4OF1A

Crystal structure of toxin from staphylococcus aureus mu50
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
115
structure length
115
Chain Sequence
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIRTLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the toxin from Staphylococcus aureus Mu50
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Toxin
molecule keywords mRNA interferase MazF
total genus 33
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4of1A00
1M1FA 3JSCA 5CKFA 2C06A 3HPWA 1UB4A 5CQYA 3VUBA 5CR2A 2KMTA 4MDXA 5HK0A 5HK3A 5CKEA 5CKHA 5HKCA 5CCAA 5DLOA 3TCJA 2MF2A 4VUBA 4MZPA 3G7ZA 5CQXA 1VUBA 2VUBA 4MZTA 4ELYC 5CKDA 3NFCA 4OF1A 5CK9A 3JRZA 5CKBA 1X75C 4HKEA 5CO7A 4ME7A 1NE8A 4ELZC 4MZMA
chains in the Genus database with same CATH superfamily
2FZGB 2RK1A 2X4WA 1Y0MA 1W4SA 4FW1A 1KC8R 5GMKh 3ZEHA 2HDAA 2J7IA 4GLMA 1YIJA 2QEXA 1K9MR 2V8KA 2YSQA 2MMPA 2H3EB 1KD1C 4PJOA 3CMEQ 3RMQA 3PE0A 1YJ9T 1NJIU 4HVVA 1QVGP 4DOVA 4HVWA 2IIMA 1I07A 3JCMf 4XTVA 4QT7A 4CC2A 4J7FA 3NMZC 3PFSA 4ESRA 1KC8U 3FJ5A 3RBBB 2YRVA 4RTTA 4F14A 3OYCA 4M7DG 5C6SA 3SWNB 4WF2A 1LJOA 2D6FA 2DKGA 4IUVA 4Z8AA 3VRZA 4KBMB 2K4YA 4M78F 3LWHA 1VQPA 2QDLA 3P8DA 4JJNK 4XTZA 2DRMA 1K73R 3OW2P 2E6NA 1KK7A 1LCKA 4AMCA 2Y4XA 5CCAA 4FL6A 5D6YA 4Z02A 3CCUQ 4RTVA 3QXEB 3RKYA 4M75D 1CSKA 3CCUA 3CC2T 5I2MA 1K0SA 2P4TA 1YCSB 3M0UA 4MDWA 1VA7A 5AT1B 1VQKQ 2CUDA 3M0RA 3MPUB 1YJ9Q 2SEMA 3NPFA 2NUTB 4M75B 4OVAA 1X27A 4A4HA 2QI2A 4HCBA 3MEVA 2E3IA 1VIEA 3QZ5B 3VU3C 5GANg 3CCLT 4DBHA 1JO8A 1OX8A 2C0TA 2RJCA 2VWFA 3BDLA 3JCMV 4C5HA 2QAZA 2YLCA 2K3YA 4Y92A 4AG1C 3CXCA 1VQ5T 3QWXX 3CPWA 4KGVB 4CC3A 4EMKC 1PNJA 3WXMB 1PKSA 4F16A 2QDYB 1ZSZB 1E7OA 4Y91A 3OYGA 1JBMA 1ABQA 2KNBB 2DL4A 3JCMe 2CP5A 4J8OA 4M7DF 1UE9A 2YUOA 3VS4A 4CC7A 3GBQA 4X9DA 3J81E 2BIVA 3CBMA 1UTIA 1ZX6A 3JV3A 3H9NA 3LWIA 4DA4A 2I2LA 5LJ5g 1IZ6A 2MWPA 1EFNA 3KUFA 1RLPC 3H0IA 1VQ8Q 1VQPT 5GMKi 1PG5B 1K9AA 2P4RA 3PTAA 2EW3A 1YJWT 2QQAA 5GAOl 2Z0WA 1NLPC 3X20B 3ME9A 1U1SA 1OPLA 1M90U 1G3YA 1NJIR 1JXMA 2DEUA 4PJOB 1F1BB 3CCRA 2E12A 3JCMJ 2DL3A 1WJQA 3I9QA 2XKOC 5C0MA 4DBQA 2DL7A 3A8LB 3H6ZA 4ME7A 1K4US 4PJOE 4EMHA 2XIDA 3I35A 3I56T 1OU8A 1YHQT 2AKLA 3QSUA 1M1GA 1M9SA 4FYYB 4PJOF 2ESWA 1WXBA 1YJNQ 1NBEB 4BD3A 2JXBA 5IHIA 2BZXA 1VQLA 1M3BA 4OMPA 2ZCFB 3OYEA 3G6EQ 4C0DC 2QA4T 3JCMX 3KFVA 1N9SA 3G1JA 2W10A 2RI5A 1W2BP 1W2BS 1C6VX 1R0CB 1OX9A 3VKIA 3VS6A 4FW2A 1FMVA 3OYMA 4XK8E 3TREA 2F5TX 2KXCA 1AHJB 1K76A 2K5IA 1FMWA 2EJFA 1AT1B 2EVRA 4QVZA 3FC3A 3RDVA 2CYZB 2AK5A 3DB3A 4AG2C 5I11A 1K9MC 2O31A 3AT1B 3QJYA 3X28B 2LNVA 1VQ9Q 5GANe 3ZFJA 4XU2A 2DO3A 1YHQA 4FT2A 3VYHB 2DZ9A 1M30A 1UGVA 2KEAA 1FWZA 2FRWA 2RMOA 3RR6A 3OYNA 1TUDA 3CCVQ 2E41A 2LVMA 5KYYA 9ATCB 4PJLA 1X2KA 2E6ZA 2RO0A 1K73C 2V1RA 4C8QE 4M77A 4AFQC 1UB4A 1AWWA 4DOWA 1MUZA 2X4YA 4M75E 4C0FA 3QO3A 3MEUA 4GLKA 2DNUA 3L2RA 2CSQA 5HK3A 2K5FA 1JJ2P 2KVQG 1D1AA 1OZ2A 4OMMA 1X6GA 3PT9A 3QKJA 1BCOA 3HP9A 2ECZA 1VQKT 5DY9A 2YT6A 2F69A 3NTHA 5A0LA 3CCSA 2JOYA 3OBWA 3JCMW 2WSCE 5IAYA 4RTUA 2BTTA 2LC4A 1OOTA 3PGGA 2PU9B 4D8DA 5FROA 1G3TA 2PVGB 1HXDA 2X4XA 5LJ5j 2L3RA 1WHLA 3C95A 2JM9A 5CKDA 4A4GA 4IUQA 4E7SA 2MAMA 2RQRA 1Y96B 1ZUKA 5CKBA 3CCRQ 4JJDA 3OYFA 1OQKA 4OMQA 2F2WA 2XDDA 1TWBA 2LZ6B 1KHIA 2A7YA 1TUGB 2QEXT 3SB2A 1W2BA 5FW9A 4RUGA 1VQ4A 4HCCA 4R0KA 1QVPA 2GQVA 4C0ZA 2Y4YA 5J3BA 2EBPA 2OTLT 1VQ5Q 3L2VA 1UUEA 2QQ9A 1QP3A 1FMKA 2YRCA 5GAMf 1ARKA 1BI3A 2DL8A 4PJJA 3HRUA 1IGQA 2EGCA 4II1A 3KXTA 2OTJT 3CXCP 4J6YA 1U06A 4LD9K 2DYBA 3CPWS 3CCJQ 1IGUA 2KT8A 4JDSA 1WIEA 1TH7A 3CXCS 1YITQ 3CD6T 2E10A 2F2XA 4OMNA 1KFZA 1CKBA 2JN0A 3VUZA 2DL5A 4QVDA 3GOXA 2FVUA 2ZPGB 4Y28E 4E47A 2DVJA 4A53A 1RI0A 2RJFA 4K11A 1AVZC 2RHXA 4OMFB 3PMTA 3L2ZA 4M7AG 3G71Q 2A37A 3M53A 4JRIA 1ACMB 3CC2A 3OS1A 3EG9B 1GFCA 2LP5A 3LLRA 1KD1R 4QQDA 4AFZC 2MOXA 3I55T 2ROLA 2V26A 3CMEA 2KR3A 2R5MA 1KC8C 2FPDA 3LGLA 3RESA 1UFFA 3VYGA 3S6WA 1TU0B 3A8OB 1DJ7B 5IXFA 2LT1A 2C0OA 5GAOq 3CCQA 4KULA 4C5EA 1AEYA 4M77E 4KGZB 2GTOA 1B07A 2AHJB 4PNOA 1MMDA 1WX6A 4BI4A 4C0DB 3SWNC 3EH2A 2XK0A 1PC0A 2AIRB 5GMKm 3O8VA 3LYIA 3LX7A 4TVRA 4BY6B 2KRMA 2K3BA 2O4XB 1ZBJA 5GMKe 1LVKA 3EFOB 1SG5A 1RUWA 4J6WA 4JZ4A 3CCVT 2FZKB 4OGCA 3CCEQ 1OI1A 4XTXA 4F7UF 3MCAB 4Z88A 5GAOr 1LNXA 4FYWB 4M77F 3OYJA 1SSHA 1OPKA 2KQWA 1D0ZA 4EIKA 5FRMA 1VQNQ 3REBB 1YNZA 1GXIE 3CPFA 2FPFA 2LTOA 5GAMd 4LDWA 3CCQT 3LGFA 2L3PA 5GMKj 1R8OB 4IUTA 1UECA 1VYTA 4BE0A 2K79A 3OYBA 4AFUC 2K7AA 3EG9A 1TS9A 4HT8A 4E7KA 2EGAA 2FB7A 4C8QF 4V2SA 4JS5A 4BI8B 4JJBA 2NUPA 2FEIA 4QQ6A 3MP6A 2LT4A 2RQWA 2L8DA 3I56A 5LJ3h 4PFOA 2HMAA 2RH2A 5IT9E 2DIGA 3CCVA 3NGPA 3V8KA 5IH2A 2EYQA 4JPBW 3FIFA 2JTEA 1UHCA 3CC4A 5GMKl 1VQLT 3PNWC 5KH6A 2PVDB 1UG1A 3QIIA 2HCKA 3A8HB 4OP0A 5LJ5e 3S3NA 2G3RA 4M7DE 1M1KU 4PL6A 2QEXQ 1YITT 2ABLA 5J26A 1X69A 1N6AA 1Q86U 1NYGA 1K8AC 3META 1VQOQ 4PJMA 1VQ7Q 5D6XA 1GCQC 5HKCA 4J6XA 3SWNA 1SRLA 2VGNA 1QVGA 2QQBA 5GAN2 2FRYA 2X4JA 1HD3A 1C1AA 2M02A 2O2OA 1Q86R 4KUDK 2RHIA 4HKEA 2HQXA 1VQ6Q 3X25B 4IIMA 1YI2Q 2GBQA 4QKUA 1M1KR 5L8RE 3UT1A 5CVIA 2RQTA 3WVDB 1YWPA 3EH1A 3JB9I 5LJ5h 2J06A 4ATOA 3QJ6A 2D0QB 4XQ3A 1Y57A 4KH1B 2VYTA 3QHSA 2DA9A 3JCMd 4ELZC 5LJ5d 1GCPA 3QYGB 2RPNA 5LJ3e 2YUPA 3LH0A 4PLIA 1WHGA 4ZGDB 1VQ4Q 2EKHA 4M75A 2RB6A 2COZA 5KYUB 2QASA 1VQ5A 5GAOp 1OU9A 3I55Q 1XTDA 2EJ9A 1T0HA 2DXCA 2FG0A 1W70A 1VQNA 2E65A 2KYMA 2RQUA 2A28A 1AWXA 4Q5WA 2X3WD 2FZCB 2CZ7B 5IN1A 4XTUA 1H8KA 5KE2A 1OULA 5DLOA 1H92A 3BFMA 3O5ZA 2LJ3A 3T9NA 2EKOA 5GANf 1KQSA 5KE3A 3OSVA 1X75C 2KI7A 2DRKA 5CO7A 3MKDA 4ZGEB 5ECAA 1AWOA 4R55A 1G5VA 3EHRA 3CCJA 4ANJA 2OJ2A 3HPWA 2XHCA 2BE9B 1D3BB 3JB9J 4PJOD 1IRXA 2CREA 3CBPA 4B9XA 3DLLA 2CT4A 4ORZA 1GCQA 4LNPA 1BI2A 2VKNA 3CCUT 2EFIA 1EX4A 1V29B 2OTLA 1YCYA 4M77G 1ZUYA 2PVOB 2HEQA 4ZTJA 1NJIC 4F7UA 3L1AA 2DIQA 1VOMA 5HCKA 2QXFA 1UGPB 4JZ3A 1M8MA 1S72A 5KYXA 1K1ZA 4PK4A 3H41A 1M90C 1QW1A 3V8JA 5EC7A 2I0NA 2LRQA 5LJ5f 5GANj 4E7ZA 1RAHB 3GLXA 5L23A 3CCMQ 4OGEA 1NM7A 3CD6A 2EYWA 4E6RA 3CC7A 4KGXB 1KD1U 3C94A 4JLIA 2HKNA 2XI9A 1OEBA 3HSBA 2P84A 4HVUA 1JQQA 3RUXA 1Q82R 1U8RA 1D1CA 1AWJA 3JB9D 1Q7YR 1O9SA 2D1XA 1BBZA 2AZSA 2WSFE 3N5BB 2HL5C 2HNIA 1UEBA 2HD0A 2K2MA 3PMIA 1E6GA 