2RJEA

Crystal structure of l3mbtl1 in complex with h4k20me2 (residues 17-25), orthorhombic form ii
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
313
structure length
309
Chain Sequence
WSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Lethal(3)malignant brain tumor-like protein
publication title L3MBTL1 recognition of mono- and dimethylated histones.
pubmed doi rcsb
source organism Homo sapiens
total genus 84
structure length 309
sequence length 313
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rjeA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rjeA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rjeA03
3SD4A 4Z02A 4BE1A 4PLLA 3OQ5A 2GFUA 2RJFA 3LYIA 4GY5A 4HCZA 2NLUA 3L2VA 2K3YA 4IKFA 3BDLA 2RJCA 2RJEA 3OYFA 2EQUA 2XDPA 4QQGA 4BE0A 2EQMA 3Q1JA 2L8DA 4IUPA 4LD6A 3NTIA 3OYJA 4CRIA 4E7LA 2O4XB 2GF7A 3OYKA 3E9FA 3QBYA 1MHNA 2L3RA 4E7HA 5IN1A 1G5VA 3OB9A 4N4GA 5KCOA 1KHCA 3ME9A 1WGSA 2F5KA 2DAQA 2R5AA 4UC4A 5D6WA 3MP8A 4QVZA 3S3OA 2M16A 5J39A 4BACA 1WJSA 2RI3A 1OI1A 3QJ6A 2GFAA 3MEWA 3S6WA 3FEOA 5KCHA 3DLMA 3MP6A 4BDZA 5C0MA 3NTKA 4E7KA 1XNIA 2K3XA 3L2RA 2FHDA 3OYEA 1H3ZA 3OS2A 2R58A 3P8DA 5J26A 4A4EA 1RI0A 3QIIA 4E7IA 2JZ2A 3LX7A 2EKOA 2QQSA 2G3RA 2M1HA 3PMIA 2RHIA 3H6ZA 2P0KA 2RHUA 1OYXA 4PLIA 2DIGA 1SSFA 2JTFA 2B8AA 4B9XA 3CEYA 4FU6A 5D6YA 2VYTA 3OS0A 2BKDN 3NTHA 3O8VA 3GOXA 3UWNA 4Q5WA 2X4WA 5CIUA 2LVMA 3OS1A 3OYHA 2E6NA 3OYNA 1OZ3A 3OYAA 4FL6A 4IUQA 5FRNA 5M9OA 2RJDA 2MWPA 4N4HA 3OYIA 2XK0A 4ZTJA 3ASKA 4OVAA 3KUFA 5C6SA 3LGLA 2L89A 3FDRA 3P8HA 4X34A 4C5IA 2RHXA 3OYBA 3FLGA 3OY9A 3M9QA 2LRQA 2RI5A 5D6XA 1OZ2A 3PFSA 3E9GA 2RI2A 4C5GA 5KE3A 3MP1A 2LTOA 2X4YA 4QQ6A 3L2QA 5KE2A 3LGFA 2BIVA 3PMTA 3S3MA 2MWOA 3OYDA 3FC3A 3L2WA 2QQRA 3OYGA 2EQKA 4II1A 3DB3A 4IUTA 2R57A 4IUUA 4RG2A 4C5HA 4QW2A 3OYMA 4L59A 4E7JA 2EFIA 3H8ZA 3ZEHA 4ZTFA 2CKKA 3OYCA 3EAEA 2R5MA 3LLRA 2RHZA 3OMGA 4A4GA 3MEUA 5KH6A 3MO8A 3OYLA 3META 3L42A 2M0OA 2D9TA 4PL6A 4EDUA 4N4IA 3UT1A 3C4SA 2DIQA 2LCCA 2HQEA 3F70A 1WJRA 5IAYA 3L2UA 3MEAA 4BE2A 3MEVA 1WJQA 2O4XA 2PQWA 2RO0A 2WACA 2X4XA 4QQDA 4C5EA 2RHYA 2X35A 3LH0A 2BUDA 4A4FA 4IUVA 2YRVA 2EQJA 2E5QA 5FROA 5FRMA 3OMCA 4B9WA 4BD3A 2LDMA 4IURA 3S3NA 4BDYA 3DB4A 2HQXA 2IG0A 3QKJA 4NS5A 3OA6A 3PNWC 1N27A 4A4HA
chains in the Genus database with same CATH superfamily
3L1AA 2KYMA 5GMKj 3LYIA 2LNVA 1RAFB 3P8BB 4J6YA 2RF0A 1FX7A 2ZPHB 3CMAA 2LCLA 4PFPA 3E9FA 1VQ9Q 2CS7A 2DNUA 1MMNA 2B86A 1PWTA 4JRQA 4M77F 1WIEA 3GP8A 1AZEA 2CT3A 4OGCA 3LWIA 1VQKA 3EFSA 3M59A 2K3XA 1DJ7B 1UGVA 5KYXA 3J81E 1KG1A 4J5YA 4IIMA 4AFUC 2Y4XA 1OYXA 2JTFA 1KC8U 2ZPBB 5FLXE 3NMZC 3G6EA 1J3TA 4KT0E 3OW2P 1WDXA 1B7TA 2KSSA 2F2WA 1SRLA 2X4WA 3VJPA 2WSFE 5GANe 2E6NA 2LX9A 2JVVA 1M8MA 2F2VA 4ZN3A 3SFMA 4D8KA 4C5IA 2PNIA 1M27C 4OF1A 2RI5A 2YUNA 4Y92A 2A37A 5KYYA 3CCUQ 2OTLA 1YNZA 1U5SA 1BI0A 1YHQQ 1UGQB 4FM4B 2DETA 4IUTA 4C5HA 2AKKA 5I2MA 4ZTFA 1Q7YR 2KXDA 5GANf 2AIRB 2JN0A 1G83A 3MEUA 2OTJT 1R77A 1M8VA 1W4SA 1WJRA 2LQWA 2VVKA 3CCSQ 3TQ7P 1Y57A 2E5KA 5LJ3e 3TU4K 2BZ8A 5GAMd 3RDVA 3DB4A 4OB0B 1MNEA 1ZBXA 3REBB 3EHQA 1M90R 2K57A 2F69A 2RJFA 5CKBA 5LJ5d 1BCOA 1PRLC 2DJQA 2GTJA 2KT8A 1M90C 2RK1A 4OMPA 3C95A 2KRSA 2CZ6B 5IH2A 3JCMQ 4N4GA 1Q86U 4OMFB 4C8QF 2RM4A 5LJ3f 8ATCB 3CCLQ 4PFOA 4M78B 3A8MB 2ZAEA 3CCET 1WXBA 3QWXX 4HVUA 3GPLA 1X2QA 4M75B 1VQMA 5FU6C 3CEYA 1HD3A 2VYTA 1YJWQ 2BKDN 1HYOA 1JBMA 5FU6B 5GANj 1OULA 1YP5A 2FZGB 1FWZA 4JJBA 5FRNA 4ZGJB 5L23A 2NUTB 4C92E 3UA7A 4PJOB 4OVAA 2QQ9A 4FYXB 3VRYA 5KYXB 2L2PA 1KD1C 1FMWA 1V29B 2VWFA 4II1A 2K4YA 2R57A 4J9GA 4QW2A 1ZSZA 2P4RA 2CZ7B 2E3HA 2R5MA 2YRCA 7AT1B 3MO8A 3M4YA 1IRXA 1ZBJA 4E7SA 4LUEA 3UT1A 1YITA 1VQ4T 2L3QA 4M78F 2O4XA 5KYYB 4XTZA 1WFWA 5GANg 2WSCE 3LH0A 5DLQE 3G1JA 3QJYA 2AZSA 4M75F 3PNWC 3V7RA 2DM1A 3SD4A 4ATOA 3FIFA 2NLUA 4PFZA 2XI9A 2KR3A 1TTHB 4R0KA 3EHRA 3HFOA 3OYJA 4CRIA 4E7LA 2IVWA 3G71A 2OTJQ 3IQLA 3RKYA 4PJOF 2HKQB 2CZ1B 1EZZB 1G2BA 2DAQA 1IXDA 4J7FA 4VUBA 1OI1A 1SSHA 4RTVA 3DLMA 4OB1B 4V2SA 4M7AF 1KQ1A 2FO0A 1K4US 1NBEB 1D09B 1YFNA 1VQOA 4RG8A 2DZ9A 4JRIA 1OEBA 2V8KA 4FU6A 1TH7A 2ZZDA 4JPBW 4F7UE 2FRYA 2GGRA 2KVQG 5GAN2 4M7DF 2LQNA 1MNDA 1WHJA 3JV3A 2MWPA 5GAN6 3EG2A 4JLGA 2C0TA 3CD6T 1CKBA 1W6XA 3M0SA 2RQVA 3JCMb 2BE7D 1HJDA 1Q7YU 2MYSA 2MK5A 3CPFA 3CCVA 5GAMe 4RTXA 1D1BA 2HL3A 2J7IA 1UEBA 4JUVA 1W1FA 1MV3A 5LJ5e 2EYZA 1NEGA 1VQ8T 2A08A 3INZA 3META 3JAME 2RH2A 3C4SA 4BY6C 1EIFA 4BUGA 4MZTA 1UGPB 3I55A 3JCMW 3WVDB 2J05A 1M90U 1OPLA 4IUVA 4C0ZA 5FROA 1ZSZC 2COZA 2CT4A 3JCMc 2M9UA 1SPKA 1ZSZB 3H0FA 4FT4A 5GAMf 2VV5A 2DL4A 2YUOA 2QEXA 2CP6A 1VQNQ 1FMVA 1OPKA 1FMKA 5LJ5f 1I81A 3M57A 4LN2A 3GLXA 3TEEA 2O4XB 5HK0A 2EQIA 2DLPA 1N8RC 5IN1A 1KHIA 1IZ6A 4RTZA 3RNJA 1AD5A 2AZVA 3O5ZA 4AG2C 4IIOA 5KCHA 3SEMA 4ELYC 2PTKA 3QZ9B 4HT9A 3JB9D 5GAN3 4A4EA 2LX7A 1M2OA 3PMIA 1RLPC 2P0KA 1PSEA 2V1RA 1AWJA 4YTLA 4J9HA 1K0SA 3RBBB 1KD1U 5CQYA 1NEBA 2GBQA 1N9SA 1O75A 1SHGA 4Y91A 1YWOA 2DF6A 1IB8A 2BE9B 1I07A 2LC4A 2M0YA 2EJ9A 4E2FB 1VQ5T 4DOWA 4M77A 1QVFP 1WHLA 2X4YA 1V1CA 3VS4A 1A0NB 4FW1A 1F1BB 5GAMj 2SEMA 4L5GA 2MIOA 2QGGA 2LP5A 4RG2A 3KBGA 3CCJT 3OW2S 3ZEHA 4CC2A 5LJ5j 1I8FA 4KGXB 3RMSA 4PL6A 3TSWA 3QZ5B 3QUIA 1WLPB 2QQAA 4KGVB 1M2VA 3CMAQ 1RL2A 5GAOl 1GFCA 1RACB 2DBKA 1K9MR 1BI1A 4B9WA 3RKXA 1PKSA 2QTXA 3ZL7C 1K9MC 1VQKQ 2AHJB 2XDBA 4IKFA 3DKMA 3VKIA 2DL8A 2RA2A 2RJEA 2XDPA 4J83A 2EYXA 2EQMA 2HQHA 2EGAA 2LT1A 1U3OA 1PSFA 1QMCA 2LQKA 2R5AA 3E1SA 4AG1C 3G6EQ 1K8AR 3BDUA 1VQ6T 3I35A 1VIFA 1NPPA 2MF2A 2YT6A 5C0MA 2K5FA 3E2UA 3OS2A 2VC8A 3JB9G 1YITT 5IXBA 1P92A 3DLLA 4KH1B 1Z9ZA 1SSFA 2JMCA 1N9RA 4PK4A 2E65A 1HSQA 5LJ3d 5IHIA 4M7AG 2ROLA 5A0LA 3ASKA 3UATA 5GMKh 4C92G 4XTWA 2HDAA 2LMJA 4C8QA 4E47A 3NPFA 4C5GA 3QDRB 1Q86C 3S3MA 1CKAA 3OYDA 3OYGA 2EQKA 3VV0A 1WX6A 2EFIA 2V1QA 2XMFA 2P0PA 2DD4A 3LWHA 1I0CA 2FPEA 1VQOT 1R0BG 2FEIA 1YBYA 3WXMB 4BE2A 4M77B 2XU8A 2JOYA 4QQDA 3CC2A 4EPCA 5AYFA 2CYZB 4XTYA 3JCMJ 3VUBA 1GXIE 1RADB 5GAN4 2LJ1A 3JCMX 1O9SA 3A8OB 4PLLA 2HBWA 1NZ9A 2YWWA 2KI7A 2HL5C 2EQUA 3I5RA 1YIJA 2KEAA 2L5QA 4J6XA 1M2VB 3QBYA 4QKUA 1RLQC 2E64A 4F16A 4OMNA 1PD0A 1VQMQ 3KXTA 5CKDA 1AWWA 1KHCA 2DXTA 2F5KA 2PZ1A 3QG1A 1YJ9A 2EIFA 3CBPA 2GNCA 4BACA 4WCIA 3HRSA 4M78A 2YSQA 1YI2A 3TVTA 2FHDA 3CCRA 2KYBA 1RI0A 3QIIA 3I55T 1YJWT 3URGA 1ZLMA 3EH2A 2QQSA 5FU7B 4M75A 2E1HA 2EW3A 3OBYA 4CC3A 2A28A 5CCAA 5CKHA 1D1CA 4F7UG 2CP5A 4XAXB 1TWBA 2DL7A 3JRZA 2QAZA 1WYXA 4AFZC 2NUTA 2L89A 1VQ6Q 4PJOA 5DLOA 3VS2A 1WI7A 1KQSP 3FLGA 1KSWA 2E10A 4DQ2A 4GLKA 5I11A 1LNXA 3HFNA 1YITQ 2XG8D 4QQ6A 1PRMC 4M7AA 3L2WA 2A7YA 1X6GA 2EYWA 4B6MA 1H641 2DVEA 3VYGA 3CBMA 4FSSA 1S72A 2RHZA 3OMGA 