1W2BP

Trigger factor ribosome binding domain in complex with 50s
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
molecule tags Ribosome
source organism Escherichia coli
publication title Trigger Factor in Complex with the Ribosome Forms a Molecular Cradle for Nascent Proteins
pubmed doi rcsb
total genus 14
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1w2bP00
3G6EQ 3G71Q 1YITQ 3CC4Q 3I56Q 1N8RR 1KD1R 3CCVQ 3OW2P 1YIJQ 1K8AR 2QA4Q 1Q82R 1QVFP 1YHQQ 1W2BP 1Q7YR 3CMAQ 1VQLQ 2OTLQ 3CPWP 3G4SQ 3CXCP 3CCMQ 1VQOQ 1VQ6Q 1VQ9Q 3CCQQ 1KC8R 3CC7Q 1VQMQ 3CD6Q 3CCSQ 1YJWQ 1Q81R 3CC2Q 1K9MR 1VQ5Q 1VQNQ 1S72Q 1VQPQ 2QEXQ 1YJNQ 3CCRQ 1KQSP 1VQ8Q 1K73R 3CCUQ 1M90R 1NJIR 1QVGP 3I55Q 3CCEQ 1M1KR 1JJ2P 1VQ4Q 1YJ9Q 1VQKQ 3CMEQ 3CCJQ 1YI2Q 1VQ7Q 2OTJQ 1Q86R 3CCLQ
chains in the Genus database with same CATH superfamily
2AK5A 3HRTA 3QIIA 2L3RA 1SRLA 3H6ZA 1ZA2B 1I5OB 5ECAA 4O6JA 4QW2A 3GNGA 5KYNA 3M0QA 4C5HA 5FU7C 3OYLA 2K4YA 4HCKA 3PFSA 2RA2A 1GFDA 1JJ2P 2K57A 3RESA 1YIJT 3RKWA 5DM7R 4E7ZA 2Y90A 5CKDA 1WX6A 1K9MU 1YITT 4M77C 5GAOq 3S3NA 3QXEB 1RAHB 4QQGA 3GOXA 2BZXA 2DLPA 1FXXA 2OJ2A 4HVVA 4J6WA 3C4SA 1MNDA 1CKBA 1BBZA 4IURA 4OMQA 3WXMB 1UE9A 2CP2A 2NLUA 2ZPIB 3CCQA 1PKSA 2RHUA 1WDXA 1M1KR 4OGEA 1NZ9A 5LJ5h 5KYXA 3MKDA 2LT1A 3EGXA 5I21A 2YUQA 5LJ5d 3OA6A 3EG9B 3QG1A 4A4KA 1VQMA 2HDAA 1IGQA 2LJ0A 1WJQA 3G71A 2JM9A 5DLQE 2R5AA 4Z8AA 1U1SA 1KSWA 4C92F 4JJCA 5GAOr 3OBYA 1LCKA 1H3HA 4PFZA 1RI0A 3U23A 2MYSA 3CCEA 2JJ9A 4BI3A 3UWNA 2EQIA 1AZEA 2YRVA 2OTJA 3H9NA 1JXOA 1VYUA 2OTLQ 2DTIA 3D7SB 2KYMA 2RK2A 1IREB 5GAMh 4AT1B 2GNCA 2WSCE 3SHWA 2HBPA 4LDYA 1NEGA 2LNHB 4AFUC 4PJOE 3LLRA 1PSFA 1KHIA 1Y7XA 2B86A 1PSEA 3REBB 2PQWA 1ZBXA 2K3YA 4B9XA 2DYIA 1QVFP 2O4XA 5FW9A 1OV3A 3ER0A 3OYCA 3VS7A 2F2XA 4JS4A 1W2BA 2QASA 1IGUA 4KBMB 2EBPA 2B8AA 3CCUQ 2VGMA 3PE0A 5HKCA 5LJ5j 4EMHA 2EJ9A 4PJLA 1N8RU 3ASKA 3TU4K 2DNUA 3GIBA 1ZX6A 2DRKA 2HQEA 1YI2Q 2E6ZA 2LX9A 2EW3A 2C0TA 1OX8A 4ELYC 4GBQA 4JLGA 2CDTA 1TUGB 2FG0A 4C92D 3M54A 1ZQ1A 4FW2A 2GQIA 1IB8A 1UGSB 4Y28E 1RI9A 1BB9A 1D1CA 3A8HB 2KVQG 2JXBA 2KDSA 3I56T 2RK1A 4K11A 1RUWA 2ABLA 4HA8A 2M51A 3TSZA 3DB4A 1IXDA 2M0OA 2QA4A 3EHQA 4C92G 3VRYA 1X6GA 2EJFA 4RTYA 4C0FA 5I22A 3CPWP 7AT1B 1KC8R 1VQ8T 1M1GA 5IN1A 3NTHA 1WXUA 5IHNA 2QYZA 4QVDA 1S72T 2FB7A 2BUDA 5FU7B 1V76A 1N8RC 2DAQA 2E6NA 1J3TA 2XDDA 3THKA 3CPWA 3CCVQ 3V7SA 3CPFA 4OMNA 4E7KA 3CMAA 1Q7YR 3KXTA 2FVUA 2PNIA 5A0GA 2RQRA 3PIPA 4O5VA 1AWXA 2WSEE 4Q5WA 4EMKB 2RQWA 4J9DA 1VQ7T 2GQVA 3VJPA 5KCHA 4BUGA 4PLIA 4RUGA 2DX1A 4M7DG 2SEMA 4X9DA 1VUBA 6AT1B 2Z0WA 2VGNA 1QMCA 3P8HA 4XU0A 1X6BA 1VQPT 1MMGA 1AWWA 3V8KA 2ZPGB 1XNIA 3CCRT 2OAUA 2EPDA 3O5ZA 4BY6C 2P0QA 2LQNA 4JRPA 4NL3A 5CCAA 3JB9D 3MEVA 2RI5A 4XU3A 1U3OA 1T3LA 2DIQA 3CC4Q 3V7CA 2E5KA 1M1FA 3SFMA 1YHQA 2ED1A 2F2VA 4BD3A 3NTIA 3HFOA 2QEXT 3JCMc 4OF1A 1D1AA 2JS2A 1PD1A 4J9GA 1G3SA 1ZUKA 2DL7A 5IXFA 5J39A 4ANJA 3I55Q 2QG9B 4QVZA 3RKXA 5CKBA 1I8FA 2AT1B 4HVUA 3CCET 2JM8A 3OYYA 3M56A 3H0FA 3M55A 1W2BP 4XTYA 1WHKA 1W70A 2XICA 4C0DC 2F69A 3CCSQ 1YJWQ 4BACA 4XTXA 3ULRB 3OMCA 5GAMg 1IHVA 3MCAB 5FRNA 1N9SA 1PHTA 1OOTA 3GP8A 1VQ4Q 3GNFB 1JO8A 2RD1A 3JAME 1AOJA 2O31A 1WJRA 1YNZA 2EJGA 4NL2A 3UATA 4OB1B 3C12A 1BCMA 1XQHA 2RQVA 2RO0A 2PZ1A 1UGVA 1VQOQ 2EQKA 5GANf 1VQ6Q 2LX7A 3G7ZA 4MZMA 2LCLA 1K9MC 5FU6B 1JJ2S 5GAOm 2OX7A 1RLQC 2OTJT 4IUPA 3QUIA 3QYGB 2YLBA 5GANg 1VQNA 4JJBA 2G6FX 3QZ5B 2COZA 4Z88A 2KROA 5AT1B 2OAWA 3VS4A 2K2VA 2P84A 4OB3B 1K0XA 4RTZA 2L3SA 4ZTJA 1M4ZA 2BE7D 3OYJA 2MOXA 2CZ6B 2V8JA 5LJ5e 1VQLT 2KRMA 4LDWA 3CD6T 1UUEA 1TUCA 1QCFA 5J26A 1I5LA 1M2VB 2CZ7B 2AZSA 2DEQA 4R55A 2XKOC 4M77D 2EGCA 1Y0MA 4JUVA 2GBQA 2FZCB 4M75B 4C0ZA 4F16A 1NYGA 4A4GA 4C92C 4IUQA 1K9MR 1JQQA 1Z9ZA 1GRIA 1Q86U 1T0JA 1XOVA 1S1NA 2CSQA 4BY6B 4RTTA 2HEQA 2XU8A 1QVGS 2E41A 3AHUA 3EG3A 3PIOA 2CT4A 1RAIB 2KT1A 1WHGA 2BZ8A 2DETA 1WZOA 2NUPB 1M90U 2HL5C 1LNXA 2LVMA 1VA7A 3WVEB 1SSFA 1WJSA 2MF2A 1NBEB 4DA4A 2AKLA 2EYQA 2K5LA 3L2ZA 4PJNA 1EFNA 1SKUB 1QQJA 5FRMA 5KYYA 2QGGA 3CCLQ 5CAIA 1BYMA 1KD1R 2D8HA 3MP6A 2RJDA 3EAEA 1N27A 5GAN2 2E3HA 1QKWA 1I0CA 2GCXA 1RAFB 1Q82C 3JCMh 1B34A 3OYMA 4QQ6A 2L3QA 1X6OA 2L0AA 9ATCB 2J6OA 4J83A 2FL7A 