3CCVQ

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2616a
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3ccvQ00
3I56Q 1VQ7Q 3CC4Q 3CMEQ 1Q81R 1Q86R 3CCUQ 1Q82R 1QVGP 3CC2Q 1Q7YR 3CCLQ 3CCVQ 1M90R 1VQ4Q 1JJ2P 2OTLQ 3OW2P 3CCQQ 1W2BP 1VQ9Q 1K8AR 1YI2Q 2OTJQ 3CD6Q 3CCMQ 1N8RR 2QEXQ 1VQMQ 1S72Q 1YJWQ 1YHQQ 3CCRQ 1VQ6Q 1KQSP 3CCEQ 1VQ8Q 2QA4Q 3G71Q 1YIJQ 1YJNQ 1NJIR 1YJ9Q 1KD1R 1YITQ 3CC7Q 3CXCP 3CMAQ 1M1KR 3CCJQ 1K9MR 3I55Q 1K73R 1QVFP 3CCSQ 1VQOQ 3CPWP 1KC8R 1VQNQ 3G6EQ 1VQPQ 3G4SQ 1VQ5Q 1VQLQ 1VQKQ
chains in the Genus database with same CATH superfamily
1YFNA 4LE9A 1Q81R 1FX7A 2VYTA 1I07A 2EQKA 1TUGB 4RUGA 4AT1B 1X2QA 4J9FA 3H41A 3NTHA 3X26B 3META 5C6SA 4HCCA 1M3CA 2KRSA 1BIBA 4BE0A 2HDAA 4HCBA 1OYXA 3IQLA 4Z88A 2XI9A 4A4HA 2GGRA 4EMKA 1VQLQ 3FEOA 3M59A 1SHFA 1ZBJA 4TVRA 3TREA 2NWMA 4MZPA 3ULRB 2AK5A 2H3JA 2JJ9A 3L2UA 2BIVA 3CD6Q 3OS1A 3DLMA 1V29B 2K57A 1PM3A 1CKBA 3S3OA 3X24B 1LOJA 2YSQA 3SB2A 2FZCB 5LJ3f 2FZKB 4AFZC 4FYVB 2KQWA 2JT4A 2OTJA 3WVEB 3OW2P 3N5BB 5GJVB 2DYIA 1VQMQ 2DTIA 3CXCS 3GF5A 4E7LA 1AHJB 2YWWA 1YITT 2NUTB 4KRTA 3G1JA 3CPWS 3GNFB 5GANh 3URGA 4Z89A 5CK9A 5DLOA 2DL7A 4M78C 1W6XA 1T0JA 3TQ7P 3OYJA 1BCMA 2X3WD 3LLRA 1Q82R 1Q86R 4M77B 1D3BB 2FHDA 1XQHA 4OF1A 1IZ6A 1WJSA 4F16A 4HCZA 3NTKA 1GFCA 2LT1A 1WIEA 1VQ8Q 3RKXA 3J7AF 1VIFA 1Q7YU 4L59A 2MK5A 3CEYA 3EG9B 1U3OA 1RUWA 5KYUB 1OOTA 1G3SA 3CC2T 4PJNA 4FSSA 1KC8C 3JB9G 2LQKA 2LT4A 4ELZC 2ZPBB 1W70A 1C1AA 1YIJA 3M0RA 5LJ5j 1WGSA 1ZQ1A 3TSZA 4ZTFA 4DBQA 4GBQA 5CIUA 2YUQA 2MPXC 4RTTA 3RKWA 4XTYA 4PLLA 1IRXA 2G3RA 2IG0A 2K7AA 1SRLA 3QWXX 3HPWA 1WNLA 1M1GA 1K8AR 2LP5A 2ED0A 1S72T 1QWEA 1JQQA 2F2WA 3OY9A 1ZLMA 3THKA 2RNAA 4JRIA 4FW2A 4M7DG 3ZEHA 2DLPA 3CCST 5KCOA 1D0ZA 3ASKA 3MP6A 1M4ZA 9ATCB 3I56T 2NUPB 1JEGA 2MMPA 2WSCE 3JSCA 1WLPB 1UFFA 4XQ3A 1U1SA 3M0QA 4UC4A 3CCRT 1Q81U 4BE1A 1LJOA 3A8LB 3HKSA 2WACA 3I55A 5A0LA 4C0FA 3NTIA 3M0UA 4MDXA 2YRDA 4M75B 5AT1B 2DD4A 4E2FB 1QVFA 3UA6A 2M1HA 2Y90A 5GANg 5GAN7 1C0MA 1ZBXA 2RHUA 3HRTA 4RCCA 3VU3C 1N6AA 2DXBA 2DEUA 4AG2C 1DJ7B 4OB2B 4JLIA 1QP3A 3QYGB 2HBPA 5CCAA 4EMGA 3C95A 4M7AC 2ED1A 1U8RA 1XNIA 2F5TX 2GBQA 1X43A 3JCMX 2GQVA 1VQKQ 2ROTA 5LJ3e 4Y91A 4RTZA 2JTMA 2RI5A 3CCVQ 2MIOA 3BY7A 4LDWA 4NL2A 1R8OB 2R5MA 3JCMh 5EG2A 4C92A 1GFDA 1H92A 2AKLA 4C5IA 2QGGA 3H0HA 3FDRA 5GAN8 3G71T 4DA4A 2EQIA 1TWBA 4DBFA 4D8DA 2ABLA 6AT1B 2M16A 2CP0A 2JUFA 1RAFB 4FT2A 5GAMj 1IB8A 2DXCA 5IT9E 1AEYA 3CCLQ 2EPDA 1HYOA 4QKUA 1Y71A 3SWNB 4FCYA 1VQ9T 3LGFA 2LTOA 3PTAA 2E5KA 1WHJA 1YHQT 4B9WA 2DYBA 4RKUE 5KYWB 1P92A 1Q82U 2PNIA 4HVVA 1Y07A 1VQNA 1V1CA 4PJOA 1BI0A 1K0SA 3CXCA 4N0AA 3QHSA 3MO8A 2CSQA 3CPWA 1GBQA 3V7SA 1YJWA 4XTVA 1X6GA 1QMCA 5CKEA 4FYXB 2HMAA 2A08A 3OYHA 3RBBB 1NEBA 1VQOA 1D0XA 1X2KA 1U06A 4KGXB 1VQ4A 1D1AA 3WXMB 1T3SA 5AYFA 3OB9A 1M27C 2IPOB 4M77A 4F7UB 3A8MB 3EH1A 2OAUA 2LZ6B 1IGUA 2HQEA 2OTJQ 5HKCA 1I5LA 2J7IA 4A4FA 4C92D 1IO6A 2J06A 2A37A 3DKMA 2DRKA 3QXEB 3QDRB 2DBKA 1K8AU 3VS2A 3M53A 5I2SA 2MAMA 1QLYA 1S1NA 3CC4A 2EYXA 4CC3A 2OTLA 5CVIA 2CT4A 4C8QG 2F1LA 2HKQB 4DQ2A 2I2LA 4F04B 4AFUC 5I22A 1PKTA 2DZ9A 3MP8A 4K11A 4XTUA 2HEQA 2LQNA 3G4SA 3JCMg 5I2MA 4PJOD 1M8MA 5EC7A 2J6FA 2GTJA 4Y28E 4DEYA 4ELYC 1WHLA 1SG5A 4QW2A 3OBWA 4QVCA 3CCMA 1OX9A 2DL8A 4EPCA 5HK3A 2ZPIB 1YI2T 1G8XA 3KBGA 2AIRB 3CCEA 5CO7A 4OMQA 2QA4T 1YIJQ 3H6ZA 2D8JA 4OMOA 2LC4A 3KFVA 1OEBA 1RLPC 3VS6A 4ORZA 4EMKB 4PFZA 4LDYA 2NUPA 2KDSA 2FPDA 3CCQT 2YUNA 4JPBW 1Y0MA 1ZSZA 2QTVA 5A2QE 1Q81C 1NBEB 4J9HA 1SSHA 2VGNA 1K9AA 2LMJA 4C0GA 1ABQA 1SKUB 2O31A 3T9NA 4OGCA 4X34A 3RR6A 4HVWA 2QQSA 1UB4A 3SHWA 4C0DC 2LDMA 3M4YA 2DMOA 3H0IA 4C5HA 4M75A 2ECZA 3SFMA 4R55A 4IUTA 1I81A 5LJ5d 3CBMA 3WVDB 2CREA 4LD6A 1NJIR 1YJ9Q 4JUVA 1BKBA 1RAIB 3QJ6A 3G6EA 1VQPA 2O01E 3I55Q 2J05A 2KT8A 4AFSC 4ZNXA 1RAHB 1QVGP 1H641 1K4US 2M9UA 1YNZA 4A4KA 2BZ8A 2J6KA 1EFNA 4QQ6A 4RTWA 2EW3A 2CDTA 1QVGS 4E7ZA 1G3TA 5C0MA 4LN2A 3RNJA 3EG3A 3UWNA 1JJ2S 2BZYA 8ATCB 1OULA 1O75A 5I11A 5HK0A 2JTEA 3OYFA 4WTOB 4PFOA 2DILA 1UECA 1NEGA 1Q86C 1Q82C 3M9QA 1MNEA 2D0NA 3LW5E 3QPHA 4Z8AA 3QWYA 4WF2A 5KYNA 2DVJA 2LJ0A 2LJ1A 2XDBA 2RD1A 3EFSA 3EGXB 2PZ1A 1VQLT 1VYUA 3JV3A 