1YJ9Q

Crystal structure of the mutant 50s ribosomal subunit of haloarcula marismortui containing a three residue deletion in l22
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1yj9Q00
1S72Q 3CD6Q 1VQ7Q 3CCMQ 3CC7Q 3CC4Q 3I56Q 1YJNQ 3CMEQ 1VQ6Q 1Q82R 3CCLQ 1YITQ 1NJIR 1M90R 1VQPQ 1VQKQ 1YJ9Q 3CCJQ 1YIJQ 3CCUQ 3CCRQ 2QA4Q 3G6EQ 1Q7YR 1VQMQ 1YJWQ 1Q86R 1N8RR 1KD1R 3CMAQ 3OW2P 1YHQQ 3CCVQ 1K9MR 2QEXQ 1KQSP 1YI2Q 1QVGP 1VQNQ 3CCEQ 1KC8R 1VQ9Q 3CCQQ 3CCSQ 3G4SQ 3CPWP 1VQ5Q 1VQLQ 2OTLQ 1VQ8Q 1Q81R 1VQ4Q 1W2BP 1K73R 1K8AR 1QVFP 1JJ2P 1VQOQ 1M1KR 3CXCP 3CC2Q 3G71Q 2OTJQ 3I55Q
chains in the Genus database with same CATH superfamily
1VQ7Q 1WHJA 1G3TA 2X9HA 2JNGA 2ZZDA 2SEMA 4KGZB 2VGNA 1QVPA 2LQKA 2D9TA 3CCVQ 3CCJA 3M5AA 3DB4A 5GAMd 1Y71A 2LT1A 2DL8A 1OX8A 2E5KA 4RTYA 3CPWP 2PU9B 4CC4B 5KYXA 1K0SA 2RHXA 4M75C 2E65A 3JB9J 1T3SA 2LCLA 1OEBA 3JCMW 1G83A 2KK4A 4FSXA 4OB3B 1NG2A 4IUUA 2IPOB 1UDLA 4HVUA 1ZSGA 4M78A 5LJ3g 1PNJA 2K57A 3ULRB 5I21A 2CH4A 1IXDA 2OTJT 2V8KA 2OTLQ 3L2VA 1KD1C 3CQTA 2HSEB 1Q95G 5GAOn 3UF4A 1P92A 3CCRT 1N27A 2YSQA 2HQHA 1B7TA 2AZVA 2EKOA 2LDMA 4C92C 2EQKA 3X26B 3A5ZB 1OU9A 2A37A 2E3HA 1UE9A 1ZQ1A 4E6RA 2AT1B 3PFSA 1I81A 2XK0A 1V1CA 3EGDA 4HKEA 2XDDA 5I2SA 4JJDA 5FWBA 2DYBA 5I11A 2EGAA 2EQIA 3RERA 3G71Q 3VS1A 3H8ZA 3EG9A 1N6AA 4BY6C 3QPHA 4DEXA 4PKCC 1M27C 2KDSA 3QJ6A 4BB7A 3E9GA 2MOXA 4QVZA 4R55A 1QKXA 2DXTA 2DRMA 3VS3A 4FYWB 3CCQA 1WHMA 4CC2A 2MMPA 1M3AA 1AVZC 4XU0A 1FMWA 2XI9A 2M0OA 1SSHA 1NYGA 2VC8A 2B8AA 4ZGDB 1YJNA 1Y0MA 5IXBA 4A63B 4PJOC 2EQUA 5KYNA 1BYMA 4M7AD 4M75E 4FU6A 4ZGEB 1U3OA 1ZA1B 5IN1A 5LJ5e 3EHQA 2JTEA 1NJIC 3I5SA 3MP6A 3L2UA 1SKUB 1W2BS 4LDVA 4E7SA 4XTXA 3GP8A 1FXXA 5IHIA 4D8DA 5D7UA 4IKFA 1MGQA 3OYYA 3CC4A 4IUQA 1YITA 1KD1U 4JLGA 3GIBA 2RHUA 2WSCE 3OMGA 5KH6A 3H0FA 2EWNA 4NS5A 2EQMA 3F70A 3WVDB 3CCMT 4LDYA 1PM3A 4J9IA 1I1JA 4OMLA 2AZSA 4C92E 1YJ9T 3A8GB 2JM8A 2KBTA 2CZ0B 2EGCA 2KVQG 3DB3A 3MP8A 5J26A 4HCBA 5KYXB 2CKKA 3G6EA 2KYBA 3M0TA 1KC8R 1B3QA 2X4XA 1KQ2A 3PTAA 2CP6A 3JCMf 4EDUA 3LGFA 3VS4A 1EX4A 2HSPA 2V8IA 4J9CA 1WXBA 3CEYA 1VA7A 2BIVA 5GMKh 1G3SA 1LNXA 2RQWA 4DOVA 2C06A 2OTJA 5GMKi 3CXCA 3JV3A 2ZGWA 3OMCA 1WHKA 4EMKA 2RM4A 4DOWA 3QUIA 3CCRA 2IVWA 3MO8A 2QDYB 2VYTA 1QLYA 2K5FA 1SRLA 2CP0A 8ATCB 2EW3A 2FZKB 4L6V5 5GMKl 4BDZA 1OX9A 1UGPB 3QDFA 4N0AC 4PJNA 4FM4B 3R6NA 1ZUYA 4JRKA 1NJIU 4KH0B 3H9NA 2P4TA 2MK5A 4M7DG 3EGUA 2X3XD 3DKMA 2F2XA 4A4KA 4E7ZA 2BZYA 2J6FA 2DYIA 5EG2A 3M0PA 3QBYA 1IGUA 3C0CA 5I2MA 1GCQA 2KROA 3KBGA 1QQJA 4C8QF 3SWNB 2QA4T 4JRQA 1JXMA 3L2RA 2CT3A 3EH2A 2GCXA 2L0AA 3HL8A 2F5KA 3EG3A 2FHDA 2KY9A 5C0MA 2CP3A 1OZ3A 1OPKA 2JZ2A 5DLQE 3OYCA 4ZTFA 1S72T 1RI0A 2DBKA 2LQ8A 5CKHA 3NTIA 1D3BA 4M75D 2DA9A 2LJ0A 3OYEA 3OY9A 2O01E 3QWYA 4EMGA 1Y07A 3FC3A 1OPLA 5IHNA 1WJRA 3EG1A 2LC4A 1QCNA 4QVCA 1ZSZB 2HNIA 2OI3A 2DERA 3AT1B 4E2FB 4J8OA 1ZHIA 2EYXA 3M9QA 1GL5A 2DX1A 3ASKA 5GANg 4YTLA 4JLIA 5GAOp 2JXBA 4RTXA 1YJ9A 3VYHB 1QCOA 2KXDA 1YP5A 2M0YA 3KUFA 2KGTA 3G4SA 2MIOA 1V29B 4N4GA 1OI1A 3OYBA 3I55Q 1SF9A 2CZ6B 2FG0A 1VQPT 2LT4A 1WHLA 2JTMA 3M0SA 1G5VA 1K4US 1FWZA 2EKHA 3AHUA 1U5SA 4M78F 1YIJQ 5GJVB 2A08A 4M77A 2JOYA 1RL2A 2MWOA 3MCAB 1M1GA 4K11A 1M2VB 4HVVA 2KAFA 5LJ5d 2FVUA 1B07A 1S72Q 3M58A 3CC7Q 3IQLA 4MMLA 2VXFA 4C8QG 3UDCA 1PSEA 2X4JA 2Y4YA 2F2VA 2LQWA 1J3TA 3OYLA 1VUBA 2LTOA 1GRIA 3S6WA 2DM1A 1X6OA 2XU8A 3GNFB 1K73R 5DM7R 4PJOD 1OYXA 5IAYA 2LCCA 1H92A 4LDWA 1VQOQ 1QVGA 2I0NA 2COYA 2CREA 1C0MA 1QVFA 2BE9B 1CSKA 5IXFA 2EYZA 1YI2T 3A1PA 1RAHB 2O9SA 4M7DA 4XU3A 4F7UA 2E10A 2JJ9A 5HK3A 2QA4A 3HTRA 3FB9A 1Y57A 4KGXB 4AG1C 1TTHB 5A0LA 2HBWA 1SPKA 3HKSA 2MYSA 2O2OA 2LCSA 5LL6S 1VQPQ 1WLPB 3LGLA 1MNEA 1UEBA 4RTUA 2EJGA 4BE0A 2NLUA 3PMIA 2DXBA 1X69A 4HCKA 4XU2A 2ZPHB 2A3LA 3CPWA 1KJWA 2RJCA 3VUBA 2M51A 3HRSA 1YN8A 5DY9A 4J5YA 3NTKA 1VQKQ 4Y91A 2LX9A 2VGMA 2J6KA 3VJPA 1UHFA 5CK9A 1OOTA 1JO8A 1BU1A 3CCEA 3CD6T 1VQ9A 4C5GA 4LXCA 2YT6A 1I5OB 4RTTA 2FL7A 3CPFA 2K2MA 2ATCB 4M75B 4C0GA 3KXTA 1YHQT 5FROA 1X01A 5FRNA 4XTZA 3TQ7P 5C6SA 5LJ3e 2QK0A 4LNPA 1D0ZA 5KCHA 2JUFA 3VYGA 1M3BA 3E1SA 3SDZA 1Y7XA 1KHIA 3PGGA 3ME9A 1YWPA 4JDSA 3H0IA 4CC3A 2DTOA 1D09B 5GAMj 1MMNA 