3CCVQ

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2616a
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3ccvQ00
3CC4Q 1S72Q 3I56Q 3G4SQ 1M90R 1YJNQ 2OTJQ 3G6EQ 1VQOQ 1K73R 2QA4Q 1VQ8Q 3CCUQ 1W2BP 1Q82R 1VQPQ 1YHQQ 3CCVQ 3CCLQ 3CXCP 3CMEQ 1Q81R 1VQ9Q 1VQLQ 1KD1R 3G71Q 1KC8R 1K8AR 1K9MR 1M1KR 1YI2Q 1VQ4Q 1VQKQ 1VQ5Q 1Q7YR 1JJ2P 3CMAQ 1NJIR 1VQ7Q 3CPWP 1YJ9Q 3CC2Q 2OTLQ 1Q86R 1VQNQ 1N8RR 1QVGP 3CCJQ 2QEXQ 1YITQ 3OW2P 1YIJQ 1VQ6Q 3CD6Q 3CCEQ 3CC7Q 3CCMQ 1VQMQ 3CCSQ 3CCQQ 3I55Q 1KQSP 1QVFP 3CCRQ 1YJWQ
chains in the Genus database with same CATH superfamily
1VQMT 3QWYA 1SRMA 2M0OA 3P8BB 5KYYB 3CCUQ 4ZNXA 1YHQT 3A8HB 2V8KA 1PKSA 2V26A 2O01E 4M75G 1X01A 3A98A 1UHFA 1K0SA 2LZ6B 5I2MA 2FG0A 5ECAA 2LP5A 4M4ZA 1YJ9T 1QW1A 1VIEA 4XTWA 4BY6C 1GBRA 3OMCA 1LCKA 4PL6A 1I1JA 2HQXA 4OMNA 3TQ7P 5KYUB 4PJOF 4XAXB 5CKFA 1VQ6A 4J6YA 2LX9A 2P0QA 2ZGWA 1GCQA 2L3SA 1VOMA 4M78C 2P4RA 4PLIA 3QHSA 2XDPA 3BFMA 3VU3C 2HL5C 4R56A 1M1KC 2D8HA 3RKWA 1UG1A 1B07A 4IIMA 4RTWA 2FRWA 1RUWA 2CS7A 1H3ZA 4FM4B 3EG3A 2J6KA 4EMKA 3EFSA 3INZA 4EIKA 1SHGA 2SRCA 3ZEHA 2DMOA 2DL8A 4FIBA 3ULRB 2L3PA 4A4FA 4M75A 1M90R 5GANh 2M51A 1YI2A 5HK3A 3I9QA 1W4SA 5A0DA 3REBB 2RI2A 3QKJA 3V7SA 2PNIA 1KQ2A 3VUZA 1O9SA 1BB9A 4F7UF 3OYYA 2RJFA 1QMCA 4NS5A 4BE1A 7AT1B 4PFOA 1Q95G 1WNLA 3CCUA 2ZPIB 2K3BA 2DYIA 1PKTA 1KJWA 4BD3A 2EQKA 2EYWA 1D0XA 4OB1B 1FX7A 3JCMe 3SD4A 2XG8D 3E9FA 4F16A 3I5RA 1JEGA 3CMAQ 3CMET 4PJOG 4X9CA 2RHZA 1OYXA 2QAZA 5CCAA 3MEAA 2RHUA 3V8LA 1E6HA 2ROTA 4HT9A 3P8DA 1GXIE 2CSQA 2F2WA 3C4SA 3OYDA 2QA4Q 1OX9A 2DEUA 2VC8A 2VXEA 2H8HA 5EG2A 4KUIA 3KUFA 3EFOB 3L2UA 5I22A 4C0DB 2FHDA 3CCEQ 4HCZA 2CUDA 1UGPB 3CPFA 1LOJA 4OB2B 4NL3A 4KGXB 2VVKA 4M77C 3OYEA 3M54A 4M7DC 3PMTA 5DLOA 1WHGA 2YT6A 2MF2A 3G71Q 2DRMA 3DKMA 5FRMA 1C6VX 2FB7A 3X25B 2XICA 2AKLA 3VS7A 4R55A 2JM9A 1VQNQ 3EH2A 2RQUA 1UFFA 3OB9A 1NYGA 2E65A 3OBYA 4F7UG 1PWTA 3JB9F 1WHLA 3CCRQ 3QZ9B 1M3CA 3JCMQ 2KRSA 3EG9B 1MMAA 1X27A 4EDUA 1M2VB 1KD1C 3RIRA 3JSCA 4C92D 4BY6B 3MEWA 2KRMA 3JCMV 2NWMA 2VWFA 2GTOA 2CP0A 1QVFA 4N0AA 2PU9B 1JQQA 1WLPB 2XU8A 3H41A 4JRQA 4NOYA 3AT1B 2YUQA 3ME9A 4C0ZA 4PJMA 3CCJT 1M90U 4M78B 2KBTA 2MCNA 2EBPA 5AT1B 3CMAA 2OJ2A 2AZVA 3DLMA 3E2UA 5A0GA 3RKXA 2O88A 4M78D 1NJIR 3MP1A 2Y4YA 1R77A 3OYLA 1IRXA 2QA4A 4OMPA 4A54A 8ATCB 1JO8A 3M9QA 1ZLMA 5KYYA 2KNBB 1YCSB 1Z9ZA 2JVVA 1MNDA 5CQXA 4FCYA 1AWOA 5LJ5e 2DFUA 4QVCA 1KIKA 2L0AA 2YUPA 2E3HA 4A4GA 4J9EA 2O4XB 3ER0A 5LJ5j 3GP8A 1LNXA 3CCEA 4HCCA 4V2SA 1UDLA 2LCLA 4CC2A 2DTHA 1VQKT 1X69A 2VGNA 5GAN2 1IXDA 4IURA 3L2RA 4J9IA 3G71A 1XTDA 4XU2A 4AFZC 5KYUA 4BB7A 2DX1A 2D1XA 4Z02A 2DVJA 3JB9G 1VQNA 2XDBA 2BUDA 3CCVT 4IIOA 2DO3A 4BI3A 3V8JA 3CCRA 4L6V5 4RTYA 3M59A 2KK4A 2O2OA 1BK2A 2CP7A 2K3YA 2DBMA 3JB9H 1V29B 1YCYA 1W2BP 1ZBJA 1BKBA 1MNEA 4CI0C 1Q81R 2CGHA 2JZ2A 3HFNA 3PGGA 1VYUA 1R8OB 3A8LB 3OSSC 3RUXA 4FW2A 2K2MA 1YBYA 4QQ6A 5IXBA 2K79A 4ZTFA 3MP8A 4XK8E 3PTAA 1K73C 2MIOA 1IGQA 1EZZB 3OA6A 2JS2A 2M16A 4RTXA 2FPFA 5GMKh 3JCMg 3I56T 4M77B 2KDSA 1JB0E 4EMGA 4M7DB 5LJ5d 4A4KA 1VQLT 2DE0X 2F69A 3OYIA 1VQ4T 4C5IA 3JB9I 2HQHA 4P5NA 5D6XA 1WXBA 4M77D 3EHQA 2A3LA 3A5ZB 3VS4A 1FMVA 1V76A 2QXFA 1IHVA 3L2VA 2M0YA 1KC8R 4F14A 4FSSA 2BTTA 2QGGA 2F2XA 4IUVA 3E9GA 1NLOC 2PVGB 2GQIA 2JMCA 2EQIA 2DETA 3NTHA 1SG5A 3SWNC 4XU0A 4ZGEB 2VKNA 2RMOA 4JZ4A 3VYHB 2JTFA 5HY6A 2I0NA 3VUBA 3PE0A 3GBQA 4Y91A 1NPRA 2EFIA 1AWWA 1G3SA 3V7RA 2K4YA 2YWWA 1N8RC 1UUEA 1BYMA 3EFOA 1RADB 3D7SB 1FXXA 5FU6B 4C5GA 1QCNA 3NPFA 2ED1A 1B34B 2PUKB 4XTUA 3M0PA 1JU5C 2C0OA 1SSHA 3V7CA 4J9FA 2J6OA 3CPWA 4LD9K 3MP6A 2HL3A 1SPKA 2YRDA 1Q86C 3EGDB 1YN8A 3RBBB 2QTVA 2K6DA 5IAYA 2M9UA 2LT4A 3M56A 2C0IA 4QVZA 5FU7C 2JS0A 5GAOq 3EG9A 3GNGA 1YIJT 1M2VA 5A0LA 3HL8A 3PVQA 3TSZA 3FEOA 1TOVA 1Q81U 2A37A 1YJNT 2G6FX 4O5VA 4Z88A 4C8QB 1VQOA 2HKQB 2GFAA 3VRZA 3CC2T 4M78A 5KH6A 4J6XA 3OYAA 2QEXT 4RTUA 4RTZA 4ESRA 2MOXA 3G6EQ 4X9DA 2MPXC 2KQWA 4C8QD 1X2QA 4ZGDB 4FYXB 2R57A 1KFZA 5LJ5g 2LTOA 4BDYA 1QCOA 2J06A 2KE9A 2F5TX 2LNVA 1BBZA 1TUCA 1I5LA 2YDLA 1K9AA 1B3QA 3OYGA 1M1GA 2AZSA 4MDWA 1A0NB 1MHNA 3JCMc 3PIOA 1ZSGA 3CCMT 4M75F 1Q82R 4B6MA 4RG8A 1KC8U 2O4XA 3OYFA 5CKHA 