1YJ9Q

Crystal structure of the mutant 50s ribosomal subunit of haloarcula marismortui containing a three residue deletion in l22
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1yj9Q00
1K8AR 1VQNQ 3CCMQ 3CCUQ 3CXCP 1VQMQ 3G6EQ 1VQ9Q 3CCEQ 1S72Q 2OTJQ 3I55Q 1VQOQ 3CCSQ 1YJNQ 1VQPQ 1JJ2P 1YI2Q 1W2BP 1VQ5Q 3CD6Q 1YJWQ 1VQLQ 1QVFP 1QVGP 1KQSP 1YIJQ 3CCQQ 1Q86R 3CCJQ 1N8RR 1M1KR 1VQ7Q 1VQKQ 3I56Q 3OW2P 1YHQQ 1VQ6Q 1Q81R 3CCLQ 1Q7YR 1YJ9Q 1M90R 3CC7Q 1KC8R 2QA4Q 3CCRQ 3CPWP 3CMAQ 1YITQ 1VQ4Q 3G4SQ 3CCVQ 1KD1R 3CC2Q 1K73R 1VQ8Q 2OTLQ 3G71Q 3CC4Q 1Q82R 3CMEQ 1NJIR 1K9MR 2QEXQ
chains in the Genus database with same CATH superfamily
1YI2A 3LGLA 4XQ3A 3OYBA 3OW2S 2WACA 3GIBA 3UF4A 1VQPQ 3BE3A 2I0NA 5FROA 5LJ5d 1IB8A 4LDXA 3VS7A 5AT1B 3CCRA 3CCRT 5GAMh 3LWIA 3META 1OPLA 5FW9A 1PRMC 1K73R 1N8RC 3EH1A 4J9GA 4N0AC 4LNPA 1MHNA 2YRVA 3N5BB 3JCMf 4L5GA 1QLYA 1JJ2P 3EFSA 1UDLA 2KMTA 3QWYA 2OI3A 3EGUA 4GBQA 3SWNB 2QDLA 1VYUA 2DL3A 4BY6C 3CMAA 1WI7A 1T0JA 4M77A 3CMAT 4OB3B 1M2OA 4RCBA 2M0OA 3VUBA 2B86A 3V8LA 2D8JA 4C92A 3VS2A 5DY9A 2ZPFB 1U1TA 1C1AA 1I81A 3I5SA 5FLXE 2R5AA 2EBPA 2H3EB 3OYHA 3A8OB 4M4ZA 3CC7Q 2F2XA 5I2SA 4N4HA 2MYSA 2G3RA 2KQWA 2P4RA 2JM9A 1WQ7A 1ZA1B 4QQDA 1RI0A 2GQVA 3LW5E 3HFNA 1YCSB 5FU6C 1ZX6A 5ECAA 2PQWA 4OF1A 4M78D 2K5FA 3MEUA 1FXXA 4M75A 1QVGP 3MP8A 2QQSA 3CCQQ 1PD0A 4C0DB 5GAOn 3BFMA 4F7UA 1TH7A 4DEYA 2RD1A 3FJPA 3PTAA 1MNDA 1RAIB 1YITQ 1HK9A 3NHNA 3NTHA 1M1KC 3JB9F 5IHIA 1ZSZA 2FHDA 2COZA 5IT9E 1UGRB 2DD4A 2VB6A 1G5VA 1KQSP 3C12A 2QQBA 4M7DF 2LQKA 2DIQA 2ZCFB 4M78B 4ZN1A 3CEYA 2JOYA 2CP5A 3M59A 4JLIA 5CVIA 3JCMc 2DJZA 3CC4T 2KXCA 4Y28E 3T9NA 2RH2A 2DMOA 1N9SA 1UUEA 5GAMg 4M7AE 3EHRA 4PJMA 4PJLA 4C8QC 2E41A 1TXQA 2K3BA 3TVTA 1D1BA 4PFPA 4D8DA 1QCFA 2KYMA 2VWFA 2XG8D 1I5OB 4PJOC 1SEMA 4RTYA 3JCMd 1JJ2S 4IUPA 4FYWB 3VJPA 2M02A 3SFMA 2KYBA 4OMNA 3FLGA 1K0SA 4DEXA 2ED0A 1ZQ1A 2XU8A 2A7YA 1XNIA 4V2SA 3S3OA 2EYZA 2RJFA 1PKTA 1T3SA 1Q7YU 1Q81U 1W70A 2E64A 2WSFE 2F1LA 3CCMA 3CCMT 1PKSA 2KE9A 3E9GA 1YNZA 2LCCA 5GAOl 2AZSA 2E5KA 4HT9A 1YJ9A 1QP3A 1YJ9T 3MP6A 1GFCA 3R6OA 3A1PA 3JB9J 1LVKA 5IHKA 4XAXB 1FYNA 2E6NA 5EC7A 2A08A 1QVGS 2CP3A 3MJXA 1HSQA 1BI2A 3JRZA 2X4XA 1WHJA 1Y71A 2K4YA 3OA6A 4DOVA 2O31A 4KGXB 4J9FA 2J7IA 2LTOA 1VQ4A 1VQ4T 1AWXA 4BDZA 2EGCA 1Q82R 1KQSS 4C8QG 2ZZDA 3VS1A 4EMGA 3NTKA 2KVQG 2OAUA 1TUDA 5CK9A 2RN8A 4PJOG 3RKYA 5FRMA 2DKGA 2K3XA 3EGDB 4IUTA 4M77C 1VQ8A 5GANe 1VQ8T 1V1CA 2AHJB 3PIOA 1S72A 1S72T 1BI1A 4BE1A 1KD1U 2LDMA 4WCIA 2ECZA 1OZ2A 5LJ5e 1KC8C 2NUPA 4HCKA 1AHJB 1W2BA 4BB7A 1YHQQ 1G3TA 1Q82C 2LQWA 3JCMV 1RL2A 3QXEB 1X01A 1Q86U 5LJ3f 4BD3A 3GNFB 3MP1A 3SB2A 3M56A 4JLGA 3G4SQ 1TU0B 2M16A 1YP5A 4XTZA 1VQ9T 1GRIA 3CCSA 3CCST 2DE0X 2FPDA 2CZ1B 2L8DA 3HP9A 3VS4A 1YWOA 2MCNA 4EMKB 3CCLT 1SF9A 2BE9B 2D9TA 3LGFA 4DA4A 2FVUA 2DVJA 3BDLA 4M7DE 1PD1A 3EFOA 2EAYA 4RTZA 1JQQA 2RPNA 2RB6A 3JB9D 2M9UA 1Y57A 1H641 1QMCA 1YJWQ 5LJ5h 1IZ6A 4LDYA 2RHUA 2EWNA 2W10A 3M4GA 1NEGA 2IVWA 5A0GA 3RBBB 1M9SA 2DJQA 1TSFA 2CUDA 2HQEA 1QWFA 2NUZA 2EPDA 1BU1A 3X24B 1KK7A 2YT6A 1BK2A 1VQNA 1VQNT 1KIKA 4N4GA 2KRNA 1Y7XA 1O75A 4AFUC 3CD6A 3CD6T 4PLLA 1H92A 2XI9A 2LRQA 2JT4A 3GBQA 3QG1A 4K11A 3M0PA 4PFZA 1PM3A 2DLPA 4LXCA 3OW2A 1WQWA 3E1SA 4M77G 1WGSA 3INZA 3PGGA 3RMQA 1G3WA 2QG9B 3M53A 4Q5WA 3OYKA 6AT1B 3JB9H 3X25B 4GY5A 4R56A 2RO0A 4NL2A 3WXMB 2RA2A 3P8HA 3SD4A 4Y92A 5KYWA 4M7AC 4N4IA 1NBEB 2E10A 1UE9A 3NFCA 3OYLA 2DBMA 1JU5C 2D0QB 3H8ZA 4RG2A 5KYYA 1MNEA 1M1KU 3TREA 3CCVA 2F2VA 3CCVT 2HBWA 1KFZA 1F1BB 1M1GA 1GBRA 3AHUA 4KGVB 3E19A 2JVVA 1YIJA 1N27A 1YIJT 2RF0A 5GAN4 3H41A 5LJ3d 2DNUA 4BY6B 2GNCA 4TVRA 2A3LA 1Y96A 3V8KA 3M58A 1YCYA 1NYFA 4A4EA 4UC4A 3WVEB 2EYXA 1IRXA 3UA7A 2COYA 1WHMA 1QVPA 4ZTFA 2L0AA 5FU7C 2EQMA 3A8HB 4FSSA 4M75F 2OTJT 1B3QA 1M5Q1 4F7UF 1BI0A 4J9IA 3L2UA 3CPFA 1QVFA 4IIOA 2RHYA 1AVZC 5GANg 5GAN2 4L59A 1NE8A 3NGPA 3PNWC 1NYGA 2JUFA 5LJ5g 3X20B 3JCMQ 1X2KA 5FU6B 4A53A 4MDXA 2DRMA 2DF6A 1Q7YC 2KGTA 1VQ5A 1VQ5T 2K79A 2ZPEB 1JEGA 1WDXA 1VQLQ 5KYXB 5D6XA 1P92A 3PIPA 2JN0A 3OYGA 1NLOC 5HCKA 2CKKA 2R57A 2BE7D 2VV5A 4M7AG 2HBPA 4BI3A 5DM7R 4ANJA 1K1ZA 1RAGB 4A4GA 2XDBA 1GCPA 4DBRA 2P0QA 3C4SA 