1W2BP

Trigger factor ribosome binding domain in complex with 50s
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title Trigger Factor in Complex with the Ribosome Forms a Molecular Cradle for Nascent Proteins
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 14
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1w2bP00
3CCLQ 1YJNQ 1YJWQ 1VQPQ 1Q81R 1VQ9Q 1K73R 1VQKQ 3CCVQ 3CCRQ 1KD1R 1VQ4Q 3I55Q 3CMEQ 3CPWP 1YITQ 3CCUQ 1QVFP 1M1KR 3I56Q 3CCMQ 1VQLQ 3CC2Q 1VQ6Q 1VQOQ 1NJIR 3CXCP 3CMAQ 1M90R 3CC7Q 1S72Q 3CCJQ 3CC4Q 1VQMQ 3G4SQ 1YJ9Q 1QVGP 1Q86R 1VQ7Q 1VQNQ 1YI2Q 3CCEQ 1JJ2P 1Q7YR 3G71Q 1K8AR 1KQSP 2QA4Q 1W2BP 3CCQQ 1YIJQ 2OTLQ 3CD6Q 1N8RR 1KC8R 3CCSQ 1YHQQ 2QEXQ 1K9MR 2OTJQ 3G6EQ 1Q82R 1VQ5Q 3OW2P 1VQ8Q
chains in the Genus database with same CATH superfamily
4DA4A 1VYTA 4BI8B 1KC8C 2LMJA 2M16A 4HCZA 2ZPGB 2KBTA 4M78G 1G3YA 4FSXA 1TSFA 5LJ3d 3CC2A 5GMKi 3AHUA 5GMKe 2CP3A 2GQIA 3EG9A 5FU6B 3JCMe 5I11A 5GAMj 4RTVA 3CXCA 2COZA 3EHQA 4OB1B 2EYXA 2MPXC 3JCMg 2IG0A 3MKDA 5KYWA 4A4HA 3ZFJA 2CZ0B 4C8QC 8AT1B 3G6ET 2DF6A 4EMHA 3MP1A 3MO8A 4M77E 2CS7A 1VQLQ 1AVZC 4J9FA 4BY6C 4LDYA 3LW5E 5FU7C 1TUGB 3LWIA 5GAMf 4PFZA 1KQSS 3V7SA 4AT1B 2B8AA 1KC8R 4PK4A 2BZXA 2ED0A 4DOVA 3RMSA 3CPWP 1ZQ1A 3OBWA 4M7AD 5ECAA 2NUTB 2RQRA 3I5SA 2M51A 5CIUA 1Y57A 2XDBA 2YDLA 1NEBA 3R6NA 2D1XA 2JS0A 2BKDN 1B3QA 2JS2A 1D0ZA 3OSVA 1OX8A 1BU1A 1PKSA 4JZ4A 2CZ7B 2CGHA 1VQKT 4LXCA 2X51A 5GAN7 5I2SA 2DXUA 3G71Q 1MGQA 2EGAA 3PVQA 1NLPC 3BFMA 4M7AB 4F16A 1RAFB 2BZYA 2HDAA 4N0AA 3CCRQ 1Y7XA 3ZEHA 3HTRA 1BKBA 3QPHA 2PVDB 1H641 5GAN5 1QP3A 2RHZA 5GAMh 2Y4XA 4L6V5 3A98A 4HKEA 3NFCA 2QA4Q 3L2UA 4BDZA 3TREA 1ARKA 2DIGA 2LJ1A 2KNBB 1GCQC 2LRQA 2EGEA 3X20B 1YITQ 2R5MA 4LN2A 3KUFA 4EMKA 1VIFA 2VUBA 4OF1A 3M55A 4PJOF 2GTOA 2V8IA 2CKKA 4A63B 4QVDA 3SFMA 2JMAA 2JW4A 1UECA 4DEXA 2KYBA 3A8MB 1ZLMA 4MZMA 5KCOA 3UWNA 4LUDA 1KHIA 4RG2A 1QVFA 4LD9K 2HQHA 2JUFA 2DBKA 3I56T 2V8KA 4E7IA 3CCQA 1W2BP 2HAXA 4JUVA 4D6WA 1G5VA 2RQUA 1QKWA 1K9MR 3RBBB 1VQ8Q 1T3SA 2L5QA 2BZ8A 1B7TA 1WHHA 1XTDA 2E4HA 3JB9D 4JRIA 2EQIA 1G3TA 1ZHIA 3HP9A 4KGVB 1M1FA 1M1KC 4L59A 1U1SA 4J8OA 4XQ3A 1X2QA 2MIOA 2DFUA 4M7DE 2JXBA 2DXCA 5D6YA 2ZCFB 3CQTA 4HVVA 2D8JA 4J7IA 1K4US 5A2QE 3S3OA 4C5EA 1T0JA 2E70A 2KRMA 2KYMA 5HK0A 1MUZA 3QBYA 5I2MA 4J9IA 3JCMc 2J6KA 3EHRA 3VU3C 2OTLQ 1LCKA 3CD6Q 1QVGA 3EG3A 3EG9B 3OYAA 4RCCA 2QG9B 3CCLQ 1NYFA 4PNOA 2I0NA 3P8DA 3KXTA 2MMPA 4GLMA 4C0DB 4C5HA 4HCKA 3V8LA 4C8QE 2F5TX 1Y0MA 4C0GA 2ABLA 2EYYA 3WVDB 4F17A 3CXCP 3BDUA 1AOJA 4F7UB 3AT1B 2V8JA 3SDZA 1ZX6A 4KUDK 3G4ST 4M7AC 4JJDA 1M4ZA 1ABOA 3IQLA 2CP0A 1CKBA 3EH2A 2EYQA 1RLQC 3OW2A 4IURA 1I07A 2JN0A 2LC4A 1E6GA 1UJ0A 3CMAA 3A8OB 2B86A 2JJ9A 3HKSA 1YJ9A 4IUQA 4M77G 3CC2T 1D1CA 1LPLA 4OB2B 1D0YA 1M2OA 4WTOB 2BE9B 2QDYB 2O88A 2RHUA 1YJWA 1ZSZA 1RAEB 2KMTA 1RLPC 2DLPA 3MJXA 4PJJA 1X6OA 2XICA 1JO8A 2A36A 3KFVA 4M78A 3M56A 1X2KA 4HCBA 3EGXA 2LJ0A 3QZ5B 3HL8A 2KT8A 2RQWA 3PGGA 1AZGB 3CBMA 5LJ3e 2BTTA 2FG0A 4XU2A 4DBQA 3HSBA 2KI7A 1RI0A 2GGRA 3L1AA 2LDMA 4RKUE 5IAYA 2P4RA 2DL8A 5LJ3g 3M0PA 1E7OA 4Z02A 2Z0WA 1Z9ZA 3H0IA 2KR3A 4M75F 1VQ7A 3EFSA 1SF9A 4DQ2A 3JCMf 2G6FX 3M53A 2RI3A 2K5FA 3MHXA 1NJIU 4ZTFA 1NZ9A 1SRLA 1N9RA 2CT3A 5KCHA 2CP7A 5GANd 1YN8A 3X24B 2DL4A 3C94A 2RPNA 1HYOA 4KGXB 4B9WA 1R77A 4PJOA 5LJ5d 4TVRA 1Y71A 4XU1A 2RB6A 2J06A 3M54A 5C6SA 2QQ9A 1WQ7A 4XK8E 4Z8AA 1NG2A 4HXJA 5IHNA 3OQ5A 5KYYA 4EMKB 1SHGA 3JCMJ 3TSZA 4A4EA 1W4SA 2VYTA 3JCMb 2E64A 1LJOA 1U1TA 4RTWA 3PTAA 9ATCB 3CCEA 3CPWA 2CT4A 2YXYA 4B9XA 4NS5A 3BY7A 2K9GA 1IREB 5CO7A 1QW1A 1UHFA 4FCYA 1GCPA 2DEUA 2LT1A 2EJGA 4JJBA 2AK5A 1UFFA 3BW1A 4C0DC 3CCVA 3A1PA 3EG2A 4CRIA 2ZZDA 1UGPB 1M8MA 3VKIA 5L23A 