1W2BP

Trigger factor ribosome binding domain in complex with 50s
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Trigger Factor in Complex with the Ribosome Forms a Molecular Cradle for Nascent Proteins
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 14
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1w2bP00
1YIJQ 3CCEQ 3CCQQ 1YITQ 1K8AR 1VQ4Q 1VQ8Q 3I56Q 3CPWP 1VQKQ 1YJNQ 1VQOQ 3G71Q 2QA4Q 3CC7Q 1YI2Q 3CCSQ 3CCLQ 3CCJQ 3G6EQ 3CXCP 1KC8R 3CCRQ 3CCMQ 2OTJQ 1VQ9Q 1KD1R 1JJ2P 1YJ9Q 1K73R 3CC2Q 1VQPQ 1VQ7Q 2OTLQ 1VQ6Q 3CMAQ 3CCVQ 1YJWQ 1W2BP 3CC4Q 1VQ5Q 1N8RR 1VQNQ 1QVGP 2QEXQ 1Q82R 1S72Q 1VQMQ 3CD6Q 1YHQQ 1M90R 3CCUQ 3CMEQ 1QVFP 3OW2P 1VQLQ 3I55Q 1KQSP 3G4SQ 1M1KR 1Q86R 1NJIR 1Q81R 1K9MR 1Q7YR
chains in the Genus database with same CATH superfamily
2KGTA 2EKHA 2DTIA 2JOYA 1Q82U 3QYGB 1VQ8T 1HYOA 3E1SA 4J9FA 3CCMQ 2L3RA 5HK0A 2DE0X 3RUXA 3UDCA 1I81A 1WXTA 4HA8A 4M78C 2QK0A 2R5MA 4FYWB 1O75A 1ZSZC 1KQ1A 2DEQA 5LJ5f 2CDTA 3EHRA 3I35A 1TTHB 2P0QA 3HP9A 4PL6A 1N8RC 3M0QA 4E7KA 2HD0A 1MMNA 2CSQA 4M7AF 1VQ9Q 4NL3A 3V8JA 4OVAA 4MZPA 2XG8D 2KBTA 4XU2A 2EYYA 2YHTA 2RH2A 4OB0B 3LWHA 4UC4A 3E9GA 3EFSA 1K9MC 1K8AC 3QDRB 2H3JA 1VQOT 2DVEA 2QQ9A 1Q82C 2DBMA 1BIAA 2YUPA 3HTRA 1GL5A 2FZKB 4M75A 5CR2A 4M75B 1BI2A 4B9WA 2JM9A 3OS0A 3VS0A 1KFZA 3OYKA 2A3LA 5KH6A 2VC8A 2MPXC 4BDYA 3T9NA 2K3BA 3M4GA 2DEUA 1G8XA 4OP0A 2CGHA 3OA6A 3CC4A 2B86A 2ABLA 3FC3A 1JQQA 3MCAB 5CKFA 1LVKA 4XK8E 2R5AA 1SSHA 1M30A 3JB9F 4N0AA 1J3TA 1UTIA 4RCBA 1OX9A 1YHQA 3EAEA 1YITT 4C92B 4ZGDB 4M75D 4E7HA 1UFFA 1RI0A 1XOVA 3CPWP 1MGQA 2QXFA 3A8LB 5FU6C 3CCSQ 5KYXA 5GANe 1JJ2A 4XU1A 3HRTA 3RR6A 1ABOA 1PC0A 1VQ7Q 2IG0A 1WQ7A 3CMET 5FROA 4RTWA 2K5FA 2DETA 3AT1B 2M16A 2DKGA 1QP3A 1NJIC 1SHGA 2XMFA 2YUQA 4TVRA 1VQNT 3WVEB 4DOWA 3KFVA 1RACB 2KT8A 2EIFA 2Y4YA 3QWYA 2OAWA 1TUDA 3VS4A 2X4JA 5LJ3g 5DLOA 4E7JA 3X24B 5A0LA 1M4ZA 2BE7D 4RCCA 3CPFA 4PJOA 4RUGA 3RKWA 2LC4A 2HQEA 2RJDA 4ZN1A 3MEAA 2RQWA 2KEAA 2F5TX 3CXCS 2X4XA 5CKEA 3SWNA 1RLPC 3R6NA 2DL7A 3I55T 1RL2A 5LJ5e 3C95A 3P8HA 4M7DA 2JZ2A 1VQPT 4IUVA 3RERA 2KNBB 3VS2A 3NPFA 1UGPB 5GMKl 3E9FA 3J81E 3G71Q 3H41A 1M9SA 4C8QF 3J7AF 2E12A 5GMKe 4JS5A 4LUEA 1I4K1 5LJ3h 4AG2C 5LL6S 2OTLQ 1SSFA 2EYZA 3G6EA 1W2BP 4QVDA 2DMOA 3V8LA 3P8DA 3CCST 2E4HA 3MEVA 1JXMA 4LNPA 4CRIA 1BIBA 1Z9QA 3I56Q 1NZ9A 2BZYA 5KYUB 1CKAA 1OPLA 2GQVA 3I56A 4C92D 2DJZA 1FXXA 3CEYA 1Q81C 2K6DA 4J83A 1YJ9Q 3C0CA 3EG3A 1VQNQ 2K2VA 1BBZA 1OOTA 2EFIA 3GLXA 1U1TA 5GANf 2OTJT 2EJFA 3HFNA 1YIJQ 4BE1A 5I22A 4N4IA 3MEWA 4D6WA 4GLMA 4C8QA 1RAIB 4C8QB 3GF5A 5GAN3 3L2QA 2KRSA 2C0OA 4M77F 5GAMd 4C8QG 1VIEA 3OY9A 1TSFA 1WHJA 3S6WA 2QEXT 4JRIA 3UT1A 2AZSA 1NJIR 1S72A 1Q7YC 1YN8A 1M5Q1 3G4ST 1HD3A 2BZ8A 4HT9A 3TU4K 2QGGA 4LDYA 2LT4A 1B07A 1IHWA 3CPWS 3U23A 1YJNT 5GAOl 3A5ZB 2CYZB 1OPKA 3OYBA 1VQ5Q 1Q81U 4PJOF 2K5IA 2E1HA 3OSVA 4E7SA 1UJ0A 2K4YA 1V76A 3RMSA 3V7RA 3CCQA 1ZUKA 4DEXA 1K76A 4E7ZA 1T0JA 2SRCA 2XD0A 4RTVA 2O9VA 2DX1A 6AT1B 1K0XA 2JM8A 2HAXA 1M2VA 2B8AA 5CQYA 4JRQA 1G3YA 1ZLMA 3CMAT 2HKNA 2LZ6B 4FW2A 2RM4A 4PJMA 4M77C 3VUZA 5IXBA 3VS3A 3JCMV 5D6XA 2K5LA 4LDVA 2XK0A 4M7AB 3HSBA 4OMQA 1E6GA 4LD6A 2J6KA 2EQIA 4JLGA 1YP5A 2LJ1A 3OBYA 1UDLA 4X9DA 4J6YA 1OYXA 2OAUA 1EIFA 1KG1A 1EFNA 5KYNA 1Q82R 2EAYA 1LNXA 1NLPC 1YCYA 2HEQA 3VUBA 3VV0A 2L89A 3JB9G 1YI2Q 2OI3A 1UB4A 1PCXA 2JUFA 3CMAA 2D6FA 1M8MA 4PJLA 3JCMh 2D0QB 3SDZA 1UHCA 1HJDA 4QQDA 2O88A 2LX9A 4GLKA 1Y57A 3VS6A 4FL6A 1QVGP 3G4SA 1UJYA 1I1JA 4DOVA 1VQNA 5HKCA 3QZ9B 4AFZC 4M7DF 4M78D 2PU9B 2QDYB 4EIKA 3CCJT 1BCOA 2EBPA 2RHYA 3L2WA 4PJOD 2YRDA 5J3BA 1Q86C 4JLIA 4KRTA 5KE3A 1KSWA 1JBMA 1GRIA 2DYIA 2WSCE 2LTOA 1D1AA 5LJ5h 4C5GA 2ZPGB 1QP2A 5CO7A 1K73U 1I5OB 4AFUC 1M3AA 1X2QA 4IUTA 5IAYA 2YSQA 3JCMg 4C0FA 3JB9I 2CT3A 4A4KA 5CAIA 1NEBA 4M77D 1ZQ1A 1K4US 5LJ3e 2MAMA 3PE0A 4WF2A 2V26A 2RJFA 2AK5A 4PJOG 3KUFA 4KUIA 1JO8A 2P4TA 1KQSS 3L2UA 2EQUA 8AT1B 1H3ZA 2LJ0A 3JV3A 3I5RA 1U06A 1I0CA 4PFPA 5FWBA 4MZMA 3MKDA 2HMAA 2DLPA 1EZZB 3ZEHA 3CCJA 3CCMT 3CMAQ 2L0AA 4OMLA 1IXDA 1WX6A 1G3SA 3E2UA 1B34B 4RTZA 3OW2P 3FJ5A 4Y91A 1ZUYA 3I56T 2DVJA 4LE9A 1M1FA 3RBBB 3QUIA 3X20B 4M77G 4ZGJB 2KDSA 2L5QA 2LQNA 3QJYA 4AT1B 3OYGA 