1M30A 1X2KA 1GBRA 1K9MU 2YRDA 2L3SA 4C8QB 2ZPGB 2VKNA 5KYWA 3OW2A 3JCMd 4M7DA 4DEYA 2K3BA 2NYSA 2JXBA 4F17A 5D7UA 4CC4B 2CSIA 1PC0A 2D6FA 5GANh 2ECZA 3R6OA 2EJFA 2RQRA 5IHKA 3OQ5A 3CC7T 1LCKA 2W0ZA 1E6GA 1M4ZA 3D7SB 3M55A 3A1PA 2YDLA 4XU1A 2DTIA 1Q7YC 2QQBA 2RPNA 1VQOQ 2EJGA 1MMDA 2A0FB 4QVZA 2M16A 1VQPA 3RESA 2AKLA 3VS3A 1Z9QA 5ECAA 2CUDA 2OAWA 1S1NA 3QO3A 2O31A 1LVKA 1GL5A 1LPLA 4J9CA 4ZGDB 3OS0A 1JO8A 2PUKB 3FJPA 3GNGA 2HZYA 1ZUUA 2K9GA 1GRIA 4M78C 3OYHA 4AFQC 3CCVQ 5GMKl 5M9OA 3C12A 3LW5E 3OYIA 4FYWB 2EAYA 3EG0A 3FDRA 1GCPA 4X34A 1AWXA 2KRNA 4ORZA 5KYUB 4M75C 1OZ2A 1PD1A 4J9IA 3L2QA 3RUXA 3I55Q 4R55A 3OYMA 4JS5A 3RMQA 2DRMA 4PJOC 2CKKA 3OYCA 3V8JA 2QK0A 2JJ9A 4OB3B 2RQWA 1QP2A 9ATCB 2HSPA 2OI3A 2QEXQ 2M0OA 2MI6A 3PE0A 2MOXA 1VQ7T 1SHFA 3F70A 4JZ4A 1T0JA 2BUDA 1YCYA 4A4FA 1VYVA 1Y0MA 2FG0A 2ZCFB 5FRMA 2DTHA 4M7AB 1QVFS 3CPWP 2HCKA 2HKNA 5IHNA 1H8KA 1VQNT 1UHCA 3OA6A 4JJCA 4D6WA 1VQLA 1YJNA 1QKWA 1OX9A 3CCMA 2PVGB 4WF2A 5KYWB 4HCKA 4M7DB 2FZKB 3RIRA 1X27A 4E7ZA 5LJ3j 2HD0A 2HSEB 2JNGA 2FYKA 5D6WA 5LL6S 2ED1A 2O2OA 1QCOA 4Z8AA 1UTIA 3OSVA 3FEOA 4BDZA 1AZGB 4J9BA 2W10A 2ZPFB 1ZA2B 2AT1B 3P8DA 3V8KA 3CC7Q 3CC2T 3LX7A 2KT1A 2GQIA 3JB9F 4B9XA 1SRMA 2V8IA 2EWNA 4AT1B 1VUBA 1WHHA 4ZGEB 4GLMA 3MCAB 1QVGP 4OMOA 1BU1A 2EGEA 4MZMA 1JJ2P 2YLCA 3EG9A 1AEYA 2RHXA 1YIJT 3OYBA 4FIBA 3G4ST 5LJ3g 1UFFA 4C92F 3JCMe 3JB9J 4DA4A 3JCMV 4KGZB 1PHTA 1RUWA 3PMTA 4X9DA 5DY9A 3PVLA 3FC3A 4LE9A 4D8DA 3QHSA 2C0OA 3L42A 2DTOA 1MV0B 1JXMA 3CMAT 1QLYA 1U1TA 2DVJA 3L2UA 2LCSA 1X6BA 4CI0C 1D0XA 2D0NA 2FZCB 3M0UA 4XU0A 3JCMf 2E5QA 3JCMP 2HMAA 2IPOB 5FWCA 1VQKT 2IG0A 4FSXA 2DEQA 1N27A 2DILA 2K3YA 3NGPA 3CC4A 4R56A 3L2ZA 1T3LA 2QA4A 2PVOB 2H3JA 4WTOB 2CP2A 2RMOA 3G6ET 1VQ7Q 4EMKA 4NL3A 3ME9A 2O88A 3HRUA 2DA9A 2EGCA 2ENMA 5GAMh 3EGDB 1MMGA 3C0CA 4DBQA 4A63B 4PJNA 4HVWA 2H3EB 5LJ5h 2COWA 4ELZC 1ZUYA 2ZPIB 5GAN5 1SF9A 5GAOq 1JU5C 2OTLT 1QWEA 1BBZA 1JB0E 4FYVB 3UWNA 4Q5WA 2A36A 1BB9A 2LVMA 4C0DB 2MPXC 3OYNA 2VXFA 1OZ3A 3X25B 1NYGA 1WHKA 4N4HA 1N5ZA 4ZTJA 4F7UF 1K76A 4M78D 2X4JA 2O9SA 2DL5A 3V8LA 1NM7A 4J6WA 1IO6A 1LJOA 3E9GA 3V7SA 2G6FX 4M75D 3CC2Q 3CCQA 2RNAA 3EAEA 4OMQA 3EG9B 1ZX6A 4RTUA 3M5AA 4PJOD 2LNHB 3MEAA 1Y96A 4XTXA 1X01A 1W70A 1G3SA 2ATCB 1YIJQ 1KQSS 3G4SQ 2YRVA 1PNJA 1NLOC 1M3BA 3OMCA 4HCBA 4BD3A 2NWMA 3FB9A 1YJ9Q 3HSBA 1BKBA 1I1JA 5GAOn 1BI3A 3L2VA 3CXCP 2A3LA 4PKCC 1QVFA 2DK3A 3MJXA 4QT7A 3Q1JA 4JLIA 3J7AF 3CMEA 2QDYB 3EGXA 1VQMT 4PJJA 2CDTA 3E19A 2P4TA 1M5Q1 2L3RA 1K73R 3H9NA 2DX1A 3G7ZA 2KY9A 1R8OB 3S3OA 1NPRA 5J39A 3V7CA 1KC8R 2YUQA 3KFVA 4JRKA 5J26A 4DBFA 1OQKA 1W2BP 3H0HA 4EMKC 3VS7A 5GAMg 2G3RA 1ACMB 2RHIA 4EMKB 2JT4A 4RMOA 1VOMA 2KROA 2KGTA 2K6DA 1B34B 5LJ5g 3OS1A 1OV3A 2P0QA 5A2QE 1RAEB 1VQLT 3NHNA 4P5NA 3M0TA 4MMKA 1AT1B 4BI3A 3I56A 1FYNA 5EG2A 4FT2A 3QDFA 1S72Q 1K8AC 1Q95G 3CCEA 4KBMB 2EBPA 1M1KR 1ZHIA 1KK7A 1OOTA 1BIAA 3A8GB 3MKDA 3X28B 2MWOA 2OTLQ 2RB6A 3DB3A 4ZN1A 1M1KC 1GCQA 2KXCA 1NJIR 3LLRA 5IXFA 5GMKe 3M0QA 3GIBA 1ZUKA 4FW2A 3TSZA 1RAAB 3A5ZB 1NJIC 2LT4A 3G71T 1E6HA 2OJ2A 2RO0A 2DYBA 2RQUA 2EVRA 4BB7A 2E6ZA 4XTVA 1M9SA 3EGUA 5AT1B 3GF5A 1ZSGA 4A4HA 1VQPQ 2DYIA 4Z88A 4QQGA 4M77C 2DBMA 2L8DA 1Y96B 1VA7A 4M77E 4QVCA 1VQ4A 1SKUB 3RKWA 2FB7A 2BTTA 1G3YA 5IT9E 5HY6A 3RR6A 3HP9A 3PIOA 1WJSA 3QJ6A 3MEWA 3S6WA 1SG5A 3CPWS 2MMPA 1D3BA 1JEGA 3M58A 4KULA 3OYEA 1WNLA 2D0QB 2O01E 3EGXB 3HKSA 2K79A 4E7IA 4XTUA 4EIKA 1WXUA 2J6KA 3M0PA 3I9QA 4PLIA 2B8AA 3NTHA 3CCVT 4EMHA 3GOXA 2RD1A 4LNPA 5J3BA 3OYAA 2L0AA 3VU3C 2P84A 3FJ5A 3EFOA 5A0GA 2E4HA 1Q81R 3CC4T 1TUGB 2X3XD 2QA4T 4FCYA 4PNOA 3M9QA 2DEUA 5FU7C 1Q81C 1AHJB 3PFSA 5KYUA 3AT1B 2DJZA 2X51A 2J6FA 2JM9A 4XK8E 2KQWA 2DRKA 4IUUA 5I2SA 1IGUA 2QEXT 3BFMA 1PM3A 2CGHA 3CQTA 4BI4A 2KK4A 4PJMA 1RAHB 1VQLQ 2F1LA 3OSSC 1YJNQ 3CCMQ 1QVGS 3CD6A 2KRMA 4AMCA 5IAYA 2HQEA 3AHUA 1JJ2S 3TREA 3OYYA 2JMAA 2RHYA 1KJWA 3C94A 1GCQC 1R0CB 2HQXA 3JB9H 4GBQA 3X20B 1TOVA 2FPDA 2CH4A 1KQSA 4C92A 3LH5A 2COYA 4Z02A 2XHCA 4GY5A 3ZFJA 2E70A 1K73U 4C8QC 1VQ8A 4HKEA 4J8OA 2JM8A 2D8JA 3NTIA 4C8QE 5CK9A 1B3QA 2K2MA 3OYKA 5A0DA 5GAOm 3HRTA 1JRIA 2ESWA 3HTRA 3G71Q 3CCQT 1SEMA 3MP8A 1OU8A 2CH4W 1AWOA 4ANJA 1H3ZA 1X69A 2YXYA 4MDWA 4K11A 5GAOp 2R58A 4HVVA 4DEXA 1D0ZA 1K8AU 2JZ2A 2Z0WA 2M1HA 1JQQA 2MCNA 3H0IA 1M1FA 1U06A 1X75C 4A54A 2VGMA 3M54A 5CIUA 1UGSB 4J9DA 2JTEA 2DXCA 3QYGB 4MZPA 5GMKi 5GJVB 1UJ0A 2CUBA 2ABLA 1M1KU 1D3BB 3RERA 2GQVA 3LGLA 5DM7R 2DFUA 3CMET 3JSCA 2D1XA 1UE9A 4KRTA 4TVRA 2LRQA 1BYMA 4AFSC 1D1AA 1WXTA 5KE3A 3UA6A 5EC7A 1NJIU 1LOJA 5LJ3h 4LUDA 5GAN7 4F14A 1ABQA 2RQTA 5GJWB 4L59A 1UDLA 3EFOB 2X9HA 4M78E 1X6OA 2DZCA 4HA8A 5HCKA 2I0NA 2HNIA 2BZXA 4EDUA 5HKCA 2F2XA 1OX8A 2DIQA 3CC4Q 2LCCA 5I22A 2WSEE 1VQ5A 1WJQA 2X4XA 2QA4Q 4NL2A 2FL7A 1B07A 4M75E 1TUDA 4F7UA 2LJ0A 1ABOA 1RAIB 3BE3A 1WPYA 3ZBDA 3I56T 6AT1B 2JTMA 3CCJA 2QG9B 1WZOA 4PJOE 1IREB 3OYFA 4IUPA 4N0AA 4HT8A 4J9EA 2GF7A 2C06A 1BCMA 4M77D 4M7AC 5FWBA 2E12A 4LDUA 5KCOA 5KYNA 3MPUB 1TS9A 4M7AE 2QYZA 8AT1B 4C92C 2DKGA 5CR2A 2RI3A 2MAMA 3EGDA 4OMLA 2GFAA 4C92B 2CREA 1AOJA 1UB4A 1UECA 1KD1R 3NTKA 1XNIA 2SRCA 2KAFA 4M7DC 1ZQ1A 3OS5A 3CXCS 3UF4A 1KFZA 3PIPA 2K5IA 4RUGA 1VQ9A 3CPWA 4M7DE 1T0HA 3H6ZA 1KQ2A 2RHUA 3A98A 3HPWA 2DIGA 2QGFB 1Q81U 4RCBA 2DPPB 2Y4YA 2ED0A 4FL6A 2RK2A 4Z89A 4LXCA 1VQ6A 2EPDA 3CCQQ 4NOYA 2M51A 2XK0A 3J80E 2DO3A 1M3AA 3SWNA 1WA7A 3P8HA 1QCFA 1QKXA 1NE8A 1KIKA 2JUFA 2RI2A 3BW1A 4QVDA 2VUBA 2CSQA 1RABB 1W2BS 3VYHB 5KE2A 3SDZA 3LGFA 4KH0B 1TSFA 4BI8B 1I5OB 2BZYA 5CKEA 2CP3A 3PVQA 2DMOA 4A4GA 5KH6A 4MDXA 2NUPA 2EKHA 1QVPA 4RKUE 2E3IA 3CCUA 2WACA 3X24B 1YHQA 3CMEQ 1UGRB 2RN8A 4OP0A 1BI2A 5HK3A 1YJ9T 1QVGA 1JJ2A 1EX4A 3QKJA 1V76A 2L3PA 4LDYA 2K7AA 2KE9A 1YI2T 3QYHB 3CCRT 4HCZA 1GBQA 1PG5B 1JXOA 1X43A 1WQWA 4LDXA 4DOVA 1ARKA 3CCSA 2F5TX 2CZ0B 4EMGA 3THKA 2HEQA 1G3TA 4C8QD 3JCMh 2KBTA 4M77G 4E7HA 4F7UB 5GAOr 1RAGB 3VS6A 4UC4A 2Y90A 5CQXA 1TXQA 2JS2A 4F04B 3UPUA 1UHFA 1T3SA 2VB6A 4N0AC 3I56Q 2PVDB 4C0FA 3M0RA 1TG0A 2DE0X 4O6JA 4ZNXA 3CCEQ 1WHGA 3X26B 1MUZA 2GCXA 5D6YA 4KUDK 2E41A 4RTTA 1QP3A 2CP0A 3O8VA 3GBQA 3CCLA 1AVZC 1NG2A 2XIDA 1B34A 1S72T 1M3CA 2X3WD 4J7IA 4A53A 4LD9K 1WQ7A 1N6AA 3OY9A 1HXDA 4BY6B 1YJWA 2EYQA 3NFCA 2NUZA 1TUCA 2AK5A 1Q82R 2BIVA 5CVIA 3JB9I 4C0DC 2FRWA 4A4KA 3A8HB 5CKFA 2D8HA 3SWNC 5GMKm 4LDVA 1Q82C 4RCCA 4OMMA 3SWNB 1N8RR 2QASA 3OYLA 2XDDA 3MEVA 4JRPA 2OX7A 3H41A 2X35A 4OGEA 1VQ4Q 1QQJA 3UDCA 1VYTA 3S3NA 1VQPT 3VS0A 2O9VA 4BE1A 2GFUA 1YCSB 2KDSA 2NUPB 3VRZA 3BDLA 2LJ3A 4BE0A 2PUOB 5L8RE 3VS5A 4LD6A 2QI2A 3BY7A 4C8QG 4KUIA 3VS1A 1OU9A 1MHNA 1XTDA 3OB9A 1WGSA 3M4GA 4JZ3A 3HHTB 2DERA 4M7AD 2K2VA 3I5SA 1ZA1B 2QXFA 3MP6A 