1G5VA 1ZUKA 1RAHB 2D6FA 2ZPHB 4C92E 4LE9A 4PK4A 4J7IA 1ZUUA 1VQ6Q 2DYBA 3NTKA 4JJCA 2KGTA 1W70A 3C95A 2L2PA 2ZZDA 2DD5A 2LVMA 5GMKm 5J26A 3X20B 4BUGA 3JCMf 2BZXA 4KGVB 1OPKA 1MGQA 4D8KA 2DEQA 2C06A 2QQRA 1AZGB 3FLGA 2QQ9A 3E19A 5KCHA 1ZA2B 4M78E 1BI1A 2X4JA 4JRKA 3SWNB 1UB4A 1D09B 2E1HA 2G3RA 1T3SA 1VQPQ 4HT8A 5CQYA 1VQ9Q 4QQGA 4BI8B 2RHXA 2QTXA 2HD0A 1PG5B 2E10A 3LX7A 3VYGA 3OW2P 3G6EA 1K9MC 3GPLA 4IUPA 2JM8A 1VUBA 4A63B 1WZOA 2DK3A 3L2WA 2W0ZA 1D1CA 5GAMe 3EH1A 2EW3A 1BI0A 4M77A 3UWNA 4M7DA 3M55A 2NUPB 3RMQA 4C92C 2RF0A 4KULA 4AMCA 3OYCA 4XU3A 1YI2T 2P4TA 1GCPA 2F5KA 2SEMA 1WA7A 2Y4XA 5CK9A 5D6WA 4QVDA 2PVOB 3CCSQ 5I11A 1M4ZA 4RG2A 1UGRB 5FU7B 2GGRA 3VKIA 2RK2A 2FYKA 2RJEA 3MJXA 2DL7A 3CCUT 3PNWC 3QDRB 1CSKA 1KQSA 2OTLQ 2CP5A 2E5QA 4XTVA 1WJRA 2ECZA 4FT4A 4JLGA 4OB0B 3M0SA 2EJ9A 4CRIA 1D0ZA 5DY9A 1Y7XA 1Q7YC 4E7KA 2LQKA 2FL7A 1WHHA 2EWNA 1NEBA 1BU1A 1B34A 3THKA 2Z0WA 3V8KA 2MWOA 1VQPA 1MMNA 2QQSA 3CXCA 2EYXA 2E41A 3TREA 1VQ9A 3H9NA 3HSBA 4HCKA 1I07A 1G83A 2DVEA 4J8OA 4M77E 1VIFA 5LJ5f 2D0NA 4J9HA 3EGDA 4M7DE 3OW2S 4M7AC 2DIGA 2AT1B 1OEBA 2OAWA 4DBFA 2X51A 3L2QA 2L89A 5CR2A 2RM4A 3M0TA 2R58A 1S1NA 2J05A 3DLLA 2RPNA 3QDFA 3EG0A 4KH0B 2HDAA 2GBQA 3UDCA 3GF5A 3H0FA 4C8QA 3CCSA 2YUNA 1OULA 1HJDA 1MMDA 1UGQB 1Y96B 2HQEA 3S3OA 1YWOA 3S6WA 4KGZB 2EQUA 2CDTA 4RTVA 2DL4A 1MMGA 2WSEE 2JTEA 1AOJA 3OSVA 5GANf 4HKEA 2OTLA 4TVRA 3NFCA 3TU4K 2FZKB 2RNAA 1NM7A 3KXTA 4OP0A 2CREA 1YFNA 3ZFJA 1KQSS 2KMTA 3A8OB 2DTIA 3MKDA 9ATCB 4FT2A 2EYQA 3CMAT 1X2KA 2C0TA 2RHYA 2LJ0A 4F17A 1TWBA 1EX4A 4WF2A 3R6OA 3OYBA 2FPEA 2O9SA 3DB3A 5M9OA 1M5Q1 2W10A 2QA4T 2CP2A 5IHIA 4RCCA 2M02A 1WHMA 2A7YA 5IHNA 3C0CA 1PSFA 4HVWA 2LT1A 4XTYA 4C92B 3QYHB 2E70A 1UTIA 1W1FA 5J39A 1UJYA 2ABLA 1R0BG 4UC4A 3CCET 1WJQA 1YWPA 2HKNA 2LQWA 3HPWA 5IN1A 2EQJA 1M1KR 2K5LA 3G1JA 2M1HA 2XD0A 3JCMd 2V1RA 1NBEB 4R0KA 4C8QE 4Y92A 2K5FA 4LXCA 3G71T 1AHJB 1YITQ 1WPYA 1BIAA 3SWNA 1VQNT 1CKBA 2A08A 1U1TA 5GAMg 3I35A 3CCRT 1WXUA 3QYGB 1JBMA 1G3WA 2LMJA 2KXCA 2XIDA 5FU6C 1VQ5Q 1M8VA 1AWXA 4MDXA 2KYBA 3FJPA 4BE0A 4KUDK 4OGCA 4B9WA 3QZ5B 4CC3A 4C0GA 4AFSC 1ZUYA 3M0RA 3I55Q 4GLKA 2LQ8A 3TCJA 1PD1A 2JN0A 2DBKA 2QQBA 1K8AC 3X28B 3H0HA 2NUPA 3HKSA 2YLBA 4PFZA 4Z89A 4PJLA 3FJ5A 3I5SA 1G8XA 2JW4A 4M7AB 3M5AA 1BCMA 4MMLA 4HVUA 4ELZC 3CD6Q 2GFUA 3T9NA 4PKCC 3CC4Q 3G4SQ 1JJ2A 1K0XA 1VQ8Q 5IXFA 4B9XA 4M7AD 1RL2A 1OU8A 4J9BA 2DA9A 4RTTA 4C8QC 4BI4A 2LQNA 2ZPFB 2RI5A 2VYTA 2FEIA 1WQ7A 2AHJB 1WDXA 2KEAA 1T0HA 1RACB 2PQWA 1TU0B 4M78F 2CSIA 1RAFB 5GAN7 4FYWB 1S72Q 5GJVB 3JCMP 5GANe 3C94A 2IIMA 1VYVA 3TEEA 3CCJA 5GANj 1YITA 3MHXA 3OS2A 2DJQA 4IUUA 2PVDB 1QVFS 3OS5A 1W2BA 3LGFA 1X75C 1PD0A 2X3WD 4J9GA 1NE8A 1M3BA 1TUGB 2KROA 3VJPA 1VQ5A 1OZ2A 2KT8A 2HZYA 1M1KU 1KD1R 4JJDA 2LC4A 5KYWB 3I55A 1QWFA 1UEBA 4ZGJB 2L3RA 1IZ6A 3EFRA 2AIRB 2DPPB 4C92G 4ATOA 1U1SA 2DKGA 1ZHIA 1VQOQ 4OVAA 2MK5A 2DXTA 2LRQA 1NJIU 2RQWA 1Y96A 4E7ZA 5CKDA 4HVVA 3CD6A 2H3EB 3CC4A 3G4SA 3QXEB 3SHWA 3S3MA 1VQ8A 5GMKl 5LJ3f 2I2LA 2MMPA 2QDYB 1YJWQ 4PJOC 1JJ2S 2X4WA 1WI7A 5GAN8 3J80E 4LUDA 1T0JA 1UE9A 1VQOT 4M78G 3H6ZA 2RI3A 2L3QA 5GANd 3L1AA 1IGUA 1F1BB 2LX7A 1SRLA 2VGMA 1YP5A 2GNCA 1S72A 2X4XA 4QW2A 3HHTB 3GLXA 3LWIA 2WACA 2XKOC 2E6ZA 1WHJA 5FW9A 1XOVA 4PJJA 5GAMf 2WSFE 3N5BB 1AEYA 1WFWA 4E7SA 4M77F 4M7DF 5CVIA 1Y71A 4PNOA 2E6NA 5J3BA 4C92A 5CKEA 3LYIA 2KXDA 3QBYA 2IG0A 3A8GB 4IKFA 1RLQC 1QWEA 2A0FB 1UGVA 2EAYA 3REAB 4J9CA 4OB3B 2KYMA 3URGA 2BE9B 2BE7D 3OYJA 4WTOB 2A36A 1QVGA 2DRKA 4LDYA 3P8HA 4XTZA 2EYZA 3ASKA 3VS6A 4M75D 3VS1A 1I8FA 2DM1A 4MZMA 1X6OA 4D6WA 2LJ1A 4PJNA 4JJBA 3RR6A 4HA8A 2ENMA 3OYKA 2OTJQ 1K73R 1KQ1A 2IVWA 3M4GA 5C6SA 2DXCA 3RDVA 1KD1U 2BIVA 2RD1A 1JRIA 2DLPA 2IPOB 1ARKA 4ORZA 3RNJA 2QI2A 1J3TA 1M2OA 1YJWA 2VB6A 4CC4B 4ELYC 1OOTA 2QG9B 2HSEB 1NZ9A 3MO8A 3L2ZA 4AG2C 3JCMh 3HRTA 2DERA 3SDZA 1HXDA 1NPPA 3A1PA 2K5IA 3CCLQ 4L59A 4BE2A 1QCFA 3G6ET 5KYNA 2DL3A 4XQ3A 5GAN5 4M7AA 4JZ3A 4NL2A 3JB9J 2EVRA 3HRUA 4M77G 3LLRA 2OI3A 1I81A 4M7DG 2GTJA 1E7OA 3VV0A 2VASA 2YRCA 3EG2A 5HKCA 3CCQQ 5KCOA 2LCCA 1OI1A 1NG2A 5GJWB 3CPWS 5GANg 5HK0A 3BDUA 2YHTA 2BKDN 2PZ1A 1VQ7Q 5KYXB 4C8QF 1N8RR 3CEYA 3PFSA 5LJ3e 