3CCVQ

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2616a
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3ccvQ00
1M90R 3CCRQ 1VQMQ 1YI2Q 1KD1R 3CCMQ 3G71Q 3CMEQ 1YHQQ 1VQ6Q 1YITQ 1Q81R 1VQ4Q 1VQ5Q 1KC8R 2OTLQ 1M1KR 3CCSQ 1VQ9Q 1VQ7Q 1VQNQ 3OW2P 1K73R 1QVFP 1YJNQ 2QA4Q 3CC2Q 1QVGP 1VQLQ 3CC7Q 2OTJQ 3CCLQ 3CCQQ 3CC4Q 3CCJQ 1VQOQ 1VQKQ 1VQPQ 2QEXQ 1YIJQ 3CCEQ 3CCVQ 1YJ9Q 1W2BP 1K9MR 3G6EQ 1KQSP 1Q86R 3CD6Q 1N8RR 1S72Q 3CXCP 3CMAQ 1NJIR 3CPWP 1K8AR 1JJ2P 3I56Q 1Q82R 3G4SQ 3CCUQ 3I55Q 1VQ8Q 1Q7YR 1YJWQ
chains in the Genus database with same CATH superfamily
3CPWA 5GAN5 1ZBXA 3TEEA 2P4TA 3C94A 3JB9J 2JT4A 1VQPT 1W1FA 2VXEA 3CMEA 4OMQA 1TS9A 3JCMQ 1ZHIA 2HQHA 2HQEA 1NPRA 2K7AA 4OMPA 3VKIA 2RJDA 4KH0B 1QCFA 4R55A 1AZEA 4BE2A 2EPDA 3RDVA 4J83A 3V8KA 3NHNA 2ZGWA 4AFQC 3GIBA 1N9SA 4HVUA 1EFNA 3CC7T 5I2SA 4L59A 2OTLQ 1B34A 3SFMA 3FJ5A 1ZUUA 4C0DC 1K9AA 2GGRA 1Y7XA 2GCXA 4MZTA 2KNBB 4GLMA 5LJ5e 2O31A 4JLIA 3PT9A 3CC4A 2MI6A 4DQ2A 3CCEA 4J7IA 1YI2T 4PJNA 2DXUA 1MV0B 2OX7A 4HCKA 3J81E 1RAEB 2L8DA 2JM8A 1AHJB 3G71A 3J80E 2QYZA 3BY7A 3BFMA 1KIKA 3M55A 3CC4Q 2ZPGB 1VQ7A 1KQSS 2AZVA 4F14A 1VQPQ 3L2VA 5LJ5h 5FROA 2QTVA 4J9IA 3REAB 5IAYA 2A36A 4M7DF 3MEUA 3EG3A 1E7OA 3VS6A 1SEMA 5GAMd 1YWOA 4CC4B 1VQ7Q 5A0LA 1RADB 2DJZA 4C92F 1K8AC 2JS0A 1QVGA 1ABQA 3V7RA 5CO7A 2BIVA 4DOVA 2M0YA 1FMWA 1JJ2S 5D7UA 5GMKm 3RKWA 3M0QA 1X6GA 4HVWA 5KYWA 2KT8A 4II1A 2FRWA 3L2QA 4ZTFA 4IKFA 2B86A 2J05A 1Q86C 4QKUA 3QHSA 2DFUA 2A3LA 3TQ7P 4D8DA 3RKYA 1IO6A 3E9GA 3KUFA 1ZSZB 2DTOA 1QQJA 3CPWS 1WJRA 3LH0A 1KC8C 3OYFA 1CKBA 1PHTA 3AHUA 4ZN3A 1LCKA 4E7HA 1BI3A 4OGCA 4FT4A 3LX7A 1T3SA 3OYHA 4RTXA 2YUOA 4PJOG 5HK0A 1K76A 2J06A 4EPCA 5FLXE 2LRQA 1GFCA 4FSXA 1RAGB 3BW1A 2SEMA 3E2UA 4PJOB 3C95A 3I56T 4M75B 3FEOA 1Q81C 2X9HA 2LQ8A 3CCVA 1PWTA 4PJJA 5HY6A 2ED0A 4EMKA 4IUQA 1WXUA 4RTUA 4F04B 2KI7A 3I9QA 1B7TA 1Y07A 2AT1B 3H41A 2KEAA 3OS5A 2DZ9A 3CCVQ 1U1SA 3OS0A 3JCMe 3I55T 4LXCA 2FYKA 2LQNA 1I5LA 4M78C 2EVRA 2K5LA 1M2VB 2FG0A 3OYMA 2IVWA 4M78D 5CR2A 2G3RA 3HP9A 1UEBA 4JRKA 5D6YA 4OMOA 5I22A 1M2OA 3EH2A 4KGVB 3JCMh 1YHQT 2BUDA 2AKLA 4FM4B 1WNLA 5GJVB 2JJ9A 3L42A 4ZN1A 1H8KA 2BZYA 2HBWA 2JNGA 1QVGS 2D9TA 3CCRA 1AWJA 2LQKA 1IREB 4ESRA 3QYGB 4M77A 3FB9A 2V26A 5GAMg 5CVIA 5GAN2 5GAOp 3HRSA 3QZ5B 4AFUC 5GANj 1YP5A 1QKXA 4ME7A 1AD5A 2I2LA 3NFCA 3CCRQ 3U23A 1X01A 2KDSA 2O88A 4M7DG 1ZA1B 1GL5A 3OYLA 1OULA 2QQRA 5GMKj 4M7DB 3VS7A 2XMFA 4OGEA 1Y0MA 2HBPA 3JCMJ 4XTYA 3EHQA 1XJWB 2LZ6B 3Q1JA 8AT1B 1WQWA 1WPYA 3PVQA 3A5ZB 2RK1A 1Q95G 4C92B 2FPDA 1LPLA 3SEMA 5GAN8 4F7UE 2DM1A 4FSSA 1YJWA 4MDWA 4CC2A 1WFWA 2V1RA 2NUTB 4JZ3A 1D09B 4AG1C 4NL3A 1VQ9A 4KT0E 2LJ1A 4C0GA 1OPKA 4NL2A 4A4KA 2BZXA 5GMKi 2KRSA 2DPPB 3JAME 5CAIA 1VQ4T 2MWOA 1LNXA 1IGQA 3DB3A 4FCYA 2E5QA 4JUVA 1YJWQ 2XDPA 1PKSA 2IIMA 1I0CA 2GBQA 1VQ9Q 1RI9A 1RAFB 2EYQA 2JS2A 1D0ZA 1TU0B 1AZGB 3QKJA 3CC2A 3L2UA 3CCQA 2XD0A 2CYZB 2ZZDA 3V8JA 2K3YA 3OS1A 1SRLA 4KGXB 4HKEA 1VIFA 5CK9A 4LD9K 5IHNA 2ECZA 2MYSA 2KE9A 4XTZA 3KXTA 3EH1A 4RCBA 3CC2Q 2FPFA 3CCQQ 3S3NA 1QVFA 1S1NA 4E7ZA 2QDLA 1TTHB 5GAOr 3NPFA 1Z9QA 4J9BA 1WHMA 4RKUE 3M57A 2O2OA 2XK0A 3S3MA 5I11A 4KULA 4EMKC 3M56A 1GCQA 3A8GB 5GANe 1VQ4Q 1ZSZA 1ZX6A 2QEXT 3MKDA 1VQ6A 4RTZA 2DE0X 2K2MA 1QP2A 4J9FA 5D6XA 1WHKA 5CCAA 1MHNA 1PC0A 1MMDA 2PNIA 3M0TA 3VYHB 1KQSP 2DL7A 4HCCA 5GMKe 2BE7D 2JVVA 2HKQB 4ANJA 2ZPEB 3BE3A 2YUPA 4PJOA 1U5SA 4FYVB 3RBBB 1VQ6Q 4M75A 4QQ6A 1BI0A 2KRMA 2CT4A 2RN8A 5GANh 4VUBA 3TREA 1NG2A 3CCJQ 4C8QF 3SB2A 3OW2A 2HAXA 1T3LA 2RI3A 3P8DA 3CXCS 2DO3A 3JCMX 1X6BA 2J7IA 2RNAA 1YITT 3CCMT 2LMJA 1JJ2P 5GMKh 2YHTA 3EHRA 1UDLA 2GFAA 2Y4XA 2L3PA 2QA4T 1M90U 4RTVA 3VRYA 1JO8A 2AIRB 3V7SA 3GNFB 1D1BA 2F5TX 3QO3A 1GRIA 2E64A 2JTFA 2RQRA 2MOXA 3PGGA 2Z0WA 4M4ZA 4BUGA 2L5QA 1WJSA 1C1AA 1M2VA 2K5IA 2RM4A 2QQ9A 4DA4A 2E3HA 1PSEA 2XKOC 2ATCB 1NJIU 4M77D 3CPWP 3M0UA 2YRCA 4X34A 3PMIA 1VQ8A 1H92A 5D6WA 5LJ5f 1UJ0A 2RQWA 1AVZC 1Y96B 1DJ7B 4D6WA 4DBHA 1OZ3A 2LT1A 3HRTA 5CQXA 3J7AF 1VQ8Q 2OAUA 3CQTA 3EGDB 3MCAB 5KYYA 2X4WA 1YITQ 1QVFS 4Y92A 2G6FX 3JB9I 1V76A 4J8OA 4ELZC 4PL6A 3FJPA 4ZGJB 3EG9B 2EBPA 3M4YA 2P0PA 3I35A 2C0TA 1M1FA 4LNPA 5FU7B 