3CCVQ

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2616a
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3ccvQ00
1YJWQ 3CCSQ 1JJ2P 1VQ5Q 1VQ7Q 1K9MR 1Q81R 3CPWP 3CXCP 1YHQQ 3I55Q 1YJNQ 3CMAQ 3CCJQ 1QVGP 3CC2Q 1QVFP 1YJ9Q 3CCVQ 1VQ8Q 3G71Q 1M1KR 3G6EQ 1VQKQ 1M90R 3CCRQ 1YI2Q 1Q7YR 2OTJQ 3CC4Q 3CCEQ 2QEXQ 1K73R 1YITQ 3CCMQ 1NJIR 1N8RR 1VQLQ 1K8AR 3I56Q 1YIJQ 3CCUQ 1KC8R 2OTLQ 1Q82R 3G4SQ 3CMEQ 3CC7Q 1Q86R 2QA4Q 1VQPQ 1VQ6Q 1KQSP 1W2BP 1KD1R 3CD6Q 1VQ9Q 3OW2P 3CCQQ 1VQOQ 1VQ4Q 1S72Q 1VQNQ 3CCLQ 1VQMQ
chains in the Genus database with same CATH superfamily
1VQ7A 3M54A 3RESA 1QKWA 3H0HA 1O75A 3EHRA 4M7DF 3HTRA 1ABQA 4BUGA 3OSVA 3CD6T 1KC8R 1I07A 4E7ZA 4M7AG 1LVKA 5I21A 3JB9J 2KYBA 2ROTA 4OMFB 1VQ7T 4J9BA 5LJ5h 1W2BA 3JCMQ 4F7UA 2FYKA 1OI1A 3QIIA 2YUPA 1WHJA 2KY9A 3OYGA 5ECAA 4BI4A 1OU8A 3CCVQ 1VQKA 1QVGA 1JU5C 2LT4A 3CBMA 4DOWA 4BB7A 5D7UA 1B7TA 2HDAA 4HVWA 2DTHA 1WIEA 1MV3A 1H3HA 1WJQA 2ESWA 3I35A 3EG9B 3T9NA 2FRYA 4JPBW 1VA7A 1U3OA 2JW4A 2HKQB 4PFPA 1TTHB 2SRCA 1OULA 2V8KA 1DJ7B 4RMOA 3NFCA 4J83A 1VQMA 3R6NA 4FW1A 1VQKT 4L59A 2MOXA 1M1KC 4HA8A 2MIOA 4EPCA 5GMKl 4WCIA 5CCAA 2C0OA 1X27A 1KD1U 2HL5C 1IO6A 4FSSA 3TSWA 3VYHB 1VQMT 4M78D 1JB0E 1AVZC 2X4WA 3H8ZA 1F1BB 1QP3A 3CBPA 4OVAA 4PLIA 4RCCA 4PJOF 3PIPA 2K5FA 2QQBA 3CC2A 2DBKA 3AHUA 1EIFA 1M2OA 4C8QD 4PJLA 1R0BG 2J7IA 1MGQA 2KDSA 1OZ2A 1D09B 4C5GA 3BY7A 2MAMA 3OA6A 1KQSS 2LJ3A 3LW5E 4N4IA 4E2FB 5GAMh 3SWNB 4M77D 2YT6A 4M78E 1OZ3A 2CDTA 3CC2T 1YJWQ 2KBTA 2EGCA 4MZMA 2EJFA 1OX8A 2OX7A 2DTOA 3G7ZA 1YJ9Q 3M0SA 2XU8A 4BE1A 4C92A 3NTIA 2V26A 2QASA 2QEXQ 1N8RC 1TUDA 4M7DB 3RIRA 2LX7A 4C8QE 2GCXA 1TG0A 4F14A 1WXUA 1JXOA 1OU9A 5L23A 2OAUA 2BE7D 3OS5A 2PU9B 5LJ5f 4HCKA 4MMLA 1K9MC 4CC7A 4CRIA 4M77E 4XTWA 2YLBA 3EG1A 5IXFA 3EG3A 3M9QA 3PNWC 2VASA 1MMGA 5FU7B 2JM9A 2COYA 1ZUKA 2XKOC 4NOYA 3OYIA 3ZBDA 2QGFB 2K3YA 2R58A 2L0AA 1SF9A 4JRKA 3NTKA 4JJCA 2DFUA 2NYSA 4J6YA 4C92C 5A2QE 1VIEA 2M16A 1YCSB 3OYKA 4PLLA 1K73U 1UFFA 4A4FA 2KQWA 5GANh 4XQ3A 3CC4A 1D0XA 1SRLA 2B8AA 4KULA 1I4K1 3VJPA 1JO8A 2MCNA 4BACA 3THKA 4KBMB 1NPRA 1YBYA 1KG1A 2DRMA 1UGVA 2E10A 2YDLA 3QZ9B 4JRPA 2E12A 2CUBA 3CC4T 2HMAA 3VRYA 4PJOB 3V8JA 4Y91A 1ZUYA 2RHUA 1GXIE 3R6OA 1Y07A 1ZSZB 2L3PA 2Z0WA 5I11A 4MZTA 4AFUC 2QQSA 5KYUB 2AKKA 2ZZDA 3CPFA 1Y71A 4ZTFA 2CH4A 2K2VA 2E6NA 1FX7A 1X43A 2JS0A 2DXCA 3BW1A 1G8XA 2LJ0A 1ABOA 1SKUB 5GMKi 4B9WA 3J81E 3EH2A 5CAIA 4IUTA 1PC0A 2CP2A 5KYWA 1UJ0A 2NUTB 3VS0A 1FMKA 1D3BA 2YRDA 1M8MA 3UA6A 1Q7YR 2KGTA 3JB9G 2X9HA 3QYGB 4FT4A 3TSZA 3LLRA 4E7HA 1UECA 3TCJA 1HD3A 2BE9B 3QDFA 3VUZA 4Q5WA 3OYEA 3JAME 3P8DA 3UA7A 1C0MA 3RKXA 2DPPB 1Y96B 4B9XA 2ZCFB 8AT1B 1RI0A 4M75D 3M0RA 2I0NA 2CREA 2JMCA 1YI2A 2F5KA 2F69A 2BZYA 4JDSA 5GANf 3A8GB 1MMNA 1W1FA 2CS7A 1ZA2B 2L3SA 1M1FA 4DOVA 4JS4A 1Q86R 1QVPA 2VXEA 1ARKA 1S72A 3OW2A 3FJPA 5GAN8 1SEMA 4Y92A 1VQ8A 3RBBB 1BI2A 1JQQA 2HL3A 1ZSGA 1RLQC 2DL5A 3QZ5B 4RTVA 4M75E 2EBPA 3RMQA 3H9NA 2D0QB 9ATCB 5KYXB 2DEQA 3EFOA 4KT0E 3RMSA 2VV5A 2QA4Q 2DXBA 2YLCA 4M78F 2R57A 3FDRA 4IUPA 2GNCA 1AHJB 1VQ8T 1JXMA 1AWOA 1UG1A 5GMKh 3GNFB 2JXBA 3SWNA 1Z9ZA 3GOXA 2IIMA 1BB9A 4C8QF 4C92G 5DLQE 2COZA 2PNIA 1YIJQ 2OI3A 3QSUA 1KK7A 1NEBA 1KSWA 1K1ZA 3FEOA 4PFOA 3PVLA 3OSSC 1S1NA 4FU6A 5GAOn 4M77F 1M1KU 5HY6A 2D9TA 2DZ9A 3M4GA 2MWOA 1M2VA 1QQJA 4HKEA 1K8AU 4FYYB 1M30A 4XK8E 3V8LA 1H641 4J9EA 1RAEB 3FRNA 3VS7A 3QBYA 3A8HB 3S6WA 4M7AD 3SWNC 1PNJA 2NUPB 1VQNQ 3LWIA 3BFMA 2GF7A 3I55Q 3F70A 1MMAA 3G6EQ 1LPLA 2MWPA 2QQRA 1I1JA 3OS2A 1Q82R 3KXTA 3G4SA 4HCBA 1YFNA 1UB4A 2XK0A 2FL7A 5KYYA 2VKNA 2A28A 3H41A 3M0PA 5I2MA 2NLUA 4M7AE 4ZTJA 1NYFA 1WGSA 1TXQA 1TH7A 4VUBA 3EGXB 2FZCB 3OBWA 1VIFA 3CCEA 1SSHA 3EGDB 3G4ST 2RJCA 3REAB 5GAN2 3A8MB 2O2OA 2HBWA 3UF4A 4A4KA 4C5EA 4OGCA 5GAOq 3RKWA 3MKDA 4M78B 1QWFA 1BI0A 1BIBA 1C1AA 1GCPA 1OEBA 3CCET 4LUDA 3CMAQ 1MHNA 1UEBA 2LQKA 1M1GA 1UHCA 1K73C 3M0TA 4LDWA 2RJFA 2OJ2A 1NJIR 2LJ1A 1D1AA 1Y0MA 3QO3A 4C8QB 3LX7A 3KFVA 3M56A 2M1HA 2PZ1A 3PIOA 3JCMV 2LQ8A 2FEIA 2Y90A 4JRIA 4XU3A 3S3OA 1C6VX 2WSEE 3CXCP 4M77B 4BY6C 3CCVA 2EYYA 4JJNK 1QVFA 4DQ2A 1E6HA 3WVEB 1UUEA 2YRVA 1X2KA 3HP9A 3C95A 2RQVA 2OTLQ 5FU6B 2DXUA 