2RJEA

Crystal structure of l3mbtl1 in complex with h4k20me2 (residues 17-25), orthorhombic form ii
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
313
structure length
309
Chain Sequence
WSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title L3MBTL1 recognition of mono- and dimethylated histones.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Lethal(3)malignant brain tumor-like protein
total genus 84
structure length 309
sequence length 313
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rjeA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rjeA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rjeA03
3ME9A 2EFIA 3OS0A 3L42A 4IUPA 2LDMA 2LRQA 1WGSA 5C0MA 2RO0A 3OYHA 5KH6A 1KHCA 3MO8A 4PLIA 3LYIA 2X4WA 2X4XA 3PFSA 4C5EA 2RHIA 3QIIA 3FC3A 2L8DA 2RHXA 3LLRA 3L2UA 2QQSA 2L3RA 1OYXA 3OS2A 2M0OA 2X35A 3H6ZA 3E9FA 4B9WA 3PNWC 4C5GA 2F5KA 3META 3OYAA 2O4XA 3F70A 2DIGA 4LD6A 4PL6A 4NS5A 4E7IA 4BDZA 2XDPA 4N4HA 3OMCA 3DB3A 3OYJA 3NTIA 1WJQA 4QQ6A 3OYEA 3OYBA 3OYKA 3MP1A 5IAYA 2G3RA 3OYIA 3OA6A 2NLUA 3H8ZA 3OQ5A 4OVAA 5KCOA 4IKFA 3OYDA 4QQDA 2RI5A 3S3MA 2QQRA 3E9GA 4BE1A 3OY9A 2B8AA 2XK0A 3MP8A 2JTFA 5D6YA 3M9QA 3OMGA 3UT1A 3MEAA 5KE3A 5CIUA 3MP6A 2R5AA 2BUDA 2M16A 3PMIA 4QW2A 2IG0A 3FLGA 4FL6A 2R58A 3C4SA 4RG2A 3S6WA 3UWNA 2RI2A 4B9XA 4QQGA 3Q1JA 2MWOA 3ASKA 4E7KA 5FRMA 2MWPA 3MEVA 4C5HA 4E7HA 4BD3A 2GFUA 2EQJA 5KCHA 4BACA 2D9TA 3OYLA 1OZ3A 2WACA 2RJEA 4A4HA 3OYGA 2GFAA 4BDYA 4X34A 4IUVA 1MHNA 3GOXA 3MEWA 4FU6A 4IUTA 3NTKA 3L2VA 3MEUA 2EQKA 4PLLA 4ZTFA 3OYMA 4E7LA 3LH0A 1OZ2A 4GY5A 5J39A 2M1HA 1OI1A 5FRNA 2BKDN 3OYCA 3OB9A 4II1A 5M9OA 2RHZA 3S3OA 2JZ2A 3CEYA 3L2QA 1XNIA 4IUUA 4BE0A 1RI0A 2K3YA 4A4GA 3OYFA 3LX7A 1SSFA 2RHUA 3KUFA 4Z02A 3OS1A 3OYNA 2EQMA 3L2RA 1WJSA 2P0KA 5KE2A 3P8HA 3PMTA 3EAEA 2HQEA 3P8DA 4A4FA 2RJCA 3DB4A 2GF7A 2RHYA 4HCZA 3QJ6A 4IURA 5FROA 2FHDA 4IUQA 2PQWA 5D6XA 4E7JA 4UC4A 2R57A 2BIVA 4CRIA 2L89A 2RI3A 2LCCA 2DIQA 1N27A 2EKOA 2E6NA 2HQXA 2R5MA 2E5QA 4N4IA 2O4XB 2VYTA 4C5IA 4BE2A 3SD4A 5IN1A 3O8VA 5C6SA 3QBYA 3LGFA 4L59A 4ZTJA 3L2WA 2YRVA 3LGLA 1WJRA 2RJDA 3BDLA 3FEOA 2EQUA 3NTHA 4N4GA 2RJFA 2X4YA 2CKKA 2DAQA 3DLMA 3ZEHA 3S3NA 1G5VA 1H3ZA 4QVZA 3QKJA 2K3XA 2LTOA 2LVMA 4A4EA 5J26A 4Q5WA 5D6WA 4EDUA 3FDRA
chains in the Genus database with same CATH superfamily
3NHNA 2JN0A 5C0MA 5DLOA 4FYXB 3R6NA 4LN2A 2X4WA 4C8QE 2A08A 2RHXA 2JJ9A 1VQOQ 1WX6A 2KK4A 3RIRA 3META 3EGXA 1CKAA 3V8KA 3RR6A 1Q7YU 2XDPA 1QCOA 2F2XA 1OX9A 4JPBW 1KD1U 2GQIA 3VS2A 4NL2A 3OA6A 3EGUA 4NL3A 4IIMA 2RI5A 2EJ9A 2KT1A 3GPLA 5D7UA 3FRNA 2CSIA 2FPFA 4O6JA 1ZLMA 3UWNA 2CUDA 4BY6C 1LNXA 3NGPA 4FW2A 3VRZA 3JCMW 5FRMA 4MZPA 1TUGB 2VWFA 4LDYA 2EYWA 2HBWA 2ZPHB 4KH0B 4C92G 3FB9A 4XU0A 6AT1B 3SWNA 1YJ9T 3M0UA 2CP0A 2KR3A 2QA4Q 1K9AA 2DLPA 1AT1B 4PKCC 1AVZC 4HCBA 3BDUA 2KI7A 1KK7A 3VV0A 2KBTA 3DB4A 1WLPB 3BFMA 2K5IA 3CC2A 4GLMA 1NE8A 4PJOF 1KQ2A 4J6XA 3VS4A 3EFOA 3E2UA 3JB9D 4YTLA 1Z9QA 1N27A 2NUTB 1EIFA 2JXBA 3BW1A 3M4GA 1O9SA 4ZGEB 1GCQA 3QBYA 4L59A 4MDWA 1WPYA 1Y0MA 2X4YA 2CKKA 3DLMA 1K9MC 3QKJA 3CCVT 1K0SA 4ME7A 1S72A 2C0IA 1ABQA 3ME9A 4A54A 3CCUA 4M75D 2JMAA 2CZ7B 2RO0A 4E47A 4PLIA 1W6XA 5KYUA 4CC3A 2JS0A 2DERA 3PIPA 2EKHA 2PUKB 3V8JA 5GJVB 2DILA 2L0AA 1K73R 2L2PA 1JB0E 3H6ZA 2DEUA 2O9SA 1I81A 3OYJA 1VQMT 2QK0A 1KFZA 5IAYA 1YBYA 4WF2A 4JRQA 3QWYA 4IKFA 4FYYB 2ATCB 3CBPA 3LWHA 3OMGA 2LCLA 1VQ8A 3JCMQ 3CPWS 1M1KR 2IG0A 3O5ZA 4LDUA 1IB8A 5ECAA 4ELYC 2MWOA 4J9DA 1N8RC 5LL6S 1T3LA 2BTTA 2PZ1A 2OAUA 3OYLA 2NUTA 3PT9A 1GFDA 1YIJA 1VQMA 2CT4A 3MEUA 2XKOC 2KQWA 4HT8A 1YHQQ 2D8HA 1ZHIA 4VUBA 4E7LA 2GTJA 1R77A 1RI9A 1RAAB 5J3BA 3OS5A 2RHZA 2NUPB 1K8AC 3OYFA 2QGFB 3UF4A 3I5SA 2QEXT 1QKXA 1KD1C 3CCLQ 3QO3A 4M78E 3VS3A 4IURA 1UGRB 2ZPEB 1E6HA 4M78F 4CRIA 1D09B 2EJFA 3OBWA 4HT9A 2XMFA 1PSFA 3O8VA 2RD1A 4ZTJA 1QKWA 3LGLA 1WJRA 3ZEHA 2RB6A 2ZZDA 4RMOA 1SEMA 1VQKQ 2FZGB 1C0MA 1G83A 1ZX6A 2E64A 2K6DA 1ZSGA 4L5GA 4F7UF 4M75B 3M0SA 3VS5A 2GNCA 1D0YA 3JCMg 3A8MB 2DVJA 4Z89A 4BI8B 2X35A 3E9FA 3PNWC 1LJOA 3A8HB 2DIGA 2VVKA 4JJNK 1BI1A 3JB9J 1VQNT 2JW4A 4QQ6A 1X2KA 1PKSA 5IH2A 3I55A 2EGEA 1E6GA 4QQGA 1S1NA 4KRTA 1JEGA 1B34A 5GANh 5CR2A 2GGRA 2LQ8A 1FMWA 4F17A 2DKGA 1KJWA 2E70A 2FRYA 1VQPA 1MHNA 1RLPC 3I35A 4IUTA 4M7AE 2DJQA 2HSPA 1Y96A 1MMGA 1WHJA 1BKBA 4M77A 1R0CB 4CC4B 2JZ2A 2KRSA 1KC8C 2OTJA 3UA7A 3M58A 2J06A 4M7AB 2D1XA 5D6XA 3QPHA 3ZL7C 5GAN4 2RI3A 2KT8A 1K73U 4ZGDB 4OP0A 2D6FA 2P0QA 5IN1A 3QG1A 3JCMJ 2KYMA 3EGDB 1PKTA 2L5QA 2BZ8A 4ANJA 3CBMA 4JUVA 2HAXA 2YUPA 5KYUB 1KIKA 1N5ZA 1D3BA 2E10A 4C92F 3HFNA 2EYYA 1KQSS 4HA8A 3OYHA 4M77B 4JDSA 2EJGA 1WXUA 2X4XA 2MPXC 1JXOA 4PJNA 3QIIA 3HKSA 1XTDA 2K3BA 3C94A 4XAXB 4PJOC 1Q82U 1R0BG 4RTZA 3OMCA 3DB3A 3QDFA 3VU3C 5I11A 1NLPC 2D0NA 4PJOD 3OYKA 3CMEQ 2JVVA 1AWOA 4AFZC 3OYIA 3H8ZA 2KSSA 3H0IA 3CC7Q 1G3WA 5GMKe 2JUFA 3QYGB 3UT1A 2KMTA 2DYBA 1PRMC 4M7AA 2DL4A 5I2MA 4AG2C 3G71A 4IIOA 3ULRB 3CXCP 4F14A 1VQKT 4OMPA 4C92A 2K5FA 4J9CA 3WVDB 2D9TA 3CXCA 1AZEA 1B3QA 2F2WA 3AT1B 3G4ST 2NYSA 2KRMA 3M0TA 4OMNA 5GAOn 2QQBA 3CBOA 1BCMA 4PLLA 2K79A 3CD6Q 1VQ5Q 1M27C 5A0DA 1B7TA 3RESA 1ZA2B 5J39A 4RG8A 2ABLA 2V26A 3PVLA 4LNPA 2J6FA 9ATCB 3L2QA 4R0KA 3LX7A 3GNGA 3OS1A 1I5OB 2EQMA 2I2LA 2LP5A 3A8LB 3INZA 1OQKA 2EQIA 1MMDA 1YJWT 5HKCA 2OX7A 2HBPA 1WHLA 1WHHA 2IVWA 4M75A 2M9UA 3HTRA 4KUDK 5CKDA 4JZ3A 2DETA 2ZPIB 1XOVA 2ZPBB 1X75C 2A0FB 2JNGA 4FSXA 4C0GA 2HKQB 3C95A 4XU2A 1K76A 3LGFA 2RMOA 4C0DC 4M7DE 1OPKA 1SRMA 1WDXA 1HXDA 5GANe 4LD9K 2CSQA 2V8JA 1VUBA 5GAMg 4PJMA 1M90C 1BIBA 5KH6A 4KT0E 1PSEA 3EH1A 3T9NA 3RMSA 4F04B 1Y71A 2BE7D 2RHIA 1MUZA 1M5Q1 3FC3A 2KYBA 5LJ5f 2CH4W 1Q7YC 2LX7A 2RQUA 2QEXQ 4ZN1A 4NOYA 1Q82C 3REAB 2MAMA 3ER0A 3HRSA 2QQ9A 5A2QE 4LXCA 3ZBDA 1GL5A 1V1CA 5GAN8 2E65A 4J6YA 3OYBA 1NYGA 1A0NB 4J9IA 2JTFA 2LT4A 4FT2A 3FLGA 3TU4K 1K9MU 2M0YA 3PE0A 3C4SA 3KXTA 1M1FA 4E7ZA 1QP3A 2YWWA 3Q1JA 3ASKA 1OX8A 4XU1A 4C8QD 2P0PA 4BACA 1Y96B 1WZOA 2K9GA 3CCET 1U5SA 3RKWA 2YT6A 4RKUE 3M5AA 3A5ZB 3I9QA 3L2VA 3CCRQ 1M1KU 4C92C 1YITA 2IIMA 4GY5A 1WNLA 4JS4A 3CPWA 4II1A 5M9OA 1U1SA 3CEYA 2E4HA 1GCQC 2VXEA 1RADB 5LJ3d 5IHIA 2FPDA 3VS7A 1UECA 3BE3A 3L2ZA 3P8DA 1JJ2A 2RHYA 4HKEA 2COYA 4JLIA 2MOXA 3QYHB 3AHUA 2DL3A 1UDLA 2LCCA 1U8RA 2E6NA 2RK1A 2KXDA 3VKIA 5GMKh 1B07A 5CQYA 2EYZA 5A0LA 3MKDA 3SEMA 4KULA 4J9BA 2LTOA 2LVMA 3VS0A 1LPLA 5J26A 5GAOq 4ATOA 1UG1A 2K2MA 1AWWA 2DXBA 1BB9A 2RQTA 1N6AA 3C12A 3SWNB 4J9EA 3JCMc 4RTWA 1K4US 1ZSZC 4PJOG 2ED1A 2YHTA 1M3CA 1E7OA 3A98A 3GIBA 1WJQA 3I56Q 1WQWA 2PVDB 5GAMf 2CREA 3S3MA 2VGNA 2DXTA 2MF2A 2XK0A 3MP8A 4HCKA 3M9QA 4DOWA 1G8XA 3HFOA 2HKNA 2E12A 4M75E 5LJ5g 3RMQA 4ZGJB 4E7HA 