4C92D 2KNBB 3CC7A 3REAB 4E7KA 3JCMg 3L2RA 4XU3A 1FXXA 2OTJA 2PU9B 1YI2Q 3CCRQ 4ME7A 1C6VX 2EKOA 4J9FA 4HXJA 4M7DD 2V26A 1QW1A 2IIMA 4MMLA 1H3HA 3HL8A 1MMAA 3FRNA 3CXCA 4Y28E 3WVEB 1D0YA 4O5VA 2DXUA 4IUQA 2RJDA 1K73C 3M53A 5C6SA 3KUFA 3GNFB 4XQ3A 3TCJA 4HCCA 2FVUA 4E6RA 2HBPA 2LZ6B 3N5BB 1KC8C 3CD6Q 3MP1A 2VASA 2LTOA 5CAIA 2M02A 4CC7A 1GFDA 1BK2A 1TU0B 5GAN8 3ULRB 5CO7A 5GANd 4JS4A 2ROTA 1I4K1 1YJNT 1W2BA 3VUZA 3CCMT 2KMTA 3QSUA 4M78G 2J06A 2D9TA 4N4IA 1VQ9T 1VQ8Q 4ESRA 4JJNK 1H92A 4C5EA 4M4ZA 2YLBA 3R6NA 2K5LA 4OB2B 4M75G 1EFNA 3MHXA 1K0XA 2GTOA 1XOVA 5FW9A 1C0MA 3ER0A 4NS5A 4XU2A 2QDLA 2V8JA 1HK9A 1NYFA 3SB2A 4LDWA 4DBRA 2XICA 1VIEA 1IGQA 4FYYB 2RJCA 2YHTA 1G8XA 2QTVA 4PJOG 4DBHA 3QPHA 1VQ7A 1UJYA 1MGQA 1Y07A 2FPFA 3QWYA 1G5VA 2DXBA 1NLPC 1E7OA 1YN8A 2HAXA 1VQNA 2OAUA 4RTWA 1IHWA 3SHWA 4L6V5 1Q86R 2EYYA 1M1GA 1UUEA 3CCUT 1UG1A 1YHQT 3PT9A 1U1SA 2XKOC 4M7DG 1PCXA 1XQHA 1I5LA 3CBOA 1QCNA 4JDSA 1XJWB 1K9AA 3QXEB 1IHVA 1BIBA 3PTAA 1WHMA 3EG1A 3CCST 2H8HA 1Q82U 2ZGWA 2I2LA 2YUPA 3OBWA 3EH1A 2DL3A 5I21A 5D6XA 2LQ8A 1QWFA 1VQ5Q 3EG3A 4X1VA 2JS0A 1G3WA 2VGNA 1N8RU 4PJLA 1K1ZA 1RI9A 2QQRA 4E7JA 3T9NA 3H8ZA 4C0GA 4RTYA 2VXEA 2DD5A 1PKTA 4JJDA 3CCJQ 1CSKA 2XD0A 1YWPA 3G4SA 1Y71A 2JW4A 2PQWA 1U8RA 3A8LB 3PGGA 3M56A 1VYUA 1Y7XA 3CCLT 2EQJA 2J6OA 2C0IA 2LDMA 4IURA 4X9CA 3U23A 4BDYA 1C1AA 3EFRA 2ZPEB 2CP7A
chains in the Genus database with same CATH topology
3L1AA 5GMKj 2AHJB 3LYIA 2LNVA 2XDBA 4IKFA 2K3YA 3DKMA 3VKIA 3CC4A 1IREB 2RA2A 2RJEA 3P8BB 2XDPA 4R56A 3OYFA 4J6YA 4J83A 1FX7A 2EQMA 3L2ZA 4IUPA 4N0AA 2QA4A 2ZPHB 2PVOB 3CMAA 2H3JA 2LCLA 4HT8A 2GF7A 3E9FA 2LT1A 2C06A 4M77D 3G6ET 4M7AC 2CS7A 1PSFA 2E12A 4LDUA 4EMKA 4NL3A 5KCOA 2LQKA 3ME9A 3HRUA 5GAMh 2R5AA 4M7AE 3E1SA 4C92C 4JRQA 4M77F 3GP8A 2DKGA 3BDUA 5CR2A 1VQ6T 2RI3A 2MAMA 4OGCA 2GFAA 3LWIA 1VQKA 4C92B 1VIFA 1NPPA 1UB4A 3EFSA 2MF2A 3M59A 3NTKA 5C0MA 5LJ5h 1XNIA 2K3XA 2K5FA 3OS2A 2KAFA 2VC8A 1DJ7B 3JB9G 4ELZC 1YITT 4M7DC 1ZQ1A 3OS5A 1P92A 3CXCS 3DLLA 2ZPIB 5GAN5 3J81E 3PIPA 1KG1A 2K5IA 5GAOq 1VQ9A 3CPWA 4M7DE 4J5YA 2OTLT 3H6ZA 1KQ2A 2RHUA 2Y4XA 1OYXA 3HPWA 2DIGA 1SSFA 2JTFA 1N9RA 1Q81U 2E65A 2ZPBB 4RCBA 5FLXE 3G6EA 1KC8U 4KT0E 1JB0E 5LJ3d 3UWNA 2KSSA 4Q5WA 2DPPB 2X4WA 3VJPA 2LVMA 2WSFE 4C0DB 2E6NA 2Y4YA 2VXFA 1OZ3A 5GANe 4FL6A 3X25B 3OYNA 2LX9A 2JVVA 2RK2A 1VQ6A 4M7AG 5A0LA 4N4HA 4NOYA 2XK0A 4ZTJA 4F7UF 3ASKA 4ZN3A 3SFMA 5GMKh 4M78D 2DO3A 3J80E 4C92G 3SWNA 3P8HA 2X4JA 4XTWA 4C5IA 3V8LA 4OF1A 4C8QA 4E47A 4J6WA 2RI5A 1LJOA 1NE8A 3E9GA 1K9MC 2JUFA 2RI2A 3BW1A 4QVDA 4C5GA 3QDRB 3V7SA 2VUBA 1Q86C 2OTLA 1W2BS 4M75D 3VYHB 5KE2A 1BI0A 3SDZA 1UGQB 3LGFA 3S3MA 3OYDA 4FM4B 3OYGA 4BI8B 3CCQA 2EQKA 4IUTA 4C5HA 5I2MA 3VV0A 2EFIA 4ZTFA 3EAEA 5CKEA 2JN0A 5GANf 4A4GA 2P0PA 3MEUA 5KH6A 4MDXA 2DD4A 3LWHA 2OTJT 1M8VA 3M5AA 4PJOD 1VQOT 1W4SA 1WJRA 1QVPA 1YBYA 4RKUE 3MEAA 1Y96A 4M77B 4XTXA 3WXMB 2XU8A 1X01A 2WACA 3CCUA 4BE2A 2JOYA 1G3SA 3X24B 1YHQA 1KQSS 4QQDA 3CC2A 1UGRB 2YRVA 4OP0A 4EPCA 5AYFA 5LJ3e 1BI2A 2CYZB 5HK3A 3OMCA 3TU4K 4HCBA 1YJ9T 1QVGA 4XTYA 4BD3A 5GAMd 3JCMJ 3VUBA 1JJ2A 3FB9A 1GXIE 3DB4A 3QKJA 4OB0B 5GAN4 1ZBXA 3HSBA 3JCMX 1BKBA 4LDYA 1O9SA 1BI3A 5GAOn 3A8OB 4PLLA 2K57A 2F69A 2RJFA 3QYHB 5CKBA 1NZ9A 4HCZA 5LJ5d 3L2VA 3CCRT 1WQWA 1YI2T 4LDXA 2A3LA 4PKCC 4DOVA 1QVFA 2DK3A 2EQUA 3CCSA 2F5TX 2CZ0B 3Q1JA 4JLIA 4EMGA 1YIJA 3J7AF 2L5QA 2QDYB 3CMEA 2RK1A 1M90C 1G3TA 4J6XA 1VQMT 4C8QD 3JCMh 3C95A 3E19A 3QBYA 2P4TA 1M5Q1 2CZ6B 2E64A 2L3RA 4M77G 3JCMQ 4E7HA 4F7UB 4N4GA 1Q86U 3G7ZA 4OMFB 5CKDA 1KHCA 2KY9A 2DXTA 2F5KA 4C8QF 3KXTA 5GAOr 2RM4A 1R8OB 3QG1A 2Y90A 4UC4A 2EIFA 1NPRA 5CQXA 5LJ3f 3CBPA 5J39A 4BACA 3S3OA 1YJ9A 4M78B 3V7CA 3A8MB 3UPUA 3HRSA 4M78A 4N0AC 2PVDB 1YI2A 3CCRA 2FHDA 3CCET 4C0FA 4JRKA 4O6JA 5J26A 1RI0A 3QIIA 3I55T 1YJWT 3GPLA 3URGA 4EMKC 5GAMg 4M75B 2QQSA 2G3RA 3X26B 2RHIA 5FU7B 1VQMA 2GCXA 4M75A 5FU6C 3CEYA 5D6YA 4KUDK 4EMKB 2E41A 2E1HA 2VYTA 2BKDN 3OBYA 4RMOA 1QP3A 5CCAA 3O8VA 5CKHA 1JBMA 5FU6B 3CCLA 4F7UG 1B34B 5LJ5g 5GANj 3OS1A 2P0QA 4XAXB 2XIDA 5A2QE 1VQLT 1B34A 3JRZA 4P5NA 4MMKA 1FWZA 5FRNA 4BI3A 3I56A 4ZGJB 1S72T 5EG2A 4C92E 4PJOB 4OVAA 4FT2A 2QQ9A 4J7IA 2L89A 4A53A 4PJOA 4LD9K 5DLOA 1WQ7A 1K8AC 1N6AA 3CCEA 3FLGA 3OY9A 1HXDA 4KBMB 2E10A 4DQ2A 4GLKA 4BY6B 1KD1C 1YJWA 2EYQA 1V29B 1LNXA 3NFCA 3HFNA 2XG8D 4QQ6A 1ZHIA 1BIAA 3A8GB 2BIVA 5CVIA 3JB9I 3X28B 4C0DC 2MWOA 4M7AA 2RB6A 3L2WA 4II1A 2K4YA 3DB3A 2R57A 4A4KA 4ZN1A 2A7YA 3A8HB 4QW2A 5CKFA 3SWNC 5GMKm 1H641 2DVEA 4LDVA 1Q82C 2CZ7B 2R5MA 3LLRA 4RCCA 3CBMA 3VYGA 5GMKe 1S72A 2RHZA 3OMGA 3SWNB 3MO8A 3OYLA 3GIBA 3M4YA 1K9MU 3UT1A 4C8QB 2ZPGB 2XDDA 3A5ZB 1NJIC 2LT4A 3G71T 3OW2A 1YITA 1VQ4T 3MEVA 4M78F 3JCMd 2O4XA 2RO0A 4JRPA 4M7DA 4XTZA 5GANg 2WSCE 2X35A 3LH0A 4OGEA 5DLQE 4BB7A 2E6ZA 3QJYA 4XTVA 3UDCA 1M9SA 3S3NA 1VQPT 2D6FA 3GF5A 5GANh 4M75F 3PNWC 3R6OA 3V7RA 4A4HA 3SD4A 2EJFA 4ATOA 4BE1A 3CC7T 3OQ5A 3FIFA 2GFUA 2KDSA 2NLUA 3BDLA 2XI9A 4QQGA 4BE0A 2PUOB 5L8RE 3HFOA 1M4ZA 4M77C 3M55A 2QI2A 2L8DA 4LD6A 3OYJA 1Y96B 4CRIA 4E7LA 3BY7A 4XU1A 2DTIA 2IVWA 2QQBA 1Q7YC 4M77E 4C8QG 3G71A 4KUIA 4QVCA 1VQ4A 3RKYA 1MHNA 2EJGA 4PJOF 1XTDA 3RKWA 2FB7A 1G3YA 3OB9A 2CZ1B 5IT9E 5HY6A 1WGSA 2DAQA 3HP9A 3M4GA 3PIOA 4QVZA 2M16A 1VQPA 3HHTB 1WJSA 4J7FA 4VUBA 3QJ6A 1OI1A 4M7AD 3RESA 2K2VA 3MEWA 3S6WA 3DLMA 3CPWS 2MMPA 4OB1B 2QXFA 3MP6A 4V2SA 4C92D 1D3BA 3CC7A 4E7KA 1KQ1A 3M58A 4KULA 3JCMg 3L2RA 3OYEA 4XU3A 4M7AF 1WNLA 2D0QB 1FXXA 2O01E 2OTJA 3HKSA 2PU9B 3QO3A 4E7IA 1VQOA 4XTUA 4ME7A 2EKOA 4ZGDB 4PLIA 4RG8A 2DZ9A 4JRIA 4M7DD 2B8AA 1QW1A 2V8KA 4FU6A 4MMLA 3OS0A 1TH7A 3NTHA 2PUKB 2ZZDA 3FJPA 3GNGA 4F7UE 3CCVT 4EMHA 3HL8A 3GOXA 3FRNA 2RD1A 2KVQG 3CD6A 5GAN2 3CXCA 4Y28E 4M78C 3OYHA 4M7DF 3WVEB 5J3BA 3OYAA 4O5VA 3VU3C 2DXUA 4IUQA 5GMKl 5M9OA 3C12A 3LW5E 2RJDA 2MWPA 5A0GA 3OYIA 1K73C 2EAYA 5GAN6 3CC4T 3M53A 5C6SA 3KUFA 3GNFB 4XQ3A 3TCJA 3FDRA 4JLGA 4X34A 4HCCA 2QA4T 2FVUA 3CD6T 4PNOA 2HBPA 3N5BB 3M9QA 4M75C 4PJOE 3JCMb 5FU7C 1Q81C 1AHJB 1OZ2A 3PFSA 1KC8C 2DJZA 3MP1A 2LTOA 5CAIA 1Q7YU 3L2QA 3RUXA 3CPFA 3CCVA 4XK8E 5GAMe 5GAN8 4R55A 2KQWA 5CO7A 4IUUA 5GANd 4JS4A 3OYMA 4JS5A 1UEBA 4JUVA 5I2SA 3RMQA 2QEXT 1I4K1 4PJOC 3BFMA 2CKKA 3OYCA 3V8JA 2CGHA 4BI4A 3VUZA 3CCMT 2KMTA 1YJNT 2KK4A 4OB3B 1W2BA 3QSUA 5LJ5e 1QP2A 1VQ8T 3INZA 4M78G 3META 3OSSC 2M0OA 2D9TA 2MI6A 4N4IA 3JAME 1QVGS 2RH2A 1VQ9T 1VQ7T 3C4SA 4BY6C 3AHUA 5IAYA 1EIFA 2HQEA 3F70A 1JJ2S 4BUGA 4MZTA 3OYYA 3TREA 4JJNK 1UGPB 3I55A 3JCMW 4C5EA 3WVDB 2RHYA 1M90U 2BUDA 1YCYA 4IUVA 2YLBA 4A4FA 2K5LA 4C0ZA 3C94A 4OB2B 2ZCFB 4M75G 2DTHA 5FROA 5FRMA 4M7AB 3MHXA 1QVFS 3JCMc 1XOVA 2M9UA 1VQNT 3ER0A 2HQXA 