2RJEA

Crystal structure of l3mbtl1 in complex with h4k20me2 (residues 17-25), orthorhombic form ii
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
313
structure length
309
Chain Sequence
WSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lethal(3)malignant brain tumor-like protein
publication title L3MBTL1 recognition of mono- and dimethylated histones.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 84
structure length 309
sequence length 313
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rjeA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rjeA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rjeA03
3S3NA 4E7KA 4IKFA 1KHCA 2O4XB 4BD3A 3GOXA 2RHZA 3OYMA 4HCZA 2LDMA 4Q5WA 4A4GA 2GF7A 3UT1A 3CEYA 3ZEHA 3QBYA 3L2WA 3DB4A 4IURA 5KCHA 2B8AA 1OZ2A 2JTFA 2JZ2A 2QQRA 3EAEA 4IUPA 3L2VA 3DB3A 1MHNA 1RI0A 2EQKA 2L3RA 2L89A 2X4YA 3OQ5A 4ZTFA 3OS1A 1OZ3A 2DAQA 5KE3A 2E5QA 4Z02A 4PL6A 2HQEA 3OYBA 3OYEA 4E7HA 2BIVA 4C5IA 4QQ6A 3OYFA 4LD6A 3OYNA 2RHYA 3OYGA 3L2RA 3LGLA 2BUDA 2LRQA 4C5GA 5C6SA 2DIQA 3NTKA 3OYAA 3H6ZA 4BE0A 3LH0A 4A4HA 2FHDA 2CKKA 2L8DA 4BE2A 5CIUA 4CRIA 2R57A 4OVAA 4A4FA 2M16A 4IUTA 2X35A 3OYLA 3MP1A 4C5HA 3H8ZA 4FU6A 3OS0A 2E6NA 4E7JA 2R5MA 1SSFA 4IUQA 3S3OA 2X4XA 3FDRA 3LYIA 3NTHA 4II1A 4QQDA 3L2UA 2MWOA 3DLMA 4GY5A 2VYTA 2D9TA 4IUVA 4NS5A 2BKDN 3OYHA 3PFSA 5M9OA 4B9WA 4N4IA 3OY9A 2O4XA 4PLIA 2R5AA 3UWNA 3OYCA 2XDPA 3OA6A 1WJQA 2LCCA 3MP8A 3E9FA 3QIIA 3MEWA 3FC3A 2MWPA 2EKOA 3ME9A 5IN1A 3OS2A 3OMCA 3L42A 2PQWA 5D6WA 2K3XA 4E7IA 2XK0A 3OB9A 3BDLA 5J26A 1G5VA 3M9QA 5J39A 4IUUA 3MO8A 1N27A 5D6XA 4EDUA 2EQUA 3FLGA 4N4GA 4A4EA 5KH6A 2EQJA 3ASKA 1XNIA 3P8DA 2RJDA 3NTIA 4X34A 4BE1A 2WACA 3C4SA 3S6WA 2QQSA 2RJCA 4N4HA 3L2QA 2LTOA 4L59A 3MEVA 1WJSA 3P8HA 3SD4A 3Q1JA 3QJ6A 2RI2A 2YRVA 5KE2A 2M1HA 2RI5A 3KUFA 4BACA 2RJFA 4QQGA 4QW2A 5FROA 2GFAA 3LLRA 2EFIA 3O8VA 2IG0A 3MEUA 1OYXA 1WGSA 3F70A 3PMIA 2RHUA 3E9GA 3PMTA 3PNWC 5D6YA 3LGFA 2RO0A 4PLLA 4BDYA 3MP6A 2G3RA 2M0OA 2RHXA 4QVZA 4FL6A 4BDZA 1WJRA 2RHIA 4B9XA 2R58A 2F5KA 2DIGA 2X4WA 3OYIA 2GFUA 3LX7A 3QKJA 4C5EA 5FRMA 3OMGA 4ZTJA 2RI3A 2RJEA 5KCOA 1H3ZA 3MEAA 4RG2A 4UC4A 2EQMA 5C0MA 3OYKA 3FEOA 3OYJA 3OYDA 2K3YA 3S3MA 4E7LA 5IAYA 2P0KA 2LVMA 5FRNA 2NLUA 1OI1A 2HQXA 3META
chains in the Genus database with same CATH superfamily
4PJOC 4BD3A 3CCRA 2CUBA 1YITT 4JRPA 4J9DA 1Q86R 1QVFA 4LDXA 4PJOE 1WQ7A 3EAEA 1ZA1B 5IHIA 1UHFA 1GCQC 2L89A 2K5IA 2E65A 3OS1A 2V8JA 2LQKA 3VS6A 2PVGB 5CQYA 2WSCE 3EH1A 1IHVA 4XU0A 2K7AA 1HSQA 4M7AC 4F7UB 1QP3A 4CC2A 1WA7A 4DA4A 3M4GA 2DNUA 2K2MA 2HL3A 1AOJA 2R57A 2KT8A 3G1JA 2JW4A 2E6NA 1QKXA 1RI9A 2LC4A 1MMNA 4D6WA 2OI3A 2DRMA 3OYHA 4FW2A 1IRXA 1ZUYA 2CDTA 5LJ3f 4RTWA 1PSFA 2D8HA 2YDLA 3OW2A 1PNJA 4K11A 2VB6A 3MO8A 1X43A 1M9SA 5KH6A 3ULRB 3EG9B 4PJOD 2LT1A 2A7YA 2MPXC 4BE1A 1TUCA 3CCLA 3CPWS 3RNJA 3GP8A 4L5GA 1GRIA 4MZMA 2CSIA 1RAFB 1AWJA 1V29B 4J9CA 4J6YA 2DEQA 4M7AD 5FLXE 2AK5A 2ENMA 5I21A 3RKXA 3CCVA 5IT9E 4ZTJA 1H3ZA 2DFUA 3A8OB 1NJIC 4LUDA 5CKDA 1UE9A 3JCMW 2E1HA 1XOVA 4J8OA 2NWMA 1M1KC 2CZ0B 2GF7A 2COWA 1K73C 1M90C 5GAN6 2CZ1B 3EGXA 5KCHA 3MKDA 2GQVA 1E7OA 3HRUA 4B6MA 2CP3A 4AFQC 1K0XA 2CSQA 2DF6A 2EYWA 2RMOA 1G8XA 3OYGA 2PNIA 2DXUA 3NTKA 3I5RA 1LPLA 2DETA 1YHQA 4PNOA 2L8DA 4WCIA 1UECA 2RQUA 4DBHA 1JXMA 5LJ5j 3WVEB 5KYWA 1KQ2A 3OYLA 4C5HA 3UDCA 1VQ5Q 5GANh 2ZPBB 1VOMA 3D7SB 1VQMA 1UGSB 3CMAQ 2DK3A 1W2BS 3UF4A 2OJ2A 3X28B 4R56A 4AT1B 4M75F 2RF0A 1ACMB 4C92D 1NJIU 1VA7A 2XDDA 2HCKA 1EIFA 3VV0A 2KROA 2JM8A 1M1KU 1M90U 4XTVA 4AG1C 4F7UA 1M1GA 4C92B 1KQSS 1PKTA 3VS2A 1E6HA 3O8VA 3EHQA 2X3WD 1IREB 2DBKA 5CCAA 5FWBA 1VQPQ 4M78B 2QGGA 5GANf 2M0OA 1ABQA 1WX6A 1E6GA 2JJ9A 2DYBA 2DILA 1B3QA 3EGUA 3OYJA 1I1JA 1HJDA 2DM1A 5DM7R 3S3NA 5IHNA 2PVOB 2QTVA 2J7IA 3EG1A 5CQXA 3CEYA 1GL5A 4RUGA 3CPWA 3EG9A 1TOVA 1NM7A 3TU4K 1TG0A 1AWWA 2ZPGB 2L3RA 3EGDB 1TUDA 1PD1A 4PL6A 5GANg 3H0FA 3PIOA 1ZHIA 1BCOA 1X2KA 2K4YA 4LDWA 1R0BG 4OMNA 3QWYA 4CC3A 1ZUUA 2EAYA 1VQOQ 2M51A 1Q86U 1D1CA 4V2SA 2KRMA 4II1A 1IHWA 2I2LA 2QG9B 5A0DA 3CCRT 2DTOA 2VYTA 3G71A 2A0FB 5I2MA 5GAMj 2OTLA 2OTJA 4O6JA 1I81A 2F5TX 2WSEE 3UWNA 1FMWA 1WJQA 4KBMB 1X01A 2D1XA 3E9FA 3RR6A 2VASA 1NLPC 1ZBXA 5LJ5d 2PQWA 4EIKA 1XQHA 4QT7A 2HKNA 2HBPA 3M55A 2YRDA 2O9SA 3MPUB 3FLGA 1YJNQ 1G3TA 1NE8A 1BI1A 1FWZA 1U1TA 2QASA 1EX4A 2RJCA 4N4HA 4M4ZA 4FCYA 3CCQQ 1Y57A 3JCMc 3Q1JA 4JJNK 1DJ7B 1C0MA 4HA8A 3RESA 3HFOA 1GXIE 2EYZA 4HCCA 3CD6T 2GBQA 2CZ7B 1W2BA 3A5ZB 1JO8A 4FIBA 1FMKA 3HFNA 1U5SA 2BZYA 4ORZA 4UC4A 1C6VX 3OYKA 3CCSA 4C0DB 3UA7A 2HEQA 2LVMA 4XU1A 4IKFA 2M02A 1G3SA 2EYXA 1M2VB 2GGRA 2MF2A 4XTYA 3ZEHA 2DD4A 3QWXX 2FL7A 1SHGA 3CCLT 1KQSA 3QUIA 1MUZA 4ESRA 1RI0A 1EFNA 3OQ5A 3BDUA 1O75A 1SSHA 2KE9A 2DAQA 4C92A 4Z02A 4R55A 1RLPC 4J6XA 3L2ZA 2IPOB 1I4K1 4XU2A 2K79A 3CXCS 4C5GA 1BIAA 3A8GB 4M77D 3I9QA 1TUGB 1M1FA 3E1SA 3CMEA 1QMCA 4M78A 3CCVT 1GFCA 3JB9G 1P92A 2D6FA 4M7DB 2HL5C 2CT3A 2O31A 4IUQA 2KNBB 4Z8AA 4OP0A 1UFFA 1RADB 2FPEA 4M77B 4NS5A 2BKDN 2QEXA 1KG1A 1M3BA 4B9WA 4JLGA 1NEGA 2KY9A 3JB9D 2RQWA 3M57A 2XKOC 1I07A 2QGFB 3X26B 5L8RE 5LJ3d 1V76A 3R6OA 3CCMQ 3EGDA 3QG1A 4A4EA 5CKBA 4JZ3A 2D0NA 1XNIA 5J3BA 2DJZA 2QQSA 2PU9B 1YHQT 2V1RA 3MEVA 3QJ6A 2E12A 4ZNXA 2J6KA 1WHHA 1U3OA 2CYZB 4PFOA 3LLRA 1PD0A 3HKSA 3MEUA 1M8MA 2HAXA 2LT4A 3VKIA 5GAN8 3GNFB 1ZSZB 1VQMT 4F16A 3CBMA 1WFWA 1BK2A 1R8OB 4X9DA 3CCJT 3G7ZA 5GANe 3CCET 4EMHA 5KYXB 3JCMV 3OYDA 2MYSA 8ATCB 1X6GA 4ELZC 1NPRA 2C0TA 2DZ9A 4HCZA 2AHJB 4Q5WA 4C8QD 4LE9A 1N6AA 2AKKA 2YRCA 5GAN7 4KH0B 2DL8A 5HCKA 2ZPHB 3QZ5B 1YNZA 2X4YA 4DEXA 2X4JA 4A63B 4JLIA 4C8QB 3VS1A 2H8HA 1RAHB 3LGLA 4QVDA 3JCMJ 4A4HA 2LZ6B 1TH7A 4OB1B 1SF9A 1RABB 4RTVA 2KVQG 1KK7A 2MCNA 1X27A 1Y07A 5GAN2 2DTHA 3OS0A 3SWNC 1GBQA 1B7TA 2CGHA 4EMKC 1K4US 2RB6A 1QP2A 2KK4A 4OGCA 1M2VA 2EKOA 2L3PA 2RD1A 5IN1A 1VQNA 2H3JA 1X75C 1N9SA 2PUKB 3LWIA 3SB2A 5L23A 2V1QA 1T0HA 2DXBA 3E19A 3CXCA 2L0AA 5EC7A 4NL3A 2WSFE 3VRZA 5LJ5f 2QA4A 1K73R 5FWCA 3KBGA 3SD4A 3JB9J 1WI7A 4ATOA 2XI9A 3AT1B 1ABOA 1UGRB 4M7DA 3G71T 2K5LA 2OTLT 2OTJT 1S1NA 3GNGA 4FYXB 4RKUE 4KULA 3BFMA 3QO3A 4FL6A 2EYQA 2O88A 4M77A 3G4ST 4LDYA 3E2UA 2GFUA 1Z9ZA 3M5AA 2CT4A 3JB9H 4YTLA 1RAEB 5GAOm 4HCKA 3QHSA 2QAZA 1Q7YC 3L2WA 1VYVA 4XTXA 5GMKj 2LCLA 1WPYA 4Z89A 1RUWA 1HYOA 1YJ9A 4GBQA 3GBQA 5CKHA 2DVEA 2HD0A 4QQ6A 1HXDA 4JJCA 5LJ3h 3I55A 1YI2A 1BBZA 1MMGA 3CCRQ 1ZSZA 4OGEA 2RQVA 3I35A 4BI4A 4F7UF 4HT9A 3NGPA 5GAOl 1QWFA 1ZQ1A 3FDRA 5KYXA 4F7UG 4KH1B 2D9TA 2HDAA 2K9GA 4OMQA 3PFSA 1WHLA 3A8MB 1BI3A 3CBOA 4BY6B 1FX7A 3M0UA 2DMOA 3ME9A 3OS2A 2DRKA 5D6WA 2LJ1A 1D1BA 1I5LA 2JS2A 2CP0A 4LNPA 4RG8A 4A4KA 4TVRA 2DVJA 