3QSUA 1QVFP 5IXBA 5KYUA 2K3XA 1OI1A 1MMDA 1YBYA 3JCMh 4A53A 1U5SA 1EZZB 1FMWA 4C5GA 3JB9I 2PTKA 1NYGA 2EQUA 4O5VA 4JLIA 3OBYA 4FYXB 4CC3A 4E47A 5GAN6 4C92G 4DEYA 1XNIA 1AZEA 1B34B 1CSKA 2DEQA 2FYKA 2PNIA 1RAGB 1PC0A 1VQMA 2CP2A 4FYVB 1UB4A 2XK0A 3FJPA 1HSQA 3HRTA 1LNXA 4MMLA 1GBQA 3M57A 3EFOB 3QXEB 1VQPQ 4XTUA 4LDUA 2RJEA 3UT1A 1NEGA 1Q81C 4A4GA 3URGA 3I56Q 1VQOQ 3F70A 4NL3A 2NUZA 1T3LA 2V1RA 4X9DA 1TUCA 1I4K1 1M90C 4N4HA 3FJ5A 4ZGEB 1YHQA 3GIBA 1WXUA 3HHTB 2F1LA 5HKCA 1YI2T 1Q95G 2DYBA 3SWNB 1QKXA 1M30A 2EGCA 4XTXA 2VVKA 1X27A 1AWJA 4M78D 1RAAB 2LQWA 4QT7A 2EJ9A 1A0NB 3VUZA 3L2WA 1JEGA 4N0AC 4HT8A 2KXDA 4XAXB 2HQXA 4E7JA 4BD3A 3VS2A 2HD0A 4ZGJB 1IHVA 2J6FA 1K9AA 3OW2P 1Q81R 3JCMV 1OPKA 3FRNA 4FT4A 1TS9A 1OULA 1U3OA 3VS5A 3QZ9B 2DXBA 2H3JA 1M90R 5CQYA 4FYWB 5J26A 2JM8A 1YIJA 2LX7A 5EG2A 4KT0E 4M78B 2V26A 3HPWA 3JCMX 1JU5C 1AWWA 4KBMB 1IRXA 3RKWA 1ACMB 3A8LB 3OYJA 3CCUA 4M75A 3DB4A 1YJNT 3JCMW 5FROA 2YRVA 4LNPA 1N9SA 1ZSGA 2EKOA 3VS4A 2LQ8A 1OX9A 1BI2A 2QDLA 4QQGA 4WF2A 5GAMd 4BI4A 1YJ9T 3CCJT 4OP0A 2M1HA 2LVMA 3PNWC 1KQ1A 1M9SA 2O31A 1VQ4A 1ZUUA 2QK0A 3CMEA 2ZGWA 2X4YA 1WDXA 4J6XA 3NTHA 4CC4B 2XMFA 2X4WA 3CC7A 1WHJA 2PU9B 1Q7YR 3L2VA 2LNHB 4M77A 2EWNA 2L8DA 4LDVA 3PIOA 1H3HA 4C8QF 3QWXX 3FEOA 2LP5A 3I35A 3OYKA 3HFNA 1NE8A 1WPYA 2FZGB 4JS4A 5CKBA 3VJPA 4D8KA 1YWPA 1OOTA 2DM1A 4D8DA 1VQ6T 5A0LA 3VS1A 5EC7A 3UA7A 1VQ7T 1NPRA 2MYSA 1S72Q 2M02A 2I2LA 5LJ3j 3TU4K 1K8AU 4OMLA 2HKNA 2YUNA 3A8HB 1VQLA 1Y96B 2QI2A 4PJOG 1JBMA 1S1NA 3EAEA 1SSHA 2J05A 1J3TA 1UJYA 4XTVA 1X6GA 1I5OB 4F7UE 2RO0A 5KYUB 1MHNA 2H8HA 3CCSQ 4R56A 3SWNC 4C0FA 2COWA 1QLYA 5LJ3f 1R8OB 2LT4A 3A8GB 2C0TA 3QDFA 2X3WD 3HFOA 5CK9A 3ZL7C 2RQTA 5CKFA 2L3SA 3QUIA 3L42A 4BE2A 5GANe 3OYEA 3EGUA 4R55A 2YT6A 2DO3A 3CCET 2CZ6B 1OZ3A 4ATOA 2QQSA 1KQSA 5FRMA 5KYXA 3OYNA 5LJ5e 3OYLA 4Y28E 1W1FA 1GFCA 2QQRA 3JCMQ 2PUKB 3T9NA 3H0FA 3CCVT 4IIMA 4KUIA 4RUGA 2W0ZA 5LJ5g 3I55T 3L2QA 3G71A 2P0PA 4J83A 2FRYA 2RM4A 4RCBA 1HD3A 3MEVA 4M78C 4BB7A 2LJ3A 3VS3A 2OTJQ 4DBHA 5A0GA 1BYMA 1Q86U 2DTOA 2DE0X 2X4XA 3CCRA 2GTJA 2LZ6B 2JMCA 3BDLA 3EG1A 2DPPB 2SRCA 1KD1C 1UDLA 1MNDA 3C95A 1JJ2P 2DL5A 2BIVA 2MWOA 4OVAA 4RG8A 3OMCA 2QA4A 3JRZA 2X4JA 1M1GA 3RKXA 2EQJA 3X26B 1MV3A 3OYMA 4PLLA 2E3HA 5LJ3h 2RH2A 5DLQE 4ESRA 1FWZA 4IKFA 3EFRA 3REBB 1YITA 4MDXA 3CBOA 1SEMA 2DBMA 1X75C 4C92A 5J3BA 2YLCA 5FU6C 5GAN3 2A08A 1NJIC 1WHLA 2XD0A 2FPDA 4O6JA 1UTIA 3A5ZB 4JRKA 2QEXQ 2OI3A 1JQQA 2HEQA 3MEAA 2DMOA 4J5YA 1BIAA 3TQ7P 4M7DA 1YHQT 1KD1R 1FXXA 3C12A 4XU0A 4HVUA 2K57A 1K1ZA 2DJZA 4LD6A 5IH2A 3EG0A 4RTZA 3CC4Q 2E41A 1YI2Q 2AKKA 2ED1A 3GLXA 4IUVA 2HL5C 2QTXA 3EGDA 4BI3A 4BE1A 2CP5A 4BACA 1W6XA 5DM7R 1TXQA 2VWFA 1VQ8A 3FIFA 1OZ2A 4J9DA 3S3NA 4FT2A 4P5NA 2RN8A 1WGSA 2ZPIB 2HNIA 1AD5A 1O9SA 2K79A 1GL5A 1ZA2B 1RI9A 2LNVA 2HMAA 1C1AA 3OA6A 1U8RA 4N4IA 1YIJT 1FYNA 2A7YA 2KQWA 2GF7A 4M77B 4M75G 3CPFA 2AKLA 3DB3A 1Z9QA 5IHIA 5L8RE 1VQ9T 4PFOA 2O4XA 3CCMQ 1M1KR 2E1HA 2RMOA 1C0MA 3M0RA 2EPDA 2EVRA 2LQNA 2DVJA 3NHNA 4E7KA 5KYWB 4HT9A 1M3CA 4FYYB 4LUEA 4M7AF 5GAN8 2CP6A 5KE3A 4MMKA 2OTLA 3CD6A 4AFQC 4KGZB 1EIFA 1VQ5Q 1HJDA 5IN1A 1OV3A 3CCLA 1YJNQ 2R5AA 3GF5A 2VASA 3OS1A 5CVIA 4J9HA 3CCMA 1P92A 3I9QA 2YLBA 3CCJQ 2DKGA 3CMET 1VQNQ 1ABQA 3ME9A 1WX6A 1G2BA 1VYUA 3CC7T 3DKMA 1VQ5A 4Y92A 5GMKl 3HRUA 1NLOC 3FDRA 1MMAA 1IXDA 1X6BA 2DRKA 5M9OA 4LE9A 4HA8A 2LTOA 4E6RA 1I81A 4J9GA 4CC2A 1Y07A 4LDWA 1VQNA 2O01E 5GMKj 1D3BA 1GXIE 2HQEA 3G6EQ 1HK9A 2YSQA 2K2MA 3FB9A 3H8ZA 1F1BB 1OYXA 2KXCA 4L5GA 2GNCA 1UGVA 4A4FA 4A4KA 2JT4A 1IO6A 1K9MU 3VRZA 2KRNA 2DERA 3NTKA 2JVVA 3RDVA 5CKDA 4CC7A 1V29B 1VQLT 2Y90A 1KQSP 3RNJA 2RA2A 1GCQA 2DNUA 2VGMA 8ATCB 4M78E 3MEWA 2XI9A 4OGCA 2XKOC 2QASA 