4F04B 2RJEA 4P5NA 2NWMA 3CCVT 2CP3A 2JMAA 1NPPA 2K2MA 5LJ3j 3CPWA 1ZX6A 2HQXA 4A4GA 1WHMA 2HQEA 5AYFA 1UGQB 3OYDA 5GAN5 3A8LB 3GIBA 2J6OA 2E3IA 2L8DA 3QYHB 3META 3BDLA 1W2BP 2DETA 4EMKB 5IXBA 1VOMA 1XJWB 1HK9A 4Z02A 2EW3A 1QVGP 4FW2A 3JCMW 4M75F 2DTIA 2E70A 2RN8A 4E7SA 1IREB 2RMOA 5LJ3g 3MJXA 2JUFA 1T3SA 3PVQA 4A53A 5CR2A 2KRNA 2AKLA 2KR3A 3S3NA 2DF6A 5KYXA 1YJWA 3DB4A 1W70A 1ZLMA 1Q81R 2DA9A 1JBMA 1UGRB 1YJ9A 2O9VA 4JZ4A 4K11A 2CP7A 2D0NA 2CUDA 2DL4A 3OYYA 3CCUQ 3GLXA 1AOJA 3C94A 4PNOA 5J39A 1X2QA 3JV3A 1YJWT 3CCQQ 2RO0A 1YJ9T 1R8OB 2H3EB 4IIOA 2AZVA 4LXCA 3MP1A 3JB9I 3SB2A 5CO7A 3EHQA 4BE2A 1YITQ 2LZ6B 4LN2A 4RG2A 4ZNXA 4IKFA 4ANJA 1ZBXA 5GJWB 1KQSA 2XDPA 4O5VA 4DBFA 1WQ7A 7AT1B 4RG8A 2P4RA 1M5Q1 4NS5A 2RQTA 4MZPA 1D0ZA 3PTAA 4L6V5 1KHCA 1CKBA 1IGQA 2VYTA 2A0FB 1BKBA 3JB9D 1MMDA 2XD0A 5GAN6 2EQJA 3GBQA 2HCKA 4M7AF 3TQ7P 3VV0A 1QWEA 2RF0A 1M9SA 8ATCB 2V8JA 3G71Q 4GLKA 2DVJA 4QQDA 3CBOA 3OMCA 4M75B 5HCKA 1G3SA 4F7UE 2QTXA 1K8AC 1RAIB 2L89A 1SG5A 4PJOG 4E6RA 1E6GA 4BI8B 4ZGDB 1XQHA 1NLOC 2KEAA 2KYMA 3G1JA 2M9UA 2IG0A 3V7CA 2J05A 1V76A 2OTJQ 2GFUA 1WNLA 2DXTA 1VQLQ 3UDCA 1PD1A 2RHYA 5L8RE 4RUGA 2O4XB 2ZGWA 3OYFA 2AIRB 1H8KA 4KGVB 2RM4A 1VQ4Q 1JJ2S 4GY5A 1WDXA 5CK9A 2CKKA 2DM1A 3NHNA 3QWXX 1OYXA 1Q7YC 2FHDA 2KE9A 3SFMA 3JCMb 2QAZA 3CQTA 3M0UA 2MI6A 4OMOA 1OQKA 1YN8A 4C92D 2DAQA 4C0DC 1M3AA 2QDLA 2EYXA 2DL3A 5CVIA 3VYGA 1X75C 5D6XA 4HVUA 2K5LA 3HRUA 1GBQA 3L42A 2A37A 4PJNA 1M90R 4BDYA 4PKCC 1BYMA 1BU1A 3OYMA 1NLPC 4OB0B 3HKSA 2A08A 3OYJA 4J9FA 2GTJA 3CMEQ 3QWYA 4FYVB 4OMQA 1IGUA 2E64A 5KCOA 5C6SA 1N6AA 1OPLA 1VQOQ 4C92E 3MHXA 4M7AB 1MUZA 4JRQA 2H8HA 5LJ3e 1QLYA 2VC8A 2F2VA 3QKJA 2YWWA 3DLMA 1KC8U 1RAFB 2COWA 5HKCA 2CP5A 5LL6S 1B34A 3M0QA 3V7RA 4ME7A 5GAMe 4DBQA 3O5ZA 1E7OA 4XAXB 2QA4A 2BUDA 3GF5A 2P4TA 1UHFA 1YP5A 2KAFA 6AT1B 4TVRA 1G3TA 3X24B 4QQGA 3CCSQ 1A0NB 1AD5A 1I81A 2O31A 4QW2A 1YJNQ 1FWZA 1PCXA 3JCMg 4GBQA 1H92A 5GJVB 1NG2A 2IVWA 1TUCA 2X3XD 2MF2A 2QA4T 2KROA 1YIJA 1SRMA 2EYWA 2QGGA 3SHWA 3L2RA 2BKDN 4FIBA 3OW2P 3GNGA 2CZ6B 3VS4A 3HRTA 2YRCA 2GFAA 4E7LA 3E19A 3A1PA 4ZGJB 3OYHA 1PSEA 3M55A 1ZHIA 3VS3A 1YIJT 5A0DA 2EQIA 4FL6A 4C0GA 1T0HA 3UPUA 2PQWA 4IIMA 4IUQA 2ZPIB 3EH1A 2EGAA 5J26A 3JSCA 4JUVA 2BTTA 2Y4XA 1VQNA 2CP0A 2X4XA 5FRNA 5KCHA 1VQ5Q 3I55A 2QXFA 2EJGA 4LUEA 1UE9A 2VB6A 3CC2Q 3PGGA 3G6EA 3A8OB 2ATCB 2J6FA 1NM7A 3MPUB 2M0YA 1WZOA 4ORZA 2LMJA 1IXDA 2PUOB 4QVDA 2FPEA 4II1A 2JT4A 2L5QA 1VQNT 2QYZA 1NE8A 3NPFA 1WI7A 4J9HA 3I55T 2BZ8A 2HAXA 3L2VA 3G6ET 1D0YA 3EG9A 4XTXA 2AHJB 1XNIA 1Y57A 2RPNA 2CZ0B 3WVDB 4F7UF 3TU4K 3JB9H 1LJOA 1GL5A 1N8RR 2DERA 5FWBA 2CH4W 3JB9F 3V7SA 3EG0A 2DBMA 3GPLA 4C0ZA 1PRMC 2CZ7B 2JZ2A 3VS6A 2IPOB 2LVMA 4WF2A 3NMZC 2A7YA 1K9MR 1PKSA 3CMAA 1U1SA 4DA4A 3D7SB 1WFWA 2V1QA 4RTYA 1MNEA 2O01E 3I56Q 2K6DA 2K4YA 3NTHA 3A98A 4CC4B 1NEGA 2JTMA 4JS5A 3CMAT 1WYXA 2FVUA 3OMGA 2RD1A 3RNJA 1H3ZA 4N4GA 3CEYA 3VRZA 1TSFA 2ROLA 2KSSA 1BI3A 2RHXA 4FYWB 4DBRA 3JCMX 4J9CA 2OTLA 4M77G 3OYCA 2K9GA 3IQLA 4J7IA 2A3LA 2Y4YA 4M7DA 4J9IA 3MEAA 1PWTA 5LJ3d 3C0CA 1HYOA 5GAOr 2RNAA 3P8BB 2OTLT 2LRQA 4F16A 2J06A 5DM7R 4JLGA 3L1AA 4HCZA 3E1SA 2GQIA 4C92F 3JCMP 1UDLA 1VQ9Q 4KUDK 4OMNA 4QKUA 3U23A 2EQKA 2QQAA 2DD4A 2D1XA 3CCJQ 1QVFP 4QT7A 2RQRA 5IT9E 4OMLA 1UTIA 1PM3A 4F7UB 4ZGEB 4M7DC 2MMPA 3Q1JA 4KH0B 4EDUA 3HFOA 3QG1A 4AFSC 5GMKe 1RL2A 3JCMe 4XU1A 1Q81C 3L2WA 1SSFA 1Q7YU 2LTOA 2KRSA 3CPWP 1M3CA 2EKOA 3C4SA 1X69A 1G83A 5FU7C 2LNHB 3J80E 1U5SA 1T3LA 3CCUA 1N27A 4OB3B 1O9SA 2HSEB 4PJOA 2XI9A 4J5YA 3TREA 2NUZA 3E9GA 4GLMA 5LJ5j 1RI9A 2K5IA 3CCQA 2E3HA 2BZXA 3ULRB 1X6BA 3OYAA 2ZAEA 1VYTA 4RTXA 2XICA 1ZSZA 2CT3A 1NYGA 2EYQA 2ZPHB 5KYUA 4AFZC 1YI2Q 3CCUT 4KRTA 3DB3A 1YITA 2GBQA 1Q86U 1VUBA 3EFSA 4KGXB 4F17A 2PTKA 2EQMA 1KC8C 4NL3A 3CCQT 2EJ9A 5AT1B 1WPYA 2DEUA 2WSFE 4LD9K 3LH0A 1S72Q 1W4SA 1QCFA 5M9OA 5LJ5g 3VU3C 2QK0A 3N5BB 5C0MA 1WXTA 1G5VA 1YITT 1VQ8Q 4LDUA 2LCLA 4A4HA 4PJOC 3QUIA 3LWHA 2NUTA 3RKYA 1RUWA 4FCYA 4KUIA 2YUOA 1ZSZC 2RI2A 1VQ6Q 1SHFA 2DVEA 2XHCA 4JJBA 1BBZA 4C92B 3M57A 4Y28E 4CI0C 2KT1A 1K76A 2SEMA 4AG2C 2K57A 3G71A 2PVOB 2KK4A 4X9CA 3M5AA 1G3WA 1Y96A 3KUFA 1RAHB 2E5QA 3RDVA 2GQVA 2E41A 3M53A 4OMPA 1G3YA 4PJMA 1W6XA 1FMWA 1B3QA 5GAMj 1N9RA 3LGFA 2VWFA 1VQPQ 1KQSP 1KD1R 2ECZA 4R55A 3G71T 3L2ZA 4B6MA 1ZA1B 4HXJA 2H3JA 1YWOA 2A36A 4E47A 2C06A 1PG5B 2DRKA 2OTJA 3CCRQ 2JS2A 2KXCA 2ZPGB 1M3BA 1VQLA 1TU0B 2G3RA 2X3WD 5D6YA 1Y7XA 3CC7Q 2EVRA 5KE2A 1VQ4A 5IHIA 3ME9A 5GAMg 1BI1A 3ZEHA 4IUUA 3EGUA 2OTJT 2V8IA 5GMKm 2EYZA 4A4EA 3HPWA 1WHLA 3EAEA 4PFZA 3QPHA 1ZUUA 1VQLT 5CKHA 1AWJA 3SD4A 1Q82U 4R56A 2QEXA 3CCMQ 2P0PA 1VQ4T 2RHZA 2D8JA 4ELZC 2ZPFB 3GP8A 2GGRA 2JJ9A 3ER0A 2XDBA 1K0SA 3UT1A 4ELYC 4M7DG 2BIVA 2X51A 1I5LA 2RHIA 3MO8A 5GANj 1RAAB 4LDYA 2QEXT 4EIKA 1AZGB 2CSIA 1AZEA 3H0IA 4AG1C 1UGSB 2DNUA 2C0IA 3NGPA 2P0KA 1RLPC 3CMEA 3E2UA 1TWBA 3X26B 2J6KA 2LCCA 3JCMd 3INZA 4J8OA 4BE0A 2EKHA 5A0GA 3RR6A 1D1CA 1YHQQ 1B07A 1JJ2A 3RERA 5I22A 1NJIU 2GTOA 1WHKA 1GFCA 1TUGB 2NUPA 4E7JA 4XTVA 5GANg 1K73R 2FRWA 3CMET 5KYWB 3OYNA 3MEVA 2YHTA 2WACA 4C0FA 1VQOT 1KQ1A 2E65A 1PHTA 3SDZA 5GAOm 1D3BB 1AEYA 3OYLA 2XIDA 1KFZA 3CCLQ 3UWNA 2VGMA 2KNBB 2FO0A 4D8KA 3CCSA 2MYSA 1YJNA 2AK5A 4J7FA 1J3TA 1FXXA 1BK2A 2DD5A 2LCSA 4CC3A 1WJSA 1IHVA 3BDUA 4QQ6A 3VKIA 3OB9A 3EGXA 1U1TA 2DE0X 1LOJA 1OPKA 4FT2A 4JJDA 5EG2A 3CCST 3EGDA 2DMOA 1QMCA 1YJNT 1PKTA 3CXCS 1K0XA 1U8RA 1WHHA 2JTFA 3L2QA 4EMGA 4OMMA 4HCCA 5CKFA 5GAN4 4M78A 4ZN3A 1HJDA 2ZPEB 2CSQA 4O6JA 1P92A 3PE0A 1NBEB 2RB6A 1EZZB 2KT8A 4RKUE 3EFRA 5LJ5e 2DZCA 2V1RA 2PVGB 1WHGA 2EPDA 2KMTA 4L5GA 4C8QA 2AT1B 1VQ5A 1SHGA 1JEGA 4LDXA 3O8VA 3EFOB 2HNIA 5LJ3h 1UGPB 1RABB 2KXDA 4MDXA 4RTWA 4EMHA 1GBRA 2EWNA 4D6WA 1YCYA 2LQNA 4M77A 4AFQC 2ABLA 1QP2A 1OOTA 5CKEA 1W2BS 1NZ9A 3ZFJA 1Q81U 2JM8A 1VQ5T 5CKBA 2C0TA 2F1LA 4M78C 3FJ5A 4J9GA 1QVGS 2HSPA 2PVDB 3DKMA 3MEWA 3M59A 2YSQA 2E5KA 4OP0A 1CKAA 4RTTA 3REBB 5D6WA 2LX9A 3DLLA 2DIGA 4C8QC 1Q86C 2DL7A 2DL8A 5FLXE 1M2VB 1MV0B 3CD6Q 2L3RA 3FC3A 3HSBA 4ZN1A 5GAOl 4HT9A 5GMKj 3KBGA 5KE3A 1VQ7Q 2X4YA 3MP8A 1Z9QA 4M77C 4N0AA 4EMKA 3HHTB 3TEEA 4HVVA 2YUQA 2HQHA 2RH2A 1V29B 1XOVA 3TVTA 5FW9A 2F2WA 1SPKA 3I56A 2FB7A 4C5IA 4RTUA 5FU6C 2XG8D 3OS0A 1VYUA 3QJ6A 2VUBA 1GFDA 5GAOp 3M58A 2QG9B 1FYNA 2LNVA 1AT1B 4J6XA 1N5ZA 4YTLA 4Z8AA 1VQKQ 3I56T 2K7AA 1X6GA 5KYYB 2DO3A 2WSCE 4A63B 4BD3A 2L3QA 3EG2A 4N0AC 5IH2A 4EMKC 2RJDA 4DEYA 4XTUA 2FPFA 2E1HA 1KJWA 1VQMQ 2O9SA 1D1BA 4BY6B 3S3MA 1IHWA 1M1KR 1LCKA 5LJ3f 4FM4B 1K8AR 4AMCA 4XTYA 1OX9A 4E7KA 1VQ9A 5GAMf 4J9DA 2KVQG 1ACMB 5I2SA 2FG0A 4MDWA 4R0KA 1AWXA 3CCJA 5GANe 4QVCA 3I5RA 5FWCA 2M0OA 3V8KA 1AWWA 3PMTA 3QJYA 4LNPA 1BCMA 2RI3A 4E7IA 1VQ9T 1Q82C 2FPDA 1U06A 2ENMA 2D6FA 2EQUA 5IHKA 2MPXC 3CCJT 1ZQ1A 4Z89A 2AZSA 2HD0A 3JCMc 4F7UG 2I2LA 1RADB 2EFIA 3OBYA 4CC2A 5DY9A 2W0ZA 1WQWA 3QXEB 1I0CA 4PJJA 1QCOA 4OF1A 2DX1A 2K3XA 5LJ5d 4KH1B 1PD0A 4WTOB 4M75A 3UATA 2VVKA 1M90U 1UJYA 4UC4A 2FZGB 4FYXB 1K9AA 5GAN3 3J7AF 1PSFA 2QTVA 4QVZA 2OAWA 1V1CA 3FLGA 3BE3A 1NJIC 1M8VA 4M78G 3WXMB 2W10A 2EAYA 4IURA 5IAYA 4NL2A 1M27C 1CSKA 2M51A 3LH5A 1YI2T 1QCNA 2O4XA 4C8QG 5DLOA 1T0JA 3CC4Q 4ESRA 1RACB 2VGNA 4M75C 2M02A 4KGZB 2RA2A 4LDVA 4LD6A 2KI7A 1S72T 1ZBJA 3HL8A 2ZPBB 1VQ6A 4OB2B 3I5SA 1KQ2A 2HBPA 2RQWA 3MEUA 5CKDA 2RK1A 3VS1A 1BCOA 4RTZA 3JCMh 4HT8A 1HSQA 3C12A 4ATOA 2ED0A 4M7DD 1WA7A 1R77A 1TOVA 4RCBA 3X25B 1VQ6T 5GAMd 2X35A 1EFNA 2D8HA 5HK3A 2JNGA 1KD1C 1VQPA 3I9QA 2QI2A 1YWPA 4OGEA 3PFSA 1GCQA 1R0CB 3ASKA 1JRIA 3P8HA 4PK4A 2QDYB 2P84A 2RI5A 3CCRA 1KHIA 2XDDA 3JRZA 3HFNA 4DEXA 4M7AA 4M7DE 1VQPT 5KYNA 5FROA 3CC7A 1WXBA 2G6FX 3VUBA 3OW2S 2JTEA 2YXYA 2VXFA 4J6WA 3SEMA 4X1VA 3OYBA 3CCRT 1OV3A 2DLPA 1HXDA 2K3BA 3A5ZB 2LT1A 3OY9A 3CC7T 1GRIA 3CCMA 1XTDA 1TS9A 4XU2A 1GCQC 4IUVA 2XMFA 2HKNA 1MNDA 4V2SA 1I5OB 3URGA 5J3BA 4XU0A 5GANd 4PJOD 2HZYA 4M7AC 3CCMT 1N8RU 2PUKB 5KH6A 3X28B 3OS1A 4LE9A 1PRLC 2EGEA 4D8DA 4JZ3A 2CT4A 4C0DB 5CQYA 5EC7A 1K9MU 2QQ9A 3MCAB 2E6ZA 2E4HA 4JLIA 4PL6A 1I8FA 1YHQA 4AT1B 3QHSA 3JCMf 4PJOE 2RK2A 3JCMJ 1K4US 5HK0A 2DKGA 1YNZA 1VYVA 3X20B 1M4ZA 3FB9A 2CGHA 3H6ZA 2X4JA 1YHQT 3CCLA 5CIUA 2LC4A 5A0LA 2HEQA 4OB1B 3E9FA 4M4ZA 1BIAA 4C5HA 2CYZB 2R5AA 2FZKB 3RUXA 2JOYA 3H0FA 3PMIA 3CCLT 3PT9A 1KIKA 1Q95G 2R5MA 4DBHA 4M75G 4BI3A 1IZ6A 1JJ2P 4Z88A 3HRSA 4BDZA 2F5TX 1LNXA 2JN0A 3FIFA 1IB8A 1WJRA 3LGLA 1X6OA 4MMKA 1EX4A 4X34A 2LDMA 3OQ5A 2MK5A 2DYIA 1X01A 3L2UA 5CQXA 2JVVA 1B34B 4XTZA 2CP6A 2ED1A 2YUNA 4FSXA 1WLPB 2DJZA 3QDRB 1QKXA 2LP5A 4A54A 4N4HA 1G2BA 3AT1B 2KRMA 2DYBA 3G4SQ 1FMVA 2EIFA 3MP6A 5IN1A 2P0QA 2K79A 2CZ1B 1WX6A 2F2XA 2DIQA 2LQWA 1QVFS 1N9SA 4X9DA 3CXCA 1M90C 5FRMA 3VS2A 2DK3A 3CCEQ 1IRXA 2DILA 3ZL7C 1QW1A 2B86A 5GAN7 2O88A 5IHNA 1RAGB 3LYIA 3VS5A 2L2PA 3CD6A 3M4YA 1VQOA 2RQUA 2DJQA 3CPWS