4ATOA 2CUBA 2A7YA 4FT2A 3HPWA 1ZBJA 1KJWA 4B9XA 4QVCA 3JB9F 2V8IA 3X26B 1PKTA 1YJNT 2X51A 3X20B 1GCPA 1R77A 2M51A 5CIUA 2ESWA 4JRPA 2DD4A 2EWNA 1IB8A 4E7LA 1TG0A 4C92A 4PLLA 3TSZA 4MZMA 2DRKA 2GFUA 1IHVA 2F2VA 2L2PA 4B9WA 2K79A 2DL4A 2ZPBB 1KQSA 2NUTA 4FYYB 3OW2S 4IUUA 1VQ5A 1SF9A 1QVGP 3PE0A 1IZ6A 2FZGB 3CMET 3EG2A 2RI2A 4C0FA 2CP2A 3LLRA 4CC3A 4J6XA 1GCQC 3VYGA 3UPUA 1WJQA 1JJ2A 1N5ZA 1ZSZC 2ZPHB 3P8BB 3MP1A 2XDBA 2YDLA 1VQNA 3QZ9B 3TU4K 2PTKA 1MMAA 2LX7A 3UT1A 1AWXA 1VQKA 3RESA 2XHCA 3HFNA 4C8QG 3M59A 1GBQA 2MIOA 4OB1B 1I4K1 4BI4A 2EQMA 3HRUA 2KSSA 4XAXB 4C8QB 1UTIA 5GAMj 1WQ7A 3G4SA 3CC4T 2PVOB 1YN8A 3CCET 4M75C 2DEQA 1VQNQ 2V8JA 3UWNA 5FRNA 2K2VA 1N9RA 2E41A 3NGPA 4PJOD 5CKEA 1W2BS 2QQAA 3JCMf 4M75D 1WHLA 3OBYA 1MUZA 4C5EA 3G71T 1OEBA 2P4RA 2O9VA 2FVUA 2L3QA 2RPNA 4LDYA 1RI0A 3G4SQ 2ZPFB 3NMZC 2JMAA 1VQ7T 3OYJA 2EYXA 2RJEA 3VS2A 3CMEQ 3VV0A 2NUPA 3LH5A 5HCKA 2RHXA 3OYYA 2RJCA 2QQBA 3M0SA 2E1HA 4YTLA 3A8LB 2RHZA 3D7SB 3OMGA 1YJ9A 3BDUA 1OU9A 2HDAA 4IURA 3H6ZA 1BI1A 2KY9A 1QP3A 3FRNA 1VA7A 2COZA 4DOWA 2BKDN 3META 1V1CA 2EYWA 1UGPB 5HK3A 5GJWB 4DEXA 1G8XA 1EX4A 5KE2A 1VQLA 3M9QA 3CCEQ 5KYXB 4WCIA 4R56A 4M7AA 2DIQA 4B6MA 4LD6A 1D0XA 4JJCA 1I81A 3G71Q 2RHYA 2FB7A 2KXDA 1Y71A 3QDFA 5FWBA 2D8HA 3NTIA 2O4XB 4M78E 2CP6A 3JB9G 5LJ3f 4NOYA 3IQLA 2L0AA 2CP7A 2HKNA 1WI7A 1BU1A 1K9MU 1UGSB 1FYNA 2PVGB 2DXCA 5EG2A 3CMAA 4BB7A 3CBMA 1UHFA 1Y96A 1UJYA 3C12A 2VB6A 1UB4A 4E7IA 3CCVT 5I21A 3AT1B 4BY6B 5GAMe 2YRVA 3OYGA 2OTJA 2CS7A 1MNEA 2F2XA 4C92C 2MK5A 2R5MA 2XG8D 2KQWA 3CXCP 4TVRA 3EG9A 1PNJA 1ZUYA 2DF6A 4C92D 2COYA 3SWNC 3JSCA 4OMLA 4Z8AA 5KYUB 4XQ3A 1OQKA 4RUGA 3G7ZA 2L3SA 3GPLA 8ATCB 2PUOB 4E47A 1X2KA 5GAMh 1SKUB 1OX8A 5IT9E 3A1PA 3HHTB 4A4EA 2DZCA 4J9DA 3P8HA 4BE0A 4N0AA 1M90R 1M1KU 3L2RA 3MO8A 5FWCA 5AT1B 5A2QE 3OYBA 4E2FB 1WXTA 2FEIA 5IH2A 4XU2A 2GTOA 3VS0A 2YLCA 3CCRT 4M78F 2KROA 1I8FA 1NJIR 2CT3A 2YUQA 2EKOA 5GANf 4Z88A 4PLIA 1KK7A 4ZNXA 4XU0A 1FWZA 1QVFP 4PFZA 3GNGA 5IHIA 2JN0A 1YNZA 5C6SA 4N4GA 2F5KA 4QQGA 4JS5A 2DD5A 2D6FA 1NE8A 2K9GA 1HYOA 4EMGA 1FX7A 4E7JA 3CCUA 2LDMA 2CKKA 2COWA 1OYXA 1XQHA 5FU6C 2LCLA 1IXDA 2DMOA 2RHIA 1HSQA 2HEQA 5J26A 4BI8B 4LE9A 1TUDA 2KR3A 3OYCA 4C8QA 3E19A 4AMCA 1YJWT 2MCNA 4WF2A 2YT6A 1Q82R 1VQ9T 5LJ3d 2OAWA 3PFSA 2FO0A 1UUEA 2YUNA 2CZ0B 3OW2P 1M1GA 5IN1A 2R58A 2D1XA 1AWWA 3EG0A 1M5Q1 1EIFA 1QCNA 1ZUKA 3JCMb 2KGTA 2PQWA 1JBMA 2EQUA 4M7AC 2RA2A 1G3YA 4F17A 3CC2T 3CXCA 3CCQT 4GLKA 1D3BB 2FPEA 1OX9A 4M7AD 1YHQA 3ZEHA 4J6WA 4X9CA 2XIDA 3EFOB 9ATCB 1NBEB 1RACB 1NLOC 4ZGEB 3CBOA 3CPFA 1QW1A 1GBRA 3MJXA 3RKXA 5KCOA 4HCZA 5KYXA 4LDUA 2RD1A 1TUGB 4J9EA 2H3JA 3QJ6A 1MMNA 3WXMB 3RMSA 2V8KA 2A37A 2QK0A 3M53A 5IXBA 1JRIA 1W2BP 3VUBA 2D0QB 2KAFA 3FLGA 2KMTA 2RQTA 1LVKA 4M77E 2CSIA 1VQ6T 2DJQA 2O4XA 4J9CA 3DLMA 3UATA 4Y91A 1X2QA 2CZ7B 3CCJT 1M4ZA 2H3EB 2MF2A 1K73R 4JRIA 1NM7A 3S6WA 4BACA 1U1TA 1RAHB 4N4HA 1KSWA 1T0HA 4RG2A 1ZLMA 3RMQA 2FZCB 1KFZA 4N0AC 4DEYA 5L8RE 3DB4A 1NZ9A 4M78G 1LJOA 3OB9A 3DKMA 1V29B 4M78B 2M02A 2OJ2A 2XI9A 4FU6A 3VS5A 4PJMA 4F7UF 1M90C 3O8VA 3MHXA 2E12A 2EGCA 2MWPA 2FRYA 3R6OA 5GMKl 1VQMA 2DL5A 2EIFA 2EJFA 2PVDB 1JXOA 3CCSA 1NJIC 4DBQA 2A08A 2F2WA 3JCMV 5LJ3g 3H0FA 4PKCC 1VQ8T 1N8RR 4QQDA 2RI5A 3OYKA 2C06A 4MZPA 1JB0E 4PK4A 1RLPC 3CCSQ 2ZPIB 2DETA 1G3TA 4JJBA 4M77C 3JCMW 4EDUA 1OI1A 1TSFA 4RTWA 1H641 1SSHA 3G6EA 1U3OA 3C4SA 2HL5C 4OMMA 1Z9ZA 1U8RA 4OF1A 1SPKA 1UHCA 3EGXB 3L1AA 4C0ZA 4BI3A 2DNUA 2LJ3A 2DXTA 4E6RA 4LDVA 1Q82C 4RG8A 3QYHB 3QSUA 3G6EQ 1WGSA 1YIJA 1OPLA 1JQQA 2L89A 2PU9B 5I2MA 1W2BA 1CKAA 2QDYB 1H3HA 3E1SA 1XTDA 1AT1B 1KD1R 2JZ2A 2RHUA 3PMTA 5KYWB 2E4HA 4RTYA 4PJOE 5IXFA 1YIJQ 1K9MR 4M75E 3O5ZA 3ZFJA 3CCLA 3MEAA 2A28A 2VVKA 1VQ5T 2X35A 4NS5A 3CD6A 1MGQA 4DBRA 4A4HA 1Q82U 4HT9A 4BD3A 4M7DA 4EIKA 4IUVA 2EAYA 3PIOA 1PCXA 1TH7A 1M1KR 3L2ZA 2E70A 5CKHA 3CCLQ 2DTHA 2PUKB 1OU8A 2RF0A 1BKBA 1D3BA 4FW2A 4IIOA 3CD6Q 2CP5A 1W4SA 2AHJB 3VJPA 2E65A 2HSEB 3LYIA 1S72A 3EFOA 1YBYA 5LL6S 1SG5A 4AFZC 1VQNT 3H0HA 2HL3A 2I0NA 4OB2B 1VQKT 4CRIA 2X4YA 3TVTA 5GAMf 4EMKB 3QDRB 4DBFA 3NTKA 2Y4YA 3HSBA 3CBPA 1WHHA 5GAOm 1WXBA 3G4ST 2B8AA 1VQOA 4Z89A 4J9GA 1KHCA 1RLQC 