4OP0A 1VQNT 2M9UA 2G3RA 3PNWC 3VS1A 3CCEQ 3CMEQ 4RTXA 2V1QA 2VXEA 3OSSC 1Z9QA 4MZPA 3M53A 3T9NA 5LJ3e 2QA4T 1Q7YC 3EG0A 5LJ5f 3OYKA 3CCUT 1I1JA 5IXBA 1S72A 4J6XA 4M7DF 2QQRA 2RQTA 3E19A 4M78D 1KQ1A 3FJ5A 4B9WA 5CKFA 1C1AA 2RJFA 3JCMX 2EYXA 1G8XA 2FPDA 4M78F 4PJOF 3SEMA 2O4XB 4ESRA 3OW2A 1Y57A 1W1FA 4J6YA 1M30A 1Q81R 1QKXA 3CCJA 2X51A 4AG2C 3JB9F 2CS7A 1MHNA 1PKTA 4N4IA 2J06A 3HKSA 4M75A 2DXCA 1YITQ 3HFNA 5C0MA 1TG0A 4OMPA 2VVKA 4OVAA 4BDZA 3CD6Q 2RMOA 1YHQT 3CCLA 1W2BS 2DA9A 3SWNA 1M5Q1 1WXTA 3OYAA 3OS5A 1YJNA 3PMIA 2YUOA 3EFOA 1PRMC 3VUZA 4IKFA 3MPUB 3E9GA 1M27C 2QQBA 1YJNT 1VQKQ 1X01A 3M0RA 1BU1A 2A3LA 5A0LA 4QVCA 1CSKA 4F04B 2DVJA 2PVDB 4EPCA 1WIEA 2O2OA 4L6V5 5GANj 2DPPB 2YUPA 5EG2A 3AT1B 2VXFA 3CMEA 2CH4W 2KRSA 4PKCC 2VV5A 3EHRA 3ZL7C 3F70A 4M7AF 4FIBA 5GMKi 3CCMA 4IUUA 4C92B 4PJJA 2DL8A 4KT0E 1H3ZA 4E7IA 5L23A 3CMAQ 2K3XA 3M4GA 3FB9A 2R57A 1SG5A 4KUDK 3IQLA 3UA6A 2YHTA 3CBMA 5I2SA 3A8LB 1D09B 3KUFA 4Z02A 3CBOA 2K5IA 3A98A 1GBRA 4M7AA 3JCMV 1TSFA 3G4SQ 1RACB 1TH7A 2P4RA 3CCMQ 1ZSZC 3EG2A 3GLXA 3VS0A 2RHYA 3MEAA 2DD5A 3CCQT 3OW2S 1K73R 3HPWA 3JB9J 3FLGA 4PJOG 3CCJQ 2ECZA 1SPKA 1LJOA 2C06A 2V1RA 4J9EA 4FT4A 3M4YA 1Q82R 2X4YA 1K9AA 3HSBA 1ZSZA 2V26A 1TU0B 4KGXB 3R6NA 4M7DB 2D8JA 1M3BA 3PVQA 3E2UA 2HSEB 2FO0A 2LDMA 1T0HA 1D3BB 1WGSA 5AYFA 1M1KU 5LJ3h 2NUTA 1JRIA 3H8ZA 1QVPA 1WYXA 4JRQA 3VKIA 4CI0C 4RTVA 3GBQA 2EYZA 1LOJA 3JCMf 1VQ9T 2R58A 4XTZA 2HKNA 3QJ6A 1VQKA 2RI3A 3OS2A 4F7UA 4XU1A 2FEIA 1AEYA 3L42A 1ZA1B 1D0YA 1RAAB 4EMKA 4QQDA 4PJOA 4M7DE 4M78G 1O9SA 2A28A 3PVLA 2DL5A 2YLCA 4ZGJB 1YFNA 4JRKA 2IVWA 2ZPBB 1YIJQ 3BDUA 3MP1A 2LCSA 1H641 1YHQQ 1VIFA 2JMAA 1QLYA 4R56A 1HXDA 3NGPA 2KGTA 2KK4A 1VQ5Q 1V29B 4Y91A 1YIJA 5IHKA 3DKMA 3S3MA 3QO3A 3I55A 2KAFA 3I5SA 3LX7A 4FW1A 4E7LA 1M3AA 3KBGA 1E7OA 1GXIE 1VQ5A 2DZ9A 3M0PA 1QVGA 4N4GA 3G6EQ 2DEUA 2CZ0B 2DBKA 3LH0A 2OTLA 2JOYA 4OB2B 1X2QA 4JJNK 4RCCA 4Y92A 2K2MA 1N5ZA 1QW1A 2O9SA 1GL5A 3CBPA 3L2WA 3G4SA 4QKUA 4HCZA 3EG1A 2W10A 4E7JA 2KT8A 2X3WD 2RB6A 1Q86R 4LUDA 4RKUE 4XAXB 4MMLA 2RHXA 3OW2P 1NYFA 3MJXA 2RNAA 2CP7A 4PJOC 4M78C 3TSWA 4J9CA 1Q81C 2DD4A 1YI2T 2YSQA 4IIMA 3G71T 1N6AA 4IUVA 3C0CA 4M7DC 3OS1A 5GANe 2IG0A 1FMKA 5I11A 2QTXA 1X27A 2DF6A 2OTLT 1ARKA 4CC7A 2HAXA 3G1JA 3A8MB 2FRWA 3JB9G 5CQYA 2ZPHB 4Z89A 3RNJA 1W4SA 1JBMA 5GAMj 3ME9A 1ZUUA 3JCMb 1ZSZB 1MNEA 1R0BG 2DJZA 3A5ZB 2E70A 1SEMA 2D1XA 1KQ2A 2DTHA 2EKOA 2GFAA 2MMPA 4PNOA 4JZ4A 5CVIA 3CCSA 1QCNA 1YJWA 1OZ3A 4CC3A 1JB0E 4BE0A 1I81A 2DE0X 4AMCA 3JB9I 4C8QC 1IHWA 3H0HA 1QP3A 2K5FA 5GMKh 1MMAA 1AZGB 1C0MA 2X4XA 3CCVA 4XU2A 1VQ6T 4C5EA 1W6XA 2VB6A 2Y4YA 2LQ8A 4II1A 4KGZB 3EG9A 1SRMA 5CIUA 1KC8U 2HSPA 4LDXA 2DTOA 1M2OA 3I35A 2P4TA 3CC2T 2YRCA 4C5IA 3OYDA 3P8DA 3RMSA 2QI2A 5KYWA 1H8KA 5KYXB 2LJ1A 2JTFA 3I56Q 4M77G 2MK5A 1RAGB 1Y96B 4ZNXA 1FYNA 4VUBA 1G3WA 2JNGA 5IH2A 1G2BA 1X43A 2CP5A 2O9VA 2KSSA 1VQMQ 1HK9A 1VIEA 3L2QA 1EZZB 3EGDA 4KULA 2K9GA 2X4JA 1K8AU 4EDUA 2DYBA 1GCQC 4M7DD 2Y4XA 4XTWA 1VQ7A 3X24B 2EGEA 2DIGA 2QAZA 1SHGA 2V8IA 4EMGA 4HKEA 5GAN3 1IRXA 4M77F 2BKDN 1OPLA 2LRQA 1NLOC 4LXCA 4XTUA 1TWBA 1EIFA 2D0NA 3EFOB 1GCQA 4M77B 1ZHIA 3MHXA 5CKEA 3SWNB 1QP2A 2HCKA 3META 1YITA 2ESWA 1VQ8A 3I9QA 3MEUA 4OMFB 2XDPA 2JS0A 3VUBA 5CKHA 1V1CA 4M75F 1VQPQ 3QHSA 3CCRQ 1M90R 4J9BA 5A0DA 2VUBA 1WLPB 1NJIC 2PVGB 1KD1C 4LE9A 4F7UB 3QWXX 2DM1A 4M7AE 1NEBA 2K79A 4FSSA 4V2SA 2CP3A 2CSIA 1KK7A 1WQ7A 2KXCA 2QDYB 4DOVA 3CCQQ 1M8VA 4NOYA 2E12A 3I55T 1OEBA 1FWZA 2XI9A 4J7FA 3RIRA 4AFZC 1Y71A 4FU6A 4JZ3A 3X26B 2ZPEB 3NMZC 2M1HA 4XTVA 4BI8B 2RJEA 2LZ6B 1YJ9Q 1WPYA 3E9FA 3BY7A 2EYYA 1B7TA 3N5BB 2MAMA 4C92E 8ATCB 4KGVB 2KNBB 4M77A 2ED0A 1S72Q 4E47A 1PD0A 5I2MA 1VQ4T 1XJWB 2XHCA 2A0FB 1BKBA 4TVRA 5EC7A 2COWA 2KRNA 3FC3A 2FRYA 1AD5A 3OQ5A 4HVWA 4JS5A 3PT9A 3JCMd 1OI1A 4M75D 5KYYB 4FCYA 4GLMA 4AFSC 3BE3A 4P5NA 3EGDB 4IUTA 2L5QA 3L2RA 2KEAA 5GAMe 5GAN6 1K73C 1UGRB 4C5GA 4WCIA 2CT3A 3OMGA 4C0GA 1MMDA 2YUNA 1Y96A 3INZA 2RF0A 1PWTA 1Y07A 1NG2A 1VQLQ 2CYZB 4PJMA 1MV3A 1YWPA 2O01E 3SDZA 4PJOB 2J05A 4DBHA 3C95A 4PJOD 5CR2A 5HK3A 1VYTA 2L3PA 2WACA 1YJNQ 2A7YA 1VQ8Q 2JW4A 4OB0B 3R6OA 1H92A 2KBTA 4X34A 4KH1B 4M7AG 3RR6A 5FLXE 1NJIU 1UDLA 2D0QB 5CK9A 2E5QA 