3G4SQ 2A3LA 2LJ0A 4FIBA 1SPKA 2COYA 3TCJA 2XMFA 2DX1A 5DM7R 1I0CA 5A0GA 2K57A 3RKWA 3M0SA 5FU6C 2QGGA 1VQMA 1SRMA 3FDRA 1UGRB 2V8JA 1ZSZA 5I21A 4J5YA 1QVGS 3SEMA 3J80E 1C0MA 2CP3A 2VB6A 4C92C 5GAOm 1JB0E 4J7IA 2WACA 4B9WA 4M78A 4ZNXA 5IHNA 4QW2A 2JS2A 2CUBA 4F7UB 3UDCA 1MMAA 2ZPEB 4J9BA 3FB9A 1N8RC 2L3SA 4J9CA 2KRSA 4JUVA 3MEWA 2LCSA 2OI3A 4BY6C 3AHUA 1KQ1A 2KXDA 2CS7A 3SDZA 1QQJA 1WXUA 3BW1A 3CCLQ 3QPHA 2EAYA 4FSSA 3CEYA 1O75A 1Q81C 1ZLMA 4LDXA 4ZN3A 2QA4A 1VQMT 4MZMA 1K73U 1WHJA 1SKUB 4E7HA 5I22A 2FPEA 1JU5C 3M0QA 3V8LA 3EFOA 3FRNA 2ED0A 1VQ7A 2L2PA 2CP7A 4XTYA 2E3HA 1WLPB 4Z89A 4DQ2A 2DTOA 1VQ4T 3QDFA 4M77C 1QVFA 4FCYA 3C4SA 2HSEB 3M4YA 3OS2A 2CP6A 4RG2A 3UA6A 3JCMQ 6AT1B 2J05A 3VRYA 5GAN3 1HJDA 4C8QC 1QP2A 3OS5A 2DVEA 2KROA 1VIFA 3ULRB 1V76A 1ZA1B 2EYZA 1UDLA 2DXBA 1VQPQ 2D8HA 1TTHB 3JCMc 5J39A 3M59A 3M57A 1D0YA 1BU1A 4ZTFA 1Y7XA 1U3OA 3V7RA 2ZGWA 5GAN6 3UF4A 1YI2T 1G3WA 3JCMb 3I5SA 2JZ2A 1YFNA 2GGRA 1HYOA 1Z9QA 1X6OA 1QKWA 2LCCA 2MCNA 2EQMA 2O4XA 3MJXA 1VQ7T 4VUBA 1BK2A 1QKXA 1NYFA 2KE9A 5CIUA 4OB0B 2ENMA 3CCST 1M2VB 1G2BA 4A4KA 1TG0A 2E4HA 3E9GA 1MNEA 3EFRA 3HKSA 1WI7A 1QCNA 3PVQA 4LD6A 1YJWQ 2HSPA 4KUIA 3JAME 3QBYA 2EQJA 1J3TA 1G83A 2KGTA 3OMCA 2R57A 2EGEA 4EPCA 1P92A 3PIPA 4OMLA 4XAXB 1AOJA 2PNIA 2DZCA 5KYWA 2HZYA 4M7AB 2Y90A 4HCKA 4BB7A 3P8BB 4C92G 2YHTA 3JB9H 2NUPB 3PVLA 2AZVA 5AYFA 5CKHA 2DETA 1N8RU 2AT1B 4M78E 5CK9A 3G71A 2NWMA 3E19A 2CZ1B 1WFWA 1Y96A 2MIOA 4FYXB 3EG0A 1MMNA 2A08A 2DD4A 3GNFB 8ATCB 2E5KA 1E6HA 2OTJA 1XOVA 3M58A 3RIRA 4DBRA 1B34A 1SSFA 2OTJQ 4RTWA 3URGA 1PSEA 1SEMA 2EQUA 4ELYC 5DLQE 2DPPB 2D9TA 4M77B 4EMKA 2F1LA 2IVWA 2FHDA 2JMAA 2X3XD 3QWYA 2CH4A 1M1FA 1PD1A 2M0YA 1I5OB 3JCMh 5LJ3g 2J6KA 1QCOA 2NUTA 2YUNA 3QDRB 4WTOB 2CZ0B 1JJ2S 4C92D 2XICA 3HHTB 2PZ1A 2W0ZA 4NL2A 2GF7A 1KJWA 3CQTA 5FWBA 1JXOA 2LX9A 4C0GA 3G71T 2LJ1A 3I55A 2VXFA 1OZ3A 1TOVA 2JJ9A 1MHNA 2PUKB 4A63B 2CZ6B 3GIBA 4MDXA 3UPUA 5A0DA 3V7CA 4RCCA 4LXCA 3FLGA 2BUDA 2G6FX 3HTRA 4BI3A 4FYVB 4GBQA 3NFCA 2B86A 3H0HA 1W1FA 1WJSA 2JVVA 1PCXA 1BI1A 2RHUA 3HRSA 4M7DA 1YITA 2DTHA 1QCFA 2VXEA 3VUBA 2E64A 2DF6A 4BUGA 3LW5E 3EG3A 2CH4W 1KQSP 3E1SA 1N9RA 3OQ5A 3MP8A 3I56Q 2V8IA 4IUPA 4N4IA 1M1KC 2JUFA 1K0XA 2E5QA 4D6WA 4JLGA 3ZL7C 4BDZA 1RAIB 1Y07A 3VJPA 1OYXA 2JTFA 4DEYA 2YUQA 2ED1A 4A4EA 5KCOA 3G6ET 1K8AR 3CC2Q 1PSFA 1B7TA 2KYBA 2ZPBB 4RTZA 2DBKA 1MMGA 2DAQA 4J9DA 1WA7A 1TUCA 1RAEB 2IPOB 2CGHA 1WNLA 5CKFA 4JS4A 5A2QE 3SFMA 1U5SA 2J6OA 3UWNA 3M56A 2RJDA 2DD5A 1K8AU 2RK2A 4C8QB 4NS5A 1GL5A 2YDLA 2XDBA 3DKMA 4M4ZA 4PKCC 3VS3A 3CCMA 4J9HA 4YTLA 1N8RR 3QUIA 3CMAT 4X34A 1H3HA 2JM8A 1VQ6A 3OMGA 3REAB 1CKAA 4E2FB 2H8HA 1MV0B 2MK5A 2ZPHB 3OYLA 1IREB 2WSEE 2ROTA 4BE2A 2QGFB 1JRIA 5IXBA 2XDPA 1PWTA 5FU7C 2AKKA 1KG1A 5GJVB 3V7SA 2DMOA 5GAMj 2R5AA 3C12A 1RL2A 5HY6A 3M0PA 3ZBDA 3G4SA 4M77D 1NPPA 5GAMh 2EIFA 4C8QD 1VQOT 4KT0E 1QLYA 3CCRT 1WYXA 4IKFA 3QG1A 5GAN5 1Q82U 3L2QA 1ZA2B 4N0AA 5GAN8 4JRKA 4MMKA 4F7UE 4PFZA 4N4GA 1ZQ1A 4RTYA 3RMSA 4LDUA 4OB1B 1Q82C 1XQHA 5CQXA 2BZ8A 2MYSA 2PQWA 4M7AF 1Q81R 1G3SA 4HA8A 3OB9A 3QYHB 1WZOA 2CT3A 1IHVA 3M4GA 1LPLA 4WCIA 2CP2A 1M90R 2VASA 1WDXA 4C92E 4XTWA 3OYIA 1AD5A 1SF9A 1YN8A 4EMGA 5FWCA 4E7LA 2YWWA 3CMAA 1KQSS 1YIJQ 4X1VA 1QVFP 3JCMg 2GFAA 1S72Q 8AT1B 1PRMC 4RCBA 3OY9A 2YLBA 3CC7Q 3EFSA 3NHNA 2GCXA 2M16A 3CD6Q 1RACB 3CPWP 2O9SA 3M55A 3Q1JA 1ZSGA 1S1NA 1UGQB 3EGXA 3CCJT 3SD4A 1BKBA 1MNDA 3I5RA 1KIKA 3OSSC 4R56A 2JTMA 2OX7A 5LJ3d 4C5IA 2FO0A 2DERA 2COWA 3TQ7P 2M1HA 4MZPA 4L59A 2VGMA 1WXTA 4KH0B 4M75C 2JNGA 1JJ2A 1QMCA 1H641 4BDYA 3BY7A 3H0FA 3RERA 2XD0A 3M5AA 3TSZA 2LCLA 2ZAEA 1Q7YC 2DE0X 2C06A 1RADB 3R6NA 1WGSA 3CCEA 2KMTA 3J7AF 1WQWA 2RHZA 3MEAA 1NEBA 2QQRA 1Q7YU 3OA6A 4X9CA 4JJCA 1XJWB 5KCHA 1X2QA 1MV3A 2RHYA 1PM3A 2GTJA 2OAUA 3CC7T 3H8ZA 2RI2A 3GP8A 3KBGA 5IHKA 1UHFA 5FU7B 1JEGA 2KY9A 2DJQA 2DXUA 3NTKA 3GPLA 2EWNA 1M5Q1 2K2VA 5CKEA 1UJ0A 4LN2A 3A1PA 3HFOA 2VVKA 2HKQB 2H3JA 2DEQA 4BE1A 4IIOA 2K5LA 2B8AA 3FEOA 3HFNA 2KK4A 4A4FA 5D7UA 5EG2A 1HSQA 5GAOn 2JW4A 4IURA 2ZPIB 1UGSB 4RTXA 3M54A 4RKUE 4E7JA 1RI9A 1Z9ZA 3CC4Q 3TSWA 4ZN1A 3OYDA 3CCLA 2A36A 5KYWB 1T3SA 4MZTA 4C8QA 2QA4Q 2L89A 4M75F 2L0AA 2P0QA 4PJOC 2NYSA 4A54A 1OV3A 2YRDA 3CCSQ 2F5KA 3E9FA 1IXDA 2FYKA 3EGXB 1VYUA 3CCQQ 2BZYA 1I81A 3THKA 4C5GA 4IUUA 2D0NA 1EIFA 3PIOA 1N5ZA 5KYYB 4M7DC 2QTXA 2RQVA 2GQIA 5KYXB 1VQNT 4C92A 5LL6S 2YXYA 4N4HA 3OYKA 4J9EA 4O5VA 2QG9B 4JRQA 5LJ3j 1B34B 4M7DD 3L42A 1WQ7A 5KYUA 1AZEA 2O9VA 1AZGB 2K9GA 4FM4B 1QWFA 2QK0A 2XG8D 3M0TA 1QVFS 4AFSC 3RNJA 2C0IA 1M3CA 4FSXA 2O88A 1NG2A 5CAIA 2LQKA 2PTKA 4PLLA 3G6EA 1BIAA 2LQ8A 4D8KA 1WPYA 1BIBA 2RF0A 1PKTA 1BCMA 3DLMA 1VQLQ 2LQNA 1VQMQ 3EAEA 3EGDB 2K3XA 1R77A 3VS1A 3MO8A 3X26B 3OYHA 2KSSA 3NTIA 2DFUA 3OS0A 2LQWA 1UJYA 1KSWA 2M51A 3X24B 3OBYA 3OW2S 1KHCA 3GF5A 2GFUA 4J9IA 1SHFA 4OF1A 1K9MU 1VQKA 2JT4A 1VQ9A 3CCMT 4J9FA 1IHWA 2J6FA 1YWOA 1D3BA 3UA7A 3GNGA 2HQHA 1YBYA 2HBPA 2LNHB 4OMOA 2E1HA 2MF2A 4F17A 1T0JA 1IB8A 2K6DA 1VUBA 2RNAA 1N27A 1Q95G 4JRPA 2CKKA 1M2OA 4M7AE 4XU1A 4LDYA 1EZZB 2OAWA 1M2VA 2V1QA 4L6V5 3D7SB 3ER0A 1ZUUA 4PJOG 4P5NA 3CBOA 4RMOA 1VYVA 1ABOA 1D09B 1PHTA 5FLXE 3G4ST 4C92B 3JB9F 3F70A 3CMAQ 2NLUA 4O6JA 1VQOA 1LOJA 1NEGA 3EGUA 3JRZA 4LUDA 2KBTA 4QVCA 4CRIA 1I5LA 2LDMA 1M8VA 4HXJA 1MGQA 1Q81U 2E70A 3FJPA 2KAFA 1WHHA 2EYXA 1D0XA 2DILA 1NLOC 5HK0A 2LMJA 2EYYA 3CC4T 1NZ9A 1PRLC 3ASKA 2L5QA 2M9UA 1ZBXA 4M78D 1RABB 2RD1A 1X01A 3EG1A 3DB4A 4GY5A 4J83A 1BYMA 2HL3A 2HQEA 3EGDA 1RAAB 5LJ3f 3A5ZB 5CQYA 7AT1B 1WJRA 2DM1A 2P0PA 2CDTA 3UATA 1YJNA 1I8FA 2DBMA 2P0KA 1M27C 2ZZDA 4DBFA 4M7AD 2ATCB 4RG8A 1VQ9T 5D6WA 2SRCA 2NUZA 3S3MA 5KYNA 2CSIA 4MMLA 5GAMg 3CMET 2JMCA 2RN8A 1RAGB 3U23A 4CI0C 4M7AC 4M75G 2MWOA 5M9OA 1FX7A 1NPRA 3LH5A 3EHQA 1T3LA 3TU4K 1TSFA 3JCMP 3OYAA 2VV5A 5GAN7 2L3QA 3SHWA 2KRNA 2O01E 2DK3A 1I4K1 4EDUA 3M9QA 4N0AC 1RAFB 3S3OA 1GBQA 3HRTA 3BE3A 2JS0A 4L5GA 3VV0A 2DJZA 4LE9A 1YJWA 2F2VA 2EPDA 2MPXC 1TXQA 1U1TA 3R6OA 1I1JA 1X43A 4ZGJB 1KQ2A 1D1BA 1YIJT 1W6XA 2MI6A 4J9GA 1WHKA 2QTVA 2VUBA 1Q86C 4KRTA 2DLPA 1G8XA 2XU8A 3HL8A 3C0CA 4EMKB 3INZA 4HT9A 1M4ZA 4NOYA 5GANh 3TVTA 3P8HA 1M3AA 1IO6A 3CCET 2A0FB 1VQ6T 4M7DB 2FL7A 5GANd 4NL3A 4AT1B 1QWEA 3BDUA 4XU3A 3VS2A 1V1CA 2HBWA 4M7AA 5GAN4 2OTLQ 2HAXA 4OB3B 1RLQC 2X35A 1BB9A 5FRNA 5GJWB 1XNIA 3L2UA 1GBRA 4BACA 1YI2A 3MP1A 4F7UG 3IQLA 2BKDN 1VQ8A 4C8QG 1YJNT 3L2WA 3TEEA 2IG0A 4LUEA 4FU6A 1GFDA 2KT1A 2D8JA 4PJNA 1BI0A 1HK9A 2BE7D 2CP0A 2RA2A 4M78G 5I2SA 2X51A 2KDSA 1S72T 2VC8A 2DTIA 4C92F 1GRIA 2RM4A 1B3QA 4F04B 1A0NB 1PD0A 1ZHIA 3A98A 4XU0A 2LX7A 3VS7A 1FXXA 2GNCA 4E7IA 4QQGA 4B6MA 3A8GB 3VS5A 3RKXA 2EJGA 1VQ8T 2DYIA 5FU6B 5CR2A 2QQSA 3EG2A 2EQIA 2PUOB 1WHMA 2M0OA 4UC4A 3OW2A 1X6BA 1ZSZC 3G7ZA 5GAMe 1R0BG 2EQKA 4DEXA 1YJ9A 2R58A 2X9HA 2RJEA 3OYYA 2DXTA 3QZ9B 3VS0A 3E2UA 1NE8A 1H3ZA 4HCZA 4PFPA 3JSCA 3A8MB 4FT4A 3MHXA 1Y71A 2QYZA 4LDVA 4OB2B 1YP5A 2ZPFB 1YHQQ 3JB9G 4M78B 3WVEB 1FYNA 2RI3A 4M78C 4CC4B 1SHGA
