1YJ9Q

Crystal structure of the mutant 50s ribosomal subunit of haloarcula marismortui containing a three residue deletion in l22
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1yj9Q00
2QA4Q 3G71Q 1N8RR 1KD1R 1K9MR 3I56Q 1YIJQ 1M1KR 1VQ8Q 3CD6Q 3CCVQ 1VQOQ 1VQ6Q 1KC8R 3CCSQ 1S72Q 1VQNQ 3I55Q 1Q7YR 1K8AR 1JJ2P 3CCUQ 1YJWQ 3CMAQ 1M90R 1KQSP 1VQKQ 1VQPQ 1YHQQ 3CCEQ 1QVGP 1Q86R 1NJIR 3CC2Q 1YJNQ 3CCRQ 3CC4Q 2QEXQ 3CXCP 3CCLQ 1VQ5Q 1W2BP 1Q82R 1K73R 3CCJQ 2OTLQ 2OTJQ 3CPWP 1QVFP 1Q81R 1YJ9Q 1VQ9Q 1YI2Q 1VQ7Q 3CCMQ 3CC7Q 3G6EQ 3CMEQ 3OW2P 1VQLQ 3CCQQ 1YITQ 3G4SQ 1VQMQ 1VQ4Q
chains in the Genus database with same CATH superfamily
5HK0A 2K4YA 1OYXA 1ZUKA 1Q86U 1VQ4A 2FPDA 1MV3A 3CC2T 2DL4A 2LRQA 4PJNA 2GNCA 3MPUB 4DOWA 4BI4A 1I81A 4M75C 1UGPB 5KCOA 1Q82C 2RQUA 1Q81R 2EKHA 2RM4A 4CI0C 4KGXB 3U23A 1GRIA 2VKNA 2J06A 2RQRA 2DAQA 4GLMA 4M77F 3I56A 5A0LA 4XU2A 2YRVA 4LDYA 2LVMA 2A08A 5HCKA 1Y0MA 3NTHA 2OAWA 1E6GA 3LLRA 3BFMA 1NPRA 4MMKA 5GAOr 1VQ9Q 5L8RE 2DD4A 1WIEA 3CCVT 2PVOB 1VQ8Q 3G71A 3PIPA 4J7IA 5FU7B 1AZGB 4R56A 3CMAA 4II1A 1WGSA 4XTZA 4E47A 2CP5A 4OP0A 4C8QB 4NS5A 2DO3A 3CCJQ 3CCMT 1I5LA 1H641 3JB9D 1VYTA 2KMTA 1PSFA 1M3AA 4RTXA 5KE2A 3JCMP 3C0CA 4C92E 4BACA 1T3SA 1YIJA 4FSXA 3CCSA 1YHQQ 3NMZC 2RI5A 2KT8A 3ZFJA 2XDDA 3VS6A 5GAN6 1WHHA 2E6ZA 1OOTA 1R0BG 4OMQA 5IN1A 3A98A 4LDWA 3CCQT 3LWHA 1X2KA 4Q5WA 5LJ3e 1AWJA 4IKFA 4M7DE 3ZEHA 3OYGA 1UFFA 2JZ2A 3HRTA 2X4JA 1RI0A 4XU1A 3HTRA 3EG1A 3NPFA 1YN8A 4CC7A 1NJIR 3H6ZA 2QQRA 5GANh 2HZYA 3JCMf 5LJ5f 5LJ5d 2DILA 3PTAA 1KD1U 3TQ7P 2LX9A 1IRXA 2XKOC 2LTOA 4OMFB 3E19A 1BI1A 1QWFA 1VQMQ 3EAEA 2YUQA 3QKJA 3E9FA 3AHUA 2K57A 1XNIA 2E4HA 5IAYA 2KI7A 1RLQC 4D6WA 1EZZB 4C92D 1ZBJA 2H3JA 2AKLA 3RKWA 2X51A 3QIIA 2A28A 5KYWA 3QWXX 2YUNA 4FIBA 5HKCA 2D0QB 1KC8U 2OTLA 3VKIA 2KXCA 1FXXA 1PKTA 4OMLA 4M7DD 3OYNA 3S3NA 3IQLA 4J9BA 3G1JA 3Q1JA 2E3IA 4RUGA 2XD0A 4E2FB 2AT1B 2R57A 4IIOA 2BTTA 1Q82R 4M75G 1YWPA 1G2BA 2L89A 5KYUB 4RTWA 1RLPC 1Y96A 3EFOA 5CKEA 2RHZA 1KQSS 3P8DA 3OYEA 3OYBA 1TUCA 1N6AA 2DVEA 1IO6A 3CCET 5GJVB 1KG1A 1YNZA 3QSUA 2EQUA 2L2PA 2R58A 5KYNA 2GTJA 1T0HA 4M78E 2CP7A 1N5ZA 1WFWA 2AZVA 4O5VA 3G4ST 3CBMA 1OZ2A 5HY6A 3CC7Q 3RIRA 4RG2A 2KXDA 3ZL7C 2COWA 3CD6T 2CH4A 5CCAA 1YITA 2XDBA 5C6SA 2P4RA 2KK4A 4QQGA 1AOJA 3GPLA 4MDWA 2XHCA 3JAME 3MEAA 1YBYA 4EMKB 4BE0A 1TOVA 2LX7A 4XU0A 2YT6A 2IVWA 3CXCP 4XTVA 5L23A 3NTKA 1AHJB 1Y7XA 2JUFA 1TG0A 1QCNA 3LWIA 2JTFA 2QI2A 2NUPB 3EGDB 1SKUB 4JJCA 4PLLA 2HQXA 3NHNA 4EMHA 4PLIA 4OB2B 6AT1B 1EFNA 2HDAA 4JRKA 3EG3A 2VV5A 4JJNK 4N4GA 5J26A 2XDPA 1ZA2B 3CCLA 2JW4A 2RHXA 1VA7A 4M78D 1Q7YU 3G6EA 2L3RA 2DL7A 2KQWA 4M77E 3URGA 4IUUA 4JS5A 1X6GA 2OI3A 2CS7A 2CYZB 2M51A 2YSQA 5CIUA 3ER0A 2F1LA 3MHXA 3SWNC 5CQYA 2E6NA 1UB4A 4LD6A 3OYIA 3OYCA 4NL3A 4E7KA 2HKNA 1PRLC 1WDXA 3CCMQ 2AKKA 4M7DA 2EWNA 1UJ0A 3MKDA 4J8OA 4A53A 5GAOp 2YLBA 4E7IA 4JZ3A 3EFRA 4XTWA 5CVIA 3EG2A 2KAFA 4KT0E 1Y57A 3F70A 3C4SA 1AVZC 3CC4T 3VS3A 4UC4A 2LC4A 3E1SA 1GBQA 3OYYA 1D3BB 2YUOA 1M1GA 1JQQA 3CCQQ 2O88A 1LPLA 4RTVA 3A8GB 3I5RA 1VQ7A 2L5QA 2EKOA 3ZBDA 4DA4A 2O4XA 2XK0A 5CK9A 3FJ5A 3CCUA 4PJJA 3UPUA 3QPHA 4C0ZA 2LQ8A 3OYLA 2EQIA 3JCMh 1XJWB 5GAMd 1QP2A 1G3WA 1G5VA 3M59A 4J9GA 1OU9A 1YI2A 5LL6S 4M7AA 1M1KC 3L2UA 2CZ6B 1PSEA 2PUOB 1E6HA 4D8DA 4BI8B 2MF2A 2HQEA 1FMVA 2MK5A 2KE9A 3LYIA 2W10A 1VQLT 3HPWA 4QQDA 1GFDA 3FLGA 1RAIB 1PG5B 1LNXA 3C94A 3OMCA 4V2SA 3EHQA 1QLYA 4KH1B 4XTYA 1M90C 3DLMA 2CUDA 2RH2A 5A0GA 1IGUA 1WHKA 3HRUA 2EFIA 2EYYA 3X24B 1TTHB 2K6DA 1ZSZA 1K0SA 2ZCFB 2OTJA 4C92B 2DL8A 2DZCA 2KVQG 4JJBA 4M75D 4M7AC 1UGSB 1YCSB 4RKUE 2JS2A 1C1AA 1S72T 3E9GA 2HNIA 5FROA 1TUDA 4B6MA 2ABLA 3CCEQ 1N9SA 1A0NB 1U1SA 2DF6A 5CKHA 1YFNA 1QP3A 3M55A 1VQKA 1B34B 3OYMA 1BIBA 1YCYA 2NLUA 2DA9A 4MZMA 4X1VA 1K73R 1Q81C 2H3EB 2ZGWA 2WSEE 4ZGEB 3G4SQ 3HFOA 1RADB 3HSBA 3CD6Q 3X25B 2E70A 4F16A 1TS9A 2J7IA 1MMDA 2NYSA 2NWMA 1OZ3A 5D6YA 2KY9A 2EQMA 2LMJA 1D1AA 2BE7D 3PFSA 1ZSZC 4ME7A 4IIMA 1OX8A 3CPWP 2DTHA 2HL5C 1D09B 1VQ9A 4JLIA 2EGCA 2RQVA 3LGLA 1K9MC 2VGNA 2PUKB 4Z88A 2X9HA 1AZEA 2QQ9A 3QYGB 1VQ8A 5KYXB 5DLQE 5IXBA 2DXUA 2QGGA 5FRMA 1YJNT 3LH0A 1MMGA 2LQKA 1NZ9A 2OJ2A 2G3RA 2QEXT 