2RJEA

Crystal structure of l3mbtl1 in complex with h4k20me2 (residues 17-25), orthorhombic form ii
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
313
structure length
309
Chain Sequence
b'WSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lethal(3)malignant brain tumor-like protein
publication title L3MBTL1 recognition of mono- and dimethylated histones.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 84
structure length 309
sequence length 313
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rjeA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rjeA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rjeA03
2MWOA 2RHIA 3O8VA 4EDUA 2RHYA 3OMCA 2QQRA 2XDPA 3OYBA 3F70A 4QVZA 5C6SA 1OZ2A 2EQMA 3NTIA 2BUDA 2RI3A 5KH6A 2G3RA 2M0OA 3OS2A 2EQUA 3Q1JA 3L2UA 2RJDA 3L42A 1N27A 4N4HA 3S3MA 2X4XA 5CIUA 3ME9A 3GOXA 2RHXA 3OYJA 4IURA 4BDZA 3EAEA 2XK0A 2X4WA 5FROA 3S3OA 4A4FA 4X34A 2MWPA 2BIVA 3BDLA 3OYFA 2R57A 2LDMA 2WACA 3DB4A 3FLGA 4BACA 2E5QA 3LX7A 4PLLA 4PL6A 3ZEHA 5KCHA 3OYEA 4N4IA 2EQKA 1G5VA 4N4GA 2F5KA 2L8DA 3KUFA 4QQGA 4E7IA 3P8HA 4C5IA 4HCZA 3MP6A 3PMTA 3FDRA 3S3NA 3MEUA 5D6XA 5J39A 2RJFA 3OYAA 1H3ZA 4IUQA 4C5GA 4ZTFA 5IN1A 3H8ZA 4UC4A 3OS1A 2VYTA 2EQJA 2RHUA 2D9TA 4Z02A 3P8DA 3DLMA 1OYXA 3MEWA 1WGSA 3L2WA 2K3YA 2P0KA 2CKKA 3FEOA 3CEYA 3QBYA 3NTKA 4IUVA 5D6YA 4FU6A 4BDYA 2RJCA 3OQ5A 2YRVA 4IUPA 2RJEA 1RI0A 3MO8A 2PQWA 3OYHA 4IKFA 5M9OA 4BD3A 2EFIA 4CRIA 3META 5J26A 4Q5WA 3PFSA 4ZTJA 4B9XA 2DIQA 1WJSA 3PMIA 5KE3A 4QQ6A 3L2VA 1KHCA 3OYDA 3OA6A 4BE1A 4PLIA 2O4XB 1WJQA 3SD4A 4IUTA 2X35A 3OYLA 3LGLA 3NTHA 2L89A 5KCOA 3QIIA 3S6WA 2M1HA 4BE2A 3QKJA 4QQDA 3OYCA 2JTFA 3LH0A 3MEAA 4LD6A 2GF7A 1OI1A 4E7KA 3H6ZA 3MP8A 3OMGA 2DAQA 4II1A 4IUUA 4L59A 1MHNA 3OYNA 2GFUA 3OB9A 2RHZA 2LRQA 2O4XA 4GY5A 3MEVA 2M16A 4FL6A 5IAYA 4RG2A 4A4GA 4A4HA 3FC3A 2QQSA 4C5HA 2FHDA 1WJRA 3UT1A 5KE2A 2HQEA 2LTOA 2LVMA 3E9FA 3PNWC 2DIGA 3E9GA 4A4EA 2HQXA 4C5EA 5C0MA 2B8AA 2LCCA 1XNIA 3OYGA 2NLUA 3OYIA 3L2QA 4NS5A 2E6NA 2BKDN 4BE0A 3QJ6A 2R58A 2R5MA 1SSFA 2IG0A 4E7JA 3OY9A 4E7HA 3OYMA 3C4SA 3LGFA 3MP1A 3ASKA 4OVAA 2EKOA 2JZ2A 3DB3A 3LLRA 2RI2A 2R5AA 2RI5A 1OZ3A 4QW2A 2L3RA 2RO0A 2K3XA 5D6WA 5FRNA 3M9QA 5FRMA 3L2RA 2X4YA 3OYKA 3LYIA 4E7LA 4B9WA 3UWNA 2GFAA 3OS0A
chains in the Genus database with same CATH superfamily
5FWBA 1TUCA 8AT1B 5KYNA 5GMKh 1PSEA 1YJWQ 2DL4A 5C6SA 1VQOA 1VQKA 4OB0B 3GF5A 3QWXX 3M57A 3CD6Q 1D1CA 1V29B 4BDZA 3NMZC 5HCKA 3G6EQ 1G2BA 2K5LA 3CCJA 5GAN2 1DJ7B 4DOVA 4FSSA 2CP6A 3OYEA 1Q7YU 4JLGA 2GQVA 1UGVA 2DEQA 3CC4A 2VXEA 3V8LA 2PVOB 2Y90A 2EQJA 4JRKA 1WGSA 1R77A 4FSXA 3M4GA 1VQ7Q 1R0BG 2FO0A 4EPCA 4MDWA 1WXTA 3JCMJ 5GANj 1AHJB 1N9SA 4AFQC 4IKFA 1BI1A 2ZPFB 4R55A 3QG1A 1WXBA 4M75E 2LZ6B 1WJSA 2O88A 1MMDA 5GAOq 3G4SA 3J80E 4PJLA 5GAOr 2HKNA 1B7TA 1M3BA 3URGA 2Y4YA 2P0PA 2QA4T 3H6ZA 1I5OB 2W0ZA 4OGCA 4PK4A 1GBQA 2L5QA 2QQBA 5GANf 4M7AG 1KFZA 1YHQA 4C8QG 2QQSA 1KIKA 1QVFS 1K73C 4PFOA 2LTOA 2FVUA 3JB9F 2LCSA 3HSBA 2VVKA 4BE0A 3CXCP 1YP5A 5I21A 1LJOA 4M78B 3E1SA 5KYXA 1X01A 4X1VA 1LCKA 1OZ3A 1I0CA 1X43A 2D6FA 1A0NB 1FXXA 5J3BA 3I35A 2QTVA 3VYHB 3QZ5B 5CCAA 3JB9I 3F70A 4PJOC 2HKQB 1KQ2A 3GPLA 2M0OA 2BTTA 3WVEB 1QVFA 3GOXA 1VQKQ 4J9DA 2QG9B 2X4WA 2MWPA 2O2OA 2QYZA 3DB4A 3CCJQ 3LX7A 4PL6A 1UTIA 1IHWA 4HT9A 4JS4A 5LJ3e 3CCLA 4DBQA 1I07A 1D1BA 1MV0B 5KYUB 2RJFA 1KC8U 1U3OA 2KVQG 5IN1A 4DOWA 4F7UF 2LNHB 4OF1A 4HXJA 2PUOB 2XIDA 3QDRB 4K11A 2K5IA 1PSFA 2CP0A 1M1KC 2AKKA 2X4JA 4XTWA 4ESRA 5M9OA 2ZPBB 2NUTB 2A37A 2DXTA 4QQ6A 1RAIB 6AT1B 2QAZA 3D7SB 3NTHA 2J7IA 1TG0A 3A8MB 3CCUA 4LD6A 2QQAA 2ED1A 1X69A 2COYA 1M30A 1PD1A 5FU7C 4KULA 2GNCA 4KBMB 3I56A 3CBMA 3TSWA 4A4GA 1M27C 1ABOA 2FEIA 3EH2A 2IVWA 1UE9A 2DYBA 3HTRA 5KE2A 3PT9A 1NBEB 1V1CA 2J05A 1Q82C 4RTTA 5KYWB 3UA7A 5CK9A 4C92E 2D8HA 1Q95G 4P5NA 2KT1A 1Q7YR 4M77B 8ATCB 3X24B 2V8JA 2JMAA 2RQUA 5GAMg 4B9WA 3QJYA 3M54A 2CP5A 4JUVA 3MHXA 1SPKA 3OS2A 2XMFA 2C0TA 2OJ2A 3CMET 4M78G 3JAME 3L2UA 1N27A 2L3SA 2CH4A 3U23A 1AD5A 1VQ5Q 1K73U 3OBYA 1VQMT 3CCMT 2VUBA 4DQ2A 2LDMA 2DLPA 2ROLA 4EMKC 4N4IA 1G5VA 2XU8A 1E6HA 3JCMW 1I1JA 1UGPB 1WHGA 2KYMA 5GAOn 2P4TA 1JJ2S 3FRNA 3CCLQ 1XTDA 3RUXA 4C0FA 3L2ZA 3DKMA 1MMGA 1NPRA 2GCXA 3SWNC 1QVGS 1G83A 3L2WA 1OPLA 3EHRA 5D6YA 3LWIA 2KRSA 5DLOA 5GAOl 1VYUA 4AFZC 2KYBA 2D0NA 1Y0MA 2MAMA 4CRIA 1X27A 1JXMA 5GAMj 4OMOA 1YJNT 2JTEA 2QI2A 4BE1A 4M7AF 3VV0A 4C8QF 2JM9A 2OAUA 1YJ9Q 3UF4A 1D3BA 1Y96A 3CCUQ 1PRLC 3HPWA 4XTYA 1VUBA 4C92D 1EZZB 2LP5A 5GAMf 5LJ3d 3I56Q 4FW1A 2FHDA 2KK4A 4FW2A 1ZSZC 2KR3A 4E47A 1R8OB 4LD9K 3JCMP 2LCCA 3HRSA 1M1KU 2YUQA 3QYGB 1VYVA 3EG9A 2BE9B 2EW3A 1U8RA 2JZ2A 1VQ4T 5A0GA 2F5TX 4AFSC 2I2LA 3CCSQ 2DK3A 1VQPQ 2HSPA 1KC8R 3OMCA 2JUFA 1N6AA 1UFFA 2AHJB 4A63B 2PU9B 2VGNA 3I5SA 2V8IA 4M7DB 5HK3A 2HL3A 2RK2A 5CR2A 3G71A 4O5VA 1UB4A 3Q1JA 3L42A 4M77G 1TOVA 2DTIA 2A0FB 4JJBA 4LDWA 4WCIA 2XKOC 2BZ8A 1YCYA 3V8KA 2BIVA 1Q82U 1EX4A 4KGVB 1NG2A 1QCFA 2KAFA 2DERA 2YT6A 3VS2A 5A2QE 4BI3A 4Z8AA 3LWHA 1WHKA 1BI0A 1HYOA 1PC0A 2DMOA 3FJ5A 3SWNB 3C95A 3P8DA 2JOYA 1VQNQ 2RQVA 4FU6A 2FZGB 2E64A 1GL5A 1RI9A 4BY6B 2J06A 3V7RA 3OYHA 3J7AF 2DM1A 1HXDA 4C92A 1B07A 1IZ6A 2M9UA 4PFZA 3GIBA 4B9XA 1V76A 1XJWB 3OA6A 3JSCA 1Y71A 4PLIA 2O4XB 4N0AC 3R6NA 1S72Q 5GAN5 4RCCA 3ZBDA 1IGUA 2M1HA 1YFNA 2FZCB 3LH0A 2GFUA 3TU4K 3OB9A 2X3WD 1P92A 2LRQA 4CC3A 2EQIA 4J9CA 2H3EB 4NL2A 3VKIA 3RESA 2RPNA 2K2VA 1ZSZB 1UGRB 5C0MA 3GLXA 4ZNXA 1K73R 2KXDA 4M7AC 3CBOA 1BKBA 1HK9A 1SEMA 3TEEA 4OVAA 4LDXA 4M78F 4QW2A 2NUPA 3QXEB 1TUDA 3CMAT 4E7LA 4OMNA 3M55A 1KG1A 3H41A 2FB7A 2H8HA 3TVTA 2P4RA 3RERA 3EGXA 2M02A 2JS0A 3VS5A 3LH5A 2O9VA 3VS1A 2PUKB 3G71Q 1KK7A 2X4XA 4RCBA 1YITQ 3AT1B 4RTVA 2HEQA 1U1SA 2LJ3A 4A4FA 5ECAA 1JEGA 2LJ0A 1BI2A 4RTXA 4M7DG 5CQYA 1AZEA 1U5SA 1QMCA 1NLOC 3P8HA 4PJNA 1VQMA 2QXFA 1LPLA 4HCZA 1SKUB 2DL3A 2EGEA 3EGUA 5A0DA 4RTYA 1X2KA 3NHNA 1KQSS 3P8BB 3GNFB 1NJIC 3TREA 3INZA 3JCMf 4C0ZA 3MO8A 2OI3A 2DEUA 1M1KR 5KE3A 4NOYA 2LCLA 3OYDA 1WZOA 3V7CA 3EFSA 3REAB 1ZLMA 1AWJA 1WJQA 1GFCA 3R6OA 2L89A 2VXFA 1YI2T 3S6WA 1O9SA 2DKGA 1YJNA 1RLPC 2AT1B 1ABQA 4D8DA 3QZ9B 1UUEA 5IAYA 1M5Q1 2EYXA 1IB8A 1WPYA 5KYXB 1M90C 4M7AE 4F16A 1WJRA 2FG0A 4C8QE 2HQEA 3PNWC 2DXBA 3CCRT 2MIOA 1G3WA 1Q82R 1BIBA 4BB7A 2OTJT 2R58A 2ROTA 3MP1A 3ZEHA 2EKOA 2R5AA 2I0NA 3MKDA 5GMKj 4KH0B 2K3XA 1FX7A 4M77F 3JRZA 2FPFA 5I2SA 1QP3A 2DD5A 3M5AA 2RHIA 2YWWA 1J3TA 1VQ4A 5CKEA 3C94A 4J9FA 2RD1A 3RMSA 5GAOp 2JN0A 3ME9A 4A54A 3OSSC 3SB2A 4M78C 1SHFA 3CXCA 1CSKA 4FYYB 1W4SA 3QO3A 5GANg 2JVVA 2CDTA 3CCST 4OMMA 3HKSA 1VQ8A 2KRMA 5D6XA 4ZGJB 3A98A 1SSHA 1VQ9Q 2D9TA 3A1PA 3EG2A 3HHTB 1NE8A 4BDYA 3X20B 3C0CA 