1YJ9Q

Crystal structure of the mutant 50s ribosomal subunit of haloarcula marismortui containing a three residue deletion in l22
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1yj9Q00
3CCVQ 1VQOQ 1VQ5Q 2OTLQ 3CCEQ 3CC4Q 2QA4Q 1YITQ 1YJNQ 1KD1R 3OW2P 1VQ7Q 2QEXQ 1YIJQ 1M90R 3CD6Q 1KC8R 3G71Q 1VQNQ 1Q82R 1VQ8Q 1QVGP 1Q86R 3I56Q 3CPWP 1VQ6Q 3CC7Q 1S72Q 1N8RR 3CCMQ 3G6EQ 3CCLQ 2OTJQ 1VQPQ 3CC2Q 1VQ9Q 1Q7YR 1VQLQ 1YI2Q 3CCSQ 1QVFP 3CCQQ 3CCJQ 3CCRQ 3CMEQ 1YJ9Q 1YJWQ 1NJIR 3CCUQ 3I55Q 1W2BP 1K73R 1K8AR 1KQSP 1VQKQ 1M1KR 1VQMQ 1K9MR 3G4SQ 3CXCP 1VQ4Q 3CMAQ 1YHQQ 1Q81R 1JJ2P
chains in the Genus database with same CATH superfamily
1N9SA 4RKUE 3FJPA 1WHJA 1Y96A 4OMFB 3CPWS 3RBBB 2KYBA 1PG5B 4IIOA 2ZGWA 2RJFA 3X24B 5GANg 3JAME 4KH0B 5CKEA 1FYNA 4M77B 1OPKA 4IKFA 2KK4A 3A8GB 1Q81C 4C0DC 4M78B 1G3TA 2LNHB 1ZUUA 4UC4A 4LD6A 1YJ9A 1NYGA 5GANd 4IUUA 4Z89A 3H0IA 4PJJA 2DL7A 4BD3A 2FPDA 3SFMA 1M8VA 1AWWA 2FPEA 4M7DE 1WXUA 1LNXA 3C12A 1M3AA 3M0RA 4M77D 4E6RA 2L89A 1YI2T 1X01A 4OMQA 2FEIA 3TSZA 3PVQA 5KYNA 1VUBA 1K73U 2V8KA 1K8AU 2E3IA 4BY6C 4QQDA 1VQOT 1QKXA 4FSSA 2VASA 4M7DG 1FWZA 2NYSA 4F16A 1WDXA 1YP5A 3SD4A 1RL2A 1V29B 3G4SA 2XHCA 4C0DB 5I22A 2DM1A 1SHFA 2X3XD 4Y28E 2DJQA 1R0CB 3ME9A 4OMPA 1VA7A 2JTEA 3EG9A 5D6WA 4MMKA 2DZCA 1G8XA 1TUCA 2QYZA 4C92B 3JCMX 2PVGB 2L3PA 2O88A 2RK2A 1VQ9T 2COZA 4DOWA 4Z8AA 3DKMA 2WSFE 4F7UA 2EGCA 3I5SA 2IIMA 4FYWB 2KDSA 3CCLA 4KGVB 2QASA 1SF9A 2AKLA 4M75B 4ZGDB 4JZ3A 3HPWA 2A28A 1RLPC 1SHGA 3QSUA 3CC4T 4M7AE 3EG2A 1HSQA 3L2WA 4Y91A 1RUWA 3EGDA 4RG8A 1D3BB 4C8QC 1ZA1B 2EQUA 2F5KA 4LDVA 8AT1B 2BZXA 3M55A 4A63B 5GAN4 2RMOA 1BBZA 2MYSA 3CD6T 4OGEA 3CCEQ 4IUQA 2QA4Q 3QXEB 2DVEA 3M57A 1OYXA 1RADB 2R57A 2CSQA 1M9SA 4C8QG 3PNWC 1WXTA 1N27A 5GAOm 3ZBDA 5CVIA 2J05A 3HFOA 4C0FA 3LLRA 4PNOA 5FU7B 4PJOA 4B9XA 1QW1A 3X20B 2KT1A 3H8ZA 2C0IA 1VQ7T 1WJSA 4M7DC 5CIUA 1M1KC 4OGCA 2DE0X 5CK9A 1MHNA 1SRLA 2HDAA 4C5IA 1KHIA 3CCSQ 4EMKC 3JCMb 2L3SA 1TTHB 3CXCA 1G3WA 1VQ5A 1M5Q1 1QQJA 3CMEA 1VQOQ 1OI1A 5IXBA 2O4XB 4PK4A 1YJNQ 2GBQA 2IVWA 2V8IA 4PJNA 2E6ZA 4PFPA 4M7AB 1W1FA 2IG0A 1M3BA 5CAIA 2DXBA 4HVUA 5GMKe 1VYVA 2XG8D 4GLKA 5A0GA 1M1FA 3MEUA 4J8OA 4N4GA 2E5QA 3V8JA 2K79A 1NBEB 2FZCB 1O75A 4HT8A 2K4YA 1QVGP 4L59A 3NHNA 2ZCFB 3TVTA 4MDXA 3DB3A 2DVJA 2K3XA 3QDRB 2YWWA 1BKBA 4OF1A 4ZN3A 1Q82C 1K8AR 2PVDB 4E7ZA 1JB0E 2YUQA 4RTZA 3CC2T 2LT4A 2HZYA 4BI3A 2IPOB 2RQRA 1UTIA 3HHTB 4C8QF 2JW4A 2NUPB 4XTYA 4HVWA 5FWCA 3L2ZA 5J3BA 1UGPB 1JXMA 4JDSA 1YNZA 1ZSZB 1C1AA 3M0SA 3M59A 3CCRT 2KY9A 2P0QA 2HKQB 3GF5A 3R6OA 4M4ZA 5KYYB 2BUDA 1U5SA 1BCMA 4MMLA 2XDBA 1X6GA 2MCNA 1AVZC 2E64A 5C0MA 4LDYA 2FL7A 3RNJA 3VYHB 3KXTA 4BUGA 1T3SA 4C5HA 1I5LA 2OTJQ 2CUDA 1MUZA 1XJWB 2RI2A 2XKOC 5KYXB 1YJ9Q 3CC2A 2FVUA 3JRZA 2J06A 3M9QA 4A53A 5GAOp 4X34A 4EPCA 2B8AA 3GPLA 4CC3A 4M78E 2RJCA 2HBPA 3OW2P 1GCQA 2P84A 3CEYA 1VYTA 3JB9J 3DLMA 2EKHA 3M54A 1K9MC 4LXCA 2MMPA 3MHXA 4M7AG 2GFAA 4E7LA 2X4WA 3EFOB 5D7UA 1N6AA 2DBMA 2HKNA 4OP0A 4M7DA 2CKKA 2LQKA 2VKNA 4KUIA 1JJ2S 3HP9A 4QQGA 3P8BB 5CKFA 4HCKA 3CCJA 2VXEA 1VQ4A 4FL6A 2OJ2A 4J9DA 4NOYA 1YIJA 1YI2A 1QP2A 2DD4A 3RMSA 1KK7A 4PJOB 1UJ0A 1MMNA 3I56A 1NM7A 3CCUT 2ZZDA 3RKWA 1GFDA 1AZEA 2JMCA 3BDLA 2RK1A 4PFOA 4E7KA 3EHQA 1MMAA 1IZ6A 2M0YA 3PVLA 3OYBA 1JBMA 3CPFA 1B07A 3MP1A 4ME7A 1OU9A 2CP0A 4C8QB 2O9SA 3UT1A 2DTOA 2QGGA 2CZ1B 2RO0A 4QW2A 4FSXA 1QLYA 5GAN2 2KT8A 2VYTA 1GBRA 2HQXA 4LDXA 1K76A 2KE9A 5GAOr 1PRLC 3F70A 4XTVA 1Q82R 1R8OB 3SWNB 3RMQA 1BIBA 5CKDA 2PU9B 3LGLA 3G71A 2L8DA 3NPFA 1C6VX 3C95A 3PIOA 1BU1A 3I55Q 2ESWA 3JCMc 3HFNA 2C0TA 1I5OB 3CCUA 1EX4A 4YTLA 3OS0A 2M16A 2FPFA 1YITA 1JU5C 2QTXA 1UECA 4D8KA 2FHDA 1NLPC 4JJNK 4JRPA 3G7ZA 4HT9A 3UA7A 1VQKQ 1EZZB 2EWNA 2KAFA 5GAOl 4C92G 4J7FA 2ROLA 4QVCA 3VS2A 2LCLA 4BY6B 3JB9G 3NTIA 1YJNT 2DIQA 2HQHA 4JJCA 3H41A 3CCSA 2D8JA 5LJ3g 1JQQA 1TG0A 2NUTB 3L1AA 2DMOA 5CO7A 3RUXA 3PE0A 1K73C 1M1KR 1K8AC 4AMCA 3UPUA 2GTJA 4LNPA 1YJNA 1X2KA 3BW1A 4OB3B 3THKA 1YITT 4JUVA 3SEMA 1LCKA 4JRKA 3JB9F 1PD0A 3EFRA 2V1RA 2EYQA 3L2RA 3AT1B 3VS7A 3CMET 2LVMA 2HNIA 3OW2A 3JB9D 1YJWQ 3OYYA 3X28B 1NEBA 4AFUC 1Z9QA 4BI4A 3A98A 3M53A 3MO8A 5CKBA 2F2VA 3EGXA 3NTHA 