2YHTA 3MPUB 1SSFA 2E65A 2AT1B 1ZUKA 2KVQG 4C92D 1TTHB 3ZBDA 1I8FA 5D6XA 2RD1A 4UC4A 1ZUYA 2IPOB 2LCSA 3V7RA 2BUDA 1WIEA 5C0MA 3META 3VYGA 3JCMP 3QYHB 4RTUA 2GFUA 1VQKQ 1N5ZA 4QVZA 2RJDA 2JZ2A 2L3RA 2ZPEB 3PMIA 4GLKA 2FZCB 3JB9F 2RHXA 3TSWA 4PJMA 5GAOp 1MMGA 3H9NA 3INZA 2KDSA 5FRNA 2KT1A 2GBQA 4C92B 4K11A 3G71T 3L2RA 4FSSA 4WCIA 4M4ZA 2P4TA 3PIPA 4DBFA 3I55Q 2DYIA 3PFSA 2ZPHB 4F7UF 2J6OA 4PJLA 4XTYA 1K0SA 3CCRT 3OYFA 4EDUA 1TG0A 5GMKh 1FMKA 1QMCA 1PCXA 5AT1B 1X01A 2ESWA 4OB0B 2CSIA 4YTLA 3OSSC 5HCKA 3P8HA 3OY9A 1Q82U 3WVEB 2ZPFB 3C0CA 1MV0B 4E7ZA 1E6HA 5CR2A 1YITT 7AT1B 1OEBA 3KBGA 4A54A 4JPBW 5AYFA 3M0UA 2GQVA 1PD0A 3RIRA 1K8AC 4JJCA 3OYHA 2DD5A 3ASKA 1JB0E 2DK3A 2D9TA 4M7DG 1G83A 3QO3A 3CCQT 2PZ1A 5GAOr 3J81E 3VS0A 3V8JA 2K5IA 2XG8D 1M8VA 3ER0A 3GP8A 2A0FB 3X25B 3FLGA 2E6NA 1VA7A 1W2BS 2K6DA 3DLMA 3OMGA 2JM9A 1JJ2A 2MI6A 2RQVA 3P8BB 2DZ9A 4FU6A 1VQPA 4M7AE 2P0QA 3H41A 3OS0A 2E3IA 1NPPA 1VQ8T 3I56A 1AHJB 2W10A 1RAHB 3G7ZA 1VQOA 4JRQA 3SD4A 3QJYA 1K73U 2MF2A 2F2WA 1PD1A 4PFPA 4C8QG 3OYGA 4AG1C 4X9CA 4Z89A 3SB2A 2MK5A 4OMOA 3GPLA 1M2VA 4XTZA 2JTEA 4PL6A 2YUPA 2CSQA 1LVKA 5LJ5h 2F69A 2FZKB 1N8RU 1M27C 2VV5A 5I21A 4MDWA 2X3XD 1I1JA 2EQMA 1ZSZB 2G3RA 4E7HA 2FPEA 3E9FA 3UF4A 2DAQA 5GAOq 1I0CA 3LWHA 1Q86C 3L2ZA 1D1BA 2IVWA 1WFWA 1VQ9Q 2CREA 3FC3A 3EGXB 4EMKC 2OTLT 2KGTA 1KSWA 3QG1A 4ZNXA 2A3LA 2EYWA 2KRSA 3CCLT 4AFSC 2QAZA 1QCOA 3CXCS 3THKA 3S3MA 4PJOD 5GAOm 3G4SQ 5FW9A 1AWXA 1WI7A 3GNFB 4E7SA 2KSSA 3M0SA 2EAYA 3CMAT 1TUDA 2VGNA 4ANJA 4C92C 1KFZA 1AEYA 5IHKA 1UGSB 1YFNA 2MAMA 2L0AA 2CUBA 3NMZC 4J6YA 3CC2Q 1YJWT 3SEMA 1QWEA 1SPKA 1Q86R 2EFIA 1PRMC 2EYZA 1WLPB 1H8KA 5DLOA 3LX7A 4PJOB 1BBZA 5LL6S 1C6VX 2O2OA 3H6ZA 2ROTA 2E6ZA 4JLGA 1V1CA 2D0QB 2KAFA 5KYYB 1QCNA 5CAIA 1WQWA 2HBPA 1G3WA 2HSPA 2RJFA 3QJ6A 3QWYA 2AZVA 4AG2C 3CBPA 4ZGDB 2DTHA 4F7UA 2FVUA 2O9SA 2EW3A 2VXEA 2D0NA 4RTYA 4X1VA 2BE7D 2R58A 3O8VA 3TVTA 2EBPA 2Y4YA 3GNGA 2J7IA 2D6FA 1GFDA 4Q5WA 1HXDA 1FMVA 3G1JA 3OYIA 4RMOA 4B6MA 4XTWA 3E1SA 3TCJA 2XHCA 2AZSA 4E7LA 3TEEA 4MZTA 1S72A 1CKAA 1VIEA 4HVWA 2KY9A 4KRTA 1ZBJA 1Q81U 2HKQB 2NWMA 2JTFA 3MP6A 5FWBA 1X69A 1LOJA 4QQ6A 1YCSB 3CCSA 5D6WA 3OYBA 1M90U 1WNLA 2E5QA 4FM4B 4KH0B 2AIRB 2RNAA 1OU9A 1JRIA 2X35A 5GANg 2E5KA 3M0TA 1ZSZC 3BE3A 4DOWA 3QYGB 4M78F 1EFNA 2AHJB 2GFAA 4IUTA 1QWFA 2KROA 5DY9A 5KYNA 3RUXA 3LH5A 1WJSA 1DJ7B 2ZPBB 1M3AA 2YWWA 4ELZC 1BB9A 3UATA 4E2FB 3LGFA 3OYCA 1KG1A 1QVFS 5CQXA 3WXMB 2DZCA 1WHMA 1G8XA 1JXOA 1KK7A 3DLLA 5GAN4 2XIDA 2MWPA 2K4YA 2QQBA 4KULA 1VQMT 2OTJA 1UUEA 5HK3A 4F04B 2X9HA 1GBRA 1Q7YU 3OB9A 3R6OA 1K9MC 3RESA 4M75D 2HBWA 1XQHA 3OS5A 4MZPA 2E10A 3ULRB 4M7AG 2NUPA 2RJCA 1M2VB 3LGLA 2ROLA 1R0BG 3O5ZA 2JTMA 3VRYA 1WJQA 1RUWA 2R57A 4J9BA 3OYDA 3CCQQ 1MMNA 1X43A 3JSCA 2CH4W 4PJOC 4NOYA 4QW2A 4KH1B 2VC8A 1GRIA 4OGEA 1BK2A 2F5KA 1JXMA 1AWOA 1VQPT 3RR6A 1KC8U 2DL3A 1QVGS 2KK4A 1UHCA 4M77D 1VQOT 3M4GA 4M75B 3E2UA 4IUPA 3QIIA 2QEXA 4C92E 2NYSA 1FX7A 1TWBA 2EJFA 1KQ2A 2VXFA 1NJIR 3QHSA 3CC4A 2QXFA 2HZYA 1YI2A 3N5BB 2GCXA 2JNGA 4GY5A 5GAOn 4Y91A 4C8QA 4ZTJA 1WXBA 1B34A 1SKUB 2C0OA 2QGGA 3OW2S 1K76A 2RI5A 3X28B 3QKJA 3H0HA 3VS6A 1BI3A 2OAWA 1WA7A 2WSFE 3OS2A 1OU8A 3UPUA 3EFOA 4RTTA 2K7AA 2O9VA 1IB8A 4VUBA 3CCUT 2DD4A 4AMCA 4OMFB 3MCAB 4AFUC 1M3BA 3M59A 2DL7A 5GAN2 2FB7A 3JB9J 1Q82C 2DIQA 2CYZB 2NLUA 3CMAQ 3J80E 3MEUA 3SWNA 1YJ9Q 3NPFA 1VQ4T 3HRSA 1PRLC 3JV3A 2YUQA 2LCCA 4FIBA 2F2VA 1IHWA 2FPFA 5IXFA 2OX7A 2DA9A 2YUOA 3JCMd 2E12A 1YJNA 1YJWQ 1SG5A 1TU0B 1H92A 1PNJA 5GMKm 2L3QA 2FEIA 3JB9G 4JDSA 1NBEB 1KIKA 2QTVA 3OYYA 4ELYC 2FL7A 3C4SA 5GAMe 1WYXA 3CCJA 1UE9A 4J6WA 4V2SA 1PSEA 2C0IA 4X34A 1K0XA 1R0CB 2PQWA 4BE0A 2L2PA 3RKYA 5GAMg 5HY6A 1Q82R 4AFZC 