1YJ9Q

Crystal structure of the mutant 50s ribosomal subunit of haloarcula marismortui containing a three residue deletion in l22
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1yj9Q00
3CC2Q 3I56Q 1Q86R 1K9MR 1Q82R 1Q81R 1JJ2P 1KQSP 1KC8R 1M1KR 3CMEQ 3CCRQ 1K8AR 1VQ5Q 1N8RR 1VQOQ 3CCUQ 1VQ9Q 2OTLQ 3CD6Q 3I55Q 2QA4Q 1YJWQ 3CCMQ 3CC7Q 3G71Q 3CCVQ 3G6EQ 1KD1R 1QVGP 1NJIR 1VQLQ 1VQNQ 2OTJQ 1W2BP 3CCQQ 3OW2P 3CMAQ 1VQ8Q 1YI2Q 1VQ6Q 1VQ4Q 1VQMQ 1YJNQ 3CPWP 2QEXQ 1VQKQ 3CCJQ 3CXCP 1QVFP 3G4SQ 3CC4Q 1M90R 3CCLQ 1YITQ 3CCSQ 3CCEQ 1VQPQ 1YHQQ 1Q7YR 1YIJQ 1VQ7Q 1K73R 1S72Q 1YJ9Q
chains in the Genus database with same CATH superfamily
3QDRB 3SB2A 3JB9H 1JO8A 5GAOr 3OYBA 4LDWA 3SWNC 2EJFA 5FLXE 4FM4B 4C8QE 1C0MA 2E5KA 2AHJB 2EVRA 3GNGA 1WXBA 2JXBA 2JTEA 2XMFA 1UDLA 1KD1R 1YWOA 1W2BP 2LQNA 4OMOA 1W6XA 1IREB 4CC7A 3SHWA 1YHQA 2COWA 2COZA 3EFOA 2LJ3A 3VS6A 4A63B 3UWNA 4BY6C 5KYWB 1YJNT 3VS7A 3UA6A 3EG9A 4JJDA 2ED1A 2L8DA 2PVGB 3O8VA 1M2VB 2ZZDA 4XTYA 2QI2A 1WXUA 2KSSA 2NUTA 3VRZA 4M75F 3ULRB 4AMCA 1RAFB 1HK9A 3CCLA 5KYWA 3VV0A 3H8ZA 3UA7A 2DTIA 1WHGA 4E7SA 1YJNA 4J9HA 1AVZC 4MMKA 1ZA1B 3M4GA 4YTLA 1FX7A 3M0SA 3VS4A 2FB7A 3OYFA 1NLPC 4PKCC 3URGA 4C0GA 2M1HA 4F7UG 3H0FA 1M1KC 2DYBA 3LLRA 4R55A 1JJ2A 1UGRB 4XU1A 4X9DA 3CCJA 5IN1A 2LRQA 3X20B 2K5LA 3QG1A 3CCMT 1IXDA 3FIFA 2FZGB 3EG9B 4E7HA 1QKWA 2ZPGB 4J6YA 3CXCA 1QW1A 1V1CA 2Z0WA 4RTZA 4FW2A 1G5VA 3CQTA 5CVIA 1PRLC 2ROLA 1KHCA 4V2SA 3CXCS 1KC8U 3FJ5A 3OMCA 2VKNA 5FWCA 2AIRB 3I55Q 2EQUA 4C0DC 3PIOA 2GBQA 1D0YA 2IVWA 5GAN6 2QA4T 2JZ2A 1KFZA 1PKSA 2A37A 1WPYA 1JXMA 3CCVT 1VQ7Q 1K0SA 2XU8A 4IUUA 4M77F 3G4SA 1C6VX 4C5HA 3O5ZA 4JS5A 1UECA 1ZQ1A 2D0NA 3OS2A 3GNFB 4QVDA 1ZBJA 3V8KA 1QWFA 4C92B 1RLPC 1LPLA 2DM1A 3HP9A 4M7AA 4MDWA 3LGLA 5LJ5e 4LDUA 4E6RA 3KXTA 4J9EA 2M02A 3CMET 2K5FA 2BZ8A 1N9SA 4DEYA 1OPKA 3CC4Q 1M90R 2YUNA 2ZPFB 3HFNA 5IT9E 2JUFA 4FYXB 5LJ3f 1S72Q 1H8KA 4M75D 2F2XA 2O01E 4FIBA 4J8OA 4M77C 2F2WA 1LCKA 2EFIA 4QT7A 3NPFA 3JCMe 4DA4A 1G3WA 3L2VA 4C5IA 3LWHA 1HSQA 2YUQA 3KUFA 3CCVA 1QVFA 5FROA 1VQ9A 1JEGA 3OYKA 1MV0B 4OB0B 3RDVA 1BU1A 2XG8D 1MUZA 2MCNA 3CC7T 3L2ZA 2RHIA 3JCMV 2CZ0B 5CQYA 1ABOA 3M0QA 3M0TA 4HCZA 3I9QA 2QYZA 4II1A 3OS5A 5GAMj 4IIOA 4M7DD 4KGXB 3OYEA 3L2RA 3L42A 1RAGB 3QJYA 5HY6A 2RHUA 2E4HA 4C92G 2M51A 3RESA 2OAWA 4M7DA 3UPUA 2HSEB 5IH2A 3BY7A 4PK4A 4KH1B 1VQ6A 5GANj 3VS1A 2OI3A 5IAYA 1IGQA 4PJOC 1B7TA 1W4SA 4BDYA 1JXOA 5LJ3j 1IGUA 4ZGJB 2GF7A 1TXQA 1UG1A 1H92A 4MZPA 2XDDA 1B07A 2FG0A 3MEUA 1T0HA 1OV3A 2XHCA 1BI3A 2I0NA 4M78A 3JB9G 2HQXA 2DL8A 4TVRA 2A28A 2LCCA 5CQXA 3CPWA 3BW1A 2X4WA 4PFZA 2FPFA 1Q95G 5IXFA 2KNBB 1B3QA 2LP5A 3QSUA 1E7OA 3SFMA 2RM4A 1UGVA 3CCSQ 4JJNK 5FU7B 3H9NA 2JJ9A 4A4KA 1WJRA 1WJQA 1KC8R 4KH0B 5CKDA 2LNHB 4J7IA 3G71Q 1AWXA 1SF9A 2B8AA 4OMFB 3S6WA 5J39A 2LT4A 3M54A 2QEXQ 2DNUA 2P0PA 2LNVA 2QGFB 1ARKA 4HA8A 2HEQA 1D1AA 4IIMA 2DF6A 3EFSA 1U06A 5LJ3d 4J9IA 1Q82U 2LQWA 2VASA 3QWYA 1OQKA 1R77A 4OMQA 3CC4T 4N0AC 2CP3A 1S72A 3REBB 4DOWA 5GMKe 2L3SA 4M7AB 1K0XA 4A54A 3BDLA 2VGNA 2P0QA 2DKGA 2P4RA 1G3SA 1NYGA 4OVAA 3VRYA 4PJOF 3VU3C 1I5OB 3N5BB 1VQMT 4E7LA 4O6JA 2CZ6B 2H8HA 3DB3A 1G83A 4FL6A 4C5EA 3A8LB 1D09B 4JUVA 3I56T 4PJMA 2O9VA 4J9CA 1K9MR 2E1HA 1SG5A 1GXIE 2PU9B 1HJDA 1VQ8A 5FU6B 3KBGA 2RQTA 2FZCB 1VQLA 2NWMA 1FWZA 3GLXA 4A4GA 3UF4A 4QQGA 1AHJB 5KYXB 1VQKT 1RAHB 2AZVA 1WYXA 4OP0A 4BE0A 1CKBA 3G71T 3EAEA 2DBMA 4RKUE 2LX7A 5GMKj 1MMDA 4LXCA 2L2PA 2LJ0A 4F16A 3JCMQ 2HDAA 2FZKB 2KYMA 1NYFA 1QQJA 4GLMA 3CCRQ 4EMKC 2KQWA 1C1AA 1ZX6A 2KYBA 1M3CA 4GBQA 1RADB 4D8DA 1HYOA 4ELYC 2J6OA 4Y28E 3HPWA 3TQ7P 1N6AA 4BUGA 1VQ6T 1F1BB 3OYIA 1GRIA 3QJ6A 2KEAA 1BKBA 1NM7A 1WA7A 2Y4XA 3OYNA 5D6YA 2ZAEA 5J3BA 3V7RA 4BI8B 4N4IA 1UB4A 1OU9A 2K5IA 2L0AA 2W10A 1WHKA 1WJSA 3PGGA 1YJ9A 1M90C 2KRMA 4IUVA 3E2UA 4FSXA 3E9FA 1K73R 1BCMA 3U23A 8AT1B 4BE1A 1Q86R 3RKYA 1VQOT 5GANe 4J6XA 1BIAA 3E1SA 2E41A 2F2VA 5KCOA 2BZYA 2KVQG 4BE2A 1LNXA 2PUKB 1IHVA 3CMEA 1GCPA 4PJOE 4MDXA 1K9MC 1AWOA 2O31A 4RG2A 1X01A 1Q81U 1PSFA 3ZL7C 3AT1B 4DBRA 2EPDA 3OYJA 5CR2A 1YHQQ 2DVJA 1U1SA 1VOMA 3SDZA 3OYGA 2O9SA 2DYIA 1J3TA 4GY5A 2DA9A 2HCKA 3V8JA 2DZCA 4FYYB 3QO3A 3RMSA 3CCVQ 