2HSEB 3OYAA 1S1NA 3QZ9B 2L2PA 3UATA 4JJBA 3V7CA 5IH2A 1PD1A 1TSFA 1WFWA 2QI2A 3U23A 1YWOA 4M77G 3VS3A 4C92E 4LE9A 3CCRQ 1M2OA 3TQ7P 3JCMg 2JTMA 2DO3A 2LP5A 5HCKA 2O01E 4PJOD 2EQKA 4WTOB 2ED0A 1AT1B 1PKSA 3ZFJA 2NUTA 4M7DD 1AWOA 5EC7A 2HMAA 2EQJA 4BE0A 3MPUB 2DK3A 2K57A 3G6EQ 1I4K1 2DL5A 2JTFA 4KBMB 2DIGA 4J9CA 1GFCA 1W2BS 3S6WA 2LQNA 2EYZA 2MAMA 2D0QB 3VUZA 2X51A 1YHQA 4PJOC 2ED1A 3HRSA 4FT2A 4LN2A 2JM9A 3EGUA 5GAMh 2OTJA 1G3SA 3JCMf 1VQ4T 2KYMA 1OU8A 3CC2Q 1VQ9Q 5FLXE 2ZPBB 2LJ0A 1K73R 4OB1B 3LYIA 1XNIA 2J7IA 1VQLA 3P8DA 4DBRA 4J9BA 5GMKj 1OQKA 1W4SA 1M1KU 3VV0A 5GAN5 3A5ZB 4FYYB 2DD5A 2QQSA 1FX7A 4PKCC 1VQ7A 1VQNA 1IREB 3RDVA 2X3WD 2Z0WA 3VRYA 1EIFA 1G5VA 3CCQQ 4M75F 2RQVA 3H0FA 2P0KA 4JRIA 2MPXC 4OMMA 5AT1B 2MIOA 1TOVA 1VQ4Q 2CT3A 2K5FA 4M77E 4O6JA 4K11A 2OTLA 1VOMA 4OMNA 5FU6B 3JCMe 2CDTA 1D1CA 4RCBA 3OSVA 5ECAA 4C0GA 3I56Q 4KUDK 2XD0A 2RA2A 1C0MA 2CP3A 2QG9B 1Q7YR 3OY9A 4X9CA 3WVDB 3QYHB 2RM4A 2GFUA 3X26B 3BE3A 4QQ6A 4EIKA 5FRNA 3FRNA 1KC8C 3A8LB 3L2UA 4C8QD 2DETA 2KMTA 2LMJA 4XU0A 1E6HA 3L2VA 3FEOA 1U8RA 2JM8A 3REAB 1NJIR 2CZ0B 1ZQ1A 3H9NA 4KGXB 1YHQT 1GCQC 2G6FX 3URGA 5GAOn 5L8RE 4D6WA 1XOVA 2QQRA 3ASKA 4LUEA 1ZLMA 2XDDA 1MMGA 1VQ6Q 4E47A 1WYXA 4A4GA 2LDMA 2DPPB 4J9EA 4FIBA 4XU3A 3C4SA 2R58A 4HA8A 1UFFA 3S3MA 3TSWA 1UUEA 2QA4A 1WHMA 5GAN8 2LX9A 1MGQA 2ZPHB 2MK5A 3I5RA 1RAAB 1Q7YC 2DXUA 4XTXA 1R0BG 4FYVB 2PNIA 2QK0A 2DL3A 1S72Q 4DA4A 5CQXA 4L6V5 1VQKA 2DA9A 4E7SA 4M78G 3M56A 3V8LA 4B9WA 2FB7A 7AT1B 3FDRA 2KSSA 1W6XA 1AZGB 5KCHA 4J83A 5KYWA 1VYUA 3I55T 4ZGJB 2C06A 2FZGB 2VGNA 2L3QA 3OS1A 5GMKm 1MNDA 5EG2A 2QXFA 1AHJB 3V7RA 3CMEQ 1SEMA 2QTVA 3RKXA 4M77A 3HTRA 3JSCA 3FB9A 2A36A 2L0AA 3CMAQ 3LW5E 1NPPA 3X25B 1IGUA 4F7UF 3GOXA 2HBWA 1H92A 4J6XA 3V8KA 1YCSB 4M75D 4RTUA 5CQYA 1ZUKA 1YJWA 2ENMA 2O2OA 2L5QA 2LTOA 2A08A 2DBKA 2RHIA 1UDLA 2HQEA 2EYWA 2EJ9A 2M9UA 4M78F 1ZA2B 5GANf 1SPKA 3SWNC 4FW2A 1UEBA 1OPLA 3EH2A 2KRNA 1Y57A 1N8RU 3FC3A 3CMAT 4QVDA 1IB8A 2RPNA 1KQSP 4CC7A 3G1JA 3WVEB 1VIEA 3C94A 2AKKA 3CD6A 5DLOA 4PJLA 1MNEA 4BDZA 2QEXQ 2QQBA 2H8HA 4C8QE 2CZ6B 4FT4A 2F2XA 4ELZC 5CKHA 1RACB 5LL6S 4EMGA 3CCLQ 4HXJA 3LH5A 3PTAA 1KQSA 3H0HA 1NLOC 4RCCA 5LJ5e 1VQ8A 3RKYA 3LWIA 4RTYA 1KC8R 2YLBA 2EGEA 3OMCA 4ELYC 5GAMd 1A0NB 1S72T 3JV3A 1VQ9A 2E41A 4N0AC 4XK8E 2BE7D 3QYGB 3EAEA 2RQTA 5I11A 5KYUA 3P8HA 1WJQA 1VQ8T 2A37A 2E1HA 3QHSA 3VS6A 5LJ5h 3G4SQ 3G6ET 3CCEA 4M77F 3E19A 1BYMA 1E6GA 1BI3A 1QMCA 5A0DA 2HSPA 2F5TX 2P4RA 5DLQE 1OOTA 2CUBA 1BIAA 5FW9A 2CP7A 2AT1B 2JOYA 3E9FA 3L42A 3GNGA 1UB4A 1H3HA 1P92A 3O5ZA 2YT6A 1G2BA 1UGVA 2NUPA 2ZPIB 2X4JA 2A0FB 3VJPA 1UHCA 3EG0A 4KGZB 1NEGA 1UGSB 3CC4Q 1KSWA 4OMLA 2VXFA 4LUDA 3M5AA 4RTTA 4XTUA 1YFNA 2RJDA 2DJZA 4M77C 5FROA 3JCMQ 4TVRA 2OTJT 4GBQA 2KR3A 2FRYA 3G71T 5C6SA 4J9IA 3REBB 1IO6A 3IQLA 5A2QE 4A4KA 1KJWA 1IRXA 3J80E 2V8JA 2QA4T 1H641 4RTVA 2JS0A 2RI3A 4OVAA 4MZPA 2CP6A 3OB9A 1ZBXA 5KYYA 1XTDA 4R56A 4EMHA 1CKAA 1PSEA 1SSFA 2BE9B 1LPLA 3OYFA 2OX7A 1W2BP 1MV3A 4JJDA 2AK5A 4IIMA 5I21A 1OZ3A 5LJ3j 2GNCA 3CXCS 2JT4A 2BKDN 2K9GA 1PKTA 4JRQA 1X6BA 3I55A 1GL5A 4X1VA 1WIEA 4O5VA 2RJEA 4XU1A 3CC7T 2RN8A 2XI9A 1X43A 3E9GA 2E65A 4Z02A 4AFSC 1KQ1A 2OI3A 1TH7A 2E4HA 2YUOA 2PUKB 2XK0A 3T9NA 1YIJT 2RNAA 1KD1U 3H6ZA 3CCVT 1KQ2A 4AT1B 1VQKT 2M51A 5KCOA 5FU6C 2ZPGB 2LQ8A 1S72A 1K0SA 4N4IA 3UDCA 2D0NA 4LD9K 6AT1B 4R55A 3GNFB 2VGMA 1M90C 1V76A 4EMKB 1VQ6T 2F69A 2K2VA 5GAMg 1HD3A 3OS2A 2X4XA 4N0AA 1WLPB 4DBFA 1NJIC 5KYUB 3OW2S 2DERA 2VV5A 4XQ3A 4M7DB 2K5LA 2V1QA 3CCST 2KXCA 2RB6A 4J9HA 5D6XA 2ABLA 1I81A 4RTWA 1JJ2A 2KNBB 3OYKA 3CMAA 1V1CA 2W0ZA 1VQPA 2EW3A 1Q81R 5FU7C 4RTXA 3KUFA 4FW1A 1B3QA 4Q5WA 3CBPA 4J6WA 4N4HA 1RAFB 5M9OA 2BTTA 3OBYA 4PJMA 3DLLA 1Q95G 3PFSA 1GRIA 3QO3A 3CCMQ 5AYFA 3M0QA 2X9HA 1LJOA 2EAYA 1FMWA 4DQ2A 4KT0E 5GANh 3CCVQ 1PM3A 3ER0A 1SSHA 4A4FA 2CP2A 1YIJQ 2JXBA 1VQNT 5J39A 1H8KA 1U1TA 1KIKA 1BI1A 2DXCA 1WPYA 1KQSS 3I35A 4M75C 2D8HA 3RR6A 2DRKA 2AHJB 4JLGA 2J6FA 4RG2A 2YRVA 2CP5A 2E3HA 4RUGA 5IN1A 3JCMJ 2F1LA 4FM4B 1M8MA 4HVVA 1WX6A 4BACA 2SEMA 1MMDA 1D0XA 1T0JA 4J5YA 3UWNA 4ATOA 1FXXA 4KULA 4EMKA 1FMKA 2I2LA 3QKJA 1M90U 3M0PA 3ULRB 1QVGS 4C92C 3GLXA 8ATCB 1PWTA 