3UDCA 4L5GA 4QKUA 1RI0A 1RACB 1T3LA 4OMLA 3OYYA 1MUZA 2QGFB 4Z88A 4CC2A 5GAOm 1GRIA 4JLIA 5KCOA 1NEGA 1PCXA 4FM4B 1VQ6T 2L2PA 5LJ3h 3I9QA 2LNVA 4R56A 2YSQA 3MEVA 2HCKA 3WVDB 1WDXA 2KGTA 1K76A 2KSSA 1N8RC 3I55Q 3SEMA 2CUDA 1NJIU 1KQ1A 1M8MA 1VQLQ 4C5EA 3E9FA 4LXCA 2E10A 2E5KA 1W2BP 2EKHA 2KY9A 2IG0A 4E7HA 2E70A 2VASA 2RI2A 5CKHA 2RI5A 4HCCA 2EBPA 4XU1A 1HJDA 1WQ7A 1NYGA 4R0KA 3CC7Q 1N5ZA 3EHQA 4M7DF 2OTLQ 1BB9A 1UHCA 2E1HA 3CQTA 1YIJQ 1VYTA 5IH2A 2J6FA 2M0YA 1GCPA 4A53A 5I11A 2A28A 1IXDA 1JQQA 1M3CA 2RHXA 1M90U 2ZPEB 3N5BB 4IURA 2YRDA 3CCQQ 3H0HA 4M77C 5CKDA 1E6GA 1WHMA 4MZMA 1FMVA 2SEMA 2VB6A 3X26B 1BCMA 2LQWA 2DETA 5L23A 4XTUA 3FB9A 3VS0A 2Y4XA 2YUOA 2MCNA 2QEXT 5FW9A 5I2MA 1VQOQ 5CKBA 2DL7A 2CKKA 3QBYA 1IHVA 3J81E 4JS5A 2ZGWA 4QVDA 4J7FA 4FT4A 1D3BB 1Y96B 2H3JA 2JM8A 3CPFA 1WIEA 5AT1B 7AT1B 3CC4Q 4M75D 1Z9QA 3OYNA 2LX7A 3EGDA 3CC2T 4FL6A 3EG9B 1YI2A 2HQXA 2D0QB 2ECZA 2NLUA 1Y07A 2E6NA 2K7AA 4XK8E 4F04B 1SSFA 3G4SQ 3C4SA 3LGFA 5CKFA 4FIBA 1Z9ZA 1UEBA 2KE9A 3QPHA 3OYKA 3CCVT 4JPBW 2AZVA 2OTJA 3O8VA 3OSVA 2L0AA 1YHQQ 5KH6A 2MOXA 2EQUA 1Q81C 4XAXB 1JU5C 2XD0A 1TS9A 1T0JA 1N8RU 4M77E 2VV5A 1ZA1B 2F2WA 4J9HA 2LX9A 3S3OA 3CCET 1O75A 2CZ1B 2YUNA 5GANe 4M75G 5KCHA 1UDLA 2J6KA 2EQKA 3KXTA 4PJOE 3KUFA 1E7OA 4E7IA 3TQ7P 2YHTA 4Y92A 2CZ6B 2MF2A 3BFMA 2AIRB 4M7DC 2AZSA 3M0PA 2DVEA 1H3ZA 3RNJA 4C92B 3VJPA 3ER0A 5IXBA 1X2QA 3PIPA 3FEOA 2LC4A 2E3HA 4M75A 2RJCA 1NJIR 3OQ5A 4IUPA 4HCBA 2QQ9A 4J9IA 5CQXA 1PWTA 1NPPA 3META 2CUBA 2RQRA 2YUPA 2D8JA 4OB2B 4OP0A 2DBMA 1B34A 2PTKA 3QIIA 1YJWT 9ATCB 4BE2A 3MEAA 4IIMA 2LQNA 1ACMB 4E7KA 1OI1A 3PVLA 2FPDA 3CD6T 2MMPA 1MHNA 2IPOB 2RHZA 1WHHA 4BY6C 3G6ET 3CPWA 2M16A 3VYGA 1QCNA 2RK1A 4Z89A 1KJWA 2NUPB 1VQ6A 1M90R 2DXUA 1BIAA 3E9GA 2IIMA 5HK0A 2DL5A 3OYIA 4DEYA 3RDVA 2VWFA 4D8KA 2EVRA 5GMKi 3OYMA 2CP2A 4FYWB 2RA2A 1PKSA 3L2QA 3EGXB 2E12A 3V8JA 3L2RA 1ZBJA 1KHIA 3M0SA 1ZQ1A 2MWOA 5HY6A 1R0CB 1VQ7T 4Y28E 2KRNA 2QTXA 2QA4A 4NL3A 4GBQA 3I55T 4EIKA 1TWBA 2K3BA 3QWYA 5IHNA 3TSZA 4PJOD 2KT8A 2HL5C 1C0MA 3JCMQ 4RTZA 1QCOA 1NM7A 2BZXA 5GAN7 5LJ5g 1AZGB 1AT1B 4XU0A 3NFCA 4HVVA 4DBHA 4J6YA 1KD1C 3M0TA 2HBWA 2XDBA 1MMAA 3OYAA 1AWXA 4MMKA 4VUBA 4XU2A 1TH7A 3WXMB 5GAMh 2X3XD 2QK0A 3DLMA 4J9EA 4JRIA 4IUVA 4X9CA 1OU8A 2X51A 1U06A 5I22A 1TUGB 1Q81U 1OEBA 4JRQA 2QEXA 2F2VA 3PFSA 4XTVA 4CC4B 2XDDA 1X6BA 3FJPA 1MMNA 4C92G 3EFOA 2OX7A 3JB9J 1WFWA 2YLCA 1NLPC 1RL2A 2DVJA 1M1FA 4KRTA 3A8GB 3CPWP 4L59A 2ED0A 5GANd 1VQKT 5LJ5j 1NZ9A 2SRCA 3JCMX 3RIRA 4LNPA 4RG2A 2JJ9A 1OOTA 4AG1C 2LQ8A 3CCJT 2LVMA 4LDYA 2YDLA 3L1AA 4F7UE 5DLQE 3TCJA 3CC2A 2BKDN 2JT4A 2VGMA 3ASKA 4KH1B 1RAGB 2XICA 4PJOA 3HL8A 4AMCA 3JCMg 2X4YA 5LJ5f 3HP9A 1G8XA 4CI0C 4AT1B 2FRYA 1QLYA 1VOMA 2QQRA 1K0XA 4ZGDB 3AHUA 4JJCA 1OZ2A 3NTIA 1Y7XA 1JRIA 2RB6A 2G3RA 2K4YA 3CCVA 2YXYA 2A7YA 2C0OA 1UJYA 5CIUA 1QW1A 4MZPA 3JB9D 2HZYA 2EYWA 4X34A 2CREA 1UG1A 2WACA 2CGHA 1K9AA 1UECA 2ZPGB 1ARKA 5FWCA 5GAMe 2L8DA 2J6OA 4ZN3A 1OULA 3E2UA 4J6XA 3MEUA 5J39A 1YCSB 4ATOA 1I5LA 3H8ZA 1RAAB 1OYXA 2K3YA 3NTKA 2MI6A 4YTLA 3PE0A 1QKWA 3HFOA 4QVCA 3SHWA 2PQWA 1QQJA 3CMEA 4BD3A 4Q5WA 1U1TA 4ZTJA 3RKXA 2COWA 2E6ZA 1I81A 4QT7A 3CCMA 2MPXC 3UA6A 2XG8D 2YLBA 1KD1U 5HKCA 3OMGA 4MMLA 4IUUA 1VQ5T 3BY7A 2KNBB 2LMJA 1YJWA 2KBTA 4C5HA 2DE0X 1W2BS 1C6VX 2B8AA 1BI3A 1ZSGA 1H92A 4M4ZA 1GXIE 2HDAA 3QJ6A 1BCOA 3VRZA 3CCLT 1SRMA 2RO0A 1ZUKA 4AFUC 4RUGA 3X25B 4X9DA 1M2VA 5L8RE 4QVZA 2HD0A 1BYMA 2OAWA 2D1XA 2KDSA 3CXCS 2RJDA 2KROA 4EMKA 1KSWA 1W1FA 2DD4A 1Q81R 2CSIA 4E7SA 4XQ3A 2CT3A 1W2BA 1D0ZA 1YJ9T 5LJ5e 2CT4A 3OS5A 1YWPA 1VA7A 3X28B 3CCUT 1EIFA 4N4GA 2PNIA 2RN8A 1T0HA 2COZA 1HSQA 4M75C 3SFMA 3VS3A 3H9NA 3I56T 4UC4A 2QDYB 1X6GA 4Z02A 4C92F 2QGGA 1FMKA 1QWFA 1GFDA 4XTZA 3NPFA 1UJ0A 2YRVA 2LT4A 1PHTA 3OS0A 5FU6C 4PKCC 4F7UA 2DA9A 2DTHA 3PMIA 3CMEQ 1VQPT 1HD3A 1WNLA 3VS4A 3UATA 4LDVA 3EGDB 5IHIA 4IUTA 2EGCA 2X35A 5IT9E 1VQMQ 3CCMQ 1AOJA 2GF7A 3OW2P 1QKXA 2K79A 1OQKA 3PIOA 3HRTA 3H0FA 1GCQA 3THKA 5GAMd 1PD0A 2CSQA 2RM4A 1OX8A 4OMQA 2E3IA 5LJ3f 2ZCFB 1XNIA 3HRUA 2FPEA 1F1BB 3I5RA 4E6RA 5IHKA 4M7AD 2K9GA 4C8QD 3DB3A 3QYHB 4FT2A 3MCAB 1MNEA 2GTJA 4FYXB 3JCMe 1VQNT 3M4YA 2RNAA 2FL7A 1YJNQ 4ME7A 1OV3A 2DILA 1H3HA 2RHYA 1IGQA 3PGGA 1B3QA 1JB0E 2JS2A 1XOVA 4JJDA 2EJ9A 1Q86C 2GTOA 3KBGA 3S3MA 1WHLA 1IRXA 3OYJA 3BE3A 1S72T 1KQSP 3MJXA 1RADB 1FYNA 5D7UA 4LE9A 3OYFA 2R57A 2EJGA 3FLGA 2F69A 2PVDB 1TSFA 2RMOA 4KGXB 2F5KA 2PVGB 3QSUA 3O5ZA 3V7SA 2P84A 4M75B 3M53A 1KD1R 1H641 2ZPHB 2WSCE 3MP6A 1TTHB 4HCKA 5A0LA 3CMAA 1VQ4Q 1M3AA 2VYTA 3SDZA 2RQWA 4M78E 1SHGA 4E7JA 2P0KA 5KYYA 3C12A 4N0AA 3JCMV 1B34B 2RJEA 5FU6B 5GAN4 1K0SA 3FIFA 2DNUA 5J26A 4A4KA 3L2VA 3A5ZB 2GGRA 4ELZC 3EH1A 5GANh 4BUGA 1VQ8Q 2X9HA 1UHFA 2C06A 2ABLA 1S1NA 4C92C 4DA4A 5GMKe 5LJ5d 3G71T 5GAN6 4M7AA 4C8QA 1YITT 2EYYA 2M51A 4A4HA 4J5YA 1Y57A 4JJNK 4DBFA 2EYZA 1VQ5A 2QASA 5GMKl 3UPUA 2ZZDA 4O6JA 1YN8A 3LLRA 4FCYA 4B6MA 2CZ0B 3GBQA 3GP8A 3OYBA 1ZX6A 1RUWA 2DBKA 2DFUA 1FMWA 1G3SA 3ULRB 1K8AC 1I8FA 1M4ZA 4EMHA 2DYIA 2LT1A 2XK0A 3CCRA 1LOJA 4PLLA 1WA7A 5GJWB 4M78D 4Y91A 2HSEB 1QWEA 2E41A 4KT0E 2XHCA 1YJ9A 3FDRA 2E65A 1G3TA 4C5GA 4CC7A 2B86A 4ZTFA 3OS1A 3A8LB 3CMAQ 3MEWA 3A8OB 2LJ1A 3EFOB 3JCMd 1Q86U 4PJJA 4D6WA 2WSEE 1LNXA 1AWWA 5CVIA 2KXCA 1M1GA 2DX1A 1CKBA 2ZPIB 4ZN1A 1KHCA 2DZCA 2K5FA 2FRWA 3PTAA 1GBRA 1M2OA 5EC7A 3QKJA 3CPWS 2JTFA 3VU3C 4C0DC 4V2SA 4ELYC 3CCSA 1VQPA 1ZBXA 2A08A 2P0QA 2G6FX 3CBPA 4J9GA 3GNGA 3M59A 2V1RA 4PJOB 4MDXA 1RAFB 2AK5A 2DIGA 3A8HB 1QVFP 4RTUA 2DF6A 1K9MC 1WX6A 1M9SA 1FWZA 1RLQC 1BBZA 2KEAA 1PM3A 2BZYA 1BU1A 3M0RA 1VQ9T 2O01E 2CP7A 5D6WA 2HNIA 3M9QA 3RKYA 1IO6A 1MV3A 1YWOA 1CKAA 3UWNA 1RABB 4JZ4A 4M78A 4J83A 1YI2Q 2LQKA 2RI3A 3VRYA 1VQNA 4OMFB 1W70A 2K2MA 3EAEA 2O31A 5FROA 3IQLA 1D1AA 5CAIA 2DXCA 2DZ9A 4LDUA 1I4K1 3CCRQ 4RKUE 1UGSB 4M77D 1S72A 1JXOA 2CH4W 2KQWA 5GJVB 3QUIA 5GAN3 2AKLA 3BW1A 4TVRA 2L3PA 4J6WA 2OTJQ 1RAEB 2E4HA 1TXQA 1QVPA 1OX9A 1OPKA 1VQLT 3JCMb 3H0IA 2O9SA 5AYFA 4PFPA 1JJ2A 2DRKA 3CEYA 3BDUA 5FU7B 5DY9A 1XQHA 1QP2A 5KYUA 3PVQA 1K8AU 1QVGA 3EFRA 4RG8A 4PNOA 4LUDA 4M7DE 1K1ZA 4AG2C 3VS7A 1BK2A 3CC7T 4GLKA 1GCQC 1ZHIA 2OTLT 1YIJT 4KUIA 3OYCA 4C0DB 2ATCB 2V1QA 2NUTA 4FYVB 2DAQA 4II1A 3G7ZA 2F2XA 4GY5A 2EPDA 2NYSA 4F17A 3CCQT 5IXFA 2QDLA 3LW5E 3JCMc 2W10A 1M8VA 1K4US 1VIFA 2EJFA 4J7IA 4E7ZA 1AEYA 2XI9A 1YITA 4NS5A 4HA8A 4DBRA 4LN2A 2R5MA 1M2VB 2ENMA 4WTOB 1VQ8T 2DTOA 1WYXA 2L3RA 3QHSA 5FRNA 5FRMA 1VQOT 4EMKB 4PJOG 1PRMC 2L3QA 1EFNA 3VUBA 2JNGA 5KYWA 2CP3A 3HFNA 1UGQB 4HT8A 2XDPA 4EMGA 1N8RR 4M77A 1H8KA 1IREB 2EAYA 2HAXA 2EQMA 3RBBB 1Q86R 1N9RA 1VQ6Q 4N4HA 3VUZA 2JXBA 2ESWA 1AVZC 3ZL7C 4HVWA 2NWMA 3T9NA 