1W2BP

Trigger factor ribosome binding domain in complex with 50s
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Trigger Factor in Complex with the Ribosome Forms a Molecular Cradle for Nascent Proteins
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 14
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1w2bP00
3CD6Q 3CCLQ 3CCRQ 3OW2P 1VQOQ 3CC4Q 1YIJQ 1Q82R 1VQ7Q 3G4SQ 1QVFP 1VQ8Q 3CMEQ 3G71Q 1K8AR 3CXCP 3CC2Q 1JJ2P 1KC8R 2OTJQ 1VQMQ 3CCQQ 1VQ9Q 2QA4Q 3G6EQ 1S72Q 2OTLQ 3I56Q 1VQPQ 2QEXQ 1Q81R 1VQ4Q 1W2BP 3CCUQ 3CCMQ 1K73R 1QVGP 1VQ5Q 1YJWQ 1Q7YR 1KD1R 1M1KR 3CCJQ 3I55Q 1NJIR 3CC7Q 1VQNQ 1YITQ 3CMAQ 1KQSP 3CCSQ 3CCVQ 3CCEQ 1YI2Q 1VQKQ 1VQLQ 1N8RR 1VQ6Q 3CPWP 1K9MR 1YJNQ 1Q86R 1YJ9Q 1M90R 1YHQQ
chains in the Genus database with same CATH superfamily
2GF7A 1W6XA 3C4SA 1ACMB 2K9GA 2CKKA 3EG3A 1RAGB 2RHXA 2D0NA 4IIOA 1B34A 2CH4W 2P4TA 3UPUA 4MZPA 2M0YA 2O01E 2JT4A 3M0UA 4HCKA 1Q82C 1BIBA 1BCOA 2K57A 4J9BA 3CD6T 4M7DC 3A1PA 3L2QA 3R6NA 2B8AA 3LGFA 3SFMA 5KCHA 1T0JA 3QSUA 2DILA 4ZGJB 1TUCA 3QPHA 1VQ7T 2J6FA 5HCKA 2CREA 4AFSC 4WF2A 5IN1A 1N9RA 2VC8A 3OYDA 1G3YA 2I0NA 2HZYA 1V76A 2XKOC 3NFCA 1N8RU 2DIQA 3QZ5B 5KYNA 4M78B 4J8OA 1ZUUA 3H9NA 1VQLT 2K5FA 1YNZA 1R0CB 1LNXA 2ROLA 4LDWA 2LJ1A 3TREA 1TWBA 2LT4A 4JRPA 3KBGA 1WA7A 1M3BA 1WNLA 4OGCA 1NBEB 2W0ZA 4BE0A 3V8JA 5CCAA 4MMKA 4F7UA 4KGXB 1RL2A 1N8RR 3V8LA 4QT7A 3M0PA 4XU2A 2CT3A 1I8FA 4ZN1A 1JXOA 1I4K1 1WHLA 2GCXA 3I56T 1X27A 1AWWA 2IVWA 2F1LA 1AZEA 1MNEA 3E2UA 5LJ5f 4QVDA 1GBRA 2DXUA 3S3OA 2BZYA 1VQ4A 4XU3A 3A8HB 3PIPA 1VQ5Q 2Y90A 4EMKB 1Q7YR 4M7DF 4FW1A 1AT1B 3REAB 4AFZC 2G6FX 3VUBA 1H3HA 2JZ2A 3WXMB 3HKSA 3H0HA 2ESWA 4X1VA 4C92C 2DIGA 2LC4A 4L5GA 5I11A 1NEBA 2GFUA 2JVVA 1EZZB 4Y28E 3RBBB 5GAMd 1ZSZA 1YJWQ 4CC2A 5GAN7 2LZ6B 4J6XA 3NPFA 2EQUA 4PJOA 1VQ6T 3L2ZA 3OSSC 2K6DA 3M0QA 3O8VA 1M4ZA 4ATOA 1ZHIA 2VXFA 4B9WA 1B34B 1H92A 1PC0A 1UJYA 4ORZA 3OB9A 1YCSB 2KRSA 2JTFA 2JS0A 3SEMA 1KQ1A 1WQ7A 2DVJA 2XDPA 1WIEA 2RK1A 2QK0A 1QVFP 4N4GA 2QQ9A 2ZPGB 3PT9A 2L3PA 3UF4A 3OBWA 3KFVA 3S3NA 3JCMJ 5GAN3 2EKOA 1TSFA 5GAOr 4XTXA 2E3HA 1KHIA 1ZLMA 3LH5A 1C6VX 3CCSA 3CCRA 1HK9A 2DO3A 1S1NA 1W1FA 1M8MA 2K3BA 3WVEB 4IUVA 2RO0A 1H3ZA 2GQVA 3GIBA 2KEAA 4JLIA 2EQJA 1VQ8A 1N6AA 5J3BA 3NTKA 5FWCA 5IT9E 1G2BA 2YLCA 4Z88A 2D9TA 1G3TA 4M7AA 2EYZA 1ZUKA 1KD1U 1SSHA 4N0AA 2CUDA 1YWOA 3VS6A 3L2WA 1AZGB 3UATA 2COYA 3OYYA 5GAMe 4M4ZA 5D7UA 1B7TA 2VV5A 4LXCA 5GAN6 1O75A 4CC3A 1OULA 2DE0X 4A63B 1IZ6A 1VQNA 2KRNA 4NL3A 3T9NA 1F1BB 1D3BA 4LUEA 2EGCA 2PNIA 4FM4B 3CC4A 3EG0A 2GFAA 2EJGA 1PM3A 3RDVA 4CRIA 1JB0E 2LMJA 1VQMQ 2KVQG 1YBYA 3UWNA 3PTAA 2H3EB 1D1BA 5DLOA 4KT0E 4IIMA 1WHGA 3M4YA 4HCCA 1WHMA 2HL5C 2DEQA 3OW2P 2ZZDA 4M7AC 4OMOA 3M58A 4OB0B 2M16A 4RG2A 4M77C 4MDWA 2GQIA 3S6WA 2DYBA 3BW1A 4JZ3A 5GAN4 3UA7A 1MV0B 2HMAA 2RHIA 1KSWA 3HL8A 4IUUA 1VQNQ 1A0NB 2I2LA 1OX8A 1VQOA 3VRZA 1UGRB 1CSKA 3TSZA 5GMKm 5KCOA 2RNAA 4J9IA 1Q7YC 3CCQT 3TEEA 1WHKA 3N5BB 3VYHB 2ZPHB 2A3LA 3OYIA 4DEYA 3DKMA 4HVWA 3UA6A 2RQVA 3FIFA 4J9GA 3CC7A 4J5YA 3VS0A 2AZVA 5GANd 1UE9A 4C5GA 1UGVA 3PMIA 1VQOQ 1FMWA 3EGUA 3CBPA 2OTJT 3MPUB 4A53A 5KH6A 3LGLA 2DL3A 4FSXA 4L59A 5GAOl 2HBPA 2QEXQ 2IIMA 2RA2A 1ABOA 2CGHA 5FU6B 5KYUB 2A36A 2AIRB 1FXXA 3MEVA 1YJNA 3X28B 3CBOA 4OP0A 3OS0A 3H41A 4F7UE 4R55A 1X6BA 4X9CA 2LQNA 1MGQA 1VQ5T 2EWNA 4QKUA 2DLPA 2PVOB 2DYIA 2A7YA 3CCQA 2DL5A 2XDBA 2EJ9A 3EFOB 2PVGB 4F17A 4DEXA 3GP8A 2EYXA 2ZPIB 1Q82R 4KH0B 2K3YA 4A4HA 1B07A 1IHVA 3G4SA 2AKKA 2ZPBB 1W4SA 5GAOm 1KG1A 3A8OB 4KH1B 2IPOB 2K4YA 5GAMg 4J9CA 4OGEA 1T0HA 4BUGA 4C0DC 2MAMA 5HK0A 4LD9K 4XU1A 1T3SA 2RJFA 1SF9A 4D8KA 2L3QA 3VS2A 3EG1A 2CP7A 3CCRT 2K3XA 2K5IA 3H0IA 4K11A 5GJWB 1QP3A 5IXBA 3I56A 3PVQA 1W2BP 2JMAA 1NZ9A 2R57A 2QQSA 3FJ5A 3HRSA 1VQ4T 3VKIA 1VQ5A 1QKWA 1YJNQ 2E3IA 5DM7R 3CD6Q 2BKDN 2YHTA 4OVAA 2LJ3A 3X26B 2DETA 3IQLA 1M2OA 3JB9F 1MMAA 2EIFA 4PFZA 4PJOE 2LX9A 3JCMg 2F2XA 5D6WA 2YSQA 4J83A 2VB6A 4C8QC 1YJ9A 1AWJA 1D0XA 5HK3A 1VQ9Q 5IXFA 4C92F 2KBTA 2JXBA 3HFOA 3LX7A 3MKDA 2DERA 1VYVA 2KY9A 2QGGA 3CCSQ 4A4FA 5KYXA 2X51A 1VOMA 4A4EA 3CPWA 3FEOA 1I81A 2HKNA 2BE9B 2DD5A 3URGA 3JAME 1U5SA 5KE3A 5KYYA 3BDLA 5D6YA 4E7JA 1KC8U 1D3BB 1PRMC 