3CC7Q 4EMHA 1M90C 1DJ7B 4J83A 4A53A 4OF1A 1VQ6T 1IREB 5LJ3j 4AFUC 4DEXA 2K7AA 3MPUB 2JMAA 4PJOB 1H3HA 1AD5A 5EC7A 5GMKe 1QVGS 2P84A 1ABQA 1PRLC 2F1LA 2ZPEB 1Q86R 2ROLA 2K57A 5IHKA 2OTJA 4JDSA 3OS1A 1PHTA 2KI7A 2VXFA 2HBWA 5AYFA 1VQMQ 4PJOD 1OZ3A 4N4HA 4JJNK 2RQVA 2COZA 1YHQQ 3EGXB 2D0QB 1CKAA 4LDUA 3VS2A 6AT1B 3UPUA 4MZPA 4GBQA 1TG0A 1KHIA 1Y07A 3QIIA 5GAMj 3EHRA 5KYWA 1K1ZA 2A28A 4YTLA 1VQPT 2EJGA 2EGCA 2FPDA 5FROA 2YRVA 4MZTA 1VQ9T 4M7AE 1YJ9Q 3FIFA 3HTRA 2JOYA 1QKWA 2X4YA 2EGAA 4K11A 1C0MA 3CCLA 1ZSZC 1K73U 3NTIA 3X26B 4QQDA 1M1FA 1N6AA 3M57A 5KE2A 5GAOp 1QVPA 4F7UB 3BDLA 1NLPC 1XQHA 4LDWA 5CKBA 3CCQA 1AZEA 4E2FB 3VS0A 4Y28E 4ZTJA 2FZGB 1SKUB 4E7IA 4C8QG 1KQSP 4XTXA 5LJ3d 3CCST 2J6FA 3MEUA 4JS4A 5LJ5h 1Q82U 1Y0MA 3M0UA 2CP6A 1VQ7A 3WXMB 3VS5A 2JNGA 2DTOA 4BDZA 1KHCA 3LGLA 3CC7A 1KK7A 1LJOA 3UATA 3PVLA 2L5QA 3LW5E 1RAIB 1WHKA 4E47A 2OTLT 2E64A 2O31A 3SB2A 2Y90A 3M0QA 2MYSA 2RHIA 1QP3A 3CBOA 1BIBA 3MEVA 5D6YA 1WYXA 1FWZA 3CXCP 2HCKA 3BW1A 5GAMd 1GBQA 3CBMA 2EIFA 1WGSA 1VQMA 1N8RU 1M30A 1PC0A 1BI2A 4J6WA 1YNZA 1YHQA 3BY7A 1SHFA 1OX8A 2V8IA 3EAEA 1IB8A 2CUBA 1YJ9A 2L8DA 3CMEQ 1NJIC 1Z9QA 5GAOm 1Q86U 2DAQA 4J9DA 2XK0A 2COYA 4AG1C 3SEMA 2QK0A 4D8DA 1XNIA 1NYFA 3JAME 1RLPC 4OGEA 2VUBA 1K9MR 1BCOA 1LVKA 1T3LA 1HD3A 2DF6A 3C12A 1RABB 4KH1B 4LD6A 1VA7A 1N9SA 2HAXA 1AT1B 2K2VA 1GFDA 2YSQA 3JB9D 2DXUA 1TUDA 4JLIA 1ZA1B 2J7IA 4A4HA 4DOVA 1OU9A 3Q1JA 1WIEA 3JCMW 1FYNA 5GAOr 1ZX6A 3G7ZA 1X43A 4RMOA 3M4YA 2HEQA 4LDXA 3HP9A 3NGPA 5GAN6 2MWPA 1IHWA 3JCMX 3EG1A 2EKHA 2KY9A 5LJ3g 3LH0A 3PMIA 4M75E 3CXCS 1Q81C 1H8KA 2H3JA 4Z8AA 1ZSZB 4PLLA 4ANJA 2DZ9A 4C0FA 1GFCA 1UJ0A 5L8RE 3GNFB 1Q7YR 3KFVA 2FO0A 3IQLA 5KYXA 2RK1A 1GL5A 1G3YA 3FC3A 2FZCB 1P92A 3CCJQ 4HCBA 1TH7A 1I0CA 3LWHA 3M53A 1XJWB 3GIBA 3CMEA 1QVFP 1G3TA 2RQTA 3KBGA 3MCAB 1UGSB 2BZYA 4PJOA 1VYTA 3M58A 4CC7A 4E7HA 1AWJA 3F70A 2O9VA 3UF4A 1GCQC 1PRMC 2EJFA 1RI0A 4DA4A 2QGFB 4ME7A 2K9GA 3EGXA 2LCSA 1YITT 4JRIA 5GAN3 2K3XA 2X35A 5CIUA 3PT9A 1KC8C 2V1QA 1MUZA 2PUOB 4OMFB 2ZAEA 4EMKC 1VQKQ 2RQRA 1TS9A 5IH2A 1KG1A 3OYMA 1VQ5T 1GRIA 2ESWA 4C92F 2EYYA 3UT1A 2AKKA 4C5EA 2EKOA 5I21A 1U3OA 2JJ9A 1K9MU 4N4IA 1MV0B 4M75C 1M9SA 3HRSA 1D3BB 1LPLA 3R6NA 4A4EA 3I55T 1TXQA 2RN8A 4L5GA 3CCVQ 1G2BA 4II1A 4F7UA 3META 3VRYA 1RAGB 4ZN1A 1D1AA 1RAEB 1JJ2P 2F2VA 2CH4W 3NMZC 4AFQC 4KT0E 1UECA 2HMAA 2CP3A 2RB6A 4HXJA 3QWXX 5FWCA 3X24B 1UHCA 2DIQA 4PJOE 3TSWA 3CD6T 3QSUA 1EIFA 1E6GA 4DQ2A 3CC4T 3G4ST 3QUIA 5GAN4 2NUTB 4RCBA 1VQ8T 3OBWA 4IUTA 2VV5A 1TTHB 4QT7A 2NYSA 1WXTA 5FWBA 1KSWA 4LNPA 1X6BA 3RMSA 2GQVA 2V8JA 3U23A 3I56Q 2NUZA 4C5HA 2B8AA 3A8MB 5IT9E 3WVEB 3L42A 1S72T 4PFPA 2P0PA 1Q7YU 1VQLQ 1VQ4Q 4JRPA 2E4HA 3RESA 3LH5A 3QO3A 1M27C 3JRZA 3RERA 5LJ3h 4M7AF 3QJ6A 4DBQA 4LN2A 1FMKA 1N5ZA 1RI9A 2HNIA 2CZ0B 1QQJA 2CKKA 2XDDA 5A2QE 4FYYB 1VQKA 1D0YA 3RKYA 2RH2A 3OS0A 2D9TA 3UA6A 3H0IA 4F7UE 1AVZC 3HFOA 4RUGA 3OMGA 1Y57A 2KVQG 4FYVB 2R5MA 2E12A 4X34A 3CCVA 5DLQE 5GAMh 1Q82C 1OV3A 4M7DD 2KAFA 5LL6S 4KBMB 2QYZA 4LDVA 2E5KA 2GF7A 2B86A 1K8AR 4N0AC 4BACA 1JXOA 1K76A 2P0KA 4IUQA 4OMQA 3JV3A 2RJCA 2E3IA 1QKXA 1SEMA 2NLUA 1I5OB 1WQWA 2LDMA 3OY9A 5HCKA 2HBPA 1YJWT 5FRNA 3J81E 3VS3A 1I4K1 5GAOn 2AK5A 2XMFA 3E1SA 3ZL7C 1QP2A 5FLXE 4VUBA 3OYNA 3CPWP 4FSXA 4J7FA 1JXMA 4EMKB 3I56A 1YIJQ 1H641 2CT3A 2ZCFB 2JXBA 1W2BS 5I2SA 2DD4A 4OMOA 1VQLA 4M7AG 2X3XD 4DOWA 5C0MA 1VQ4A 1YJNQ 1ZSZA 4M75B 2QASA 3JCMb 1R0CB 2CH4A 4FW1A 1K4US 2QQAA 2RO0A 1D1BA 1WX6A 2DILA 2RJDA 3JCMJ 3CC2Q 2GCXA 1QVGP 2QEXQ 1U8RA 4F04B 1ACMB 5L23A 3WVDB 4J5YA 2YXYA 2JT4A 2HSPA 2EPDA 2YLCA 4JS5A 4E7JA 2FVUA 3CQTA 4Q5WA 1X6GA 1W6XA 1B7TA 1M3AA 4LUEA 3QG1A 5CAIA 2CYZB 1BI3A 4GLMA 2OAUA 3GOXA 2KSSA 1PNJA 3QPHA 2KR3A 3CCMQ 3ZBDA 3FRNA 4WCIA 2LNHB 3PIPA 4E7LA 3O5ZA 2ZPBB 2DJZA 1IO6A 3FB9A 2COWA 4JUVA 4XU1A 2EQMA 2OTJT 2DNUA 4DEYA 1MV3A 1SSFA 2RA2A 3UA7A 1PSEA 4O6JA 1OQKA 5D7UA 2YUOA 2BZ8A 1WJSA 3J7AF 2ATCB 2LJ3A 2DZCA 3CBPA 3DB4A 4FL6A 4OMLA 2EGEA 2QDLA 1D3BA 3QJYA 1SF9A 1PCXA 4EPCA 1ZBXA 2PTKA 5CO7A 2MAMA 1K8AU 3O8VA 1N9RA 3OQ5A 1YIJA 5DM7R 3CCLT 1TSFA 2ZPGB 2DXBA 1YJNA 8AT1B 2ED0A 4X1VA 2DL5A 2KT1A 2XI9A 1V1CA 4MMKA 5KE3A 4JPBW 3SFMA 5GAOl 1FMWA 1M8MA 3CCQT 2NUTA 1N27A 1ZQ1A 3CC2A 2CZ7B 4E6RA 1O75A 2QEXA 2MI6A 5GMKj 1U06A 1C1AA 4QKUA 4GY5A 1VQ7T 1QLYA 2CZ6B 1HYOA 2OX7A 1EFNA 2X9HA 5GMKi 2R5AA 3CC7T 2XHCA 4KRTA 1NEGA 1HK9A 4N4GA 4DBHA 1ABOA 2CZ1B 4ZN3A 1U5SA 3OW2A 4AT1B 2D8JA 3EGUA 3TVTA 1YI2Q 1HSQA 3CCMA 4C0DC 4RKUE 2JUFA 1PM3A 4FU6A 1RAAB 3FDRA 3OYHA 3BE3A 2CT4A 2JTMA 3H8ZA 1OPLA 1H92A 3S3NA 2WSCE 4OMMA 3AHUA 2FRYA 3NHNA 4DBRA 2KRNA