3NGPA 3CC4T 2F1LA 3BDLA 2EWNA 1YBYA 4BACA 2E5QA 3ZFJA 3E19A 1K9MU 4QQGA 4C5IA 3EG1A 1ZUYA 2RQTA 3G1JA 4M75F 1C1AA 3PMTA 4OMPA 4F7UB 2QA4Q 3MPUB 1JJ2P 2RHUA 4HVUA 4M7DD 3M0UA 4J9BA 2V26A 4OB1B 2JW4A 4JDSA 5LL6S 3G4ST 1QVGP 2CYZB 4DEXA 1WXUA 4HKEA 2KI7A 1VIEA 4PJMA 4ORZA 4IIOA 2EYQA 4C8QC 3CCEA 5LJ5h 1G3YA 3SD4A 3QDFA 3OYLA 3LGLA 2WSFE 1MGQA 1W6XA 3RKWA 3OW2S 1YHQT 1SG5A 4QQDA 4BI8B 1D09B 2DJZA 2JMCA 1JO8A 2Z0WA 1LVKA 3RMQA 3UT1A 3RR6A 2DO3A 2MK5A 2QEXQ 4A4EA 4KGZB 4L6V5 2DRMA 1Q7YC 1D0XA 3OY9A 4ANJA 2HMAA 2C0IA 4BI4A 1WLPB 4GLMA 2FZKB 2JTMA 3OW2A 2K6DA 5GMKm 1PKTA 2V8KA 3JB9G 2HBPA 2YRCA 4EDUA 4JZ3A 2VC8A 2A36A 5GAN8 1VQ9A 4E2FB 2NUZA 3CD6A 3M56A 1WQWA 2BUDA 1OU9A 4XU3A 2RF0A 3G6EA 2BE7D 2EIFA 1K8AR 2RH2A 3CC2Q 2FYKA 1RAHB 1T3SA 4M7DA 1ZUUA 2GQIA 5KYYB 5LJ3g 2KMTA 3S3NA 3REBB 3JCMh 1D0YA 4IUQA 1SF9A 1JBMA 2A3LA 1VQ7A 3CCVQ 2DJQA 5FLXE 3I55A 3JV3A 1KQSA 1VQLA 2ZAEA 4RMOA 4RTWA 1MNDA 1PG5B 2EFIA 3SWNA 2DIQA 4M7AB 3EG3A 4F7UG 4LUEA 4C8QB 2DPPB 2PZ1A 3OBWA 1YNZA 2HQHA 3CCEQ 2CS7A 4MZTA 2EGAA 2CZ7B 3MP8A 4OGEA 1WI7A 2GBQA 5EG2A 3M58A 2K57A 2O4XA 3CC7A 1AWOA 1X6OA 1NEBA 1NYFA 1SRLA 4ZGEB 2OTLA 4C0GA 3FC3A 1YIJA 2VKNA 4PJOF 4JRPA 3DLLA 5LJ3j 4J8OA 1PNJA 1TU0B 3OYGA 3EG0A 3VS6A 1WHJA 4XTXA 4OB3B 5DM7R 1X75C 3CCQA 3KFVA 1ZA2B 5CO7A 3M0QA 1K9MR 4WF2A 2MYSA 1ZSZA 2DL8A 4KUDK 3LYIA 1KC8C 2GFAA 4F14A 3JB9H
chains in the Genus database with same CATH topology
2MWOA 5HY6A 1VQ7T 4Y28E 1KG1A 2FB7A 3OYBA 2QTXA 2QA4A 5GMKh 4NL3A 1PSEA 3RERA 5C6SA 3I55T 1VQOA 1G3SA 1VQKA 1K8AC 4OB0B 1I8FA 1M4ZA 2PUKB 3GF5A 3M57A 4EMHA 4PJOD 2X4XA 4RCBA 1V29B 3JCMQ 4BDZA 2LT1A 1U1SA 2K5LA 5GAN7 3CCJA 2XK0A 5GAN2 1DJ7B 5LJ5g 4A4FA 4XU0A 3NFCA 1BI2A 3CCRA 1LOJA 4DOVA 4PLLA 3OYEA 4M7DG 4J6YA 5CQYA 4M78D 4Y91A 1Q7YU 4JLGA 1KD1C 3P8HA 2E41A 2GQVA 4KT0E 1VQMA 2QXFA 2DEQA 4HCZA 2XDBA 2XHCA 1YJ9A 3CC4A 3FDRA 2VXEA 2E65A 1G3TA 3V8LA 5A0DA 3OYAA 2PVOB 4MMKA 4VUBA 4C5GA 4XU2A 4ZTFA 3OS1A 1TH7A 3A8LB 2Y90A 3WXMB 5GAMh 2EQJA 1KQSS 3P8BB 4JRKA 3GNFB 3DLMA 3MEWA 1WGSA 3A8OB 4JRIA 1NJIC 4IUVA 3TREA 4X9CA 3INZA 3JCMd 4FSXA 1Q86U 3M4GA 4D6WA 2WSEE 3JCMf 1LNXA 4C0ZA 3MO8A 5CVIA 4EPCA 4MDWA 4IKFA 3JCMJ 5GANj 1AHJB 1N9SA 1Q81U 1M1GA 1BI1A 2ZPFB 4R55A 3QG1A 4JRQA 2QEXA 4M75E 3PFSA 4XTVA 1WJSA 2XDDA 5KE3A 3FJPA 4NOYA 2LCLA 2ZPIB 1KHCA 4ZN1A 3OYDA 3V7CA 3EFSA 4C92G 5GAOq 2DZCA 3JB9J 2K5FA 1WJQA 3G4SA 3J80E 5GAOr 3R6OA 3PTAA 2L89A 2VXFA 2YLCA 1RL2A 1YI2T 3S6WA 1O9SA 3URGA 2Y4YA 3QKJA 3CPWS 2JTFA 3VU3C 2P0PA 2QA4T 4C0DC 2DKGA 3H6ZA 4V2SA 1M1FA 4ELYC 3CCSA 1VQPA 1YJNA 1ZBXA 3A8GB 4L59A 4OGCA 3QZ9B 5GANd 2P0QA 1VQKT 2L5QA 2QQBA 5LJ5j 5IAYA 1M5Q1 1NZ9A 5GANf 3CBPA 3JCMX 3RIRA 4M7AG 3GNGA 3M59A 4RG2A 1YHQA 4C8QG 1WPYA 2LQ8A 2QQSA 1M90C 4M7AE 4PJOB 4MDXA 1WJRA 3CCJT 1K73C 4C8QE 1QVFS 2HQEA 2LTOA 2LVMA 2DXBA 2FVUA 2DIGA 3PNWC 3A8HB 4LDYA 3CCRT 3L1AA 3HSBA 3JB9F 1G3WA 4F7UE 5DLQE 3TCJA 3CC2A 2BKDN 4BE0A 1BIBA 4BB7A 2VGMA 2OTJT 2R58A 1K9MC 1M9SA 5I21A 1FWZA 1LJOA 4M78B 3E1SA 3MP1A 3ASKA 3ZEHA 1X01A 2EKOA 2XICA 4PJOA 3HL8A 2R5AA 1VQ9T 1OZ3A 5GMKj 2O01E 2K3XA 4M77F 1FX7A 2HNIA 3M9QA 5D6WA 3RKYA 3JCMg 2D6FA 2X4YA 5LJ5f 3HP9A 1FXXA 3JRZA 5J3BA 5I2SA 3UWNA 2DD5A 1QP3A 4CI0C 3VYHB 3M5AA 3QZ5B 2RHIA 5CCAA 3JB9I 2QQRA 4ZGDB 3AHUA 3F70A 4M78A 4PJOC 1VQ4A 4J83A 2LQKA 5CKEA 1OZ2A 3C94A 3NTIA 1Y7XA 1JRIA 2RB6A 2G3RA 2K4YA 2M0OA 2RI3A 2RD1A 4OMFB 3GPLA 3CCVA 1VQNA 3RMSA 5GAOp 2A7YA 3WVEB 1QVFA 2JN0A 5CIUA 1QW1A 3ME9A 4A54A 3GOXA 4MZPA 3OSSC 3JB9D 3EAEA 3SB2A 4M78C 5FROA 2X4WA 3CXCA 4X34A 2MWPA 1W4SA 3QO3A 3DB4A 2WACA 5CAIA 5GANg 2DXCA 2DZ9A 2CGHA 2JVVA 3LX7A 2ZPGB 4LDUA 4PL6A 5GAMe 1I4K1 4HT9A 2L8DA 4RKUE 1UGSB 4M77D 3CCST 4JS4A 4ZN3A 5LJ3e 1S72A 3CCLA 2KQWA 5GAN3 3QUIA 3HKSA 3BW1A 1VQ8A 4TVRA 4J6WA 4J6XA 3MEUA 5D6XA 5J39A 2RJFA 1QVPA 4ZGJB 1KC8U 2KVQG 1I5LA 3JCMb 1VQLT 4ATOA 5IN1A 3H8ZA 4DOWA 4F7UF 2D9TA 4OF1A 5AYFA 1OYXA 2PUOB 2XIDA 3QDRB 2K3YA 3HHTB 1JJ2A 2K5IA 3CEYA 1NE8A 1PSFA 2MI6A 3BDUA 3NTKA 4YTLA 5FU7B 5DY9A 3X20B 4BDYA 3HFOA 3UDCA 4L5GA 4QVCA 1RI0A 1M1KC 1XQHA 1QP2A 2PQWA 2X4JA 4XTWA 1K8AU 1QVGA 1KQ2A 5M9OA 3CMEA 3OYYA 2ZPBB 4BD3A 3EFRA 4Q5WA 4RG8A 4PNOA 1U1TA 4ZTJA 3RKXA 2DXTA 4M7DE 4QQ6A 5GAOm 2E6ZA 1I81A 3CCMA 3CC7T 4GLKA 4JLIA 3NTHA 5KCOA 1ZHIA 2OTLT 2XG8D 3A8MB 2YLBA 1YIJT 4KUIA 3OYCA 4LD6A 4FM4B 2QQAA 4C0DB 5HKCA 3CCUA 1KD1U 1VQ6T 5LJ3h 3OMGA 4MMLA 2DAQA 2LNVA 4II1A 4IUUA 3G7ZA 4R56A 5FU7C 4KULA 1VQ5T 3BY7A 4KBMB 4GY5A 3MEVA 3I56A 3CBMA 3WVDB 3CCQT 1YJWA 4A4GA 2KSSA 3LW5E 1N8RC 4C5HA 2IVWA 1NJIU 1KQ1A 3JCMc 5KE2A 1M8VA 4C5EA 3PT9A 3E9FA 1VIFA 1W2BS 2EJFA 3GP8A 1Q82C 2E10A 2B8AA 4J7IA 2XI9A 1YITA 1BI3A 4NS5A 5CK9A 4HA8A 4C92E 1GXIE 3QJ6A 2KY9A 2R5MA 2IG0A 4E7HA 3CCLT 2E70A 4P5NA 1VQ8T 2DTOA 2RI2A 2RI5A 4M77B 5CKHA 2L3RA 2RO0A 3QHSA 4HCCA 5FRNA 3X24B 2V8JA 5FRMA 4XU1A 1VQOT 4EMKB 4PJOG 3VUBA 2JNGA 5GAMg 3HFNA 3X25B 4B9WA 1WQ7A 4X9DA 3QJYA 1UGQB 3M54A 4HT8A 2XDPA 5L8RE 4QVZA 2HD0A 4JUVA 4EMGA 3MHXA 4M77A 4M7DF 2E1HA 1IREB 2EAYA 2HAXA 1BYMA 2EQMA 3OS2A 2KDSA 3CMET 4M78G 1N9RA 3JAME 2RJDA 4EMKA 1N27A 3L2UA 3CXCS 4N4HA 3VUZA 4A53A 2DD4A 1M90U 2RHXA 4XQ3A 2ZPEB 3N5BB 4IURA 3OBYA 3T9NA 1K73U 1VQMT 1W2BA 1YJ9T 3CC4T 3CCMT 5LJ5e 3OS5A 4M77C 3BDLA 2VUBA 4DQ2A 5CKDA 2EWNA 2LDMA 1YBYA 4BACA 2E5QA 3ZFJA 4MZMA 3X28B 4EMKC 3CCUT 4N4IA 1EIFA 3E19A 1G5VA 1K9MU 2XU8A 4N4GA 4QQGA 3JCMW 4C5IA 3X26B 1UGPB 4M75C 3SFMA 4M75F 5GAOn 2P4TA 1JJ2S 3PMTA 3I56T 3FRNA 1XTDA 3RUXA 4C0FA 4XTUA 3FB9A 4F7UB 2Y4XA 4UC4A 2QDYB 2QEXT 2RHUA 3DKMA 1NPRA 2GCXA 3L2ZA 4Z02A 5I2MA 3SWNC 4C92F 1QVGS 4M7DD 4OB1B 5CKBA 3L2WA 2CKKA 3QBYA 5D6YA 3J81E 4XTZA 3LWIA 4JS5A 4JDSA 2YRVA 5DLOA 5GAOl 5LL6S 3G4ST 2LT4A 2CYZB 2ZGWA 5FU6C 4PKCC 4F7UA 4HKEA 4QVDA 2MAMA 4J7FA 4CRIA 5GAMj 2DTHA 4FT4A 1D3BB 3PMIA 1VIEA 1Y96B 2H3JA 1YJNT 1WNLA 1VQPT 2QI2A 4BE1A 2EYQA 3CPFA 4M7AF 4C8QC 3VV0A 3CCEA 4C8QF 4LDVA 5LJ5h 1G3YA 3SD4A 4IUTA 2X35A 3OYLA 3LGLA 2WSFE 5IT9E 1MGQA 3RKWA 3OW2S 1YHQT 2OAUA 4QQDA 4M75D 4BI8B 2GF7A 1D3BA 1Y96A 2DJZA 3PIOA 3HRTA 3OYNA 3HPWA 4XTYA 1VUBA 4C92D 3CC2T 4FL6A 5GAMd 2RM4A 3RMQA 1YI2A 5GAMf 5LJ3d 2FHDA 2KK4A 3UT1A 5LJ3f 4E47A 1R8OB 2DO3A 4LD9K 3JCMP 2ZCFB 4A4EA 2HQXA 2D0QB 2LCCA 3HRSA 1XNIA 1M1KU 2NLUA 3HRUA 1Y07A 2E6NA 3QYGB 4L6V5 4XK8E 1SSFA 1Q7YC 3OY9A 3C4SA 3LGFA 4M7AD 5CKFA 1U8RA 4FIBA 4C8QD 2JZ2A 3DB3A 3QYHB 4FT2A 4BI4A 5A0GA 1VQ4T 3MCAB 2F5TX 1UEBA 2I2LA 3JCMe 3QPHA 2JTMA 3OYKA 3OW2A 1VQNT 3M4YA 3CCVT 2DK3A 2FL7A 5GMKm 4ME7A 2V8KA 3JB9G 2HBPA 2OTJA 3O8VA 4EDUA 3OSVA 2RHYA 3OMCA 2JUFA 1N6AA 2VC8A 2AHJB 3PGGA 1JB0E 5GAN8 2PU9B 2VGNA 2V8IA 1XOVA 4M7DB 2EJ9A 5HK3A 2RK2A 1VQ9A 1Q86C 5CR2A 3G71A 3CD6A 3M56A 