5GAMj 1AOJA 2MMPA 4LN2A 3DLMA 2P0PA 4RTZA 4IKFA 1AWOA 3CCVA 4XTWA 3CBMA 4F7UG 1UB4A 2SRCA 1GXIE 3EFOA 1RAEB 1YHQA 3VYGA 1M1KU 2K5LA 2CP6A 1BI2A 2DJZA 4JJCA 2L3SA 3JCMf 4J7IA 1WXUA 2MYSA 1ARKA 3FC3A 1VQOT 2KQWA 2OTJQ 1YN8A 3OBYA 1DJ7B 3PMTA 1T3LA 3EGDB 5LL6S 4ME7A 2KMTA 1M30A 4QQ6A 5GAOn 2FG0A 4ZTFA 2X4XA 3FJPA 2FZCB 3E19A 1V29B 1PD0A 3CCEA 1SSFA 1WHJA 3QG1A 4ELZC 2X3WD 5CQXA 2KDSA 2BZ8A 2LCLA 3RMSA 4KUIA 3OYLA 4MDXA 5L8RE 4NOYA 2DX1A 4HT9A 1PWTA 1UHFA 4Q5WA 1WI7A 1VQ9A 1GL5A 2FL7A 1I1JA 3HRUA 4OMNA 4IUQA 3MP1A 5CO7A 3VS1A 4PFPA 2YWWA 1M2VB 4F04B 1WXBA 2RHUA 3G4SQ 3CCVT 3G7ZA 2RN8A 4C5EA 1AD5A 1W70A 1NE8A 2J05A 2JTEA 2OI3A 4C92D 5CQYA 2ED1A 2VWFA 3P8BB 1JJ2S 2LP5A 3QZ9B 4AFQC 1NEGA 4IUPA 1PG5B 2QGFB 3A8MB 2J7IA 1J3TA 4DBFA 2EKHA 5A0LA 3M56A 4E7LA 2P84A 4M78E 3OYMA 2QAZA 2CP0A 2E10A 1M1KR 3TCJA 1OZ3A 3RESA 2M9UA 4E7SA 3CCEQ 1JO8A 4V2SA 3BY7A 4M7AF 3CPWP 4X34A 4AMCA 1MV3A 4JS5A 1K8AR 4EMKA 3CCMT 5AT1B 2KK4A 2RM4A 3SB2A 2OTLA 1HYOA 2V1RA 3CPFA 3CCLA 2VXEA 3SWNA 1RI0A 1U8RA 4M7AG 4KUDK 4FYYB 1K73C 1YIJQ 3RERA 2RB6A 2DZCA 1NM7A 5LJ3h 4KGZB 4A54A 2YUQA 3PGGA 2QA4Q 3QJYA 4C8QF 1BYMA 2EVRA 3MP8A 1G83A 2MCNA 4C92G 4M7DB 3P8DA 1VQMT 4JDSA 4M75E 2CDTA 4ANJA 1NLPC 1AVZC 1YJWT 3CCLQ 2YXYA 4XQ3A 2ZPEB 2RK2A 2E64A 3L2VA 3REBB 1YJNT 2EQIA 1MUZA 3C12A 3OYKA 2DD4A 3CCQQ 1VQ4Q 2EYYA 1Z9QA 2LQKA 2MOXA 1YI2Q 1C0MA 4CC7A 1WHHA 4DQ2A 1UG1A 1NPPA 4BD3A 1VQ6A 1UGSB 3M5AA 3CCLT 3Q1JA 5GAMf 1BK2A 3E1SA 1VQPQ 3O5ZA 1QWFA 1SPKA 4LD6A 2PU9B 3G6ET 2ATCB 2FYKA 1BKBA 1QWEA 1QLYA 2YUNA 2PUOB 4M7AD 3GLXA 5GMKl 2AHJB 2O9SA 1RABB 2F69A 2YUOA 1ZSGA 2NUPB 2RF0A 4KBMB 5LJ5j 1HXDA 3VS7A 1YFNA 2EBPA 3VV0A 2P0KA 3I55Q 2DK3A 1K9AA 1KFZA 1GBQA 5I2SA 5GAN2 2QDYB 3MEUA 1VYUA 3LLRA 2EJFA 2LQWA 3PVLA 3LWIA 1OPKA 2V8KA 1OU8A 1RAFB 1BCMA 3OSVA 3QDFA 4OB2B 3NTIA 2FRYA 4FYWB 4RUGA 1RAHB 3RKYA 3NHNA 2A08A 3I56Q 2FVUA 1G8XA 1I5LA 3OW2A 1TUGB 1M90C 5LJ3g 3CCUT 4JUVA 1OV3A 1OZ2A 2WSCE 1M8VA 3VU3C 2CT4A 1VQLA 4ZN3A 4RCBA 2LRQA 2WSFE 2XG8D 8AT1B 3OYJA 3S3MA 1WDXA 5GAN5 3CC7Q 4BY6C 2XK0A 2M02A 3UT1A 4TVRA 2H3JA 4JRIA 9ATCB 3GNFB 4RMOA 2HSEB 1ZA2B 3CC2T 5GANf 4HXJA 5I2MA 2DEUA 1VQ8Q 5ECAA 1M1KC 3G71A 4HCZA 1SG5A 2KNBB 1Q81U 2RQWA 2E5QA 3FDRA 4M75A 1K9MC 1QCNA 3A8GB 2QEXA 1LCKA 4II1A 1RI9A 1UTIA 2PVDB 3CCJQ 4C5HA 1G3WA 4PJNA 4C8QE 1X2QA 2RHZA 4BDYA 3EG9A 3R6OA 7AT1B 3QO3A 4HCBA 2J6KA 4O5VA 2LT1A 1RAIB 2KYMA 4FYXB 3CC2Q 4B6MA 2V26A 2PTKA 1MHNA 1TH7A 3VJPA 1M3CA 4C8QA 1QKXA 3SDZA 2GNCA 2F5KA 4RCCA 2L3RA 2KXDA 2JTMA 1RLQC 4LUDA 4BACA 1PKTA 2YLBA 2VUBA 2EYWA 2F5TX 1EFNA 5KYUA 1GFDA 2GTJA 4XTZA 2MPXC 2NYSA 1IREB 3FB9A 3GOXA 1Y07A 5KYWA 1K73R 3CCMQ 4F7UB 4MMLA 2RH2A 2EQKA 3BFMA 1JJ2A 1QQJA 3JB9I 2EFIA 3FRNA 4JJNK 2EPDA 4YTLA 5GMKe 5CAIA 3MHXA 3BE3A 3EFSA 1OX9A 1EX4A 3JCMQ 5CK9A 1OI1A 2FZKB 1IRXA 1KC8R 1K76A 2Y4YA 4ELYC 1GCQC 1X69A 2DTOA 4WCIA 5GANh 2D8JA 3I9QA 1YITQ 3M0RA 3HHTB 2LVMA 5FW9A 4FYVB 2DRKA 3PE0A 3CD6A 5CKDA 4BY6B 4PJMA 3JB9H 1R0BG 2QA4T 3X25B 4RTXA 3JCMh 1SKUB 1IO6A 2DZ9A 4A4GA 4OMMA 3CPWS 3EH2A 1KQ2A 2E12A 3VRYA 2YDLA 4XAXB 3CQTA 2LQ8A 3C94A 1NJIR 2XICA 1MMNA 3I5SA 3MEAA 2FPFA 4KGVB 5LJ5d 2XDDA 4J9HA 1Y96B 3ME9A 1W2BA 1HD3A 1RADB 1RAAB 2MIOA 2R5AA 1TOVA 3RR6A 1BB9A 3ZEHA 4D6WA 1Z9ZA 2ROTA 4M75B 3MP6A 1JXMA 1VIFA 1Q82U 1R8OB 2RPNA 5FLXE 2DF6A 5CKBA 2K7AA 1JRIA 4A4KA 2LNHB 2ZPFB 4C5IA 1NJIU 1D0ZA 4HVUA 2HKQB 3QIIA 3CC4Q 1QVPA 2HQHA 2DXCA 2L8DA 4M78A 1OPLA 5GAMh 3LWHA 1TXQA 3EGXB 4DBRA 1UECA 3QWXX 2DXBA 2QTXA 3E9FA 5D6XA 1QVGA 4LDUA 1MMDA 2A37A 2AK5A 2HDAA 3CMAA 2YUPA 1OOTA 2G3RA 1UHCA 2A0FB 2YRCA 1VQKQ 1JEGA 2EYQA 4LDYA 1LVKA 4M75C 4EMHA 4JRQA 3TSWA 1YHQT 2XHCA 1N8RC 1SHGA 4O6JA 2MWOA 4OMPA 1O9SA 2DBMA 3AT1B 5EG2A 5HKCA 1FMKA 3LYIA 3RKWA 1IB8A 4QW2A 5FU7B 4M7AB 4NS5A 3HP9A 1OU9A 3CMET 1WJSA 1Q7YU 1SEMA 2M1HA 1K4US 1X6OA 2DAQA 3NGPA 2DL7A 3I35A 1Q81R 4C0ZA 4LDVA 2JJ9A 1OQKA 3TU4K 1MNDA 2DA9A 2X4WA 1K9MR 5FROA 1N9SA 3EGDA 1WXTA 3HSBA 2KAFA 4PJOB 2JUFA 1GFCA 1UEBA 4Y92A 1H641 1VQPA 1UGPB 3M57A 3HRTA 2QQAA 1OEBA 3V7CA 3CC4T 1BIAA 2X4YA 1FWZA 3M55A 2XI9A 3QYHB 1Q86R 2A28A 2NUTA 4QVCA 4GLMA 3LW5E 2DNUA 3OMGA 2MWPA 1UUEA 2E41A 4FT4A 4D8DA 1GCPA 3CCJT 4DOVA 3CEYA 5HY6A 5GAOq 