chains in the Genus database with same CATH topology
3KBGA 2ZGWA 5GAN6 5FU7B 1YI2T 2RK1A 2KY9A 1G3WA 2X4WA 4M77E 2DXUA 3JCMb 2JZ2A 1W4SA 3NTKA 3GPLA 5GMKh 2AHJB 1X6OA 2EWNA 4PNOA 2LCCA 3ZEHA 1M5Q1 2K2VA 5CKEA 2EQMA 2O4XA 4BI4A 3HFOA 1YIJA 4C0DB 3SWNC 2QEXA 2XK0A 5GMKm 1VQ7T 4VUBA 3O8VA 2V8KA 3LYIA 5CIUA 2H3JA 2DEQA 2MMPA 4BE1A 4OB0B 3LX7A 4TVRA 4BY6B 1KD1C 4PJOA 3RMQA 3CCST 2K5LA 2O4XB 2B8AA 4A4KA 1YJ9T 1NJIU 3FEOA 5GMKe 3HFNA 2KK4A 3E9GA 4DOVA 4A4FA 3JCMf 3EFRA 3HKSA 5EG2A 4XTVA 4J6WA 5GAOn 3CCVT 4J7FA 4OGCA 4IURA 2ZPIB 1OI1A 3PFSA 4XTXA 1UGSB 4F7UF 3MCAB 5GAOr 1LNXA 4LD6A 1KC8U 3M54A 4RKUE 4M77F 3OYJA 4E7JA 2KQWA 4KUIA 2YRVA 3OYCA 5FRMA 4M7DG 5C6SA 4ZN1A 3JAME 3QBYA 2EQJA 3OYDA 3SWNB 4WF2A 3CCLA 1LJOA 4MZTA 4C8QA 2D6FA 2DKGA 2R57A 3OMCA 4IUVA 1P92A 4EPCA 3PIPA 2L89A 4XAXB 1GXIE 4M75F 3CPFA 2P0QA 4KBMB 2K4YA 2LTOA 4M78F 4A54A 5GAMd 4PJOC 4LDWA 3LWHA 3CCQT 3LGFA 1VQPA 2DZCA 1R8OB 3P8DA 5GMKj 2F5KA 3E9FA 4JJNK 2FYKA 4XTZA 4M7AB 2Y90A 4BB7A 4IUTA 2E6NA 3P8BB 1I81A 4BE0A 4C92G 4C5GA 3OYBA 4IUUA 1EIFA 2YHTA 2Y4XA 3PIOA 5AYFA 3JB9H 5CKHA 5CCAA 4FL6A 4HT8A 4E7KA 2FB7A 4M7DC 5D6YA 4C8QF 1N8RU 2QTXA 4Z02A 4V2SA 4JS5A 4M78E 3QXEB 3RKYA 5CK9A 4BI8B 4M75D 4C92A 3G71A 1VQNT 3CCUA 3CC2T 5LL6S 4QQ6A 3E19A 4N4HA 5I2MA 3OYKA 2CZ1B 2P4TA 1Y96A 3MP6A 4O5VA 2LT4A 2L8DA 3I56A 4JRQA 5LJ3h 4MDWA 5LJ3j 1B34B 4M7DD 2DD4A 3L42A 2RH2A 3GNFB 1WQ7A 5IT9E 2DIGA 3CCVA 3V8KA 4FM4B 2XG8D 2EYQA 1QVFS 1XOVA 3M58A 4M75B 2OTJA 4OVAA 3RIRA 3FIFA 2QI2A 4FSXA 4A4HA 4HCBA 3MEVA 3CC4A 1B34A 1SSFA 5GMKl 1VQLT 1VIEA 3PNWC 5KH6A 2PVDB 3URGA 1PSEA 2LQKA 5CAIA 2EQUA 3QIIA 1BIAA 4PLLA 4ELYC 3G6EA 3QZ5B 3A8HB 2LQ8A 4OP0A 2DPPB 5DLQE 1WPYA 2D9TA 1BIBA 4M77B 5LJ5e 4EMKA 2IVWA 3S3NA 2G3RA 4M7DE 2FHDA 3DLMA 1M1KU 4PL6A 1YITT 5J26A 1M1FA 1N6AA 1Q86U 3EAEA 2RJCA 2K3XA 3BDLA 3JCMV 4C5HA 3JCMh 5LJ3g 1K8AC 3META 3MO8A 2YLCA 2K3YA 3X26B 3CXCA 3OYHA 3QDRB 2KSSA 3NTIA 2CZ0B 5D6XA 5HKCA 1JJ2S 3CPWA 4J6XA 1VQ5T 3OS0A 3X24B 2XICA 4C92D 3HHTB 3SWNA 3CCLT 3OBYA 4EMKC 2VGNA 4NL2A 1KHCA 2QQBA 2GF7A 3OW2S 5GAN2 1QVGA 3GF5A 2GFUA 3WXMB 2LX9A 2X4JA 4OF1A 2QDYB 1K9MU 4KUDK 4Y91A 3OYGA 1JBMA 2RHIA 4C0GA 1VQKA 4HKEA 2HQXA 1VQ9A 3X25B 3CCMT 3G71T 3I55A 2VXFA 1OZ3A 3JCMe 1MHNA 1D3BA 2PUKB 4J8OA 5L8RE 4M7DF 3UT1A 5CVIA 2CZ6B 3GIBA 3WVDB 3GNGA 4X9DA 3J81E 2BIVA 4MDXA 3CBMA 3UPUA 5A0DA 3V7CA 4RCCA 1YBYA 2HBPA 3JB9I 5LJ5h 2E1HA 3FLGA 4ATOA 2BUDA 3LWIA 3QJ6A 4DA4A 2MF2A 2I2LA 5LJ5g 4BI3A 1IZ6A 2D0QB 1VUBA 2MWPA 4XQ3A 1N27A 3NFCA 4JRPA 2CKKA 2VYTA 3QHSA 3JCMd 4M7AE 1WJSA 2JVVA 3KUFA 4LDYA 4XU1A 1VQPT 1BI1A 2RHUA 5GMKi 4ELZC 5LJ5d 3HRSA 4L6V5 4M7DA 3QYGB 1YITA 5LJ3e 2DTHA 3ER0A 3PTAA 1YJWT 2QQAA 3LH0A 4PLIA 4PJOG 5GAOl 2VXEA 4P5NA 3CBOA 2E64A 3VUBA 4ZGDB 4RMOA 3X20B 3ME9A 1U1SA 4M75A 5FLXE 2RB6A 4BUGA 4C92B 3G4ST 1M90U 3LW5E 1G3YA 3JB9F 3F70A 4PJOB 1VQ5A 5GAOp 1XTDA 2EJ9A 3CCRA 2E12A 2NLUA 3E1SA 4O6JA 3JCMJ 1VQOA 1LOJA 1N9RA 1WJQA 2DXCA 2XKOC 3MP8A 3OQ5A 5C0MA 3JRZA 4QVCA 2V8IA 4IUPA 3A8LB 4N4IA 4CRIA 2LDMA 3H6ZA 4ME7A 2JUFA 1M1KC 1MGQA 1I5LA 2E65A 4PJOE 1M8VA 4EMHA 2E5QA 1Q81U 2E70A 2XIDA 4D6WA 3FJPA 2KAFA 3I56T 4JLGA 1YHQT 4Q5WA 3QSUA 4BDZA 1M1GA 1M9SA 1Y07A 2CZ7B 4PJOF 3VJPA 5HK0A 1OYXA 2JTFA 5IN1A 4XTUA 4A4EA 5KE2A 5DLOA 4BD3A 5KCOA 3G6ET 3BFMA 3CC4T 1NZ9A 1VQLA 3ASKA 2L5QA 2M9UA 1PSFA 2EKOA 3T9NA 5GANf 1KQSA 2ZCFB 3OYEA 1ZBXA 4M78D 2ZPBB 5KE3A 2RD1A 1X01A 3OSVA 1X75C 3DB4A 4GY5A 5CO7A 4J83A 4C0DC 1BYMA 2DAQA 4ZGEB 2QA4T 4R55A 3JCMX 1G5VA 2CGHA 1N9SA 2HQEA 1WNLA 5CKFA 2RI5A 4JS4A 3CCJA 5A2QE 3SFMA 3HPWA 5LJ3f 2XHCA 3A5ZB 3UWNA 5CQYA 1D3BB 1W2BS 1WJRA 3M56A 3VKIA 3JB9J 2P0PA 2RJDA 1YJNA 4PJOD 1I8FA 2DD5A 1K8AU 2P0KA 3CBPA 2RK2A 4B9XA 4C8QB 3DLLA 3OYMA 4XK8E 3TREA 2F5TX 4NS5A 1AHJB 2ZZDA 1BI2A 2K5IA 2EJFA 4QVZA 4M7AD 2XDBA 3DKMA 3CCUT 4RG8A 2EFIA 3FC3A 5D6WA 3CCMA 4PKCC 1VQ9T 1V29B 2OTLA 2CYZB 3DB3A 1YCYA 4M77G 4YTLA 3QUIA 3S3MA 1K9MC 3CMAT 2PVOB 4X34A 4ZTJA 1NJIC 4F7UA 3L1AA 3QJYA 3X28B 2LNVA 4MMLA 1VQ6A 2DIQA 3OMGA 5GAMg 2QXFA 5GANe 1UGPB 3ZFJA 3CMET 4M7AC 4CI0C 4XU2A 2DO3A 1YHQA 4FT2A 3VYHB 4M75G 2DZ9A 1S72A 2MWOA 5M9OA 1FX7A 1NPRA 1M90C 1QW1A 3V8JA 1FWZA 2LRQA 3TU4K 5LJ5f 3OYNA 2ZPHB 3JCMP 5GANj 2E41A 3OYAA 3OYLA 1IREB 2LVMA 3GLXA 2VV5A 2WSEE 5GAN7 4OGEA 2E6ZA 2RO0A 1K73C 4BE2A 2O01E 3CD6A 1JRIA 2DK3A 2XDPA 4C8QE 1I4K1 4M77A 5FU7C 1KG1A 4EDUA 3M9QA 4N0AC 1UB4A 3CC7A 3S3OA 4DOWA 1KD1U 3HRTA 3C94A 2X4YA 4JLIA 4L5GA 4M75E 3V7SA 4C0FA 5GAMj 2R5AA 2XI9A 3C12A 1RL2A 2DJZA 3VV0A 1YJWA 3HSBA 3QO3A 5HY6A 3MEUA 4GLKA 3RUXA 3ZBDA 3L2RA 3G4SA 4M77D 1NPPA 2K5FA 5HK3A 1U1TA 1U8RA 3R6OA 4ZGJB 3JB9D 2KVQG 1KQ2A 5GAMh 1OZ2A 2EIFA 1YIJT 5GANg 4C8QD 1O9SA 1VQOT 3PT9A 2MI6A 3QKJA 2VUBA 4KT0E 3HP9A 3CCRT 1Q86C 1VQKT 5DY9A 2F69A 2WSFE 3NTHA 4IKFA 3N5BB 2XU8A 3HL8A 3QG1A 5A0LA 2HNIA 3CCSA 2JOYA 3OBWA 3JCMW 2WSCE 5IAYA 5GAN5 1Q82U 4EMKB 1UEBA 2LC4A 3INZA 3L2QA 4N0AA 5GAN8 1M4ZA 4NOYA 3PGGA 5GANh 3P8HA 4HT9A 2HD0A 2PU9B 3CCET 3PMIA 4JRKA 1G3TA 5FROA 1VQ6T 4MMKA 2PVGB 1VQNA 4M7DB 1HXDA 2A3LA 2X4XA 4F7UE 5LJ5j 2FL7A 5GANd 4NL3A 4N4GA 1ZQ1A 2L3RA 4FIBA 3BDUA 4XU3A 3RMSA 3C95A 3TCJA 4M7AA 4LDUA 4OB1B 5GAN4 5DM7R 1Q82C 1XQHA 2HAXA 5CQXA 4OB3B 2X35A 2PQWA 5CKDA 4A4GA 5A0GA 2K57A 3RKWA 5FRNA 4IUQA 4M7AF 2MAMA 5FU6C 1Y96B 5CKBA 1VQMA 1XNIA 3FDRA 1UGRB 3L2UA 3OYFA 1G3SA 2V8JA 4BACA 4HA8A 5I21A 1YI2A 3MP1A 4J5YA 4F7UG 3OB9A 1QVGS 3QYHB 2BKDN 1VQ8A 4C8QG 3J80E 2XDDA 1YJNT 3L2WA 3TEEA 3M4GA 1KHIA 