3MP8A 1K8AR 1K76A 3QWYA 1GBQA 4N4HA 4OMLA 5A2QE 4C8QF 4HT9A 3SWNC 5D6XA 4HXJA 1SSHA 4YTLA 3ZFJA 4N0AC 3I5RA 5FU6C 1IZ6A 2W0ZA 3FJPA 3M5AA 3CC2A 3LWHA 1Q95G 1M3CA 1GFCA 3S6WA 1YJ9A 4M77E 3VYGA 3RBBB 2DXBA 2QQ9A 2QK0A 3M57A 2D9TA 4OMOA 3OY9A 2A08A 1QVGP 2DK3A 1WHHA 1R8OB 1PC0A 2F1LA 4J9FA 1VQ6A 3OBWA 2KI7A 1ACMB 1K8AC 1OYXA 1PRLC 3CCMT 4X9CA 1TTHB 3CXCP 3URGA 4LD6A 3DLLA 4C8QD 1WHLA 4MDXA 1UFFA 1VQNQ 1IO6A 4AG1C 4FYVB 3O8VA 2FZGB 3CMET 2OI3A 3FEOA 2H8HA 5HK0A 1M9SA 2EGAA 4N0AA 2H3EB 4D8DA 4A54A 3G6EA 1K73U 1PG5B 5LJ3d 1TOVA 2CZ1B 3PGGA 1KHCA 3LWIA 1KC8C 2X4WA 5IT9E 2C0IA 4PK4A 2FPFA 5LJ3j 1AWOA 1VYVA 2JMCA 3TVTA 1B07A 2MWPA 3M59A 1QWFA 5KYUB 1I4K1 2HQHA 3L2VA 2HL3A 4F7UG 2A36A 3CC2Q 5IHIA 1UGQB 2KQWA 2ROTA 5HY6A 4GY5A 2QDLA 3RERA 4M75G 5LJ3g 3GPLA 1OPKA 4ZGDB 4KRTA 2NUZA 2XMFA 1VQMT 2NYSA 4ME7A 3QSUA 3EH1A 1HYOA 3HL8A 2EFIA 3E1SA 1UJ0A 1MMNA 3HP9A 3M0TA 4C8QA 3JCMQ 2YT6A 3VS6A 2HKQB 1K4US 2PUOB 1KD1U 4RG2A 4C8QB 3EGUA 1N9RA 2JT4A 1KQSA 2HNIA 2LP5A 4ELZC 1VQ4A 3CCVT 4FT2A 4DBRA 5GAOp 1QVFA 1M2VA 4BDYA 2NUTB 3CC7Q 4LD9K 2CKKA 4E7HA 1D3BA 1O75A 1QVFS 3RDVA 2M02A 2RPNA 3A8GB 3JRZA 3DB3A 4M7DA 2VASA 4OGCA 4M78B 4DOWA 2DERA 2E10A 3QPHA 4E6RA 3M0UA 2LQKA 3V8JA 3V7RA 1JU5C 1AT1B 4ATOA 4ZN3A 2QEXA 3HTRA 2HD0A 1YP5A 1JEGA 2DFUA 2QXFA 3NHNA 3H41A 4M7AB 2IPOB 1UHFA 4BB7A 4M78A 1G5VA 5LJ5g 2RQUA 4EMKC 4MZTA 3BDLA 5GAMd 2ZCFB 2E1HA 1VQPA 1OU9A 2JVVA 5DLOA 2EQJA 5GAMf 1K1ZA 5GJVB 1B3QA 1WA7A 3HRSA 3J7AF 4M75E 2HMAA 1I07A 2EVRA 1NPPA 3L1AA 1G3YA 2X35A 1FX7A 4C92A 1NM7A 1WFWA 3UA7A 4M7AD 1EX4A 2P0PA 1F1BB 3OYHA 2CP6A 2BE9B 4XK8E 3JV3A 1M8MA 1D0XA 2MPXC 1WI7A 3BW1A 5GANd 2ROLA 4FYWB 3EH2A 5LL6S 3RMQA 2FPEA 1JJ2A 1M1KC 1MGQA 5HCKA 4M75C 1U5SA 3DLMA 2AZVA 2DKGA 5M9OA 4RG8A 1D1BA 2YWWA 1UJYA 3VS2A 3GF5A 2DL3A 5FROA 1ABOA 2GF7A 1A0NB 2P0KA 4L5GA 1PM3A 1RAEB 2MCNA 1VQ7Q 2XDBA 1TUDA 4QT7A 1ZBJA 2GTJA 4DBQA 5GMKl 2EIFA 4XQ3A 3I56A 3FDRA 2HZYA 2KR3A 1VQ5T 4A63B 1DJ7B 2YRDA 1UG1A 4PLLA 2RHIA 3EFSA 3OSVA 3WVDB 3QJYA 5GMKe 2XD0A 3QDRB 2LQWA 3QZ9B 1TS9A 4X1VA 1VQKT 2KXDA 4J9HA 1Q81U 4A4EA 4A53A 3CC7T 3JB9H 2DZCA 3JCMP 4M78E 1LPLA 3KFVA 1U8RA 4BI4A 1X2KA 2YDLA 3LYIA 3OYIA 2VKNA 3OYGA 3TQ7P 3PMTA 2J7IA 2GFUA 4OMMA 1HD3A 3CD6A 4WF2A 2CREA 4C0DB 2HQXA 3CCST 1YJWT 1AWJA 3JSCA 1MV0B 1YCSB 3QDFA 3H0IA 1BI0A 4DBFA 3LH5A 4A4FA 3QBYA 2XK0A 4CC4B 4LN2A 4ZGEB 4M4ZA 3CCRA 1UECA 1NE8A 1BIAA 1B34B 2K6DA 4NS5A 4HCBA 1WNLA 4FYYB 3LW5E 3G71Q 3RUXA 1U06A 1VQOT 1X69A 2EWNA 5GMKm 4MMKA 3CC4T 2VC8A 3CPWS 2V8KA 1U1TA 4LDUA 3FIFA 3CCUA 1UEBA 2LMJA 2RHZA 3BFMA 3HHTB 2DILA 1PCXA 2FHDA 2NUPA 3OS0A 1YI2A 2OTJQ 5D6WA 4HCCA 2PTKA 2COYA 2AIRB 1R77A 2GGRA 4PL6A 3VV0A 4F7UF 2FZKB 2LCCA 1NLPC 5LJ3f 3ZBDA 2L89A 2IIMA 4KH0B 3A1PA 1BI3A 3JCMW 1KJWA 4JDSA 1BK2A 3NPFA 3TREA 4J5YA 3OYNA 2VWFA 3G6ET 4DEYA 5IAYA 3A8OB 4WTOB 3TEEA 2C0OA 2RJCA 1ZSGA 3CXCA 3VU3C 5J3BA 1N8RR 4KUIA 1WXBA 2A37A 2EQUA 2LTOA 1ABQA 2CUBA 3M58A 1KIKA 4A4HA 3CC7A 3V8LA 2JTMA 1TXQA 3NTKA 3CXCS 2DMOA 1RADB 4R0KA 3MO8A 1SF9A 3OYBA 2ATCB 1HSQA 3MEWA 3LGFA 2ENMA 2H3JA 3TCJA 4JRIA 3ZEHA 4ZN1A 5KYUA 2LJ3A 3VS3A 2LNVA 4FYXB 1K0SA 3VS5A 1E6GA 2KY9A 1Q82U 2JTEA 2AKKA 3X20B 4C8QE 4LNPA 2RH2A 3EFRA 4FM4B 1HJDA 5GAN4 4UC4A 3CCLT 3LGLA 2MWOA 1OU8A 2DVEA 3QKJA 1LVKA 4CRIA 2BZYA 1ZUYA 1NPRA 1XTDA 2HBWA 1CKAA 1VQLA 2WSFE 4RTUA 4DEXA 1E6HA 2CGHA 5CO7A 3J80E 4J9IA 5GJWB 3UT1A 3QYHB 2EYWA 1M90C 1BIBA 1OX9A 1UHCA 5GAN7 4GLKA 2PU9B 2EAYA 3CCJT 1NJIR 4MDWA 1QCOA 4FSXA 4J8OA 5KH6A 4M7AC 2BTTA 3OYFA 1QWEA 2E4HA 2LC4A 1Q86C 2DXUA 2KE9A 3JCMe 2QA4Q 2FYKA 2ZPFB 4EIKA 5KE2A 2X9HA 1PNJA 2QQSA 1RABB 1UTIA 1P92A 5DY9A 3X28B 1KG1A 4FL6A 2E65A 1G3TA 2L8DA 4LDVA 1G83A 3JCMJ 2RM4A 2J6KA 1RLPC 2XG8D 3X25B 3CQTA 5L8RE 2F5KA 4B6MA 3SB2A 2I0NA 1YN8A 2DJQA 2DL4A 1OULA 2RI2A 5GAN8 4E2FB 3PTAA 4BE2A 3OYEA 2LT4A 2BIVA 2QTVA 5FWCA 2RN8A 2QQAA 3UDCA 3FRNA 1ZLMA 2M16A 1YJ9T 4D6WA 4ZTFA 5C6SA 3JCMg 4ORZA 3OB9A 1BCOA 1BI1A 1UGPB 2EKHA 2O88A 1FMVA 2XIDA 4PFPA 2VYTA 2CUDA 1VOMA 3S3OA 3RKYA 2KMTA 4E7SA 3EGXB 2DXTA 1OQKA 4PFOA 5FWBA 3REAB 3L2UA 1UB4A 5GAOn 4HT8A 3UPUA 4J7IA 2PUKB 5CQXA 3M9QA 1R0CB 2EQMA 5KYWB 2YXYA 4F7UE 1VQ9Q 1Q7YU 5GMKj 2ZZDA 3VRZA 2DO3A 2I2LA 2PVOB 2K3BA 4JLIA 1KQSS 1YWOA 2ZGWA 1VQ9A 3Q1JA 1T3SA 1JXMA 2CP0A 2X3XD 1KQSP 3CC4A 2E64A 1AVZC 5GANh 2R5MA 1OZ2A 8AT1B 1WHMA 1FMWA 3NFCA 4BE1A 5GAOl 2F2WA 3CMAT 2F5TX 1WHJA 5D7UA 1GCPA 4DQ2A 3HRUA 1MUZA 2MIOA 5GAN5 2DRMA 5D6YA 1BI2A 3VYHB 3C94A 3SD4A 1VQOA 2ZAEA 1SHFA 1RL2A 2M0YA 3G4ST 4IIOA 2QEXQ 2CH4A 2JZ2A 2AHJB 2J6FA 2KYBA 1WQWA 1AHJB 3UF4A 2DBMA 2K7AA 2GTOA 4RMOA 1YCYA 3M0SA 3CEYA 2NWMA 5KE3A 1KFZA 5KCOA 4F17A 4JJDA 2L2PA 2QGFB 2JN0A 1YBYA 3J81E 2E3IA 4LUEA 1D0ZA 4CC2A 3P8BB 2D6FA 4RCBA 1C6VX 4RTWA 4AFQC 4F14A 4C8QG 2MI6A 2SRCA 1X75C 2JUFA 4D8KA 4JPBW 4L59A