1SSFA 5GMKj 1QP2A 2D8HA 3TSWA 3OB9A 4D6WA 2QA4Q 4AFSC 1E6HA 2GFUA 3M54A 2CT3A 1FX7A 2EYWA 3RMSA 5IXFA 2HKNA 2SEMA 2OTLA 2OTLT 3L1AA 4OGEA 3QPHA 1UEBA 1W4SA 1H3HA 3EGXB 1YJNA 1YJNT 1TUCA 1KHIA 4JZ3A 2YUOA 4OB2B 1JJ2A 4A4HA 3UT1A 3TSZA 4FSXA 3OY9A 1Q95G 3J81E 4OMFB 1DJ7B 4JJCA 4LUEA 2O88A 3M0UA 1WXUA 4DQ2A 3OYCA 2LZ6B 4JUVA 2DXUA 4MMKA 3FB9A 2LNVA 2DO3A 4LDVA 2FL7A 2NYSA 5C0MA 2FB7A 3HL8A 1KD1C 5LJ3j 3CBPA 2DFUA 1T3LA 2ABLA 4HCBA 2YLBA 1MMDA 2RNAA 3AT1B 3OYEA 4JRIA 3SHWA 4M7DC 3VS3A 2JM8A 2DTIA 2QEXA 2QEXT 1Q86C 5GAN5 1V76A 1NJIR 2YRDA 2CUBA 2P0PA 1YI2T 4F04B 1Q82U 1QVGA 1B34A 3CBOA 1VYVA 4QW2A 2HCKA 4M77E 2O01E 1AT1B 3PE0A 4HKEA 1M2VA 3G71Q 2D0NA 1KG1A 4OVAA 1UJ0A 2CYZB 1R0BG 2K2MA 3DB3A 4M77D 4J8OA 4C92E 1KQSA 3SWNA 5CAIA 3LLRA 4GLMA 4R0KA 1M27C 4BE0A 1X6BA 5CQXA 4C92D 1JRIA 5KE3A 2JZ2A 2V8JA 4LUDA 2LX9A 2MWOA 3ME9A 3OYAA 2MAMA 3M0SA 5GMKe 2X4YA 3EG9B 5CKBA 3QHSA 1MMNA 3TQ7P 1QWEA 4M75E 2LVMA 1K73C 2JXBA 5CKEA 1HYOA 4M77B 3OYMA 1I0CA 2X35A 1TG0A 5GAOq 4XTVA 1ZHIA 1UJYA 1WXTA 2FZGB 2X9HA 3H9NA 4BI4A 4RCCA 2LT4A 4C92B 4E7SA 1VQOQ 2LJ0A 3CPWS 3RNJA 4J7IA 5I21A 1BB9A 3JB9G 1IREB 2PTKA 4RTTA 1O9SA 1FMKA 1TUGB 4M7DG 2KI7A 2V1QA 2CS7A 3IQLA 1VIFA 2FZKB 3M9QA 2CREA 2LC4A 3QSUA 5HK0A 4LDWA 3ZBDA 2C0TA 1RAFB 4FYYB 5LJ3e 2J06A 5GMKm 1YHQA 3QUIA 1VQ6A 1VQ6T 1GCQA 2YDLA 4QVDA 4QKUA 3PVQA 2CP2A 2EJFA 2VGNA 3ZFJA 4KT0E 2QXFA 4M78A 4B6MA 2QAZA 2DL7A 3G4SA 1IHVA 1QKWA 4Y91A 4J83A 4R55A 3JCMb 3GPLA 4WF2A 5KYNA 1BIBA 1VQMQ 5HY6A 3CXCP 1RACB 3L2ZA 1ZSZB 2EQKA 2FO0A 3DB4A 2SRCA 3TU4K 3RKWA 2CH4A 5KYUB 4M7AD 3VU3C 2E3IA 2O4XB 3PMIA 8AT1B 2M0YA 5GAMf 3CC2Q 4FT2A 2XMFA 2DAQA 4IUUA 2O9SA 3OQ5A 1ZUYA 1YJWA 1WJQA 1WPYA 1K0XA 1VQ7A 1VQ7T 1OU9A 3J7AF 2R58A 3GOXA 3VUZA 1N6AA 2AKKA 3DLLA 1BKBA 3ZEHA 4C0ZA 3LH0A 1ZUKA 4BE2A 1WYXA 4DBFA 2FYKA 2F5TX 5GAN8 4FU6A 2HDAA 2K7AA 4M7AB 3L2RA 3G6EQ 2KT1A 4C5IA 4B9XA 2PVDB 3JB9I 1G2BA 3QYGB 5HKCA 1U1SA 4KRTA 3CCRQ 2DZCA 2P84A 3DLMA 2RM4A 4PJNA 3F70A 2JS2A 4ORZA 2EFIA 3MPUB 1OPKA 1D0XA 2I2LA 2BUDA 3UDCA 4ELZC 4F17A 1SG5A 4OP0A 4E7HA 2FRWA 1OI1A 2E65A 2HL3A 5GAN3 1XQHA 2HKQB 2ROTA 4FIBA 2Y4YA 4OMQA 4YTLA 2G6FX 5FU7B 3CMAQ 2VVKA 2XHCA 4WTOB 4CC4B 5I2MA 1SRLA 2YRCA 4XU2A 1X6OA 5A0LA 2GBQA 5IHNA 3UATA 1N9RA 1MMAA 1QQJA 2YLCA 1M90R 2JNGA 3EGDA 1BI3A 1D3BA 5D6WA 2VKNA 3CXCS 1BYMA 2W0ZA 3E2UA 1RAEB 2V8KA 2DM1A 1CKAA 2IG0A 4C92C 1BBZA 3UPUA 1R77A 4E7KA 2DL4A 2BZ8A 2L5QA 2COWA 1WHHA 4HT8A 5GAMd 1RI9A 4ZGJB 2EQJA 2YUQA 3WVDB 1OX8A 4JJDA 4C8QF 2KDSA 5L8RE 1LOJA 1MV0B 5LJ3g 2ED1A 3VS0A 3FC3A 4OMMA 2YUNA 5EG2A 3EAEA 1M90C 3EG3A 1VQLA 4PJOF 3HKSA 4KUIA 2NUPB 2HQHA 4CC2A 1PCXA 2F69A 1I5LA 1RAHB 4EMKA 3VRYA 2R5MA 2QTXA 4M75C 2EJGA 1S1NA 4OMOA 3OYNA 2CH4W 1WIEA 1UTIA 5GANh 3CC4Q 3OYYA 5GAOr 2ZPIB 1K8AR 3OSSC 1JBMA 1K76A 4RUGA 1NJIU 4J6YA 4M7DD 3I56A 3I56T 1ZSZC 2EGEA 1AZEA 1G3YA 1IGQA 2L3PA 3G1JA 2DPPB 2JTEA 3HTRA 2VUBA 2HSPA 3ER0A 4P5NA 1I4K1 3L42A 2FPFA 4C5GA 5KH6A 3CMEA 3CMET 1IXDA 2E4HA 3EG1A 4X9DA 4XK8E 2KSSA 2CP7A 2K5IA 2KXDA 2OAWA 1K73U 2LCSA 3QJ6A 2EJ9A 3FEOA 2LX7A 4IUQA 2K5LA 2NUTA 3EFRA 3GP8A 4M7DB 3JCMP 3LH5A 2LMJA 1G8XA 2DD5A 1VA7A 5CKHA 3CCUA 3CCUT 3CCEA 2X4WA 3CCET 2Y4XA 4C92G 3OS5A 3RR6A 3CCMQ 4A4KA 4AMCA 3CCJA 2CSQA 3CCJT 1C0MA 1M8MA 1VQKQ 2QGFB 4ZGDB 4HVUA 1YJ9Q 1MUZA 4PLIA 1UGVA 4N0AA 1PRLC 3C0CA 3DKMA 1UGQB 2JMAA 2AT1B 1AOJA 4FYXB 1VQPA 1VQPT 1WHKA 4CRIA 2EQIA 5I22A 3I55Q 4M75G 2BZYA 2YHTA 1NEBA 4LD6A 4F7UG 2F2WA 1HXDA 4J9EA 1UHFA 1G83A 3RUXA 4NL3A 5GAMj 1KSWA 2DL5A 3JCMe 1ZSGA 3HFOA 2BTTA 3MO8A 1VQ4Q 4BUGA 2ROLA 1ZUUA 4QVCA 1KJWA 2CP0A 2P0KA 2KEAA 4PKCC 2MMPA 4L6V5 4X34A 3GF5A 3TEEA 4KBMB 4ELYC 4E7JA 2EVRA 1Q81R 3A5ZB 4JJNK 2QASA 3Q1JA 2L3SA 3G7ZA 1VQ8Q 2EIFA 2PU9B 2DK3A 3JCMW 3S3MA 3FJ5A 2MK5A 2O2OA 2EYQA 1IHWA 3VS5A 1S72Q 2CP6A 4M78F 4CI0C 5KYXA 3O8VA 4OB0B 1K9AA 3A98A 3CC7A 3CC7T 1JB0E 4X9CA 3HRUA 1Z9ZA 5LJ5f 1JXMA 4Z8AA 2ZPHB 1WLPB 3JCMh 1LCKA 2VC8A 1OV3A 4J6WA 2P4TA 1VQOA 3THKA 1TTHB 2PUOB 1VQ9Q 2H3JA 3CCQA 3CCQT 1WJRA 3CCSQ 1M30A 2PZ1A 5GAN6 5C6SA 1U06A 3QZ9B 3CCLQ 3OYDA 1YITA 2RI3A 1YITT 2RJCA 2GQIA 4AT1B 4A54A 1Z9QA 4C8QA 1K9MR 2D1XA 3E9FA 1PNJA 3FDRA 4J6XA 5DLQE 3GNGA 4RMOA 