4F7UG 1V76A 1RAIB 4BUGA 4QVCA 2XU8A 1BI1A 1BIBA 4CI0C 1K73C 1VQ6Q 4EIKA 1VQ7Q 3V7CA 5KYXB 1KD1U 1IGUA 3S6WA 1EX4A 2PUOB 5FLXE 2K3BA 4C0ZA 2CH4A 1SHFA 2EIFA 2MOXA 3G6EA 1RL2A 2RHIA 1MNEA 4BDYA 1N8RC 4GBQA 1S72T 1PKTA 1VQ6A 3CPWS 2DTIA 3E19A 2DRMA 1M5Q1 2FO0A 1TH7A 3I5RA 2C06A 3NTIA 5CKHA 5GJVB 1VOMA 4M75C 1WJRA 1I5LA 2YRDA 2YRCA 2QGFB 4M7DD 1WZOA 2HL3A 1K73R 1D1AA 5FWCA 4FL6A 3CCST 1G3SA 3PVLA 2HSEB 2EQKA 3D7SB 1TOVA 2DETA 3M58A 4OMNA 1OPLA 4R0KA 3M0QA 3UA6A 1PWTA 3CCEQ 1XOVA 2CDTA 1M1KU 3U23A 2NUPB 4ZN1A 2DILA 3PE0A 2RK2A 2CUDA 1N8RR 1OQKA 4M77F 5GANj 2RI2A 4OB3B 4PJOE 2EKHA 2ENMA 4PKCC 1VQKA 3CCVQ 2A37A 4J9CA 2K5LA 4M77C 3RERA 3M9QA 6AT1B 4EPCA 5LJ5j 3VV0A 3QDRB 1PSFA 4Z88A 4C8QD 4M7DB 1XJWB 3VUBA 4IUUA 1N27A 1KJWA 1BCMA 1Y96A 1BCOA 5GANf 1RABB 2NUTA 2K2VA 2QA4T 3VYHB 2XDPA 1QCFA 3EGDB 4ME7A 2OTJT 3I55A 1N6AA 3MP8A 3Q1JA 5LJ5f 5KE2A 1RACB 1UGQB 1VYVA 3M4YA 1YNZA 1VQMQ 4J9EA 1JJ2S 1WHGA 5I22A 5KH6A 1YCYA 3LYIA 2L89A 2RHYA 1PM3A 2M9UA 3REAB 2PVOB 4JZ3A 1D09B 4N4GA 1H3ZA 2OJ2A 2K3YA 1VUBA 3EH1A 4C8QB 2MCNA 3UDCA 4RTXA 2WSCE 2FHDA 4BY6B 4M7AA 3V8KA 1B07A 2A28A 4J7FA 5FU7B 1WHKA 1ZA1B 1WXTA 1D0XA 4C5IA 5J39A 2O4XB 1UG1A 1YHQQ 2F2XA 2HCKA 1QVPA 3GBQA 2CZ1B 3JAME 4ORZA 3VS7A 3CEYA 2SEMA 1UEBA 2V1QA 2QEXT 1U06A 4QQDA 3LLRA 2ATCB 4FW1A 2XDDA 1RADB 2LQKA 1QVGP 1QQJA 2OAUA 2RF0A 1K8AR 2QYZA 2VB6A 1SRMA 4NL2A 2KEAA 3CC4T 4HCCA 5GANh 4JRPA 3LH0A 1KHCA 2KE9A 2IIMA 3SHWA 4LDXA 5D7UA 2DXTA 2H3EB 5GJWB 2PVGB 2ZAEA 1T0HA 3M5AA 1W70A 3J7AF 2DX1A 3GOXA 4II1A 4JJNK 4QKUA 5A0DA 4PLIA 1PHTA 3NGPA 1YIJQ 2RK1A 2COYA 4DBRA 3E9GA 1W2BA 2DVEA 3PT9A 3CD6T 1YWOA 1D3BB 1O75A 2ECZA 5IT9E 1PG5B 2D8HA 1ZBXA 2WSEE 4FW2A 3CCUQ 2M0OA 1NM7A 2P0KA 1AT1B 3CCMT 4C92F 3PMTA 1BI0A 2P84A 5CCAA 2M0YA 1Q7YC 1VQ9A 5CKEA 2JOYA 1YP5A 4OMQA 2DJQA 1VQ4Q 1VQ5T 1IZ6A 1IGQA 4OMPA 4PJNA 3CMEQ 5GAOl 2QQAA 4M7DF 4EMGA 2LCLA 4JS5A 1QP2A 2VKNA 3CC7Q 1UGRB 2FRWA 3G4SA 4F14A 2WACA 4ZN3A 4M7DC 2LX9A 2L3PA 4M75E 4OMMA 1VQNT 3JB9H 3RMQA 4IIOA 4XU3A
chains in the Genus database with same CATH topology
3CCLQ 1YJNQ 1YJWQ 1VQPQ 1Q81R 1VQ9Q 1K73R 1VQKQ 3CCVQ 3CCRQ 1KD1R 1VQ4Q 3I55Q 3CMEQ 3CPWP 1YITQ 3CCUQ 1QVFP 1M1KR 3I56Q 3CCMQ 1VQLQ 3CC2Q 1VQ6Q 1VQOQ 1NJIR 3CXCP 3CMAQ 1M90R 3CC7Q 1S72Q 3CCJQ 3CC4Q 1VQMQ 3G4SQ 1YJ9Q 1QVGP 1Q86R 1VQ7Q 1VQNQ 1YI2Q 3CCEQ 1JJ2P 1Q7YR 3G71Q 1K8AR 1KQSP 2QA4Q 1W2BP 3CCQQ 1YIJQ 2OTLQ 3CD6Q 1N8RR 1KC8R 3CCSQ 1YHQQ 2QEXQ 1K9MR 2OTJQ 3G6EQ 1Q82R 1VQ5Q 3OW2P 1VQ8Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCL Q;  1YJN Q;  1YJW Q;  1VQP Q;  1Q81 R;  1VQ9 Q;  1K73 R;  1VQK Q;  3CCV Q;  3CCR Q;  1KD1 R;  1VQ4 Q;  3I55 Q;  3CME Q;  3CPW P;  1YIT Q;  3CCU Q;  1QVF P;  1M1K R;  3I56 Q;  3CCM Q;  1VQL Q;  3CC2 Q;  1VQ6 Q;  1VQO Q;  1NJI R;  3CXC P;  3CMA Q;  1M90 R;  3CC7 Q;  1S72 Q;  3CCJ Q;  3CC4 Q;  1VQM Q;  3G4S Q;  1YJ9 Q;  1QVG P;  1Q86 R;  1VQ7 Q;  1VQN Q;  1YI2 Q;  3CCE Q;  1JJ2 P;  1Q7Y R;  3G71 Q;  1K8A R;  1KQS P;  2QA4 Q;  1W2B P;  3CCQ Q;  1YIJ Q;  2OTL Q;  3CD6 Q;  1N8R R;  1KC8 R;  3CCS Q;  1YHQ Q;  2QEX Q;  1K9M R;  2OTJ Q;  3G6E Q;  1Q82 R;  1VQ5 Q;  3OW2 P;  1VQ8 Q; 
#chains in the Genus database with same CATH topology