3NMZC 3EG2A 1D0YA 4C92A 1QVFA 3OS5A 1CKBA 2LDMA 2DXTA 4C8QB 1WPYA 5A2QE 4PJJA 5LJ5g 3RIRA 1YHQQ 3JCMX 2DJQA 1FYNA 1Q81C 3V8KA 2O2OA 3M53A 4PLIA 1JJ2P 1TS9A 3V7RA 2EGAA 4OMFB 3EGXA 3QYGB 1U3OA 5DLQE 1IGUA 5CKEA 5I22A 2PUKB 2ZGWA 4PFOA 1I0CA 4PNOA 1X01A 4F7UF 2HQEA 2FB7A 1KHCA 2DTHA 4Z8AA 3SD4A 4Z02A 2JN0A 1K0XA 2FHDA 1RACB 2EQMA 2KYBA 2Z0WA 1YCYA 4PJOF 1NJIC 5LJ3j 2L5QA 1JBMA 3CC2A 3P8HA 1D09B 2DVEA 2DKGA 3L2UA 2CS7A 4HA8A 3M0TA 2QXFA 1YITT 4C0DB 1LOJA 1M3AA 2EW3A 3G1JA 1QVGP 4OMLA 4MZTA 3CXCA 5AYFA 1M90U 1FMVA 2COZA 1NYFA 2NLUA 4UC4A 2C0OA 2R58A 1I5OB 5I21A 3X24B 2YRDA 4DA4A 2FO0A 5FRNA 1S72T 1PSFA 5GANe 3PIOA 1NPRA 2V8IA 4C0FA 3EFRA 3RNJA 1QW1A 3HPWA 4GLKA 3CCST 1QCFA 3L1AA 5CIUA 1WGSA 3WVDB 2D8HA 1VQKA 5LJ3e 3JCMV 4M77G 2HCKA 4BDZA 2L0AA 2MK5A 1JU5C 1G5VA 1X75C 2D0QB 1M9SA 1V1CA 1WFWA 3RMQA 5GAN8 4FSSA 2V8JA 1YJ9T 3KUFA 3OS1A 2VYTA 4DOWA 4M7DA 4FT2A 4QQDA 2FPDA 2CZ0B 4C8QD 3JCMe 4PKCC 3KXTA 4IURA 1WX6A 2HD0A 1KIKA 4RTWA 1Q86U 2HQXA 2ZCFB 2OAWA 3MCAB 4PK4A 3EH1A 2DTIA 4OB1B 5A0DA 1VQ7Q 2M51A 2KI7A 2NUTB 4ZGEB 4M78F 4M7DE 2JOYA 4JZ4A 2JW4A 1XTDA 1X2KA 5A0GA 2PQWA 5EC7A 1YWPA 2QTVA 1VQMA 5J26A 1BI3A 4DBQA 3I55A 3H8ZA 1KJWA 3RUXA 3UDCA 3JB9J 2BUDA 1VA7A 4BI8B 1M1GA 3OYFA 4HKEA 1VQKT 4J6WA 2NWMA 2VKNA 3JRZA 2QI2A 4M75G 3CMEA 3GBQA 4QVZA 2HSPA 2LNVA 4XTVA 3JSCA 4M77D 2DRMA 2Y4XA 5IAYA 3META 5DY9A 1KK7A 3ASKA 3V7SA 2DL4A 1JQQA 2K79A 3H0FA 1LPLA 3RKXA 5GJVB 1NYGA 4DBHA 4LE9A 1K1ZA 5LJ5e 5LJ3d 4PJOC 1IHWA 3TVTA 4C8QG 2CP3A 4FIBA 2WACA 3JCMd 3OS2A 4ZNXA 1Y57A 1RUWA 3OMCA 1M27C 5KYXB 1K9MU 2XMFA 2DFUA 3JB9G 1WJQA 3JCMW 3C0CA 4X9DA 3PFSA 2KGTA 3CCRQ 2DL8A 2QASA 2OAUA 1R77A 1WJRA 3G71Q 3A98A 3ER0A 4M77E 1KQSS 4E2FB 3BDUA 4RKUE 3GNGA 2HL3A 2OX7A 4M7AE 2BTTA 1ZA1B 2DMOA 3JCMc 5GANj 5J39A 1YI2A 2B86A 2C06A 4E7HA 3ZL7C 2CSQA 2O4XA 2HEQA 4KULA 1KQSA 1TUDA 2JMCA 1XQHA 1PSEA 1ZSZB 1Y71A 3CMAT 1PCXA 4M78D 5FRMA 3M59A 2LTOA 4M75D 3OYAA 3ZBDA 3QHSA 2ECZA 2NUZA 2CZ1B 3OY9A 2F2WA 4J6YA 1U1TA 1RLPC 4EMKC 2JNGA 2RQUA 4PL6A 4HVVA 1SRLA 1WLPB 2JM9A 2SEMA 3GF5A 3HTRA 2X4JA 2O9VA 3OW2S 4PJOD 1QMCA 4RTUA 2HAXA 3CXCP 2MI6A 2X3XD 3QKJA 4M77B 2H8HA 4L6V5 2C0IA 4XU0A 1Y0MA 1BI1A 2OTLQ 2M0OA 4EPCA 5IHKA 3CCMA 4BE1A 3CCET 1BI0A 3PNWC 4N4IA 2COWA 2ABLA 1U06A 3MO8A 2PZ1A 2QDLA 2QQBA 3JB9D 2J06A 3OA6A 2CYZB 3OQ5A 1EIFA 4EDUA 2RJCA 4C0GA 1M5Q1 1UGQB 3QDRB 4OB3B 1YP5A 4AFUC 4J9FA 2J6OA 1C1AA 1HSQA 4RTYA 3EHRA 1VQPT 3ULRB 3OYHA 1D1CA 2L2PA 5FU7C 1YIJA 4XTUA 2LCSA 5M9OA 5KYWB 3CXCS 4M78G 4FCYA 2CZ6B 5KYYB 1GCQA 2RJDA 1LJOA 1I07A 1XOVA 4VUBA 4J9EA 3SHWA 3JV3A 3OYNA 1K8AC 5LJ3f 3HFNA 1P92A 3U23A 3THKA 1MMGA 5FU6C 3CCJA 4JS4A 2P0QA 4FL6A 1IGQA 1PRLC 2E4HA 2RI5A 3MEWA 2KXCA 1ZBXA 3EAEA 3GPLA 1KC8C 1XJWB 4PJOG 4IUTA 4XTYA 1QP2A 1Q95G 1VUBA 1VYTA 4J9DA 3CMEQ 4GY5A 4P5NA 1ZSZC 5GAOp 4M75F 2RHYA 2EAYA 4BB7A 4E47A 4EIKA 1X6GA 3VS4A 5KE2A 2FRWA 4F16A 2CP2A 1PNJA 3AHUA 1VQ9T 1PKSA 3SWNB 5CKFA 3JCMP 3H6ZA 3M0SA 1VQ6Q 2DM1A 1M1FA 4JPBW 4Y91A 2O4XB 2FPEA 2EGEA 4BI3A 1K73U 1H8KA 2AKLA 2KROA 1ZUYA 4OF1A 2MF2A 3NTHA 5IHIA 4WTOB 1YIJT 3DB3A 2YT6A 3JCMb 3G6EQ 5IHNA 1OYXA 2E6NA 2ENMA 3QBYA 3VUZA 3CCUQ 5CVIA 5L23A 4M77F 3L2RA 1Y96A 2R5MA 3FLGA 3MJXA 3CCVQ 2VGMA 2KSSA 3QXEB 1Y7XA 1M2VA 2OTJA 4FU6A 3I5RA 4E7ZA 3QJ6A 1S72A 2YRVA 2CZ7B 1ZBJA 3EHQA 4JJBA 1YJWA 4RTVA 3CCUA 4JLGA 5CR2A 3A5ZB 4B9XA 4C92E 4ZGDB 2KR3A 4CI0C 2CH4A 4E7KA 2DBKA 1K0SA 3TQ7P 2VVKA 2QYZA 3E9GA 4ESRA 4NL2A 4J7FA 4CC4B 2AZSA 2O88A 1U1SA 4BE2A 1VQ7A 4LDXA 1VQLQ 2K2MA 2D1XA 1TTHB 1WZOA 2HNIA 4RTTA 2VGNA 1TU0B 2O31A 1XNIA 4JRKA 1YI2T 1TG0A 4Z89A 5GANg 4M7DD 3J80E 3G4ST 1UJ0A 4AG2C 3OYCA 3G71T 3OYBA 1S72Q 3G6EA 2VASA 3M4GA 1K8AU 4LNPA 5LJ5h 2E65A 2KT8A 2XU8A 2ZAEA 2RD1A 1AHJB 1AWXA 5GMKh 2CUBA 3I55T 4F14A 3SWNC 2JM8A 1ZQ1A 2V1QA 2K2VA 1SHFA 1WQWA 2IG0A 2RI2A 4PLLA 1Q86C 1BBZA 2RI3A 1N27A 3D7SB 5GMKi 2DPPB 2F2VA 4OMQA 4XK8E 3DB4A 3CMAQ 2QQRA 2ED0A 1YJ9Q 2OJ2A 4HT8A 2QG9B 2RMOA 4EMGA 3F70A 2XD0A 4R56A 1X43A 2JS2A 4ZTJA 4MZMA 4E7IA 5IH2A 4N0AC 1N5ZA 5C0MA 3M9QA 2BE7D 3DLLA 2WSEE 1HJDA 5GMKj 1QCOA 4M77A 2BZXA 2LCCA 1KQSP 2FZGB 3INZA 1UFFA 1WYXA 2RQRA 3VS3A 3VS5A 2CP5A 2P4RA 8ATCB 3X20B 2OTLT 4C92B 4M7DG 4JJDA 2LX7A 1VQNT 3J81E 1NG2A 2CSIA 1KD1R 1YITA 3EG9B 3QUIA 2FEIA 4GBQA 2E1HA 1NLOC 2X9HA 2QEXT 3M54A 1QVGS 1VIEA 3OYGA 3J7AF 2QA4A 2NUPA 5CKHA 2E5KA 1CKAA 3LH0A 3ZFJA 4M78C 3C95A 1E6HA 2GTOA 2GGRA 2HBWA 1PHTA 2LJ0A 1W2BS 3L42A 2KT1A 2KE9A 2KRMA 1IXDA 1UDLA 2AT1B 1GRIA 1D1AA 2D6FA 2E6ZA 4N4HA 1G3SA 2L89A 3A8LB 4AG1C 1QVFS 1E7OA 1VQ8T 4AT1B 3OYEA 1PD1A 2E70A 1M90R 1ZX6A 2BIVA 2W10A 4KRTA 1SRMA 2XIDA 5FWBA 1B3QA 1FX7A 6AT1B 1KD1C 4R0KA 2X35A 4FW2A 1AEYA 4QQGA 4E6RA 3CC7T 2GBQA 2RJEA 1E6GA 4BI4A 4PJLA 1ABQA 3QWYA 2RQTA 1BU1A 5C6SA 2C0TA 4RG8A