3X24B 5KYXA 1ZUUA 5KCHA 3V7CA 4X34A 3CC2Q 1Q7YR 1YWPA 5GAN3 2FZKB 2CP7A 2KDSA 1TH7A 1IO6A 2HZYA 2QASA 4M7DB 2BKDN 4DA4A 2FVUA 5L23A 2HQHA 4XTYA 1IZ6A 2DXCA 3H41A 1S72Q 1Q86U 2GF7A 2QQAA 1CKBA 3OYYA 1MGQA 1WI7A 2AK5A 4OMMA 4BB7A 2V8KA 3X26B 1DJ7B 2JM8A 4PFZA 2R5MA 2DFUA 1W1FA 1ZUKA 2FB7A 1QVFA 1I1JA 4Z88A 2OTJQ 1UGPB 1I8FA 2K3XA 2DYIA 4A4EA 4Q5WA 5D6WA 2CP2A 2CT3A 2MCNA 3A8OB 2HL5C 2LDMA 4PJOA 3OBYA 3J80E 3MHXA 1Q81U 1VQ4A 2KXCA 2EVRA 4QVCA 1QQJA 2OTJT 3LLRA 3OSSC 1GBQA 2OTLA 5KYWA 4E7IA 4PL6A 2O31A 2DPPB 1WFWA 2G3RA 2QG9B 1G3TA 1AD5A 1NYFA 5KCOA 1N8RR 5KYYA 1YHQA 1K1ZA 3VS6A 3JB9F 3IQLA 5GAMe 5CIUA 2R5AA 4RG2A 4FL6A 1YP5A 3CCVQ 2OI3A 2YRCA 4FT4A 4EIKA 4M7DG 3SDZA 2VASA 3BY7A 4J6WA 2GFAA 5LJ3j 5FWCA 1YFNA 1TWBA 4BI3A 2KVQG 2H3JA 4DBFA 3HPWA 2BZYA 5CVIA 1AEYA 2J6OA 4RCBA 3G71Q 4AFUC 1OU8A 1B34B 3J7AF 4DBRA 4X9DA 5KE2A 1Q86C 1LOJA 1YHQT 3VYHB 2LNVA 1NLOC 1ZBXA 1Z9ZA 4ORZA 2AZSA 2FHDA 2CGHA 5GMKi 3EHQA 1YITT 4FYVB 3I56T 1KQSA 1VQ5A 5IXBA 1SPKA 1WHGA 3TEEA 3CMAQ 4N4IA 2CP6A 1PWTA 2ROLA 4AT1B 2CDTA 1ZA1B 4JRPA 3NPFA 3JRZA 1QCNA 3BDLA 2MIOA 3EG3A 1Q86R 2RJFA 1Q81R 2DAQA 1HYOA 1UHFA 4RUGA 2DXUA 5GAMj 3OSVA 3OS0A 3CCJT 2LJ3A 4OGEA 1WGSA 2COWA 1M1GA 2PVGB 1UJYA 1OOTA 5IHKA 4X1VA 4D8KA 1RAIB 3M54A 2L8DA 2VUBA 1N9RA 2LNHB 1BYMA 2PNIA 1W4SA 3HHTB 1VQNA 3CPWP 2K57A 1UB4A 4KGXB 1X6GA 5KYYB 1FWZA 2H3EB 2DRKA 4LD6A 3CCMT 4C8QA 1PG5B 3GLXA 4AFSC 1LCKA 5GANg 4E6RA 4XK8E 3CCMQ 1H3HA 3CMAT 3OQ5A 2FO0A 4BY6B 1BI0A 1G3SA 2GQVA 1VQLA 5AYFA 2HNIA 1YJNT 5KE3A 2RQWA 2V1RA 2GFUA 1QVGP 2EQJA 1I5LA 1QLYA 3MEWA 4FU6A 1GCPA 4M77G 1UE9A 4ZTFA 3CCEQ 3PIOA 3GF5A 1M9SA 3LH0A 3EG9B 3S3OA 4PJOE 1UTIA 1FX7A 1KG1A 2QGGA 3L2RA 3CCSQ 2P0KA 5HY6A 2DRMA 2I0NA 1Y7XA 2HQEA 1X2QA 1JRIA 2ESWA 5IXFA 3UATA 3C0CA 2DJZA 1VQ6T 1S72T 5HK3A 4M7AG 1KD1R 1D0ZA 2ED0A 2DE0X 5FU7B 4JRKA 2X3WD 4D6WA 2XDBA 1H8KA 3CD6T 2EFIA 4XTWA 1RL2A 2FEIA 3CC7A 2ZCFB 1GXIE 4KGZB 2QA4T 1GFCA 4M78A 3OS2A 1TU0B 5GAN7 3NMZC 2A36A 3M53A 1IHWA 1VQ8T 2YUQA 4LUEA 1MV0B 1SG5A 5CKFA 3E19A 2O01E 4KBMB 4M7DD 4Y92A 4QQDA 3CD6A 1VIFA 2ROTA 2L3PA 3PGGA 2DNUA 2EW3A 3PMIA 4F7UA 2DBKA 2X51A 1O75A 3VUZA 1QVFP 1NBEB 2K2VA 3EG2A 1YWOA 3J81E 1BI2A 1OV3A 2X9HA 1V29B 5KYXB 3EGDA 4M77F 5GAN5 1T3SA 4LDWA 1KC8U 2KGTA 3OW2A 1RAEB 2QI2A 1NPPA 4A4HA 4PJLA 5DLQE 2V1QA 2Z0WA 2RH2A 1IGQA 4MMLA 2EQKA 1T0HA 5LJ5h 3HRUA 5GANj 5LJ5e 3E1SA 3TVTA 1M90R 4V2SA 1YIJT 3OB9A 1SF9A 1U1TA 4DQ2A 1JBMA 2RNAA 1P92A 4A4FA 4EMHA 2AHJB 2MYSA 4HCZA 4N0AA 1G3YA 4IUQA 2PQWA 2KE9A 5GJWB 1UHCA 4JZ4A 1K0XA 2YUNA 4HVUA 5I2SA 1I07A 2DTHA 5GAMh 4PJJA 5GMKl 4M78C 2VYTA 3L2WA 2QEXA 2IPOB 3EFOB 1RUWA 3P8BB 1G5VA 1H3ZA 4BUGA 4EMGA 2W0ZA 4PJOB 3SWNC 4F7UG 2HL3A 1LVKA 1QP2A 1M8VA 2AKKA 2OJ2A 1SHGA 4DEYA 4KUIA 2HDAA 2PTKA 3LW5E 4JJBA 1RAFB 1KQ1A 3JB9I 2M0OA 2QDLA 1YJ9Q 1MNEA 1NM7A 3H9NA 3X28B 2JT4A 2ZAEA 4NS5A 2W10A 3QSUA 4C0FA 2RF0A 2AZVA 5FU7C 1NZ9A 5GAN2 1VQ6Q 1IXDA 4M78G 4M4ZA 4OF1A 1UGQB 4OVAA 1EFNA 3HRTA 2KY9A 1YITQ 2CZ1B 1VQ4Q 1WHMA 2FPEA 1RABB 5FW9A 1H92A 1YN8A 5EG2A 2FZCB 1MMNA 3JCMd 2OTLQ 4OB0B 4E7KA 1QW1A 2FRWA 3QZ9B 2VB6A 4JJDA 1Q82R 1VQ4T 4J5YA 3CC4Q 3GOXA 1PCXA 5FU6B 4DBQA 3KFVA 1KSWA 2KRNA 4CC7A 3RBBB 4J7IA 4A63B 1X6OA 2Y4XA 4JRIA 3CCVA 5FWBA 1BCOA 2DK3A 2XI9A 1BI3A 1VQOT 1NEBA 5FU6C 1X01A 2LJ0A 3TSWA 4J8OA 4RTTA 5CO7A 4J9HA 2RJCA 5DM7R 3HP9A 3MJXA 5FROA 1VQ9Q 2QTXA 3QXEB 4XTZA 3CMET 2DIQA 4C92E 5CKBA 2O4XB 4QKUA 3SD4A 1M8MA 1ZBJA 5GAMd 4J9FA 4P5NA 1KC8R 4Y91A 1C6VX 4F7UE 2CYZB 3I56A 1IRXA 5CQXA 1QCFA 2LRQA 3MO8A 4C92B 3TSZA 3V7SA 4JS5A 4OGCA 1ZSZB 3CMAA 5GAN6 5FLXE 2F69A 5GMKm 4F16A 4AFQC 1OYXA 2Y4YA 2BZXA 2GTOA 3F70A 4O5VA 1JO8A 2P4RA 4C0ZA 2D8JA 2P4TA 2PVOB 1YJWQ 3QDRB 4B6MA 4ZN3A 3R6OA 1ACMB 3G4SA 1YI2A 2EPDA 2KEAA 1M1KC 1M3AA 2AIRB 3MP6A 2O9VA 1VQNQ 2WSEE 3QHSA 4PK4A 1YNZA 1HSQA 4EMKA 4PFOA 5LJ5d 1GBRA 3LH5A 4M7DC 4IUVA 3CCQQ 2LC4A 3UDCA 2B86A 1TXQA 1MV3A 4ELZC 1K73C 1M2VB 5CKHA 1VQLQ 2DZ9A 1WQ7A 5FRNA 5CAIA 5IT9E 3SB2A 1W2BS 3FJPA 3GBQA 4A4GA 1VQLT 4Z02A 3EH2A 1AHJB 4C8QC 3EAEA 1YI2T 3QJ6A 1D0XA 1YJNA 2DD4A 1KHIA 1K9MR 2R57A 2O88A 1WXTA 2HQXA 2MK5A 1VA7A 2VXFA 1W2BP 2LCSA 2ECZA 3MCAB 2LJ1A 2XU8A 3D7SB 1OEBA 5AT1B 1JU5C 1WXBA 2BE9B 2DA9A 3LYIA 1I4K1 2ZGWA 2EWNA 3PFSA 4C8QF 1VQ7A 3CCJA 1U06A 2QQSA 4RTVA 4FYWB 5EC7A 2NWMA 2EIFA 2AKLA 4QT7A 4OMFB 1BIAA 4DOVA 1IREB 1D1BA 1M30A 2QQRA 2EGAA 4C0DB 2EAYA 2X3XD 1TUDA 2XG8D 4J7FA 2CP3A 1VQOA 3RDVA 3JCMV 1NJIC 4XQ3A 3FJ5A 3VJPA 2COZA 4C5HA 3JCMP 4M77E 3X25B 2JS2A 1OZ3A 2VC8A 2WACA 3OYGA 2QTVA 2L3SA 2O2OA 2GCXA 1NEGA 5KYWB 1CSKA 4GLKA 3M4YA 4M75C 1RAGB 1OI1A 2K7AA 2RM4A 2CH4A 1HJDA 4M7AF 1KQSP 1WJSA 2AT1B 2LT1A 2K4YA 3ZFJA 2NUZA 3RKYA 3EG1A 5GANf 5CKEA 4UC4A 4FSSA 1M90U 1U3OA 2BIVA 4XTXA 2E5KA 1VYUA 1PD0A 1M2OA 4C5IA 5LJ3f 1G2BA 1YCYA 4A4KA 1AZGB 3EG9A 4M7AC 2X4JA 2QA4A 2YRVA 2RJDA 3NTHA 1C1AA 2MMPA 3OW2S 2OTLT 1RACB 1PC0A 2DL8A 3G6EQ 2WSFE 1K8AR 3CCRT 4IUPA 5GAOr 3CCMA 2HEQA 2E6ZA 4N0AC 1RAHB 4L6V5 1QVPA 3QUIA 2NUPA 1ABOA 3M59A 2HSEB 2RA2A 1FXXA 4RTUA 1FYNA 3U23A 1IGUA 2F5KA 4KGVB 4Z8AA 5IHNA 2HD0A 4JLGA 4XU3A 2G6FX 1TG0A 1WHKA 3DLLA 1ARKA 3CCEA 2RQVA 3V7RA 1NJIR 3CC4T 2DTIA 1QVGA 3MEAA 3VUBA 3CCQT 3S6WA 4MMKA 5I21A 2E3IA 2RI2A 1YJ9A 2MWPA 1UUEA 3CCSA 5DY9A 1EX4A 1M2VA 1D1CA 1NPRA 4WTOB 2CZ6B 2QDYB 2YXYA 5GAOl 3LWIA 4HVWA 4K11A 2H8HA 3N5BB 4F7UB 5A0GA 5GAOm 1BK2A 3H0FA 2RHUA 3KUFA 1T0JA 2KROA 2DEQA 4R55A 4HVVA 1EZZB 4C8QG 2JOYA 2YLBA 2JMCA 1YIJQ 1VQMQ 1ZQ1A 2SRCA 3VS1A 3HL8A 2LX9A 4FCYA 1AOJA 2ZPGB 2E5QA 2DO3A 2F2VA 1Q95G 5C6SA 2F1LA 1N9SA 1X69A 2CP5A 1FMVA 3CCLA 4EDUA 3FDRA 4RCCA 1IHVA 1VQ5T 3WXMB 1VQ9A 3CC2T 4M7DF 4CC2A 5GAOp 2XD0A 1J3TA 2DD5A 3H0HA 1H641 4C5EA 1XJWB 3L2UA 1AWJA 1WYXA 2YUOA 2EGCA 4RTXA 2PUOB 3M0PA 4N4HA 1VIEA 2DL5A 3NTIA 3OYEA 5GANd 3RKXA 4LUDA 1VOMA 2A3LA 3X20B 2VGMA 3OY9A 1UFFA 2PU9B 3NFCA 4M78D 2R58A 1MNDA 3RERA 4BD3A 2DVEA 4X9CA 4EMKC 3WVEB 4M7DA 1FMKA 2M02A 4OMQA 2HMAA 1GRIA 3G4SQ 1YI2Q 2A7YA 2ENMA 3L1AA 2CZ0B 3UA6A 3FIFA 2YRDA 4M75G 3OYCA 2DM1A 2MI6A 2LQWA 4BE0A 1RI0A 8AT1B 2K3YA 5CK9A 4HCCA 2RK2A 1VQ7T 3P8HA 5CCAA 1JJ2S 2DX1A 3CCUQ 3CCQA 1OPLA 2M51A 3CCLT 1W2BA 1VQPT 3EFSA 1Q81C 4ZNXA 3G6ET 4D8DA 3QZ5B 1R8OB 3JV3A 1Y07A 5LJ3e 4EPCA 5LJ3h 2C0TA 4M78B 1TTHB 3JSCA 4QVZA 2FL7A 5KYNA 3G1JA 4AMCA 1VQ6A 2C06A 3M0RA 3TCJA 2DBMA 4QVDA 4DBHA 1KHCA 4C8QB 2KNBB 4PNOA 4MDXA 1RLQC 2EBPA 3I5RA 2WSCE 1V76A 4OB1B 3A8GB 1N8RU 3JCMX 2A28A 1VQ8Q 2P84A 1PD1A 2HCKA 4JJCA 4M7AD 3CCST 4CI0C 4XTVA 4E2FB 3OYAA 1K8AU 2SEMA 1M4ZA 4C92D 2QAZA 3CC4A 3MP1A 1X27A 2A37A 3EFRA 1MMAA 3E9GA 1AWXA 2ZPFB 2BUDA 2M16A 4QW2A 4BE1A 2XHCA 1BU1A 1SRLA 4B9XA 1VYVA 1HK9A 2DMOA 1VYTA 3M0QA 4TVRA 1WA7A 