 4DA4 A;  1VYT A;  4BI8 B;  1KC8 C;  2LMJ A;  2M16 A;  4HCZ A;  2ZPG B;  2KBT A;  4M78 G;  1G3Y A;  4FSX A;  1TSF A;  5LJ3 d;  3CC2 A;  5GMK i;  3AHU A;  5GMK e;  2CP3 A;  2GQI A;  3EG9 A;  5FU6 B;  3JCM e;  5I11 A;  5GAM j;  4RTV A;  3CXC A;  2COZ A;  3EHQ A;  4OB1 B;  2EYX A;  2MPX C;  3JCM g;  2IG0 A;  3MKD A;  5KYW A;  4A4H A;  3ZFJ A;  2CZ0 B;  4C8Q C;  8AT1 B;  3G6E T;  2DF6 A;  4EMH A;  3MP1 A;  3MO8 A;  4M77 E;  2CS7 A;  1VQL Q;  1AVZ C;  4J9F A;  4BY6 C;  4LDY A;  3LW5 E;  5FU7 C;  1TUG B;  3LWI A;  5GAM f;  4PFZ A;  1KQS S;  3V7S A;  4AT1 B;  2B8A A;  1KC8 R;  4PK4 A;  2BZX A;  2ED0 A;  4DOV A;  3RMS A;  3CPW P;  1ZQ1 A;  3OBW A;  4M7A D;  5ECA A;  2NUT B;  2RQR A;  3I5S A;  2M51 A;  5CIU A;  1Y57 A;  2XDB A;  2YDL A;  1NEB A;  3R6N A;  2D1X A;  2JS0 A;  2BKD N;  1B3Q A;  2JS2 A;  1D0Z A;  3OSV A;  1OX8 A;  1BU1 A;  1PKS A;  4JZ4 A;  2CZ7 B;  2CGH A;  1VQK T;  4LXC A;  2X51 A;  5GAN 7;  5I2S A;  2DXU A;  3G71 Q;  1MGQ A;  2EGA A;  3PVQ A;  1NLP C;  3BFM A;  4M7A B;  4F16 A;  1RAF B;  2BZY A;  2HDA A;  4N0A A;  3CCR Q;  1Y7X A;  3ZEH A;  3HTR A;  1BKB A;  3QPH A;  2PVD B;  1H64 1;  5GAN 5;  1QP3 A;  2RHZ A;  5GAM h;  2Y4X A;  4L6V 5;  3A98 A;  4HKE A;  3NFC A;  2QA4 Q;  3L2U A;  4BDZ A;  3TRE A;  1ARK A;  2DIG A;  2LJ1 A;  2KNB B;  1GCQ C;  2LRQ A;  2EGE A;  3X20 B;  1YIT Q;  2R5M A;  4LN2 A;  3KUF A;  4EMK A;  1VIF A;  2VUB A;  4OF1 A;  3M55 A;  4PJO F;  2GTO A;  2V8I A;  2CKK A;  4A63 B;  4QVD A;  3SFM A;  2JMA A;  2JW4 A;  1UEC A;  4DEX A;  2KYB A;  3A8M B;  1ZLM A;  4MZM A;  5KCO A;  3UWN A;  4LUD A;  1KHI A;  4RG2 A;  1QVF A;  4LD9 K;  2HQH A;  2JUF A;  2DBK A;  3I56 T;  2V8K A;  4E7I A;  3CCQ A;  1W2B P;  2HAX A;  4JUV A;  4D6W A;  1G5V A;  2RQU A;  1QKW A;  1K9M R;  3RBB B;  1VQ8 Q;  1T3S A;  2L5Q A;  2BZ8 A;  1B7T A;  1WHH A;  1XTD A;  2E4H A;  3JB9 D;  4JRI A;  2EQI A;  1G3T A;  1ZHI A;  3HP9 A;  4KGV B;  1M1F A;  1M1K C;  4L59 A;  1U1S A;  4J8O A;  4XQ3 A;  1X2Q A;  2MIO A;  2DFU A;  4M7D E;  2JXB A;  2DXC A;  5D6Y A;  2ZCF B;  3CQT A;  4HVV A;  2D8J A;  4J7I A;  1K4U S;  5A2Q E;  3S3O A;  4C5E A;  1T0J A;  2E70 A;  2KRM A;  2KYM A;  5HK0 A;  1MUZ A;  3QBY A;  5I2M A;  4J9I A;  3JCM c;  2J6K A;  3EHR A;  3VU3 C;  2OTL Q;  1LCK A;  3CD6 Q;  1QVG A;  3EG3 A;  3EG9 B;  3OYA A;  4RCC A;  2QG9 B;  3CCL Q;  1NYF A;  4PNO A;  2I0N A;  3P8D A;  3KXT A;  2MMP A;  4GLM A;  4C0D B;  4C5H A;  4HCK A;  3V8L A;  4C8Q E;  2F5T X;  1Y0M A;  4C0G A;  2ABL A;  2EYY A;  3WVD B;  4F17 A;  3CXC P;  3BDU A;  1AOJ A;  4F7U B;  3AT1 B;  2V8J A;  3SDZ A;  1ZX6 A;  4KUD K;  3G4S T;  4M7A C;  4JJD A;  1M4Z A;  1ABO A;  3IQL A;  2CP0 A;  1CKB A;  3EH2 A;  2EYQ A;  1RLQ C;  3OW2 A;  4IUR A;  1I07 A;  2JN0 A;  2LC4 A;  1E6G A;  1UJ0 A;  3CMA A;  3A8O B;  2B86 A;  2JJ9 A;  3HKS A;  1YJ9 A;  4IUQ A;  4M77 G;  3CC2 T;  1D1C A;  1LPL A;  4OB2 B;  1D0Y A;  1M2O A;  4WTO B;  2BE9 B;  2QDY B;  2O88 A;  2RHU A;  1YJW A;  1ZSZ A;  1RAE B;  2KMT A;  1RLP C;  2DLP A;  3MJX A;  4PJJ A;  1X6O A;  2XIC A;  1JO8 A;  2A36 A;  3KFV A;  4M78 A;  3M56 A;  1X2K A;  4HCB A;  3EGX A;  2LJ0 A;  3QZ5 B;  3HL8 A;  2KT8 A;  2RQW A;  3PGG A;  1AZG B;  3CBM A;  5LJ3 e;  2BTT A;  2FG0 A;  4XU2 A;  4DBQ A;  3HSB A;  2KI7 A;  1RI0 A;  2GGR A;  3L1A A;  2LDM A;  4RKU E;  5IAY A;  2P4R A;  2DL8 A;  5LJ3 g;  3M0P A;  1E7O A;  4Z02 A;  2Z0W A;  1Z9Z A;  3H0I A;  2KR3 A;  4M75 F;  1VQ7 A;  3EFS A;  1SF9 A;  4DQ2 A;  3JCM f;  2G6F X;  3M53 A;  2RI3 A;  2K5F A;  3MHX A;  1NJI U;  4ZTF A;  1NZ9 A;  1SRL A;  1N9R A;  2CT3 A;  5KCH A;  2CP7 A;  5GAN d;  1YN8 A;  3X24 B;  2DL4 A;  3C94 A;  2RPN A;  1HYO A;  4KGX B;  4B9W A;  1R77 A;  4PJO A;  5LJ5 d;  4TVR A;  1Y71 A;  4XU1 A;  2RB6 A;  2J06 A;  3M54 A;  5C6S A;  2QQ9 A;  1WQ7 A;  4XK8 E;  4Z8A A;  1NG2 A;  4HXJ A;  5IHN A;  3OQ5 A;  5KYY A;  4EMK B;  1SHG A;  3JCM J;  3TSZ A;  4A4E A;  1W4S A;  2VYT A;  3JCM b;  2E64 A;  1LJO A;  1U1T A;  4RTW A;  3PTA A;  9ATC B;  3CCE A;  3CPW A;  2CT4 A;  2YXY A;  4B9X A;  4NS5 A;  3BY7 A;  2K9G A;  1IRE B;  5CO7 A;  1QW1 A;  1UHF A;  4FCY A;  1GCP A;  2DEU A;  2LT1 A;  2EJG A;  4JJB A;  