4KRTA 2CSIA 1NYFA 2RHZA 1BI0A 3S3OA 2HAXA 2DYBA 5GAN6 4LDWA 1Q7YU 2YRCA 2FZKB 2XDPA 5GAMf 3EH1A 3I9QA 3CPWP 1IHWA 5GANe 4EDUA 2HEQA 4J9FA 1SRMA 5LJ5d 5HY6A 1JO8A 2DFUA 4QVZA 3SWNA 3OA6A 2ECZA 3INZA 3TREA 1VQMA 2Y90A 2OAWA 2XMFA 2QQAA 2WSCE 2NUZA 3EG3A 2DNUA 1GBQA 3MEAA 1ZUYA 1X27A 2JVVA 2PVOB 3QBYA 3M0UA 2DYIA 3QWYA 1TU0B 4RMOA 1OEBA 1OULA 1ZX6A 2QDYB 2GTOA 4J7IA 2X35A 1K9MU 4Y92A 4JS5A 4HKEA 2LRQA 2KGTA 4M7AF 4C5EA 3LX7A 4CC2A 1NE8A 1YWPA 3OYJA 2DLPA 3EGXB 1UGQB 2FG0A 1TXQA 2RHUA 4M78D 2DAQA 5KYWB 2BZ8A 2CGHA 2DXTA 2YXYA 1X69A 1H3ZA 1O9SA 1N8RC 3TU4K 4HCBA 1UHFA 1ABQA 1ACMB 1D1AA 3LH0A 3HRTA 2DEQA 1UGRB 5LJ5g 3SDZA 3CC7Q 1JRIA 1KFZA 2D1XA 1QVFP 5I2SA 2E5KA 1U1SA 1RAGB 4MDWA 3RESA 1WGSA 2EIFA 3EGDB 3I56T 3HKSA 1M1GA 2GF7A 4XTWA 3OYLA 1B34A 2O31A 2DL4A 4HCZA 1NG2A 2VUBA 1K9AA 3QUIA 3O8VA 4PLIA 3EG9B 3NFCA 3QJ6A 1IHVA 2LC4A 2LCCA 2ZAEA 4DEXA 3CCJT 2M1HA 2D6FA 2EFIA 4IUTA 4JLIA 3A8MB 5GAMj 3KBGA 2E10A 1GXIE 4F7UB 3GIBA 1B7TA 1D3BA 3LGFA 3QZ5B 3J81E 3MEWA 2DEUA 1VQOA 2YSQA 3PGGA 5KE2A 2ROTA 4R0KA 4E7JA 2MWPA 5GMKh 2JNGA 4F7UG 2G3RA 3DB4A 1YJWT 2COYA 4AG2C 2EYXA 1HYOA 3UA6A 3S3NA 4A54A 2QQ9A 1BB9A 2R5MA 1Y07A 2DF6A 2JN0A 4GLMA 1DJ7B 3CQTA 4ZGEB 1NZ9A 3M0TA 1YHQQ 1W2BA 4FCYA 3M58A 3E2UA 2KXDA 4X9DA 3TEEA 4PJOG 3PT9A 2P0PA 4NL3A 2KRMA 3JCMV 1LOJA 1I1JA 2Y4YA 1QCOA 2MI6A 1KG1A 2YLCA 2YUNA 3CCRA 1RLQC 5DM7R 3CBOA 5FRMA 2DKGA 4KH1B 5L23A 1VQNQ 2B86A 4ESRA 2J6OA 1KD1C 1VQMT 3SB2A 1AOJA 3JCMd 1UG1A 1RAIB 2VVKA 2ZPEB 4P5NA 3CCJQ 1I07A 1U06A 2K5IA 3MP8A 1M3CA 2K3BA 3CCQT 1M27C 3UF4A 1ZSZC 4M7AD 2OTLQ 4J6YA 1BK2A 4V2SA 2V26A 2A7YA 3L2QA 5I2MA 5LJ3f 2DILA 4C0ZA 2RQUA 5LJ3d 1QWEA 1B34B 3GBQA 1PHTA 3PIPA 2K6DA 3NTKA 2LZ6B 3OYCA 2QEXA 3CXCP 3BFMA 1JJ2P 2JZ2A 2ATCB 2J6KA 1ZHIA 2OTLT 4JPBW 5D6YA 4BE1A 1WXBA 2WSEE 1EFNA 2FO0A 1CSKA 4F04B 5HK0A 2GGRA 3VUBA 4LDUA 2O4XA 1QKWA 1W70A 1D1BA 2L3RA 1IGQA 2KROA 2F2WA 3N5BB 1Q81U 3EHRA 3HL8A 3MKDA 4DOVA 1QVPA 2KVQG 4M7AC 1QVFA 1RABB 3EFOA 3META 1D09B 1Y71A 2QDLA 3A8OB 3D7SB 3G4ST 2LX7A 3EFSA 3G71Q 4M7DF 5GANj 3RIRA 4MZTA 2MOXA 3LWHA 2PTKA 3C0CA 2BIVA 2CS7A 2CYZB 5LJ5f 3CCUQ 4CRIA 3M4YA 1NJIU 2RH2A 3SHWA 3ZEHA 1YITQ 1WZOA 3VS0A 2H3EB 2QGFB 4PLLA 1F1BB 1E7OA 1Q86R 4GY5A 4BDYA 4OB0B 5CCAA 4M75A 1U3OA 2YUPA 1PRMC 4DBQA 2EKOA 1VQPT 1WHGA 2VC8A 1G83A 1KD1R 1YBYA 5GJVB 4CC4B 2W10A 5J26A 9ATCB 5GMKi 1CKBA 1UJYA 2R5AA 3MP6A 5GAOq 5GMKl 3OS5A 1ZSGA 3VS4A 2M02A 1FMVA 1YCYA 3FIFA 1RAHB 2PQWA 4C92D 4C92A 2K2MA 1M2VA 2XU8A 2HL5C 3PMIA 4QKUA 4C92F 1VQ6A 5IHNA 3CCLT 2EYYA 1TS9A 3QIIA 4WCIA 3TCJA 5DY9A 2A3LA 3FLGA 2YDLA 1JEGA 2EJFA 1PSFA 1I8FA 3CCMT 2CZ7B 2Y4XA 3VS1A 4E7IA 2ZPFB 4XU2A 3OQ5A 2I0NA 1QCNA 2VB6A 4J9GA 4OB2B 1M30A 5IAYA 2GQVA 1VQ5T 4JZ4A 1QWFA 4ORZA 3JCMW 5KH6A 3Q1JA 4IURA 3QWXX 1WA7A 2CH4A 1NPRA 2DTHA 3VRZA 1D0YA 1J3TA 4JS4A 4FU6A 5GAMe 1I0CA 1XQHA 2HD0A 3RERA 3ZL7C 3A1PA 4XTZA 4M75G 1T0HA 4WF2A 5IT9E 4E7HA 2RI5A 4L5GA 4ZNXA 1WQ7A 1VQLT 2DZ9A 1OX9A 4PJOE 1ARKA 1HK9A 5LJ5j 1RI0A 2K7AA 1OV3A 3R6NA 3OYEA 3QDFA 1AWXA 3GP8A 3VKIA 1PCXA 4F17A 2AIRB 3QG1A 1QP3A 2EQIA 3QPHA 1X2QA 2RHXA 4PJOF 2WACA 2GQIA 4NS5A 5IHIA 3CPWA 3M4GA 3MJXA 4E2FB 4IUPA 1D0ZA 1Q86C 2QAZA 1KC8U 4DBHA 1Y96B 1AWJA 3OBWA 1PNJA 1VQPQ 1N9RA 3QJYA 1OX8A 1YI2Q 3NGPA 1VQLQ 4M78C 2JS2A 4AFQC 5GAN3 1R77A 2DL8A 2EQMA 3JB9H 3AHUA 1M2VB 4F14A 4C5GA 1VQ7Q 1SG5A 1IXDA 2EJGA 3WXMB 3CD6Q 3JB9I 4D8DA 3OYMA 3CCQA 4A4EA 5FWBA 2OAUA 2KRSA 4NL2A 2E12A 1OZ2A 2LJ3A 4M75E 2MWOA 2COWA 3G6EA 3CCVA 1PC0A 1Y7XA 3OYIA 1JXOA 1AD5A 2RHYA 2RF0A 4DEYA 1HXDA 3HSBA 2O9VA 1RAEB 4OMOA 1VQ8Q 1QVFS 4A4HA 2VWFA 2XICA 1N8RR 3HRUA 5LJ3h 2JJ9A 4ANJA 4HCCA 2PZ1A 2NLUA 3OYHA 2E6NA 1N5ZA 1X6OA 3MCAB 5GAN7 1YJ9T 1K1ZA 2C0OA 4IUVA 3CBMA 2AZSA 3JCMP 3VU3C 4BB7A 2YRDA 2MF2A 3NMZC 4ZTJA 1K0XA 2JUFA 4B6MA 1TWBA 2JMAA 5LJ3e 2CREA 2EGAA 2M0OA 2NWMA 2BZYA 2KBTA 3KFVA 4PFZA 2LNVA 1K9MR 2EPDA 4AFZC 3JCMh 2GCXA 1Q86U 1ABOA 2DX1A 1M90R 3OYGA 1AEYA 3FJ5A 1LVKA 3CC4A 1TUDA 2SRCA 2FYKA 1Q82U 4ZN1A 1WHKA 2HCKA 2LJ1A 1HJDA 3J7AF 1WHLA 1X75C 3BDUA 1K4US 1VQMQ 1ZSZA 2AZVA 2HL3A 1VQ5Q 4II1A 2H3JA 2DTIA 2YHTA 3EG1A 4AG1C 1QVGA 2RD1A 2QEXT 4F7UE 3OYNA 2X4YA 4BE2A 5HK3A 2LQWA 2KI7A 4FYXB 1UE9A 2CH4W 1WHHA 3OSSC 3VS5A 3CCET 4XAXB 2KEAA 1ZBJA 5GJWB 3V7SA 3BY7A 1WQWA 1VIFA 2FRWA 1M4ZA 1Z9ZA 5IHKA 3A8HB 1GCPA 4M78A 1G3YA 2DRMA 4VUBA 5IXFA 1WI7A 3OYDA 2PUOB 1QCFA 1Y0MA 2LT1A 4BI8B 4ZTFA 4PL6A 5CR2A 3OMGA 5A0LA 2CT4A 1WJRA 4M7AA 1TUGB 1RI9A 2D9TA 4C8QA 4MZMA 3CC7A 4QT7A 3VYGA 5KYXA 2EBPA 2LCSA 1SKUB 1T3LA 2EVRA 1WNLA 2XIDA 3CCMA 1MV0B 1KHCA 5HKCA 2KQWA 2E70A 2K3YA 2P4TA 5KE3A 3E1SA 4Z88A 2RQWA 1YN8A 3MEVA 4CI0C 1BI2A 1BCOA 3PMTA