1JQQA 1W70A 3VYGA 2J7IA 2YDLA 3I55T 1TS9A 3CMEA 4Y28E 3NTKA 1XQHA 2E3HA 4MZMA 2DF6A 5HK0A 1ZSZA 1WIEA 1OZ2A 2DZCA 2JTMA 2M1HA 4WCIA 4J83A 1QVFS 1SKUB 3OW2P 2C0OA 4IUUA 1OU9A 2LQNA 1SSFA 3TQ7P 4FIBA 2F5TX 4LE9A 1UJ0A 5GMKj 3JB9H 1VQKA 1PHTA 5LJ3g 2RQRA 1SSHA 1D3BB 4GBQA 4R56A 4E7JA 2L89A 1I0CA 2Y90A 3QJYA 3CPFA 2EKOA 2DTOA 2JTEA 4J9GA 3TREA 3JCMe 3FEOA 4N4GA 4LDXA 4RTYA 2FG0A 3JCMh 3PVQA 2E41A 1VQ9T 1TOVA 3QWXX 1PRLC 2QXFA 1JXMA 1QMCA 4OMLA 3EG0A 3L42A 1ZUYA 1YJWA 4BI4A 2EYXA 3I55Q 2XICA 2K5LA 1JJ2P 4KH1B 4E7SA 3RUXA 4PFPA 2OAWA 3REBB 3GNFB 4FM4B 4M77C 2QYZA 4M75F 2L3RA 8ATCB 2D0QB 2VKNA 4B9WA 4C5GA 2O4XA 1X6BA 3G71T 3JCMb 1QVGS 4BDZA 3VRYA 3G6EA 4HXJA 2XIDA 1VQPQ 2YSQA 1HD3A 2NLUA 1QWEA 3OYDA 2V8IA 3CCUT 1NJIU 3M57A 2B8AA 2J6KA 5D6YA 2LZ6B 2RPNA 1BBZA 1F1BB 3MEVA 2LQKA 3M56A 1QWFA 5HCKA 2CUBA 3MPUB 2RJEA 3CC7T 1UGSB 1Y57A 4BDYA 2VV5A 2KAFA 2XDDA 2CS7A 1YJNQ 4MZTA 2LMJA 3EGXB 4OMOA 3JAME 5I22A 1UGVA 4LDVA 3OYMA 3DKMA 1TSFA 2EYQA 1YCSB 4OB3B 3M55A 3CXCS 3JB9G 4OB2B 3G7ZA 3A1PA 1XNIA 1PM3A 2RN8A 3OYNA 4FW1A 1TUCA 3SFMA 3PMTA 2DL7A 3V8LA 3HSBA 1NG2A 2J05A 3JCMf 1SHFA 2GBQA 2JM9A 3GP8A 4EMKB 3KBGA 3CCRA 3RNJA 3SHWA 4M77D 3CQTA 4BE2A 1VQ7Q 3CCJQ 1M3BA 1D1AA 1OULA 2FYKA 5L8RE 4XTUA 2YLCA 1X43A 4ESRA 1UEBA 2EQUA 4DEXA 2E1HA 2L3QA 4A53A 3EHRA 3S3NA 3THKA 4AG1C 7AT1B 5LJ5j 3PTAA 1PNJA 3URGA 3UPUA
chains in the Genus database with same CATH topology
3CD6T 2EFIA 5GAMg 3CCRT 4IUPA 2JN0A 5C0MA 5DLOA 3CCMA 5GAOr 1M90C 1BIBA 5KH6A 2E6ZA 4N0AC 4XTWA 4KT0E 1RL2A 1PSEA 4L6V5 2X4WA 4C8QE 1QVPA 3T9NA 3QUIA 3RMSA 3CC7A 1Y71A 2ZCFB 1GXIE 2RHIA 3M59A 2RA2A 2QA4T 1M5Q1 3FC3A 1FXXA 2RHXA 5LJ5f 1Q7YC 4M78A 3OS2A 2KK4A 4ZN1A 5GAN7 4NOYA 1Q82C 3RIRA 2MAMA 2F5KA 3M53A 3ER0A 3META 1VQ8T 3HRSA 2QQ9A 5A2QE 3V8KA 1Q7YU 3ZBDA 2XDPA 5GAN8 5CKFA 2E65A 2HD0A 3E19A 2O01E 4J6YA 4JLGA 4KBMB 3OYBA 1KD1U 4NL2A 4XU3A 3OA6A 4M7DD 3DLLA 4NL3A 3CCEA 4QQDA 2RI5A 2EJ9A 3CD6A 3V7RA 3GPLA 3FRNA 1VIFA 2JTFA 2LT4A 2DTIA 3CC4T 1QVGA 3MEAA 3VUBA 3CCQT 4O6JA 3PGGA 3PMIA 4FT2A 3FLGA 4MMKA 3S6WA 1O75A 3C4SA 3UWNA 3VUZA 1LNXA 2RI2A 2K2VA 1M1FA 4BY6C 3KXTA 3JCMW 1QP3A 3Q1JA 3J81E 1BI2A 3ASKA 5FRMA 1YJ9A 2MWPA 1V29B 4MZPA 4M77F 5GAN5 4XU1A 4C8QD 3CCSA 4LDYA 4LDWA 2P0PA 5DY9A 4BACA 1KC8U 3OW2A 1Y96B 2ZPHB 2QI2A 3CCET 1NPPA 4A4HA 3RKWA 4RKUE 3M5AA 5DLQE 2RH2A 4C92G 3A5ZB 4MMLA 1NPRA 3L2VA 2EQKA 1M1KU 3FB9A 4C92C 5LJ5h 2CZ6B 2QDYB 1YITA 3HRUA 4XU0A 5GANj 5LJ5e 3E1SA 4GY5A 4V2SA 1YIJT 1WNLA 5GAOl 4JS4A 3SWNA 3LWIA 3CPWA 3OB9A 1U1TA 4II1A 5M9OA 1YJ9T 1U1SA 3CEYA 4F7UB 3N5BB 4DQ2A 5A0GA 5GAOm 2VXEA 2RHUA 3KUFA 4PKCC 1JBMA 4HCBA 2DEQA 3BDUA 5LJ3d 4R55A 1P92A 3VV0A 3L2ZA 3P8DA 4A4FA 4EMHA 2AHJB 1JJ2A 3DB4A 3BFMA 4C8QG 2K5IA 2RHYA 4HCZA 4HKEA 4N0AA 2JOYA 2YLBA 1G3YA 3CC2A 4IUQA 2PQWA 1NE8A 4PJOF 1ZQ1A 1KQ2A 4J6XA 3HL8A 4JLIA 3QYHB 3JB9D 3AHUA 2LCCA 2LX9A 5I2SA 4YTLA 2DTHA 1U8RA 2ZPGB 1N27A 2E6NA 2RK1A 5GMKl 2E5QA 4M78C 2VYTA 3VKIA 5GMKh 5GAMh 1EIFA 3BW1A 3M4GA 1O9SA 2DO3A 4ZGEB 5C6SA 3QBYA 4L59A 4MDWA 5CQYA 3L2WA 2QEXA 1WPYA 5A0LA 3P8BB 1N9SA 1VQPT 2X4YA 2CKKA 3DLMA 1G5VA 1H3ZA 1K9MC 3QKJA 4KULA 3CCVT 4BUGA 3CCLA 2LTOA 2LVMA 4ME7A 4EMGA 1S72A 5J26A 5GAOq 4EDUA 4ATOA 3FDRA 4RCCA 3ME9A 4A54A 3CCUA 4PJOB 3SWNC 1VQ5T 4M75D 3WXMB 2CZ7B 4F7UG 1QP2A 2RO0A 2DXBA 1M8VA 1VQ9A 4E47A 4PLIA 3CC2T 4M7DF 5GAOp 2XD0A 1N6AA 2DD5A 1H641 3C12A 4C5EA 3PIPA 2PUKB 4KUIA 3SWNB 3V8JA 3LW5E 1KQ1A 3JCMc 3L2UA 3JB9I 2M0OA 1JB0E 3H6ZA 4PJOG 2YHTA 2PUOB 3X28B 3GIBA 4NS5A 3QSUA 4N4HA 1I81A 4C0FA 3OYJA 1VQMT 1VIEA 1WJQA 3NTIA 5FU7C 1NZ9A 5GANd 5GAN2 1WQWA 3OYEA 2PVDB 3RKXA 4M78G 4OF1A 5IAYA 1YBYA 4WF2A 4JRQA 1UGQB 2A3LA 5GAMf 4OVAA 3X20B 4IKFA 2VGMA 3S3MA 3HRTA 2KY9A 2CZ1B 2DXTA 2VGNA 3OY9A 2MF2A 2XK0A 2PU9B 3CBPA 3MP8A 3LWHA 3M9QA 3OMGA 2LCLA 3NFCA 5EG2A 4DOWA 1VQ8A 4M78D 3JCMQ 3HFOA 3CPWS 3JCMd 2IG0A 2E12A 2R58A 4M75E 3RMQA 4LDUA 5LJ5g 4ELYC 4OB0B 2MWOA 4E7KA 1N8RC 3RERA 4ZGJB 5LL6S 4E7HA 4BD3A 2DVEA 4X9CA 3X24B 1QW1A 4EMKC 2OAUA 3QZ9B 3V7CA 5KCHA 3OYLA 3WVEB 1VQ4T 4M7DA 3PT9A 4J5YA 4X34A 3GOXA 1YIJA 5FU6B 5GAN3 1VQMA 3MEUA 2XKOC 2KDSA 2KQWA 4HT8A 2A7YA 1ZHIA 4VUBA 3L1AA 4E7LA 1TH7A 4J7IA 2CZ0B 3FIFA 4M7DB 4M75G 2BKDN 5J3BA 3OYCA 4DA4A 3OS5A 2RHZA 1X6OA 2FVUA 2Y4XA 2MI6A 4JRIA 1K8AC 3CCVA 4XTYA 4BE0A 1RI0A 1IZ6A 2K3YA 2DK3A 2XI9A 1BI3A 3OYFA 1VQOT 5FU6C 5CK9A 4HCCA 2RK2A 1VQ7T 1X01A 2QEXT 4J8OA 2DXCA 3P8HA 1KD1C 5CO7A 5CCAA 1JJ2S 2RJCA 3QO3A 1Q86U 4M78E 5DM7R 2GF7A 2QQAA 3HP9A 4IURA 5FROA 1UGRB 3OYYA 3CCQA 2ZPEB 1MGQA 2QTXA 3CCLT 3QXEB 5I21A 1W2BA 4XTZA 3EFSA 4M78F 4BB7A 4CRIA 2V8KA 3CMET 2EJFA 3X26B 3G6ET 1DJ7B 3OBWA 2DIQA 4HT9A 4C92E 2R5MA 5CKBA 3QZ5B 2O4XB 1PSFA 1R8OB 3SD4A 1Y07A 5LJ3e 2FB7A 4EPCA 3O8VA 1QVFA 2RD1A 4ZTJA 5LJ3h 4M78B 3LGLA 1WJRA 3ZEHA 3JSCA 5GAMd 1UGPB 2RB6A 4QVZA 2ZZDA 4P5NA 4RMOA 1I8FA 2FL7A 4Y91A 2K3XA 4A4EA 2E64A 2CYZB 4Q5WA 4F7UE 5D6WA 3I56A 1VQ6A 2C06A 3A8OB 5CQXA 3TCJA 2LDMA 2LRQA 4PJOA 4QVDA 3OBYA 3J80E 3MHXA 1Q81U 1KHCA 3MO8A 4L5GA 4C8QB 4C92B 4PNOA 4F7UF 4MDXA 3V7SA 4JS5A 2WSCE 4OB1B 1VQ4A 4OGCA 4M75B 3A8GB 3CMAA 5GAN6 3JCMX 5FLXE 4QVCA 3JCMg 1N8RU 2OTJT 2F69A 3A8MB 5GMKm 3LLRA 3OSSC 4M7AD 1OYXA 3CCST 2Y4YA 4BI8B 4XTVA 2X35A 4CI0C 3E9FA 2OTLA 3PNWC 4F7UA 1LJOA 3OYAA 3F70A 4O5VA 1K8AU 3A8HB 2DIGA 4E7IA 4PL6A 1M4ZA 4C92D 4JJNK 1BI1A 4C0ZA 3JB9J 1VQNT 4QQ6A 2P4TA 2DPPB 3CC4A 3MP1A 2G3RA 1G3TA 2PVOB 3QDRB 3I55A 3EFRA 5KCOA 4ZN3A 3R6OA 3E9GA 3G4SA 1YI2A 1YHQA 3JB9F 1M1KC 2ZPFB 5GAMe 5CIUA 3MP6A 2R5AA 2BUDA 2M16A 4QW2A 4RG2A 4BE1A 2XHCA 4FL6A 4B9XA 4QQGA 1HK9A 1B34A 2WSEE 3QHSA 4FT4A 5GANh 5CR2A 2LQ8A 4TVRA 4EMKA 3VYGA 4M7DG 3SDZA 2DKGA 3BY7A 4J6WA 5LJ5d 2E70A 2GFAA 3I55T 5LJ3j 3CMEA 4M7DC 1VQPA 4IUVA 1MHNA 4IUTA 4M7AE 2LC4A 4Y28E 3UDCA 2KVQG 3NTKA 4BI3A 2H3JA 1XQHA 4MZMA 1Y96A 5HK0A 3HPWA 4ELZC 5CVIA 1K73C 5CKHA 1OZ2A 2DZCA 2JTMA 2DZ9A 2M1HA 1BKBA 1WQ7A 5CAIA 4M77A 4RCBA 4J83A 5IT9E 5FRNA 1QVFS 3SB2A 2JZ2A 1W2BS 3FJPA 4IUUA 4A4GA 1VQLT 4Z02A 1SSFA 1KC8C 1B34B 4FIBA 2F5TX 3J7AF 2OTJA 5GMKj 1AHJB 3JB9H 4X9DA 4C8QC 5KE2A 3M58A 1VQKA 5LJ3g 3EAEA 1Q86C 1D3BB 4M7AB 1LOJA 1YHQT 1YI2T 3VYHB 2LNVA 3QJ6A 1ZBXA 2FHDA 1YJNA 2DD4A 1KHIA 2CGHA 5GMKi 5D6XA 1YITT 4R56A 3QPHA 3I56T 2R57A 4E7JA 1KQSA 5GAN4 2L89A 2RI3A 1VQ5A 2Y90A 1K73U 3QJYA 3CPFA 3TEEA 4OP0A 4ZGDB 2EKOA 2DTOA 2HQXA 4N4IA 2VXFA 2D6FA 2P0QA 5IN1A 3QG1A 3JCMJ 4JRPA 3MCAB 3JRZA 3TREA 3FEOA 2L5QA 3BDLA 4N4GA 3JCMe 4LDXA 2RJFA 2DAQA 2XU8A 3JCMh 3CBMA 2E41A 1VQ9T 4JUVA 2HAXA 2E10A 2QXFA 1D3BA 4C92F 2DXUA 5GAMj 3HFNA 3OSVA 1KQSS 4HA8A 3L42A 3OS0A 3OYHA 4OGEA 1WGSA 3CCJT 1M1GA 1YJWA 2PVGB 4JDSA 4M77B 4BI4A 2XICA 2K5LA 2EJGA 1K9MU 