4J6XA 3A8OB 5GAN5 5DM7R 3HL8A 1WQWA 3QWXX 1KK7A 5GAOm 1YWPA 1QMCA 1PHTA 1JJ2S 2VV5A 2DM1A 5CKDA 3OYJA 2FRYA 1BYMA 5GJVB 1VQOQ 4OB1B 1MUZA 3QKJA 2LCLA 3CCRQ 3E19A 8ATCB 5CKBA 3VS7A 3CC2Q 4F14A 4E47A 2V8IA 2V8JA 4OGCA 4BUGA 4PFOA 2F69A 1XNIA 3NGPA 1OZ3A 2GBQA 1YIJT 2DERA 4KT0E 2J05A 4IUQA 2KROA 2ROLA 3M59A 1H641 5A0DA 2BIVA 2FB7A 3C94A 2XICA 2NUTB 1RAAB 2NUTA 3UATA 1ZSZB 3A1PA 3INZA 2ATCB 1RI9A 4FYYB 2V1RA 1GFDA 1OU8A 4JZ3A 1RAEB 4C0DB 1VQLQ 1QVFP 2O4XB 4RTUA 1NYFA 2KMTA 3OMGA 3MO8A 1QW1A 4C8QC 1B3QA 1WHMA 4M78E 1R8OB 2QYZA 4M78F 1TH7A 1N27A 2VXEA 1Y0MA 3VJPA 3LLRA 2K3XA 1TXQA 4FSXA 2MOXA 4J9IA 2JVVA 4C92E 3EGDA 1MV0B 3MHXA 1YIJA 1JJ2P 3PMIA 4K11A 2PZ1A 1YITQ 5KYYA 2KR3A 1UGQB 2A08A 1K0SA 2V8KA 1NJIU 4EPCA 2DYBA 1QKWA 2O01E 4E2FB 3C4SA 3CCVT 1SPKA 1IREB 2JTEA 4EMGA 1AZGB 3RNJA 1A0NB 4J9GA 1VQ6Q 1Q7YR 3MP1A 2K79A 3CCEQ 2CUBA 5IHNA 3CBMA 3GIBA 3NTIA 2C06A 1FWZA 3FJPA 4DA4A 2PVDB 2CZ6B 4FYXB 4ZGEB 2C0IA 2QEXA 1BCMA 1ZHIA 1MNEA 2E5QA 1M90C 4LDUA 5GMKj 2E70A 2X3WD 4C0ZA 1YJ9T 4M7DC 3GP8A 2KY9A 3HRSA 3UA7A 4L6V5 3PFSA 4M75C 1QCOA 2L3SA 3CC7A 3QG1A 2F2VA 3CCVA 3EFRA 4OMFB 1Q7YU 5LJ5j 1N8RR 3CC2A 3OYNA 5C6SA 4HVWA 4M7DD 7AT1B 3EGUA 1MMAA 3QSUA 3JCMP 1AHJB 1SEMA 3META 2M1HA 4HVUA 2E64A 4QQ6A 1W1FA 3EFOA 1OX8A 2KRMA 1BKBA 5C0MA 4PFZA 3G1JA 2CS7A 1ZSZA 1WHHA 2NUPA 4B9XA 1E7OA 3QO3A 1VYTA 4J7IA 1NG2A 1G83A 2O4XA 2HKQB 3JAME 5CVIA 1C6VX 3LGFA 1N8RU 1AWWA 3SD4A 2RI5A 4LD9K 1GBRA 1X01A 2ZZDA 5GAMg 4HKEA 5GAN6 2EYXA 5IH2A 2CP2A 1KD1U 1H8KA 1T3SA 2ZPIB 5GAOn 1N5ZA 1WHKA 4BACA 2E3IA 5D7UA 4RTYA 2F2WA 3CCQQ 1U1SA 4Y92A 4JJBA 3M58A 3QPHA 3OB9A 5GAN8 1P92A 1IB8A 5HY6A 1ZX6A 4DEYA 4PJOC 4M7DB 1K73C 2ZCFB 2I2LA 4RG2A 5ECAA 4BE0A 2VWFA 1QVFS 2BZXA 1LOJA 4A4FA 2ZPHB 2M9UA 1YHQQ 1PD1A 1V1CA 3CMEQ 1WLPB 1JRIA 1TS9A 4PNOA 2H3EB 3GBQA 2ZPBB 1TWBA 3OYDA 5D6YA 5AYFA 3OW2A 1MNDA 1X69A 2ENMA 3URGA 3CC2T 3G6EQ 2CP3A 2BKDN 1K1ZA 4XTXA 3V7CA 4GY5A 2NLUA 4EDUA 3OYCA 2CH4A 2EQKA 3M0TA 1YNZA 4PJJA 1LCKA 1VQKT 3VYHB 3I55A 3M9QA 5GANh 2DPPB 1C1AA 1EX4A 1VYUA 4FSSA 4VUBA 5CCAA 3I55Q 1X43A 4DBHA 4OGEA 1C0MA 2JMCA 2A0FB 4ZTFA 3L2ZA 3CCSA 2RB6A 2VYTA 1QKXA 1OQKA 5I21A 4C0GA 4A4HA 1AT1B 2DZCA 4FW1A 4JS4A 4F7UG 4KBMB 1T0HA 5KYYB 1KD1R 5GANd 3G7ZA 5GAOp 4M75G 4R0KA 2VGNA 1UE9A 3JCMb 2D1XA 1I8FA 1K8AR 2VXFA 5IXFA 2WSFE 1YJNA 4HT8A 2LVMA 9ATCB 1YI2T 4MMKA 3DB3A 1VQLT 2JS2A 1AZEA 1GCQC 2RK1A 1WPYA 3CC4T 1S72Q 1X75C 4XU3A 2JN0A 1YBYA 1JXOA 3G71A 3LW5E 2WACA 1B7TA 2MCNA 1YCSB 1KJWA 1TUCA 1VIFA 1UECA 4EMKA 5DY9A 1VQKA 2DA9A 2RI3A 4JJNK 1RAHB 1WGSA 2YUOA 1QWEA 1K9AA 4JUVA 2MIOA 4XTZA 2L8DA 2HNIA 2PVOB 2WSEE 3G4SQ 1VYVA 1WXUA 3RKYA 3CCUT 2E41A 3ME9A 1UGRB 3JCMd 1NPPA 1D09B 1QQJA 2W0ZA 2KAFA 1UHFA 4PJNA 2ED1A 2JJ9A 1X27A 3FLGA 3BW1A 2X51A 3QYHB 2E3HA 2EYWA 2LQWA 1RLQC 2DO3A 4DBRA 4X34A 2LNHB 1VQ7T 4FM4B 3HKSA 2CP7A 1ZA1B 3OYYA 1T3LA 1S72T 1KQSA 2JTMA 3TVTA 2ZAEA 1K8AU 2PQWA 1WFWA 2O9SA 1OV3A 3CXCP 2K3YA 4IIOA 3NHNA 3LGLA 4RTTA 2OTJQ 4C92C 2DIGA 2X9HA 1R0BG 3C12A 2KT1A 5FU6B 1VA7A 2YRCA 2GGRA 2YT6A 1FMWA 5FRMA 3CD6T 2ZPEB 3M5AA 2JMAA 4MDXA 2K57A 2DFUA 3JB9D 1WDXA 5FWCA 3JCMQ 2XU8A 4KUDK 2JT4A 2QGFB 1WNLA 2GTOA 3SWNB 2HQXA 3H0HA 2E10A 1I07A 1VQ7A 3J80E 4N4GA 1ZA2B 3EG1A 1QVGA 1M1KR 5J26A 3L2VA 2COWA 4RMOA 2DXBA 3BDUA 4J9CA 3MJXA 1AWOA 1Y96A 4F04B 2RQUA 3JRZA 1Y96B 3OYAA 4RG8A 4A4GA 1GCPA 3CCUA 1CKBA 1JB0E 2QAZA 2QQRA 3JB9J 5FU7C 4QKUA 1M3CA 3R6OA 4F7UF 5I2SA 4BDZA 3SHWA 3D7SB 1R0CB 2ED0A 1OU9A 1VQ5A 4ANJA 1KC8R 1YFNA 2RHZA 1ZSGA 2PTKA 4LDWA 5A2QE 1N9RA 4MDWA 2YWWA 4BI3A 2LNVA 1NLOC 3UA6A 2DXUA 3SEMA 4C92A 1Q95G 2QTXA 4CC3A 2LJ3A 2KYMA 3CBOA 4ELYC 4M78G 1RABB 4M78B 5HCKA 3CCJQ 1NBEB 3FB9A 5GAMf 2CREA 3S3NA 2PUOB 2DRMA 1TUGB 2M0OA 2EJGA 2BE9B 2HZYA 3QXEB 3H0IA 1WYXA 1KIKA 4P5NA 1WI7A 3CD6Q 1PSEA 1ACMB 3O5ZA 3SWNC 1ZUUA 1D1CA 1W4SA 1VQ6A 1Y07A 3TCJA 3PVQA 1VQ4T 1K73R 1VQPQ 2F1LA 1WIEA 2QQAA 4M7AG 1GFCA 4HVVA 4Z89A 1M90R 4F16A 4C92G 1PRMC 1YJWT 2YLCA 4PJOB 2L3QA 1SRMA 2RN8A 3REAB 4AMCA 3RMQA 2ROTA 4F7UE 1M3BA 2EJ9A 5GAN7 2FYKA 3EGXB 3CCVQ 1S1NA 2FG0A 3M0UA 3V8KA 1NE8A 3DLLA 1NYGA 1OZ2A 4JZ4A 1K9MR 4M7AA 4XAXB 2GNCA 2RJCA 2W10A 3SB2A 2RQTA 2RPNA 4J9DA 5CIUA 5GAMh 4J7FA 2LQ8A 