4NS5A 3JB9H 3X20B 4FT4A 4XU2A 5GAMf 3OA6A 2V8JA 1KQSA 1HK9A 3SB2A 2VV5A 4LDWA 4D6WA 4C92A 2QEXA 4Z02A 2XICA 1VIEA 1VQLA 2XHCA 4GY5A 3ZFJA 1YJNA 3CCMA 2E70A 1K73U 4C8QC 2RJCA 1VQ8A 2YHTA 2PVGB 4HKEA 4J8OA 5LJ5f 1I81A 4WF2A 4PJOG 3QPHA 3M57A 3NTIA 4C8QE 3GLXA 5CK9A 3TEEA 1VQ7A 1MGQA 2O4XB 5HK0A 4M7DB 3RIRA 3OYKA 1Y07A 5A0DA 5GAOm 1N8RC 3HRTA 1JRIA 5IN1A 1G5VA 5LJ3j 1KHIA 2DXBA 3CCQT 2HD0A 2JNGA 1IZ6A 2FYKA 3MP8A 5D6WA 5LL6S 2HAXA 1VQNA 3OSVA 3FEOA 5KCHA 2OAUA 4BDZA 4L6V5 4ELYC 4HT9A 3QZ9B 1H3ZA 2ZPFB 1M1GA 4MDWA 5GAN3 2R58A 5GAOp 3CCUT 3P8DA 3V8KA 3JB9D 4A4EA 1YHQT 3CC2T 1K8AU 2JZ2A 3LX7A 3PT9A 2M1HA 3PMIA 1U1SA 2P0KA 2XKOC 1PSEA 3JB9F 4B9XA 4YTLA 2V8IA 4M7DG 2EWNA 1M1FA 1VUBA 1KD1U 1X75C 4A54A 5CQYA 1XQHA 1I5LA 1N9SA 3CBOA 1O75A 2VGMA 3M54A 4JDSA 5CIUA 4Y91A 4ZGEB 1UGSB 2DXCA 3QXEB 3MCAB 3QYGB 4MZPA 5GMKi 1BIBA 3PTAA 1M1KU 3RERA 1D3BB 3CCST 2GQVA 4MZMA 3LGLA 2LC4A 2YLCA 2EJ9A 1Q82U 5DM7R 2ZGWA 2RHXA 2I2LA 1YIJT 3CMET 3OYBA 4FIBA 3JSCA 3G4ST 3OBWA 5LJ3g 1VQ5T 4TVRA 2LRQA 4DOWA 5D6XA 4C92F 5I21A 1BYMA 2LQ8A 4M77A 3JCMe 5KE3A 3JB9J 2X4YA 4DA4A 1NJIU 3JCMV 1LOJA 1G3WA 2VGNA 1N8RU 5LJ3h 5GAMj 3PMTA 4X9DA 5DY9A 3FC3A 2QQRA 4L5GA 5GAN7 4RG2A 3KBGA 4E7JA 4L59A 3T9NA 3CCJT 3OW2S 3H8ZA 3ZEHA 4C0GA 3QHSA 2VXEA 2DD5A 4M78E 1X6OA 5LJ5j 2DZCA 4HA8A 1I8FA 2HNIA 3L42A 3RMSA 2DTOA 4PL6A 4EDUA 5HKCA 2XD0A 3CMAT 2DIQA 1U1TA 2LCCA 3QZ5B 3L2UA 3G4SA 3QUIA 1Y71A 2QQAA 2WSEE 1VQ5A 1WJQA 2PQWA 2X4XA 1U8RA 4CI0C 1M1KC 3A8LB 4NL2A 1RL2A 2FL7A 3PGGA 4M75E 3M56A 5GAOl 1Y7XA 4XU0A 3JCMf 2EQJA 3CCLT 2E5QA 1BI1A 4F7UA 4B9WA 3RKXA 3JCMP 2LDMA 4IURA 4X9CA 4BDYA 1WPYA 2QTXA 3EFRA 3ZBDA 3I56T 1VQKT 2IG0A 2ZPEB 2DEQA 4FSXA 1N27A 2JTMA 3CCJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SD4 A;  4Z02 A;  4BE1 A;  4PLL A;  3OQ5 A;  2GFU A;  2RJF A;  3LYI A;  4GY5 A;  4HCZ A;  2NLU A;  3L2V A;  2K3Y A;  4IKF A;  3BDL A;  2RJC A;  2RJE A;  3OYF A;  2EQU A;  2XDP A;  4QQG A;  4BE0 A;  2EQM A;  3Q1J A;  2L8D A;  4IUP A;  4LD6 A;  3NTI A;  3OYJ A;  4CRI A;  4E7L A;  2O4X B;  2GF7 A;  3OYK A;  3E9F A;  3QBY A;  1MHN A;  2L3R A;  4E7H A;  5IN1 A;  1G5V A;  3OB9 A;  4N4G A;  5KCO A;  1KHC A;  3ME9 A;  1WGS A;  2F5K A;  2DAQ A;  2R5A A;  4UC4 A;  5D6W A;  3MP8 A;  4QVZ A;  3S3O A;  2M16 A;  5J39 A;  4BAC A;  1WJS A;  2RI3 A;  1OI1 A;  3QJ6 A;  2GFA A;  3MEW A;  3S6W A;  3FEO A;  5KCH A;  3DLM A;  3MP6 A;  4BDZ A;  5C0M A;  3NTK A;  4E7K A;  1XNI A;  2K3X A;  3L2R A;  2FHD A;  3OYE A;  1H3Z A;  3OS2 A;  2R58 A;  3P8D A;  5J26 A;  4A4E A;  1RI0 A;  3QII A;  4E7I A;  2JZ2 A;  3LX7 A;  2EKO A;  2QQS A;  2G3R A;  2M1H A;  3PMI A;  2RHI A;  3H6Z A;  2P0K A;  2RHU A;  1OYX A;  4PLI A;  2DIG A;  1SSF A;  2JTF A;  2B8A A;  4B9X A;  3CEY A;  4FU6 A;  5D6Y A;  2VYT A;  3OS0 A;  2BKD N;  3NTH A;  3O8V A;  3GOX A;  3UWN A;  4Q5W A;  2X4W A;  5CIU A;  2LVM A;  3OS1 A;  3OYH A;  2E6N A;  3OYN A;  1OZ3 A;  3OYA A;  4FL6 A;  4IUQ A;  5FRN A;  5M9O A;  2RJD A;  2MWP A;  4N4H A;  3OYI A;  2XK0 A;  4ZTJ A;  3ASK A;  4OVA A;  3KUF A;  5C6S A;  3LGL A;  2L89 A;  3FDR A;  3P8H A;  4X34 A;  4C5I A;  2RHX A;  3OYB A;  3FLG A;  3OY9 A;  3M9Q A;  2LRQ A;  2RI5 A;  5D6X A;  1OZ2 A;  3PFS A;  3E9G A;  2RI2 A;  4C5G A;  5KE3 A;  3MP1 A;  2LTO A;  2X4Y A;  4QQ6 A;  3L2Q A;  5KE2 A;  3LGF A;  2BIV A;  3PMT A;  3S3M A;  2MWO A;  3OYD A;  3FC3 A;  3L2W A;  2QQR A;  3OYG A;  2EQK A;  4II1 A;  3DB3 A;  4IUT A;  2R57 A;  4IUU A;  4RG2 A;  4C5H A;  4QW2 A;  3OYM A;  4L59 A;  4E7J A;  2EFI A;  3H8Z A;  3ZEH A;  4ZTF A;  2CKK A;  3OYC A;  3EAE A;  2R5M A;  3LLR A;  2RHZ A;  3OMG A;  4A4G A;  3MEU A;  5KH6 A;  3MO8 A;  3OYL A;  3MET A;  3L42 A;  2M0O A;  2D9T A;  4PL6 A;  4EDU A;  4N4I A;  3UT1 A;  3C4S A;  2DIQ A;  2LCC A;  2HQE A;  3F70 A;  1WJR A;  5IAY A;  3L2U A;  3MEA A;  4BE2 A;  3MEV A;  1WJQ A;  2O4X A;  2PQW A;  2RO0 A;  2WAC A;  2X4X A;  4QQD A;  4C5E A;  2RHY A;  2X35 A;  3LH0 A;  2BUD A;  4A4F A;  4IUV A;  2YRV A;  2EQJ A;  2E5Q A;  5FRO A;  5FRM A;  3OMC A;  4B9W A;  4BD3 A;  2LDM A;  4IUR A;  3S3N A;  4BDY A;  3DB4 A;  2HQX A;  2IG0 A;  3QKJ A;  4NS5 A;  3OA6 A;  3PNW C;  1N27 A;  4A4H A; 
#chains in the Genus database with same CATH topology
 3L1A A;  2KYM A;  5GMK j;  3LYI A;  2LNV A;  1RAF B;  3P8B B;  4J6Y A;  2RF0 A;  1FX7 A;  2ZPH B;  3CMA A;  2LCL A;  4PFP A;  3E9F A;  1VQ9 Q;  2CS7 A;  2DNU A;  1MMN A;  2B86 A;  1PWT A;  4JRQ A;  4M77 F;  1WIE A;  3GP8 A;  1AZE A;  2CT3 A;  4OGC A;  3LWI A;  1VQK A;  3EFS A;  3M59 A;  2K3X A;  1DJ7 B;  1UGV A;  5KYX A;  3J81 E;  1KG1 A;  4J5Y A;  4IIM A;  4AFU C;  2Y4X A;  1OYX A;  2JTF A;  1KC8 U;  2ZPB B;  5FLX E;  3NMZ C;  3G6E A;  1J3T A;  4KT0 E;  3OW2 P;  1WDX A;  1B7T A;  2KSS A;  2F2W A;  1SRL A;  2X4W A;  3VJP A;  2WSF E;  5GAN e;  2E6N A;  2LX9 A;  2JVV A;  1M8M A;  2F2V A;  4ZN3 A;  3SFM A;  4D8K A;  4C5I A;  2PNI A;  1M27 C;  4OF1 A;  2RI5 A;  2YUN A;  4Y92 A;  2A37 A;  5KYY A;  3CCU Q;  2OTL A;  1YNZ A;  1U5S A;  1BI0 A;  1YHQ Q;  1UGQ B;  4FM4 B;  2DET A;  4IUT A;  4C5H A;  2AKK A;  5I2M A;  4ZTF A;  1Q7Y R;  2KXD A;  5GAN f;  2AIR B;  2JN0 A;  1G83 A;  3MEU A;  2OTJ T;  1R77 A;  1M8V A;  1W4S A;  1WJR A;  2LQW A;  2VVK A;  3CCS Q;  3TQ7 P;  1Y57 A;  2E5K A;  5LJ3 e;  3TU4 K;  2BZ8 A;  5GAM d;  3RDV A;  3DB4 A;  4OB0 B;  1MNE A;  1ZBX A;  3REB B;  3EHQ A;  1M90 R;  2K57 A;  2F69 A;  2RJF A;  5CKB A;  5LJ5 d;  1BCO A;  1PRL C;  2DJQ A;  2GTJ A;  2KT8 A;  1M90 C;  2RK1 A;  4OMP A;  3C95 A;  2KRS A;  2CZ6 B;  5IH2 A;  3JCM Q;  4N4G A;  1Q86 U;  4OMF B;  4C8Q F;  2RM4 A;  5LJ3 f;  8ATC B;  3CCL Q;  4PFO A;  4M78 B;  3A8M B;  2ZAE A;  3CCE T;  1WXB A;  3QWX X;  4HVU A;  3GPL A;  1X2Q A;  4M75 B;  1VQM A;  5FU6 C;  3CEY A;  1HD3 A;  2VYT A;  1YJW Q;  2BKD N;  1HYO A;  1JBM A;  5FU6 B;  5GAN j;  1OUL A;  1YP5 A;  2FZG B;  1FWZ A;  4JJB A;  5FRN A;  4ZGJ B;  5L23 A;  2NUT B;  4C92 E;  3UA7 A;  4PJO B;  4OVA A;  2QQ9 A;  4FYX B;  3VRY A;  5KYX B;  2L2P A;  1KD1 C;  1FMW A;  1V29 B;  2VWF A;  4II1 A;  2K4Y A;  2R57 A;  4J9G A;  4QW2 A;  1ZSZ A;  2P4R A;  2CZ7 B;  2E3H A;  2R5M A;  2YRC A;  7AT1 B;  3MO8 A;  3M4Y A;  1IRX A;  1ZBJ A;  4E7S A;  4LUE A;  3UT1 A;  1YIT A;  1VQ4 T;  2L3Q A;  4M78 F;  2O4X A;  5KYY B;  4XTZ A;  1WFW A;  5GAN g;  2WSC E;  3LH0 A;  5DLQ E;  3G1J A;  3QJY A;  2AZS A;  4M75 F;  3PNW C;  3V7R A;  2DM1 A;  3SD4 A;  4ATO A;  3FIF A;  2NLU A;  4PFZ A;  2XI9 A;  2KR3 A;  1TTH B;  4R0K A;  3EHR A;  3HFO A;  3OYJ A;  4CRI A;  4E7L A;  2IVW A;  3G71 A;  2OTJ Q;  3IQL A;  3RKY A;  4PJO F;  2HKQ B;  2CZ1 B;  1EZZ B;  1G2B A;  2DAQ A;  1IXD A;  4J7F A;  4VUB A;  1OI1 A;  1SSH A;  4RTV A;  3DLM A;  4OB1 B;  4V2S A;  4M7A F;  1KQ1 A;  2FO0 A;  1K4U S;  1NBE B;  1D09 B;  1YFN A;  1VQO A;  4RG8 A;  2DZ9 A;  4JRI A;  1OEB A;  2V8K A;  4FU6 A;  1TH7 A;  2ZZD A;  4JPB W;  4F7U E;  2FRY A;  2GGR A;  2KVQ G;  5GAN 2;  4M7D F;  2LQN A;  1MND A;  1WHJ A;  3JV3 A;  2MWP A;  5GAN 6;  3EG2 A;  4JLG A;  2C0T A;  3CD6 T;  1CKB A;  1W6X A;  3M0S A;  2RQV A;  3JCM b;  2BE7 D;  1HJD A;  1Q7Y U;  2MYS A;  2MK5 A;  3CPF A;  3CCV A;  5GAM e;  4RTX A;  1D1B A;  2HL3 A;  2J7I A;  1UEB A;  4JUV A;  1W1F A;  1MV3 A;  5LJ5 e;  2EYZ A;  1NEG A;  1VQ8 T;  2A08 A;  3INZ A;  3MET A;  3JAM E;  2RH2 A;  3C4S A;  4BY6 C;  1EIF A;  4BUG A;  4MZT A;  1UGP B;  3I55 A;  3JCM W;  3WVD B;  2J05 A;  1M90 U;  1OPL A;  4IUV A;  4C0Z A;  5FRO A;  1ZSZ C;  2COZ A;  2CT4 A;  3JCM c;  2M9U A;  1SPK A;  1ZSZ B;  3H0F A;  4FT4 A;  5GAM f;  2VV5 A;  2DL4 A;  2YUO A;  2QEX A;  2CP6 A;  1VQN Q;  1FMV A;  1OPK A;  1FMK A;  5LJ5 f;  1I81 A;  3M57 A;  4LN2 A;  3GLX A;  3TEE A;  2O4X B;  5HK0 A;  2EQI A;  2DLP A;  1N8R C;  5IN1 A;  1KHI A;  1IZ6 A;  4RTZ A;  3RNJ A;  1AD5 A;  2AZV A;  3O5Z A;  4AG2 C;  4IIO A;  5KCH A;  3SEM A;  4ELY C;  2PTK A;  3QZ9 B;  4HT9 A;  3JB9 D;  5GAN 3;  4A4E A;  2LX7 A;  1M2O A;  3PMI A;  1RLP C;  2P0K A;  1PSE A;  2V1R A;  1AWJ A;  4YTL A;  4J9H A;  1K0S A;  3RBB B;  1KD1 U;  5CQY A;  1NEB A;  2GBQ A;  1N9S A;  1O75 A;  1SHG A;  4Y91 A;  1YWO A;  2DF6 A;  1IB8 A;  2BE9 B;  1I07 A;  2LC4 A;  2M0Y A;  2EJ9 A;  4E2F B;  1VQ5 T;  4DOW A;  4M77 A;  1QVF P;  1WHL A;  2X4Y A;  1V1C A;  3VS4 A;  1A0N B;  4FW1 A;  1F1B B;  5GAM j;  2SEM A;  4L5G A;  2MIO A;  2QGG A;  2LP5 A;  4RG2 A;  3KBG A;  3CCJ T;  3OW2 S;  3ZEH A;  4CC2 A;  5LJ5 j;  1I8F A;  4KGX B;  3RMS A;  4PL6 A;  3TSW A;  3QZ5 B;  3QUI A;  1WLP B;  2QQA A;  4KGV B;  1M2V A;  3CMA Q;  1RL2 A;  5GAO l;  1GFC A;  1RAC B;  2DBK A;  1K9M R;  1BI1 A;  4B9W A;  3RKX A;  1PKS A;  2QTX A;  3ZL7 C;  1K9M C;  1VQK Q;  2AHJ B;  2XDB A;  4IKF A;  3DKM A;  3VKI A;  2DL8 A;  2RA2 A;  2RJE A;  2XDP A;  4J83 A;  2EYX A;  2EQM A;  2HQH A;  2EGA A;  2LT1 A;  1U3O A;  1PSF A;  1QMC A;  2LQK A;  2R5A A;  3E1S A;  4AG1 C;  3G6E Q;  1K8A R;  3BDU A;  1VQ6 T;  3I35 A;  1VIF A;  1NPP A;  2MF2 A;  2YT6 A;  5C0M A;  2K5F A;  3E2U A;  3OS2 A;  2VC8 A;  3JB9 G;  1YIT T;  5IXB A;  1P92 A;  3DLL A;  4KH1 B;  1Z9Z A;  1SSF A;  2JMC A;  1N9R A;  4PK4 A;  2E65 A;  1HSQ A;  5LJ3 d;  5IHI A;  4M7A G;  2ROL A;  5A0L A;  3ASK A;  3UAT A;  5GMK h;  4C92 G;  4XTW A;  2HDA A;  2LMJ A;  4C8Q A;  4E47 A;  3NPF A;  4C5G A;  3QDR B;  1Q86 C;  3S3M A;  1CKA A;  3OYD A;  3OYG A;  2EQK A;  3VV0 A;  1WX6 A;  2EFI A;  2V1Q A;  2XMF A;  2P0P A;  2DD4 A;  3LWH A;  1I0C A;  2FPE A;  1VQO T;  1R0B G;  2FEI A;  1YBY A;  3WXM B;  4BE2 A;  4M77 B;  2XU8 A;  2JOY A;  4QQD A;  3CC2 A;  4EPC A;  5AYF A;  2CYZ B;  4XTY A;  3JCM J;  3VUB A;  1GXI E;  1RAD B;  5GAN 4;  2LJ1 A;  3JCM X;  1O9S A;  3A8O B;  4PLL A;  2HBW A;  1NZ9 A;  2YWW A;  2KI7 A;  2HL5 C;  2EQU A;  3I5R A;  1YIJ A;  2KEA A;  2L5Q A;  4J6X A;  1M2V B;  3QBY A;  4QKU A;  1RLQ C;  2E64 A;  4F16 A;  4OMN A;  1PD0 A;  1VQM Q;  3KXT A;  5CKD A;  1AWW A;  1KHC A;  2DXT A;  2F5K A;  2PZ1 A;  3QG1 A;  1YJ9 A;  2EIF A;  3CBP A;  2GNC A;  4BAC A;  4WCI A;  3HRS A;  4M78 A;  2YSQ A;  1YI2 A;  3TVT A;  2FHD A;  3CCR A;  2KYB A;  1RI0 A;  3QII A;  3I55 T;  1YJW T;  3URG A;  1ZLM A;  3EH2 A;  2QQS A;  5FU7 B;  4M75 A;  2E1H A;  2EW3 A;  3OBY A;  4CC3 A;  2A28 A;  5CCA A;  5CKH A;  1D1C A;  4F7U G;  2CP5 A;  4XAX B;  1TWB A;  2DL7 A;  3JRZ A;  2QAZ A;  1WYX A;  4AFZ C;  2NUT A;  2L89 A;  1VQ6 Q;  4PJO A;  5DLO A;  3VS2 A;  1WI7 A;  1KQS P;  3FLG A;  1KSW A;  2E10 A;  4DQ2 A;  4GLK A;  5I11 A;  1LNX A;  3HFN A;  1YIT Q;  2XG8 D;  4QQ6 A;  1PRM C;  4M7A A;  3L2W A;  2A7Y A;  1X6G A;  2EYW A;  4B6M A;  1H64 1;  2DVE A;  3VYG A;  3CBM A;  4FSS A;  1S72 A;  2RHZ A;  3OMG A;  1M30 A;  1X2K A;  1GBR A;  1K9M U;  2YRD A;  2L3S A;  4C8Q B;  2ZPG B;  2VKN A;  5KYW A;  3OW2 A;  3JCM d;  4M7D A;  4DEY A;  2K3B A;  2NYS A;  2JXB A;  4F17 A;  5D7U A;  4CC4 B;  2CSI A;  1PC0 A;  2D6F A;  5GAN h;  2ECZ A;  3R6O A;  2EJF A;  2RQR A;  5IHK A;  3OQ5 A;  3CC7 T;  1LCK A;  2W0Z A;  1E6G A;  1M4Z A;  3D7S B;  3M55 A;  3A1P A;  2YDL A;  4XU1 A;  2DTI A;  1Q7Y C;  2QQB A;  2RPN A;  1VQO Q;  2EJG A;  1MMD A;  2A0F B;  4QVZ A;  2M16 A;  1VQP A;  3RES A;  2AKL A;  3VS3 A;  1Z9Q A;  5ECA A;  2CUD A;  2OAW A;  1S1N A;  3QO3 A;  2O31 A;  1LVK A;  1GL5 A;  1LPL A;  4J9C A;  4ZGD B;  3OS0 A;  1JO8 A;  2PUK B;  3FJP A;  3GNG A;  2HZY A;  1ZUU A;  2K9G A;  1GRI A;  4M78 C;  3OYH A;  4AFQ C;  3CCV Q;  5GMK l;  5M9O A;  3C12 A;  3LW5 E;  3OYI A;  4FYW B;  2EAY A;  3EG0 A;  3FDR A;  1GCP A;  4X34 A;  1AWX A;  2KRN A;  4ORZ A;  5KYU B;  4M75 C;  1OZ2 A;  1PD1 A;  4J9I A;  3L2Q A;  3RUX A;  3I55 Q;  4R55 A;  3OYM A;  4JS5 A;  3RMQ A;  2DRM A;  4PJO C;  2CKK A;  3OYC A;  3V8J A;  2QK0 A;  2JJ9 A;  4OB3 B;  2RQW A;  1QP2 A;  9ATC B;  2HSP A;  2OI3 A;  2QEX Q;  2M0O A;  2MI6 A;  3PE0 A;  2MOX A;  1VQ7 T;  1SHF A;  3F70 A;  4JZ4 A;  1T0J A;  2BUD A;  1YCY A;  4A4F A;  1VYV A;  1Y0M A;  2FG0 A;  2ZCF B;  5FRM A;  2DTH A;  4M7A B;  1QVF S;  3CPW P;  2HCK A;  2HKN A;  5IHN A;  1H8K A;  1VQN T;  1UHC A;  3OA6 A;  4JJC A;  4D6W A;  1VQL A;  1YJN A;  1QKW A;  1OX9 A;  3CCM A;  2PVG B;  4WF2 A;  5KYW B;  4HCK A;  4M7D B;  2FZK B;  3RIR A;  1X27 A;  4E7Z A;  5LJ3 j;  2HD0 A;  2HSE B;  2JNG A;  2FYK A;  5D6W A;  5LL6 S;  2ED1 A;  2O2O A;  1QCO A;  4Z8A A;  1UTI A;  3OSV A;  3FEO A;  4BDZ A;  1AZG B;  4J9B A;  2W10 A;  2ZPF B;  1ZA2 B;  2AT1 B;  3P8D A;  3V8K A;  3CC7 Q;  3CC2 T;  3LX7 A;  2KT1 A;  2GQI A;  3JB9 F;  4B9X A;  1SRM A;  2V8I A;  2EWN A;  4AT1 B;  1VUB A;  1WHH A;  4ZGE B;  4GLM A;  3MCA B;  1QVG P;  4OMO A;  1BU1 A;  2EGE A;  4MZM A;  1JJ2 P;  2YLC A;  3EG9 A;  1AEY A;  2RHX A;  1YIJ T;  3OYB A;  4FIB A;  3G4S T;  5LJ3 g;  1UFF A;  4C92 F;  3JCM e;  3JB9 J;  4DA4 A;  3JCM V;  4KGZ B;  1PHT A;  1RUW A;  3PMT A;  4X9D A;  5DY9 A;  3PVL A;  3FC3 A;  4LE9 A;  4D8D A;  3QHS A;  2C0O A;  3L42 A;  2DTO A;  1MV0 B;  1JXM A;  3CMA T;  1QLY A;  1U1T A;  2DVJ A;  3L2U A;  2LCS A;  1X6B A;  4CI0 C;  1D0X A;  2D0N A;  2FZC B;  3M0U A;  4XU0 A;  3JCM f;  2E5Q A;  3JCM P;  2HMA A;  2IPO B;  5FWC A;  1VQK T;  2IG0 A;  4FSX A;  2DEQ A;  1N27 A;  2DIL A;  2K3Y A;  3NGP A;  3CC4 A;  4R56 A;  3L2Z A;  1T3L A;  2QA4 A;  2PVO B;  2H3J A;  4WTO B;  2CP2 