3LYIA 1I4K1 3RUXA 2X4XA 2EWNA 2ZGWA 3PFSA 4C8QF 1VQ7A 3CCJA 3M54A 3GNFB 2L8DA 3HKSA 3QIIA 2VUBA 1N9RA 4FM4B 1XTDA 4M77C 1BYMA 2QQSA 3C94A 1W4SA 2L3RA 3HHTB 4M75F 4XAXB 1VQNA 4PJOC 2K57A 2D0QB 1UB4A 4B9WA 4C5GA 1Q82U 2O4XA 1FWZA 2EIFA 3G71T 4LD6A 3JCMb 3CCMT 1QVGS 4C8QA 4BDZA 3OMCA 3DB3A 4OMFB 3GLXA 3G6EA 1BIAA 3VU3C 4DOVA 1IREB 5GANg 3OYKA 4PJOD 2JVVA 2XIDA 3OYIA 4XK8E 2NLUA 3H8ZA 3OQ5A 3CMAT 3OYDA 2V8IA 3CCUT 2QQRA 4BY6B 1BI0A 2KSSA 3M57A 1NJIU 1G3WA 2B8AA 5GMKe 2JUFA 3QYGB 1G3SA 2GQVA 5D6YA 3UT1A 1VQLA 5AYFA 2HNIA 2KMTA 4C0DB 2EAYA 5KE3A 1YJNT 4J7FA 2XG8D 4M7AA 1VQOA 5I2MA 3JCMV 3G71A 1NJIC 4XQ3A 1VQKT 3VJPA 1Q81C 3MEVA 4C5HA 4C92A 2GFUA 2K5FA 2LQKA 2EQJA 3M56A 4M77E 3JCMP 3WVDB 2D9TA 3X25B 1OZ3A 3CXCA 2VC8A 2WACA 1I5LA 2RJEA 3CC7T 3OYGA 1UGSB 3G4ST 4BDYA 2GCXA 2KAFA 2VV5A 2XDDA 2CS7A 3MEWA 4FU6A 5GAOn 2QQBA 4MZTA 4M77G 3CBOA 3TU4K 3JAME 4ZTFA 4GLKA 4PLLA 3PIOA 3GF5A 5A0DA 3M4YA 4LDVA 4M75C 1M9SA 3RESA 3OYMA 3LH0A 3DKMA 5J39A 4RG8A 1OI1A 2EYQA 4OB3B 3M55A 3S3OA 4PJOE 3CXCS 3JB9G 4OB2B 3G7ZA 1FX7A 3L2QA 1XNIA 2RM4A 1KG1A 3LX7A 3GNGA 3OS1A 3OYNA 4M7AF 2EQMA 3L2RA 2I2LA 1WJSA 2LT1A 2P0KA 3A8LB 3INZA 5HY6A 2K4YA 1Y7XA 3SFMA 3PMTA 2HQEA 1YJWT 3ZFJA 5HKCA 2HBPA 3V8LA 3JCMf 3HSBA 1JRIA 3RKYA 5GANf 2IVWA 3GP8A 5CKEA 4M75A 4UC4A 4EMKB 1M90U 2DJZA 2BIVA 2M9UA 3KBGA 4XTXA 3CCRA 1S72T 5CKDA 4KUDK 1VQ6T 5HK3A 2ZPIB 4M77D 4C5IA 1XOVA 4M7AG 2ZPBB 5LJ3f 1X75C 4BE2A 2JNGA 1YCYA 4FSXA 4C0GA 3C95A 4A4KA 4XU2A 2FYKA 4M7AC 3LGFA 2X4JA 4XTUA 2YLCA 5L8RE 4C0DC 2QA4A 2YRVA 4M7DE 2RJDA 3NTHA 1UEBA 2EQUA 2E1HA 4A53A 2MMPA 1HXDA 3S3NA 5GANe 3OW2S 4LD9K 5LJ5j 3PTAA 2OTLT 5FU7B 2V8JA 4JRKA 3URGA 4D6WA 2WSFE 2XDBA 3UPUA 1VUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ME9 A;  2EFI A;  3OS0 A;  3L42 A;  4IUP A;  2LDM A;  2LRQ A;  1WGS A;  5C0M A;  2RO0 A;  3OYH A;  5KH6 A;  1KHC A;  3MO8 A;  4PLI A;  3LYI A;  2X4W A;  2X4X A;  3PFS A;  4C5E A;  2RHI A;  3QII A;  3FC3 A;  2L8D A;  2RHX A;  3LLR A;  3L2U A;  2QQS A;  2L3R A;  1OYX A;  3OS2 A;  2M0O A;  2X35 A;  3H6Z A;  3E9F A;  4B9W A;  3PNW C;  4C5G A;  2F5K A;  3MET A;  3OYA A;  2O4X A;  3F70 A;  2DIG A;  4LD6 A;  4PL6 A;  4NS5 A;  4E7I A;  4BDZ A;  2XDP A;  4N4H A;  3OMC A;  3DB3 A;  3OYJ A;  3NTI A;  1WJQ A;  4QQ6 A;  3OYE A;  3OYB A;  3OYK A;  3MP1 A;  5IAY A;  2G3R A;  3OYI A;  3OA6 A;  2NLU A;  3H8Z A;  3OQ5 A;  4OVA A;  5KCO A;  4IKF A;  3OYD A;  4QQD A;  2RI5 A;  3S3M A;  2QQR A;  3E9G A;  4BE1 A;  3OY9 A;  2B8A A;  2XK0 A;  3MP8 A;  2JTF A;  5D6Y A;  3M9Q A;  3OMG A;  3UT1 A;  3MEA A;  5KE3 A;  5CIU A;  3MP6 A;  2R5A A;  2BUD A;  2M16 A;  3PMI A;  4QW2 A;  2IG0 A;  3FLG A;  4FL6 A;  2R58 A;  3C4S A;  4RG2 A;  3S6W A;  3UWN A;  2RI2 A;  4B9X A;  4QQG A;  3Q1J A;  2MWO A;  3ASK A;  4E7K A;  5FRM A;  2MWP A;  3MEV A;  4C5H A;  4E7H A;  4BD3 A;  2GFU A;  2EQJ A;  5KCH A;  4BAC A;  2D9T A;  3OYL A;  1OZ3 A;  2WAC A;  2RJE A;  4A4H A;  3OYG A;  2GFA A;  4BDY A;  4X34 A;  4IUV A;  1MHN A;  3GOX A;  3MEW A;  4FU6 A;  4IUT A;  3NTK A;  3L2V A;  3MEU A;  2EQK A;  4PLL A;  4ZTF A;  3OYM A;  4E7L A;  3LH0 A;  1OZ2 A;  4GY5 A;  5J39 A;  2M1H A;  1OI1 A;  5FRN A;  2BKD N;  3OYC A;  3OB9 A;  4II1 A;  5M9O A;  2RHZ A;  3S3O A;  2JZ2 A;  3CEY A;  3L2Q A;  1XNI A;  4IUU A;  4BE0 A;  1RI0 A;  2K3Y A;  4A4G A;  3OYF A;  3LX7 A;  1SSF A;  2RHU A;  3KUF A;  4Z02 A;  3OS1 A;  3OYN A;  2EQM A;  3L2R A;  1WJS A;  2P0K A;  5KE2 A;  3P8H A;  3PMT A;  3EAE A;  2HQE A;  3P8D A;  4A4F A;  2RJC A;  3DB4 A;  2GF7 A;  2RHY A;  4HCZ A;  3QJ6 A;  4IUR A;  5FRO A;  2FHD A;  4IUQ A;  2PQW A;  5D6X A;  4E7J A;  4UC4 A;  2R57 A;  2BIV A;  4CRI A;  2L89 A;  2RI3 A;  2LCC A;  2DIQ A;  1N27 A;  2EKO A;  2E6N A;  2HQX A;  2R5M A;  2E5Q A;  4N4I A;  2O4X B;  2VYT A;  4C5I A;  4BE2 A;  3SD4 A;  5IN1 A;  3O8V A;  5C6S A;  3QBY A;  3LGF A;  4L59 A;  4ZTJ A;  3L2W A;  2YRV A;  3LGL A;  1WJR A;  2RJD A;  3BDL A;  3FEO A;  2EQU A;  3NTH A;  4N4G A;  2RJF A;  2X4Y A;  2CKK A;  2DAQ A;  3DLM A;  3ZEH A;  3S3N A;  1G5V A;  1H3Z A;  4QVZ A;  3QKJ A;  2K3X A;  2LTO A;  2LVM A;  4A4E A;  5J26 A;  4Q5W A;  5D6W A;  4EDU A;  3FDR A; 
#chains in the Genus database with same CATH topology
 3NHN A;  2JN0 A;  5C0M A;  5DLO A;  4FYX B;  3R6N A;  4LN2 A;  2X4W A;  4C8Q E;  2A08 A;  2RHX A;  2JJ9 A;  1VQO Q;  1WX6 A;  2KK4 A;  3RIR A;  3MET A;  3EGX A;  1CKA A;  3V8K A;  3RR6 A;  1Q7Y U;  2XDP A;  1QCO A;  2F2X A;  1OX9 A;  4JPB W;  1KD1 U;  2GQI A;  3VS2 A;  4NL2 A;  3OA6 A;  3EGU A;  4NL3 A;  4IIM A;  2RI5 A;  2EJ9 A;  2KT1 A;  3GPL A;  5D7U A;  3FRN A;  2CSI A;  2FPF A;  4O6J A;  1ZLM A;  3UWN A;  2CUD A;  4BY6 C;  1LNX A;  3NGP A;  4FW2 A;  3VRZ A;  3JCM W;  5FRM A;  4MZP A;  1TUG B;  2VWF A;  4LDY A;  2EYW A;  2HBW A;  2ZPH B;  4KH0 B;  4C92 G;  3FB9 A;  4XU0 A;  6AT1 B;  3SWN A;  1YJ9 T;  3M0U A;  2CP0 A;  2KR3 A;  2QA4 Q;  1K9A A;  2DLP A;  1AT1 B;  4PKC C;  1AVZ C;  4HCB A;  3BDU A;  2KI7 A;  1KK7 A;  3VV0 A;  2KBT A;  3DB4 A;  1WLP B;  3BFM A;  2K5I A;  3CC2 A;  4GLM A;  1NE8 A;  4PJO F;  1KQ2 A;  4J6X A;  3VS4 A;  3EFO A;  3E2U A;  3JB9 D;  4YTL A;  1Z9Q A;  1N27 A;  2NUT B;  1EIF A;  2JXB A;  3BW1 A;  3M4G A;  1O9S A;  4ZGE B;  1GCQ A;  3QBY A;  4L59 A;  4MDW A;  1WPY A;  1Y0M A;  2X4Y A;  2CKK A;  3DLM A;  1K9M C;  3QKJ A;  3CCV T;  1K0S A;  4ME7 A;  1S72 A;  2C0I A;  1ABQ A;  3ME9 A;  4A54 A;  3CCU A;  4M75 D;  2JMA A;  2CZ7 B;  2RO0 A;  4E47 A;  4PLI A;  1W6X A;  5KYU A;  4CC3 A;  2JS0 A;  2DER A;  3PIP A;  2EKH A;  2PUK B;  3V8J A;  5GJV B;  2DIL A;  2L0A A;  1K73 R;  2L2P A;  1JB0 E;  3H6Z A;  2DEU A;  2O9S A;  1I81 A;  3OYJ A;  1VQM T;  2QK0 A;  1KFZ A;  5IAY A;  1YBY A;  4WF2 A;  4JRQ A;  3QWY A;  4IKF A;  4FYY B;  2ATC B;  3CBP A;  3LWH A;  3OMG A;  2LCL A;  1VQ8 A;  3JCM Q;  3CPW S;  1M1K R;  2IG0 A;  3O5Z A;  4LDU A;  1IB8 A;  5ECA A;  4ELY C;  2MWO A;  4J9D A;  1N8R C;  5LL6 S;  1T3L A;  2BTT A;  2PZ1 A;  2OAU A;  3OYL A;  2NUT A;  3PT9 A;  1GFD A;  1YIJ A;  1VQM A;  2CT4 A;  3MEU A;  2XKO C;  2KQW A;  4HT8 A;  1YHQ Q;  2D8H A;  1ZHI A;  4VUB A;  4E7L A;  2GTJ A;  1R77 A;  1RI9 A;  1RAA B;  5J3B A;  3OS5 A;  2RHZ A;  2NUP B;  1K8A C;  3OYF A;  2QGF B;  3UF4 A;  3I5S A;  2QEX T;  1QKX A;  1KD1 C;  3CCL Q;  3QO3 A;  4M78 E;  3VS3 A;  4IUR A;  1UGR B;  2ZPE B;  1E6H A;  4M78 F;  4CRI A;  1D09 B;  2EJF A;  3OBW A;  4HT9 A;  2XMF A;  1PSF A;  3O8V A;  2RD1 A;  4ZTJ A;  1QKW A;  3LGL A;  1WJR A;  3ZEH A;  2RB6 A;  2ZZD A;  4RMO A;  1SEM A;  1VQK Q;  2FZG B;  1C0M A;  1G83 A;  1ZX6 A;  2E64 A;  2K6D A;  1ZSG