4OF1A

Crystal structure of toxin from staphylococcus aureus mu50
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
115
structure length
115
Chain Sequence
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIRTLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the toxin from Staphylococcus aureus Mu50
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Toxin
molecule keywords mRNA interferase MazF
total genus 33
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4of1A00
2VUBA 5CQYA 5CKEA 1UB4A 4VUBA 5CKHA 4OF1A 4ELZC 1VUBA 5CO7A 3JRZA 5HKCA 1M1FA 5CQXA 5CCAA 1NE8A 5DLOA 3JSCA 3NFCA 5HK3A 2MF2A 2KMTA 5CR2A 4ELYC 4HKEA 3G7ZA 5CKFA 4MZMA 5CKDA 1X75C 2C06A 5CKBA 4ME7A 5HK0A 5CK9A 3VUBA 4MZTA 3TCJA 4MZPA 3HPWA 4MDXA
chains in the Genus database with same CATH superfamily
2KVQG 1I8FA 2HZYA 1UDLA 1UTIA 5KYYB 2DRMA 4HVUA 3RKWA 2HCKA 1UHCA 4HVWA 1OPKA 2P84A 3JB9H 4GBQA 3RR6A 1H3HA 1LJOA 1RAIB 1D0XA 5LJ5j 4JLIA 3G6EA 1UGPB 2R57A 5LJ3e 2JMCA 2RJEA 2GBQA 2MYSA 4GY5A 3EGDA 3OQ5A 2QASA 3CCVT 2F2WA 1M9SA 4LUEA 4XU0A 1VQMA 1WHHA 4GLMA 3HKSA 1UGSB 1Q82U 5I2MA 2CGHA 2DYBA 3A1PA 4M7AF 2FHDA 2NYSA 2WSFE 4MDWA 1SPKA 2KRSA 3M4GA 3QJ6A 4LNPA 2QA4T 5C6SA 1PCXA 3EFOB 3RESA 2Y4XA 1KJWA 1ZA1B 1YJ9T 1FMKA 3CC7T 4BDYA 4XU2A 3PMTA 2O9VA 2NUPB 3S3NA 1K9MU 2G3RA 3N5BB 1EFNA 1BK2A 4RCBA 6AT1B 2CSQA 2FO0A 5HCKA 1YHQA 1NJIC 4XTXA 4QW2A 3VS4A 1VQ9T 1CKBA 4JJDA 4C92A 2LP5A 5KYUB 3A5ZB 4M7DA 5D6WA 1YP5A 2HKQB 4LDVA 2RMOA 4K11A 2EPDA 2DILA 2SEMA 3WVEB 1VQNQ 3J7AF 1V29B 3CBOA 3NTIA 4AG2C 1YN8A 1YJ9Q 4MDXA 5GJVB 4OF1A 4F14A 4E7KA 1WIEA 1Q81R 1KSWA 2XI9A 1M1KR 4PJOC 2XDDA 3RMQA 2FEIA 2V1QA 1X2KA 3GBQA 5GAN7 3A8LB 3QIIA 4HA8A 1JO8A 1G83A 2O88A 4Y91A 1M90C 2A28A 2RQWA 1YBYA 2KSSA 5LJ3d 5DM7R 3OW2S 4DA4A 1UB4A 2V8IA 3HFOA 1YWPA 4J9IA 4F7UF 2RQTA 2QA4A 3M5AA 2HAXA 3CCJA 1M1KC 2J6KA 1RLPC 2JVVA 2EYQA 3H0FA 2OTLT 1SRMA 4AMCA 2LQNA 3FJPA 3VKIA 5GAOm 2RI3A 1MGQA 4BE2A 1ZUKA 1VQ5A 4QVZA 5IHKA 3OBWA 1PKTA 3QZ9B 1ZUYA 2DAQA 4E2FB 5GAN5 1GCQA 4OB1B 5AT1B 1VQ8A 1WFWA 2E10A 4J9EA 1PM3A 1IGQA 1D3BA 1GBRA 1WZOA 1VYVA 2DL8A 3G4SA 2BZXA 5GAOp 2EQKA 2RH2A 3L2UA 1N27A 3L2WA 2RPNA 1NG2A 3JV3A 2YHTA 4XTUA 4J7FA 2F2VA 4Z89A 2BKDN 2F69A 1K9AA 3MP6A 2LRQA 4PKCC 3CC4T 5GANf 1S1NA 4A4EA 1YHQT 3X25B 2RB6A 3M56A 3JCMV 1H641 2JJ9A 4BY6C 3V7RA 2BE9B 1X01A 4ELYC 2CP0A 4KGXB 3OW2A 2D6FA 1M8MA 2ZGWA 3I55T 2JM9A 2X4WA 5AYFA 2NLUA 2MI6A 2HSPA 2CREA 2YWWA 1FX7A 3EFOA 1M3CA 2EGCA 4ZNXA 1PRMC 1X6GA 2HNIA 3OBYA 1R8OB 3GF5A 1MV0B 2M0YA 4M7DD 2LZ6B 2GQVA 3OW2P 3V8LA 5A2QE 3M4YA 1VQMT 2RJFA 3GIBA 3VU3C 5KYUA 4OGEA 2C0OA 5CKEA 5FU7B 4PJOB 1RUWA 1RAGB 2YUQA 3CCRT 1M1FA 1FXXA 1YJNT 1GXIE 2HL3A 3G6ET 2YUPA 4ZGEB 1Q86U 4OMFB 2IVWA 5GANg 2F2XA 4ZGJB 4L59A 4WTOB 2E70A 1YFNA 3M0RA 3V8JA 3BW1A 1MMGA 3E19A 4PJOA 2KQWA 2PZ1A 2DPPB 1RAFB 4FCYA 1QVFP 2DEQA 5GANh 3ZEHA 2EIFA 1G5VA 1K8AC 2DXUA 2ECZA 3OYGA 3P8BB 2XG8D 4E7HA 1YJWT 2L3SA 3GLXA 2M0OA 3DKMA 2M16A 4HKEA 4C92G 1Q7YR 2EQJA 2K3YA 2DYIA 1UGVA 1WQ7A 1VYUA 4LD9K 3S3MA 4KH1B 3UA7A 2JOYA 4C8QE 1H3ZA 1VQKA 4M75A 1UHFA 4F17A 2VASA 4ELZC 5GANj 4N0AC 2J05A 4E7LA 4F7UB 3NFCA 2AKKA 4CC3A 4X9DA 1R0CB 2YXYA 3G71A 3M58A 2AK5A 4LD6A 2LJ0A 3ZFJA 4C5EA 2RHUA 1RAHB 2XHCA 4M7AC 3CD6Q 2GNCA 2DETA 3NMZC 2FB7A 3DLMA 3O5ZA 1AWJA 4QQGA 2ZPEB 1BBZA 2SRCA 5CCAA 3Q1JA 3VS7A 1VQ4T 1QVGS 3M57A 1N8RU 4M78A 2CZ7B 1UEBA 3EFSA 3I55A 4QVCA 1WJRA 4J9CA 1OX9A 4XAXB 1SHGA 3CBMA 1M3BA 5HY6A 1YI2A 1VQ5T 4OB2B 2EYXA 2FPDA 2RA2A 4C8QB 1D1CA 5HKCA 2G6FX 3A98A 4EMKC 2NUZA 2R58A 2R5MA 2YRCA 2MCNA 1V1CA 1QWFA 3FDRA 2ROLA 1SSFA 3ME9A 2QXFA 3CCRQ 2BE7D 4A63B 3PMIA 3H0IA 1XNIA 2LT4A 2RJCA 1Q7YU 3VRYA 1NBEB 4M77C 1NJIU 5CQXA 4CC4B 5IT9E 4D8KA 2D8HA 2KK4A 2LVMA 2QQAA 4J9HA 3AT1B 3L2ZA 3UDCA 3EHQA 2HBWA 4BE1A 3RNJA 4FSSA 1RLQC 2J06A 5GAN6 2PTKA 2EQIA 1UGQB 4BI8B 4M78B 4EMKA 3JCMX 5CKHA 1IHVA 1MMAA 2NUTA 4JPBW 2LCCA 2QQSA 4ATOA 1HXDA 4IUUA 1Y96A 1SHFA 3CXCA 1JXMA 2A7YA 1BU1A 3VYHB 2LX7A 5FU6B 2QI2A 2C0IA 3JCMQ 2ENMA 4M78F 4PLIA 3JB9G 4O6JA 4C5IA 3EAEA 1KG1A 2E12A 2EJGA 2CH4W 2DNUA 4M4ZA 5GAMd 3FEOA 2KI7A 4M7DB 1WYXA 3CC7A 1YIJQ 1RACB 3QJYA 1K73U 2KGTA 3NGPA 3META 1G3WA 2QK0A 1M8VA 5FW9A 1WHMA 4FM4B 3SDZA 1I0CA 3LLRA 4IUVA 2DD4A 4N0AA 4YTLA 2KR3A 3QBYA 5FU6C 1QVFS 4A53A 1T0JA 2BIVA 4A4GA 2CH4A 5CAIA 1D0YA 1KK7A 2V8KA 3THKA 3MEVA 2EW3A 2OJ2A 4P5NA 2X3XD 4OP0A 5GAMj 4M7DC 4ME7A 5IXBA 3RERA 3CCQQ 3URGA 3FIFA 2EQMA 1WA7A 3OYDA 5LJ5d 4OMPA 3CMET 3D7SB 1WJQA 4N4IA 4IUTA 2A0FB 8ATCB 2KNBB 3H0HA 1JQQA 4J9BA 4DOWA 1BKBA 2XDBA 4B9WA 2GFUA 5GANd 1TH7A 1K8AU 2I0NA 2RN8A 1IXDA 3WVDB 5M9OA 2CUBA 2DBKA 1FYNA 1U1SA 2KT8A 4M75D 3I55Q 3PIPA 4JRIA 4M7AA 1VQ9A 3QPHA 3EHRA 4C8QC 4A4FA 2QGFB 2MOXA 2AIRB 1BI2A 3OYBA 2RI2A 2RQUA 5I11A 1K73R 1AD5A 1KC8R 4QKUA 1YCSB 2JS2A 2A3LA 1I1JA 2MK5A 3HTRA 2K57A 3GOXA 1QKWA 4FU6A 5I2SA 3BDUA 1KHCA 2DRKA 2F5KA 4KH0B 1W1FA 1D09B 4JJNK 2LQ8A 3GNFB 4OB3B 1O75A 1PRLC 5A0GA 2KT1A 3OYHA 4MZTA 4C5GA 3HPWA 1OYXA 1TUCA 4C8QD 2BZYA 5GAN3 1VQMQ 3CCLT 4M77G 3M0SA 1HJDA 5J39A 3TREA 4OMMA 1QCFA 1G8XA 3M55A 2A36A 2L3PA 2DZ9A 4TVRA 2XDPA 1UECA 1RL2A 2XKOC 4ZN1A 4C8QF 4L6V5 4M77A 3JCMb 1KQ2A 1J3TA 3CPWP 3CPWS 1VQPT 1NM7A 3LW5E 2DEUA 5GMKj 1K8AR 3H41A 2D0QB 2KMTA 2X4JA 4M77D 2OTLQ 5LJ3f 2EAYA 2WACA 1HSQA 2GF7A 2K7AA 2QQBA 1B34B 2YRVA 3G1JA 3I5SA 3HRUA 3ASKA 1UGRB 2JXBA 2CYZB 1MHNA 3CCQA 3QYGB 2K6DA 3RKXA 4AFQC 1AZEA 2ZPHB 1M4ZA 2CDTA 4J6YA 2VGMA 4EMKB 4E7IA 1VQLQ 4F7UA 2DBMA 2LNHB 3P8DA 3H8ZA 1X75C 2K3BA 3PIOA 1JXOA 1PWTA 2QYZA 5LL6S 1QKXA 4QQ6A 4DBHA 2M02A 5CIUA 2LMJA 5I22A 2RQVA 3KBGA 3OS0A 1MMDA 4M77B 4X1VA 1QVGP 1BIAA 3H6ZA 1K1ZA 1CSKA 2LJ1A 3M0QA 2RJDA 1RI9A 1E6HA 2FPEA 2EYZA 4FT4A 3J81E 1SEMA 3G6EQ 3FJ5A 1QP3A 1Q81U 4IIOA 4E6RA 4Q5WA 2XIDA 5I21A 5KH6A 2ED0A 3HHTB 4HCCA 1ZBJA 1MV3A 4C8QA 1BB9A 1ARKA 1MNEA 5D6YA 4Z88A 3CMAT 2ZZDA 3RKYA 3OYLA 4ZTJA 5LJ3h 1Z9QA 3G7ZA 1KQSS 3DLLA 2WSCE 2DXCA 1YI2T 4EIKA 4E7SA 4ZGDB 1Y07A 1HYOA 2HMAA 1WPYA 1UUEA 2VB6A 4X9CA 2KRMA 2EYWA 3PTAA 1Q86C 2ZPFB 1VQOQ 2K2VA 4PFPA 4PJOG 3A8MB 3L42A 1VQ6Q 2NWMA 4AG1C 3FC3A 5KCOA 2EKHA 3CXCP 1GFDA 4PL6A 3S3OA 2K5FA 2KAFA 1X43A 1M3AA 2M51A 1WNLA 1M90R 1PKSA 3LGFA 4JRQA 1ZSZC 5KYYA 1W70A 3CCSA 1OI1A 