chains in the Genus database with same CATH topology
3CCVQ 1VQOQ 1VQ5Q 2OTLQ 3CCEQ 3CC4Q 2QA4Q 1YITQ 1YJNQ 1KD1R 3OW2P 1VQ7Q 2QEXQ 1YIJQ 1M90R 3CD6Q 1KC8R 3G71Q 1VQNQ 1Q82R 1VQ8Q 1QVGP 1Q86R 3I56Q 3CPWP 1VQ6Q 3CC7Q 1S72Q 1N8RR 3CCMQ 3G6EQ 3CCLQ 2OTJQ 1VQPQ 3CC2Q 1VQ9Q 1Q7YR 1VQLQ 1YI2Q 3CCSQ 1QVFP 3CCQQ 3CCJQ 3CCRQ 3CMEQ 1YJ9Q 1YJWQ 1NJIR 3CCUQ 3I55Q 1W2BP 1K73R 1K8AR 1KQSP 1VQKQ 1M1KR 1VQMQ 1K9MR 3G4SQ 3CXCP 1VQ4Q 3CMAQ 1YHQQ 1Q81R 1JJ2P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCV Q;  1VQO Q;  1VQ5 Q;  2OTL Q;  3CCE Q;  3CC4 Q;  2QA4 Q;  1YIT Q;  1YJN Q;  1KD1 R;  3OW2 P;  1VQ7 Q;  2QEX Q;  1YIJ Q;  1M90 R;  3CD6 Q;  1KC8 R;  3G71 Q;  1VQN Q;  1Q82 R;  1VQ8 Q;  1QVG P;  1Q86 R;  3I56 Q;  3CPW P;  1VQ6 Q;  3CC7 Q;  1S72 Q;  1N8R R;  3CCM Q;  3G6E Q;  3CCL Q;  2OTJ Q;  1VQP Q;  3CC2 Q;  1VQ9 Q;  1Q7Y R;  1VQL Q;  1YI2 Q;  3CCS Q;  1QVF P;  3CCQ Q;  3CCJ Q;  3CCR Q;  3CME Q;  1YJ9 Q;  1YJW Q;  1NJI R;  3CCU Q;  3I55 Q;  1W2B P;  1K73 R;  1K8A R;  1KQS P;  1VQK Q;  1M1K R;  1VQM Q;  1K9M R;  3G4S Q;  3CXC P;  1VQ4 Q;  3CMA Q;  1YHQ Q;  1Q81 R;  1JJ2 P; 
#chains in the Genus database with same CATH topology
 1N9S A;  4RKU E;  3FJP A;  1WHJ A;  1Y96 A;  4OMF B;  3CPW S;  3RBB B;  2KYB A;  1PG5 B;  4IIO A;  2ZGW A;  2RJF A;  3X24 B;  5GAN g;  3JAM E;  4KH0 B;  5CKE A;  1FYN A;  4M77 B;  1OPK A;  4IKF A;  2KK4 A;  3A8G B;  1Q81 C;  4C0D C;  4M78 B;  1G3T A;  2LNH B;  1ZUU A;  4UC4 A;  4LD6 A;  1YJ9 A;  1NYG A;  5GAN d;  4IUU A;  4Z89 A;  3H0I A;  4PJJ A;  2DL7 A;  4BD3 A;  2FPD A;  3SFM A;  1M8V A;  1AWW A;  2FPE A;  4M7D E;  1WXU A;  1LNX A;  3C12 A;  1M3A A;  3M0R A;  4M77 D;  4E6R A;  2L89 A;  1YI2 T;  1X01 A;  4OMQ A;  2FEI A;  3TSZ A;  3PVQ A;  5KYN A;  1VUB A;  1K73 U;  2V8K A;  1K8A U;  2E3I A;  4BY6 C;  4QQD A;  1VQO T;  1QKX A;  4FSS A;  2VAS A;  4M7D G;  1FWZ A;  2NYS A;  4F16 A;  1WDX A;  1YP5 A;  3SD4 A;  1RL2 A;  1V29 B;  3G4S A;  2XHC A;  4C0D B;  5I22 A;  2DM1 A;  1SHF A;  2X3X D;  4Y28 E;  2DJQ A;  1R0C B;  3ME9 A;  4OMP A;  1VA7 A;  2JTE A;  3EG9 A;  5D6W A;  4MMK A;  2DZC A;  1G8X A;  1TUC A;  2QYZ A;  4C92 B;  3JCM X;  2PVG B;  2L3P A;  2O88 A;  2RK2 A;  1VQ9 T;  2COZ A;  4DOW A;  4Z8A A;  3DKM A;  2WSF E;  4F7U A;  2EGC A;  3I5S A;  2IIM A;  4FYW B;  2KDS A;  3CCL A;  4KGV B;  2QAS A;  1SF9 A;  2AKL A;  4M75 B;  4ZGD B;  4JZ3 A;  3HPW A;  2A28 A;  1RLP C;  1SHG A;  3QSU A;  3CC4 T;  4M7A E;  3EG2 A;  1HSQ A;  3L2W A;  4Y91 A;  1RUW A;  3EGD A;  4RG8 A;  1D3B B;  4C8Q C;  1ZA1 B;  2EQU A;  2F5K A;  4LDV A;  8AT1 B;  2BZX A;  3M55 A;  4A63 B;  5GAN 4;  2RMO A;  1BBZ A;  2MYS A;  3CD6 T;  4OGE A;  3CCE Q;  4IUQ A;  2QA4 Q;  3QXE B;  2DVE A;  3M57 A;  1OYX A;  1RAD B;  2R57 A;  2CSQ A;  1M9S A;  4C8Q G;  3PNW C;  1WXT A;  1N27 A;  5GAO m;  3ZBD A;  5CVI A;  2J05 A;  3HFO A;  4C0F A;  3LLR A;  4PNO A;  5FU7 B;  4PJO A;  4B9X A;  1QW1 A;  3X20 B;  2KT1 A;  3H8Z A;  2C0I A;  1VQ7 T;  1WJS A;  4M7D C;  5CIU A;  1M1K C;  4OGC A;  2DE0 X;  5CK9 A;  1MHN A;  1SRL A;  2HDA A;  4C5I A;  1KHI A;  3CCS Q;  4EMK C;  3JCM b;  2L3S A;  1TTH B;  3CXC A;  1G3W A;  1VQ5 A;  1M5Q 1;  1QQJ A;  3CME A;  1VQO Q;  1OI1 A;  5IXB A;  2O4X B;  4PK4 A;  1YJN Q;  2GBQ A;  2IVW A;  2V8I A;  4PJN A;  2E6Z A;  4PFP A;  4M7A B;  1W1F A;  2IG0 A;  1M3B A;  5CAI A;  2DXB A;  4HVU A;  5GMK e;  1VYV A;  2XG8 D;  4GLK A;  5A0G A;  1M1F A;  3MEU A;  4J8O A;  4N4G A;  2E5Q A;  3V8J A;  2K79 A;  1NBE B;  2FZC B;  1O75 A;  4HT8 A;  2K4Y A;  1QVG P;  4L59 A;  3NHN A;  2ZCF B;  3TVT A;  4MDX A;  3DB3 A;  2DVJ A;  2K3X A;  3QDR B;  2YWW A;  1BKB A;  4OF1 A;  4ZN3 A;  1Q82 C;  1K8A