chains in the Genus database with same CATH topology
3CC4Q 1S72Q 3I56Q 3G4SQ 1M90R 1YJNQ 2OTJQ 3G6EQ 1VQOQ 1K73R 2QA4Q 1VQ8Q 3CCUQ 1W2BP 1Q82R 1VQPQ 1YHQQ 3CCVQ 3CCLQ 3CXCP 3CMEQ 1Q81R 1VQ9Q 1VQLQ 1KD1R 3G71Q 1KC8R 1K8AR 1K9MR 1M1KR 1YI2Q 1VQ4Q 1VQKQ 1VQ5Q 1Q7YR 1JJ2P 3CMAQ 1NJIR 1VQ7Q 3CPWP 1YJ9Q 3CC2Q 2OTLQ 1Q86R 1VQNQ 1N8RR 1QVGP 3CCJQ 2QEXQ 1YITQ 3OW2P 1YIJQ 1VQ6Q 3CD6Q 3CCEQ 3CC7Q 3CCMQ 1VQMQ 3CCSQ 3CCQQ 3I55Q 1KQSP 1QVFP 3CCRQ 1YJWQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC4 Q;  1S72 Q;  3I56 Q;  3G4S Q;  1M90 R;  1YJN Q;  2OTJ Q;  3G6E Q;  1VQO Q;  1K73 R;  2QA4 Q;  1VQ8 Q;  3CCU Q;  1W2B P;  1Q82 R;  1VQP Q;  1YHQ Q;  3CCV Q;  3CCL Q;  3CXC P;  3CME Q;  1Q81 R;  1VQ9 Q;  1VQL Q;  1KD1 R;  3G71 Q;  1KC8 R;  1K8A R;  1K9M R;  1M1K R;  1YI2 Q;  1VQ4 Q;  1VQK Q;  1VQ5 Q;  1Q7Y R;  1JJ2 P;  3CMA Q;  1NJI R;  1VQ7 Q;  3CPW P;  1YJ9 Q;  3CC2 Q;  2OTL Q;  1Q86 R;  1VQN Q;  1N8R R;  1QVG P;  3CCJ Q;  2QEX Q;  1YIT Q;  3OW2 P;  1YIJ Q;  1VQ6 Q;  3CD6 Q;  3CCE Q;  3CC7 Q;  3CCM Q;  1VQM Q;  3CCS Q;  3CCQ Q;  3I55 Q;  1KQS P;  1QVF P;  3CCR Q;  1YJW Q; 
#chains in the Genus database with same CATH topology
 1VQM T;  3QWY A;  1SRM A;  2M0O A;  3P8B B;  5KYY B;  3CCU Q;  4ZNX A;  1YHQ T;  3A8H B;  2V8K A;  1PKS A;  2V26 A;  2O01 E;  4M75 G;  1X01 A;  3A98 A;  1UHF A;  1K0S A;  2LZ6 B;  5I2M A;  2FG0 A;  5ECA A;  2LP5 A;  4M4Z A;  1YJ9 T;  1QW1 A;  1VIE A;  4XTW A;  4BY6 C;  1GBR A;  3OMC A;  1LCK A;  4PL6 A;  1I1J A;  2HQX A;  4OMN A;  3TQ7 P;  5KYU B;  4PJO F;  4XAX B;  5CKF A;  1VQ6 A;  4J6Y A;  2LX9 A;  2P0Q A;  2ZGW A;  1GCQ A;  2L3S A;  1VOM A;  4M78 C;  2P4R A;  4PLI A;  3QHS A;  2XDP A;  3BFM A;  3VU3 C;  2HL5 C;  4R56 A;  1M1K C;  2D8H A;  3RKW A;  1UG1 A;  1B07 A;  4IIM A;  4RTW A;  2FRW A;  1RUW A;  2CS7 A;  1H3Z A;  4FM4 B;  3EG3 A;  2J6K A;  4EMK A;  3EFS A;  3INZ A;  4EIK A;  1SHG A;  2SRC A;  3ZEH A;  2DMO A;  2DL8 A;  4FIB A;  3ULR B;  2L3P A;  4A4F A;  4M75 A;  1M90 R;  5GAN h;  2M51 A;  1YI2 A;  5HK3 A;  3I9Q A;  1W4S A;  5A0D A;  3REB B;  2RI2 A;  3QKJ A;  3V7S A;  2PNI A;  1KQ2 A;  3VUZ A;  1O9S A;  1BB9 A;  4F7U F;  3OYY A;  2RJF A;  1QMC A;  4NS5 A;  4BE1 A;  7AT1 B;  4PFO A;  1Q95 G;  1WNL A;  3CCU A;  2ZPI B;  2K3B A;  2DYI A;  1PKT A;  1KJW A;  4BD3 A;  2EQK A;  2EYW A;  1D0X A;  4OB1 B;  1FX7 A;  3JCM e;  3SD4 A;  2XG8 D;  3E9F A;  4F16 A;  3I5R A;  1JEG A;  3CMA Q;  3CME T;  4PJO G;  4X9C A;  2RHZ A;  1OYX A;  2QAZ A;  5CCA A;  3MEA A;  2RHU A;  3V8L A;  1E6H A;  2ROT A;  4HT9 A;  3P8D A;  1GXI E;  2CSQ A;  2F2W A;  3C4S A;  3OYD A;  2QA4 Q;  1OX9 A;  2DEU A;  2VC8 A;  2VXE A;  2H8H A;  5EG2 A;  4KUI A;  3KUF A;  3EFO B;  3L2U A;  5I22 A;  4C0D B;  2FHD A;  3CCE Q;  4HCZ A;  2CUD A;  1UGP B;  3CPF A;  1LOJ A;  4OB2 B;  4NL3 A;  4KGX B;  2VVK A;  4M77 C;  3OYE A;  3M54 A;  4M7D C;  3PMT A;  5DLO A;  1WHG A;  2YT6 A;  2MF2 A;  3G71 Q;  2DRM A;  3DKM A;  5FRM A;  1C6V X;  2FB7 A;  3X25 B;  2XIC A;  2AKL A;  3VS7 A;  4R55 A;  2JM9 A;  1VQN Q;  3EH2 A;  2RQU A;  1UFF A;  3OB9 A;  1NYG A;  2E65 A;  3OBY A;  4F7U G;  1PWT A;  3JB9 F;  1WHL A;  3CCR Q;  3QZ9 B;  1M3C A;  3JCM Q;  2KRS A;  3EG9 B;  1MMA A;  1X27 A;  4EDU A;  1M2V B;  1KD1 C;  3RIR A;  3JSC A;  4C92 D;  4BY6 B;  3MEW A;  2KRM A;  3JCM V;  2NWM A;  2VWF A;  2GTO A;  2CP0 A;  1QVF A;  4N0A A;  2PU9 B;  1JQQ A;  1WLP B;  2XU8 A;  3H41 A;  4JRQ A;  4NOY A;  3AT1 B;  2YUQ A;  3ME9 A;  4C0Z A;  4PJM A;  3CCJ T;  1M90 U;  4M78 B;  2KBT A;  2MCN A;  2EBP A;  5AT1 B;  3CMA A;  2OJ2 A;  2AZV A;  3DLM A;  3E2U A;  5A0G A;  3RKX A;  2O88 A;  4M78 D;  1NJI R;  3MP1 A;  2Y4Y A;  1R77 A;  3OYL A;  1IRX A;  2QA4 A;  