2A7YA 2IG0A 4C92C 5GAOm 2QEXT 1JB0E 4J7IA 2WACA 3SB2A 4B9WA 4FU6A 1W2BA 4M78A 4QW2A 4C92E 1VQ4A 4HCCA 4F7UB 1QVPA 2GQVA 4XTWA 3UDCA 4C0ZA 3OYIA 2Y4YA 5J3BA 2OTLT 2ZPEB 4EMGA 4E7LA 1BI0A 1HK9A 3FB9A 3CMAA 3L2VA 1N8RC 1KQSS 2RA2A 4M78G 5I2SA 2QQ9A 3MEWA 4JUVA 3JCMg 2GFAA 4BY6C 3AHUA 1QP3A 5GAMf 1BI3A 1KQ1A 3HRUA 2CS7A 3SDZA 2KDSA 3BW1A 4RCBA 1S72T 3OY9A 2VC8A 2YLBA 4II1A 2DTIA 3KXTA 3EFSA 3QPHA 4C92F 2OTJT 2EAYA 4J6YA 2GCXA 2M16A 3CEYA 2RM4A 1O75A 1Q81C 1ZHIA 4LD9K 3CPWS 4LDXA 4JDSA 1TH7A 4ZN3A 3CXCS 2QA4A 3M55A 4XU0A 3CD6T 2E10A 1VQMT 1FXXA 4MZMA 4E7IA 1K73U 3Q1JA 2JN0A 1UGQB 3CCJT 3VUZA 3SD4A 1BKBA 4QQGA 4QVDA 3A8GB 3GOXA 2FVUA 2ZPGB 2EJGA 4Y28E 3RKXA 4E7HA 4E47A 1VQ8T 3OSSC 5FU6B 3V8LA 5CR2A 4R56A 4A53A 2QQSA 3FRNA 2JTMA 1RI0A 5LJ3d 4C5IA 2PUOB 2RJFA 1VQ7A 4XTYA 2RHXA 4OMFB 3PMTA 2M1HA 2M0OA 3L2ZA 4MZPA 4UC4A 4L59A 3VU3C 3G7ZA 3OW2A 4M7AG 2VGMA 4DQ2A 2DTOA 5GAMe 2EQKA 3M53A 4M75C 4JRIA 2JNGA 1VQ4T 1YJ9A 2R58A 1JJ2A 3CC2A 1H641 2RJEA 4BDYA 3OYYA 2DXTA 3BY7A 3OS1A 3LLRA 4M77C 1QVFA 3RERA 2XD0A 3C4SA 3QZ9B 3OS2A 3M4YA 4QQDA 3M5AA 1NE8A 4RG2A 1H3ZA 2LCLA 4HCZA 3JCMQ 3I55T 1Q7YC 5GAN3 4C8QC 1QP2A 3JSCA 3CMEA 2C06A 3A8MB 3OS5A 2DVEA 3GP8A 1VIFA 1WGSA 3CCEA 2R5MA 1KC8C 2KMTA 4FT4A 1WQWA 2RHZA 3LGLA 3MEAA 3MHXA 3RESA 3J7AF 1Y71A 4LDVA 4OB2B 3VYGA 2ZPFB 2DXBA 3S6WA 3JCMc 2QQRA 1Q7YU 3A8OB 3OA6A 1DJ7B 3JB9G 4X9CA 4M78B 3WVEB 2LT1A 3M59A 3M57A 5KCHA 5J39A 5GAOq 3CCQA 4ZTFA 4KULA 1Y7XA 2RI3A 2RHYA 2OAUA 4C5EA 3CC7T 4M78C 3H8ZA 2RI2A 3V7RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1F A;  3JSC A;  5CKF A;  2C06 A;  3HPW A;  1UB4 A;  5CQY A;  3VUB A;  5CR2 A;  2KMT A;  4MDX A;  5HK0 A;  5HK3 A;  5CKE A;  5CKH A;  5HKC A;  5CCA A;  5DLO A;  3TCJ A;  2MF2 A;  4VUB A;  4MZP A;  3G7Z A;  5CQX A;  1VUB A;  2VUB A;  4MZT A;  4ELY C;  5CKD A;  3NFC A;  4OF1 A;  5CK9 A;  3JRZ A;  5CKB A;  1X75 C;  4HKE A;  5CO7 A;  4ME7 A;  1NE8 A;  4ELZ C;  4MZM A; 
#chains in the Genus database with same CATH topology
 2FZG B;  2RK1 A;  2X4W A;  1Y0M A;  1W4S A;  4FW1 A;  1KC8 R;  5GMK h;  3ZEH A;  2HDA A;  2J7I A;  4GLM A;  1YIJ A;  2QEX A;  1K9M R;  2V8K A;  2YSQ A;  2MMP A;  2H3E B;  1KD1 C;  4PJO A;  3CME Q;  3RMQ A;  3PE0 A;  1YJ9 T;  1NJI U;  4HVV A;  1QVG P;  4DOV A;  4HVW A;  2IIM A;  1I07 A;  3JCM f;  4XTV A;  4QT7 A;  4CC2 A;  4J7F A;  3NMZ C;  3PFS A;  4ESR A;  1KC8 U;  3FJ5 A;  3RBB B;  2YRV A;  4RTT A;  4F14 A;  3OYC A;  4M7D G;  5C6S A;  3SWN B;  4WF2 A;  1LJO A;  2D6F A;  2DKG A;  4IUV A;  4Z8A A;  3VRZ A;  4KBM B;  2K4Y A;  4M78 F;  3LWH A;  1VQP A;  2QDL A;  3P8D A;  4JJN K;  4XTZ A;  2DRM A;  1K73 R;  3OW2 P;  2E6N A;  1KK7 A;  1LCK A;  4AMC A;  2Y4X A;  5CCA A;  4FL6 A;  5D6Y A;  4Z02 A;  3CCU Q;  4RTV A;  3QXE B;  3RKY A;  4M75 D;  1CSK A;  3CCU A;  3CC2 T;  5I2M A;  1K0S A;  2P4T A;  1YCS B;  3M0U A;  4MDW A;  1VA7 A;  5AT1 B;  1VQK Q;  2CUD A;  3M0R A;  3MPU B;  1YJ9 Q;  2SEM A;  3NPF A;  2NUT B;  4M75 B;  4OVA A;  1X27 A;  4A4H A;  2QI2 A;  4HCB A;  3MEV A;  2E3I A;  1VIE A;  3QZ5 B;  3VU3 C;  5GAN g;  3CCL T;  4DBH A;  1JO8 A;  1OX8 A;  2C0T A;  2RJC A;  2VWF A;  3BDL A;  3JCM V;  4C5H A;  2QAZ A;  2YLC A;  2K3Y A;  4Y92 A;  4AG1 C;  3CXC A;  1VQ5 T;  3QWX X;  3CPW A;  4KGV B;  4CC3 A;  4EMK C;  1PNJ A;  3WXM B;  1PKS A;  4F16 A;  2QDY B;  1ZSZ B;  1E7O A;  4Y91 A;  3OYG A;  1JBM A;  1ABQ A;  2KNB B;  2DL4 A;  3JCM e;  2CP5 A;  4J8O A;  4M7D F;  1UE9 A;  2YUO A;  3VS4 A;  4CC7 A;  3GBQ A;  4X9D A;  3J81 E;  2BIV A;  3CBM A;  1UTI A;  1ZX6 A;  3JV3 A;  3H9N A;  3LWI A;  4DA4 A;  2I2L A;  5LJ5 g;  1IZ6 A;  2MWP A;  1EFN A;  3KUF A;  1RLP C;  3H0I A;  1VQ8 Q;  1VQP T;  5GMK i;  1PG5 B;  1K9A A;  2P4R A;  3PTA A;  2EW3 A;  1YJW T;  2QQA A;  5GAO l;  2Z0W A;  1NLP C;  3X20 B;  3ME9 A;  1U1S A;  1OPL A;  1M90 U;  1G3Y A;  1NJI R;  1JXM A;  2DEU A;  4PJO B;  1F1B B;  3CCR A;  2E12 A;  3JCM J;  2DL3 A;  1WJQ A;  3I9Q A;  2XKO C;  5C0M A;  4DBQ A;  2DL7 A;  3A8L B;  3H6Z A;  4ME7 A;  1K4U S;  4PJO E;  4EMH A;  2XID A;  3I35 A;  3I56 T;  1OU8 A;  1YHQ T;  2AKL A;  3QSU A;  1M1G A;  1M9S A;  4FYY B;  4PJO F;  2ESW A;  1WXB A;  1YJN Q;  1NBE B;  4BD3 A;  2JXB A;  5IHI A;  2BZX A;  1VQL A;  1M3B A;  4OMP A;  2ZCF B;  3OYE A;  3G6E Q;  4C0D C;  2QA4 T;  3JCM X;  3KFV A;  1N9S A;  3G1J A;  2W10 A;  2RI5 A;  1W2B P;  1W2B S;  1C6V X;  1R0C B;  1OX9 A;  3VKI A;  3VS6 A;  4FW2 A;  1FMV A;  3OYM A;  4XK8 E;  3TRE A;  2F5T X;  2KXC A;  1AHJ B;  1K76 A;  2K5I A;  1FMW A;  2EJF A;  1AT1 B;  2EVR A;  4QVZ A;  3FC3 A;  3RDV A;  2CYZ B;  2AK5 A;  3DB3 A;  4AG2 C;  5I11 A;  1K9M C;  2O31 A;  3AT1 B;  3QJY A;  3X28 B;  2LNV A;  1VQ9 Q;  5GAN e;  3ZFJ A;  4XU2 A;  2DO3 A;  1YHQ A;  4FT2 A;  3VYH B;  2DZ9 A;  1M30 A;  1UGV A;  2KEA A;  1FWZ A;  2FRW A;  2RMO A;  3RR6 A;  3OYN A;  1TUD A;  3CCV Q;  2E41 A;  2LVM A;  5KYY A;  9ATC B;  4PJL A;  1X2K A;  2E6Z A;  2RO0 A;  1K73 C;  2V1R A;  4C8Q E;  4M77 A;  4AFQ C;  1UB4 A;  1AWW A;  4DOW A;  1MUZ A;  2X4Y A;  4M75 E;  4C0F A;  3QO3 A;  3MEU A;  4GLK A;  2DNU A;  3L2R A;  2CSQ A;  5HK3 A;  2K5F A;  1JJ2 P;  2KVQ G;  1D1A A;  1OZ2 A;  4OMM A;  1X6G A;  3PT9 A;  3QKJ A;  1BCO A;  3HP9 A;  2ECZ A;  1VQK T;  5DY9 A;  2YT6 A;  2F69 A;  3NTH A;  5A0L A;  3CCS A;  2JOY A;  3OBW A;  3JCM W;  2WSC E;  5IAY A;  4RTU A;  2BTT A;  2LC4 A;  1OOT A;  3PGG A;  2PU9 B;  4D8D A;  5FRO A;  1G3T A;  2PVG B;  1HXD A;  2X4X A;  5LJ5 j;  2L3R A;  1WHL A;  3C95 A;  2JM9 A;  5CKD A;  4A4G A;  4IUQ A;  4E7S A;  2MAM A;  2RQR A;  1Y96 B;  1ZUK A;  5CKB A;  3CCR Q;  4JJD A;  3OYF A;  1OQK A;  4OMQ A;  2F2W A;  2XDD A;  1TWB A;  2LZ6 B;  1KHI A;  2A7Y A;  1TUG B;  2QEX T;  3SB2 A;  1W2B A;  5FW9 A;  4RUG A;  1VQ4 A;  4HCC A;  4R0K A;  1QVP A;  2GQV A;  4C0Z A;  2Y4Y A;  5J3B A;  2EBP A;  2OTL T;  1VQ5 Q;  3L2V A;  1UUE A;  2QQ9 A;  1QP3 A;  1FMK A;  2YRC A;  5GAM f;  1ARK A;  1BI3 A;  2DL8 A;  4PJJ A;  3HRU A;  1IGQ A;  2EGC A;  4II1 A;  3KXT A;  2OTJ T;  3CXC P;  4J6Y A;  1U06 A;  4LD9 K;  2DYB A;  3CPW S;  3CCJ Q;  1IGU A;  2KT8 A;  4JDS A;  1WIE A;  1TH7 A;  3CXC S;  1YIT Q;  3CD6 T;  2E10 A;  