A;  4L5G A;  4F7U F;  4M75 B;  3M0S A;  3VS5 A;  2GNC A;  1D0Y A;  3JCM g;  3A8M B;  2DVJ A;  4Z89 A;  4BI8 B;  2X35 A;  3E9F A;  3PNW C;  1LJO A;  3A8H B;  2DIG A;  2VVK A;  4JJN K;  1BI1 A;  3JB9 J;  1VQN T;  2JW4 A;  4QQ6 A;  1X2K A;  1PKS A;  5IH2 A;  3I55 A;  2EGE A;  1E6G A;  4QQG A;  1S1N A;  4KRT A;  1JEG A;  1B34 A;  5GAN h;  5CR2 A;  2GGR A;  2LQ8 A;  1FMW A;  4F17 A;  2DKG A;  1KJW A;  2E70 A;  2FRY A;  1VQP A;  1MHN A;  1RLP C;  3I35 A;  4IUT A;  4M7A E;  2DJQ A;  2HSP A;  1Y96 A;  1MMG A;  1WHJ A;  1BKB A;  4M77 A;  1R0C B;  4CC4 B;  2JZ2 A;  2KRS A;  1KC8 C;  2OTJ A;  3UA7 A;  3M58 A;  2J06 A;  4M7A B;  2D1X A;  5D6X A;  3QPH A;  3ZL7 C;  5GAN 4;  2RI3 A;  2KT8 A;  1K73 U;  4ZGD B;  4OP0 A;  2D6F A;  2P0Q A;  5IN1 A;  3QG1 A;  3JCM J;  2KYM A;  3EGD B;  1PKT A;  2L5Q A;  2BZ8 A;  4ANJ A;  3CBM A;  4JUV A;  2HAX A;  2YUP A;  5KYU B;  1KIK A;  1N5Z A;  1D3B A;  2E10 A;  4C92 F;  3HFN A;  2EYY A;  1KQS S;  4HA8 A;  3OYH A;  4M77 B;  4JDS A;  2EJG A;  1WXU A;  2X4X A;  2MPX C;  1JXO A;  4PJN A;  3QII A;  3HKS A;  1XTD A;  2K3B A;  3C94 A;  4XAX B;  4PJO C;  1Q82 U;  1R0B G;  4RTZ A;  3OMC A;  3DB3 A;  3QDF A;  3VU3 C;  5I11 A;  1NLP C;  2D0N A;  4PJO D;  3OYK A;  3CME Q;  2JVV A;  1AWO A;  4AFZ C;  3OYI A;  3H8Z A;  2KSS A;  3H0I A;  3CC7 Q;  1G3W A;  5GMK e;  2JUF A;  3QYG B;  3UT1 A;  2KMT A;  2DYB A;  1PRM C;  4M7A A;  2DL4 A;  5I2M A;  4AG2 C;  3G71 A;  4IIO A;  3ULR B;  3CXC P;  4F14 A;  1VQK T;  4OMP A;  4C92 A;  2K5F A;  4J9C A;  3WVD B;  2D9T A;  3CXC A;  1AZE A;  1B3Q A;  2F2W A;  3AT1 B;  3G4S T;  2NYS A;  2KRM A;  3M0T A;  4OMN A;  5GAO n;  2QQB A;  3CBO A;  1BCM A;  4PLL A;  2K79 A;  3CD6 Q;  1VQ5 Q;  1M27 C;  5A0D A;  1B7T A;  3RES A;  1ZA2 B;  5J39 A;  4RG8 A;  2ABL A;  2V26 A;  3PVL A;  4LNP A;  2J6F A;  9ATC B;  3L2Q A;  4R0K A;  3LX7 A;  3GNG A;  3OS1 A;  1I5O B;  2EQM A;  2I2L A;  2LP5 A;  3A8L B;  3INZ A;  1OQK A;  2EQI A;  1MMD A;  1YJW T;  5HKC A;  2OX7 A;  2HBP A;  1WHL A;  1WHH A;  2IVW A;  4M75 A;  2M9U A;  3HTR A;  4KUD K;  5CKD A;  4JZ3 A;  2DET A;  2ZPI B;  1XOV A;  2ZPB B;  1X75 C;  2A0F B;  2JNG A;  4FSX A;  4C0G A;  2HKQ B;  3C95 A;  4XU2 A;  1K76 A;  3LGF A;  2RMO A;  4C0D C;  4M7D E;  1OPK A;  1SRM A;  1WDX A;  1HXD A;  5GAN e;  4LD9 K;  2CSQ A;  2V8J A;  1VUB A;  5GAM g;  4PJM A;  1M90 C;  1BIB A;  5KH6 A;  4KT0 E;  1PSE A;  3EH1 A;  3T9N A;  3RMS A;  4F04 B;  1Y71 A;  2BE7 D;  2RHI A;  1MUZ A;  1M5Q 1;  3FC3 A;  2KYB A;  5LJ5 f;  2CH4 W;  1Q7Y C;  2LX7 A;  2RQU A;  2QEX Q;  4ZN1 A;  4NOY A;  1Q82 C;  3REA B;  2MAM A;  3ER0 A;  3HRS A;  2QQ9 A;  5A2Q E;  4LXC A;  3ZBD A;  1GL5 A;  1V1C A;  5GAN 8;  2E65 A;  4J6Y A;  3OYB A;  1NYG A;  1A0N B;  4J9I A;  2JTF A;  2LT4 A;  4FT2 A;  3FLG A;  3TU4 K;  1K9M U;  2M0Y A;  3PE0 A;  3C4S A;  3KXT A;  1M1F A;  4E7Z A;  1QP3 A;  2YWW A;  3Q1J A;  3ASK A;  1OX8 A;  4XU1 A;  4C8Q D;  2P0P A;  4BAC A;  1Y96 B;  1WZO A;  2K9G A;  3CCE T;  1U5S A;  3RKW A;  2YT6 A;  4RKU E;  3M5A A;  3A5Z B;  3I9Q A;  3L2V A;  3CCR Q;  1M1K U;  4C92 C;  1YIT A;  2IIM A;  4GY5 A;  1WNL A;  4JS4 A;  3CPW A;  4II1 A;  5M9O A;  1U1S A;  3CEY A;  2E4H A;  1GCQ C;  2VXE A;  1RAD B;  5LJ3 d;  5IHI A;  2FPD A;  3VS7 A;  1UEC A;  3BE3 A;  3L2Z A;  3P8D A;  1JJ2 A;  2RHY A;  4HKE A;  2COY A;  4JLI A;  2MOX A;  3QYH B;  3AHU A;  2DL3 A;  1UDL A;  2LCC A;  1U8R A;  2E6N A;  2RK1 A;  2KXD A;  3VKI A;  5GMK h;  1B07 A;  5CQY A;  2EYZ A;  5A0L A;  3MKD A;  3SEM A;  4KUL A;  4J9B A;  2LTO A;  2LVM A;  3VS0 A;  1LPL A;  5J26 A;  5GAO q;  4ATO A;  1UG1 A;  2K2M A;  1AWW A;  2DXB A;  1BB9 A;  2RQT A;  1N6A A;  3C12 A;  3SWN B;  4J9E A;  3JCM c;  4RTW A;  1K4U S;  1ZSZ C;  4PJO G;  2ED1 A;  2YHT A;  1M3C A;  1E7O A;  3A98 A;  3GIB A;  1WJQ A;  3I56 Q;  1WQW A;  2PVD B;  5GAM f;  2CRE A;  3S3M A;  2VGN A;  2DXT A;  2MF2 A;  2XK0 A;  3MP8 A;  4HCK A;  3M9Q A;  4DOW A;  1G8X A;  3HFO A;  2HKN A;  2E12 A;  4M75 E;  5LJ5 g;  3RMQ A;  4ZGJ B;  4E7H A;  3X24 B;  5KYX A;  1ZUU A;  5KCH A;  3V7C A;  4X34 A;  3CC2 Q;  1Q7Y R;  1YWP A;  5GAN 3;  2FZK B;  2CP7 A;  2KDS A;  1TH7 A;  1IO6 A;  2HZY A;  2QAS A;  4M7D B;  2BKD N;  4DA4 A;  2FVU A;  5L23 A;  2HQH A;  4XTY A;  1IZ6 A;  2DXC A;  3H41 A;  1S72 Q;  1Q86 U;  2GF7 A;  2QQA A;  1CKB A;  3OYY A;  1MGQ A;  1WI7 A;  2AK5 A;  4OMM A;  4BB7 A;  2V8K A;  3X26 B;  1DJ7 B;  2JM8 A;  4PFZ A;  2R5M A;  2DFU A;  1W1F A;  1ZUK A;  2FB7 A;  1QVF A;  1I1J A;  4Z88 A;  2OTJ Q;  1UGP B;  1I8F A;  2K3X A;  2DYI A;  4A4E A;  4Q5W A;  5D6W A;  2CP2 A;  2CT3 A;  2MCN A;  3A8O B;  2HL5 C;  2LDM A;  4PJO A;  3OBY A;  3J80 E;  3MHX A;  1Q81 U;  1VQ4 A;  2KXC A;  2EVR A;  4QVC A;  1QQJ A;  2OTJ T;  3LLR A;  3OSS C;  1GBQ A;  2OTL A;  5KYW A;  4E7I A;  4PL6 A;  2O31 A;  2DPP B;  1WFW A;  2G3R A;  2QG9 B;  1G3T A;  1AD5 A;  1NYF A;  5KCO A;  1N8R R;  5KYY A;  1YHQ A;  1K1Z A;  3VS6 A;  3JB9 F;  3IQL A;  5GAM e;  5CIU A;  2R5A A;  4RG2 A;  4FL6 A;  1YP5 A;  3CCV Q;  2OI3 A;  2YRC A;  4FT4 A;  4EIK A;  4M7D G;  3SDZ A;  2VAS A;  3BY7 A;  4J6W A;  2GFA A;  5LJ3 j;  5FWC A;  1YFN A;  1TWB A;  4BI3 A;  2KVQ G;  2H3J A;  4DBF A;  3HPW A;  2BZY A;  5CVI A;  1AEY A;  2J6O A;  4RCB A;  3G71 Q;  4AFU C;  1OU8 A;  1B34 B;  3J7A F;  4DBR A;  4X9D A;  5KE2 A;  1Q86 C;  1LOJ A;  1YHQ T;  3VYH B;  2LNV A;  1NLO C;  1ZBX A;  1Z9Z A;  4ORZ A;  2AZS A;  2FHD A;  2CGH A;  5GMK i;  3EHQ A;  1YIT T;  4FYV B;  3I56 T;  1KQS A;  1VQ5 A;  5IXB A;  1SPK A;  1WHG A;  3TEE A;  3CMA Q;  4N4I A;  2CP6 A;  1PWT A;  2ROL A;  4AT1 B;  2CDT A;  1ZA1 B;  4JRP A;  3NPF A;  3JRZ A;  1QCN A;  3BDL A;  2MIO A;  3EG3 A;  1Q86 R;  2RJF A;  1Q81 R;  2DAQ A;  1HYO A;  1UHF A;  4RUG A;  2DXU A;  5GAM j;  3OSV A;  3OS0 A;  3CCJ T;  2LJ3 A;  4OGE A;  1WGS A;  2COW A;  1M1G A;  2PVG B;  1UJY A;  1OOT A;  5IHK A;  4X1V A;  4D8K A;  1RAI B;  3M54 A;  2L8D A;  2VUB A;  1N9R A;  2LNH B;  1BYM A;  2PNI A;  1W4S A;  3HHT B;  1VQN A;  3CPW P;  2K57 A;  1UB4 A;  4KGX B;  1X6G A;  5KYY B;  1FWZ A;  2H3E B;  2DRK A;  4LD6 A;  3CCM T;  4C8Q A;  1PG5 B;  3GLX A;  4AFS C;  1LCK A;  5GAN g;  4E6R A;  4XK8 E;  3CCM Q;  1H3H A;  3CMA T;  3OQ5 A;  2FO0 A;  4BY6 B;  1BI0 A;  1G3S A;  2GQV A;  1VQL A;  5AYF A;  2HNI A;  1YJN T;  5KE3 A;  2RQW A;  2V1R A;  2GFU A;  1QVG P;  2EQJ A;  1I5L A;  1QLY A;  3MEW A;  4FU6 A;  1GCP A;  4M77 G;  1UE9 A;  4ZTF A;  3CCE Q;  3PIO A;  3GF5 A;  1M9S A;  3LH0 A;  3EG9 B;  3S3O A;  4PJO E;  1UTI A;  1FX7 A;  1KG1 A;  2QGG A;  3L2R A;  3CCS Q;  2P0K A;  5HY6 A;  2DRM A;  2I0N