5GJWB 1K4US 3CPWA 4LUEA 3CCJA 2JM9A 1X75C 2D6FA 5KYYB 2MIOA 4M7AF 4GY5A 1GCPA 2H8HA 3JCMX 3RR6A 4RG8A 2DEQA 3M58A 3JV3A 3OS1A 4E6RA 3KFVA 2FZCB 4DEYA 1W2BP 1NE8A 1R0CB 3BDLA 4C5IA 1HJDA 1UTIA 3CBPA 3MO8A 1D0YA 3QDRB 1M1KR 3OY9A 2RK1A 4HVVA 4PNOA 1QKXA 4M78B 5CAIA 1NJIC 2EBPA 4F7UG 1IREB 4R55A 3H8ZA 3V7RA 2CREA 3CC4Q 4M75A 1RAAB 2FEIA 4M7AG 2P0QA 2SEMA 4ZN3A 2BZ8A 1KQ1A 1F1BB 1VQMA 1N27A 4A63B 1KJWA 4HCBA 4E7JA 2R5MA 2IPOB 2YRDA 1SF9A 2M16A 4XTXA 2EIFA 1M90R 1RAEB 2Z0WA 5GAN5 2EYQA 4QVCA 2DTIA 3JRZA 5IXFA 2PVGB 4F17A 3I56T 1X6BA 1LVKA 4L59A 2DX1A 2JOYA 3V8KA 2KRMA 1PM3A 1FMWA 1Z9QA 5GAN2 2BE9B 1Q86C 3TSZA 2F2XA 5EG2A 3META 5FU7C 3R6NA 4J9FA 1NLPC 4AG1C 2A36A 2PVDB 3JCMb 4M77B 2JT4A 2F69A 1QW1A 2RHIA 2QA4T 3M0QA 1J3TA 2ROLA 2OX7A 3PVQA 2QQBA 3UA6A 1YJWT 4BDZA 3HP9A 1H8KA 1MMNA 5DY9A 2DLPA 1M2VA 3L2RA 3REAB 3OMGA 5I22A 5GANj 2DRMA 4EIKA 2RQWA 5D6XA 3UWNA 4OMMA 3VV0A 1YIJT 1G3TA 4BB7A 2HCKA 1UHFA 1AT1B 4FW1A 3CCST 1K9MR 3OS5A 1S72Q 1QVFS 1M8MA 5FRNA 1SPKA 4DBRA 2NUTB 2O9SA 1BYMA 4HVUA 2VASA 4XTUA 3EGXA 1BCOA 1Y71A 3M0RA 2RJDA 3CCRA 1MMAA 4IUTA 2DYIA 1OI1A 2DBKA 2J6OA 2DL5A 2FRWA 3QZ9B 2FB7A 1VYVA 2CP0A 3I55T 4EDUA 1RAGB 5FU6C 3M53A 3HRSA 5FW9A 3QZ5B 3UT1A 3UA7A 2XMFA 1VQPA 2DIGA 2O01E 3HHTB 4PFZA 3VYHB 4XK8E 2ZZDA 2VUBA 1BI2A 2LDMA 4EPCA 1NYFA 4M75F 5D7UA 1MHNA 1TUGB 4FSSA 2MYSA 5GMKi 3CXCS 2I0NA 1AWXA 2CUBA 1YJNQ 2OTLT 3JCMd 2QEXQ 1YJ9T 3RKXA 3S6WA 1JJ2S 1KD1C 3TCJA 3J80E 1MNEA 5CO7A 4PK4A 3GF5A 1KSWA 5FWCA 1VQNQ 1W1FA 3REBB 1M2OA 2M02A 2VXFA 5CKBA 2E5QA 2K3YA 2AZSA 2KNBB 4X9DA 1FX7A 1O9SA 3QBYA 1B7TA 4N0AC 4ANJA 2MWPA 4J9HA 2VYTA 1QKWA 2FZGB 2EJGA 4M7AE 1V29B 2GF7A 3RUXA 1WQ7A 2CZ0B 1ZSGA 3THKA 2L3QA 1JXOA 2R5AA 5CQXA 2OAUA 1Q86R 3MP6A 2ZPGB 1ZUYA 2KSSA 3C95A 3VU3C 4WTOB 2CP6A 5HK3A 2DBMA 2DXBA 3EH1A 1QVFP 1MGQA 1ZHIA 5FWBA 3J7AF 1OX9A 4ZGJB 1S1NA 1G3YA 4C8QG 2E3HA 4FM4B 3FC3A 2RD1A 2ZPFB 1BBZA 2RHYA 5IHNA 3RBBB 5GANe 1WXBA 2BIVA 3DB4A 3PE0A 2VWFA 1JBMA 4LUDA 2RB6A 3QUIA 1N8RU 1QVFA 3NGPA 5GMKm 1K8AU 2GGRA 5GMKl 4PJOB 1JRIA 3SFMA 4IUQA 2VC8A 3I56Q 1X27A 1AEYA 4M7AD 3A1PA 3RNJA 2BZYA 5I2MA 1WX6A 2DNUA 2KR3A 3I5SA 2QGFB 3CC2Q 3N5BB 1ACMB 2X4YA 3CCLT 2F2WA 3L2QA 2P84A 3G6ET 2K5FA 3SWNA 4CC4B 2C06A 1JO8A 4K11A 1X2QA 1PC0A 2QA4Q 1QVGS 5GAOl 1U3OA 2J6KA 3SDZA 3HFNA 3GNGA 1VUBA 1JJ2P 1YJWQ 1ZA1B 2PTKA 1MV0B 1XOVA 3M4YA 4WCIA 1BKBA 4E7LA 1C0MA 4QKUA 1K73C 4FW2A 3CXCA 5LJ5j 5GMKj 4J6WA 4IURA 4E7HA 3OS0A 4XU3A 3PGGA 3L2ZA 5GAN3 1VQOT 3PIOA 4KUIA 3BE3A 1YIJQ 5A2QE 4KUDK 4J7FA 3CCVQ 1HK9A 1Q7YC 3CD6A 2HSPA 5LJ3g 1JJ2A 3JCMc 5KYWB 2F2VA 3OSVA 2X4WA 1BIAA 1VQ5T 3S3OA 4JJDA 2LT1A 2KRSA 3M0PA 1TXQA 4A4HA 1WXUA 2HL3A 1BK2A 2EQKA 4L6V5 3PVLA 5M9OA 3CMEA 1KD1R 4VUBA 3KUFA 3A8LB 2YLCA 3VS2A 2Y4YA 3I55Q 5GAOn 1I5OB 4TVRA 2CDTA 4F7UA 3QJYA 1Y96B 1B3QA 2DK3A 4HCKA 1OEBA 1YI2T 3EFOB 2E5KA 1IZ6A 2MPXC 2FZKB 1VIFA 4FT4A 1PKSA 3PT9A 2JNGA 2HKQB 3VS1A 2F5TX 4PJOG 2EYWA 1U06A 5EC7A 3H0FA 1KC8R 1NEGA 4FYYB 4DEXA 3CPWS 2XU8A 1GCQA 1UE9A 1B07A 1UGVA 1WYXA 1E7OA 1I4K1 1WHLA 2OTLQ 3M0SA 3QHSA 4LDUA 4M75E 2VB6A 1YJ9Q 4HA8A 3OYHA 2D9TA 4HVWA 1HXDA 7AT1B 4A4FA 3M57A 2E1HA 3H0IA 1SRMA 3RESA 2A7YA 1QVGP 3OW2S 2FVUA 2OTJT 2XIDA 3JB9I 5CKFA 2E12A 4EMGA 1EIFA 3CC4A 1KHCA 2DYBA 1WJQA 3H41A 1IHVA 1N8RR 1NG2A 1U8RA 4C5HA 1H3HA 5KYYA 1CSKA 2DERA 2JS0A 1VQKT 2MOXA 4F04B 5GAN7 4ATOA 3QJ6A 1T0JA 4DQ2A 1W2BS 3M5AA 3VS0A 4J83A 2DZ9A 1GCQC 4IUVA 1QVGA 3INZA 3PMIA 4Y91A 1WPYA 1TH7A 2QASA 2YHTA 3EG9A 2FYKA 5LJ3f 5LJ3d 1KQ2A 4J5YA 1SEMA 2JMCA 1WZOA 1VQ6T 1N9RA 2IG0A 1PHTA 3ULRB 1SHGA 5IHIA 3TSWA 5GAOq 3A8HB 5KH6A 4JUVA 3A8OB 5LJ5e 5GMKe 3GLXA 4AFSC 4OF1A 2L3SA 4M7DB 2DJQA 1V76A 1UECA 1VQ8T 3VUBA 5AT1B 2RA2A 2E41A 2GQIA 2CSIA 4HKEA 2V26A 4PJMA 1OPLA 1Q7YR 2JN0A 3UDCA 1Q81U 3QO3A 1OULA 1QCOA 4Z02A 1KFZA 8ATCB 3OYDA 4F7UF 3JB9G 3DKMA 3CCLQ 1K9AA 2E64A 4OB3B 2LQWA 2KT1A 1M5Q1 1KK7A 3RERA 2RJCA 2KROA 4HXJA 2O4XB 2V8IA 1D0ZA 1K1ZA 1BB9A 2LJ0A 1WXTA 2JTMA 3H9NA 4AFZC 3LX7A 3VS7A 2GFAA 1V1CA 2EYXA 2EJ9A 1DJ7B 2DM1A 3VYGA 4X34A 2V1QA 1OQKA 2KBTA 1NLOC 4M7AB 2EW3A 5GAN4 5GAMj 2P4TA 4R0KA 3OW2P 3VS5A 1UDLA 3FJPA 1WNLA 4YTLA 2COYA 1VQOQ 3RMSA 4BI3A 3VJPA 3LGFA 