4M77E 5EG2A 1D1CA 3OMGA 4HT9A 2QG9B 2H3EB 2HBWA 1GFDA 4RTUA 2QEXT 2LC4A 5KYUB 1SSHA 3I35A 2DERA 1WNLA 1R0CB 1PWTA 2DETA 3PMTA 3CC4A 4XTVA 4C8QG 3EGDB 1YN8A 4JRIA 4ME7A 4EIKA 1MHNA 1JBMA 4MMLA 3WVEB 1VA7A 2GFAA 3MCAB 2YUOA 1MMNA 2E70A 3R6OA 1SRLA 4A53A 4M7AF 1GBRA 1NE8A 4HVUA 3OS1A 3OYCA 3CEYA 3FJPA 5KH6A 2PUOB 3A5ZB 1S1NA 5KYUA 1VQ7A 3QHSA 4PJOB 2KI7A 3CMAT 1JRIA 3RBBB 2EYQA 5LJ5d 3QIIA 1NPPA 3E9GA 2BTTA 1ZSZA 3CCQA 3RKXA 4BDZA 3THKA 4RTWA 2YUPA 4ZTJA 5GMKi 1AZEA 4NOYA 2RHXA 3JCMg 4M78D 1M1GA 1QVPA 3MO8A 2KGTA 1CSKA 2OTLA 2LX9A 5GMKl 2EQIA 3OBWA 1E6GA 2M16A 3BE3A 4ZGEB 4NL3A 1I4K1 4OF1A 1I0CA 1RL2A 3SWNB 1X43A 2QQAA 3TSZA 4PFPA 4E7IA 1M3AA 5D7UA 1KQSP 2DPPB 4RTXA 2CSIA 5CO7A 3M9QA 3OYHA 2DILA 5A2QE 4M78E 4R0KA 2QA4A 2EJ9A 1KQSA 3CCUA 5KYNA 4VUBA 1KQSS 1X27A 3CCJQ 2X35A 3TREA 3RKWA 4PFOA 3QKJA 3WXMB 4C0DB 3MEAA 1VQPA 2KXDA 3UATA 3PE0A 2I2LA 1I5LA 1UHCA 1RAEB 1VQ4A 2J05A 2J6KA 2CGHA 4RTYA 1FMVA 3M53A 4X1VA 3GP8A 1KD1U 1VQ8T 2E3HA 5FRNA 3OYAA 3RUXA 4ZNXA 5LJ3h 1ZSZC 2RHZA 3HHTB 2F1LA 1N27A 4RUGA 1WQ7A 3NTHA 2MAMA 4OB1B 3SEMA 4PLIA 3AHUA 5GAOp 4JRPA 5CKHA 4ZGDB 5I11A 4J83A 1FXXA 1M2VA 2XK0A 1N8RR 1TTHB 5GAMh 1ZUKA 3EGDA 5C0MA 4X34A 1QCNA 3CCST 2D1XA 1RI9A 3G7ZA 3M0PA 4M7AC 3CCQT 3EGXB 2QAZA 1YCSB 3OQ5A 4MZTA 1X2QA 4C8QD 3X24B 4CC2A 5HKCA 2JS0A 2K9GA 1VYVA 2JMCA 4FYVB 3M58A 3H0IA 3LH0A 4PJJA 3VS5A 5CAIA 4PJLA 1VQOQ 2BKDN 2D8HA 1Y7XA 2LJ1A 1PNJA 3J81E 2EYWA 1NJIU 2RH2A 3P8HA 1ZSGA 3M56A 4JZ4A 2DXCA 1LVKA 2DE0X 4BI3A 1X6BA 2VB6A 3DLMA 3CBOA 4EMGA 3GF5A 1MV3A 2FEIA 4XU3A 2ZPIB 1YHQT 5GJVB 2LCSA 2KMTA 1ACMB 1JB0E 4Z02A 4PLLA 1YCYA 1RABB 1ZLMA 3A8MB 4JS4A 1UE9A 1U1TA 1Y0MA 1SEMA 5GAOn 3M59A 5GAMd 3J80E 2V1QA 3QBYA 3OYMA 1O9SA 2CSQA 1ZA2B 3JCMc 2L89A 1V29B 1YITA 1G2BA 4NL2A 2V26A 2LQKA 4F7UB 1BI2A 1Z9QA 2P84A 1U8RA 4JRKA 1EIFA 1EFNA 3JB9F 2JNGA 2VV5A 3L2UA 1Y57A 2DK3A 2F69A 1JU5C 4IKFA 5GAN2 1BI1A 1RUWA 5I22A 2EKOA 1UGSB 4C92C 2KDSA 1KG1A 4D6WA 2ESWA 4EPCA 1I8FA 1WDXA 2KR3A 1AT1B 3OBYA 2K3YA 4J6WA 2LZ6B 4RCCA 1M30A 1AD5A 3JB9I 3WVDB 3VYHB 5IXBA 3G6EQ 3CCMA 5FU7C 4JLGA 3ASKA 3OSSC 2BE9B 3EG0A 2R5MA 3I56A 3CXCP 3NTKA 4HT8A 2X3WD 2CZ1B 3F70A 3ZEHA 4C92D 3EGXA 2FHDA 2DEQA 3VJPA 1VQKA 2KT8A 3P8BB 4XAXB 1UTIA 1OZ2A 4LDVA 5LJ3g 3QDFA 1BBZA 2L3QA 1AOJA 2XD0A 3MPUB 3MP6A 2WSEE 2L5QA 4HVVA 4RCBA 5CKEA 3M0RA 3CC2A 1M27C 2AK5A 1S72T 2A36A 2JT4A 3C95A 3QZ9B 2G6FX 4D8KA 4OB3B 2DJQA 4BD3A 1U3OA 3GBQA 2DD5A 1YBYA 1Z9ZA 4FT2A 2JMAA 4PNOA 2CDTA 1GCQC 2VXEA 4C5GA 4M78B 4PL6A 3JCMf 4DBQA 2DL7A 4N4GA 5GANf 2DBKA 1QVGS 2BE7D 2GCXA 1PD1A 4XTWA 4CC3A 2YDLA 4GLKA 3CC7Q 2OTJT 2K7AA 4KGVB 1YJ9T 3T9NA 3A1PA 2K2VA 2KY9A 3A8HB 2E6ZA 4EMKA 4M78F 4XTUA 2A0FB 5LJ5h 2K2MA 1RACB 3OB9A 1B34B 3CC2Q 5GANh 2XIDA 5I2MA 5GJWB 3CMAA 5DLOA 2CKKA 1EX4A 1ZBXA 2PVDB 3JAME 3HKSA 1QP2A 1W1FA 1Q82C 2FO0A 2YT6A 3UT1A 2QASA 1KC8C 1WX6A 2HQHA 3CD6T 2E5QA 3OY9A 2EQJA 2X3XD 2R58A 4AFUC 3CCEQ 1I1JA 1M5Q1 1PD0A 5CK9A 2GTJA 4UC4A 1SHGA 1QWEA 4M78G 3JB9D 1XTDA 2ZPHB 1XJWB 2KRSA 4LUDA 4Y91A 4O5VA 4KULA 3H6ZA 3TSWA 2MYSA 1UGQB 2HZYA 2P0KA 3NMZC 2FYKA 1G3TA 5AT1B 2VUBA 2RJDA 5EC7A 2MWOA 1I07A 4M7DF 1TH7A 1SKUB 3X28B 1NG2A 4B6MA 4FCYA 1A0NB 2QQBA 4XTZA 2D0QB 1NJIR 4QVCA 1QVFS 1M8MA 1CKAA 1X69A 1TOVA 4DOVA 4M75C 1YITQ 1Q7YU 1UEBA 2M9UA 1WHJA 1K8AR 1IRXA 5IHIA 3G4ST 1OYXA 4KUIA 2X4YA 3A8OB 1WXTA 2RA2A 3G6ET 3FLGA 2M0OA 2K3BA 2DEUA 2K3XA 1YFNA 2SEMA 2NUZA 4JPBW 2VXFA 1BYMA 3META 4M7AE 2FRYA 2QDLA 4M7DB 2B86A 4HKEA 1Q81R 3NHNA 4LN2A 1WZOA 3EFRA 2O4XA 2CUBA 4LD6A 1WI7A 2DL4A 3BFMA 4F04B 1KQ2A 5GAN4 1VQOA 1T3SA 2DZ9A 3CD6A 4F14A 1OOTA 1Q7YC 2W0ZA 1PSEA 4Y92A 4M77A 2LVMA 4E7JA 2E6NA 2EWNA 4KGZB 2E10A 1JJ2P 1WLPB 5DM7R 2X4XA 4C8QC 2DFUA 2MPXC 2E3IA 7AT1B 2V1RA 3RIRA 1VQ9T 4P5NA 3FC3A 2DIGA 3OYYA 2JS2A 2QGGA 1ZUUA 2E12A 3CPWS 2JVVA 2DMOA 1VQMQ 1WQWA 2QDYB 2JW4A 2GNCA 3CC2T 3HL8A 4JJCA 1M1FA 4DQ2A 2ZPBB 2VC8A 3C94A 1VQ5Q 3OW2A 4LD9K 1K1ZA 2OTJQ 3L2QA 2CZ7B 3LH5A 4LDXA 1MNEA 1T3LA 2DVEA 1VQKQ 1I81A 4B9WA 2HL5C 3EG3A 4KBMB 4HCCA 2CP7A 5GAMe 4IUQA 5LJ5f 3PT9A 4OMPA 2GQIA 3OYLA 3RR6A 4LDYA 2EBPA 1TUGB 2DRKA 3HRSA 1YJWQ 3L1AA 5GANg 3G6EA 3QPHA 2E65A 3MP1A 2C0IA 4L5GA 2KE9A 2BZXA 