1WQWA 4O5VA 2BUDA 5KH6A 1UB4A 2EQUA 3Q1JA 4XU3A 3L42A 1Q81C 4XAXB 3KBGA 4M77G 3G6EA 3S3MA 2EIFA 2DTIA 2XD0A 1N8RU 2RH2A 4LDWA 3OYJA 4M77E 1S72T 2VV5A 2FYKA 2XKOC 2LX9A 3S3OA 1YCYA 3V8KA 3CCET 1O75A 2CZ1B 4M7DA 2BIVA 3OYFA 1Q82U 2R57A 2EJGA 3FLGA 2F69A 5GANe 2PVDB 4M75G 5KCHA 2EQKA 3KXTA 4PJOE 2KAFA 2F5KA 3KUFA 2PVGB 4E7IA 3V7SA 5LJ3g 3QSUA 2KMTA 4M75B 2YHTA 3M53A 1H641 2ZPHB 2CZ6B 2WSCE 2MF2A 3BFMA 3MP6A 4M7DC 5A2QE 4BI3A 3S3NA 3JCMh 2DVEA 5A0LA 1H3ZA 4IUQA 3LWHA 1BI0A 3CMAA 4C92B 2VYTA 3VJPA 1JBMA 3SDZA 3SWNB 2A3LA 3C95A 3ER0A 3P8DA 2JOYA 4M78E 4E7JA 1VQ7A 3PIPA 2P0KA 3FEOA 2LC4A 3C12A 4M75A 4FU6A 2E64A 2RJCA 3OQ5A 4IUPA 4N0AA 3V7RA 3JCMV 1B34B 4BY6B 2RJEA 5FLXE 4HCBA 3I55A 1KQSA 5FU6B 5GAN4 2QQ9A 3OYHA 3J7AF 1VQLA 4RMOA 3FIFA 5CQXA 2EFIA 1NPPA 3META 1HXDA 5J26A 4C92A 1IZ6A 2M9UA 3GIBA 3SWNA 4B9XA 2DIQA 4A4KA 4M7AB 4F7UG 3L2VA 4OB2B 3OA6A 4C8QB 4OP0A 3JSCA 1Y71A 2DPPB 4PLIA 2O4XB 3OBWA 3A5ZB 4N0AC 1B34A 4ELZC 5GANh 5GAN5 3QIIA 4RCCA 3ZBDA 4BUGA 1YJWT 2CS7A 4MZTA 2C06A 2M1HA 4BE2A 3LH0A 3MEAA 4C92C 4E7KA 1OI1A 4DA4A 2CZ7B 5GMKe 3MP8A 5LJ5d 4OGEA 3G71T 3CD6T 5GAN6 4M7AA 2MMPA 1MHNA 3M58A 5EG2A 4C8QA 2GFUA 3TU4K 3OB9A 2K57A 2RHZA 1P92A 2LRQA 1YITT 2O4XA 3CPWA 4BY6C 3G6ET 1X6OA 2M16A 3VYGA 3CC7A 2RK1A 4NL2A 3VKIA 4ZGEB 3RESA 4A4HA 4C0GA 3FC3A 1YIJA 2OTLA 2K2VA 4J5YA 4JJNK 1UGRB 4PJOF 1VQ6A 4JRPA 2DXUA 3DLLA 1BIAA 5C0MA 3GLXA 5LJ3j 3E9GA 4J8OA 4M7AC 3OYGA 3CBOA 4XTXA 5HK0A 3OYIA 1VQ5A 1BKBA 4OB3B 5DM7R 1HK9A 5GMKl 1X75C 3CCQA 3UPUA 2ZZDA 5GMKi 3OYMA 4O6JA 5CO7A 2RA2A 3TEEA 4OVAA 4LDXA 3LLRA 3L2QA 4M78F 2E12A 4QW2A 4WF2A 3V8JA 3QXEB 2CZ0B 4KUDK 3L2RA 3CMAT 3LYIA 4E7LA 1KC8C 1KHIA 3M55A 2GFAA 3OS0A 3JB9H 1ZQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MWO A;  2RHI A;  3O8V A;  4EDU A;  2RHY A;  3OMC A;  2QQR A;  2XDP A;  3OYB A;  3F70 A;  4QVZ A;  5C6S A;  1OZ2 A;  2EQM A;  3NTI A;  2BUD A;  2RI3 A;  5KH6 A;  2G3R A;  2M0O A;  3OS2 A;  2EQU A;  3Q1J A;  3L2U A;  2RJD A;  3L42 A;  1N27 A;  4N4H A;  3S3M A;  2X4X A;  5CIU A;  3ME9 A;  3GOX A;  2RHX A;  3OYJ A;  4IUR A;  4BDZ A;  3EAE A;  2XK0 A;  2X4W A;  5FRO A;  3S3O A;  4A4F A;  4X34 A;  2MWP A;  2BIV A;  3BDL A;  3OYF A;  2R57 A;  2LDM A;  2WAC A;  3DB4 A;  3FLG A;  4BAC A;  2E5Q A;  3LX7 A;  4PLL A;  4PL6 A;  3ZEH A;  5KCH A;  3OYE A;  4N4I A;  2EQK A;  1G5V A;  4N4G A;  2F5K A;  2L8D A;  3KUF A;  4QQG A;  4E7I A;  3P8H A;  4C5I A;  4HCZ A;  3MP6 A;  3PMT A;  3FDR A;  3S3N A;  3MEU A;  5D6X A;  5J39 A;  2RJF A;  3OYA A;  1H3Z A;  4IUQ A;  4C5G A;  4ZTF A;  5IN1 A;  3H8Z A;  4UC4 A;  3OS1 A;  2VYT A;  2EQJ A;  2RHU A;  2D9T A;  4Z02 A;  3P8D A;  3DLM A;  1OYX A;  3MEW A;  1WGS A;  3L2W A;  2K3Y A;  2P0K A;  2CKK A;  3FEO A;  3CEY A;  3QBY A;  3NTK A;  4IUV A;  5D6Y A;  4FU6 A;  4BDY A;  2RJC A;  3OQ5 A;  2YRV A;  4IUP A;  2RJE A;  1RI0 A;  3MO8 A;  2PQW A;  3OYH A;  4IKF A;  5M9O A;  4BD3 A;  2EFI A;  4CRI A;  3MET A;  5J26 A;  4Q5W A;  3PFS A;  4ZTJ A;  4B9X A;  2DIQ A;  1WJS A;  3PMI A;  5KE3 A;  4QQ6 A;  3L2V A;  1KHC A;  3OYD A;  3OA6 A;  4BE1 A;  4PLI A;  2O4X B;  1WJQ A;  3SD4 A;  4IUT A;  2X35 A;  3OYL A;  3LGL A;  3NTH A;  2L89 A;  5KCO A;  3QII A;  3S6W A;  2M1H A;  4BE2 A;  3QKJ A;  4QQD A;  3OYC A;  2JTF A;  3LH0 A;  3MEA A;  4LD6 A;  2GF7 A;  1OI1 A;  4E7K A;  3H6Z A;  3MP8 A;  3OMG A;  2DAQ A;  4II1 A;  4IUU A;  4L59 A;  1MHN A;  3OYN A;  2GFU A;  3OB9 A;  2RHZ A;  2LRQ A;  2O4X A;  4GY5 A;  3MEV A;  2M16 A;  4FL6 A;  5IAY A;  4RG2 A;  4A4G A;  4A4H A;  3FC3 A;  2QQS A;  4C5H A;  2FHD A;  1WJR A;  3UT1 A;  5KE2 A;  2HQE A;  2LTO A;  2LVM A;  3E9F A;  3PNW C;  2DIG A;  3E9G A;  4A4E A;  2HQX A;  4C5E A;  5C0M A;  2B8A A;  2LCC A;  1XNI A;  3OYG A;  2NLU A;  3OYI A;  3L2Q A;  4NS5 A;  2E6N A;  2BKD N;  4BE0 A;  3QJ6 A;  2R58 A;  2R5M A;  1SSF A;  2IG0 A;  4E7J A;  3OY9 A;  4E7H A;  3OYM A;  3C4S A;  3LGF A;  3MP1 A;  3ASK A;  4OVA A;  2EKO A;  2JZ2 A;  3DB3 A;  3LLR A;  2RI2 A;  2R5A A;  2RI5 A;  1OZ3 A;  4QW2 A;  2L3R A;  2RO0 A;  2K3X A;  5D6W A;  5FRN A;  3M9Q A;  5FRM A;  3L2R A;  2X4Y A;  3OYK A;  3LYI A;  4E7L A;  4B9W A;  3UWN A;  2GFA A;  3OS0 A; 
#chains in the Genus database with same CATH topology
 5FWB A;  1TUC A;  8AT1 B;  5KYN A;  5GMK h;  1PSE A;  1YJW Q;  2DL4 A;  5C6S A;  1VQO A;  1VQK A;  4OB0 B;  3GF5 A;  3QWX X;  3M57 A;  3CD6 Q;  1D1C A;  1V29 B;  4BDZ A;  3NMZ C;  5HCK A;  3G6E Q;  1G2B A;  2K5L A;  3CCJ A;  5GAN 2;  1DJ7 B;  4DOV A;  4FSS A;  2CP6 A;  3OYE A;  1Q7Y U;  4JLG A;  2GQV A;  1UGV A;  2DEQ A;  3CC4 A;  2VXE A;  3V8L A;  2PVO B;  2Y90 A;  2EQJ A;  4JRK A;  1WGS A;  1R77 A;  4FSX A;  3M4G A;  1VQ7 Q;  1R0B G;  2FO0 A;  4EPC A;  4MDW A;  1WXT A;  3JCM J;  5GAN j;  1AHJ B;  1N9S A;  4AFQ C;  4IKF A;  1BI1 A;  2ZPF B;  4R55 A;  3QG1 A;  1WXB A;  4M75 E;  2LZ6 B;  1WJS A;  2O88 A;  1MMD A;  5GAO q;  3G4S A;  3J80 E;  4PJL A;  5GAO r;  2HKN A;  1B7T A;  1M3B A;  3URG A;  2Y4Y A;  2P0P A;  2QA4 T;  3H6Z A;  1I5O B;  2W0Z A;  4OGC A;  4PK4 A;  1GBQ A;  2L5Q A;  2QQB A;  5GAN f;  4M7A G;  1KFZ A;  1YHQ A;  4C8Q G;  2QQS A;  1KIK A;  1QVF S;  1K73 C;  4PFO A;  2LTO A;  2FVU A;  3JB9 F;  2LCS A;  3HSB A;  2VVK A;  4BE0 A;  3CXC P;  1YP5 A;  5I21 A;  1LJO A;  4M78 B;  3E1S A;  5KYX A;  1X01 A;  4X1V A;  1LCK A;  1OZ3 A;  1I0C A;  1X43 A;  2D6F A;  1A0N B;  1FXX A;  5J3B A;  3I35 A;  2QTV A;  3VYH B;  3QZ5 B;  5CCA A;  3JB9 I;  3F70 A;  4PJO C;  2HKQ B;  1KQ2 A;  3GPL A;  2M0O A;  2BTT A;  3WVE B;  1QVF A;  3GOX A;  1VQK Q;  4J9D A;  2QG9 B;  2X4W A;  2MWP A;  2O2O A;  2QYZ A;  3DB4 A;  3CCJ Q;  3LX7 A;  4PL6 A;  1UTI A;  1IHW A;  4HT9 A;  4JS4 A;  5LJ3 e;  3CCL A;  4DBQ A;  1I07 A;  1D1B A;  1MV0 B;  5KYU B;  2RJF A;  1KC8 U;  1U3O A;  2KVQ G;  5IN1 A;  4DOW A;  4F7U F;  2LNH B;  4OF1 A;  4HXJ A;  2PUO B;  2XID A;  3QDR B;  4K11 A;  2K5I A;  1PSF A;  2CP0 A;  1M1K C;  2AKK A;  2X4J A;  4XTW A;  4ESR A;  5M9O A;  2ZPB B;  2NUT B;  2A37 A;  2DXT A;  4QQ6 A;  1RAI B;  6AT1 B;  2QAZ A;  3D7S B;  3NTH A;  2J7I A;  1TG0 A;  3A8M B;  3CCU A;  4LD6 A;  2QQA A;  2ED1 A;  1X69 A;  2COY A;  1M30 A;  1PD1 A;  5FU7 C;  4KUL A;  2GNC A;  4KBM B;  3I56 A;  3CBM A;  3TSW A;  4A4G A;  1M27 C;  1ABO A;  2FEI A;  3EH2 A;  2IVW A;  1UE9 A;  2DYB A;  3HTR A;  5KE2 A;  3PT9 A;  1NBE B;  1V1C A;  2J05 A;  1Q82 C;  4RTT A;  5KYW B;  3UA7 A;  5CK9 A;  4C92 E;  2D8H A;  1Q95 G;  4P5N A;  2KT1 A;  1Q7Y R;  4M77 B;  8ATC B;  3X24 B;  2V8J A;  2JMA A;  2RQU A;  5GAM g;  4B9W A;  3QJY A;  3M54 A;  2CP5 A;  4JUV A;  3MHX A;  1SPK A;  3OS2 A;  2XMF