2F2X A;  4OMN A;  1KFZ A;  1CKB A;  2JN0 A;  3VUZ A;  2DL5 A;  4QVD A;  3GOX A;  2FVU A;  2ZPG B;  4Y28 E;  4E47 A;  2DVJ A;  4A53 A;  1RI0 A;  2RJF A;  4K11 A;  1AVZ C;  2RHX A;  4OMF B;  3PMT A;  3L2Z A;  4M7A G;  3G71 Q;  2A37 A;  3M53 A;  4JRI A;  1ACM B;  3CC2 A;  3OS1 A;  3EG9 B;  1GFC A;  2LP5 A;  3LLR A;  1KD1 R;  4QQD A;  4AFZ C;  2MOX A;  3I55 T;  2ROL A;  2V26 A;  3CME A;  2KR3 A;  2R5M A;  1KC8 C;  2FPD A;  3LGL A;  3RES A;  1UFF A;  3VYG A;  3S6W A;  1TU0 B;  3A8O B;  1DJ7 B;  5IXF A;  2LT1 A;  2C0O A;  5GAO q;  3CCQ A;  4KUL A;  4C5E A;  1AEY A;  4M77 E;  4KGZ B;  2GTO A;  1B07 A;  2AHJ B;  4PNO A;  1MMD A;  1WX6 A;  4BI4 A;  4C0D B;  3SWN C;  3EH2 A;  2XK0 A;  1PC0 A;  2AIR B;  5GMK m;  3O8V A;  3LYI A;  3LX7 A;  4TVR A;  4BY6 B;  2KRM A;  2K3B A;  2O4X B;  1ZBJ A;  5GMK e;  1LVK A;  3EFO B;  1SG5 A;  1RUW A;  4J6W A;  4JZ4 A;  3CCV T;  2FZK B;  4OGC A;  3CCE Q;  1OI1 A;  4XTX A;  4F7U F;  3MCA B;  4Z88 A;  5GAO r;  1LNX A;  4FYW B;  4M77 F;  3OYJ A;  1SSH A;  1OPK A;  2KQW A;  1D0Z A;  4EIK A;  5FRM A;  1VQN Q;  3REB B;  1YNZ A;  1GXI E;  3CPF A;  2FPF A;  2LTO A;  5GAM d;  4LDW A;  3CCQ T;  3LGF A;  2L3P A;  5GMK j;  1R8O B;  4IUT A;  1UEC A;  1VYT A;  4BE0 A;  2K79 A;  3OYB A;  4AFU C;  2K7A A;  3EG9 A;  1TS9 A;  4HT8 A;  4E7K A;  2EGA A;  2FB7 A;  4C8Q F;  4V2S A;  4JS5 A;  4BI8 B;  4JJB A;  2NUP A;  2FEI A;  4QQ6 A;  3MP6 A;  2LT4 A;  2RQW A;  2L8D A;  3I56 A;  5LJ3 h;  4PFO A;  2HMA A;  2RH2 A;  5IT9 E;  2DIG A;  3CCV A;  3NGP A;  3V8K A;  5IH2 A;  2EYQ A;  4JPB W;  3FIF A;  2JTE A;  1UHC A;  3CC4 A;  5GMK l;  1VQL T;  3PNW C;  5KH6 A;  2PVD B;  1UG1 A;  3QII A;  2HCK A;  3A8H B;  4OP0 A;  5LJ5 e;  3S3N A;  2G3R A;  4M7D E;  1M1K U;  4PL6 A;  2QEX Q;  1YIT T;  2ABL A;  5J26 A;  1X69 A;  1N6A A;  1Q86 U;  1NYG A;  1K8A C;  3MET A;  1VQO Q;  4PJM A;  1VQ7 Q;  5D6X A;  1GCQ C;  5HKC A;  4J6X A;  3SWN A;  1SRL A;  2VGN A;  1QVG A;  2QQB A;  5GAN 2;  2FRY A;  2X4J A;  1HD3 A;  1C1A A;  2M02 A;  2O2O A;  1Q86 R;  4KUD K;  2RHI A;  4HKE A;  2HQX A;  1VQ6 Q;  3X25 B;  4IIM A;  1YI2 Q;  2GBQ A;  4QKU A;  1M1K R;  5L8R E;  3UT1 A;  5CVI A;  2RQT A;  3WVD B;  1YWP A;  3EH1 A;  3JB9 I;  5LJ5 h;  2J06 A;  4ATO A;  3QJ6 A;  2D0Q B;  4XQ3 A;  1Y57 A;  4KH1 B;  2VYT A;  3QHS A;  2DA9 A;  3JCM d;  4ELZ C;  5LJ5 d;  1GCP A;  3QYG B;  2RPN A;  5LJ3 e;  2YUP A;  3LH0 A;  4PLI A;  1WHG A;  4ZGD B;  1VQ4 Q;  2EKH A;  4M75 A;  2RB6 A;  2COZ A;  5KYU B;  2QAS A;  1VQ5 A;  5GAO p;  1OU9 A;  3I55 Q;  1XTD A;  2EJ9 A;  1T0H A;  2DXC A;  2FG0 A;  1W70 A;  1VQN A;  2E65 A;  2KYM A;  2RQU A;  2A28 A;  1AWX A;  4Q5W A;  2X3W D;  2FZC B;  2CZ7 B;  5IN1 A;  4XTU A;  1H8K A;  5KE2 A;  1OUL A;  5DLO A;  1H92 A;  3BFM A;  3O5Z A;  2LJ3 A;  3T9N A;  2EKO A;  5GAN f;  1KQS A;  5KE3 A;  3OSV A;  1X75 C;  2KI7 A;  2DRK A;  5CO7 A;  3MKD A;  4ZGE B;  5ECA A;  1AWO A;  4R55 A;  1G5V A;  3EHR A;  3CCJ A;  4ANJ A;  2OJ2 A;  3HPW A;  2XHC A;  2BE9 B;  1D3B B;  3JB9 J;  4PJO D;  1IRX A;  2CRE A;  3CBP A;  4B9X A;  3DLL A;  2CT4 A;  4ORZ A;  1GCQ A;  4LNP A;  1BI2 A;  2VKN A;  3CCU T;  2EFI A;  1EX4 A;  1V29 B;  2OTL A;  1YCY A;  4M77 G;  1ZUY A;  2PVO B;  2HEQ A;  4ZTJ A;  1NJI C;  4F7U A;  3L1A A;  2DIQ A;  1VOM A;  5HCK A;  2QXF A;  1UGP B;  4JZ3 A;  1M8M A;  1S72 A;  5KYX A;  1K1Z A;  4PK4 A;  3H41 A;  1M90 C;  1QW1 A;  3V8J A;  5EC7 A;  2I0N A;  2LRQ A;  5LJ5 f;  5GAN j;  4E7Z A;  1RAH B;  3GLX A;  5L23 A;  3CCM Q;  4OGE A;  1NM7 A;  3CD6 A;  2EYW A;  4E6R A;  3CC7 A;  4KGX B;  1KD1 U;  3C94 A;  4JLI A;  2HKN A;  2XI9 A;  1OEB A;  3HSB A;  2P84 A;  4HVU A;  1JQQ A;  3RUX A;  1Q82 R;  1U8R A;  1D1C A;  1AWJ A;  3JB9 D;  1Q7Y R;  1O9S A;  2D1X A;  1BBZ A;  2AZS A;  2WSF E;  3N5B B;  2HL5 C;  2HNI A;  1UEB A;  2HD0 A;  2K2M A;  3PMI A;  1E6G A;  3G4S Q;  2A3L A;  2LJ0 A;  4FIB A;  1SPK A;  2COY A;  3TCJ A;  2XMF A;  2DX1 A;  5DM7 R;  1I0C A;  5A0G A;  2K57 A;  3RKW A;  3M0S A;  5FU6 C;  2QGG A;  1VQM A;  1SRM A;  3FDR A;  1UGR B;  2V8J A;  1ZSZ A;  5I21 A;  4J5Y A;  1QVG S;  3SEM A;  3J80 E;  1C0M A;  2CP3 A;  2VB6 A;  4C92 C;  5GAO m;  1JB0 E;  4J7I A;  2WAC A;  4B9W A;  4M78 A;  4ZNX A;  5IHN A;  4QW2 A;  2JS2 A;  2CUB A;  4F7U B;  3UDC A;  1MMA A;  2ZPE B;  4J9B A;  3FB9 A;  1N8R C;  2L3S A;  4J9C A;  2KRS A;  4JUV A;  3MEW A;  2LCS A;  2OI3 A;  4BY6 C;  3AHU A;  1KQ1 A;  2KXD A;  2CS7 A;  3SDZ A;  1QQJ A;  1WXU A;  3BW1 A;  3CCL Q;  3QPH A;  2EAY A;  4FSS A;  3CEY A;  1O75 A;  1Q81 C;  1ZLM A;  4LDX A;  4ZN3 A;  2QA4 A;  1VQM T;  4MZM A;  1K73 U;  1WHJ A;  1SKU B;  4E7H A;  5I22 A;  2FPE A;  1JU5 C;  3M0Q A;  3V8L A;  3EFO A;  3FRN A;  2ED0 A;  1VQ7 A;  2L2P A;  2CP7 A;  4XTY A;  2E3H A;  1WLP B;  4Z89 A;  4DQ2 A;  2DTO A;  1VQ4 T;  3QDF A;  4M77 C;  1QVF A;  4FCY A;  3C4S A;  2HSE B;  3M4Y A;  3OS2 A;  2CP6 A;  4RG2 A;  3UA6 A;  3JCM Q;  6AT1 B;  2J05 A;  3VRY A;  5GAN 3;  1HJD A;  4C8Q C;  1QP2 A;  3OS5 A;  2DVE A;  2KRO A;  1VIF A;  3ULR B;  1V76 A;  1ZA1 B;  2EYZ A;  1UDL A;  2DXB A;  1VQP Q;  2D8H A;  1TTH B;  3JCM c;  5J39 A;  3M59 A;  3M57 A;  1D0Y A;  1BU1 A;  4ZTF A;  1Y7X A;  1U3O A;  3V7R A;  2ZGW A;  5GAN 6;  3UF4 A;  1YI2 T;  1G3W A;  3JCM b;  3I5S A;  2JZ2 A;  1YFN A;  2GGR A;  1HYO A;  1Z9Q A;  1X6O A;  1QKW A;  2LCC A;  2MCN A;  2EQM A;  2O4X A;  3MJX A;  1VQ7 T;  4VUB A;  1BK2 A;  1QKX A;  1NYF A;  2KE9 A;  5CIU A;  4OB0 B;  2ENM A;  3CCS T;  1M2V B;  1G2B A;  4A4K A;  1TG0 A;  2E4H A;  3E9G A;  1MNE A;  3EFR A;  3HKS A;  1WI7 A;  1QCN A;  3PVQ A;  4LD6 A;  1YJW Q;  2HSP A;  4KUI A;  3JAM E;  3QBY A;  2EQJ A;  1J3T A;  1G83 A;  2KGT A;  3OMC A;  2R57 A;  2EGE A;  4EPC A;  1P92 A;  3PIP A;  4OML A;  4XAX B;  1AOJ A;  2PNI A;  2DZC A;  5KYW A;  2HZY A;  4M7A B;  2Y90 A;  4HCK A;  4BB7 A;  3P8B B;  4C92 G;  2YHT A;  3JB9 H;  2NUP B;  3PVL A;  2AZV A;  5AYF A;  5CKH A;  2DET A;  1N8R U;  2AT1 B;  4M78 E;  5CK9 A;  3G71 A;  2NWM A;  3E19 A;  2CZ1 B;  1WFW A;  1Y96 A;  2MIO A;  4FYX B;  3EG0 A;  1MMN A;  2A08 A;  2DD4 A;  3GNF B;  8ATC B;  2E5K A;  1E6H A;  2OTJ A;  1XOV A;  3M58 A;  3RIR A;  