A;  2RMO A;  3G6E T;  1VQ7 Q;  4EMK A;  4NL3 A;  3ME9 A;  2O88 A;  3HRU A;  2DA9 A;  2EGC A;  2ENM A;  5GAM h;  3EGD B;  1MMG A;  3C0C A;  4DBQ A;  4A63 B;  4PJN A;  4HVW A;  2H3E B;  5LJ5 h;  2COW A;  4ELZ C;  1ZUY A;  2ZPI B;  5GAN 5;  1SF9 A;  5GAO q;  1JU5 C;  2OTL T;  1QWE A;  1BBZ A;  1JB0 E;  4FYV B;  3UWN A;  4Q5W A;  2A36 A;  1BB9 A;  2LVM A;  4C0D B;  2MPX C;  3OYN A;  2VXF A;  1OZ3 A;  3X25 B;  1NYG A;  1WHK A;  4N4H A;  1N5Z A;  4ZTJ A;  4F7U F;  1K76 A;  4M78 D;  2X4J A;  2O9S A;  2DL5 A;  3V8L A;  1NM7 A;  4J6W A;  1IO6 A;  1LJO A;  3E9G A;  3V7S A;  2G6F X;  4M75 D;  3CC2 Q;  3CCQ A;  2RNA A;  3EAE A;  4OMQ A;  3EG9 B;  1ZX6 A;  4RTU A;  3M5A A;  4PJO D;  2LNH B;  3MEA A;  1Y96 A;  4XTX A;  1X01 A;  1W70 A;  1G3S A;  2ATC B;  1YIJ Q;  1KQS S;  3G4S Q;  2YRV A;  1PNJ A;  1NLO C;  1M3B A;  3OMC A;  4HCB A;  4BD3 A;  2NWM A;  3FB9 A;  1YJ9 Q;  3HSB A;  1BKB A;  1I1J A;  5GAO n;  1BI3 A;  3L2V A;  3CXC P;  2A3L A;  4PKC C;  1QVF A;  2DK3 A;  3MJX A;  4QT7 A;  3Q1J A;  4JLI A;  3J7A F;  3CME A;  2QDY B;  3EGX A;  1VQM T;  4PJJ A;  2CDT A;  3E19 A;  2P4T A;  1M5Q 1;  2L3R A;  1K73 R;  3H9N A;  2DX1 A;  3G7Z A;  2KY9 A;  1R8O B;  3S3O A;  1NPR A;  5J39 A;  3V7C A;  1KC8 R;  2YUQ A;  3KFV A;  4JRK A;  5J26 A;  4DBF A;  1OQK A;  1W2B P;  3H0H A;  4EMK C;  3VS7 A;  5GAM g;  2G3R A;  1ACM B;  2RHI A;  4EMK B;  2JT4 A;  4RMO A;  1VOM A;  2KRO A;  2KGT A;  2K6D A;  1B34 B;  5LJ5 g;  3OS1 A;  1OV3 A;  2P0Q A;  5A2Q E;  1RAE B;  1VQL T;  3NHN A;  4P5N A;  3M0T A;  4MMK A;  1AT1 B;  4BI3 A;  3I56 A;  1FYN A;  5EG2 A;  4FT2 A;  3QDF A;  1S72 Q;  1K8A C;  1Q95 G;  3CCE A;  4KBM B;  2EBP A;  1M1K R;  1ZHI A;  1KK7 A;  1OOT A;  1BIA A;  3A8G B;  3MKD A;  3X28 B;  2MWO A;  2OTL Q;  2RB6 A;  3DB3 A;  4ZN1 A;  1M1K C;  1GCQ A;  2KXC A;  1NJI R;  3LLR A;  5IXF A;  5GMK e;  3M0Q A;  3GIB A;  1ZUK A;  4FW2 A;  3TSZ A;  1RAA B;  3A5Z B;  1NJI C;  2LT4 A;  3G71 T;  1E6H A;  2OJ2 A;  2RO0 A;  2DYB A;  2RQU A;  2EVR A;  4BB7 A;  2E6Z A;  4XTV A;  1M9S A;  3EGU A;  5AT1 B;  3GF5 A;  1ZSG A;  4A4H A;  1VQP Q;  2DYI A;  4Z88 A;  4QQG A;  4M77 C;  2DBM A;  2L8D A;  1Y96 B;  1VA7 A;  4M77 E;  4QVC A;  1VQ4 A;  1SKU B;  3RKW A;  2FB7 A;  2BTT A;  1G3Y A;  5IT9 E;  5HY6 A;  3RR6 A;  3HP9 A;  3PIO A;  1WJS A;  3QJ6 A;  3MEW A;  3S6W A;  1SG5 A;  3CPW S;  2MMP A;  1D3B A;  1JEG A;  3M58 A;  4KUL A;  3OYE A;  1WNL A;  2D0Q B;  2O01 E;  3EGX B;  3HKS A;  2K79 A;  4E7I A;  4XTU A;  4EIK A;  1WXU A;  2J6K A;  3M0P A;  3I9Q A;  4PLI A;  2B8A A;  3NTH A;  3CCV T;  4EMH A;  3GOX A;  2RD1 A;  4LNP A;  5J3B A;  3OYA A;  2L0A A;  3VU3 C;  2P84 A;  3FJ5 A;  3EFO A;  5A0G A;  2E4H A;  1Q81 R;  3CC4 T;  1TUG B;  2X3X D;  2QA4 T;  4FCY A;  4PNO A;  3M9Q A;  2DEU A;  5FU7 C;  1Q81 C;  1AHJ B;  3PFS A;  5KYU A;  3AT1 B;  2DJZ A;  2X51 A;  2J6F A;  2JM9 A;  4XK8 E;  2KQW A;  2DRK A;  4IUU A;  5I2S A;  1IGU A;  2QEX T;  3BFM A;  1PM3 A;  2CGH A;  3CQT A;  4BI4 A;  2KK4 A;  4PJM A;  1RAH B;  1VQL Q;  2F1L A;  3OSS C;  1YJN Q;  3CCM Q;  1QVG S;  3CD6 A;  2KRM A;  4AMC A;  5IAY A;  2HQE A;  3AHU A;  1JJ2 S;  3TRE A;  3OYY A;  2JMA A;  2RHY A;  1KJW A;  3C94 A;  1GCQ C;  1R0C B;  2HQX A;  3JB9 H;  4GBQ A;  3X20 B;  1TOV A;  2FPD A;  2CH4 A;  1KQS A;  4C92 A;  3LH5 A;  2COY A;  4Z02 A;  2XHC A;  4GY5 A;  3ZFJ A;  2E70 A;  1K73 U;  4C8Q C;  1VQ8 A;  4HKE A;  4J8O A;  2JM8 A;  2D8J A;  3NTI A;  4C8Q E;  5CK9 A;  1B3Q A;  2K2M A;  3OYK A;  5A0D A;  5GAO m;  3HRT A;  1JRI A;  2ESW A;  3HTR A;  3G71 Q;  3CCQ T;  1SEM A;  3MP8 A;  1OU8 A;  2CH4 W;  1AWO A;  4ANJ A;  1H3Z A;  1X69 A;  2YXY A;  4MDW A;  4K11 A;  5GAO p;  2R58 A;  4HVV A;  4DEX A;  1D0Z A;  1K8A U;  2JZ2 A;  2Z0W A;  2M1H A;  1JQQ A;  2MCN A;  3H0I A;  1M1F A;  1U06 A;  1X75 C;  4A54 A;  2VGM A;  3M54 A;  5CIU A;  1UGS B;  4J9D A;  2JTE A;  2DXC A;  3QYG B;  4MZP A;  5GMK i;  5GJV B;  1UJ0 A;  2CUB A;  2ABL A;  1M1K U;  1D3B B;  3RER A;  2GQV A;  3LGL A;  5DM7 R;  2DFU A;  3CME T;  3JSC A;  2D1X A;  1UE9 A;  4KRT A;  4TVR A;  2LRQ A;  1BYM A;  4AFS C;  1D1A A;  1WXT A;  5KE3 A;  3UA6 A;  5EC7 A;  1NJI U;  1LOJ A;  5LJ3 h;  4LUD A;  5GAN 7;  4F14 A;  1ABQ A;  2RQT A;  5GJW B;  4L59 A;  1UDL A;  3EFO B;  2X9H A;  4M78 E;  1X6O A;  2DZC A;  4HA8 A;  5HCK A;  2I0N A;  2HNI A;  2BZX A;  4EDU A;  5HKC A;  2F2X A;  1OX8 A;  2DIQ A;  3CC4 Q;  2LCC A;  5I22 A;  2WSE E;  1VQ5 A;  1WJQ A;  2X4X A;  2QA4 Q;  4NL2 A;  2FL7 A;  1B07 A;  4M75 E;  1TUD A;  4F7U A;  2LJ0 A;  1ABO A;  1RAI B;  3BE3 A;  1WPY A;  3ZBD A;  3I56 T;  6AT1 B;  2JTM A;  3CCJ A;  2QG9 B;  1WZO A;  4PJO E;  1IRE B;  3OYF A;  4IUP A;  4N0A A;  4HT8 A;  4J9E A;  2GF7 A;  2C06 A;  1BCM A;  4M77 D;  4M7A C;  5FWB A;  2E12 A;  4LDU A;  5KCO A;  5KYN A;  3MPU B;  1TS9 A;  4M7A E;  2QYZ A;  8AT1 B;  4C92 C;  2DKG A;  5CR2 A;  2RI3 A;  2MAM A;  3EGD A;  4OML A;  2GFA A;  4C92 B;  2CRE A;  1AOJ A;  1UB4 A;  1UEC A;  1KD1 R;  3NTK A;  1XNI A;  2SRC A;  2KAF A;  4M7D C;  1ZQ1 A;  3OS5 A;  3CXC S;  3UF4 A;  1KFZ A;  3PIP A;  2K5I A;  4RUG A;  1VQ9 A;  3CPW A;  4M7D E;  1T0H A;  3H6Z A;  1KQ2 A;  2RHU A;  3A98 A;  3HPW A;  2DIG A;  2QGF B;  1Q81 U;  4RCB A;  2DPP B;  2Y4Y A;  2ED0 A;  4FL6 A;  2RK2 A;  4Z89 A;  4LXC A;  1VQ6 A;  2EPD A;  3CCQ Q;  4NOY A;  2M51 A;  2XK0 A;  3J80 E;  2DO3 A;  1M3A A;  3SWN A;  1WA7 A;  3P8H A;  1QCF A;  1QKX A;  1NE8 A;  1KIK A;  2JUF A;  2RI2 A;  3BW1 A;  4QVD A;  2VUB A;  2CSQ A;  1RAB B;  1W2B S;  3VYH B;  5KE2 A;  3SDZ A;  3LGF A;  4KH0 B;  1TSF A;  4BI8 B;  1I5O B;  2BZY A;  5CKE A;  2CP3 A;  3PVQ A;  2DMO A;  4A4G A;  5KH6 A;  4MDX A;  2NUP A;  2EKH A;  1QVP A;  4RKU E;  2E3I A;  3CCU A;  2WAC A;  3X24 B;  1YHQ A;  3CME Q;  1UGR B;  2RN8 A;  4OP0 A;  1BI2 A;  5HK3 A;  1YJ9 T;  1QVG A;  1JJ2 A;  1EX4 A;  3QKJ A;  1V76 A;  2L3P A;  4LDY A;  2K7A A;  2KE9 A;  1YI2 T;  3QYH B;  3CCR T;  4HCZ A;  1GBQ A;  1PG5 B;  1JXO A;  1X43 A;  1WQW A;  4LDX A;  4DOV A;  1ARK A;  3CCS A;  2F5T X;  2CZ0 B;  4EMG A;  3THK A;  2HEQ A;  1G3T A;  4C8Q D;  3JCM h;  2KBT A;  4M77 G;  4E7H A;  4F7U B;  5GAO r;  1RAG B;  3VS6 A;  4UC4 A;  2Y90 A;  5CQX A;  1TXQ A;  2JS2 A;  4F04 B;  3UPU A;  1UHF A;  1T3S A;  2VB6 A;  4N0A C;  3I56 Q;  2PVD B;  4C0F A;  3M0R A;  1TG0 A;  2DE0 X;  4O6J A;  4ZNX A;  3CCE Q;  1WHG A;  3X26 B;  1MUZ A;  2GCX A;  5D6Y A;  4KUD K;  2E41 A;  4RTT A;  1QP3 A;  2CP0 A;  3O8V A;  3GBQ A;  3CCL A;  1AVZ C;  1NG2 A;  2XID A;  1B34 A;  1S72 T;  1M3C A;  2X3W D;  4J7I A;  4A53 A;  4LD9 K;  1WQ7 A;  1N6A A;  3OY9 