chains in the Genus database with same CATH topology
3G6EQ 3G71Q 1YITQ 3CC4Q 3I56Q 1N8RR 1KD1R 3CCVQ 3OW2P 1YIJQ 1K8AR 2QA4Q 1Q82R 1QVFP 1YHQQ 1W2BP 1Q7YR 3CMAQ 1VQLQ 2OTLQ 3CPWP 3G4SQ 3CXCP 3CCMQ 1VQOQ 1VQ6Q 1VQ9Q 3CCQQ 1KC8R 3CC7Q 1VQMQ 3CD6Q 3CCSQ 1YJWQ 1Q81R 3CC2Q 1K9MR 1VQ5Q 1VQNQ 1S72Q 1VQPQ 2QEXQ 1YJNQ 3CCRQ 1KQSP 1VQ8Q 1K73R 3CCUQ 1M90R 1NJIR 1QVGP 3I55Q 3CCEQ 1M1KR 1JJ2P 1VQ4Q 1YJ9Q 1VQKQ 3CMEQ 3CCJQ 1YI2Q 1VQ7Q 2OTJQ 1Q86R 3CCLQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G6E Q;  3G71 Q;  1YIT Q;  3CC4 Q;  3I56 Q;  1N8R R;  1KD1 R;  3CCV Q;  3OW2 P;  1YIJ Q;  1K8A R;  2QA4 Q;  1Q82 R;  1QVF P;  1YHQ Q;  1W2B P;  1Q7Y R;  3CMA Q;  1VQL Q;  2OTL Q;  3CPW P;  3G4S Q;  3CXC P;  3CCM Q;  1VQO Q;  1VQ6 Q;  1VQ9 Q;  3CCQ Q;  1KC8 R;  3CC7 Q;  1VQM Q;  3CD6 Q;  3CCS Q;  1YJW Q;  1Q81 R;  3CC2 Q;  1K9M R;  1VQ5 Q;  1VQN Q;  1S72 Q;  1VQP Q;  2QEX Q;  1YJN Q;  3CCR Q;  1KQS P;  1VQ8 Q;  1K73 R;  3CCU Q;  1M90 R;  1NJI R;  1QVG P;  3I55 Q;  3CCE Q;  1M1K R;  1JJ2 P;  1VQ4 Q;  1YJ9 Q;  1VQK Q;  3CME Q;  3CCJ Q;  1YI2 Q;  1VQ7 Q;  2OTJ Q;  1Q86 R;  3CCL Q; 
#chains in the Genus database with same CATH topology
 2AK5 A;  3HRT A;  3QII A;  2L3R A;  1SRL A;  3H6Z A;  1ZA2 B;  1I5O B;  5ECA A;  4O6J A;  4QW2 A;  3GNG A;  5KYN A;  3M0Q A;  4C5H A;  5FU7 C;  3OYL A;  2K4Y A;  4HCK A;  3PFS A;  2RA2 A;  1GFD A;  1JJ2 P;  2K57 A;  3RES A;  1YIJ T;  3RKW A;  5DM7 R;  4E7Z A;  2Y90 A;  5CKD A;  1WX6 A;  1K9M U;  1YIT T;  4M77 C;  5GAO q;  3S3N A;  3QXE B;  1RAH B;  4QQG A;  3GOX A;  2BZX A;  2DLP A;  1FXX A;  2OJ2 A;  4HVV A;  4J6W A;  3C4S A;  1MND A;  1CKB A;  1BBZ A;  4IUR A;  4OMQ A;  3WXM B;  1UE9 A;  2CP2 A;  2NLU A;  2ZPI B;  3CCQ A;  1PKS A;  2RHU A;  1WDX A;  1M1K R;  4OGE A;  1NZ9 A;  5LJ5 h;  5KYX A;  3MKD A;  2LT1 A;  3EGX A;  5I21 A;  2YUQ A;  5LJ5 d;  3OA6 A;  3EG9 B;  3QG1 A;  4A4K A;  1VQM A;  2HDA A;  1IGQ A;  2LJ0 A;  1WJQ A;  3G71 A;  2JM9 A;  5DLQ E;  2R5A A;  4Z8A A;  1U1S A;  1KSW A;  4C92 F;  4JJC A;  5GAO r;  3OBY A;  1LCK A;  1H3H A;  4PFZ A;  1RI0 A;  3U23 A;  2MYS A;  3CCE A;  2JJ9 A;  4BI3 A;  3UWN A;  2EQI A;  1AZE A;  2YRV A;  2OTJ A;  3H9N A;  1JXO A;  1VYU A;  2OTL Q;  2DTI A;  3D7S B;  2KYM A;  2RK2 A;  1IRE B;  5GAM h;  4AT1 B;  2GNC A;  2WSC E;  3SHW A;  2HBP A;  4LDY A;  1NEG A;  2LNH B;  4AFU C;  4PJO E;  3LLR A;  1PSF A;  1KHI A;  1Y7X A;  2B86 A;  1PSE A;  3REB B;  2PQW A;  1ZBX A;  2K3Y A;  4B9X A;  2DYI A;  1QVF P;  2O4X A;  5FW9 A;  1OV3 A;  3ER0 A;  3OYC A;  3VS7 A;  2F2X A;  4JS4 A;  1W2B A;  2QAS A;  1IGU A;  4KBM B;  2EBP A;  2B8A A;  3CCU Q;  2VGM A;  3PE0 A;  5HKC A;  5LJ5 j;  4EMH A;  2EJ9 A;  4PJL A;  1N8R U;  3ASK A;  3TU4 K;  2DNU A;  3GIB A;  1ZX6 A;  2DRK A;  2HQE A;  1YI2 Q;  2E6Z A;  2LX9 A;  2EW3 A;  2C0T A;  1OX8 A;  4ELY C;  4GBQ A;  4JLG A;  2CDT A;  1TUG B;  2FG0 A;  4C92 D;  3M54 A;  1ZQ1 A;  4FW2 A;  2GQI A;  1IB8 A;  1UGS B;  4Y28 E;  1RI9 A;  1BB9 A;  1D1C A;  3A8H B;  2KVQ G;  2JXB A;  2KDS A;  3I56 T;  2RK1 A;  4K11 A;  1RUW A;  2ABL A;  4HA8 A;  2M51 A;  3TSZ A;  3DB4 A;  1IXD A;  2M0O A;  2QA4 A;  3EHQ A;  4C92 G;  3VRY A;  1X6G A;  2EJF A;  4RTY A;  4C0F A;  5I22 A;  3CPW P;  7AT1 B;  1KC8 R;  1VQ8 T;  1M1G A;  5IN1 A;  3NTH A;  1WXU A;  5IHN A;  2QYZ A;  4QVD A;  1S72 T;  2FB7 A;  2BUD A;  5FU7 B;  1V76 A;  1N8R C;  2DAQ A;  2E6N A;  1J3T A;  2XDD A;  3THK A;  3CPW A;  3CCV Q;  3V7S A;  3CPF A;  4OMN A;  4E7K A;  3CMA A;  1Q7Y R;  3KXT A;  2FVU A;  2PNI A;  5A0G A;  2RQR A;  3PIP A;  4O5V A;  1AWX A;  