A;  2C0T A;  2OJ2 A;  3CME T;  4M78 G;  3JAM E;  3L2U A;  1N27 A;  2L3S A;  2CH4 A;  3U23 A;  1AD5 A;  1VQ5 Q;  1K73 U;  3OBY A;  1VQM T;  3CCM T;  2VUB A;  4DQ2 A;  2LDM A;  2DLP A;  2ROL A;  4EMK C;  4N4I A;  1G5V A;  2XU8 A;  1E6H A;  3JCM W;  1I1J A;  1UGP B;  1WHG A;  2KYM A;  5GAO n;  2P4T A;  1JJ2 S;  3FRN A;  3CCL Q;  1XTD A;  3RUX A;  4C0F A;  3L2Z A;  3DKM A;  1MMG A;  1NPR A;  2GCX A;  3SWN C;  1QVG S;  1G83 A;  3L2W A;  1OPL A;  3EHR A;  5D6Y A;  3LWI A;  2KRS A;  5DLO A;  5GAO l;  1VYU A;  4AFZ C;  2KYB A;  2D0N A;  1Y0M A;  2MAM A;  4CRI A;  1X27 A;  1JXM A;  5GAM j;  4OMO A;  1YJN T;  2JTE A;  2QI2 A;  4BE1 A;  4M7A F;  3VV0 A;  4C8Q F;  2JM9 A;  2OAU A;  1YJ9 Q;  3UF4 A;  1D3B A;  1Y96 A;  3CCU Q;  1PRL C;  3HPW A;  4XTY A;  1VUB A;  4C92 D;  1EZZ B;  2LP5 A;  5GAM f;  5LJ3 d;  3I56 Q;  4FW1 A;  2FHD A;  2KK4 A;  4FW2 A;  1ZSZ C;  2KR3 A;  4E47 A;  1R8O B;  4LD9 K;  3JCM P;  2LCC A;  3HRS A;  1M1K U;  2YUQ A;  3QYG B;  1VYV A;  3EG9 A;  2BE9 B;  2EW3 A;  1U8R A;  2JZ2 A;  1VQ4 T;  5A0G A;  2F5T X;  4AFS C;  2I2L A;  3CCS Q;  2DK3 A;  1VQP Q;  2HSP A;  1KC8 R;  3OMC A;  2JUF A;  1N6A A;  1UFF A;  2AHJ B;  4A63 B;  2PU9 B;  2VGN A;  3I5S A;  2V8I A;  4M7D B;  5HK3 A;  2HL3 A;  2RK2 A;  5CR2 A;  3G71 A;  4O5V A;  1UB4 A;  3Q1J A;  3L42 A;  4M77 G;  1TOV A;  2DTI A;  2A0F B;  4JJB A;  4LDW A;  4WCI A;  2XKO C;  2BZ8 A;  1YCY A;  3V8K A;  2BIV A;  1Q82 U;  1EX4 A;  4KGV B;  1NG2 A;  1QCF A;  2KAF A;  2DER A;  2YT6 A;  3VS2 A;  5A2Q E;  4BI3 A;  4Z8A A;  3LWH A;  1WHK A;  1BI0 A;  1HYO A;  1PC0 A;  2DMO A;  3FJ5 A;  3SWN B;  3C95 A;  3P8D A;  2JOY A;  1VQN Q;  2RQV A;  4FU6 A;  2FZG B;  2E64 A;  1GL5 A;  1RI9 A;  4BY6 B;  2J06 A;  3V7R A;  3OYH A;  3J7A F;  2DM1 A;  1HXD A;  4C92 A;  1B07 A;  1IZ6 A;  2M9U A;  4PFZ A;  3GIB A;  4B9X A;  1V76 A;  1XJW B;  3OA6 A;  3JSC A;  1Y71 A;  4PLI A;  2O4X B;  4N0A C;  3R6N A;  1S72 Q;  5GAN 5;  4RCC A;  3ZBD A;  1IGU A;  2M1H A;  1YFN A;  2FZC B;  3LH0 A;  2GFU A;  3TU4 K;  3OB9 A;  2X3W D;  1P92 A;  2LRQ A;  4CC3 A;  2EQI A;  4J9C A;  2H3E B;  4NL2 A;  3VKI A;  3RES A;  2RPN A;  2K2V A;  1ZSZ B;  1UGR B;  5C0M A;  3GLX A;  4ZNX A;  1K73 R;  2KXD A;  4M7A C;  3CBO A;  1BKB A;  1HK9 A;  1SEM A;  3TEE A;  4OVA A;  4LDX A;  4M78 F;  4QW2 A;  2NUP A;  3QXE B;  1TUD A;  3CMA T;  4E7L A;  4OMN A;  3M55 A;  1KG1 A;  3H41 A;  2FB7 A;  2H8H A;  3TVT A;  2P4R A;  3RER A;  3EGX A;  2M02 A;  2JS0 A;  3VS5 A;  3LH5 A;  2O9V A;  3VS1 A;  2PUK B;  3G71 Q;  1KK7 A;  2X4X A;  4RCB A;  1YIT Q;  3AT1 B;  4RTV A;  2HEQ A;  1U1S A;  2LJ3 A;  4A4F A;  5ECA A;  1JEG A;  2LJ0 A;  1BI2 A;  4RTX A;  4M7D G;  5CQY A;  1AZE A;  1U5S A;  1QMC A;  1NLO C;  3P8H A;  4PJN A;  1VQM A;  2QXF A;  1LPL A;  4HCZ A;  1SKU B;  2DL3 A;  2EGE A;  3EGU A;  5A0D A;  4RTY A;  1X2K A;  3NHN A;  1KQS S;  3P8B B;  3GNF B;  1NJI C;  3TRE A;  3INZ A;  3JCM f;  4C0Z A;  3MO8 A;  2OI3 A;  2DEU A;  1M1K R;  5KE3 A;  4NOY A;  2LCL A;  3OYD A;  1WZO A;  3V7C A;  3EFS A;  3REA B;  1ZLM A;  1AWJ A;  1WJQ A;  1GFC A;  3R6O A;  2L89 A;  2VXF A;  1YI2 T;  3S6W A;  1O9S A;  2DKG A;  1YJN A;  1RLP C;  2AT1 B;  1ABQ A;  4D8D A;  3QZ9 B;  1UUE A;  5IAY A;  1M5Q 1;  2EYX A;  1IB8 A;  1WPY A;  5KYX B;  1M90 C;  4M7A E;  4F16 A;  1WJR A;  2FG0 A;  4C8Q E;  2HQE A;  3PNW C;  2DXB A;  3CCR T;  2MIO A;  1G3W A;  1Q82 R;  1BIB A;  4BB7 A;  2OTJ T;  2R58 A;  2ROT A;  3MP1 A;  3ZEH A;  2EKO A;  2R5A A;  2I0N A;  3MKD A;  5GMK j;  4KH0 B;  2K3X A;  1FX7 A;  4M77 F;  3JRZ A;  2FPF A;  5I2S A;  1QP3 A;  2DD5 A;  3M5A A;  2RHI A;  2YWW A;  1J3T A;  1VQ4 A;  5CKE A;  3C94 A;  4J9F A;  2RD1 A;  3RMS A;  5GAO p;  2JN0 A;  3ME9 A;  4A54 A;  3OSS C;  3SB2 A;  4M78 C;  1SHF A;  3CXC A;  1CSK A;  4FYY B;  1W4S A;  3QO3 A;  5GAN g;  2JVV A;  2CDT A;  3CCS T;  4OMM A;  3HKS A;  1VQ8 A;  2KRM A;  5D6X A;  4ZGJ B;  3A98 A;  1SSH A;  1VQ9 Q;  2D9T A;  3A1P A;  3EG2 A;  3HHT B;  1NE8 A;  4BDY A;  3X20 B;  3C0C A;  3UDC A;  4L5G A;  4QKU A;  1RI0 A;  1RAC B;  1T3L A;  4OML A;  3OYY A;  1MUZ A;  2QGF B;  4Z88 A;  4CC2 A;  5GAO m;  1GRI A;  4JLI A;  5KCO A;  1NEG A;  1PCX A;  4FM4 B;  1VQ6 T;  2L2P A;  5LJ3 h;  3I9Q A;  2LNV A;  4R56 A;  2YSQ A;  3MEV A;  2HCK A;  3WVD B;  1WDX A;  2KGT A;  1K76 A;  2KSS A;  1N8R C;  3I55 Q;  3SEM A;  2CUD A;  1NJI U;  1KQ1 A;  1M8M A;  1VQL Q;  4C5E A;  3E9F A;  4LXC A;  2E10 A;  2E5K A;  1W2B P;  2EKH A;  2KY9 A;  2IG0 A;  4E7H A;  2E70 A;  2VAS A;  2RI2 A;  5CKH A;  2RI5 A;  4HCC A;  2EBP A;  4XU1 A;  1HJD A;  1WQ7 A;  1NYG A;  4R0K A;  3CC7 Q;  1N5Z A;  3EHQ A;  4M7D F;  2OTL Q;  1BB9 A;  1UHC A;  2E1H A;  3CQT A;  1YIJ Q;  1VYT A;  5IH2 A;  2J6F A;  2M0Y A;  1GCP A;  4A53 A;  5I11 A;  2A28 A;  1IXD A;  1JQQ A;  1M3C A;  2RHX A;  1M90 U;  2ZPE B;  3N5B B;  4IUR A;  2YRD A;  3CCQ Q;  3H0H A;  4M77 C;  5CKD A;  1E6G A;  1WHM A;  4MZM A;  1FMV A;  2SEM A;  2VB6 A;  3X26 B;  1BCM A;  2LQW A;  2DET A;  5L23 A;  4XTU A;  3FB9 A;  3VS0 A;  2Y4X A;  2YUO A;  2MCN A;  2QEX T;  5FW9 A;  5I2M A;  1VQO Q;  5CKB A;  2DL7 A;  2CKK A;  3QBY A;  1IHV A;  3J81 E;  4JS5 A;  2ZGW A;  4QVD A;  4J7F A;  4FT4 A;  1D3B B;  1Y96 B;  2H3J A;  2JM8 A;  3CPF A;  1WIE A;  5AT1 B;  7AT1 B;  3CC4 Q;  4M75 D;  1Z9Q A;  3OYN A;  2LX7 A;  3EGD A;  3CC2 T;  4FL6 A;  3EG9 B;  1YI2 A;  2HQX A;  2D0Q B;  2ECZ A;  2NLU A;  1Y07 A;  2E6N A;  2K7A A;  4XK8 E;  4F04 B;  1SSF A;  3G4S Q;  3C4S A;  3LGF A;  5CKF A;  4FIB A;  1Z9Z A;  1UEB A;  2KE9 A;  3QPH A;  3OYK A;  3CCV T;  4JPB W;  2AZV A;  2OTJ A;  3O8V A;  3OSV A;  2L0A A;  1YHQ Q;  5KH6 A;  2MOX A;  2EQU A;  1Q81 C;  4XAX B;  1JU5 C;  2XD0 A;  1TS9 A;  1T0J A;  1N8R U;  4M77 E;  2VV5 A;  1ZA1 B;  2F2W A;  4J9H A;  2LX9 A;  3S3O A;  3CCE T;  1O75 A;  2CZ1 B;  2YUN A;  5GAN e;  4M75 G;  5KCH A;  1UDL A;  2J6K A;  2EQK A;  3KXT A;  4PJO E;  3KUF A;  1E7O A;  4E7I A;  3TQ7 P;  2YHT A;  4Y92 A;  2CZ6 B;  2MF2 A;  3BFM A;  2AIR B;  4M7D C;  2AZS A;  3M0P A;  2DVE A;  1H3Z A;  3RNJ A;  4C92 B;  3VJP A;  3ER0 A;  5IXB A;  1X2Q A;  3PIP A;  3FEO A;  2LC4 A;  2E3H A;  4M75 A;  2RJC A;  1NJI R;  3OQ5 A;  4IUP A;  4HCB A;  2QQ9 A;  4J9I A;  5CQX A;  1PWT A;  1NPP A;  3MET A;  2CUB A;  2RQR A;  2YUP A;  2D8J A;  4OB2 B;  4OP0 A;  2DBM A;  1B34 A;  2PTK A;  3QII A;  1YJW T;  9ATC B;  4BE2 A;  3MEA A;  4IIM A;  2LQN A;  1ACM B;  4E7K A;  1OI1 A;  3PVL A;  2FPD A;  3CD6 T;  2MMP A;  1MHN A;  2IPO B;  2RHZ A;  1WHH A;  4BY6 C;  3G6E T;  3CPW A;  2M16 A;  3VYG A;  1QCN A;  2RK1 A;  4Z89 A;  1KJW A;  2NUP