A;  1HXD A;  4BY6 B;  1YJW A;  2EYQ A;  3NFC A;  2NUZ A;  1TUC A;  2AK5 A;  1Q82 R;  2BIV A;  5CVI A;  3JB9 I;  4C0D C;  2FRW A;  4A4K A;  3A8H B;  5CKF A;  2D8H A;  3SWN C;  5GMK m;  4LDV A;  1Q82 C;  4RCC A;  4OMM A;  3SWN B;  1N8R R;  2QAS A;  3OYL A;  2XDD A;  3MEV A;  4JRP A;  2OX7 A;  3H41 A;  2X35 A;  4OGE A;  1VQ4 Q;  1QQJ A;  3UDC A;  1VYT A;  3S3N A;  1VQP T;  3VS0 A;  2O9V A;  4BE1 A;  2GFU A;  1YCS B;  2KDS A;  2NUP B;  3VRZ A;  3BDL A;  2LJ3 A;  4BE0 A;  2PUO B;  5L8R E;  3VS5 A;  4LD6 A;  2QI2 A;  3BY7 A;  4C8Q G;  4KUI A;  3VS1 A;  1OU9 A;  1MHN A;  1XTD A;  3OB9 A;  1WGS A;  3M4G A;  4JZ3 A;  3HHT B;  2DER A;  4M7A D;  2K2V A;  3I5S A;  1ZA1 B;  2QXF A;  3MP6 A;  4C92 D;  2KNB B;  3CC7 A;  3REA B;  4E7K A;  3JCM g;  3L2R A;  4XU3 A;  1FXX A;  2OTJ A;  2PU9 B;  1YI2 Q;  3CCR Q;  4ME7 A;  1C6V X;  2EKO A;  4J9F A;  4HXJ A;  4M7D D;  2V26 A;  1QW1 A;  2IIM A;  4MML A;  1H3H A;  3HL8 A;  1MMA A;  3FRN A;  3CXC A;  4Y28 E;  3WVE B;  1D0Y A;  4O5V A;  2DXU A;  4IUQ A;  2RJD A;  1K73 C;  3M53 A;  5C6S A;  3KUF A;  3GNF B;  4XQ3 A;  3TCJ A;  4HCC A;  2FVU A;  4E6R A;  2HBP A;  2LZ6 B;  3N5B B;  1KC8 C;  3CD6 Q;  3MP1 A;  2VAS A;  2LTO A;  5CAI A;  2M02 A;  4CC7 A;  1GFD A;  1BK2 A;  1TU0 B;  5GAN 8;  3ULR B;  5CO7 A;  5GAN d;  4JS4 A;  2ROT A;  1I4K 1;  1YJN T;  1W2B A;  3VUZ A;  3CCM T;  2KMT A;  3QSU A;  4M78 G;  2J06 A;  2D9T A;  4N4I A;  1VQ9 T;  1VQ8 Q;  4ESR A;  4JJN K;  1H92 A;  4C5E A;  4M4Z A;  2YLB A;  3R6N A;  2K5L A;  4OB2 B;  4M75 G;  1EFN A;  3MHX A;  1K0X A;  2GTO A;  1XOV A;  5FW9 A;  1C0M A;  3ER0 A;  4NS5 A;  4XU2 A;  2QDL A;  2V8J A;  1HK9 A;  1NYF A;  3SB2 A;  4LDW A;  4DBR A;  2XIC A;  1VIE A;  1IGQ A;  4FYY B;  2RJC A;  2YHT A;  1G8X A;  2QTV A;  4PJO G;  4DBH A;  3QPH A;  1VQ7 A;  1UJY A;  1MGQ A;  1Y07 A;  2FPF A;  3QWY A;  1G5V A;  2DXB A;  1NLP C;  1E7O A;  1YN8 A;  2HAX A;  1VQN A;  2OAU A;  4RTW A;  1IHW A;  3SHW A;  4L6V 5;  1Q86 R;  2EYY A;  1M1G A;  1UUE A;  3CCU T;  1UG1 A;  1YHQ T;  3PT9 A;  1U1S A;  2XKO C;  4M7D G;  1PCX A;  1XQH A;  1I5L A;  3CBO A;  1QCN A;  4JDS A;  1XJW B;  1K9A A;  3QXE B;  1IHV A;  1BIB A;  3PTA A;  1WHM A;  3EG1 A;  3CCS T;  2H8H A;  1Q82 U;  2ZGW A;  2I2L A;  2YUP A;  3OBW A;  3EH1 A;  2DL3 A;  5I21 A;  5D6X A;  2LQ8 A;  1QWF A;  1VQ5 Q;  3EG3 A;  4X1V A;  2JS0 A;  1G3W A;  2VGN A;  1N8R U;  4PJL A;  1K1Z A;  1RI9 A;  2QQR A;  4E7J A;  3T9N A;  3H8Z A;  4C0G A;  4RTY A;  2VXE A;  2DD5 A;  1PKT A;  4JJD A;  3CCJ Q;  1CSK A;  2XD0 A;  1YWP A;  3G4S A;  1Y71 A;  2JW4 A;  2PQW A;  1U8R A;  3A8L B;  3PGG A;  3M56 A;  1VYU A;  1Y7X A;  3CCL T;  2EQJ A;  2J6O A;  2C0I A;  2LDM A;  4IUR A;  4X9C A;  3U23 A;  4BDY A;  1C1A A;  3EFR A;  2ZPE B;  2CP7 A; 
#chains in the Genus database with same CATH homology
 3L1A A;  5GMK j;  2AHJ B;  3LYI A;  2LNV A;  2XDB A;  4IKF A;  2K3Y A;  3DKM A;  3VKI A;  3CC4 A;  1IRE B;  2RA2 A;  2RJE A;  3P8B B;  2XDP A;  4R56 A;  3OYF A;  4J6Y A;  4J83 A;  1FX7 A;  2EQM A;  3L2Z A;  4IUP A;  4N0A A;  2QA4 A;  2ZPH B;  2PVO B;  3CMA A;  2H3J A;  2LCL A;  4HT8 A;  2GF7 A;  3E9F A;  2LT1 A;  2C06 A;  4M77 D;  3G6E T;  4M7A C;  2CS7 A;  1PSF A;  2E12 A;  4LDU A;  4EMK A;  4NL3 A;  5KCO A;  2LQK A;  3ME9 A;  3HRU A;  5GAM h;  2R5A A;  4M7A E;  3E1S A;  4C92 C;  4JRQ A;  4M77 F;  3GP8 A;  2DKG A;  3BDU A;  5CR2 A;  1VQ6 T;  2RI3 A;  2MAM A;  4OGC A;  2GFA A;  3LWI A;  1VQK A;  4C92 B;  1VIF A;  1NPP A;  1UB4 A;  3EFS A;  2MF2 A;  3M59 A;  3NTK A;  5C0M A;  5LJ5 h;  1XNI A;  2K3X A;  2K5F A;  3OS2 A;  2KAF A;  2VC8 A;  1DJ7 B;  3JB9 G;  4ELZ C;  1YIT T;  4M7D C;  1ZQ1 A;  3OS5 A;  1P92 A;  3CXC S;  3DLL A;  2ZPI B;  5GAN 5;  3J81 E;  3PIP A;  1KG1 A;  2K5I A;  5GAO q;  1VQ9 A;  3CPW A;  4M7D E;  4J5Y A;  2OTL T;  3H6Z A;  1KQ2 A;  2RHU A;  2Y4X A;  1OYX A;  3HPW A;  2DIG A;  1SSF A;  2JTF A;  1N9R A;  1Q81 U;  2E65 A;  2ZPB B;  4RCB A;  5FLX E;  3G6E A;  1KC8 U;  4KT0 E;  1JB0 E;  5LJ3 d;  3UWN A;  2KSS A;  4Q5W A;  2DPP B;  2X4W A;  3VJP A;  2LVM A;  2WSF E;  4C0D B;  2E6N A;  2Y4Y A;  2VXF A;  1OZ3 A;  5GAN e;  4FL6 A;  3X25 B;  3OYN A;  2LX9 A;  2JVV A;  2RK2 A;  1VQ6 A;  4M7A G;  5A0L A;  4N4H A;  4NOY A;  2XK0 A;  4ZTJ A;  4F7U F;  3ASK A;  4ZN3 A;  3SFM A;  5GMK h;  4M78 D;  2DO3 A;  3J80 E;  4C92 G;  3SWN A;  3P8H A;  2X4J A;  4XTW A;  4C5I A;  3V8L A;  4OF1 A;  4C8Q A;  4E47 A;  4J6W A;  2RI5 A;  1LJO A;  1NE8 A;  3E9G A;  1K9M C;  2JUF A;  2RI2 A;  3BW1 A;  4QVD A;  4C5G A;  3QDR B;  3V7S A;  2VUB A;  1Q86 C;  2OTL A;  1W2B S;  4M75 D;  3VYH B;  5KE2 A;  1BI0 A;  3SDZ A;  1UGQ B;  3LGF A;  3S3M A;  3OYD A;  4FM4 B;  3OYG A;  4BI8 B;  3CCQ A;  2EQK A;  4IUT A;  4C5H A;  5I2M A;  3VV0 A;  2EFI A;  4ZTF A;  3EAE A;  5CKE A;  2JN0 A;  5GAN f;  4A4G A;  2P0P A;  3MEU A;  5KH6 A;  4MDX A;  2DD4 A;  3LWH A;  2OTJ T;  1M8V A;  3M5A A;  4PJO D;  1VQO T;  1W4S A;  1WJR A;  1QVP A;  1YBY A;  4RKU E;  3MEA A;  1Y96 A;  4M77 B;  4XTX A;  3WXM B;  2XU8 A;  1X01 A;  2WAC A;  3CCU A;  4BE2 A;  2JOY A;  1G3S A;  3X24 B;  1YHQ A;  1KQS S;  4QQD A;  3CC2 A;  1UGR B;  2YRV A;  4OP0 A;  4EPC A;  5AYF A;  5LJ3 e;  1BI2 A;  2CYZ B;  5HK3 A;  3OMC A;  3TU4 K;  4HCB A;  1YJ9 T;  1QVG A;  4XTY A;  4BD3 A;  5GAM d;  3JCM J;  3VUB A;  1JJ2 A;  3FB9 A;  1GXI E;  3DB4 A;  3QKJ A;  4OB0 B;  5GAN 4;  1ZBX A;  3HSB A;  3JCM X;  1BKB A;  4LDY A;  1O9S A;  1BI3 A;  5GAO n;  3A8O B;  4PLL A;  2K57 A;  2F69 A;  2RJF A;  3QYH B;  5CKB A;  1NZ9 A;  4HCZ A;  5LJ5 d;  3L2V A;  3CCR T;  1WQW A;  1YI2 T;  4LDX A;  2A3L A;  4PKC C;  4DOV A;  1QVF A;  2DK3 A;  2EQU A;  3CCS A;  2F5T X;  2CZ0 B;  3Q1J A;  4JLI A;  4EMG A;  1YIJ A;  3J7A F;  2L5Q A;  2QDY B;  3CME A;  2RK1 A;  1M90 C;  1G3T A;  4J6X A;  1VQM T;  4C8Q D;  3JCM h;  3C95 A;  3E19 A;  3QBY A;  2P4T A;  1M5Q 1;  2CZ6 B;  2E64 A;  2L3R A;  4M77 G;  3JCM Q;  4E7H A;  4F7U B;  4N4G A;  1Q86 U;  3G7Z A;  4OMF B;  5CKD A;  1KHC A;  2KY9 A;  2DXT A;  2F5K A;  4C8Q F;  3KXT A;  5GAO r;  2RM4 A;  1R8O B;  3QG1 A;  2Y90 A;  4UC4 A;  2EIF A;  1NPR A;  5CQX A;  5LJ3 f;  3CBP A;  5J39 A;  4BAC A;  3S3O A;  1YJ9 A;  4M78 B;  3V7C A;  3A8M B;  3UPU A;  3HRS A;  4M78 A;  4N0A C;  2PVD B;  1YI2 A;  3CCR A;  2FHD A;  3CCE T;  4C0F A;  4JRK A;  4O6J A;  5J26 A;  1RI0 A;  3QII A;  3I55 T;  1YJW T;  3GPL A;  3URG A;  4EMK C;  5GAM g;  4M75 B;  2QQS A;  2G3R A;  3X26 B;  2RHI A;  5FU7 B;  1VQM A;  2GCX A;  4M75 A;  5FU6 C;  3CEY A;  5D6Y A;  4KUD K;  4EMK B;  2E41 A;  2E1H A;  2VYT A;  2BKD N;  3OBY A;  4RMO A;  1QP3 