2WSE E;  4Q5W A;  4EMK B;  2RQW A;  4J9D A;  1VQ7 T;  2GQV A;  3VJP A;  5KCH A;  4BUG A;  4PLI A;  4RUG A;  2DX1 A;  4M7D G;  2SEM A;  4X9D A;  1VUB A;  6AT1 B;  2Z0W A;  2VGN A;  1QMC A;  3P8H A;  4XU0 A;  1X6B A;  1VQP T;  1MMG A;  1AWW A;  3V8K A;  2ZPG B;  1XNI A;  3CCR T;  2OAU A;  2EPD A;  3O5Z A;  4BY6 C;  2P0Q A;  2LQN A;  4JRP A;  4NL3 A;  5CCA A;  3JB9 D;  3MEV A;  2RI5 A;  4XU3 A;  1U3O A;  1T3L A;  2DIQ A;  3CC4 Q;  3V7C A;  2E5K A;  1M1F A;  3SFM A;  1YHQ A;  2ED1 A;  2F2V A;  4BD3 A;  3NTI A;  3HFO A;  2QEX T;  3JCM c;  4OF1 A;  1D1A A;  2JS2 A;  1PD1 A;  4J9G A;  1G3S A;  1ZUK A;  2DL7 A;  5IXF A;  5J39 A;  4ANJ A;  3I55 Q;  2QG9 B;  4QVZ A;  3RKX A;  5CKB A;  1I8F A;  2AT1 B;  4HVU A;  3CCE T;  2JM8 A;  3OYY A;  3M56 A;  3H0F A;  3M55 A;  1W2B P;  4XTY A;  1WHK A;  1W70 A;  2XIC A;  4C0D C;  2F69 A;  3CCS Q;  1YJW Q;  4BAC A;  4XTX A;  3ULR B;  3OMC A;  5GAM g;  1IHV A;  3MCA B;  5FRN A;  1N9S A;  1PHT A;  1OOT A;  3GP8 A;  1VQ4 Q;  3GNF B;  1JO8 A;  2RD1 A;  3JAM E;  1AOJ A;  2O31 A;  1WJR A;  1YNZ A;  2EJG A;  4NL2 A;  3UAT A;  4OB1 B;  3C12 A;  1BCM A;  1XQH A;  2RQV A;  2RO0 A;  2PZ1 A;  1UGV A;  1VQO Q;  2EQK A;  5GAN f;  1VQ6 Q;  2LX7 A;  3G7Z A;  4MZM A;  2LCL A;  1K9M C;  5FU6 B;  1JJ2 S;  5GAO m;  2OX7 A;  1RLQ C;  2OTJ T;  4IUP A;  3QUI A;  3QYG B;  2YLB A;  5GAN g;  1VQN A;  4JJB A;  2G6F X;  3QZ5 B;  2COZ A;  4Z88 A;  2KRO A;  5AT1 B;  2OAW A;  3VS4 A;  2K2V A;  2P84 A;  4OB3 B;  1K0X A;  4RTZ A;  2L3S A;  4ZTJ A;  1M4Z A;  2BE7 D;  3OYJ A;  2MOX A;  2CZ6 B;  2V8J A;  5LJ5 e;  1VQL T;  2KRM A;  4LDW A;  3CD6 T;  1UUE A;  1TUC A;  1QCF A;  5J26 A;  1I5L A;  1M2V B;  2CZ7 B;  2AZS A;  2DEQ A;  4R55 A;  2XKO C;  4M77 D;  2EGC A;  1Y0M A;  4JUV A;  2GBQ A;  2FZC B;  4M75 B;  4C0Z A;  4F16 A;  1NYG A;  4A4G A;  4C92 C;  4IUQ A;  1K9M R;  1JQQ A;  1Z9Z A;  1GRI A;  1Q86 U;  1T0J A;  1XOV A;  1S1N A;  2CSQ A;  4BY6 B;  4RTT A;  2HEQ A;  2XU8 A;  1QVG S;  2E41 A;  3AHU A;  3EG3 A;  3PIO A;  2CT4 A;  1RAI B;  2KT1 A;  1WHG A;  2BZ8 A;  2DET A;  1WZO A;  2NUP B;  1M90 U;  2HL5 C;  1LNX A;  2LVM A;  1VA7 A;  3WVE B;  1SSF A;  1WJS A;  2MF2 A;  1NBE B;  4DA4 A;  2AKL A;  2EYQ A;  2K5L A;  3L2Z A;  4PJN A;  1EFN A;  1SKU B;  1QQJ A;  5FRM A;  5KYY A;  2QGG A;  3CCL Q;  5CAI A;  1BYM A;  1KD1 R;  2D8H A;  3MP6 A;  2RJD A;  3EAE A;  1N27 A;  5GAN 2;  2E3H A;  1QKW A;  1I0C A;  2GCX A;  1RAF B;  1Q82 C;  3JCM h;  1B34 A;  3OYM A;  4QQ6 A;  2L3Q A;  1X6O A;  2L0A A;  9ATC B;  2J6O A;  4J83 A;  2FL7 A;  4OP0 A;  1VQN T;  2M9U A;  2G3R A;  3PNW C;  3VS1 A;  3CCE Q;  3CME Q;  4RTX A;  2V1Q A;  2VXE A;  3OSS C;  1Z9Q A;  4MZP A;  3M53 A;  3T9N A;  5LJ3 e;  2QA4 T;  1Q7Y C;  3EG0 A;  5LJ5 f;  3OYK A;  3CCU T;  1I1J A;  5IXB A;  1S72 A;  4J6X A;  4M7D F;  2QQR A;  2RQT A;  3E19 A;  4M78 D;  1KQ1 A;  3FJ5 A;  4B9W A;  5CKF A;  1C1A A;  2RJF A;  3JCM X;  2EYX A;  1G8X A;  2FPD A;  4M78 F;  4PJO F;  3SEM A;  2O4X B;  4ESR A;  3OW2 A;  1Y57 A;  1W1F A;  4J6Y A;  1M30 A;  1Q81 R;  1QKX A;  3CCJ A;  2X51 A;  4AG2 C;  3JB9 F;  2CS7 A;  1MHN A;  1PKT A;  4N4I A;  2J06 A;  3HKS A;  4M75 A;  2DXC A;  1YIT Q;  3HFN A;  5C0M A;  1TG0 A;  4OMP A;  2VVK A;  4OVA A;  4BDZ A;  3CD6 Q;  2RMO A;  1YHQ T;  3CCL A;  1W2B S;  2DA9 A;  3SWN A;  1M5Q 1;  1WXT A;  3OYA A;  3OS5 A;  1YJN A;  3PMI A;  2YUO A;  3EFO A;  1PRM C;  3VUZ A;  4IKF A;  3MPU B;  3E9G A;  1M27 C;  2QQB A;  1YJN T;  1VQK Q;  1X01 A;  3M0R A;  1BU1 A;  2A3L A;  5A0L A;  4QVC A;  1CSK A;  4F04 B;  2DVJ A;  2PVD B;  4EPC A;  1WIE A;  2O2O A;  4L6V 5;  5GAN j;  2DPP B;  2YUP A;  5EG2 A;  3AT1 B;  2VXF A;  3CME A;  2CH4 W;  2KRS A;  4PKC C;  2VV5 A;  3EHR A;  3ZL7 C;  3F70 A;  4M7A F;  4FIB A;  5GMK i;  3CCM A;  4IUU A;  4C92 B;  4PJJ A;  2DL8 A;  4KT0 E;  1H3Z A;  4E7I A;  5L23 A;  3CMA Q;  2K3X A;  3M4G A;  3FB9 A;  2R57 A;  1SG5 A;  4KUD K;  3IQL A;  3UA6 A;  2YHT A;  3CBM A;  5I2S A;  3A8L B;  1D09 B;  3KUF A;  4Z02 A;  3CBO A;  2K5I A;  3A98 A;  1GBR A;  4M7A A;  3JCM V;  1TSF A;  3G4S Q;  1RAC B;  1TH7 A;  2P4R A;  3CCM Q;  1ZSZ C;  3EG2 A;  3GLX A;  3VS0 A;  2RHY