chains in the Genus database with same CATH topology
1YJWQ 3CCSQ 1JJ2P 1VQ5Q 1VQ7Q 1K9MR 1Q81R 3CPWP 3CXCP 1YHQQ 3I55Q 1YJNQ 3CMAQ 3CCJQ 1QVGP 3CC2Q 1QVFP 1YJ9Q 3CCVQ 1VQ8Q 3G71Q 1M1KR 3G6EQ 1VQKQ 1M90R 3CCRQ 1YI2Q 1Q7YR 2OTJQ 3CC4Q 3CCEQ 2QEXQ 1K73R 1YITQ 3CCMQ 1NJIR 1N8RR 1VQLQ 1K8AR 3I56Q 1YIJQ 3CCUQ 1KC8R 2OTLQ 1Q82R 3G4SQ 3CMEQ 3CC7Q 1Q86R 2QA4Q 1VQPQ 1VQ6Q 1KQSP 1W2BP 1KD1R 3CD6Q 1VQ9Q 3OW2P 3CCQQ 1VQOQ 1VQ4Q 1S72Q 1VQNQ 3CCLQ 1VQMQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJW Q;  3CCS Q;  1JJ2 P;  1VQ5 Q;  1VQ7 Q;  1K9M R;  1Q81 R;  3CPW P;  3CXC P;  1YHQ Q;  3I55 Q;  1YJN Q;  3CMA Q;  3CCJ Q;  1QVG P;  3CC2 Q;  1QVF P;  1YJ9 Q;  3CCV Q;  1VQ8 Q;  3G71 Q;  1M1K R;  3G6E Q;  1VQK Q;  1M90 R;  3CCR Q;  1YI2 Q;  1Q7Y R;  2OTJ Q;  3CC4 Q;  3CCE Q;  2QEX Q;  1K73 R;  1YIT Q;  3CCM Q;  1NJI R;  1N8R R;  1VQL Q;  1K8A R;  3I56 Q;  1YIJ Q;  3CCU Q;  1KC8 R;  2OTL Q;  1Q82 R;  3G4S Q;  3CME Q;  3CC7 Q;  1Q86 R;  2QA4 Q;  1VQP Q;  1VQ6 Q;  1KQS P;  1W2B P;  1KD1 R;  3CD6 Q;  1VQ9 Q;  3OW2 P;  3CCQ Q;  1VQO Q;  1VQ4 Q;  1S72 Q;  1VQN Q;  3CCL Q;  1VQM Q; 
#chains in the Genus database with same CATH topology
 1VQ7 A;  3M54 A;  3RES A;  1QKW A;  3H0H A;  1O75 A;  3EHR A;  4M7D F;  3HTR A;  1ABQ A;  4BUG A;  3OSV A;  3CD6 T;  1KC8 R;  1I07 A;  4E7Z A;  4M7A G;  1LVK A;  5I21 A;  3JB9 J;  2KYB A;  2ROT A;  4OMF B;  1VQ7 T;  4J9B A;  5LJ5 h;  1W2B A;  3JCM Q;  4F7U A;  2FYK A;  1OI1 A;  3QII A;  2YUP A;  1WHJ A;  2KY9 A;  3OYG A;  5ECA A;  4BI4 A;  1OU8 A;  3CCV Q;  1VQK A;  1QVG A;  1JU5 C;  2LT4 A;  3CBM A;  4DOW A;  4BB7 A;  5D7U A;  1B7T A;  2HDA A;  4HVW A;  2DTH A;  1WIE A;  1MV3 A;  1H3H A;  1WJQ A;  2ESW A;  3I35 A;  3EG9 B;  3T9N A;  2FRY A;  4JPB W;  1VA7 A;  1U3O A;  2JW4 A;  2HKQ B;  4PFP A;  1TTH B;  2SRC A;  1OUL A;  2V8K A;  1DJ7 B;  4RMO A;  3NFC A;  4J83 A;  1VQM A;  3R6N A;  4FW1 A;  1VQK T;  4L59 A;  2MOX A;  1M1K C;  4HA8 A;  2MIO A;  4EPC A;  5GMK l;  4WCI A;  5CCA A;  2C0O A;  1X27 A;  1KD1 U;  2HL5 C;  1IO6 A;  4FSS A;  3TSW A;  3VYH B;  1VQM T;  4M78 D;  1JB0 E;  1AVZ C;  2X4W A;  3H8Z A;  1F1B B;  1QP3 A;  3CBP A;  4OVA A;  4PLI A;  4RCC A;  4PJO F;  3PIP A;  2K5F A;  2QQB A;  3CC2 A;  2DBK A;  3AHU A;  1EIF A;  1M2O A;  4C8Q D;  4PJL A;  1R0B G;  2J7I A;  1MGQ A;  2KDS A;  1OZ2 A;  1D09 B;  4C5G A;  3BY7 A;  2MAM A;  3OA6 A;  1KQS S;  2LJ3 A;  3LW5 E;  4N4I A;  4E2F B;  5GAM h;  3SWN B;  4M77 D;  2YT6 A;  4M78 E;  1OZ3 A;  2CDT A;  3CC2 T;  1YJW Q;  2KBT A;  2EGC A;  4MZM A;  2EJF A;  1OX8 A;  2OX7 A;  2DTO A;  3G7Z A;  1YJ9 Q;  3M0S A;  2XU8 A;  4BE1 A;  4C92 A;  3NTI A;  2V26 A;  2QAS A;  2QEX Q;  1N8R C;  1TUD A;  4M7D B;  3RIR A;  2LX7 A;  4C8Q E;  2GCX A;  1TG0 A;  4F14 A;  1WXU A;  1JXO A;  1OU9 A;  5L23 A;  2OAU A;  2BE7 D;  3OS5 A;  2PU9 B;  5LJ5 f;  4HCK A;  4MML A;  1K9M C;  4CC7 A;  4CRI A;  4M77 E;  4XTW A;  2YLB A;  3EG1 A;  5IXF A;  3EG3 A;  3M9Q A;  3PNW C;  2VAS A;  1MMG A;  5FU7 B;  2JM9 A;  2COY A;  1ZUK A;  2XKO C;  4NOY A;  3OYI A;  3ZBD A;  2QGF B;  2K3Y A;  2R58 A;  2L0A A;  1SF9 A;  4JRK A;  3NTK A;  4JJC A;  2DFU A;  2NYS A;  4J6Y A;  4C92 C;  5A2Q E;  1VIE A;  2M16 A;  1YCS B;  3OYK A;  4PLL A;  1K73 U;  1UFF A;  4A4F A;  2KQW A;  5GAN h;  4XQ3 A;  3CC4 A;  1D0X A;  1SRL A;  2B8A A;  4KUL A;  1I4K 1;  3VJP A;  1JO8 A;  2MCN A;  4BAC A;  3THK A;  4KBM B;  1NPR A;  1YBY A;  1KG1 A;  2DRM A;  1UGV A;  2E10 A;  2YDL A;  3QZ9 B;  4JRP A;  2E12 A;  2CUB A;  3CC4 T;  2HMA A;  3VRY A;  4PJO B;  3V8J A;  4Y91 A;  1ZUY A;  2RHU A;  1GXI E;  3R6O A;  1Y07 A;  1ZSZ B;  2L3P A;  2Z0W A;  5I11 A;  4MZT A;  4AFU C;  2QQS A;  5KYU B;  2AKK A;  2ZZD A;  