2AK5 A;  1UFF A;  3BW1 A;  4C0D C;  3CCV A;  3A1P A;  3EG2 A;  4CRI A;  2ZZD A;  1UGP B;  1M8M A;  3VKI A;  5L23 A;  3QSU A;  1QVF P;  5IXB A;  5KYU A;  2K3X A;  1OI1 A;  1MMD A;  1YBY A;  3JCM h;  4A53 A;  1U5S A;  1EZZ B;  1FMW A;  4C5G A;  3JB9 I;  2PTK A;  1NYG A;  2EQU A;  4O5V A;  4JLI A;  3OBY A;  4FYX B;  4CC3 A;  4E47 A;  5GAN 6;  4C92 G;  4DEY A;  1XNI A;  1AZE A;  1B34 B;  1CSK A;  2DEQ A;  2FYK A;  2PNI A;  1RAG B;  1PC0 A;  1VQM A;  2CP2 A;  4FYV B;  1UB4 A;  2XK0 A;  3FJP A;  1HSQ A;  3HRT A;  1LNX A;  4MML A;  1GBQ A;  3M57 A;  3EFO B;  3QXE B;  1VQP Q;  4XTU A;  4LDU A;  2RJE A;  3UT1 A;  1NEG A;  1Q81 C;  4A4G A;  3URG A;  3I56 Q;  1VQO Q;  3F70 A;  4NL3 A;  2NUZ A;  1T3L A;  2V1R A;  4X9D A;  1TUC A;  1I4K 1;  1M90 C;  4N4H A;  3FJ5 A;  4ZGE B;  1YHQ A;  3GIB A;  1WXU A;  3HHT B;  2F1L A;  5HKC A;  1YI2 T;  1Q95 G;  2DYB A;  3SWN B;  1QKX A;  1M30 A;  2EGC A;  4XTX A;  2VVK A;  1X27 A;  1AWJ A;  4M78 D;  1RAA B;  2LQW A;  4QT7 A;  2EJ9 A;  1A0N B;  3VUZ A;  3L2W A;  1JEG A;  4N0A C;  4HT8 A;  2KXD A;  4XAX B;  2HQX A;  4E7J A;  4BD3 A;  3VS2 A;  2HD0 A;  4ZGJ B;  1IHV A;  2J6F A;  1K9A A;  3OW2 P;  1Q81 R;  3JCM V;  1OPK A;  3FRN A;  4FT4 A;  1TS9 A;  1OUL A;  1U3O A;  3VS5 A;  3QZ9 B;  2DXB A;  2H3J A;  1M90 R;  5CQY A;  4FYW B;  5J26 A;  2JM8 A;  1YIJ A;  2LX7 A;  5EG2 A;  4KT0 E;  4M78 B;  2V26 A;  3HPW A;  3JCM X;  1JU5 C;  1AWW A;  4KBM B;  1IRX A;  3RKW A;  1ACM B;  3A8L B;  3OYJ A;  3CCU A;  4M75 A;  3DB4 A;  1YJN T;  3JCM W;  5FRO A;  2YRV A;  4LNP A;  1N9S A;  1ZSG A;  2EKO A;  3VS4 A;  2LQ8 A;  1OX9 A;  1BI2 A;  2QDL A;  4QQG A;  4WF2 A;  5GAM d;  4BI4 A;  1YJ9 T;  3CCJ T;  4OP0 A;  2M1H A;  2LVM A;  3PNW C;  1KQ1 A;  1M9S A;  2O31 A;  1VQ4 A;  1ZUU A;  2QK0 A;  3CME A;  2ZGW A;  2X4Y A;  1WDX A;  4J6X A;  3NTH A;  4CC4 B;  2XMF A;  2X4W A;  3CC7 A;  1WHJ A;  2PU9 B;  1Q7Y R;  3L2V A;  2LNH B;  4M77 A;  2EWN A;  2L8D A;  4LDV A;  3PIO A;  1H3H A;  4C8Q F;  3QWX X;  3FEO A;  2LP5 A;  3I35 A;  3OYK A;  3HFN A;  1NE8 A;  1WPY A;  2FZG B;  4JS4 A;  5CKB A;  3VJP A;  4D8K A;  1YWP A;  1OOT A;  2DM1 A;  4D8D A;  1VQ6 T;  5A0L A;  3VS1 A;  5EC7 A;  3UA7 A;  1VQ7 T;  1NPR A;  2MYS A;  1S72 Q;  2M02 A;  2I2L A;  5LJ3 j;  3TU4 K;  1K8A U;  4OML A;  2HKN A;  2YUN A;  3A8H B;  1VQL A;  1Y96 B;  2QI2 A;  4PJO G;  1JBM A;  1S1N A;  3EAE A;  1SSH A;  2J05 A;  1J3T A;  1UJY A;  4XTV A;  1X6G A;  1I5O B;  4F7U E;  2RO0 A;  5KYU B;  1MHN A;  2H8H A;  3CCS Q;  4R56 A;  3SWN C;  4C0F A;  2COW A;  1QLY A;  5LJ3 f;  1R8O B;  2LT4 A;  3A8G B;  2C0T A;  3QDF A;  2X3W D;  3HFO A;  5CK9 A;  3ZL7 C;  2RQT A;  5CKF A;  2L3S A;  3QUI A;  3L42 A;  4BE2 A;  5GAN e;  3OYE A;  3EGU A;  4R55 A;  2YT6 A;  2DO3 A;  3CCE T;  2CZ6 B;  1OZ3 A;  4ATO A;  2QQS A;  1KQS A;  5FRM A;  5KYX A;  3OYN A;  5LJ5 e;  3OYL A;  4Y28 E;  1W1F A;  1GFC A;  2QQR A;  3JCM Q;  2PUK B;  3T9N A;  3H0F A;  3CCV T;  4IIM A;  4KUI A;  4RUG A;  2W0Z A;  5LJ5 g;  3I55 T;  3L2Q A;  3G71 A;  2P0P A;  4J83 A;  2FRY A;  2RM4 A;  4RCB A;  1HD3 A;  3MEV A;  4M78 C;  4BB7 A;  2LJ3 A;  3VS3 A;  2OTJ Q;  4DBH A;  5A0G A;  1BYM A;  1Q86 U;  2DTO A;  2DE0 X;  2X4X A;  3CCR A;  2GTJ A;  2LZ6 B;  2JMC A;  3BDL A;  3EG1 A;  2DPP B;  2SRC A;  1KD1 C;  1UDL A;  1MND A;  3C95 A;  1JJ2 P;  2DL5 A;  2BIV A;  2MWO A;  4OVA A;  4RG8 A;  3OMC A;  2QA4 A;  3JRZ A;  2X4J A;  1M1G A;  3RKX A;  2EQJ A;  3X26 B;  1MV3 A;  3OYM A;  4PLL A;  2E3H A;  5LJ3 h;  2RH2 A;  5DLQ E;  4ESR A;  1FWZ A;  4IKF A;  3EFR A;  3REB B;  1YIT A;  4MDX A;  3CBO A;  1SEM A;  2DBM A;  1X75 C;  4C92 A;  5J3B A;  2YLC A;  5FU6 C;  5GAN 3;  2A08 