A;  3MEA A;  2DD5 A;  3CCQ T;  3OW2 S;  1K73 R;  3HPW A;  3JB9 J;  3FLG A;  4PJO G;  3CCJ Q;  2ECZ A;  1SPK A;  1LJO A;  2C06 A;  2V1R A;  4J9E A;  4FT4 A;  3M4Y A;  1Q82 R;  2X4Y A;  1K9A A;  3HSB A;  1ZSZ A;  2V26 A;  1TU0 B;  4KGX B;  3R6N A;  4M7D B;  2D8J A;  1M3B A;  3PVQ A;  3E2U A;  2HSE B;  2FO0 A;  2LDM A;  1T0H A;  1D3B B;  1WGS A;  5AYF A;  1M1K U;  5LJ3 h;  2NUT A;  1JRI A;  3H8Z A;  1QVP A;  1WYX A;  4JRQ A;  3VKI A;  4CI0 C;  4RTV A;  3GBQ A;  2EYZ A;  1LOJ A;  3JCM f;  1VQ9 T;  2R58 A;  4XTZ A;  2HKN A;  3QJ6 A;  1VQK A;  2RI3 A;  3OS2 A;  4F7U A;  4XU1 A;  2FEI A;  1AEY A;  3L42 A;  1ZA1 B;  1D0Y A;  1RAA B;  4EMK A;  4QQD A;  4PJO A;  4M7D E;  4M78 G;  1O9S A;  2A28 A;  3PVL A;  2DL5 A;  2YLC A;  4ZGJ B;  1YFN A;  4JRK A;  2IVW A;  2ZPB B;  1YIJ Q;  3BDU A;  3MP1 A;  2LCS A;  1H64 1;  1YHQ Q;  1VIF A;  2JMA A;  1QLY A;  4R56 A;  1HXD A;  3NGP A;  2KGT A;  2KK4 A;  1VQ5 Q;  1V29 B;  4Y91 A;  1YIJ A;  5IHK A;  3DKM A;  3S3M A;  3QO3 A;  3I55 A;  2KAF A;  3I5S A;  3LX7 A;  4FW1 A;  4E7L A;  1M3A A;  3KBG A;  1E7O A;  1GXI E;  1VQ5 A;  2DZ9 A;  3M0P A;  1QVG A;  4N4G A;  3G6E Q;  2DEU A;  2CZ0 B;  2DBK A;  3LH0 A;  2OTL A;  2JOY A;  4OB2 B;  1X2Q A;  4JJN K;  4RCC A;  4Y92 A;  2K2M A;  1N5Z A;  1QW1 A;  2O9S A;  1GL5 A;  3CBP A;  3L2W A;  3G4S A;  4QKU A;  4HCZ A;  3EG1 A;  2W10 A;  4E7J A;  2KT8 A;  2X3W D;  2RB6 A;  1Q86 R;  4LUD A;  4RKU E;  4XAX B;  4MML A;  2RHX A;  3OW2 P;  1NYF A;  3MJX A;  2RNA A;  2CP7 A;  4PJO C;  4M78 C;  3TSW A;  4J9C A;  1Q81 C;  2DD4 A;  1YI2 T;  2YSQ A;  4IIM A;  3G71 T;  1N6A A;  4IUV A;  3C0C A;  4M7D C;  3OS1 A;  5GAN e;  2IG0 A;  1FMK A;  5I11 A;  2QTX A;  1X27 A;  2DF6 A;  2OTL T;  1ARK A;  4CC7 A;  2HAX A;  3G1J A;  3A8M B;  2FRW A;  3JB9 G;  5CQY A;  2ZPH B;  4Z89 A;  3RNJ A;  1W4S A;  1JBM A;  5GAM j;  3ME9 A;  1ZUU A;  3JCM b;  1ZSZ B;  1MNE A;  1R0B G;  2DJZ A;  3A5Z B;  2E70 A;  1SEM A;  2D1X A;  1KQ2 A;  2DTH A;  2EKO A;  2GFA A;  2MMP A;  4PNO A;  4JZ4 A;  5CVI A;  3CCS A;  1QCN A;  1YJW A;  1OZ3 A;  4CC3 A;  1JB0 E;  4BE0 A;  1I81 A;  2DE0 X;  4AMC A;  3JB9 I;  4C8Q C;  1IHW A;  3H0H A;  1QP3 A;  2K5F A;  5GMK h;  1MMA A;  1AZG B;  1C0M A;  2X4X A;  3CCV A;  4XU2 A;  1VQ6 T;  4C5E A;  1W6X A;  2VB6 A;  2Y4Y A;  2LQ8 A;  4II1 A;  4KGZ B;  3EG9 A;  1SRM A;  5CIU A;  1KC8 U;  2HSP A;  4LDX A;  2DTO A;  1M2O A;  3I35 A;  2P4T A;  3CC2 T;  2YRC A;  4C5I A;  3OYD A;  3P8D A;  3RMS A;  2QI2 A;  5KYW A;  1H8K A;  5KYX B;  2LJ1 A;  2JTF A;  3I56 Q;  4M77 G;  2MK5 A;  1RAG B;  1Y96 B;  4ZNX A;  1FYN A;  4VUB A;  1G3W A;  2JNG A;  5IH2 A;  1G2B A;  1X43 A;  2CP5 A;  2O9V A;  2KSS A;  1VQM Q;  1HK9 A;  1VIE A;  3L2Q A;  1EZZ B;  3EGD A;  4KUL A;  2K9G A;  2X4J A;  1K8A U;  4EDU A;  2DYB A;  1GCQ C;  4M7D D;  2Y4X A;  4XTW A;  1VQ7 A;  3X24 B;  2EGE A;  2DIG A;  2QAZ A;  1SHG A;  2V8I A;  4EMG A;  4HKE A;  5GAN 3;  1IRX A;  4M77 F;  2BKD N;  1OPL A;  2LRQ A;  1NLO C;  4LXC A;  4XTU A;  1TWB A;  1EIF A;  2D0N A;  3EFO B;  1GCQ A;  4M77 B;  1ZHI A;  3MHX A;  5CKE A;  3SWN B;  1QP2 A;  2HCK A;  3MET A;  1YIT A;  2ESW A;  1VQ8 A;  3I9Q A;  3MEU A;  4OMF B;  2XDP A;  2JS0 A;  3VUB A;  5CKH A;  1V1C A;  4M75 F;  1VQP Q;  3QHS A;  3CCR Q;  1M90 R;  4J9B A;  5A0D A;  2VUB A;  1WLP B;  1NJI C;  2PVG B;  1KD1 C;  4LE9 A;  4F7U B;  3QWX X;  2DM1 A;  4M7A E;  1NEB A;  2K79 A;  4FSS A;  4V2S A;  2CP3 A;  2CSI A;  1KK7 A;  1WQ7 A;  2KXC A;  2QDY B;  4DOV A;  3CCQ Q;  1M8V A;  4NOY A;  2E12 A;  3I55 T;  1OEB A;  1FWZ A;  2XI9 A;  4J7F A;  3RIR A;  4AFZ C;  1Y71 A;  4FU6 A;  4JZ3 A;  3X26 B;  2ZPE B;  3NMZ C;  2M1H A;  4XTV A;  4BI8 B;  2RJE A;  2LZ6 B;  1YJ9 Q;  1WPY A;  3E9F A;  3BY7 A;  2EYY A;  1B7T A;  3N5B B;  2MAM A;  4C92 E;  8ATC B;  4KGV B;  2KNB B;  4M77 A;  2ED0 A;  1S72 Q;  4E47 A;  1PD0 A;  5I2M A;  1VQ4 T;  1XJW B;  2XHC A;  2A0F B;  1BKB A;  4TVR A;  5EC7 A;  2COW A;  2KRN A;  3FC3 A;  2FRY A;  1AD5 A;  3OQ5 A;  4HVW A;  4JS5 A;  3PT9 A;  3JCM d;  1OI1 A;  4M75 D;  5KYY B;  4FCY A;  4GLM A;  4AFS C;  3BE3 A;  4P5N A;  3EGD B;  4IUT A;  2L5Q A;  3L2R A;  2KEA A;  5GAM e;  