B;  1VQ6 A;  1M90 R;  2DXU A;  1BIA A;  3E9G A;  2IIM A;  5HK0 A;  2DL5 A;  3OYI A;  4DEY A;  3RDV A;  2VWF A;  4D8K A;  2EVR A;  5GMK i;  3OYM A;  2CP2 A;  4FYW B;  2RA2 A;  1PKS A;  3L2Q A;  3EGX B;  2E12 A;  3V8J A;  3L2R A;  1ZBJ A;  1KHI A;  3M0S A;  1ZQ1 A;  2MWO A;  5HY6 A;  1R0C B;  1VQ7 T;  4Y28 E;  2KRN A;  2QTX A;  2QA4 A;  4NL3 A;  4GBQ A;  3I55 T;  4EIK A;  1TWB A;  2K3B A;  3QWY A;  5IHN A;  3TSZ A;  4PJO D;  2KT8 A;  2HL5 C;  1C0M A;  3JCM Q;  4RTZ A;  1QCO A;  1NM7 A;  2BZX A;  5GAN 7;  5LJ5 g;  1AZG B;  1AT1 B;  4XU0 A;  3NFC A;  4HVV A;  4DBH A;  4J6Y A;  1KD1 C;  3M0T A;  2HBW A;  2XDB A;  1MMA A;  3OYA A;  1AWX A;  4MMK A;  4VUB A;  4XU2 A;  1TH7 A;  3WXM B;  5GAM h;  2X3X D;  2QK0 A;  3DLM A;  4J9E A;  4JRI A;  4IUV A;  4X9C A;  1OU8 A;  2X51 A;  1U06 A;  5I22 A;  1TUG B;  1Q81 U;  1OEB A;  4JRQ A;  2QEX A;  2F2V A;  3PFS A;  4XTV A;  4CC4 B;  2XDD A;  1X6B A;  3FJP A;  1MMN A;  4C92 G;  3EFO A;  2OX7 A;  3JB9 J;  1WFW A;  2YLC A;  1NLP C;  1RL2 A;  2DVJ A;  1M1F A;  4KRT A;  3A8G B;  3CPW P;  4L59 A;  2ED0 A;  5GAN d;  1VQK T;  5LJ5 j;  1NZ9 A;  2SRC A;  3JCM X;  3RIR A;  4LNP A;  4RG2 A;  2JJ9 A;  1OOT A;  4AG1 C;  2LQ8 A;  3CCJ T;  2LVM A;  4LDY A;  2YDL A;  3L1A A;  4F7U E;  5DLQ E;  3TCJ A;  3CC2 A;  2BKD N;  2JT4 A;  2VGM A;  3ASK A;  4KH1 B;  1RAG B;  2XIC A;  4PJO A;  3HL8 A;  4AMC A;  3JCM g;  2X4Y A;  5LJ5 f;  3HP9 A;  1G8X A;  4CI0 C;  4AT1 B;  2FRY A;  1QLY A;  1VOM A;  2QQR A;  1K0X A;  4ZGD B;  3AHU A;  4JJC A;  1OZ2 A;  3NTI A;  1Y7X A;  1JRI A;  2RB6 A;  2G3R A;  2K4Y A;  3CCV A;  2YXY A;  2A7Y A;  2C0O A;  1UJY A;  5CIU A;  1QW1 A;  4MZP A;  3JB9 D;  2HZY A;  2EYW A;  4X34 A;  2CRE A;  1UG1 A;  2WAC A;  2CGH A;  1K9A A;  1UEC A;  2ZPG B;  1ARK A;  5FWC A;  5GAM e;  2L8D A;  2J6O A;  4ZN3 A;  1OUL A;  3E2U A;  4J6X A;  3MEU A;  5J39 A;  1YCS B;  4ATO A;  1I5L A;  3H8Z A;  1RAA B;  1OYX A;  2K3Y A;  3NTK A;  2MI6 A;  4YTL A;  3PE0 A;  1QKW A;  3HFO A;  4QVC A;  3SHW A;  2PQW A;  1QQJ A;  3CME A;  4BD3 A;  4Q5W A;  1U1T A;  4ZTJ A;  3RKX A;  2COW A;  2E6Z A;  1I81 A;  4QT7 A;  3CCM A;  2MPX C;  3UA6 A;  2XG8 D;  2YLB A;  1KD1 U;  5HKC A;  3OMG A;  4MML A;  4IUU A;  1VQ5 T;  3BY7 A;  2KNB B;  2LMJ A;  1YJW A;  2KBT A;  4C5H A;  2DE0 X;  1W2B S;  1C6V X;  2B8A A;  1BI3 A;  1ZSG A;  1H92 A;  4M4Z A;  1GXI E;  2HDA A;  3QJ6 A;  1BCO A;  3VRZ A;  3CCL T;  1SRM A;  2RO0 A;  1ZUK A;  4AFU C;  4RUG A;  3X25 B;  4X9D A;  1M2V A;  5L8R E;  4QVZ A;  2HD0 A;  1BYM A;  2OAW A;  2D1X A;  2KDS A;  3CXC S;  2RJD A;  2KRO A;  4EMK A;  1KSW A;  1W1F A;  2DD4 A;  1Q81 R;  2CSI A;  4E7S A;  4XQ3 A;  2CT3 A;  1W2B A;  1D0Z A;  1YJ9 T;  5LJ5 e;  2CT4 A;  3OS5 A;  1YWP A;  1VA7 A;  3X28 B;  3CCU T;  1EIF A;  4N4G A;  2PNI A;  2RN8 A;  1T0H A;  2COZ A;  1HSQ A;  4M75 C;  3SFM A;  3VS3 A;  3H9N A;  3I56 T;  4UC4 A;  2QDY B;  1X6G A;  4Z02 A;  4C92 F;  2QGG A;  1FMK A;  1QWF A;  1GFD A;  4XTZ A;  3NPF A;  1UJ0 A;  2YRV A;  2LT4 A;  1PHT A;  3OS0 A;  5FU6 C;  4PKC C;  4F7U A;  2DA9 A;  2DTH A;  3PMI A;  3CME Q;  1VQP T;  1HD3 A;  1WNL A;  3VS4 A;  3UAT A;  4LDV A;  3EGD B;  5IHI A;  4IUT A;  2EGC A;  2X35 A;  5IT9 E;  1VQM Q;  3CCM Q;  1AOJ A;  2GF7 A;  3OW2 P;  1QKX A;  2K79 A;  1OQK A;  3PIO A;  3HRT A;  3H0F A;  1GCQ A;  3THK A;  5GAM d;  1PD0 A;  2CSQ A;  2RM4 A;  1OX8 A;  4OMQ A;  2E3I A;  5LJ3 f;  2ZCF B;  1XNI A;  3HRU A;  2FPE A;  1F1B B;  3I5R A;  4E6R A;  5IHK A;  4M7A D;  2K9G A;  4C8Q D;  3DB3 A;  3QYH B;  4FT2 A;  3MCA B;  1MNE A;  2GTJ A;  4FYX B;  3JCM e;  1VQN T;  3M4Y A;  2RNA A;  2FL7 A;  1YJN Q;  4ME7 A;  1OV3 A;  2DIL A;  1H3H A;  2RHY A;  1IGQ A;  3PGG A;  1B3Q A;  1JB0 E;  2JS2 A;  1XOV A;  4JJD A;  2EJ9 A;  1Q86 C;  2GTO A;  3KBG A;  3S3M A;  1WHL A;  1IRX A;  3OYJ A;  3BE3 A;  1S72 T;  1KQS P;  3MJX A;  1RAD B;  1FYN A;  5D7U A;  4LE9 A;  3OYF A;  2R57 A;  2EJG A;  3FLG A;  2F69 A;  2PVD B;  1TSF A;  2RMO A;  4KGX B;  2F5K A;  2PVG B;  3QSU A;  3O5Z A;  3V7S A;  2P84 A;  4M75 B;  3M53 A;  1KD1 R;  1H64 1;  2ZPH B;  2WSC E;  3MP6 A;  1TTH B;  4HCK A;  5A0L A;  3CMA A;  1VQ4 Q;  1M3A A;  2VYT A;  3SDZ A;  2RQW A;  4M78 E;  1SHG A;  4E7J A;  2P0K A;  5KYY A;  3C12 A;  4N0A A;  3JCM V;  1B34 B;  2RJE A;  5FU6 B;  5GAN 4;  1K0S A;  3FIF A;  2DNU A;  5J26 A;  4A4K A;  3L2V A;  3A5Z B;  2GGR A;  4ELZ C;  3EH1 A;  5GAN h;  4BUG A;  1VQ8 Q;  2X9H A;  1UHF A;  2C06 A;  2ABL A;  1S1N A;  4C92 C;  4DA4 A;  5GMK e;  5LJ5 d;  3G71 T;  5GAN 6;  4M7A A;  4C8Q A;  1YIT T;  2EYY A;  2M51 A;  4A4H A;  4J5Y A;  1Y57 A;  4JJN K;  4DBF A;  2EYZ A;  1VQ5 A;  2QAS A;  5GMK l;  3UPU A;  2ZZD A;  4O6J A;  1YN8 A;  3LLR A;  4FCY A;  4B6M A;  2CZ0 B;  3GBQ A;  3GP8 A;  3OYB A;  1ZX6 A;  1RUW A;  2DBK A;  2DFU A;  1FMW A;  1G3S A;  3ULR B;  1K8A C;  1I8F A;  1M4Z A;  4EMH A;  2DYI A;  2LT1 A;  2XK0 A;  3CCR A;  1LOJ A;  4PLL A;  1WA7 A;  5GJW B;  4M78 D;  4Y91 A;  2HSE B;  1QWE A;  2E41 A;  4KT0 E;  2XHC A;  1YJ9 A;  3FDR A;  2E65 A;  1G3T A;  4C5G A;  4CC7 A;  2B86 A;  4ZTF A;  3OS1 A;  3A8L B;  3CMA Q;  3MEW A;  3A8O B;  2LJ1 A;  3EFO B;  3JCM d;  1Q86 U;  4PJJ A;  4D6W A;  2WSE E;  1LNX A;  1AWW A;  5CVI A;  2KXC A;  1M1G A;  2DX1 A;  1CKB A;  2ZPI B;  4ZN1 A;  1KHC A;  2DZC A;  2K5F A;  2FRW A;  3PTA A;  1GBR A;  1M2O A;  5EC7 A;  3QKJ A;  3CPW S;  2JTF A;  3VU3 C;  4C0D C;  4V2S A;  4ELY C;  3CCS A;  1VQP A;  1ZBX A;  2A08 A;  2P0Q A;  2G6F X;  3CBP A;  4J9G A;  3GNG A;  3M59 A;  2V1R A;  4PJO B;  4MDX A;  1RAF B;  2AK5 A;  2DIG A;  3A8H B;  1QVF P;  4RTU A;  2DF6 A;  1K9M C;  1WX6 A;  1M9S A;  1FWZ A;  1RLQ C;  1BBZ A;  2KEA A;  1PM3 A;  2BZY A;  1BU1 A;  3M0R A;  1VQ9 T;  2O01 E;  2CP7 A;  5D6W A;  2HNI A;  3M9Q A;  3RKY A;  1IO6 A;  1MV3 A;  1YWO A;  1CKA A;  3UWN A;  1RAB B;  4JZ4 A;  4M78 A;  4J83 A;  1YI2 Q;  2LQK A;  2RI3 A;  3VRY A;  1VQN A;  4OMF B;  1W70 A;  2K2M A;  3EAE A;  2O31 A;  5FRO A;  3IQL A;  1D1A A;  5CAI A;  2DXC A;  2DZ9 A;  4LDU A;  1I4K 1;  3CCR Q;  4RKU E;  1UGS B;  4M77 D;  1S72 A;  1JXO A;  2CH4 W;  2KQW A;  5GJV B;  3QUI A;  5GAN 3;  2AKL A;  3BW1 A;  4TVR A;  2L3P A;  4J6W A;  2OTJ Q;  1RAE B;  2E4H A;  1TXQ A;  1QVP A;  1OX9 A;  1OPK A;  1VQL T;  3JCM b;  3H0I A;  2O9S A;  5AYF A;  4PFP A;  1JJ2 A;  2DRK A;  3CEY A;  3BDU A;  5FU7 B;  5DY9 A;  1XQH A;  1QP2 A;  5KYU A;  3PVQ A;  1K8A U;  1QVG A;  3EFR A;  4RG8 A;  4PNO A;  4LUD A;  4M7D E;  1K1Z A;  4AG2 C;  3VS7 A;  1BK2 A;  3CC7 T;  4GLK A;  1GCQ C;  1ZHI A;  2OTL T;  1YIJ T;  4KUI A;  3OYC A;  4C0D B;  2ATC