;  2QQR A;  1ZQ1 A;  2CZ6 B;  5CKH A;  3GF5 A;  4CRI A;  2YRV A;  3X26 B;  3JRZ A;  4FM4 B;  4FSX A;  2NLU A;  4PLI A;  3S6W A;  2EIF A;  3VU3 C;  4EPC A;  1O9S A;  1FWZ A;  2RI2 A;  2XKO C;  3L2Q A;  2YHT A;  4XTW A;  5FU6 C;  2P0Q A;  1UGR B;  3LLR A;  2E70 A;  3J81 E;  2PVO B;  3GIB A;  3RMS A;  5A2Q E;  2FHD A;  4M7A D;  3TCJ A;  1KHI A;  2O4X A;  4IUQ A;  2KQW A;  1O75 A;  5LJ3 e;  4JRQ A;  3E1S A;  2WSE E;  5LJ3 j;  2LCL A;  3LGF A;  2QEX A;  2PUO B;  3G6E A;  4QW2 A;  3C12 A;  3J7A F;  4ZGJ B;  5J39 A;  3X25 B;  5GMK h;  1YIT A;  2RHI A;  2Y4X A;  3OYE A;  3LWI A;  1VQ4 A;  3JCM f;  1VQP A;  3QSU A;  1RI0 A;  3S3M A;  1Q7Y U;  4XTY A;  1BIA A;  1BI1 A;  3SFM A;  4QQ6 A;  4QVD A;  2GFU A;  4XTV A;  3URG A;  5HK0 A;  2DJZ A;  4M77 B;  5GAN 3;  1VQ7 T;  4E7I A;  5IT9 E;  4M7A E;  1I4K 1;  4LD9 K;  3M56 A;  1NJI C;  4RG2 A;  3INZ A;  3RKW A;  3GP8 A;  4KT0 E;  3HRT A;  5HY6 A;  2LQK A;  2HBP A;  3S3N A;  1QP2 A;  2IVW A;  4KBM B;  3CC4 T;  1VIF A;  2XDB A;  2EQJ A;  4M7A A;  4X9D A;  3JB9 G;  5KE2 A;  3SDZ A;  2K2V A;  4C92 E;  4HKE A;  2DXB A;  3E19 A;  2IG0 A;  5I2M A;  3A8M B;  4RCB A;  3JCM b;  3CCM T;  4A4F A;  4EMK B;  4C8Q E;  3E9G A;  4M77 D;  4M78 B;  5C0M A;  2XDD A;  2LC4 A;  1YIJ A;  3LH0 A;  1BI2 A;  3DB3 A;  3CME A;  2MAM A;  3M4G A;  3QJY A;  4M75 F;  2DTI A;  3CD6 A;  2JN0 A;  2MI6 A;  1U1T A;  2OAU A;  2LT4 A;  2RJF A;  2DAQ A;  2E5Q A;  3CBO A;  3ME9 A;  2QQB A;  3PT9 A;  5GMK i;  5GMK l;  3CMA A;  3SB2 A;  3L2Z A;  4KUD K;  3HKS A;  3L2U A;  4MDX A;  3CC2 A;  2VGM A;  5GAN d;  1NJI U;  3HPW A;  3P8D A;  1YJW A;  2QEX T;  1YJ9 A;  3OYB A;  5J3B A;  3OYI A;  3JCM e;  5DM7 R;  3G6E T;  3P8B B;  4LDW A;  1NE8 A;  2V8I A;  3RKX A;  3UT1 A;  4C0Z A;  5KH6 A;  1VQO A;  2JUF A;  2M16 A;  2X4Y A;  1VQ4 T;  3X20 B;  2QQ9 A;  1QVG A;  3OYJ A;  1VQP T;  2CZ0 B;  2DXT A;  2L5Q A;  4C8Q G;  3OS0 A;  3OS1 A;  2XD0 A;  5GAM d;  5LJ5 d;  1G3T A;  5GAO n;  4KUI A;  3QBY A;  4M77 A;  4JLI A;  4XU2 A;  3OQ5 A;  2DO3 A;  3ZBD A;  4XU3 A;  1G3S A;  1KQ1 A;  1KQS A;  3PMT A;  2HQX A;  4E7H A;  1X75 C;  1W2B A;  4OGC A;  2OTL A;  4LD6 