2OTLA 3M56A 1RUWA 2E6NA 3GNFB 3HHTB 3M4YA 5LJ3j 2V1QA 3LH5A 5M9OA 2X4WA 3MP8A 4Y28E 4L59A 4V2SA 4AFSC 1WA7A 3OYHA 2RHIA 3L1AA 4NS5A 1SF9A 3ULRB 2HBPA 2COYA 3OBWA 3AHUA 1G5VA 2OTJA 2KQWA 4HCCA 2P4RA 3N5BB 2VASA 3PIOA 3CCRT 3JCMX 1FMVA 1GBQA 1GCQA 3GNGA 4QT7A 2Y90A 4XU0A 3WVDB 2FRWA 1M1KU 1VQMA 2HDAA 2RMOA 3MPUB 1VQ9A 2JTFA 3ZBDA 1YITA 2DL3A 3CD6A 1VQ8Q 4FYVB 2K7AA 2RNAA 4PK4A 4C0DC 2HSPA 5KE2A 3OYIA 2LRQA 5KYXB 3CCLQ 2NYSA 1JEGA 2BUDA 2QG9B 2KSSA 2DIQA 4F17A 2EQJA 2OJ2A 1YHQT 1YJWQ 1PD0A 1VUBA 2ZPFB 2F5KA 1SHFA 2YRVA 1Z9ZA 1U5SA 1RAFB 1QLYA 1K9MU 4WCIA 3FRNA 2CZ0B 3QZ5B 2LX7A 3CMEA 1RADB 3VRYA 2EGAA 1H3HA 5GAN2 3F70A 1M1KC 5L8RE 3I5SA 2RQRA 3QBYA 2LCSA 5KYWA 1AEYA 5EC7A 5GJWB 2QASA 1ZBXA 3OYEA 1NEGA 1WHLA 1VQMT 2GFUA 2RO0A 1D1BA 1AWJA 3H0FA 1BI0A 2YDLA 4J5YA 2FO0A 4EMKC 5GMKi 4MZTA 4RTXA 1ABQA 3CC7T 1Y7XA 2A37A 1MMGA 1UGSB 2MI6A 1B34A 3O8VA 4C5IA 4DQ2A 2DL5A 3X28B 4N0AC 3NMZC 2J7IA 2EGCA 2K9GA 1BI1A 2NUPB 3VRZA 2IVWA 1M1GA 2DF6A 2XIDA 4ZN3A 5KCOA 4MMLA 4A63B 2DNUA 5KCHA 1GXIE 2DTOA 4YTLA 4C5HA 1W2BS 3CCEA 2CSIA 2NUZA 2EWNA 1Q86R 3OYMA 3PT9A 2VUBA 2QI2A 2DBKA 1QVFA 2PUKB 2RD1A 1BK2A 4IURA 2JS0A 2DAQA 3FIFA 4BB7A 2G6FX 2FZCB 4HXJA 3NTHA 4D8KA 4D8DA 1VQ4A 4F7UA 1XJWB 2XDBA 3A98A 4M77E 4LN2A 4R55A 2DTHA 2FVUA 2Y4XA 1WJRA 1IRXA 1PRLC 4CC4B 2QA4T 3OYFA 1VQMQ 3OS2A 1D0YA 4BE2A 4KGXB 1IGUA 4IIMA 1X2KA 3H8ZA 1BB9A 4NOYA 2GCXA 3KBGA 3DB4A 4XTWA 2X3XD 4JJCA 3L2RA 1KC8U 3V7SA 2BTTA 4M7DE 1O9SA 3DKMA 3LH0A 4M7AD 3OYLA 2AZVA 2RK2A 3I9QA 3TQ7P 1FX7A 3HRUA 3PGGA 1V29B 3CC7Q 1W70A 2DZ9A 1KQ2A 4ELZC 1PSFA 1VQOA 1E6HA 4QVZA 3A8GB 2DJQA 3UF4A 1FYNA 2SEMA 1M8VA 4PLLA 4OB2B 4GBQA 2O2OA 2DD4A 5FRNA 2DK3A 1FMKA 2FPDA 2GFAA 2JW4A 4XTUA 2X35A 5KYWB 2MWPA 2JNGA 1KD1C 2P0KA 2OTLT 4A53A 3CQTA 2FPEA 2QA4A 3OW2S 1DJ7B 2QA4Q 2P0PA 3MP6A 4JPBW 5FU7B 3M53A 3CCQT 4M78A 5LJ3f 1N9SA 4CC2A 5CQXA 4QVCA 5FLXE 4J9BA 2AHJB 2RHUA 3RDVA 3EHQA 2QTVA 4ORZA 4R56A 1W2BA 2K2MA 3JCMe 1ARKA 2RJEA 3VU3C 1SKUB 3QDFA 1WZOA 1IZ6A 2KXDA 3S3OA 3OS1A 2IIMA 2ZGWA 3A8MB 1PNJA 1X6GA 1F1BB 3NTKA 2LP5A 3DLMA 1VQ9T 3BE3A 3IQLA 2HL5C 1M27C 1BU1A 2CP6A 2YXYA 2R58A 2AKLA 2CP5A 4NL2A 1IO6A 2L3PA 4Z02A 2E65A 3HFOA 2QQBA 1VQKQ 1Y71A 3RKXA 5AT1B 3P8BB 2P84A 2VVKA 1D0ZA 4F7UB 5HK3A 1WJQA 3PNWC 3G6ET 1ZBJA 1PKSA 2D0NA 4O6JA 5GANj 1M2VB 2GF7A 1M90U 2OX7A 1KC8C 3EH1A 3EG9B 2YUNA 2VB6A 3FEOA 1HK9A 2GTJA 3CBPA 2M0YA 1UEBA 2FPFA 2FZGB 1G2BA 5GAOr 2EGEA 2DXCA 5J39A 4JJDA 3ZFJA 4BD3A 2D8HA 2LQKA 1VQLA 2QQSA 4KULA 3VKIA 3CCUQ 4XTVA 4X1VA 4L5GA 2XDPA 4ATOA 3BY7A 1OI1A 2KK4A 4DBFA 2CZ1B 4JRKA 1G3TA 3BDLA 3BFMA 4PKCC 3LYIA 2D8JA 3UPUA 1U8RA 4Q5WA 4C92F 5IT9E 4C8QD 3TSZA 2FL7A 3JSCA 3CCET 2DRKA 3THKA 1KHIA 4LXCA 1OEBA 3VYGA 2MWOA 1BI3A 3JB9H 3X26B 2AT1B 1VQ4Q 2PVGB 1YJNQ 3WXMB 3L42A 1AVZC 1X6OA 3CCRA 2G3RA 1D3BA 3TEEA 2E6ZA 5IHIA 2EKOA 4J9EA 4WTOB 1D3BB 1U3OA 2EW3A 3FDRA 4HCBA 2H8HA 5LJ3d 4M7AE 2CKKA 2LT1A 3MEUA 1PG5B 2M51A 1UG1A 3TSWA 1UGVA 2VKNA 1HSQA 1AD5A 3TREA 4OF1A 3M0SA 4BY6B 2XHCA 1MHNA 4FT2A 4B6MA 5GANg 3M55A 1AOJA 2KXCA 3PTAA 4XTYA 1VQPA 2EYQA 1MV3A 5LJ5d 1KQSP 1XTDA 4EMKB 4E7IA 2FEIA 4HCZA 4ZTJA 4M4ZA 4M77A 1IHVA 2RI2A 2AKKA 4M77B 1PKTA 4BI8B 2HL3A 4FT4A 4OMOA 1QCNA 3S3MA 2GQIA 5GMKh 4J8OA 4XQ3A 3UWNA 4AFQC 3H6ZA 2L2PA 5GAMe 2VGMA 2XDDA 4LUDA 3CPWA 3OS5A 4C5EA 3H9NA 3PVLA 5GAN4 2J6FA 2J06A 2PNIA 2MMPA 1VQ8A 4RKUE 4N4HA 3VS1A 4C8QE 3G71T 5FW9A 4IUPA 2MK5A 1G3WA 3EFOB 2J6OA 2EVRA 5I11A 2KRNA 1LJOA 2X4YA 2KVQG 4JDSA 1YJWA 4M7DG 3CXCA 3VS5A 4IUUA 5IHKA 3LX7A 2QDLA 3KXTA 1QVGS 5EG2A 2CZ7B 1YWOA 1VOMA 2CP0A 1VQ5T 2DXTA 1KHCA 5IN1A 2LMJA 2O31A 4ESRA 1VQ6T 1NPRA 1W6XA 2M02A 4QW2A 1N6AA 2HSEB 4BY6C 3OMCA 5I2MA 3EGDB 4AG1C 4FCYA 2F2XA 2C0TA 2A7YA 2NWMA 2XKOC 5GMKm 2XI9A 3EG9A 2ECZA 2KI7A 4KGVB 4KH1B 3GOXA 2IPOB 1WJSA 2Z0WA 2YLBA 3PMTA 1SG5A 2RA2A 3M54A 1WHGA 1I5LA 4Z88A 2AIRB 1OULA 4J9HA 2EQMA 2KE9A 1QVPA 2EPDA 4OMMA 2HBWA 4IKFA 1TOVA 5CKHA 5GAOq 3EG0A 4OMNA 3OSSC 3QJ6A 3RESA 1TG0A 2R57A 3HPWA 4E6RA 1M2OA 2FHDA 4BI4A 3CC4Q 2COZA 2HCKA 2DL4A 4OMPA 2KYBA 5KYUA 1H92A 3PIPA 3X25B 4EMHA 4X9CA 4PLIA 3CCMA 4J6WA 1CSKA 2A28A 3JCMf 1PM3A 1WXBA 4QQGA 3ER0A 2A36A 2RF0A 3QIIA 2RHXA 1YJ9A 3GPLA 2DILA 1NM7A 4KGZB 4OB3B 4JRPA 3ZL7C 2CUDA 4DBQA 3CCLA 2ESWA 3QHSA 4LDXA 1IGQA 1LPLA 4FU6A 2LDMA 1TU0B 1Q86U 4ZNXA 4A54A 5A0GA 4HCKA 3RIRA 2CH4W 2CT4A 1RAGB 2JXBA 2LCCA 2DL8A 4FIBA 3SFMA 3EH2A 5DLQE 3M57A 4M75F 4II1A 1Q81R 1YI2A 1R77A 2DD5A 1PWTA 2RQVA 4A4EA 2MF2A 1SRLA 4CC7A 1XQHA 3EG2A 3M0RA 3ASKA 5LJ5g 1X6BA 1QCFA 4O5VA 1HXDA 1D0XA 5CK9A 2D9TA 4M7AC 4PJOE 3NFCA 2MYSA 2E5KA 1UUEA 1QWFA 4KH0B 4M75E 2I0NA 4ME7A 2HQHA 3EGXA 3REBB 5GAMj 4E7LA 4Z8AA 3JCMJ 4CI0C 3A8HB 3JCMc 5D6WA 1AWXA 1JU5C 2QEXQ 3JCMW 3CCLT 3Q1JA 3LWIA 1MMDA 5L23A 3OQ5A 3M0PA