B;  2V1Q A;  2NUT A;  4FYV B;  2DAQ A;  4II1 A;  3G7Z A;  2F2X A;  4GY5 A;  2EPD A;  2NYS A;  4F17 A;  3CCQ T;  5IXF A;  2QDL A;  3LW5 E;  3JCM c;  2W10 A;  1M8V A;  1K4U S;  1VIF A;  2EJF A;  4J7I A;  4E7Z A;  1AEY A;  2XI9 A;  1YIT A;  4NS5 A;  4HA8 A;  4DBR A;  4LN2 A;  2R5M A;  1M2V B;  2ENM A;  4WTO B;  1VQ8 T;  2DTO A;  1WYX A;  2L3R A;  3QHS A;  5FRN A;  5FRM A;  1VQO T;  4EMK B;  4PJO G;  1PRM C;  2L3Q A;  1EFN A;  3VUB A;  2JNG A;  5KYW A;  2CP3 A;  3HFN A;  1UGQ B;  4HT8 A;  2XDP A;  4EMG A;  1N8R R;  4M77 A;  1H8K A;  1IRE B;  2EAY A;  2HAX A;  2EQM A;  3RBB B;  1Q86 R;  1N9R A;  1VQ6 Q;  4N4H A;  3VUZ A;  2JXB A;  2ESW A;  1AVZ C;  3ZL7 C;  4HVW A;  2NWM A;  3T9N A;  3NGP A;  3CC4 T;  2F1L A;  3BDL A;  2EWN A;  1YBY A;  4BAC A;  2E5Q A;  3ZFJ A;  3E19 A;  1K9M U;  4QQG A;  4C5I A;  3EG1 A;  1ZUY A;  2RQT A;  3G1J A;  4M75 F;  1C1A A;  3PMT A;  4OMP A;  4F7U B;  2QA4 Q;  3MPU B;  1JJ2 P;  2RHU A;  4HVU A;  4M7D D;  3M0U A;  4J9B A;  2V26 A;  4OB1 B;  2JW4 A;  4JDS A;  5LL6 S;  3G4S T;  1QVG P;  2CYZ B;  4DEX A;  1WXU A;  4HKE A;  2KI7 A;  1VIE A;  4PJM A;  4ORZ A;  4IIO A;  2EYQ A;  4C8Q C;  3CCE A;  5LJ5 h;  1G3Y A;  3SD4 A;  3QDF A;  3OYL A;  3LGL A;  2WSF E;  1MGQ A;  1W6X A;  3RKW A;  3OW2 S;  1YHQ T;  1SG5 A;  4QQD A;  4BI8 B;  1D09 B;  2DJZ A;  2JMC A;  1JO8 A;  2Z0W A;  1LVK A;  3RMQ A;  3UT1 A;  3RR6 A;  2DO3 A;  2MK5 A;  2QEX Q;  4A4E A;  4KGZ B;  4L6V 5;  2DRM A;  1Q7Y C;  1D0X A;  3OY9 A;  4ANJ A;  2HMA A;  2C0I A;  4BI4 A;  1WLP B;  4GLM A;  2FZK B;  2JTM A;  3OW2 A;  2K6D A;  5GMK m;  1PKT A;  2V8K A;  3JB9 G;  2HBP A;  2YRC A;  4EDU A;  4JZ3 A;  2VC8 A;  2A36 A;  5GAN 8;  1VQ9 A;  4E2F B;  2NUZ A;  3CD6 A;  3M56 A;  1WQW A;  2BUD A;  1OU9 A;  4XU3 A;  2RF0 A;  3G6E A;  2BE7 D;  2EIF A;  1K8A R;  2RH2 A;  3CC2 Q;  2FYK A;  1RAH B;  1T3S A;  4M7D A;  1ZUU A;  2GQI A;  5KYY B;  5LJ3 g;  2KMT A;  3S3N A;  3REB B;  3JCM h;  1D0Y A;  4IUQ A;  1SF9 A;  1JBM A;  2A3L A;  1VQ7 A;  3CCV Q;  2DJQ A;  5FLX E;  3I55 A;  3JV3 A;  1KQS A;  1VQL A;  2ZAE A;  4RMO A;  4RTW A;  1MND A;  1PG5 B;  2EFI A;  3SWN A;  2DIQ A;  4M7A B;  3EG3 A;  4F7U G;  4LUE A;  4C8Q B;  2DPP B;  2PZ1 A;  3OBW A;  1YNZ A;  2HQH A;  3CCE Q;  2CS7 A;  4MZT A;  2EGA A;  2CZ7 B;  3MP8 A;  4OGE A;  1WI7 A;  2GBQ A;  5EG2 A;  3M58 A;  2K57 A;  2O4X A;  3CC7 A;  1AWO A;  1X6O A;  1NEB A;  1NYF A;  1SRL A;  4ZGE B;  2OTL A;  4C0G A;  3FC3 A;  1YIJ A;  2VKN A;  4PJO F;  4JRP A;  3DLL A;  5LJ3 j;  4J8O A;  1PNJ A;  1TU0 B;  3OYG A;  3EG0 A;  3VS6 A;  1WHJ A;  4XTX A;  4OB3 B;  5DM7 R;  1X75 C;  3CCQ A;  3KFV A;  1ZA2 B;  5CO7 A;  3M0Q A;  1K9M R;  4WF2 A;  2MYS A;  1ZSZ A;  2DL8 A;  4KUD K;  3LYI A;  1KC8 C;  2GFA A;  4F14 A;  3JB9 H; 
#chains in the Genus database with same CATH homology
 2MWO A;  5HY6 A;  1VQ7 T;  4Y28 E;  1KG1 A;  2FB7 A;  3OYB A;  2QTX A;  2QA4 A;  5GMK h;  4NL3 A;  1PSE A;  3RER A;  5C6S A;  3I55 T;  1VQO A;  1G3S A;  1VQK A;  1K8A C;  4OB0 B;  1I8F A;  1M4Z A;  2PUK B;  3GF5 A;  3M57 A;  4EMH A;  4PJO D;  2X4X A;  4RCB A;  1V29 B;  3JCM Q;  4BDZ A;  2LT1 A;  1U1S A;  2K5L A;  5GAN 7;  3CCJ A;  2XK0 A;  5GAN 2;  1DJ7 B;  5LJ5 g;  4A4F A;  4XU0 A;  3NFC A;  1BI2 A;  3CCR A;  1LOJ A;  4DOV A;  4PLL A;  3OYE A;  4M7D G;  4J6Y A;  5CQY A;  4M78 D;  4Y91 A;  1Q7Y U;  4JLG A;  1KD1 C;  3P8H A;  2E41 A;  2GQV A;  4KT0 E;  1VQM A;  2QXF A;  2DEQ A;  4HCZ A;  2XDB A;  2XHC A;  1YJ9 A;  3CC4 A;  3FDR A;  2VXE A;  2E65 A;  1G3T A;  3V8L A;  5A0D A;  3OYA A;  2PVO B;  4MMK A;  4VUB A;  4C5G A;  4XU2 A;  4ZTF A;  3OS1 A;  1TH7 A;  3A8L B;  2Y90 A;  3WXM B;  5GAM h;  2EQJ A;  1KQS S;  3P8B B;  4JRK A;  3GNF B;  3DLM A;  3MEW A;  1WGS A;  3A8O B;  4JRI A;  1NJI C;  4IUV A;  3TRE A;  4X9C A;  3INZ A;  3JCM d;  4FSX A;  1Q86 U;  3M4G A;  4D6W A;  2WSE E;  3JCM f;  1LNX A;  4C0Z A;  3MO8 A;  5CVI A;  4EPC A;  4MDW A;  4IKF A;  3JCM J;  5GAN j;  1AHJ B;  1N9S A;  1Q81 U;  1M1G A;  1BI1 A;  2ZPF B;  4R55 A;  3QG1 A;  4JRQ A;  2QEX A;  4M75 E;  3PFS A;  4XTV A;  1WJS A;  2XDD A;  5KE3 A;  3FJP A;  4NOY A;  2LCL A;  2ZPI B;  1KHC A;  4ZN1 A;  3OYD A;  3V7C A;  3EFS A;  4C92 G;  5GAO q;  2DZC A;  3JB9 J;  2K5F A;  1WJQ A;  3G4S A;  3J80 E;  5GAO r;  3R6O A;  3PTA A;  2L89 A;  2VXF A;  2YLC A;  1RL2 A;  1YI2 T;  3S6W A;  1O9S A;  3URG A;  2Y4Y A;  3QKJ A;  3CPW S;  2JTF A;  3VU3 C;  2P0P A;  2QA4 T;  4C0D C;  2DKG A;  3H6Z A;  4V2S A;  1M1F A;  4ELY C;  3CCS A;  1VQP A;  1YJN A;  1ZBX A;  3A8G B;  4L59 A;  4OGC A;  3QZ9 B;  5GAN d;  2P0Q A;  1VQK T;  2L5Q A;  2QQB A;  5LJ5 j;  5IAY A;  1M5Q 1;  1NZ9 A;  5GAN f;  3CBP A;  3JCM X;  3RIR A;  4M7A G;  3GNG A;  3M59 A;  4RG2 A;  1YHQ A;  4C8Q G;  1WPY A;  2LQ8 A;  2QQS A;  1M90 C;  4M7A E;  4PJO B;  4MDX A;  1WJR A;  3CCJ T;  1K73 C;  4C8Q E;  1QVF S;  2HQE A;  2LTO A;  2LVM A;  2DXB A;  2FVU A;  2DIG A;  3PNW C;  3A8H B;  4LDY A;  3CCR T;  3L1A A;  3HSB A;  3JB9 F;  1G3W A;  4F7U E;  5DLQ E;  3TCJ A;  3CC2 A;  2BKD N;  4BE0 A;  1BIB A;  4BB7 A;  2VGM A;  2OTJ T;  2R58 A;  1K9M C;  1M9S A;  5I21 A;  1FWZ A;  1LJO A;  4M78 B;  3E1S A;  3MP1 A;  3ASK A;  3ZEH A;  1X01 A;  2EKO A;  2XIC A;  4PJO A;  3HL8 A;  2R5A A;  1VQ9 T;  1OZ3 A;  5GMK j;  2O01 E;  2K3X A;  4M77 F;  1FX7 A;  2HNI A;  3M9Q A;  5D6W A;  3RKY A;  3JCM g;  2D6F A;  2X4Y A;  5LJ5 f;  3HP9 A;  1FXX A;  3JRZ A;  5J3B A;  5I2S A;  3UWN A;  2DD5 A;  1QP3 A;  4CI0 C;  3VYH B;  3M5A A;  3QZ5 B;  2RHI A;  5CCA A;  3JB9 I;  2QQR A;  4ZGD B;  3AHU A;  3F70 A;  4M78 A;  4PJO C;  1VQ4 A;  4J83 A;  2LQK A;  5CKE A;  1OZ2 A;  3C94 A;  3NTI A;  1Y7X A;  1JRI A;  2RB6 A;  2G3R A;  2K4Y A;  2M0O A;  2RI3 A;  2RD1 A;  4OMF B;  3GPL A;  3CCV A;  1VQN A;  3RMS A;  5GAO p;  2A7Y A;  3WVE B;  1QVF A;  2JN0 A;  5CIU A;  1QW1 A;  3ME9 A;  4A54 A;  3GOX A;  4MZP A;  3OSS C;  3JB9 D;  3EAE A;  3SB2 A;  4M78 C;  5FRO A;  2X4W A;  3CXC A;  4X34 A;  2MWP A;  1W4S A;  3QO3 A;  3DB4 A;  2WAC A;  5CAI A;  5GAN g;  2DXC A;  2DZ9 A;  2CGH A;  2JVV A;  3LX7 A;  2ZPG B;  4LDU A;  4PL6 A;  5GAM e;  1I4K 1;  4HT9 A;  2L8D A;  4RKU E;  1UGS B;  4M77 D;  3CCS T;  4JS4 A;  4ZN3 A;  5LJ3 e;  1S72 A;  3CCL A;  2KQW A;  5GAN 3;  3QUI A;  3HKS A;  3BW1 A;  1VQ8 A;  4TVR A;  4J6W A;  4J6X A;  3MEU A;  5D6X A;  5J39 A;  2RJF A;  1QVP A;  4ZGJ B;  1KC8 U;  2KVQ G;  1I5L A;  3JCM b;  1VQL T;  4ATO A;  5IN1 A;  3H8Z A;  4DOW A;  4F7U F;  2D9T A;  4OF1 A;  5AYF A;  1OYX A;  2PUO B;  2XID A;  3QDR B;  2K3Y A;  3HHT B;  1JJ2 A;  2K5I A;  3CEY A;  1NE8 A;  1PSF A;  2MI6 