2MI6A 4C0DC 1JJ2A 2X51A 4J9EA 5AYFA 2AIRB 1GBRA 2DFUA 2RJEA 4Z88A 3QHSA 2Y4XA 3M0QA 2K9GA 1JBMA 4AFQC 4C92B 2L3QA 3OYHA 2QTXA 2YHTA 4EMKC 3JCMh 2BZ8A 1YCYA 3SEMA 1YWOA 3S3OA 1KC8C 3LWIA 4P5NA 2WSFE 5GAMg 3CCJQ 5GAN7 4BACA 4BY6B 1PD1A 3MPUB 4CRIA 3UPUA 1JEGA 1ARKA 3M4YA 1AZEA 1V76A 3JB9I 1YI2A 2DL3A 4M7AE 1YJNT 1UUEA 2RD1A 2CUDA 1LPLA 1Z9QA 4RUGA 2WSEE 2BZXA 2R58A 3VRZA 3SB2A 1IO6A 5I22A 4MDXA 2EAYA 2DXCA 4HVWA 3RESA 2CYZB 1TS9A 2P0QA 3VV0A 3OYDA 4PFOA 3S3MA 2QGGA 3CC4T 2YRCA 4QW2A 4JRPA 1D1BA 1UECA 5IH2A 2QEXT 2YUQA 3MEUA 1AWOA 4NOYA 4FYYB 3UA7A 1A0NB 4F14A 1NEGA 2PVDB 2L5QA 1IREB 2G6FX 4R56A 2CS7A 4BD3A 1IRXA 4DBHA 2ED1A 3EFSA 5A2QE 4Y92A 2RN8A 3P8BB 1ABOA 3PIPA 3G6ET 1AZGB 4M78D 3OSSC 3CD6A 2J7IA 2K5LA 2Y90A 2QI2A 3OS2A 1HYOA 5CKBA 2O31A 5J39A 1YJWA 2HL5C 4IIOA 1YHQA 2KE9A 3CCQQ 3KFVA 1KC8U 1N8RC 4XK8E 3PE0A 1AWJA 1QVFS 4BE1A 2FPFA 3V8LA 3T9NA 2NYSA 3D7SB 5CKEA 3RDVA 2HAXA 4DA4A 1ZLMA 2OAUA 4M77F 5FU6C 1VQLT 1WYXA 4AG2C 1Y96B 4OMPA 1TWBA 2K5IA 4V2SA 3ZBDA 1X6BA 3CC2T 3FEOA 1KFZA 1W2BP 2QXFA 2RPNA 3GF5A 1JJ2P 3CMET 5D6XA 2ROTA 2RF0A 3CC4Q 2IG0A 2R5MA 8AT1B 1YITQ 3SWNA 4EIKA 4TVRA 4B6MA 5KE2A 4ME7A 2DLPA 1PKTA 3M56A 2EFIA 2BUDA 3OYJA 2DNUA 1I07A 4ZTJA 2ESWA 4C5HA 2HKQB 2V1QA 1PKSA 1WA7A 3A8OB 3CPWS 4R0KA 1BI2A 1WHGA 3LWHA 1X6GA 5GAN4 3REAB 3REBB 2A36A 3ZFJA 5GMKm 1VIEA 4M7DF 1UB4A 3G6EQ 4F7UF 4NL3A 4C5EA 5LJ3d 3M53A 2ZPBB 4Q5WA 4Z02A 4J9BA 2BKDN 3OW2S 4ELZC 4M7DC 1NZ9A 3PMTA 4A4HA 2OTJQ 3NTHA 5FLXE 5GAMh 1GFDA 4XTYA 1ZSZA 1KG1A 2E64A 3C94A 1C6VX 2QQRA 5CCAA 1K73C 1W70A 2V8JA 5LJ5f 4JRIA 3CCRQ 1N8RU 2JS2A 1ZX6A 1G8XA 1AD5A 4PL6A 3QKJA 3CBMA 4M7AA 4HT9A 1MMDA 4J9GA 3QJYA 2QQBA 3QYGB 2QEXA 4OP0A 3JRZA 4BDYA 2P4RA 1M30A 2L3SA 4X9DA 2M1HA 4QQDA 3QXEB 1GFCA 3G71A 4MZTA 2DPPB 4EPCA 1QWEA 3INZA 3O8VA 2L8DA 2EJFA 5GANe 2YRVA 1VQ5T 2PUKB 3G4ST 4JJCA 2YXYA 2RQRA 4M77G 5KCOA 2HMAA 5D6YA 4MMKA 4RCCA 4ELYC 4XTWA 4A4FA 1XNIA 1NPRA 5A0GA 1M2VA 3EFOB 1O75A 1JQQA 2DF6A 1T0JA 1T0HA 3VKIA 2DMOA 1RAIB 1K76A 1AHJB 4N4IA 2ZPIB 4OVAA 3V7SA 3UATA 2RNAA 1ZUKA 2VV5A 2LVMA 2GF7A 1WFWA 1KIKA 1VQLA 1RADB 1NLOC 1VQ6T 1G3YA 3CC2A 2VASA 4OMFB 3U23A 4AT1B 4PJOE 3TU4K 2K7AA 4OMNA 2YDLA 1UFFA 2JM9A 1RACB 1QP3A 4M4ZA 3CMEA 4J7IA 1PRMC 2PNIA 1XQHA 3JCMQ 2VKNA 1VYUA 4F7UG 2R57A 4BI8B 1M8VA 3EGXA 3LH5A 2VWFA 2K3BA 3JCMJ 1BB9A 2RQUA 2RH2A 1K73U 2DZCA 4AFUC 3RMQA 3HSBA 3CCLT 3H41A 5GAOl 3QO3A 5CQYA 3CCMQ 2PVGB 3CMAT 2DJQA 1RAAB 3I5RA 1HK9A 2Z0WA 1YJ9Q 4GBQA 3QDRB 5LJ5j 2QG9B 1LOJA 2D0NA 2X3WD 2KT1A 1QWFA 1WXUA 2VB6A 4C8QC 1MNDA 2HCKA 4OB1B 2RB6A 2HQEA 3BDUA 1KQSA 3UWNA 2K3YA 1XTDA 4ZGJB 1RAFB 1AEYA 3CBPA 2H3JA 2CP2A 2IIMA 5J3BA 4DBFA 1VQNT 4ANJA 5KYWB 1Q7YR 1N8RR 2C0IA 4J6XA 1RI9A 4FL6A 3TEEA 5CAIA 2KI7A 2PUOB 2O88A 1BK2A 1UGQB 3JCMV 1H3HA 1W6XA 1RLQC 2KYMA 1BIBA 3MEVA 2M16A 2ZPFB 1LJOA 1M4ZA 4M75A 4C0FA 1I5LA 1Q86R 1VQ9T 3CCET 3FIFA 4M7AB 4QKUA 1PG5B 2O4XB 2HZYA 5KYUB 2KMTA 2NUZA 4QQGA 1ZBJA 1YFNA 2CP5A 1H641 4JUVA 1IGQA 3VS0A 3V8KA 1UGRB 2V26A 4E7KA 3HPWA 1VQ5A 2D1XA 3I56T 3OQ5A 1EIFA 3RMSA 4X1VA 3VS2A 2OJ2A 3JCMg 4M77D 1WXTA 1QP2A 3WVEB 2QA4Q 5HCKA 2EGEA 4DBQA 1M2OA 1N9RA 1CKBA 2GNCA 2FO0A 3QSUA 2HBPA 4C92A 4J9DA 3OS0A 4PJLA 2DK3A 4IUVA 4M78C 4JJBA 1OZ2A 4QT7A 2A0FB 3L42A 4BI4A 1T3LA 2D0QB 4FYVB 1AT1B 4ATOA 2ED0A 4C8QE 1N5ZA 1VQ6A 4PJMA 3V7RA 2FZCB 4OMOA 2DTIA 4RTZA 3HRUA 3QYHB 3TSWA 1E6GA 2C0OA 3CCSA 2E3IA 2DO3A 3PNWC 3CBOA 1FX7A 2LRQA 5GJWB 1K8AC 4M7DD 5GAMe 2QQSA 3N5BB 3RBBB 1FMVA 3LX7A 3CCLA 2CDTA 4ORZA 1VQ4T 1HD3A 1SG5A 3EGXB 2VXEA 2FRYA 3CMAA 3JB9F 1MV3A 3SWNC 2COZA 2QYZA 2XG8D 4PJOA 3E9FA 4RMOA 2DVJA 1PSFA 2DE0X 3QZ5B 4XQ3A 3OYFA 1MV0B 2DAQA 4J6WA 1M8MA 2DXUA 3L2QA 1SEMA 1U1SA 3EH1A 1KQSP 1FMKA 2QQAA 2EYYA 2QDLA 3OSVA 3M59A 4QVDA 1KHCA 1VQNA 1WIEA 1KQ1A 1WJSA 5GAN2 2RK2A 4BUGA 2RJFA 2GQVA 1VQMT 4O6JA 5GAN5 1PD0A 2D8HA 3CXCS 1NPPA 4XU1A 5GMKe 2JVVA 1CKAA 2DJZA 5CKFA 1VQ8T 2DD5A 5HKCA 4M7AF 1UGVA 1ZA2B 4M78E 2QASA 1SSFA 2KSSA 1M1KR 3WXMB 2E41A 1R0CB 4ESRA 1VQOA 2XKOC 3OYMA 1DJ7B 2EJ9A 4IUPA 1TUDA 3OS1A 1YJWT 4LUEA 4FT2A 2EYQA 2QAZA 4KT0E 3I56A 2GTJA 3NGPA 1UGSB 5LJ5h 3RKWA 2ZCFB 2LX7A 2KT8A 4AFZC 3P8HA 1YI2Q 2K3XA 5M9OA 1Y96A 