2HSEB 2EJ9A 4X34A 4C8QA 2EGEA 3M54A 3CD6Q 4C0GA 3CC4T 2ZAEA 3CMET 2C0OA 1M8VA 2OAWA 5GAMf 5AT1B 3A8HB 2AKLA 2LP5A 3F70A 3NMZC 2RHUA 1MV3A 2ZPIB 2QEXT 4E6RA 4C0ZA 1WJRA 2DA9A 2EQIA 2KAFA 2X4WA 3OYIA 4R0KA 2K3YA 1FXXA 3NPFA 4E7LA 2KR3A 2J05A 3CCLQ 2JS0A 2MOXA 3CCMT 2E6ZA 1PC0A 1K0SA 1RL2A 1N5ZA 2HNIA 8AT1B 4AFSC 4F04B 5LJ3g 2K2VA 3UT1A 4PJOB 1NZ9A 3QBYA 1I0CA 4LDVA 3HP9A 2B8AA 2JTFA 1OQKA 2DZCA 3U23A 1NG2A 3CC7T 1W1FA 3OBYA 1OZ3A 3CCVQ 1OX9A 2BIVA 3TQ7P 2K6DA 1KFZA 2BUDA 4BE0A 2ESWA 4M7AB 3HHTB 2GTJA 3HRTA 2CH4W 1MMDA 2FVUA 3VS7A 3SDZA 1LVKA 2X51A 4ZGEB 1SSFA 2J6FA 4GY5A 4M75C 2FRYA 4MMLA 2LJ0A 2P4TA 1PG5B 2MWPA 4M75E 3OMCA 1GCPA 1S72T 2K3XA 3MCAB 1RAAB 1YHQQ 3BDLA 5ECAA 3H0IA 2W0ZA 4JUVA 2MAMA 3A98A 3NTIA 1QQJA 4DBQA 1SKUB 4J9GA 4JDSA 2EVRA 2CUDA 3RKWA 1VQMQ 1CKAA 2QDLA 3DKMA 3EFOB 3JCMf 1YN8A 2L5QA 2RI5A 1TXQA 1YCYA 3FB9A 3CCJQ 4QW2A 1KIKA 2P84A 4LUEA 3CCEQ 2VGNA 3HPWA 1OU8A 3I56A 2CP6A 3C95A 3LGFA 2RO0A 1VQ5A 2EGAA 1SEMA 3O5ZA 4JJBA 4HXJA 3V7RA 4M75G 1UJYA 1G83A 3LX7A 2YXYA 1WXUA 4M78F 4RG2A 1N9RA 1PWTA 2V8KA 2Z0WA 1K73U 4OMMA 1OI1A 2PVDB 4M78G 2RN8A 1XJWB 2RHZA 1UGVA 1W70A 3H9NA 4M75D 1SRLA 1VUBA 4IIMA 2F1LA 3EHRA 3OBWA 1I8FA 4FSXA 4IUPA 1U1SA 4AFUC 2VV5A 1ZUKA 4VUBA 4WF2A 3RMSA 3M0TA 5HKCA 2GCXA 4CC7A 4JJDA 1UUEA 3EH2A 3JCMb 1QCNA 2COZA 2YUNA 4CRIA 2M16A 1YIJT 3H41A 3M59A 1X2QA 4E7JA 2JOYA 4E7SA 3LYIA 4FSSA 2E10A 1QW1A 2A36A 3TVTA 4N4IA 3OY9A 1TS9A 3DLLA 4N0AC 2Y90A 1HK9A 4PJOA 1QKWA 2AZVA 1VQKA 1X69A 2F69A 4Y28E 1OOTA 5J26A 3T9NA 4OB3B 4KUDK 1N27A 2O01E 4N4GA 1VQ6A 2VC8A 3ASKA 2PUOB 1GCQA 3I55T 2EBPA 1YI2T 2KBTA 3GLXA 3G71Q 4E7ZA 2OTLQ 2OTJQ 3P8HA 5CVIA 5A0LA 3M0PA 3G4SQ 4M7AA 1Y71A 5LJ3e 3TSZA 2GFAA 5DY9A 2CP5A 1LJOA 2XICA 2LX9A 1VQ9A 3PMIA 3PNWC 5D6YA 4PLLA 3CCUA 2XIDA 3MP6A 1NPPA 2ZPEB 3J81E 4A53A 1JJ2P 3UA6A 3EG0A 3S3MA 2P0KA 4PFZA 1Q95G 2V26A 1QWEA 5IH2A 1VYTA 5FU6C 1YFNA 3CC2A 2HBWA 4X1VA 1WIEA 4FYWB 4IIOA 5I11A 1T3LA 1YWPA 1NYGA 4EPCA 2DL5A 2FYKA 4M7DE 3VJPA 1HD3A 5KE3A 2FO0A 3EFOA 3REAB 2HQEA 4BI8B 3QYGB 3OYFA 3G6EA 2MI6A 2QI2A 4PFPA 1BU1A 2CZ6B 1ZBJA 4J83A 2YT6A 3GPLA 2EYYA 2CS7A 4OVAA 5HK3A 2NUPB 1X6BA 1YITA 3L2UA 1WQWA 4PJJA 3GIBA 1VQ8A 4M7DF 5M9OA 2D8JA 2KI7A 1MNDA 1QVGP 2ZCFB 5FW9A 2L3QA 3MP8A 3MEWA 4M7DG 2X3XD 1RLQC 4PK4A 2DPPB 3CC4Q 2QQBA 3CMEQ 1TSFA 5CR2A 3TCJA 2EQUA 4D8DA 2JM9A 3C4SA 1WZOA 1Q7YR 1NLOC 3OS5A 1KQSP 4RCCA 5GJWB 1CKBA 2QEXQ 2XDBA 1K9MR 1JQQA 2BE9B 2YRVA 2JUFA 5DLQE 1AVZC 3KUFA 4RTXA 1OPKA 4PKCC 2EFIA 2L2PA 2FB7A 1IXDA 1WGSA 2IVWA 3PTAA 2RHXA 5GAMd 2DYIA 1YJWA 3OSSC 4HVUA 1Q81R 3HSBA 5C0MA 1VQ4A 3CQTA 3THKA 2NYSA 3RDVA 1C1AA 3CC7Q 3QXEB 1VQ7A 1RAIB 1AZGB 2VUBA 4IURA 2RQTA 4WTOB 4F14A 2QK0A 2E5QA 2ZGWA 2LMJA 2RA2A 4C5IA 4LD6A 4OMFB 3I56T 4J9IA 2ABLA 2OX7A 2LRQA 2CP7A 4DOVA 1H92A 1QLYA 2CKKA 3REBB 4OMLA 2XMFA 3X25B 1K8AR 1XTDA 3LWHA 4FU6A 2KSSA 3PVLA 1S72Q 2MWOA 4IUVA 2AT1B 4XQ3A 5LJ5h 4OMOA 5GAOn 1VYUA 2G6FX 5GMKm 2E41A 2KRSA 3V7SA 3J80E 3RUXA 2J06A 3QSUA 5FU7C 4LDUA 5D6XA 4EDUA 1I5OB 4HCBA 2FPDA 2KDSA 3JB9I 4FYYB 3S6WA 2QXFA 3L2QA 2LTOA 1Z9QA 1N8RC 3QPHA 4QVCA 3AHUA 3SFMA 4QQGA 2NUPA 1VQNQ 1OYXA 2KQWA 3V7CA 4RMOA 2DD5A 4F17A 3JCMd 3PIPA 1PHTA 2VVKA 1GBRA 1NEBA 1QCOA 2RHIA 1MGQA 5D7UA 3EG3A 5FRMA 1ZSGA 1M4ZA 1VQKT 2QA4Q 3X24B 3MJXA 1J3TA 3VYHB 2QTXA 1ZA2B 4Z88A 1VQ6T 2DJQA 4O5VA 2VKNA 3NHNA 1JBMA 3M53A 3OSVA 4MMKA 3ER0A 2J6OA 1IGQA 1B34B 4FT2A 4OB2B 1PM3A 3OYYA 4NL2A 6AT1B 2FRWA 2A37A 1YIJQ 3M58A 5DLOA 2BZXA 3ZFJA 3L2RA 3OYAA 1BB9A 3CCUT 2LQWA 3H6ZA 1Q82R 5LJ5g 2LJ3A 2IIMA 4J7IA 4RTZA 4F7UE 4RTYA 1JU5C 2ATCB 3A8LB 4IUTA 3VU3C 1K9MC 3H8ZA 1BKBA 4KRTA 1VIFA 1M3CA 3NTHA 4ANJA 3DLMA 2KT1A 1CSKA 1MNEA 3CC2T 3SWNB 4ZN3A 2LX7A 4EMKB 4AMCA 2XDPA 2GQIA 2FPFA 3ZBDA 5IXBA 4DBFA 3FJPA 2QQAA 3I55Q 1YI2Q 1Q81C 2I0NA 5GAMh 1QCFA 2HMAA 3VS4A 4IUUA 1VQLA 3CCST 3G6ET 5CKEA 2EQJA 2EIFA 2F2XA 1M2OA 1V1CA 7AT1B 4KUIA 1G3YA 4BI3A 1D0ZA 4HKEA 2BZ8A 2RJFA 1NBEB 2B86A 2ROTA 2C06A 3R6NA 3TEEA 1ARKA 1BCMA 3VS3A 4MDXA 1VQ8T 2XU8A 2RK2A 1AWOA 1JRIA 1PKSA 1QVPA 2G3RA 4QVZA 2ECZA 1R0CB 3M56A 4C5EA 1TWBA 5KCOA 1QVFP 5CAIA 1Q7YU 2JTMA 3M4YA 5A0GA 2RPNA 5IAYA 1K8AC 1UGPB 1T0JA 1UTIA 3H0HA 1K9MU 3GOXA 3VRYA 2LDMA 2DEUA 4HVVA 4XU3A 4A4GA 4Y92A 2CP2A 4M7AE 1OZ2A 3A1PA 1U06A 3CD6A 2DL3A 3HRSA 4PJOF 4ZN1A 2EQKA 4MZTA 4FW1A 2YUQA 3BY7A 2YLCA 4MDWA 3OYEA 1Q81U 1TU0B 4PJOG 3JAME 2DIQA 1OX8A 4LXCA 1YJWT 5HY6A 5I22A 1VQ4T 5GAMg 2KRNA 3QZ9B 4M7AF 3QDFA 3OW2P 1Y96B 5IXFA 2D0QB 2DTIA 1WLPB 2DX1A 4M7AG 1VQ7T 1EZZB 2VXFA 1K9AA 3CPFA 4ELYC 3JCMh 2AZSA 4FT4A 1WHKA 1B34A 5KYUB 3M9QA 3IQLA 1K8AU 3VS0A 2FEIA 2K5FA 4C92C 3QDRB 1JJ2S 5GAN5 2YUOA 1WHJA 4C92E 1OU9A 5FROA 4M78C 3RKYA 2DXCA 3E9GA 1GFDA 4HVWA 4J9BA 4M78E 3SWNA 1Q82C 2E3IA 4EMKA 1M27C 1UB4A 2KXCA 2OAUA 5LJ5e 2ED0A 2NLUA 5FRNA 2LCSA 2E3HA 1Y0MA 3OYMA 1UG1A 2NUTB 1UGQB 1D1AA 2QQ9A 4C92F 1OEBA 3FRNA 3I56Q 3QYHB 1SG5A 2F2VA 2H3EB 4DEYA 4C92G 1AD5A 4Y91A 3P8BB 3CMAA 1BYMA 3URGA 1VQNT 1AHJB 4C0FA 1M3AA 5KYYB 2A3LA 3CCJA 3VUBA 5C6SA 2VXEA 1QVGS 3JCMX 4XK8E 3CCEA 3LH0A 2K3BA 2FHDA 1AWXA 2P0QA 4CC4B 3I5SA 5CIUA 2LQ8A 3RERA 4JRQA 3JCMg 4KT0E 4FYVB 4J6WA 2QA4T 3MP1A 1IZ6A 3VS5A 3VUZA 1B07A 2M9UA 2X4XA 2CREA 4KGZB 4QQDA 4DOWA 4M78D 1Q86C 1JEGA 1H8KA 1KJWA 1ZX6A 4LD9K 2EPDA 2R5AA 4M75B 3HTRA 4P5NA 4JRIA 3QIIA 3WXMB 2DXTA 2COYA 1Q82U 2FZCB 1WNLA 5GAN4 4E7IA 2F2WA 3LH5A 1G5VA 1VQPA 2V8IA 2XG8D 5GMKi 1K76A 1FMVA 2HZYA 1U8RA 2HKQB 2JMCA 2RJDA 2SEMA 2NUZA 3C12A 1WJSA 4J9EA 2M1HA 4PJMA 3RMQA 2LQNA 4OMPA 2DL4A 2IG0A 2Y4XA 1LOJA 1VQKQ 1YJ9T 1Y96A 4E47A 9ATCB 3SHWA 1VQ6Q 1OPLA 4C0DC 2RK1A 2RI3A 2RJEA 3CPWP 3FEOA 2JT4A 1D09B 4ME7A 2EJGA 1VQLT 2FG0A 1SPKA 5KYUA 1VQOA 4PJNA 1JJ2A 4PJLA 4XAXB 5GAMe 5CK9A 2EGCA 4XTWA 1VQ9Q 5IHKA 2KXDA 4OF1A 2JZ2A 5A2QE 3CCUQ 3HL8A 5LJ3j 1IB8A 3EFRA 1IO6A 1YBYA 4ZTFA 4J9FA 3OYBA 1D3BB 1H641 1A0NB 3OYNA 4JRKA 1X6OA 2DBMA 3G4SA 5GMKh 2LNHB 3PE0A 3M0SA 2BTTA 3CC2Q 4M7DC 3FIFA 1WYXA 3RIRA 5GAN3 4A4FA 1KC8R 5KYNA 2X35A 1N8RR 1YJNA 1LCKA 1M30A 4M77C 4RTTA 3PT9A 1BIBA 5CO7A 3ZL7C 3CCQA 1BI0A 2YHTA 2Y4YA 1UJ0A 4M77E 3OA6A 3CCSQ 3G6EQ 2NUTA 2LCCA 3VYGA 3EFSA 4J7FA 4BUGA 2ROLA 5I2SA 4JS5A 2DO3A 2EWNA 4AG2C 4FM4B 1KD1R 3X20B 1G2BA 1QVGA 2FZKB 1NYFA 2DE0X 1YITQ 4CI0C 3P8DA 2MMPA 1PSEA 1UHCA 2WACA 5KYYA 4QKUA 3GF5A 1W2BP 2QYZA 4D8KA 1VQ8Q 2RI2A 2W10A 5KE2A 1KHIA 2YUPA 3UPUA 4M77F 1KSWA 1ZSZC 2ZPFB 1KQ1A 3V8JA 3KXTA 1PCXA 1RAGB 1SRMA 2DL7A 4M77G 1ZLMA 2VGMA 4A54A 2DERA 1IGUA 3TREA 2RH2A 3FJ5A 3QKJA 4M75A 2YWWA 2EQMA 3BW1A 4M7DD 1MV0B 2YSQA 4AFZC 4E7KA 2KEAA 3JB9F 2O4XB 3INZA 3CC4A 3JCMe 5FU6B 2DLPA 3V8KA 3DB4A 1AEYA 4LN2A 3L2VA 1MHNA 2GTOA 2E70A 4C8QC 2AIRB 1YJWQ 4J5YA 4E7HA 