1NEGA 5FRMA 1N8RC 1M2OA 2DTOA 2R57A 1R8OB 1MMAA 2K4YA 2RI3A 2RMOA 4B9XA 4M75A 4Q5WA 1UJYA 2EGAA 5KYYB 3V8LA 1KIKA 5KE3A 2FL7A 3A98A 3CPWP 2G3RA 1X6OA 3QYHB 2SRCA 4LNPA 1GFCA 4ANJA 5L23A 2EKHA 2PNIA 2RN8A 2MK5A 3PVQA 4AG2C 3UDCA 3JCMX 4RMOA 4Z8AA 1UFFA 4M7DG 2QQSA 2X51A 1H3ZA 5KE2A 1FMKA 5IHNA 3CCRT 3C12A 3C4SA 4OGEA 2DIQA 2LQ8A 1LJOA 4K11A 4Z88A 1MMGA 2DXTA 3MJXA 2XI9A 5FWBA 2WACA 1V76A 4C0FA 2ENMA 2RQWA 1BCOA 1QP3A 2EGEA 1X6GA 1VYTA 1X75C 1OX8A 3PTAA 5D6XA 4A4FA 1JJ2S 2GFUA 1PC0A 1AWJA 2QQRA 1GCQA 2FVUA 2VWFA 1RAAB 3JV3A 3CBMA 4XU0A 2A3LA 1G8XA 2MI6A 3OS0A 3P8DA 3HRTA 5HK0A 4OB2B 4XK8E 1H3HA 1VQNA 3M0UA 4JRQA 4L59A 3H41A 4C92E 2MWPA 2DXBA 2LT1A 4X9CA 4QVZA 5GAMf 2ZPEB 4E7KA 2GGRA 1K73U 2MMPA 1QVFP 3ME9A 2RI2A 3DB4A 4PJNA 2E64A 1YJ9Q 1OPLA 2DX1A 1D0XA 2VVKA 4M7DE 2DXUA 3VKIA 1UJ0A 1VIEA 4ELZC 3LYIA 4E47A 2WSFE 2YLBA 1WGSA 2YWWA 4WF2A 2O4XB 3I5RA 2FPEA 1RAIB 1WHMA 2DAQA 2BUDA 3RMQA 1YIJQ 2CT3A 3EH2A 4QQ6A 2DJZA 1N8RU 4FU6A 1IO6A 1RLQC 1NJIC 3CCET 2QTXA 2YRVA 1YI2Q 4F7UA 2YRCA 3CCRA 2CP0A 5I21A 3VUBA 2IPOB 2NUPB 5A0DA 3TVTA 1M8VA 1VIFA 1BI0A 3QYGB 5J26A 2OTLQ 3C0CA 1YI2A 1K9AA 4OMNA 2MF2A 1QCFA 2D9TA 2L3RA 1KK7A 2GTOA 2P4TA 1YJWA 2RQRA 3CCQQ 1OU8A 1VQ8Q 3QXEB 4M75G 4BY6B 2ROTA 3REAB 1YIJA 5HK3A 1JQQA 4ZN3A 2COYA 2RNAA 3MHXA 1D3BB 1AZGB 4PJOA 2OTJA 1T0JA 3FDRA 3EFOB 1HD3A 4MZMA 1W2BA 3OSVA 2Y4YA 2K79A 1D1BA 1OX9A 2PQWA 4KT0E 3S3OA 1DJ7B 2HBPA 1Q7YR 3TU4K 5GMKm 4E7ZA 1XNIA 2IG0A 2NUPA 3MEWA 4CI0C 1VQMA 2F5KA 2AT1B 3CCJT 2EQMA 2NUTB 4BACA 1YIJT 1SHFA 3X25B 1VQNQ 4M7AG 3OW2P 2OAUA 4M4ZA 2LDMA 2CREA 3VYGA 4N0AA 2HKNA 1XOVA 4AFQC 2Y90A 3JCMb 4IUTA 1TU0B 4M77G 3KFVA 3EG2A 3FEOA 2DRMA 2X4JA 2K57A 3CMEQ 2V8IA 4C0ZA 3Q1JA 2EJGA 3GOXA 3FB9A 2HMAA 5GMKh 1UUEA 1Y96A 4OMMA 1IZ6A 3G71A 2XDPA 2HAXA 3DLLA 5DLQE 9ATCB 4ZN1A 2AKKA 3MKDA 1IB8A 2CS7A 5L8RE 2EYXA 3INZA 2RF0A 3CCSA 2RO0A 4LUEA 3OYDA 4DBFA 1UGPB 2PTKA 1M1KU 2QTVA 3JCMh 1M9SA 1SPKA 2J6FA 3JCMJ 1Y71A 5LJ5g 2ABLA 2KRNA 1MNDA 3PIPA 4PJOG 4NS5A 3QUIA 5LJ3e 1QMCA 3CCUT 2RPNA 2JTMA 4C92A 2QK0A 5DY9A 4M78C 4E2FB 3PFSA 2GQVA 1H641 4M75B 2D8JA 2FPDA 2JM8A 5A0GA 5I2SA 3A8GB 2RI5A 5GAOm 3CPFA 3QWXX 4A4HA 2DLPA 2LTOA 1YP5A 3MP8A 4FYWB 1VYUA 3E19A 4N4HA 4F17A 3IQLA 2OTLT 1TG0A 1OULA 1M4ZA 3RERA 1K4US 1PRMC 4HVWA 5FW9A 1WHHA 3H0HA 2YXYA 4C8QA 2EYZA 4BI4A 1VQLQ 3D7SB 6AT1B 3VS3A 1M3BA 1OEBA 2O88A 1K76A 1P92A 4M7DC 2MOXA 1YI2T 1X2KA 2KK4A 4XU2A 3JCMd 2DL5A 5FU6C 4HCBA 4JDSA 2AKLA 2DTHA 3MEVA 2H3JA 4AT1B 3VS0A 1N5ZA 4ORZA 3JCMP 3S3NA 5KYYA 4IURA 2CUDA 4XQ3A 1VQ5A 3PMIA 2HQEA 2JTFA 2QQ9A 2ECZA 5LJ5j 2J7IA 4M77D 2KAFA 3NTIA 2ATCB 2YRDA 1PM3A 2RJFA 4A4EA 4DEXA 3CBPA 2A08A 2HSPA 1MGQA 1D0ZA 1VQNT 1SRMA 3CCLT 3CC7A 4QW2A 5AYFA 3JSCA 3SWNA 1KQ1A 2XICA 2HL3A 4KUDK 2KT1A 2BIVA 3L2WA 2ZGWA 4XTXA 4AFZC 4R56A 2V8JA 4DBHA 1W70A 4CRIA 1AWWA 4RG8A 3S3MA 1K73C 2QEXA 2KROA 3JCMW 3CD6Q 1O75A 4QKUA 5KCHA 1ZHIA 2YLCA 3JRZA 3ZBDA 2R5AA 4M77B 4C8QF 3I55A 3J7AF 2KXCA 2EGCA 4JJBA 4FT4A 1OI1A 1SSFA 3LX7A 1VQPT 1FMWA 1U5SA 5GAOq 3M4YA 4FSSA 1KHIA 2A7YA 4CC4B 2AZSA 1ABQA 1GL5A 2RK2A 2KBTA 5D6WA 4KRTA 2CH4W 1Q86U 1YWPA 2C0OA 1VUBA 5ECAA 2DO3A 1NZ9A 3M55A 2QXFA 1WHLA 4M7AD 5HCKA 2M0YA 1TSFA 5A0LA 1KJWA 2RHYA 1VQ4T 2CH4A 1KSWA 5GAN8 3M5AA 3I56Q 4BB7A 2DL3A 1G3YA 2YSQA 4LE9A 3RNJA 5GAN3 2JM9A 3HRUA 3OA6A 5IHKA 1VQ6Q 1TS9A 3QZ5B 5GAMg 1BB9A 3OW2S 2EQKA 3LGFA 3CCLQ 2OX7A 1YITT 2ED0A 2X9HA 3LWIA 4RTTA 3EHQA 3TCJA 4EDUA 1VQLT 2LCLA 1OZ3A 4ZTFA 1QLYA 2RD1A 1N9RA 2C06A 4AG1C 1NEBA 2FRWA 4C92F 1EZZB 5M9OA 3CCEA 4J9GA 2JN0A 2OJ2A 3FRNA 3GIBA 5CCAA 1VQ9Q 2LMJA 3NFCA 2NLUA 4FW1A 3EGUA 3I5SA 3LW5E 3EG1A 3NGPA 4AFSC 3ZFJA 3CMAQ 2CT4A 2NYSA 1AEYA 5CKFA 1E6HA 2ZCFB 2XDBA 1UHFA 1PHTA 4Z89A 4EMKB 2MIOA 3GPLA 2RQUA 1TUCA 1R0BG 4JLIA 3TEEA 1VQ5T 1IHWA 4EMHA 3X26B 1WFWA 2VGMA 2PZ1A 3R6NA 5LL6S 1GBQA 2HNIA 4HCKA 3ER0A 3V7CA 2CP2A 3G4SQ 1PG5B 2EYYA 1W2BS 5CIUA 3JB9J 5KYXA 3G1JA 1TWBA 2L3PA 2V8KA 2WSCE 3PNWC 3DKMA 1D3BA 1ZSZB 4L6V5 1LOJA 1KD1C 5GAN5 1FYNA 4J9BA 3EH1A 4JZ3A 4ESRA 2C0TA 4QQDA 5C6SA 1M90U 2K6DA 2RJEA 2O2OA 1ZUYA 3V7SA 2HKQB 2YHTA 1Q82R 1Q81C 4PJOD 3VUZA 3PVLA 2EAYA 2JOYA 3EHRA 4WTOB 2RB6A 1BIBA 5GANd 5GAN7 2F5TX 1Q86C 2VYTA 4WCIA 2D6FA 1K8AC 2RQVA 1VQ4Q 3HSBA 2IIMA 8ATCB 1HXDA 1VQPQ 1NBEB 1QVGA 1NPRA 3HTRA 1PKTA 4F7UE 3CCUQ 2HD0A 4RTVA 2QA4Q 2EIFA 3CCMQ 4J5YA 3VS2A 1B34A 1Y07A 1QVGP 1QCOA 4M75E 2RJCA 2DD4A 4C8QB 1Y96B 1TUDA 1BK2A 1YJNQ 2RK1A 1QKXA 2XKOC 4J7FA 2EW3A 1VQ7T 4OGCA 1WIEA 1NLOC 4J9DA 1YNZA 4J9FA 4F7UF 4IUPA 1K9MU 1RI0A 2J06A 1M1KR 4ATOA 4HXJA 3I55T 5CKBA 2PVOB 3SD4A 2CYZB 1K8AU 1XQHA 5GAOl 2CP5A 3BDUA 3HFOA 1PCXA 4OMLA 3M57A 2CP6A 1YJWT