5GAN 6;  1K73 C;  1UGR B;  4C5G A;  4WCI A;  2CT3 A;  3OMG A;  4C0G A;  1MMD A;  2YUN A;  1Y96 A;  3INZ A;  2RF0 A;  1PWT A;  1Y07 A;  1NG2 A;  1VQL Q;  2CYZ B;  4PJM A;  1MV3 A;  1YWP A;  2O01 E;  3SDZ A;  4PJO B;  2J05 A;  4DBH A;  3C95 A;  4PJO D;  5CR2 A;  5HK3 A;  1VYT A;  2L3P A;  2WAC A;  1YJN Q;  2A7Y A;  1VQ8 Q;  2JW4 A;  4OB0 B;  3R6O A;  1H92 A;  2KBT A;  4X34 A;  4KH1 B;  4M7A G;  3RR6 A;  5FLX E;  1NJI U;  1UDL A;  2D0Q B;  5CK9 A;  2E5Q A;  3MP8 A;  1K8A R;  1K76 A;  3QWY A;  1GBQ A;  4N4H A;  4OML A;  5A2Q E;  4C8Q F;  4HT9 A;  3SWN C;  5D6X A;  4HXJ A;  1SSH A;  4YTL A;  3ZFJ A;  4N0A C;  3I5R A;  5FU6 C;  1IZ6 A;  2W0Z A;  3FJP A;  3M5A A;  3CC2 A;  3LWH A;  1Q95 G;  1M3C A;  1GFC A;  3S6W A;  1YJ9 A;  4M77 E;  3VYG A;  3RBB B;  2DXB A;  2QQ9 A;  2QK0 A;  3M57 A;  2D9T A;  4OMO A;  3OY9 A;  2A08 A;  1QVG P;  2DK3 A;  1WHH A;  1R8O B;  1PC0 A;  2F1L A;  4J9F A;  1VQ6 A;  3OBW A;  2KI7 A;  1ACM B;  1K8A C;  1OYX A;  1PRL C;  3CCM T;  4X9C A;  1TTH B;  3CXC P;  3URG A;  4LD6 A;  3DLL A;  4C8Q D;  1WHL A;  4MDX A;  1UFF A;  1VQN Q;  1IO6 A;  4AG1 C;  4FYV B;  3O8V A;  2FZG B;  3CME T;  2OI3 A;  3FEO A;  2H8H A;  5HK0 A;  1M9S A;  2EGA A;  4N0A A;  2H3E B;  4D8D A;  4A54 A;  3G6E A;  1K73 U;  1PG5 B;  5LJ3 d;  1TOV A;  2CZ1 B;  3PGG A;  1KHC A;  3LWI A;  1KC8 C;  2X4W A;  5IT9 E;  2C0I A;  4PK4 A;  2FPF A;  5LJ3 j;  1AWO A;  1VYV A;  2JMC A;  3TVT A;  1B07 A;  2MWP A;  3M59 A;  1QWF A;  5KYU B;  1I4K 1;  2HQH A;  3L2V A;  2HL3 A;  4F7U G;  2A36 A;  3CC2 Q;  5IHI A;  1UGQ B;  2KQW A;  2ROT A;  5HY6 A;  4GY5 A;  2QDL A;  3RER A;  4M75 G;  5LJ3 g;  3GPL A;  1OPK A;  4ZGD B;  4KRT A;  2NUZ A;  2XMF A;  1VQM T;  2NYS A;  4ME7 A;  3QSU A;  3EH1 A;  1HYO A;  3HL8 A;  2EFI A;  3E1S A;  1UJ0 A;  1MMN A;  3HP9 A;  3M0T A;  4C8Q A;  3JCM Q;  2YT6 A;  3VS6 A;  2HKQ B;  1K4U S;  2PUO B;  1KD1 U;  4RG2 A;  4C8Q B;  3EGU A;  1N9R A;  2JT4 A;  1KQS A;  2HNI A;  2LP5 A;  4ELZ C;  1VQ4 A;  3CCV T;  4FT2 A;  4DBR A;  5GAO p;  1QVF A;  1M2V A;  4BDY A;  2NUT B;  3CC7 Q;  4LD9 K;  2CKK A;  4E7H A;  1D3B A;  1O75 A;  1QVF S;  3RDV A;  2M02 A;  2RPN A;  3A8G B;  3JRZ A;  3DB3 A;  4M7D A;  2VAS A;  4OGC A;  4M78 B;  4DOW A;  2DER A;  2E10 A;  3QPH A;  4E6R A;  3M0U A;  2LQK A;  3V8J A;  3V7R A;  1JU5 C;  1AT1 B;  4ATO A;  4ZN3 A;  2QEX A;  3HTR A;  2HD0 A;  1YP5 A;  1JEG A;  2DFU A;  2QXF A;  3NHN A;  3H41 A;  4M7A B;  2IPO B;  1UHF A;  4BB7 A;  4M78 A;  1G5V A;  5LJ5 g;  2RQU A;  4EMK C;  4MZT A;  3BDL A;  5GAM d;  2ZCF B;  2E1H A;  1VQP A;  1OU9 A;  2JVV A;  5DLO A;  2EQJ A;  5GAM f;  1K1Z A;  5GJV B;  1B3Q A;  1WA7 A;  3HRS A;  3J7A F;  4M75 E;  2HMA A;  1I07 A;  2EVR A;  1NPP A;  3L1A A;  1G3Y A;  2X35 A;  1FX7 A;  4C92 A;  1NM7 A;  1WFW A;  3UA7 A;  4M7A D;  1EX4 A;  2P0P A;  1F1B B;  3OYH A;  2CP6 A;  2BE9 B;  4XK8 E;  3JV3 A;  1M8M A;  1D0X A;  2MPX C;  1WI7 A;  3BW1 A;  5GAN d;  2ROL A;  4FYW B;  3EH2 A;  5LL6 S;  3RMQ A;  2FPE A;  1JJ2 A;  1M1K C;  1MGQ A;  5HCK A;  4M75 C;  1U5S A;  3DLM A;  2AZV A;  2DKG A;  5M9O A;  4RG8 A;  1D1B A;  2YWW A;  1UJY A;  3VS2 A;  3GF5 A;  2DL3 A;  5FRO A;  1ABO A;  2GF7 A;  1A0N B;  2P0K A;  4L5G A;  1PM3 A;  1RAE B;  2MCN A;  1VQ7 Q;  2XDB A;  1TUD A;  4QT7 A;  1ZBJ A;  2GTJ A;  4DBQ A;  5GMK l;  2EIF A;  4XQ3 A;  3I56 A;  3FDR A;  2HZY A;  2KR3 A;  1VQ5 T;  4A63 B;  1DJ7 B;  2YRD A;  1UG1 A;  4PLL A;  2RHI A;  3EFS A;  3OSV A;  3WVD B;  3QJY A;  5GMK e;  2XD0 A;  3QDR B;  2LQW A;  3QZ9 B;  1TS9 A;  4X1V A;  1VQK T;  2KXD A;  4J9H A;  1Q81 U;  4A4E A;  4A53 A;  3CC7 T;  3JB9 H;  2DZC A;  3JCM P;  4M78 E;  1LPL A;  3KFV A;  1U8R A;  4BI4 A;  1X2K A;  2YDL A;  3LYI A;  3OYI A;  2VKN A;  3OYG A;  3TQ7 P;  3PMT A;  2J7I A;  2GFU A;  4OMM A;  1HD3 A;  3CD6 A;  4WF2 A;  2CRE A;  4C0D B;  2HQX A;  3CCS T;  1YJW T;  1AWJ A;  3JSC A;  1MV0 B;  1YCS B;  3QDF A;  3H0I A;  1BI0 A;  4DBF A;  3LH5 A;  4A4F A;  3QBY A;  2XK0 A;  4CC4 B;  4LN2 A;  4ZGE B;  4M4Z A;  3CCR A;  1UEC A;  1NE8 A;  1BIA A;  1B34 B;  2K6D A;  4NS5 A;  4HCB A;  1WNL A;  4FYY B;  3LW5 E;  3G71 Q;  3RUX A;  1U06 A;  1VQO T;  1X69 