1K1ZA 3M0RA 1VQ4Q 2QDYB 2RHYA 2O2OA 1H3HA 1D0YA 4C8QE 4OB0B 3N5BB 4XTUA 2PTKA 3MHXA 5AYFA 2P0PA 3CCMA 1VQ7Q 5GJVB 4GLKA 3EG2A 4JPBW 4ZGDB 1T3SA 1Y7XA 2R5MA 5EG2A 4EMGA 2HQHA 2YLBA 3L1AA 4PLIA 5GAOp 3CC7A 4GLMA 5CKFA 1VQ5T 2EW3A 2KYBA 3L42A 5GANj 4HT8A 3OB9A 4C8QF 4RCBA 1WHMA 4JS4A 3CMAT 5GAOq 2LNVA 5J39A 4C8QG 3JSCA 2EKHA 2XHCA 1D3BA 2MIOA 4L59A 1WDXA 1QVFS 1F1BB 2X9HA 4BACA 3JV3A 3PVQA 1UEBA 5HK0A 2JN0A 3JRZA 2KGTA 1R77A 1WXTA 4DQ2A 3NFCA 5GAOr 1S72A 4J9HA 3UATA 4B9XA 3J7AF 1AZEA 4X9CA 2F5KA 1TTHB 4KGXB 1YWOA 3OMGA 3WVDB 2JXBA 4DBRA 1D0XA 3MEAA 2ED1A 3LW5E 1KC8C 1VQPT 2DIGA 2HQXA 4N0AA 1KHCA 3PGGA 3C0CA 2JTEA 1MMAA 5LL6S 2A08A 2JVVA 3M0QA 2QQRA 1SHFA 3DB3A 3V8LA 3TSWA 5GMKl 3JCMQ 3OW2S 1O9SA 3CBPA 2RM4A 2HSPA 1KD1C 2EJFA 2E64A 2MK5A 4BB7A 2CH4A 4MZPA 1AT1B 1W6XA 1FYNA 2L3SA 2RNAA 4BE2A 1NJIR 2P4RA 4E2FB 3SEMA 2FZGB 4RTUA 2KMTA 1W4SA 3S3OA 1G3WA 1YCSB 2SRCA 2C0IA 1M1KR 1VIEA 4BY6C 4KGVB 1M90R 1VQOT 3CXCP 2BE7D 2RQRA 2O4XA 3RBBB 1OULA 3OYCA 3JCMP 1VQ9T 3FC3A 1PRLC 2O9VA 2XK0A 2M0YA 2PZ1A 2K57A 2DKGA 2GNCA 1YP5A 4JZ4A 3KFVA 1KC8U 2E4HA 1BI2A 1N8RU 2JMAA 1JB0E 3EGXB 5FU7B 1JXOA 1YIJA 4XTZA 4NOYA 1WHGA 1YJ9Q 5GANd 2KYMA 3BE3A 1RACB 5GMKe 1YJNT 1LNXA 2JNGA 4ZGJB 1M5Q1 2XD0A 1WXBA 3C94A 3PMTA 3CCQT 4L6V5 4BDYA 1KD1U 3QJYA 4BDZA 1VQLQ 5KYWB 2R58A 2A28A 2E5KA 2VWFA 1PRMC 2ZZDA 1OV3A 1UDLA 3META
chains in the Genus database with same CATH topology
1NPRA 5FU6C 2DZ9A 4PJOC 4BD3A 3CCRA 3CC2A 3OYMA 1YITT 4HCZA 4JRPA 2AHJB 4Q5WA 4C8QD 1UGQB 1N6AA 5GAN7 2QQ9A 4C92F 3FRNA 1QVFA 4LDXA 2ZPHB 4PJOE 1WQ7A 3EAEA 3QZ5B 3QYHB 4EPCA 2FYKA 4C92G 4M7DE 4Y91A 3VJPA 2L89A 2X4YA 3P8BB 2K5IA 2E65A 2X4JA 3OS1A 3CMAA 5KE3A 1BYMA 2V8JA 3URGA 2LQKA 1VQNT 4BI8B 2HQEA 4JLIA 1AHJB 4C8QB 4C0FA 2PVGB 3QYGB 5CQYA 3OYFA 2WSCE 3G6EA 2A3LA 2MI6A 2QI2A 3CCJA 3VUBA 4XU0A 3LGLA 4QVDA 5C6SA 2VXEA 3JCMJ 1QVGS 4M7AC 4F7UB 3JCMX 4XK8E 3CCEA 2CZ6B 1QP3A 3LH0A 4A4HA 1TH7A 2FHDA 4OB1B 4DA4A 2KVQG 2P0QA 3M4GA 4J83A 5CIUA 2LQ8A 3GPLA 3RERA 2R57A 4JRQA 2CS7A 3JCMg 4OVAA 4KT0E 5HK3A 4J6WA 2QA4T 3MP1A 1Y07A 5GAN2 1IZ6A 2DTHA 3OS0A 2E6NA 1YITA 3VUZA 3SWNC 2M9UA 2X4XA 2LC4A 1WQWA 4QQDA 2CGHA 3L2UA 4EMKC 4DOWA 4M78D 4D6WA 1Q86C 3GIBA 1VQ8A 4M7DF 3OYHA 2RB6A 5M9OA 5LJ3f 4LD9K 2R5AA 1QP2A 2KK4A 4M75B 4P5NA 4OGCA 2ZCFB 1PSFA 4JRIA 3MP8A 3QIIA 3MEWA 2DXTA 3WXMB 4M7DG 2EKOA 2RD1A 5IN1A 1VQ5A 1VQNA 1Q82U 2H3JA 1X75C 1WNLA 5GAN4 4E7IA 1N9SA 2PUKB 3OW2A 3LWIA 3SB2A 2DPPB 2QQBA 1G5VA 1VQPA 2V8IA 2XG8D 5CR2A 5GMKi 3MO8A 3E19A 2DXBA 3TCJA 3CXCA 2EQUA 1M9SA 5KH6A 4PJOD 2LT1A 4NL3A 2A7YA 2WSFE 2RJDA 1U8RA 4BE1A 5LJ5f 3C4SA 2QA4A 3OS5A 3C12A 3KBGA 4RCCA 3CCLA 1WJSA 2XDBA 3SD4A 3CPWS 3JB9J 2YRVA 2JUFA 3GP8A 2M1HA 4L5GA 5DLQE 4ATOA 3RMQA 3KUFA 4MZMA 4PKCC 2EFIA 2XI9A 2IG0A 2Y4XA 2FB7A 1LOJA 1WGSA 2IVWA 1UGRB 1V29B 4M7DA 3G71T 2K5LA 2OTLT 2OTJT 3PTAA 1YJ9T 1Y96A 3GNGA 4RKUE 4J6YA 4E47A 4KULA 2RHXA 3BFMA 2DEQA 3QO3A 4FL6A 2EYQA 4M7AD 4M77A 5FLXE 5GAMd 3G4ST 1YJWA 4LDYA 4C0DC 5I21A 2GFUA 3RKXA 3OSSC 3CCVA 5IT9E 2RK1A 2RI3A 2RJEA 4ZTJA 3M5AA 3A8OB 1H3ZA 3HSBA 5C0MA 3JB9H 3FEOA 1VQ4A 4YTLA 1NJIC 5CKDA 4ME7A 2EJGA 3JCMW 5GAOm 1VQLT 2E1HA 1XOVA 4J8OA 1VQOA 3QHSA 3QXEB 1Q7YC 2CZ0B 1M1KC 2GF7A 1JJ2A 1K73C 1M90C 1VQ7A 4XAXB 5GAMe 5CK9A 4XTWA 3L2WA 5GAN6 2VUBA 4IURA 2CZ1B 4OF1A 2JZ2A 4XTXA 5KCHA 5A2QE 5GMKj 3HL8A 2GQVA 5LJ3j 2LCLA 1WPYA 3HRUA 3EFRA 1YBYA 4ZTFA 2E5QA 2ZGWA 1YJ9A 5CKHA 3OYBA 2DVEA 2RA2A 4C5IA 1D3BB 1H641 2HD0A 4QQ6A 1HXDA 4JRKA 1X6OA 4LD6A 4OMFB 3OYNA 3I56T 3OYGA 3G4SA 2LRQA 2DXUA 3NTKA 4DOVA 5GMKh 5LJ3h 3I55A 1YI2A 2CKKA 1YHQA 4PNOA 2L8DA 4OGEA 4M7DC 3FIFA 3RIRA 3X25B 5GAN3 4BI4A 4A4FA 4F7UF 5LJ5j 4HT9A 1XTDA 3WVEB 1KQ2A 2X35A 3OYLA 3LWHA 1YJNA 4C5HA 4FU6A 3UDCA 4M77C 2KSSA 5GAOl 1ZQ1A 3FDRA 4F7UG 5GANh 2ZPBB 2MWOA 1BIBA 3PT9A 5CO7A 2D9TA 3CCQA 4IUVA 1VQMA 1BI0A 1UGSB 2YHTA 2DK3A 3PFSA 2Y4YA 4XQ3A 4M77E 5LJ5h 3A8MB 1BI3A 3CBOA 4BY6B 3OA6A 1W2BS 1FX7A 2LCCA 3VYGA 3EFSA 4J7FA 5GAOn 3ME9A 3OS2A 3X28B 4BUGA 5GMKm 2E41A 5D6WA 3V7SA 4R56A 3J80E 5I2SA 4PJOB 4JS5A 2DO3A 4M75F 2EWNA 1I5LA 3RUXA 4C92D 4RG8A 3QSUA 4FM4B 1NJIU 4A4KA 5FU7C 4TVRA 4LDUA 5D6XA 4EDUA 2XDDA 4HCBA 3X20B 2KDSA 1QVGA 3JB9I 2EJ9A 1EIFA 3VV0A 4CI0C 3P8DA 4X34A 2MMPA 1PSEA 4C8QA 3M54A 2WACA 3S6WA 2QXFA 4C0GA 1M1KU 3GF5A 3CC4T 3L2QA 2LTOA 3CMET 1M90U 4XTVA 4F7UA 1N8RC 1M1GA 4C92B 2RI2A 5KE2A 1KHIA 3QPHA 1KQSS 4QVCA 1M8VA 3UPUA 5GAMf 3AHUA 4M77F 3SFMA 2ZPFB 3A8HB 1KQ1A 4QQGA 3V8JA 3O8VA 3KXTA 1OYXA 1IREB 2KQWA 3F70A 2RHUA 3V7CA 4RMOA 2ZPIB 2DD5A 4M77G 5CCAA 2VGMA 2QEXT 3JCMd 3PIPA 4M78B 4A54A 5GANf 4C0ZA 2M0OA 1WJRA 2RHIA 1MGQA 2KAFA 2X4WA 2RH2A 3TREA 3OYIA 3QKJA 5FRMA 1M4ZA 4M75A 2EQMA 3BW1A 4M7DD 3OYJA 1VQKT 2K3YA 1FXXA 3X24B 4E7LA 5DM7R 3S3NA 3VYHB 3CCMT 4E7KA 3JB9F 2O4XB 2QTXA 2E6ZA 3INZA 3CC4A 1VQ6T 2PVOB 1RL2A 3JCMe 2HNIA 4O5VA 1JBMA 3M53A 3OSVA 5FU6B 2K2VA 5CQXA 3CEYA 1NZ9A 3QBYA 4MMKA 3ER0A 3UT1A 5LJ3g 3V8KA 3DB4A 3CPWA 4LDVA 3HP9A 1B34B 4FT2A 2B8AA 2JTFA 3TU4K 3L2VA 4OB2B 2DZCA 1MHNA 2E70A 4C8QC 2ZPGB 2L3RA 3CC7T 3OYYA 3OBYA 4NL2A 1OZ3A 4J5YA 4PL6A 5GANg 4E7HA 2BIVA 3M58A 5DLOA 2QDYB 2RHYA 3PIOA 1ZHIA 3ZFJA 4C8QE 2BUDA 4OB0B 3N5BB 4XTUA 3OYAA 3L2RA 2K4YA 3H6ZA 3CCUT 4BE0A 5LJ5g 4LDWA 3MHXA 4J7IA 4F7UE 4M7AB 2EAYA 5AYFA 2P0PA 1Q86U 3A8LB 3HHTB 3CCMA 4IUTA 3VU3C 4V2SA 3HRTA 2FVUA 4GLKA 4ZGDB 3SDZA 1K9MC 3H8ZA 1Y7XA 2R5MA 1BKBA 1SSFA 1VIFA 4ZGEB 3NTHA 5EG2A 4II1A 2I2LA 3DLMA 4GY5A 3CCRT 5A0DA 2DTOA 2VYTA 4M75C 4EMGA 3G71A 3CC2T 4MMLA 5I2MA 3SWNB 2YLBA 5GAMj 2OTLA 2OTJA 3L1AA 4ZN3A 4O6JA 1I81A 2F5TX 4PLIA 2P4TA 4EMKB 2WSEE 3UWNA 2XDPA 5GAOp 1WJQA 4KBMB 3CC7A 1X01A 3ZBDA 3E9FA 5CKFA 1ZBXA 2MWPA 4M75E 1VQ5T 3OMCA 5LJ5d 3FJPA 2PQWA 3L42A 5GANj 1S72T 2K3XA 4HT8A 2QQAA 3MCAB 3OB9A 4C8QF 4RCBA 1XQHA 3BDLA 1Q81C 5GAMh 4JS4A 3CMAT 5GAOq 2LNVA 2HBPA 3M55A 4IUUA 5J39A 1VQLA 4C8QG 3CCST 3JSCA 3FLGA 3G6ET 5CKEA 2EQJA 1G3TA 1NE8A 4JUVA 2MAMA 2EIFA 1BI1A 1FWZA 1U1TA 2XHCA 3NTIA 1D3BA 4JDSA 2RJCA 4N4HA 4L59A 3RKWA 4KUIA 1QVFS 3JCMc 1G3YA 3DKMA 3Q1JA 4BI3A 3JCMf 4JJNK 1DJ7B 2L5QA 4HA8A 2RI5A 3FB9A 1YCYA 2RJFA 4HKEA 1UEBA 3HFOA 4QW2A 3RESA 4BACA 5HK0A 2C06A 4HCCA 1GXIE 3TEEA 2JN0A 3CD6T 2VGNA 3HPWA 3JRZA 3I56A 3C95A 2CZ7B 4MDXA 1VQ8T 2XU8A 2RK2A 3LGFA 2RO0A 1JRIA 3NFCA 4DQ2A 5GAOr 1W2BA 3A5ZB 1S72A 1QVPA 2G3RA 4QVZA 3V7RA 4M75G 4FIBA 4B9XA 3J7AF 3M56A 4X9CA 2F5KA 3HFNA 3LX7A 4C5EA 3OMGA 3WVDB 5KCOA 3MEAA 4M78F 4RG2A 1N9RA 4UC4A 5CAIA 2V8KA 3OYKA 3CCSA 1Q7YU 2JTMA 3M4YA 3LW5E 4C0DB 5A0GA 5IAYA 1K73U 1KC8C 1K8AC 2LVMA 1UGPB 2DIGA 2PVDB 1OI1A 2HQXA 4N0AA 4XU1A 1VQPT 1K9MU 4M78G 4IKFA 1KHCA 3PGGA 3GOXA 2RHZA 1G3SA 2LDMA 5LL6S 