3M9QA 1PWTA 2D8JA 2D0NA 1NBEB 1YHQA 1K76A 1O75A 3EG0A 1C6VX 2K3XA 2CGHA 2CZ1B 4MMLA 1M3CA 1VQ5Q 1W6XA 3FIFA 3OW2A 3TEEA 2EAYA 4OMPA 2K9GA 4C92G 1Y07A 3P8HA 3V8LA 1ZSZB 3BW1A 4FYXB 2HSEB 1RACB 2AK5A 2QAZA 2M0YA 4LDVA 2JXBA 9ATCB 1W2BA 2LJ3A 5DLOA 2QEXA 2J6FA 2PQWA 4C0DB 2I2LA 4JPBW 2X4XA 1YI2Q 2ENMA 4M77C 1VQ4T 4M7DG 2MMPA 4C8QA 1ABOA 2FHDA 5IH2A 3JB9H 2X35A 4ESRA 2XICA 1VQNA 2YUPA 1HYOA 3A5ZB 3L42A 4FYVB 4Z8AA 4KBMB 3D7SB 3OA6A 1P92A 1D1CA 5I11A 3OSSC 3M0TA 2QDLA 3BY7A 2W0ZA 4P5NA 1W4SA 4PJLA 3WXMB 3OYKA 1X01A 4JRIA 3KBGA 3MCAB 4FU6A 4Y92A 1IB8A 2ZPBB 2CP3A 5J39A 4CRIA 3VS4A 2RO0A 2RPNA 2V8KA 2HD0A 2PU9B 1NPPA 4ZNXA 3SD4A 4C8QC 1VQLQ 3G71T 5LJ5g 2COZA 2DFUA 2QYZA 1QQJA 5ECAA 1X69A 3M54A 3CMAT 2RI3A 3MP1A 1Q82U 1WJSA 2WACA 1VQKQ 3CCRT 2ED0A 1NEBA 1ZX6A 2KYMA 1UUEA 4RTYA 5LJ3h 3WVEB 3CC7A 1HD3A 4B9WA 3WVDB 4A4KA 1VQ6Q 1VQPT 4C0FA 2PZ1A 4ELYC 3JB9J 1UGRB 4BY6B 4XAXB 4N4IA 1G83A 3CC2A 2JVVA 4LXCA 2K79A 5GAMe 4M78G 3X26B 2C0OA 1I8FA 1ZQ1A 2K2MA 1OU8A 3TREA 1JXMA 1QVPA 3L2WA 3ASKA 1JB0E 4WF2A 5KYUA 4QT7A 1M9SA 4KH0B 2QA4A 1SHFA 1GL5A 1WI7A 4N4HA 2DETA 2P0KA 1YJWA 4M75B 1JU5C 1U5SA 1IHWA 4KGZB 4A54A 1D1BA 2ECZA 1R77A 4XQ3A 3FB9A 4NL2A 3OBYA 4N0AA 1XQHA 2K5IA 2QG9B 3L1AA 3PMTA 3C12A 4C8QF 1PD0A 4J9CA 4PJOA 2JTEA 2LZ6B 3CCVA 2G6FX 2P0PA 2QQSA 2XG8D 2FPFA 3OYJA 2RJFA 4F7UE 1UEBA 4EMKA 1RAFB 2EYZA 3JCMV 2QQAA 3RDVA 2GCXA 2ROTA 4BE1A 1AD5A 3CCMA 4M77G 2DL3A 2ESWA 1JEGA 4MZTA 3JCMW 3TVTA 1U1TA 1KHIA 2NUPA 3EGDA 3I9QA 3I55A 4GLKA 2CT4A 2L3PA 1SRLA 2XI9A 3HL8A 1ABQA 2DJZA 2BUDA 4M4ZA 2DXCA 3KXTA 5IT9E 4DBFA 3FEOA 1M27C 3UF4A 2C0TA 3G7ZA 2DVJA 1SSFA 1RI9A 3EHRA 2Y4XA 2CT3A 2MWOA 3CCQA 3X28B 5FU6B 4PJOC 2LNVA 3CQTA 2KYBA 2ZPEB 4FL6A 2LCLA 2YXYA 1KC8C 4OMOA 3NTIA 2PNIA 1Q95G 3SB2A 2DTOA 2QDYB 1M4ZA 2FG0A 3R6OA 1M2VB 3T9NA 1PD1A 2FRYA 3ME9A 4A4EA 2MI6A 2EGAA 5CR2A 4JDSA 1QCFA 2RJEA 5FLXE 4EMKC 5I2SA 3V7CA 3BDUA 1GXIE 1UG1A 2L8DA 2LCCA 4C5EA 1X43A 1YITT 1ZUUA 1ZBXA 1YJ9A 2K2VA 4KULA 3S3MA 1VQ4Q 2RF0A 3TU4K 1ZLMA 2CKKA 1VOMA 3I35A 1BI0A 2LNHB 3EGXB 4LNPA 2DRKA 3M56A 5D6WA 1XTDA 3QYHB 4DBQA 4AT1B 4DBHA 4OMNA 4HCZA 1CKBA 2NUZA 2LQNA 1TU0B 2DXTA 4OGCA 1D3BA 1N8RC 2WSFE 3AT1B 4QVZA 2VVKA 1K8AC 4HT8A 2GBQA 1NM7A 2DIQA 2MAMA 3FDRA 3RKYA 1VYUA 2EGEA 1I07A 2B8AA 1FYNA 2EJFA 1AWWA 4OVAA 1I1JA 1LCKA 3VRZA 1ARKA 2QTVA 5GAMg 5GAOm 2GQVA 4OB0B 3G71Q 3QDFA 2CH4W 2O2OA 2YDLA 2L0AA 4ZN1A 1RABB 1WQWA 3UATA 3CEYA 1IXDA 2MCNA 1TWBA 3CMAQ 4PJOF 4JZ4A 2BZXA 2HMAA 4BUGA 1UGQB 2ZPIB 4A4GA 3CCEA 3HKSA 3CCRQ 4AG2C 2V1RA 3CMET 1KIKA 4QQ6A 3OS2A 3LW5E 4JRPA 3G4SA 4J9IA 3A8MB 1WA7A 3CCSQ 1K73U 1VQPQ 2AIRB 3J81E 1WHGA 1GBRA 4FT2A 2JM8A 4NOYA 4CC3A 3M0UA 2HBWA 2EPDA 4C0GA 1VQ7T 1R8OB 3GOXA 3OYAA 3JCMQ 5CKDA 2HAXA 4C92A 1IGQA 3CCUT 5C0MA 5AYFA 4FCYA 2QK0A 2KRNA 2M1HA 2YWWA 2LP5A 2B86A 4Y28E 2QXFA 1M8VA 1AWOA 1X6OA 1B34A 1PCXA 3LH5A 2KEAA 4B9XA 1VQOA 2O9VA 1KQSP 1WLPB 2CP2A 3DLLA 1SSHA 2X3WD 1T3LA 2K5LA 1VQ5A 2K7AA 1M1FA 2X3XD 5KCHA 3SHWA 3MP8A 2DMOA 3GP8A 4C8QE 4C92C 4JS4A 3OBWA 4M77D 1FWZA 3X20B 3O5ZA 2Y90A 2VXEA 1KQSA 2CZ7B 2RHUA 3SWNB 5DM7R 1M3BA 5KYXA 4C5GA 5LJ5h 5GMKh 5GAMf 1SG5A 1M1KU 2DKGA 1NYGA 3JB9F 4M7DC 5GANg 2RI2A 4BE2A 4LD9K 4CC2A 1K8AR 2A37A 2YRCA 1W70A 2DD5A 2GTOA 1CKAA 3L2VA 1RUWA 2JMAA 2E65A 2HEQA 1QWEA 2E10A 1Z9ZA 3QG1A 5I21A 4LN2A 1YITQ 1M90U 2LT4A 1D0XA 4C8QD 4MDXA 3MEWA 2C0IA 4RMOA 3NFCA 1PRMC 3JCMe 4DOVA 4ELZC 4D8KA 3VRYA 4M78A 2ZPHB 1VQ9T 4RCCA 1HSQA 1H3ZA 2IIMA 2AHJB 2BKDN 1RL2A 3MEUA 1VQLA 5KE3A 1TSFA 3OQ5A 2LCSA 2O31A 4F7UB 2JJ9A 4J6XA 4C92F 3V7SA 2ATCB 1UHCA 1OV3A 1G3SA 5GAN8 1LJOA 3CCJT 2KGTA 4RTUA 3M4GA 3OYFA 2DEUA 2RMOA 3EGUA 4BD3A 4PKCC 4Z89A 2QTXA 3EFSA 3G6EQ 2ZAEA 4BDYA 2D8HA 3P8BB 4PFPA 2CSQA 4M7DF 4LE9A 4O6JA 4RTZA 1FMKA 4OGEA 3VUZA 4LDXA 3OB9A 1YHQT 1VQ6A 3EH2A 1VIEA 2GFUA 1S72A 2DE0X 4FYWB 4QVDA 8AT1B 3GIBA 4M78C 2WSCE 4OB1B 2HBPA 1K9MU 3PNWC 3CMEQ 1I0CA 1YWOA 4C0DC 4AMCA 2F5KA 4M77A 4PL6A 1OPKA 3MEVA 5J3BA 2EQJA 4PJOE 3JSCA 2LJ1A 2D1XA 2RN8A 1LOJA 2ED1A 3DB3A 5GANf 5GANd 2A3LA 3GNFB 4ZGDB 1VQMT 2RQTA 5A0DA 1PNJA 1VQ7Q 4ORZA 4PFOA 1VQNT 4HCCA 4RTTA 1RAHB 2J05A 2RNAA 4L5GA 1G8XA 1YP5A 4IUPA 3E2UA 3CCUQ 1H92A 4JLGA 1UJYA 1WJRA 3H0HA 3EG9B 5IHKA 2K3BA 1YJNA 2NUTA 2FL7A 3QWYA 4X9CA 3JCMJ 2VGMA 4F14A 5LJ3j 3QXEB 4MZPA 1NJIU 1WHMA 4J6YA 3O8VA 2KDSA 1M30A 4PJOD 4J9DA 3MJXA 2A0FB 3FRNA 1EX4A 3GBQA 2V8JA 1BU1A 4JRQA 1MNDA 2FO0A 4M78F 1BCMA 4QW2A 3CBOA 1BI3A 2DPPB 4HT9A 4KRTA 2M9UA 2HQHA 2FPEA 1GFCA 4ZTFA 4AFQC 3SEMA 2RK2A 1QMCA 4ZTJA 2EVRA 4J9EA 2M0OA 4AFUC 4BY6C 1K0XA 5GAMh 4KGVB 4E7SA 1MUZA 3CC7T 2OTJQ 3CPFA 4E7ZA 4GBQA 3RMQA 4RCBA 3JCMg 1WHJA 2SRCA 3V8JA