A;  5CCA A;  3O8V A;  5CKH A;  1JBM A;  5FU6 B;  3CCL A;  4F7U G;  1B34 B;  5LJ5 g;  5GAN j;  3OS1 A;  2P0Q A;  4XAX B;  2XID A;  5A2Q E;  1VQL T;  1B34 A;  3JRZ A;  4P5N A;  4MMK A;  1FWZ A;  5FRN A;  4BI3 A;  3I56 A;  4ZGJ B;  1S72 T;  5EG2 A;  4C92 E;  4PJO B;  4OVA A;  4FT2 A;  2QQ9 A;  4J7I A;  2L89 A;  4A53 A;  4PJO A;  4LD9 K;  5DLO A;  1WQ7 A;  1K8A C;  1N6A A;  3CCE A;  3FLG A;  3OY9 A;  1HXD A;  4KBM B;  2E10 A;  4DQ2 A;  4GLK A;  4BY6 B;  1KD1 C;  1YJW A;  2EYQ A;  1V29 B;  1LNX A;  3NFC A;  3HFN A;  2XG8 D;  4QQ6 A;  1ZHI A;  1BIA A;  3A8G B;  2BIV A;  5CVI A;  3JB9 I;  3X28 B;  4C0D C;  2MWO A;  4M7A A;  2RB6 A;  3L2W A;  4II1 A;  2K4Y A;  3DB3 A;  2R57 A;  4A4K A;  4ZN1 A;  2A7Y A;  3A8H B;  4QW2 A;  5CKF A;  3SWN C;  5GMK m;  1H64 1;  2DVE A;  4LDV A;  1Q82 C;  2CZ7 B;  2R5M A;  3LLR A;  4RCC A;  3CBM A;  3VYG A;  5GMK e;  1S72 A;  2RHZ A;  3OMG A;  3SWN B;  3MO8 A;  3OYL A;  3GIB A;  3M4Y A;  1K9M U;  3UT1 A;  4C8Q B;  2ZPG B;  2XDD A;  3A5Z B;  1NJI C;  2LT4 A;  3G71 T;  3OW2 A;  1YIT A;  1VQ4 T;  3MEV A;  4M78 F;  3JCM d;  2O4X A;  2RO0 A;  4JRP A;  4M7D A;  4XTZ A;  5GAN g;  2WSC E;  2X35 A;  3LH0 A;  4OGE A;  5DLQ E;  4BB7 A;  2E6Z A;  3QJY A;  4XTV A;  3UDC A;  1M9S A;  3S3N A;  1VQP T;  2D6F A;  3GF5 A;  5GAN h;  4M75 F;  3PNW C;  3R6O A;  3V7R A;  4A4H A;  3SD4 A;  2EJF A;  4ATO A;  4BE1 A;  3CC7 T;  3OQ5 A;  3FIF A;  2GFU A;  2KDS A;  2NLU A;  3BDL A;  2XI9 A;  4QQG A;  4BE0 A;  2PUO B;  5L8R E;  3HFO A;  1M4Z A;  4M77 C;  3M55 A;  2QI2 A;  2L8D A;  4LD6 A;  3OYJ A;  1Y96 B;  4CRI A;  4E7L A;  3BY7 A;  4XU1 A;  2DTI A;  2IVW A;  2QQB A;  1Q7Y C;  4M77 E;  4C8Q G;  3G71 A;  4KUI A;  4QVC A;  1VQ4 A;  3RKY A;  1MHN A;  2EJG A;  4PJO F;  1XTD A;  3RKW A;  2FB7 A;  1G3Y A;  3OB9 A;  2CZ1 B;  5IT9 E;  5HY6 A;  1WGS A;  2DAQ A;  3HP9 A;  3M4G A;  3PIO A;  4QVZ A;  2M16 A;  1VQP A;  3HHT B;  1WJS A;  4J7F A;  4VUB A;  3QJ6 A;  1OI1 A;  4M7A D;  3RES A;  2K2V A;  3MEW A;  3S6W A;  3DLM A;  3CPW S;  2MMP A;  4OB1 B;  2QXF A;  3MP6 A;  4V2S A;  4C92 D;  1D3B A;  3CC7 A;  4E7K A;  1KQ1 A;  3M58 A;  4KUL A;  3JCM g;  3L2R A;  3OYE A;  4XU3 A;  4M7A F;  1WNL A;  2D0Q B;  1FXX A;  2O01 E;  2OTJ A;  3HKS A;  2PU9 B;  3QO3 A;  4E7I A;  1VQO A;  4XTU A;  4ME7 A;  2EKO A;  4ZGD B;  4PLI A;  4RG8 A;  2DZ9 A;  4JRI A;  4M7D D;  2B8A A;  1QW1 A;  2V8K A;  4FU6 A;  4MML A;  3OS0 A;  1TH7 A;  3NTH A;  2PUK B;  2ZZD A;  3FJP A;  3GNG A;  4F7U E;  3CCV T;  4EMH A;  3HL8 A;  3GOX A;  3FRN A;  2RD1 A;  2KVQ G;  3CD6 A;  5GAN 2;  3CXC A;  4Y28 E;  4M78 C;  3OYH A;  4M7D F;  3WVE B;  5J3B A;  3OYA A;  4O5V A;  3VU3 C;  2DXU A;  4IUQ A;  5GMK l;  5M9O A;  3C12 A;  3LW5 E;  2RJD A;  2MWP A;  5A0G A;  3OYI A;  1K73 C;  2EAY A;  5GAN 6;  3CC4 T;  3M53 A;  5C6S A;  3KUF A;  3GNF B;  4XQ3 A;  3TCJ A;  3FDR A;  4JLG A;  4X34 A;  4HCC A;  2QA4 T;  2FVU A;  3CD6 T;  4PNO A;  2HBP A;  3N5B B;  3M9Q A;  4M75 C;  4PJO E;  3JCM b;  5FU7 C;  1Q81 C;  1AHJ B;  1OZ2 A;  3PFS A;  1KC8 C;  2DJZ A;  3MP1 A;  2LTO A;  5CAI A;  1Q7Y U;  3L2Q A;  3RUX A;  3CPF A;  3CCV A;  4XK8 E;  5GAM e;  5GAN 8;  4R55 A;  2KQW A;  5CO7 A;  4IUU A;  5GAN d;  4JS4 A;  3OYM A;  4JS5 A;  1UEB A;  4JUV A;  5I2S A;  3RMQ A;  2QEX T;  1I4K 1;  4PJO C;  3BFM A;  2CKK A;  3OYC A;  3V8J A;  2CGH A;  4BI4 A;  3VUZ A;  3CCM T;  2KMT A;  1YJN T;  2KK4 A;  4OB3 B;  1W2B A;  3QSU A;  5LJ5 e;  1QP2 A;  1VQ8 T;  3INZ A;  4M78 G;  3MET A;  3OSS C;  2M0O A;  2D9T A;  2MI6 A;  4N4I A;  3JAM E;  1QVG S;  2RH2 A;  1VQ9 T;  1VQ7 T;  3C4S A;  4BY6 C;  3AHU A;  5IAY A;  1EIF A;  2HQE A;  3F70 A;  1JJ2 S;  4BUG A;  4MZT A;  3OYY A;  3TRE A;  4JJN K;  1UGP B;  3I55 A;  3JCM W;  4C5E A;  3WVD B;  2RHY A;  1M90 U;  2BUD A;  1YCY A;  4IUV A;  2YLB A;  4A4F A;  2K5L A;  4C0Z A;  3C94 A;  4OB2 B;  2ZCF B;  4M75 G;  2DTH A;  5FRO A;  5FRM A;  4M7A B;  3MHX A;  1QVF S;  3JCM c;  1XOV A;  2M9U A;  1VQN T;  3ER0 A;  2HQX A;  4NS5 A;  3JB9 H;  3X20 B;  4FT4 A;  4XU2 A;  5GAM f;  3OA6 A;  2V8J A;  1KQS A;  1HK9 A;  3SB2 A;  2VV5 A;  4LDW A;  4D6W A;  4C92 A;  2QEX A;  4Z02 A;  2XIC A;  1VIE A;  1VQL A;  2XHC A;  4GY5 A;  3ZFJ A;  1YJN A;  3CCM A;  2E70 A;  1K73 U;  4C8Q C;  2RJC A;  1VQ8 A;  2YHT A;  2PVG B;  4HKE A;  4J8O A;  5LJ5 f;  1I81 A;  4WF2 A;  4PJO G;  3QPH A;  3M57 A;  3NTI A;  4C8Q E;  3GLX A;  5CK9 A;  3TEE A;  1VQ7 A;  1MGQ A;  2O4X B;  5HK0 A;  4M7D B;  3RIR A;  3OYK A;  1Y07 A;  5A0D A;  5GAO m;  1N8R C;  3HRT A;  1JRI A;  5IN1 A;  1G5V A;  5LJ3 j;  1KHI A;  2DXB A;  3CCQ T;  2HD0 A;  2JNG A;  1IZ6 A;  2FYK A;  3MP8 A;  5D6W A;  5LL6 S;  2HAX A;  1VQN A;  3OSV A;  3FEO A;  5KCH A;  2OAU A;  4BDZ A;  4L6V 5;  4ELY C;  4HT9 A;  3QZ9 B;  1H3Z A;  2ZPF B;  1M1G A;  4MDW A;  5GAN 3;  2R58 A;  5GAO p;  3CCU T;  3P8D A;  3V8K A;  3JB9 D;  4A4E A;  1YHQ T;  3CC2 T;  1K8A U;  2JZ2 A;  3LX7 A;  3PT9 A;  2M1H A;  3PMI A;  1U1S A;  2P0K A;  2XKO C;  1PSE A;  3JB9 F;  4B9X A;  4YTL A;  2V8I A;  4M7D G;  2EWN A;  1M1F A;  1VUB A;  1KD1 U;  1X75 C;  4A54 A;  5CQY A;  1XQH A;  1I5L A;  1N9S A;  3CBO A;  1O75 A;  2VGM A;  3M54 A;  4JDS A;  5CIU A;  4Y91 A;  4ZGE B;  1UGS B;  2DXC A;  3QXE B;  3MCA B;  3QYG B;  4MZP A;  5GMK i;  1BIB A;  3PTA A;  1M1K U;  3RER A;  1D3B B;  3CCS T;  2GQV A;  4MZM A;  3LGL A;  2LC4 A;  2YLC A;  2EJ9 A;  1Q82 U;  5DM7 R;  2ZGW A;  2RHX A;  2I2L A;  1YIJ T;  3CME T;  3OYB A;  4FIB A;  3JSC A;  3G4S T;  3OBW A;  5LJ3 g;  1VQ5 T;  4TVR A;  2LRQ A;  4DOW A;  5D6X A;  4C92 F;  5I21 A;  1BYM A;  2LQ8 A;  4M77 A;  3JCM e;  5KE3 A;  3JB9 J;  2X4Y A;  4DA4 A;  1NJI U;  3JCM V;  1LOJ A;  1G3W A;  2VGN A;  1N8R U;  5LJ3 h;  5GAM j;  3PMT A;  4X9D A;  5DY9 A;  3FC3 A;  2QQR A;  4L5G A;  5GAN 7;  4RG2 A;  3KBG A;  4E7J A;  4L59 A;  3T9N A;  3CCJ T;  3OW2 S;  3H8Z A;  3ZEH A;  4C0G A;  3QHS A;  2VXE A;  2DD5 A;  4M78 E;  1X6O A;  5LJ5 j;  2DZC A;  4HA8 A;  1I8F A;  2HNI A;  3L42 A;  3RMS A;  2DTO A;  4PL6 A;  4EDU A;  5HKC A;  2XD0 A;  3CMA T;  2DIQ A;  1U1T A;  2LCC A;  3QZ5 B;  3L2U A;  3G4S A;  3QUI A;  1Y71 A;  2QQA A;  2WSE E;  1VQ5 A;  1WJQ A;  2PQW A;  2X4X A;  1U8R A;  4CI0 C;  1M1K C;  3A8L B;  4NL2 A;  1RL2 A;  2FL7 A;  3PGG A;  4M75 E;  3M56 A;  5GAO l;  1Y7X A;  4XU0 A;  3JCM f;  2EQJ A;  3CCL T;  2E5Q A;  1BI1 A;  4F7U A;  4B9W A;  3RKX A;  3JCM P;  2LDM A;  4IUR A;  4X9C A;  4BDY A;  1WPY A;  2QTX A;  3EFR A;  3ZBD A;  3I56 T;  1VQK T;  2IG0 A;  2ZPE B;  2DEQ A;  4FSX A;  1N27 A;  2JTM A;  3CCJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...