4XU3A 2MF2A 4M75D 4XTYA 4A4GA 2JVVA 3ZEHA 1VUBA 2DD4A 4M7AE 3OBWA 2FL7A 1OZ2A 1I8FA 4FSXA 2QQRA 4IUPA 3QUIA 3CCLT 1KQSA 3DB3A 3CD6A 3HRSA 4PJOF 1RI0A 1U1SA 3V8LA 2EQKA 2VV5A 3BDUA 1O75A 3OQ5A 4ZN1A 4MZTA 5GMKl 4VUBA 3JCMQ 4WF2A 2DAQA 3RMSA 3BY7A 3OW2S 1O9SA 4C92A 4Z02A 2YLCA 3CBPA 4MDWA 4R55A 2RM4A 3OYEA 4PJOG 1Q81U 5HKCA 2GCXA 3L2ZA 4J6XA 1KD1C 1I4K1 4XU2A 3CXCS 2EJFA 2E64A 3JAME 3JCMb 4C5GA 2DIQA 4BB7A 1BIAA 3A8GB 4MZPA 4M77D 1M1FA 3E1SA 3CMEA 1YJWT 4BE2A 4M78A 5HY6A 3CCVT 4CRIA 3JB9G 2M16A 1YIJT 1P92A 1VQ4T 2D6FA 3M59A 4M7DB 5GAMg 2KMTA 4E7JA 3QZ9B 1W4SA 2JOYA 4IUQA 3S3OA 1Y96B 3LYIA 1G3WA 4M7AF 4OP0A 2D0QB 2DTIA 2E10A 1QW1A 1VIEA 4M77B 4BY6C 4NS5A 2BKDN 2QEXA 1VQOT 4M7AG 1KG1A 4B9WA 4N4IA 3OY9A 2O4XA 3DLLA 1VQ7T 4N0AC 2Y90A 3OYCA 3JCMP 4JLGA 1VQ9T 2VXFA 3CPFA 2KY9A 3FC3A 3JB9D 3M57A 1HK9A 4ELYC 4PJOA 3JCMh 2XKOC 2XK0A 1VQKA 4FT4A 3X26B 4ELZC 2F69A 4Y28E 1B34A 2K57A 4OB3B 5J26A 5L8RE 3T9NA 2DKGA 3M9QA 5LJ3d 4KUDK 3R6OA 1KC8U 1N27A 1K8AU 2O01E 3QG1A 1BI2A 4N4GA 4A4EA 1N8RU 1VQ6A 5CKBA 2VC8A 3ASKA 1JB0E 2PUOB 2K5FA 1XNIA 5FU7B 5J3BA 2DJZA 3I55T 1YIJA 4C92C 1YI2T 2QQSA 2PU9B 1YHQT 3GLXA 4XTZA 3QDRB 1JJ2S 3MEVA 4NOYA 3P8HA 5GANd 5GAN5 3QJ6A 5CVIA 2E12A 5A0LA 2CYZB 5GMKe 1YJNT 4M7AA 1LNXA 1Y71A 2JNGA 4C92E 5LJ3e 5FROA 2GFAA 3LLRA 4ZGJB 1M5Q1 5DY9A 2XD0A 3HKSA 3MEUA 4M78C 2HAXA 3RKYA 2LT4A 1LJOA 3VKIA 2XICA 3GNFB 2LX9A 3C94A 2DXCA 5GAN8 3PMIA 1VQ9A 3E9GA 3PMTA 3PNWC 3CCQT 4L6V5 5D6YA 1VQMT 4PLLA 3CCUA 2XIDA 4BDYA 1KD1U 3MP6A 3QJYA 4BDZA 3CBMA 1NPPA 2ZPEB 3J81E 4M78E 1R8OB 2R58A 4X9DA 3SWNA 3G7ZA 4A53A 5GANe 3CCJT 1Q82C 4EMKA 3CCET 4EMHA 1UB4A 2ZZDA 3JCMV 3OYDA 3S3MA 2OAUA 2P0KA 5LJ5e 5FRNA 2NLUA 3META
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S3N A;  4E7K A;  4IKF A;  1KHC A;  2O4X B;  4BD3 A;  3GOX A;  2RHZ A;  3OYM A;  4HCZ A;  2LDM A;  4Q5W A;  4A4G A;  2GF7 A;  3UT1 A;  3CEY A;  3ZEH A;  3QBY A;  3L2W A;  3DB4 A;  4IUR A;  5KCH A;  2B8A A;  1OZ2 A;  2JTF A;  2JZ2 A;  2QQR A;  3EAE A;  4IUP A;  3L2V A;  3DB3 A;  1MHN A;  1RI0 A;  2EQK A;  2L3R A;  2L89 A;  2X4Y A;  3OQ5 A;  4ZTF A;  3OS1 A;  1OZ3 A;  2DAQ A;  5KE3 A;  2E5Q A;  4Z02 A;  4PL6 A;  2HQE A;  3OYB A;  3OYE A;  4E7H A;  2BIV A;  4C5I A;  4QQ6 A;  3OYF A;  4LD6 A;  3OYN A;  2RHY A;  3OYG A;  3L2R A;  3LGL A;  2BUD A;  2LRQ A;  4C5G A;  5C6S A;  2DIQ A;  3NTK A;  3OYA A;  3H6Z A;  4BE0 A;  3LH0 A;  4A4H A;  2FHD A;  2CKK A;  2L8D A;  4BE2 A;  5CIU A;  4CRI A;  2R57 A;  4OVA A;  4A4F A;  2M16 A;  4IUT A;  2X35 A;  3OYL A;  3MP1 A;  4C5H A;  3H8Z A;  4FU6 A;  3OS0 A;  2E6N A;  4E7J A;  2R5M A;  1SSF A;  4IUQ A;  3S3O A;  2X4X A;  3FDR A;  3LYI A;  3NTH A;  4II1 A;  4QQD A;  3L2U A;  2MWO A;  3DLM A;  4GY5 A;  2VYT A;  2D9T A;  4IUV A;  4NS5 A;  2BKD N;  3OYH A;  3PFS A;  5M9O A;  4B9W A;  4N4I A;  3OY9 A;  2O4X A;  4PLI A;  2R5A A;  3UWN A;  3OYC A;  2XDP A;  3OA6 A;  1WJQ A;  2LCC A;  3MP8 A;  3E9F A;  3QII A;  3MEW A;  3FC3 A;  2MWP A;  2EKO A;  3ME9 A;  5IN1 A;  3OS2 A;  3OMC A;  3L42 A;  2PQW A;  5D6W A;  2K3X A;  4E7I A;  2XK0 A;  3OB9 A;  3BDL A;  5J26 A;  1G5V A;  3M9Q A;  5J39 A;  4IUU A;  3MO8 A;  1N27 A;  5D6X A;  4EDU A;  2EQU A;  3FLG A;  4N4G A;  4A4E A;  5KH6 A;  2EQJ A;  3ASK A;  1XNI A;  3P8D A;  2RJD A;  3NTI A;  4X34 A;  4BE1 A;  2WAC A;  3C4S A;  3S6W A;  2QQS A;  2RJC A;  4N4H A;  3L2Q A;  2LTO A;  4L59 A;  3MEV A;  1WJS A;  3P8H A;  3SD4 A;  3Q1J A;  3QJ6 A;  2RI2 A;  2YRV A;  5KE2 A;  2M1H A;  2RI5 A;  3KUF A;  4BAC A;  2RJF A;  4QQG A;  4QW2 A;  5FRO A;  2GFA A;  3LLR A;  2EFI A;  3O8V A;  2IG0 A;  3MEU A;  1OYX A;  1WGS A;  3F70 A;  3PMI A;  2RHU A;  3E9G A;  3PMT A;  3PNW C;  5D6Y A;  3LGF A;  2RO0 A;  4PLL A;  4BDY A;  3MP6 A;  2G3R A;  2M0O A;  2RHX A;  4QVZ A;  4FL6 A;  4BDZ A;  1WJR A;  2RHI A;  4B9X A;  2R58 A;  2F5K A;  2DIG A;  2X4W A;  3OYI A;  2GFU A;  3LX7 A;  3QKJ A;  4C5E A;  5FRM A;  3OMG A;  4ZTJ A;  2RI3 A;  2RJE A;  5KCO A;  1H3Z A;  3MEA A;  4RG2 A;  4UC4 A;  2EQM A;  5C0M A;  3OYK A;  3FEO A;  3OYJ A;  3OYD A;  2K3Y A;  3S3M A;  4E7L A;  5IAY A;  2P0K A;  2LVM A;  5FRN A;  2NLU A;  1OI1 A;  2HQX A;  3MET A; 
#chains in the Genus database with same CATH topology
 4PJO C;  4BD3 A;  3CCR A;  2CUB A;  1YIT T;  4JRP A;  4J9D A;  1Q86 R;  1QVF A;  4LDX A;  4PJO E;  1WQ7 A;  3EAE A;  1ZA1 B;  5IHI A;  1UHF A;  1GCQ C;  2L89 A;  2K5I A;  2E65 A;  3OS1 A;  2V8J A;  2LQK A;  3VS6 A;  2PVG B;  5CQY A;  2WSC E;  3EH1 A;  1IHV A;  4XU0 A;  2K7A A;  1HSQ A;  4M7A C;  4F7U B;  1QP3 A;  4CC2 A;  1WA7 A;  4DA4 A;  3M4G A;  2DNU A;  2K2M A;  2HL3 A;  1AOJ A;  2R57 A;  2KT8 A;  3G1J A;  2JW4 A;  2E6N A;  1QKX A;  1RI9 A;  2LC4 A;  1MMN A;  4D6W A;  2OI3 A;  2DRM A;  3OYH A;  4FW2 A;  1IRX A;  1ZUY A;  2CDT A;  5LJ3 f;  4RTW A;  1PSF A;  2D8H A;  2YDL A;  3OW2 A;  1PNJ A;  4K11 A;  2VB6 A;  3MO8 A;  1X43 A;  1M9S A;  5KH6 A;  3ULR B;  3EG9 B;  4PJO D;  2LT1 A;  2A7Y A;  2MPX C;  4BE1 A;  1TUC A;  3CCL A;  3CPW S;  3RNJ A;  3GP8 A;  4L5G A;  1GRI A;  4MZM A;  2CSI A;  1RAF B;  1AWJ A;  1V29 B;  4J9C A;  4J6Y A;  2DEQ A;  4M7A D;  5FLX E;  2AK5 A;  2ENM A;  5I21 A;  3RKX A;  3CCV A;  5IT9 E;  4ZTJ A;  1H3Z A;  2DFU A;  3A8O B;  1NJI C;  4LUD A;  5CKD A;  1UE9 A;  3JCM W;  2E1H A;  1XOV A;  4J8O A;  2NWM A;  1M1K C;  2CZ0 B;  2GF7 A;  2COW A;  1K73 C;  1M90 C;  5GAN 6;  2CZ1 B;  3EGX A;  5KCH A;  3MKD A;  2GQV A;  1E7O A;  3HRU A;  4B6M A;  2CP3 A;  4AFQ C;  1K0X A;  2CSQ A;  2DF6 A;  2EYW A;  2RMO A;  1G8X A;  3OYG A;  2PNI A;  2DXU A;  3NTK A;  3I5R A;  1LPL A;  2DET A;  1YHQ A;  4PNO A;  2L8D A;  4WCI A;  1UEC A;  2RQU A;  4DBH A;  1JXM A;  5LJ5 j;  3WVE B;  5KYW A;  1KQ2 A;  3OYL A;  4C5H A;  3UDC A;  1VQ5 Q;  5GAN h;  2ZPB B;  1VOM A;  3D7S B;  1VQM A;  1UGS B;  3CMA Q;  2DK3 A;  1W2B S;  3UF4 A;  2OJ2 A;  3X28 B;  4R56 A;  4AT1 B;  4M75 F;  2RF0 A;  1ACM B;  4C92 D;  1NJI U;  1VA7 A;  2XDD A;  2HCK A;  1EIF A;  3VV0 A;  2KRO A;  2JM8 A;  1M1K U;  1M90 U;  4XTV A;  4AG1 C;  4F7U A;  1M1G A;  4C92 B;  1KQS S;  1PKT A;  3VS2 A;  1E6H A;  3O8V A;  3EHQ A;  2X3W D;  1IRE B;  2DBK A;  5CCA A;  5FWB A;  1VQP Q;  4M78 B;  2QGG A;  5GAN f;  2M0O A;  1ABQ A;  1WX6 A;  1E6G A;  2JJ9 A;  2DYB A;  2DIL A;  1B3Q A;  3EGU A;  3OYJ A;  1I1J A;  1HJD A;  2DM1 A;  5DM7 R;  3S3N A;  5IHN A;  2PVO B;  2QTV A;  2J7I A;  3EG1 A;  5CQX A;  3CEY A;  1GL5 A;  4RUG A;  3CPW A;  3EG9 A;  1TOV A;  1NM7 A;  3TU4 K;  1TG0 A;  1AWW A;  2ZPG B;  2L3R A;  3EGD B;  1TUD A;  1PD1 A;  4PL6 A;  5GAN g;  3H0F A;  3PIO A;  1ZHI A;  1BCO A;  1X2K