2LJ3A 4J9DA 3U23A 5L8RE 2KBTA 1Q86R 4ESRA 1Q82C 3OSVA 3CCLQ 5C0MA 2X9HA 3A8HB 3NTHA 3QZ5B 2YUNA 3HRSA 2CS7A 3MEUA 2LCLA 4QQDA 1ZA2B 2L3RA 2M9UA 3VS0A 1QCOA 3CCJT 1BIBA 4LDUA 1TWBA 4F7UE 1OZ3A 3DB3A 4KRTA 5FRNA 4BACA 1SF9A 2XK0A 4IIMA 1KD1R 1S72Q 2EFIA 1M30A 2ZPIB 2EGEA 1I81A 4C0DC 2E6ZA 2V8JA 1S72T 1T3SA 2DMOA 3JB9J 2CT3A 4XTYA 4IUQA 4NL2A 5ECAA 3OYNA 3JCMd 3PNWC 4DEXA 4M7DF 1RI0A 2GCXA 1VQOT 1YNZA 3REAB 5LJ5f 1AOJA 3CMEA 4Z8AA 3CCMQ 1VQ8Q 2DLPA 1CKAA 4C92E 4C0GA 3JB9I 4HCBA 1W4SA 4J9FA 4J6WA 1FWZA 2PUOB 4OMLA 2J6OA 3X28B 2L5QA 5GMKh 2QEXQ 5GAOq 2YDLA 4LN2A 1JU5C 3SB2A 2Y90A 2GFAA 4BI3A 1XTDA 4A54A 3C12A 4D8DA 2EQUA 3JCMW 4QVDA 4M75G 1U8RA 4J6XA 3LH0A 3KXTA 1VQ5Q 3QHSA 2I2LA 2HQEA 3E2UA 5GAN8 2HEQA 4RTVA 3CC2A 4HVVA 4RTXA 5EC7A 2K5IA 1O9SA 1XOVA 2B8AA 4E7JA 3SFMA 1VQPA 3HFNA 4PFOA 2O4XB 3EG3A 3M54A 1M27C 1PSFA 3EGXA 3JCMe 1JJ2S 4OMQA 5GMKe 1DJ7B 1TUDA 2L2PA 1KD1U 3SWNB 1JRIA 2CP3A 3CEYA 1PNJA 2DL7A 3SHWA 1W2BA 2CP2A 3VYGA 1T0HA 3VS3A 1VQOA 4HT8A 2XD0A 2X4YA 5LJ5h 1KQSP 1ZHIA 1VQ7T 3CPWA 3X26B 2J6FA 2E64A 1LOJA 3A8GB 2MIOA 1M5Q1 2AZVA 3T9NA 4RTTA 3ER0A 4NOYA 3G71T 2OTLA 4LDYA 1VQ7Q 2DIGA 2EWNA 1UG1A 1WHKA 4RMOA 1Q7YC 1A0NB 3QYHB 1KQSA 4MMLA 1WHGA 2E3IA 3FRNA 3OYYA 1S72A 4V2SA 4AFUC 3OB9A 4D6WA 4J8OA 2FZCB 1YWOA 3UPUA 1Y71A 3EFRA 3VS5A 1K73C 1VQLA 1QMCA 1VQLT 2MMPA 1YIJT 2VUBA 2DVJA 1PC0A 2JTMA 3CD6T 3CC7Q 2O2OA 3CMAA 2BTTA 5DLOA 4L5GA 2ABLA 4M77F 2VXFA 1Y57A 3OYAA 1X6BA 2JM8A 5CKFA 3VS1A 4KUIA 4PLLA 1ZBXA 1H8KA 2QGGA 5CKBA 4RUGA 2OTJT 4C0DB 1BYMA 3PFSA 1GFCA 1RABB 3CCLA 3WXMB 1NYFA 2E1HA 5FRMA 4J7IA 1QCNA 1TTHB 3E9GA 2DXTA 1Y0MA 2XICA 3ZL7C 1QW1A 4N4HA 1B3QA 1YCYA 2MAMA 3I9QA 2O01E 2VKNA 2IG0A 2MPXC 5J26A 1U1TA 2QA4Q 3LYIA 4MMKA 1X6OA 2KXDA 2ROTA 5IHIA 4C8QG 3CCMT 4JUVA 4ORZA 1TU0B 3OY9A 5KYXB 2D8JA 2FVUA 3PVLA 5GANe 2EGAA 4F04B 4JRPA 1Q82R 1QQJA 4J9GA 1R0BG 4FIBA 2RF0A 1ZSGA 1UJYA 2K9GA 2HDAA 2FRWA 1QVPA 1TSFA 4PK4A 2GTJA 5GMKm 2HD0A 4PFZA 4IKFA 4DBFA 3UA6A 1K9MR 1WQWA 1K4US 1E6GA 1IO6A 4M7DE 1BI3A 1IB8A 2BZ8A 3LGLA 3UT1A 4LUDA 1G3TA 1Y96B 4FYYB 2LTOA 2Y4YA 2R5AA 1PHTA 4F7UG 5FWCA 2RHIA 4RKUE 1Q81C 3DB4A 5KYNA 1WXUA 4NL3A 5CQYA 1T3LA 5IHNA 3JAME 1N8RC 4VUBA 4C92F 7AT1B 3GNGA 3M0PA 2YLBA 5KCHA 1NE8A 5GAMf 3CCRA 3EGXB 3CCUQ 2ZAEA 2LT1A 3TU4K 3INZA 1GL5A 3I56T 2VWFA 4BUGA 4EMGA 1EIFA 3EG2A 2RQRA 1AWOA 2H3EB 2LQKA 1OU9A 1VQ6A 1BCMA 3QG1A 4CI0C 1W2BS 2JTEA 1KIKA 4CC2A 2YUOA 3CCET 2YLCA 3C4SA 2COWA 2RD1A 3OYFA 1IGUA 2EJ9A 1RAAB 1QLYA 3RIRA 3UATA 2ATCB 1N9RA 1RAEB 2KYMA 3PT9A 3GP8A 4CRIA 8AT1B 2KE9A 3OA6A 2A37A 2RO0A 2PQWA 2E5KA 1VUBA 2KROA 3JCMh 4M75C 2P4TA 1NEBA 3EG9A 1YHQQ 1NPPA 5CR2A 3JCMP 4KGVB 1VQ4Q 5L23A 5FROA 2JW4A 3MP1A 4FYXB 3CCEQ 2QDLA 2LX9A 4FYWB 3VJPA 1KC8U 1VQ6T 2CT4A 1AHJB 1K0XA 1P92A 1M2OA 4LE9A 4Y28E 4M78E 5GAMh 3M53A 4XTZA 3A8OB 3ZBDA 3MJXA 1VQ4A 3OMGA 2FYKA 1TG0A 2H8HA 4AT1B 2X4XA 3E1SA 1KFZA 2CZ1B 1YIJA 2ED1A 3SWNA 2PVOB 2DL4A 1WLPB 3CCUT 4PJOD 4MZPA 2K2MA 4A4HA 2X35A 3G71Q 1ZX6A 2HSEB 1WXTA 3M0TA 4JS4A 5FWBA 1MNDA 3VS6A 2RNAA 1ABOA 4DBRA 3REBB 2PUKB 2MF2A 2DL5A 4M75B 2CZ6B 5GMKi 3G4SQ 4II1A 3OYIA 1D0ZA 2QDYB 3QDFA 3CCVQ 4ZTFA 1I07A 3TQ7P 4M7DG 1MUZA 1F1BB 1AT1B 2PU9B 1LCKA 2LDMA 3FLGA 1QVFA 3QXEB 4JS5A 3ULRB 5DLQE 4UC4A 1NLPC 2D1XA 3JCMf 2ZPGB 2QEXA 4HXJA 4J5YA 4PJOF 1K9MC 4X34A 2J7IA 3E9FA 2V26A 4KGZB 3CCST 3V7CA 2DX1A 3CMEQ 3CCMA 1I5OB 4AFZC 3P8HA 1VQPQ 1M1GA 4WCIA 2B86A 2K79A 3RUXA 3FB9A 3L2VA 3EG1A 2JT4A 5LJ3g 1M1KU 3MEWA 4DOVA 2L89A 4M78G 2OI3A 4XTWA 1TOVA 3L2RA 4DEYA 5IXFA 4JDSA 3OYEA 2IIMA 4N4GA 9ATCB 1SRLA 2DVEA 4C0FA 4OVAA 2COZA 2HQXA 4RTZA 1KC8C 4JZ3A 4PJNA 2A08A 1HK9A 1LVKA 1VQ9Q 3MHXA 2FL7A 2DTIA 3I35A 3CC2T 1G2BA 3OYMA 1KD1C 5A0LA 2M1HA 3I56A 2DM1A 2RK2A 4FSXA 4OGCA 2ESWA 1ZQ1A 2MWOA 2E4HA 3TSZA 2KY9A 3CXCS 2EJFA 3VUZA 4J83A 3J80E 1N9SA 3PE0A 3TSWA 3SWNC 1X2QA 5GAN2 2F1LA 5CO7A 5FLXE 1TXQA 3OMCA 1VA7A 1NPRA 2FRYA 3H9NA 1IHWA 2P0QA 3MKDA 2DO3A 1OULA 2YT6A 2E5QA 4A4KA 2JNGA 2LQWA 3GPLA 2WSEE 2DZCA 1OOTA 2QTVA 5GJWB 3VUBA 3CCUA 3MP8A 2EKOA 4PJLA 2X3WD 1YJNA 3PGGA 2OTJA 1X69A 3HP9A 4IUPA 2DFUA 1VQ7A 4ANJA 4M75F 2GTOA 3BDLA 2DTOA 5GAOl 1KHIA 1Q95G 1W6XA 2XU8A 3CMAQ 1N8RR 2VXEA 3M9QA 1YJNQ 1YJWA 4RG2A 1M90U 2AKLA 1WGSA 4PNOA 1LNXA 2YSQA 5KE3A 3EH1A 4KUDK 3JSCA 4FL6A 4PJMA 3CD6A 3CC4Q 3TVTA 1FMWA 1JEGA 1ABQA 3JCMJ 4CC7A 1N5ZA 3EG0A 5GAOr 1B07A 2F5TX 1IREB 4BDZA 3V8KA 3C94A 1H92A 1PG5B 3NTKA 1C0MA 2DE0X 2E3HA 1YITA 1D3BB 1SG5A 5LJ5e 4LDXA 3EG9B 2K3XA 2KXCA 3L2QA 3M0UA 2JN0A 2LC4A 1WX6A 1NLOC 3CCEA 2MWPA 1TUGB 5HK3A 1WJSA 3TEEA 1AZGB 3KFVA 1JB0E 3L1AA 1X27A 2O4XA 2O31A 4RCCA 1W2BP 3EH2A 1GRIA 5CKDA 3CC2Q 1B34A 2GGRA 3JB9D 2FZKB 4B9XA 3QUIA 2JTFA 2CUDA 1C6VX 2DIQA 3X24B 3X20B 3QSUA 1UFFA 2HQHA 2E65A 3VRZA 3JB9F 3SD4A 2EYYA 1G3YA 3JCMg 2FG0A 4BE0A 4DBQA 4DQ2A 3QWYA 1NYGA 2FZGB 5IH2A 5GAMe 2COYA 4M78D 1VQ8T 4EPCA 1Y7XA 2X51A 2NUPA 1EZZB 1OQKA 3OYKA 4LXCA 1YI2Q 2O9SA 3CCSQ 1VQNA 2RM4A 1VQKT 2DERA 2HL5C 1WHLA 3BFMA 3CPFA 3C95A 2OX7A 5GAMg 2QQ9A 1OX8A 4M78C 2YRDA 3OS2A 1QWEA 4QT7A 3TCJA 3EGUA 3CQTA 4PJOE 4E47A 3OS5A 5A0DA 1B7TA 4XTVA 3I56Q 2DTHA 1GBQA 4M75E 1SSHA 2L0AA 1K0SA 4JJBA 4RTYA 2IPOB 2P0PA 1E7OA 2EVRA 4Y92A 4PJJA 2ZPBB 1OPLA 2P4RA 1MMNA 4M7AB 2KDSA 3CCJQ 1WHJA 4BB7A 3HRTA 3UWNA 3EGDB 2CP6A 3RBBB 5LJ3j 5KYXA 2K5LA 1KQ1A 4BD3A 4AFSC 2RHYA 2VVKA 1VYTA 1ACMB 1OV3A 1WXBA 1R77A 3F70A 3MEAA 4FYVB 2CP5A 2DA9A 4OB0B 2C06A 2V1RA 1BI0A 3LWHA 4JJCA 2PNIA 3O8VA 4C0ZA 4GLKA 5GAN4 3OYCA 3CCQT 5KYWB 4IURA 3HSBA 4KT0E 4BI4A 1VIEA 3LWIA 5EG2A 1AWWA 1N6AA 4NS5A 3NPFA 1U3OA 2VGNA 1G3SA 5J3BA 4E7ZA 1UE9A 3CBPA 1YJ9A 1OU8A 2PVDB 5LJ5g 4M7AG 2DK3A 1I4K1 2FPFA 3BY7A 3LH5A 1D1AA 2W10A 4OMOA 2QEXT 3R6OA 3C0CA 3JRZA 1AVZC 1VOMA 4R56A 3CC4A 2AHJB 4FW2A 1C1AA 4M77E 1LPLA 2VYTA 2CZ0B 2E41A 2AZSA 2OTJQ 3UF4A 2CSIA 2NUTB 1XQHA 3CCVA 1GCPA 2JUFA 2DD5A 1YITT 1AEYA 2VC8A 3SEMA 2LCSA 4M7AD 3OSSC 1ZSZA 1V76A 4FT2A 3RDVA 3G4ST 2PVGB 4WF2A 3QKJA 4ZN3A 1PD1A 1ZUUA 1PD0A 4XU1A 2D0NA 3QWXX 2JZ2A 3QO3A 4EMHA 4KBMB 4BY6B 2Z0WA 1GCQC 2KRNA 4HCZA 1IZ6A 1QP2A 2EBPA 4XU3A 3OS1A 1U06A 4C92D 2RHXA 2CKKA 3MPUB 1M2VA 5D6XA 2H3JA 5FU7C 4JRKA 4C92C 5IAYA 3V7SA 1QVGA 3KUFA 5KE2A 1TS9A 4B6MA 2XMFA 4LDWA 1VIFA 2JS0A 3S6WA 2CP7A 2E6NA 4JLGA 4M7AE 4XQ3A 1Z9ZA 1BCOA 2L8DA 2DL3A 1PSEA 2QTXA 2RHZA 5D7UA 1XJWB 3HL8A 4F16A 3RMSA 3R6NA 2DJZA 3BE3A 1WDXA 3I5RA 1OEBA 4C92B 1UJ0A 2L3QA 2KEAA 1IRXA 1D1BA 2P0KA 1NJIR 1VQNT 4RTWA 1M2VB 2D9TA 3JCMc 2QG9B 1U5SA 1ZLMA 1NEGA 4C5HA 1VQKQ 3LX7A 3VV0A 1HD3A 4MZMA 3VS2A 5GAOn 2RI5A 3AHUA 4OMNA 4R55A 1OZ2A 1JJ2A 3NHNA 1FMVA 2QAZA 2QQRA 1I5LA 1YITQ 4KULA 1AWXA 1SKUB 2W0ZA 4EDUA 2K4YA 4RG8A 1ZSZB 2JMAA 4HCKA 2ZCFB 5IN1A 3IQLA 1JJ2P 2HKNA 2VV5A 2DJQA 2AT1B 2GQIA 5HK0A 5CK9A 2RK1A 4O5VA 2OAUA 3MCAB 4RTUA 1WI7A 5GMKl 2BUDA 2OAWA 4FW1A 4XK8E 5DY9A 1NZ9A 2HBPA 3MO8A 1K76A 5CVIA 3OYJA 4HT9A 3PVQA 1JBMA 1RADB 1BI1A 2DF6A 2KYBA 4JZ4A 1YJWQ 3QDRB 2C0TA 2DKGA 4R0KA 3M59A 2DXBA 5KYWA 2LNVA 4Z02A 1EX4A