A;  1Y7X A;  2HQE A;  1X2Q A;  1JRI A;  2ESW A;  5IXF A;  3UAT A;  3C0C A;  2DJZ A;  1VQ6 T;  1S72 T;  5HK3 A;  4M7A G;  1KD1 R;  1D0Z A;  2ED0 A;  2DE0 X;  5FU7 B;  4JRK A;  2X3W D;  4D6W A;  2XDB A;  1H8K A;  3CD6 T;  2EFI A;  4XTW A;  1RL2 A;  2FEI A;  3CC7 A;  2ZCF B;  1GXI E;  4KGZ B;  2QA4 T;  1GFC A;  4M78 A;  3OS2 A;  1TU0 B;  5GAN 7;  3NMZ C;  2A36 A;  3M53 A;  1IHW A;  1VQ8 T;  2YUQ A;  4LUE A;  1MV0 B;  1SG5 A;  5CKF A;  3E19 A;  2O01 E;  4KBM B;  4M7D D;  4Y92 A;  4QQD A;  3CD6 A;  1VIF A;  2ROT A;  2L3P A;  3PGG A;  2DNU A;  2EW3 A;  3PMI A;  4F7U A;  2DBK A;  2X51 A;  1O75 A;  3VUZ A;  1QVF P;  1NBE B;  2K2V A;  3EG2 A;  1YWO A;  3J81 E;  1BI2 A;  1OV3 A;  2X9H A;  1V29 B;  5KYX B;  3EGD A;  4M77 F;  5GAN 5;  1T3S A;  4LDW A;  1KC8 U;  2KGT A;  3OW2 A;  1RAE B;  2QI2 A;  1NPP A;  4A4H A;  4PJL A;  5DLQ E;  2V1Q A;  2Z0W A;  2RH2 A;  1IGQ A;  4MML A;  2EQK A;  1T0H A;  5LJ5 h;  3HRU A;  5GAN j;  5LJ5 e;  3E1S A;  3TVT A;  1M90 R;  4V2S A;  1YIJ T;  3OB9 A;  1SF9 A;  1U1T A;  4DQ2 A;  1JBM A;  2RNA A;  1P92 A;  4A4F A;  4EMH A;  2AHJ B;  2MYS A;  4HCZ A;  4N0A A;  1G3Y A;  4IUQ A;  2PQW A;  2KE9 A;  5GJW B;  1UHC A;  4JZ4 A;  1K0X A;  2YUN A;  4HVU A;  5I2S A;  1I07 A;  2DTH A;  5GAM h;  4PJJ A;  5GMK l;  4M78 C;  2VYT A;  3L2W A;  2QEX A;  2IPO B;  3EFO B;  1RUW A;  3P8B B;  1G5V A;  1H3Z A;  4BUG A;  4EMG A;  2W0Z A;  4PJO B;  3SWN C;  4F7U G;  2HL3 A;  1LVK A;  1QP2 A;  1M8V A;  2AKK A;  2OJ2 A;  1SHG A;  4DEY A;  4KUI A;  2HDA A;  2PTK A;  3LW5 E;  4JJB A;  1RAF B;  1KQ1 A;  3JB9 I;  2M0O A;  2QDL A;  1YJ9 Q;  1MNE A;  1NM7 A;  3H9N A;  3X28 B;  2JT4 A;  2ZAE A;  4NS5 A;  2W10 A;  3QSU A;  4C0F A;  2RF0 A;  2AZV A;  5FU7 C;  1NZ9 A;  5GAN 2;  1VQ6 Q;  1IXD A;  4M78 G;  4M4Z A;  4OF1 A;  1UGQ B;  4OVA A;  1EFN A;  3HRT A;  2KY9 A;  1YIT Q;  2CZ1 B;  1VQ4 Q;  1WHM A;  2FPE A;  1RAB B;  5FW9 A;  1H92 A;  1YN8 A;  5EG2 A;  2FZC B;  1MMN A;  3JCM d;  2OTL Q;  4OB0 B;  4E7K A;  1QW1 A;  2FRW A;  3QZ9 B;  2VB6 A;  4JJD A;  1Q82 R;  1VQ4 T;  4J5Y A;  3CC4 Q;  3GOX A;  1PCX A;  5FU6 B;  4DBQ A;  3KFV A;  1KSW A;  2KRN A;  4CC7 A;  3RBB B;  4J7I A;  4A63 B;  1X6O A;  2Y4X A;  4JRI A;  3CCV A;  5FWB A;  1BCO A;  2DK3 A;  2XI9 A;  1BI3 A;  1VQO T;  1NEB A;  5FU6 C;  1X01 A;  2LJ0 A;  3TSW A;  4J8O A;  4RTT A;  5CO7 A;  4J9H A;  2RJC A;  5DM7 R;  3HP9 A;  3MJX A;  5FRO A;  1VQ9 Q;  2QTX A;  3QXE B;  4XTZ A;  3CME T;  2DIQ A;  4C92 E;  5CKB A;  2O4X B;  4QKU A;  3SD4 A;  1M8M A;  1ZBJ A;  5GAM d;  4J9F A;  4P5N A;  1KC8 R;  4Y91 A;  1C6V X;  4F7U E;  2CYZ B;  3I56 A;  1IRX A;  5CQX A;  1QCF A;  2LRQ A;  3MO8 A;  4C92 B;  3TSZ A;  3V7S A;  4JS5 A;  4OGC A;  1ZSZ B;  3CMA A;  5GAN 6;  5FLX E;  2F69 A;  5GMK m;  4F16 A;  4AFQ C;  1OYX A;  2Y4Y A;  2BZX A;  2GTO A;  3F70 A;  4O5V A;  1JO8 A;  2P4R A;  4C0Z A;  2D8J A;  2P4T A;  2PVO B;  1YJW Q;  3QDR B;  4B6M A;  4ZN3 A;  3R6O A;  1ACM B;  3G4S A;  1YI2 A;  2EPD A;  2KEA A;  1M1K C;  1M3A A;  2AIR B;  3MP6 A;  2O9V A;  1VQN Q;  2WSE E;  3QHS A;  4PK4 A;  1YNZ A;  1HSQ A;  4EMK A;  4PFO A;  5LJ5 d;  1GBR A;  3LH5 A;  4M7D C;  4IUV A;  3CCQ Q;  2LC4 A;  3UDC A;  2B86 A;  1TXQ A;  1MV3 A;  4ELZ C;  1K73 C;  1M2V B;  5CKH A;  1VQL Q;  2DZ9 A;  1WQ7 A;  5FRN A;  5CAI A;  5IT9 E;  3SB2 A;  1W2B S;  3FJP A;  3GBQ A;  4A4G A;  1VQL T;  4Z02 A;  3EH2 A;  1AHJ B;  4C8Q C;  3EAE A;  1YI2 T;  3QJ6 A;  1D0X A;  1YJN A;  2DD4 A;  1KHI A;  1K9M R;  2R57 A;  2O88 A;  1WXT A;  2HQX A;  2MK5 A;  1VA7 A;  2VXF A;  1W2B P;  2LCS A;  2ECZ A;  3MCA B;  2LJ1 A;  2XU8 A;  3D7S B;  1OEB A;  5AT1 B;  1JU5 C;  1WXB A;  2BE9 B;  2DA9 A;  3LYI A;  1I4K 1;  2ZGW A;  2EWN A;  3PFS A;  4C8Q F;  1VQ7 A;  3CCJ A;  1U06 A;  2QQS A;  4RTV A;  4FYW B;  5EC7 A;  2NWM A;  2EIF A;  2AKL A;  4QT7 A;  4OMF B;  1BIA A;  4DOV A;  1IRE B;  1D1B A;  1M30 A;  2QQR A;  2EGA A;  4C0D B;  2EAY A;  2X3X D;  1TUD A;  2XG8 D;  4J7F A;  2CP3 A;  1VQO A;  3RDV A;  3JCM V;  1NJI C;  4XQ3 A;  3FJ5 A;  3VJP A;  2COZ A;  4C5H A;  3JCM P;  4M77 E;  3X25 B;  2JS2 A;  1OZ3 A;  2VC8 A;  2WAC A;  3OYG A;  2QTV A;  2L3S A;  2O2O A;  2GCX A;  1NEG A;  5KYW B;  1CSK A;  4GLK A;  3M4Y A;  4M75 C;  1RAG B;  1OI1 A;  2K7A A;  2RM4 A;  2CH4 A;  1HJD A;  4M7A F;  1KQS P;  1WJS A;  2AT1 B;  2LT1 A;  2K4Y A;  3ZFJ A;  2NUZ A;  3RKY A;  3EG1 A;  5GAN f;  5CKE A;  4UC4 A;  4FSS A;  1M90 U;  1U3O A;  2BIV A;  4XTX A;  2E5K A;  1VYU A;  1PD0 A;  1M2O A;  4C5I A;  5LJ3 f;  1G2B A;  1YCY A;  4A4K A;  1AZG B;  3EG9 A;  4M7A C;  2X4J A;  2QA4 A;  2YRV A;  2RJD A;  3NTH A;  1C1A A;  2MMP A;  3OW2 S;  2OTL T;  1RAC B;  1PC0 A;  2DL8 A;  3G6E Q;  2WSF E;  1K8A R;  3CCR T;  4IUP A;  5GAO r;  3CCM A;  2HEQ A;  2E6Z A;  4N0A C;  1RAH B;  4L6V 5;  1QVP A;  3QUI A;  2NUP A;  1ABO A;  3M59 A;  2HSE B;  2RA2 A;  1FXX A;  4RTU A;  1FYN A;  3U23 A;  1IGU A;  2F5K A;  4KGV B;  4Z8A A;  5IHN A;  2HD0 A;  4JLG A;  4XU3 A;  2G6F X;  1TG0 A;  1WHK A;  3DLL A;  1ARK A;  3CCE A;  2RQV A;  3V7R A;  1NJI R;  3CC4 T;  2DTI A;  1QVG A;  3MEA A;  3VUB A;  3CCQ T;  3S6W A;  4MMK A;  5I21 A;  2E3I A;  2RI2 A;  1YJ9 A;  2MWP A;  1UUE A;  3CCS A;  5DY9 A;  1EX4 A;  1M2V A;  1D1C A;  1NPR A;  4WTO B;  2CZ6 B;  2QDY B;  2YXY A;  5GAO l;  3LWI A;  4HVW A;  4K11 A;  2H8H A;  3N5B B;  4F7U B;  5A0G A;  5GAO m;  1BK2 A;  3H0F A;  2RHU A;  3KUF A;  1T0J A;  2KRO A;  2DEQ A;  4R55 A;  4HVV A;  1EZZ B;  4C8Q G;  2JOY A;  2YLB A;  2JMC A;  1YIJ Q;  1VQM Q;  1ZQ1 A;  2SRC A;  3VS1 A;  3HL8 A;  2LX9 A;  4FCY A;  1AOJ A;  2ZPG B;  2E5Q A;  2DO3 A;  2F2V A;  1Q95 G;  5C6S A;  2F1L A;  1N9S A;  1X69 A;  2CP5 A;  1FMV A;  3CCL A;  4EDU A;  3FDR A;  4RCC A;  1IHV A;  1VQ5 T;  3WXM B;  1VQ9 A;  3CC2 T;  4M7D F;  4CC2 A;  5GAO p;  2XD0 A;  1J3T A;  2DD5 A;  3H0H A;  1H64 1;  4C5E A;  1XJW B;  3L2U A;  1AWJ A;  1WYX A;  2YUO A;  2EGC A;  4RTX A;  2PUO B;  3M0P A;  4N4H A;  1VIE A;  2DL5 A;  3NTI A;  3OYE A;  5GAN d;  3RKX A;  4LUD A;  1VOM A;  2A3L A;  3X20 B;  2VGM A;  3OY9 A;  1UFF A;  2PU9 B;  3NFC A;  4M78 D;  2R58 A;  1MND A;  3RER A;  4BD3 A;  2DVE A;  4X9C A;  4EMK C;  3WVE B;  4M7D A;  1FMK A;  2M02 A;  4OMQ A;  2HMA A;  1GRI A;  3G4S Q;  1YI2 Q;  2A7Y A;  2ENM A;  3L1A A;  2CZ0 B;  3UA6 A;  3FIF A;  2YRD A;  4M75 G;  3OYC A;  2DM1 A;  2MI6 A;  2LQW A;  4BE0 A;  1RI0 A;  8AT1 B;  2K3Y A;  5CK9 A;  4HCC A;  2RK2 A;  1VQ7 T;  3P8H A;  5CCA A;  1JJ2 S;  2DX1 A;  3CCU Q;  3CCQ A;  1OPL A;  2M51 A;  3CCL T;  1W2B A;  1VQP T;  3EFS A;  1Q81 C;  4ZNX A;  3G6E T;  4D8D A;  3QZ5 