3KFVA 1XJWB 2CSIA 2FZCB 2XK0A 3JAME 2EKHA 4RTWA 1NG2A 4PJOA 2K57A 2MPXC 3CPWP 4XU1A 3NPFA 4KH1B 1M3CA 2E1HA 4EDUA 1SPKA 2AK5A 2DRKA 3BY7A 2RQUA 4KH0B 1HD3A 3FRNA 1WA7A 2GTOA 2L89A 3RKXA 1VQNQ 4C5EA 2DZ9A 1ZLMA 2BZXA 3CD6Q 1VOMA 1WHLA 2LQNA 2C0OA 3MHXA 3OS1A 5GAMe 5LL6S 2KT8A 2KRMA 4NOYA 3M5AA 2FRYA 2C06A 2HZYA 3VKIA 1UB4A 1AD5A 1E6GA 1YN8A 2ESWA 5J3BA 4JJBA 3ULRB 3QYHB 4J9BA 5GMKi 1PSEA 2CZ7B 2KY9A 4EIKA 1N8RR 4J9CA 4XU3A 4ZGEB 3PFSA 1JO8A 1ZBJA 1M1FA 3LWHA 2RQTA 4QQGA 3I35A 1ZBXA 3UA6A 3RIRA 4J9DA 4QT7A 1M90U 4MZPA 1FMWA 3CCVQ 2EW3A 1JXOA 1R0CB 5CCAA 4EPCA 3I5RA 2V1RA 4FL6A 2DX1A 4FW2A 1SHFA 4E47A 1YIJQ 2RK1A 1B34B 1QCNA 3JCMg 4QQ6A 1VUBA 3URGA 2XIDA 1NJIC 3CBMA 3QO3A 2YSQA 1OULA 2RHZA 2LP5A 4KULA 4ATOA 4NS5A 1M2VB 2O9VA 4CC3A 3HRTA 3LX7A 5KCHA 3ASKA 4O5VA 3CXCA 3EG9A 2OTJQ 3MCAB 5IAYA 2QK0A 2ZPBB 3KUFA 4FCYA 3VYHB 4II1A 2PVOB 4F7UE 4JS5A 1X2QA 2RMOA 2NLUA 2ZAEA 4M75D 2K3YA 1WNLA 3RERA 2HEQA 5CQYA 4OB1B 1VQ5Q 1K8AU 2MWPA 4Z02A 4FW1A 1M1KR 2CZ6B 3JV3A 2DEUA 3NTIA 4JDSA 1NM7A 4LDUA 2J05A 1EIFA 4M78E 3A8LB 2DILA 1RAAB 2KNBB 2GCXA 1VYTA 4HVVA 1QVFS 2Z0WA 4DBHA 2K9GA 2PVGB 2AZVA 2CGHA 5KCOA 4HCZA 2ZPGB 5GMKh 2JMCA 1YHQT 2VXFA 4AFQC 4M75B 2RI2A 1M3AA 3VS6A 2H8HA 4F7UB 3G4ST 3CQTA 2LNHB 2BKDN 4RTXA 3S3NA 1ARKA 3QIIA 2OTLQ 2RK2A 3MKDA 2MF2A 3MEVA 2WSCE 1I07A 1RADB 2V26A 3L2VA 1YJNQ 3H0FA 4BACA 5KYUA 2OJ2A 4J5YA 3JSCA 3KBGA 3OBYA 2O4XA 4AFZC 3CC4A 3KXTA 5CR2A 1I8FA 5A0DA 1WJSA 5GJWB 3JCMJ 5GANj 3U23A 4KGZB 5GAOm 1YJWT 2J6OA 4XTUA 4C0GA 4RKUE 1NPPA 2LCLA 2ATCB 2VXEA 3OS0A 3PVLA 5LJ3h 5GMKl 3LYIA 1IGUA 4E6RA 5LJ5j 4ZTJA 1YFNA 5D6YA 5GJVB 1W6XA 1PG5B 3QWXX 2E3HA 3BW1A 5M9OA 4M7AA 2QEXQ 4IURA 4B9WA 1UG1A 1D1AA 3I9QA 2BIVA 3C94A 3OMCA 2PUKB 1YI2Q 1D0ZA 5FWBA 3ZL7C 1CKBA 5KE2A 1X6GA 2LJ3A 1IO6A 3EH2A 3R6NA 4RG8A 4ESRA 3P8DA 3M57A 2XKOC 1ZA2B 4J9HA 4QVZA 2VYTA 2L3RA 4E7ZA 2FPEA 2DYIA 1QKXA 3A8GB 4LN2A 2JS0A 3VYGA 4GLKA 3X26B 4IUVA 2HD0A 4E7LA 1VQKA 1VQKT 1BCMA 4C5HA 1I1JA 3VRZA 1X75C 1FWZA 3PT9A 4PNOA 4DOWA 2QDYB 1K4US 2LT1A 1AZGB 1VIEA 1GL5A 1LPLA 2DERA 3QZ5B 2YWWA 4MMLA 1EFNA 2DXTA 1X43A 3C95A 2M51A 5D7UA 3I55A 3I55T 2VGMA 3QDFA 2XICA 3UWNA 1BCOA 4MZMA 1SKUB 1NLPC 1D1CA 5I11A 1H3ZA 3SWNC 3J80E 1KC8R 4MDWA 2KK4A 2RHIA 4AG1C 1Y07A 4AG2C 3REBB 1M8VA 2C0IA 1N5ZA 2GGRA 1TWBA 3OYIA 1PWTA 2KBTA 1TOVA 2D6FA 1K9MU 3V8JA 4OGCA 1SRMA 3H6ZA 1G3SA 2K2VA 1LNXA 2FEIA 4OMPA 1D3BB 1U5SA 1ABQA 4BI8B 2XDPA 3QJYA 1T0HA 2X4JA 3HHTB 2M1HA 2RQRA 2HSEB 2EGAA 2RHXA 1OX9A 2QI2A 2QQAA 2YUPA 3V7CA 2E6ZA 1VQLT 1CSKA 2FG0A 2AIRB 1VQ6Q 4C0DC 4HVWA 1EX4A 1WHGA 1AWWA 1XTDA 2KAFA 1RABB 2L3QA 3EG0A 1VQ9A 9ATCB 5IH2A 3QBYA 2E12A 3VV0A 1NZ9A 1FMVA 1OZ3A 1OOTA 2KROA 1V29B 3CCLA 3M4YA 3JCMX 1ACMB 4XTXA 2Y90A 2QA4T 2QA4A 1GCQC 5AYFA 1N8RU 1A0NB 1B7TA 1AWJA 2MIOA 1J3TA 1UFFA 4M78C 3EHQA 1R8OB 3EFOB 3SDZA 2QQRA 2F5KA 3L2WA 5CIUA 5CO7A 2QTVA 4D8KA 3V7SA 2AKLA 1YBYA 3V7RA 4JRKA 1YWPA 1VQ7Q 2X51A 4FM4B 2EYYA 3H0IA 2GFAA 1K8AC 1WZOA 5GAOp 4M7DA 1WX6A 2RQVA 2KR3A 3RESA 2RJEA 2WSEE 5FWCA 2DA9A 1QCOA 1GXIE 5DLOA 1D09B 2ZGWA 4LD9K 3OYFA 7AT1B 1W2BP 2DXBA 2JTFA 4A4FA 2JTMA 4Z88A 4E7IA 2X3XD 3D7SB 4C0FA 1D0YA 1KHCA 2NUTB 4CC7A 1Y0MA 2CT4A 1OYXA 1NPRA 4ME7A 2IPOB 3RDVA 2XDDA 2MI6A 2RQWA 2LQ8A 1LJOA 1UECA 3OBWA 3OYJA 4JS4A 1BIAA 3O5ZA 1C6VX 2X3WD 1M4ZA 2E70A 4M77F 5KYWB 4Z89A 2A0FB 2JJ9A 5A2QE 4KUDK 2RI5A 1WXBA 2HQXA 4DBQA 3MEWA 3BDUA 2CZ0B 4PL6A 4HA8A 5KYYB 4C92F 4PK4A 3QKJA 1U3OA 3G71A 3G71T 2L2PA 2HMAA 1X69A 4VUBA 4X1VA 3OSVA 4FYVB 1MGQA 2DIGA 3HRSA 2DTHA 1GFDA 3S6WA 4HXJA 2VASA 1KQ2A 1Q7YR 4M78G 4RTUA 2DVEA 2LJ1A 2QQ9A 1Y96B 4MZTA 3CPWA 1SSHA 3REAB 3L2QA 2YXYA 3FIFA 3HSBA 2PNIA 3TCJA 2HAXA 2DXCA 1OQKA 2OTJA 2QGGA 2KRSA 4A63B 5L23A 5IXBA 2HL5C 3MEAA 1OEBA 4PFOA 4HCCA 5GANf 4ZNXA 5FRNA 3OW2P 1MV3A 5HK3A 2J6KA 2QYZA 3P8BB 1GBQA 2ENMA 2E5QA 3M0RA 8ATCB 3GLXA 2B8AA 1AEYA 1E7OA 2JW4A 2DETA 1Q81C 1VQOT 4C8QE 1KQ1A 5CKDA 4FT4A 5J39A 1EZZB 1XOVA 4IKFA 1MMGA 2A36A 2IIMA 1PC0A 4O6JA 4PJJA 4RTVA 4IIMA 4C8QD 4PJOE 3OMGA 1UGSB 4F16A 3PMTA 1OU8A 1W2BS 3NMZC 4PJOD 3EGXA 1AWOA 2V8IA 4XU0A 1X27A 2A37A 1PSFA 2EQUA 4ZN3A 2DTOA 3M55A 2DL8A 2DEQA 3I56Q 4EMKC 1H8KA 2J6FA 4M7AF 1SHGA 1UGPB 3SEMA 2XD0A 2OX7A 1KD1R 1VQMA 3M0TA 4JRQA 3CMEQ 1VQMT 4C8QB 4F14A 5CKFA 2CDTA 2RJDA 4XTYA 2DBKA 4JRPA 4BDYA 2GTJA 1RLQC 4E2FB 5IN1A 1QVFP 1WFWA 5GAN7 1M3BA 2A28A 1Q86R 3M0QA 4PJOB 1K9MC 1RUWA 1PHTA 1HJDA 3CC2A 3CC2T 4EMHA 1U8RA 1RLPC 5J26A 3QDRB 2K6DA 3EG2A 4JPBW 2NWMA 3CCUQ 4JZ4A 3CCEQ 4J7FA 3H0HA 1QW1A 3HPWA 2EKOA 1TS9A 2GF7A 3A8MB 3CCJQ 1ABOA 1B07A 3X28B 2HNIA 1W1FA 3OS2A 2MOXA 1UHCA 4OMLA 4XTWA 4LE9A 1KC8U 2DYBA 5GANd 3G6EA 3G6ET