4DBR A;  1B34 A;  1SSF A;  2OTJ Q;  4RTW A;  3URG A;  1PSE A;  1SEM A;  2EQU A;  4ELY C;  5DLQ E;  2DPP B;  2D9T A;  4M77 B;  4EMK A;  2F1L A;  2IVW A;  2FHD A;  2JMA A;  2X3X D;  3QWY A;  2CH4 A;  1M1F A;  1PD1 A;  2M0Y A;  1I5O B;  3JCM h;  5LJ3 g;  2J6K A;  1QCO A;  2NUT A;  2YUN A;  3QDR B;  4WTO B;  2CZ0 B;  1JJ2 S;  4C92 D;  2XIC A;  3HHT B;  2PZ1 A;  2W0Z A;  4NL2 A;  2GF7 A;  1KJW A;  3CQT A;  5FWB A;  1JXO A;  2LX9 A;  4C0G A;  3G71 T;  2LJ1 A;  3I55 A;  2VXF A;  1OZ3 A;  1TOV A;  2JJ9 A;  1MHN A;  2PUK B;  4A63 B;  2CZ6 B;  3GIB A;  4MDX A;  3UPU A;  5A0D A;  3V7C A;  4RCC A;  4LXC A;  3FLG A;  2BUD A;  2G6F X;  3HTR A;  4BI3 A;  4FYV B;  4GBQ A;  3NFC A;  2B86 A;  3H0H A;  1W1F A;  1WJS A;  2JVV A;  1PCX A;  1BI1 A;  2RHU A;  3HRS A;  4M7D A;  1YIT A;  2DTH A;  1QCF A;  2VXE A;  3VUB A;  2E64 A;  2DF6 A;  4BUG A;  3LW5 E;  3EG3 A;  2CH4 W;  1KQS P;  3E1S A;  1N9R A;  3OQ5 A;  3MP8 A;  3I56 Q;  2V8I A;  4IUP A;  4N4I A;  1M1K C;  2JUF A;  1K0X A;  2E5Q A;  4D6W A;  4JLG A;  3ZL7 C;  4BDZ A;  1RAI B;  1Y07 A;  3VJP A;  1OYX A;  2JTF A;  4DEY A;  2YUQ A;  2ED1 A;  4A4E A;  5KCO A;  3G6E T;  1K8A R;  3CC2 Q;  1PSF A;  1B7T A;  2KYB A;  2ZPB B;  4RTZ A;  2DBK A;  1MMG A;  2DAQ A;  4J9D A;  1WA7 A;  1TUC A;  1RAE B;  2IPO B;  2CGH A;  1WNL A;  5CKF A;  4JS4 A;  5A2Q E;  3SFM A;  1U5S A;  2J6O A;  3UWN A;  3M56 A;  2RJD A;  2DD5 A;  1K8A U;  2RK2 A;  4C8Q B;  4NS5 A;  1GL5 A;  2YDL A;  2XDB A;  3DKM A;  4M4Z A;  4PKC C;  3VS3 A;  3CCM A;  4J9H A;  4YTL A;  1N8R R;  3QUI A;  3CMA T;  4X34 A;  1H3H A;  2JM8 A;  1VQ6 A;  3OMG A;  3REA B;  1CKA A;  4E2F B;  2H8H A;  1MV0 B;  2MK5 A;  2ZPH B;  3OYL A;  1IRE B;  2WSE E;  2ROT A;  4BE2 A;  2QGF B;  1JRI A;  5IXB A;  2XDP A;  1PWT A;  5FU7 C;  2AKK A;  1KG1 A;  5GJV B;  3V7S A;  2DMO A;  5GAM j;  2R5A A;  3C12 A;  1RL2 A;  5HY6 A;  3M0P A;  3ZBD A;  3G4S A;  4M77 D;  1NPP A;  5GAM h;  2EIF A;  4C8Q D;  1VQO T;  4KT0 E;  1QLY A;  3CCR T;  1WYX A;  4IKF A;  3QG1 A;  5GAN 5;  1Q82 U;  3L2Q A;  1ZA2 B;  4N0A A;  5GAN 8;  4JRK A;  4MMK A;  4F7U E;  4PFZ A;  4N4G A;  1ZQ1 A;  4RTY A;  3RMS A;  4LDU A;  4OB1 B;  1Q82 C;  1XQH A;  5CQX A;  2BZ8 A;  2MYS A;  2PQW A;  4M7A F;  1Q81 R;  1G3S A;  4HA8 A;  3OB9 A;  3QYH B;  1WZO A;  2CT3 A;  1IHV A;  3M4G A;  1LPL A;  4WCI A;  2CP2 A;  1M90 R;  2VAS A;  1WDX A;  4C92 E;  4XTW A;  3OYI A;  1AD5 A;  1SF9 A;  1YN8 A;  4EMG A;  5FWC A;  4E7L A;  2YWW A;  3CMA A;  1KQS S;  1YIJ Q;  4X1V A;  1QVF P;  3JCM g;  2GFA A;  1S72 Q;  8AT1 B;  1PRM C;  4RCB A;  3OY9 A;  2YLB A;  3CC7 Q;  3EFS A;  3NHN A;  2GCX A;  2M16 A;  3CD6 Q;  1RAC B;  3CPW P;  2O9S A;  3M55 A;  3Q1J A;  1ZSG A;  1S1N A;  1UGQ B;  3EGX A;  3CCJ T;  3SD4 A;  1BKB A;  1MND A;  3I5R A;  1KIK A;  3OSS C;  4R56 A;  2JTM A;  2OX7 A;  5LJ3 d;  4C5I A;  2FO0 A;  2DER A;  2COW A;  3TQ7 P;  2M1H A;  4MZP A;  4L59 A;  2VGM A;  1WXT A;  4KH0 B;  4M75 C;  2JNG A;  1JJ2 A;  1QMC A;  1H64 1;  4BDY A;  3BY7 A;  3H0F A;  3RER A;  2XD0 A;  3M5A A;  3TSZ A;  2LCL A;  2ZAE A;  1Q7Y C;  2DE0 X;  2C06 A;  1RAD B;  3R6N A;  1WGS A;  3CCE A;  2KMT A;  3J7A F;  1WQW A;  2RHZ A;  3MEA A;  1NEB A;  2QQR A;  1Q7Y U;  3OA6 A;  4X9C A;  4JJC A;  1XJW B;  5KCH A;  1X2Q A;  1MV3 A;  2RHY A;  1PM3 A;  2GTJ A;  2OAU A;  3CC7 T;  3H8Z A;  2RI2 A;  3GP8 A;  3KBG A;  5IHK A;  1UHF A;  5FU7 B;  1JEG A;  2KY9 A;  2DJQ A;  2DXU A;  3NTK A;  3GPL A;  2EWN A;  1M5Q 1;  2K2V A;  5CKE A;  1UJ0 A;  4LN2 A;  3A1P A;  3HFO A;  2VVK A;  2HKQ B;  2H3J A;  2DEQ A;  4BE1 A;  4IIO A;  2K5L A;  2B8A A;  3FEO A;  3HFN A;  2KK4 A;  4A4F A;  5D7U A;  5EG2 A;  1HSQ A;  5GAO n;  2JW4 A;  4IUR A;  2ZPI B;  1UGS B;  4RTX A;  3M54 A;  4RKU E;  4E7J A;  1RI9 A;  1Z9Z A;  3CC4 Q;  3TSW A;  4ZN1 A;  3OYD A;  3CCL A;  2A36 A;  5KYW B;  1T3S A;  4MZT A;  4C8Q A;  2QA4 Q;  2L89 A;  4M75 F;  2L0A A;  2P0Q A;  4PJO C;  2NYS A;  4A54 A;  1OV3 A;  2YRD A;  3CCS Q;  2F5K A;  3E9F A;  1IXD A;  2FYK A;  3EGX B;  1VYU A;  3CCQ Q;  2BZY A;  1I81 A;  3THK A;  4C5G A;  4IUU A;  2D0N A;  1EIF A;  3PIO A;  1N5Z A;  5KYY B;  4M7D C;  2QTX A;  2RQV A;  2GQI A;  5KYX B;  1VQN T;  4C92 A;  5LL6 S;  2YXY A;  4N4H A;  3OYK A;  4J9E A;  4O5V A;  2QG9 B;  4JRQ A;  5LJ3 j;  1B34 B;  4M7D D;  3L42 A;  1WQ7 A;  5KYU A;  1AZE A;  2O9V A;  1AZG B;  2K9G A;  4FM4 B;  1QWF A;  2QK0 A;  2XG8 D;  3M0T A;  1QVF S;  4AFS C;  3RNJ A;  2C0I A;  1M3C A;  4FSX A;  2O88 A;  1NG2 A;  5CAI A;  2LQK A;  2PTK A;  4PLL A;  3G6E A;  1BIA A;  2LQ8 A;  4D8K A;  1WPY A;  1BIB A;  2RF0 A;  1PKT A;  1BCM A;  3DLM A;  1VQL Q;  2LQN A;  1VQM Q;  3EAE A;  3EGD B;  2K3X A;  1R77 A;  3VS1 A;  3MO8 A;  3X26 B;  3OYH A;  2KSS A;  3NTI A;  2DFU A;  3OS0 A;  2LQW A;  1UJY A;  1KSW A;  2M51 A;  3X24 B;  3OBY A;  3OW2 S;  1KHC A;  3GF5 A;  2GFU A;  4J9I A;  1SHF A;  4OF1 A;  1K9M U;  1VQK A;  2JT4 A;  1VQ9 A;  3CCM T;  4J9F A;  1IHW A;  2J6F A;  1YWO A;  1D3B A;  3UA7 A;  3GNG A;  2HQH A;  1YBY A;  2HBP A;  2LNH B;  4OMO A;  2E1H A;  2MF2 A;  4F17 A;  1T0J A;  1IB8 A;  2K6D A;  1VUB A;  2RNA A;  1N27 A;  1Q95 G;  4JRP A;  2CKK A;  1M2O A;  4M7A E;  4XU1 A;  4LDY A;  1EZZ B;  2OAW A;  1M2V A;  2V1Q A;  4L6V 5;  3D7S B;  3ER0 A;  1ZUU A;  4PJO G;  4P5N A;  3CBO A;  4RMO A;  1VYV A;  1ABO A;  1D09 B;  1PHT A;  5FLX E;  3G4S T;  4C92 B;  3JB9 F;  3F70 A;  3CMA Q;  2NLU A;  4O6J A;  1VQO A;  1LOJ A;  1NEG A;  3EGU A;  3JRZ A;  4LUD A;  2KBT A;  4QVC A;  4CRI A;  1I5L A;  2LDM A;  1M8V A;  4HXJ A;  1MGQ A;  1Q81 U;  2E70 A;  3FJP A;  2KAF A;  1WHH A;  2EYX A;  1D0X A;  2DIL A;  1NLO C;  5HK0 A;  2LMJ A;  2EYY A;  3CC4 T;  1NZ9 A;  1PRL C;  3ASK A;  2L5Q A;  2M9U A;  1ZBX A;  4M78 D;  1RAB B;  2RD1 A;  1X01 A;  3EG1 A;  3DB4 A;  4GY5 A;  4J83 A;  1BYM A;  2HL3 A;  2HQE A;  3EGD A;  1RAA B;  5LJ3 f;  3A5Z B;  5CQY A;  7AT1 B;  1WJR A;  2DM1 A;  2P0P A;  2CDT A;  3UAT A;  1YJN A;  1I8F A;  2DBM A;  2P0K A;  1M27 C;  2ZZD A;  4DBF A;  4M7A D;  2ATC B;  4RG8 A;  1VQ9 T;  5D6W A;  2SRC A;  2NUZ A;  3S3M A;  5KYN A;  2CSI A;  4MML A;  5GAM g;  3CME T;  2JMC A;  2RN8 A;  1RAG B;  