A;  3BDU A;  3NTK A;  4YTL A;  5FU7 B;  5DY9 A;  3X20 B;  4BDY A;  3HFO A;  3UDC A;  4L5G A;  4QVC A;  1RI0 A;  1M1K C;  1XQH A;  1QP2 A;  2PQW A;  2X4J A;  4XTW A;  1K8A U;  1QVG A;  1KQ2 A;  5M9O A;  3CME A;  3OYY A;  2ZPB B;  4BD3 A;  3EFR A;  4Q5W A;  4RG8 A;  4PNO A;  1U1T A;  4ZTJ A;  3RKX A;  2DXT A;  4M7D E;  4QQ6 A;  5GAO m;  2E6Z A;  1I81 A;  3CCM A;  3CC7 T;  4GLK A;  4JLI A;  3NTH A;  5KCO A;  1ZHI A;  2OTL T;  2XG8 D;  3A8M B;  2YLB A;  1YIJ T;  4KUI A;  3OYC A;  4LD6 A;  4FM4 B;  2QQA A;  4C0D B;  5HKC A;  3CCU A;  1KD1 U;  1VQ6 T;  5LJ3 h;  3OMG A;  4MML A;  2DAQ A;  2LNV A;  4II1 A;  4IUU A;  3G7Z A;  4R56 A;  5FU7 C;  4KUL A;  1VQ5 T;  3BY7 A;  4KBM B;  4GY5 A;  3MEV A;  3I56 A;  3CBM A;  3WVD B;  3CCQ T;  1YJW A;  4A4G A;  2KSS A;  3LW5 E;  1N8R C;  4C5H A;  2IVW A;  1NJI U;  1KQ1 A;  3JCM c;  5KE2 A;  1M8V A;  4C5E A;  3PT9 A;  3E9F A;  1VIF A;  1W2B S;  2EJF A;  3GP8 A;  1Q82 C;  2E10 A;  2B8A A;  4J7I A;  2XI9 A;  1YIT A;  1BI3 A;  4NS5 A;  5CK9 A;  4HA8 A;  4C92 E;  1GXI E;  3QJ6 A;  2KY9 A;  2R5M A;  2IG0 A;  4E7H A;  3CCL T;  2E70 A;  4P5N A;  1VQ8 T;  2DTO A;  2RI2 A;  2RI5 A;  4M77 B;  5CKH A;  2L3R A;  2RO0 A;  3QHS A;  4HCC A;  5FRN A;  3X24 B;  2V8J A;  5FRM A;  4XU1 A;  1VQO T;  4EMK B;  4PJO G;  3VUB A;  2JNG A;  5GAM g;  3HFN A;  3X25 B;  4B9W A;  1WQ7 A;  4X9D A;  3QJY A;  1UGQ B;  3M54 A;  4HT8 A;  2XDP A;  5L8R E;  4QVZ A;  2HD0 A;  4JUV A;  4EMG A;  3MHX A;  4M77 A;  4M7D F;  2E1H A;  1IRE B;  2EAY A;  2HAX A;  1BYM A;  2EQM A;  3OS2 A;  2KDS A;  3CME T;  4M78 G;  1N9R A;  3JAM E;  2RJD A;  4EMK A;  1N27 A;  3L2U A;  3CXC S;  4N4H A;  3VUZ A;  4A53 A;  2DD4 A;  1M90 U;  2RHX A;  4XQ3 A;  2ZPE B;  3N5B B;  4IUR A;  3OBY A;  3T9N A;  1K73 U;  1VQM T;  1W2B A;  1YJ9 T;  3CC4 T;  3CCM T;  5LJ5 e;  3OS5 A;  4M77 C;  3BDL A;  2VUB A;  4DQ2 A;  5CKD A;  2EWN A;  2LDM A;  1YBY A;  4BAC A;  2E5Q A;  3ZFJ A;  4MZM A;  3X28 B;  4EMK C;  3CCU T;  4N4I A;  1EIF A;  3E19 A;  1G5V A;  1K9M U;  2XU8 A;  4N4G A;  4QQG A;  3JCM W;  4C5I A;  3X26 B;  1UGP B;  4M75 C;  3SFM A;  4M75 F;  5GAO n;  2P4T A;  1JJ2 S;  3PMT A;  3I56 T;  3FRN A;  1XTD A;  3RUX A;  4C0F A;  4XTU A;  3FB9 A;  4F7U B;  2Y4X A;  4UC4 A;  2QDY B;  2QEX T;  2RHU A;  3DKM A;  1NPR A;  2GCX A;  3L2Z A;  4Z02 A;  5I2M A;  3SWN C;  4C92 F;  1QVG S;  4M7D D;  4OB1 B;  5CKB A;  3L2W A;  2CKK A;  3QBY A;  5D6Y A;  3J81 E;  4XTZ A;  3LWI A;  4JS5 A;  4JDS A;  2YRV A;  5DLO A;  5GAO l;  5LL6 S;  3G4S T;  2LT4 A;  2CYZ B;  2ZGW A;  5FU6 C;  4PKC C;  4F7U A;  4HKE A;  4QVD A;  2MAM A;  4J7F A;  4CRI A;  5GAM j;  2DTH A;  4FT4 A;  1D3B B;  3PMI A;  1VIE A;  1Y96 B;  2H3J A;  1YJN T;  1WNL A;  1VQP T;  2QI2 A;  4BE1 A;  2EYQ A;  3CPF A;  4M7A F;  4C8Q C;  3VV0 A;  3CCE A;  4C8Q F;  4LDV A;  5LJ5 h;  1G3Y A;  3SD4 A;  4IUT A;  2X35 A;  3OYL A;  3LGL A;  2WSF E;  5IT9 E;  1MGQ A;  3RKW A;  3OW2 S;  1YHQ T;  2OAU A;  4QQD A;  4M75 D;  4BI8 B;  2GF7 A;  1D3B A;  1Y96 A;  2DJZ A;  3PIO A;  3HRT A;  3OYN A;  3HPW A;  4XTY A;  1VUB A;  4C92 D;  3CC2 T;  4FL6 A;  5GAM d;  2RM4 A;  3RMQ A;  1YI2 A;  5GAM f;  5LJ3 d;  2FHD A;  2KK4 A;  3UT1 A;  5LJ3 f;  4E47 A;  1R8O B;  2DO3 A;  4LD9 K;  3JCM P;  2ZCF B;  4A4E A;  2HQX A;  2D0Q B;  2LCC A;  3HRS A;  1XNI A;  1M1K U;  2NLU A;  3HRU A;  1Y07 A;  2E6N A;  3QYG B;  4L6V 5;  4XK8 E;  1SSF A;  1Q7Y C;  3OY9 A;  3C4S A;  3LGF A;  4M7A D;  5CKF A;  1U8R A;  4FIB A;  4C8Q D;  2JZ2 A;  3DB3 A;  3QYH B;  4FT2 A;  4BI4 A;  5A0G A;  1VQ4 T;  3MCA B;  2F5T X;  1UEB A;  2I2L A;  3JCM e;  3QPH A;  2JTM A;  3OYK A;  3OW2 A;  1VQN T;  3M4Y A;  3CCV T;  2DK3 A;  2FL7 A;  5GMK m;  4ME7 A;  2V8K A;  3JB9 G;  2HBP A;  2OTJ A;  3O8V A;  4EDU A;  3OSV A;  2RHY A;  3OMC A;  2JUF A;  1N6A A;  2VC8 A;  2AHJ B;  3PGG A;  1JB0 E;  5GAN 8;  2PU9 B;  2VGN A;  2V8I A;  1XOV A;  4M7D B;  2EJ9 A;  5HK3 A;  2RK2 A;  1VQ9 A;  1Q86 C;  5CR2 A;  3G71 A;  3CD6 A;  3M56 A;  1WQW A;  4O5V A;  2BUD A;  5KH6 A;  1UB4 A;  2EQU A;  3Q1J A;  4XU3 A;  3L42 A;  1Q81 C;  4XAX B;  3KBG A;  4M77 G;  3G6E A;  3S3M A;  2EIF A;  2DTI A;  2XD0 A;  1N8R U;  2RH2 A;  4LDW A;  3OYJ A;  4M77 E;  1S72 T;  2VV5 A;  2FYK A;  2XKO C;  2LX9 A;  3S3O A;  1YCY A;  3V8K A;  3CCE T;  1O75 A;  2CZ1 B;  4M7D A;  2BIV A;  3OYF A;  1Q82 U;  2R57 A;  2EJG A;  3FLG A;  2F69 A;  5GAN e;  2PVD B;  4M75 G;  5KCH A;  2EQK A;  3KXT A;  4PJO E;  2KAF A;  2F5K A;  3KUF A;  2PVG B;  4E7I A;  3V7S A;  5LJ3 g;  3QSU A;  2KMT A;  4M75 B;  2YHT A;  3M53 A;  1H64 1;  2ZPH B;  2CZ6 B;  2WSC E;  2MF2 A;  3BFM A;  3MP6 A;  4M7D C;  5A2Q E;  4BI3 A;  3S3N A;  3JCM h;  2DVE A;  5A0L A;  1H3Z A;  4IUQ A;  3LWH A;  1BI0 A;  3CMA A;  4C92 B;  2VYT A;  3VJP A;  1JBM A;  3SDZ A;  3SWN B;  2A3L A;  3C95 A;  3ER0 A;  3P8D A;  2JOY A;  4M78 E;  4E7J A;  1VQ7 A;  3PIP A;  2P0K A;  3FEO A;  2LC4 A;  3C12 A;  4M75 A;  4FU6 A;  2E64 A;  2RJC A;  3OQ5 A;  4IUP A;  4N0A A;  3V7R A;  3JCM V;  1B34 B;  4BY6 B;  2RJE A;  5FLX E;  4HCB A;  3I55 A;  1KQS A;  5FU6 B;  5GAN 4;  2QQ9 A;  3OYH A;  3J7A F;  1VQL A;  4RMO A;  3FIF A;  5CQX A;  2EFI A;  1NPP A;  3MET A;  1HXD A;  5J26 A;  4C92 A;  1IZ6 A;  2M9U A;  3GIB A;  3SWN A;  4B9X A;  2DIQ A;  4A4K A;  4M7A B;  4F7U G;  3L2V A;  4OB2 B;  3OA6 A;  4C8Q B;  4OP0 A;  3JSC A;  1Y71 A;  2DPP B;  4PLI A;  2O4X B;  3OBW A;  3A5Z B;  4N0A C;  1B34 A;  4ELZ C;  5GAN h;  5GAN 5;  3QII A;  4RCC A;  3ZBD A;  4BUG A;  1YJW T;  2CS7 A;  4MZT A;  2C06 A;  2M1H A;  4BE2 A;  3LH0 A;  3MEA A;  4C92 C;  4E7K A;  1OI1 A;  4DA4 A;  2CZ7 B;  5GMK e;  3MP8 A;  5LJ5 d;  4OGE A;  3G71 T;  3CD6 T;  5GAN 6;  4M7A A;  2MMP A;  1MHN A;  3M58 A;  5EG2 A;  4C8Q A;  2GFU A;  3TU4 K;  3OB9 A;  2K57 A;  2RHZ A;  1P92 A;  2LRQ A;  1YIT T;  2O4X A;  3CPW A;  4BY6 C;  3G6E T;  1X6O A;  2M16 A;  3VYG A;  3CC7 A;  2RK1 A;  4NL2 A;  3VKI A;  4ZGE B;  3RES A;  4A4H A;  4C0G A;  3FC3 A;  1YIJ A;  2OTL A;  2K2V A;  4J5Y A;  4JJN K;  1UGR B;  4PJO F;  1VQ6 A;  4JRP A;  2DXU A;  3DLL A;  1BIA A;  5C0M A;  3GLX A;  5LJ3 j;  3E9G A;  4J8O A;  4M7A C;  3OYG A;  3CBO A;  4XTX A;  5HK0 A;  3OYI A;  1VQ5 A;  1BKB A;  4OB3 B;  5DM7 R;  1HK9 A;  5GMK l;  1X75 C;  3CCQ A;  3UPU A;  2ZZD A;  5GMK i;  3OYM A;  4O6J A;  5CO7 A;  2RA2 A;  3TEE A;  4OVA A;  4LDX A;  3LLR A;  3L2Q A;  4M78 F;  2E12 A;  4QW2 A;  4WF2 A;  3V8J A;  3QXE B;  2CZ0 B;  4KUD K;  3L2R A;  3CMA T;  3LYI A;  4E7L A;  1KC8 C;  1KHI A;  3M55 A;  2GFA A;  3OS0 A;  3JB9 H;  1ZQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...