A;  1NJI C;  1WHL A;  2XD0 A;  2FPD A;  4O6J A;  1UTI A;  3A5Z B;  4JRK A;  2QEX Q;  2OI3 A;  1JQQ A;  2HEQ A;  3MEA A;  2DMO A;  4J5Y A;  1BIA A;  3TQ7 P;  4M7D A;  1YHQ T;  1KD1 R;  1FXX A;  3C12 A;  4XU0 A;  4HVU A;  2K57 A;  1K1Z A;  2DJZ A;  4LD6 A;  5IH2 A;  3EG0 A;  4RTZ A;  3CC4 Q;  2E41 A;  1YI2 Q;  2AKK A;  2ED1 A;  3GLX A;  4IUV A;  2HL5 C;  2QTX A;  3EGD A;  4BI3 A;  4BE1 A;  2CP5 A;  4BAC A;  1W6X A;  5DM7 R;  1TXQ A;  2VWF A;  1VQ8 A;  3FIF A;  1OZ2 A;  4J9D A;  3S3N A;  4FT2 A;  4P5N A;  2RN8 A;  1WGS A;  2ZPI B;  2HNI A;  1AD5 A;  1O9S A;  2K79 A;  1GL5 A;  1ZA2 B;  1RI9 A;  2LNV A;  2HMA A;  1C1A A;  3OA6 A;  1U8R A;  4N4I A;  1YIJ T;  1FYN A;  2A7Y A;  2KQW A;  2GF7 A;  4M77 B;  4M75 G;  3CPF A;  2AKL A;  3DB3 A;  1Z9Q A;  5IHI A;  5L8R E;  1VQ9 T;  4PFO A;  2O4X A;  3CCM Q;  1M1K R;  2E1H A;  2RMO A;  1C0M A;  3M0R A;  2EPD A;  2EVR A;  2LQN A;  2DVJ A;  3NHN A;  4E7K A;  5KYW B;  4HT9 A;  1M3C A;  4FYY B;  4LUE A;  4M7A F;  5GAN 8;  2CP6 A;  5KE3 A;  4MMK A;  2OTL A;  3CD6 A;  4AFQ C;  4KGZ B;  1EIF A;  1VQ5 Q;  1HJD A;  5IN1 A;  1OV3 A;  3CCL A;  1YJN Q;  2R5A A;  3GF5 A;  2VAS A;  3OS1 A;  5CVI A;  4J9H A;  3CCM A;  1P92 A;  3I9Q A;  2YLB A;  3CCJ Q;  2DKG A;  3CME T;  1VQN Q;  1ABQ A;  3ME9 A;  1WX6 A;  1G2B A;  1VYU A;  3CC7 T;  3DKM A;  1VQ5 A;  4Y92 A;  5GMK l;  3HRU A;  1NLO C;  3FDR A;  1MMA A;  1IXD A;  1X6B A;  2DRK A;  5M9O A;  4LE9 A;  4HA8 A;  2LTO A;  4E6R A;  1I81 A;  4J9G A;  4CC2 A;  1Y07 A;  4LDW A;  1VQN A;  2O01 E;  5GMK j;  1D3B A;  1GXI E;  2HQE A;  3G6E Q;  1HK9 A;  2YSQ A;  2K2M A;  3FB9 A;  3H8Z A;  1F1B B;  1OYX A;  2KXC A;  4L5G A;  2GNC A;  1UGV A;  4A4F A;  4A4K A;  2JT4 A;  1IO6 A;  1K9M U;  3VRZ A;  2KRN A;  2DER A;  3NTK A;  2JVV A;  3RDV A;  5CKD A;  4CC7 A;  1V29 B;  1VQL T;  2Y90 A;  1KQS P;  3RNJ A;  2RA2 A;  1GCQ A;  2DNU A;  2VGM A;  8ATC B;  4M78 E;  3MEW A;  2XI9 A;  4OGC A;  2XKO C;  2QAS A;  2YHT A;  3MPU B;  1SSF A;  2E65 A;  2AT1 B;  1ZUK A;  2KVQ G;  4C92 D;  1TTH B;  3ZBD A;  1I8F A;  5D6X A;  2RD1 A;  4UC4 A;  1ZUY A;  2IPO B;  2LCS A;  3V7R A;  2BUD A;  1WIE A;  5C0M A;  3MET A;  3VYG A;  3JCM P;  3QYH B;  4RTU A;  2GFU A;  1VQK Q;  1N5Z A;  4QVZ A;  2RJD A;  2JZ2 A;  2L3R A;  2ZPE B;  3PMI A;  4GLK A;  2FZC B;  3JB9 F;  2RHX A;  3TSW A;  4PJM A;  5GAO p;  1MMG A;  3H9N A;  3INZ A;  2KDS A;  5FRN A;  2KT1 A;  2GBQ A;  4C92 B;  4K11 A;  3G71 T;  3L2R A;  4FSS A;  4WCI A;  4M4Z A;  2P4T A;  3PIP A;  4DBF A;  3I55 Q;  2DYI A;  3PFS A;  2ZPH B;  4F7U F;  2J6O A;  4PJL A;  4XTY A;  1K0S A;  3CCR T;  3OYF A;  4EDU A;  1TG0 A;  5GMK h;  1FMK A;  1QMC A;  1PCX A;  5AT1 B;  1X01 A;  2ESW A;  4OB0 B;  2CSI A;  4YTL A;  3OSS C;  5HCK A;  3P8H A;  3OY9 A;  1Q82 U;  3WVE B;  2ZPF B;  3C0C A;  1MV0 B;  4E7Z A;  1E6H A;  5CR2 A;  1YIT T;  7AT1 B;  1OEB A;  3KBG A;  4A54 A;  4JPB W;  5AYF A;  3M0U A;  2GQV A;  1PD0 A;  3RIR A;  1K8A C;  4JJC A;  3OYH A;  2DD5 A;  3ASK A;  1JB0 E;  2DK3 A;  2D9T A;  4M7D G;  1G83 A;  3QO3 A;  3CCQ T;  2PZ1 A;  5GAO r;  3J81 E;  3VS0 A;  3V8J A;  2K5I A;  2XG8 D;  1M8V A;  3ER0 A;  3GP8 A;  2A0F B;  3X25 B;  3FLG A;  2E6N A;  1VA7 A;  1W2B S;  2K6D A;  3DLM A;  3OMG A;  2JM9 A;  1JJ2 A;  2MI6 A;  2RQV A;  3P8B B;  2DZ9 A;  4FU6 A;  1VQP A;  4M7A E;  2P0Q A;  3H41 A;  3OS0 A;  2E3I A;  1NPP A;  1VQ8 T;  3I56 A;  1AHJ B;  2W10 A;  1RAH B;  3G7Z A;  1VQO A;  4JRQ A;  3SD4 A;  3QJY A;  1K73 U;  2MF2 A;  2F2W A;  1PD1 A;  4PFP A;  4C8Q G;  3OYG A;  4AG1 C;  4X9C A;  4Z89 A;  3SB2 A;  2MK5 A;  4OMO A;  3GPL A;  1M2V A;  4XTZ A;  2JTE A;  4PL6 A;  2YUP A;  2CSQ A;  1LVK A;  5LJ5 h;  