chains in the Genus database with same CATH topology
3CD6Q 3CCLQ 3CCRQ 3OW2P 1VQOQ 3CC4Q 1YIJQ 1Q82R 1VQ7Q 3G4SQ 1QVFP 1VQ8Q 3CMEQ 3G71Q 1K8AR 3CXCP 3CC2Q 1JJ2P 1KC8R 2OTJQ 1VQMQ 3CCQQ 1VQ9Q 2QA4Q 3G6EQ 1S72Q 2OTLQ 3I56Q 1VQPQ 2QEXQ 1Q81R 1VQ4Q 1W2BP 3CCUQ 3CCMQ 1K73R 1QVGP 1VQ5Q 1YJWQ 1Q7YR 1KD1R 1M1KR 3CCJQ 3I55Q 1NJIR 3CC7Q 1VQNQ 1YITQ 3CMAQ 1KQSP 3CCSQ 3CCVQ 3CCEQ 1YI2Q 1VQKQ 1VQLQ 1N8RR 1VQ6Q 3CPWP 1K9MR 1YJNQ 1Q86R 1YJ9Q 1M90R 1YHQQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CD6 Q;  3CCL Q;  3CCR Q;  3OW2 P;  1VQO Q;  3CC4 Q;  1YIJ Q;  1Q82 R;  1VQ7 Q;  3G4S Q;  1QVF P;  1VQ8 Q;  3CME Q;  3G71 Q;  1K8A R;  3CXC P;  3CC2 Q;  1JJ2 P;  1KC8 R;  2OTJ Q;  1VQM Q;  3CCQ Q;  1VQ9 Q;  2QA4 Q;  3G6E Q;  1S72 Q;  2OTL Q;  3I56 Q;  1VQP Q;  2QEX Q;  1Q81 R;  1VQ4 Q;  1W2B P;  3CCU Q;  3CCM Q;  1K73 R;  1QVG P;  1VQ5 Q;  1YJW Q;  1Q7Y R;  1KD1 R;  1M1K R;  3CCJ Q;  3I55 Q;  1NJI R;  3CC7 Q;  1VQN Q;  1YIT Q;  3CMA Q;  1KQS P;  3CCS Q;  3CCV Q;  3CCE Q;  1YI2 Q;  1VQK Q;  1VQL Q;  1N8R R;  1VQ6 Q;  3CPW P;  1K9M R;  1YJN Q;  1Q86 R;  1YJ9 Q;  1M90 R;  1YHQ Q; 
#chains in the Genus database with same CATH topology
 2GF7 A;  1W6X A;  3C4S A;  1ACM B;  2K9G A;  2CKK A;  3EG3 A;  1RAG B;  2RHX A;  2D0N A;  4IIO A;  1B34 A;  2CH4 W;  2P4T A;  3UPU A;  4MZP A;  2M0Y A;  2O01 E;  2JT4 A;  3M0U A;  4HCK A;  1Q82 C;  1BIB A;  1BCO A;  2K57 A;  4J9B A;  3CD6 T;  4M7D C;  3A1P A;  3L2Q A;  3R6N A;  2B8A A;  3LGF A;  3SFM A;  5KCH A;  1T0J A;  3QSU A;  2DIL A;  4ZGJ B;  1TUC A;  3QPH A;  1VQ7 T;  2J6F A;  5HCK A;  2CRE A;  4AFS C;  4WF2 A;  5IN1 A;  1N9R A;  2VC8 A;  3OYD A;  1G3Y A;  2I0N A;  2HZY A;  1V76 A;  2XKO C;  3NFC A;  1N8R U;  2DIQ A;  3QZ5 B;  5KYN A;  4M78 B;  4J8O A;  1ZUU A;  3H9N A;  1VQL T;  2K5F A;  1YNZ A;  1R0C B;  1LNX A;  2ROL A;  4LDW A;  2LJ1 A;  3TRE A;  1TWB A;  2LT4 A;  4JRP A;  3KBG A;  1WA7 A;  1M3B A;  1WNL A;  4OGC A;  1NBE B;  2W0Z A;  4BE0 A;  3V8J A;  5CCA A;  4MMK A;  4F7U A;  4KGX B;  1RL2 A;  1N8R R;  3V8L A;  4QT7 A;  3M0P A;  4XU2 A;  2CT3 A;  1I8F A;  4ZN1 A;  1JXO A;  1I4K 1;  1WHL A;  2GCX A;  3I56 T;  1X27 A;  1AWW A;  2IVW A;  2F1L A;  1AZE A;  1MNE A;  3E2U A;  5LJ5 f;  4QVD A;  1GBR A;  2DXU A;  3S3O A;  2BZY A;  1VQ4 A;  4XU3 A;  3A8H B;  3PIP A;  1VQ5 Q;  2Y90 A;  4EMK B;  1Q7Y R;  4M7D F;  4FW1 A;  1AT1 B;  3REA B;  4AFZ C;  2G6F X;  3VUB A;  1H3H A;  2JZ2 A;  3WXM B;  3HKS A;  3H0H A;  2ESW A;  4X1V A;  4C92 C;  2DIG A;  2LC4 A;  4L5G A;  5I11 A;  1NEB A;  2GFU A;  2JVV A;  1EZZ B;  4Y28 E;  3RBB B;  5GAM d;  1ZSZ A;  1YJW Q;  4CC2 A;  5GAN 7;  2LZ6 B;  4J6X A;  3NPF A;  2EQU A;  4PJO A;  1VQ6 T;  3L2Z A;  3OSS C;  2K6D A;  3M0Q A;  3O8V A;  1M4Z A;  4ATO A;  1ZHI A;  2VXF A;  4B9W A;  1B34 B;  1H92 A;  1PC0 A;  1UJY A;  4ORZ A;  3OB9 A;  1YCS B;  2KRS A;  2JTF A;  2JS0 A;  3SEM A;  1KQ1 A;  1WQ7 A;  2DVJ A;  2XDP A;  1WIE A;  2RK1 A;  2QK0 A;  1QVF P;  4N4G A;  2QQ9 A;  2ZPG B;  3PT9 A;  2L3P A;  3UF4 A;  3OBW A;  3KFV A;  3S3N A;  3JCM J;  5GAN 3;  2EKO A;  1TSF A;  5GAO r;  4XTX A;  2E3H A;  1KHI A;  1ZLM A;  3LH5 A;  1C6V X;  3CCS A;  3CCR A;  1HK9 A;  2DO3 A;  1S1N A;  1W1F A;  1M8M A;  2K3B A;  3WVE B;  4IUV A;  2RO0 A;  1H3Z A;  2GQV A;  3GIB A;  2KEA A;  4JLI A;  2EQJ A;  1VQ8 A;  1N6A A;  5J3B A;  3NTK A;  5FWC A;  5IT9 E;  1G2B A;  2YLC A;  4Z88 A;  2D9T A;  1G3T A;  4M7A A;  2EYZ A;  1ZUK A;  1KD1 U;  1SSH A;  4N0A A;  2CUD A;  1YWO A;  3VS6 A;  3L2W A;  1AZG B;  3UAT A;  2COY A;  3OYY A;  5GAM e;  4M4Z A;  5D7U A;  1B7T A;  2VV5 A;  4LXC