3CPF A;  1Y71 A;  4ZTF A;  2CH4 A;  2K2V A;  2E6N A;  1FX7 A;  1X43 A;  2JS0 A;  2DXC A;  3BW1 A;  1G8X A;  2LJ0 A;  1ABO A;  1SKU B;  5GMK i;  4B9W A;  3J81 E;  3EH2 A;  5CAI A;  4IUT A;  1PC0 A;  2CP2 A;  5KYW A;  1UJ0 A;  2NUT B;  3VS0 A;  1FMK A;  1D3B A;  2YRD A;  1M8M A;  3UA6 A;  1Q7Y R;  2KGT A;  3JB9 G;  2X9H A;  3QYG B;  4FT4 A;  3TSZ A;  3LLR A;  4E7H A;  1UEC A;  3TCJ A;  1HD3 A;  2BE9 B;  3QDF A;  3VUZ A;  4Q5W A;  3OYE A;  3JAM E;  3P8D A;  3UA7 A;  1C0M A;  3RKX A;  2DPP B;  1Y96 B;  4B9X A;  2ZCF B;  8AT1 B;  1RI0 A;  4M75 D;  3M0R A;  2I0N A;  2CRE A;  2JMC A;  1YI2 A;  2F5K A;  2F69 A;  2BZY A;  4JDS A;  5GAN f;  3A8G B;  1MMN A;  1W1F A;  2CS7 A;  1ZA2 B;  2L3S A;  1M1F A;  4DOV A;  4JS4 A;  1Q86 R;  1QVP A;  2VXE A;  1ARK A;  1S72 A;  3OW2 A;  3FJP A;  5GAN 8;  1SEM A;  4Y92 A;  1VQ8 A;  3RBB B;  1BI2 A;  1JQQ A;  2HL3 A;  1ZSG A;  1RLQ C;  2DL5 A;  3QZ5 B;  4RTV A;  4M75 E;  2EBP A;  3RMQ A;  3H9N A;  2D0Q B;  9ATC B;  5KYX B;  2DEQ A;  3EFO A;  4KT0 E;  3RMS A;  2VV5 A;  2QA4 Q;  2DXB A;  2YLC A;  4M78 F;  2R57 A;  3FDR A;  4IUP A;  2GNC A;  1AHJ B;  1VQ8 T;  1JXM A;  1AWO A;  1UG1 A;  5GMK h;  3GNF B;  2JXB A;  3SWN A;  1Z9Z A;  3GOX A;  2IIM A;  1BB9 A;  4C8Q F;  4C92 G;  5DLQ E;  2COZ A;  2PNI A;  1YIJ Q;  2OI3 A;  3QSU A;  1KK7 A;  1NEB A;  1KSW A;  1K1Z A;  3FEO A;  4PFO A;  3PVL A;  3OSS C;  1S1N A;  4FU6 A;  5GAO n;  4M77 F;  1M1K U;  5HY6 A;  2D9T A;  2DZ9 A;  3M4G A;  2MWO A;  1M2V A;  1QQJ A;  4HKE A;  1K8A U;  4FYY B;  1M30 A;  4XK8 E;  3V8L A;  1H64 1;  4J9E A;  1RAE B;  3FRN A;  3VS7 A;  3QBY A;  3A8H B;  3S6W A;  4M7A D;  3SWN C;  1PNJ A;  2NUP B;  1VQN Q;  3LWI A;  3BFM A;  2GF7 A;  3I55 Q;  3F70 A;  1MMA A;  3G6E Q;  1LPL A;  2MWP A;  2QQR A;  1I1J A;  3OS2 A;  1Q82 R;  3KXT A;  3G4S A;  4HCB A;  1YFN A;  1UB4 A;  2XK0 A;  2FL7 A;  5KYY A;  2VKN A;  2A28 A;  3H41 A;  3M0P A;  5I2M A;  2NLU A;  4M7A E;  4ZTJ A;  1NYF A;  1WGS A;  1TXQ A;  1TH7 A;  4VUB A;  3EGX B;  2FZC B;  3OBW A;  1VIF A;  3CCE A;  1SSH A;  3EGD B;  3G4S T;  2RJC A;  3REA B;  5GAN 2;  3A8M B;  2O2O A;  2HBW A;  3UF4 A;  4A4K A;  4C5E A;  4OGC A;  5GAO q;  3RKW A;  3MKD A;  4M78 B;  1QWF A;  1BI0 A;  1BIB A;  1C1A A;  1GCP A;  1OEB A;  3CCE T;  4LUD A;  3CMA Q;  1MHN A;  1UEB A;  2LQK A;  1M1G A;  1UHC A;  1K73 C;  3M0T A;  4LDW A;  2RJF A;  2OJ2 A;  1NJI R;  2LJ1 A;  1D1A A;  1Y0M A;  3QO3 A;  4C8Q B;  3LX7 A;  3KFV A;  3M56 A;  2M1H A;  2PZ1 A;  3PIO A;  3JCM V;  2LQ8 A;  2FEI A;  2Y90 A;  4JRI A;  4XU3 A;  3S3O A;  1C6V X;  2WSE E;  3CXC P;  4M77 B;  4BY6 C;  3CCV A;  2EYY A;  4JJN K;  1QVF A;  4DQ2 A;  1E6H A;  3WVE B;  1UUE A;  2YRV A;  1X2K A;  3HP9 A;  3C95 A;  2RQV A;  2OTL Q;  5FU6 B;  2DXU A;  4F04 B;  2RJE A;  4P5N A;  2NWM A;  3CCV T;  2CP3 A;  2JMA A;  1NPP A;  2K2M A;  5LJ3 j;  3CPW A;  1ZX6 A;  2HQX A;  4A4G A;  1WHM A;  2HQE A;  5AYF A;  1UGQ B;  3OYD A;  5GAN 5;  3A8L B;  3GIB A;  2J6O A;  2E3I A;  2L8D A;  3QYH B;  3MET A;  3BDL A;  1W2B P;  2DET A;  4EMK B;  5IXB A;  1VOM A;  1XJW B;  1HK9 A;  4Z02 A;  2EW3 A;  1QVG P;  4FW2 A;  3JCM W;  4M75 F;  2DTI A;  2E70 A;  2RN8 A;  4E7S A;  1IRE B;  2RMO A;  5LJ3 g;  3MJX A;  2JUF A;  1T3S A;  3PVQ A;  4A53 A;  5CR2 A;  2KRN A;  2AKL A;  2KR3 A;  3S3N A;  2DF6 A;  5KYX A;  1YJW A;  3DB4 A;  1W70 A;  1ZLM A;  1Q81 R;  2DA9 A;  1JBM A;  1UGR B;  1YJ9 A;  2O9V A;  4JZ4 A;  4K11 A;  2CP7 A;  2D0N A;  2CUD A;  2DL4 A;  3OYY A;  3CCU Q;  3GLX A;  1AOJ A;  3C94 A;  4PNO A;  5J39 A;  1X2Q A;  3JV3 A;  1YJW T;  3CCQ Q;  2RO0 A;  1YJ9 T;  1R8O B;  2H3E B;  4IIO A;  2AZV A;  4LXC A;  3MP1 A;  3JB9 I;  3SB2 A;  5CO7 A;  3EHQ A;  4BE2 A;  1YIT Q;  2LZ6 B;  4LN2 A;  4RG2 A;  4ZNX A;  4IKF A;  4ANJ A;  1ZBX A;  5GJW B;  1KQS A;  2XDP A;  4O5V A;  4DBF A;  1WQ7 A;  7AT1 B;  4RG8 A;  2P4R A;  1M5Q 1;  4NS5 A;  2RQT A;  4MZP A;  1D0Z A;  3PTA A;  4L6V 5;  1KHC A;  1CKB A;  1IGQ A;  2VYT A;  2A0F B;  1BKB A;  3JB9 D;  1MMD A;  2XD0 A;  5GAN 6;  2EQJ A;  3GBQ A;  2HCK A;  4M7A F;  3TQ7 P;  3VV0 A;  1QWE A;  2RF0 A;  1M9S A;  8ATC B;  2V8J A;  