chains in the Genus database with same CATH topology
2GFAA 1N9SA 4EMKA 3JCMX 5CKHA 4BI3A 3SWNC 2KVQG 1XTDA 2LCCA 5GAN2 1I8FA 3C12A 4A54A 5CO7A 5FLXE 2QQSA 2EQUA 3OMCA 3JCMW 4ATOA 1HXDA 4QVDA 4M75G 4IUUA 1Y96A 1NPRA 1U8RA 4J6XA 3LH0A 3CXCA 2P0QA 2A7YA 3RKWA 3KXTA 3QHSA 2DO3A 3VYHB 2E5QA 4A4KA 2JNGA 5FU6B 3GPLA 2WSEE 2I2LA 2HQEA 2QI2A 2DZCA 5GAN8 3JB9H 3JCMQ 1LJOA 4M78F 4PLIA 3VUBA 3CCUA 3CC2A 3JB9G 5LJ5j 2K5IA 3MP8A 4O6JA 4C5IA 3EAEA 1KG1A 4JLIA 2EKOA 2E12A 1O9SA 1XOVA 2EJGA 3G6EA 2B8AA 1UGPB 2R57A 3SFMA 5LJ3e 3PGGA 4E7JA 1VQPA 1YJNA 2OTJA 3HFNA 3HP9A 5GAMd 4IUPA 1VQ7A 3FEOA 2RJEA 2O4XB 4M7DB 3M54A 1PSFA 1JJ2S 4M75F 3JCMe 4GY5A 3CC7A 1K73U 3QJYA 3BDLA 5GMKe 1DJ7B 3OQ5A 1KD1U 3META 3SWNB 1JRIA 3CEYA 1G3WA 2DTOA 3CCVT 5GAOl 1M8VA 1KHIA 1M9SA 2XU8A 4XU0A 3SDZA 4FM4B 1VQMA 3LLRA 4IUVA 2VXEA 1UGSB 2DD4A 3HKSA 3M9QA 2CGHA 4N0AA 4YTLA 5I2MA 1W2BA 1Q82U 3VYGA 4M7AF 1YJWA 3QBYA 5FU6C 4RG2A 1QVFS 2FHDA 2WSFE 4MDWA 4A53A 1M90U 1WGSA 4PNOA 1VQOA 4HT8A 1LNXA 2BIVA 2XD0A 3M4GA 4A4GA 3QJ6A 2X4YA 5LJ5h 5KE3A 5C6SA 2QA4T 4KUDK 5CAIA 3JSCA 4FL6A 3CD6A 1ZHIA 3RESA 2V8KA 2Y4XA 1VQ7T 3CPWA 3X26B 3MEVA 1YJ9T 3JCMJ 2E64A 1LOJA 5GAOr 3CC7T 3A8GB 4P5NA 4OP0A 1M5Q1 2F5TX 3T9NA 1IREB 3ER0A 4NOYA 3PMTA 4XU2A 4ME7A 3V8KA 3C94A 4LDYA 5GAMj 4BDZA 2DIGA 3S3NA 3RERA 2EWNA 3NTKA 1K9MU 3URGA 3FIFA 2EQMA 2G3RA 4RMOA 3N5BB 1YITA 1D3BB 3OYDA 1Q7YC 5LJ5d 3QYHB 4RCBA 5LJ5e 1KQSA 3CMET 4MMLA 4LDXA 2K3XA 1WJQA 3L2QA 3FRNA 1YHQA 3OYYA 4N4IA 1S72A 4V2SA 2JN0A 2LC4A 4IUTA 1NJIC 3CCEA 3OB9A 4XTXA 4QW2A 2MWPA 4D6WA 4J8OA 5HK3A 1VQ9T 4C92A 1WJSA 3TEEA 3A5ZB 1JB0E 3L1AA 4M7DA 2O4XA 5D6WA 4DOWA 1BKBA 3UPUA 4LDVA 1Y71A 4RCCA 2GFUA 3EFRA 4B9WA 2XDBA 5CKDA 3WVEB 1K73C 1VQLA 1B34A 3J7AF 5GANd 1V29B 3CBOA 1VQLT 1TH7A 2MMPA 3JB9D 3NTIA 1K8AU 4ZTJA 1YIJT 4MDXA 2VUBA 2JTMA 4OF1A 3QUIA 2JTFA 3WVDB 4B9XA 4E7KA 2DIQA 3CD6T 2XI9A 3X24B 3X20B 5M9OA 3QSUA 4PJOC 2XDDA 3CMAA 3RMQA 1U1SA 5DLOA 2E65A 4L5GA 4M75D 4JJNK 4M77F 5GAN7 3SD4A 2VXFA 3JB9F 1G3YA 3JCMg 3A8LB 3PIPA 3QIIA 4HA8A 3OYAA 4JRIA 4M7AA 1VQ9A 3QPHA 4BE0A 4DQ2A 5CKFA 4Y91A 4C8QC 4KUIA 4PLLA 1ZBXA 1M90C 4A4FA 5CKBA 1BI2A 2OTJT 4C0DB 5GAMe 4M78D 1VQ8T 1BYMA 1YBYA 2KSSA 3PFSA 5LJ3d 4EPCA 1Y7XA 2RI2A 5DM7R 3OYBA 3OW2S 4DA4A 3CCLA 3WXMB 1UB4A 2A3LA 2V8IA 3OYKA 2E1HA 3HFOA 4F7UF 5FRMA 4J7IA 3GOXA 2K57A 1VQNA 2RM4A 2QA4A 3M5AA 3E9GA 4FU6A 1VQKT 5I2SA 3BDUA 2HAXA 3CCJA 2DXTA 1KHCA 2F5KA 2XICA 1M1KC 3BFMA 3CPFA 3C95A 2LQ8A 1QW1A 3GNFB 4N4HA 4OB3B 1O75A 1YCYA 2MAMA 5GAMg 2QQ9A 2O01E 2IG0A 2JVVA 5J26A 5A0GA 1U1TA 2EYQA 4M78C 3OS2A 2OTLT 3LYIA 4MMKA 3FJPA 3OYHA 4MZTA 1X6OA 3VKIA 4C8QG 3CCMT 3TCJA 5GAOm 2RI3A 1MGQA 3HPWA 4JUVA 4C5GA 1OYXA 4C8QD 4BE2A 4E47A 3OS5A 5A0DA 4PJOE 1VQ5A 3OY9A 4XTVA 4QVZA 5GAN3 3OBWA 2DTHA 3CCLT 2FVUA 3QZ9B 4M75E 5GANe 2DAQA 4M77G 4JRPA 5GAN5 4OB1B 5J39A 3TREA 2P0PA 3M55A 4M7DC 4FIBA 1VQ8A 2E10A 1D3BA 2DZ9A 4TVRA 2ZPBB 2XDPA 1QVPA 3G71T 4M7AB 1RL2A 2KDSA 2XKOC 4BB7A 4ZN1A 5GMKm 2HD0A 3HRTA 3UWNA 4C8QF 4L6V5 4M77A 3G4SA 5LJ3j 3JCMb 1KQ2A 5GAOp 2EQKA 1KQ1A 2K5LA 2RH2A 3CPWS 4IKFA 4BD3A 1VQPT 3L2UA 3LW5E 1N27A 2RHYA 5GMKj 1WQWA 3L2WA 4M7DE 1BI3A 3LGLA 2KMTA 2D0QB 2X4JA 4M77D 3UT1A 1G3TA 2YHTA 3F70A 1Y96B 3MEAA 2LTOA 4XTUA 2Y4YA 5LJ3f 2EAYA 2WACA 2R5AA 4J7FA 2GF7A 2QQBA 4OB0B 4F7UG 2C06A 1B34B 1BI0A 2BKDN 3LWHA 2RHIA 2YRVA 4RKUE 1Q81C 2F69A 3DB4A 3HRUA 3MP6A 2LRQA 3ASKA 4PKCC 1UGRB 4NL3A 3O8VA 4C0ZA 3CC4T 4GLKA 5CQYA 2CYZB 1MHNA 5GANf 5GAN4 3OYCA 3CCQA 3QYGB 3JAME 3CCQT 4VUBA 1N8RC 4C92F 3RKXA 4A4EA 1YHQT 3GNGA 3X25B 4IURA 3HSBA 2RB6A 3M56A 2YLBA 2ZPHB 4KT0E 1VIEA 1M4ZA 3JCMV 4BI4A 5KCHA 3LWIA 1NE8A 5EG2A 5GAMf 3CCRA 4J6YA 1H641 1N6AA 2VGMA 3V7RA 4NS5A 4BY6C 4EMKB 4E7IA 1X01A 2LT1A 2VGNA 4ELYC 3TU4K 3INZA 4F7UA 1G3SA 3I56T 5J3BA 3P8DA 3H8ZA 1X75C 3CBPA 3OW2A 3PIOA 1YJ9A 2D6FA 2PVDB 2ZGWA 3I55T 4BUGA 2OTLA 2X4WA 4EMGA 5LJ5g 4M7AG 1EIFA 2DK3A 5AYFA 1I4K1 5LL6S 2NLUA 2MI6A 3BY7A 2LQKA 1FX7A 2QEXT 4QQ6A 3R6OA 1VQ6A 3QG1A 5CIUA 3JRZA 4R56A 3KBGA 3OS0A 2AHJB 4CI0C 3CC4A 2HNIA 1W2BS 3OBYA 1R8OB 3GF5A 4M77B 1BIAA 4M7DD 4M77E 2GQVA 3CCET 2YLCA 2VYTA 2CZ0B 3C4SA 2RD1A 3H6ZA 3V8LA 5A2QE 3OYFA 2RJDA 2E41A 2EJ9A 1XQHA 3M4YA 3RIRA 3CCVA 1VQMT 2JUFA 1N9RA 2DD5A 2RJFA 1YITT 4FT4A 3GIBA 2VC8A 3VU3C 3J81E 3GP8A 3PT9A 4M7AD 4CRIA 1QP3A 4OGEA 3OSSC 5CKEA 5FU7B 3OA6A 4PJOB 1Q81U 2RO0A 2PQWA 4FT2A 1VUBA 3CCRT 4Q5WA 2XIDA 2PVGB 1M1FA 5I21A 5KH6A 4WF2A 3HHTB 3G4ST 3QKJA 3JCMh 4HCCA 4M75C 2P4TA 4ZN3A 1FXXA 4C8QA 1YJNT 1GXIE 3G6ET 4XU1A 1NPPA 5CR2A 5D6YA 3JCMP 4ZGEB 1Q86U 3CMAT 2JZ2A 4OMFB 2IVWA 2ZZDA 3QO3A 4EMHA 3RKYA 4KBMB 4BY6B 4ZGJB 4L59A 5LJ3h 5GANg 2E70A 3OYLA 3G7ZA 1KQSS 3DLLA 3V8JA 2WSCE 2DXCA 3BW1A 3E19A 5FROA 3MP1A 4PJOA 1YI2T 2KQWA 4HCZA 1IZ6A 1Y07A 1QP2A 2DPPB 4ZGDB 2LX9A 2DEQA 4XU3A 3VJPA 5GANh 1KC8U 3ZEHA 1VQ6T 3OS1A 2EIFA 1G5VA 1WPYA 1K8AC 2DXUA 1AHJB 4C92D 2RHXA 2CKKA 3OYGA 1P92A 4X9CA 3P8BB 2XG8D 4E7HA 1YJWT 3PTAA 5D6XA 4Y28E 4M78E 2ZPFB 3M53A 3GLXA 4XTZA 5GAMh 1Q86C 2M0OA 2K2VA 3A8OB 2H3JA 3ZBDA 4PJOG 1VQ4A 3A8MB 3OMGA 5FU7C 2FYKA 3DKMA 4JRKA 3L42A 2M16A 4HKEA 4C92C 4C92G 5IAYA 3FC3A 2EQJA 3V7SA 2K3YA 3KUFA 5KCOA 1QVGA 5KE2A 4PL6A 1WQ7A 3S3OA 2X4XA 2K5FA 3E1SA 4LDWA 1VIFA 2KAFA 3S6WA 4LD9K 2CZ1B 3S3MA 1YIJA 3SWNA 2JOYA 2E6NA 2PVOB 4JLGA 4M7AE 4C8QE 3CCUT 4MZPA 4PJOD 4A4HA 1H3ZA 1VQKA 4XQ3A 4M75A 2X35A 2L8DA 1PSEA 1WNLA 2QTXA 2RHZA 4ELZC 3LGFA 4JS4A 5GANj 4N0AC 4JRQA 4E7LA 4F7UB 3HL8A 3NFCA 