chains in the Genus database with same CATH topology
1K8AR 1VQNQ 3CCMQ 3CCUQ 3CXCP 1VQMQ 3G6EQ 1VQ9Q 3CCEQ 1S72Q 2OTJQ 3I55Q 1VQOQ 3CCSQ 1YJNQ 1VQPQ 1JJ2P 1YI2Q 1W2BP 1VQ5Q 3CD6Q 1YJWQ 1VQLQ 1QVFP 1QVGP 1KQSP 1YIJQ 3CCQQ 1Q86R 3CCJQ 1N8RR 1M1KR 1VQ7Q 1VQKQ 3I56Q 3OW2P 1YHQQ 1VQ6Q 1Q81R 3CCLQ 1Q7YR 1YJ9Q 1M90R 3CC7Q 1KC8R 2QA4Q 3CCRQ 3CPWP 3CMAQ 1YITQ 1VQ4Q 3G4SQ 3CCVQ 1KD1R 3CC2Q 1K73R 1VQ8Q 2OTLQ 3G71Q 3CC4Q 1Q82R 3CMEQ 1NJIR 1K9MR 2QEXQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K8A R;  1VQN Q;  3CCM Q;  3CCU Q;  3CXC P;  1VQM Q;  3G6E Q;  1VQ9 Q;  3CCE Q;  1S72 Q;  2OTJ Q;  3I55 Q;  1VQO Q;  3CCS Q;  1YJN Q;  1VQP Q;  1JJ2 P;  1YI2 Q;  1W2B P;  1VQ5 Q;  3CD6 Q;  1YJW Q;  1VQL Q;  1QVF P;  1QVG P;  1KQS P;  1YIJ Q;  3CCQ Q;  1Q86 R;  3CCJ Q;  1N8R R;  1M1K R;  1VQ7 Q;  1VQK Q;  3I56 Q;  3OW2 P;  1YHQ Q;  1VQ6 Q;  1Q81 R;  3CCL Q;  1Q7Y R;  1YJ9 Q;  1M90 R;  3CC7 Q;  1KC8 R;  2QA4 Q;  3CCR Q;  3CPW P;  3CMA Q;  1YIT Q;  1VQ4 Q;  3G4S Q;  3CCV Q;  1KD1 R;  3CC2 Q;  1K73 R;  1VQ8 Q;  2OTL Q;  3G71 Q;  3CC4 Q;  1Q82 R;  3CME Q;  1NJI R;  1K9M R;  2QEX Q; 
#chains in the Genus database with same CATH topology
 1YI2 A;  3LGL A;  4XQ3 A;  3OYB A;  3OW2 S;  2WAC A;  3GIB A;  3UF4 A;  1VQP Q;  3BE3 A;  2I0N A;  5FRO A;  5LJ5 d;  1IB8 A;  4LDX A;  3VS7 A;  5AT1 B;  3CCR A;  3CCR T;  5GAM h;  3LWI A;  3MET A;  1OPL A;  5FW9 A;  1PRM C;  1K73 R;  1N8R C;  3EH1 A;  4J9G A;  4N0A C;  4LNP A;  1MHN A;  2YRV A;  3N5B B;  3JCM f;  4L5G A;  1QLY A;  1JJ2 P;  3EFS A;  1UDL A;  2KMT A;  3QWY A;  2OI3 A;  3EGU A;  4GBQ A;  3SWN B;  2QDL A;  1VYU A;  2DL3 A;  4BY6 C;  3CMA A;  1WI7 A;  1T0J A;  4M77 A;  3CMA T;  4OB3 B;  1M2O A;  4RCB A;  2M0O A;  3VUB A;  2B86 A;  3V8L A;  2D8J A;  4C92 A;  3VS2 A;  5DY9 A;  2ZPF B;  1U1T A;  1C1A A;  1I81 A;  3I5S A;  5FLX E;  2R5A A;  2EBP A;  2H3E B;  3OYH A;  3A8O B;  4M4Z A;  3CC7 Q;  2F2X A;  5I2S A;  4N4H A;  2MYS A;  2G3R A;  2KQW A;  2P4R A;  2JM9 A;  1WQ7 A;  1ZA1 B;  4QQD A;  1RI0 A;  2GQV A;  3LW5 E;  3HFN A;  1YCS B;  5FU6 C;  1ZX6 A;  5ECA A;  2PQW A;  4OF1 A;  4M78 D;  2K5F A;  3MEU A;  1FXX A;  4M75 A;  1QVG P;  3MP8 A;  2QQS A;  3CCQ Q;  1PD0 A;  4C0D B;  5GAO n;  3BFM A;  4F7U A;  1TH7 A;  4DEY A;  2RD1 A;  3FJP A;  3PTA A;  1MND A;  1RAI B;  1YIT Q;  1HK9 A;  3NHN A;  3NTH A;  1M1K C;  3JB9 F;  5IHI A;  1ZSZ A;  2FHD A;  2COZ A;  5IT9 E;  1UGR B;  2DD4 A;  2VB6 A;  1G5V A;  1KQS P;  3C12 A;  2QQB A;  4M7D F;  2LQK A;  2DIQ A;  2ZCF B;  4M78 B;  4ZN1 A;  3CEY A;  2JOY A;  2CP5 A;  3M59 A;  4JLI A;  5CVI A;  3JCM c;  2DJZ A;  3CC4 T;  2KXC A;  4Y28 E;  3T9N A;  2RH2 A;  2DMO A;  1N9S A;  1UUE A;  5GAM g;  4M7A E;  3EHR A;  4PJM A;  4PJL A;  4C8Q C;  2E41 A;  1TXQ A;  2K3B A;  3TVT A;  1D1B A;  4PFP A;  4D8D A;  1QCF A;  2KYM A;  2VWF A;  2XG8 D;  1I5O B;  4PJO C;  1SEM A;  4RTY A;  3JCM d;  1JJ2 S;  4IUP A;  4FYW B;  3VJP A;  2M02 A;  3SFM A;  2KYB A;  4OMN A;  3FLG A;  1K0S A;  4DEX A;  2ED0 A;  1ZQ1 A;  2XU8 A;  2A7Y A;  1XNI A;  4V2S A;  3S3O A;  2EYZ A;  2RJF A;  1PKT A;  1T3S A;  1Q7Y U;  1Q81 U;  1W70 A;  2E64 A;  2WSF E;  2F1L A;  3CCM A;  3CCM T;  1PKS A;  2KE9 A;  3E9G A;  1YNZ A;  2LCC A;  5GAO l;  2AZS A;  2E5K A;  4HT9 A;  1YJ9 A;  1QP3 A;  1YJ9 T;  3MP6 A;  1GFC A;  3R6O A;  3A1P A;  3JB9 J;  1LVK A;  5IHK A;  4XAX B;  1FYN A;  2E6N A;  5EC7 A;  2A08 A;  1QVG S;  2CP3 A;  3MJX A;  1HSQ A;  1BI2 A;  3JRZ A;  2X4X A;  1WHJ A;  1Y71 A;  2K4Y A;  3OA6 A;  4DOV A;  2O31 A;  4KGX B;  4J9F A;  2J7I A;  2LTO A;  1VQ4 A;  1VQ4 T;  1AWX A;  4BDZ A;  2EGC A;  1Q82 R;  1KQS S;  4C8Q G;  2ZZD A;  3VS1 A;  4EMG A;  3NTK