chains in the Genus database with same CATH topology
2QA4Q 3G71Q 1N8RR 1KD1R 1K9MR 3I56Q 1YIJQ 1M1KR 1VQ8Q 3CD6Q 3CCVQ 1VQOQ 1VQ6Q 1KC8R 3CCSQ 1S72Q 1VQNQ 3I55Q 1Q7YR 1K8AR 1JJ2P 3CCUQ 1YJWQ 3CMAQ 1M90R 1KQSP 1VQKQ 1VQPQ 1YHQQ 3CCEQ 1QVGP 1Q86R 1NJIR 3CC2Q 1YJNQ 3CCRQ 3CC4Q 2QEXQ 3CXCP 3CCLQ 1VQ5Q 1W2BP 1Q82R 1K73R 3CCJQ 2OTLQ 2OTJQ 3CPWP 1QVFP 1Q81R 1YJ9Q 1VQ9Q 1YI2Q 1VQ7Q 3CCMQ 3CC7Q 3G6EQ 3CMEQ 3OW2P 1VQLQ 3CCQQ 1YITQ 3G4SQ 1VQMQ 1VQ4Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QA4 Q;  3G71 Q;  1N8R R;  1KD1 R;  1K9M R;  3I56 Q;  1YIJ Q;  1M1K R;  1VQ8 Q;  3CD6 Q;  3CCV Q;  1VQO Q;  1VQ6 Q;  1KC8 R;  3CCS Q;  1S72 Q;  1VQN Q;  3I55 Q;  1Q7Y R;  1K8A R;  1JJ2 P;  3CCU Q;  1YJW Q;  3CMA Q;  1M90 R;  1KQS P;  1VQK Q;  1VQP Q;  1YHQ Q;  3CCE Q;  1QVG P;  1Q86 R;  1NJI R;  3CC2 Q;  1YJN Q;  3CCR Q;  3CC4 Q;  2QEX Q;  3CXC P;  3CCL Q;  1VQ5 Q;  1W2B P;  1Q82 R;  1K73 R;  3CCJ Q;  2OTL Q;  2OTJ Q;  3CPW P;  1QVF P;  1Q81 R;  1YJ9 Q;  1VQ9 Q;  1YI2 Q;  1VQ7 Q;  3CCM Q;  3CC7 Q;  3G6E Q;  3CME Q;  3OW2 P;  1VQL Q;  3CCQ Q;  1YIT Q;  3G4S Q;  1VQM Q;  1VQ4 Q; 
#chains in the Genus database with same CATH topology
 5HK0 A;  2K4Y A;  1OYX A;  1ZUK A;  1Q86 U;  1VQ4 A;  2FPD A;  1MV3 A;  3CC2 T;  2DL4 A;  2LRQ A;  4PJN A;  2GNC A;  3MPU B;  4DOW A;  4BI4 A;  1I81 A;  4M75 C;  1UGP B;  5KCO A;  1Q82 C;  2RQU A;  1Q81 R;  2EKH A;  2RM4 A;  4CI0 C;  4KGX B;  3U23 A;  1GRI A;  2VKN A;  2J06 A;  2RQR A;  2DAQ A;  4GLM A;  4M77 F;  3I56 A;  5A0L A;  4XU2 A;  2YRV A;  4LDY A;  2LVM A;  2A08 A;  5HCK A;  1Y0M A;  3NTH A;  2OAW A;  1E6G A;  3LLR A;  3BFM A;  1NPR A;  4MMK A;  5GAO r;  1VQ9 Q;  5L8R E;  2DD4 A;  1WIE A;  3CCV T;  2PVO B;  1VQ8 Q;  3G71 A;  3PIP A;  4J7I A;  5FU7 B;  1AZG B;  4R56 A;  3CMA A;  4II1 A;  1WGS A;  4XTZ A;  4E47 A;  2CP5 A;  4OP0 A;  4C8Q B;  4NS5 A;  2DO3 A;  3CCJ Q;  3CCM T;  1I5L A;  1H64 1;  3JB9 D;  1VYT A;  2KMT A;  1PSF A;  1M3A A;  4RTX A;  5KE2 A;  3JCM P;  3C0C A;  4C92 E;  4BAC A;  1T3S A;  1YIJ A;  4FSX A;  3CCS A;  1YHQ Q;  3NMZ C;  2RI5 A;  2KT8 A;  3ZFJ A;  2XDD A;  3VS6 A;  5GAN 6;  1WHH A;  2E6Z A;  1OOT A;  1R0B G;  4OMQ A;  5IN1 A;  3A98 A;  4LDW A;  3CCQ T;  3LWH A;  1X2K A;  4Q5W A;  5LJ3 e;  1AWJ A;  4IKF A;  4M7D E;  3ZEH A;  3OYG A;  1UFF A;  2JZ2 A;  3HRT A;  2X4J A;  1RI0 A;  4XU1 A;  3HTR A;  3EG1 A;  3NPF A;  1YN8 A;  4CC7 A;  1NJI R;  3H6Z A;  2QQR A;  5GAN h;  2HZY A;  3JCM f;  5LJ5 f;  5LJ5 d;  2DIL A;  3PTA A;  1KD1 U;  3TQ7 P;  2LX9 A;  1IRX A;  2XKO C;  2LTO A;  4OMF B;  3E19 A;  1BI1 A;  1QWF A;  1VQM Q;  3EAE A;  2YUQ A;  3QKJ A;  3E9F A;  3AHU A;  2K57 A;  1XNI A;  2E4H A;  5IAY A;  2KI7 A;  1RLQ C;  4D6W A;  1EZZ B;  4C92 D;  1ZBJ A;  2H3J A;  2AKL A;  3RKW A;  2X51 A;  3QII A;  2A28 A;  5KYW A;  3QWX X;  2YUN A;  4FIB A;  5HKC A;  2D0Q B;  1KC8 U;  2OTL A;  3VKI A;  2KXC A;  1FXX A;  1PKT A;  4OML A;  4M7D D;  3OYN A;  3S3N A;  3IQL A;  4J9B A;  3G1J A;  3Q1J A;  2E3I A;  4RUG A;  2XD0 A;  4E2F B;  2AT1 B;  2R57 A;  4IIO A;  2BTT A;  1Q82 R;  4M75 G;  1YWP A;  1G2B A;  2L89 A;  5KYU B;  4RTW A;  1RLP C;  1Y96 A;  3EFO A;  5CKE A;  2RHZ A;  1KQS S;  3P8D A;  3OYE A;  3OYB A;  1TUC A;  1N6A A;  2DVE A;  1IO6 A;  3CCE T;  5GJV B;  1KG1 A;  1YNZ A;  3QSU A;  2EQU A;  2L2P A;  2R58 A;  5KYN A;  2GTJ A;  1T0H A;  4M78 E;  2CP7 A;  1N5Z A;  1WFW A;  2AZV A;  4O5V A;  3G4S T;  3CBM A;  1OZ2 A;  5HY6 A;  3CC7 Q;  3RIR A;  4RG2 A;  2KXD A;  3ZL7 C;  2COW A;  3CD6 T;  2CH4 A;  5CCA A;  1YIT A;  2XDB A;  5C6S A;  2P4R A;  2KK4 A;  4QQG A;  1AOJ A;  3GPL A;  4MDW A;  2XHC A;  3JAM E;  3MEA A;  1YBY A;  4EMK B;  4BE0 