chains in the Genus database with same CATH topology
3CC2Q 3I56Q 1Q86R 1K9MR 1Q82R 1Q81R 1JJ2P 1KQSP 1KC8R 1M1KR 3CMEQ 3CCRQ 1K8AR 1VQ5Q 1N8RR 1VQOQ 3CCUQ 1VQ9Q 2OTLQ 3CD6Q 3I55Q 2QA4Q 1YJWQ 3CCMQ 3CC7Q 3G71Q 3CCVQ 3G6EQ 1KD1R 1QVGP 1NJIR 1VQLQ 1VQNQ 2OTJQ 1W2BP 3CCQQ 3OW2P 3CMAQ 1VQ8Q 1YI2Q 1VQ6Q 1VQ4Q 1VQMQ 1YJNQ 3CPWP 2QEXQ 1VQKQ 3CCJQ 3CXCP 1QVFP 3G4SQ 3CC4Q 1M90R 3CCLQ 1YITQ 3CCSQ 3CCEQ 1VQPQ 1YHQQ 1Q7YR 1YIJQ 1VQ7Q 1K73R 1S72Q 1YJ9Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC2 Q;  3I56 Q;  1Q86 R;  1K9M R;  1Q82 R;  1Q81 R;  1JJ2 P;  1KQS P;  1KC8 R;  1M1K R;  3CME Q;  3CCR Q;  1K8A R;  1VQ5 Q;  1N8R R;  1VQO Q;  3CCU Q;  1VQ9 Q;  2OTL Q;  3CD6 Q;  3I55 Q;  2QA4 Q;  1YJW Q;  3CCM Q;  3CC7 Q;  3G71 Q;  3CCV Q;  3G6E Q;  1KD1 R;  1QVG P;  1NJI R;  1VQL Q;  1VQN Q;  2OTJ Q;  1W2B P;  3CCQ Q;  3OW2 P;  3CMA Q;  1VQ8 Q;  1YI2 Q;  1VQ6 Q;  1VQ4 Q;  1VQM Q;  1YJN Q;  3CPW P;  2QEX Q;  1VQK Q;  3CCJ Q;  3CXC P;  1QVF P;  3G4S Q;  3CC4 Q;  1M90 R;  3CCL Q;  1YIT Q;  3CCS Q;  3CCE Q;  1VQP Q;  1YHQ Q;  1Q7Y R;  1YIJ Q;  1VQ7 Q;  1K73 R;  1S72 Q;  1YJ9 Q; 
#chains in the Genus database with same CATH topology
 3QDR B;  3SB2 A;  3JB9 H;  1JO8 A;  5GAO r;  3OYB A;  4LDW A;  3SWN C;  2EJF A;  5FLX E;  4FM4 B;  4C8Q E;  1C0M A;  2E5K A;  2AHJ B;  2EVR A;  3GNG A;  1WXB A;  2JXB A;  2JTE A;  2XMF A;  1UDL A;  1KD1 R;  1YWO A;  1W2B P;  2LQN A;  4OMO A;  1W6X A;  1IRE B;  4CC7 A;  3SHW A;  1YHQ A;  2COW A;  2COZ A;  3EFO A;  2LJ3 A;  3VS6 A;  4A63 B;  3UWN A;  4BY6 C;  5KYW B;  1YJN T;  3VS7 A;  3UA6 A;  3EG9 A;  4JJD A;  2ED1 A;  2L8D A;  2PVG B;  3O8V A;  1M2V B;  2ZZD A;  4XTY A;  2QI2 A;  1WXU A;  2KSS A;  2NUT A;  3VRZ A;  4M75 F;  3ULR B;  4AMC A;  1RAF B;  1HK9 A;  3CCL A;  5KYW A;  3VV0 A;  3H8Z A;  3UA7 A;  2DTI A;  1WHG A;  4E7S A;  1YJN A;  4J9H A;  1AVZ C;  4MMK A;  1ZA1 B;  3M4G A;  4YTL A;  1FX7 A;  3M0S A;  3VS4 A;  2FB7 A;  3OYF A;  1NLP C;  4PKC C;  3URG A;  4C0G A;  2M1H A;  4F7U G;  3H0F A;  1M1K C;  2DYB A;  3LLR A;  4R55 A;  1JJ2 A;  1UGR B;  4XU1 A;  4X9D A;  3CCJ A;  5IN1 A;  2LRQ A;  3X20 B;  2K5L A;  3QG1 A;  3CCM T;  1IXD A;  3FIF A;  2FZG B;  3EG9 B;  4E7H A;  1QKW A;  2ZPG B;  4J6Y A;  3CXC A;  1QW1 A;  1V1C A;  2Z0W A;  4RTZ A;  4FW2 A;  1G5V A;  3CQT A;  5CVI A;  1PRL C;  2ROL A;  1KHC A;  4V2S A;  3CXC S;  1KC8 U;  3FJ5 A;  3OMC A;  2VKN A;  5FWC A;  2AIR B;  3I55 Q;  2EQU A;  4C0D C;  3PIO A;  2GBQ A;  1D0Y A;  2IVW A;  5GAN 6;  2QA4 T;  2JZ2 A;  1KFZ A;  1PKS A;  2A37 A;  1WPY A;  1JXM A;  3CCV T;  1VQ7 Q;  1K0S A;  2XU8 A;  4IUU A;  4M77 F;  3G4S A;  1C6V X;  4C5H A;  3O5Z A;  4JS5 A;  1UEC A;  1ZQ1 A;  2D0N A;  3OS2 A;  3GNF B;  4QVD A;  1ZBJ A;  3V8K A;  1QWF A;  4C92 B;  1RLP C;  1LPL A;  2DM1 A;  3HP9 A;  4M7A A;  4MDW A;  3LGL A;  5LJ5 e;  4LDU A;  4E6R A;  3KXT A;  4J9E A;  2M02 A;  3CME T;  2K5F A;  2BZ8 A;  1N9S A;  4DEY A;  1OPK A;  3CC4 Q;  1M90 R;  2YUN A;  2ZPF B;  3HFN A;  5IT9 E;  2JUF A;  4FYX B;  5LJ3 f;  1S72 Q;  1H8K A;  4M75 D;  2F2X A;  2O01 E;  4FIB A;  4J8O A;  4M77 C;  2F2W A;  1LCK A;  2EFI A;  4QT7 A;  3NPF A;  3JCM e;  4DA4 A;  1G3W A;  3L2V A;  4C5I A;  3LWH A;  1HSQ A;  2YUQ A;  3KUF A;  3CCV A;  1QVF A;  5FRO A;  1VQ9 A;  1JEG A;  3OYK A;  1MV0 B;  4OB0 B;  3RDV A;  1BU1 A;  2XG8 D;  1MUZ A;  2MCN A;  3CC7 T;  3L2Z A;  2RHI A;  3JCM V;  2CZ0 B;  5CQY A;  1ABO A;  3M0Q A;  3M0T A;  4HCZ A;  3I9Q A;  2QYZ A;  4II1 A;  3OS5 A;  5GAM j;  4IIO A;  4M7D D;  4KGX B;  3OYE A;  3L2R A;  3L42 A;  1RAG B;  3QJY A;  5HY6 A;  2RHU A;  2E4H A;  4C92 G;  2M51 A;  3RES A;  2OAW A;  4M7D A;  3UPU A;  2HSE B;  5IH2 