4OMP A;  4A54 A;  8ATC B;  1JO8 A;  3M9Q A;  1ZLM A;  5KYY A;  2KNB B;  1YCS B;  1Z9Z A;  2JVV A;  1MND A;  5CQX A;  4FCY A;  1AWO A;  5LJ5 e;  2DFU A;  4QVC A;  1KIK A;  2L0A A;  2YUP A;  2E3H A;  4A4G A;  4J9E A;  2O4X B;  3ER0 A;  5LJ5 j;  3GP8 A;  1LNX A;  3CCE A;  4HCC A;  4V2S A;  1UDL A;  2LCL A;  4CC2 A;  2DTH A;  1VQK T;  1X69 A;  2VGN A;  5GAN 2;  1IXD A;  4IUR A;  3L2R A;  4J9I A;  3G71 A;  1XTD A;  4XU2 A;  4AFZ C;  5KYU A;  4BB7 A;  2DX1 A;  2D1X A;  4Z02 A;  2DVJ A;  3JB9 G;  1VQN A;  2XDB A;  2BUD A;  3CCV T;  4IIO A;  2DO3 A;  4BI3 A;  3V8J A;  3CCR A;  4L6V 5;  4RTY A;  3M59 A;  2KK4 A;  2O2O A;  1BK2 A;  2CP7 A;  2K3Y A;  2DBM A;  3JB9 H;  1V29 B;  1YCY A;  1W2B P;  1ZBJ A;  1BKB A;  1MNE A;  4CI0 C;  1Q81 R;  2CGH A;  2JZ2 A;  3HFN A;  3PGG A;  1VYU A;  1R8O B;  3A8L B;  3OSS C;  3RUX A;  4FW2 A;  2K2M A;  1YBY A;  4QQ6 A;  5IXB A;  2K79 A;  4ZTF A;  3MP8 A;  4XK8 E;  3PTA A;  1K73 C;  2MIO A;  1IGQ A;  1EZZ B;  3OA6 A;  2JS2 A;  2M16 A;  4RTX A;  2FPF A;  5GMK h;  3JCM g;  3I56 T;  4M77 B;  2KDS A;  1JB0 E;  4EMG A;  4M7D B;  5LJ5 d;  4A4K A;  1VQL T;  2DE0 X;  2F69 A;  3OYI A;  1VQ4 T;  4C5I A;  3JB9 I;  2HQH A;  4P5N A;  5D6X A;  1WXB A;  4M77 D;  3EHQ A;  2A3L A;  3A5Z B;  3VS4 A;  1FMV A;  1V76 A;  2QXF A;  1IHV A;  3L2V A;  2M0Y A;  1KC8 R;  4F14 A;  4FSS A;  2BTT A;  2QGG A;  2F2X A;  4IUV A;  3E9G A;  1NLO C;  2PVG B;  2GQI A;  2JMC A;  2EQI A;  2DET A;  3NTH A;  1SG5 A;  3SWN C;  4XU0 A;  4ZGE B;  2VKN A;  2RMO A;  4JZ4 A;  3VYH B;  2JTF A;  5HY6 A;  2I0N A;  3VUB A;  3PE0 A;  3GBQ A;  4Y91 A;  1NPR A;  2EFI A;  1AWW A;  1G3S A;  3V7R A;  2K4Y A;  2YWW A;  1N8R C;  1UUE A;  1BYM A;  3EFO A;  1RAD B;  3D7S B;  1FXX A;  5FU6 B;  4C5G A;  1QCN A;  3NPF A;  2ED1 A;  1B34 B;  2PUK B;  4XTU A;  3M0P A;  1JU5 C;  2C0O A;  1SSH A;  3V7C A;  4J9F A;  2J6O A;  3CPW A;  4LD9 K;  3MP6 A;  2HL3 A;  1SPK A;  2YRD A;  1Q86 C;  3EGD B;  1YN8 A;  3RBB B;  2QTV A;  2K6D A;  5IAY A;  2M9U A;  2LT4 A;  3M56 A;  2C0I A;  4QVZ A;  5FU7 C;  2JS0 A;  5GAO q;  3EG9 A;  3GNG A;  1YIJ T;  1M2V A;  5A0L A;  3HL8 A;  3PVQ A;  3TSZ A;  3FEO A;  1TOV A;  1Q81 U;  2A37 A;  1YJN T;  2G6F X;  4O5V A;  4Z88 A;  4C8Q B;  1VQO A;  2HKQ B;  2GFA A;  3VRZ A;  3CC2 T;  4M78 A;  5KH6 A;  4J6X A;  3OYA A;  2QEX T;  4RTU A;  4RTZ A;  4ESR A;  2MOX A;  3G6E Q;  4X9D A;  2MPX C;  2KQW A;  4C8Q D;  1X2Q A;  4ZGD B;  4FYX B;  2R57 A;  1KFZ A;  5LJ5 g;  2LTO A;  4BDY A;  1QCO A;  2J06 A;  2KE9 A;  2F5T X;  2LNV A;  1BBZ A;  1TUC A;  1I5L A;  2YDL A;  1K9A A;  1B3Q A;  3OYG A;  1M1G A;  2AZS A;  4MDW A;  1A0N B;  1MHN A;  3JCM c;  3PIO A;  1ZSG A;  3CCM T;  4M75 F;  1Q82 R;  4B6M A;  4RG8 A;  1KC8 U;  2O4X A;  3OYF A;  5CKH A;  1G5V A;  1ZUK A;  1RAH B;  2D6F A;  2ZPH B;  4C92 E;  4LE9 A;  4PK4 A;  4J7I A;  1ZUU A;  1VQ6 Q;  2DYB A;  3NTK A;  4JJC A;  2KGT A;  1W70 A;  3C95 A;  2L2P A;  2ZZD A;  2DD5 A;  2LVM A;  5GMK m;  5J26 A;  3X20 B;  4BUG A;  3JCM f;  2BZX A;  4KGV B;  1OPK A;  1MGQ A;  4D8K A;  2DEQ A;  2C06 A;  2QQR A;  1AZG B;  3FLG A;  2QQ9 A;  3E19 A;  5KCH A;  1ZA2 B;  4M78 E;  1BI1 A;  2X4J A;  4JRK A;  3SWN B;  1UB4 A;  1D09 B;  2E1H A;  2G3R A;  1T3S A;  1VQP Q;  4HT8 A;  5CQY A;  1VQ9 Q;  4QQG A;  4BI8 B;  2RHX A;  2QTX A;  2HD0 A;  1PG5 B;  2E10 A;  3LX7 A;  3VYG A;  3OW2 P;  3G6E A;  1K9M C;  3GPL A;  4IUP A;  2JM8 A;  1VUB A;  4A63 B;  1WZO A;  2DK3 A;  3L2W A;  2W0Z A;  1D1C A;  5GAM e;  3EH1 A;  2EW3 A;  1BI0 A;  4M77 A;  3UWN A;  4M7D A;  3M55 A;  2NUP B;  3RMQ A;  4C92 C;  2RF0 A;  4KUL A;  4AMC A;  3OYC A;  4XU3 A;  1YI2 T;  2P4T A;  1GCP A;  2F5K A;  2SEM A;  1WA7 A;  2Y4X A;  5CK9 A;  5D6W A;  4QVD A;  2PVO B;  3CCS Q;  5I11 A;  1M4Z A;  4RG2 A;  1UGR B;  5FU7 B;  2GGR A;  3VKI A;  2RK2 A;  2FYK A;  2RJE A;  3MJX A;  2DL7 A;  3CCU T;  3PNW C;  3QDR B;  1CSK A;  1KQS A;  2OTL Q;  2CP5 A;  2E5Q A;  4XTV A;  1WJR A;  2ECZ A;  4FT4 A;  4JLG A;  4OB0 B;  3M0S A;  2EJ9 A;  4CRI A;  1D0Z A;  5DY9 A;  1Y7X A;  1Q7Y C;  4E7K A;  2LQK A;  2FL7 A;  1WHH A;  2EWN A;  1NEB A;  1BU1 A;  1B34 A;  