1X43A 5A0DA 1K73C 2F1LA 4LDWA 4BY6C 4F7UG 1PD0A 2BZ8A 1VQ5Q 4IUPA 2CH4W 4F7UB 3SDZA 5EC7A 2X4XA 5GAOq 5AYFA 2J6KA 4AG2C 1VQOQ 4A4FA 2E6ZA 2QGFB 3QWXX 1IGUA 2DVEA 1X69A 2SRCA 1VYVA 3RUXA 1PSFA 1HD3A 2LP5A 2MMPA 1O9SA 3JRZA 1KG1A 4M75F 2DKGA 1K1ZA 2GF7A 1M3AA 4PJOC 4WTOB 1GFDA 3HL8A 1YJ9T 1PD1A 1NLPC 2DRMA 3QPHA 5M9OA 3T9NA 1K73U 2DEUA 1AWOA 2EW3A 1M8MA 2JUFA 1VQKQ 1WX6A 1VOMA 4M77G 2VKNA 1JXMA 1RAIB 3URGA 2KK4A 4GBQA 4PNOA 1C6VX 1AOJA 3X25B 3PIPA 1PRLC 2PZ1A 4C92E 3OYDA 4KUDK 5GAN4 3EAEA 1MV3A 1W70A 3H0IA 1VQLT 5LJ5d 4XU3A 3WVDB 2OI3A 4AFSC 2JTMA 3M0PA 2OTLA 3VU3C 1N8RC 1R0CB 3OYIA 1BIAA 3X28B 1SRMA 1VUBA 3UA6A 1EZZB 2VGNA 1CSKA 2VGMA 4J6YA 1OOTA 3MEWA 3VUZA 2RJFA 1QWEA 4FYWB 5HKCA 1K9MC 2JM9A 4N4IA 3R6NA 3M4GA 2ROLA 2XDDA 3CMAT 1SHGA 1WDXA 1YJ9Q 1VQPA 3OMCA 1G3WA 1N8RU 5L23A 2GQVA 3EFRA 2ROTA 2RQUA 2OTJT 1VYTA 1M9SA 1D0YA 4KGZB 4PFOA 1HK9A 4EMHA 1XOVA 2CSQA 1HXDA 2EQJA 2LCSA 1VQLQ 2DTIA 1NEBA 2P0QA 2EKHA 4XTWA 3CC7A 4ZTJA 4IUTA 3EGXA 3UF4A 1KD1C 2EQIA 2LTOA 4KRTA 1QMCA 2X3WD 3VS3A 1B07A 1TWBA 1FMVA 1AEYA 1D1CA 4CC7A 4M7DC 1G5VA 2R5AA 2DA9A 1K0SA 1YI2A 2C0OA 2JW4A 4E7KA 2WSEE 3CC7Q 2LJ0A 2RB6A 4M7DD 2CP3A 2RH2A 5KCHA 2DL8A 4O5VA 4OB3B 3EGDA 2M0OA 1M1KC 3CMAQ 2K57A 3JCMc 4C5GA 1I1JA 2EJ9A 4UC4A 2J6FA 1YI2Q 4LUDA 1KD1U 2CH4A 4C5HA 2IG0A 2DK3A 4JS4A 2D0NA 1ARKA 2GQIA 2RQVA 2OTJQ 3OQ5A 1UGVA 1UFFA 2LQWA 4QW2A 1WZOA 4LN2A 1QVPA 2VC8A 2K5FA 1BI2A 3F70A 1K8AU 2RMOA 5KE3A 2LC4A 1Q7YR 2QTXA 1VYUA 4OB0B 2BE9B 4HVVA 5LJ3j 4M7AE 2IPOB 2GTJA 3PTAA 2EQKA 1BK2A 3JCMd 3JV3A 4QVZA 1SSFA 1BCOA 4O6JA 3V7CA 2NUZA 2K4YA 4M75G 3G1JA 5LJ5g 4JJDA 3CCUT 1FXXA 1Q86U 2LVMA 1FMKA 3TCJA 3OBWA 4JDSA 3VRZA 2DXBA 2CREA 1X75C 6AT1B 1NPPA 1KC8U 3OA6A 2CZ6B 2M16A 2MPXC 3RNJA 3HTRA 2R57A 1J3TA 1G2BA 2FZKB 2QQSA 1ACMB 1PRMC 4A54A 3OYEA 4J5YA 4C0DB 4Y28E 3EG1A 3MPUB 3KBGA 1KHIA 4F7UA 1JU5C 3H9NA 2QXFA 4P5NA 3FIFA 2W0ZA 3I56A 4HXJA 1Q81U 1E6HA 3WVEB 2EYYA 3BDLA 4V2SA 4X9DA 2AZSA 3ME9A 1QWFA 5ECAA 1NYGA 1M3CA 3OYAA 4OVAA 3GP8A 2QG9B 2DILA 4JLGA 2FHDA 5IHKA 3N5BB 5GAOl 1WHGA 3I56Q 3LWIA 3CCUQ 1M30A 1TOVA 3I55A 5DLOA 2VASA 2M1HA 4KBMB 5GAN7 2QAZA 2L3RA 4XTVA 1QKWA 3CEYA 5KYYB 1BYMA 4ELYC 1LOJA 4M7AF 2EGAA 3RERA 1G3SA 1R0BG 2EJGA 2YWWA 2CDTA 3C0CA 2ED1A 7AT1B 2QI2A 3ZBDA 2WSFE 4K11A 3I55Q 1RL2A 1UE9A 3A8HB 4HA8A 4JRQA 4OMFB 3TSWA 4HT8A 2FL7A 2K3BA 5LJ3e 2ABLA 3M54A 4L5GA 4C92G 1O75A 1ZA2B 5DY9A 2DYIA 3ER0A 1UGRB 4J7FA 4JZ4A 4Z02A 4L6V5 3M5AA 5CKFA 2DLPA 2NWMA 1YHQQ 3THKA 5FRMA 3SWNB 4A4GA 3PVLA 3EFSA 2V1QA 3X24B 2YSQA 2BTTA 3L2WA 2O9SA 5LJ3h 1PG5B 2K6DA 1I07A 1OV3A 1GXIE 3JCMg 1IRXA 2E10A 2HQXA 3M0RA 3LW5E 4C8QE 3NTHA 2WSCE 3ASKA 3GOXA 4KUIA 2KYBA 2X3XD 1E6GA 1OZ2A 2GNCA 5FU7C 2O01E 4QVDA 5GAN6 5CKBA 2LNHB 1YCSB 2C0IA 1W6XA 1VQMT 5GANd 2LNVA 4XK8E 1BCMA 3CCST 2HD0A 2CZ1B 3QIIA 3I5RA 3M58A 2KYMA 3A8MB 1UECA 1VQ4A 1RAAB 4A53A 1ZQ1A 2DIGA 2F69A 2KBTA 2VV5A 3MP8A 1Q7YC 1K4US 2CP0A 1NYFA 3SD4A 3GLXA 5KYUA 1TUCA 2DBMA 1R8OB 4FYXB 1WIEA 2P0KA 2W10A 4QT7A 4ZGDB 1RUWA 4IIMA 3E9FA 3G6ET 3MP6A 2YRDA 2D8JA 2NUPB 1B34B 3CCJA 1X6OA 2HZYA 2M9UA 2VXFA 5FU6B 2ENMA 1UG1A 5FW9A 4GY5A 2E3IA 1A0NB 5CKDA 1B3QA 3OY9A 3REBB 1Q7YU 4BDYA 1VQMQ 4Q5WA 2E6NA 4FL6A 1YIJT 4M77F 5A0GA 2YXYA 4JJNK 2CUDA 2KXCA 2HCKA 1HJDA 3UDCA 1PM3A 3I5SA 2KVQG 2YLBA 2CGHA 4R0KA 4C8QC 2QEXA 5GAN3 4A63B 2A0FB 3EGUA 2H8HA 2LX9A 1ZSGA 1YWPA 4M7AG 1WLPB 1F1BB 1YFNA 4PFPA 4C8QD 3CCLT 4XTXA 4MMKA 2DYBA 4M7AB 1U06A 3JCMP 2XU8A 4BE1A 4AT1B 4FW1A 3CD6T 3JB9H 2QEXQ 3VS1A 1H3ZA 1G83A 3QJYA 4X1VA 4D8KA 3ZL7C 3HKSA 3INZA 3DLLA 1P92A 1N6AA 1TXQA 1ABOA 4ORZA 1YITA 1YCYA 3CCMA 2DL3A 4MDXA 1S72T 2RK2A 2AKKA 3S3OA 4OMNA 2QA4A 2LT4A 3QG1A 4CI0C 4E7SA 3LGLA 1RABB 4OP0A 1K8AR 4RCCA 1T0JA 5C0MA 2DERA 4LDXA 3QUIA 3LWHA 3CCMQ 2VWFA 2DX1A 2RO0A 2X4JA 1VIEA 2HNIA 1MMGA 1VQOT 2E5KA 5GANg 1UGQB 2QA4Q 4PJLA 2EYZA 1X27A 3HFOA 3KFVA 3QXEB 1WA7A 1XNIA 3OSVA 1KQ1A 3GF5A 2DVJA 1Q86R 1JEGA 2P84A 2JOYA 3H8ZA 4RTTA 3A8OB 5KH6A 3RIRA 3RR6A 3MEVA 2K3XA 1NEGA 3SHWA 5LJ5j 1KC8R 3OYNA 3QWYA 4MMLA 2KT1A 4BDZA 2EFIA 1WYXA 3V8LA 2AK5A 1QLYA 3JB9D 4HCBA 1D1AA 1BIBA 2HSPA 3OSSC 1S72Q 2HMAA 4LUEA 1IHWA 3SWNA 1BB9A 1M3BA 5KYNA 3FC3A 4XTUA 4XU1A 4KH1B 1Q81R 2JXBA 2ZCFB 3VS4A 2J6OA 2JMCA 3LGFA 1BBZA 3GBQA 2WACA 2VYTA 4C5IA 5DM7R 1SHFA 5J3BA 3A98A 1YJNA 2VUBA 1M8VA 1I5OB 2DBKA 3QBYA 5CQYA 5GAOn 1Y57A 2OTLT 2NYSA 2QASA 4PJOF 4JPBW 2XICA 2Y90A 3FDRA 2EGEA 3UA7A 3ULRB 3OS2A 4RMOA 2JTEA 1C0MA 1QCOA 1YJNQ 4M7DE 2ZAEA 2LCCA 3PNWC 2QGGA 4FIBA 2KRNA 1KQ2A 5J39A 4F16A 1N27A 2NLUA 4J9HA 1WHJA 4M77B 2DAQA 1K0XA 1MNDA 1M27C 5DLQE 2MAMA 4M78A