A;  3BY7 A;  4PK4 A;  4KH1 B;  1VQ6 A;  5GAN j;  3VS1 A;  2OI3 A;  5IAY A;  1IGQ A;  4PJO C;  1B7T A;  1W4S A;  4BDY A;  1JXO A;  5LJ3 j;  1IGU A;  4ZGJ B;  2GF7 A;  1TXQ A;  1UG1 A;  1H92 A;  4MZP A;  2XDD A;  1B07 A;  2FG0 A;  3MEU A;  1T0H A;  1OV3 A;  2XHC A;  1BI3 A;  2I0N A;  4M78 A;  3JB9 G;  2HQX A;  2DL8 A;  4TVR A;  2A28 A;  2LCC A;  5CQX A;  3CPW A;  3BW1 A;  2X4W A;  4PFZ A;  2FPF A;  1Q95 G;  5IXF A;  2KNB B;  1B3Q A;  2LP5 A;  3QSU A;  1E7O A;  3SFM A;  2RM4 A;  1UGV A;  3CCS Q;  4JJN K;  5FU7 B;  3H9N A;  2JJ9 A;  4A4K A;  1WJR A;  1WJQ A;  1KC8 R;  4KH0 B;  5CKD A;  2LNH B;  4J7I A;  3G71 Q;  1AWX A;  1SF9 A;  2B8A A;  4OMF B;  3S6W A;  5J39 A;  2LT4 A;  3M54 A;  2QEX Q;  2DNU A;  2P0P A;  2LNV A;  2QGF B;  1ARK A;  4HA8 A;  2HEQ A;  1D1A A;  4IIM A;  2DF6 A;  3EFS A;  1U06 A;  5LJ3 d;  4J9I A;  1Q82 U;  2LQW A;  2VAS A;  3QWY A;  1OQK A;  1R77 A;  4OMQ A;  3CC4 T;  4N0A C;  2CP3 A;  1S72 A;  3REB B;  4DOW A;  5GMK e;  2L3S A;  4M7A B;  1K0X A;  4A54 A;  3BDL A;  2VGN A;  2P0Q A;  2DKG A;  2P4R A;  1G3S A;  1NYG A;  4OVA A;  3VRY A;  4PJO F;  3VU3 C;  1I5O B;  3N5B B;  1VQM T;  4E7L A;  4O6J A;  2CZ6 B;  2H8H A;  3DB3 A;  1G83 A;  4FL6 A;  4C5E A;  3A8L B;  1D09 B;  4JUV A;  3I56 T;  4PJM A;  2O9V A;  4J9C A;  1K9M R;  2E1H A;  1SG5 A;  1GXI E;  2PU9 B;  1HJD A;  1VQ8 A;  5FU6 B;  3KBG A;  2RQT A;  2FZC B;  1VQL A;  2NWM A;  1FWZ A;  3GLX A;  4A4G A;  3UF4 A;  4QQG A;  1AHJ B;  5KYX B;  1VQK T;  1RAH B;  2AZV A;  1WYX A;  4OP0 A;  4BE0 A;  1CKB A;  3G71 T;  3EAE A;  2DBM A;  4RKU E;  2LX7 A;  5GMK j;  1MMD A;  4LXC A;  2L2P A;  2LJ0 A;  4F16 A;  3JCM Q;  2HDA A;  2FZK B;  2KYM A;  1NYF A;  1QQJ A;  4GLM A;  3CCR Q;  4EMK C;  2KQW A;  1C1A A;  1ZX6 A;  2KYB A;  1M3C A;  4GBQ A;  1RAD B;  4D8D A;  1HYO A;  4ELY C;  2J6O A;  4Y28 E;  3HPW A;  3TQ7 P;  1N6A A;  4BUG A;  1VQ6 T;  1F1B B;  3OYI A;  1GRI A;  3QJ6 A;  2KEA A;  1BKB A;  1NM7 A;  1WA7 A;  2Y4X A;  3OYN A;  5D6Y A;  2ZAE A;  5J3B A;  3V7R A;  4BI8 B;  4N4I A;  1UB4 A;  1OU9 A;  2K5I A;  2L0A A;  2W10 A;  1WHK A;  1WJS A;  3PGG A;  1YJ9 A;  1M90 C;  2KRM A;  4IUV A;  3E2U A;  4FSX A;  3E9F A;  1K73 R;  1BCM A;  3U23 A;  8AT1 B;  4BE1 A;  1Q86 R;  3RKY A;  1VQO T;  5GAN e;  4J6X A;  1BIA A;  3E1S A;  2E41 A;  2F2V A;  5KCO A;  2BZY A;  2KVQ G;  4BE2 A;  1LNX A;  2PUK B;  1IHV A;  3CME A;  1GCP A;  4PJO E;  4MDX A;  1K9M C;  1AWO A;  2O31 A;  4RG2 A;  1X01 A;  1Q81 U;  1PSF A;  3ZL7 C;  3AT1 B;  4DBR A;  2EPD A;  3OYJ A;  5CR2 A;  1YHQ Q;  2DVJ A;  1U1S A;  1VOM A;  3SDZ A;  3OYG A;  2O9S A;  2DYI A;  1J3T A;  4GY5 A;  2DA9 A;  2HCK A;  3V8J A;  2DZC A;  4FYY B;  3QO3 A;  3RMS A;  3CCV Q;  4M77 E;  5EG2 A;  1D1C A;  3OMG A;  4HT9 A;  2QG9 B;  2H3E B;  2HBW A;  1GFD A;  4RTU A;  2QEX T;  2LC4 A;  5KYU B;  1SSH A;  3I35 A;  2DER A;  1WNL A;  1R0C B;  1PWT A;  2DET A;  3PMT A;  3CC4 A;  4XTV A;  4C8Q G;  3EGD B;  1YN8 A;  4JRI A;  4ME7 A;  4EIK A;  1MHN A;  1JBM A;  4MML A;  3WVE B;  1VA7 A;  2GFA A;  3MCA B;  2YUO A;  1MMN A;  2E70 A;  3R6O A;  1SRL A;  4A53 A;  4M7A F;  1GBR A;  1NE8 A;  4HVU A;  3OS1 A;  3OYC A;  3CEY A;  3FJP A;  5KH6 A;  2PUO B;  3A5Z B;  1S1N A;  5KYU A;  1VQ7 A;  3QHS A;  4PJO B;  2KI7 A;  3CMA T;  1JRI A;  3RBB B;  2EYQ A;  5LJ5 d;  3QII A;  1NPP A;  3E9G A;  2BTT A;  1ZSZ A;  3CCQ A;  3RKX A;  4BDZ A;  3THK A;  4RTW A;  2YUP A;  4ZTJ A;  5GMK i;  1AZE A;  4NOY A;  2RHX A;  3JCM g;  4M78 D;  1M1G A;  1QVP A;  3MO8 A;  2KGT A;  1CSK A;  2OTL A;  2LX9 A;  5GMK l;  2EQI A;  3OBW A;  1E6G A;  2M16 A;  3BE3 A;  4ZGE B;  4NL3 A;  1I4K 1;  4OF1 A;  1I0C A;  1RL2 A;  3SWN B;  1X43 A;  2QQA A;  3TSZ A;  4PFP A;  4E7I A;  1M3A A;  5D7U A;  1KQS P;  2DPP B;  4RTX A;  2CSI A;  5CO7 A;  3M9Q A;  3OYH A;  2DIL A;  5A2Q E;  4M78 E;  4R0K A;  2QA4 A;  2EJ9 A;  1KQS A;  3CCU A;  5KYN A;  4VUB A;  1KQS S;  1X27 A;  3CCJ Q;  2X35 A;  3TRE A;  3RKW A;  4PFO A;  3QKJ A;  3WXM B;  4C0D B;  3MEA A;  1VQP A;  2KXD A;  3UAT A;  3PE0 A;  2I2L A;  1I5L A;  1UHC A;  1RAE B;  1VQ4 A;  2J05 A;  2J6K A;  2CGH A;  4RTY A;  1FMV A;  3M53 