3THK A;  2Z0W A;  3V8K A;  2MWO A;  1VQP A;  1MMN A;  2QQS A;  3CXC A;  2EYX A;  2E41 A;  3TRE A;  1VQ9 A;  3H9N A;  3HSB A;  4HCK A;  1I07 A;  1G83 A;  2DVE A;  4J8O A;  4M77 E;  1VIF A;  5LJ5 f;  2D0N A;  4J9H A;  3EGD A;  4M7D E;  3OW2 S;  4M7A C;  2DIG A;  2AT1 B;  1OEB A;  2OAW A;  4DBF A;  2X51 A;  3L2Q A;  2L89 A;  5CR2 A;  2RM4 A;  3M0T A;  2R58 A;  1S1N A;  2J05 A;  3DLL A;  2RPN A;  3QDF A;  3EG0 A;  4KH0 B;  2HDA A;  2GBQ A;  3UDC A;  3GF5 A;  3H0F A;  4C8Q A;  3CCS A;  2YUN A;  1OUL A;  1HJD A;  1MMD A;  1UGQ B;  1Y96 B;  2HQE A;  3S3O A;  1YWO A;  3S6W A;  4KGZ B;  2EQU A;  2CDT A;  4RTV A;  2DL4 A;  1MMG A;  2WSE E;  2JTE A;  1AOJ A;  3OSV A;  5GAN f;  4HKE A;  2OTL A;  4TVR A;  3NFC A;  3TU4 K;  2FZK B;  2RNA A;  1NM7 A;  3KXT A;  4OP0 A;  2CRE A;  1YFN A;  3ZFJ A;  1KQS S;  2KMT A;  3A8O B;  2DTI A;  3MKD A;  9ATC B;  4FT2 A;  2EYQ A;  3CMA T;  1X2K A;  2C0T A;  2RHY A;  2LJ0 A;  4F17 A;  1TWB A;  1EX4 A;  4WF2 A;  3R6O A;  3OYB A;  2FPE A;  2O9S A;  3DB3 A;  5M9O A;  1M5Q 1;  2W10 A;  2QA4 T;  2CP2 A;  5IHI A;  4RCC A;  2M02 A;  1WHM A;  2A7Y A;  5IHN A;  3C0C A;  1PSF A;  4HVW A;  2LT1 A;  4XTY A;  4C92 B;  3QYH B;  2E70 A;  1UTI A;  1W1F A;  5J39 A;  1UJY A;  2ABL A;  1R0B G;  4UC4 A;  3CCE T;  1WJQ A;  1YWP A;  2HKN A;  2LQW A;  3HPW A;  5IN1 A;  2EQJ A;  1M1K R;  2K5L A;  3G1J A;  2M1H A;  2XD0 A;  3JCM d;  2V1R A;  1NBE B;  4R0K A;  4C8Q E;  4Y92 A;  2K5F A;  4LXC A;  3G71 T;  1AHJ B;  1YIT Q;  1WPY A;  1BIA A;  3SWN A;  1VQN T;  1CKB A;  2A08 A;  1U1T A;  5GAM g;  3I35 A;  3CCR T;  1WXU A;  3QYG B;  1JBM A;  1G3W A;  2LMJ A;  2KXC A;  2XID A;  5FU6 C;  1VQ5 Q;  1M8V A;  1AWX A;  4MDX A;  2KYB A;  3FJP A;  4BE0 A;  4KUD K;  4OGC A;  4B9W A;  3QZ5 B;  4CC3 A;  4C0G A;  4AFS C;  1ZUY A;  3M0R A;  3I55 Q;  4GLK A;  2LQ8 A;  3TCJ A;  1PD1 A;  2JN0 A;  2DBK A;  2QQB A;  1K8A C;  3X28 B;  3H0H A;  2NUP A;  3HKS A;  2YLB A;  4PFZ A;  4Z89 A;  4PJL A;  3FJ5 A;  3I5S A;  1G8X A;  2JW4 A;  4M7A B;  3M5A A;  1BCM A;  4MML A;  4HVU A;  4ELZ C;  3CD6 Q;  2GFU A;  3T9N A;  4PKC C;  3CC4 Q;  3G4S Q;  1JJ2 A;  1K0X A;  1VQ8 Q;  5IXF A;  4B9X A;  4M7A D;  1RL2 A;  1OU8 A;  4J9B A;  2DA9 A;  4RTT A;  4C8Q C;  4BI4 A;  2LQN A;  2ZPF B;  2RI5 A;  2VYT A;  2FEI A;  1WQ7 A;  2AHJ B;  1WDX A;  2KEA A;  1T0H A;  1RAC B;  2PQW A;  1TU0 B;  4M78 F;  2CSI A;  1RAF B;  5GAN 7;  4FYW B;  1S72 Q;  5GJV B;  3JCM P;  5GAN e;  3C94 A;  2IIM A;  1VYV A;  3TEE A;  3CCJ A;  5GAN j;  1YIT A;  3MHX A;  3OS2 A;  2DJQ A;  4IUU A;  2PVD B;  1QVF S;  3OS5 A;  1W2B A;  3LGF A;  1X75 C;  1PD0 A;  2X3W D;  4J9G A;  1NE8 A;  1M3B A;  1TUG B;  2KRO A;  3VJP A;  1VQ5 A;  1OZ2 A;  2KT8 A;  2HZY A;  1M1K U;  1KD1 R;  4JJD A;  2LC4 A;  5KYW B;  3I55 A;  1QWF A;  1UEB A;  4ZGJ B;  2L3R A;  1IZ6 A;  3EFR A;  2AIR B;  2DPP B;  4C92 G;  4ATO A;  1U1S A;  2DKG A;  1ZHI A;  1VQO Q;  4OVA A;  2MK5 A;  2DXT A;  2LRQ A;  1NJI U;  2RQW A;  1Y96 A;  4E7Z A;  5CKD A;  4HVV A;  3CD6 A;  2H3E B;  3CC4 A;  3G4S A;  3QXE B;  3SHW A;  3S3M A;  1VQ8 A;  5GMK l;  5LJ3 f;  2I2L A;  2MMP A;  2QDY B;  1YJW Q;  4PJO C;  1JJ2 S;  2X4W A;  1WI7 A;  5GAN 8;  3J80 E;  4LUD A;  1T0J A;  1UE9 A;  1VQO T;  4M78 G;  3H6Z A;  2RI3 A;  2L3Q A;  5GAN d;  3L1A A;  1IGU A;  1F1B B;  2LX7 A;  1SRL A;  2VGM A;  1YP5 A;  2GNC A;  1S72 A;  2X4X A;  4QW2 A;  3HHT B;  3GLX A;  3LWI A;  2WAC A;  2XKO C;  2E6Z A;  1WHJ A;  5FW9 A;  1XOV A;  4PJJ A;  5GAM f;  2WSF E;  3N5B B;  1AEY A;  1WFW A;  4E7S A;  4M77 F;  4M7D F;  5CVI A;  1Y71 A;  4PNO A;  2E6N A;  5J3B A;  4C92 A;  5CKE A;  3LYI A;  2KXD A;  3QBY A;  2IG0 A;  3A8G B;  4IKF A;  1RLQ C;  1QWE A;  2A0F B;  1UGV A;  2EAY A;  3REA B;  4J9C A;  4OB3 B;  2KYM A;  3URG A;  2BE9 B;  2BE7 D;  3OYJ A;  4WTO B;  2A36 A;  1QVG A;  2DRK A;  4LDY A;  3P8H A;  4XTZ A;  2EYZ A;  3ASK A;  3VS6 A;  4M75 D;  3VS1 A;  1I8F A;  2DM1 A;  4MZM A;  1X6O A;  4D6W A;  2LJ1 A;  4PJN A;  4JJB A;  3RR6 A;  4HA8 A;  2ENM A;  3OYK A;  2OTJ Q;  1K73 R;  1KQ1 A;  2IVW A;  3M4G A;  5C6S A;  2DXC A;  3RDV A;  1KD1 U;  2BIV A;  2RD1 A;  