A;  1TOV A;  2LX7 A;  4XU0 A;  2YT6 A;  2IVW A;  3CXC P;  4XTV A;  5L23 A;  3NTK A;  1AHJ B;  1Y7X A;  2JUF A;  1TG0 A;  1QCN A;  3LWI A;  2JTF A;  2QI2 A;  2NUP B;  3EGD B;  1SKU B;  4JJC A;  4PLL A;  2HQX A;  3NHN A;  4EMH A;  4PLI A;  4OB2 B;  6AT1 B;  1EFN A;  2HDA A;  4JRK A;  3EG3 A;  2VV5 A;  4JJN K;  4N4G A;  5J26 A;  2XDP A;  1ZA2 B;  3CCL A;  2JW4 A;  2RHX A;  1VA7 A;  4M78 D;  1Q7Y U;  3G6E A;  2L3R A;  2DL7 A;  2KQW A;  4M77 E;  3URG A;  4IUU A;  4JS5 A;  1X6G A;  2OI3 A;  2CS7 A;  2CYZ B;  2M51 A;  2YSQ A;  5CIU A;  3ER0 A;  2F1L A;  3MHX A;  3SWN C;  5CQY A;  2E6N A;  1UB4 A;  4LD6 A;  3OYI A;  3OYC A;  4NL3 A;  4E7K A;  2HKN A;  1PRL C;  1WDX A;  3CCM Q;  2AKK A;  4M7D A;  2EWN A;  1UJ0 A;  3MKD A;  4J8O A;  4A53 A;  5GAO p;  2YLB A;  4E7I A;  4JZ3 A;  3EFR A;  4XTW A;  5CVI A;  3EG2 A;  2KAF A;  4KT0 E;  1Y57 A;  3F70 A;  3C4S A;  1AVZ C;  3CC4 T;  3VS3 A;  4UC4 A;  2LC4 A;  3E1S A;  1GBQ A;  3OYY A;  1D3B B;  2YUO A;  1M1G A;  1JQQ A;  3CCQ Q;  2O88 A;  1LPL A;  4RTV A;  3A8G B;  3I5R A;  1VQ7 A;  2L5Q A;  2EKO A;  3ZBD A;  4DA4 A;  2O4X A;  2XK0 A;  5CK9 A;  3FJ5 A;  3CCU A;  4PJJ A;  3UPU A;  3QPH A;  4C0Z A;  2LQ8 A;  3OYL A;  2EQI A;  3JCM h;  1XJW B;  5GAM d;  1QP2 A;  1G3W A;  1G5V A;  3M59 A;  4J9G A;  1OU9 A;  1YI2 A;  5LL6 S;  4M7A A;  1M1K C;  3L2U A;  2CZ6 B;  1PSE A;  2PUO B;  1E6H A;  4D8D A;  4BI8 B;  2MF2 A;  2HQE A;  1FMV A;  2MK5 A;  2KE9 A;  3LYI A;  2W10 A;  1VQL T;  3HPW A;  4QQD A;  1GFD A;  3FLG A;  1RAI B;  1PG5 B;  1LNX A;  3C94 A;  3OMC A;  4V2S A;  3EHQ A;  1QLY A;  4KH1 B;  4XTY A;  1M90 C;  3DLM A;  2CUD A;  2RH2 A;  5A0G A;  1IGU A;  1WHK A;  3HRU A;  2EFI A;  2EYY A;  3X24 B;  1TTH B;  2K6D A;  1ZSZ A;  1K0S A;  2ZCF B;  2OTJ A;  4C92 B;  2DL8 A;  2DZC A;  2KVQ G;  4JJB A;  4M75 D;  4M7A C;  1UGS B;  1YCS B;  4RKU E;  2JS2 A;  1C1A A;  1S72 T;  3E9G A;  2HNI A;  5FRO A;  1TUD A;  4B6M A;  2ABL A;  3CCE Q;  1N9S A;  1A0N B;  1U1S A;  2DF6 A;  5CKH A;  1YFN A;  1QP3 A;  3M55 A;  1VQK A;  1B34 B;  3OYM A;  1BIB A;  1YCY A;  2NLU A;  2DA9 A;  4MZM A;  4X1V A;  1K73 R;  1Q81 C;  2H3E B;  2ZGW A;  2WSE E;  4ZGE B;  3G4S Q;  3HFO A;  1RAD B;  3HSB A;  3CD6 Q;  3X25 B;  2E70 A;  4F16 A;  1TS9 A;  2J7I A;  1MMD A;  2NYS A;  2NWM A;  1OZ3 A;  5D6Y A;  2KY9 A;  2EQM A;  2LMJ A;  1D1A A;  2BE7 D;  3PFS A;  1ZSZ C;  4ME7 A;  4IIM A;  1OX8 A;  3CPW P;  2DTH A;  2HL5 C;  1D09 B;  1VQ9 A;  4JLI A;  2EGC A;  2RQV A;  3LGL A;  1K9M C;  2VGN A;  2PUK B;  4Z88 A;  2X9H A;  1AZE A;  2QQ9 A;  3QYG B;  1VQ8 A;  5KYX B;  5DLQ E;  5IXB A;  2DXU A;  2QGG A;  5FRM A;  1YJN T;  3LH0 A;  1MMG A;  2LQK A;  1NZ9 A;  2OJ2 A;  2G3R A;  2QEX T;  5GJW B;  1K4U S;  3CPW A;  4LUE A;  3CCJ A;  2JM9 A;  1X75 C;  2D6F A;  5KYY B;  2MIO A;  4M7A F;  4GY5 A;  1GCP A;  2H8H A;  3JCM X;  3RR6 A;  4RG8 A;  2DEQ A;  3M58 A;  3JV3 A;  3OS1 A;  4E6R A;  3KFV A;  2FZC B;  4DEY A;  1W2B P;  1NE8 A;  1R0C B;  3BDL A;  4C5I A;  1HJD A;  1UTI A;  3CBP A;  3MO8 A;  1D0Y A;  3QDR B;  1M1K R;  3OY9 A;  2RK1 A;  4HVV A;  4PNO A;  1QKX A;  4M78 B;  5CAI A;  1NJI C;  2EBP A;  4F7U G;  1IRE B;  4R55 A;  3H8Z A;  3V7R A;  2CRE A;  3CC4 Q;  4M75 A;  1RAA B;  2FEI A;  4M7A G;  2P0Q A;  2SEM A;  4ZN3 A;  2BZ8 A;  1KQ1 A;  1F1B B;  1VQM A;  1N27 A;  4A63 B;  1KJW A;  4HCB A;  4E7J A;  2R5M A;  2IPO B;  2YRD A;  1SF9 A;  2M16 A;  4XTX A;  2EIF A;  1M90 R;  1RAE B;  2Z0W A;  5GAN 5;  2EYQ A;  4QVC A;  2DTI A;  3JRZ A;  5IXF A;  2PVG B;  4F17 A;  3I56 T;  1X6B A;  1LVK A;  4L59 A;  2DX1 A;  2JOY A;  3V8K A;  2KRM A;  1PM3 A;  1FMW A;  1Z9Q A;  5GAN 2;  2BE9 B;  1Q86 C;  3TSZ A;  2F2X A;  5EG2 A;  3MET A;  5FU7 C;  3R6N A;  4J9F A;  1NLP C;  4AG1 C;  2A36 A;  2PVD B;  3JCM b;  4M77 B;  2JT4 A;  2F69 A;  1QW1 A;  2RHI A;  2QA4 T;  3M0Q A;  1J3T A;  2ROL A;  2OX7 A;  3PVQ A;  2QQB A;  3UA6 A;  1YJW T;  4BDZ A;  3HP9 A;  1H8K A;  1MMN A;  5DY9 A;  2DLP A;  1M2V A;  3L2R A;  3REA B;  3OMG A;  5I22 A;  5GAN j;  2DRM A;  4EIK A;  2RQW A;  5D6X A;  3UWN A;  4OMM A;  3VV0 A;  1YIJ T;  1G3T A;  4BB7 A;  2HCK A;  1UHF A;  1AT1 