3CCSA 2PUKB 4X9DA 1OI1A 2MF2A 3RMSA 4M75B 2DJZA 2CZ6B 5L8RE 5GMKi 3M58A 3G71A 1Q82C 3OSVA 4LD6A 5C0MA 3ZFJA 4C5EA 2RHUA 4II1A 3A8HB 2XHCA 4M7AC 3NTHA 3OYIA 3QZ5B 2QDYB 3HRSA 4ZTFA 2CS7A 4M7DG 3MEUA 4C92B 2FB7A 2LCLA 3DLMA 4QQDA 2PU9B 4QQGA 2M9UA 2L3RA 2P0KA 2ZPEB 2LDMA 3FLGA 1QVFA 3QXEB 4JS5A 1VQNT 5DLQE 4UC4A 2D9TA 3JCMf 5CCAA 3Q1JA 1VQ4T 3JCMc 2ZPGB 2QEXA 3CCJT 1QVGS 3M57A 4J5YA 4PJOF 1BIBA 1N8RU 4M78A 1K9MC 2CZ7B 4X34A 4C5HA 3E9FA 3LX7A 4LDUA 1UEBA 3VV0A 3CCST 3EFSA 4MZMA 3V7CA 3I55A 4QVCA 5GAOn 4F7UE 2RI5A 1OZ3A 3DB3A 1WJRA 5FRNA 4BACA 3AHUA 4R55A 3CCMA 2XK0A 4XAXB 1OZ2A 3CBMA 1JJ2A 4BDYA 3P8HA 5HY6A 1YI2A 1VQ5T 4OB2B 1M1GA 3RUXA 3FB9A 2RA2A 2EFIA 3L2VA 4C8QB 2ZPIB 2QQRA 1I5LA 5HKCA 1I81A 4KULA 5LJ3g 1M1KU 3MEWA 4EMKC 4C0DC 2E6ZA 2L89A 2R58A 2V8JA 2R5MA 4M78G 4DOVA 1S72T 4XTWA 4EDUA 2K4YA 3JB9J 3L2RA 4RG8A 4JDSA 3OYEA 3FDRA 4N4GA 2ZCFB 4XTYA 5IN1A 1SSFA 2DVEA 2VV5A 4IUQA 4NL2A 4C0FA 3ME9A 3OYNA 2QXFA 3JCMd 4OVAA 2HQXA 3PNWC 5HK0A 5CK9A 1KC8C 2RK1A 3PMIA 4M7DF 4O5VA 2OAUA 1RI0A 2GCXA 3MCAB 1HK9A 1XNIA 3MHXA 2LT4A 2FL7A 2DTIA 2BUDA 2RJCA 5GMKl 1VQOT 1Q7YU 3CC2T 3OYMA 4M77C 4XK8E 1NJIU 5DY9A 1KD1C 5LJ5f 1NZ9A 2HBPA 3MO8A 5CQXA 5CVIA 3OYJA 5IT9E 4HT9A 5A0LA 2M1HA 3I56A 1JBMA 2KK4A 3CMEA 1BI1A 2LVMA 2QQAA 2RK2A 4C92E 3L2ZA 3UDCA 4FSXA 4OGCA 4C0GA 3JB9I 1W4SA 4HCBA 4BE1A 3QDRB 4J6WA 1FWZA 1ZQ1A 2PUOB 2DKGA 5GAN6 3M59A 2DXBA 2MWOA 3X28B 3CXCS 2KY9A 2L5QA 5GMKh 1UGQB 2EJFA 4BI8B 2LNVA 3VUZA 5GAOq 4Z02A 4M78B 4J83A 3SB2A 2Y90A 3J80E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VUB A;  5CQY A;  5CKE A;  1UB4 A;  4VUB A;  5CKH A;  4OF1 A;  4ELZ C;  1VUB A;  5CO7 A;  3JRZ A;  5HKC A;  1M1F A;  5CQX A;  5CCA A;  1NE8 A;  5DLO A;  3JSC A;  3NFC A;  5HK3 A;  2MF2 A;  2KMT A;  5CR2 A;  4ELY C;  4HKE A;  3G7Z A;  5CKF A;  4MZM A;  5CKD A;  1X75 C;  2C06 A;  5CKB A;  4ME7 A;  5HK0 A;  5CK9 A;  3VUB A;  4MZT A;  3TCJ A;  4MZP A;  3HPW A;  4MDX A; 
#chains in the Genus database with same CATH topology
 2KVQ G;  1I8F A;  2HZY A;  1UDL A;  1UTI A;  5KYY B;  2DRM A;  4HVU A;  3RKW A;  2HCK A;  1UHC A;  4HVW A;  1OPK A;  2P84 A;  3JB9 H;  4GBQ A;  3RR6 A;  1H3H A;  1LJO A;  1RAI B;  1D0X A;  5LJ5 j;  4JLI A;  3G6E A;  1UGP B;  2R57 A;  5LJ3 e;  2JMC A;  2RJE A;  2GBQ A;  2MYS A;  4GY5 A;  3EGD A;  3OQ5 A;  2QAS A;  3CCV T;  2F2W A;  1M9S A;  4LUE A;  4XU0 A;  1VQM A;  1WHH A;  4GLM A;  3HKS A;  1UGS B;  1Q82 U;  5I2M A;  2CGH A;  2DYB A;  3A1P A;  4M7A F;  2FHD A;  2NYS A;  2WSF E;  4MDW A;  1SPK A;  2KRS A;  3M4G A;  3QJ6 A;  4LNP A;  2QA4 T;  5C6S A;  1PCX A;  3EFO B;  3RES A;  2Y4X A;  1KJW A;  1ZA1 B;  1YJ9 T;  1FMK A;  3CC7 T;  4BDY A;  4XU2 A;  3PMT A;  2O9V A;  2NUP B;  3S3N A;  1K9M U;  2G3R A;  3N5B B;  1EFN A;  1BK2 A;  4RCB A;  6AT1 B;  2CSQ A;  2FO0 A;  5HCK A;  1YHQ A;  1NJI C;  4XTX A;  4QW2 A;  3VS4 A;  1VQ9 T;  1CKB A;  4JJD A;  4C92 A;  2LP5 A;  5KYU B;  3A5Z B;  4M7D A;  5D6W A;  1YP5 A;  2HKQ B;  4LDV A;  2RMO A;  4K11 A;  2EPD A;  2DIL A;  2SEM A;  3WVE B;  1VQN Q;  3J7A F;  1V29 B;  3CBO A;  3NTI A;  4AG2 C;  1YN8 A;  1YJ9 Q;  4MDX A;  5GJV B;  4OF1 A;  4F14 A;  4E7K A;  1WIE A;  1Q81 R;  1KSW A;  2XI9 A;  1M1K R;  4PJO C;  2XDD A;  3RMQ A;  2FEI A;  2V1Q A;  1X2K A;  3GBQ A;  5GAN 7;  3A8L B;  3QII A;  4HA8 A;  1JO8 A;  1G83 A;  2O88 A;  4Y91 A;  1M90 C;  2A28 A;  2RQW A;  1YBY A;  2KSS A;  5LJ3 d;  5DM7 R;  3OW2 S;  4DA4 A;  1UB4 A;  2V8I A;  3HFO A;  1YWP A;  4J9I A;  4F7U F;  2RQT A;  2QA4 A;  3M5A A;  2HAX A;  3CCJ A;  1M1K C;  2J6K A;  1RLP C;  2JVV A;  2EYQ A;  3H0F A;  2OTL T;  1SRM A;  4AMC A;  2LQN A;  3FJP A;  3VKI A;  5GAO m;  2RI3 A;  1MGQ A;  4BE2 A;  1ZUK A;  1VQ5 A;  4QVZ A;  5IHK A;  3OBW A;  1PKT A;  3QZ9 B;  1ZUY A;  2DAQ A;  4E2F B;  5GAN 5;  1GCQ A;  4OB1 B;  5AT1 B;  1VQ8 A;  1WFW A;  2E10 A;  4J9E A;  1PM3 A;  1IGQ A;  1D3B A;  1GBR A;  1WZO A;  1VYV A;  2DL8 A;  3G4S A;  2BZX A;  5GAO p;  2EQK A;  2RH2 A;  3L2U A;  1N27 A;  3L2W A;  2RPN A;  1NG2 A;  3JV3 A;  2YHT A;  4XTU A;  4J7F A;  2F2V A;  4Z89 A;  2BKD N;  2F69 A;  1K9A A;  3MP6 A;  2LRQ A;  4PKC C;  3CC4 T;  5GAN f;  1S1N A;  4A4E A;  1YHQ T;  3X25 B;  2RB6 A;  3M56 A;  3JCM V;  1H64 1;  2JJ9 A;  4BY6 C;  3V7R A;  2BE9 B;  1X01 A;  4ELY C;  2CP0 A;  4KGX B;  3OW2 A;  2D6F A;  1M8M A;  2ZGW A;  3I55 T;  2JM9 A;  2X4W A;  5AYF A;  2NLU A;  2MI6 A;  2HSP A;  2CRE A;  2YWW A;  1FX7 A;  3EFO A;  1M3C A;  2EGC A;  4ZNX A;  1PRM C;  1X6G A;  2HNI A;  3OBY A;  1R8O B;  3GF5 A;  1MV0 B;  2M0Y A;  4M7D D;  2LZ6 B;  2GQV A;  3OW2 P;  3V8L A;  5A2Q E;  3M4Y A;  1VQM T;  2RJF A;  3GIB A;  3VU3 C;  5KYU A;  4OGE A;  2C0O A;  5CKE A;  5FU7 B;  4PJO B;  1RUW A;  1RAG B;  2YUQ A;  3CCR T;  1M1F A;  1FXX A;  1YJN T;  1GXI E;  2HL3 A;  3G6E T;  2YUP A;  4ZGE B;  1Q86 U;  4OMF B;  2IVW A;  5GAN g;  2F2X A;  4ZGJ B;  4L59 A;  4WTO B;  2E70 A;  1YFN A;  3M0R A;  3V8J A;  3BW1 A;  1MMG A;  3E19 A;  4PJO A;  2KQW A;  2PZ1 A;  2DPP B;  1RAF B;  4FCY A;  1QVF P;  2DEQ A;  5GAN h;  3ZEH A;  2EIF A;  1G5V A;  1K8A C;  2DXU A;  2ECZ A;  3OYG A;  3P8B B;  2XG8 D;  4E7H A;  1YJW T;  2L3S A;  3GLX A;  2M0O A;  3DKM A;  2M16 A;  4HKE A;  4C92 G;  1Q7Y R;  2EQJ A;  2K3Y A;  2DYI A;  1UGV A;  1WQ7 A;  1VYU A;  4LD9 K;  3S3M A;  4KH1 B;  3UA7 A;  2JOY A;  4C8Q E;  1H3Z A;  1VQK A;  4M75 A;  1UHF A;  4F17 A;  2VAS A;  4ELZ C;  5GAN j;  4N0A C;  2J05 A;  4E7L A;  4F7U B;  3NFC A;  2AKK A;  4CC3 A;  4X9D A;  1R0C B;  2YXY A;  3G71 A;  3M58 A;  2AK5 A;  4LD6 A;  2LJ0 A;  3ZFJ A;  4C5E A;  2RHU A;  1RAH B;  2XHC A;  4M7A C;  3CD6 Q;  2GNC A;  2DET A;  3NMZ C;  2FB7 A;  3DLM A;  3O5Z A;  1AWJ A;  4QQG A;  2ZPE B;  1BBZ A;  2SRC A;  5CCA A;  3Q1J A;  3VS7 A;  1VQ4 T;  1QVG S;  3M57 A;  1N8R U;  4M78 A;  2CZ7 B;  1UEB A;  3EFS A;  3I55 A;  4QVC A;  1WJR A;  4J9C A;  1OX9 A;  4XAX B;  1SHG A;  3CBM A;  1M3B A;  5HY6 A;  1YI2 A;  1VQ5 T;  4OB2 B;  2EYX A;  2FPD A;  2RA2 A;  4C8Q B;  1D1C A;  5HKC A;  2G6F X;  3A98 A;  4EMK C;  2NUZ A;  2R58 A;  2R5M A;  2YRC A;  2MCN A;  1V1C A;  1QWF A;  3FDR A;  2ROL A;  1SSF A;  3ME9 A;  2QXF A;  3CCR Q;  