1JRI A;  2DLP A;  2IPO B;  1ARK A;  4ORZ A;  3RNJ A;  2QI2 A;  1J3T A;  1M2O A;  1YJW A;  2VB6 A;  4CC4 B;  4ELY C;  1OOT A;  2QG9 B;  2HSE B;  1NZ9 A;  3MO8 A;  3L2Z A;  4AG2 C;  3JCM h;  3HRT A;  2DER A;  3SDZ A;  1HXD A;  1NPP A;  3A1P A;  2K5I A;  3CCL Q;  4L59 A;  4BE2 A;  1QCF A;  3G6E T;  5KYN A;  2DL3 A;  4XQ3 A;  5GAN 5;  4M7A A;  4JZ3 A;  4NL2 A;  3JB9 J;  2EVR A;  3HRU A;  4M77 G;  3LLR A;  2OI3 A;  1I81 A;  4M7D G;  2GTJ A;  1E7O A;  3VV0 A;  2VAS A;  2YRC A;  3EG2 A;  5HKC A;  3CCQ Q;  5KCO A;  2LCC A;  1OI1 A;  1NG2 A;  5GJW B;  3CPW S;  5GAN g;  5HK0 A;  3BDU A;  2YHT A;  2BKD N;  2PZ1 A;  1VQ7 Q;  5KYX B;  4C8Q F;  1N8R R;  3CEY A;  3PFS A;  5LJ3 e;  3CC7 Q;  4EMH A;  1M90 C;  1DJ7 B;  4J83 A;  4A53 A;  4OF1 A;  1VQ6 T;  1IRE B;  5LJ3 j;  4AFU C;  4DEX A;  2K7A A;  3MPU B;  2JMA A;  4PJO B;  1H3H A;  1AD5 A;  5EC7 A;  5GMK e;  1QVG S;  2P84 A;  1ABQ A;  1PRL C;  2F1L A;  2ZPE B;  1Q86 R;  2ROL A;  2K57 A;  5IHK A;  2OTJ A;  4JDS A;  3OS1 A;  1PHT A;  2KI7 A;  2VXF A;  2HBW A;  5AYF A;  1VQM Q;  4PJO D;  1OZ3 A;  4N4H A;  4JJN K;  2RQV A;  2COZ A;  1YHQ Q;  3EGX B;  2D0Q B;  1CKA A;  4LDU A;  3VS2 A;  6AT1 B;  3UPU A;  4MZP A;  4GBQ A;  1TG0 A;  1KHI A;  1Y07 A;  3QII A;  5GAM j;  3EHR A;  5KYW A;  1K1Z A;  2A28 A;  4YTL A;  1VQP T;  2EJG A;  2EGC A;  2FPD A;  5FRO A;  2YRV A;  4MZT A;  1VQ9 T;  4M7A E;  1YJ9 Q;  3FIF A;  3HTR A;  2JOY A;  1QKW A;  2X4Y A;  2EGA A;  4K11 A;  1C0M A;  3CCL A;  1ZSZ C;  1K73 U;  3NTI A;  3X26 B;  4QQD A;  1M1F A;  1N6A A;  3M57 A;  5KE2 A;  5GAO p;  1QVP A;  4F7U B;  3BDL A;  1NLP C;  1XQH A;  4LDW A;  5CKB A;  3CCQ A;  1AZE A;  4E2F B;  3VS0 A;  4Y28 E;  4ZTJ A;  2FZG B;  1SKU B;  4E7I A;  4C8Q G;  1KQS P;  4XTX A;  5LJ3 d;  3CCS T;  2J6F A;  3MEU A;  4JS4 A;  5LJ5 h;  1Q82 U;  1Y0M A;  3M0U A;  2CP6 A;  1VQ7 A;  3WXM B;  3VS5 A;  2JNG A;  2DTO A;  4BDZ A;  1KHC A;  3LGL A;  3CC7 A;  1KK7 A;  1LJO A;  3UAT A;  3PVL A;  2L5Q A;  3LW5 E;  1RAI B;  1WHK A;  4E47 A;  2OTL T;  2E64 A;  2O31 A;  3SB2 A;  2Y90 A;  3M0Q A;  2MYS A;  2RHI A;  1QP3 A;  3CBO A;  1BIB A;  3MEV A;  5D6Y A;  1WYX A;  1FWZ A;  3CXC P;  2HCK A;  3BW1 A;  5GAM d;  1GBQ A;  3CBM A;  2EIF A;  1WGS A;  1VQM A;  1N8R U;  1M30 A;  1PC0 A;  1BI2 A;  4J6W A;  1YNZ A;  1YHQ A;  3BY7 A;  1SHF A;  1OX8 A;  2V8I A;  3EAE A;  1IB8 A;  2CUB A;  1YJ9 A;  2L8D A;  3CME Q;  1NJI C;  1Z9Q A;  5GAO m;  1Q86 U;  2DAQ A;  4J9D A;  2XK0 A;  2COY A;  4AG1 C;  3SEM A;  2QK0 A;  4D8D A;  1XNI A;  1NYF A;  3JAM E;  1RLP C;  4OGE A;  2VUB A;  1K9M R;  1BCO A;  1LVK A;  1T3L A;  1HD3 A;  2DF6 A;  3C12 A;  1RAB B;  4KH1 B;  4LD6 A;  1VA7 A;  1N9S A;  2HAX A;  1AT1 B;  2K2V A;  1GFD A;  2YSQ A;  3JB9 D;  2DXU A;  1TUD A;  4JLI A;  1ZA1 B;  2J7I A;  4A4H A;  4DOV A;  1OU9 A;  3Q1J A;  1WIE A;  3JCM W;  1FYN A;  5GAO r;  1ZX6 A;  3G7Z A;  1X43 A;  4RMO A;  3M4Y A;  2HEQ A;  4LDX A;  3HP9 A;  3NGP A;  5GAN 6;  2MWP A;  1IHW A;  3JCM X;  3EG1 A;  2EKH A;  2KY9 A;  5LJ3 g;  3LH0 A;  3PMI A;  4M75 E;  3CXC S;  1Q81 C;  1H8K A;  2H3J A;  4Z8A A;  1ZSZ B;  4PLL A;  4ANJ A;  2DZ9 A;  4C0F A;  1GFC A;  1UJ0 A;  5L8R E;  3GNF B;  1Q7Y R;  3KFV A;  2FO0 A;  3IQL A;  5KYX A;  2RK1 A;  1GL5 A;  1G3Y A;  3FC3 A;  2FZC B;  1P92 A;  3CCJ Q;  4HCB A;  1TH7 A;  1I0C A;  3LWH A;  3M53 A;  1XJW B;  3GIB A;  3CME A;  1QVF P;  1G3T A;  2RQT A;  3KBG A;  3MCA B;  1UGS B;  2BZY A;  4PJO A;  1VYT A;  3M58 A;  4CC7 A;  4E7H A;  1AWJ A;  3F70 A;  2O9V A;  3UF4 A;  1GCQ C;  1PRM C;  2EJF A;  1RI0 A;  4DA4 A;  2QGF B;  4ME7 A;  2K9G A;  3EGX A;  2LCS A;  1YIT T;  4JRI A;  5GAN 3;  2K3X A;  2X35 A;  5CIU A;  3PT9 A;  1KC8 C;  2V1Q A;  1MUZ A;  2PUO B;  4OMF B;  2ZAE A;  4EMK C;  1VQK Q;  2RQR A;  1TS9 A;  5IH2 A;  1KG1 A;  3OYM A;  1VQ5 T;  1GRI A;  2ESW A;  4C92 F;  2EYY A;  3UT1 A;  2AKK A;  4C5E A;  2EKO A;  5I21 A;  1U3O A;  2JJ9 A;  1K9M U;  4N4I A;  1MV0 B;  4M75 C;  1M9S A;  3HRS A;  1D3B B;  1LPL A;  3R6N A;  4A4E A;  3I55 T;  1TXQ A;  2RN8 A;  4L5G A;  3CCV Q;  1G2B A;  4II1 A;  4F7U A;  3MET A;  3VRY A;  1RAG B;  4ZN1 A;  