chains in the Genus database with same CATH topology
1YIJQ 3CCEQ 3CCQQ 1YITQ 1K8AR 1VQ4Q 1VQ8Q 3I56Q 3CPWP 1VQKQ 1YJNQ 1VQOQ 3G71Q 2QA4Q 3CC7Q 1YI2Q 3CCSQ 3CCLQ 3CCJQ 3G6EQ 3CXCP 1KC8R 3CCRQ 3CCMQ 2OTJQ 1VQ9Q 1KD1R 1JJ2P 1YJ9Q 1K73R 3CC2Q 1VQPQ 1VQ7Q 2OTLQ 1VQ6Q 3CMAQ 3CCVQ 1YJWQ 1W2BP 3CC4Q 1VQ5Q 1N8RR 1VQNQ 1QVGP 2QEXQ 1Q82R 1S72Q 1VQMQ 3CD6Q 1YHQQ 1M90R 3CCUQ 3CMEQ 1QVFP 3OW2P 1VQLQ 3I55Q 1KQSP 3G4SQ 1M1KR 1Q86R 1NJIR 1Q81R 1K9MR 1Q7YR
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIJ Q;  3CCE Q;  3CCQ Q;  1YIT Q;  1K8A R;  1VQ4 Q;  1VQ8 Q;  3I56 Q;  3CPW P;  1VQK Q;  1YJN Q;  1VQO Q;  3G71 Q;  2QA4 Q;  3CC7 Q;  1YI2 Q;  3CCS Q;  3CCL Q;  3CCJ Q;  3G6E Q;  3CXC P;  1KC8 R;  3CCR Q;  3CCM Q;  2OTJ Q;  1VQ9 Q;  1KD1 R;  1JJ2 P;  1YJ9 Q;  1K73 R;  3CC2 Q;  1VQP Q;  1VQ7 Q;  2OTL Q;  1VQ6 Q;  3CMA Q;  3CCV Q;  1YJW Q;  1W2B P;  3CC4 Q;  1VQ5 Q;  1N8R R;  1VQN Q;  1QVG P;  2QEX Q;  1Q82 R;  1S72 Q;  1VQM Q;  3CD6 Q;  1YHQ Q;  1M90 R;  3CCU Q;  3CME Q;  1QVF P;  3OW2 P;  1VQL Q;  3I55 Q;  1KQS P;  3G4S Q;  1M1K R;  1Q86 R;  1NJI R;  1Q81 R;  1K9M R;  1Q7Y R; 
#chains in the Genus database with same CATH topology
 2KGT A;  2EKH A;  2DTI A;  2JOY A;  1Q82 U;  3QYG B;  1VQ8 T;  1HYO A;  3E1S A;  4J9F A;  3CCM Q;  2L3R A;  5HK0 A;  2DE0 X;  3RUX A;  3UDC A;  1I81 A;  1WXT A;  4HA8 A;  4M78 C;  2QK0 A;  2R5M A;  4FYW B;  1O75 A;  1ZSZ C;  1KQ1 A;  2DEQ A;  5LJ5 f;  2CDT A;  3EHR A;  3I35 A;  1TTH B;  2P0Q A;  3HP9 A;  4PL6 A;  1N8R C;  3M0Q A;  4E7K A;  2HD0 A;  1MMN A;  2CSQ A;  4M7A F;  1VQ9 Q;  4NL3 A;  3V8J A;  4OVA A;  4MZP A;  2XG8 D;  2KBT A;  4XU2 A;  2EYY A;  2YHT A;  2RH2 A;  4OB0 B;  3LWH A;  4UC4 A;  3E9G A;  3EFS A;  1K9M C;  1K8A C;  3QDR B;  2H3J A;  1VQO T;  2DVE A;  2QQ9 A;  1Q82 C;  2DBM A;  1BIA A;  2YUP A;  3HTR A;  1GL5 A;  2FZK B;  4M75 A;  5CR2 A;  4M75 B;  1BI2 A;  4B9W A;  2JM9 A;  3OS0 A;  3VS0 A;  1KFZ A;  3OYK A;  2A3L A;  5KH6 A;  2VC8 A;  2MPX C;  4BDY A;  3T9N A;  2K3B A;  3M4G A;  2DEU A;  1G8X A;  4OP0 A;  2CGH A;  3OA6 A;  3CC4 A;  2B86 A;  2ABL A;  3FC3 A;  1JQQ A;  3MCA B;  5CKF A;  1LVK A;  4XK8 E;  2R5A A;  1SSH A;  1M30 A;  3JB9 F;  4N0A A;  1J3T A;  1UTI A;  4RCB A;  1OX9 A;  1YHQ A;  3EAE A;  1YIT T;  4C92 B;  4ZGD B;  4M75 D;  4E7H A;  1UFF A;  1RI0 A;  1XOV A;  3CPW P;  1MGQ A;  2QXF A;  3A8L B;  5FU6 C;  3CCS Q;  5KYX A;  5GAN e;  1JJ2 A;  4XU1 A;  3HRT A;  3RR6 A;  1ABO A;  1PC0 A;  1VQ7 Q;  2IG0 A;  1WQ7 A;  3CME T;  5FRO A;  4RTW A;  2K5F A;  2DET A;  3AT1 B;  2M16 A;  2DKG A;  1QP3 A;  1NJI C;  1SHG A;  2XMF A;  2YUQ A;  4TVR A;  1VQN T;  3WVE B;  4DOW A;  3KFV A;  1RAC B;  2KT8 A;  2EIF A;  2Y4Y A;  3QWY A;  2OAW A;  1TUD A;  3VS4 A;  2X4J A;  5LJ3 g;  5DLO A;  4E7J A;  3X24 B;  5A0L A;  1M4Z A;  2BE7 D;  4RCC A;  3CPF A;  4PJO A;  4RUG A;  3RKW A;  2LC4 A;  2HQE A;  2RJD A;  4ZN1 A;  3MEA A;  2RQW A;  2KEA A;  2F5T X;  3CXC S;  2X4X A;  5CKE A;  3SWN A;  1RLP C;  3R6N A;  2DL7 A;  3I55 T;  1RL2 A;  5LJ5 e;  3C95 A;  3P8H A;  4M7D A;  2JZ2 A;  1VQP T;  4IUV A;  3RER A;  2KNB B;  3VS2 A;  3NPF A;  1UGP B;  5GMK l;  3E9F A;  3J81 E;  3G71 Q;  3H41 A;  1M9S A;  4C8Q F;  3J7A F;  2E12 A;  5GMK e;  4JS5 A;  4LUE A;  1I4K 1;  5LJ3 h;  4AG2 C;  5LL6 S;  2OTL Q;  1SSF A;  2EYZ A;  3G6E A;  1W2B P;  4QVD A;  2DMO A;  3V8L A;  3P8D A;  3CCS T;  2E4H A;  3MEV A;  1JXM A;  4LNP A;  4CRI A;  1BIB A;  1Z9Q A;  3I56 Q;  1NZ9 A;  2BZY A;  5KYU B;  1CKA A;  1OPL A;  2GQV A;  3I56 A;  4C92 D;  2DJZ A;  1FXX A;  3CEY A;  1Q81 C;  2K6D A;  4J83 A;  1YJ9 Q;  3C0C A;  