chains in the Genus database with same CATH topology
1M90R 3CCRQ 1VQMQ 1YI2Q 1KD1R 3CCMQ 3G71Q 3CMEQ 1YHQQ 1VQ6Q 1YITQ 1Q81R 1VQ4Q 1VQ5Q 1KC8R 2OTLQ 1M1KR 3CCSQ 1VQ9Q 1VQ7Q 1VQNQ 3OW2P 1K73R 1QVFP 1YJNQ 2QA4Q 3CC2Q 1QVGP 1VQLQ 3CC7Q 2OTJQ 3CCLQ 3CCQQ 3CC4Q 3CCJQ 1VQOQ 1VQKQ 1VQPQ 2QEXQ 1YIJQ 3CCEQ 3CCVQ 1YJ9Q 1W2BP 1K9MR 3G6EQ 1KQSP 1Q86R 3CD6Q 1N8RR 1S72Q 3CXCP 3CMAQ 1NJIR 3CPWP 1K8AR 1JJ2P 3I56Q 1Q82R 3G4SQ 3CCUQ 3I55Q 1VQ8Q 1Q7YR 1YJWQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M90 R;  3CCR Q;  1VQM Q;  1YI2 Q;  1KD1 R;  3CCM Q;  3G71 Q;  3CME Q;  1YHQ Q;  1VQ6 Q;  1YIT Q;  1Q81 R;  1VQ4 Q;  1VQ5 Q;  1KC8 R;  2OTL Q;  1M1K R;  3CCS Q;  1VQ9 Q;  1VQ7 Q;  1VQN Q;  3OW2 P;  1K73 R;  1QVF P;  1YJN Q;  2QA4 Q;  3CC2 Q;  1QVG P;  1VQL Q;  3CC7 Q;  2OTJ Q;  3CCL Q;  3CCQ Q;  3CC4 Q;  3CCJ Q;  1VQO Q;  1VQK Q;  1VQP Q;  2QEX Q;  1YIJ Q;  3CCE Q;  3CCV Q;  1YJ9 Q;  1W2B P;  1K9M R;  3G6E Q;  1KQS P;  1Q86 R;  3CD6 Q;  1N8R R;  1S72 Q;  3CXC P;  3CMA Q;  1NJI R;  3CPW P;  1K8A R;  1JJ2 P;  3I56 Q;  1Q82 R;  3G4S Q;  3CCU Q;  3I55 Q;  1VQ8 Q;  1Q7Y R;  1YJW Q; 
#chains in the Genus database with same CATH topology
 3CPW A;  5GAN 5;  1ZBX A;  3TEE A;  2P4T A;  3C94 A;  3JB9 J;  2JT4 A;  1VQP T;  1W1F A;  2VXE A;  3CME A;  4OMQ A;  1TS9 A;  3JCM Q;  1ZHI A;  2HQH A;  2HQE A;  1NPR A;  2K7A A;  4OMP A;  3VKI A;  2RJD A;  4KH0 B;  1QCF A;  4R55 A;  1AZE A;  4BE2 A;  2EPD A;  3RDV A;  4J83 A;  3V8K A;  3NHN A;  2ZGW A;  4AFQ C;  3GIB A;  1N9S A;  4HVU A;  1EFN A;  3CC7 T;  5I2S A;  4L59 A;  2OTL Q;  1B34 A;  3SFM A;  3FJ5 A;  1ZUU A;  4C0D C;  1K9A A;  2GGR A;  1Y7X A;  2GCX A;  4MZT A;  2KNB B;  4GLM A;  5LJ5 e;  2O31 A;  4JLI A;  3PT9 A;  3CC4 A;  2MI6 A;  4DQ2 A;  3CCE A;  4J7I A;  1YI2 T;  4PJN A;  2DXU A;  1MV0 B;  2OX7 A;  4HCK A;  3J81 E;  1RAE B;  2L8D A;  2JM8 A;  1AHJ B;  3G71 A;  3J80 E;  2QYZ A;  3BY7 A;  3BFM A;  1KIK A;  3M55 A;  3CC4 Q;  2ZPG B;  1VQ7 A;  1KQS S;  2AZV A;  4F14 A;  1VQP Q;  3L2V A;  5LJ5 h;  5FRO A;  2QTV A;  4J9I A;  3REA B;  5IAY A;  2A36 A;  4M7D F;  3MEU A;  3EG3 A;  1E7O A;  3VS6 A;  1SEM A;  5GAM d;  1YWO A;  4CC4 B;  1VQ7 Q;  5A0L A;  1RAD B;  2DJZ A;  4C92 F;  1K8A C;  2JS0 A;  1QVG A;  1ABQ A;  3V7R A;  5CO7 A;  2BIV A;  4DOV A;  2M0Y A;  1FMW A;  1JJ2 S;  5D7U A;  5GMK m;  3RKW A;  3M0Q A;  1X6G A;  4HVW A;  5KYW A;  2KT8 A;  4II1 A;  2FRW A;  3L2Q A;  4ZTF A;  4IKF A;  2B86 A;  2J05 A;  1Q86 C;  4QKU A;  3QHS A;  2DFU A;  2A3L A;  3TQ7 P;  4D8D A;  3RKY A;  1IO6 A;  3E9G A;  3KUF A;  1ZSZ B;  2DTO A;  1QQJ A;  3CPW S;  1WJR A;  3LH0 A;  1KC8 C;  3OYF A;  1CKB A;  1PHT A;  3AHU A;  4ZN3 A;  1LCK A;  4E7H A;  1BI3 A;  4OGC A;  4FT4 A;  3LX7 A;  1T3S A;  3OYH A;  4RTX A;  2YUO A;  4PJO G;  5HK0 A;  1K76 A;  2J06 A;  4EPC A;  5FLX E;  2LRQ A;  1GFC A;  4FSX A;  1RAG B;  3BW1 A;  2SEM A;  3E2U A;  4PJO B;  3C95 A;  3I56 T;  4M75 B;  3FEO A;  1Q81 C;  2X9H A;  2LQ8 A;  3CCV A;  1PWT A;  4PJJ A;  5HY6 A;  2ED0 A;  4EMK A;  4IUQ A;  1WXU A;  4RTU A;  4F04 B;  2KI7 A;  3I9Q A;  1B7T A;  1Y07 A;  2AT1 B;  3H41 A;  2KEA A;  3OS5 A;  2DZ9 A;  3CCV Q;  1U1S A;  3OS0 A;  3JCM e;  3I55 T;  4LXC A;  2FYK A;  2LQN A;  1I5L A;  4M78 C;  2EVR A;  2K5L A;  1M2V B;  2FG0 A;  3OYM A;  2IVW A;  4M78 D;  5CR2 A;  2G3R A;  3HP9 A;  1UEB A;  4JRK A;  5D6Y A;  4OMO A;  5I22 A;  1M2O A;  3EH2 A;  4KGV B;  3JCM h;  1YHQ T;  2BUD A;  2AKL A;  4FM4 B;  1WNL A;  5GJV B;  2JJ9 A;  3L42 A;  4ZN1 A;  1H8K A;  2BZY A;  2HBW A;  2JNG A;  1QVG S;  2D9T A;  3CCR A;  1AWJ A;  2LQK A;  1IRE B;  4ESR A;  3QYG B;  4M77 A;  3FB9 A;  2V26 A;  5GAM g;  5CVI A;  5GAN 2;  5GAO p;  3HRS A;  3QZ5 B;  