B;  4FW1 A;  3CCS T;  1K9M R;  3OS5 A;  1S72 Q;  1QVF S;  1M8M A;  5FRN A;  1SPK A;  4DBR A;  2NUT B;  2O9S A;  1BYM A;  4HVU A;  2VAS A;  4XTU A;  3EGX A;  1BCO A;  1Y71 A;  3M0R A;  2RJD A;  3CCR A;  1MMA A;  4IUT A;  2DYI A;  1OI1 A;  2DBK A;  2J6O A;  2DL5 A;  2FRW A;  3QZ9 B;  2FB7 A;  1VYV A;  2CP0 A;  3I55 T;  4EDU A;  1RAG B;  5FU6 C;  3M53 A;  3HRS A;  5FW9 A;  3QZ5 B;  3UT1 A;  3UA7 A;  2XMF A;  1VQP A;  2DIG A;  2O01 E;  3HHT B;  4PFZ A;  3VYH B;  4XK8 E;  2ZZD A;  2VUB A;  1BI2 A;  2LDM A;  4EPC A;  1NYF A;  4M75 F;  5D7U A;  1MHN A;  1TUG B;  4FSS A;  2MYS A;  5GMK i;  3CXC S;  2I0N A;  1AWX A;  2CUB A;  1YJN Q;  2OTL T;  3JCM d;  2QEX Q;  1YJ9 T;  3RKX A;  3S6W A;  1JJ2 S;  1KD1 C;  3TCJ A;  3J80 E;  1MNE A;  5CO7 A;  4PK4 A;  3GF5 A;  1KSW A;  5FWC A;  1VQN Q;  1W1F A;  3REB B;  1M2O A;  2M02 A;  2VXF A;  5CKB A;  2E5Q A;  2K3Y A;  2AZS A;  2KNB B;  4X9D A;  1FX7 A;  1O9S A;  3QBY A;  1B7T A;  4N0A C;  4ANJ A;  2MWP A;  4J9H A;  2VYT A;  1QKW A;  2FZG B;  2EJG A;  4M7A E;  1V29 B;  2GF7 A;  3RUX A;  1WQ7 A;  2CZ0 B;  1ZSG A;  3THK A;  2L3Q A;  1JXO A;  2R5A A;  5CQX A;  2OAU A;  1Q86 R;  3MP6 A;  2ZPG B;  1ZUY A;  2KSS A;  3C95 A;  3VU3 C;  4WTO B;  2CP6 A;  5HK3 A;  2DBM A;  2DXB A;  3EH1 A;  1QVF P;  1MGQ A;  1ZHI A;  5FWB A;  3J7A F;  1OX9 A;  4ZGJ B;  1S1N A;  1G3Y A;  4C8Q G;  2E3H A;  4FM4 B;  3FC3 A;  2RD1 A;  2ZPF B;  1BBZ A;  2RHY A;  5IHN A;  3RBB B;  5GAN e;  1WXB A;  2BIV A;  3DB4 A;  3PE0 A;  2VWF A;  1JBM A;  4LUD A;  2RB6 A;  3QUI A;  1N8R U;  1QVF A;  3NGP A;  5GMK m;  1K8A U;  2GGR A;  5GMK l;  4PJO B;  1JRI A;  3SFM A;  4IUQ A;  2VC8 A;  3I56 Q;  1X27 A;  1AEY A;  4M7A D;  3A1P A;  3RNJ A;  2BZY A;  5I2M A;  1WX6 A;  2DNU A;  2KR3 A;  3I5S A;  2QGF B;  3CC2 Q;  3N5B B;  1ACM B;  2X4Y A;  3CCL T;  2F2W A;  3L2Q A;  2P84 A;  3G6E T;  2K5F A;  3SWN A;  4CC4 B;  2C06 A;  1JO8 A;  4K11 A;  1X2Q A;  1PC0 A;  2QA4 Q;  1QVG S;  5GAO l;  1U3O A;  2J6K A;  3SDZ A;  3HFN A;  3GNG A;  1VUB A;  1JJ2 P;  1YJW Q;  1ZA1 B;  2PTK A;  1MV0 B;  1XOV A;  3M4Y A;  4WCI A;  1BKB A;  4E7L A;  1C0M A;  4QKU A;  1K73 C;  4FW2 A;  3CXC A;  5LJ5 j;  5GMK j;  4J6W A;  4IUR A;  4E7H A;  3OS0 A;  4XU3 A;  3PGG A;  3L2Z A;  5GAN 3;  1VQO T;  3PIO A;  4KUI A;  3BE3 A;  1YIJ Q;  5A2Q E;  4KUD K;  4J7F A;  3CCV Q;  1HK9 A;  1Q7Y C;  3CD6 A;  2HSP A;  5LJ3 g;  1JJ2 A;  3JCM c;  5KYW B;  2F2V A;  3OSV A;  2X4W A;  1BIA A;  1VQ5 T;  3S3O A;  4JJD A;  2LT1 A;  2KRS A;  3M0P A;  1TXQ A;  4A4H A;  1WXU A;  2HL3 A;  1BK2 A;  2EQK A;  4L6V 5;  3PVL A;  5M9O A;  3CME A;  1KD1 R;  4VUB A;  3KUF A;  3A8L B;  2YLC A;  3VS2 A;  2Y4Y A;  3I55 Q;  5GAO n;  1I5O B;  4TVR A;  2CDT A;  4F7U A;  3QJY A;  1Y96 B;  1B3Q A;  2DK3 A;  4HCK A;  1OEB A;  1YI2 T;  3EFO B;  2E5K A;  1IZ6 A;  2MPX C;  2FZK B;  1VIF A;  4FT4 A;  1PKS A;  3PT9 A;  2JNG A;  2HKQ B;  3VS1 A;  2F5T X;  4PJO G;  2EYW A;  1U06 A;  5EC7 A;  3H0F A;  1KC8 R;  1NEG A;  4FYY B;  4DEX A;  3CPW S;  2XU8 A;  1GCQ A;  1UE9 A;  1B07 A;  1UGV A;  1WYX A;  1E7O A;  1I4K 1;  1WHL A;  2OTL Q;  3M0S A;  3QHS A;  4LDU A;  4M75 E;  2VB6 A;  1YJ9 Q;  4HA8 A;  3OYH A;  2D9T A;  4HVW A;  1HXD A;  7AT1 B;  4A4F A;  3M57 A;  2E1H A;  3H0I A;  1SRM A;  3RES A;  2A7Y A;  1QVG P;  3OW2 S;  2FVU A;  2OTJ T;  2XID A;  3JB9 I;  5CKF A;  2E12 A;  4EMG A;  1EIF A;  3CC4 A;  1KHC A;  2DYB A;  1WJQ A;  3H41 A;  1IHV A;  1N8R R;  1NG2 A;  1U8R A;  4C5H A;  1H3H A;  5KYY A;  1CSK A;  2DER A;  2JS0 A;  1VQK T;  2MOX A;  4F04 B;  5GAN 7;  4ATO A;  3QJ6 A;  1T0J A;  4DQ2 A;  1W2B S;  3M5A A;  3VS0 A;  4J83 A;  2DZ9 A;  1GCQ C;  4IUV A;  1QVG A;  3INZ A;  3PMI A;  4Y91 A;  1WPY A;  1TH7 A;  2QAS A;  2YHT A;  3EG9 A;  2FYK A;  5LJ3 f;  5LJ3 d;  1KQ2 A;  4J5Y A;  1SEM A;  2JMC A;  1WZO A;  1VQ6 T;  1N9R A;  2IG0 A;  1PHT A;  3ULR B;  1SHG A;  5IHI A;  3TSW A;  5GAO q;  3A8H B;  5KH6 A;  4JUV A;  3A8O B;  5LJ5 e;  5GMK e;  3GLX A;  4AFS C;  4OF1 A;  2L3S A;  4M7D B;  2DJQ A;  1V76 A;  1UEC A;  1VQ8 T;  3VUB A;  5AT1 B;  2RA2 A;  2E41 A;  2GQI A;  2CSI A;  4HKE A;  2V26 A;  4PJM A;  