1D1A A;  1RAE B;  1JJ2 P;  2F2V A;  2CH4 W;  3NMZ C;  4AFQ C;  4KT0 E;  1UEC A;  2HMA A;  2CP3 A;  2RB6 A;  4HXJ A;  3QWX X;  5FWC A;  3X24 B;  1UHC A;  2DIQ A;  4PJO E;  3TSW A;  3CD6 T;  3QSU A;  1EIF A;  1E6G A;  4DQ2 A;  3CC4 T;  3G4S T;  3QUI A;  5GAN 4;  2NUT B;  4RCB A;  1VQ8 T;  3OBW A;  4IUT A;  2VV5 A;  1TTH B;  4QT7 A;  2NYS A;  1WXT A;  5FWB A;  1KSW A;  4LNP A;  1X6B A;  3RMS A;  2GQV A;  2V8J A;  3U23 A;  3I56 Q;  2NUZ A;  4C5H A;  2B8A A;  3A8M B;  5IT9 E;  3WVE B;  3L42 A;  1S72 T;  4PFP A;  2P0P A;  1Q7Y U;  1VQL Q;  1VQ4 Q;  4JRP A;  2E4H A;  3RES A;  3LH5 A;  3QO3 A;  1M27 C;  3JRZ A;  3RER A;  5LJ3 h;  4M7A F;  3QJ6 A;  4DBQ A;  4LN2 A;  1FMK A;  1N5Z A;  1RI9 A;  2HNI A;  2CZ0 B;  1QQJ A;  2CKK A;  2XDD A;  5A2Q E;  4FYY B;  1VQK A;  1D0Y A;  3RKY A;  2RH2 A;  3OS0 A;  2D9T A;  3UA6 A;  3H0I A;  4F7U E;  1AVZ C;  3HFO A;  4RUG A;  3OMG A;  1Y57 A;  2KVQ G;  4FYV B;  2R5M A;  2E12 A;  4X34 A;  3CCV A;  5DLQ E;  5GAM h;  1Q82 C;  1OV3 A;  4M7D D;  2KAF A;  5LL6 S;  4KBM B;  2QYZ A;  4LDV A;  2E5K A;  2GF7 A;  2B86 A;  1K8A R;  4N0A C;  4BAC A;  1JXO A;  1K76 A;  2P0K A;  4IUQ A;  4OMQ A;  3JV3 A;  2RJC A;  2E3I A;  1QKX A;  1SEM A;  2NLU A;  1I5O B;  1WQW A;  2LDM A;  3OY9 A;  5HCK A;  2HBP A;  1YJW T;  5FRN A;  3J81 E;  3VS3 A;  1I4K 1;  5GAO n;  2AK5 A;  2XMF A;  3E1S A;  3ZL7 C;  1QP2 A;  5FLX E;  4VUB A;  3OYN A;  3CPW P;  4FSX A;  4J7F A;  1JXM A;  4EMK B;  3I56 A;  1YIJ Q;  1H64 1;  2CT3 A;  2ZCF B;  2JXB A;  1W2B S;  5I2S A;  2DD4 A;  4OMO A;  1VQL A;  4M7A G;  2X3X D;  4DOW A;  5C0M A;  1VQ4 A;  1YJN Q;  1ZSZ A;  4M75 B;  2QAS A;  3JCM b;  1R0C B;  2CH4 A;  4FW1 A;  1K4U S;  2QQA A;  2RO0 A;  1D1B A;  1WX6 A;  2DIL A;  2RJD A;  3JCM J;  3CC2 Q;  2GCX A;  1QVG P;  2QEX Q;  1U8R A;  4F04 B;  1ACM B;  5L23 A;  3WVD B;  4J5Y A;  2YXY A;  2JT4 A;  2HSP A;  2EPD A;  2YLC A;  4JS5 A;  4E7J A;  2FVU A;  3CQT A;  4Q5W A;  1X6G A;  1W6X A;  1B7T A;  1M3A A;  4LUE A;  3QG1 A;  5CAI A;  2CYZ B;  1BI3 A;  4GLM A;  2OAU A;  3GOX A;  2KSS A;  1PNJ A;  3QPH A;  2KR3 A;  3CCM Q;  3ZBD A;  3FRN A;  4WCI A;  2LNH B;  3PIP A;  4E7L A;  3O5Z A;  2ZPB B;  2DJZ A;  1IO6 A;  3FB9 A;  2COW A;  4JUV A;  4XU1 A;  2EQM A;  2OTJ T;  2DNU A;  4DEY A;  1MV3 A;  1SSF A;  2RA2 A;  3UA7 A;  1PSE A;  4O6J A;  1OQK A;  5D7U A;  2YUO A;  2BZ8 A;  1WJS A;  3J7A F;  2ATC B;  2LJ3 A;  2DZC A;  3CBP A;  3DB4 A;  4FL6 A;  4OML A;  2EGE A;  2QDL A;  1D3B A;  3QJY A;  1SF9 A;  1PCX A;  4EPC A;  1ZBX A;  2PTK A;  5CO7 A;  2MAM A;  1K8A U;  3O8V A;  1N9R A;  3OQ5 A;  1YIJ A;  5DM7 R;  3CCL T;  1TSF A;  2ZPG B;  2DXB A;  1YJN A;  8AT1 B;  2ED0 A;  4X1V A;  2DL5 A;  2KT1 A;  2XI9 A;  1V1C A;  4MMK A;  5KE3 A;  4JPB W;  3SFM A;  5GAO l;  1FMW A;  1M8M A;  3CCQ T;  2NUT A;  1N27 A;  1ZQ1 A;  3CC2 A;  2CZ7 B;  4E6R A;  1O75 A;  2QEX A;  2MI6 A;  5GMK j;  1U06 A;  1C1A A;  4QKU A;  4GY5 A;  1VQ7 T;  1QLY A;  2CZ6 B;  1HYO A;  2OX7 A;  1EFN A;  2X9H A;  5GMK i;  2R5A A;  3CC7 T;  2XHC A;  4KRT A;  1NEG A;  1HK9 A;  4N4G A;  4DBH A;  1ABO A;  2CZ1 B;  4ZN3 A;  1U5S A;  3OW2 A;  4AT1 B;  2D8J A;  3EGU A;  3TVT A;  1YI2 Q;  1HSQ A;  3CCM A;  4C0D C;  4RKU E;  2JUF A;  1PM3 A;  4FU6 A;  1RAA B;  3FDR A;  3OYH A;  3BE3 A;  2CT4 A;  2JTM A;  3H8Z A;  1OPL A;  1H92 A;  3S3N A;  2WSC E;  4OMM A;  3AHU A;  2FRY A;  3NHN A;  4DBR A;  2KRN A; 
#chains in the Genus database with same CATH homology
 3CC4 Q;  1S72 Q;  3I56 Q;  3G4S Q;  1M90 R;  1YJN Q;  2OTJ Q;  3G6E Q;  1VQO Q;  1K73 R;  2QA4 Q;  1VQ8 Q;  3CCU Q;  1W2B P;  1Q82 R;  1VQP Q;  1YHQ Q;  3CCV Q;  3CCL Q;  3CXC P;  3CME Q;  1Q81 R;  1VQ9 Q;  1VQL Q;  1KD1 R;  3G71 Q;  1KC8 R;  1K8A R;  1K9M R;  1M1K R;  1YI2 Q;  1VQ4 Q;  1VQK Q;  1VQ5 Q;  1Q7Y R;  1JJ2 P;  3CMA Q;  1NJI R;  1VQ7 Q;  3CPW P;  1YJ9 Q;  3CC2 Q;  2OTL Q;  1Q86 R;  1VQN Q;  1N8R R;  1QVG P;  3CCJ Q;  2QEX Q;  1YIT Q;  3OW2 P;  1YIJ Q;  1VQ6 Q;  3CD6 Q;  3CCE Q;  3CC7 Q;  3CCM Q;  1VQM Q;  3CCS Q;  3CCQ Q;  3I55 Q;  1KQS P;  1QVF P;  3CCR Q;  1YJW Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...