3EG3 A;  1VQN Q;  2K2V A;  1BBZ A;  1OOT A;  2EFI A;  3GLX A;  1U1T A;  5GAN f;  2OTJ T;  2EJF A;  3HFN A;  1YIJ Q;  4BE1 A;  5I22 A;  4N4I A;  3MEW A;  4D6W A;  4GLM A;  4C8Q A;  1RAI B;  4C8Q B;  3GF5 A;  5GAN 3;  3L2Q A;  2KRS A;  2C0O A;  4M77 F;  5GAM d;  4C8Q G;  1VIE A;  3OY9 A;  1TSF A;  1WHJ A;  3S6W A;  2QEX T;  4JRI A;  3UT1 A;  2AZS A;  1NJI R;  1S72 A;  1Q7Y C;  1YN8 A;  1M5Q 1;  3G4S T;  1HD3 A;  2BZ8 A;  4HT9 A;  3TU4 K;  2QGG A;  4LDY A;  2LT4 A;  1B07 A;  1IHW A;  3CPW S;  3U23 A;  1YJN T;  5GAO l;  3A5Z B;  2CYZ B;  1OPK A;  3OYB A;  1VQ5 Q;  1Q81 U;  4PJO F;  2K5I A;  2E1H A;  3OSV A;  4E7S A;  1UJ0 A;  2K4Y A;  1V76 A;  3RMS A;  3V7R A;  3CCQ A;  1ZUK A;  4DEX A;  1K76 A;  4E7Z A;  1T0J A;  2SRC A;  2XD0 A;  4RTV A;  2O9V A;  2DX1 A;  6AT1 B;  1K0X A;  2JM8 A;  2HAX A;  1M2V A;  2B8A A;  5CQY A;  4JRQ A;  1G3Y A;  1ZLM A;  3CMA T;  2HKN A;  2LZ6 B;  4FW2 A;  2RM4 A;  4PJM A;  4M77 C;  3VUZ A;  5IXB A;  3VS3 A;  3JCM V;  5D6X A;  2K5L A;  4LDV A;  2XK0 A;  4M7A B;  3HSB A;  4OMQ A;  1E6G A;  4LD6 A;  2J6K A;  2EQI A;  4JLG A;  1YP5 A;  2LJ1 A;  3OBY A;  1UDL A;  4X9D A;  4J6Y A;  1OYX A;  2OAU A;  1EIF A;  1KG1 A;  1EFN A;  5KYN A;  1Q82 R;  2EAY A;  1LNX A;  1NLP C;  1YCY A;  2HEQ A;  3VUB A;  3VV0 A;  2L89 A;  3JB9 G;  1YI2 Q;  2OI3 A;  1UB4 A;  1PCX A;  2JUF A;  3CMA A;  2D6F A;  1M8M A;  4PJL A;  3JCM h;  2D0Q B;  3SDZ A;  1UHC A;  1HJD A;  4QQD A;  2O88 A;  2LX9 A;  4GLK A;  1Y57 A;  3VS6 A;  4FL6 A;  1QVG P;  3G4S A;  1UJY A;  1I1J A;  4DOV A;  1VQN A;  5HKC A;  3QZ9 B;  4AFZ C;  4M7D F;  4M78 D;  2PU9 B;  2QDY B;  4EIK A;  3CCJ T;  1BCO A;  2EBP A;  2RHY A;  3L2W A;  4PJO D;  2YRD A;  5J3B A;  1Q86 C;  4JLI A;  4KRT A;  5KE3 A;  1KSW A;  1JBM A;  1GRI A;  2DYI A;  2WSC E;  2LTO A;  1D1A A;  5LJ5 h;  4C5G A;  2ZPG B;  1QP2 A;  5CO7 A;  1K73 U;  1I5O B;  4AFU C;  1M3A A;  1X2Q A;  4IUT A;  5IAY A;  2YSQ A;  3JCM g;  4C0F A;  3JB9 I;  2CT3 A;  4A4K A;  5CAI A;  1NEB A;  4M77 D;  1ZQ1 A;  1K4U S;  5LJ3 e;  2MAM A;  3PE0 A;  4WF2 A;  2V26 A;  2RJF A;  2AK5 A;  4PJO G;  3KUF A;  4KUI A;  1JO8 A;  2P4T A;  1KQS S;  3L2U A;  2EQU A;  8AT1 B;  1H3Z A;  2LJ0 A;  3JV3 A;  3I5R A;  1U06 A;  1I0C A;  4PFP A;  5FWB A;  4MZM A;  3MKD A;  2HMA A;  2DLP A;  1EZZ B;  3ZEH A;  3CCJ A;  3CCM T;  3CMA Q;  2L0A A;  4OML A;  1IXD A;  1WX6 A;  1G3S A;  3E2U A;  1B34 B;  4RTZ A;  3OW2 P;  3FJ5 A;  4Y91 A;  1ZUY A;  3I56 T;  2DVJ A;  4LE9 A;  1M1F A;  3RBB B;  3QUI A;  3X20 B;  4M77 G;  4ZGJ B;  2KDS A;  2L5Q A;  2LQN A;  3QJY A;  4AT1 B;  3OYG A;  4J6X A;  3A8O B;  5GAN 5;  5DM7 R;  3HL8 A;  1WQW A;  3QWX X;  1KK7 A;  5GAO m;  1YWP A;  1QMC A;  1PHT A;  1JJ2 S;  2VV5 A;  2DM1 A;  5CKD A;  3OYJ A;  2FRY A;  1BYM A;  5GJV B;  1VQO Q;  4OB1 B;  1MUZ A;  3QKJ A;  2LCL A;  3CCR Q;  3E19 A;  8ATC B;  5CKB A;  3VS7 A;  3CC2 Q;  4F14 A;  4E47 A;  2V8I A;  2V8J A;  4OGC A;  4BUG A;  4PFO A;  2F69 A;  1XNI A;  3NGP A;  1OZ3 A;  2GBQ A;  1YIJ T;  2DER A;  4KT0 E;  2J05 A;  4IUQ A;  2KRO A;  2ROL A;  3M59 A;  1H64 1;  5A0D A;  2BIV A;  2FB7 A;  3C94 A;  2XIC A;  2NUT B;  1RAA B;  2NUT A;  3UAT A;  1ZSZ B;  3A1P A;  3INZ A;  2ATC B;  1RI9 A;  4FYY B;  2V1R A;  1GFD A;  1OU8 A;  4JZ3 A;  1RAE B;  4C0D B;  1VQL Q;  1QVF P;  2O4X B;  4RTU A;  1NYF A;  2KMT A;  3OMG A;  3MO8 A;  1QW1 A;  4C8Q C;  1B3Q A;  1WHM A;  4M78 E;  1R8O B;  2QYZ A;  4M78 F;  1TH7 A;  1N27 A;  2VXE A;  1Y0M A;  3VJP A;  3LLR A;  2K3X A;  1TXQ A;  4FSX A;  2MOX A;  4J9I A;  2JVV A;  4C92 E;  3EGD A;  1MV0 B;  3MHX A;  1YIJ A;  1JJ2 P;  3PMI A;  4K11 A;  2PZ1 A;  1YIT Q;  5KYY A;  2KR3 A;  1UGQ B;  2A08 A;  1K0S A;  2V8K A;  1NJI U;  4EPC A;  2DYB A;  1QKW A;  2O01 E;  4E2F B;  3C4S A;  3CCV T;  1SPK A;  1IRE B;  2JTE A;  4EMG A;  1AZG B;  3RNJ A;  1A0N B;  4J9G A;  1VQ6 Q;  1Q7Y R;  3MP1 A;  2K79 A;  3CCE Q;  2CUB A;  5IHN A;  3CBM A;  3GIB A;  3NTI A;  2C06 A;  1FWZ A;  3FJP A;  4DA4 A;  2PVD B;  2CZ6 B;  4FYX B;  4ZGE B;  2C0I A;  2QEX A;  1BCM A;  1ZHI A;  1MNE A;  2E5Q A;  1M90 C;  4LDU A;  5GMK j;  2E70 A;  2X3W D;  4C0Z A;  1YJ9 T;  4M7D C;  3GP8 