B;  1R8O B;  3JV3 A;  1Y07 A;  5LJ3 e;  4EPC A;  5LJ3 h;  2C0T A;  4M78 B;  1TTH B;  3JSC A;  4QVZ A;  2FL7 A;  5KYN A;  3G1J A;  4AMC A;  1VQ6 A;  2C06 A;  3M0R A;  3TCJ A;  2DBM A;  4QVD A;  4DBH A;  1KHC A;  4C8Q B;  2KNB B;  4PNO A;  4MDX A;  1RLQ C;  2EBP A;  3I5R A;  2WSC E;  1V76 A;  4OB1 B;  3A8G B;  1N8R U;  3JCM X;  2A28 A;  1VQ8 Q;  2P84 A;  1PD1 A;  2HCK A;  4JJC A;  4M7A D;  3CCS T;  4CI0 C;  4XTV A;  4E2F B;  3OYA A;  1K8A U;  2SEM A;  1M4Z A;  4C92 D;  2QAZ A;  3CC4 A;  3MP1 A;  1X27 A;  2A37 A;  3EFR A;  1MMA A;  3E9G A;  1AWX A;  2ZPF B;  2BUD A;  2M16 A;  4QW2 A;  4BE1 A;  2XHC A;  1BU1 A;  1SRL A;  4B9X A;  1VYV A;  1HK9 A;  2DMO A;  1VYT A;  3M0Q A;  4TVR A;  1WA7 A;  1JQQ A;  1W70 A;  3VYG A;  2J7I A;  2YDL A;  3I55 T;  1TS9 A;  3CME A;  4Y28 E;  3NTK A;  1XQH A;  2E3H A;  4MZM A;  2DF6 A;  5HK0 A;  1ZSZ A;  1WIE A;  1OZ2 A;  2DZC A;  2JTM A;  2M1H A;  4WCI A;  4J83 A;  1QVF S;  1SKU B;  3OW2 P;  2C0O A;  4IUU A;  1OU9 A;  2LQN A;  1SSF A;  3TQ7 P;  4FIB A;  2F5T X;  4LE9 A;  1UJ0 A;  5GMK j;  3JB9 H;  1VQK A;  1PHT A;  5LJ3 g;  2RQR A;  1SSH A;  1D3B B;  4GBQ A;  4R56 A;  4E7J A;  2L89 A;  1I0C A;  2Y90 A;  3QJY A;  3CPF A;  2EKO A;  2DTO A;  2JTE A;  4J9G A;  3TRE A;  3JCM e;  3FEO A;  4N4G A;  4LDX A;  4RTY A;  2FG0 A;  3JCM h;  3PVQ A;  2E41 A;  1VQ9 T;  1TOV A;  3QWX X;  1PRL C;  2QXF A;  1JXM A;  1QMC A;  4OML A;  3EG0 A;  3L42 A;  1ZUY A;  1YJW A;  4BI4 A;  2EYX A;  3I55 Q;  2XIC A;  2K5L A;  1JJ2 P;  4KH1 B;  4E7S A;  3RUX A;  4PFP A;  2OAW A;  3REB B;  3GNF B;  4FM4 B;  4M77 C;  2QYZ A;  4M75 F;  2L3R A;  8ATC B;  2D0Q B;  2VKN A;  4B9W A;  4C5G A;  2O4X A;  1X6B A;  3G71 T;  3JCM b;  1QVG S;  4BDZ A;  3VRY A;  3G6E A;  4HXJ A;  2XID A;  1VQP Q;  2YSQ A;  1HD3 A;  2NLU A;  1QWE A;  3OYD A;  2V8I A;  3CCU T;  1NJI U;  3M57 A;  2B8A A;  2J6K A;  5D6Y A;  2LZ6 B;  2RPN A;  1BBZ A;  1F1B B;  3MEV A;  2LQK A;  3M56 A;  1QWF A;  5HCK A;  2CUB A;  3MPU B;  2RJE A;  3CC7 T;  1UGS B;  1Y57 A;  4BDY A;  2VV5 A;  2KAF A;  2XDD A;  2CS7 A;  1YJN Q;  4MZT A;  2LMJ A;  3EGX B;  4OMO A;  3JAM E;  5I22 A;  1UGV A;  4LDV A;  3OYM A;  3DKM A;  1TSF A;  2EYQ A;  1YCS B;  4OB3 B;  3M55 A;  3CXC S;  3JB9 G;  4OB2 B;  3G7Z A;  3A1P A;  1XNI A;  1PM3 A;  2RN8 A;  3OYN A;  4FW1 A;  1TUC A;  3SFM A;  3PMT A;  2DL7 A;  3V8L A;  3HSB A;  1NG2 A;  2J05 A;  3JCM f;  1SHF A;  2GBQ A;  2JM9 A;  3GP8 A;  4EMK B;  3KBG A;  3CCR A;  3RNJ A;  3SHW A;  4M77 D;  3CQT A;  4BE2 A;  1VQ7 Q;  3CCJ Q;  1M3B A;  1D1A A;  1OUL A;  2FYK A;  5L8R E;  4XTU A;  2YLC A;  1X43 A;  4ESR A;  1UEB A;  2EQU A;  4DEX A;  2E1H A;  2L3Q A;  4A53 A;  3EHR A;  3S3N A;  3THK A;  4AG1 C;  7AT1 B;  5LJ5 j;  3PTA A;  1PNJ A;  3URG A;  3UPU A; 
#chains in the Genus database with same CATH homology
 3CD6 T;  2EFI A;  5GAM g;  3CCR T;  4IUP A;  2JN0 A;  5C0M A;  5DLO A;  3CCM A;  5GAO r;  1M90 C;  1BIB A;  5KH6 A;  2E6Z A;  4N0A C;  4XTW A;  4KT0 E;  1RL2 A;  1PSE A;  4L6V 5;  2X4W A;  4C8Q E;  1QVP A;  3T9N A;  3QUI A;  3RMS A;  3CC7 A;  1Y71 A;  2ZCF B;  1GXI E;  2RHI A;  3M59 A;  2RA2 A;  2QA4 T;  1M5Q 1;  3FC3 A;  1FXX A;  2RHX A;  5LJ5 f;  1Q7Y C;  4M78 A;  3OS2 A;  2KK4 A;  4ZN1 A;  5GAN 7;  4NOY A;  1Q82 C;  3RIR A;  2MAM A;  2F5K A;  3M53 A;  3ER0 A;  3MET A;  1VQ8 T;  3HRS A;  2QQ9 A;  5A2Q E;  3V8K A;  1Q7Y U;  3ZBD A;  2XDP A;  5GAN 8;  5CKF A;  2E65 A;  2HD0 A;  3E19 A;  2O01 E;  4J6Y A;  4JLG A;  4KBM B;  3OYB A;  1KD1 U;  4NL2 A;  4XU3 A;  3OA6 A;  4M7D D;  3DLL A;  4NL3 A;  3CCE A;  4QQD A;  2RI5 A;  2EJ9 A;  3CD6 A;  3V7R A;  3GPL A;  3FRN A;  1VIF A;  2JTF A;  2LT4 A;  2DTI A;  3CC4 T;  1QVG A;  3MEA A;  3VUB A;  3CCQ T;  4O6J A;  3PGG A;  3PMI A;  4FT2 A;  3FLG A;  4MMK A;  3S6W A;  1O75 A;  3C4S A;  3UWN A;  3VUZ A;  1LNX A;  2RI2 A;  2K2V A;  1M1F A;  4BY6 C;  3KXT A;  3JCM W;  1QP3 A;  3Q1J A;  3J81 E;  1BI2 A;  3ASK A;  5FRM A;  1YJ9 A;  2MWP A;  1V29 B;  4MZP A;  4M77 F;  5GAN 5;  4XU1 A;  4C8Q D;  3CCS A;  4LDY A;  4LDW A;  2P0P A;  5DY9 A;  4BAC A;  1KC8 U;  3OW2 A;  1Y96 B;  2ZPH B;  2QI2 A;  3CCE T;  1NPP A;  4A4H A;  3RKW A;  4RKU E;  3M5A A;  5DLQ E;  2RH2 A;  4C92 G;  3A5Z B;  4MML A;  1NPR A;  3L2V A;  2EQK A;  1M1K U;  3FB9 A;  4C92 C;  5LJ5 h;  2CZ6 B;  2QDY B;  1YIT A;  3HRU A;  4XU0 A;  5GAN j;  5LJ5 e;  3E1S A;  4GY5 A;  4V2S A;  1YIJ T;  1WNL A;  5GAO l;  4JS4 A;  3SWN A;  3LWI A;  3CPW A;  3OB9 A;  1U1T A;  4II1 A;  5M9O A;  1YJ9 T;  1U1S A;  3CEY A;  4F7U B;  3N5B B;  4DQ2 A;  5A0G A;  5GAO m;  2VXE A;  2RHU A;  3KUF A;  4PKC C;  1JBM A;  4HCB A;  2DEQ A;  3BDU A;  5LJ3 d;  4R55 A;  1P92 A;  3VV0 A;  3L2Z A;  3P8D A;  4A4F A;  4EMH A;  2AHJ B;  1JJ2 A;  3DB4 A;  3BFM A;  4C8Q G;  2K5I A;  2RHY A;  4HCZ A;  4HKE A;  4N0A A;  2JOY A;  2YLB A;  1G3Y A;  3CC2 A;  4IUQ A;  2PQW A;  1NE8 A;  4PJO F;  1ZQ1 A;  1KQ2 A;  4J6X A;  3HL8 A;  4JLI A;  3QYH B;  3JB9 D;  3AHU A;  2LCC A;  2LX9 A;  5I2S A;  4YTL A;  2DTH A;  1U8R A;  2ZPG B;  1N27 A;  2E6N A;  2RK1 A;  5GMK l;  2E5Q A;  4M78 C;  2VYT A;  3VKI A;  5GMK h;  5GAM h;  1EIF A;  3BW1 A;  3M4G A;  1O9S A;  2DO3 A;  4ZGE B;  5C6S A;  3QBY A;  4L59 A;  4MDW A;  5CQY A;  3L2W A;  2QEX A;  1WPY A;  5A0L A;  3P8B B;  1N9S A;  1VQP T;  2X4Y A;  2CKK A;  3DLM A;  1G5V A;  1H3Z A;  1K9M C;  3QKJ A;  4KUL A;  3CCV T;  4BUG A;  3CCL A;  2LTO A;  2LVM A;  4ME7 A;  4EMG A;  1S72 A;  5J26 A;  5GAO q;  4EDU A;  4ATO A;  3FDR A;  4RCC A;  3ME9 A;  4A54 A;  3CCU A;  4PJO B;  3SWN C;  1VQ5 T;  4M75 D;  3WXM B;  2CZ7 B;  4F7U G;  1QP2 A;  2RO0 A;  2DXB A;  1M8V A;  1VQ9 A;  4E47 A;  4PLI A;  3CC2 T;  4M7D F;  5GAO p;  2XD0 A;  1N6A A;  2DD5 A;  1H64 1;  3C12 A;  4C5E A;  3PIP A;  2PUK B;  4KUI A;  3SWN B;  3V8J A;  3LW5 E;  1KQ1 A;  3JCM c;  3L2U A;  3JB9 I;  2M0O A;  1JB0 E;  3H6Z A;  4PJO G;  2YHT A;  2PUO B;  3X28 B;  3GIB A;  4NS5 A;  3QSU A;  4N4H A;  1I81 A;  4C0F A;  3OYJ A;  1VQM T;  1VIE A;  1WJQ A;  3NTI A;  5FU7 C;  1NZ9 A;  5GAN d;  5GAN 2;  1WQW A;  3OYE A;  2PVD B;  3RKX A;  4M78 G;  4OF1 A;  5IAY A;  1YBY A;  4WF2 A;  4JRQ A;  1UGQ B;  2A3L A;  5GAM f;  4OVA A;  3X20 B;  4IKF A;  2VGM A;  3S3M A;  3HRT A;  2KY9 A;  2CZ1 B;  2DXT A;  2VGN A;  3OY9 A;  2MF2 A;  2XK0 A;  2PU9 B;  3CBP A;  3MP8 A;  3LWH A;  3M9Q A;  3OMG A;  2LCL A;  3NFC A;  5EG2 A;  4DOW A;  1VQ8 A;  4M78 D;  3JCM Q;  3HFO A;  3CPW S;  3JCM d;  2IG0 A;  2E12 A;  2R58 A;  4M75 E;  3RMQ A;  4LDU A;  5LJ5 g;  4ELY C;  4OB0 B;  2MWO A;  4E7K A;  1N8R C;  3RER A;  4ZGJ B;  5LL6 S;  4E7H A;  4BD3 