1SHGA 1KJWA 4L5GA 3C94A 2A3LA 2E12A 3CD6T 3ME9A 3OYEA 5LJ5f 4AFQC 1D0YA 3OYMA 1TOVA 4A54A 1CKAA 3OQ5A 3JB9D 1WA7A 1OPLA 3OBYA 1I0CA 3OSVA 3OYNA 2OAWA 2ZAEA 3JB9F 2OX7A 1VQNQ 1NYFA 2V1QA 3HRUA 4BE2A 3RMSA 4PFPA 4E7KA 1NM7A 3V8KA 1IGQA 4IIMA 5M9OA 2L89A 1VQMT 4YTLA 2BTTA 5CKBA 1YJWQ 3VV0A 4PJMA 1YJNQ 1K8AC 4IKFA 2FB7A 4CI0C 5GMKj 4CRIA 2EKHA 2O88A 3NPFA 3M58A 5GAMd 1VQOQ 1VQ7A 2KK4A 1WPYA 2RQRA 3JCMP 3JB9J 1B34A 1GCQA 2IVWA 1IHVA 1VQ4Q 4QQGA 3AT1B 4M7DF 2P0PA 3VYGA 1VQ8T 4ZN3A 4F14A 2C0TA 2D1XA 4KH1B 3UDCA 1J3TA 3RERA 3EG2A 3CCUA 1VQ5Q 2RJFA 1X6BA 3CC4Q 1ZUYA 2B86A 2OI3A 3L2QA 4J6XA 4ANJA 2OTLQ 4C92B 1Y96A 2K3BA 2DRMA 2EYWA 2K6DA 1UDLA 1C6VX 3LX7A 1YP5A 1Z9ZA 1M1KR 2FPFA 1NJIU 1ZX6A 3LWIA 1NG2A 2H8HA 1EIFA 1AD5A 3M57A 3MCAB 4M7DE 1YBYA 2M0OA 3TSWA 1MMDA 3CCMQ 4J9DA 1FMKA 3VS4A 1QCOA 2DFUA 3CCEQ 2KMTA 4A53A 4OMNA 5FU6B 3L2ZA 4DBHA 2KY9A 7AT1B 4PJOB 2X9HA 1WI7A 3QIIA 3I56A 1I5OB 4M78G 5GAMf 4M77C 2CP3A 3OMGA 1AZEA 2C0OA 2DF6A 2YUPA 2XD0A 2RQUA 2DNUA 2E70A 3H8ZA 4JJBA 5LJ3h 3U23A 1ACMB 3PVLA 1O9SA 3SEMA 5D7UA 4BDYA 3TCJA 3OW2S 4KT0E 2FVUA 1E6GA 2L3PA 3OMCA 4JS5A 2AZVA 2QQRA 3CBPA 4RTXA 5GAN6 4OB1B 2KVQG 5LJ5e 1JJ2A 2KEAA 1KQSP 2CH4A 3L1AA 1GL5A 4HA8A 2JMAA 3MEUA 1TUCA 2CZ0B 3D7SB 1MMNA 3H0FA 3VS3A 4WCIA 1VQKT 2RA2A 4PJJA 3G6EQ 1VQPQ 1VOMA 2RO0A 2EGAA 2M02A 3CCVT 1TSFA 2CH4W 3VS0A 5CAIA 2COYA 1KQSS 2GNCA 3FLGA 4X9DA 2GQIA 4XU0A 2K5IA 3G7ZA 3AHUA 2ZPGB 1OV3A 4J6WA 1QW1A 4R56A 1WHGA 3CMAA 3MKDA 1XOVA 2LCLA 5IHKA 2PQWA 2A28A 2X4JA 2CZ7B 3REAB 1N9SA 4F17A 2MOXA 3EGXA 4XAXB 3SD4A 1LCKA 5KYXA 1QWFA 3CCLT 3M54A 1PHTA 4E7JA 1YHQA 2KYMA 5D6XA 1PC0A 3S6WA 3CC7A 4Z02A 4C8QD 2RQVA 3X25B 2MCNA 4FT4A 4M75C 3E19A 1NE8A 2W10A 1G2BA 4C8QF 2PUOB 2AT1B 2RHZA 2DO3A 1BYMA 2H3EB 1B07A 1ZSZB 3ZFJA 1N5ZA 2Y4YA 1AOJA 3BDUA 2P4TA 2JM8A 5IXBA 2KYBA 2KE9A 3LH0A 2L0AA 2K2VA 2LNHB 2RHIA 3VS5A 2E65A 4BI4A 2ENMA 2RN8A 4M7AG 4KGZB 1K73R 2MWPA 2EQUA 5LJ3g 3O8VA 3PT9A 2X4YA 4MMKA 4MDWA 2QEXA 4NOYA 2OTJT 3QSUA 4NS5A 2JXBA 2NLUA 1ABOA 2K79A 5IN1A 4C8QE 2CP6A 3CPFA 3I5RA 2DK3A 4EMHA 2GTOA 1FYNA 5GAMe 5FROA 5GJWB 1VQ7Q 3M55A 3SWNC 4PK4A 1JXMA 2QGFB 1V76A 3QDFA 2DA9A 3EAEA 1I4K1 5GMKl 2KAFA 2E64A 1UGQB 3LYIA 4R0KA 4FM4B 3JCMb 4D6WA 1NJIC 4F7UG 2KROA 2X4WA 1M1FA 2EYQA 3CCUQ 3MPUB 3PGGA 4QT7A 2E3IA 2JM9A 1W2BP 1ZA2B 3HTRA 3NGPA 5FU7B 1AT1B 1YIJT 5FWBA 3GBQA 3P8HA 1Q86U 2KXCA 1BI3A 4LUDA 5A0DA 2FG0A 3HFNA 2HZYA 2QYZA 1XTDA 2O9SA 1K9MR 3GP8A 5GAN2 1W2BS 2BZXA 3NHNA 2XHCA 3PMIA 1I1JA 1MV0B 3UT1A 1FXXA 1BIAA 2LNVA 1U1TA 4DOWA 4JRPA 1RI0A 4FW1A 1N8RR 4JRQA 2COWA 1KK7A 5GANj 4ZN1A 1YN8A 2EYYA 1UGRB 4BI8B 4II1A 3DB3A 2PVDB 2DKGA 1LNXA 3I35A 2EBPA 2KR3A 3E2UA 3RIRA 2VV5A 2L3QA 3LWHA 2HSEB 4BY6B 1AWXA 4XTXA 2DL3A 4A63B 4AMCA 2HQHA 1PCXA 2EKOA 1OI1A 2DD5A 1YJ9T 2ESWA 1PKSA 5CKFA 3EFOA 1UE9A 3I55T 2YRCA 1ZA1B 2QG9B 1JRIA 3QZ9B 3L2RA 1B34B 3FJPA 1M90R 1F1BB 1Y57A 1E7OA 1YCSB 2W0ZA 2DTOA 3REBB 3PVQA 4LNPA 2IIMA 5FWCA 3O5ZA 3MP1A 3A8OB 4CC4B 1H3ZA 5KYYA 4OMLA 1RADB 2HL3A 3LGLA 2VXEA 5I21A 4EMKC 5HY6A 2PU9B 2P0KA 4VUBA 1YCYA 3EGDA 4C0ZA 2FEIA 2X51A 1K0XA 2KGTA 5J39A 1Y96B 1VQ6A 3RUXA 4XU1A 2EWNA 4J9IA 2RQTA 4L6V5 3CMAQ 4X1VA 3P8BB 3VJPA 1Q95G 2DJZA 2FYKA 3CD6A 5FW9A 1H3HA 4M4ZA 2DM1A 1WX6A 5HCKA 4O5VA 1WXBA 3PIOA 2DXUA 2YT6A 5IH2A 3GNGA 2B8AA 4N4HA 4FYWB 2XDPA 3CC7Q 3JCMe 1VIEA 3CMEA 1VQNT 4JZ3A 3C0CA 1M1KC 4FIBA 4O6JA 1YJWT 1TXQA 4C8QB 2VVKA 2RJEA 1YJNT 4C5GA 4Q5WA 5GAN5 3CCJA 3M4GA 1VQOT 1SSFA 2QQAA 2O4XA 1UHCA 1E6HA 1WZOA 3ER0A 2DBMA 1VQ4T 4M78D 2EJ9A 1VQ8A 1ZSGA 3F70A 2QEXQ 1SPKA 4HXJA 2JTFA 5FRMA 4M78F 2D8HA 2JS0A 2RK1A 2VB6A 3PMTA 1X01A 3OYIA 3HL8A 1N8RU 2PTKA 1VQ5T 4M7DA 2V8JA 3CC4T 2AHJB 1VA7A 4BUGA 1NZ9A 2OTLT 2MWOA 3EHRA 2RQWA 4DBRA 2PVOB 1TG0A 1GRIA 2GF7A 4KBMB 1YWOA 1JB0E 3BDLA 2LX7A 4QQDA 1KQ1A 2DL5A 4IUUA 1KHCA 5D6YA 4LXCA 5KYXB 5FRNA 3J80E 2K9GA 4QVDA 3CCMT 2DZCA 2KNBB 4M78E 1ZUKA 3DLLA 3CCET 2FRWA 1M90U 4HCKA 2K3YA 2XIDA 5GMKe 2EGEA 5LJ5h 2WSFE 2I0NA 3NMZC 3PIPA 4JRKA 4C92G 2BUDA 1R77A 4J83A 1Q7YR 2G6FX 3MHXA 1RAEB 2D6FA 2XKOC 1UUEA 1PD1A 1OZ3A 1WQ7A 2F69A 1I8FA 1YITA 1BI1A 4IUPA 4PNOA 2AZSA 1KD1R 4OB0B 2BKDN 1M3AA 3M0TA 5GAOn 4FU6A 