1QKWA 4AFSC 2P0PA 1K8AU 4FSSA 5LJ3f 4ZNXA 4J6YA 4NL2A 1W2BA 4LN2A 4CI0C 1TOVA 2DVEA 2KRMA 3HP9A 4GY5A 4PK4A 1BI0A 1TG0A 5GAOr 5FU6B 3BW1A 2JTFA 1EZZB 1W4SA 1VQ7T 4MZPA 3JB9G 1GBQA 1WDXA 3O5ZA 4C8QD 4OB2B 2YUOA 5KYYB 2RI2A 4JJNK 3CCVT 1D0XA 2AKKA 2J6OA 5GAN8 3MEWA 1TUCA 2X4WA 3PVQA 1BCOA 4LD9K 2KR3A 4OGEA 4KBMB 5FWCA 1XJWB 3V7CA 2E5QA 4OMMA 2MAMA 2NUTB 3FJ5A 3E2UA 1RUWA 2EIFA 4UC4A 1Q81U 1QCFA 1ACMB 5GAN6 5IHKA 1E7OA 1VQ4A 4XTVA 1W1FA 3CD6Q 3MKDA 3MJXA 4A54A 1JB0E 4KULA 4DBRA 1GCQC 2OTLT 1U06A 1YHQQ 2QGFB 3CCUA 2L3PA 1BBZA 2HL3A 4M7AG 4PJOB 4LE9A 4BE2A 1IZ6A 2ZPGB 2PVOB 2CP7A 2J05A 2A7YA 4BI3A 1X43A 4ZN1A 3Q1JA 3META 3A98A 1SHGA 9ATCB 1VQMA 1BIAA 3G7ZA 3G71T 4IURA 4L5GA 3QZ9B 3JCMX 3RUXA 2GQIA 1VQ8A 5LJ3j 4C5IA 4WTOB 1I0CA 3RKYA 4KUDK 1NEBA 1VOMA 4M75F 3EG2A 3J80E 5FU7C 3EFOA 1N9SA 5KE3A 1WPYA 3VRYA 5FW9A 1M90C 1UTIA 1QW1A 1K8AR 1NYFA 4FIBA 3TREA 1Q7YC 4EMHA 2FZGB 5HK0A 2NUPB 2RI3A 2XICA 1QVGS 1UJ0A 3V8JA 1H3ZA 4KUIA 4E7IA 1IB8A 4CC7A 1YJNQ 2DRKA 4J9HA 1Q82R 3NMZC 2EVRA 2CUBA 1G3WA 3OW2P 3GPLA 4A53A 1D1CA 2F1LA 1SHFA 1WGSA 4C92F 1Q86C 3VUZA 3L2WA 3GOXA 4M77C 1B34B 4RCBA 4GLKA 2LQNA 2ECZA 3M57A 4Z8AA 5L23A 2RMOA 2PTKA 1VQ7A 1AOJA 3FLGA 4JS5A 4JPBW 5CIUA 2QEXQ 2GTOA 2DEUA 2LMJA 3LH0A 1OQKA 4HXJA 3CCVA 3JB9D 1Q81R 2X35A 2YLBA 2E6ZA 2H3EB 1KK7A 2DD4A 2M02A 1K9AA 4OF1A 3VS5A 2R5AA 3G1JA 4A4EA 1OU8A 2M9UA 3TCJA 3OBWA 1KSWA 4HCCA 2HEQA 3EHRA 1TXQA 1K9MR 3EG0A 2RO0A 5KYWA 2WACA 2P84A 4PJOF 3GLXA 1WZOA 4J83A 2E6NA 1NLPC 5CVIA 4C8QB 2OTLA 2HD0A 2K6DA 2MPXC 2ABLA 5GAOm 1NBEB 2F5TX 4WF2A 2HKNA 1M90U 3HFOA 2PZ1A 4M75G 3X20B 1TUGB 1Q7YU 2E4HA 2QTVA 2DL4A 1YCSB 1U1TA 2O4XA 1AWWA 1VQLQ 5KYUA 4X9CA 2ZAEA 3CC2Q 5CR2A 1JJ2S 3OYKA 2F69A 4OMQA 1QMCA 2GFAA 3CMEQ 4F17A 1WQ7A 3QIIA 1PC0A 2A28A 3M54A 3ZEHA 1Q86U 1D0YA 1I8FA 2P0KA 4JS4A 2W0ZA 5EC7A 2DBMA 4M77E 1NE8A 3ER0A 5D6WA 4LDUA 3X25B 5GANf 3GBQA 4C92G 3JSCA 2RJDA 2D6FA 2ENMA 4RTVA 4LD6A 3JCMe 1I4K1 2C0TA 1WHHA 2RQVA 3FRNA 2OX7A 3M0RA 3DLLA 2CSQA 4KH1B 3R6OA 4XAXB 1M9SA 4X34A 2PQWA 4GLMA 3MHXA 4L59A 4LUDA 2JMCA 3NPFA 2FPDA 2H8HA 4M78B 2XHCA 3A8LB 1UHCA 2CT4A 3J7AF 1M1KC 4MDWA 3CCST 2FRWA 2NWMA 1WI7A 4KRTA 3OS5A 3SFMA 4M7DE 3QG1A 4F7UE 2AHJB 1GCPA 2COWA 2F2WA 5LJ3h 4PJOG 2K2VA 1LCKA 1RAGB 4Y28E 1LVKA 4II1A 3LW5E 2B86A 3H0HA 2DTHA 3EGDB 4F04B 2VVKA 2VUBA 1X2KA 1GXIE 4HT8A 3LYIA 1VQ5Q 3G4SQ 3I55T 3TVTA 2GGRA 3EG9B 1SRMA 1WQWA 1R0BG 2KRSA 2LJ3A 1YIJT 3JAME 3S3NA 2RA2A 2XIDA 3OYGA 3PVLA 1JU5C 2DZ9A 3BY7A 3GNGA 1M90R 2BTTA 3LLRA 3VU3C 4J9FA 2YUNA 2YUPA 2EQJA 1JRIA 1S1NA 1TU0B 2D8JA 3RNJA 3SD4A 3P8DA 3RR6A 4JZ4A 4E47A 3OYAA 6AT1B 2W10A 5LJ5g 3CC7T 2L3RA 5GANj 3VS6A 3BDLA 2EBPA 4PJJA 3JCMb 4E7HA 1VQ6Q 5L8RE 1ZUUA 1KD1R 2FB7A 1RABB 4RKUE 4O5VA 3MEAA 1VQOT 2LJ1A 3CCSQ 4A4GA 3ZL7C 1BKBA 2LNVA 1M1KU 3OYNA 3PIOA 2EYWA 4KGVB 2FPEA 3CCLQ 4JZ3A 3CCMA 1D1AA 1Z9ZA 4AMCA 1X2QA 4IIMA 3CMAQ 5ECAA 2ROLA 4FT4A 4C92D 1MUZA 2LZ6B 2RQTA 2DILA 1BCMA 1ABQA 3A8MB 1X75C 1M5Q1 3THKA 5KYYA 3URGA 3C4SA 4C0DB 3OA6A 1EFNA 4B9WA 1TSFA 4C0ZA 1VQNQ 1UJYA 3M4GA 2CH4W 2NUTA 3CXCP 1IHWA 1PWTA 4D6WA 2AK5A 4OB0B 2L89A 1VQKT 4HA8A 5CKDA 3RIRA 4EMKB 2LP5A 2JN0A 1NJIR 5CO7A 1C1AA 5FRMA 1ZBXA 3OB9A 1JXOA 2YRDA 5GANd 2E12A 5CQXA 3H6ZA 3CCEQ 1VQ9Q 3JCMc 1Q82C 1VYVA 3RKXA 4DEYA 3E19A 4QQ6A 5GAMf 2J06A 2CZ1B 1G2BA 5IT9E 1WX6A 3L1AA 4PLIA 4ZN3A 3M0UA 4MZMA 3CCUT 3I56Q 3I55A 4D8KA 1TH7A 3EAEA 5GAN3 2DL5A 2LNHB 3JCMd 2X4YA 4DQ2A 1YIJA 1BI1A 2XD0A 2JW4A 3HFNA 1XOVA 4WCIA 7AT1B 3X24B 3UT1A 3C12A 1FYNA 1NM7A 1RLPC 3HRTA 1IHVA 3FDRA 1Q81C 1PRLC 1S72A 4J7FA 3CC7A 3L2ZA 5HY6A 1M3CA 1PHTA 2E70A 1ZSZC 2OAWA 1AWXA 1D3BB 2DIQA 1HJDA 2KEAA 1OV3A 2KNBB 2BE7D 4PNOA 1K9MC 3CCJT 4M7AC 2NUPA 2HQXA 2KXCA 4E7LA 2DETA 4Z89A 1X27A 1UG1A 4RG2A 2MF2A 2KRNA 2RI5A 2XDBA 2SRCA 3JCMP 4FW1A 4M78G 2QQ9A 4LDXA 4OGCA 3BE3A 3NFCA 5FU7B 1K0XA 1E6HA 4N4HA 2RHZA 3OYIA 2FEIA 3DLMA 3OW2A 1VQ4Q 3C95A 4FCYA 2HDAA 4RTWA 5AT1B 2ZPEB 2JT4A 4B9XA 5GAOq 1B34A 1RAEB 2CGHA 3I9QA 1Q82U 3CCUQ 2I2LA 1VQPA 3UA6A 2YWWA 4PFZA 4PFPA 2O9VA 1MHNA 2CSIA 3NHNA 4E7JA 4N0AA 2DIGA 2L2PA 1HXDA 1KQSS 2CZ7B 1U8RA 1WJQA 2JMAA 3X28B 5GANh 2DL7A 2RHIA 1F1BB 4XTUA 2MWPA 1O9SA 4RG8A 1R8OB 4M77B 3M55A 2EPDA 2G3RA 1MMAA 1VQMQ 2JS0A 1VQKA 3EFRA 1VQ8Q 4FYXB 3FJPA 3JB9H 1BI3A 5A0DA 3OBYA 3J81E 5DLOA 3TSZA 1OULA 4C8QA 1YNZA 1M1FA 2GFUA 2AKLA 3HHTB 3CCQT 2DKGA 1YJWQ 3I35A 1K1ZA 2XDPA 1HSQA 3MP1A 2E1HA 1H8KA 2FYKA 2RK1A 1QVGP 1K9MU 1MMGA 2YLCA 2DEQA 2KQWA 3PT9A 1QVFP 3SHWA 3VS7A 4VUBA 1VYTA 1WNLA 1PCXA 5GMKj 4F16A 4FW2A 4PLLA 4M7DB 4IUTA 3QWXX 4F7UB 2K4YA 2RHYA 4HCZA 3BFMA 3A8HB 1YBYA 1VIFA 2K79A 1R77A 2XMFA 2GBQA 2V1RA 1YITT 2MCNA