4AFU C;  5GAN j;  1YP5 A;  1QKX A;  4ME7 A;  1AD5 A;  2I2L A;  3NFC A;  3CCR Q;  3U23 A;  1X01 A;  2KDS A;  2O88 A;  4M7D G;  1ZA1 B;  1GL5 A;  3OYL A;  1OUL A;  2QQR A;  5GMK j;  4M7D B;  3VS7 A;  2XMF A;  4OGE A;  1Y0M A;  2HBP A;  3JCM J;  4XTY A;  3EHQ A;  1XJW B;  2LZ6 B;  3Q1J A;  8AT1 B;  1WQW A;  1WPY A;  3PVQ A;  3A5Z B;  2RK1 A;  1Q95 G;  4C92 B;  2FPD A;  1LPL A;  3SEM A;  5GAN 8;  4F7U E;  2DM1 A;  4FSS A;  1YJW A;  4MDW A;  4CC2 A;  1WFW A;  2V1R A;  2NUT B;  4JZ3 A;  1D09 B;  4AG1 C;  4NL3 A;  1VQ9 A;  4KT0 E;  2LJ1 A;  4C0G A;  1OPK A;  4NL2 A;  4A4K A;  2BZX A;  5GMK i;  2KRS A;  2DPP B;  3JAM E;  5CAI A;  1VQ4 T;  2MWO A;  1LNX A;  1IGQ A;  3DB3 A;  4FCY A;  2E5Q A;  4JUV A;  1YJW Q;  2XDP A;  1PKS A;  2IIM A;  1I0C A;  2GBQ A;  1VQ9 Q;  1RI9 A;  1RAF B;  2EYQ A;  2JS2 A;  1D0Z A;  1TU0 B;  1AZG B;  3QKJ A;  3CC2 A;  3L2U A;  3CCQ A;  2XD0 A;  2CYZ B;  2ZZD A;  3V8J A;  2K3Y A;  3OS1 A;  1SRL A;  4KGX B;  4HKE A;  1VIF A;  5CK9 A;  4LD9 K;  5IHN A;  2ECZ A;  2MYS A;  2KE9 A;  4XTZ A;  3KXT A;  3EH1 A;  4RCB A;  3CC2 Q;  2FPF A;  3CCQ Q;  3S3N A;  1QVF A;  1S1N A;  4E7Z A;  2QDL A;  1TTH B;  5GAO r;  3NPF A;  1Z9Q A;  4J9B A;  1WHM A;  4RKU E;  3M57 A;  2O2O A;  2XK0 A;  3S3M A;  5I11 A;  4KUL A;  4EMK C;  3M56 A;  1GCQ A;  3A8G B;  5GAN e;  1VQ4 Q;  1ZSZ A;  1ZX6 A;  2QEX T;  3MKD A;  1VQ6 A;  4RTZ A;  2DE0 X;  2K2M A;  1QP2 A;  4J9F A;  5D6X A;  1WHK A;  5CCA A;  1MHN A;  1PC0 A;  1MMD A;  2PNI A;  3M0T A;  3VYH B;  1KQS P;  2DL7 A;  4HCC A;  5GMK e;  2BE7 D;  2JVV A;  2HKQ B;  4ANJ A;  2ZPE B;  3BE3 A;  2YUP A;  4PJO A;  1U5S A;  4FYV B;  3RBB B;  1VQ6 Q;  4M75 A;  4QQ6 A;  1BI0 A;  2KRM A;  2CT4 A;  2RN8 A;  5GAN h;  4VUB A;  3TRE A;  1NG2 A;  3CCJ Q;  4C8Q F;  3SB2 A;  3OW2 A;  2HAX A;  1T3L A;  2RI3 A;  3P8D A;  3CXC S;  2DO3 A;  3JCM X;  1X6B A;  2J7I A;  2RNA A;  1YIT T;  3CCM T;  2LMJ A;  1JJ2 P;  5GMK h;  2YHT A;  3EHR A;  1UDL A;  2GFA A;  2Y4X A;  2L3P A;  2QA4 T;  1M90 U;  4RTV A;  3VRY A;  1JO8 A;  2AIR B;  3V7S A;  3GNF B;  1D1B A;  2F5T X;  3QO3 A;  1GRI A;  2E64 A;  2JTF A;  2RQR A;  2MOX A;  3PGG A;  2Z0W A;  4M4Z A;  4BUG A;  2L5Q A;  1WJS A;  1C1A A;  1M2V A;  2K5I A;  2RM4 A;  2QQ9 A;  4DA4 A;  2E3H A;  1PSE A;  2XKO C;  2ATC B;  1NJI U;  4M77 D;  3CPW P;  3M0U A;  2YRC A;  4X34 A;  3PMI A;  1VQ8 A;  1H92 A;  5D6W A;  5LJ5 f;  1UJ0 A;  2RQW A;  1AVZ C;  1Y96 B;  1DJ7 B;  4D6W A;  4DBH A;  1OZ3 A;  2LT1 A;  3HRT A;  5CQX A;  3J7A F;  1VQ8 Q;  2OAU A;  3CQT A;  3EGD B;  3MCA B;  5KYY A;  2X4W A;  1YIT Q;  1QVF S;  4Y92 A;  2G6F X;  3JB9 I;  1V76 A;  4J8O A;  4ELZ C;  4PL6 A;  3FJP A;  4ZGJ B;  3EG9 B;  2EBP A;  3M4Y A;  2P0P A;  3I35 A;  2C0T A;  1M1F A;  4LNP A;  5FU7 B;  4ATO A;  2CUB A;  2A7Y A;  4FT2 A;  3HPW A;  1ZBJ A;  1KJW A;  4B9X A;  4QVC A;  3JB9 F;  2V8I A;  3X26 B;  1PKT A;  1YJN T;  2X51 A;  3X20 B;  1GCP A;  1R77 A;  2M51 A;  5CIU A;  2ESW A;  4JRP A;  2DD4 A;  2EWN A;  1IB8 A;  4E7L A;  1TG0 A;  4C92 A;  4PLL A;  3TSZ A;  4MZM A;  2DRK A;  2GFU A;  1IHV A;  2F2V A;  2L2P A;  4B9W A;  2K79 A;  2DL4 A;  2ZPB B;  1KQS A;  2NUT A;  4FYY B;  3OW2 S;  4IUU A;  1VQ5 A;  1SF9 A;  1QVG P;  3PE0 A;  1IZ6 A;  2FZG B;  3CME T;  3EG2 A;  2RI2 A;  4C0F A;  2CP2 A;  3LLR A;  4CC3 A;  4J6X A;  1GCQ C;  3VYG A;  3UPU A;  1WJQ A;  1JJ2 A;  1N5Z A;  1ZSZ C;  2ZPH B;  3P8B B;  3MP1 A;  2XDB A;  2YDL A;  1VQN A;  3QZ9 B;  3TU4 K;  2PTK A;  1MMA A;  2LX7 A;  3UT1 A;  1AWX A;  1VQK A;  3RES A;  2XHC A;  3HFN A;  4C8Q G;  3M59 A;  1GBQ A;  2MIO A;  4OB1 B;  1I4K 1;  4BI4 A;  2EQM A;  3HRU A;  2KSS A;  4XAX B;  4C8Q B;  1UTI A;  5GAM j;  1WQ7 A;  3G4S A;  3CC4 T;  2PVO B;  1YN8 A;  3CCE T;  4M75 C;  2DEQ A;  1VQN Q;  2V8J A;  3UWN A;  5FRN A;  2K2V A;  1N9R A;  2E41 A;  3NGP A;  4PJO D;  5CKE A;  1W2B S;  2QQA A;  3JCM f;  4M75 D;  1WHL A;  3OBY A;  1MUZ A;  4C5E A;  3G71 T;  1OEB A;  2P4R A;  2O9V A;  2FVU A;  2L3Q A;  2RPN A;  4LDY A;  1RI0 A;  3G4S Q;  2ZPF B;  3NMZ C;  2JMA A;  1VQ7 T;  3OYJ A;  2EYX A;  2RJE A;  3VS2 A;  3CME Q;  3VV0 A;  2NUP A;  3LH5 A;  