3U23 A;  4CI0 C;  4M7A C;  4M75 G;  2MWO A;  5M9O A;  1FX7 A;  1NPR A;  3LH5 A;  3EHQ A;  1T3L A;  3TU4 K;  1TSF A;  3JCM P;  3OYA A;  2VV5 A;  5GAN 7;  2L3Q A;  3SHW A;  2KRN A;  2O01 E;  2DK3 A;  1I4K 1;  4EDU A;  3M9Q A;  4N0A C;  1RAF B;  3S3O A;  1GBQ A;  3HRT A;  3BE3 A;  2JS0 A;  4L5G A;  3VV0 A;  2DJZ A;  4LE9 A;  1YJW A;  2F2V A;  2EPD A;  2MPX C;  1TXQ A;  1U1T A;  3R6O A;  1I1J A;  1X43 A;  4ZGJ B;  1KQ2 A;  1D1B A;  1YIJ T;  1W6X A;  2MI6 A;  4J9G A;  1WHK A;  2QTV A;  2VUB A;  1Q86 C;  4KRT A;  2DLP A;  1G8X A;  2XU8 A;  3HL8 A;  3C0C A;  4EMK B;  3INZ A;  4HT9 A;  1M4Z A;  4NOY A;  5GAN h;  3TVT A;  3P8H A;  1M3A A;  1IO6 A;  3CCE T;  2A0F B;  1VQ6 T;  4M7D B;  2FL7 A;  5GAN d;  4NL3 A;  4AT1 B;  1QWE A;  3BDU A;  4XU3 A;  3VS2 A;  1V1C A;  2HBW A;  4M7A A;  5GAN 4;  2OTL Q;  2HAX A;  4OB3 B;  1RLQ C;  2X35 A;  1BB9 A;  5FRN A;  5GJW B;  1XNI A;  3L2U A;  1GBR A;  4BAC A;  1YI2 A;  3MP1 A;  4F7U G;  3IQL A;  2BKD N;  1VQ8 A;  4C8Q G;  1YJN T;  3L2W A;  3TEE A;  2IG0 A;  4LUE A;  4FU6 A;  1GFD A;  2KT1 A;  2D8J A;  4PJN A;  1BI0 A;  1HK9 A;  2BE7 D;  2CP0 A;  2RA2 A;  4M78 G;  5I2S A;  2X51 A;  2KDS A;  1S72 T;  2VC8 A;  2DTI A;  4C92 F;  1GRI A;  2RM4 A;  1B3Q A;  4F04 B;  1A0N B;  1PD0 A;  1ZHI A;  3A98 A;  4XU0 A;  2LX7 A;  3VS7 A;  1FXX A;  2GNC A;  4E7I A;  4QQG A;  4B6M A;  3A8G B;  3VS5 A;  3RKX A;  2EJG A;  1VQ8 T;  2DYI A;  5FU6 B;  5CR2 A;  2QQS A;  3EG2 A;  2EQI A;  2PUO B;  1WHM A;  2M0O A;  4UC4 A;  3OW2 A;  1X6B A;  1ZSZ C;  3G7Z A;  5GAM e;  1R0B G;  2EQK A;  4DEX A;  1YJ9 A;  2R58 A;  2X9H A;  2RJE A;  3OYY A;  2DXT A;  3QZ9 B;  3VS0 A;  3E2U A;  1NE8 A;  1H3Z A;  4HCZ A;  4PFP A;  3JSC A;  3A8M B;  4FT4 A;  3MHX A;  1Y71 A;  2QYZ A;  4LDV A;  4OB2 B;  1YP5 A;  2ZPF B;  1YHQ Q;  3JB9 G;  4M78 B;  3WVE B;  1FYN A;  2RI3 A;  4M78 C;  4CC4 B;  1SHG A; 
#chains in the Genus database with same CATH homology
 3KBG A;  2ZGW A;  5GAN 6;  5FU7 B;  1YI2 T;  2RK1 A;  2KY9 A;  1G3W A;  2X4W A;  4M77 E;  2DXU A;  3JCM b;  2JZ2 A;  1W4S A;  3NTK A;  3GPL A;  5GMK h;  2AHJ B;  1X6O A;  2EWN A;  4PNO A;  2LCC A;  3ZEH A;  1M5Q 1;  2K2V A;  5CKE A;  2EQM A;  2O4X A;  4BI4 A;  3HFO A;  1YIJ A;  4C0D B;  3SWN C;  2QEX A;  2XK0 A;  5GMK m;  1VQ7 T;  4VUB A;  3O8V A;  2V8K A;  3LYI A;  5CIU A;  2H3J A;  2DEQ A;  2MMP A;  4BE1 A;  4OB0 B;  3LX7 A;  4TVR A;  4BY6 B;  1KD1 C;  4PJO A;  3RMQ A;  3CCS T;  2K5L A;  2O4X B;  2B8A A;  4A4K A;  1YJ9 T;  1NJI U;  3FEO A;  5GMK e;  3HFN A;  2KK4 A;  3E9G A;  4DOV A;  4A4F A;  3JCM f;  3EFR A;  3HKS A;  5EG2 A;  4XTV A;  4J6W A;  5GAO n;  3CCV T;  4J7F A;  4OGC A;  4IUR A;  2ZPI B;  1OI1 A;  3PFS A;  4XTX A;  1UGS B;  4F7U F;  3MCA B;  5GAO r;  1LNX A;  4LD6 A;  1KC8 U;  3M54 A;  4RKU E;  4M77 F;  3OYJ A;  4E7J A;  2KQW A;  4KUI A;  2YRV A;  3OYC A;  5FRM A;  4M7D G;  5C6S A;  4ZN1 A;  3JAM E;  3QBY A;  2EQJ A;  3OYD A;  3SWN B;  4WF2 A;  3CCL A;  1LJO A;  4MZT A;  4C8Q A;  2D6F A;  2DKG A;  2R57 A;  3OMC A;  4IUV A;  1P92 A;  4EPC A;  3PIP A;  2L89 A;  4XAX B;  1GXI E;  4M75 F;  3CPF A;  2P0Q A;  4KBM B;  2K4Y A;  2LTO A;  4M78 F;  4A54 A;  5GAM d;  4PJO C;  4LDW A;  3LWH A;  3CCQ T;  3LGF A;  1VQP A;  2DZC A;  1R8O B;  3P8D A;  5GMK j;  2F5K A;  3E9F A;  4JJN K;  2FYK A;  4XTZ A;  4M7A B;  2Y90 A;  4BB7 A;  4IUT A;  2E6N A;  3P8B B;  1I81 A;  4BE0 A;  4C92 G;  4C5G A;  3OYB A;  4IUU A;  1EIF A;  2YHT A;  2Y4X A;  3PIO A;  5AYF A;  3JB9 H;  5CKH A;  5CCA A;  4FL6 A;  4HT8 A;  4E7K A;  2FB7 A;  4M7D C;  5D6Y A;  4C8Q F;  1N8R U;  2QTX A;  4Z02 A;  4V2S A;  4JS5 A;  4M78 E;  3QXE B;  3RKY A;  5CK9 A;  4BI8 B;  4M75 D;  4C92 A;  3G71 A;  1VQN T;  3CCU A;  3CC2 T;  5LL6 S;  4QQ6 A;  3E19 A;  4N4H A;  5I2M A;  3OYK A;  2CZ1 B;  2P4T A;  1Y96 A;  3MP6 A;  4O5V A;  2LT4 A;  2L8D A;  3I56 A;  4JRQ A;  5LJ3 h;  4MDW A;  5LJ3 j;  1B34 B;  4M7D D;  2DD4 A;  3L42 A;  2RH2 A;  3GNF B;  1WQ7 A;  5IT9 E;  2DIG A;  3CCV A;  3V8K A;  4FM4 B;  2XG8 D;  2EYQ A;  1QVF S;  1XOV A;  3M58 A;  4M75 B;  2OTJ A;  4OVA A;  3RIR A;  3FIF A;  2QI2 A;  4FSX A;  4A4H A;  4HCB A;  3MEV A;  3CC4 A;  1B34 A;  1SSF A;  5GMK l;  1VQL T;  1VIE A;  3PNW C;  5KH6 A;  2PVD B;  3URG A;  1PSE A;  2LQK A;  5CAI A;  2EQU A;  3QII A;  1BIA A;  4PLL A;  4ELY C;  3G6E A;  3QZ5 B;  3A8H B;  2LQ8 A;  4OP0 A;  2DPP B;  5DLQ E;  1WPY A;  2D9T A;  1BIB A;  4M77 B;  5LJ5 e;  4EMK A;  2IVW A;  3S3N A;  2G3R A;  4M7D E;  2FHD A;  3DLM A;  1M1K U;  4PL6 A;  1YIT T;  5J26 A;  1M1F A;  1N6A A;  1Q86 U;  3EAE A;  2RJC A;  2K3X A;  3BDL A;  3JCM V;  4C5H A;  3JCM h;  5LJ3 g;  1K8A C;  3MET A;  3MO8 A;  2YLC A;  2K3Y A;  3X26 B;  3CXC A;  3OYH A;  3QDR B;  2KSS A;  3NTI A;  2CZ0 B;  5D6X A;  5HKC A;  1JJ2 S;  3CPW A;  4J6X A;  1VQ5 T;  3OS0 A;  3X24 B;  2XIC A;  4C92 D;  3HHT B;  3SWN A;  3CCL T;  3OBY A;  4EMK C;  2VGN A;  4NL2 A;  1KHC A;  2QQB A;  2GF7 A;  3OW2 S;  5GAN 2;  1QVG A;  3GF5 A;  2GFU A;  3WXM B;  2LX9 A;  2X4J A;  4OF1 A;  2QDY B;  1K9M U;  4KUD K;  4Y91 A;  3OYG A;  1JBM A;  2RHI A;  4C0G A;  1VQK A;  4HKE A;  2HQX A;  1VQ9 A;  3X25 B;  3CCM T;  3G71 T;  3I55 A;  2VXF A;  1OZ3 A;  3JCM e;  1MHN A;  1D3B A;  2PUK B;  4J8O A;  5L8R E;  4M7D F;  3UT1 A;  5CVI A;  2CZ6 B;  3GIB A;  3WVD B;  3GNG A;  4X9D A;  3J81 E;  2BIV A;  4MDX A;  3CBM A;  3UPU A;  5A0D A;  3V7C A;  4RCC A;  1YBY A;  2HBP A;  3JB9 I;  5LJ5 h;  2E1H A;  3FLG A;  4ATO A;  2BUD A;  3LWI A;  3QJ6 A;  4DA4 A;  2MF2 A;  2I2L A;  5LJ5 g;  4BI3 A;  1IZ6 A;  2D0Q B;  1VUB A;  2MWP A;  4XQ3 A;  1N27 A;  3NFC A;  4JRP A;  2CKK A;  2VYT A;  3QHS A;  3JCM d;  4M7A E;  1WJS A;  2JVV A;  3KUF A;  4LDY A;  4XU1 A;  1VQP T;  1BI1 A;  2RHU A;  5GMK i;  4ELZ C;  5LJ5 d;  3HRS A;  4L6V 5;  4M7D A;  3QYG B;  1YIT A;  5LJ3 e;  2DTH A;  3ER0 A;  3PTA A;  1YJW T;  2QQA A;  3LH0 A;  4PLI A;  4PJO G;  5GAO l;  2VXE A;  4P5N A;  3CBO A;  2E64 A;  3VUB A;  4ZGD B;  4RMO A;  3X20 B;  3ME9 A;  1U1S A;  4M75 A;  5FLX E;  2RB6 A;  4BUG A;  4C92 B;  3G4S T;  1M90 U;  3LW5 E;  1G3Y A;  3JB9 F;  3F70 A;  4PJO B;  1VQ5 A;  5GAO p;  1XTD A;  2EJ9 