2BE7 D;  4A63 B;  3PMI A;  3H0I A;  1XNI A;  2LT4 A;  2RJC A;  1Q7Y U;  3VRY A;  1NBE B;  4M77 C;  1NJI U;  5CQX A;  4CC4 B;  5IT9 E;  4D8K A;  2D8H A;  2KK4 A;  2LVM A;  2QQA A;  4J9H A;  3AT1 B;  3L2Z A;  3UDC A;  3EHQ A;  2HBW A;  4BE1 A;  3RNJ A;  4FSS A;  1RLQ C;  2J06 A;  5GAN 6;  2PTK A;  2EQI A;  1UGQ B;  4BI8 B;  4M78 B;  4EMK A;  3JCM X;  5CKH A;  1IHV A;  1MMA A;  2NUT A;  4JPB W;  2LCC A;  2QQS A;  4ATO A;  1HXD A;  4IUU A;  1Y96 A;  1SHF A;  3CXC A;  1JXM A;  2A7Y A;  1BU1 A;  3VYH B;  2LX7 A;  5FU6 B;  2QI2 A;  2C0I A;  3JCM Q;  2ENM A;  4M78 F;  4PLI A;  3JB9 G;  4O6J A;  4C5I A;  3EAE A;  1KG1 A;  2E12 A;  2EJG A;  2CH4 W;  2DNU A;  4M4Z A;  5GAM d;  3FEO A;  2KI7 A;  4M7D B;  1WYX A;  3CC7 A;  1YIJ Q;  1RAC B;  3QJY A;  1K73 U;  2KGT A;  3NGP A;  3MET A;  1G3W A;  2QK0 A;  1M8V A;  5FW9 A;  1WHM A;  4FM4 B;  3SDZ A;  1I0C A;  3LLR A;  4IUV A;  2DD4 A;  4N0A A;  4YTL A;  2KR3 A;  3QBY A;  5FU6 C;  1QVF S;  4A53 A;  1T0J A;  2BIV A;  4A4G A;  2CH4 A;  5CAI A;  1D0Y A;  1KK7 A;  2V8K A;  3THK A;  3MEV A;  2EW3 A;  2OJ2 A;  4P5N A;  2X3X D;  4OP0 A;  5GAM j;  4M7D C;  4ME7 A;  5IXB A;  3RER A;  3CCQ Q;  3URG A;  3FIF A;  2EQM A;  1WA7 A;  3OYD A;  5LJ5 d;  4OMP A;  3CME T;  3D7S B;  1WJQ A;  4N4I A;  4IUT A;  2A0F B;  8ATC B;  2KNB B;  3H0H A;  1JQQ A;  4J9B A;  4DOW A;  1BKB A;  2XDB A;  4B9W A;  2GFU A;  5GAN d;  1TH7 A;  1K8A U;  2I0N A;  2RN8 A;  1IXD A;  3WVD B;  5M9O A;  2CUB A;  2DBK A;  1FYN A;  1U1S A;  2KT8 A;  4M75 D;  3I55 Q;  3PIP A;  4JRI A;  4M7A A;  1VQ9 A;  3QPH A;  3EHR A;  4C8Q C;  4A4F A;  2QGF B;  2MOX A;  2AIR B;  1BI2 A;  3OYB A;  2RI2 A;  2RQU A;  5I11 A;  1K73 R;  1AD5 A;  1KC8 R;  4QKU A;  1YCS B;  2JS2 A;  2A3L A;  1I1J A;  2MK5 A;  3HTR A;  2K57 A;  3GOX A;  1QKW A;  4FU6 A;  5I2S A;  3BDU A;  1KHC A;  2DRK A;  2F5K A;  4KH0 B;  1W1F A;  1D09 B;  4JJN K;  2LQ8 A;  3GNF B;  4OB3 B;  1O75 A;  1PRL C;  5A0G A;  2KT1 A;  3OYH A;  4MZT A;  4C5G A;  3HPW A;  1OYX A;  1TUC A;  4C8Q D;  2BZY A;  5GAN 3;  1VQM Q;  3CCL T;  4M77 G;  3M0S A;  1HJD A;  5J39 A;  3TRE A;  4OMM A;  1QCF A;  1G8X A;  3M55 A;  2A36 A;  2L3P A;  2DZ9 A;  4TVR A;  2XDP A;  1UEC A;  1RL2 A;  2XKO C;  4ZN1 A;  4C8Q F;  4L6V 5;  4M77 A;  3JCM b;  1KQ2 A;  1J3T A;  3CPW P;  3CPW S;  1VQP T;  1NM7 A;  3LW5 E;  2DEU A;  5GMK j;  1K8A R;  3H41 A;  2D0Q B;  2KMT A;  2X4J A;  4M77 D;  2OTL Q;  5LJ3 f;  2EAY A;  2WAC A;  1HSQ A;  2GF7 A;  2K7A A;  2QQB A;  1B34 B;  2YRV A;  3G1J A;  3I5S A;  3HRU A;  3ASK A;  1UGR B;  2JXB A;  2CYZ B;  1MHN A;  3CCQ A;  3QYG B;  2K6D A;  3RKX A;  4AFQ C;  1AZE A;  2ZPH B;  1M4Z A;  2CDT A;  4J6Y A;  2VGM A;  4EMK B;  4E7I A;  1VQL Q;  4F7U A;  2DBM A;  2LNH B;  3P8D A;  3H8Z A;  1X75 C;  2K3B A;  3PIO A;  1JXO A;  1PWT A;  2QYZ A;  5LL6 S;  1QKX A;  4QQ6 A;  4DBH A;  2M02 A;  5CIU A;  2LMJ A;  5I22 A;  2RQV A;  3KBG A;  3OS0 A;  1MMD A;  4M77 B;  4X1V A;  1QVG P;  1BIA A;  3H6Z A;  1K1Z A;  1CSK A;  2LJ1 A;  3M0Q A;  2RJD A;  1RI9 A;  1E6H A;  2FPE A;  2EYZ A;  4FT4 A;  3J81 E;  1SEM A;  3G6E Q;  3FJ5 A;  1QP3 A;  1Q81 U;  4IIO A;  4E6R A;  4Q5W A;  2XID A;  5I21 A;  5KH6 A;  2ED0 A;  3HHT B;  4HCC A;  1ZBJ A;  1MV3 A;  4C8Q A;  1BB9 A;  1ARK A;  1MNE A;  5D6Y A;  4Z88 A;  3CMA T;  2ZZD A;  3RKY A;  3OYL A;  4ZTJ A;  5LJ3 h;  1Z9Q A;  3G7Z A;  1KQS S;  3DLL A;  2WSC E;  2DXC A;  1YI2 T;  4EIK A;  4E7S A;  4ZGD B;  1Y07 A;  1HYO A;  2HMA A;  1WPY A;  1UUE A;  2VB6 A;  4X9C A;  2KRM A;  2EYW A;  3PTA A;  1Q86 C;  2ZPF B;  1VQO Q;  2K2V A;  4PFP A;  4PJO G;  3A8M B;  3L42 A;  1VQ6 Q;  2NWM A;  4AG1 C;  3FC3 A;  5KCO A;  2EKH A;  3CXC P;  1GFD A;  4PL6 A;  3S3O A;  2K5F A;  2KAF A;  1X43 A;  1M3A A;  2M51 A;  1WNL A;  1M90 R;  1PKS A;  3LGF A;  4JRQ A;  1ZSZ C;  5KYY A;  1W70 A;  3CCS A;  1OI1 A;  2LJ3 A;  4J9D A;  3U23 A;  5L8R E;  2KBT A;  1Q86 R;  4ESR A;  1Q82 C;  3OSV A;  3CCL Q;  5C0M A;  2X9H A;  3A8H B;  3NTH A;  3QZ5 B;  2YUN A;  3HRS A;  2CS7 A;  3MEU A;  2LCL A;  4QQD A;  1ZA2 B;  2L3R A;  2M9U A;  3VS0 A;  1QCO A;  3CCJ T;  1BIB A;  4LDU A;  1TWB A;  4F7U E;  1OZ3 A;  3DB3 A;  4KRT A;  5FRN A;  4BAC A;  1SF9 A;  2XK0 A;  4IIM A;  1KD1 R;  1S72 Q;  2EFI A;  1M30 A;  2ZPI B;  2EGE A;  1I81 A;  4C0D C;  2E6Z A;  2V8J A;  1S72 T;  1T3S A;  2DMO A;  3JB9 J;  2CT3 A;  4XTY A;  4IUQ A;  4NL2 A;  5ECA A;  3OYN A;  3JCM d;  3PNW C;  4DEX A;  4M7D F;  1RI0 A;  2GCX A;  1VQO T;  1YNZ A;  3REA B;  5LJ5 f;  1AOJ A;  3CME A;  4Z8A A;  3CCM Q;  1VQ8 Q;  2DLP A;  1CKA A;  4C92 E;  4C0G A;  3JB9 I;  4HCB A;  1W4S A;  4J9F A;  4J6W A;  1FWZ A;  2PUO B;  4OML A;  2J6O A;  3X28 B;  2L5Q A;  5GMK h;  2QEX Q;  5GAO q;  2YDL A;  4LN2 A;  1JU5 C;  3SB2 A;  2Y90 A;  2GFA A;  4BI3 A;  1XTD A;  4A54 A;  3C12 A;  4D8D A;  2EQU A;  3JCM W;  4QVD A;  4M75 G;  1U8R A;  4J6X A;  3LH0 A;  3KXT A;  1VQ5 Q;  3QHS A;  2I2L A;  2HQE A;  3E2U A;  5GAN 8;  2HEQ A;  4RTV A;  3CC2 A;  4HVV A;  4RTX A;  5EC7 A;  2K5I A;  1O9S A;  1XOV A;  2B8A A;  4E7J A;  3SFM A;  1VQP A;  3HFN A;  4PFO A;  2O4X B;  3EG3 A;  3M54 A;  1M27 C;  1PSF A;  3EGX A;  3JCM e;  1JJ2 S;  4OMQ A;  5GMK e;  1DJ7 B;  1TUD A;  2L2P A;  1KD1 U;  3SWN B;  1JRI A;  2CP3 A;  3CEY A;  1PNJ A;  2DL7 A;  3SHW A;  1W2B A;  2CP2 A;  3VYG A;  1T0H A;  3VS3 A;  1VQO A;  4HT8 A;  2XD0 A;  2X4Y A;  5LJ5 h;  1KQS P;  1ZHI A;  1VQ7 T;  3CPW A;  3X26 B;  2J6F A;  2E64 A;  1LOJ A;  3A8G B;  2MIO A;  1M5Q 1;  2AZV A;  3T9N A;  4RTT A;  3ER0 A;  4NOY A;  3G71 T;  2OTL A;  4LDY A;  1VQ7 Q;  2DIG A;  2EWN A;  1UG1 A;  1WHK A;  4RMO A;  1Q7Y C;  1A0N B;  3QYH B;  1KQS A;  4MML A;  1WHG A;  2E3I A;  3FRN A;  3OYY A;  1S72 A;  4V2S A;  4AFU C;  3OB9 A;  4D6W A;  4J8O A;  2FZC B;  1YWO A;  3UPU A;  1Y71 A;  3EFR A;  3VS5 A;  1K73 C;  1VQL A;  1QMC A;  1VQL T;  2MMP A;  1YIJ T;  2VUB A;  2DVJ A;  1PC0 A;  2JTM A;  3CD6 T;  3CC7 Q;  2O2O A;  3CMA A;  2BTT A;  5DLO A;  4L5G A;  2ABL A;  4M77 F;  2VXF A;  1Y57 A;  3OYA A;  1X6B A;  2JM8 A;  5CKF A;  3VS1 A;  4KUI A;  4PLL A;  1ZBX A;  1H8K A;  2QGG A;  5CKB A;  4RUG A;  2OTJ T;  4C0D B;  1BYM A;  