5HCK A;  2RHX A;  3OYY A;  2RJC A;  2QQB A;  3M0S A;  2E1H A;  4YTL A;  3A8L B;  2RHZ A;  3D7S B;  3OMG A;  1YJ9 A;  3BDU A;  1OU9 A;  2HDA A;  4IUR A;  3H6Z A;  1BI1 A;  2KY9 A;  1QP3 A;  3FRN A;  1VA7 A;  2COZ A;  4DOW A;  2BKD N;  3MET A;  1V1C A;  2EYW A;  1UGP B;  5HK3 A;  5GJW B;  4DEX A;  1G8X A;  1EX4 A;  5KE2 A;  1VQL A;  3M9Q A;  3CCE Q;  5KYX B;  4WCI A;  4R56 A;  4M7A A;  2DIQ A;  4B6M A;  4LD6 A;  1D0X A;  4JJC A;  1I81 A;  3G71 Q;  2RHY A;  2FB7 A;  2KXD A;  1Y71 A;  3QDF A;  5FWB A;  2D8H A;  3NTI A;  2O4X B;  4M78 E;  2CP6 A;  3JB9 G;  5LJ3 f;  4NOY A;  3IQL A;  2L0A A;  2CP7 A;  2HKN A;  1WI7 A;  1BU1 A;  1K9M U;  1UGS B;  1FYN A;  2PVG B;  2DXC A;  5EG2 A;  3CMA A;  4BB7 A;  3CBM A;  1UHF A;  1Y96 A;  1UJY A;  3C12 A;  2VB6 A;  1UB4 A;  4E7I A;  3CCV T;  5I21 A;  3AT1 B;  4BY6 B;  5GAM e;  2YRV A;  3OYG A;  2OTJ A;  2CS7 A;  1MNE A;  2F2X A;  4C92 C;  2MK5 A;  2R5M A;  2XG8 D;  2KQW A;  3CXC P;  4TVR A;  3EG9 A;  1PNJ A;  1ZUY A;  2DF6 A;  4C92 D;  2COY A;  3SWN C;  3JSC A;  4OML A;  4Z8A A;  5KYU B;  4XQ3 A;  1OQK A;  4RUG A;  3G7Z A;  2L3S A;  3GPL A;  8ATC B;  2PUO B;  4E47 A;  1X2K A;  5GAM h;  1SKU B;  1OX8 A;  5IT9 E;  3A1P A;  3HHT B;  4A4E A;  2DZC A;  4J9D A;  3P8H A;  4BE0 A;  4N0A A;  1M90 R;  1M1K U;  3L2R A;  3MO8 A;  5FWC A;  5AT1 B;  5A2Q E;  3OYB A;  4E2F B;  1WXT A;  2FEI A;  5IH2 A;  4XU2 A;  2GTO A;  3VS0 A;  2YLC A;  3CCR T;  4M78 F;  2KRO A;  1I8F A;  1NJI R;  2CT3 A;  2YUQ A;  2EKO A;  5GAN f;  4Z88 A;  4PLI A;  1KK7 A;  4ZNX A;  4XU0 A;  1FWZ A;  1QVF P;  4PFZ A;  3GNG A;  5IHI A;  2JN0 A;  1YNZ A;  5C6S A;  4N4G A;  2F5K A;  4QQG A;  4JS5 A;  2DD5 A;  2D6F A;  1NE8 A;  2K9G A;  1HYO A;  4EMG A;  1FX7 A;  4E7J A;  3CCU A;  2LDM A;  2CKK A;  2COW A;  1OYX A;  1XQH A;  5FU6 C;  2LCL A;  1IXD A;  2DMO A;  2RHI A;  1HSQ A;  2HEQ A;  5J26 A;  4BI8 B;  4LE9 A;  1TUD A;  2KR3 A;  3OYC A;  4C8Q A;  3E19 A;  4AMC A;  1YJW T;  2MCN A;  4WF2 A;  2YT6 A;  1Q82 R;  1VQ9 T;  5LJ3 d;  2OAW A;  3PFS A;  2FO0 A;  1UUE A;  2YUN A;  2CZ0 B;  3OW2 P;  1M1G A;  5IN1 A;  2R58 A;  2D1X A;  1AWW A;  3EG0 A;  1M5Q 1;  1EIF A;  1QCN A;  1ZUK A;  3JCM b;  2KGT A;  2PQW A;  1JBM A;  2EQU A;  4M7A C;  2RA2 A;  1G3Y A;  4F17 A;  3CC2 T;  3CXC A;  3CCQ T;  4GLK A;  1D3B B;  2FPE A;  1OX9 A;  4M7A D;  1YHQ A;  3ZEH A;  4J6W A;  4X9C A;  2XID A;  3EFO B;  9ATC B;  1NBE B;  1RAC B;  1NLO C;  4ZGE B;  3CBO A;  3CPF A;  1QW1 A;  1GBR A;  3MJX A;  3RKX A;  5KCO A;  4HCZ A;  5KYX A;  4LDU A;  2RD1 A;  1TUG B;  4J9E A;  2H3J A;  3QJ6 A;  1MMN A;  3WXM B;  3RMS A;  2V8K A;  2A37 A;  2QK0 A;  3M53 A;  5IXB A;  1JRI A;  1W2B P;  3VUB A;  2D0Q B;  2KAF A;  3FLG A;  2KMT A;  2RQT A;  1LVK A;  4M77 E;  2CSI A;  1VQ6 T;  2DJQ A;  2O4X A;  4J9C A;  3DLM A;  3UAT A;  4Y91 A;  1X2Q A;  2CZ7 B;  3CCJ T;  1M4Z A;  2H3E B;  2MF2 A;  1K73 R;  4JRI A;  1NM7 A;  3S6W A;  4BAC A;  1U1T A;  1RAH B;  4N4H A;  1KSW A;  1T0H A;  4RG2 A;  1ZLM A;  3RMQ A;  2FZC B;  1KFZ A;  4N0A C;  4DEY A;  5L8R E;  3DB4 A;  1NZ9 A;  4M78 G;  1LJO A;  3OB9 A;  3DKM A;  1V29 B;  4M78 B;  2M02 A;  2OJ2 A;  2XI9 A;  4FU6 A;  3VS5 A;  4PJM A;  4F7U F;  1M90 C;  3O8V A;  3MHX A;  2E12 A;  2EGC A;  2MWP A;  2FRY A;  3R6O A;  5GMK l;  1VQM A;  2DL5 A;  2EIF A;  2EJF A;  2PVD B;  1JXO A;  3CCS A;  1NJI C;  4DBQ A;  2A08 A;  2F2W A;  3JCM V;  5LJ3 g;  3H0F A;  4PKC C;  1VQ8 T;  1N8R R;  4QQD A;  2RI5 A;  3OYK A;  2C06 A;  4MZP A;  1JB0 E;  4PK4 A;  1RLP C;  3CCS Q;  2ZPI B;  2DET A;  1G3T A;  4JJB A;  4M77 C;  3JCM W;  4EDU A;  1OI1 A;  1TSF A;  4RTW A;  1H64 1;  1SSH A;  3G6E A;  1U3O A;  3C4S A;  2HL5 C;  4OMM A;  1Z9Z A;  1U8R A;  4OF1 A;  1SPK A;  1UHC A;  3EGX B;  3L1A A;  4C0Z A;  4BI3 A;  2DNU A;  2LJ3 A;  2DXT A;  4E6R A;  4LDV A;  1Q82 C;  4RG8 A;  3QYH B;  3QSU A;  3G6E Q;  1WGS A;  1YIJ A;  1OPL A;  1JQQ A;  2L89 A;  2PU9 B;  5I2M A;  1W2B A;  1CKA A;  2QDY B;  1H3H A;  3E1S A;  1XTD A;  1AT1 B;  1KD1 R;  2JZ2 A;  2RHU A;  3PMT A;  5KYW B;  2E4H A;  4RTY A;  4PJO E;  5IXF A;  1YIJ Q;  1K9M R;  4M75 E;  3O5Z A;  3ZFJ A;  