A;  2KVQ G;  2OAU A;  1TUD A;  5CK9 A;  2RN8 A;  4PJO G;  3RKY A;  5FRM A;  2DKG A;  2K3X A;  3EGD B;  4IUT A;  4M77 C;  1VQ8 A;  5GAN e;  1VQ8 T;  1V1C A;  2AHJ B;  3PIO A;  1S72 A;  1S72 T;  1BI1 A;  4BE1 A;  1KD1 U;  2LDM A;  4WCI A;  2ECZ A;  1OZ2 A;  5LJ5 e;  1KC8 C;  2NUP A;  4HCK A;  1AHJ B;  1W2B A;  4BB7 A;  1YHQ Q;  1G3T A;  1Q82 C;  2LQW A;  3JCM V;  1RL2 A;  3QXE B;  1X01 A;  1Q86 U;  5LJ3 f;  4BD3 A;  3GNF B;  3MP1 A;  3SB2 A;  3M56 A;  4JLG A;  3G4S Q;  1TU0 B;  2M16 A;  1YP5 A;  4XTZ A;  1VQ9 T;  1GRI A;  3CCS A;  3CCS T;  2DE0 X;  2FPD A;  2CZ1 B;  2L8D A;  3HP9 A;  3VS4 A;  1YWO A;  2MCN A;  4EMK B;  3CCL T;  1SF9 A;  2BE9 B;  2D9T A;  3LGF A;  4DA4 A;  2FVU A;  2DVJ A;  3BDL A;  4M7D E;  1PD1 A;  3EFO A;  2EAY A;  4RTZ A;  1JQQ A;  2RPN A;  2RB6 A;  3JB9 D;  2M9U A;  1Y57 A;  1H64 1;  1QMC A;  1YJW Q;  5LJ5 h;  1IZ6 A;  4LDY A;  2RHU A;  2EWN A;  2W10 A;  3M4G A;  1NEG A;  2IVW A;  5A0G A;  3RBB B;  1M9S A;  2DJQ A;  1TSF A;  2CUD A;  2HQE A;  1QWF A;  2NUZ A;  2EPD A;  1BU1 A;  3X24 B;  1KK7 A;  2YT6 A;  1BK2 A;  1VQN A;  1VQN T;  1KIK A;  4N4G A;  2KRN A;  1Y7X A;  1O75 A;  4AFU C;  3CD6 A;  3CD6 T;  4PLL A;  1H92 A;  2XI9 A;  2LRQ A;  2JT4 A;  3GBQ A;  3QG1 A;  4K11 A;  3M0P A;  4PFZ A;  1PM3 A;  2DLP A;  4LXC A;  3OW2 A;  1WQW A;  3E1S A;  4M77 G;  1WGS A;  3INZ A;  3PGG A;  3RMQ A;  1G3W A;  2QG9 B;  3M53 A;  4Q5W A;  3OYK A;  6AT1 B;  3JB9 H;  3X25 B;  4GY5 A;  4R56 A;  2RO0 A;  4NL2 A;  3WXM B;  2RA2 A;  3P8H A;  3SD4 A;  4Y92 A;  5KYW A;  4M7A C;  4N4I A;  1NBE B;  2E10 A;  1UE9 A;  3NFC A;  3OYL A;  2DBM A;  1JU5 C;  2D0Q B;  3H8Z A;  4RG2 A;  5KYY A;  1MNE A;  1M1K U;  3TRE A;  3CCV A;  2F2V A;  3CCV T;  2HBW A;  1KFZ A;  1F1B B;  1M1G A;  1GBR A;  3AHU A;  4KGV B;  3E19 A;  2JVV A;  1YIJ A;  1N27 A;  1YIJ T;  2RF0 A;  5GAN 4;  3H41 A;  5LJ3 d;  2DNU A;  4BY6 B;  2GNC A;  4TVR A;  2A3L A;  1Y96 A;  3V8K A;  3M58 A;  1YCY A;  1NYF A;  4A4E A;  4UC4 A;  3WVE B;  2EYX A;  1IRX A;  3UA7 A;  2COY A;  1WHM A;  1QVP A;  4ZTF A;  2L0A A;  5FU7 C;  2EQM A;  3A8H B;  4FSS A;  4M75 F;  2OTJ T;  1B3Q A;  1M5Q 1;  4F7U F;  1BI0 A;  4J9I A;  3L2U A;  3CPF A;  1QVF A;  4IIO A;  2RHY A;  1AVZ C;  5GAN g;  5GAN 2;  4L59 A;  1NE8 A;  3NGP A;  3PNW C;  1NYG A;  2JUF A;  5LJ5 g;  3X20 B;  3JCM Q;  1X2K A;  5FU6 B;  4A53 A;  4MDX A;  2DRM A;  2DF6 A;  1Q7Y C;  2KGT A;  1VQ5 A;  1VQ5 T;  2K79 A;  2ZPE B;  1JEG A;  1WDX A;  1VQL Q;  5KYX B;  5D6X A;  1P92 A;  3PIP A;  2JN0 A;  3OYG A;  1NLO C;  5HCK A;  2CKK A;  2R57 A;  2BE7 D;  2VV5 A;  4M7A G;  2HBP A;  4BI3 A;  5DM7 R;  4ANJ A;  1K1Z A;  1RAG B;  4A4G A;  2XDB A;  1GCP A;  4DBR A;  2P0Q A;  3C4S A;  1SSF A;  5GMK j;  1QP2 A;  2D8H A;  3TSW A;  3OB9 A;  4D6W A;  2QA4 Q;  4AFS C;  1E6H A;  2GFU A;  3M54 A;  2CT3 A;  1FX7 A;  2EYW A;  3RMS A;  5IXF A;  2HKN A;  2SEM A;  2OTL A;  2OTL T;  3L1A A;  4OGE A;  3QPH A;  1UEB A;  1W4S A;  1H3H A;  3EGX B;  1YJN A;  1YJN T;  1TUC A;  1KHI A;  4JZ3 A;  2YUO A;  4OB2 B;  1JJ2 A;  4A4H A;  3UT1 A;  3TSZ A;  4FSX A;  3OY9 A;  1Q95 G;  3J81 E;  4OMF B;  1DJ7 B;  4JJC A;  4LUE A;  2O88 A;  3M0U A;  1WXU A;  4DQ2 A;  3OYC A;  2LZ6 B;  4JUV A;  2DXU A;  4MMK A;  3FB9 A;  2LNV A;  2DO3 A;  4LDV A;  2FL7 A;  2NYS A;  5C0M A;  2FB7 A;  3HL8 A;  1KD1 C;  5LJ3 j;  3CBP A;  2DFU A;  1T3L A;  2ABL A;  4HCB A;  2YLB A;  1MMD A;  2RNA A;  3AT1 B;  3OYE A;  4JRI A;  3SHW A;  4M7D C;  3VS3 A;  2JM8 A;  2DTI A;  2QEX A;  2QEX T;  1Q86 C;  5GAN 5;  1V76 A;  1NJI R;  2YRD A;  2CUB A;  2P0P A;  1YI2 T;  4F04 B;  1Q82 U;  1QVG A;  1B34 A;  3CBO A;  1VYV A;  4QW2 A;  2HCK A;  4M77 E;  2O01 E;  1AT1 B;  3PE0 A;  4HKE A;  1M2V A;  3G71 Q;  2D0N A;  1KG1 A;  4OVA A;  1UJ0 A;  2CYZ B;  1R0B G;  2K2M A;  3DB3 A;  4M77 D;  4J8O A;  4C92 E;  1KQS A;  3SWN A;  5CAI A;  3LLR A;  4GLM A;  4R0K A;  1M27 C;  4BE0 A;  1X6B A;  5CQX A;  4C92 D;  1JRI A;  5KE3 A;  2JZ2 A;  2V8J A;  4LUD A;  2LX9 A;  2MWO A;  3ME9 A;  3OYA A;  2MAM A;  3M0S A;  5GMK e;  2X4Y A;  3EG9 B;  5CKB A;  3QHS A;  1MMN A;  3TQ7 P;  1QWE A;  4M75 E;  2LVM A;  