R;  2PVD B;  4E7Z A;  1JB0 E;  2YUQ A;  4RTZ A;  3CC2 T;  2LT4 A;  2HZY A;  4BI3 A;  2IPO B;  2RQR A;  1UTI A;  3HHT B;  4C8Q F;  2JW4 A;  2NUP B;  4XTY A;  4HVW A;  5FWC A;  3L2Z A;  5J3B A;  1UGP B;  1JXM A;  4JDS A;  1YNZ A;  1ZSZ B;  1C1A A;  3M0S A;  3M59 A;  3CCR T;  2KY9 A;  2P0Q A;  2HKQ B;  3GF5 A;  3R6O A;  4M4Z A;  5KYY B;  2BUD A;  1U5S A;  1BCM A;  4MML A;  2XDB A;  1X6G A;  2MCN A;  1AVZ C;  2E64 A;  5C0M A;  4LDY A;  2FL7 A;  3RNJ A;  3VYH B;  3KXT A;  4BUG A;  1T3S A;  4C5H A;  1I5L A;  2OTJ Q;  2CUD A;  1MUZ A;  1XJW B;  2RI2 A;  2XKO C;  5KYX B;  1YJ9 Q;  3CC2 A;  2FVU A;  3JRZ A;  2J06 A;  3M9Q A;  4A53 A;  5GAO p;  4X34 A;  4EPC A;  2B8A A;  3GPL A;  4CC3 A;  4M78 E;  2RJC A;  2HBP A;  3OW2 P;  1GCQ A;  2P84 A;  3CEY A;  1VYT A;  3JB9 J;  3DLM A;  2EKH A;  3M54 A;  1K9M C;  4LXC A;  2MMP A;  3MHX A;  4M7A G;  2GFA A;  4E7L A;  2X4W A;  3EFO B;  5D7U A;  1N6A A;  2DBM A;  2HKN A;  4OP0 A;  4M7D A;  2CKK A;  2LQK A;  2VKN A;  4KUI A;  1JJ2 S;  3HP9 A;  4QQG A;  3P8B B;  5CKF A;  4HCK A;  3CCJ A;  2VXE A;  1VQ4 A;  4FL6 A;  2OJ2 A;  4J9D A;  4NOY A;  1YIJ A;  1YI2 A;  1QP2 A;  2DD4 A;  3RMS A;  1KK7 A;  4PJO B;  1UJ0 A;  1MMN A;  3I56 A;  1NM7 A;  3CCU T;  2ZZD A;  3RKW A;  1GFD A;  1AZE A;  2JMC A;  3BDL A;  2RK1 A;  4PFO A;  4E7K A;  3EHQ A;  1MMA A;  1IZ6 A;  2M0Y A;  3PVL A;  3OYB A;  1JBM A;  3CPF A;  1B07 A;  3MP1 A;  4ME7 A;  1OU9 A;  2CP0 A;  4C8Q B;  2O9S A;  3UT1 A;  2DTO A;  2QGG A;  2CZ1 B;  2RO0 A;  4QW2 A;  4FSX A;  1QLY A;  5GAN 2;  2KT8 A;  2VYT A;  1GBR A;  2HQX A;  4LDX A;  1K76 A;  2KE9 A;  5GAO r;  1PRL C;  3F70 A;  4XTV A;  1Q82 R;  1R8O B;  3SWN B;  3RMQ A;  1BIB A;  5CKD A;  2PU9 B;  3LGL A;  3G71 A;  2L8D A;  3NPF A;  1C6V X;  3C95 A;  3PIO A;  1BU1 A;  3I55 Q;  2ESW A;  3JCM c;  3HFN A;  2C0T A;  1I5O B;  3CCU A;  1EX4 A;  4YTL A;  3OS0 A;  2M16 A;  2FPF A;  1YIT A;  1JU5 C;  2QTX A;  1UEC A;  4D8K A;  2FHD A;  1NLP C;  4JJN K;  4JRP A;  3G7Z A;  4HT9 A;  3UA7 A;  1VQK Q;  1EZZ B;  2EWN A;  2KAF A;  5GAO l;  4C92 G;  4J7F A;  2ROL A;  4QVC A;  3VS2 A;  2LCL A;  4BY6 B;  3JB9 G;  3NTI A;  1YJN T;  2DIQ A;  2HQH A;  4JJC A;  3H41 A;  3CCS A;  2D8J A;  5LJ3 g;  1JQQ A;  1TG0 A;  2NUT B;  3L1A A;  2DMO A;  5CO7 A;  3RUX A;  3PE0 A;  1K73 C;  1M1K R;  1K8A C;  4AMC A;  3UPU A;  2GTJ A;  4LNP A;  1YJN A;  1X2K A;  3BW1 A;  4OB3 B;  3THK A;  1YIT T;  4JUV A;  3SEM A;  1LCK A;  4JRK A;  3JB9 F;  1PD0 A;  3EFR A;  2V1R A;  2EYQ A;  3L2R A;  3AT1 B;  3VS7 A;  3CME T;  2LVM A;  2HNI A;  3OW2 A;  3JB9 D;  1YJW Q;  3OYY A;  3X28 B;  1NEB A;  4AFU C;  1Z9Q A;  4BI4 A;  3A98 A;  3M53 A;  3MO8 A;  5CKB A;  2F2V A;  3EGX A;  3NTH A;  2HSE B;  3OYA A;  1S1N A;  3QZ9 B;  2L2P A;  3UAT A;  4JJB A;  3V7C A;  5IH2 A;  1PD1 A;  1TSF A;  1WFW A;  2QI2 A;  3U23 A;  1YWO A;  4M77 G;  3VS3 A;  4C92 E;  4LE9 A;  3CCR Q;  1M2O A;  3TQ7 P;  3JCM g;  2JTM A;  2DO3 A;  2LP5 A;  5HCK A;  2O01 E;  4PJO D;  2EQK A;  4WTO B;  2ED0 A;  1AT1 B;  1PKS A;  3ZFJ A;  2NUT A;  4M7D D;  1AWO A;  5EC7 A;  2HMA A;  2EQJ A;  4BE0 A;  3MPU B;  2DK3 A;  2K57 A;  3G6E Q;  1I4K 1;  2DL5 A;  2JTF A;  4KBM B;  2DIG A;  4J9C A;  1GFC A;  1W2B S;  3S6W A;  2LQN A;  2EYZ A;  2MAM A;  2D0Q B;  3VUZ A;  2X51 A;  1YHQ A;  4PJO C;  2ED1 A;  3HRS A;  4FT2 A;  4LN2 A;  2JM9 A;  3EGU A;  5GAM h;  2OTJ A;  1G3S A;  3JCM f;  1VQ4 T;  2KYM A;  1OU8 A;  3CC2 Q;  1VQ9 Q;  5FLX E;  2ZPB B;  2LJ0 A;  1K73 R;  4OB1 B;  3LYI A;  1XNI A;  2J7I A;  1VQL A;  3P8D A;  4DBR A;  4J9B A;  5GMK j;  1OQK A;  1W4S A;  1M1K U;  3VV0 A;  5GAN 5;  3A5Z B;  4FYY B;  2DD5 A;  2QQS A;  1FX7 A;  4PKC C;  1VQ7 A;  1VQN A;  1IRE B;  3RDV A;  2X3W D;  2Z0W A;  3VRY A;  1EIF A;  1G5V A;  3CCQ Q;  4M75 F;  2RQV A;  3H0F A;  2P0K A;  4JRI A;  2MPX C;  4OMM A;  5AT1 B;  2MIO A;  1TOV A;  1VQ4 Q;  2CT3 A;  2K5F A;  4M77 E;  4O6J A;  4K11 A;  2OTL A;  1VOM A;  4OMN A;  5FU6 B;  3JCM e;  2CDT A;  1D1C A;  4RCB A;  3OSV A;  5ECA A;  4C0G A;  3I56 Q;  4KUD K;  2XD0 A;  2RA2 A;  1C0M A;  2CP3 A;  2QG9 B;  1Q7Y R;  3OY9 A;  4X9C A;  3WVD B;  3QYH B;  2RM4 