3PFS A;  1GFC A;  1RAB B;  3CCL A;  3WXM B;  1NYF A;  2E1H A;  5FRM A;  4J7I A;  1QCN A;  1TTH B;  3E9G A;  2DXT A;  1Y0M A;  2XIC A;  3ZL7 C;  1QW1 A;  4N4H A;  1B3Q A;  1YCY A;  2MAM A;  3I9Q A;  2O01 E;  2VKN A;  2IG0 A;  2MPX C;  5J26 A;  1U1T A;  2QA4 Q;  3LYI A;  4MMK A;  1X6O A;  2KXD A;  2ROT A;  5IHI A;  4C8Q G;  3CCM T;  4JUV A;  4ORZ A;  1TU0 B;  3OY9 A;  5KYX B;  2D8J A;  2FVU A;  3PVL A;  5GAN e;  2EGA A;  4F04 B;  4JRP A;  1Q82 R;  1QQJ A;  4J9G A;  1R0B G;  4FIB A;  2RF0 A;  1ZSG A;  1UJY A;  2K9G A;  2HDA A;  2FRW A;  1QVP A;  1TSF A;  4PK4 A;  2GTJ A;  5GMK m;  2HD0 A;  4PFZ A;  4IKF A;  4DBF A;  3UA6 A;  1K9M R;  1WQW A;  1K4U S;  1E6G A;  1IO6 A;  4M7D E;  1BI3 A;  1IB8 A;  2BZ8 A;  3LGL A;  3UT1 A;  4LUD A;  1G3T A;  1Y96 B;  4FYY B;  2LTO A;  2Y4Y A;  2R5A A;  1PHT A;  4F7U G;  5FWC A;  2RHI A;  4RKU E;  1Q81 C;  3DB4 A;  5KYN A;  1WXU A;  4NL3 A;  5CQY A;  1T3L A;  5IHN A;  3JAM E;  1N8R C;  4VUB A;  4C92 F;  7AT1 B;  3GNG A;  3M0P A;  2YLB A;  5KCH A;  1NE8 A;  5GAM f;  3CCR A;  3EGX B;  3CCU Q;  2ZAE A;  2LT1 A;  3TU4 K;  3INZ A;  1GL5 A;  3I56 T;  2VWF A;  4BUG A;  4EMG A;  1EIF A;  3EG2 A;  2RQR A;  1AWO A;  2H3E B;  2LQK A;  1OU9 A;  1VQ6 A;  1BCM A;  3QG1 A;  4CI0 C;  1W2B S;  2JTE A;  1KIK A;  4CC2 A;  2YUO A;  3CCE T;  2YLC A;  3C4S A;  2COW A;  2RD1 A;  3OYF A;  1IGU A;  2EJ9 A;  1RAA B;  1QLY A;  3RIR A;  3UAT A;  2ATC B;  1N9R A;  1RAE B;  2KYM A;  3PT9 A;  3GP8 A;  4CRI A;  8AT1 B;  2KE9 A;  3OA6 A;  2A37 A;  2RO0 A;  2PQW A;  2E5K A;  1VUB A;  2KRO A;  3JCM h;  4M75 C;  2P4T A;  1NEB A;  3EG9 A;  1YHQ Q;  1NPP A;  5CR2 A;  3JCM P;  4KGV B;  1VQ4 Q;  5L23 A;  5FRO A;  2JW4 A;  3MP1 A;  4FYX B;  3CCE Q;  2QDL A;  2LX9 A;  4FYW B;  3VJP A;  1KC8 U;  1VQ6 T;  2CT4 A;  1AHJ B;  1K0X A;  1P92 A;  1M2O A;  4LE9 A;  4Y28 E;  4M78 E;  5GAM h;  3M53 A;  4XTZ A;  3A8O B;  3ZBD A;  3MJX A;  1VQ4 A;  3OMG A;  2FYK A;  1TG0 A;  2H8H A;  4AT1 B;  2X4X A;  3E1S A;  1KFZ A;  2CZ1 B;  1YIJ A;  2ED1 A;  3SWN A;  2PVO B;  2DL4 A;  1WLP B;  3CCU T;  4PJO D;  4MZP A;  2K2M A;  4A4H A;  2X35 A;  3G71 Q;  1ZX6 A;  2HSE B;  1WXT A;  3M0T A;  4JS4 A;  5FWB A;  1MND A;  3VS6 A;  2RNA A;  1ABO A;  4DBR A;  3REB B;  2PUK B;  2MF2 A;  2DL5 A;  4M75 B;  2CZ6 B;  5GMK i;  3G4S Q;  4II1 A;  3OYI A;  1D0Z A;  2QDY B;  3QDF A;  3CCV Q;  4ZTF A;  1I07 A;  3TQ7 P;  4M7D G;  1MUZ A;  1F1B B;  1AT1 B;  2PU9 B;  1LCK A;  2LDM A;  3FLG A;  1QVF A;  3QXE B;  4JS5 A;  3ULR B;  5DLQ E;  4UC4 A;  1NLP C;  2D1X A;  3JCM f;  2ZPG B;  2QEX A;  4HXJ A;  4J5Y A;  4PJO F;  1K9M C;  4X34 A;  2J7I A;  3E9F A;  2V26 A;  4KGZ B;  3CCS T;  3V7C A;  2DX1 A;  3CME Q;  3CCM A;  1I5O B;  4AFZ C;  3P8H A;  1VQP Q;  1M1G A;  4WCI A;  2B86 A;  2K79 A;  3RUX A;  3FB9 A;  3L2V A;  3EG1 A;  2JT4 A;  5LJ3 g;  1M1K U;  3MEW A;  4DOV A;  2L89 A;  4M78 G;  2OI3 A;  4XTW A;  1TOV A;  3L2R A;  4DEY A;  5IXF A;  4JDS A;  3OYE A;  2IIM A;  4N4G A;  9ATC B;  1SRL A;  2DVE A;  4C0F A;  4OVA A;  2COZ A;  2HQX A;  4RTZ A;  1KC8 C;  4JZ3 A;  4PJN A;  2A08 A;  1HK9 A;  1LVK A;  1VQ9 Q;  3MHX A;  2FL7 A;  2DTI A;  3I35 A;  3CC2 T;  1G2B A;  3OYM A;  1KD1 C;  5A0L A;  2M1H A;  3I56 A;  2DM1 A;  2RK2 A;  4FSX A;  4OGC A;  2ESW A;  1ZQ1 A;  2MWO A;  2E4H A;  3TSZ A;  2KY9 A;  3CXC S;  2EJF A;  3VUZ A;  4J83 A;  3J80 E;  1N9S A;  3PE0 A;  3TSW A;  3SWN C;  1X2Q A;  5GAN 2;  2F1L A;  5CO7 A;  5FLX E;  1TXQ A;  3OMC A;  1VA7 A;  1NPR A;  2FRY A;  3H9N A;  1IHW A;  2P0Q A;  3MKD A;  2DO3 A;  1OUL A;  2YT6 A;  2E5Q A;  4A4K A;  2JNG A;  2LQW A;  3GPL A;  2WSE E;  2DZC A;  1OOT A;  2QTV A;  5GJW B;  3VUB A;  3CCU A;  3MP8 A;  2EKO A;  4PJL A;  2X3W D;  1YJN A;  3PGG A;  2OTJ A;  1X69 A;  3HP9 A;  4IUP A;  2DFU A;  1VQ7 A;  4ANJ A;  4M75 F;  2GTO A;  3BDL A;  2DTO A;  5GAO l;  1KHI A;  1Q95 G;  1W6X A;  2XU8 A;  3CMA Q;  1N8R R;  2VXE A;  3M9Q A;  1YJN Q;  1YJW A;  4RG2 A;  1M90 U;  2AKL A;  1WGS A;  4PNO A;  1LNX A;  2YSQ A;  5KE3 A;  3EH1 A;  4KUD K;  3JSC A;  4FL6 A;  4PJM A;  3CD6 A;  3CC4 Q;  3TVT A;  1FMW A;  1JEG A;  1ABQ A;  3JCM J;  4CC7 A;  1N5Z A;  3EG0 A;  5GAO r;  1B07 A;  2F5T X;  1IRE B;  4BDZ A;  3V8K A;  3C94 A;  1H92 A;  1PG5 B;  3NTK A;  1C0M A;  2DE0 X;  2E3H A;  1YIT A;  1D3B B;  1SG5 A;  5LJ5 e;  4LDX A;  3EG9 B;  2K3X A;  2KXC A;  3L2Q A;  3M0U A;  2JN0 A;  2LC4 A;  1WX6 A;  1NLO C;  3CCE A;  2MWP A;  1TUG B;  5HK3 A;  1WJS A;  3TEE A;  1AZG B;  3KFV A;  1JB0 E;  3L1A A;  1X27 A;  2O4X A;  2O31 A;  4RCC A;  1W2B P;  3EH2 A;  1GRI A;  5CKD A;  3CC2 Q;  1B34 A;  2GGR A;  3JB9 D;  2FZK B;  4B9X A;  3QUI A;  2JTF A;  2CUD A;  1C6V X;  2DIQ A;  3X24 B;  3X20 B;  3QSU A;  1UFF A;  2HQH A;  2E65 A;  3VRZ A;  3JB9 F;  3SD4 A;  2EYY A;  1G3Y A;  3JCM g;  2FG0 A;  4BE0 A;  4DBQ A;  4DQ2 A;  3QWY A;  1NYG A;  2FZG B;  5IH2 A;  5GAM e;  2COY A;  4M78 D;  1VQ8 T;  4EPC A;  1Y7X A;  2X51 A;  2NUP A;  1EZZ B;  1OQK A;  3OYK A;  4LXC A;  1YI2 Q;  2O9S A;  3CCS Q;  1VQN A;  2RM4 A;  1VQK T;  2DER A;  2HL5 C;  1WHL A;  3BFM A;  3CPF A;  3C95 A;  2OX7 A;  5GAM g;  2QQ9 A;  1OX8 A;  4M78 C;  2YRD A;  3OS2 A;  1QWE A;  4QT7 A;  3TCJ A;  3EGU A;  3CQT A;  4PJO E;  4E47 A;  3OS5 A;  5A0D A;  1B7T A;  4XTV A;  3I56 Q;  2DTH A;  1GBQ A;  4M75 E;  1SSH A;  2L0A A;  1K0S A;  4JJB A;  4RTY A;  2IPO B;  2P0P A;  1E7O A;  2EVR A;  4Y92 A;  4PJJ A;  2ZPB B;  1OPL A;  2P4R A;  1MMN A;  4M7A B;  2KDS A;  3CCJ Q;  1WHJ A;  4BB7 A;  3HRT A;  3UWN A;  3EGD B;  2CP6 A;  3RBB B;  5LJ3 j;  5KYX A;  2K5L A;  1KQ1 A;  4BD3 A;  4AFS C;  2RHY A;  2VVK A;  1VYT A;  1ACM B;  1OV3 A;  1WXB A;  1R77 A;  3F70 A;  3MEA A;  4FYV B;  2CP5 A;  2DA9 A;  4OB0 B;  2C06 A;  2V1R A;  1BI0 A;  3LWH A;  4JJC A;  2PNI A;  3O8V A;  4C0Z A;  4GLK A;  5GAN 4;  3OYC A;  3CCQ T;  5KYW B;  4IUR A;  3HSB A;  4KT0 E;  4BI4 A;  1VIE A;  3LWI A;  5EG2 A;  1AWW A;  1N6A A;  4NS5 A;  3NPF A;  1U3O A;  2VGN A;  1G3S A;  5J3B A;  4E7Z A;  1UE9 A;  3CBP A;  1YJ9 A;  1OU8 A;  2PVD B;  5LJ5 g;  4M7A G;  2DK3 A;  1I4K 1;  2FPF A;  3BY7 A;  3LH5 A;  1D1A A;  2W10 A;  4OMO A;  2QEX T;  3R6O A;  