A;  2K4Y A;  4LDW A;  1R0B G;  4OMN A;  3QWY A;  4CC3 A;  1ZUU A;  2EAY A;  1VQO Q;  2M51 A;  1Q86 U;  1D1C A;  4V2S A;  2KRM A;  4II1 A;  1IHW A;  2I2L A;  2QG9 B;  5A0D A;  3CCR T;  2DTO A;  2VYT A;  3G71 A;  2A0F B;  5I2M A;  5GAM j;  2OTL A;  2OTJ A;  4O6J A;  1I81 A;  2F5T X;  2WSE E;  3UWN A;  1FMW A;  1WJQ A;  4KBM B;  1X01 A;  2D1X A;  3E9F A;  3RR6 A;  2VAS A;  1NLP C;  1ZBX A;  5LJ5 d;  2PQW A;  4EIK A;  1XQH A;  4QT7 A;  2HKN A;  2HBP A;  3M55 A;  2YRD A;  2O9S A;  3MPU B;  3FLG A;  1YJN Q;  1G3T A;  1NE8 A;  1BI1 A;  1FWZ A;  1U1T A;  2QAS A;  1EX4 A;  2RJC A;  4N4H A;  4M4Z A;  4FCY A;  3CCQ Q;  1Y57 A;  3JCM c;  3Q1J A;  4JJN K;  1DJ7 B;  1C0M A;  4HA8 A;  3RES A;  3HFO A;  1GXI E;  2EYZ A;  4HCC A;  3CD6 T;  2GBQ A;  2CZ7 B;  1W2B A;  3A5Z B;  1JO8 A;  4FIB A;  1FMK A;  3HFN A;  1U5S A;  2BZY A;  4ORZ A;  4UC4 A;  1C6V X;  3OYK A;  3CCS A;  4C0D B;  3UA7 A;  2HEQ A;  2LVM A;  4XU1 A;  4IKF A;  2M02 A;  1G3S A;  2EYX A;  1M2V B;  2GGR A;  2MF2 A;  4XTY A;  3ZEH A;  2DD4 A;  3QWX X;  2FL7 A;  1SHG A;  3CCL T;  1KQS A;  3QUI A;  1MUZ A;  4ESR A;  1RI0 A;  1EFN A;  3OQ5 A;  3BDU A;  1O75 A;  1SSH A;  2KE9 A;  2DAQ A;  4C92 A;  4Z02 A;  4R55 A;  1RLP C;  4J6X A;  3L2Z A;  2IPO B;  1I4K 1;  4XU2 A;  2K79 A;  3CXC S;  4C5G A;  1BIA A;  3A8G B;  4M77 D;  3I9Q A;  1TUG B;  1M1F A;  3E1S A;  3CME A;  1QMC A;  4M78 A;  3CCV T;  1GFC A;  3JB9 G;  1P92 A;  2D6F A;  4M7D B;  2HL5 C;  2CT3 A;  2O31 A;  4IUQ A;  2KNB B;  4Z8A A;  4OP0 A;  1UFF A;  1RAD B;  2FPE A;  4M77 B;  4NS5 A;  2BKD N;  2QEX A;  1KG1 A;  1M3B A;  4B9W A;  4JLG A;  1NEG A;  2KY9 A;  3JB9 D;  2RQW A;  3M57 A;  2XKO C;  1I07 A;  2QGF B;  3X26 B;  5L8R E;  5LJ3 d;  1V76 A;  3R6O A;  3CCM Q;  3EGD A;  3QG1 A;  4A4E A;  5CKB A;  4JZ3 A;  2D0N A;  1XNI A;  5J3B A;  2DJZ A;  2QQS A;  2PU9 B;  1YHQ T;  2V1R A;  3MEV A;  3QJ6 A;  2E12 A;  4ZNX A;  2J6K A;  1WHH A;  1U3O A;  2CYZ B;  4PFO A;  3LLR A;  1PD0 A;  3HKS A;  3MEU A;  1M8M A;  2HAX A;  2LT4 A;  3VKI A;  5GAN 8;  3GNF B;  1ZSZ B;  1VQM T;  4F16 A;  3CBM A;  1WFW A;  1BK2 A;  1R8O B;  4X9D A;  3CCJ T;  3G7Z A;  5GAN e;  3CCE T;  4EMH A;  5KYX B;  3JCM V;  3OYD A;  2MYS A;  8ATC B;  1X6G A;  4ELZ C;  1NPR A;  2C0T A;  2DZ9 A;  4HCZ A;  2AHJ B;  4Q5W A;  4C8Q D;  4LE9 A;  1N6A A;  2AKK A;  2YRC A;  5GAN 7;  4KH0 B;  2DL8 A;  5HCK A;  2ZPH B;  3QZ5 B;  1YNZ A;  2X4Y A;  4DEX A;  2X4J A;  4A63 B;  4JLI A;  4C8Q B;  3VS1 A;  2H8H A;  1RAH B;  3LGL A;  4QVD A;  3JCM J;  4A4H A;  2LZ6 B;  1TH7 A;  4OB1 B;  1SF9 A;  1RAB B;  4RTV A;  2KVQ G;  1KK7 A;  2MCN A;  1X27 A;  1Y07 A;  5GAN 2;  2DTH A;  3OS0 A;  3SWN C;  1GBQ A;  1B7T A;  2CGH A;  4EMK C;  1K4U S;  2RB6 A;  1QP2 A;  2KK4 A;  4OGC A;  1M2V A;  2EKO A;  2L3P A;  2RD1 A;  5IN1 A;  1VQN A;  2H3J A;  1X75 C;  1N9S A;  2PUK B;  3LWI A;  3SB2 A;  5L23 A;  2V1Q A;  1T0H A;  2DXB A;  3E19 A;  3CXC A;  2L0A A;  5EC7 A;  4NL3 A;  2WSF E;  3VRZ A;  5LJ5 f;  2QA4 A;  1K73 R;  5FWC A;  3KBG A;  3SD4 A;  3JB9 J;  1WI7 A;  4ATO A;  2XI9 A;  3AT1 B;  1ABO A;  1UGR B;  4M7D A;  3G71 T;  2K5L A;  2OTL T;  2OTJ T;  1S1N A;  3GNG A;  4FYX B;  4RKU E;  4KUL A;  3BFM A;  3QO3 A;  4FL6 A;  2EYQ A;  2O88 A;  4M77 A;  3G4S T;  4LDY A;  3E2U A;  2GFU A;  1Z9Z A;  3M5A A;  2CT4 A;  3JB9 H;  4YTL A;  1RAE B;  5GAO m;  4HCK A;  3QHS A;  2QAZ A;  1Q7Y C;  3L2W A;  1VYV A;  4XTX A;  5GMK j;  2LCL A;  1WPY A;  4Z89 A;  1RUW A;  1HYO A;  1YJ9 A;  4GBQ A;  3GBQ A;  5CKH A;  2DVE A;  2HD0 A;  4QQ6 A;  1HXD A;  4JJC A;  5LJ3 h;  3I55 A;  1YI2 A;  1BBZ A;  1MMG A;  3CCR Q;  1ZSZ A;  4OGE A;  2RQV A;  3I35 A;  4BI4 A;  4F7U F;  4HT9 A;  3NGP A;  5GAO l;  1QWF A;  1ZQ1 A;  3FDR A;  5KYX A;  4F7U G;  4KH1 B;  2D9T A;  2HDA A;  2K9G A;  4OMQ A;  3PFS A;  1WHL A;  3A8M B;  1BI3 A;  3CBO A;  4BY6 B;  1FX7 A;  3M0U A;  2DMO A;  3ME9 A;  3OS2 A;  2DRK A;  5D6W A;  2LJ1 A;  1D1B A;  1I5L A;  2JS2 A;  2CP0 A;  4LNP A;  4RG8 A;  4A4K A;  4TVR A;  2DVJ A;  2HSE B;  2EJ9 A;  4X34 A;  4C8Q A;  2EGE A;  3M54 A;  3CD6 Q;  4C0G A;  3CC4 T;  2ZAE A;  3CME T;  2C0O A;  1M8V A;  2OAW A;  5GAM f;  5AT1 B;  3A8H B;  2AKL A;  2LP5 A;  3F70 A;  3NMZ C;  2RHU A;  1MV3 A;  2ZPI B;  2QEX T;  4E6R A;  4C0Z A;  1WJR A;  2DA9 A;  2EQI A;  2KAF A;  2X4W A;  3OYI A;  4R0K A;  2K3Y A;  1FXX A;  3NPF A;  4E7L A;  2KR3 A;  2J05 A;  3CCL Q;  2JS0 A;  2MOX A;  3CCM T;  2E6Z A;  1PC0 A;  1K0S A;  1RL2 A;  1N5Z A;  2HNI A;  8AT1 B;  4AFS C;  4F04 B;  5LJ3 g;  2K2V A;  3UT1 A;  4PJO B;  1NZ9 A;  3QBY A;  1I0C A;  4LDV A;  3HP9 A;  2B8A A;  2JTF A;  1OQK A;  2DZC A;  3U23 A;  1NG2 A;  3CC7 T;  1W1F A;  3OBY A;  1OZ3 A;  3CCV Q;  1OX9 A;  2BIV A;  3TQ7 P;  2K6D A;  1KFZ A;  2BUD A;  4BE0 A;  2ESW A;  4M7A B;  3HHT B;  2GTJ A;  3HRT A;  2CH4 W;  1MMD A;  2FVU A;  3VS7 A;  3SDZ A;  1LVK A;  2X51 A;  4ZGE B;  1SSF A;  2J6F A;  4GY5 A;  4M75 C;  2FRY A;  4MML A;  2LJ0 A;  2P4T A;  1PG5 B;  2MWP A;  4M75 E;  3OMC A;  1GCP A;  1S72 T;  2K3X A;  3MCA B;  1RAA B;  1YHQ Q;  3BDL A;  5ECA A;  3H0I A;  2W0Z A;  4JUV A;  2MAM A;  3A98 A;  3NTI A;  1QQJ A;  4DBQ A;  1SKU B;  4J9G A;  4JDS A;  2EVR A;  2CUD A;  3RKW A;  1VQM Q;  1CKA A;  2QDL A;  3DKM A;  3EFO B;  3JCM f;  1YN8 A;  2L5Q A;  2RI5 A;  1TXQ A;  1YCY A;  3FB9 A;  3CCJ Q;  4QW2 A;  1KIK A;  2P84 A;  4LUE A;  3CCE Q;  2VGN A;  3HPW A;  1OU8 A;  3I56 A;  2CP6 A;  3C95 A;  3LGF A;  2RO0 A;  1VQ5 A;  2EGA A;  1SEM A;  3O5Z A;  4JJB A;  4HXJ A;  3V7R A;  4M75 G;  1UJY A;  1G83 A;  3LX7 A;  2YXY A;  1WXU A;  4M78 F;  4RG2 A;  1N9R A;  1PWT A;  2V8K A;  2Z0W A;  1K73 U;  4OMM A;  1OI1 A;  2PVD B;  4M78 G;  2RN8 A;  1XJW B;  2RHZ A;  1UGV A;  1W70 A;  3H9N A;  4M75 D;  1SRL A;  1VUB A;  4IIM A;  2F1L A;  3EHR A;  3OBW A;  1I8F A;  4FSX A;  4IUP A;  1U1S A;  4AFU C;  2VV5 A;  1ZUK A;  4VUB A;  4WF2 A;  3RMS A;  3M0T A;  5HKC A;  2GCX A;  4CC7 A;  4JJD A;  1UUE A;  3EH2 A;  3JCM b;  1QCN A;  2COZ A;  2YUN A;  4CRI A;  2M16 A;  1YIJ T;  3H41 A;  3M59 A;  1X2Q A;  4E7J A;  2JOY A;  4E7S A;  3LYI A;  4FSS A;  2E10 A;  1QW1 A;  2A36 A;  3TVT A;  4N4I A;  3OY9 A;  1TS9 A;  3DLL A;  4N0A C;  2Y90 A;  1HK9 A;  4PJO A;  1QKW A;  2AZV A;  1VQK A;  1X69 A;  2F69 A;  4Y28 E;  1OOT A;  5J26 A;  3T9N A;  4OB3 B;  4KUD K;  1N27 A;  2O01 E;  4N4G A;  1VQ6 A;  2VC8 A;  3ASK A;  2PUO B;  1GCQ A;  3I55 T;  2EBP A;  1YI2 T;  2KBT A;  3GLX A;  3G71 Q;  4E7Z A;  2OTL Q;  2OTJ Q;  3P8H A;  5CVI A;  5A0L A;  3M0P A;  3G4S Q;  4M7A A;  1Y71 A;  5LJ3 e;  3TSZ A;  2GFA A;  5DY9 A;  2CP5 A;  1LJO