1K73 C;  2JXB A;  5CKE A;  1HYO A;  4M77 B;  3OYM A;  1I0C A;  2X35 A;  1TG0 A;  5GAO q;  4XTV A;  1ZHI A;  1UJY A;  1WXT A;  2FZG B;  2X9H A;  3H9N A;  4BI4 A;  4RCC A;  2LT4 A;  4C92 B;  4E7S A;  1VQO Q;  2LJ0 A;  3CPW S;  3RNJ A;  4J7I A;  5I21 A;  1BB9 A;  3JB9 G;  1IRE B;  2PTK A;  4RTT A;  1O9S A;  1FMK A;  1TUG B;  4M7D G;  2KI7 A;  2V1Q A;  2CS7 A;  3IQL A;  1VIF A;  2FZK B;  3M9Q A;  2CRE A;  2LC4 A;  3QSU A;  5HK0 A;  4LDW A;  3ZBD A;  2C0T A;  1RAF B;  4FYY B;  5LJ3 e;  2J06 A;  5GMK m;  1YHQ A;  3QUI A;  1VQ6 A;  1VQ6 T;  1GCQ A;  2YDL A;  4QVD A;  4QKU A;  3PVQ A;  2CP2 A;  2EJF A;  2VGN A;  3ZFJ A;  4KT0 E;  2QXF A;  4M78 A;  4B6M A;  2QAZ A;  2DL7 A;  3G4S A;  1IHV A;  1QKW A;  4Y91 A;  4J83 A;  4R55 A;  3JCM b;  3GPL A;  4WF2 A;  5KYN A;  1BIB A;  1VQM Q;  5HY6 A;  3CXC P;  1RAC B;  3L2Z A;  1ZSZ B;  2EQK A;  2FO0 A;  3DB4 A;  2SRC A;  3TU4 K;  3RKW A;  2CH4 A;  5KYU B;  4M7A D;  3VU3 C;  2E3I A;  2O4X B;  3PMI A;  8AT1 B;  2M0Y A;  5GAM f;  3CC2 Q;  4FT2 A;  2XMF A;  2DAQ A;  4IUU A;  2O9S A;  3OQ5 A;  1ZUY A;  1YJW A;  1WJQ A;  1WPY A;  1K0X A;  1VQ7 A;  1VQ7 T;  1OU9 A;  3J7A F;  2R58 A;  3GOX A;  3VUZ A;  1N6A A;  2AKK A;  3DLL A;  1BKB A;  3ZEH A;  4C0Z A;  3LH0 A;  1ZUK A;  4BE2 A;  1WYX A;  4DBF A;  2FYK A;  2F5T X;  5GAN 8;  4FU6 A;  2HDA A;  2K7A A;  4M7A B;  3L2R A;  3G6E Q;  2KT1 A;  4C5I A;  4B9X A;  2PVD B;  3JB9 I;  1G2B A;  3QYG B;  5HKC A;  1U1S A;  4KRT A;  3CCR Q;  2DZC A;  2P84 A;  3DLM A;  2RM4 A;  4PJN A;  3F70 A;  2JS2 A;  4ORZ A;  2EFI A;  3MPU B;  1OPK A;  1D0X A;  2I2L A;  2BUD A;  3UDC A;  4ELZ C;  4F17 A;  1SG5 A;  4OP0 A;  4E7H A;  2FRW A;  1OI1 A;  2E65 A;  2HL3 A;  5GAN 3;  1XQH A;  2HKQ B;  2ROT A;  4FIB A;  2Y4Y A;  4OMQ A;  4YTL A;  2G6F X;  5FU7 B;  3CMA Q;  2VVK A;  2XHC A;  4WTO B;  4CC4 B;  5I2M A;  1SRL A;  2YRC A;  4XU2 A;  1X6O A;  5A0L A;  2GBQ A;  5IHN A;  3UAT A;  1N9R A;  1MMA A;  1QQJ A;  2YLC A;  1M90 R;  2JNG A;  3EGD A;  1BI3 A;  1D3B A;  5D6W A;  2VKN A;  3CXC S;  1BYM A;  2W0Z A;  3E2U A;  1RAE B;  2V8K A;  2DM1 A;  1CKA A;  2IG0 A;  4C92 C;  1BBZ A;  3UPU A;  1R77 A;  4E7K A;  2DL4 A;  2BZ8 A;  2L5Q A;  2COW A;  1WHH A;  4HT8 A;  5GAM d;  1RI9 A;  4ZGJ B;  2EQJ A;  2YUQ A;  3WVD B;  1OX8 A;  4JJD A;  4C8Q F;  2KDS A;  5L8R E;  1LOJ A;  1MV0 B;  5LJ3 g;  2ED1 A;  3VS0 A;  3FC3 A;  4OMM A;  2YUN A;  5EG2 A;  3EAE A;  1M90 C;  3EG3 A;  1VQL A;  4PJO F;  3HKS A;  4KUI A;  2NUP B;  2HQH A;  4CC2 A;  1PCX A;  2F69 A;  1I5L A;  1RAH B;  4EMK A;  3VRY A;  2R5M A;  2QTX A;  4M75 C;  2EJG A;  1S1N A;  4OMO A;  3OYN A;  2CH4 W;  1WIE A;  1UTI A;  5GAN h;  3CC4 Q;  3OYY A;  5GAO r;  2ZPI B;  1K8A R;  3OSS C;  1JBM A;  1K76 A;  4RUG A;  1NJI U;  4J6Y A;  4M7D D;  3I56 A;  3I56 T;  1ZSZ C;  2EGE A;  1AZE A;  1G3Y A;  1IGQ A;  2L3P A;  3G1J A;  2DPP B;  2JTE A;  3HTR A;  2VUB A;  2HSP A;  3ER0 A;  4P5N A;  1I4K 1;  3L42 A;  2FPF A;  4C5G A;  5KH6 A;  3CME A;  3CME T;  1IXD A;  2E4H A;  3EG1 A;  4X9D A;  4XK8 E;  2KSS A;  2CP7 A;  2K5I A;  2KXD A;  2OAW A;  1K73 U;  2LCS A;  3QJ6 A;  2EJ9 A;  3FEO A;  2LX7 A;  4IUQ A;  2K5L A;  2NUT A;  3EFR A;  3GP8 A;  4M7D B;  3JCM P;  3LH5 A;  2LMJ A;  1G8X A;  2DD5 A;  1VA7 A;  5CKH A;  3CCU A;  3CCU T;  3CCE A;  2X4W A;  3CCE T;  2Y4X A;  4C92 G;  3OS5 A;  3RR6 A;  3CCM Q;  4A4K A;  4AMC A;  3CCJ A;  2CSQ A;  3CCJ T;  1C0M A;  1M8M A;  1VQK Q;  2QGF B;  4ZGD B;  4HVU A;  1YJ9 Q;  1MUZ A;  4PLI A;  1UGV A;  4N0A A;  1PRL C;  3C0C A;  3DKM A;  1UGQ B;  2JMA A;  2AT1 B;  1AOJ A;  4FYX B;  1VQP A;  1VQP T;  1WHK A;  4CRI A;  2EQI A;  5I22 A;  3I55 Q;  4M75 G;  2BZY A;  2YHT A;  1NEB A;  4LD6 A;  4F7U G;  2F2W A;  1HXD A;  4J9E A;  1UHF A;  1G83 A;  3RUX A;  4NL3 A;  5GAM j;  1KSW A;  2DL5 A;  3JCM e;  1ZSG A;  3HFO A;  2BTT A;  3MO8 A;  1VQ4 Q;  4BUG A;  2ROL A;  1ZUU A;  4QVC A;  1KJW A;  2CP0 A;  2P0K A;  2KEA A;  4PKC C;  2MMP A;  4L6V 5;  4X34 A;  3GF5 A;  3TEE A;  4KBM B;  4ELY C;  4E7J A;  2EVR A;  1Q81 R;  3A5Z B;  4JJN K;  2QAS A;  3Q1J A;  2L3S A;  3G7Z A;  1VQ8 Q;  2EIF A;  2PU9 B;  2DK3 A;  3JCM W;  