3C0C A;  3JRZ A;  1AVZ C;  1VOM A;  4R56 A;  3CC4 A;  2AHJ B;  4FW2 A;  1C1A A;  4M77 E;  1LPL A;  2VYT A;  2CZ0 B;  2E41 A;  2AZS A;  2OTJ Q;  3UF4 A;  2CSI A;  2NUT B;  1XQH A;  3CCV A;  1GCP A;  2JUF A;  2DD5 A;  1YIT T;  1AEY A;  2VC8 A;  3SEM A;  2LCS A;  4M7A D;  3OSS C;  1ZSZ A;  1V76 A;  4FT2 A;  3RDV A;  3G4S T;  2PVG B;  4WF2 A;  3QKJ A;  4ZN3 A;  1PD1 A;  1ZUU A;  1PD0 A;  4XU1 A;  2D0N A;  3QWX X;  2JZ2 A;  3QO3 A;  4EMH A;  4KBM B;  4BY6 B;  2Z0W A;  1GCQ C;  2KRN A;  4HCZ A;  1IZ6 A;  1QP2 A;  2EBP A;  4XU3 A;  3OS1 A;  1U06 A;  4C92 D;  2RHX A;  2CKK A;  3MPU B;  1M2V A;  5D6X A;  2H3J A;  5FU7 C;  4JRK A;  4C92 C;  5IAY A;  3V7S A;  1QVG A;  3KUF A;  5KE2 A;  1TS9 A;  4B6M A;  2XMF A;  4LDW A;  1VIF A;  2JS0 A;  3S6W A;  2CP7 A;  2E6N A;  4JLG A;  4M7A E;  4XQ3 A;  1Z9Z A;  1BCO A;  2L8D A;  2DL3 A;  1PSE A;  2QTX A;  2RHZ A;  5D7U A;  1XJW B;  3HL8 A;  4F16 A;  3RMS A;  3R6N A;  2DJZ A;  3BE3 A;  1WDX A;  3I5R A;  1OEB A;  4C92 B;  1UJ0 A;  2L3Q A;  2KEA A;  1IRX A;  1D1B A;  2P0K A;  1NJI R;  1VQN T;  4RTW A;  1M2V B;  2D9T A;  3JCM c;  2QG9 B;  1U5S A;  1ZLM A;  1NEG A;  4C5H A;  1VQK Q;  3LX7 A;  3VV0 A;  1HD3 A;  4MZM A;  3VS2 A;  5GAO n;  2RI5 A;  3AHU A;  4OMN A;  4R55 A;  1OZ2 A;  1JJ2 A;  3NHN A;  1FMV A;  2QAZ A;  2QQR A;  1I5L A;  1YIT Q;  4KUL A;  1AWX A;  1SKU B;  2W0Z A;  4EDU A;  2K4Y A;  4RG8 A;  1ZSZ B;  2JMA A;  4HCK A;  2ZCF B;  5IN1 A;  3IQL A;  1JJ2 P;  2HKN A;  2VV5 A;  2DJQ A;  2AT1 B;  2GQI A;  5HK0 A;  5CK9 A;  2RK1 A;  4O5V A;  2OAU A;  3MCA B;  4RTU A;  1WI7 A;  5GMK l;  2BUD A;  2OAW A;  4FW1 A;  4XK8 E;  5DY9 A;  1NZ9 A;  2HBP A;  3MO8 A;  1K76 A;  5CVI A;  3OYJ A;  4HT9 A;  3PVQ A;  1JBM A;  1RAD B;  1BI1 A;  2DF6 A;  2KYB A;  4JZ4 A;  1YJW Q;  3QDR B;  2C0T A;  2DKG A;  4R0K A;  3M59 A;  2DXB A;  5KYW A;  2LNV A;  4Z02 A;  1EX4 A; 
#chains in the Genus database with same CATH homology
 2GFA A;  1N9S A;  4EMK A;  3JCM X;  5CKH A;  4BI3 A;  3SWN C;  2KVQ G;  1XTD A;  2LCC A;  5GAN 2;  1I8F A;  3C12 A;  4A54 A;  5CO7 A;  5FLX E;  2QQS A;  2EQU A;  3OMC A;  3JCM W;  4ATO A;  1HXD A;  4QVD A;  4M75 G;  4IUU A;  1Y96 A;  1NPR A;  1U8R A;  4J6X A;  3LH0 A;  3CXC A;  2P0Q A;  2A7Y A;  3RKW A;  3KXT A;  3QHS A;  2DO3 A;  3VYH B;  2E5Q A;  4A4K A;  2JNG A;  5FU6 B;  3GPL A;  2WSE E;  2I2L A;  2HQE A;  2QI2 A;  2DZC A;  5GAN 8;  3JB9 H;  3JCM Q;  1LJO A;  4M78 F;  4PLI A;  3VUB A;  3CCU A;  3CC2 A;  3JB9 G;  5LJ5 j;  2K5I A;  3MP8 A;  4O6J A;  4C5I A;  3EAE A;  1KG1 A;  4JLI A;  2EKO A;  2E12 A;  1O9S A;  1XOV A;  2EJG A;  3G6E A;  2B8A A;  1UGP B;  2R57 A;  3SFM A;  5LJ3 e;  3PGG A;  4E7J A;  1VQP A;  1YJN A;  2OTJ A;  3HFN A;  3HP9 A;  5GAM d;  4IUP A;  1VQ7 A;  3FEO A;  2RJE A;  2O4X B;  4M7D B;  3M54 A;  1PSF A;  1JJ2 S;  4M75 F;  3JCM e;  4GY5 A;  3CC7 A;  1K73 U;  3QJY A;  3BDL A;  5GMK e;  1DJ7 B;  3OQ5 A;  1KD1 U;  3MET A;  3SWN B;  1JRI A;  3CEY A;  1G3W A;  2DTO A;  3CCV T;  5GAO l;  1M8V A;  1KHI A;  1M9S A;  2XU8 A;  4XU0 A;  3SDZ A;  4FM4 B;  1VQM A;  3LLR A;  4IUV A;  2VXE A;  1UGS B;  2DD4 A;  3HKS A;  3M9Q A;  2CGH A;  4N0A A;  4YTL A;  5I2M A;  1W2B A;  1Q82 U;  3VYG A;  4M7A F;  1YJW A;  3QBY A;  5FU6 C;  4RG2 A;  1QVF S;  2FHD A;  2WSF E;  4MDW A;  4A53 A;  1M90 U;  1WGS A;  4PNO A;  1VQO A;  4HT8 A;  1LNX A;  2BIV A;  2XD0 A;  3M4G A;  4A4G A;  3QJ6 A;  2X4Y A;  5LJ5 h;  5KE3 A;  5C6S A;  2QA4 T;  4KUD K;  5CAI A;  3JSC A;  4FL6 A;  3CD6 A;  1ZHI A;  3RES A;  2V8K A;  2Y4X A;  1VQ7 T;  3CPW A;  3X26 B;  3MEV A;  1YJ9 T;  3JCM J;  2E64 A;  1LOJ A;  5GAO r;  3CC7 T;  3A8G B;  4P5N A;  4OP0 A;  1M5Q 1;  2F5T X;  3T9N A;  1IRE B;  3ER0 A;  4NOY A;  3PMT A;  4XU2 A;  4ME7 A;  3V8K A;  3C94 A;  4LDY A;  5GAM j;  4BDZ A;  2DIG A;  3S3N A;  3RER A;  2EWN A;  3NTK A;  1K9M U;  3URG A;  3FIF A;  2EQM A;  2G3R A;  4RMO A;  3N5B B;  1YIT A;  1D3B B;  3OYD A;  1Q7Y C;  5LJ5 d;  3QYH B;  4RCB A;  5LJ5 e;  1KQS A;  3CME T;  4MML A;  4LDX A;  2K3X A;  1WJQ A;  3L2Q A;  3FRN A;  1YHQ A;  3OYY A;  4N4I A;  1S72 A;  4V2S A;  2JN0 A;  2LC4 A;  4IUT A;  1NJI C;  3CCE A;  3OB9 A;  4XTX A;  4QW2 A;  2MWP A;  4D6W A;  4J8O A;  5HK3 A;  1VQ9 T;  4C92 A;  1WJS A;  3TEE A;  3A5Z B;  1JB0 E;  3L1A A;  4M7D A;  2O4X A;  5D6W A;  4DOW A;  1BKB A;  3UPU A;  4LDV A;  1Y71 A;  4RCC A;  2GFU A;  3EFR A;  4B9W A;  2XDB A;  5CKD A;  3WVE B;  1K73 C;  1VQL A;  1B34 A;  3J7A F;  5GAN d;  1V29 B;  3CBO A;  1VQL T;  1TH7 A;  2MMP A;  3JB9 D;  3NTI A;  1K8A U;  4ZTJ A;  1YIJ T;  4MDX A;  2VUB A;  2JTM A;  4OF1 A;  3QUI A;  2JTF A;  3WVD B;  4B9X A;  4E7K A;  2DIQ A;  3CD6 T;  2XI9 A;  3X24 B;  3X20 B;  5M9O A;  3QSU A;  4PJO C;  2XDD A;  3CMA A;  3RMQ A;  1U1S A;  5DLO A;  2E65 A;  4L5G A;  4M75 D;  4JJN K;  4M77 F;  5GAN 7;  3SD4 A;  2VXF A;  3JB9 F;  1G3Y A;  3JCM g;  3A8L B;  3PIP A;  3QII A;  4HA8 A;  3OYA A;  4JRI A;  4M7A A;  1VQ9 A;  3QPH A;  4BE0 A;  4DQ2 A;  5CKF A;  4Y91 A;  4C8Q C;  4KUI A;  4PLL A;  1ZBX A;  1M90 C;  4A4F A;  5CKB A;  1BI2 A;  2OTJ T;  4C0D B;  5GAM e;  4M78 D;  1VQ8 T;  1BYM A;  1YBY A;  2KSS A;  3PFS A;  5LJ3 d;  4EPC A;  1Y7X A;  2RI2 A;  5DM7 R;  3OYB A;  3OW2 S;  4DA4 A;  3CCL A;  3WXM B;  1UB4 A;  2A3L A;  2V8I A;  3OYK A;  2E1H A;  3HFO A;  4F7U F;  5FRM A;  4J7I A;  3GOX A;  2K57 A;  1VQN A;  2RM4 A;  2QA4 A;  3M5A A;  3E9G A;  4FU6 A;  1VQK T;  5I2S A;  3BDU A;  2HAX A;  3CCJ A;  2DXT A;  1KHC A;  2F5K A;  2XIC A;  1M1K C;  3BFM A;  3CPF A;  3C95 A;  2LQ8 A;  1QW1 A;  3GNF B;  4N4H A;  4OB3 B;  1O75 A;  1YCY A;  2MAM A;  5GAM g;  2QQ9 A;  2O01 E;  2IG0 A;  2JVV A;  5J26 A;  5A0G A;  1U1T A;  2EYQ A;  4M78 C;  3OS2 A;  2OTL T;  3LYI A;  4MMK A;  3FJP A;  3OYH A;  4MZT A;  1X6O A;  3VKI A;  4C8Q G;  3CCM T;  3TCJ A;  5GAO m;  2RI3 A;  1MGQ A;  3HPW A;  4JUV A;  4C5G A;  1OYX A;  4C8Q D;  4BE2 A;  4E47 A;  3OS5 A;  5A0D A;  4PJO E;  1VQ5 A;  3OY9 A;  4XTV A;  4QVZ A;  5GAN 3;  3OBW A;  2DTH A;  3CCL T;  2FVU A;  3QZ9 B;  4M75 E;  5GAN e;  2DAQ A;  4M77 G;  4JRP A;  5GAN 5;  4OB1 B;  5J39 A;  3TRE A;  2P0P A;  3M55 A;  4M7D C;  4FIB A;  