A;  2KY9 A;  3HRS A;  3UA7 A;  4L6V 5;  3PFS A;  4M75 C;  1QCO A;  2L3S A;  3CC7 A;  3QG1 A;  2F2V A;  3CCV A;  3EFR A;  4OMF B;  1Q7Y U;  5LJ5 j;  1N8R R;  3CC2 A;  3OYN A;  5C6S A;  4HVW A;  4M7D D;  7AT1 B;  3EGU A;  1MMA A;  3QSU A;  3JCM P;  1AHJ B;  1SEM A;  3MET A;  2M1H A;  4HVU A;  2E64 A;  4QQ6 A;  1W1F A;  3EFO A;  1OX8 A;  2KRM A;  1BKB A;  5C0M A;  4PFZ A;  3G1J A;  2CS7 A;  1ZSZ A;  1WHH A;  2NUP A;  4B9X A;  1E7O A;  3QO3 A;  1VYT A;  4J7I A;  1NG2 A;  1G83 A;  2O4X A;  2HKQ B;  3JAM E;  5CVI A;  1C6V X;  3LGF A;  1N8R U;  1AWW A;  3SD4 A;  2RI5 A;  4LD9 K;  1GBR A;  1X01 A;  2ZZD A;  5GAM g;  4HKE A;  5GAN 6;  2EYX A;  5IH2 A;  2CP2 A;  1KD1 U;  1H8K A;  1T3S A;  2ZPI B;  5GAO n;  1N5Z A;  1WHK A;  4BAC A;  2E3I A;  5D7U A;  4RTY A;  2F2W A;  3CCQ Q;  1U1S A;  4Y92 A;  4JJB A;  3M58 A;  3QPH A;  3OB9 A;  5GAN 8;  1P92 A;  1IB8 A;  5HY6 A;  1ZX6 A;  4DEY A;  4PJO C;  4M7D B;  1K73 C;  2ZCF B;  2I2L A;  4RG2 A;  5ECA A;  4BE0 A;  2VWF A;  1QVF S;  2BZX A;  1LOJ A;  4A4F A;  2ZPH B;  2M9U A;  1YHQ Q;  1PD1 A;  1V1C A;  3CME Q;  1WLP B;  1JRI A;  1TS9 A;  4PNO A;  2H3E B;  3GBQ A;  2ZPB B;  1TWB A;  3OYD A;  5D6Y A;  5AYF A;  3OW2 A;  1MND A;  1X69 A;  2ENM A;  3URG A;  3CC2 T;  3G6E Q;  2CP3 A;  2BKD N;  1K1Z A;  4XTX A;  3V7C A;  4GY5 A;  2NLU A;  4EDU A;  3OYC A;  2CH4 A;  2EQK A;  3M0T A;  1YNZ A;  4PJJ A;  1LCK A;  1VQK T;  3VYH B;  3I55 A;  3M9Q A;  5GAN h;  2DPP B;  1C1A A;  1EX4 A;  1VYU A;  4FSS A;  4VUB A;  5CCA A;  3I55 Q;  1X43 A;  4DBH A;  4OGE A;  1C0M A;  2JMC A;  2A0F B;  4ZTF A;  3L2Z A;  3CCS A;  2RB6 A;  2VYT A;  1QKX A;  1OQK A;  5I21 A;  4C0G A;  4A4H A;  1AT1 B;  2DZC A;  4FW1 A;  4JS4 A;  4F7U G;  4KBM B;  1T0H A;  5KYY B;  1KD1 R;  5GAN d;  3G7Z A;  5GAO p;  4M75 G;  4R0K A;  2VGN A;  1UE9 A;  3JCM b;  2D1X A;  1I8F A;  1K8A R;  2VXF A;  5IXF A;  2WSF E;  1YJN A;  4HT8 A;  2LVM A;  9ATC B;  1YI2 T;  4MMK A;  3DB3 A;  1VQL T;  2JS2 A;  1AZE A;  1GCQ C;  2RK1 A;  1WPY A;  3CC4 T;  1S72 Q;  1X75 C;  4XU3 A;  2JN0 A;  1YBY A;  1JXO A;  3G71 A;  3LW5 E;  2WAC A;  1B7T A;  2MCN A;  1YCS B;  1KJW A;  1TUC A;  1VIF A;  1UEC A;  4EMK A;  5DY9 A;  1VQK A;  2DA9 A;  2RI3 A;  4JJN K;  1RAH B;  1WGS A;  2YUO A;  1QWE A;  1K9A A;  4JUV A;  2MIO A;  4XTZ A;  2L8D A;  2HNI A;  2PVO B;  2WSE E;  3G4S Q;  1VYV A;  1WXU A;  3RKY A;  3CCU T;  2E41 A;  3ME9 A;  1UGR B;  3JCM d;  1NPP A;  1D09 B;  1QQJ A;  2W0Z A;  2KAF A;  1UHF A;  4PJN A;  2ED1 A;  2JJ9 A;  1X27 A;  3FLG A;  3BW1 A;  2X51 A;  3QYH B;  2E3H A;  2EYW A;  2LQW A;  1RLQ C;  2DO3 A;  4DBR A;  4X34 A;  2LNH B;  1VQ7 T;  4FM4 B;  3HKS A;  2CP7 A;  1ZA1 B;  3OYY A;  1T3L A;  1S72 T;  1KQS A;  2JTM A;  3TVT A;  2ZAE A;  1K8A U;  2PQW A;  1WFW A;  2O9S A;  1OV3 A;  3CXC P;  2K3Y A;  4IIO A;  3NHN A;  3LGL A;  4RTT A;  2OTJ Q;  4C92 C;  2DIG A;  2X9H A;  1R0B G;  3C12 A;  2KT1 A;  5FU6 B;  1VA7 A;  2YRC A;  2GGR A;  2YT6 A;  1FMW A;  5FRM A;  3CD6 T;  2ZPE B;  3M5A A;  2JMA A;  4MDX A;  2K57 A;  2DFU A;  3JB9 D;  1WDX A;  5FWC A;  3JCM Q;  2XU8 A;  4KUD K;  2JT4 A;  2QGF B;  1WNL A;  2GTO A;  3SWN B;  2HQX A;  3H0H A;  2E10 A;  1I07 A;  1VQ7 A;  3J80 E;  4N4G A;  1ZA2 B;  3EG1 A;  1QVG A;  1M1K R;  5J26 A;  3L2V A;  2COW A;  4RMO A;  2DXB A;  3BDU A;  4J9C A;  3MJX A;  1AWO A;  1Y96 A;  4F04 B;  2RQU A;  3JRZ A;  1Y96 B;  3OYA A;  4RG8 A;  4A4G A;  1GCP A;  3CCU A;  1CKB A;  1JB0 E;  2QAZ A;  2QQR A;  3JB9 J;  5FU7 C;  4QKU A;  1M3C A;  3R6O A;  4F7U F;  5I2S A;  4BDZ A;  3SHW A;  3D7S B;  1R0C B;  2ED0 A;  1OU9 A;  1VQ5 A;  4ANJ A;  1KC8 R;  1YFN A;  2RHZ A;  1ZSG A;  2PTK A;  4LDW A;  5A2Q E;  1N9R A;  4MDW A;  2YWW A;  4BI3 A;  2LNV A;  1NLO C;  3UA6 A;  2DXU A;  3SEM A;  4C92 A;  1Q95 G;  2QTX A;  4CC3 A;  2LJ3 A;  2KYM A;  3CBO A;  4ELY C;  4M78 G;  1RAB B;  4M78 B;  5HCK A;  3CCJ Q;  1NBE B;  3FB9 A;  5GAM f;  2CRE A;  3S3N A;  2PUO B;  2DRM A;  1TUG B;  2M0O A;  2EJG A;  2BE9 B;  2HZY A;  3QXE B;  3H0I A;  1WYX A;  1KIK A;  4P5N A;  1WI7 A;  3CD6 Q;  1PSE A;  1ACM B;  3O5Z A;  3SWN C;  1ZUU A;  1D1C A;  1W4S A;  1VQ6 A;  1Y07 A;  3TCJ A;  3PVQ A;  1VQ4 T;  1K73 R;  1VQP Q;  2F1L A;  1WIE A;  2QQA A;  4M7A G;  1GFC A;  4HVV A;  4Z89 A;  1M90 R;  4F16 A;  4C92 G;  1PRM C;  1YJW T;  2YLC A;  4PJO B;  2L3Q A;  1SRM A;  2RN8 A;  3REA B;  4AMC A;  3RMQ A;  2ROT A;  4F7U E;  1M3B A;  2EJ9 A;  5GAN 7;  2FYK A;  3EGX B;  3CCV Q;  1S1N A;  2FG0 A;  3M0U A;  3V8K A;  1NE8 A;  3DLL A;  1NYG A;  1OZ2 A;  4JZ4 A;  1K9M R;  4M7A A;  4XAX B;  2GNC A;  2RJC A;  2W10 A;  3SB2 A;  2RQT A;  2RPN A;  4J9D A;  5CIU A;  5GAM h;  4J7F A;  2LQ8 A;  2OTL A;  3M56 A;  1RUW A;  2E6N A;  3GNF B;  3HHT B;  3M4Y A;  5LJ3 j;  2V1Q A;  3LH5 A;  5M9O A;  2X4W A;  3MP8 A;  4Y28 E;  4L59 A;  4V2S A;  4AFS C;  1WA7 A;  3OYH A;  2RHI A;  3L1A A;  4NS5 A;  1SF9 A;  3ULR B;  2HBP A;  2COY A;  3OBW A;  3AHU A;  1G5V A;  2OTJ A;  2KQW A;  4HCC A;  2P4R A;  3N5B B;  2VAS A;  3PIO A;  3CCR T;  3JCM X;  1FMV A;  1GBQ A;  1GCQ A;  3GNG A;  4QT7 A;  2Y90 A;  4XU0 A;  3WVD B;  2FRW A;  1M1K U;  1VQM A;  2HDA A;  2RMO A;  3MPU B;  1VQ9 A;  2JTF A;  3ZBD A;  1YIT A;  2DL3 A;  3CD6 A;  1VQ8 Q;  4FYV B;  2K7A A;  2RNA A;  4PK4 A;  4C0D C;  2HSP A;  5KE2 A;  3OYI A;  2LRQ A;  5KYX B;  3CCL Q;  2NYS A;  1JEG A;  2BUD A;  2QG9 B;  2KSS A;  2DIQ A;  4F17 A;  2EQJ A;  2OJ2 A;  1YHQ T;  1YJW Q;  1PD0 A;  1VUB A;  2ZPF B;  2F5K A;  1SHF A;  2YRV A;  1Z9Z A;  1U5S A;  1RAF B;  1QLY A;  1K9M U;  4WCI A;  3FRN A;  2CZ0 B;  3QZ5 B;  2LX7 A;  3CME A;  1RAD B;  3VRY A;  2EGA A;  1H3H A;  5GAN 2;  3F70 A;  1M1K C;  5L8R E;  3I5S A;  2RQR A;  3QBY A;  2LCS A;  5KYW A;  1AEY A;  5EC7 A;  5GJW B;  2QAS A;  1ZBX A;  3OYE A;  1NEG A;  1WHL A;  1VQM T;  2GFU A;  2RO0 A;  1D1B A;  1AWJ A;  3H0F A;  1BI0 A;  2YDL A;  4J5Y A;  2FO0 A;  4EMK C;  5GMK i;  4MZT A;  4RTX A;  1ABQ A;  3CC7 T;  1Y7X A;  2A37 A;  1MMG A;  1UGS B;  2MI6 A;  1B34 A;  3O8V A;  4C5I A;  4DQ2 A;  2DL5 A;  3X28 B;  4N0A C;  3NMZ C;  2J7I A;  2EGC A;  2K9G A;  1BI1 A;  2NUP B;  3VRZ A;  2IVW A;  1M1G A;  2DF6 A;  2XID A;  4ZN3 A;  5KCO A;  4MML A;  4A63 B;  2DNU A;  5KCH A;  1GXI E;  2DTO A;  4YTL A;  4C5H A;  1W2B S;  3CCE A;  2CSI A;  2NUZ A;  2EWN A;  1Q86 R;  3OYM A;  3PT9 A;  2VUB A;  2QI2 A;  2DBK A;  1QVF A;  2PUK B;  2RD1 A;  1BK2 A;  4IUR A;  2JS0 A;  2DAQ A;  3FIF A;  4BB7 A;  2G6F X;  2FZC B;  4HXJ A;  3NTH A;  4D8K A;  4D8D A;  1VQ4 A;  4F7U A;  1XJW B;  2XDB A;  3A98 A;  4M77 E;  4LN2 A;  4R55 A;  2DTH A;  2FVU A;  2Y4X A;  1WJR A;  1IRX A;  1PRL C;  4CC4 B;  2QA4 T;  3OYF A;  1VQM Q;  3OS2 A;  1D0Y A;  4BE2 A;  4KGX B;  1IGU A;  4IIM A;  1X2K A;  3H8Z A;  1BB9 A;  4NOY A;  2GCX A;  3KBG A;  3DB4 A;  4XTW A;  2X3X D;  4JJC A;  3L2R A;  1KC8 U;  3V7S A;  2BTT A;  4M7D E;  1O9S A;  3DKM A;  3LH0 A;  4M7A D;  3OYL A;  2AZV A;  2RK2 A;  3I9Q A;  3TQ7 P;  1FX7 A;  3HRU A;  3PGG A;  1V29 B;  3CC7 Q;  1W70 A;  2DZ9 A;  1KQ2 A;  4ELZ C;  1PSF A;  1VQO A;  1E6H A;  4QVZ A;  3A8G B;  2DJQ A;  3UF4 A;  1FYN A;  2SEM A;  1M8V A;  4PLL A;  4OB2 B;  4GBQ A;  2O2O A;  2DD4 A;  5FRN A;  2DK3 A;  1FMK A;  2FPD A;  2GFA A;  2JW4 A;  4XTU A;  2X35 A;  5KYW B;  2MWP A;  2JNG A;  1KD1 C;  2P0K A;  2OTL T;  4A53 A;  3CQT A;  2FPE A;  2QA4 A;  3OW2 S;  1DJ7 B;  2QA4 Q;  2P0P A;  3MP6 A;  4JPB W;  5FU7 B;  3M53 A;  3CCQ T;  4M78 A;  5LJ3 f;  1N9S A;  4CC2 A;  5CQX A;  4QVC A;  5FLX E;  4J9B A;  2AHJ B;  2RHU A;  3RDV A;  3EHQ A;  2QTV A;  4ORZ A;  4R56 A;  1W2B A;  2K2M A;  3JCM e;  1ARK A;  2RJE A;  3VU3 C;  1SKU B;  3QDF A;  1WZO A;  1IZ6 A;  2KXD A;  3S3O A;  3OS1 A;  2IIM A;  2ZGW A;  3A8M B;  1PNJ A;  1X6G A;  1F1B B;  3NTK A;  2LP5 A;  3DLM A;  1VQ9 T;  3BE3 A;  3IQL A;  2HL5 C;  1M27 C;  1BU1 A;  2CP6 A;  2YXY A;  2R58 A;  2AKL A;  2CP5 A;  4NL2 A;  1IO6 A;  2L3P A;  4Z02 A;  2E65 A;  3HFO A;  2QQB A;  1VQK Q;  1Y71 A;  3RKX A;  5AT1 B;  3P8B B;  2P84 A;  2VVK A;  1D0Z A;  4F7U B;  5HK3 A;  1WJQ A;  3PNW C;  3G6E T;  1ZBJ A;  1PKS A;  2D0N A;  4O6J A;  5GAN j;  1M2V B;  2GF7 A;  1M90 U;  2OX7 A;  1KC8 C;  3EH1 A;  3EG9 B;  2YUN A;  2VB6 A;  3FEO A;  1HK9 A;  2GTJ A;  3CBP A;  2M0Y A;  1UEB A;  2FPF A;  2FZG B;  1G2B A;  5GAO r;  2EGE A;  2DXC A;  