A;  4X1V A;  3GP8 A;  1KD1 U;  1VQ8 T;  2E3H A;  5FRN A;  3OYA A;  3RUX A;  4ZNX A;  5LJ3 h;  1ZSZ C;  2RHZ A;  3HHT B;  2F1L A;  1N27 A;  4RUG A;  1WQ7 A;  3NTH A;  2MAM A;  4OB1 B;  3SEM A;  4PLI A;  3AHU A;  5GAO p;  4JRP A;  5CKH A;  4ZGD B;  5I11 A;  4J83 A;  1FXX A;  1M2V A;  2XK0 A;  1N8R R;  1TTH B;  5GAM h;  1ZUK A;  3EGD A;  5C0M A;  4X34 A;  1QCN A;  3CCS T;  2D1X A;  1RI9 A;  3G7Z A;  3M0P A;  4M7A C;  3CCQ T;  3EGX B;  2QAZ A;  1YCS B;  3OQ5 A;  4MZT A;  1X2Q A;  4C8Q D;  3X24 B;  4CC2 A;  5HKC A;  2JS0 A;  2K9G A;  1VYV A;  2JMC A;  4FYV B;  3M58 A;  3H0I A;  3LH0 A;  4PJJ A;  3VS5 A;  5CAI A;  4PJL A;  1VQO Q;  2BKD N;  2D8H A;  1Y7X A;  2LJ1 A;  1PNJ A;  3J81 E;  2EYW A;  1NJI U;  2RH2 A;  3P8H A;  1ZSG A;  3M56 A;  4JZ4 A;  2DXC A;  1LVK A;  2DE0 X;  4BI3 A;  1X6B A;  2VB6 A;  3DLM A;  3CBO A;  4EMG A;  3GF5 A;  1MV3 A;  2FEI A;  4XU3 A;  2ZPI B;  1YHQ T;  5GJV B;  2LCS A;  2KMT A;  1ACM B;  1JB0 E;  4Z02 A;  4PLL A;  1YCY A;  1RAB B;  1ZLM A;  3A8M B;  4JS4 A;  1UE9 A;  1U1T A;  1Y0M A;  1SEM A;  5GAO n;  3M59 A;  5GAM d;  3J80 E;  2V1Q A;  3QBY A;  3OYM A;  1O9S A;  2CSQ A;  1ZA2 B;  3JCM c;  2L89 A;  1V29 B;  1YIT A;  1G2B A;  4NL2 A;  2V26 A;  2LQK A;  4F7U B;  1BI2 A;  1Z9Q A;  2P84 A;  1U8R A;  4JRK A;  1EIF A;  1EFN A;  3JB9 F;  2JNG A;  2VV5 A;  3L2U A;  1Y57 A;  2DK3 A;  2F69 A;  1JU5 C;  4IKF A;  5GAN 2;  1BI1 A;  1RUW A;  5I22 A;  2EKO A;  1UGS B;  4C92 C;  2KDS A;  1KG1 A;  4D6W A;  2ESW A;  4EPC A;  1I8F A;  1WDX A;  2KR3 A;  1AT1 B;  3OBY A;  2K3Y A;  4J6W A;  2LZ6 B;  4RCC A;  1M30 A;  1AD5 A;  3JB9 I;  3WVD B;  3VYH B;  5IXB A;  3G6E Q;  3CCM A;  5FU7 C;  4JLG A;  3ASK A;  3OSS C;  2BE9 B;  3EG0 A;  2R5M A;  3I56 A;  3CXC P;  3NTK A;  4HT8 A;  2X3W D;  2CZ1 B;  3F70 A;  3ZEH A;  4C92 D;  3EGX A;  2FHD A;  2DEQ A;  3VJP A;  1VQK A;  2KT8 A;  3P8B B;  4XAX B;  1UTI A;  1OZ2 A;  4LDV A;  5LJ3 g;  3QDF A;  1BBZ A;  2L3Q A;  1AOJ A;  2XD0 A;  3MPU B;  3MP6 A;  2WSE E;  2L5Q A;  4HVV A;  4RCB A;  5CKE A;  3M0R A;  3CC2 A;  1M27 C;  2AK5 A;  1S72 T;  2A36 A;  2JT4 A;  3C95 A;  3QZ9 B;  2G6F X;  4D8K A;  4OB3 B;  2DJQ A;  4BD3 A;  1U3O A;  3GBQ A;  2DD5 A;  1YBY A;  1Z9Z A;  4FT2 A;  2JMA A;  4PNO A;  2CDT A;  1GCQ C;  2VXE A;  4C5G A;  4M78 B;  4PL6 A;  3JCM f;  4DBQ A;  2DL7 A;  4N4G A;  5GAN f;  2DBK A;  1QVG S;  2BE7 D;  2GCX A;  1PD1 A;  4XTW A;  4CC3 A;  2YDL A;  4GLK A;  3CC7 Q;  2OTJ T;  2K7A A;  4KGV B;  1YJ9 T;  3T9N A;  3A1P A;  2K2V A;  2KY9 A;  3A8H B;  2E6Z A;  4EMK A;  4M78 F;  4XTU A;  2A0F B;  5LJ5 h;  2K2M A;  1RAC B;  3OB9 A;  1B34 B;  3CC2 Q;  5GAN h;  2XID A;  5I2M A;  5GJW B;  3CMA A;  5DLO A;  2CKK A;  1EX4 A;  1ZBX A;  2PVD B;  3JAM E;  3HKS A;  1QP2 A;  1W1F A;  1Q82 C;  2FO0 A;  2YT6 A;  3UT1 A;  2QAS A;  1KC8 C;  1WX6 A;  2HQH A;  3CD6 T;  2E5Q A;  3OY9 A;  2EQJ A;  2X3X D;  2R58 A;  4AFU C;  3CCE Q;  1I1J A;  1M5Q 1;  1PD0 A;  5CK9 A;  2GTJ A;  4UC4 A;  1SHG A;  1QWE A;  4M78 G;  3JB9 D;  1XTD A;  2ZPH B;  1XJW B;  2KRS A;  4LUD A;  4Y91 A;  4O5V A;  4KUL A;  3H6Z A;  3TSW A;  2MYS A;  1UGQ B;  2HZY A;  2P0K A;  3NMZ C;  2FYK A;  1G3T A;  5AT1 B;  2VUB A;  2RJD A;  5EC7 A;  2MWO A;  1I07 A;  4M7D F;  1TH7 A;  1SKU B;  3X28 B;  1NG2 A;  4B6M A;  4FCY A;  1A0N B;  2QQB A;  4XTZ A;  2D0Q B;  1NJI R;  4QVC A;  1QVF S;  1M8M A;  1CKA A;  1X69 A;  1TOV A;  4DOV A;  4M75 C;  1YIT Q;  1Q7Y U;  1UEB A;  2M9U A;  1WHJ A;  1K8A R;  1IRX A;  5IHI A;  3G4S T;  1OYX A;  4KUI A;  2X4Y A;  3A8O B;  1WXT A;  2RA2 A;  3G6E T;  3FLG A;  2M0O A;  2K3B A;  2DEU A;  2K3X A;  1YFN A;  2SEM A;  2NUZ A;  4JPB W;  2VXF A;  1BYM A;  3MET A;  4M7A E;  2FRY A;  2QDL A;  4M7D B;  2B86 A;  4HKE A;  1Q81 R;  3NHN A;  4LN2 A;  1WZO A;  3EFR A;  2O4X A;  2CUB A;  4LD6 A;  1WI7 A;  2DL4 A;  3BFM A;  4F04 B;  1KQ2 A;  5GAN 4;  1VQO A;  1T3S A;  2DZ9 A;  3CD6 A;  4F14 A;  1OOT A;  1Q7Y C;  2W0Z A;  1PSE A;  4Y92 A;  4M77 A;  2LVM A;  4E7J A;  2E6N A;  2EWN A;  4KGZ B;  2E10 A;  1JJ2 P;  1WLP B;  5DM7 R;  2X4X A;  4C8Q C;  2DFU A;  2MPX C;  2E3I A;  7AT1 B;  2V1R A;  3RIR A;  