3CQTA 1MMGA 1PSFA 4M7DD 4C92C 1QKWA 5KE2A 1MHNA 1WHMA 5J26A 2EQJA 3ZBDA 1RACB 4RTUA 2E41A 2LX9A 1RI9A 2RI3A 4PJOG 2QQ9A 3OYLA 1QVFP 2CYZB 3G6ET 1VQPT 3C12A 3CC2A 2L2PA 2O9VA 3VYHB 4M7AD 1D1BA 1K73C 2KRMA 2YDLA 2WSEE 2K2MA 2Z0WA 5GANd 5DM7R 2ZPEB 1OPKA 2DX1A 4M7AF 2K4YA 5FU6C 3L2WA 2VXFA 1QVFS 3OYDA 1X75C 2DIQA 4PJOC 1PG5B 3PNWC 1B7TA 1WXUA 3S3MA 4P5NA 4N0AC 5CQXA 3CCLA 2X35A 3G4SQ 1M8VA 4M77G 3INZA 2K5FA 1GCPA 1W4SA 2E6NA 3X28B 1S72A 2OJ2A 4OMFB 1VQ6Q 5CQYA 1M9SA 1HXDA 1M2OA 4C5EA 2DJQA 3CCSA 3QJYA 4LDUA 4CC7A 2X4XA 3PE0A 1T3LA 2QDYB 3OYCA 4LDVA 1HSQA 1LPLA 2P84A 2QXFA 4M7AE 2E3HA 1RAAB 2CP2A 3CCRA 5LJ5g 5GAMh 2LRQA 2YLCA 3MEWA 2E6ZA 2JOYA 4J6YA 4C8QA 4JJDA 1MNDA 3FJ5A 4F7UF 1QKXA 3CXCP 2ZPFB 3CPWP 2LQ8A 2HD0A 3JAME 3CMEQ 2K5LA 1K9MC 2EGCA 1K76A 2C0IA 1JBMA 2QTXA 5GMKi 5GANf 1QVGA 2AKKA 3JCMc 2P4RA 3DB4A 3QUIA 2ZPHB 5LL6S 2RJDA 2EIFA 5GAN4 3EFOB 4XU2A 5KE3A 1N8RC 1UGSB 2XICA 2CUBA 2FRYA 4BACA 3JCMV 3CCJQ 1NLPC 2XK0A 4LUEA 5DY9A 1VQ7T 1RABB 2ROLA 3GPLA 3SDZA 4MMLA 2DXTA 3BFMA 3RESA 3JB9H 5GAN3 3G71A 3OA6A 4F7UE 2DIGA 3H9NA 4B6MA 3P8DA 5KYYB 5KH6A 5GAOq 4E7IA 1AWJA 1RL2A 4HT8A 1KHIA 2FO0A 4M75G 1Z9QA 1NYGA 5CKDA 1KFZA 2CZ6B 1JO8A 3CCUT 1KD1U 2MF2A 1ZSZC 2HQXA 4M78B 1UJ0A 1VQ9A 3EGDB 3RMQA 4AG1C 3RKYA 2J6OA 2DVEA 3A8GB 4HKEA 4KUDK 1M90C 1NPPA 4ME7A 2JNGA 3JCMd 1WDXA 4JJCA 3OS0A 2RK2A 1KSWA 3I9QA 5L8RE 4IURA 2HCKA 2YLBA 2VWFA 1UTIA 2F2VA 4MZTA 1BBZA 2QI2A 3S3NA 2BE9B 5J3BA 1TU0B 1QVPA 1M2VA 3J81E 4J9BA 3VS1A 3FC3A 1W1FA 3V8JA 2CGHA 1TS9A 5GAMg 1T0HA 2V8IA 1SF9A 3NFCA 2F2XA 1PRLC 1TTHB 2CP5A 4PJLA 1UGPB 1M1KU 3QKJA 1YJ9A 1PD0A 1NLOC 2CZ1B 1YITQ 4M7DC 4E47A 5KCHA 2BE7D 4A4GA 1A0NB 1X69A 4FYYB 3OYKA 3JCMW 5GAOr 4OB3B 2O4XB 2VC8A 4N4IA 2FZGB 3FRNA 2DL4A 8AT1B 1WFWA 2EJGA 2XU8A 4RTVA 3M56A 3QZ5B 1UG1A 3UF4A 2GFAA 3A8HB 5FU7C 2R5AA 5IXFA 5GMKm 5ECAA 3A98A 3A5ZB 1X6OA 3MEVA 3V7CA 3OS5A 3HFOA 4KH0B 2EQMA 4B9XA 4ZTJA 4ZGJB 4GLKA 2DPPB 4PL6A 5IAYA 3C4SA 3JCMf 4HT9A 4M7DB 1EX4A 2EVRA 2V8KA 3M5AA 3E9FA 1QCFA 4PKCC 1YI2A 2F5KA 3CC2Q 2YRVA 1PNJA 4IIOA 2FL7A 5GANe 4N4GA 2QA4A 2LJ3A 2L3SA 1MV3A 4RTYA 4LD9K 5IHIA 3CMAT 3OS2A 4E7HA 4BY6C 3TEEA 1OU9A 4J8OA 4M7AB 4BDZA 2LCCA 2DE0X 3CCQA 5LJ3j 2JW4A 4RMOA 2L5QA 1TUDA 4XU3A 1G3WA 2QK0A 3HP9A 1S72Q 1WYXA 1CSKA 1PRMC 2E10A 1G3YA 2L8DA 2VGMA 3OW2A 2JZ2A 4X9CA 1IHWA 1SEMA 1BCOA 3CC7T 3EH2A 3V8LA 2NUZA 1M5Q1 1OQKA 3VUZA 3LH5A 3CCSQ 1GCQC 4E6RA 4J9CA 3I56Q 3MEAA 2RH2A 3HRSA 2RHXA 1BK2A 1PWTA 1Y7XA 1YJNA 3X20B 2HBWA 2JS2A 3R6OA 4EDUA 2EFIA 3CCRQ 3EGUA 2NUTA 2D9TA 2KI7A 2A0FB 3Q1JA 1KG1A 1KQSA 3MJXA 5DLQE 3JCMJ 3GIBA 1IREB 1KC8R 3HSBA 1KQ2A 4JJNK 2A36A 1OU8A 1FMVA 1MGQA 3EFRA 3TU4K 1AWWA 1D3BA 1QQJA 4RG2A 4XTWA 2QEXT 4LDXA 4MZMA 1Q7YC 4ZGDB 2HNIA 2XMFA 3PFSA 2X3XD 2KRNA 4C92F 1VQ5A 5FLXE 1HK9A 3FB9A 3EG9A 1R0BG 1KD1C 5KYUA 1PSEA 2GFUA 1LVKA 5GMKh 1X27A 4M78A 1K73U 2K3XA 3GOXA 5L23A 4EIKA 3TVTA 1BB9A 2VASA 2RB6A 1AZGB 1JXOA 3G71Q 2A7YA 3QBYA 1U5SA 4DEXA 3V7RA 1VQLA 1QP2A 2FPEA 2YHTA 4JZ4A 3OYBA 3M0SA 4J7FA 2O2OA 1MMAA 4ATOA 1HD3A 2EYZA 2ZZDA 4ZGEB 2QASA 3QO3A 4PJOF 5GAOm 4OVAA 4JDSA 3KXTA 4C8QC 1VQ9Q 2ZCFB 2RF0A 5IHNA 5GAOl 1YHQQ 4C92E 2HSPA 3KUFA 1MUZA 3VKIA 3JB9I 1KIKA 5CKHA 3M0PA 1NPRA 2RM4A 1XJWB 4OP0A 2M0YA 2LVMA 4NL3A 3UA7A 1QCNA 1G83A 1VYTA 2MI6A 2COZA 1VQMA 1OZ2A 4M77D 3QG1A 1TH7A 2E1HA 3E1SA 2CKKA 3VS7A 1AVZC 4BI3A 2NYSA 2CS7A 3A1PA 4M77F 4BB7A 1FMWA 3EHQA 1K1ZA 1N27A 2R57A 2DERA 2SEMA 1RLQC 4J5YA 4PJOE 1M30A 2E4HA 2D0QB 2LCSA 1UEBA 3GLXA 3HHTB 4FL6A 4OMMA 2KXDA 3UATA 1K9MU 3L2VA 4JLGA 3R6NA 3VUBA 2JVVA 3JCMQ 4J9GA 4DOVA 1JU5C 1ARKA 2SRCA 2V26A 4QVZA 2HAXA 1ZHIA 2RPNA 2CSIA 3JRZA 4C0DB 2DEQA 5A0GA 4JS4A 4KULA 1JJ2P 4J7IA 3RDVA 2DTHA 2RMOA 4PLIA 5GAOp 3I5SA 2KSSA 4GY5A 1M3BA 2DAQA 4M77E 3CBOA 1W2BA 2RI2A 4KUIA 3VRYA 2QAZA 2P0QA 3UPUA 1UGVA 4Y92A 1IXDA 3G4ST 1WHHA 2EJFA 3BW1A 4M7AA 4A4EA 4E7SA 3FIFA 1WXTA 1B3QA 1YWPA 3SWNA 2HL5C 2XDDA 3VRZA 1YI2Q 1KC8U 4RG8A 1VQ6T 4OGEA 1EZZB 5KYWA 2QA4Q 1WQWA 2L3RA 4OMPA 2MYSA 2VUBA 2E5QA 1H8KA 1R0CB 3EG1A 3BE3A 1FWZA 1ZUUA 1WJRA 1GBRA 3OYYA 4M75D 3E9GA 3OSSC 1D1CA 2VKNA 2Y4XA 2KT1A 2LQWA 2PVGB 1AWOA 2EAYA 3CCQQ 2PUKB 4M75F 1HJDA 4IUQA 1M2VB 4RCBA 4V2SA 2DETA 4CC2A 1WJQA 2KBTA 2C06A 3EG0A 2JN0A 4J9EA 3CMET 1SRMA 2M51A 2RHYA 2CP7A 1D09B 4BD3A 1OX8A 2YUOA 2CUDA 2R58A 4IUVA 4F7UA 1VYVA 4FSXA 2GCXA 2XG8D 2CT3A 3ZL7C 2QQBA 1BU1A 3QYHB 3CCJT 1UJYA 1VQKA 4KGVB 1N9RA 5D6WA 4ESRA 5LJ3d 3CCVA 1WHKA 4XTZA 2ZGWA 2JMCA 2V1RA 2RJCA 4M75E 3L42A 5CR2A 2ATCB 3OYGA 2QDLA 4XK8E 2HKNA 1UHFA 4D8KA 1VUBA 1GXIE 1G5VA 2YXYA 3OYAA 4GLMA 4HVUA 1RAGB 1BI2A