3S3M A;  3FJ5 A;  2MK5 A;  2O2O A;  2EYQ A;  1IHW A;  3VS5 A;  1S72 Q;  2CP6 A;  4M78 F;  4CI0 C;  5KYX A;  3O8V A;  4OB0 B;  1K9A A;  3A98 A;  3CC7 A;  3CC7 T;  1JB0 E;  4X9C A;  3HRU A;  1Z9Z A;  5LJ5 f;  1JXM A;  4Z8A A;  2ZPH B;  1WLP B;  3JCM h;  1LCK A;  2VC8 A;  1OV3 A;  4J6W A;  2P4T A;  1VQO A;  3THK A;  1TTH B;  2PUO B;  1VQ9 Q;  2H3J A;  3CCQ A;  3CCQ T;  1WJR A;  3CCS Q;  1M30 A;  2PZ1 A;  5GAN 6;  5C6S A;  1U06 A;  3QZ9 B;  3CCL Q;  3OYD A;  1YIT A;  2RI3 A;  1YIT T;  2RJC A;  2GQI A;  4AT1 B;  4A54 A;  1Z9Q A;  4C8Q A;  1K9M R;  2D1X A;  3E9F A;  1PNJ A;  3FDR A;  4J6X A;  5DLQ E;  3GNG A;  4RMO A;  3KFV A;  1XJW B;  2CSI A;  2FZC B;  2XK0 A;  3JAM E;  2EKH A;  4RTW A;  1NG2 A;  4PJO A;  2K57 A;  2MPX C;  3CPW P;  4XU1 A;  3NPF A;  4KH1 B;  1M3C A;  2E1H A;  4EDU A;  1SPK A;  2AK5 A;  2DRK A;  3BY7 A;  2RQU A;  4KH0 B;  1HD3 A;  3FRN A;  1WA7 A;  2GTO A;  2L89 A;  3RKX A;  1VQN Q;  4C5E A;  2DZ9 A;  1ZLM A;  2BZX A;  3CD6 Q;  1VOM A;  1WHL A;  2LQN A;  2C0O A;  3MHX A;  3OS1 A;  5GAM e;  5LL6 S;  2KT8 A;  2KRM A;  4NOY A;  3M5A A;  2FRY A;  2C06 A;  2HZY A;  3VKI A;  1UB4 A;  1AD5 A;  1E6G A;  1YN8 A;  2ESW A;  5J3B A;  4JJB A;  3ULR B;  3QYH B;  4J9B A;  5GMK i;  1PSE A;  2CZ7 B;  2KY9 A;  4EIK A;  1N8R R;  4J9C A;  4XU3 A;  4ZGE B;  3PFS A;  1JO8 A;  1ZBJ A;  1M1F A;  3LWH A;  2RQT A;  4QQG A;  3I35 A;  1ZBX A;  3UA6 A;  3RIR A;  4J9D A;  4QT7 A;  1M90 U;  4MZP A;  1FMW A;  3CCV Q;  2EW3 A;  1JXO A;  1R0C B;  5CCA A;  4EPC A;  3I5R A;  2V1R A;  4FL6 A;  2DX1 A;  4FW2 A;  1SHF A;  4E47 A;  1YIJ Q;  2RK1 A;  1B34 B;  1QCN A;  3JCM g;  4QQ6 A;  1VUB A;  3URG A;  2XID A;  1NJI C;  3CBM A;  3QO3 A;  2YSQ A;  1OUL A;  2RHZ A;  2LP5 A;  4KUL A;  4ATO A;  4NS5 A;  1M2V B;  2O9V A;  4CC3 A;  3HRT A;  3LX7 A;  5KCH A;  3ASK A;  4O5V A;  3CXC A;  3EG9 A;  2OTJ Q;  3MCA B;  5IAY A;  2QK0 A;  2ZPB B;  3KUF A;  4FCY A;  3VYH B;  4II1 A;  2PVO B;  4F7U E;  4JS5 A;  1X2Q A;  2RMO A;  2NLU A;  2ZAE A;  4M75 D;  2K3Y A;  1WNL A;  3RER A;  2HEQ A;  5CQY A;  4OB1 B;  1VQ5 Q;  1K8A U;  2MWP A;  4Z02 A;  4FW1 A;  1M1K R;  2CZ6 B;  3JV3 A;  2DEU A;  3NTI A;  4JDS A;  1NM7 A;  4LDU A;  2J05 A;  1EIF A;  4M78 E;  3A8L B;  2DIL A;  1RAA B;  2KNB B;  2GCX A;  1VYT A;  4HVV A;  1QVF S;  2Z0W A;  4DBH A;  2K9G A;  2PVG B;  2AZV A;  2CGH A;  5KCO A;  4HCZ A;  2ZPG B;  5GMK h;  2JMC A;  1YHQ T;  2VXF A;  4AFQ C;  4M75 B;  2RI2 A;  1M3A A;  3VS6 A;  2H8H A;  4F7U B;  3G4S T;  3CQT A;  2LNH B;  2BKD N;  4RTX A;  3S3N A;  1ARK A;  3QII A;  2OTL Q;  2RK2 A;  3MKD A;  2MF2 A;  3MEV A;  2WSC E;  1I07 A;  1RAD B;  2V26 A;  3L2V A;  1YJN Q;  3H0F A;  4BAC A;  5KYU A;  2OJ2 A;  4J5Y A;  3JSC A;  3KBG A;  3OBY A;  2O4X A;  4AFZ C;  3CC4 A;  3KXT A;  5CR2 A;  1I8F A;  5A0D A;  1WJS A;  5GJW B;  3JCM J;  5GAN j;  3U23 A;  4KGZ B;  5GAO m;  1YJW T;  2J6O A;  4XTU A;  4C0G A;  4RKU E;  1NPP A;  2LCL A;  2ATC B;  2VXE A;  3OS0 A;  3PVL A;  5LJ3 h;  5GMK l;  3LYI A;  1IGU A;  4E6R A;  5LJ5 j;  4ZTJ A;  1YFN A;  5D6Y A;  5GJV B;  1W6X A;  1PG5 B;  3QWX X;  2E3H A;  3BW1 A;  5M9O A;  4M7A A;  2QEX Q;  4IUR A;  4B9W A;  1UG1 A;  1D1A A;  3I9Q A;  2BIV A;  3C94 A;  3OMC A;  2PUK B;  1YI2 Q;  1D0Z A;  5FWB A;  3ZL7 C;  1CKB A;  5KE2 A;  1X6G A;  2LJ3 A;  1IO6 A;  3EH2 A;  3R6N A;  4RG8 A;  4ESR A;  3P8D A;  3M57 A;  2XKO C;  1ZA2 B;  4J9H A;  4QVZ A;  2VYT A;  2L3R A;  4E7Z A;  2FPE A;  2DYI A;  1QKX A;  3A8G B;  4LN2 A;  2JS0 A;  3VYG A;  4GLK A;  3X26 B;  4IUV A;  2HD0 A;  4E7L A;  1VQK A;  1VQK T;  1BCM A;  4C5H A;  1I1J A;  3VRZ A;  1X75 C;  1FWZ A;  3PT9 A;  4PNO A;  4DOW A;  2QDY B;  1K4U S;  2LT1 A;  1AZG B;  1VIE A;  1GL5 A;  1LPL A;  2DER A;  3QZ5 B;  2YWW A;  4MML A;  1EFN A;  2DXT A;  1X43 A;  3C95 A;  2M51 A;  5D7U A;  3I55 A;  3I55 T;  2VGM A;  3QDF A;  2XIC A;  3UWN A;  1BCO A;  4MZM A;  1SKU B;  1NLP C;  1D1C A;  5I11 A;  1H3Z A;  3SWN C;  3J80 E;  1KC8 R;  4MDW A;  2KK4 A;  2RHI A;  4AG1 C;  1Y07 A;  4AG2 C;  3REB B;  1M8V A;  2C0I A;  1N5Z A;  2GGR A;  1TWB A;  3OYI A;  1PWT A;  2KBT A;  1TOV A;  2D6F A;  1K9M U;  