1VQ8 A;  2E10 A;  1D3B A;  2DZ9 A;  4TVR A;  2ZPB B;  2XDP A;  1QVP A;  3G71 T;  4M7A B;  1RL2 A;  2KDS A;  2XKO C;  4BB7 A;  4ZN1 A;  5GMK m;  2HD0 A;  3HRT A;  3UWN A;  4C8Q F;  4L6V 5;  4M77 A;  3G4S A;  5LJ3 j;  3JCM b;  1KQ2 A;  5GAO p;  2EQK A;  1KQ1 A;  2K5L A;  2RH2 A;  3CPW S;  4IKF A;  4BD3 A;  1VQP T;  3L2U A;  3LW5 E;  1N27 A;  2RHY A;  5GMK j;  1WQW A;  3L2W A;  4M7D E;  1BI3 A;  3LGL A;  2KMT A;  2D0Q B;  2X4J A;  4M77 D;  3UT1 A;  1G3T A;  2YHT A;  3F70 A;  1Y96 B;  3MEA A;  2LTO A;  4XTU A;  2Y4Y A;  5LJ3 f;  2EAY A;  2WAC A;  2R5A A;  4J7F A;  2GF7 A;  2QQB A;  4OB0 B;  4F7U G;  2C06 A;  1B34 B;  1BI0 A;  2BKD N;  3LWH A;  2RHI A;  2YRV A;  4RKU E;  1Q81 C;  2F69 A;  3DB4 A;  3HRU A;  3MP6 A;  2LRQ A;  3ASK A;  4PKC C;  1UGR B;  4NL3 A;  3O8V A;  4C0Z A;  3CC4 T;  4GLK A;  5CQY A;  2CYZ B;  1MHN A;  5GAN f;  5GAN 4;  3OYC A;  3CCQ A;  3QYG B;  3JAM E;  3CCQ T;  4VUB A;  1N8R C;  4C92 F;  3RKX A;  4A4E A;  1YHQ T;  3GNG A;  3X25 B;  4IUR A;  3HSB A;  2RB6 A;  3M56 A;  2YLB A;  2ZPH B;  4KT0 E;  1VIE A;  1M4Z A;  3JCM V;  4BI4 A;  5KCH A;  3LWI A;  1NE8 A;  5EG2 A;  5GAM f;  3CCR A;  4J6Y A;  1H64 1;  1N6A A;  2VGM A;  3V7R A;  4NS5 A;  4BY6 C;  4EMK B;  4E7I A;  1X01 A;  2LT1 A;  2VGN A;  4ELY C;  3TU4 K;  3INZ A;  4F7U A;  1G3S A;  3I56 T;  5J3B A;  3P8D A;  3H8Z A;  1X75 C;  3CBP A;  3OW2 A;  3PIO A;  1YJ9 A;  2D6F A;  2PVD B;  2ZGW A;  3I55 T;  4BUG A;  2OTL A;  2X4W A;  4EMG A;  5LJ5 g;  4M7A G;  1EIF A;  2DK3 A;  5AYF A;  1I4K 1;  5LL6 S;  2NLU A;  2MI6 A;  3BY7 A;  2LQK A;  1FX7 A;  2QEX T;  4QQ6 A;  3R6O A;  1VQ6 A;  3QG1 A;  5CIU A;  3JRZ A;  4R56 A;  3KBG A;  3OS0 A;  2AHJ B;  4CI0 C;  3CC4 A;  2HNI A;  1W2B S;  3OBY A;  1R8O B;  3GF5 A;  4M77 B;  1BIA A;  4M7D D;  4M77 E;  2GQV A;  3CCE T;  2YLC A;  2VYT A;  2CZ0 B;  3C4S A;  2RD1 A;  3H6Z A;  3V8L A;  5A2Q E;  3OYF A;  2RJD A;  2E41 A;  2EJ9 A;  1XQH A;  3M4Y A;  3RIR A;  3CCV A;  1VQM T;  2JUF A;  1N9R A;  2DD5 A;  2RJF A;  1YIT T;  4FT4 A;  3GIB A;  2VC8 A;  3VU3 C;  3J81 E;  3GP8 A;  3PT9 A;  4M7A D;  4CRI A;  1QP3 A;  4OGE A;  3OSS C;  5CKE A;  5FU7 B;  3OA6 A;  4PJO B;  1Q81 U;  2RO0 A;  2PQW A;  4FT2 A;  1VUB A;  3CCR T;  4Q5W A;  2XID A;  2PVG B;  1M1F A;  5I21 A;  5KH6 A;  4WF2 A;  3HHT B;  3G4S T;  3QKJ A;  3JCM h;  4HCC A;  4M75 C;  2P4T A;  4ZN3 A;  1FXX A;  4C8Q A;  1YJN T;  1GXI E;  3G6E T;  4XU1 A;  1NPP A;  5CR2 A;  5D6Y A;  3JCM P;  4ZGE B;  1Q86 U;  3CMA T;  2JZ2 A;  4OMF B;  2IVW A;  2ZZD A;  3QO3 A;  4EMH A;  3RKY A;  4KBM B;  4BY6 B;  4ZGJ B;  4L59 A;  5LJ3 h;  5GAN g;  2E70 A;  3OYL A;  3G7Z A;  1KQS S;  3DLL A;  3V8J A;  2WSC E;  2DXC A;  3BW1 A;  3E19 A;  5FRO A;  3MP1 A;  4PJO A;  1YI2 T;  2KQW A;  4HCZ A;  1IZ6 A;  1Y07 A;  1QP2 A;  2DPP B;  4ZGD B;  2LX9 A;  2DEQ A;  4XU3 A;  3VJP A;  5GAN h;  1KC8 U;  3ZEH A;  1VQ6 T;  3OS1 A;  2EIF A;  1G5V A;  1WPY A;  1K8A C;  2DXU A;  1AHJ B;  4C92 D;  2RHX A;  2CKK A;  3OYG A;  1P92 A;  4X9C A;  3P8B B;  2XG8 D;  4E7H A;  1YJW T;  3PTA A;  5D6X A;  4Y28 E;  4M78 E;  2ZPF B;  3M53 A;  3GLX A;  4XTZ A;  5GAM h;  1Q86 C;  2M0O A;  2K2V A;  3A8O B;  2H3J A;  3ZBD A;  4PJO G;  1VQ4 A;  3A8M B;  3OMG A;  5FU7 C;  2FYK A;  3DKM A;  4JRK A;  3L42 A;  2M16 A;  4HKE A;  4C92 C;  4C92 G;  5IAY A;  3FC3 A;  2EQJ A;  3V7S A;  2K3Y A;  3KUF A;  5KCO A;  1QVG A;  5KE2 A;  4PL6 A;  1WQ7 A;  3S3O A;  2X4X A;  2K5F A;  3E1S A;  4LDW A;  1VIF A;  2KAF A;  3S6W A;  4LD9 K;  2CZ1 B;  3S3M A;  1YIJ A;  3SWN A;  2JOY A;  2E6N A;  2PVO B;  4JLG A;  4M7A E;  4C8Q E;  3CCU T;  4MZP A;  4PJO D;  4A4H A;  1H3Z A;  1VQK A;  4XQ3 A;  4M75 A;  2X35 A;  2L8D A;  1PSE A;  1WNL A;  2QTX A;  2RHZ A;  4ELZ C;  3LGF A;  4JS4 A;  5GAN j;  4N0A C;  4JRQ A;  4E7L A;  4F7U B;  3HL8 A;  3NFC A;  3CCS A;  2PUK B;  4X9D A;  1OI1 A;  2MF2 A;  3RMS A;  4M75 B;  2DJZ A;  2CZ6 B;  5L8R E;  5GMK i;  3M58 A;  3G71 A;  1Q82 C;  3OSV A;  4LD6 A;  5C0M A;  3ZFJ A;  4C5E A;  2RHU A;  4II1 A;  3A8H B;  2XHC A;  4M7A C;  3NTH A;  3OYI A;  3QZ5 B;  2QDY B;  3HRS A;  4ZTF A;  2CS7 A;  4M7D G;  3MEU A;  4C92 B;  2FB7 A;  2LCL A;  3DLM A;  4QQD A;  2PU9 B;  4QQG A;  2M9U A;  2L3R A;  2P0K A;  2ZPE B;  2LDM A;  3FLG A;  1QVF A;  3QXE B;  4JS5 A;  1VQN T;  5DLQ E;  4UC4 A;  2D9T A;  3JCM f;  5CCA A;  3Q1J A;  1VQ4 T;  3JCM c;  2ZPG B;  2QEX A;  3CCJ T;  1QVG S;  3M57 A;  4J5Y A;  4PJO F;  1BIB A;  1N8R U;  4M78 A;  1K9M C;  2CZ7 B;  4X34 A;  4C5H A;  3E9F A;  3LX7 A;  4LDU A;  1UEB A;  3VV0 A;  3CCS T;  3EFS A;  4MZM A;  3V7C A;  3I55 A;  4QVC A;  5GAO n;  4F7U E;  2RI5 A;  1OZ3 A;  3DB3 A;  1WJR A;  5FRN A;  4BAC A;  3AHU A;  4R55 A;  3CCM A;  2XK0 A;  4XAX B;  1OZ2 A;  3CBM A;  1JJ2 A;  4BDY A;  3P8H A;  5HY6 A;  1YI2 A;  1VQ5 T;  4OB2 B;  1M1G A;  3RUX A;  3FB9 A;  2RA2 A;  2EFI A;  3L2V A;  4C8Q B;  2ZPI B;  2QQR A;  1I5L A;  5HKC A;  1I81 A;  4KUL A;  5LJ3 g;  1M1K U;  3MEW A;  4EMK C;  4C0D C;  2E6Z A;  2L89 A;  2R58 A;  2V8J A;  2R5M A;  4M78 G;  4DOV A;  1S72 T;  4XTW A;  4EDU A;  2K4Y A;  3JB9 J;  3L2R A;  4RG8 A;  4JDS A;  3OYE A;  3FDR A;  4N4G A;  2ZCF B;  4XTY A;  5IN1 A;  1SSF A;  2DVE A;  2VV5 A;  4IUQ A;  4NL2 A;  4C0F A;  3ME9 A;  3OYN A;  2QXF A;  3JCM d;  4OVA A;  2HQX A;  3PNW C;  5HK0 A;  5CK9 A;  1KC8 C;  2RK1 A;  3PMI A;  4M7D F;  4O5V A;  2OAU A;  1RI0 A;  2GCX A;  3MCA B;  1HK9 A;  1XNI A;  3MHX A;  2LT4 A;  2FL7 A;  2DTI A;  2BUD A;  2RJC A;  5GMK l;  1VQO T;  1Q7Y U;  3CC2 T;  3OYM A;  4M77 C;  4XK8 E;  1NJI U;  5DY9 A;  1KD1 C;  5LJ5 f;  1NZ9 A;  2HBP A;  3MO8 A;  5CQX A;  5CVI A;  3OYJ A;  5IT9 E;  4HT9 A;  5A0L A;  2M1H A;  3I56 A;  1JBM A;  2KK4 A;  3CME A;  1BI1 A;  2LVM A;  2QQA A;  2RK2 A;  4C92 E;  3L2Z A;  3UDC A;  4FSX A;  4OGC A;  4C0G A;  3JB9 I;  1W4S A;  4HCB A;  4BE1 A;  3QDR B;  4J6W A;  1FWZ A;  1ZQ1 A;  2PUO B;  2DKG A;  5GAN 6;  3M59 A;  2DXB A;  2MWO A;  3X28 B;  3CXC S;  2KY9 A;  2L5Q A;  5GMK h;  1UGQ B;  2EJF A;  4BI8 B;  2LNV A;  3VUZ A;  5GAO q;  4Z02 A;  4M78 B;  4J83 A;  3SB2 A;  2Y90 A;  3J80 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...