A;  2KSS A;  2AHJ B;  3QDR B;  4M7D B;  4EMK A;  4JUV A;  2CKK A;  4M78 A;  3VUZ A;  3M5A A;  4QQD A;  2K5L A;  4DOW A;  2O01 E;  2RB6 A;  1YHQ T;  2WSF E;  2RA2 A;  1VQ8 A;  1YIJ T;  4MZP A;  4C5H A;  2YLC A;  2JVV A;  2E1H A;  3CCJ A;  4Q5W A;  3CME T;  2GQV A;  1UEB A;  2QI2 A;  1KD1 C;  3OY9 A;  5LJ3 f;  3C95 A;  3NTK A;  5LL6 S;  4A4H A;  5CCA A;  1KQS S;  3CD6 T;  1YJN A;  4M7D D;  2V8K A;  4XU0 A;  2XI9 A;  4JRK A;  2X4X A;  1M4Z A;  5GAN h;  2RHX A;  2XIC A;  3CCE A;  1W2B S;  1WQ7 A;  4PJO E;  5HKC A;  2KDS A;  2GFA A;  3TRE A;  4RMO A;  2JTF A;  4FU6 A;  3CC2 T;  4IUU A;  4BY6 B;  3PMI A;  3P8H A;  1YJ9 T;  3CPW S;  4XAX B;  5FU7 C;  5GAN 2;  2H3J A;  1KG1 A;  2EKO A;  1G3Y A;  2F69 A;  3OS2 A;  3VUB A;  4JJN K;  1VQO T;  4F7U E;  2K4Y A;  1P92 A;  3FEO A;  3I55 T;  2KK4 A;  2ZPF B;  3RKY A;  3RMQ A;  5GAM h;  2RHY A;  2WAC A;  1M90 C;  1BI0 A;  2HD0 A;  3OMC A;  1YI2 A;  5DLQ E;  2D0Q B;  3MEW A;  2LVM A;  5GAO m;  4JDS A;  3EFS A;  1IZ6 A;  2P4T A;  4PL6 A;  1VQ9 A;  1H64 1;  4M7D E;  4Y91 A;  3G7Z A;  1KD1 U;  3CCL A;  4QQG A;  3M53 A;  5L8R E;  4ZGD B;  2KAF A;  2A7Y A;  3QHS A;  4C0D C;  4ZN1 A;  2X4J A;  3FC3 A;  1NZ9 A;  4RCC A;  2OTL T;  4M7D A;  5FU6 B;  5GAN 5;  3OYN A;  4E7J A;  3HHT B;  1JBM A;  3HL8 A;  4NOY A;  3OA6 A;  1WJS A;  2XG8 D;  3QZ5 B;  3QYH B;  3OYG A;  4C5E A;  4JS4 A;  4HCB A;  2XU8 A;  4M75 B;  3OBY A;  1YBY A;  5D6W A;  1M8V A;  2LCC A;  2DXU A;  2RD1 A;  4A4E A;  1VQ8 T;  1QW1 A;  5IN1 A;  2EWN A;  2RM4 A;  1TH7 A;  4X9C A;  4BI4 A;  3CCU T;  2ZPH B;  1WGS A;  3RUX A;  3CEY A;  1M90 U;  1JJ2 S;  4M7A C;  4L59 A;  2A3L A;  2JTM A;  4J5Y A;  3MP6 A;  1M1K C;  1VQK A;  4N4H A;  5GAN 8;  3M9Q A;  4ZN3 A;  1RL2 A;  3M57 A;  2KY9 A;  5I2S A;  5A0L A;  3MEU A;  3QPH A;  3V8J A;  4C5I A;  3V7R A;  3I56 T;  3V8L A;  4JS5 A;  3HFN A;  5KE3 A;  3CCQ A;  4M75 D;  2CS7 A;  4J7I A;  2RK2 A;  3RIR A;  3LX7 A;  4BI3 A;  4C92 C;  4OP0 A;  1BIB A;  1QVF S;  4KUL A;  1VUB A;  4B9W A;  4C8Q C;  2VXE A;  2X4W A;  3Q1J A;  2I2L A;  1ZHI A;  1HK9 A;  1PSE A;  1VQL T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...