1OPL A;  1Q7Y R;  2JN0 A;  3UDC A;  1Q81 U;  3QO3 A;  1OUL A;  1QCO A;  4Z02 A;  1KFZ A;  8ATC B;  3OYD A;  4F7U F;  3JB9 G;  3DKM A;  3CCL Q;  1K9A A;  2E64 A;  4OB3 B;  2LQW A;  2KT1 A;  1M5Q 1;  1KK7 A;  3RER A;  2RJC A;  2KRO A;  4HXJ A;  2O4X B;  2V8I A;  1D0Z A;  1K1Z A;  1BB9 A;  2LJ0 A;  1WXT A;  2JTM A;  3H9N A;  4AFZ C;  3LX7 A;  3VS7 A;  2GFA A;  1V1C A;  2EYX A;  2EJ9 A;  1DJ7 B;  2DM1 A;  3VYG A;  4X34 A;  2V1Q A;  1OQK A;  2KBT A;  1NLO C;  4M7A B;  2EW3 A;  5GAN 4;  5GAM j;  2P4T A;  4R0K A;  3OW2 P;  3VS5 A;  1UDL A;  3FJP A;  1WNL A;  4YTL A;  2COY A;  1VQO Q;  3RMS A;  4BI3 A;  3VJP A;  3LGF A;  3M9Q A;  1PWT A;  2D8J A;  2D0N A;  1NBE B;  1YHQ A;  1K76 A;  1O75 A;  3EG0 A;  1C6V X;  2K3X A;  2CGH A;  2CZ1 B;  4MML A;  1M3C A;  1VQ5 Q;  1W6X A;  3FIF A;  3OW2 A;  3TEE A;  2EAY A;  4OMP A;  2K9G A;  4C92 G;  1Y07 A;  3P8H A;  3V8L A;  1ZSZ B;  3BW1 A;  4FYX B;  2HSE B;  1RAC B;  2AK5 A;  2QAZ A;  2M0Y A;  4LDV A;  2JXB A;  9ATC B;  1W2B A;  2LJ3 A;  5DLO A;  2QEX A;  2J6F A;  2PQW A;  4C0D B;  2I2L A;  4JPB W;  2X4X A;  1YI2 Q;  2ENM A;  4M77 C;  1VQ4 T;  4M7D G;  2MMP A;  4C8Q A;  1ABO A;  2FHD A;  5IH2 A;  3JB9 H;  2X35 A;  4ESR A;  2XIC A;  1VQN A;  2YUP A;  1HYO A;  3A5Z B;  3L42 A;  4FYV B;  4Z8A A;  4KBM B;  3D7S B;  3OA6 A;  1P92 A;  1D1C A;  5I11 A;  3OSS C;  3M0T A;  2QDL A;  3BY7 A;  2W0Z A;  4P5N A;  1W4S A;  4PJL A;  3WXM B;  3OYK A;  1X01 A;  4JRI A;  3KBG A;  3MCA B;  4FU6 A;  4Y92 A;  1IB8 A;  2ZPB B;  2CP3 A;  5J39 A;  4CRI A;  3VS4 A;  2RO0 A;  2RPN A;  2V8K A;  2HD0 A;  2PU9 B;  1NPP A;  4ZNX A;  3SD4 A;  4C8Q C;  1VQL Q;  3G71 T;  5LJ5 g;  2COZ A;  2DFU A;  2QYZ A;  1QQJ A;  5ECA A;  1X69 A;  3M54 A;  3CMA T;  2RI3 A;  3MP1 A;  1Q82 U;  1WJS A;  2WAC A;  1VQK Q;  3CCR T;  2ED0 A;  1NEB A;  1ZX6 A;  2KYM A;  1UUE A;  4RTY A;  5LJ3 h;  3WVE B;  3CC7 A;  1HD3 A;  4B9W A;  3WVD B;  4A4K A;  1VQ6 Q;  1VQP T;  4C0F A;  2PZ1 A;  4ELY C;  3JB9 J;  1UGR B;  4BY6 B;  4XAX B;  4N4I A;  1G83 A;  3CC2 A;  2JVV A;  4LXC A;  2K79 A;  5GAM e;  4M78 G;  3X26 B;  2C0O A;  1I8F A;  1ZQ1 A;  2K2M A;  1OU8 A;  3TRE A;  1JXM A;  1QVP A;  3L2W A;  3ASK A;  1JB0 E;  4WF2 A;  5KYU A;  4QT7 A;  1M9S A;  4KH0 B;  2QA4 A;  1SHF A;  1GL5 A;  1WI7 A;  4N4H A;  2DET A;  2P0K A;  1YJW A;  4M75 B;  1JU5 C;  1U5S A;  1IHW A;  4KGZ B;  4A54 A;  1D1B A;  2ECZ A;  1R77 A;  4XQ3 A;  3FB9 A;  4NL2 A;  3OBY A;  4N0A A;  1XQH A;  2K5I A;  2QG9 B;  3L1A A;  3PMT A;  3C12 A;  4C8Q F;  1PD0 A;  4J9C A;  4PJO A;  2JTE A;  2LZ6 B;  3CCV A;  2G6F X;  2P0P A;  2QQS A;  2XG8 D;  2FPF A;  3OYJ A;  2RJF A;  4F7U E;  1UEB A;  4EMK A;  1RAF B;  2EYZ A;  3JCM V;  2QQA A;  3RDV A;  2GCX A;  2ROT A;  4BE1 A;  1AD5 A;  3CCM A;  4M77 G;  2DL3 A;  2ESW A;  1JEG A;  4MZT A;  3JCM W;  3TVT A;  1U1T A;  1KHI A;  2NUP A;  3EGD A;  3I9Q A;  3I55 A;  4GLK A;  2CT4 A;  2L3P A;  1SRL A;  2XI9 A;  3HL8 A;  1ABQ A;  2DJZ A;  2BUD A;  4M4Z A;  2DXC A;  3KXT A;  5IT9 E;  4DBF A;  3FEO A;  1M27 C;  3UF4 A;  2C0T A;  3G7Z A;  2DVJ A;  1SSF A;  1RI9 A;  3EHR A;  2Y4X A;  2CT3 A;  2MWO A;  3CCQ A;  3X28 B;  5FU6 B;  4PJO C;  2LNV A;  3CQT A;  2KYB A;  2ZPE B;  4FL6 A;  2LCL A;  2YXY A;  1KC8 C;  4OMO A;  3NTI A;  2PNI A;  1Q95 G;  3SB2 A;  2DTO A;  2QDY B;  1M4Z A;  2FG0 A;  3R6O A;  1M2V B;  3T9N A;  1PD1 A;  2FRY A;  3ME9 A;  4A4E A;  2MI6 A;  2EGA A;  5CR2 A;  4JDS A;  1QCF A;  2RJE A;  5FLX E;  4EMK C;  5I2S A;  3V7C A;  3BDU A;  1GXI E;  1UG1 A;  2L8D A;  2LCC A;  4C5E A;  1X43 A;  1YIT T;  1ZUU A;  1ZBX A;  1YJ9 A;  2K2V A;  4KUL A;  3S3M A;  1VQ4 Q;  2RF0 A;  3TU4 K;  1ZLM A;  2CKK A;  1VOM A;  3I35 A;  1BI0 A;  2LNH B;  3EGX B;  4LNP A;  2DRK A;  3M56 A;  5D6W A;  1XTD A;  3QYH B;  4DBQ A;  4AT1 B;  4DBH A;  4OMN A;  4HCZ A;  1CKB A;  2NUZ A;  2LQN A;  1TU0 B;  2DXT A;  4OGC A;  1D3B A;  1N8R C;  2WSF E;  3AT1 B;  4QVZ A;  2VVK A;  1K8A C;  4HT8 A;  2GBQ A;  1NM7 A;  2DIQ A;  2MAM A;  3FDR A;  3RKY A;  1VYU A;  2EGE A;  1I07 A;  2B8A A;  1FYN A;  2EJF A;  1AWW A;  4OVA A;  1I1J A;  1LCK A;  3VRZ A;  1ARK A;  2QTV A;  5GAM g;  