A;  2GFU A;  3X26 B;  3BE3 A;  4QQ6 A;  4EIK A;  5FRN A;  3FRN A;  1KC8 C;  3A8L B;  3L2U A;  4C8Q D;  2DET A;  2KMT A;  2LMJ A;  4XU0 A;  1E6H A;  3L2V A;  3FEO A;  1U8R A;  2JM8 A;  3REA B;  1NJI R;  2CZ0 B;  1ZQ1 A;  3H9N A;  4KGX B;  1YHQ T;  1GCQ C;  2G6F X;  3URG A;  5GAO n;  5L8R E;  4D6W A;  1XOV A;  2QQR A;  3ASK A;  4LUE A;  1ZLM A;  2XDD A;  1MMG A;  1VQ6 Q;  4E47 A;  1WYX A;  4A4G A;  2LDM A;  2DPP B;  4J9E A;  4FIB A;  4XU3 A;  3C4S A;  2R58 A;  4HA8 A;  1UFF A;  3S3M A;  3TSW A;  1UUE A;  2QA4 A;  1WHM A;  5GAN 8;  2LX9 A;  1MGQ A;  2ZPH B;  2MK5 A;  3I5R A;  1RAA B;  1Q7Y C;  2DXU A;  4XTX A;  1R0B G;  4FYV B;  2PNI A;  2QK0 A;  2DL3 A;  1S72 Q;  4DA4 A;  5CQX A;  4L6V 5;  1VQK A;  2DA9 A;  4E7S A;  4M78 G;  3M56 A;  3V8L A;  4B9W A;  2FB7 A;  7AT1 B;  3FDR A;  2KSS A;  1W6X A;  1AZG B;  5KCH A;  4J83 A;  5KYW A;  1VYU A;  3I55 T;  4ZGJ B;  2C06 A;  2FZG B;  2VGN A;  2L3Q A;  3OS1 A;  5GMK m;  1MND A;  5EG2 A;  2QXF A;  1AHJ B;  3V7R A;  3CME Q;  1SEM A;  2QTV A;  3RKX A;  4M77 A;  3HTR A;  3JSC A;  3FB9 A;  2A36 A;  2L0A A;  3CMA Q;  3LW5 E;  1NPP A;  3X25 B;  1IGU A;  4F7U F;  3GOX A;  2HBW A;  1H92 A;  4J6X A;  3V8K A;  1YCS B;  4M75 D;  4RTU A;  5CQY A;  1ZUK A;  1YJW A;  2ENM A;  2O2O A;  2L5Q A;  2LTO A;  2A08 A;  2DBK A;  2RHI A;  1UDL A;  2HQE A;  2EYW A;  2EJ9 A;  2M9U A;  4M78 F;  1ZA2 B;  5GAN f;  1SPK A;  3SWN C;  4FW2 A;  1UEB A;  1OPL A;  3EH2 A;  2KRN A;  1Y57 A;  1N8R U;  3FC3 A;  3CMA T;  4QVD A;  1IB8 A;  2RPN A;  1KQS P;  4CC7 A;  3G1J A;  3WVE B;  1VIE A;  3C94 A;  2AKK A;  3CD6 A;  5DLO A;  4PJL A;  1MNE A;  4BDZ A;  2QEX Q;  2QQB A;  2H8H A;  4C8Q E;  2CZ6 B;  4FT4 A;  2F2X A;  4ELZ C;  5CKH A;  1RAC B;  5LL6 S;  4EMG A;  3CCL Q;  4HXJ A;  3LH5 A;  3PTA A;  1KQS A;  3H0H A;  1NLO C;  4RCC A;  5LJ5 e;  1VQ8 A;  3RKY A;  3LWI A;  4RTY A;  1KC8 R;  2YLB A;  2EGE A;  3OMC A;  4ELY C;  5GAM d;  1A0N B;  1S72 T;  3JV3 A;  1VQ9 A;  2E41 A;  4N0A C;  4XK8 E;  2BE7 D;  3QYG B;  3EAE A;  2RQT A;  5I11 A;  5KYU A;  3P8H A;  1WJQ A;  1VQ8 T;  2A37 A;  2E1H A;  3QHS A;  3VS6 A;  5LJ5 h;  3G4S Q;  3G6E T;  3CCE A;  4M77 F;  3E19 A;  1BYM A;  1E6G A;  1BI3 A;  1QMC A;  5A0D A;  2HSP A;  2F5T X;  2P4R A;  5DLQ E;  1OOT A;  2CUB A;  1BIA A;  5FW9 A;  2CP7 A;  2AT1 B;  2JOY A;  3E9F A;  3L42 A;  3GNG A;  1UB4 A;  1H3H A;  1P92 A;  3O5Z A;  2YT6 A;  1G2B A;  1UGV A;  2NUP A;  2ZPI B;  2X4J A;  2A0F B;  3VJP A;  1UHC A;  3EG0 A;  4KGZ B;  1NEG A;  1UGS B;  3CC4 Q;  1KSW A;  4OML A;  2VXF A;  4LUD A;  3M5A A;  4RTT A;  4XTU A;  1YFN A;  2RJD A;  2DJZ A;  4M77 C;  5FRO A;  3JCM Q;  4TVR A;  2OTJ T;  4GBQ A;  2KR3 A;  2FRY A;  3G71 T;  5C6S A;  4J9I A;  3REB B;  1IO6 A;  3IQL A;  5A2Q E;  4A4K A;  1KJW A;  1IRX A;  3J80 E;  2V8J A;  2QA4 T;  1H64 1;  4RTV A;  2JS0 A;  2RI3 A;  4OVA A;  4MZP A;  2CP6 A;  3OB9 A;  1ZBX A;  5KYY A;  1XTD A;  4R56 A;  4EMH A;  1CKA A;  1PSE A;  1SSF A;  2BE9 B;  1LPL A;  3OYF A;  2OX7 A;  1W2B P;  1MV3 A;  4JJD A;  2AK5 A;  4IIM A;  5I21 A;  1OZ3 A;  5LJ3 j;  2GNC A;  3CXC S;  2JT4 A;  2BKD N;  2K9G A;  1PKT A;  4JRQ A;  1X6B A;  3I55 A;  1GL5 A;  4X1V A;  1WIE A;  4O5V A;  2RJE A;  4XU1 A;  3CC7 T;  2RN8 A;  2XI9 A;  1X43 A;  3E9G A;  2E65 A;  4Z02 A;  4AFS C;  1KQ1 A;  2OI3 A;  1TH7 A;  2E4H A;  2YUO A;  2PUK B;  2XK0 A;  3T9N A;  1YIJ T;  2RNA A;  1KD1 U;  3H6Z A;  3CCV T;  1KQ2 A;  4AT1 B;  1VQK T;  2M51 A;  5KCO A;  5FU6 C;  2ZPG B;  2LQ8 A;  1S72 A;  1K0S A;  4N4I A;  3UDC A;  2D0N A;  4LD9 K;  6AT1 B;  4R55 A;  3GNF B;  2VGM A;  1M90 C;  1V76 A;  4EMK B;  1VQ6 T;  2F69 A;  2K2V A;  5GAM g;  1HD3 A;  3OS2 A;  2X4X A;  4N0A A;  1WLP B;  4DBF A;  1NJI C;  5KYU B;  3OW2 S;  2DER A;  2VV5 A;  4XQ3 A;  4M7D B;  2K5L A;  2V1Q A;  3CCS T;  2KXC A;  2RB6 A;  4J9H A;  5D6X A;  2ABL A;  1I81 A;  4RTW A;  1JJ2 A;  2KNB B;  3OYK A;  3CMA A;  1V1C A;  2W0Z A;  1VQP A;  2EW3 A;  1Q81 R;  5FU7 C;  4RTX A;  3KUF A;  4FW1 A;  1B3Q A;  4Q5W A;  3CBP A;  4J6W A;  4N4H A;  1RAF B;  5M9O A;  2BTT A;  3OBY A;  4PJM A;  3DLL A;  1Q95 G;  3PFS A;  1GRI A;  3QO3 A;  