chains in the Genus database with same CATH topology
1S72Q 3CD6Q 1VQ7Q 3CCMQ 3CC7Q 3CC4Q 3I56Q 1YJNQ 3CMEQ 1VQ6Q 1Q82R 3CCLQ 1YITQ 1NJIR 1M90R 1VQPQ 1VQKQ 1YJ9Q 3CCJQ 1YIJQ 3CCUQ 3CCRQ 2QA4Q 3G6EQ 1Q7YR 1VQMQ 1YJWQ 1Q86R 1N8RR 1KD1R 3CMAQ 3OW2P 1YHQQ 3CCVQ 1K9MR 2QEXQ 1KQSP 1YI2Q 1QVGP 1VQNQ 3CCEQ 1KC8R 1VQ9Q 3CCQQ 3CCSQ 3G4SQ 3CPWP 1VQ5Q 1VQLQ 2OTLQ 1VQ8Q 1Q81R 1VQ4Q 1W2BP 1K73R 1K8AR 1QVFP 1JJ2P 1VQOQ 1M1KR 3CXCP 3CC2Q 3G71Q 2OTJQ 3I55Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S72 Q;  3CD6 Q;  1VQ7 Q;  3CCM Q;  3CC7 Q;  3CC4 Q;  3I56 Q;  1YJN Q;  3CME Q;  1VQ6 Q;  1Q82 R;  3CCL Q;  1YIT Q;  1NJI R;  1M90 R;  1VQP Q;  1VQK Q;  1YJ9 Q;  3CCJ Q;  1YIJ Q;  3CCU Q;  3CCR Q;  2QA4 Q;  3G6E Q;  1Q7Y R;  1VQM Q;  1YJW Q;  1Q86 R;  1N8R R;  1KD1 R;  3CMA Q;  3OW2 P;  1YHQ Q;  3CCV Q;  1K9M R;  2QEX Q;  1KQS P;  1YI2 Q;  1QVG P;  1VQN Q;  3CCE Q;  1KC8 R;  1VQ9 Q;  3CCQ Q;  3CCS Q;  3G4S Q;  3CPW P;  1VQ5 Q;  1VQL Q;  2OTL Q;  1VQ8 Q;  1Q81 R;  1VQ4 Q;  1W2B P;  1K73 R;  1K8A R;  1QVF P;  1JJ2 P;  1VQO Q;  1M1K R;  3CXC P;  3CC2 Q;  3G71 Q;  2OTJ Q;  3I55 Q; 
#chains in the Genus database with same CATH topology
 1VQ7 Q;  1WHJ A;  1G3T A;  2X9H A;  2JNG A;  2ZZD A;  2SEM A;  4KGZ B;  2VGN A;  1QVP A;  2LQK A;  2D9T A;  3CCV Q;  3CCJ A;  3M5A A;  3DB4 A;  5GAM d;  1Y71 A;  2LT1 A;  2DL8 A;  1OX8 A;  2E5K A;  4RTY A;  3CPW P;  2PU9 B;  4CC4 B;  5KYX A;  1K0S A;  2RHX A;  4M75 C;  2E65 A;  3JB9 J;  1T3S A;  2LCL A;  1OEB A;  3JCM W;  1G83 A;  2KK4 A;  4FSX A;  4OB3 B;  1NG2 A;  4IUU A;  2IPO B;  1UDL A;  4HVU A;  1ZSG A;  4M78 A;  5LJ3 g;  1PNJ A;  2K57 A;  3ULR B;  5I21 A;  2CH4 A;  1IXD A;  2OTJ T;  2V8K A;  2OTL Q;  3L2V A;  1KD1 C;  3CQT A;  2HSE B;  1Q95 G;  5GAO n;  3UF4 A;  1P92 A;  3CCR T;  1N27 A;  2YSQ A;  2HQH A;  1B7T A;  2AZV A;  2EKO A;  2LDM A;  4C92 C;  2EQK A;  3X26 B;  3A5Z B;  1OU9 A;  2A37 A;  2E3H A;  1UE9 A;  1ZQ1 A;  4E6R A;  2AT1 B;  3PFS A;  1I81 A;  2XK0 A;  1V1C A;  3EGD A;  4HKE A;  2XDD A;  5I2S A;  4JJD A;  5FWB A;  2DYB A;  5I11 A;  2EGA A;  2EQI A;  3RER A;  3G71 Q;  3VS1 A;  3H8Z A;  3EG9 A;  1N6A A;  4BY6 C;  3QPH A;  4DEX A;  4PKC C;  1M27 C;  2KDS A;  3QJ6 A;  4BB7 A;  3E9G A;  2MOX A;  4QVZ A;  4R55 A;  1QKX A;  2DXT A;  2DRM A;  3VS3 A;  4FYW B;  3CCQ A;  1WHM A;  4CC2 A;  2MMP A;  1M3A A;  1AVZ C;  4XU0 A;  1FMW A;  2XI9 A;  2M0O A;  1SSH A;  1NYG A;  2VC8 A;  2B8A A;  4ZGD B;  1YJN A;  1Y0M A;  5IXB A;  4A63 B;  4PJO C;  2EQU A;  5KYN A;  1BYM A;  4M7A D;  4M75 E;  4FU6 A;  4ZGE B;  1U3O A;  1ZA1 B;  5IN1 A;  5LJ5 e;  3EHQ A;  2JTE A;  1NJI C;  3I5S A;  3MP6 A;  3L2U A;  1SKU B;  1W2B S;  4LDV A;  4E7S A;  4XTX A;  3GP8 A;  1FXX A;  5IHI A;  4D8D A;  5D7U A;  4IKF A;  1MGQ A;  3OYY A;  3CC4 A;  4IUQ A;  1YIT A;  1KD1 U;  4JLG A;  3GIB A;  2RHU A;  2WSC E;  3OMG A;  5KH6 A;  3H0F A;  2EWN A;  4NS5 A;  2EQM A;  3F70 A;  3WVD B;  3CCM T;  4LDY A;  1PM3 A;  4J9I A;  1I1J A;  4OML A;  2AZS A;  4C92 E;  1YJ9 T;  3A8G B;  2JM8 A;  2KBT A;  2CZ0 B;  2EGC A;  2KVQ G;  3DB3 A;  3MP8 A;  5J26 A;  4HCB A;  5KYX B;  2CKK A;  3G6E A;  2KYB A;  3M0T A;  1KC8 R;  1B3Q A;  2X4X A;  1KQ2 A;  3PTA A;  2CP6 A;  3JCM f;  4EDU A;  3LGF A;  3VS4 A;  1EX4 A;  2HSP A;  2V8I A;  4J9C A;  1WXB A;  3CEY A;  1VA7 A;  2BIV A;  5GMK h;  1G3S A;  1LNX A;  2RQW A;  4DOV A;  2C06 A;  2OTJ A;  5GMK i;  3CXC A;  3JV3 A;  2ZGW A;  3OMC A;  1WHK A;  4EMK A;  2RM4 A;  4DOW A;  3QUI A;  3CCR A;  2IVW A;  3MO8 A;  2QDY B;  2VYT A;  1QLY A;  2K5F A;  1SRL A;  2CP0 A;  8ATC B;  2EW3 A;  2FZK B;  4L6V 5;  5GMK l;  4BDZ A;  1OX9 A;  1UGP B;  3QDF A;  4N0A C;  4PJN