A;  3CCR A;  2E12 A;  2NLU A;  3E1S A;  4O6J A;  3JCM J;  1VQO A;  1LOJ A;  1N9R A;  1WJQ A;  2DXC A;  2XKO C;  3MP8 A;  3OQ5 A;  5C0M A;  3JRZ A;  4QVC A;  2V8I A;  4IUP A;  3A8L B;  4N4I A;  4CRI A;  2LDM A;  3H6Z A;  4ME7 A;  2JUF A;  1M1K C;  1MGQ A;  1I5L A;  2E65 A;  4PJO E;  1M8V A;  4EMH A;  2E5Q A;  1Q81 U;  2E70 A;  2XID A;  4D6W A;  3FJP A;  2KAF A;  3I56 T;  4JLG A;  1YHQ T;  4Q5W A;  3QSU A;  4BDZ A;  1M1G A;  1M9S A;  1Y07 A;  2CZ7 B;  4PJO F;  3VJP A;  5HK0 A;  1OYX A;  2JTF A;  5IN1 A;  4XTU A;  4A4E A;  5KE2 A;  5DLO A;  4BD3 A;  5KCO A;  3G6E T;  3BFM A;  3CC4 T;  1NZ9 A;  1VQL A;  3ASK A;  2L5Q A;  2M9U A;  1PSF A;  2EKO A;  3T9N A;  5GAN f;  1KQS A;  2ZCF B;  3OYE A;  1ZBX A;  4M78 D;  2ZPB B;  5KE3 A;  2RD1 A;  1X01 A;  3OSV A;  1X75 C;  3DB4 A;  4GY5 A;  5CO7 A;  4J83 A;  4C0D C;  1BYM A;  2DAQ A;  4ZGE B;  2QA4 T;  4R55 A;  3JCM X;  1G5V A;  2CGH A;  1N9S A;  2HQE A;  1WNL A;  5CKF A;  2RI5 A;  4JS4 A;  3CCJ A;  5A2Q E;  3SFM A;  3HPW A;  5LJ3 f;  2XHC A;  3A5Z B;  3UWN A;  5CQY A;  1D3B B;  1W2B S;  1WJR A;  3M56 A;  3VKI A;  3JB9 J;  2P0P A;  2RJD A;  1YJN A;  4PJO D;  1I8F A;  2DD5 A;  1K8A U;  2P0K A;  3CBP A;  2RK2 A;  4B9X A;  4C8Q B;  3DLL A;  3OYM A;  4XK8 E;  3TRE A;  2F5T X;  4NS5 A;  1AHJ B;  2ZZD A;  1BI2 A;  2K5I A;  2EJF A;  4QVZ A;  4M7A D;  2XDB A;  3DKM A;  3CCU T;  4RG8 A;  2EFI A;  3FC3 A;  5D6W A;  3CCM A;  4PKC C;  1VQ9 T;  1V29 B;  2OTL A;  2CYZ B;  3DB3 A;  1YCY A;  4M77 G;  4YTL A;  3QUI A;  3S3M A;  1K9M C;  3CMA T;  2PVO B;  4X34 A;  4ZTJ A;  1NJI C;  4F7U A;  3L1A A;  3QJY A;  3X28 B;  2LNV A;  4MML A;  1VQ6 A;  2DIQ A;  3OMG A;  5GAM g;  2QXF A;  5GAN e;  1UGP B;  3ZFJ A;  3CME T;  4M7A C;  4CI0 C;  4XU2 A;  2DO3 A;  1YHQ A;  4FT2 A;  3VYH B;  4M75 G;  2DZ9 A;  1S72 A;  2MWO A;  5M9O A;  1FX7 A;  1NPR A;  1M90 C;  1QW1 A;  3V8J A;  1FWZ A;  2LRQ A;  3TU4 K;  5LJ5 f;  3OYN A;  2ZPH B;  3JCM P;  5GAN j;  2E41 A;  3OYA A;  3OYL A;  1IRE B;  2LVM A;  3GLX A;  2VV5 A;  2WSE E;  5GAN 7;  4OGE A;  2E6Z A;  2RO0 A;  1K73 C;  4BE2 A;  2O01 E;  3CD6 A;  1JRI A;  2DK3 A;  2XDP A;  4C8Q E;  1I4K 1;  4M77 A;  5FU7 C;  1KG1 A;  4EDU A;  3M9Q A;  4N0A C;  1UB4 A;  3CC7 A;  3S3O A;  4DOW A;  1KD1 U;  3HRT A;  3C94 A;  2X4Y A;  4JLI A;  4L5G A;  4M75 E;  3V7S A;  4C0F A;  5GAM j;  2R5A A;  2XI9 A;  3C12 A;  1RL2 A;  2DJZ A;  3VV0 A;  1YJW A;  3HSB A;  3QO3 A;  5HY6 A;  3MEU A;  4GLK A;  3RUX A;  3ZBD A;  3L2R A;  3G4S A;  4M77 D;  1NPP A;  2K5F A;  5HK3 A;  1U1T A;  1U8R A;  3R6O A;  4ZGJ B;  3JB9 D;  2KVQ G;  1KQ2 A;  5GAM h;  1OZ2 A;  2EIF A;  1YIJ T;  5GAN g;  4C8Q D;  1O9S A;  1VQO T;  3PT9 A;  2MI6 A;  3QKJ A;  2VUB A;  4KT0 E;  3HP9 A;  3CCR T;  1Q86 C;  1VQK T;  5DY9 A;  2F69 A;  2WSF E;  3NTH A;  4IKF A;  3N5B B;  2XU8 A;  3HL8 A;  3QG1 A;  5A0L A;  2HNI A;  3CCS A;  2JOY A;  3OBW A;  3JCM W;  2WSC E;  5IAY A;  5GAN 5;  1Q82 U;  4EMK B;  1UEB A;  2LC4 A;  3INZ A;  3L2Q A;  4N0A A;  5GAN 8;  1M4Z A;  4NOY A;  3PGG A;  5GAN h;  3P8H A;  4HT9 A;  2HD0 A;  2PU9 B;  3CCE T;  3PMI A;  4JRK A;  1G3T A;  5FRO A;  1VQ6 T;  4MMK A;  2PVG B;  1VQN A;  4M7D B;  1HXD A;  2A3L A;  2X4X A;  4F7U E;  5LJ5 j;  2FL7 A;  5GAN d;  4NL3 A;  4N4G A;  1ZQ1 A;  2L3R A;  4FIB A;  3BDU A;  4XU3 A;  3RMS A;  3C95 A;  3TCJ A;  4M7A A;  4LDU A;  4OB1 B;  5GAN 4;  5DM7 R;  1Q82 C;  1XQH A;  2HAX A;  5CQX A;  4OB3 B;  2X35 A;  2PQW A;  5CKD A;  4A4G A;  5A0G A;  2K57 A;  3RKW A;  5FRN A;  4IUQ A;  4M7A F;  2MAM A;  5FU6 C;  1Y96 B;  5CKB A;  1VQM A;  1XNI A;  3FDR A;  1UGR B;  3L2U A;  3OYF A;  1G3S A;  2V8J A;  4BAC A;  4HA8 A;  5I21 A;  1YI2 A;  3MP1 A;  4J5Y A;  4F7U G;  3OB9 A;  1QVG S;  3QYH B;  2BKD N;  1VQ8 A;  4C8Q G;  3J80 E;  2XDD A;  1YJN T;  3L2W A;  3TEE A;  3M4G A;  1KHI A;  2A7Y A;  2IG0 A;  4C92 C;  5GAO m;  2QEX T;  1JB0 E;  4J7I A;  2WAC A;  3SB2 A;  4B9W A;  4FU6 A;  1W2B A;  4M78 A;  4QW2 A;  4C92 E;  1VQ4 A;  4HCC A;  4F7U B;  1QVP A;  2GQV A;  4XTW A;  3UDC A;  4C0Z A;  3OYI A;  2Y4Y A;  5J3B A;  2OTL T;  2ZPE B;  4EMG A;  4E7L A;  1BI0 A;  1HK9 A;  3FB9 A;  3CMA A;  3L2V A;  1N8R C;  1KQS S;  2RA2 A;  4M78 G;  5I2S A;  2QQ9 A;  3MEW A;  4JUV A;  3JCM g;  2GFA A;  4BY6 C;  3AHU A;  1QP3 A;  5GAM f;  1BI3 A;  1KQ1 A;  3HRU A;  2CS7 A;  3SDZ A;  2KDS A;  3BW1 A;  4RCB A;  1S72 T;  3OY9 A;  2VC8 A;  2YLB A;  4II1 A;  2DTI A;  3KXT A;  3EFS A;  3QPH A;  4C92 F;  2OTJ T;  2EAY A;  4J6Y A;  2GCX A;  2M16 A;  3CEY A;  2RM4 A;  1O75 A;  1Q81 C;  1ZHI A;  4LD9 K;  3CPW S;  4LDX A;  4JDS A;  1TH7 A;  4ZN3 A;  3CXC S;  2QA4 A;  3M55 A;  4XU0 A;  3CD6 T;  2E10 A;  1VQM T;  1FXX A;  4MZM A;  4E7I A;  1K73 U;  3Q1J A;  2JN0 A;  1UGQ B;  3CCJ T;  3VUZ A;  3SD4 A;  1BKB A;  4QQG A;  4QVD A;  3A8G B;  3GOX A;  2FVU A;  2ZPG B;  2EJG A;  4Y28 E;  3RKX A;  4E7H A;  4E47 A;  1VQ8 T;  3OSS C;  5FU6 B;  3V8L A;  5CR2 A;  4R56 A;  4A53 A;  2QQS A;  3FRN A;  2JTM A;  1RI0 A;  5LJ3 d;  4C5I A;  2PUO B;  2RJF A;  1VQ7 A;  4XTY A;  2RHX A;  4OMF B;  3PMT A;  2M1H A;  2M0O A;  3L2Z A;  4MZP A;  4UC4 A;  4L59 A;  3VU3 C;  3G7Z A;  3OW2 A;  4M7A G;  2VGM A;  4DQ2 A;  2DTO A;  5GAM e;  2EQK A;  3M53 A;  4M75 C;  4JRI A;  2JNG A;  1VQ4 T;  1YJ9 A;  2R58 A;  1JJ2 A;  3CC2 A;  1H64 1;  2RJE A;  4BDY A;  3OYY A;  2DXT A;  3BY7 A;  3OS1 A;  3LLR A;  4M77 C;  1QVF A;  3RER A;  2XD0 A;  3C4S A;  3QZ9 B;  3OS2 A;  3M4Y A;  4QQD A;  3M5A A;  1NE8 A;  4RG2 A;  1H3Z A;  2LCL A;  4HCZ A;  3JCM Q;  3I55 T;  1Q7Y C;  5GAN 3;  4C8Q C;  1QP2 A;  3JSC A;  3CME A;  2C06 A;  3A8M B;  3OS5 A;  2DVE A;  3GP8 A;  1VIF A;  1WGS A;  3CCE A;  2R5M A;  1KC8 C;  2KMT A;  4FT4 A;  1WQW A;  2RHZ A;  3LGL A;  3MEA A;  3MHX A;  3RES A;  3J7A F;  1Y71 A;  4LDV A;  4OB2 B;  3VYG A;  2ZPF B;  2DXB A;  3S6W A;  3JCM c;  2QQR A;  1Q7Y U;  3A8O B;  3OA6 A;  1DJ7 B;  3JB9 G;  4X9C A;  4M78 B;  3WVE B;  2LT1 A;  3M59 A;  3M57 A;  5KCH A;  5J39 A;  5GAO q;  3CCQ A;  4ZTF A;  4KUL A;  1Y7X A;  2RI3 A;  2RHY A;  2OAU A;  4C5E A;  3CC7 T;  4M78 C;  3H8Z A;  2RI2 A;  3V7R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...