3CCM Q;  5AYF A;  3M0Q A;  2X9H A;  1LJO A;  2EAY A;  1FMW A;  4DQ2 A;  4KT0 E;  5GAN h;  3CCV Q;  1PM3 A;  3ER0 A;  1SSH A;  4A4F A;  2CP2 A;  1YIJ Q;  2JXB A;  1VQN T;  5J39 A;  1H8K A;  1U1T A;  1KIK A;  1BI1 A;  2DXC A;  1WPY A;  1KQS S;  3I35 A;  4M75 C;  2D8H A;  3RR6 A;  2DRK A;  2AHJ B;  4JLG A;  2J6F A;  4RG2 A;  2YRV A;  2CP5 A;  2E3H A;  4RUG A;  5IN1 A;  3JCM J;  2F1L A;  4FM4 B;  1M8M A;  4HVV A;  1WX6 A;  4BAC A;  2SEM A;  1MMD A;  1D0X A;  1T0J A;  4J5Y A;  3UWN A;  4ATO A;  1FXX A;  4KUL A;  4EMK A;  1FMK A;  2I2L A;  3QKJ A;  1M90 U;  3M0P A;  3ULR B;  1QVG S;  4C92 C;  3GLX A;  8ATC B;  1PWT A;  4KRT A;  2CSI A;  1NYF A;  2RHZ A;  1BI0 A;  3S3O A;  2HAX A;  2DYB A;  5GAN 6;  4LDW A;  1Q7Y U;  2YRC A;  2FZK B;  2XDP A;  5GAM f;  3EH1 A;  3I9Q A;  3CPW P;  1IHW A;  5GAN e;  4EDU A;  2HEQ A;  4J9F A;  1SRM A;  5LJ5 d;  5HY6 A;  1JO8 A;  2DFU A;  4QVZ A;  3SWN A;  3OA6 A;  2ECZ A;  3INZ A;  3TRE A;  1VQM A;  2Y90 A;  2OAW A;  2XMF A;  2QQA A;  2WSC E;  2NUZ A;  3EG3 A;  2DNU A;  1GBQ A;  3MEA A;  1ZUY A;  1X27 A;  2JVV A;  2PVO B;  3QBY A;  3M0U A;  2DYI A;  3QWY A;  1TU0 B;  4RMO A;  1OEB A;  1OUL A;  1ZX6 A;  2QDY B;  2GTO A;  4J7I A;  2X35 A;  1K9M U;  4Y92 A;  4JS5 A;  4HKE A;  2LRQ A;  2KGT A;  4M7A F;  4C5E A;  3LX7 A;  4CC2 A;  1NE8 A;  1YWP A;  3OYJ A;  2DLP A;  3EGX B;  1UGQ B;  2FG0 A;  1TXQ A;  2RHU A;  4M78 D;  2DAQ A;  5KYW B;  2BZ8 A;  2CGH A;  2DXT A;  2YXY A;  1X69 A;  1H3Z A;  1O9S A;  1N8R C;  3TU4 K;  4HCB A;  1UHF A;  1ABQ A;  1ACM B;  1D1A A;  3LH0 A;  3HRT A;  2DEQ A;  1UGR B;  5LJ5 g;  3SDZ A;  3CC7 Q;  1JRI A;  1KFZ A;  2D1X A;  1QVF P;  5I2S A;  2E5K A;  1U1S A;  1RAG B;  4MDW A;  3RES A;  1WGS A;  2EIF A;  3EGD B;  3I56 T;  3HKS A;  1M1G A;  2GF7 A;  4XTW A;  3OYL A;  1B34 A;  2O31 A;  2DL4 A;  4HCZ A;  1NG2 A;  2VUB A;  1K9A A;  3QUI A;  3O8V A;  4PLI A;  3EG9 B;  3NFC A;  3QJ6 A;  1IHV A;  2LC4 A;  2LCC A;  2ZAE A;  4DEX A;  3CCJ T;  2M1H A;  2D6F A;  2EFI A;  4IUT A;  4JLI A;  3A8M B;  5GAM j;  3KBG A;  2E10 A;  1GXI E;  4F7U B;  3GIB A;  1B7T A;  1D3B A;  3LGF A;  3QZ5 B;  3J81 E;  3MEW A;  2DEU A;  1VQO A;  2YSQ A;  3PGG A;  5KE2 A;  2ROT A;  4R0K A;  4E7J A;  2MWP A;  5GMK h;  2JNG A;  4F7U G;  2G3R A;  3DB4 A;  1YJW T;  2COY A;  4AG2 C;  2EYX A;  1HYO A;  3UA6 A;  3S3N A;  4A54 A;  2QQ9 A;  1BB9 A;  2R5M A;  1Y07 A;  2DF6 A;  2JN0 A;  4GLM A;  1DJ7 B;  3CQT A;  4ZGE B;  1NZ9 A;  3M0T A;  1YHQ Q;  1W2B A;  4FCY A;  3M58 A;  3E2U A;  2KXD A;  4X9D A;  3TEE A;  4PJO G;  3PT9 A;  2P0P A;  4NL3 A;  2KRM A;  3JCM V;  1LOJ A;  1I1J A;  2Y4Y A;  1QCO A;  2MI6 A;  1KG1 A;  2YLC A;  2YUN A;  3CCR A;  1RLQ C;  5DM7 R;  3CBO A;  5FRM A;  2DKG A;  4KH1 B;  5L23 A;  1VQN Q;  2B86 A;  4ESR A;  2J6O A;  1KD1 C;  1VQM T;  3SB2 A;  1AOJ A;  3JCM d;  1UG1 A;  1RAI B;  2VVK A;  2ZPE B;  4P5N A;  3CCJ Q;  1I07 A;  1U06 A;  2K5I A;  3MP8 A;  1M3C A;  2K3B A;  3CCQ T;  1M27 C;  3UF4 A;  1ZSZ C;  4M7A D;  2OTL Q;  4J6Y A;  1BK2 A;  4V2S A;  2V26 A;  2A7Y A;  3L2Q A;  5I2M A;  5LJ3 f;  2DIL A;  4C0Z A;  2RQU A;  5LJ3 d;  1QWE A;  1B34 B;  3GBQ A;  1PHT A;  3PIP A;  2K6D A;  3NTK A;  2LZ6 B;  3OYC A;  2QEX A;  3CXC P;  3BFM A;  1JJ2 P;  2JZ2 A;  2ATC B;  2J6K A;  1ZHI A;  2OTL T;  4JPB W;  5D6Y A;  4BE1 A;  1WXB A;  2WSE E;  1EFN A;  2FO0 A;  1CSK A;  4F04 B;  5HK0 A;  2GGR A;  3VUB A;  4LDU A;  2O4X A;  1QKW A;  1W70 A;  1D1B A;  2L3R A;  1IGQ A;  2KRO A;  2F2W A;  3N5B B;  1Q81 U;  3EHR A;  3HL8 A;  3MKD A;  4DOV A;  1QVP A;  2KVQ G;  4M7A C;  1QVF A;  1RAB B;  3EFO A;  3MET A;  1D09 B;  1Y71 A;  2QDL A;  3A8O B;  3D7S B;  3G4S T;  2LX7 A;  3EFS A;  3G71 Q;  4M7D F;  5GAN j;  3RIR A;  4MZT A;  2MOX A;  3LWH A;  2PTK A;  3C0C A;  2BIV A;  2CS7 A;  2CYZ B;  5LJ5 f;  3CCU Q;  4CRI A;  3M4Y A;  1NJI U;  2RH2 A;  3SHW A;  3ZEH A;  1YIT Q;  1WZO A;  3VS0 A;  2H3E B;  2QGF B;  4PLL A;  1F1B B;  1E7O A;  1Q86 R;  4GY5 A;  4BDY A;  4OB0 B;  5CCA A;  4M75 A;  1U3O A;  2YUP A;  1PRM C;  4DBQ A;  2EKO A;  1VQP T;  1WHG A;  2VC8 A;  1G83 A;  1KD1 R;  1YBY A;  5GJV B;  4CC4 B;  2W10 A;  