A;  4FM4 B;  3R6N A;  1ZUY A;  4JRK A;  1NJI U;  4KH0 B;  3H9N A;  2P4T A;  2MK5 A;  4M7D G;  3EGU A;  2X3X D;  3DKM A;  2F2X A;  4A4K A;  4E7Z A;  2BZY A;  2J6F A;  2DYI A;  5EG2 A;  3M0P A;  3QBY A;  1IGU A;  3C0C A;  5I2M A;  1GCQ A;  2KRO A;  3KBG A;  1QQJ A;  4C8Q F;  3SWN B;  2QA4 T;  4JRQ A;  1JXM A;  3L2R A;  2CT3 A;  3EH2 A;  2GCX A;  2L0A A;  3HL8 A;  2F5K A;  3EG3 A;  2FHD A;  2KY9 A;  5C0M A;  2CP3 A;  1OZ3 A;  1OPK A;  2JZ2 A;  5DLQ E;  3OYC A;  4ZTF A;  1S72 T;  1RI0 A;  2DBK A;  2LQ8 A;  5CKH A;  3NTI A;  1D3B A;  4M75 D;  2DA9 A;  2LJ0 A;  3OYE A;  3OY9 A;  2O01 E;  3QWY A;  4EMG A;  1Y07 A;  3FC3 A;  1OPL A;  5IHN A;  1WJR A;  3EG1 A;  2LC4 A;  1QCN A;  4QVC A;  1ZSZ B;  2HNI A;  2OI3 A;  2DER A;  3AT1 B;  4E2F B;  4J8O A;  1ZHI A;  2EYX A;  3M9Q A;  1GL5 A;  2DX1 A;  3ASK A;  5GAN g;  4YTL A;  4JLI A;  5GAO p;  2JXB A;  4RTX A;  1YJ9 A;  3VYH B;  1QCO A;  2KXD A;  1YP5 A;  2M0Y A;  3KUF A;  2KGT A;  3G4S A;  2MIO A;  1V29 B;  4N4G A;  1OI1 A;  3OYB A;  3I55 Q;  1SF9 A;  2CZ6 B;  2FG0 A;  1VQP T;  2LT4 A;  1WHL A;  2JTM A;  3M0S A;  1G5V A;  1K4U S;  1FWZ A;  2EKH A;  3AHU A;  1U5S A;  4M78 F;  1YIJ Q;  5GJV B;  2A08 A;  4M77 A;  2JOY A;  1RL2 A;  2MWO A;  3MCA B;  1M1G A;  4K11 A;  1M2V B;  4HVV A;  2KAF A;  5LJ5 d;  2FVU A;  1B07 A;  1S72 Q;  3M58 A;  3CC7 Q;  3IQL A;  4MML A;  2VXF A;  4C8Q G;  3UDC A;  1PSE A;  2X4J A;  2Y4Y A;  2F2V A;  2LQW A;  1J3T A;  3OYL A;  1VUB A;  2LTO A;  1GRI A;  3S6W A;  2DM1 A;  1X6O A;  2XU8 A;  3GNF B;  1K73 R;  5DM7 R;  4PJO D;  1OYX A;  5IAY A;  2LCC A;  1H92 A;  4LDW A;  1VQO Q;  1QVG A;  2I0N A;  2COY A;  2CRE A;  1C0M A;  1QVF A;  2BE9 B;  1CSK A;  5IXF A;  2EYZ A;  1YI2 T;  3A1P A;  1RAH B;  2O9S A;  4M7D A;  4XU3 A;  4F7U A;  2E10 A;  2JJ9 A;  5HK3 A;  2QA4 A;  3HTR A;  3FB9 A;  1Y57 A;  4KGX B;  4AG1 C;  1TTH B;  5A0L A;  2HBW A;  1SPK A;  3HKS A;  2MYS A;  2O2O A;  2LCS A;  5LL6 S;  1VQP Q;  1WLP B;  3LGL A;  1MNE A;  1UEB A;  4RTU A;  2EJG A;  4BE0 A;  2NLU A;  3PMI A;  2DXB A;  1X69 A;  4HCK A;  4XU2 A;  2ZPH B;  2A3L A;  3CPW A;  1KJW A;  2RJC A;  3VUB A;  2M51 A;  3HRS A;  1YN8 A;  5DY9 A;  4J5Y A;  3NTK A;  1VQK Q;  4Y91 A;  2LX9 A;  2VGM A;  2J6K A;  3VJP A;  1UHF A;  5CK9 A;  1OOT A;  1JO8 A;  1BU1 A;  3CCE A;  3CD6 T;  1VQ9 A;  4C5G A;  4LXC A;  2YT6 A;  1I5O B;  4RTT A;  2FL7 A;  3CPF A;  2K2M A;  2ATC B;  4M75 B;  4C0G A;  3KXT A;  1YHQ T;  5FRO A;  1X01 A;  5FRN A;  4XTZ A;  3TQ7 P;  5C6S A;  5LJ3 e;  2QK0 A;  4LNP A;  1D0Z A;  5KCH A;  2JUF A;  3VYG A;  1M3B A;  3E1S A;  3SDZ A;  1Y7X A;  1KHI A;  3PGG A;  3ME9 A;  1YWP A;  4JDS A;  3H0I A;  4CC3 A;  2DTO A;  1D09 B;  5GAM j;  1MMN A;  2MI6 A;  4C0D C;  1JJ2 A;  2X51 A;  4J9E A;  5AYF A;  2AIR B;  1GBR A;  2DFU A;  2RJE A;  4Z88 A;  3QHS A;  2Y4X A;  3M0Q A;  2K9G A;  1JBM A;  4AFQ C;  4C92 B;  2L3Q A;  3OYH A;  2QTX A;  2YHT A;  4EMK C;  3JCM h;  2BZ8 A;  1YCY A;  3SEM A;  1YWO A;  3S3O A;  1KC8 C;  3LWI A;  4P5N A;  2WSF E;  5GAM g;  3CCJ Q;  5GAN 7;  4BAC A;  4BY6 B;  1PD1 A;  3MPU B;  4CRI A;  3UPU A;  1JEG A;  1ARK A;  3M4Y A;  1AZE A;  1V76 A;  3JB9 I;  1YI2 A;  2DL3 A;  4M7A E;  1YJN T;  1UUE A;  2RD1 A;  2CUD A;  1LPL A;  1Z9Q A;  4RUG A;  2WSE E;  2BZX A;  2R58 A;  3VRZ A;  3SB2 A;  1IO6 A;  5I22 A;  4MDX A;  2EAY A;  2DXC A;  4HVW A;  3RES A;  2CYZ B;  1TS9 A;  2P0Q A;  3VV0 A;  3OYD A;  4PFO A;  3S3M A;  2QGG A;  3CC4 T;  2YRC A;  4QW2 A;  4JRP A;  1D1B A;  1UEC A;  5IH2 A;  2QEX T;  2YUQ A;  3MEU A;  1AWO A;  4NOY A;  4FYY B;  3UA7 A;  1A0N B;  4F14 A;  1NEG A;  2PVD B;  2L5Q A;  1IRE B;  2G6F X;  4R56 A;  2CS7 A;  4BD3 A;  1IRX A;  4DBH A;  2ED1 A;  3EFS A;  5A2Q E;  4Y92 A;  2RN8 A;  3P8B B;  1ABO A;  3PIP A;  3G6E T;  1AZG B;  4M78 D;  3OSS C;  3CD6 A;  2J7I A;  2K5L A;  2Y90 A;  2QI2 A;  3OS2 A;  1HYO A;  5CKB A;  2O31 A;  5J39 A;  1YJW A;  2HL5 C;  4IIO A;  1YHQ A;  2KE9 A;  3CCQ Q;  3KFV A;  1KC8 U;  1N8R C;  4XK8 E;  3PE0 A;  1AWJ A;  1QVF S;  4BE1 A;  2FPF A;  3V8L A;  3T9N A;  2NYS A;  3D7S B;  5CKE A;  3RDV A;  2HAX A;  4DA4 A;  1ZLM A;  2OAU A;  4M77 