chains in the Genus database with same CATH topology
3I56Q 1VQ7Q 3CC4Q 3CMEQ 1Q81R 1Q86R 3CCUQ 1Q82R 1QVGP 3CC2Q 1Q7YR 3CCLQ 3CCVQ 1M90R 1VQ4Q 1JJ2P 2OTLQ 3OW2P 3CCQQ 1W2BP 1VQ9Q 1K8AR 1YI2Q 2OTJQ 3CD6Q 3CCMQ 1N8RR 2QEXQ 1VQMQ 1S72Q 1YJWQ 1YHQQ 3CCRQ 1VQ6Q 1KQSP 3CCEQ 1VQ8Q 2QA4Q 3G71Q 1YIJQ 1YJNQ 1NJIR 1YJ9Q 1KD1R 1YITQ 3CC7Q 3CXCP 3CMAQ 1M1KR 3CCJQ 1K9MR 3I55Q 1K73R 1QVFP 3CCSQ 1VQOQ 3CPWP 1KC8R 1VQNQ 3G6EQ 1VQPQ 3G4SQ 1VQ5Q 1VQLQ 1VQKQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I56 Q;  1VQ7 Q;  3CC4 Q;  3CME Q;  1Q81 R;  1Q86 R;  3CCU Q;  1Q82 R;  1QVG P;  3CC2 Q;  1Q7Y R;  3CCL Q;  3CCV Q;  1M90 R;  1VQ4 Q;  1JJ2 P;  2OTL Q;  3OW2 P;  3CCQ Q;  1W2B P;  1VQ9 Q;  1K8A R;  1YI2 Q;  2OTJ Q;  3CD6 Q;  3CCM Q;  1N8R R;  2QEX Q;  1VQM Q;  1S72 Q;  1YJW Q;  1YHQ Q;  3CCR Q;  1VQ6 Q;  1KQS P;  3CCE Q;  1VQ8 Q;  2QA4 Q;  3G71 Q;  1YIJ Q;  1YJN Q;  1NJI R;  1YJ9 Q;  1KD1 R;  1YIT Q;  3CC7 Q;  3CXC P;  3CMA Q;  1M1K R;  3CCJ Q;  1K9M R;  3I55 Q;  1K73 R;  1QVF P;  3CCS Q;  1VQO Q;  3CPW P;  1KC8 R;  1VQN Q;  3G6E Q;  1VQP Q;  3G4S Q;  1VQ5 Q;  1VQL Q;  1VQK Q; 
#chains in the Genus database with same CATH topology
 1YFN A;  4LE9 A;  1Q81 R;  1FX7 A;  2VYT A;  1I07 A;  2EQK A;  1TUG B;  4RUG A;  4AT1 B;  1X2Q A;  4J9F A;  3H41 A;  3NTH A;  3X26 B;  3MET A;  5C6S A;  4HCC A;  1M3C A;  2KRS A;  1BIB A;  4BE0 A;  2HDA A;  4HCB A;  1OYX A;  3IQL A;  4Z88 A;  2XI9 A;  4A4H A;  2GGR A;  4EMK A;  1VQL Q;  3FEO A;  3M59 A;  1SHF A;  1ZBJ A;  4TVR A;  3TRE A;  2NWM A;  4MZP A;  3ULR B;  2AK5 A;  2H3J A;  2JJ9 A;  3L2U A;  2BIV A;  3CD6 Q;  3OS1 A;  3DLM A;  1V29 B;  2K57 A;  1PM3 A;  1CKB A;  3S3O A;  3X24 B;  1LOJ A;  2YSQ A;  3SB2 A;  2FZC B;  5LJ3 f;  2FZK B;  4AFZ C;  4FYV B;  2KQW A;  2JT4 A;  2OTJ A;  3WVE B;  3OW2 P;  3N5B B;  5GJV B;  2DYI A;  1VQM Q;  2DTI A;  3CXC S;  3GF5 A;  4E7L A;  1AHJ B;  2YWW A;  1YIT T;  2NUT B;  4KRT A;  3G1J A;  3CPW S;  3GNF B;  5GAN h;  3URG A;  4Z89 A;  5CK9 A;  5DLO A;  2DL7 A;  4M78 C;  1W6X A;  1T0J A;  3TQ7 P;  3OYJ A;  1BCM A;  2X3W D;  3LLR A;  1Q82 R;  1Q86 R;  4M77 B;  1D3B B;  2FHD A;  1XQH A;  4OF1 A;  1IZ6 A;  1WJS A;  4F16 A;  4HCZ A;  3NTK A;  1GFC A;  2LT1 A;  1WIE A;  1VQ8 Q;  3RKX A;  3J7A F;  1VIF A;  1Q7Y U;  4L59 A;  2MK5 A;  3CEY A;  3EG9 B;  1U3O A;  1RUW A;  5KYU B;  1OOT A;  1G3S A;  3CC2 T;  4PJN A;  4FSS A;  1KC8 C;  3JB9 G;  2LQK A;  2LT4 A;  4ELZ C;  2ZPB B;  1W70 A;  1C1A A;  1YIJ A;  3M0R A;  5LJ5 j;  1WGS A;  1ZQ1 A;  3TSZ A;  4ZTF A;  4DBQ A;  4GBQ A;  5CIU A;  2YUQ A;  2MPX C;  4RTT A;  3RKW A;  4XTY A;  4PLL A;  1IRX A;  2G3R A;  2IG0 A;  2K7A A;  1SRL A;  3QWX X;  3HPW A;  1WNL A;  1M1G A;  1K8A R;  2LP5 A;  2ED0 A;  1S72 T;  1QWE A;  1JQQ A;  2F2W A;  3OY9 A;  1ZLM A;  3THK A;  2RNA A;  4JRI A;  4FW2 A;  4M7D G;  3ZEH A;  2DLP A;  3CCS T;  5KCO A;  1D0Z A;  3ASK A;  3MP6 A;  1M4Z A;  9ATC B;  3I56 T;  2NUP B;  1JEG A;  2MMP A;  2WSC E;  3JSC A;  1WLP B;  1UFF A;  4XQ3 A;  1U1S A;  3M0Q A;  4UC4 A;  3CCR T;  1Q81 U;  4BE1 A;  1LJO A;  3A8L B;  3HKS A;  2WAC A;  3I55 A;  5A0L A;  4C0F A;  3NTI A;  3M0U A;  4MDX A;  2YRD A;  4M75 B;  5AT1 B;  2DD4 A;  4E2F B;  1QVF A;  3UA6 A;  2M1H A;  2Y90 A;  5GAN g;  5GAN 7;  1C0M A;  1ZBX A;  2RHU A;  3HRT A;  4RCC A;  3VU3 C;  1N6A A;  2DXB A;  2DEU A;  4AG2 C;  1DJ7 B;  4OB2 B;  4JLI A;  1QP3 A;  3QYG B;  2HBP A;  5CCA A;  4EMG A;  3C95 A;  4M7A C;  2ED1 A;  1U8R A;  1XNI A;  2F5T X;  2GBQ A;  1X43 A;  3JCM X;  2GQV A;  1VQK Q;  2ROT A;  5LJ3 e;  4Y91 A;  4RTZ A;  2JTM A;  2RI5 A;  3CCV Q;  2MIO A;  3BY7 A;  4LDW A;  4NL2 A;  1R8O B;  2R5M A;  3JCM h;  5EG2 A;  4C92 A;  1GFD A;  1H92 A;  