3G71 Q;  4GLK A;  2DVJ A;  4QQD A;  3CBO A;  3OMC A;  4M75 B;  5HCK A;  1G3S A;  4F7U E;  2QTX A;  1K8A C;  1RAI B;  2L89 A;  1SG5 A;  4PJO G;  4E6R A;  1E6G A;  4BI8 B;  4ZGD B;  1XQH A;  1NLO C;  2KEA A;  2KYM A;  3G1J A;  2M9U A;  2IG0 A;  3V7C A;  2J05 A;  1V76 A;  2OTJ Q;  2GFU A;  1WNL A;  2DXT A;  1VQL Q;  3UDC A;  1PD1 A;  2RHY A;  5L8R E;  4RUG A;  2O4X B;  2ZGW A;  3OYF A;  2AIR B;  1H8K A;  4KGV B;  2RM4 A;  1VQ4 Q;  1JJ2 S;  4GY5 A;  1WDX A;  5CK9 A;  2CKK A;  2DM1 A;  3NHN A;  3QWX X;  1OYX A;  1Q7Y C;  2FHD A;  2KE9 A;  3SFM A;  3JCM b;  2QAZ A;  3CQT A;  3M0U A;  2MI6 A;  4OMO A;  1OQK A;  1YN8 A;  4C92 D;  2DAQ A;  4C0D C;  1M3A A;  2QDL A;  2EYX A;  2DL3 A;  5CVI A;  3VYG A;  1X75 C;  5D6X A;  4HVU A;  2K5L A;  3HRU A;  1GBQ A;  3L42 A;  2A37 A;  4PJN A;  1M90 R;  4BDY A;  4PKC C;  1BYM A;  1BU1 A;  3OYM A;  1NLP C;  4OB0 B;  3HKS A;  2A08 A;  3OYJ A;  4J9F A;  2GTJ A;  3CME Q;  3QWY A;  4FYV B;  4OMQ A;  1IGU A;  2E64 A;  5KCO A;  5C6S A;  1N6A A;  1OPL A;  1VQO Q;  4C92 E;  3MHX A;  4M7A B;  1MUZ A;  4JRQ A;  2H8H A;  5LJ3 e;  1QLY A;  2VC8 A;  2F2V A;  3QKJ A;  2YWW A;  3DLM A;  1KC8 U;  1RAF B;  2COW A;  5HKC A;  2CP5 A;  5LL6 S;  1B34 A;  3M0Q A;  3V7R A;  4ME7 A;  5GAM e;  4DBQ A;  3O5Z A;  1E7O A;  4XAX B;  2QA4 A;  2BUD A;  3GF5 A;  2P4T A;  1UHF A;  1YP5 A;  2KAF A;  6AT1 B;  4TVR A;  1G3T A;  3X24 B;  4QQG A;  3CCS Q;  1A0N B;  1AD5 A;  1I81 A;  2O31 A;  4QW2 A;  1YJN Q;  1FWZ A;  1PCX A;  3JCM g;  4GBQ A;  1H92 A;  5GJV B;  1NG2 A;  2IVW A;  1TUC A;  2X3X D;  2MF2 A;  2QA4 T;  2KRO A;  1YIJ A;  1SRM A;  2EYW A;  2QGG A;  3SHW A;  3L2R A;  2BKD N;  4FIB A;  3OW2 P;  3GNG A;  2CZ6 B;  3VS4 A;  3HRT A;  2YRC A;  2GFA A;  4E7L A;  3E19 A;  3A1P A;  4ZGJ B;  3OYH A;  1PSE A;  3M55 A;  1ZHI A;  3VS3 A;  1YIJ T;  5A0D A;  2EQI A;  4FL6 A;  4C0G A;  1T0H A;  3UPU A;  2PQW A;  4IIM A;  4IUQ A;  2ZPI B;  3EH1 A;  2EGA A;  5J26 A;  3JSC A;  4JUV A;  2BTT A;  2Y4X A;  1VQN A;  2CP0 A;  2X4X A;  5FRN A;  5KCH A;  1VQ5 Q;  3I55 A;  2QXF A;  2EJG A;  4LUE A;  1UE9 A;  2VB6 A;  3CC2 Q;  3PGG A;  3G6E A;  3A8O B;  2ATC B;  2J6F A;  1NM7 A;  3MPU B;  2M0Y A;  1WZO A;  4ORZ A;  2LMJ A;  1IXD A;  2PUO B;  4QVD A;  2FPE A;  4II1 A;  2JT4 A;  2L5Q A;  1VQN T;  2QYZ A;  1NE8 A;  3NPF A;  1WI7 A;  4J9H A;  3I55 T;  2BZ8 A;  2HAX A;  3L2V A;  3G6E T;  1D0Y A;  3EG9 A;  4XTX A;  2AHJ B;  1XNI A;  1Y57 A;  2RPN A;  2CZ0 B;  3WVD B;  4F7U F;  3TU4 K;  3JB9 H;  1LJO A;  1GL5 A;  1N8R R;  2DER A;  5FWB A;  2CH4 W;  3JB9 F;  3V7S A;  3EG0 A;  2DBM A;  3GPL A;  4C0Z A;  1PRM C;  2CZ7 B;  2JZ2 A;  3VS6 A;  2IPO B;  2LVM A;  4WF2 A;  3NMZ C;  2A7Y A;  1K9M R;  1PKS A;  3CMA A;  1U1S A;  4DA4 A;  3D7S B;  1WFW A;  2V1Q A;  4RTY A;  1MNE A;  2O01 E;  3I56 Q;  2K6D A;  2K4Y A;  3NTH A;  3A98 A;  4CC4 B;  1NEG A;  2JTM A;  4JS5 A;  3CMA T;  1WYX A;  2FVU A;  3OMG A;  2RD1 A;  3RNJ A;  1H3Z A;  4N4G A;  3CEY A;  3VRZ A;  1TSF A;  2ROL A;  2KSS A;  1BI3 A;  2RHX A;  4FYW B;  4DBR A;  3JCM X;  4J9C A;  2OTL A;  4M77 G;  3OYC A;  2K9G A;  3IQL A;  4J7I A;  2A3L A;  2Y4Y A;  4M7D A;  4J9I A;  3MEA A;  1PWT A;  5LJ3 d;  3C0C A;  1HYO A;  5GAO r;  2RNA A;  3P8B B;  2OTL T;  2LRQ A;  4F16 A;  2J06 A;  5DM7 R;  4JLG A;  3L1A A;  4HCZ A;  3E1S A;  2GQI A;  4C92 F;  3JCM P;  1UDL A;  1VQ9 Q;  4KUD K;  4OMN A;  4QKU A;  3U23 A;  2EQK A;  2QQA A;  2DD4 A;  2D1X A;  3CCJ Q;  1QVF P;  4QT7 A;  2RQR A;  5IT9 E;  4OML A;  1UTI A;  1PM3 A;  4F7U B;  4ZGE B;  4M7D C;  2MMP A;  3Q1J A;  4KH0 B;  4EDU A;  3HFO A;  3QG1 A;  4AFS C;  5GMK e;  1RL2 A;  3JCM e;  4XU1 A;  1Q81 C;  3L2W A;  1SSF A;  1Q7Y U;  2LTO A;  2KRS A;  3CPW P;  1M3C A;  2EKO A;  3C4S A;  1X69 A;  1G83 A;  5FU7 C;  2LNH B;  3J80 E;  1U5S A;  1T3L A;  3CCU A;  1N27 A;  4OB3 B;  1O9S A;  2HSE B;  4PJO A;  2XI9 A;  4J5Y A;  3TRE A;  2NUZ A;  3E9G A;  4GLM A;  5LJ5 j;  1RI9 A;  2K5I A;  3CCQ A;  2E3H A;  2BZX A;  3ULR B;  1X6B A;  3OYA A;  2ZAE A;  1VYT A;  4RTX A;  2XIC A;  1ZSZ A;  2CT3 A;  1NYG A;  2EYQ A;  2ZPH B;  5KYU A;  4AFZ C;  1YI2 Q;  3CCU T;  4KRT A;  3DB3 A;  1YIT A;  2GBQ A;  1Q86 U;  1VUB A;  3EFS A;  4KGX B;  4F17 A;  2PTK A;  2EQM A;  1KC8 C;  4NL3 A;  3CCQ T;  2EJ9 A;  5AT1 B;  1WPY A;  2DEU A;  2WSF E;  4LD9 K;  3LH0 A;  1S72 Q;  1W4S A;  1QCF A;  5M9O A;  5LJ5 g;  3VU3 C;  2QK0 A;  3N5B B;  5C0M A;  1WXT A;  1G5V A;  1YIT T;  1VQ8 Q;  4LDU A;  2LCL A;  4A4H A;  4PJO C;  3QUI A;  3LWH A;  2NUT A;  3RKY A;  1RUW A;  4FCY A;  4KUI A;  2YUO A;  1ZSZ C;  2RI2 A;  1VQ6 Q;  1SHF A;  2DVE A;  2XHC A;  4JJB A;  1BBZ A;  4C92 B;  3M57 A;  4Y28 E;  4CI0 C;  2KT1 A;  1K76 A;  2SEM A;  4AG2 C;  2K57 A;  3G71 A;  2PVO B;  2KK4 A;  4X9C A;  3M5A A;  1G3W A;  1Y96 A;  3KUF A;  1RAH B;  2E5Q A;  3RDV A;  2GQV A;  2E41 A;  3M53 A;  4OMP A;  1G3Y A;  4PJM A;  1W6X A;  1FMW A;  1B3Q A;  5GAM j;  1N9R A;  3LGF A;  2VWF A;  1VQP Q;  1KQS P;  1KD1 R;  2ECZ A;  4R55 A;  3G71 T;  3L2Z A;  4B6M A;  1ZA1 B;  4HXJ A;  2H3J A;  1YWO A;  2A36 A;  4E47 A;  2C06 A;  1PG5 B;  2DRK A;  2OTJ A;  3CCR Q;  2JS2 A;  2KXC A;  2ZPG B;  1M3B A;  1VQL A;  1TU0 B;  2G3R A;  2X3W D;  5D6Y A;  1Y7X A;  3CC7 Q;  2EVR A;  5KE2 A;  1VQ4 A;  5IHI A;  3ME9 A;  5GAM g;  1BI1 A;  3ZEH A;  4IUU A;  3EGU A;  2OTJ T;  2V8I A;  5GMK m;  2EYZ A;  4A4E A;  3HPW A;  1WHL A;  3EAE A;  4PFZ A;  3QPH A;  1ZUU A;  1VQL T;  5CKH A;  1AWJ A;  3SD4 A;  1Q82 U;  4R56 A;  2QEX A;  3CCM Q;  2P0P A;  1VQ4 T;  2RHZ A;  2D8J A;  4ELZ C;  2ZPF B;  3GP8 A;  2GGR A;  2JJ9 A;  3ER0 A;  2XDB A;  1K0S A;  3UT1 A;  4ELY C;  4M7D G;  2BIV A;  2X51 A;  1I5L A;  2RHI A;  3MO8 A;  5GAN j;  1RAA B;  4LDY A;  2QEX T;  4EIK A;  1AZG B;  2CSI A;  1AZE A;  3H0I A;  4AG1 C;  1UGS B;  2DNU A;  2C0I A;  3NGP A;  2P0K A;  1RLP C;  3CME A;  3E2U A;  1TWB A;  3X26 B;  2J6K A;  2LCC A;  3JCM d;  3INZ A;  4J8O A;  4BE0 A;  2EKH A;  5A0G A;  3RR6 A;  1D1C A;  1YHQ Q;  1B07 A;  1JJ2 A;  3RER A;  5I22 A;  1NJI U;  2GTO A;  1WHK A;  1GFC A;  1TUG B;  2NUP A;  4E7J A;  4XTV A;  5GAN g;  1K73 R;  2FRW A;  3CME T;  5KYW B;  3OYN A;  3MEV A;  2YHT A;  2WAC A;  4C0F A;  1VQO T;  1KQ1 A;  2E65 A;  1PHT A;  3SDZ A;  5GAO m;  1D3B B;  1AEY A;  3OYL A;  2XID A;  1KFZ A;  3CCL Q;  3UWN A;  2VGM A;  2KNB B;  2FO0 A;  4D8K A;  3CCS A;  2MYS A;  1YJN A;  2AK5 A;  4J7F A;  1J3T A;  1FXX A;  1BK2 A;  2DD5 A;  2LCS A;  4CC3 A;  1WJS A;  1IHV A;  3BDU A;  4QQ6 A;  3VKI A;  3OB9 A;  3EGX A;  1U1T A;  2DE0 X;  1LOJ A;  1OPK A;  4FT2 A;  4JJD A;  5EG2 A;  3CCS T;  3EGD A;  2DMO A;  1QMC A;  1YJN T;  1PKT A;  3CXC S;  1K0X A;  1U8R A;  1WHH A;  2JTF A;  3L2Q A;  4EMG A;  4OMM A;  4HCC A;  5CKF A;  5GAN 4;  4M78 A;  4ZN3 A;  1HJD A;  2ZPE B;  2CSQ A;  4O6J A;  1P92 A;  3PE0 A;  1NBE B;  2RB6 A;  1EZZ B;  2KT8 A;  4RKU E;  3EFR A;  5LJ5 e;  2DZC A;  2V1R A;  2PVG B;  1WHG A;  2EPD A;  2KMT A;  4L5G A;  4C8Q A;  2AT1 B;  1VQ5 A;  1SHG A;  1JEG A;  4LDX A;  3O8V A;  3EFO B;  2HNI A;  5LJ3 h;  1UGP B;  1RAB B;  2KXD A;  4MDX A;  4RTW A;  4EMH A;  1GBR A;  2EWN A;  4D6W A;  1YCY A;  2LQN A;  4M77 A;  4AFQ C;  2ABL A;  1QP2 A;  1OOT A;  5CKE A;  1W2B S;  1NZ9 A;  3ZFJ A;  1Q81 U;  2JM8 A;  1VQ5 T;  5CKB A;  2C0T A;  2F1L A;  4M78 C;  3FJ5 A;  4J9G A;  1QVG S;  2HSP A;  2PVD B;  3DKM A;  3MEW A;  3M59 A;  2YSQ A;  2E5K A;  4OP0 A;  1CKA A;  4RTT A;  3REB B;  5D6W A;  2LX9 A;  3DLL A;  2DIG A;  4C8Q C;  1Q86 C;  2DL7 A;  2DL8 A;  5FLX E;  1M2V B;  1MV0 B;  3CD6 Q;  2L3R A;  3FC3 A;  3HSB A;  4ZN1 A;  5GAO l;  4HT9 A;  5GMK j;  3KBG A;  5KE3 A;  1VQ7 Q;  2X4Y A;  3MP8 A;  1Z9Q A;  4M77 C;  4N0A A;  4EMK A;  3HHT B;  3TEE A;  4HVV A;  2YUQ A;  2HQH A;  2RH2 A;  1V29 B;  1XOV A;  3TVT A;  5FW9 A;  2F2W A;  1SPK A;  3I56 A;  2FB7 A;  4C5I A;  4RTU A;  5FU6 C;  2XG8 D;  3OS0 A;  1VYU A;  3QJ6 A;  2VUB A;  1GFD A;  5GAO p;  3M58 A;  2QG9 B;  1FYN A;  2LNV A;  1AT1 B;  4J6X A;  1N5Z A;  4YTL A;  4Z8A A;  1VQK Q;  3I56 T;  2K7A A;  1X6G A;  5KYY B;  2DO3 A;  2WSC E;  4A63 B;  4BD3 A;  2L3Q A;  3EG2 A;  4N0A C;  5IH2 A;  4EMK C;  2RJD A;  4DEY A;  4XTU A;  2FPF A;  2E1H A;  1KJW A;  1VQM Q;  2O9S A;  1D1B A;  4BY6 B;  3S3M A;  1IHW A;  1M1K R;  1LCK A;  