F;  5FU6 C;  1VQL T;  1WYX A;  4AG2 C;  1Y96 B;  4OMP A;  1TWB A;  2K5I A;  4V2S A;  3ZBD A;  1X6B A;  3CC2 T;  3FEO A;  1KFZ A;  1W2B P;  2QXF A;  2RPN A;  3GF5 A;  1JJ2 P;  3CME T;  5D6X A;  2ROT A;  2RF0 A;  3CC4 Q;  2IG0 A;  2R5M A;  8AT1 B;  1YIT Q;  3SWN A;  4EIK A;  4TVR A;  4B6M A;  5KE2 A;  4ME7 A;  2DLP A;  1PKT A;  3M56 A;  2EFI A;  2BUD A;  3OYJ A;  2DNU A;  1I07 A;  4ZTJ A;  2ESW A;  4C5H A;  2HKQ B;  2V1Q A;  1PKS A;  1WA7 A;  3A8O B;  3CPW S;  4R0K A;  1BI2 A;  1WHG A;  3LWH A;  1X6G A;  5GAN 4;  3REA B;  3REB B;  2A36 A;  3ZFJ A;  5GMK m;  1VIE A;  4M7D F;  1UB4 A;  3G6E Q;  4F7U F;  4NL3 A;  4C5E A;  5LJ3 d;  3M53 A;  2ZPB B;  4Q5W A;  4Z02 A;  4J9B A;  2BKD N;  3OW2 S;  4ELZ C;  4M7D C;  1NZ9 A;  3PMT A;  4A4H A;  2OTJ Q;  3NTH A;  5FLX E;  5GAM h;  1GFD A;  4XTY A;  1ZSZ A;  1KG1 A;  2E64 A;  3C94 A;  1C6V X;  2QQR A;  5CCA A;  1K73 C;  1W70 A;  2V8J A;  5LJ5 f;  4JRI A;  3CCR Q;  1N8R U;  2JS2 A;  1ZX6 A;  1G8X A;  1AD5 A;  4PL6 A;  3QKJ A;  3CBM A;  4M7A A;  4HT9 A;  1MMD A;  4J9G A;  3QJY A;  2QQB A;  3QYG B;  2QEX A;  4OP0 A;  3JRZ A;  4BDY A;  2P4R A;  1M30 A;  2L3S A;  4X9D A;  2M1H A;  4QQD A;  3QXE B;  1GFC A;  3G71 A;  4MZT A;  2DPP B;  4EPC A;  1QWE A;  3INZ A;  3O8V A;  2L8D A;  2EJF A;  5GAN e;  2YRV A;  1VQ5 T;  2PUK B;  3G4S T;  4JJC A;  2YXY A;  2RQR A;  4M77 G;  5KCO A;  2HMA A;  5D6Y A;  4MMK A;  4RCC A;  4ELY C;  4XTW A;  4A4F A;  1XNI A;  1NPR A;  5A0G A;  1M2V A;  3EFO B;  1O75 A;  1JQQ A;  2DF6 A;  1T0J A;  1T0H A;  3VKI A;  2DMO A;  1RAI B;  1K76 A;  1AHJ B;  4N4I A;  2ZPI B;  4OVA A;  3V7S A;  3UAT A;  2RNA A;  1ZUK A;  2VV5 A;  2LVM A;  2GF7 A;  1WFW A;  1KIK A;  1VQL A;  1RAD B;  1NLO C;  1VQ6 T;  1G3Y A;  3CC2 A;  2VAS A;  4OMF B;  3U23 A;  4AT1 B;  4PJO E;  3TU4 K;  2K7A A;  4OMN A;  2YDL A;  1UFF A;  2JM9 A;  1RAC B;  1QP3 A;  4M4Z A;  3CME A;  4J7I A;  1PRM C;  2PNI A;  1XQH A;  3JCM Q;  2VKN A;  1VYU A;  4F7U G;  2R57 A;  4BI8 B;  1M8V A;  3EGX A;  3LH5 A;  2VWF A;  2K3B A;  3JCM J;  1BB9 A;  2RQU A;  2RH2 A;  1K73 U;  2DZC A;  4AFU C;  3RMQ A;  3HSB A;  3CCL T;  3H41 A;  5GAO l;  3QO3 A;  5CQY A;  3CCM Q;  2PVG B;  3CMA T;  2DJQ A;  1RAA B;  3I5R A;  1HK9 A;  2Z0W A;  1YJ9 Q;  4GBQ A;  3QDR B;  5LJ5 j;  2QG9 B;  1LOJ A;  2D0N A;  2X3W D;  2KT1 A;  1QWF A;  1WXU A;  2VB6 A;  4C8Q C;  1MND A;  2HCK A;  4OB1 B;  2RB6 A;  2HQE A;  3BDU A;  1KQS A;  3UWN A;  2K3Y A;  1XTD A;  4ZGJ B;  1RAF B;  1AEY A;  3CBP A;  2H3J A;  2CP2 A;  2IIM A;  5J3B A;  4DBF A;  1VQN T;  4ANJ A;  5KYW B;  1Q7Y R;  1N8R R;  2C0I A;  4J6X A;  1RI9 A;  4FL6 A;  3TEE A;  5CAI A;  2KI7 A;  2PUO B;  2O88 A;  1BK2 A;  1UGQ B;  3JCM V;  1H3H A;  1W6X A;  1RLQ C;  2KYM A;  1BIB A;  3MEV A;  2M16 A;  2ZPF B;  1LJO A;  1M4Z A;  4M75 A;  4C0F A;  1I5L A;  1Q86 R;  1VQ9 T;  3CCE T;  3FIF A;  4M7A B;  4QKU A;  1PG5 B;  2O4X B;  2HZY A;  5KYU B;  2KMT A;  2NUZ A;  4QQG A;  1ZBJ A;  1YFN A;  2CP5 A;  1H64 1;  4JUV A;  1IGQ A;  3VS0 A;  3V8K A;  1UGR B;  2V26 A;  4E7K A;  3HPW A;  1VQ5 A;  2D1X A;  3I56 T;  3OQ5 A;  1EIF A;  3RMS A;  4X1V A;  3VS2 A;  2OJ2 A;  3JCM g;  4M77 D;  1WXT A;  1QP2 A;  3WVE B;  2QA4 Q;  5HCK A;  2EGE A;  4DBQ A;  1M2O A;  1N9R A;  1CKB A;  2GNC A;  2FO0 A;  3QSU A;  2HBP A;  4C92 A;  4J9D A;  3OS0 A;  4PJL A;  2DK3 A;  4IUV A;  4M78 C;  4JJB A;  1OZ2 A;  4QT7 A;  2A0F B;  3L42 A;  4BI4 A;  1T3L A;  2D0Q B;  4FYV B;  1AT1 B;  4ATO A;  2ED0 A;  4C8Q E;  1N5Z A;  1VQ6 A;  4PJM A;  3V7R A;  2FZC B;  4OMO A;  2DTI A;  4RTZ A;  3HRU A;  3QYH B;  3TSW A;  1E6G A;  2C0O A;  3CCS A;  2E3I A;  2DO3 A;  3PNW C;  3CBO A;  1FX7 A;  2LRQ A;  5GJW B;  1K8A C;  4M7D D;  5GAM e;  2QQS A;  3N5B B;  3RBB B;  1FMV A;  3LX7 A;  3CCL A;  2CDT A;  4ORZ A;  1VQ4 T;  1HD3 A;  1SG5 A;  3EGX B;  2VXE A;  2FRY A;  3CMA A;  3JB9 F;  1MV3 A;  3SWN C;  2COZ A;  2QYZ A;  2XG8 D;  4PJO A;  3E9F A;  4RMO A;  2DVJ A;  1PSF A;  2DE0 X;  3QZ5 B;  4XQ3 A;  3OYF A;  1MV0 B;  2DAQ A;  4J6W A;  1M8M A;  2DXU A;  3L2Q A;  1SEM A;  1U1S A;  3EH1 A;  1KQS P;  1FMK A;  2QQA A;  2EYY A;  2QDL A;  3OSV A;  