A;  2XIC A;  2LX9 A;  1VQ9 A;  3PMI A;  3PNW C;  5D6Y A;  4PLL A;  3CCU A;  2XID A;  3MP6 A;  1NPP A;  2ZPE B;  3J81 E;  4A53 A;  1JJ2 P;  3UA6 A;  3EG0 A;  3S3M A;  2P0K A;  4PFZ A;  1Q95 G;  2V26 A;  1QWE A;  5IH2 A;  1VYT A;  5FU6 C;  1YFN A;  3CC2 A;  2HBW A;  4X1V A;  1WIE A;  4FYW B;  4IIO A;  5I11 A;  1T3L A;  1YWP A;  1NYG A;  4EPC A;  2DL5 A;  2FYK A;  4M7D E;  3VJP A;  1HD3 A;  5KE3 A;  2FO0 A;  3EFO A;  3REA B;  2HQE A;  4BI8 B;  3QYG B;  3OYF A;  3G6E A;  2MI6 A;  2QI2 A;  4PFP A;  1BU1 A;  2CZ6 B;  1ZBJ A;  4J83 A;  2YT6 A;  3GPL A;  2EYY A;  2CS7 A;  4OVA A;  5HK3 A;  2NUP B;  1X6B A;  1YIT A;  3L2U A;  1WQW A;  4PJJ A;  3GIB A;  1VQ8 A;  4M7D F;  5M9O A;  2D8J A;  2KI7 A;  1MND A;  1QVG P;  2ZCF B;  5FW9 A;  2L3Q A;  3MP8 A;  3MEW A;  4M7D G;  2X3X D;  1RLQ C;  4PK4 A;  2DPP B;  3CC4 Q;  2QQB A;  3CME Q;  1TSF A;  5CR2 A;  3TCJ A;  2EQU A;  4D8D A;  2JM9 A;  3C4S A;  1WZO A;  1Q7Y R;  1NLO C;  3OS5 A;  1KQS P;  4RCC A;  5GJW B;  1CKB A;  2QEX Q;  2XDB A;  1K9M R;  1JQQ A;  2BE9 B;  2YRV A;  2JUF A;  5DLQ E;  1AVZ C;  3KUF A;  4RTX A;  1OPK A;  4PKC C;  2EFI A;  2L2P A;  2FB7 A;  1IXD A;  1WGS A;  2IVW A;  3PTA A;  2RHX A;  5GAM d;  2DYI A;  1YJW A;  3OSS C;  4HVU A;  1Q81 R;  3HSB A;  5C0M A;  1VQ4 A;  3CQT A;  3THK A;  2NYS A;  3RDV A;  1C1A A;  3CC7 Q;  3QXE B;  1VQ7 A;  1RAI B;  1AZG B;  2VUB A;  4IUR A;  2RQT A;  4WTO B;  4F14 A;  2QK0 A;  2E5Q A;  2ZGW A;  2LMJ A;  2RA2 A;  4C5I A;  4LD6 A;  4OMF B;  3I56 T;  4J9I A;  2ABL A;  2OX7 A;  2LRQ A;  2CP7 A;  4DOV A;  1H92 A;  1QLY A;  2CKK A;  3REB B;  4OML A;  2XMF A;  3X25 B;  1K8A R;  1XTD A;  3LWH A;  4FU6 A;  2KSS A;  3PVL A;  1S72 Q;  2MWO A;  4IUV A;  2AT1 B;  4XQ3 A;  5LJ5 h;  4OMO A;  5GAO n;  1VYU A;  2G6F X;  5GMK m;  2E41 A;  2KRS A;  3V7S A;  3J80 E;  3RUX A;  2J06 A;  3QSU A;  5FU7 C;  4LDU A;  5D6X A;  4EDU A;  1I5O B;  4HCB A;  2FPD A;  2KDS A;  3JB9 I;  4FYY B;  3S6W A;  2QXF A;  3L2Q A;  2LTO A;  1Z9Q A;  1N8R C;  3QPH A;  4QVC A;  3AHU A;  3SFM A;  4QQG A;  2NUP A;  1VQN Q;  1OYX A;  2KQW A;  3V7C A;  4RMO A;  2DD5 A;  4F17 A;  3JCM d;  3PIP A;  1PHT A;  2VVK A;  1GBR A;  1NEB A;  1QCO A;  2RHI A;  1MGQ A;  5D7U A;  3EG3 A;  5FRM A;  1ZSG A;  1M4Z A;  1VQK T;  2QA4 Q;  3X24 B;  3MJX A;  1J3T A;  3VYH B;  2QTX A;  1ZA2 B;  4Z88 A;  1VQ6 T;  2DJQ A;  4O5V A;  2VKN A;  3NHN A;  1JBM A;  3M53 A;  3OSV A;  4MMK A;  3ER0 A;  2J6O A;  1IGQ A;  1B34 B;  4FT2 A;  4OB2 B;  1PM3 A;  3OYY A;  4NL2 A;  6AT1 B;  2FRW A;  2A37 A;  1YIJ Q;  3M58 A;  5DLO A;  2BZX A;  3ZFJ A;  3L2R A;  3OYA A;  1BB9 A;  3CCU T;  2LQW A;  3H6Z A;  1Q82 R;  5LJ5 g;  2LJ3 A;  2IIM A;  4J7I A;  4RTZ A;  4F7U E;  4RTY A;  1JU5 C;  2ATC B;  3A8L B;  4IUT A;  3VU3 C;  1K9M C;  3H8Z A;  1BKB A;  4KRT A;  1VIF A;  1M3C A;  3NTH A;  4ANJ A;  3DLM A;  2KT1 A;  1CSK A;  1MNE A;  3CC2 T;  3SWN B;  4ZN3 A;  2LX7 A;  4EMK B;  4AMC A;  2XDP A;  2GQI A;  2FPF A;  3ZBD A;  5IXB A;  4DBF A;  3FJP A;  2QQA A;  3I55 Q;  1YI2 Q;  1Q81 C;  2I0N A;  5GAM h;  1QCF A;  2HMA A;  3VS4 A;  4IUU A;  1VQL A;  3CCS T;  3G6E T;  5CKE A;  2EQJ A;  2EIF A;  2F2X A;  1M2O A;  1V1C A;  7AT1 B;  4KUI A;  1G3Y A;  4BI3 A;  1D0Z A;  4HKE A;  2BZ8 A;  2RJF A;  1NBE B;  2B86 A;  2ROT A;  2C06 A;  3R6N A;  3TEE A;  1ARK A;  1BCM A;  3VS3 A;  4MDX A;  1VQ8 T;  2XU8 A;  2RK2 A;  1AWO A;  1JRI A;  1PKS A;  1QVP A;  2G3R A;  4QVZ A;  2ECZ A;  1R0C B;  3M56 A;  4C5E A;  1TWB A;  5KCO A;  1QVF P;  5CAI A;  1Q7Y U;  2JTM A;  3M4Y A;  5A0G A;  2RPN A;  5IAY A;  1K8A C;  1UGP B;  1T0J A;  1UTI A;  3H0H A;  1K9M U;  3GOX A;  3VRY A;  2LDM A;  2DEU A;  4HVV A;  4XU3 A;  4A4G A;  4Y92 A;  2CP2 A;  4M7A E;  1OZ2 A;  3A1P A;  1U06 A;  3CD6 A;  2DL3 A;  3HRS A;  4PJO F;  4ZN1 A;  2EQK A;  4MZT A;  4FW1 A;  2YUQ A;  3BY7 A;  2YLC A;  4MDW A;  3OYE A;  1Q81 U;  1TU0 B;  4PJO G;  3JAM E;  2DIQ A;  1OX8 A;  4LXC A;  1YJW T;  5HY6 A;  5I22 A;  1VQ4 T;  5GAM g;  2KRN A;  3QZ9 B;  4M7A F;  3QDF A;  3OW2 P;  1Y96 B;  5IXF A;  2D0Q B;  2DTI A;  1WLP B;  2DX1 A;  4M7A G;  1VQ7 T;  1EZZ B;  2VXF A;  1K9A A;  3CPF A;  4ELY C;  3JCM h;  2AZS A;  4FT4 A;  1WHK A;  1B34 A;  5KYU B;  3M9Q A;  3IQL A;  1K8A U;  3VS0 A;  2FEI A;  2K5F A;  4C92 C;  3QDR B;  1JJ2 S;  5GAN 5;  2YUO A;  1WHJ A;  4C92 E;  1OU9 A;  5FRO A;  4M78 C;  3RKY A;  2DXC A;  3E9G A;  1GFD A;  4HVW A;  4J9B A;  4M78 E;  3SWN A;  1Q82 C;  2E3I A;  4EMK A;  1M27 C;  1UB4 A;  2KXC A;  2OAU A;  5LJ5 e;  2ED0 A;  2NLU A;  5FRN A;  2LCS A;  2E3H A;  1Y0M A;  3OYM A;  1UG1 A;  2NUT B;  1UGQ B;  1D1A A;  2QQ9 A;  4C92 F;  1OEB A;  3FRN A;  3I56 Q;  3QYH B;  1SG5 A;  2F2V A;  2H3E B;  4DEY A;  4C92 G;  1AD5 A;  4Y91 A;  3P8B B;  3CMA A;  1BYM A;  3URG A;  1VQN T;  1AHJ B;  4C0F A;  1M3A A;  5KYY B;  2A3L A;  3CCJ A;  3VUB A;  5C6S A;  2VXE A;  1QVG S;  3JCM X;  4XK8 E;  3CCE A;  3LH0 A;  2K3B A;  2FHD A;  1AWX A;  2P0Q A;  4CC4 B;  3I5S A;  5CIU A;  2LQ8 A;  3RER A;  4JRQ A;  3JCM g;  4KT0 E;  4FYV B;  4J6W A;  2QA4 T;  3MP1 A;  1IZ6 A;  3VS5 A;  3VUZ A;  1B07 A;  2M9U A;  2X4X A;  2CRE A;  4KGZ B;  4QQD A;  4DOW A;  4M78 D;  1Q86 C;  1JEG A;  1H8K A;  1KJW A;  1ZX6 A;  4LD9 K;  2EPD A;  2R5A A;  4M75 B;  3HTR A;  4P5N A;  4JRI A;  3QII A;  3WXM B;  2DXT A;  2COY A;  1Q82 U;  2FZC B;  1WNL A;  5GAN 4;  4E7I A;  2F2W A;  3LH5 A;  1G5V A;  1VQP A;  2V8I A;  2XG8 D;  5GMK i;  1K76 A;  1FMV A;  2HZY A;  1U8R A;  2HKQ B;  2JMC A;  2RJD A;  2SEM A;  2NUZ A;  3C12 A;  1WJS A;  4J9E A;  2M1H A;  4PJM A;  3RMQ A;  2LQN A;  4OMP A;  2DL4 A;  2IG0 A;  2Y4X A;  1LOJ A;  1VQK Q;  1YJ9 T;  1Y96 A;  4E47 A;  9ATC B;  3SHW A;  1VQ6 Q;  1OPL A;  4C0D C;  2RK1 A;  2RI3 A;  2RJE A;  3CPW P;  3FEO A;  2JT4 A;  1D09 B;  4ME7 A;  2EJG A;  1VQL T;  2FG0 A;  1SPK A;  5KYU A;  1VQO A;  4PJN A;  1JJ2 A;  4PJL A;  4XAX B;  5GAM e;  5CK9 A;  2EGC A;  4XTW A;  1VQ9 Q;  5IHK A;  2KXD A;  4OF1 A;  2JZ2 A;  5A2Q E;  3CCU Q;  3HL8 A;  5LJ3 j;  1IB8 A;  3EFR A;  1IO6 A;  1YBY A;  4ZTF A;  4J9F A;  3OYB A;  1D3B B;  1H64 1;  1A0N B;  3OYN A;  4JRK A;  1X6O A;  2DBM A;  3G4S A;  5GMK h;  2LNH B;  3PE0 A;  3M0S A;  2BTT A;  3CC2 Q;  4M7D C;  3FIF A;  1WYX A;  3RIR A;  5GAN 3;  4A4F A;  1KC8 R;  5KYN A;  2X35 A;  1N8R R;  1YJN A;  1LCK A;  1M30 A;  4M77 C;  4RTT A;  3PT9 A;  1BIB A;  5CO7 A;  3ZL7 C;  3CCQ A;  1BI0 A;  2YHT A;  2Y4Y A;  1UJ0 A;  4M77 E;  3OA6 A;  3CCS Q;  3G6E Q;  2NUT A;  2LCC A;  3VYG A;  3EFS A;  4J7F A;  4BUG A;  2ROL A;  5I2S A;  4JS5 A;  2DO3 A;  2EWN A;  4AG2 C;  4FM4 B;  1KD1 