5LJ3 f;  4FM4 B;  1K8A R;  4AMC A;  4XTY A;  1OX9 A;  4E7K A;  1VQ9 A;  5GAM f;  4J9D A;  2KVQ G;  1ACM B;  5I2S A;  2FG0 A;  4MDW A;  4R0K A;  1AWX A;  3CCJ A;  5GAN e;  4QVC A;  3I5R A;  5FWC A;  2M0O A;  3V8K A;  1AWW A;  3PMT A;  3QJY A;  4LNP A;  1BCM A;  2RI3 A;  4E7I A;  1VQ9 T;  1Q82 C;  2FPD A;  1U06 A;  2ENM A;  2D6F A;  2EQU A;  5IHK A;  2MPX C;  3CCJ T;  1ZQ1 A;  4Z89 A;  2AZS A;  2HD0 A;  3JCM c;  4F7U G;  2I2L A;  1RAD B;  2EFI A;  3OBY A;  4CC2 A;  5DY9 A;  2W0Z A;  1WQW A;  3QXE B;  1I0C A;  4PJJ A;  1QCO A;  4OF1 A;  2DX1 A;  2K3X A;  5LJ5 d;  4KH1 B;  1PD0 A;  4WTO B;  4M75 A;  3UAT A;  2VVK A;  1M90 U;  1UJY A;  4UC4 A;  2FZG B;  4FYX B;  1K9A A;  5GAN 3;  3J7A F;  1PSF A;  2QTV A;  4QVZ A;  2OAW A;  1V1C A;  3FLG A;  3BE3 A;  1NJI C;  1M8V A;  4M78 G;  3WXM B;  2W10 A;  2EAY A;  4IUR A;  5IAY A;  4NL2 A;  1M27 C;  1CSK A;  2M51 A;  3LH5 A;  1YI2 T;  1QCN A;  2O4X A;  4C8Q G;  5DLO A;  1T0J A;  3CC4 Q;  4ESR A;  1RAC B;  2VGN A;  4M75 C;  2M02 A;  4KGZ B;  2RA2 A;  4LDV A;  4LD6 A;  2KI7 A;  1S72 T;  1ZBJ A;  3HL8 A;  2ZPB B;  1VQ6 A;  4OB2 B;  3I5S A;  1KQ2 A;  2HBP A;  2RQW A;  3MEU A;  5CKD A;  2RK1 A;  3VS1 A;  1BCO A;  4RTZ A;  3JCM h;  4HT8 A;  1HSQ A;  3C12 A;  4ATO A;  2ED0 A;  4M7D D;  1WA7 A;  1R77 A;  1TOV A;  4RCB A;  3X25 B;  1VQ6 T;  5GAM d;  2X35 A;  1EFN A;  2D8H A;  5HK3 A;  2JNG A;  1KD1 C;  1VQP A;  3I9Q A;  2QI2 A;  1YWP A;  4OGE A;  3PFS A;  1GCQ A;  1R0C B;  3ASK A;  1JRI A;  3P8H A;  4PK4 A;  2QDY B;  2P84 A;  2RI5 A;  3CCR A;  1KHI A;  2XDD A;  3JRZ A;  3HFN A;  4DEX A;  4M7A A;  4M7D E;  1VQP T;  5KYN A;  5FRO A;  3CC7 A;  1WXB A;  2G6F X;  3VUB A;  3OW2 S;  2JTE A;  2YXY A;  2VXF A;  4J6W A;  3SEM A;  4X1V A;  3OYB A;  3CCR T;  1OV3 A;  2DLP A;  1HXD A;  2K3B A;  3A5Z B;  2LT1 A;  3OY9 A;  3CC7 T;  1GRI A;  3CCM A;  1XTD A;  1TS9 A;  4XU2 A;  1GCQ C;  4IUV A;  2XMF A;  2HKN A;  1MND A;  4V2S A;  1I5O B;  3URG A;  5J3B A;  4XU0 A;  5GAN d;  4PJO D;  2HZY A;  4M7A C;  3CCM T;  1N8R U;  2PUK B;  5KH6 A;  3X28 B;  3OS1 A;  4LE9 A;  1PRL C;  2EGE A;  4D8D A;  4JZ3 A;  2CT4 A;  4C0D B;  5CQY A;  5EC7 A;  1K9M U;  2QQ9 A;  3MCA B;  2E6Z A;  2E4H A;  4JLI A;  4PL6 A;  1I8F A;  1YHQ A;  4AT1 B;  3QHS A;  3JCM f;  4PJO E;  2RK2 A;  3JCM J;  1K4U S;  5HK0 A;  2DKG A;  1YNZ A;  1VYV A;  3X20 B;  1M4Z A;  3FB9 A;  2CGH A;  3H6Z A;  2X4J A;  1YHQ T;  3CCL A;  5CIU A;  2LC4 A;  5A0L A;  2HEQ A;  4OB1 B;  3E9F A;  4M4Z A;  1BIA A;  4C5H A;  2CYZ B;  2R5A A;  2FZK B;  3RUX A;  2JOY A;  3H0F A;  3PMI A;  3CCL T;  3PT9 A;  1KIK A;  1Q95 G;  2R5M A;  4DBH A;  4M75 G;  4BI3 A;  1IZ6 A;  1JJ2 P;  4Z88 A;  3HRS A;  4BDZ A;  2F5T X;  1LNX A;  2JN0 A;  3FIF A;  1IB8 A;  1WJR A;  3LGL A;  1X6O A;  4MMK A;  1EX4 A;  4X34 A;  2LDM A;  3OQ5 A;  2MK5 A;  2DYI A;  1X01 A;  3L2U A;  5CQX A;  2JVV A;  1B34 B;  4XTZ A;  2CP6 A;  2ED1 A;  2YUN A;  4FSX A;  1WLP B;  2DJZ A;  3QDR B;  1QKX A;  2LP5 A;  4A54 A;  4N4H A;  1G2B A;  3AT1 B;  2KRM A;  2DYB A;  3G4S Q;  1FMV A;  2EIF A;  3MP6 A;  5IN1 A;  2P0Q A;  2K79 A;  2CZ1 B;  1WX6 A;  2F2X A;  2DIQ A;  2LQW A;  1QVF S;  1N9S A;  4X9D A;  3CXC A;  1M90 C;  5FRM A;  3VS2 A;  2DK3 A;  3CCE Q;  1IRX A;  2DIL A;  3ZL7 C;  1QW1 A;  2B86 A;  5GAN 7;  2O88 A;  5IHN A;  1RAG B;  3LYI A;  3VS5 A;  2L2P A;  3CD6 A;  3M4Y A;  1VQO A;  2RQU A;  2DJQ A;  3CPW S; 
#chains in the Genus database with same CATH homology
 1YJW Q;  3CCS Q;  1JJ2 P;  1VQ5 Q;  1VQ7 Q;  1K9M R;  1Q81 R;  3CPW P;  3CXC P;  1YHQ Q;  3I55 Q;  1YJN Q;  3CMA Q;  3CCJ Q;  1QVG P;  3CC2 Q;  1QVF P;  1YJ9 Q;  3CCV Q;  1VQ8 Q;  3G71 Q;  1M1K R;  3G6E Q;  1VQK Q;  1M90 R;  3CCR Q;  1YI2 Q;  1Q7Y R;  2OTJ Q;  3CC4 Q;  3CCE Q;  2QEX Q;  1K73 R;  1YIT Q;  3CCM Q;  1NJI R;  1N8R R;  1VQL Q;  1K8A R;  3I56 Q;  1YIJ Q;  3CCU Q;  1KC8 R;  2OTL Q;  1Q82 R;  3G4S Q;  3CME Q;  3CC7 Q;  1Q86 R;  2QA4 Q;  1VQP Q;  1VQ6 Q;  1KQS P;  1W2B P;  1KD1 R;  3CD6 Q;  1VQ9 Q;  3OW2 P;  3CCQ Q;  1VQO Q;  1VQ4 Q;  1S72 Q;  1VQN Q;  3CCL Q;  1VQM Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...