3M59 A;  4QVD A;  1KHC A;  1VQN A;  1WIE A;  1KQ1 A;  1WJS A;  5GAN 2;  2RK2 A;  4BUG A;  2RJF A;  2GQV A;  1VQM T;  4O6J A;  5GAN 5;  1PD0 A;  2D8H A;  3CXC S;  1NPP A;  4XU1 A;  5GMK e;  2JVV A;  1CKA A;  2DJZ A;  5CKF A;  1VQ8 T;  2DD5 A;  5HKC A;  4M7A F;  1UGV A;  1ZA2 B;  4M78 E;  2QAS A;  1SSF A;  2KSS A;  1M1K R;  3WXM B;  2E41 A;  1R0C B;  4ESR A;  1VQO A;  2XKO C;  3OYM A;  1DJ7 B;  2EJ9 A;  4IUP A;  1TUD A;  3OS1 A;  1YJW T;  4LUE A;  4FT2 A;  2EYQ A;  2QAZ A;  4KT0 E;  3I56 A;  2GTJ A;  3NGP A;  1UGS B;  5LJ5 h;  3RKW A;  2ZCF B;  2LX7 A;  2KT8 A;  4AFZ C;  3P8H A;  1YI2 Q;  2K3X A;  5M9O A;  1Y96 A;  1QKW A;  4AFS C;  2P0P A;  1K8A U;  4FSS A;  5LJ3 f;  4ZNX A;  4J6Y A;  4NL2 A;  1W2B A;  4LN2 A;  4CI0 C;  1TOV A;  2DVE A;  2KRM A;  3HP9 A;  4GY5 A;  4PK4 A;  1BI0 A;  1TG0 A;  5GAO r;  5FU6 B;  3BW1 A;  2JTF A;  1EZZ B;  1W4S A;  1VQ7 T;  4MZP A;  3JB9 G;  1GBQ A;  1WDX A;  3O5Z A;  4C8Q D;  4OB2 B;  2YUO A;  5KYY B;  2RI2 A;  4JJN K;  3CCV T;  1D0X A;  2AKK A;  2J6O A;  5GAN 8;  3MEW A;  1TUC A;  2X4W A;  3PVQ A;  1BCO A;  4LD9 K;  2KR3 A;  4OGE A;  4KBM B;  5FWC A;  1XJW B;  3V7C A;  2E5Q A;  4OMM A;  2MAM A;  2NUT B;  3FJ5 A;  3E2U A;  1RUW A;  2EIF A;  4UC4 A;  1Q81 U;  1QCF A;  1ACM B;  5GAN 6;  5IHK A;  1E7O A;  1VQ4 A;  4XTV A;  1W1F A;  3CD6 Q;  3MKD A;  3MJX A;  4A54 A;  1JB0 E;  4KUL A;  4DBR A;  1GCQ C;  2OTL T;  1U06 A;  1YHQ Q;  2QGF B;  3CCU A;  2L3P A;  1BBZ A;  2HL3 A;  4M7A G;  4PJO B;  4LE9 A;  4BE2 A;  1IZ6 A;  2ZPG B;  2PVO B;  2CP7 A;  2J05 A;  2A7Y A;  4BI3 A;  1X43 A;  4ZN1 A;  3Q1J A;  3MET A;  3A98 A;  1SHG A;  9ATC B;  1VQM A;  1BIA A;  3G7Z A;  3G71 T;  4IUR A;  4L5G A;  3QZ9 B;  3JCM X;  3RUX A;  2GQI A;  1VQ8 A;  5LJ3 j;  4C5I A;  4WTO B;  1I0C A;  3RKY A;  4KUD K;  1NEB A;  1VOM A;  4M75 F;  3EG2 A;  3J80 E;  5FU7 C;  3EFO A;  1N9S A;  5KE3 A;  1WPY A;  3VRY A;  5FW9 A;  1M90 C;  1UTI A;  1QW1 A;  1K8A R;  1NYF A;  4FIB A;  3TRE A;  1Q7Y C;  4EMH A;  2FZG B;  5HK0 A;  2NUP B;  2RI3 A;  2XIC A;  1QVG S;  1UJ0 A;  3V8J A;  1H3Z A;  4KUI A;  4E7I A;  1IB8 A;  4CC7 A;  1YJN Q;  2DRK A;  4J9H A;  1Q82 R;  3NMZ C;  2EVR A;  2CUB A;  1G3W A;  3OW2 P;  3GPL A;  4A53 A;  1D1C A;  2F1L A;  1SHF A;  1WGS A;  4C92 F;  1Q86 C;  3VUZ A;  3L2W A;  3GOX A;  4M77 C;  1B34 B;  4RCB A;  4GLK A;  2LQN A;  2ECZ A;  3M57 A;  4Z8A A;  5L23 A;  2RMO A;  2PTK A;  1VQ7 A;  1AOJ A;  3FLG A;  4JS5 A;  4JPB W;  5CIU A;  2QEX Q;  2GTO A;  2DEU A;  2LMJ A;  3LH0 A;  1OQK A;  4HXJ A;  3CCV A;  3JB9 D;  1Q81 R;  2X35 A;  2YLB A;  2E6Z A;  2H3E B;  1KK7 A;  2DD4 A;  2M02 A;  1K9A A;  4OF1 A;  3VS5 A;  2R5A A;  3G1J A;  4A4E A;  1OU8 A;  2M9U A;  3TCJ A;  3OBW A;  1KSW A;  4HCC A;  2HEQ A;  3EHR A;  1TXQ A;  1K9M R;  3EG0 A;  2RO0 A;  5KYW A;  2WAC A;  2P84 A;  4PJO F;  3GLX A;  1WZO A;  4J83 A;  2E6N A;  1NLP C;  5CVI A;  4C8Q B;  2OTL A;  2HD0 A;  2K6D A;  2MPX C;  2ABL A;  5GAO m;  1NBE B;  2F5T X;  4WF2 A;  2HKN A;  1M90 U;  3HFO A;  2PZ1 A;  4M75 G;  3X20 B;  1TUG B;  1Q7Y U;  2E4H A;  2QTV A;  2DL4 A;  1YCS B;  1U1T A;  2O4X A;  1AWW A;  1VQL Q;  5KYU A;  4X9C A;  2ZAE A;  3CC2 Q;  5CR2 A;  1JJ2 S;  3OYK A;  2F69 A;  4OMQ A;  1QMC A;  2GFA A;  3CME Q;  4F17 A;  1WQ7 A;  3QII A;  1PC0 A;  2A28 A;  3M54 A;  3ZEH A;  1Q86 U;  1D0Y A;  1I8F A;  2P0K A;  4JS4 A;  2W0Z A;  5EC7 A;  2DBM A;  4M77 E;  1NE8 A;  3ER0 A;  5D6W A;  4LDU A;  3X25 B;  5GAN f;  3GBQ A;  4C92 G;  3JSC A;  2RJD A;  2D6F A;  2ENM A;  4RTV A;  4LD6 A;  3JCM e;  1I4K 1;  2C0T A;  1WHH A;  2RQV A;  3FRN A;  2OX7 A;  3M0R A;  3DLL A;  2CSQ A;  4KH1 B;  3R6O A;  4XAX B;  1M9S A;  4X34 A;  2PQW A;  4GLM A;  3MHX A;  4L59 A;  4LUD A;  2JMC A;  3NPF A;  2FPD A;  2H8H A;  4M78 B;  2XHC A;  3A8L B;  1UHC A;  2CT4 A;  3J7A F;  1M1K C;  4MDW A;  3CCS T;  2FRW A;  2NWM A;  1WI7 A;  4KRT A;  3OS5 A;  3SFM A;  4M7D E;  3QG1 A;  4F7U E;  2AHJ B;  1GCP A;  2COW A;  2F2W A;  5LJ3 h;  4PJO G;  2K2V A;  1LCK A;  1RAG B;  4Y28 E;  1LVK A;  4II1 A;  3LW5 E;  2B86 A;  3H0H A;  2DTH A;  3EGD B;  4F04 B;  2VVK A;  2VUB A;  1X2K A;  1GXI E;  