R;  3X20 B;  1G2B A;  1QVG A;  2FZK B;  1NYF A;  2DE0 X;  1YIT Q;  4CI0 C;  3P8D A;  2MMP A;  1PSE A;  1UHC A;  2WAC A;  5KYY A;  4QKU A;  3GF5 A;  1W2B P;  2QYZ A;  4D8K A;  1VQ8 Q;  2RI2 A;  2W10 A;  5KE2 A;  1KHI A;  2YUP A;  3UPU A;  4M77 F;  1KSW A;  1ZSZ C;  2ZPF B;  1KQ1 A;  3V8J A;  3KXT A;  1PCX A;  1RAG B;  1SRM A;  2DL7 A;  4M77 G;  1ZLM A;  2VGM A;  4A54 A;  2DER A;  1IGU A;  3TRE A;  2RH2 A;  3FJ5 A;  3QKJ A;  4M75 A;  2YWW A;  2EQM A;  3BW1 A;  4M7D D;  1MV0 B;  2YSQ A;  4AFZ C;  4E7K A;  2KEA A;  3JB9 F;  2O4X B;  3INZ A;  3CC4 A;  3JCM e;  5FU6 B;  2DLP A;  3V8K A;  3DB4 A;  1AEY A;  4LN2 A;  3L2V A;  1MHN A;  2GTO A;  2E70 A;  4C8Q C;  2AIR B;  1YJW Q;  4J5Y A;  4E7H A;  1K1Z A;  3M0R A;  1VQ4 Q;  2QDY B;  2RHY A;  2O2O A;  1H3H A;  1D0Y A;  4C8Q E;  4OB0 B;  3N5B B;  4XTU A;  2PTK A;  3MHX A;  5AYF A;  2P0P A;  3CCM A;  1VQ7 Q;  5GJV B;  4GLK A;  3EG2 A;  4JPB W;  4ZGD B;  1T3S A;  1Y7X A;  2R5M A;  5EG2 A;  4EMG A;  2HQH A;  2YLB A;  3L1A A;  4PLI A;  5GAO p;  3CC7 A;  4GLM A;  5CKF A;  1VQ5 T;  2EW3 A;  2KYB A;  3L42 A;  5GAN j;  4HT8 A;  3OB9 A;  4C8Q F;  4RCB A;  1WHM A;  4JS4 A;  3CMA T;  5GAO q;  2LNV A;  5J39 A;  4C8Q G;  3JSC A;  2EKH A;  2XHC A;  1D3B A;  2MIO A;  4L59 A;  1WDX A;  1QVF S;  1F1B B;  2X9H A;  4BAC A;  3JV3 A;  3PVQ A;  1UEB A;  5HK0 A;  2JN0 A;  3JRZ A;  2KGT A;  1R77 A;  1WXT A;  4DQ2 A;  3NFC A;  5GAO r;  1S72 A;  4J9H A;  3UAT A;  4B9X A;  3J7A F;  1AZE A;  4X9C A;  2F5K A;  1TTH B;  4KGX B;  1YWO A;  3OMG A;  3WVD B;  2JXB A;  4DBR A;  1D0X A;  3MEA A;  2ED1 A;  3LW5 E;  1KC8 C;  1VQP T;  2DIG A;  2HQX A;  4N0A A;  1KHC A;  3PGG A;  3C0C A;  2JTE A;  1MMA A;  5LL6 S;  2A08 A;  2JVV A;  3M0Q A;  2QQR A;  1SHF A;  3DB3 A;  3V8L A;  3TSW A;  5GMK l;  3JCM Q;  3OW2 S;  1O9S A;  3CBP A;  2RM4 A;  2HSP A;  1KD1 C;  2EJF A;  2E64 A;  2MK5 A;  4BB7 A;  2CH4 A;  4MZP A;  1AT1 B;  1W6X A;  1FYN A;  2L3S A;  2RNA A;  4BE2 A;  1NJI R;  2P4R A;  4E2F B;  3SEM A;  2FZG B;  4RTU A;  2KMT A;  1W4S A;  3S3O A;  1G3W A;  1YCS B;  2SRC A;  2C0I A;  1M1K R;  1VIE A;  4BY6 C;  4KGV B;  1M90 R;  1VQO T;  3CXC P;  2BE7 D;  2RQR A;  2O4X A;  3RBB B;  1OUL A;  3OYC A;  3JCM P;  1VQ9 T;  3FC3 A;  1PRL C;  2O9V A;  2XK0 A;  2M0Y A;  2PZ1 A;  2K57 A;  2DKG A;  2GNC A;  1YP5 A;  4JZ4 A;  3KFV A;  1KC8 U;  2E4H A;  1BI2 A;  1N8R U;  2JMA A;  1JB0 E;  3EGX B;  5FU7 B;  1JXO A;  1YIJ A;  4XTZ A;  4NOY A;  1WHG A;  1YJ9 Q;  5GAN d;  2KYM A;  3BE3 A;  1RAC B;  5GMK e;  1YJN T;  1LNX A;  2JNG A;  4ZGJ B;  1M5Q 1;  2XD0 A;  1WXB A;  3C94 A;  3PMT A;  3CCQ T;  4L6V 5;  4BDY A;  1KD1 U;  3QJY A;  4BDZ A;  1VQL Q;  5KYW B;  2R58 A;  2A28 A;  2E5K A;  2VWF A;  1PRM C;  2ZZD A;  1OV3 A;  1UDL A;  3MET A; 
#chains in the Genus database with same CATH homology
 1NPR A;  5FU6 C;  2DZ9 A;  4PJO C;  4BD3 A;  3CCR A;  3CC2 A;  3OYM A;  1YIT T;  4HCZ A;  4JRP A;  2AHJ B;  4Q5W A;  4C8Q D;  1UGQ B;  1N6A A;  5GAN 7;  2QQ9 A;  4C92 F;  3FRN A;  1QVF A;  4LDX A;  2ZPH B;  4PJO E;  1WQ7 A;  3EAE A;  3QZ5 B;  3QYH B;  4EPC A;  2FYK A;  4C92 G;  4M7D E;  4Y91 A;  3VJP A;  2L89 A;  2X4Y A;  3P8B B;  2K5I A;  2E65 A;  2X4J A;  3OS1 A;  3CMA A;  5KE3 A;  1BYM A;  2V8J A;  3URG A;  2LQK A;  1VQN T;  4BI8 B;  2HQE A;  4JLI A;  1AHJ B;  4C8Q B;  4C0F A;  2PVG B;  3QYG B;  5CQY A;  3OYF A;  2WSC E;  3G6E A;  2A3L A;  2MI6 A;  2QI2 A;  3CCJ A;  3VUB A;  4XU0 A;  3LGL A;  4QVD A;  5C6S A;  2VXE A;  3JCM J;  1QVG S;  4M7A C;  4F7U B;  3JCM X;  4XK8 E;  3CCE A;  2CZ6 B;  1QP3 A;  3LH0 A;  4A4H A;  1TH7 A;  2FHD A;  4OB1 B;  4DA4 A;  2KVQ G;  2P0Q A;  3M4G A;  4J83 A;  5CIU A;  2LQ8 A;  3GPL A;  3RER A;  2R57 A;  4JRQ A;  2CS7 A;  3JCM g;  4OVA A;  4KT0 E;  5HK3 A;  4J6W A;  2QA4 T;  3MP1 A;  1Y07 A;  5GAN 2;  1IZ6 A;  2DTH A;  3OS0 A;  2E6N A;  1YIT A;  3VUZ A;  3SWN C;  2M9U A;  2X4X A;  2LC4 A;  1WQW A;  4QQD A;  2CGH A;  3L2U A;  4EMK C;  4DOW A;  4M78 D;  4D6W A;  1Q86 C;  3GIB A;  1VQ8 A;  4M7D F;  3OYH A;  2RB6 A;  5M9O A;  5LJ3 f;  4LD9 K;  2R5A A;  1QP2 A;  2KK4 A;  4M75 B;  4P5N A;  4OGC A;  2ZCF B;  1PSF A;  4JRI A;  3MP8 A;  3QII A;  3MEW A;  2DXT A;  3WXM B;  4M7D G;  2EKO A;  2RD1 A;  5IN1 A;  1VQ5 A;  1VQN A;  1Q82 U;  2H3J A;  1X75 C;  1WNL A;  5GAN 4;  4E7I A;  1N9S A;  2PUK B;  3OW2 A;  3LWI A;  3SB2 A;  2DPP B;  2QQB A;  1G5V A;  1VQP A;  2V8I A;  2XG8 D;  5CR2 A;  5GMK i;  3MO8 A;  3E19 A;  2DXB A;  3TCJ A;  3CXC A;  2EQU A;  1M9S A;  5KH6 A;  4PJO D;  2LT1 A;  4NL3 A;  2A7Y A;  2WSF E;  2RJD A;  1U8R A;  4BE1 A;  5LJ5 f;  3C4S A;  2QA4 A;  3OS5 A;  3C12 A;  3KBG A;  4RCC A;  3CCL A;  1WJS A;  2XDB A;  3SD4 A;  3CPW S;  3JB9 J;  2YRV A;  2JUF A;  3GP8 A;  2M1H A;  4L5G A;  5DLQ E;  4ATO A;  3RMQ A;  3KUF A;  4MZM A;  4PKC C;  2EFI A;  2XI9 A;  2IG0 A;  2Y4X A;  2FB7 A;  1LOJ A;  1WGS A;  2IVW A;  1UGR B;  1V29 B;  4M7D A;  3G71 T;  2K5L A;  2OTL T;  2OTJ T;  3PTA A;  1YJ9 T;  1Y96 A;  3GNG A;  4RKU E;  4J6Y A;  4E47 A;  4KUL A;  2RHX A;  3BFM A;  2DEQ A;  3QO3 A;  4FL6 A;  2EYQ A;  4M7A D;  4M77 A;  5FLX E;  5GAM d;  3G4S T;  1YJW A;  4LDY A;  4C0D C;  5I21 A;  2GFU A;  3RKX A;  3OSS C;  3CCV A;  5IT9 E;  2RK1 A;  2RI3 A;  2RJE A;  4ZTJ A;  3M5A A;  3A8O B;  1H3Z A;  3HSB A;  5C0M A;  3JB9 H;  3FEO A;  1VQ4 A;  4YTL A;  1NJI C;  5CKD A;  4ME7 A;  2EJG A;  3JCM W;  5GAO m;  1VQL T;  2E1H A;  1XOV A;  4J8O A;  1VQO A;  3QHS A;  3QXE B;  1Q7Y C;  2CZ0 B;  1M1K C;  2GF7 A;  1JJ2 A;  1K73 C;  1M90 C;  1VQ7 A;  4XAX B;  5GAM e;  5CK9 A;  4XTW A;  3L2W A;  5GAN 6;  2VUB A;  4IUR A;  2CZ1 B;  4OF1 A;  2JZ2 A;  4XTX A;  5KCH A;  5A2Q E;  5GMK j;  3HL8 A;  2GQV A;  5LJ3 j;  2LCL A;  1WPY A;  3HRU A;  3EFR A;  1YBY A;  4ZTF A;  2E5Q A;  2ZGW A;  1YJ9 A;  5CKH A;  3OYB A;  2DVE A;  2RA2 A;  4C5I A;  1D3B B;  1H64 1;  2HD0 A;  4QQ6 A;  1HXD A;  4JRK A;  1X6O A;  4LD6 A;  4OMF B;  3OYN A;  3I56 T;  3OYG A;  3G4S A;  2LRQ A;  2DXU A;  3NTK A;  4DOV A;  5GMK h;  5LJ3 h;  3I55 A;  1YI2 A;  2CKK A;  1YHQ A;  4PNO A;  2L8D A;  4OGE A;  4M7D C;  3FIF A;  3RIR A;  3X25 B;  5GAN 3;  4BI4 A;  4A4F A;  4F7U F;  5LJ5 j;  4HT9 A;  1XTD A;  3WVE B;  1KQ2 A;  2X35 A;  3OYL A;  3LWH A;  1YJN A;  4C5H A;  4FU6 A;  3UDC A;  4M77 C;  2KSS A;  5GAO l;  1ZQ1 A;  3FDR A;  4F7U G;  5GAN h;  2ZPB B;  2MWO A;  1BIB A;  3PT9 A;  5CO7 A;  2D9T A;  3CCQ A;  4IUV A;  1VQM A;  1BI0 A;  1UGS B;  2YHT A;  2DK3 A;  3PFS A;  2Y4Y A;  4XQ3 A;  4M77 E;  5LJ5 h;  3A8M B;  1BI3 A;  3CBO A;  4BY6 B;  3OA6 A;  1W2B S;  1FX7 A;  2LCC A;  3VYG A;  3EFS