A;  5GAN 6;  1O75 A;  4CC3 A;  1OUL A;  2DE0 X;  4A63 B;  1IZ6 A;  1VQN A;  2KRN A;  4NL3 A;  3T9N A;  1F1B B;  1D3B A;  4LUE A;  2EGC A;  2PNI A;  4FM4 B;  3CC4 A;  3EG0 A;  2GFA A;  2EJG A;  1PM3 A;  3RDV A;  4CRI A;  1JB0 E;  2LMJ A;  1VQM Q;  2KVQ G;  1YBY A;  3UWN A;  3PTA A;  2H3E B;  1D1B A;  5DLO A;  4KT0 E;  4IIM A;  1WHG A;  3M4Y A;  4HCC A;  1WHM A;  2HL5 C;  2DEQ A;  3OW2 P;  2ZZD A;  4M7A C;  4OMO A;  3M58 A;  4OB0 B;  2M16 A;  4RG2 A;  4M77 C;  4MDW A;  2GQI A;  3S6W A;  2DYB A;  3BW1 A;  4JZ3 A;  5GAN 4;  3UA7 A;  1MV0 B;  2HMA A;  2RHI A;  1KSW A;  3HL8 A;  4IUU A;  1VQN Q;  1A0N B;  2I2L A;  1OX8 A;  1VQO A;  3VRZ A;  1UGR B;  1CSK A;  3TSZ A;  5GMK m;  5KCO A;  2RNA A;  4J9I A;  1Q7Y C;  3CCQ T;  3TEE A;  1WHK A;  3N5B B;  3VYH B;  2ZPH B;  2A3L A;  3OYI A;  4DEY A;  3DKM A;  4HVW A;  3UA6 A;  2RQV A;  3FIF A;  4J9G A;  3CC7 A;  4J5Y A;  3VS0 A;  2AZV A;  5GAN d;  1UE9 A;  4C5G A;  1UGV A;  3PMI A;  1VQO Q;  1FMW A;  3EGU A;  3CBP A;  2OTJ T;  3MPU B;  4A53 A;  5KH6 A;  3LGL A;  2DL3 A;  4FSX A;  4L59 A;  5GAO l;  2HBP A;  2QEX Q;  2IIM A;  2RA2 A;  1ABO A;  2CGH A;  5FU6 B;  5KYU B;  2A36 A;  2AIR B;  1FXX A;  3MEV A;  1YJN A;  3X28 B;  3CBO A;  4OP0 A;  3OS0 A;  3H41 A;  4F7U E;  4R55 A;  1X6B A;  4X9C A;  2LQN A;  1MGQ A;  1VQ5 T;  2EWN A;  4QKU A;  2DLP A;  2PVO B;  2DYI A;  2A7Y A;  3CCQ A;  2DL5 A;  2XDB A;  2EJ9 A;  3EFO B;  2PVG B;  4F17 A;  4DEX A;  3GP8 A;  2EYX A;  2ZPI B;  1Q82 R;  4KH0 B;  2K3Y A;  4A4H A;  1B07 A;  1IHV A;  3G4S A;  2AKK A;  2ZPB B;  1W4S A;  5GAO m;  1KG1 A;  3A8O B;  4KH1 B;  2IPO B;  2K4Y A;  5GAM g;  4J9C A;  4OGE A;  1T0H A;  4BUG A;  4C0D C;  2MAM A;  5HK0 A;  4LD9 K;  4XU1 A;  1T3S A;  2RJF A;  1SF9 A;  4D8K A;  2L3Q A;  3VS2 A;  3EG1 A;  2CP7 A;  3CCR T;  2K3X A;  2K5I A;  3H0I A;  4K11 A;  5GJW B;  1QP3 A;  5IXB A;  3I56 A;  3PVQ A;  1W2B P;  2JMA A;  1NZ9 A;  2R57 A;  2QQS A;  3FJ5 A;  3HRS A;  1VQ4 T;  3VKI A;  1VQ5 A;  1QKW A;  1YJN Q;  2E3I A;  5DM7 R;  3CD6 Q;  2BKD N;  2YHT A;  4OVA A;  2LJ3 A;  3X26 B;  2DET A;  3IQL A;  1M2O A;  3JB9 F;  1MMA A;  2EIF A;  4PFZ A;  4PJO E;  2LX9 A;  3JCM g;  2F2X A;  5D6W A;  2YSQ A;  4J83 A;  2VB6 A;  4C8Q C;  1YJ9 A;  1AWJ A;  1D0X A;  5HK3 A;  1VQ9 Q;  5IXF A;  4C92 F;  2KBT A;  2JXB A;  3HFO A;  3LX7 A;  3MKD A;  2DER A;  1VYV A;  2KY9 A;  2QGG A;  3CCS Q;  4A4F A;  5KYX A;  2X51 A;  1VOM A;  4A4E A;  3CPW A;  3FEO A;  1I81 A;  2HKN A;  2BE9 B;  2DD5 A;  3URG A;  3JAM E;  1U5S A;  5KE3 A;  5KYY A;  3BDL A;  5D6Y A;  4E7J A;  1KC8 U;  1D3B B;  1PRM C;  5GAM j;  1AOJ A;  2MMP A;  4LN2 A;  3DLM A;  2P0P A;  4RTZ A;  4IKF A;  1AWO A;  3CCV A;  4XTW A;  3CBM A;  4F7U G;  1UB4 A;  2SRC A;  1GXI E;  3EFO A;  1RAE B;  1YHQ A;  3VYG A;  1M1K U;  2K5L A;  2CP6 A;  1BI2 A;  2DJZ A;  4JJC A;  2L3S A;  3JCM f;  4J7I A;  1WXU A;  2MYS A;  1ARK A;  3FC3 A;  1VQO T;  2KQW A;  2OTJ Q;  1YN8 A;  3OBY A;  1DJ7 B;  3PMT A;  1T3L A;  3EGD B;  5LL6 S;  4ME7 A;  2KMT A;  1M30 A;  4QQ6 A;  5GAO n;  2FG0 A;  4ZTF A;  2X4X A;  3FJP A;  2FZC B;  3E19 A;  1V29 B;  1PD0 A;  3CCE A;  1SSF A;  1WHJ A;  3QG1 A;  4ELZ C;  2X3W D;  5CQX A;  2KDS A;  2BZ8 A;  2LCL A;  3RMS A;  4KUI A;  3OYL A;  4MDX A;  5L8R E;  4NOY A;  2DX1 A;  4HT9 A;  1PWT A;  1UHF A;  4Q5W A;  1WI7 A;  1VQ9 A;  1GL5 A;  2FL7 A;  1I1J A;  3HRU A;  4OMN A;  4IUQ A;  3MP1 A;  5CO7 A;  3VS1 A;  4PFP A;  2YWW A;  1M2V B;  4F04 B;  1WXB A;  2RHU A;  3G4S Q;  3CCV T;  3G7Z A;  2RN8 A;  4C5E A;  1AD5 A;  1W70 A;  1NE8 A;  2J05 A;  2JTE A;  2OI3 A;  4C92 D;  5CQY A;  2ED1 A;  2VWF A;  3P8B B;  1JJ2 S;  2LP5 A;  3QZ9 B;  4AFQ C;  1NEG A;  4IUP A;  1PG5 B;  2QGF B;  3A8M B;  2J7I A;  1J3T A;  4DBF A;  2EKH A;  5A0L A;  3M56 A;  4E7L A;  2P84 A;  4M78 E;  3OYM A;  2QAZ A;  2CP0 A;  2E10 A;  1M1K R;  3TCJ A;  1OZ3 A;  3RES A;  2M9U A;  4E7S A;  3CCE Q;  1JO8 A;  4V2S A;  3BY7 A;  4M7A F;  3CPW P;  4X34 A;  4AMC A;  1MV3 A;  4JS5 A;  1K8A R;  4EMK A;  3CCM T;  5AT1 B;  2KK4 A;  2RM4 A;  3SB2 A;  2OTL A;  1HYO A;  2V1R A;  3CPF A;  3CCL A;  2VXE A;  3SWN A;  1RI0 A;  1U8R A;  4M7A G;  4KUD