4HT8 A;  3LYI A;  1VQ5 Q;  3G4S Q;  3I55 T;  3TVT A;  2GGR A;  3EG9 B;  1SRM A;  1WQW A;  1R0B G;  2KRS A;  2LJ3 A;  1YIJ T;  3JAM E;  3S3N A;  2RA2 A;  2XID A;  3OYG A;  3PVL A;  1JU5 C;  2DZ9 A;  3BY7 A;  3GNG A;  1M90 R;  2BTT A;  3LLR A;  3VU3 C;  4J9F A;  2YUN A;  2YUP A;  2EQJ A;  1JRI A;  1S1N A;  1TU0 B;  2D8J A;  3RNJ A;  3SD4 A;  3P8D A;  3RR6 A;  4JZ4 A;  4E47 A;  3OYA A;  6AT1 B;  2W10 A;  5LJ5 g;  3CC7 T;  2L3R A;  5GAN j;  3VS6 A;  3BDL A;  2EBP A;  4PJJ A;  3JCM b;  4E7H A;  1VQ6 Q;  5L8R E;  1ZUU A;  1KD1 R;  2FB7 A;  1RAB B;  4RKU E;  4O5V A;  3MEA A;  1VQO T;  2LJ1 A;  3CCS Q;  4A4G A;  3ZL7 C;  1BKB A;  2LNV A;  1M1K U;  3OYN A;  3PIO A;  2EYW A;  4KGV B;  2FPE A;  3CCL Q;  4JZ3 A;  3CCM A;  1D1A A;  1Z9Z A;  4AMC A;  1X2Q A;  4IIM A;  3CMA Q;  5ECA A;  2ROL A;  4FT4 A;  4C92 D;  1MUZ A;  2LZ6 B;  2RQT A;  2DIL A;  1BCM A;  1ABQ A;  3A8M B;  1X75 C;  1M5Q 1;  3THK A;  5KYY A;  3URG A;  3C4S A;  4C0D B;  3OA6 A;  1EFN A;  4B9W A;  1TSF A;  4C0Z A;  1VQN Q;  1UJY A;  3M4G A;  2CH4 W;  2NUT A;  3CXC P;  1IHW A;  1PWT A;  4D6W A;  2AK5 A;  4OB0 B;  2L89 A;  1VQK T;  4HA8 A;  5CKD A;  3RIR A;  4EMK B;  2LP5 A;  2JN0 A;  1NJI R;  5CO7 A;  1C1A A;  5FRM A;  1ZBX A;  3OB9 A;  1JXO A;  2YRD A;  5GAN d;  2E12 A;  5CQX A;  3H6Z A;  3CCE Q;  1VQ9 Q;  3JCM c;  1Q82 C;  1VYV A;  3RKX A;  4DEY A;  3E19 A;  4QQ6 A;  5GAM f;  2J06 A;  2CZ1 B;  1G2B A;  5IT9 E;  1WX6 A;  3L1A A;  4PLI A;  4ZN3 A;  3M0U A;  4MZM A;  3CCU T;  3I56 Q;  3I55 A;  4D8K A;  1TH7 A;  3EAE A;  5GAN 3;  2DL5 A;  2LNH B;  3JCM d;  2X4Y A;  4DQ2 A;  1YIJ A;  1BI1 A;  2XD0 A;  2JW4 A;  3HFN A;  1XOV A;  4WCI A;  7AT1 B;  3X24 B;  3UT1 A;  3C12 A;  1FYN A;  1NM7 A;  1RLP C;  3HRT A;  1IHV A;  3FDR A;  1Q81 C;  1PRL C;  1S72 A;  4J7F A;  3CC7 A;  3L2Z A;  5HY6 A;  1M3C A;  1PHT A;  2E70 A;  1ZSZ C;  2OAW A;  1AWX A;  1D3B B;  2DIQ A;  1HJD A;  2KEA A;  1OV3 A;  2KNB B;  2BE7 D;  4PNO A;  1K9M C;  3CCJ T;  4M7A C;  2NUP A;  2HQX A;  2KXC A;  4E7L A;  2DET A;  4Z89 A;  1X27 A;  1UG1 A;  4RG2 A;  2MF2 A;  2KRN A;  2RI5 A;  2XDB A;  2SRC A;  3JCM P;  4FW1 A;  4M78 G;  2QQ9 A;  4LDX A;  4OGC A;  3BE3 A;  3NFC A;  5FU7 B;  1K0X A;  1E6H A;  4N4H A;  2RHZ A;  3OYI A;  2FEI A;  3DLM A;  3OW2 A;  1VQ4 Q;  3C95 A;  4FCY A;  2HDA A;  4RTW A;  5AT1 B;  2ZPE B;  2JT4 A;  4B9X A;  5GAO q;  1B34 A;  1RAE B;  2CGH A;  3I9Q A;  1Q82 U;  3CCU Q;  2I2L A;  1VQP A;  3UA6 A;  2YWW A;  4PFZ A;  4PFP A;  2O9V A;  1MHN A;  2CSI A;  3NHN A;  4E7J A;  4N0A A;  2DIG A;  2L2P A;  1HXD A;  1KQS S;  2CZ7 B;  1U8R A;  1WJQ A;  2JMA A;  3X28 B;  5GAN h;  2DL7 A;  2RHI A;  1F1B B;  4XTU A;  2MWP A;  1O9S A;  4RG8 A;  1R8O B;  4M77 B;  3M55 A;  2EPD A;  2G3R A;  1MMA A;  1VQM Q;  2JS0 A;  1VQK A;  3EFR A;  1VQ8 Q;  4FYX B;  3FJP A;  3JB9 H;  1BI3 A;  5A0D A;  3OBY A;  3J81 E;  5DLO A;  3TSZ A;  1OUL A;  4C8Q A;  1YNZ A;  1M1F A;  2GFU A;  2AKL A;  3HHT B;  3CCQ T;  2DKG A;  1YJW Q;  3I35 A;  1K1Z A;  2XDP A;  1HSQ A;  3MP1 A;  2E1H A;  1H8K A;  2FYK A;  2RK1 A;  1QVG P;  1K9M U;  1MMG A;  2YLC A;  2DEQ A;  2KQW A;  3PT9 A;  1QVF P;  3SHW A;  3VS7 A;  4VUB A;  1VYT A;  1WNL A;  1PCX A;  5GMK j;  4F16 A;  4FW2 A;  4PLL A;  4M7D B;  4IUT A;  3QWX X;  4F7U B;  2K4Y A;  2RHY A;  4HCZ A;  3BFM A;  3A8H B;  1YBY A;  1VIF A;  2K79 A;  1R77 A;  2XMF A;  2GBQ A;  2V1R A;  1YIT T;  2MCN A; 
#chains in the Genus database with same CATH homology
 1S72 Q;  3CD6 Q;  1VQ7 Q;  3CCM Q;  3CC7 Q;  3CC4 Q;  3I56 Q;  1YJN Q;  3CME Q;  1VQ6 Q;  1Q82 R;  3CCL Q;  1YIT Q;  1NJI R;  1M90 R;  1VQP Q;  1VQK Q;  1YJ9 Q;  3CCJ Q;  1YIJ Q;  3CCU Q;  3CCR Q;  2QA4 Q;  3G6E Q;  1Q7Y R;  1VQM Q;  1YJW Q;  1Q86 R;  1N8R R;  1KD1 R;  3CMA Q;  3OW2 P;  1YHQ Q;  3CCV Q;  1K9M R;  2QEX Q;  1KQS P;  1YI2 Q;  1QVG P;  1VQN Q;  3CCE Q;  1KC8 R;  1VQ9 Q;  3CCQ Q;  3CCS Q;  3G4S Q;  3CPW P;  1VQ5 Q;  1VQL Q;  2OTL Q;  1VQ8 Q;  1Q81 R;  1VQ4 Q;  1W2B P;  1K73 R;  1K8A R;  1QVF P;  1JJ2 P;  1VQO Q;  1M1K R;  3CXC P;  3CC2 Q;  3G71 Q;  2OTJ Q;  3I55 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...