A;  2DVE A;  4X9C A;  3X24 B;  1QW1 A;  4EMK C;  2OAU A;  3QZ9 B;  3V7C A;  5KCH A;  3OYL A;  3WVE B;  1VQ4 T;  4M7D A;  3PT9 A;  4J5Y A;  4X34 A;  3GOX A;  1YIJ A;  5FU6 B;  5GAN 3;  1VQM A;  3MEU A;  2XKO C;  2KDS A;  2KQW A;  4HT8 A;  2A7Y A;  1ZHI A;  4VUB A;  3L1A A;  4E7L A;  1TH7 A;  4J7I A;  2CZ0 B;  3FIF A;  4M7D B;  4M75 G;  2BKD N;  5J3B A;  3OYC A;  4DA4 A;  3OS5 A;  2RHZ A;  1X6O A;  2FVU A;  2Y4X A;  2MI6 A;  4JRI A;  1K8A C;  3CCV A;  4XTY A;  4BE0 A;  1RI0 A;  1IZ6 A;  2K3Y A;  2DK3 A;  2XI9 A;  1BI3 A;  3OYF A;  1VQO T;  5FU6 C;  5CK9 A;  4HCC A;  2RK2 A;  1VQ7 T;  1X01 A;  2QEX T;  4J8O A;  2DXC A;  3P8H A;  1KD1 C;  5CO7 A;  5CCA A;  1JJ2 S;  2RJC A;  3QO3 A;  1Q86 U;  4M78 E;  5DM7 R;  2GF7 A;  2QQA A;  3HP9 A;  4IUR A;  5FRO A;  1UGR B;  3OYY A;  3CCQ A;  2ZPE B;  1MGQ A;  2QTX A;  3CCL T;  3QXE B;  5I21 A;  1W2B A;  4XTZ A;  3EFS A;  4M78 F;  4BB7 A;  4CRI A;  2V8K A;  3CME T;  2EJF A;  3X26 B;  3G6E T;  1DJ7 B;  3OBW A;  2DIQ A;  4HT9 A;  4C92 E;  2R5M A;  5CKB A;  3QZ5 B;  2O4X B;  1PSF A;  1R8O B;  3SD4 A;  1Y07 A;  5LJ3 e;  2FB7 A;  4EPC A;  3O8V A;  1QVF A;  2RD1 A;  4ZTJ A;  5LJ3 h;  4M78 B;  3LGL A;  1WJR A;  3ZEH A;  3JSC A;  5GAM d;  1UGP B;  2RB6 A;  4QVZ A;  2ZZD A;  4P5N A;  4RMO A;  1I8F A;  2FL7 A;  4Y91 A;  2K3X A;  4A4E A;  2E64 A;  2CYZ B;  4Q5W A;  4F7U E;  5D6W A;  3I56 A;  1VQ6 A;  2C06 A;  3A8O B;  5CQX A;  3TCJ A;  2LDM A;  2LRQ A;  4PJO A;  4QVD A;  3OBY A;  3J80 E;  3MHX A;  1Q81 U;  1KHC A;  3MO8 A;  4L5G A;  4C8Q B;  4C92 B;  4PNO A;  4F7U F;  4MDX A;  3V7S A;  4JS5 A;  2WSC E;  4OB1 B;  1VQ4 A;  4OGC A;  4M75 B;  3A8G B;  3CMA A;  5GAN 6;  3JCM X;  5FLX E;  4QVC A;  3JCM g;  1N8R U;  2OTJ T;  2F69 A;  3A8M B;  5GMK m;  3LLR A;  3OSS C;  4M7A D;  1OYX A;  3CCS T;  2Y4Y A;  4BI8 B;  4XTV A;  2X35 A;  4CI0 C;  3E9F A;  2OTL A;  3PNW C;  4F7U A;  1LJO A;  3OYA A;  3F70 A;  4O5V A;  1K8A U;  3A8H B;  2DIG A;  4E7I A;  4PL6 A;  1M4Z A;  4C92 D;  4JJN K;  1BI1 A;  4C0Z A;  3JB9 J;  1VQN T;  4QQ6 A;  2P4T A;  2DPP B;  3CC4 A;  3MP1 A;  2G3R A;  1G3T A;  2PVO B;  3QDR B;  3I55 A;  3EFR A;  5KCO A;  4ZN3 A;  3R6O A;  3E9G A;  3G4S A;  1YI2 A;  1YHQ A;  3JB9 F;  1M1K C;  2ZPF B;  5GAM e;  5CIU A;  3MP6 A;  2R5A A;  2BUD A;  2M16 A;  4QW2 A;  4RG2 A;  4BE1 A;  2XHC A;  4FL6 A;  4B9X A;  4QQG A;  1HK9 A;  1B34 A;  2WSE E;  3QHS A;  4FT4 A;  5GAN h;  5CR2 A;  2LQ8 A;  4TVR A;  4EMK A;  3VYG A;  4M7D G;  3SDZ A;  2DKG A;  3BY7 A;  4J6W A;  5LJ5 d;  2E70 A;  2GFA A;  3I55 T;  5LJ3 j;  3CME A;  4M7D C;  1VQP A;  4IUV A;  1MHN A;  4IUT A;  4M7A E;  2LC4 A;  4Y28 E;  3UDC A;  2KVQ G;  3NTK A;  4BI3 A;  2H3J A;  1XQH A;  4MZM A;  1Y96 A;  5HK0 A;  3HPW A;  4ELZ C;  5CVI A;  1K73 C;  5CKH A;  1OZ2 A;  2DZC A;  2JTM A;  2DZ9 A;  2M1H A;  1BKB A;  1WQ7 A;  5CAI A;  4M77 A;  4RCB A;  4J83 A;  5IT9 E;  5FRN A;  1QVF S;  3SB2 A;  2JZ2 A;  1W2B S;  3FJP A;  4IUU A;  4A4G A;  1VQL T;  4Z02 A;  1SSF A;  1KC8 C;  1B34 B;  4FIB A;  2F5T X;  3J7A F;  2OTJ A;  5GMK j;  1AHJ B;  3JB9 H;  4X9D A;  4C8Q C;  5KE2 A;  3M58 A;  1VQK A;  5LJ3 g;  3EAE A;  1Q86 C;  1D3B B;  4M7A B;  1LOJ A;  1YHQ T;  1YI2 T;  3VYH B;  2LNV A;  3QJ6 A;  1ZBX A;  2FHD A;  1YJN A;  2DD4 A;  1KHI A;  2CGH A;  5GMK i;  5D6X A;  1YIT T;  4R56 A;  3QPH A;  3I56 T;  2R57 A;  4E7J A;  1KQS A;  5GAN 4;  2L89 A;  2RI3 A;  1VQ5 A;  2Y90 A;  1K73 U;  3QJY A;  3CPF A;  3TEE A;  4OP0 A;  4ZGD B;  2EKO A;  2DTO A;  2HQX A;  4N4I A;  2VXF A;  2D6F A;  2P0Q A;  5IN1 A;  3QG1 A;  3JCM J;  4JRP A;  3MCA B;  3JRZ A;  3TRE A;  3FEO A;  2L5Q A;  3BDL A;  4N4G A;  3JCM e;  4LDX A;  2RJF A;  2DAQ A;  2XU8 A;  3JCM h;  3CBM A;  2E41 A;  1VQ9 T;  4JUV A;  2HAX A;  2E10 A;  2QXF A;  1D3B A;  4C92 F;  2DXU A;  5GAM j;  3HFN A;  3OSV A;  1KQS S;  4HA8 A;  3L42 A;  3OS0 A;  3OYH A;  4OGE A;  1WGS A;  3CCJ T;  1M1G A;  1YJW A;  2PVG B;  4JDS A;  4M77 B;  4BI4 A;  2XIC A;  2K5L A;  2EJG A;  1K9M U;  3LYI A;  1I4K 1;  3RUX A;  2X4X A;  2EWN A;  2ZGW A;  3PFS A;  4C8Q F;  1VQ7 A;  3CCJ A;  3M54 A;  3GNF B;  2L8D A;  3HKS A;  3QII A;  2VUB A;  1N9R A;  4FM4 B;  1XTD A;  4M77 C;  1BYM A;  2QQS A;  3C94 A;  1W4S A;  2L3R A;  3HHT B;  4M75 F;  4XAX B;  1VQN A;  4PJO C;  2K57 A;  2D0Q B;  1UB4 A;  4B9W A;  4C5G A;  1Q82 U;  2O4X A;  1FWZ A;  2EIF A;  3G71 T;  4LD6 A;  3JCM b;  3CCM T;  1QVG S;  4C8Q A;  4BDZ A;  3OMC A;  3DB3 A;  4OMF B;  3GLX A;  3G6E A;  1BIA A;  3VU3 C;  4DOV A;  1IRE B;  5GAN g;  3OYK A;  4PJO D;  2JVV A;  2XID A;  3OYI A;  4XK8 E;  2NLU A;  3H8Z A;  3OQ5 A;  3CMA T;  3OYD A;  2V8I A;  3CCU T;  2QQR A;  4BY6 B;  1BI0 A;  2KSS A;  3M57 A;  1NJI U;  1G3W A;  2B8A A;  5GMK e;  2JUF A;  3QYG B;  1G3S A;  2GQV A;  5D6Y A;  3UT1 A;  1VQL A;  5AYF A;  2HNI A;  2KMT A;  4C0D B;  2EAY A;  5KE3 A;  1YJN T;  4J7F A;  2XG8 D;  4M7A A;  1VQO A;  5I2M A;  3JCM V;  3G71 A;  1NJI C;  4XQ3 A;  1VQK T;  3VJP A;  1Q81 C;  3MEV A;  4C5H A;  4C92 A;  2GFU A;  2K5F A;  2LQK A;  2EQJ A;  3M56 A;  4M77 E;  3JCM P;  3WVD B;  2D9T A;  3X25 B;  1OZ3 A;  3CXC A;  2VC8 A;  2WAC A;  1I5L A;  2RJE A;  3CC7 T;  3OYG A;  1UGS B;  3G4S T;  4BDY A;  2GCX A;  2KAF A;  2VV5 A;  2XDD A;  2CS7 A;  3MEW A;  4FU6 A;  5GAO n;  2QQB A;  4MZT A;  4M77 G;  3CBO A;  3TU4 K;  3JAM E;  4ZTF A;  4GLK A;  4PLL A;  3PIO A;  3GF5 A;  5A0D A;  3M4Y A;  4LDV A;  4M75 C;  1M9S A;  3RES A;  3OYM A;  3LH0 A;  3DKM A;  5J39 A;  4RG8 A;  1OI1 A;  2EYQ A;  4OB3 B;  3M55 A;  3S3O A;  4PJO E;  3CXC S;  3JB9 G;  4OB2 B;  3G7Z A;  1FX7 A;  3L2Q A;  1XNI A;  2RM4 A;  1KG1 A;  3LX7 A;  3GNG A;  3OS1 A;  3OYN A;  4M7A F;  2EQM A;  3L2R A;  2I2L A;  1WJS A;  2LT1 A;  2P0K A;  3A8L B;  3INZ A;  5HY6 A;  2K4Y A;  1Y7X A;  3SFM A;  3PMT A;  2HQE A;  1YJW T;  3ZFJ A;  5HKC A;  2HBP A;  3V8L A;  3JCM f;  3HSB A;  1JRI A;  3RKY A;  5GAN f;  2IVW A;  3GP8 A;  5CKE A;  4M75 A;  4UC4 A;  4EMK B;  1M90 U;  2DJZ A;  2BIV A;  2M9U A;  3KBG A;  4XTX A;  3CCR A;  1S72 T;  5CKD A;  4KUD K;  1VQ6 T;  5HK3 A;  2ZPI B;  4M77 D;  4C5I A;  1XOV A;  4M7A G;  2ZPB B;  5LJ3 f;  1X75 C;  4BE2 A;  2JNG A;  1YCY A;  4FSX A;  4C0G A;  3C95 A;  4A4K A;  4XU2 A;  2FYK A;  4M7A C;  3LGF A;  2X4J A;  4XTU A;  2YLC A;  5L8R E;  4C0D C;  2QA4 A;  2YRV A;  4M7D E;  2RJD A;  3NTH A;  1UEB A;  2EQU A;  2E1H A;  4A53 A;  2MMP A;  1HXD A;  3S3N A;  5GAN e;  3OW2 S;  4LD9 K;  5LJ5 j;  3PTA A;  2OTL T;  5FU7 B;  2V8J A;  4JRK A;  3URG A;  4D6W A;  2WSF E;  2XDB A;  3UPU A;  1VUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...