3V8J A;  4OGC A;  1SRM A;  3H6Z A;  1G3S A;  2K2V A;  1LNX A;  2FEI A;  4OMP A;  1D3B B;  1U5S A;  1ABQ A;  4BI8 B;  2XDP A;  3QJY A;  1T0H A;  2X4J A;  3HHT B;  2M1H A;  2RQR A;  2HSE B;  2EGA A;  2RHX A;  1OX9 A;  2QI2 A;  2QQA A;  2YUP A;  3V7C A;  2E6Z A;  1VQL T;  1CSK A;  2FG0 A;  2AIR B;  1VQ6 Q;  4C0D C;  4HVW A;  1EX4 A;  1WHG A;  1AWW A;  1XTD A;  2KAF A;  1RAB B;  2L3Q A;  3EG0 A;  1VQ9 A;  9ATC B;  5IH2 A;  3QBY A;  2E12 A;  3VV0 A;  1NZ9 A;  1FMV A;  1OZ3 A;  1OOT A;  2KRO A;  1V29 B;  3CCL A;  3M4Y A;  3JCM X;  1ACM B;  4XTX A;  2Y90 A;  2QA4 T;  2QA4 A;  1GCQ C;  5AYF A;  1N8R U;  1A0N B;  1B7T A;  1AWJ A;  2MIO A;  1J3T A;  1UFF A;  4M78 C;  3EHQ A;  1R8O B;  3EFO B;  3SDZ A;  2QQR A;  2F5K A;  3L2W A;  5CIU A;  5CO7 A;  2QTV A;  4D8K A;  3V7S A;  2AKL A;  1YBY A;  3V7R A;  4JRK A;  1YWP A;  1VQ7 Q;  2X51 A;  4FM4 B;  2EYY A;  3H0I A;  2GFA A;  1K8A C;  1WZO A;  5GAO p;  4M7D A;  1WX6 A;  2RQV A;  2KR3 A;  3RES A;  2RJE A;  2WSE E;  5FWC A;  2DA9 A;  1QCO A;  1GXI E;  5DLO A;  1D09 B;  2ZGW A;  4LD9 K;  3OYF A;  7AT1 B;  1W2B P;  2DXB A;  2JTF A;  4A4F A;  2JTM A;  4Z88 A;  4E7I A;  2X3X D;  3D7S B;  4C0F A;  1D0Y A;  1KHC A;  2NUT B;  4CC7 A;  1Y0M A;  2CT4 A;  1OYX A;  1NPR A;  4ME7 A;  2IPO B;  3RDV A;  2XDD A;  2MI6 A;  2RQW A;  2LQ8 A;  1LJO A;  1UEC A;  3OBW A;  3OYJ A;  4JS4 A;  1BIA A;  3O5Z A;  1C6V X;  2X3W D;  1M4Z A;  2E70 A;  4M77 F;  5KYW B;  4Z89 A;  2A0F B;  2JJ9 A;  5A2Q E;  4KUD K;  2RI5 A;  1WXB A;  2HQX A;  4DBQ A;  3MEW A;  3BDU A;  2CZ0 B;  4PL6 A;  4HA8 A;  5KYY B;  4C92 F;  4PK4 A;  3QKJ A;  1U3O A;  3G71 A;  3G71 T;  2L2P A;  2HMA A;  1X69 A;  4VUB A;  4X1V A;  3OSV A;  4FYV B;  1MGQ A;  2DIG A;  3HRS A;  2DTH A;  1GFD A;  3S6W A;  4HXJ A;  2VAS A;  1KQ2 A;  1Q7Y R;  4M78 G;  4RTU A;  2DVE A;  2LJ1 A;  2QQ9 A;  1Y96 B;  4MZT A;  3CPW A;  1SSH A;  3REA B;  3L2Q A;  2YXY A;  3FIF A;  3HSB A;  2PNI A;  3TCJ A;  2HAX A;  2DXC A;  1OQK A;  2OTJ A;  2QGG A;  2KRS A;  4A63 B;  5L23 A;  5IXB A;  2HL5 C;  3MEA A;  1OEB A;  4PFO A;  4HCC A;  5GAN f;  4ZNX A;  5FRN A;  3OW2 P;  1MV3 A;  5HK3 A;  2J6K A;  2QYZ A;  3P8B B;  1GBQ A;  2ENM A;  2E5Q A;  3M0R A;  8ATC B;  3GLX A;  2B8A A;  1AEY A;  1E7O A;  2JW4 A;  2DET A;  1Q81 C;  1VQO T;  4C8Q E;  1KQ1 A;  5CKD A;  4FT4 A;  5J39 A;  1EZZ B;  1XOV A;  4IKF A;  1MMG A;  2A36 A;  2IIM A;  1PC0 A;  4O6J A;  4PJJ A;  4RTV A;  4IIM A;  4C8Q D;  4PJO E;  3OMG A;  1UGS B;  4F16 A;  3PMT A;  1OU8 A;  1W2B S;  3NMZ C;  4PJO D;  3EGX A;  1AWO A;  2V8I A;  4XU0 A;  1X27 A;  2A37 A;  1PSF A;  2EQU A;  4ZN3 A;  2DTO A;  3M55 A;  2DL8 A;  2DEQ A;  3I56 Q;  4EMK C;  1H8K A;  2J6F A;  4M7A F;  1SHG A;  1UGP B;  3SEM A;  2XD0 A;  2OX7 A;  1KD1 R;  1VQM A;  3M0T A;  4JRQ A;  3CME Q;  1VQM T;  4C8Q B;  4F14 A;  5CKF A;  2CDT A;  2RJD A;  4XTY A;  2DBK A;  4JRP A;  4BDY A;  2GTJ A;  1RLQ C;  4E2F B;  5IN1 A;  1QVF P;  1WFW A;  5GAN 7;  1M3B A;  2A28 A;  1Q86 R;  3M0Q A;  4PJO B;  1K9M C;  1RUW A;  1PHT A;  1HJD A;  3CC2 A;  3CC2 T;  4EMH A;  1U8R A;  1RLP C;  5J26 A;  3QDR B;  2K6D A;  3EG2 A;  4JPB W;  2NWM A;  3CCU Q;  4JZ4 A;  3CCE Q;  4J7F A;  3H0H A;  1QW1 A;  3HPW A;  2EKO A;  1TS9 A;  2GF7 A;  3A8M B;  3CCJ Q;  1ABO A;  1B07 A;  3X28 B;  2HNI A;  1W1F A;  3OS2 A;  2MOX A;  1UHC A;  4OML A;  4XTW A;  4LE9 A;  1KC8 U;  2DYB A;  5GAN d;  3G6E A;  3G6E T; 
#chains in the Genus database with same CATH homology
 1K8A R;  1VQN Q;  3CCM Q;  3CCU Q;  3CXC P;  1VQM Q;  3G6E Q;  1VQ9 Q;  3CCE Q;  1S72 Q;  2OTJ Q;  3I55 Q;  1VQO Q;  3CCS Q;  1YJN Q;  1VQP Q;  1JJ2 P;  1YI2 Q;  1W2B P;  1VQ5 Q;  3CD6 Q;  1YJW Q;  1VQL Q;  1QVF P;  1QVG P;  1KQS P;  1YIJ Q;  3CCQ Q;  1Q86 R;  3CCJ Q;  1N8R R;  1M1K R;  1VQ7 Q;  1VQK Q;  3I56 Q;  3OW2 P;  1YHQ Q;  1VQ6 Q;  1Q81 R;  3CCL Q;  1Q7Y R;  1YJ9 Q;  1M90 R;  3CC7 Q;  1KC8 R;  2QA4 Q;  3CCR Q;  3CPW P;  3CMA Q;  1YIT Q;  1VQ4 Q;  3G4S Q;  3CCV Q;  1KD1 R;  3CC2 Q;  1K73 R;  1VQ8 Q;  2OTL Q;  3G71 Q;  3CC4 Q;  1Q82 R;  3CME Q;  1NJI R;  1K9M R;  2QEX Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...