5J26 A;  9ATC B;  5GMK i;  1CKB A;  1UJY A;  2R5A A;  3MP6 A;  5GAO q;  5GMK l;  3OS5 A;  1ZSG A;  3VS4 A;  2M02 A;  1FMV A;  1YCY A;  3FIF A;  1RAH B;  2PQW A;  4C92 D;  4C92 A;  2K2M A;  1M2V A;  2XU8 A;  2HL5 C;  3PMI A;  4QKU A;  4C92 F;  1VQ6 A;  5IHN A;  3CCL T;  2EYY A;  1TS9 A;  3QII A;  4WCI A;  3TCJ A;  5DY9 A;  2A3L A;  3FLG A;  2YDL A;  1JEG A;  2EJF A;  1PSF A;  1I8F A;  3CCM T;  2CZ7 B;  2Y4X A;  3VS1 A;  4E7I A;  2ZPF B;  4XU2 A;  3OQ5 A;  2I0N A;  1QCN A;  2VB6 A;  4J9G A;  4OB2 B;  1M30 A;  5IAY A;  2GQV A;  1VQ5 T;  4JZ4 A;  1QWF A;  4ORZ A;  3JCM W;  5KH6 A;  3Q1J A;  4IUR A;  3QWX X;  1WA7 A;  2CH4 A;  1NPR A;  2DTH A;  3VRZ A;  1D0Y A;  1J3T A;  4JS4 A;  4FU6 A;  5GAM e;  1I0C A;  1XQH A;  2HD0 A;  3RER A;  3ZL7 C;  3A1P A;  4XTZ A;  4M75 G;  1T0H A;  4WF2 A;  5IT9 E;  4E7H A;  2RI5 A;  4L5G A;  4ZNX A;  1WQ7 A;  1VQL T;  2DZ9 A;  1OX9 A;  4PJO E;  1ARK A;  1HK9 A;  5LJ5 j;  1RI0 A;  2K7A A;  1OV3 A;  3R6N A;  3OYE A;  3QDF A;  1AWX A;  3GP8 A;  3VKI A;  1PCX A;  4F17 A;  2AIR B;  3QG1 A;  1QP3 A;  2EQI A;  3QPH A;  1X2Q A;  2RHX A;  4PJO F;  2WAC A;  2GQI A;  4NS5 A;  5IHI A;  3CPW A;  3M4G A;  3MJX A;  4E2F B;  4IUP A;  1D0Z A;  1Q86 C;  2QAZ A;  1KC8 U;  4DBH A;  1Y96 B;  1AWJ A;  3OBW A;  1PNJ A;  1VQP Q;  1N9R A;  3QJY A;  1OX8 A;  1YI2 Q;  3NGP A;  1VQL Q;  4M78 C;  2JS2 A;  4AFQ C;  5GAN 3;  1R77 A;  2DL8 A;  2EQM A;  3JB9 H;  3AHU A;  1M2V B;  4F14 A;  4C5G A;  1VQ7 Q;  1SG5 A;  1IXD A;  2EJG A;  3WXM B;  3CD6 Q;  3JB9 I;  4D8D A;  3OYM A;  3CCQ A;  4A4E A;  5FWB A;  2OAU A;  2KRS A;  4NL2 A;  2E12 A;  1OZ2 A;  2LJ3 A;  4M75 E;  2MWO A;  2COW A;  3G6E A;  3CCV A;  1PC0 A;  1Y7X A;  3OYI A;  1JXO A;  1AD5 A;  2RHY A;  2RF0 A;  4DEY A;  1HXD A;  3HSB A;  2O9V A;  1RAE B;  4OMO A;  1VQ8 Q;  1QVF S;  4A4H A;  2VWF A;  2XIC A;  1N8R R;  3HRU A;  5LJ3 h;  2JJ9 A;  4ANJ A;  4HCC A;  2PZ1 A;  2NLU A;  3OYH A;  2E6N A;  1N5Z A;  1X6O A;  3MCA B;  5GAN 7;  1YJ9 T;  1K1Z A;  2C0O A;  4IUV A;  3CBM A;  2AZS A;  3JCM P;  3VU3 C;  4BB7 A;  2YRD A;  2MF2 A;  3NMZ C;  4ZTJ A;  1K0X A;  2JUF A;  4B6M A;  1TWB A;  2JMA A;  5LJ3 e;  2CRE A;  2EGA A;  2M0O A;  2NWM A;  2BZY A;  2KBT A;  3KFV A;  4PFZ A;  2LNV A;  1K9M R;  2EPD A;  4AFZ C;  3JCM h;  2GCX A;  1Q86 U;  1ABO A;  2DX1 A;  1M90 R;  3OYG A;  1AEY A;  3FJ5 A;  1LVK A;  3CC4 A;  1TUD A;  2SRC A;  2FYK A;  1Q82 U;  4ZN1 A;  1WHK A;  2HCK A;  2LJ1 A;  1HJD A;  3J7A F;  1WHL A;  1X75 C;  3BDU A;  1K4U S;  1VQM Q;  1ZSZ A;  2AZV A;  2HL3 A;  1VQ5 Q;  4II1 A;  2H3J A;  2DTI A;  2YHT A;  3EG1 A;  4AG1 C;  1QVG A;  2RD1 A;  2QEX T;  4F7U E;  3OYN A;  2X4Y A;  4BE2 A;  5HK3 A;  2LQW A;  2KI7 A;  4FYX B;  1UE9 A;  2CH4 W;  1WHH A;  3OSS C;  3VS5 A;  3CCE T;  4XAX B;  2KEA A;  1ZBJ A;  5GJW B;  3V7S A;  3BY7 A;  1WQW A;  1VIF A;  2FRW A;  1M4Z A;  1Z9Z A;  5IHK A;  3A8H B;  1GCP A;  4M78 A;  1G3Y A;  2DRM A;  4VUB A;  5IXF A;  1WI7 A;  3OYD A;  2PUO B;  1QCF A;  1Y0M A;  2LT1 A;  4BI8 B;  4ZTF A;  4PL6 A;  5CR2 A;  3OMG A;  5A0L A;  2CT4 A;  1WJR A;  4M7A A;  1TUG B;  1RI9 A;  2D9T A;  4C8Q A;  4MZM A;  3CC7 A;  4QT7 A;  3VYG A;  5KYX A;  2EBP A;  2LCS A;  1SKU B;  1T3L A;  2EVR A;  1WNL A;  2XID A;  3CCM A;  1MV0 B;  1KHC A;  5HKC A;  2KQW A;  2E70 A;  2K3Y A;  2P4T A;  5KE3 A;  3E1S A;  4Z88 A;  2RQW A;  1YN8 A;  3MEV A;  4CI0 C;  1BI2 A;  1BCO A;  3PMT A; 
#chains in the Genus database with same CATH homology
 3CCV Q;  1VQO Q;  1VQ5 Q;  2OTL Q;  3CCE Q;  3CC4 Q;  2QA4 Q;  1YIT Q;  1YJN Q;  1KD1 R;  3OW2 P;  1VQ7 Q;  2QEX Q;  1YIJ Q;  1M90 R;  3CD6 Q;  1KC8 R;  3G71 Q;  1VQN Q;  1Q82 R;  1VQ8 Q;  1QVG P;  1Q86 R;  3I56 Q;  3CPW P;  1VQ6 Q;  3CC7 Q;  1S72 Q;  1N8R R;  3CCM Q;  3G6E Q;  3CCL Q;  2OTJ Q;  1VQP Q;  3CC2 Q;  1VQ9 Q;  1Q7Y R;  1VQL Q;  1YI2 Q;  3CCS Q;  1QVF P;  3CCQ Q;  3CCJ Q;  3CCR Q;  3CME Q;  1YJ9 Q;  1YJW Q;  1NJI R;  3CCU Q;  3I55 Q;  1W2B P;  1K73 R;  1K8A R;  1KQS P;  1VQK Q;  1M1K R;  1VQM Q;  1K9M R;  3G4S Q;  3CXC P;  1VQ4 Q;  3CMA Q;  1YHQ Q;  1Q81 R;  1JJ2 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...