1VQ9 T;  4P5N A;  3FC3 A;  2DIG A;  3OYY A;  2JS2 A;  2QGG A;  1ZUU A;  2E12 A;  3CPW S;  2JVV A;  2DMO A;  1VQM Q;  1WQW A;  2QDY B;  2JW4 A;  2GNC A;  3CC2 T;  3HL8 A;  4JJC A;  1M1F A;  4DQ2 A;  2ZPB B;  2VC8 A;  3C94 A;  1VQ5 Q;  3OW2 A;  4LD9 K;  1K1Z A;  2OTJ Q;  3L2Q A;  2CZ7 B;  3LH5 A;  4LDX A;  1MNE A;  1T3L A;  2DVE A;  1VQK Q;  1I81 A;  4B9W A;  2HL5 C;  3EG3 A;  4KBM B;  4HCC A;  2CP7 A;  5GAM e;  4IUQ A;  5LJ5 f;  3PT9 A;  4OMP A;  2GQI A;  3OYL A;  3RR6 A;  4LDY A;  2EBP A;  1TUG B;  2DRK A;  3HRS A;  1YJW Q;  3L1A A;  5GAN g;  3G6E A;  3QPH A;  2E65 A;  3MP1 A;  2C0I A;  4L5G A;  2KE9 A;  2BZX A;  1NEG A;  5FRM A;  1N8R C;  1M2O A;  2DTO A;  2R57 A;  1R8O B;  1MMA A;  2K4Y A;  2RI3 A;  2RMO A;  4B9X A;  4M75 A;  4Q5W A;  1UJY A;  2EGA A;  5KYY B;  3V8L A;  1KIK A;  5KE3 A;  2FL7 A;  3A98 A;  3CPW P;  2G3R A;  1X6O A;  3QYH B;  2SRC A;  4LNP A;  1GFC A;  4ANJ A;  5L23 A;  2EKH A;  2PNI A;  2RN8 A;  2MK5 A;  3PVQ A;  4AG2 C;  3UDC A;  3JCM X;  4RMO A;  4Z8A A;  1UFF A;  4M7D G;  2QQS A;  2X51 A;  1H3Z A;  5KE2 A;  1FMK A;  5IHN A;  3CCR T;  3C12 A;  3C4S A;  4OGE A;  2DIQ A;  2LQ8 A;  1LJO A;  4K11 A;  4Z88 A;  1MMG A;  2DXT A;  3MJX A;  2XI9 A;  5FWB A;  2WAC A;  1V76 A;  4C0F A;  2ENM A;  2RQW A;  1BCO A;  1QP3 A;  2EGE A;  1X6G A;  1VYT A;  1X75 C;  1OX8 A;  3PTA A;  5D6X A;  4A4F A;  1JJ2 S;  2GFU A;  1PC0 A;  1AWJ A;  2QQR A;  1GCQ A;  2FVU A;  2VWF A;  1RAA B;  3JV3 A;  3CBM A;  4XU0 A;  2A3L A;  1G8X A;  2MI6 A;  3OS0 A;  3P8D A;  3HRT A;  5HK0 A;  4OB2 B;  4XK8 E;  1H3H A;  1VQN A;  3M0U A;  4JRQ A;  4L59 A;  3H41 A;  4C92 E;  2MWP A;  2DXB A;  2LT1 A;  4X9C A;  4QVZ A;  5GAM f;  2ZPE B;  4E7K A;  2GGR A;  1K73 U;  2MMP A;  1QVF P;  3ME9 A;  2RI2 A;  3DB4 A;  4PJN A;  2E64 A;  1YJ9 Q;  1OPL A;  2DX1 A;  1D0X A;  2VVK A;  4M7D E;  2DXU A;  3VKI A;  1UJ0 A;  1VIE A;  4ELZ C;  3LYI A;  4E47 A;  2WSF E;  2YLB A;  1WGS A;  2YWW A;  4WF2 A;  2O4X B;  3I5R A;  2FPE A;  1RAI B;  1WHM A;  2DAQ A;  2BUD A;  3RMQ A;  1YIJ Q;  2CT3 A;  3EH2 A;  4QQ6 A;  2DJZ A;  1N8R U;  4FU6 A;  1IO6 A;  1RLQ C;  1NJI C;  3CCE T;  2QTX A;  2YRV A;  1YI2 Q;  4F7U A;  2YRC A;  3CCR A;  2CP0 A;  5I21 A;  3VUB A;  2IPO B;  2NUP B;  5A0D A;  3TVT A;  1M8V A;  1VIF A;  1BI0 A;  3QYG B;  5J26 A;  2OTL Q;  3C0C A;  1YI2 A;  1K9A A;  4OMN A;  2MF2 A;  1QCF A;  2D9T A;  2L3R A;  1KK7 A;  2GTO A;  2P4T A;  1YJW A;  2RQR A;  3CCQ Q;  1OU8 A;  1VQ8 Q;  3QXE B;  4M75 G;  4BY6 B;  2ROT A;  3REA B;  1YIJ A;  5HK3 A;  1JQQ A;  4ZN3 A;  2COY A;  2RNA A;  3MHX A;  1D3B B;  1AZG B;  4PJO A;  2OTJ A;  1T0J A;  3FDR A;  3EFO B;  1HD3 A;  4MZM A;  1W2B A;  3OSV A;  2Y4Y A;  2K79 A;  1D1B A;  1OX9 A;  2PQW A;  4KT0 E;  3S3O A;  1DJ7 B;  2HBP A;  1Q7Y R;  3TU4 K;  5GMK m;  4E7Z A;  1XNI A;  2IG0 A;  2NUP A;  3MEW A;  4CI0 C;  1VQM A;  2F5K A;  2AT1 B;  3CCJ T;  2EQM A;  2NUT B;  4BAC A;  1YIJ T;  1SHF A;  3X25 B;  1VQN Q;  4M7A G;  3OW2 P;  2OAU A;  4M4Z A;  2LDM A;  2CRE A;  3VYG A;  4N0A A;  2HKN A;  1XOV A;  4AFQ C;  2Y90 A;  3JCM b;  4IUT A;  1TU0 B;  4M77 G;  3KFV A;  3EG2 A;  3FEO A;  2DRM A;  2X4J A;  2K57 A;  3CME Q;  2V8I A;  4C0Z A;  3Q1J A;  2EJG A;  3GOX A;  3FB9 A;  2HMA A;  5GMK h;  1UUE A;  1Y96 A;  4OMM A;  1IZ6 A;  3G71 A;  2XDP A;  2HAX A;  3DLL A;  5DLQ E;  9ATC B;  4ZN1 A;  2AKK A;  3MKD A;  1IB8 A;  2CS7 A;  5L8R E;  2EYX A;  3INZ A;  2RF0 A;  3CCS A;  2RO0 A;  4LUE A;  3OYD A;  4DBF A;  1UGP B;  2PTK A;  1M1K U;  2QTV A;  3JCM h;  1M9S A;  1SPK A;  2J6F A;  3JCM J;  1Y71 A;  5LJ5 g;  2ABL A;  2KRN A;  1MND A;  3PIP A;  4PJO G;  4NS5 A;  3QUI A;  5LJ3 e;  1QMC A;  3CCU T;  2RPN A;  2JTM A;  4C92 A;  2QK0 A;  5DY9 A;  4M78 C;  4E2F B;  3PFS A;  2GQV A;  1H64 1;  4M75 B;  2D8J A;  2FPD A;  2JM8 A;  5A0G A;  5I2S A;  3A8G B;  2RI5 A;  5GAO m;  3CPF A;  3QWX X;  4A4H A;  2DLP A;  2LTO A;  1YP5 A;  3MP8 A;  4FYW B;  1VYU A;  3E19 A;  4N4H A;  4F17 A;  3IQL A;  2OTL T;  1TG0 A;  1OUL A;  1M4Z A;  3RER A;  1K4U S;  1PRM C;  4HVW A;  5FW9 A;  1WHH A;  3H0H A;  2YXY A;  4C8Q A;  2EYZ A;  4BI4 A;  1VQL Q;  3D7S B;  