A;  2EWN A;  5GMK m;  4MMK A;  3CC4 T;  2VC8 A;  3CPW S;  2V8K A;  1U1T A;  4LDU A;  3FIF A;  3CCU A;  1UEB A;  2LMJ A;  2RHZ A;  3BFM A;  3HHT B;  2DIL A;  1PCX A;  2FHD A;  2NUP A;  3OS0 A;  1YI2 A;  2OTJ Q;  5D6W A;  4HCC A;  2PTK A;  2COY A;  2AIR B;  1R77 A;  2GGR A;  4PL6 A;  3VV0 A;  4F7U F;  2FZK B;  2LCC A;  1NLP C;  5LJ3 f;  3ZBD A;  2L89 A;  2IIM A;  4KH0 B;  3A1P A;  1BI3 A;  3JCM W;  1KJW A;  4JDS A;  1BK2 A;  3NPF A;  3TRE A;  4J5Y A;  3OYN A;  2VWF A;  3G6E T;  4DEY A;  5IAY A;  3A8O B;  4WTO B;  3TEE A;  2C0O A;  2RJC A;  1ZSG A;  3CXC A;  3VU3 C;  5J3B A;  1N8R R;  4KUI A;  1WXB A;  2A37 A;  2EQU A;  2LTO A;  1ABQ A;  2CUB A;  3M58 A;  1KIK A;  4A4H A;  3CC7 A;  3V8L A;  2JTM A;  1TXQ A;  3NTK A;  3CXC S;  2DMO A;  1RAD B;  4R0K A;  3MO8 A;  1SF9 A;  3OYB A;  2ATC B;  1HSQ A;  3MEW A;  3LGF A;  2ENM A;  2H3J A;  3TCJ A;  4JRI A;  3ZEH A;  4ZN1 A;  5KYU A;  2LJ3 A;  3VS3 A;  2LNV A;  4FYX B;  1K0S A;  3VS5 A;  1E6G A;  2KY9 A;  1Q82 U;  2JTE A;  2AKK A;  3X20 B;  4C8Q E;  4LNP A;  2RH2 A;  3EFR A;  4FM4 B;  1HJD A;  5GAN 4;  4UC4 A;  3CCL T;  3LGL A;  2MWO A;  1OU8 A;  2DVE A;  3QKJ A;  1LVK A;  4CRI A;  2BZY A;  1ZUY A;  1NPR A;  1XTD A;  2HBW A;  1CKA A;  1VQL A;  2WSF E;  4RTU A;  4DEX A;  1E6H A;  2CGH A;  5CO7 A;  3J80 E;  4J9I A;  5GJW B;  3UT1 A;  3QYH B;  2EYW A;  1M90 C;  1BIB A;  1OX9 A;  1UHC A;  5GAN 7;  4GLK A;  2PU9 B;  2EAY A;  3CCJ T;  1NJI R;  4MDW A;  1QCO A;  4FSX A;  4J8O A;  5KH6 A;  4M7A C;  2BTT A;  3OYF A;  1QWE A;  2E4H A;  2LC4 A;  1Q86 C;  2DXU A;  2KE9 A;  3JCM e;  2QA4 Q;  2FYK A;  2ZPF B;  4EIK A;  5KE2 A;  2X9H A;  1PNJ A;  2QQS A;  1RAB B;  1UTI A;  1P92 A;  5DY9 A;  3X28 B;  1KG1 A;  4FL6 A;  2E65 A;  1G3T A;  2L8D A;  4LDV A;  1G83 A;  3JCM J;  2RM4 A;  2J6K A;  1RLP C;  2XG8 D;  3X25 B;  3CQT A;  5L8R E;  2F5K A;  4B6M A;  3SB2 A;  2I0N A;  1YN8 A;  2DJQ A;  2DL4 A;  1OUL A;  2RI2 A;  5GAN 8;  4E2F B;  3PTA A;  4BE2 A;  3OYE A;  2LT4 A;  2BIV A;  2QTV A;  5FWC A;  2RN8 A;  2QQA A;  3UDC A;  3FRN A;  1ZLM A;  2M16 A;  1YJ9 T;  4D6W A;  4ZTF A;  5C6S A;  3JCM g;  4ORZ A;  3OB9 A;  1BCO A;  1BI1 A;  1UGP B;  2EKH A;  2O88 A;  1FMV A;  2XID A;  4PFP A;  2VYT A;  2CUD A;  1VOM A;  3S3O A;  3RKY A;  2KMT A;  4E7S A;  3EGX B;  2DXT A;  1OQK A;  4PFO A;  5FWB A;  3REA B;  3L2U A;  1UB4 A;  5GAO n;  4HT8 A;  3UPU A;  4J7I A;  2PUK B;  5CQX A;  3M9Q A;  1R0C B;  2EQM A;  5KYW B;  2YXY A;  4F7U E;  1VQ9 Q;  1Q7Y U;  5GMK j;  2ZZD A;  3VRZ A;  2DO3 A;  2I2L A;  2PVO B;  2K3B A;  4JLI A;  1KQS S;  1YWO A;  2ZGW A;  1VQ9 A;  3Q1J A;  1T3S A;  1JXM A;  2CP0 A;  2X3X D;  1KQS P;  3CC4 A;  2E64 A;  1AVZ C;  5GAN h;  2R5M A;  1OZ2 A;  8AT1 B;  1WHM A;  1FMW A;  3NFC A;  4BE1 A;  5GAO l;  2F2W A;  3CMA T;  2F5T X;  1WHJ A;  5D7U A;  1GCP A;  4DQ2 A;  3HRU A;  1MUZ A;  2MIO A;  5GAN 5;  2DRM A;  5D6Y A;  1BI2 A;  3VYH B;  3C94 A;  3SD4 A;  1VQO A;  2ZAE A;  1SHF A;  1RL2 A;  2M0Y A;  3G4S T;  4IIO A;  2QEX Q;  2CH4 A;  2JZ2 A;  2AHJ B;  2J6F A;  2KYB A;  1WQW A;  1AHJ B;  3UF4 A;  2DBM A;  2K7A A;  2GTO A;  4RMO A;  1YCY A;  3M0S A;  3CEY A;  2NWM A;  5KE3 A;  1KFZ A;  5KCO A;  4F17 A;  4JJD A;  2L2P A;  2QGF B;  2JN0 A;  1YBY A;  3J81 E;  2E3I A;  4LUE A;  1D0Z A;  4CC2 A;  3P8B B;  2D6F A;  4RCB A;  1C6V X;  4RTW A;  4AFQ C;  4F14 A;  4C8Q G;  2MI6 A;  2SRC A;  1X75 C;  2JUF A;  4D8K A;  4JPB W;  4L59 A; 
#chains in the Genus database with same CATH homology
 3G6E Q;  3G71 Q;  1YIT Q;  3CC4 Q;  3I56 Q;  1N8R R;  1KD1 R;  3CCV Q;  3OW2 P;  1YIJ Q;  1K8A R;  2QA4 Q;  1Q82 R;  1QVF P;  1YHQ Q;  1W2B P;  1Q7Y R;  3CMA Q;  1VQL Q;  2OTL Q;  3CPW P;  3G4S Q;  3CXC P;  3CCM Q;  1VQO Q;  1VQ6 Q;  1VQ9 Q;  3CCQ Q;  1KC8 R;  3CC7 Q;  1VQM Q;  3CD6 Q;  3CCS Q;  1YJW Q;  1Q81 R;  3CC2 Q;  1K9M R;  1VQ5 Q;  1VQN Q;  1S72 Q;  1VQP Q;  2QEX Q;  1YJN Q;  3CCR Q;  1KQS P;  1VQ8 Q;  1K73 R;  3CCU Q;  1M90 R;  1NJI R;  1QVG P;  3I55 Q;  3CCE Q;  1M1K R;  1JJ2 P;  1VQ4 Q;  1YJ9 Q;  1VQK Q;  3CME Q;  3CCJ Q;  1YI2 Q;  1VQ7 Q;  2OTJ Q;  1Q86 R;  3CCL Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...