5J39 A;  4JJD A;  3ZFJ A;  4BD3 A;  2D8H A;  2LQK A;  1VQL A;  2QQS A;  4KUL A;  3VKI A;  3CCU Q;  4XTV A;  4X1V A;  4L5G A;  2XDP A;  4ATO A;  3BY7 A;  1OI1 A;  2KK4 A;  4DBF A;  2CZ1 B;  4JRK A;  1G3T A;  3BDL A;  3BFM A;  4PKC C;  3LYI A;  2D8J A;  3UPU A;  1U8R A;  4Q5W A;  4C92 F;  5IT9 E;  4C8Q D;  3TSZ A;  2FL7 A;  3JSC A;  3CCE T;  2DRK A;  3THK A;  1KHI A;  4LXC A;  1OEB A;  3VYG A;  2MWO A;  1BI3 A;  3JB9 H;  3X26 B;  2AT1 B;  1VQ4 Q;  2PVG B;  1YJN Q;  3WXM B;  3L42 A;  1AVZ C;  1X6O A;  3CCR A;  2G3R A;  1D3B A;  3TEE A;  2E6Z A;  5IHI A;  2EKO A;  4J9E A;  4WTO B;  1D3B B;  1U3O A;  2EW3 A;  3FDR A;  4HCB A;  2H8H A;  5LJ3 d;  4M7A E;  2CKK A;  2LT1 A;  3MEU A;  1PG5 B;  2M51 A;  1UG1 A;  3TSW A;  1UGV A;  2VKN A;  1HSQ A;  1AD5 A;  3TRE A;  4OF1 A;  3M0S A;  4BY6 B;  2XHC A;  1MHN A;  4FT2 A;  4B6M A;  5GAN g;  3M55 A;  1AOJ A;  2KXC A;  3PTA A;  4XTY A;  1VQP A;  2EYQ A;  1MV3 A;  5LJ5 d;  1KQS P;  1XTD A;  4EMK B;  4E7I A;  2FEI A;  4HCZ A;  4ZTJ A;  4M4Z A;  4M77 A;  1IHV A;  2RI2 A;  2AKK A;  4M77 B;  1PKT A;  4BI8 B;  2HL3 A;  4FT4 A;  4OMO A;  1QCN A;  3S3M A;  2GQI A;  5GMK h;  4J8O A;  4XQ3 A;  3UWN A;  4AFQ C;  3H6Z A;  2L2P A;  5GAM e;  2VGM A;  2XDD A;  4LUD A;  3CPW A;  3OS5 A;  4C5E A;  3H9N A;  3PVL A;  5GAN 4;  2J6F A;  2J06 A;  2PNI A;  2MMP A;  1VQ8 A;  4RKU E;  4N4H A;  3VS1 A;  4C8Q E;  3G71 T;  5FW9 A;  4IUP A;  2MK5 A;  1G3W A;  3EFO B;  2J6O A;  2EVR A;  5I11 A;  2KRN A;  1LJO A;  2X4Y A;  2KVQ G;  4JDS A;  1YJW A;  4M7D G;  3CXC A;  3VS5 A;  4IUU A;  5IHK A;  3LX7 A;  2QDL A;  3KXT A;  1QVG S;  5EG2 A;  2CZ7 B;  1YWO A;  1VOM A;  2CP0 A;  1VQ5 T;  2DXT A;  1KHC A;  5IN1 A;  2LMJ A;  2O31 A;  4ESR A;  1VQ6 T;  1NPR A;  1W6X A;  2M02 A;  4QW2 A;  1N6A A;  2HSE B;  4BY6 C;  3OMC A;  5I2M A;  3EGD B;  4AG1 C;  4FCY A;  2F2X A;  2C0T A;  2A7Y A;  2NWM A;  2XKO C;  5GMK m;  2XI9 A;  3EG9 A;  2ECZ A;  2KI7 A;  4KGV B;  4KH1 B;  3GOX A;  2IPO B;  1WJS A;  2Z0W A;  2YLB A;  3PMT A;  1SG5 A;  2RA2 A;  3M54 A;  1WHG A;  1I5L A;  4Z88 A;  2AIR B;  1OUL A;  4J9H A;  2EQM A;  2KE9 A;  1QVP A;  2EPD A;  4OMM A;  2HBW A;  4IKF A;  1TOV A;  5CKH A;  5GAO q;  3EG0 A;  4OMN A;  3OSS C;  3QJ6 A;  3RES A;  1TG0 A;  2R57 A;  3HPW A;  4E6R A;  1M2O A;  2FHD A;  4BI4 A;  3CC4 Q;  2COZ A;  2HCK A;  2DL4 A;  4OMP A;  2KYB A;  5KYU A;  1H92 A;  3PIP A;  3X25 B;  4EMH A;  4X9C A;  4PLI A;  3CCM A;  4J6W A;  1CSK A;  2A28 A;  3JCM f;  1PM3 A;  1WXB A;  4QQG A;  3ER0 A;  2A36 A;  2RF0 A;  3QII A;  2RHX A;  1YJ9 A;  3GPL A;  2DIL A;  1NM7 A;  4KGZ B;  4OB3 B;  4JRP A;  3ZL7 C;  2CUD A;  4DBQ A;  3CCL A;  2ESW A;  3QHS A;  4LDX A;  1IGQ A;  1LPL A;  4FU6 A;  2LDM A;  1TU0 B;  1Q86 U;  4ZNX A;  4A54 A;  5A0G A;  4HCK A;  3RIR A;  2CH4 W;  2CT4 A;  1RAG B;  2JXB A;  2LCC A;  2DL8 A;  4FIB A;  3SFM A;  3EH2 A;  5DLQ E;  3M57 A;  4M75 F;  4II1 A;  1Q81 R;  1YI2 A;  1R77 A;  2DD5 A;  1PWT A;  2RQV A;  4A4E A;  2MF2 A;  1SRL A;  4CC7 A;  1XQH A;  3EG2 A;  3M0R A;  3ASK A;  5LJ5 g;  1X6B A;  1QCF A;  4O5V A;  1HXD A;  1D0X A;  5CK9 A;  2D9T A;  4M7A C;  4PJO E;  3NFC A;  2MYS A;  2E5K A;  1UUE A;  1QWF A;  4KH0 B;  4M75 E;  2I0N A;  4ME7 A;  2HQH A;  3EGX A;  3REB B;  5GAM j;  4E7L A;  4Z8A A;  3JCM J;  4CI0 C;  3A8H B;  3JCM c;  5D6W A;  1AWX A;  1JU5 C;  2QEX Q;  3JCM W;  3CCL T;  3Q1J A;  3LWI A;  1MMD A;  5L23 A;  3OQ5 A;  3M0P A; 
#chains in the Genus database with same CATH homology
 1YIJ Q;  3CCE Q;  3CCQ Q;  1YIT Q;  1K8A R;  1VQ4 Q;  1VQ8 Q;  3I56 Q;  3CPW P;  1VQK Q;  1YJN Q;  1VQO Q;  3G71 Q;  2QA4 Q;  3CC7 Q;  1YI2 Q;  3CCS Q;  3CCL Q;  3CCJ Q;  3G6E Q;  3CXC P;  1KC8 R;  3CCR Q;  3CCM Q;  2OTJ Q;  1VQ9 Q;  1KD1 R;  1JJ2 P;  1YJ9 Q;  1K73 R;  3CC2 Q;  1VQP Q;  1VQ7 Q;  2OTL Q;  1VQ6 Q;  3CMA Q;  3CCV Q;  1YJW Q;  1W2B P;  3CC4 Q;  1VQ5 Q;  1N8R R;  1VQN Q;  1QVG P;  2QEX Q;  1Q82 R;  1S72 Q;  1VQM Q;  3CD6 Q;  1YHQ Q;  1M90 R;  3CCU Q;  3CME Q;  1QVF P;  3OW2 P;  1VQL Q;  3I55 Q;  1KQS P;  3G4S Q;  1M1K R;  1Q86 R;  1NJI R;  1Q81 R;  1K9M R;  1Q7Y R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...