K;  4FYY B;  1K73 C;  1YIJ Q;  3RER A;  2RB6 A;  2DZC A;  1NM7 A;  5LJ3 h;  4KGZ B;  4A54 A;  2YUQ A;  3PGG A;  2QA4 Q;  3QJY A;  4C8Q F;  1BYM A;  2EVR A;  3MP8 A;  1G83 A;  2MCN A;  4C92 G;  4M7D B;  3P8D A;  1VQM T;  4JDS A;  4M75 E;  2CDT A;  4ANJ A;  1NLP C;  1AVZ C;  1YJW T;  3CCL Q;  2YXY A;  4XQ3 A;  2ZPE B;  2RK2 A;  2E64 A;  3L2V A;  3REB B;  1YJN T;  2EQI A;  1MUZ A;  3C12 A;  3OYK A;  2DD4 A;  3CCQ Q;  1VQ4 Q;  2EYY A;  1Z9Q A;  2LQK A;  2MOX A;  1YI2 Q;  1C0M A;  4CC7 A;  1WHH A;  4DQ2 A;  1UG1 A;  1NPP A;  4BD3 A;  1VQ6 A;  1UGS B;  3M5A A;  3CCL T;  3Q1J A;  5GAM f;  1BK2 A;  3E1S A;  1VQP Q;  3O5Z A;  1QWF A;  1SPK A;  4LD6 A;  2PU9 B;  3G6E T;  2ATC B;  2FYK A;  1BKB A;  1QWE A;  1QLY A;  2YUN A;  2PUO B;  4M7A D;  3GLX A;  5GMK l;  2AHJ B;  2O9S A;  1RAB B;  2F69 A;  2YUO A;  1ZSG A;  2NUP B;  2RF0 A;  4KBM B;  5LJ5 j;  1HXD A;  3VS7 A;  1YFN A;  2EBP A;  3VV0 A;  2P0K A;  3I55 Q;  2DK3 A;  1K9A A;  1KFZ A;  1GBQ A;  5I2S A;  5GAN 2;  2QDY B;  3MEU A;  1VYU A;  3LLR A;  2EJF A;  2LQW A;  3PVL A;  3LWI A;  1OPK A;  2V8K A;  1OU8 A;  1RAF B;  1BCM A;  3OSV A;  3QDF A;  4OB2 B;  3NTI A;  2FRY A;  4FYW B;  4RUG A;  1RAH B;  3RKY A;  3NHN A;  2A08 A;  3I56 Q;  2FVU A;  1G8X A;  1I5L A;  3OW2 A;  1TUG B;  1M90 C;  5LJ3 g;  3CCU T;  4JUV A;  1OV3 A;  1OZ2 A;  2WSC E;  1M8V A;  3VU3 C;  2CT4 A;  1VQL A;  4ZN3 A;  4RCB A;  2LRQ A;  2WSF E;  2XG8 D;  8AT1 B;  3OYJ A;  3S3M A;  1WDX A;  5GAN 5;  3CC7 Q;  4BY6 C;  2XK0 A;  2M02 A;  3UT1 A;  4TVR A;  2H3J A;  4JRI A;  9ATC B;  3GNF B;  4RMO A;  2HSE B;  1ZA2 B;  3CC2 T;  5GAN f;  4HXJ A;  5I2M A;  2DEU A;  1VQ8 Q;  5ECA A;  1M1K C;  3G71 A;  4HCZ A;  1SG5 A;  2KNB B;  1Q81 U;  2RQW A;  2E5Q A;  3FDR A;  4M75 A;  1K9M C;  1QCN A;  3A8G B;  2QEX A;  1LCK A;  4II1 A;  1RI9 A;  1UTI A;  2PVD B;  3CCJ Q;  4C5H A;  1G3W A;  4PJN A;  4C8Q E;  1X2Q A;  2RHZ A;  4BDY A;  3EG9 A;  3R6O A;  7AT1 B;  3QO3 A;  4HCB A;  2J6K A;  4O5V A;  2LT1 A;  1RAI B;  2KYM A;  4FYX B;  3CC2 Q;  4B6M A;  2V26 A;  2PTK A;  1MHN A;  1TH7 A;  3VJP A;  1M3C A;  4C8Q A;  1QKX A;  3SDZ A;  2GNC A;  2F5K A;  4RCC A;  2L3R A;  2KXD A;  2JTM A;  1RLQ C;  4LUD A;  4BAC A;  1PKT A;  2YLB A;  2VUB A;  2EYW A;  2F5T X;  1EFN A;  5KYU A;  1GFD A;  2GTJ A;  4XTZ A;  2MPX C;  2NYS A;  1IRE B;  3FB9 A;  3GOX A;  1Y07 A;  5KYW A;  1K73 R;  3CCM Q;  4F7U B;  4MML A;  2RH2 A;  2EQK A;  3BFM A;  1JJ2 A;  1QQJ A;  3JB9 I;  2EFI A;  3FRN A;  4JJN K;  2EPD A;  4YTL A;  5GMK e;  5CAI A;  3MHX A;  3BE3 A;  3EFS A;  1OX9 A;  1EX4 A;  3JCM Q;  5CK9 A;  1OI1 A;  2FZK B;  1IRX A;  1KC8 R;  1K76 A;  2Y4Y A;  4ELY C;  1GCQ C;  1X69 A;  2DTO A;  4WCI A;  5GAN h;  2D8J A;  3I9Q A;  1YIT Q;  3M0R A;  3HHT B;  2LVM A;  5FW9 A;  4FYV B;  2DRK A;  3PE0 A;  3CD6 A;  5CKD A;  4BY6 B;  4PJM A;  3JB9 H;  1R0B G;  2QA4 T;  3X25 B;  4RTX A;  3JCM h;  1SKU B;  1IO6 A;  2DZ9 A;  4A4G A;  4OMM A;  3CPW S;  3EH2 A;  1KQ2 A;  2E12 A;  3VRY A;  2YDL A;  4XAX B;  3CQT A;  2LQ8 A;  3C94 A;  1NJI R;  2XIC A;  1MMN A;  3I5S A;  3MEA A;  2FPF A;  4KGV B;  5LJ5 d;  2XDD A;  4J9H A;  1Y96 B;  3ME9 A;  1W2B A;  1HD3 A;  1RAD B;  1RAA B;  2MIO A;  2R5A A;  1TOV A;  3RR6 A;  1BB9 A;  3ZEH A;  4D6W A;  1Z9Z A;  2ROT A;  4M75 B;  3MP6 A;  1JXM A;  1VIF A;  1Q82 U;  1R8O B;  2RPN A;  5FLX E;  2DF6 A;  5CKB A;  2K7A A;  1JRI A;  4A4K A;  2LNH B;  2ZPF B;  4C5I A;  1NJI U;  1D0Z A;  4HVU A;  2HKQ B;  3QII A;  3CC4 Q;  1QVP A;  2HQH A;  2DXC A;  2L8D A;  4M78 A;  1OPL A;  5GAM h;  3LWH A;  1TXQ A;  3EGX B;  4DBR A;  1UEC A;  3QWX X;  2DXB A;  2QTX A;  3E9F A;  5D6X A;  1QVG A;  4LDU A;  1MMD A;  2A37 A;  2AK5 A;  2HDA A;  3CMA A;  2YUP A;  1OOT A;  2G3R A;  1UHC A;  2A0F B;  2YRC A;  1VQK Q;  1JEG A;  2EYQ A;  4LDY A;  1LVK A;  4M75 C;  4EMH A;  4JRQ A;  3TSW A;  1YHQ T;  2XHC A;  1N8R C;  1SHG A;  4O6J A;  2MWO A;  4OMP A;  1O9S A;  2DBM A;  3AT1 B;  5EG2 A;  5HKC A;  1FMK A;  3LYI A;  3RKW A;  1IB8 A;  4QW2 A;  5FU7 B;  4M7A B;  4NS5 A;  3HP9 A;  1OU9 A;  3CME T;  1WJS A;  1Q7Y U;  1SEM A;  2M1H A;  1K4U S;  1X6O A;  2DAQ A;  3NGP A;  2DL7 A;  