2AKL A;  4C5I A;  2QGG A;  3H0H A;  3FDR A;  5GAN 8;  3G71 T;  4DA4 A;  2EQI A;  1TWB A;  4DBF A;  4D8D A;  2ABL A;  6AT1 B;  2M16 A;  2CP0 A;  2JUF A;  1RAF B;  4FT2 A;  5GAM j;  1IB8 A;  2DXC A;  5IT9 E;  1AEY A;  3CCL Q;  2EPD A;  1HYO A;  4QKU A;  1Y71 A;  3SWN B;  4FCY A;  1VQ9 T;  3LGF A;  2LTO A;  3PTA A;  2E5K A;  1WHJ A;  1YHQ T;  4B9W A;  2DYB A;  4RKU E;  5KYW B;  1P92 A;  1Q82 U;  2PNI A;  4HVV A;  1Y07 A;  1VQN A;  1V1C A;  4PJO A;  1BI0 A;  1K0S A;  3CXC A;  4N0A A;  3QHS A;  3MO8 A;  2CSQ A;  3CPW A;  1GBQ A;  3V7S A;  1YJW A;  4XTV A;  1X6G A;  1QMC A;  5CKE A;  4FYX B;  2HMA A;  2A08 A;  3OYH A;  3RBB B;  1NEB A;  1VQO A;  1D0X A;  1X2K A;  1U06 A;  4KGX B;  1VQ4 A;  1D1A A;  3WXM B;  1T3S A;  5AYF A;  3OB9 A;  1M27 C;  2IPO B;  4M77 A;  4F7U B;  3A8M B;  3EH1 A;  2OAU A;  2LZ6 B;  1IGU A;  2HQE A;  2OTJ Q;  5HKC A;  1I5L A;  2J7I A;  4A4F A;  4C92 D;  1IO6 A;  2J06 A;  2A37 A;  3DKM A;  2DRK A;  3QXE B;  3QDR B;  2DBK A;  1K8A U;  3VS2 A;  3M53 A;  5I2S A;  2MAM A;  1QLY A;  1S1N A;  3CC4 A;  2EYX A;  4CC3 A;  2OTL A;  5CVI A;  2CT4 A;  4C8Q G;  2F1L A;  2HKQ B;  4DQ2 A;  2I2L A;  4F04 B;  4AFU C;  5I22 A;  1PKT A;  2DZ9 A;  3MP8 A;  4K11 A;  4XTU A;  2HEQ A;  2LQN A;  3G4S A;  3JCM g;  5I2M A;  4PJO D;  1M8M A;  5EC7 A;  2J6F A;  2GTJ A;  4Y28 E;  4DEY A;  4ELY C;  1WHL A;  1SG5 A;  4QW2 A;  3OBW A;  4QVC A;  3CCM A;  1OX9 A;  2DL8 A;  4EPC A;  5HK3 A;  2ZPI B;  1YI2 T;  1G8X A;  3KBG A;  2AIR B;  3CCE A;  5CO7 A;  4OMQ A;  2QA4 T;  1YIJ Q;  3H6Z A;  2D8J A;  4OMO A;  2LC4 A;  3KFV A;  1OEB A;  1RLP C;  3VS6 A;  4ORZ A;  4EMK B;  4PFZ A;  4LDY A;  2NUP A;  2KDS A;  2FPD A;  3CCQ T;  2YUN A;  4JPB W;  1Y0M A;  1ZSZ A;  2QTV A;  5A2Q E;  1Q81 C;  1NBE B;  4J9H A;  1SSH A;  2VGN A;  1K9A A;  2LMJ A;  4C0G A;  1ABQ A;  1SKU B;  2O31 A;  3T9N A;  4OGC A;  4X34 A;  3RR6 A;  4HVW A;  2QQS A;  1UB4 A;  3SHW A;  4C0D C;  2LDM A;  3M4Y A;  2DMO A;  3H0I A;  4C5H A;  4M75 A;  2ECZ A;  3SFM A;  4R55 A;  4IUT A;  1I81 A;  5LJ5 d;  3CBM A;  3WVD B;  2CRE A;  4LD6 A;  1NJI R;  1YJ9 Q;  4JUV A;  1BKB A;  1RAI B;  3QJ6 A;  3G6E A;  1VQP A;  2O01 E;  3I55 Q;  2J05 A;  2KT8 A;  4AFS C;  4ZNX A;  1RAH B;  1QVG P;  1H64 1;  1K4U S;  2M9U A;  1YNZ A;  4A4K A;  2BZ8 A;  2J6K A;  1EFN A;  4QQ6 A;  4RTW A;  2EW3 A;  2CDT A;  1QVG S;  4E7Z A;  1G3T A;  5C0M A;  4LN2 A;  3RNJ A;  3EG3 A;  3UWN A;  1JJ2 S;  2BZY A;  8ATC B;  1OUL A;  1O75 A;  5I11 A;  5HK0 A;  2JTE A;  3OYF A;  4WTO B;  4PFO A;  2DIL A;  1UEC A;  1NEG A;  1Q86 C;  1Q82 C;  3M9Q A;  1MNE A;  2D0N A;  3LW5 E;  3QPH A;  4Z8A A;  3QWY A;  4WF2 A;  5KYN A;  2DVJ A;  2LJ0 A;  2LJ1 A;  2XDB A;  2RD1 A;  3EFS A;  3EGX B;  2PZ1 A;  1VQL T;  1VYU A;  3JV3 A;  1SHG A;  1KJW A;  4L5G A;  3C94 A;  2A3L A;  2E12 A;  3CD6 T;  3ME9 A;  3OYE A;  5LJ5 f;  4AFQ C;  1D0Y A;  3OYM A;  1TOV A;  4A54 A;  1CKA A;  3OQ5 A;  3JB9 D;  1WA7 A;  1OPL A;  3OBY A;  1I0C A;  3OSV A;  3OYN A;  2OAW A;  2ZAE A;  3JB9 F;  2OX7 A;  1VQN Q;  1NYF A;  2V1Q A;  3HRU A;  4BE2 A;  3RMS A;  4PFP A;  4E7K A;  1NM7 A;  3V8K A;  1IGQ A;  4IIM A;  5M9O A;  2L89 A;  1VQM T;  4YTL A;  2BTT A;  5CKB A;  1YJW Q;  3VV0 A;  4PJM A;  1YJN Q;  1K8A C;  4IKF A;  2FB7 A;  4CI0 C;  5GMK j;  4CRI A;  2EKH A;  2O88 A;  3NPF A;  3M58 A;  5GAM d;  1VQO Q;  1VQ7 A;  2KK4 A;  1WPY A;  2RQR A;  3JCM P;  3JB9 J;  1B34 A;  1GCQ A;  2IVW A;  1IHV A;  1VQ4 Q;  4QQG A;  3AT1 B;  4M7D F;  2P0P A;  3VYG A;  1VQ8 T;  4ZN3 A;  4F14 A;  2C0T A;  2D1X A;  4KH1 B;  3UDC A;  1J3T A;  3RER A;  3EG2 A;  3CCU A;  1VQ5 Q;  2RJF A;  1X6B A;  3CC4 Q;  1ZUY A;  2B86 A;  2OI3 A;  3L2Q A;  4J6X A;  4ANJ A;  2OTL Q;  4C92 B;  1Y96 A;  2K3B A;  2DRM A;  2EYW A;  2K6D A;  1UDL A;  1C6V X;  3LX7 A;  1YP5 A;  1Z9Z A;  1M1K R;  2FPF A;  1NJI U;  1ZX6 A;  3LWI A;  1NG2 A;  2H8H A;  1EIF A;  1AD5 A;  3M57 A;  3MCA B;  4M7D E;  1YBY A;  2M0O A;  3TSW A;  1MMD A;  3CCM Q;  4J9D A;  1FMK A;  3VS4 A;  1QCO A;  2DFU A;  3CCE Q;  2KMT A;  4A53 A;  4OMN A;  5FU6 B;  3L2Z A;  4DBH A;  2KY9 A;  7AT1 B;  4PJO B;  2X9H A;  1WI7 A;  