3CCL A;  3MEA A;  2A28 A;  2VVK A;  1VQ5 T;  2X35 A;  4NS5 A;  3CD6 A;  1MGQ A;  4DBR A;  4A4H A;  1Q82 U;  4HT9 A;  4BD3 A;  4M7D A;  4EIK A;  4IUV A;  2EAY A;  3PIO A;  1PCX A;  1TH7 A;  1M1K R;  3L2Z A;  2E70 A;  5CKH A;  3CCL Q;  2DTH A;  2PUK B;  1OU8 A;  2RF0 A;  1BKB A;  1D3B A;  4FW2 A;  4IIO A;  3CD6 Q;  2CP5 A;  1W4S A;  2AHJ B;  3VJP A;  2E65 A;  2HSE B;  3LYI A;  1S72 A;  3EFO A;  1YBY A;  5LL6 S;  1SG5 A;  4AFZ C;  1VQN T;  3H0H A;  2HL3 A;  2I0N A;  4OB2 B;  1VQK T;  4CRI A;  2X4Y A;  3TVT A;  5GAM f;  4EMK B;  3QDR B;  4DBF A;  3NTK A;  2Y4Y A;  3HSB A;  3CBP A;  1WHH A;  5GAO m;  1WXB A;  3G4S T;  2B8A A;  1VQO A;  4Z89 A;  4J9G A;  1KHC A;  1RLQ C;  1X43 A;  5A0D A;  1K73 C;  2F1L A;  4LDW A;  4BY6 C;  4F7U G;  1PD0 A;  2BZ8 A;  1VQ5 Q;  4IUP A;  2CH4 W;  4F7U B;  3SDZ A;  5EC7 A;  2X4X A;  5GAO q;  5AYF A;  2J6K A;  4AG2 C;  1VQO Q;  4A4F A;  2E6Z A;  2QGF B;  3QWX X;  1IGU A;  2DVE A;  1X69 A;  2SRC A;  1VYV A;  3RUX A;  1PSF A;  1HD3 A;  2LP5 A;  2MMP A;  1O9S A;  3JRZ A;  1KG1 A;  4M75 F;  2DKG A;  1K1Z A;  2GF7 A;  1M3A A;  4PJO C;  4WTO B;  1GFD A;  3HL8 A;  1YJ9 T;  1PD1 A;  1NLP C;  2DRM A;  3QPH A;  5M9O A;  3T9N A;  1K73 U;  2DEU A;  1AWO A;  2EW3 A;  1M8M A;  2JUF A;  1VQK Q;  1WX6 A;  1VOM A;  4M77 G;  2VKN A;  1JXM A;  1RAI B;  3URG A;  2KK4 A;  4GBQ A;  4PNO A;  1C6V X;  1AOJ A;  3X25 B;  3PIP A;  1PRL C;  2PZ1 A;  4C92 E;  3OYD A;  4KUD K;  5GAN 4;  3EAE A;  1MV3 A;  1W70 A;  3H0I A;  1VQL T;  5LJ5 d;  4XU3 A;  3WVD B;  2OI3 A;  4AFS C;  2JTM A;  3M0P A;  2OTL A;  3VU3 C;  1N8R C;  1R0C B;  3OYI A;  1BIA A;  3X28 B;  1SRM A;  1VUB A;  3UA6 A;  1EZZ B;  2VGN A;  1CSK A;  2VGM A;  4J6Y A;  1OOT A;  3MEW A;  3VUZ A;  2RJF A;  1QWE A;  4FYW B;  5HKC A;  1K9M C;  2JM9 A;  4N4I A;  3R6N A;  3M4G A;  2ROL A;  2XDD A;  3CMA T;  1SHG A;  1WDX A;  1YJ9 Q;  1VQP A;  3OMC A;  1G3W A;  1N8R U;  5L23 A;  2GQV A;  3EFR A;  2ROT A;  2RQU A;  2OTJ T;  1VYT A;  1M9S A;  1D0Y A;  4KGZ B;  4PFO A;  1HK9 A;  4EMH A;  1XOV A;  2CSQ A;  1HXD A;  2EQJ A;  2LCS A;  1VQL Q;  2DTI A;  1NEB A;  2P0Q A;  2EKH A;  4XTW A;  3CC7 A;  4ZTJ A;  4IUT A;  3EGX A;  3UF4 A;  1KD1 C;  2EQI A;  2LTO A;  4KRT A;  1QMC A;  2X3W D;  3VS3 A;  1B07 A;  1TWB A;  1FMV A;  1AEY A;  1D1C A;  4CC7 A;  4M7D C;  1G5V A;  2R5A A;  2DA9 A;  1K0S A;  1YI2 A;  2C0O A;  2JW4 A;  4E7K A;  2WSE E;  3CC7 Q;  2LJ0 A;  2RB6 A;  4M7D D;  2CP3 A;  2RH2 A;  5KCH A;  2DL8 A;  4O5V A;  4OB3 B;  3EGD A;  2M0O A;  1M1K C;  3CMA Q;  2K57 A;  3JCM c;  4C5G A;  1I1J A;  2EJ9 A;  4UC4 A;  2J6F A;  1YI2 Q;  4LUD A;  1KD1 U;  2CH4 A;  4C5H A;  2IG0 A;  2DK3 A;  4JS4 A;  2D0N A;  1ARK A;  2GQI A;  2RQV A;  2OTJ Q;  3OQ5 A;  1UGV A;  1UFF A;  2LQW A;  4QW2 A;  1WZO A;  4LN2 A;  1QVP A;  2VC8 A;  2K5F A;  1BI2 A;  3F70 A;  1K8A U;  2RMO A;  5KE3 A;  2LC4 A;  1Q7Y R;  2QTX A;  1VYU A;  4OB0 B;  2BE9 B;  4HVV A;  5LJ3 j;  4M7A E;  2IPO B;  2GTJ A;  3PTA A;  2EQK A;  1BK2 A;  3JCM d;  3JV3 A;  4QVZ A;  1SSF A;  1BCO A;  4O6J A;  3V7C A;  2NUZ A;  2K4Y A;  4M75 G;  3G1J A;  5LJ5 g;  4JJD A;  3CCU T;  1FXX A;  1Q86 U;  2LVM A;  1FMK A;  3TCJ A;  3OBW A;  4JDS A;  3VRZ A;  2DXB A;  2CRE A;  1X75 C;  6AT1 B;  1NPP A;  1KC8 U;  3OA6 A;  2CZ6 B;  2M16 A;  2MPX C;  3RNJ A;  3HTR A;  2R57 A;  1J3T A;  1G2B A;  2FZK B;  2QQS A;  1ACM B;  1PRM C;  4A54 A;  3OYE A;  4J5Y A;  4C0D B;  4Y28 E;  3EG1 A;  3MPU B;  3KBG A;  1KHI A;  4F7U A;  1JU5 C;  3H9N A;  2QXF A;  4P5N A;  3FIF A;  2W0Z A;  3I56 A;  4HXJ A;  1Q81 U;  1E6H A;  3WVE B;  2EYY A;  3BDL A;  4V2S A;  4X9D A;  2AZS A;  3ME9 A;  1QWF A;  5ECA A;  1NYG A;  1M3C A;  3OYA A;  4OVA A;  3GP8 A;  2QG9 B;  2DIL A;  4JLG A;  2FHD A;  5IHK A;  3N5B B;  5GAO l;  1WHG A;  3I56 Q;  3LWI A;  3CCU Q;  1M30 A;  1TOV A;  3I55 A;  5DLO A;  2VAS A;  2M1H A;  4KBM B;  5GAN 7;  2QAZ A;  2L3R A;  4XTV A;  1QKW A;  3CEY A;  5KYY B;  1BYM A;  4ELY C;  1LOJ A;  4M7A F;  2EGA A;  3RER A;  1G3S A;  1R0B G;  2EJG A;  2YWW A;  2CDT A;  3C0C A;  2ED1 A;  7AT1 B;  2QI2 A;  3ZBD A;  2WSF E;  4K11 A;  3I55 Q;  1RL2 A;  