A;  4J7F A;  5GAO n;  3ME9 A;  3OS2 A;  3X28 B;  4BUG A;  5GMK m;  2E41 A;  5D6W A;  3V7S A;  4R56 A;  3J80 E;  5I2S A;  4PJO B;  4JS5 A;  2DO3 A;  4M75 F;  2EWN A;  1I5L A;  3RUX A;  4C92 D;  4RG8 A;  3QSU A;  4FM4 B;  1NJI U;  4A4K A;  5FU7 C;  4TVR A;  4LDU A;  5D6X A;  4EDU A;  2XDD A;  4HCB A;  3X20 B;  2KDS A;  1QVG A;  3JB9 I;  2EJ9 A;  1EIF A;  3VV0 A;  4CI0 C;  3P8D A;  4X34 A;  2MMP A;  1PSE A;  4C8Q A;  3M54 A;  2WAC A;  3S6W A;  2QXF A;  4C0G A;  1M1K U;  3GF5 A;  3CC4 T;  3L2Q A;  2LTO A;  3CME T;  1M90 U;  4XTV A;  4F7U A;  1N8R C;  1M1G A;  4C92 B;  2RI2 A;  5KE2 A;  1KHI A;  3QPH A;  1KQS S;  4QVC A;  1M8V A;  3UPU A;  5GAM f;  3AHU A;  4M77 F;  3SFM A;  2ZPF B;  3A8H B;  1KQ1 A;  4QQG A;  3V8J A;  3O8V A;  3KXT A;  1OYX A;  1IRE B;  2KQW A;  3F70 A;  2RHU A;  3V7C A;  4RMO A;  2ZPI B;  2DD5 A;  4M77 G;  5CCA A;  2VGM A;  2QEX T;  3JCM d;  3PIP A;  4M78 B;  4A54 A;  5GAN f;  4C0Z A;  2M0O A;  1WJR A;  2RHI A;  1MGQ A;  2KAF A;  2X4W A;  2RH2 A;  3TRE A;  3OYI A;  3QKJ A;  5FRM A;  1M4Z A;  4M75 A;  2EQM A;  3BW1 A;  4M7D D;  3OYJ A;  1VQK T;  2K3Y A;  1FXX A;  3X24 B;  4E7L A;  5DM7 R;  3S3N A;  3VYH B;  3CCM T;  4E7K A;  3JB9 F;  2O4X B;  2QTX A;  2E6Z A;  3INZ A;  3CC4 A;  1VQ6 T;  2PVO B;  1RL2 A;  3JCM e;  2HNI A;  4O5V A;  1JBM A;  3M53 A;  3OSV A;  5FU6 B;  2K2V A;  5CQX A;  3CEY A;  1NZ9 A;  3QBY A;  4MMK A;  3ER0 A;  3UT1 A;  5LJ3 g;  3V8K A;  3DB4 A;  3CPW A;  4LDV A;  3HP9 A;  1B34 B;  4FT2 A;  2B8A A;  2JTF A;  3TU4 K;  3L2V A;  4OB2 B;  2DZC A;  1MHN A;  2E70 A;  4C8Q C;  2ZPG B;  2L3R A;  3CC7 T;  3OYY A;  3OBY A;  4NL2 A;  1OZ3 A;  4J5Y A;  4PL6 A;  5GAN g;  4E7H A;  2BIV A;  3M58 A;  5DLO A;  2QDY B;  2RHY A;  3PIO A;  1ZHI A;  3ZFJ A;  4C8Q E;  2BUD A;  4OB0 B;  3N5B B;  4XTU A;  3OYA A;  3L2R A;  2K4Y A;  3H6Z A;  3CCU T;  4BE0 A;  5LJ5 g;  4LDW A;  3MHX A;  4J7I A;  4F7U E;  4M7A B;  2EAY A;  5AYF A;  2P0P A;  1Q86 U;  3A8L B;  3HHT B;  3CCM A;  4IUT A;  3VU3 C;  4V2S A;  3HRT A;  2FVU A;  4GLK A;  4ZGD B;  3SDZ A;  1K9M C;  3H8Z A;  1Y7X A;  2R5M A;  1BKB A;  1SSF A;  1VIF A;  4ZGE B;  3NTH A;  5EG2 A;  4II1 A;  2I2L A;  3DLM A;  4GY5 A;  3CCR T;  5A0D A;  2DTO A;  2VYT A;  4M75 C;  4EMG A;  3G71 A;  3CC2 T;  4MML A;  5I2M A;  3SWN B;  2YLB A;  5GAM j;  2OTL A;  2OTJ A;  3L1A A;  4ZN3 A;  4O6J A;  1I81 A;  2F5T X;  4PLI A;  2P4T A;  4EMK B;  2WSE E;  3UWN A;  2XDP A;  5GAO p;  1WJQ A;  4KBM B;  3CC7 A;  1X01 A;  3ZBD A;  3E9F A;  5CKF A;  1ZBX A;  2MWP A;  4M75 E;  1VQ5 T;  3OMC A;  5LJ5 d;  3FJP A;  2PQW A;  3L42 A;  5GAN j;  1S72 T;  2K3X A;  4HT8 A;  2QQA A;  3MCA B;  3OB9 A;  4C8Q F;  4RCB A;  1XQH A;  3BDL A;  1Q81 C;  5GAM h;  4JS4 A;  3CMA T;  5GAO q;  2LNV A;  2HBP A;  3M55 A;  4IUU A;  5J39 A;  1VQL A;  4C8Q G;  3CCS T;  3JSC A;  3FLG A;  3G6E T;  5CKE A;  2EQJ A;  1G3T A;  1NE8 A;  4JUV A;  2MAM A;  2EIF A;  1BI1 A;  1FWZ A;  1U1T A;  2XHC A;  3NTI A;  1D3B A;  4JDS A;  2RJC A;  4N4H A;  4L59 A;  3RKW A;  4KUI A;  1QVF S;  3JCM c;  1G3Y A;  3DKM A;  3Q1J A;  4BI3 A;  3JCM f;  4JJN K;  1DJ7 B;  2L5Q A;  4HA8 A;  2RI5 A;  3FB9 A;  1YCY A;  2RJF A;  4HKE A;  1UEB A;  3HFO A;  4QW2 A;  3RES A;  4BAC A;  5HK0 A;  2C06 A;  4HCC A;  1GXI E;  3TEE A;  2JN0 A;  3CD6 T;  2VGN A;  3HPW A;  3JRZ A;  3I56 A;  3C95 A;  2CZ7 B;  4MDX A;  1VQ8 T;  2XU8 A;  2RK2 A;  3LGF A;  2RO0 A;  1JRI A;  3NFC A;  4DQ2 A;  5GAO r;  1W2B A;  3A5Z B;  1S72 A;  1QVP A;  2G3R A;  4QVZ A;  3V7R A;  4M75 G;  4FIB A;  4B9X A;  3J7A F;  3M56 A;  4X9C A;  2F5K A;  3HFN A;  3LX7 A;  4C5E A;  3OMG A;  3WVD B;  5KCO A;  3MEA A;  4M78 F;  4RG2 A;  1N9R A;  4UC4 A;  5CAI A;  2V8K A;  3OYK A;  3CCS A;  1Q7Y U;  2JTM A;  3M4Y A;  3LW5 E;  4C0D B;  5A0G A;  5IAY A;  1K73 U;  1KC8 C;  1K8A C;  2LVM A;  1UGP B;  2DIG A;  2PVD B;  1OI1 A;  2HQX A;  4N0A A;  4XU1 A;  1VQP T;  1K9M U;  4M78 G;  4IKF A;  1KHC A;  3PGG A;  3GOX A;  2RHZ A;  1G3S A;  2LDM A;  5LL6 S;  4XU3 A;  2MF2 A;  4M75 D;  4XTY A;  4A4G A;  2JVV A;  3ZEH A;  1VUB A;  2DD4 A;  4M7A E;  3OBW A;  2FL7 A;  1OZ2 A;  1I8F A;  4FSX A;  2QQR A;  4IUP A;  3QUI A;  3CCL T;  1KQS A;  3DB3 A;  3CD6 A;  3HRS A;  4PJO F;  1RI0 A;  1U1S A;  3V8L A;  2EQK A;  2VV5 A;  3BDU A;  1O75 A;  3OQ5 A;  4ZN1 A;  4MZT A;  5GMK l;  4VUB A;  3JCM Q;  4WF2 A;  2DAQ A;  3RMS A;  3BY7 A;  3OW2 S;  1O9S A;  4C92 A;  4Z02 A;  2YLC A;  3CBP A;  4MDW A;  4R55 A;  2RM4 A;  3OYE A;  4PJO G;  1Q81 U;  5HKC A;  2GCX A;  3L2Z A;  4J6X A;  1KD1 C;  1I4K 1;  4XU2 A;  3CXC S;  2EJF A;  2E64 A;  3JAM E;  3JCM b;  4C5G A;  2DIQ A;  4BB7 A;  1BIA A;  3A8G B;  4MZP A;  4M77 D;  1M1F A;  3E1S A;  3CME A;  1YJW T;  4BE2 A;  4M78 A;  5HY6 A;  3CCV T;  4CRI A;  3JB9 G;  2M16 A;  1YIJ T;  1P92 A;  1VQ4 T;  2D6F A;  3M59 A;  4M7D B;  5GAM g;  2KMT A;  4E7J A;  3QZ9 B;  1W4S A;  2JOY A;  4IUQ A;  3S3O A;  1Y96 B;  3LYI A;  1G3W A;  4M7A F;  4OP0 A;  2D0Q B;  2DTI A;  2E10 A;  1QW1 A;  1VIE A;  4M77 B;  4BY6 C;  4NS5 A;  2BKD N;  2QEX A;  1VQO T;  4M7A G;  1KG1 A;  4B9W A;  4N4I A;  3OY9 A;  2O4X A;  3DLL A;  1VQ7 T;  4N0A C;  2Y90 A;  3OYC A;  3JCM P;  4JLG A;  1VQ9 T;  2VXF A;  3CPF A;  2KY9 A;  3FC3 A;  3JB9 D;  3M57 A;  1HK9 A;  4ELY C;  4PJO A;  3JCM h;  2XKO C;  2XK0 A;  1VQK A;  4FT4 A;  3X26 B;  4ELZ C;  2F69 A;  4Y28 E;  1B34 A;  2K57 A;  4OB3 B;  5J26 A;  5L8R E;  3T9N A;  2DKG A;  3M9Q A;  5LJ3 d;  4KUD K;  3R6O A;  1KC8 U;  1N27 A;  1K8A U;  2O01 E;  3QG1 A;  1BI2 A;  4N4G A;  4A4E A;  1N8R U;  1VQ6 A;  5CKB A;  2VC8 A;  3ASK A;  1JB0 E;  2PUO B;  2K5F A;  1XNI A;  5FU7 B;  5J3B A;  2DJZ A;  3I55 T;  1YIJ A;  4C92 C;  1YI2 T;  2QQS A;  2PU9 B;  1YHQ T;  3GLX A;  4XTZ A;  3QDR B;  1JJ2 S;  3MEV A;  4NOY A;  3P8H A;  5GAN d;  5GAN 5;  3QJ6 A;  5CVI A;  2E12 A;  5A0L A;  2CYZ B;  5GMK e;  1YJN T;  4M7A A;  1LNX A;  1Y71 A;  2JNG A;  4C92 E;  5LJ3 e;  5FRO A;  2GFA A;  3LLR A;  4ZGJ B;  1M5Q 1;  5DY9 A;  2XD0 A;  3HKS A;  3MEU A;  4M78 C;  2HAX A;  3RKY A;  2LT4 A;  1LJO A;  3VKI A;  2XIC A;  3GNF B;  2LX9 A;  3C94 A;  2DXC A;  5GAN 8;  3PMI A;  1VQ9 A;  3E9G A;  3PMT A;  3PNW C;  3CCQ T;  4L6V 5;  5D6Y A;  1VQM T;  4PLL A;  3CCU A;  2XID A;  4BDY A;  1KD1 U;  3MP6 A;  3QJY A;  4BDZ A;  3CBM A;  1NPP A;  2ZPE B;  3J81 E;  4M78 E;  1R8O B;  2R58 A;  4X9D A;  3SWN A;  3G7Z A;  4A53 A;  5GAN e;  3CCJ T;  1Q82 C;  4EMK A;  3CCE T;  4EMH A;  1UB4 A;  2ZZD A;  3JCM V;  3OYD A;  3S3M A;  2OAU A;  2P0K A;  5LJ5 e;  5FRN A;  2NLU A;  3MET A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...