5GAO m;  2GQV A;  4OB0 B;  3G71 Q;  3QDF A;  2CH4 W;  2O2O A;  2YDL A;  2L0A A;  4ZN1 A;  1RAB B;  1WQW A;  3UAT A;  3CEY A;  1IXD A;  2MCN A;  1TWB A;  3CMA Q;  4PJO F;  4JZ4 A;  2BZX A;  2HMA A;  4BUG A;  1UGQ B;  2ZPI B;  4A4G A;  3CCE A;  3HKS A;  3CCR Q;  4AG2 C;  2V1R A;  3CME T;  1KIK A;  4QQ6 A;  3OS2 A;  3LW5 E;  4JRP A;  3G4S A;  4J9I A;  3A8M B;  1WA7 A;  3CCS Q;  1K73 U;  1VQP Q;  2AIR B;  3J81 E;  1WHG A;  1GBR A;  4FT2 A;  2JM8 A;  4NOY A;  4CC3 A;  3M0U A;  2HBW A;  2EPD A;  4C0G A;  1VQ7 T;  1R8O B;  3GOX A;  3OYA A;  3JCM Q;  5CKD A;  2HAX A;  4C92 A;  1IGQ A;  3CCU T;  5C0M A;  5AYF A;  4FCY A;  2QK0 A;  2KRN A;  2M1H A;  2YWW A;  2LP5 A;  2B86 A;  4Y28 E;  2QXF A;  1M8V A;  1AWO A;  1X6O A;  1B34 A;  1PCX A;  3LH5 A;  2KEA A;  4B9X A;  1VQO A;  2O9V A;  1KQS P;  1WLP B;  2CP2 A;  3DLL A;  1SSH A;  2X3W D;  1T3L A;  2K5L A;  1VQ5 A;  2K7A A;  1M1F A;  2X3X D;  5KCH A;  3SHW A;  3MP8 A;  2DMO A;  3GP8 A;  4C8Q E;  4C92 C;  4JS4 A;  3OBW A;  4M77 D;  1FWZ A;  3X20 B;  3O5Z A;  2Y90 A;  2VXE A;  1KQS A;  2CZ7 B;  2RHU A;  3SWN B;  5DM7 R;  1M3B A;  5KYX A;  4C5G A;  5LJ5 h;  5GMK h;  5GAM f;  1SG5 A;  1M1K U;  2DKG A;  1NYG A;  3JB9 F;  4M7D C;  5GAN g;  2RI2 A;  4BE2 A;  4LD9 K;  4CC2 A;  1K8A R;  2A37 A;  2YRC A;  1W70 A;  2DD5 A;  2GTO A;  1CKA A;  3L2V A;  1RUW A;  2JMA A;  2E65 A;  2HEQ A;  1QWE A;  2E10 A;  1Z9Z A;  3QG1 A;  5I21 A;  4LN2 A;  1YIT Q;  1M90 U;  2LT4 A;  1D0X A;  4C8Q D;  4MDX A;  3MEW A;  2C0I A;  4RMO A;  3NFC A;  1PRM C;  3JCM e;  4DOV A;  4ELZ C;  4D8K A;  3VRY A;  4M78 A;  2ZPH B;  1VQ9 T;  4RCC A;  1HSQ A;  1H3Z A;  2IIM A;  2AHJ B;  2BKD N;  1RL2 A;  3MEU A;  1VQL A;  5KE3 A;  1TSF A;  3OQ5 A;  2LCS A;  2O31 A;  4F7U B;  2JJ9 A;  4J6X A;  4C92 F;  3V7S A;  2ATC B;  1UHC A;  1OV3 A;  1G3S A;  5GAN 8;  1LJO A;  3CCJ T;  2KGT A;  4RTU A;  3M4G A;  3OYF A;  2DEU A;  2RMO A;  3EGU A;  4BD3 A;  4PKC C;  4Z89 A;  2QTX A;  3EFS A;  3G6E Q;  2ZAE A;  4BDY A;  2D8H A;  3P8B B;  4PFP A;  2CSQ A;  4M7D F;  4LE9 A;  4O6J A;  4RTZ A;  1FMK A;  4OGE A;  3VUZ A;  4LDX A;  3OB9 A;  1YHQ T;  1VQ6 A;  3EH2 A;  1VIE A;  2GFU A;  1S72 A;  2DE0 X;  4FYW B;  4QVD A;  8AT1 B;  3GIB A;  4M78 C;  2WSC E;  4OB1 B;  2HBP A;  1K9M U;  3PNW C;  3CME Q;  1I0C A;  1YWO A;  4C0D C;  4AMC A;  2F5K A;  4M77 A;  4PL6 A;  1OPK A;  3MEV A;  5J3B A;  2EQJ A;  4PJO E;  3JSC A;  2LJ1 A;  2D1X A;  2RN8 A;  1LOJ A;  2ED1 A;  3DB3 A;  5GAN f;  5GAN d;  2A3L A;  3GNF B;  4ZGD B;  1VQM T;  2RQT A;  5A0D A;  1PNJ A;  1VQ7 Q;  4ORZ A;  4PFO A;  1VQN T;  4HCC A;  4RTT A;  1RAH B;  2J05 A;  2RNA A;  4L5G A;  1G8X A;  1YP5 A;  4IUP A;  3E2U A;  3CCU Q;  1H92 A;  4JLG A;  1UJY A;  1WJR A;  3H0H A;  3EG9 B;  5IHK A;  2K3B A;  1YJN A;  2NUT A;  2FL7 A;  3QWY A;  4X9C A;  3JCM J;  2VGM A;  4F14 A;  5LJ3 j;  3QXE B;  4MZP A;  1NJI U;  1WHM A;  4J6Y A;  3O8V A;  2KDS A;  1M30 A;  4PJO D;  4J9D A;  3MJX A;  2A0F B;  3FRN A;  1EX4 A;  3GBQ A;  2V8J A;  1BU1 A;  4JRQ A;  1MND A;  2FO0 A;  4M78 F;  1BCM A;  4QW2 A;  3CBO A;  1BI3 A;  2DPP B;  4HT9 A;  4KRT A;  2M9U A;  2HQH A;  2FPE A;  1GFC A;  4ZTF A;  4AFQ C;  3SEM A;  2RK2 A;  1QMC A;  4ZTJ A;  2EVR A;  4J9E A;  2M0O A;  4AFU C;  4BY6 C;  1K0X A;  5GAM h;  4KGV B;  4E7S A;  1MUZ A;  3CC7 T;  2OTJ Q;  3CPF A;  4E7Z A;  4GBQ A;  3RMQ A;  4RCB A;  3JCM g;  1WHJ A;  2SRC A;  3V8J A; 
#chains in the Genus database with same CATH homology
 2QA4 Q;  3G71 Q;  1N8R R;  1KD1 R;  1K9M R;  3I56 Q;  1YIJ Q;  1M1K R;  1VQ8 Q;  3CD6 Q;  3CCV Q;  1VQO Q;  1VQ6 Q;  1KC8 R;  3CCS Q;  1S72 Q;  1VQN Q;  3I55 Q;  1Q7Y R;  1K8A R;  1JJ2 P;  3CCU Q;  1YJW Q;  3CMA Q;  1M90 R;  1KQS P;  1VQK Q;  1VQP Q;  1YHQ Q;  3CCE Q;  1QVG P;  1Q86 R;  1NJI R;  3CC2 Q;  1YJN Q;  3CCR Q;  3CC4 Q;  2QEX Q;  3CXC P;  3CCL Q;  1VQ5 Q;  1W2B P;  1Q82 R;  1K73 R;  3CCJ Q;  2OTL Q;  2OTJ Q;  3CPW P;  1QVF P;  1Q81 R;  1YJ9 Q;  1VQ9 Q;  1YI2 Q;  1VQ7 Q;  3CCM Q;  3CC7 Q;  3G6E Q;  3CME Q;  3OW2 P;  1VQL Q;  3CCQ Q;  1YIT Q;  3G4S Q;  1VQM Q;  1VQ4 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...