1UE9 A;  3A8H B;  4HA8 A;  4JRQ A;  4OMF B;  3TSW A;  4HT8 A;  2FL7 A;  2K3B A;  5LJ3 e;  2ABL A;  3M54 A;  4L5G A;  4C92 G;  1O75 A;  1ZA2 B;  5DY9 A;  2DYI A;  3ER0 A;  1UGR B;  4J7F A;  4JZ4 A;  4Z02 A;  4L6V 5;  3M5A A;  5CKF A;  2DLP A;  2NWM A;  1YHQ Q;  3THK A;  5FRM A;  3SWN B;  4A4G A;  3PVL A;  3EFS A;  2V1Q A;  3X24 B;  2YSQ A;  2BTT A;  3L2W A;  2O9S A;  5LJ3 h;  1PG5 B;  2K6D A;  1I07 A;  1OV3 A;  1GXI E;  3JCM g;  1IRX A;  2E10 A;  2HQX A;  3M0R A;  3LW5 E;  4C8Q E;  3NTH A;  2WSC E;  3ASK A;  3GOX A;  4KUI A;  2KYB A;  2X3X D;  1E6G A;  1OZ2 A;  2GNC A;  5FU7 C;  2O01 E;  4QVD A;  5GAN 6;  5CKB A;  2LNH B;  1YCS B;  2C0I A;  1W6X A;  1VQM T;  5GAN d;  2LNV A;  4XK8 E;  1BCM A;  3CCS T;  2HD0 A;  2CZ1 B;  3QII A;  3I5R A;  3M58 A;  2KYM A;  3A8M B;  1UEC A;  1VQ4 A;  1RAA B;  4A53 A;  1ZQ1 A;  2DIG A;  2F69 A;  2KBT A;  2VV5 A;  3MP8 A;  1Q7Y C;  1K4U S;  2CP0 A;  1NYF A;  3SD4 A;  3GLX A;  5KYU A;  1TUC A;  2DBM A;  1R8O B;  4FYX B;  1WIE A;  2P0K A;  2W10 A;  4QT7 A;  4ZGD B;  1RUW A;  4IIM A;  3E9F A;  3G6E T;  3MP6 A;  2YRD A;  2D8J A;  2NUP B;  1B34 B;  3CCJ A;  1X6O A;  2HZY A;  2M9U A;  2VXF A;  5FU6 B;  2ENM A;  1UG1 A;  5FW9 A;  4GY5 A;  2E3I A;  1A0N B;  5CKD A;  1B3Q A;  3OY9 A;  3REB B;  1Q7Y U;  4BDY A;  1VQM Q;  4Q5W A;  2E6N A;  4FL6 A;  1YIJ T;  4M77 F;  5A0G A;  2YXY A;  4JJN K;  2CUD A;  2KXC A;  2HCK A;  1HJD A;  3UDC A;  1PM3 A;  3I5S A;  2KVQ G;  2YLB A;  2CGH A;  4R0K A;  4C8Q C;  2QEX A;  5GAN 3;  4A63 B;  2A0F B;  3EGU A;  2H8H A;  2LX9 A;  1ZSG A;  1YWP A;  4M7A G;  1WLP B;  1F1B B;  1YFN A;  4PFP A;  4C8Q D;  3CCL T;  4XTX A;  4MMK A;  2DYB A;  4M7A B;  1U06 A;  3JCM P;  2XU8 A;  4BE1 A;  4AT1 B;  4FW1 A;  3CD6 T;  3JB9 H;  2QEX Q;  3VS1 A;  1H3Z A;  1G83 A;  3QJY A;  4X1V A;  4D8K A;  3ZL7 C;  3HKS A;  3INZ A;  3DLL A;  1P92 A;  1N6A A;  1TXQ A;  1ABO A;  4ORZ A;  1YIT A;  1YCY A;  3CCM A;  2DL3 A;  4MDX A;  1S72 T;  2RK2 A;  2AKK A;  3S3O A;  4OMN A;  2QA4 A;  2LT4 A;  3QG1 A;  4CI0 C;  4E7S A;  3LGL A;  1RAB B;  4OP0 A;  1K8A R;  4RCC A;  1T0J A;  5C0M A;  2DER A;  4LDX A;  3QUI A;  3LWH A;  3CCM Q;  2VWF A;  2DX1 A;  2RO0 A;  2X4J A;  1VIE A;  2HNI A;  1MMG A;  1VQO T;  2E5K A;  5GAN g;  1UGQ B;  2QA4 Q;  4PJL A;  2EYZ A;  1X27 A;  3HFO A;  3KFV A;  3QXE B;  1WA7 A;  1XNI A;  3OSV A;  1KQ1 A;  3GF5 A;  2DVJ A;  1Q86 R;  1JEG A;  2P84 A;  2JOY A;  3H8Z A;  4RTT A;  3A8O B;  5KH6 A;  3RIR A;  3RR6 A;  3MEV A;  2K3X A;  1NEG A;  3SHW A;  5LJ5 j;  1KC8 R;  3OYN A;  3QWY A;  4MML A;  2KT1 A;  4BDZ A;  2EFI A;  1WYX A;  3V8L A;  2AK5 A;  1QLY A;  3JB9 D;  4HCB A;  1D1A A;  1BIB A;  2HSP A;  3OSS C;  1S72 Q;  2HMA A;  4LUE A;  1IHW A;  3SWN A;  1BB9 A;  1M3B A;  5KYN A;  3FC3 A;  4XTU A;  4XU1 A;  4KH1 B;  1Q81 R;  2JXB A;  2ZCF B;  3VS4 A;  2J6O A;  2JMC A;  3LGF A;  1BBZ A;  3GBQ A;  2WAC A;  2VYT A;  4C5I A;  5DM7 R;  1SHF A;  5J3B A;  3A98 A;  1YJN A;  2VUB A;  1M8V A;  1I5O B;  2DBK A;  3QBY A;  5CQY A;  5GAO n;  1Y57 A;  2OTL T;  2NYS A;  2QAS A;  4PJO F;  4JPB W;  2XIC A;  2Y90 A;  3FDR A;  2EGE A;  3UA7 A;  3ULR B;  3OS2 A;  4RMO A;  2JTE A;  1C0M A;  1QCO A;  1YJN Q;  4M7D E;  2ZAE A;  2LCC A;  3PNW C;  2QGG A;  4FIB A;  2KRN A;  1KQ2 A;  5J39 A;  4F16 A;  1N27 A;  2NLU A;  4J9H A;  1WHJ A;  4M77 B;  2DAQ A;  1K0X A;  1MND A;  1M27 C;  5DLQ E;  2MAM A;  4M78 A; 
#chains in the Genus database with same CATH homology
 1M90 R;  3CCR Q;  1VQM Q;  1YI2 Q;  1KD1 R;  3CCM Q;  3G71 Q;  3CME Q;  1YHQ Q;  1VQ6 Q;  1YIT Q;  1Q81 R;  1VQ4 Q;  1VQ5 Q;  1KC8 R;  2OTL Q;  1M1K R;  3CCS Q;  1VQ9 Q;  1VQ7 Q;  1VQN Q;  3OW2 P;  1K73 R;  1QVF P;  1YJN Q;  2QA4 Q;  3CC2 Q;  1QVG P;  1VQL Q;  3CC7 Q;  2OTJ Q;  3CCL Q;  3CCQ Q;  3CC4 Q;  3CCJ Q;  1VQO Q;  1VQK Q;  1VQP Q;  2QEX Q;  1YIJ Q;  3CCE Q;  3CCV Q;  1YJ9 Q;  1W2B P;  1K9M R;  3G6E Q;  1KQS P;  1Q86 R;  3CD6 Q;  1N8R R;  1S72 Q;  3CXC P;  3CMA Q;  1NJI R;  3CPW P;  1K8A R;  1JJ2 P;  3I56 Q;  1Q82 R;  3G4S Q;  3CCU Q;  3I55 Q;  1VQ8 Q;  1Q7Y R;  1YJW Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...