3I35 A;  1Q81 R;  4C0Z A;  4LDV A;  2JJ9 A;  1OQK A;  3TU4 K;  1MND A;  2DA9 A;  2X4W A;  1K9M R;  5FRO A;  1N9S A;  3EGD A;  1WXT A;  3HSB A;  2KAF A;  4PJO B;  2JUF A;  1GFC A;  1UEB A;  4Y92 A;  1H64 1;  1VQP A;  1UGP B;  3M57 A;  3HRT A;  2QQA A;  1OEB A;  3V7C A;  3CC4 T;  1BIA A;  2X4Y A;  1FWZ A;  3M55 A;  2XI9 A;  3QYH B;  1Q86 R;  2A28 A;  2NUT A;  4QVC A;  4GLM A;  3LW5 E;  2DNU A;  3OMG A;  2MWP A;  1UUE A;  2E41 A;  4FT4 A;  4D8D A;  1GCP A;  3CCJ T;  4DOV A;  3CEY A;  5HY6 A;  5GAO q;  3NMZ C;  3EG2 A;  1D0Y A;  4C92 A;  1QVF A;  3OS5 A;  1CKB A;  2LDM A;  2DXT A;  4C8Q B;  1WPY A;  5A2Q E;  4PJJ A;  5LJ5 g;  3RIR A;  1YHQ Q;  3JCM X;  2DJQ A;  1FYN A;  1Q81 C;  3V8K A;  2O2O A;  3M53 A;  4PLI A;  1JJ2 P;  1TS9 A;  3V7R A;  2EGA A;  4OMF B;  3EGX A;  3QYG B;  1U3O A;  5DLQ E;  1IGU A;  5CKE A;  5I22 A;  2PUK B;  2ZGW A;  4PFO A;  1I0C A;  4PNO A;  1X01 A;  4F7U F;  2HQE A;  2FB7 A;  1KHC A;  2DTH A;  4Z8A A;  3SD4 A;  4Z02 A;  2JN0 A;  1K0X A;  2FHD A;  1RAC B;  2EQM A;  2KYB A;  2Z0W A;  1YCY A;  4PJO F;  1NJI C;  5LJ3 j;  2L5Q A;  1JBM A;  3CC2 A;  3P8H A;  1D09 B;  2DVE A;  2DKG A;  3L2U A;  2CS7 A;  4HA8 A;  3M0T A;  2QXF A;  1YIT T;  4C0D B;  1LOJ A;  1M3A A;  2EW3 A;  3G1J A;  1QVG P;  4OML A;  4MZT A;  3CXC A;  5AYF A;  1M90 U;  1FMV A;  2COZ A;  1NYF A;  2NLU A;  4UC4 A;  2C0O A;  2R58 A;  1I5O B;  5I21 A;  3X24 B;  2YRD A;  4DA4 A;  2FO0 A;  5FRN A;  1S72 T;  1PSF A;  5GAN e;  3PIO A;  1NPR A;  2V8I A;  4C0F A;  3EFR A;  3RNJ A;  1QW1 A;  3HPW A;  4GLK A;  3CCS T;  1QCF A;  3L1A A;  5CIU A;  1WGS A;  3WVD B;  2D8H A;  1VQK A;  5LJ3 e;  3JCM V;  4M77 G;  2HCK A;  4BDZ A;  2L0A A;  2MK5 A;  1JU5 C;  1G5V A;  1X75 C;  2D0Q B;  1M9S A;  1V1C A;  1WFW A;  3RMQ A;  5GAN 8;  4FSS A;  2V8J A;  1YJ9 T;  3KUF A;  3OS1 A;  2VYT A;  4DOW A;  4M7D A;  4FT2 A;  4QQD A;  2FPD A;  2CZ0 B;  4C8Q D;  3JCM e;  4PKC C;  3KXT A;  4IUR A;  1WX6 A;  2HD0 A;  1KIK A;  4RTW A;  1Q86 U;  2HQX A;  2ZCF B;  2OAW A;  3MCA B;  4PK4 A;  3EH1 A;  2DTI A;  4OB1 B;  5A0D A;  1VQ7 Q;  2M51 A;  2KI7 A;  2NUT B;  4ZGE B;  4M78 F;  4M7D E;  2JOY A;  4JZ4 A;  2JW4 A;  1XTD A;  1X2K A;  5A0G A;  2PQW A;  5EC7 A;  1YWP A;  2QTV A;  1VQM A;  5J26 A;  1BI3 A;  4DBQ A;  3I55 A;  3H8Z A;  1KJW A;  3RUX A;  3UDC A;  3JB9 J;  2BUD A;  1VA7 A;  4BI8 B;  1M1G A;  3OYF A;  4HKE A;  1VQK T;  4J6W A;  2NWM A;  2VKN A;  3JRZ A;  2QI2 A;  4M75 G;  3CME A;  3GBQ A;  4QVZ A;  2HSP A;  2LNV A;  4XTV A;  3JSC A;  4M77 D;  2DRM A;  2Y4X A;  5IAY A;  3MET A;  5DY9 A;  1KK7 A;  3ASK A;  3V7S A;  2DL4 A;  1JQQ A;  2K79 A;  3H0F A;  1LPL A;  3RKX A;  5GJV B;  1NYG A;  4DBH A;  4LE9 A;  1K1Z A;  5LJ5 e;  5LJ3 d;  4PJO C;  1IHW A;  3TVT A;  4C8Q G;  2CP3 A;  4FIB A;  2WAC A;  3JCM d;  3OS2 A;  4ZNX A;  1Y57 A;  1RUW A;  3OMC A;  1M27 C;  5KYX B;  1K9M U;  2XMF A;  2DFU A;  3JB9 G;  1WJQ A;  3JCM W;  3C0C A;  4X9D A;  3PFS A;  2KGT A;  3CCR Q;  2DL8 A;  2QAS A;  2OAU A;  1R77 A;  1WJR A;  3G71 Q;  3A98 A;  3ER0 A;  4M77 E;  1KQS S;  4E2F B;  3BDU A;  4RKU E;  3GNG A;  2HL3 A;  2OX7 A;  4M7A E;  2BTT A;  1ZA1 B;  2DMO A;  3JCM c;  5GAN j;  5J39 A;  1YI2 A;  2B86 A;  2C06 A;  4E7H A;  3ZL7 C;  2CSQ A;  2O4X A;  2HEQ A;  4KUL A;  1KQS A;  1TUD A;  2JMC A;  1XQH A;  1PSE A;  1ZSZ B;  1Y71 A;  3CMA T;  1PCX A;  4M78 D;  5FRM A;  3M59 A;  2LTO A;  4M75 D;  3OYA A;  3ZBD A;  3QHS A;  2ECZ A;  2NUZ A;  2CZ1 B;  3OY9 A;  2F2W A;  4J6Y A;  1U1T A;  1RLP C;  4EMK C;  2JNG A;  2RQU A;  4PL6 A;  4HVV A;  1SRL A;  1WLP B;  2JM9 A;  2SEM A;  3GF5 A;  3HTR A;  2X4J A;  2O9V A;  3OW2 S;  4PJO D;  1QMC A;  4RTU A;  2HAX A;  3CXC P;  2MI6 A;  2X3X D;  3QKJ A;  4M77 B;  2H8H A;  4L6V 5;  2C0I A;  4XU0 A;  1Y0M A;  1BI1 A;  2OTL Q;  2M0O A;  4EPC A;  5IHK A;  3CCM A;  4BE1 A;  3CCE T;  1BI0 A;  3PNW C;  4N4I A;  2COW A;  2ABL A;  1U06 A;  3MO8 A;  2PZ1 A;  2QDL A;  2QQB A;  3JB9 D;  2J06 A;  3OA6 A;  2CYZ B;  3OQ5 A;  1EIF A;  4EDU A;  2RJC A;  4C0G A;  1M5Q 1;  1UGQ B;  3QDR B;  4OB3 B;  1YP5 A;  4AFU C;  4J9F A;  2J6O A;  1C1A A;  1HSQ A;  4RTY A;  3EHR A;  1VQP T;  3ULR B;  