3QII A;  3I56 A;  1I5O B;  4M78 G;  5GAM f;  4M77 C;  2CP3 A;  3OMG A;  1AZE A;  2C0O A;  2DF6 A;  2YUP A;  2XD0 A;  2RQU A;  2DNU A;  2E70 A;  3H8Z A;  4JJB A;  5LJ3 h;  3U23 A;  1ACM B;  3PVL A;  1O9S A;  3SEM A;  5D7U A;  4BDY A;  3TCJ A;  3OW2 S;  4KT0 E;  2FVU A;  1E6G A;  2L3P A;  3OMC A;  4JS5 A;  2AZV A;  2QQR A;  3CBP A;  4RTX A;  5GAN 6;  4OB1 B;  2KVQ G;  5LJ5 e;  1JJ2 A;  2KEA A;  1KQS P;  2CH4 A;  3L1A A;  1GL5 A;  4HA8 A;  2JMA A;  3MEU A;  1TUC A;  2CZ0 B;  3D7S B;  1MMN A;  3H0F A;  3VS3 A;  4WCI A;  1VQK T;  2RA2 A;  4PJJ A;  3G6E Q;  1VQP Q;  1VOM A;  2RO0 A;  2EGA A;  2M02 A;  3CCV T;  1TSF A;  2CH4 W;  3VS0 A;  5CAI A;  2COY A;  1KQS S;  2GNC A;  3FLG A;  4X9D A;  2GQI A;  4XU0 A;  2K5I A;  3G7Z A;  3AHU A;  2ZPG B;  1OV3 A;  4J6W A;  1QW1 A;  4R56 A;  1WHG A;  3CMA A;  3MKD A;  1XOV A;  2LCL A;  5IHK A;  2PQW A;  2A28 A;  2X4J A;  2CZ7 B;  3REA B;  1N9S A;  4F17 A;  2MOX A;  3EGX A;  4XAX B;  3SD4 A;  1LCK A;  5KYX A;  1QWF A;  3CCL T;  3M54 A;  1PHT A;  4E7J A;  1YHQ A;  2KYM A;  5D6X A;  1PC0 A;  3S6W A;  3CC7 A;  4Z02 A;  4C8Q D;  2RQV A;  3X25 B;  2MCN A;  4FT4 A;  4M75 C;  3E19 A;  1NE8 A;  2W10 A;  1G2B A;  4C8Q F;  2PUO B;  2AT1 B;  2RHZ A;  2DO3 A;  1BYM A;  2H3E B;  1B07 A;  1ZSZ B;  3ZFJ A;  1N5Z A;  2Y4Y A;  1AOJ A;  3BDU A;  2P4T A;  2JM8 A;  5IXB A;  2KYB A;  2KE9 A;  3LH0 A;  2L0A A;  2K2V A;  2LNH B;  2RHI A;  3VS5 A;  2E65 A;  4BI4 A;  2ENM A;  2RN8 A;  4M7A G;  4KGZ B;  1K73 R;  2MWP A;  2EQU A;  5LJ3 g;  3O8V A;  3PT9 A;  2X4Y A;  4MMK A;  4MDW A;  2QEX A;  4NOY A;  2OTJ T;  3QSU A;  4NS5 A;  2JXB A;  2NLU A;  1ABO A;  2K79 A;  5IN1 A;  4C8Q E;  2CP6 A;  3CPF A;  3I5R A;  2DK3 A;  4EMH A;  2GTO A;  1FYN A;  5GAM e;  5FRO A;  5GJW B;  1VQ7 Q;  3M55 A;  3SWN C;  4PK4 A;  1JXM A;  2QGF B;  1V76 A;  3QDF A;  2DA9 A;  3EAE A;  1I4K 1;  5GMK l;  2KAF A;  2E64 A;  1UGQ B;  3LYI A;  4R0K A;  4FM4 B;  3JCM b;  4D6W A;  1NJI C;  4F7U G;  2KRO A;  2X4W A;  1M1F A;  2EYQ A;  3CCU Q;  3MPU B;  3PGG A;  4QT7 A;  2E3I A;  2JM9 A;  1W2B P;  1ZA2 B;  3HTR A;  3NGP A;  5FU7 B;  1AT1 B;  1YIJ T;  5FWB A;  3GBQ A;  3P8H A;  1Q86 U;  2KXC A;  1BI3 A;  4LUD A;  5A0D A;  2FG0 A;  3HFN A;  2HZY A;  2QYZ A;  1XTD A;  2O9S A;  1K9M R;  3GP8 A;  5GAN 2;  1W2B S;  2BZX A;  3NHN A;  2XHC A;  3PMI A;  1I1J A;  1MV0 B;  3UT1 A;  1FXX A;  1BIA A;  2LNV A;  1U1T A;  4DOW A;  4JRP A;  1RI0 A;  4FW1 A;  1N8R R;  4JRQ A;  2COW A;  1KK7 A;  5GAN j;  4ZN1 A;  1YN8 A;  2EYY A;  1UGR B;  4BI8 B;  4II1 A;  3DB3 A;  2PVD B;  2DKG A;  1LNX A;  3I35 A;  2EBP A;  2KR3 A;  3E2U A;  3RIR A;  2VV5 A;  2L3Q A;  3LWH A;  2HSE B;  4BY6 B;  1AWX A;  4XTX A;  2DL3 A;  4A63 B;  4AMC A;  2HQH A;  1PCX A;  2EKO A;  1OI1 A;  2DD5 A;  1YJ9 T;  2ESW A;  1PKS A;  5CKF A;  3EFO A;  1UE9 A;  3I55 T;  2YRC A;  1ZA1 B;  2QG9 B;  1JRI A;  3QZ9 B;  3L2R A;  1B34 B;  3FJP A;  1M90 R;  1F1B B;  1Y57 A;  1E7O A;  1YCS B;  2W0Z A;  2DTO A;  3REB B;  3PVQ A;  4LNP A;  2IIM A;  5FWC A;  3O5Z A;  3MP1 A;  3A8O B;  4CC4 B;  1H3Z A;  5KYY A;  4OML A;  1RAD B;  2HL3 A;  3LGL A;  2VXE A;  5I21 A;  4EMK C;  5HY6 A;  2PU9 B;  2P0K A;  4VUB A;  1YCY A;  3EGD A;  4C0Z A;  2FEI A;  2X51 A;  1K0X A;  2KGT A;  5J39 A;  1Y96 B;  1VQ6 A;  3RUX A;  4XU1 A;  2EWN A;  4J9I A;  2RQT A;  4L6V 5;  3CMA Q;  4X1V A;  3P8B B;  3VJP A;  1Q95 G;  2DJZ A;  2FYK A;  3CD6 A;  5FW9 A;  1H3H A;  4M4Z A;  2DM1 A;  1WX6 A;  5HCK A;  4O5V A;  1WXB A;  3PIO A;  2DXU A;  2YT6 A;  5IH2 A;  3GNG A;  2B8A A;  4N4H A;  4FYW B;  2XDP A;  3CC7 Q;  3JCM e;  1VIE A;  3CME A;  1VQN T;  4JZ3 A;  3C0C A;  1M1K C;  4FIB A;  4O6J A;  1YJW T;  1TXQ A;  4C8Q B;  2VVK A;  2RJE A;  1YJN T;  4C5G A;  4Q5W A;  5GAN 5;  3CCJ A;  3M4G A;  1VQO T;  1SSF A;  2QQA A;  2O4X A;  1UHC A;  1E6H A;  1WZO A;  3ER0 A;  2DBM A;  1VQ4 T;  4M78 D;  2EJ9 A;  1VQ8 A;  1ZSG A;  3F70 A;  2QEX Q;  1SPK A;  4HXJ A;  2JTF A;  5FRM A;  4M78 F;  2D8H A;  2JS0 A;  2RK1 A;  2VB6 A;  3PMT A;  1X01 A;  3OYI A;  3HL8 A;  1N8R U;  2PTK A;  1VQ5 T;  4M7D A;  2V8J A;  3CC4 T;  2AHJ B;  1VA7 A;  4BUG A;  