6AT1 B;  3VS3 A;  1M3B A;  1OEB A;  2O88 A;  1K76 A;  1P92 A;  4M7D C;  2MOX A;  1YI2 T;  1X2K A;  2KK4 A;  4XU2 A;  3JCM d;  2DL5 A;  5FU6 C;  4HCB A;  4JDS A;  2AKL A;  2DTH A;  3MEV A;  2H3J A;  4AT1 B;  3VS0 A;  1N5Z A;  4ORZ A;  3JCM P;  3S3N A;  5KYY A;  4IUR A;  2CUD A;  4XQ3 A;  1VQ5 A;  3PMI A;  2HQE A;  2JTF A;  2QQ9 A;  2ECZ A;  5LJ5 j;  2J7I A;  4M77 D;  2KAF A;  3NTI A;  2ATC B;  2YRD A;  1PM3 A;  2RJF A;  4A4E A;  4DEX A;  3CBP A;  2A08 A;  2HSP A;  1MGQ A;  1D0Z A;  1VQN T;  1SRM A;  3CCL T;  3CC7 A;  4QW2 A;  5AYF A;  3JSC A;  3SWN A;  1KQ1 A;  2XIC A;  2HL3 A;  4KUD K;  2KT1 A;  2BIV A;  3L2W A;  2ZGW A;  4XTX A;  4AFZ C;  4R56 A;  2V8J A;  4DBH A;  1W70 A;  4CRI A;  1AWW A;  4RG8 A;  3S3M A;  1K73 C;  2QEX A;  2KRO A;  3JCM W;  3CD6 Q;  1O75 A;  4QKU A;  5KCH A;  1ZHI A;  2YLC A;  3JRZ A;  3ZBD A;  2R5A A;  4M77 B;  4C8Q F;  3I55 A;  3J7A F;  2KXC A;  2EGC A;  4JJB A;  4FT4 A;  1OI1 A;  1SSF A;  3LX7 A;  1VQP T;  1FMW A;  1U5S A;  5GAO q;  3M4Y A;  4FSS A;  1KHI A;  2A7Y A;  4CC4 B;  2AZS A;  1ABQ A;  1GL5 A;  2RK2 A;  2KBT A;  5D6W A;  4KRT A;  2CH4 W;  1Q86 U;  1YWP A;  2C0O A;  1VUB A;  5ECA A;  2DO3 A;  1NZ9 A;  3M55 A;  2QXF A;  1WHL A;  4M7A D;  5HCK A;  2M0Y A;  1TSF A;  5A0L A;  1KJW A;  2RHY A;  1VQ4 T;  2CH4 A;  1KSW A;  5GAN 8;  3M5A A;  3I56 Q;  4BB7 A;  2DL3 A;  1G3Y A;  2YSQ A;  4LE9 A;  3RNJ A;  5GAN 3;  2JM9 A;  3HRU A;  3OA6 A;  5IHK A;  1VQ6 Q;  1TS9 A;  3QZ5 B;  5GAM g;  1BB9 A;  3OW2 S;  2EQK A;  3LGF A;  3CCL Q;  2OX7 A;  1YIT T;  2ED0 A;  2X9H A;  3LWI A;  4RTT A;  3EHQ A;  3TCJ A;  4EDU A;  1VQL T;  2LCL A;  1OZ3 A;  4ZTF A;  1QLY A;  2RD1 A;  1N9R A;  2C06 A;  4AG1 C;  1NEB A;  2FRW A;  4C92 F;  1EZZ B;  5M9O A;  3CCE A;  4J9G A;  2JN0 A;  2OJ2 A;  3FRN A;  3GIB A;  5CCA A;  1VQ9 Q;  2LMJ A;  3NFC A;  2NLU A;  4FW1 A;  3EGU A;  3I5S A;  3LW5 E;  3EG1 A;  3NGP A;  4AFS C;  3ZFJ A;  3CMA Q;  2CT4 A;  2NYS A;  1AEY A;  5CKF A;  1E6H A;  2ZCF B;  2XDB A;  1UHF A;  1PHT A;  4Z89 A;  4EMK B;  2MIO A;  3GPL A;  2RQU A;  1TUC A;  1R0B G;  4JLI A;  3TEE A;  1VQ5 T;  1IHW A;  4EMH A;  3X26 B;  1WFW A;  2VGM A;  2PZ1 A;  3R6N A;  5LL6 S;  1GBQ A;  2HNI A;  4HCK A;  3ER0 A;  3V7C A;  2CP2 A;  3G4S Q;  1PG5 B;  2EYY A;  1W2B S;  5CIU A;  3JB9 J;  5KYX A;  3G1J A;  1TWB A;  2L3P A;  2V8K A;  2WSC E;  3PNW C;  3DKM A;  1D3B A;  1ZSZ B;  4L6V 5;  1LOJ A;  1KD1 C;  5GAN 5;  1FYN A;  4J9B A;  3EH1 A;  4JZ3 A;  4ESR A;  2C0T A;  4QQD A;  5C6S A;  1M90 U;  2K6D A;  2RJE A;  2O2O A;  1ZUY A;  3V7S A;  2HKQ B;  2YHT A;  1Q82 R;  1Q81 C;  4PJO D;  3VUZ A;  3PVL A;  2EAY A;  2JOY A;  3EHR A;  4WTO B;  2RB6 A;  1BIB A;  5GAN d;  5GAN 7;  2F5T X;  1Q86 C;  2VYT A;  4WCI A;  2D6F A;  1K8A C;  2RQV A;  1VQ4 Q;  3HSB A;  2IIM A;  8ATC B;  1HXD A;  1VQP Q;  1NBE B;  1QVG A;  1NPR A;  3HTR A;  1PKT A;  4F7U E;  3CCU Q;  2HD0 A;  4RTV A;  2QA4 Q;  2EIF A;  3CCM Q;  4J5Y A;  3VS2 A;  1B34 A;  1Y07 A;  1QVG P;  1QCO A;  4M75 E;  2RJC A;  2DD4 A;  4C8Q B;  1Y96 B;  1TUD A;  1BK2 A;  1YJN Q;  2RK1 A;  1QKX A;  2XKO C;  4J7F A;  2EW3 A;  1VQ7 T;  4OGC A;  1WIE A;  1NLO C;  4J9D A;  1YNZ A;  4J9F A;  4F7U F;  4IUP A;  1K9M U;  1RI0 A;  2J06 A;  1M1K R;  4ATO A;  4HXJ A;  3I55 T;  5CKB A;  2PVO B;  3SD4 A;  2CYZ B;  1K8A U;  1XQH A;  5GAO l;  2CP5 A;  3BDU A;  3HFO A;  1PCX A;  4OML A;  3M57 A;  2CP6 A;  1YJW T; 
#chains in the Genus database with same CATH homology
 3CC2 Q;  3I56 Q;  1Q86 R;  1K9M R;  1Q82 R;  1Q81 R;  1JJ2 P;  1KQS P;  1KC8 R;  1M1K R;  3CME Q;  3CCR Q;  1K8A R;  1VQ5 Q;  1N8R R;  1VQO Q;  3CCU Q;  1VQ9 Q;  2OTL Q;  3CD6 Q;  3I55 Q;  2QA4 Q;  1YJW Q;  3CCM Q;  3CC7 Q;  3G71 Q;  3CCV Q;  3G6E Q;  1KD1 R;  1QVG P;  1NJI R;  1VQL Q;  1VQN Q;  2OTJ Q;  1W2B P;  3CCQ Q;  3OW2 P;  3CMA Q;  1VQ8 Q;  1YI2 Q;  1VQ6 Q;  1VQ4 Q;  1VQM Q;  1YJN Q;  3CPW P;  2QEX Q;  1VQK Q;  3CCJ Q;  3CXC P;  1QVF P;  3G4S Q;  3CC4 Q;  1M90 R;  3CCL Q;  1YIT Q;  3CCS Q;  3CCE Q;  1VQP Q;  1YHQ Q;  1Q7Y R;  1YIJ Q;  1VQ7 Q;  1K73 R;  1S72 Q;  1YJ9 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...