3OYH A;  1D1C A;  2L2P A;  5FU7 C;  1YIJ A;  4XTU A;  2LCS A;  5M9O A;  5KYW B;  3CXC S;  4M78 G;  4FCY A;  2CZ6 B;  5KYY B;  1GCQ A;  2RJD A;  1LJO A;  1I07 A;  1XOV A;  4VUB A;  4J9E A;  3SHW A;  3JV3 A;  3OYN A;  1K8A C;  5LJ3 f;  3HFN A;  1P92 A;  3U23 A;  3THK A;  1MMG A;  5FU6 C;  3CCJ A;  4JS4 A;  2P0Q A;  4FL6 A;  1IGQ A;  1PRL C;  2E4H A;  2RI5 A;  3MEW A;  2KXC A;  1ZBX A;  3EAE A;  3GPL A;  1KC8 C;  1XJW B;  4PJO G;  4IUT A;  4XTY A;  1QP2 A;  1Q95 G;  1VUB A;  1VYT A;  4J9D A;  3CME Q;  4GY5 A;  4P5N A;  1ZSZ C;  5GAO p;  4M75 F;  2RHY A;  2EAY A;  4BB7 A;  4E47 A;  4EIK A;  1X6G A;  3VS4 A;  5KE2 A;  2FRW A;  4F16 A;  2CP2 A;  1PNJ A;  3AHU A;  1VQ9 T;  1PKS A;  3SWN B;  5CKF A;  3JCM P;  3H6Z A;  3M0S A;  1VQ6 Q;  2DM1 A;  1M1F A;  4JPB W;  4Y91 A;  2O4X B;  2FPE A;  2EGE A;  4BI3 A;  1K73 U;  1H8K A;  2AKL A;  2KRO A;  1ZUY A;  4OF1 A;  2MF2 A;  3NTH A;  5IHI A;  4WTO B;  1YIJ T;  3DB3 A;  2YT6 A;  3JCM b;  3G6E Q;  5IHN A;  1OYX A;  2E6N A;  2ENM A;  3QBY A;  3VUZ A;  3CCU Q;  5CVI A;  5L23 A;  4M77 F;  3L2R A;  1Y96 A;  2R5M A;  3FLG A;  3MJX A;  3CCV Q;  2VGM A;  2KSS A;  3QXE B;  1Y7X A;  1M2V A;  2OTJ A;  4FU6 A;  3I5R A;  4E7Z A;  3QJ6 A;  1S72 A;  2YRV A;  2CZ7 B;  1ZBJ A;  3EHQ A;  4JJB A;  1YJW A;  4RTV A;  3CCU A;  4JLG A;  5CR2 A;  3A5Z B;  4B9X A;  4C92 E;  4ZGD B;  2KR3 A;  4CI0 C;  2CH4 A;  4E7K A;  2DBK A;  1K0S A;  3TQ7 P;  2VVK A;  2QYZ A;  3E9G A;  4ESR A;  4NL2 A;  4J7F A;  4CC4 B;  2AZS A;  2O88 A;  1U1S A;  4BE2 A;  1VQ7 A;  4LDX A;  1VQL Q;  2K2M A;  2D1X A;  1TTH B;  1WZO A;  2HNI A;  4RTT A;  2VGN A;  1TU0 B;  2O31 A;  1XNI A;  4JRK A;  1YI2 T;  1TG0 A;  4Z89 A;  5GAN g;  4M7D D;  3J80 E;  3G4S T;  1UJ0 A;  4AG2 C;  3OYC A;  3G71 T;  3OYB A;  1S72 Q;  3G6E A;  2VAS A;  3M4G A;  1K8A U;  4LNP A;  5LJ5 h;  2E65 A;  2KT8 A;  2XU8 A;  2ZAE A;  2RD1 A;  1AHJ B;  1AWX A;  5GMK h;  2CUB A;  3I55 T;  4F14 A;  3SWN C;  2JM8 A;  1ZQ1 A;  2V1Q A;  2K2V A;  1SHF A;  1WQW A;  2IG0 A;  2RI2 A;  4PLL A;  1Q86 C;  1BBZ A;  2RI3 A;  1N27 A;  3D7S B;  5GMK i;  2DPP B;  2F2V A;  4OMQ A;  4XK8 E;  3DB4 A;  3CMA Q;  2QQR A;  2ED0 A;  1YJ9 Q;  2OJ2 A;  4HT8 A;  2QG9 B;  2RMO A;  4EMG A;  3F70 A;  2XD0 A;  4R56 A;  1X43 A;  2JS2 A;  4ZTJ A;  4MZM A;  4E7I A;  5IH2 A;  4N0A C;  1N5Z A;  5C0M A;  3M9Q A;  2BE7 D;  3DLL A;  2WSE E;  1HJD A;  5GMK j;  1QCO A;  4M77 A;  2BZX A;  2LCC A;  1KQS P;  2FZG B;  3INZ A;  1UFF A;  1WYX A;  2RQR A;  3VS3 A;  3VS5 A;  2CP5 A;  2P4R A;  8ATC B;  3X20 B;  2OTL T;  4C92 B;  4M7D G;  4JJD A;  2LX7 A;  1VQN T;  3J81 E;  1NG2 A;  2CSI A;  1KD1 R;  1YIT A;  3EG9 B;  3QUI A;  2FEI A;  4GBQ A;  2E1H A;  1NLO C;  2X9H A;  2QEX T;  3M54 A;  1QVG S;  1VIE A;  3OYG A;  3J7A F;  2QA4 A;  2NUP A;  5CKH A;  2E5K A;  1CKA A;  3LH0 A;  3ZFJ A;  4M78 C;  3C95 A;  1E6H A;  2GTO A;  2GGR A;  2HBW A;  1PHT A;  2LJ0 A;  1W2B S;  3L42 A;  2KT1 A;  2KE9 A;  2KRM A;  1IXD A;  1UDL A;  2AT1 B;  1GRI A;  1D1A A;  2D6F A;  2E6Z A;  4N4H A;  1G3S A;  2L89 A;  3A8L B;  4AG1 C;  1QVF S;  1E7O A;  1VQ8 T;  4AT1 B;  3OYE A;  1PD1 A;  2E70 A;  1M90 R;  1ZX6 A;  2BIV A;  2W10 A;  4KRT A;  1SRM A;  2XID A;  5FWB A;  1B3Q A;  1FX7 A;  6AT1 B;  1KD1 C;  4R0K A;  2X35 A;  4FW2 A;  1AEY A;  4QQG A;  4E6R A;  3CC7 T;  2GBQ A;  2RJE A;  1E6G A;  4BI4 A;  4PJL A;  1ABQ A;  3QWY A;  2RQT A;  1BU1 A;  5C6S A;  2C0T A;  4RG8 A; 
#chains in the Genus database with same CATH homology
 3CD6 Q;  3CCL Q;  3CCR Q;  3OW2 P;  1VQO Q;  3CC4 Q;  1YIJ Q;  1Q82 R;  1VQ7 Q;  3G4S Q;  1QVF P;  1VQ8 Q;  3CME Q;  3G71 Q;  1K8A R;  3CXC P;  3CC2 Q;  1JJ2 P;  1KC8 R;  2OTJ Q;  1VQM Q;  3CCQ Q;  1VQ9 Q;  2QA4 Q;  3G6E Q;  1S72 Q;  2OTL Q;  3I56 Q;  1VQP Q;  2QEX Q;  1Q81 R;  1VQ4 Q;  1W2B P;  3CCU Q;  3CCM Q;  1K73 R;  1QVG P;  1VQ5 Q;  1YJW Q;  1Q7Y R;  1KD1 R;  1M1K R;  3CCJ Q;  3I55 Q;  1NJI R;  3CC7 Q;  1VQN Q;  1YIT Q;  3CMA Q;  1KQS P;  3CCS Q;  3CCV Q;  3CCE Q;  1YI2 Q;  1VQK Q;  1VQL Q;  1N8R R;  1VQ6 Q;  3CPW P;  1K9M R;  1YJN Q;  1Q86 R;  1YJ9 Q;  1M90 R;  1YHQ Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...