1NZ9 A;  2OTL T;  2MWO A;  3EHR A;  2RQW A;  4DBR A;  2PVO B;  1TG0 A;  1GRI A;  2GF7 A;  4KBM B;  1YWO A;  1JB0 E;  3BDL A;  2LX7 A;  4QQD A;  1KQ1 A;  2DL5 A;  4IUU A;  1KHC A;  5D6Y A;  4LXC A;  5KYX B;  5FRN A;  3J80 E;  2K9G A;  4QVD A;  3CCM T;  2DZC A;  2KNB B;  4M78 E;  1ZUK A;  3DLL A;  3CCE T;  2FRW A;  1M90 U;  4HCK A;  2K3Y A;  2XID A;  5GMK e;  2EGE A;  5LJ5 h;  2WSF E;  2I0N A;  3NMZ C;  3PIP A;  4JRK A;  4C92 G;  2BUD A;  1R77 A;  4J83 A;  1Q7Y R;  2G6F X;  3MHX A;  1RAE B;  2D6F A;  2XKO C;  1UUE A;  1PD1 A;  1OZ3 A;  1WQ7 A;  2F69 A;  1I8F A;  1YIT A;  1BI1 A;  4IUP A;  4PNO A;  2AZS A;  1KD1 R;  4OB0 B;  2BKD N;  1M3A A;  3M0T A;  5GAO n;  4FU6 A;  3CQT A;  1MMG A;  1PSF A;  4M7D D;  4C92 C;  1QKW A;  5KE2 A;  1MHN A;  1WHM A;  5J26 A;  2EQJ A;  3ZBD A;  1RAC B;  4RTU A;  2E41 A;  2LX9 A;  1RI9 A;  2RI3 A;  4PJO G;  2QQ9 A;  3OYL A;  1QVF P;  2CYZ B;  3G6E T;  1VQP T;  3C12 A;  3CC2 A;  2L2P A;  2O9V A;  3VYH B;  4M7A D;  1D1B A;  1K73 C;  2KRM A;  2YDL A;  2WSE E;  2K2M A;  2Z0W A;  5GAN d;  5DM7 R;  2ZPE B;  1OPK A;  2DX1 A;  4M7A F;  2K4Y A;  5FU6 C;  3L2W A;  2VXF A;  1QVF S;  3OYD A;  1X75 C;  2DIQ A;  4PJO C;  1PG5 B;  3PNW C;  1B7T A;  1WXU A;  3S3M A;  4P5N A;  4N0A C;  5CQX A;  3CCL A;  2X35 A;  3G4S Q;  1M8V A;  4M77 G;  3INZ A;  2K5F A;  1GCP A;  1W4S A;  2E6N A;  3X28 B;  1S72 A;  2OJ2 A;  4OMF B;  1VQ6 Q;  5CQY A;  1M9S A;  1HXD A;  1M2O A;  4C5E A;  2DJQ A;  3CCS A;  3QJY A;  4LDU A;  4CC7 A;  2X4X A;  3PE0 A;  1T3L A;  2QDY B;  3OYC A;  4LDV A;  1HSQ A;  1LPL A;  2P84 A;  2QXF A;  4M7A E;  2E3H A;  1RAA B;  2CP2 A;  3CCR A;  5LJ5 g;  5GAM h;  2LRQ A;  2YLC A;  3MEW A;  2E6Z A;  2JOY A;  4J6Y A;  4C8Q A;  4JJD A;  1MND A;  3FJ5 A;  4F7U F;  1QKX A;  3CXC P;  2ZPF B;  3CPW P;  2LQ8 A;  2HD0 A;  3JAM E;  3CME Q;  2K5L A;  1K9M C;  2EGC A;  1K76 A;  2C0I A;  1JBM A;  2QTX A;  5GMK i;  5GAN f;  1QVG A;  2AKK A;  3JCM c;  2P4R A;  3DB4 A;  3QUI A;  2ZPH B;  5LL6 S;  2RJD A;  2EIF A;  5GAN 4;  3EFO B;  4XU2 A;  5KE3 A;  1N8R C;  1UGS B;  2XIC A;  2CUB A;  2FRY A;  4BAC A;  3JCM V;  3CCJ Q;  1NLP C;  2XK0 A;  4LUE A;  5DY9 A;  1VQ7 T;  1RAB B;  2ROL A;  3GPL A;  3SDZ A;  4MML A;  2DXT A;  3BFM A;  3RES A;  3JB9 H;  5GAN 3;  3G71 A;  3OA6 A;  4F7U E;  2DIG A;  3H9N A;  4B6M A;  3P8D A;  5KYY B;  5KH6 A;  5GAO q;  4E7I A;  1AWJ A;  1RL2 A;  4HT8 A;  1KHI A;  2FO0 A;  4M75 G;  1Z9Q A;  1NYG A;  5CKD A;  1KFZ A;  2CZ6 B;  1JO8 A;  3CCU T;  1KD1 U;  2MF2 A;  1ZSZ C;  2HQX A;  4M78 B;  1UJ0 A;  1VQ9 A;  3EGD B;  3RMQ A;  4AG1 C;  3RKY A;  2J6O A;  2DVE A;  3A8G B;  4HKE A;  4KUD K;  1M90 C;  1NPP A;  4ME7 A;  2JNG A;  3JCM d;  1WDX A;  4JJC A;  3OS0 A;  2RK2 A;  1KSW A;  3I9Q A;  5L8R E;  4IUR A;  2HCK A;  2YLB A;  2VWF A;  1UTI A;  2F2V A;  4MZT A;  1BBZ A;  2QI2 A;  3S3N A;  2BE9 B;  5J3B A;  1TU0 B;  1QVP A;  1M2V A;  3J81 E;  4J9B A;  3VS1 A;  3FC3 A;  1W1F A;  3V8J A;  2CGH A;  1TS9 A;  5GAM g;  1T0H A;  2V8I A;  1SF9 A;  3NFC A;  2F2X A;  1PRL C;  1TTH B;  2CP5 A;  4PJL A;  1UGP B;  1M1K U;  3QKJ A;  1YJ9 A;  1PD0 A;  1NLO C;  2CZ1 B;  1YIT Q;  4M7D C;  4E47 A;  5KCH A;  2BE7 D;  4A4G A;  1A0N B;  1X69 A;  4FYY B;  3OYK A;  3JCM W;  5GAO r;  4OB3 B;  2O4X B;  2VC8 A;  4N4I A;  2FZG B;  3FRN A;  2DL4 A;  8AT1 B;  1WFW A;  2EJG A;  2XU8 A;  4RTV A;  3M56 A;  3QZ5 B;  1UG1 A;  3UF4 A;  2GFA A;  3A8H B;  5FU7 C;  2R5A A;  5IXF A;  5GMK m;  5ECA A;  3A98 A;  3A5Z B;  1X6O A;  3MEV A;  3V7C A;  3OS5 A;  3HFO A;  4KH0 B;  2EQM A;  4B9X A;  4ZTJ A;  4ZGJ B;  4GLK A;  2DPP B;  4PL6 A;  5IAY A;  3C4S A;  3JCM f;  4HT9 A;  4M7D B;  1EX4 A;  2EVR A;  2V8K A;  3M5A A;  3E9F A;  1QCF A;  4PKC C;  1YI2 A;  2F5K A;  3CC2 Q;  2YRV A;  1PNJ A;  4IIO A;  2FL7 A;  5GAN e;  4N4G A;  2QA4 A;  2LJ3 A;  2L3S A;  1MV3 A;  4RTY A;  4LD9 K;  5IHI A;  3CMA T;  3OS2 A;  4E7H A;  4BY6 C;  3TEE A;  1OU9 A;  4J8O A;  4M7A B;  4BDZ A;  2LCC A;  2DE0 X;  3CCQ A;  5LJ3 j;  2JW4 A;  4RMO A;  2L5Q A;  1TUD A;  4XU3 A;  1G3W A;  2QK0 A;  3HP9 A;  1S72 Q;  1WYX A;  1CSK A;  1PRM C;  2E10 A;  1G3Y A;  2L8D A;  2VGM A;  3OW2 A;  2JZ2 A;  4X9C A;  1IHW A;  1SEM A;  1BCO A;  3CC7 T;  3EH2 A;  3V8L A;  2NUZ A;  1M5Q 1;  1OQK A;  3VUZ A;  3LH5 A;  3CCS Q;  1GCQ C;  4E6R A;  4J9C A;  3I56 Q;  3MEA A;  2RH2 A;  3HRS A;  2RHX A;  1BK2 A;  1PWT A;  1Y7X A;  1YJN A;  3X20 B;  2HBW A;  2JS2 A;  3R6O A;  4EDU A;  2EFI A;  3CCR Q;  3EGU A;  2NUT A;  2D9T A;  2KI7 A;  2A0F B;  3Q1J A;  1KG1 A;  1KQS A;  3MJX A;  5DLQ E;  3JCM J;  3GIB A;  1IRE B;  1KC8 R;  3HSB A;  1KQ2 A;  4JJN K;  2A36 A;  1OU8 A;  1FMV A;  1MGQ A;  3EFR A;  3TU4 K;  1AWW A;  1D3B A;  1QQJ A;  4RG2 A;  4XTW A;  2QEX T;  4LDX A;  4MZM A;  1Q7Y C;  4ZGD B;  2HNI A;  2XMF A;  3PFS A;  2X3X D;  2KRN A;  4C92 F;  1VQ5 A;  5FLX E;  1HK9 A;  3FB9 A;  3EG9 A;  1R0B G;  1KD1 C;  5KYU A;  1PSE A;  2GFU A;  1LVK A;  5GMK h;  1X27 A;  4M78 A;  1K73 U;  2K3X A;  3GOX A;  5L23 A;  4EIK A;  3TVT A;  1BB9 A;  2VAS A;  2RB6 A;  1AZG B;  1JXO A;  3G71 Q;  2A7Y A;  3QBY A;  1U5S A;  4DEX A;  3V7R A;  1VQL A;  1QP2 A;  2FPE A;  2YHT A;  4JZ4 A;  3OYB A;  3M0S A;  4J7F A;  2O2O A;  1MMA A;  4ATO A;  1HD3 A;  2EYZ A;  2ZZD A;  4ZGE B;  2QAS A;  3QO3 A;  4PJO F;  5GAO m;  4OVA A;  4JDS A;  3KXT A;  4C8Q C;  1VQ9 Q;  2ZCF B;  2RF0 A;  5IHN A;  5GAO l;  1YHQ Q;  4C92 E;  2HSP A;  3KUF A;  1MUZ A;  3VKI A;  3JB9 I;  1KIK A;  5CKH A;  3M0P A;  1NPR A;  2RM4 A;  1XJW B;  4OP0 A;  2M0Y A;  2LVM A;  4NL3 A;  3UA7 A;  1QCN A;  1G83 A;  1VYT A;  2MI6 A;  2COZ A;  1VQM A;  1OZ2 A;  4M77 D;  3QG1 A;  1TH7 A;  2E1H A;  3E1S A;  2CKK A;  3VS7 A;  1AVZ C;  4BI3 A;  2NYS A;  2CS7 A;  3A1P A;  4M77 F;  4BB7 A;  1FMW A;  3EHQ A;  1K1Z A;  1N27 A;  2R57 A;  2DER A;  2SEM A;  1RLQ C;  4J5Y A;  4PJO E;  1M30 A;  2E4H A;  2D0Q B;  2LCS A;  1UEB A;  3GLX A;  3HHT B;  4FL6 A;  4OMM A;  2KXD A;  3UAT A;  1K9M U;  3L2V A;  4JLG A;  3R6N A;  3VUB A;  2JVV A;  3JCM Q;  4J9G A;  4DOV A;  1JU5 C;  1ARK A;  2SRC A;  2V26 A;  4QVZ A;  2HAX A;  1ZHI A;  2RPN A;  2CSI A;  3JRZ A;  4C0D B;  2DEQ A;  5A0G A;  4JS4 A;  4KUL A;  1JJ2 P;  4J7I A;  3RDV A;  2DTH A;  2RMO A;  4PLI A;  5GAO p;  3I5S A;  2KSS A;  4GY5 A;  1M3B A;  2DAQ A;  4M77 E;  3CBO A;  1W2B A;  2RI2 A;  4KUI A;  3VRY A;  2QAZ A;  2P0Q A;  3UPU A;  1UGV A;  4Y92 A;  1IXD A;  3G4S T;  1WHH A;  2EJF A;  3BW1 A;  4M7A A;  4A4E A;  4E7S A;  3FIF A;  1WXT A;  1B3Q A;  1YWP A;  3SWN A;  2HL5 C;  2XDD A;  3VRZ A;  1YI2 Q;  1KC8 U;  4RG8 A;  1VQ6 T;  4OGE A;  1EZZ B;  5KYW A;  2QA4 Q;  1WQW A;  2L3R A;  4OMP A;  2MYS A;  2VUB A;  2E5Q A;  1H8K A;  1R0C B;  3EG1 A;  3BE3 A;  1FWZ A;  1ZUU A;  1WJR A;  1GBR A;  3OYY A;  4M75 D;  3E9G A;  3OSS C;  1D1C A;  2VKN A;  2Y4X A;  2KT1 A;  2LQW A;  2PVG B;  1AWO A;  2EAY A;  3CCQ Q;  2PUK B;  4M75 F;  1HJD A;  4IUQ A;  1M2V B;  4RCB A;  4V2S A;  2DET A;  4CC2 A;  1WJQ A;  2KBT A;  2C06 A;  3EG0 A;  2JN0 A;  4J9E A;  3CME T;  1SRM A;  2M51 A;  2RHY A;  2CP7 A;  1D09 B;  4BD3 A;  1OX8 A;  2YUO A;  2CUD A;  2R58 A;  4IUV A;  4F7U A;  1VYV A;  4FSX A;  2GCX A;  2XG8 D;  2CT3 A;  3ZL7 C;  2QQB A;  1BU1 A;  3QYH B;  3CCJ T;  1UJY A;  1VQK A;  4KGV B;  1N9R A;  5D6W A;  4ESR A;  5LJ3 d;  3CCV A;  1WHK A;  4XTZ A;  2ZGW A;  2JMC A;  2V1R A;  2RJC A;  4M75 E;  3L42 A;  5CR2 A;  2ATC B;  3OYG A;  2QDL A;  4XK8 E;  2HKN A;  1UHF A;  4D8K A;  1VUB A;  1GXI E;  1G5V A;  2YXY A;  3OYA A;  4GLM A;  4HVU A;  1RAG B;  1BI2 A; 
#chains in the Genus database with same CATH homology
 3I56 Q;  1VQ7 Q;  3CC4 Q;  3CME Q;  1Q81 R;  1Q86 R;  3CCU Q;  1Q82 R;  1QVG P;  3CC2 Q;  1Q7Y R;  3CCL Q;  3CCV Q;  1M90 R;  1VQ4 Q;  1JJ2 P;  2OTL Q;  3OW2 P;  3CCQ Q;  1W2B P;  1VQ9 Q;  1K8A R;  1YI2 Q;  2OTJ Q;  3CD6 Q;  3CCM Q;  1N8R R;  2QEX Q;  1VQM Q;  1S72 Q;  1YJW Q;  1YHQ Q;  3CCR Q;  1VQ6 Q;  1KQS P;  3CCE Q;  1VQ8 Q;  2QA4 Q;  3G71 Q;  1YIJ Q;  1YJN Q;  1NJI R;  1YJ9 Q;  1KD1 R;  1YIT Q;  3CC7 Q;  3CXC P;  3CMA Q;  1M1K R;  3CCJ Q;  1K9M R;  3I55 Q;  1K73 R;  1QVF P;  3CCS Q;  1VQO Q;  3CPW P;  1KC8 R;  1VQN Q;  3G6E Q;  1VQP Q;  3G4S Q;  1VQ5 Q;  1VQL Q;  1VQK Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...