2F69 A;  2FZK B;  1N8R U;  1M27 C;  2VV5 A;  5I21 A;  4MDW A;  2X3X D;  1I1J A;  2EQM A;  1ZSZ B;  2G3R A;  4E7H A;  2FPE A;  3E9F A;  3UF4 A;  2DAQ A;  5GAO q;  1I0C A;  3LWH A;  1Q86 C;  3L2Z A;  1D1B A;  2IVW A;  1WFW A;  1VQ9 Q;  2CRE A;  3FC3 A;  3EGX B;  4EMK C;  2OTL T;  2KGT A;  1KSW A;  3QG1 A;  4ZNX A;  2A3L A;  2EYW A;  2KRS A;  3CCL T;  4AFS C;  2QAZ A;  1QCO A;  3CXC S;  3THK A;  3S3M A;  4PJO D;  5GAO m;  3G4S Q;  5FW9 A;  1AWX A;  1WI7 A;  3GNF B;  4E7S A;  2KSS A;  3M0S A;  2EAY A;  3CMA T;  1TUD A;  2VGN A;  4ANJ A;  4C92 C;  1KFZ A;  1AEY A;  5IHK A;  1UGS B;  1YFN A;  2MAM A;  2L0A A;  2CUB A;  3NMZ C;  4J6Y A;  3CC2 Q;  1YJW T;  3SEM A;  1QWE A;  1SPK A;  1Q86 R;  2EFI A;  1PRM C;  2EYZ A;  1WLP B;  1H8K A;  5DLO A;  3LX7 A;  4PJO B;  1BBZ A;  5LL6 S;  1C6V X;  2O2O A;  3H6Z A;  2ROT A;  2E6Z A;  4JLG A;  1V1C A;  2D0Q B;  2KAF A;  5KYY B;  1QCN A;  5CAI A;  1WQW A;  2HBP A;  1G3W A;  2HSP A;  2RJF A;  3QJ6 A;  3QWY A;  2AZV A;  4AG2 C;  3CBP A;  4ZGD B;  2DTH A;  4F7U A;  2FVU A;  2O9S A;  2EW3 A;  2VXE A;  2D0N A;  4RTY A;  4X1V A;  2BE7 D;  2R58 A;  3O8V A;  3TVT A;  2EBP A;  2Y4Y A;  3GNG A;  2J7I A;  2D6F A;  1GFD A;  4Q5W A;  1HXD A;  1FMV A;  3G1J A;  3OYI A;  4RMO A;  4B6M A;  4XTW A;  3E1S A;  3TCJ A;  2XHC A;  2AZS A;  4E7L A;  3TEE A;  4MZT A;  1S72 A;  1CKA A;  1VIE A;  4HVW A;  2KY9 A;  4KRT A;  1ZBJ A;  1Q81 U;  2HKQ B;  2NWM A;  2JTF A;  3MP6 A;  5FWB A;  1X69 A;  1LOJ A;  4QQ6 A;  1YCS B;  3CCS A;  5D6W A;  3OYB A;  1M90 U;  1WNL A;  2E5Q A;  4FM4 B;  4KH0 B;  2AIR B;  2RNA A;  1OU9 A;  1JRI A;  2X35 A;  5GAN g;  2E5K A;  3M0T A;  1ZSZ C;  3BE3 A;  4DOW A;  3QYG B;  4M78 F;  1EFN A;  2AHJ B;  2GFA A;  4IUT A;  1QWF A;  2KRO A;  5DY9 A;  5KYN A;  3RUX A;  3LH5 A;  1WJS A;  1DJ7 B;  2ZPB B;  1M3A A;  2YWW A;  4ELZ C;  1BB9 A;  3UAT A;  4E2F B;  3LGF A;  3OYC A;  1KG1 A;  1QVF S;  5CQX A;  3WXM B;  2DZC A;  1WHM A;  1G8X A;  1JXO A;  1KK7 A;  3DLL A;  5GAN 4;  2XID A;  2MWP A;  2K4Y A;  2QQB A;  4KUL A;  1VQM T;  2OTJ A;  1UUE A;  5HK3 A;  4F04 B;  2X9H A;  1GBR A;  1Q7Y U;  3OB9 A;  3R6O A;  1K9M C;  3RES A;  4M75 D;  2HBW A;  1XQH A;  3OS5 A;  4MZP A;  2E10 A;  3ULR B;  4M7A G;  2NUP A;  2RJC A;  1M2V B;  3LGL A;  2ROL A;  1R0B G;  3O5Z A;  2JTM A;  3VRY A;  1WJQ A;  1RUW A;  2R57 A;  4J9B A;  3OYD A;  3CCQ Q;  1MMN A;  1X43 A;  3JSC A;  2CH4 W;  4PJO C;  4NOY A;  4QW2 A;  4KH1 B;  2VC8 A;  1GRI A;  4OGE A;  1BK2 A;  2F5K A;  1JXM A;  1AWO A;  1VQP T;  3RR6 A;  1KC8 U;  2DL3 A;  1QVG S;  2KK4 A;  1UHC A;  4M77 D;  1VQO T;  3M4G A;  4M75 B;  3E2U A;  4IUP A;  3QII A;  2QEX A;  4C92 E;  2NYS A;  1FX7 A;  1TWB A;  2EJF A;  1KQ2 A;  2VXF A;  1NJI R;  3QHS A;  3CC4 A;  2QXF A;  2HZY A;  1YI2 A;  3N5B B;  2GCX A;  2JNG A;  4GY5 A;  5GAO n;  4Y91 A;  4C8Q A;  4ZTJ A;  1WXB A;  1B34 A;  1SKU B;  2C0O A;  2QGG A;  3OW2 S;  1K76 A;  2RI5 A;  3X28 B;  3QKJ A;  3H0H A;  3VS6 A;  1BI3 A;  2OAW A;  1WA7 A;  2WSF E;  3OS2 A;  1OU8 A;  3UPU A;  3EFO A;  4RTT A;  2K7A A;  2O9V A;  1IB8 A;  4VUB A;  3CCU T;  2DD4 A;  4AMC A;  4OMF B;  3MCA B;  4AFU C;  1M3B A;  3M59 A;  2DL7 A;  5GAN 2;  2FB7 A;  3JB9 J;  1Q82 C;  2DIQ A;  2CYZ B;  2NLU A;  3CMA Q;  3J80 E;  3MEU A;  3SWN A;  1YJ9 Q;  3NPF A;  1VQ4 T;  3HRS A;  1PRL C;  3JV3 A;  2YUQ A;  2LCC A;  4FIB A;  2F2V A;  1IHW A;  2FPF A;  5IXF A;  2OX7 A;  2DA9 A;  2YUO A;  3JCM d;  2E12 A;  1YJN A;  1YJW Q;  1SG5 A;  1TU0 B;  1H92 A;  1PNJ A;  5GMK m;  2L3Q A;  2FEI A;  3JB9 G;  4JDS A;  1NBE B;  1KIK A;  2QTV A;  3OYY A;  4ELY C;  2FL7 A;  3C4S A;  5GAM e;  1WYX A;  3CCJ A;  1UE9 A;  4J6W A;  4V2S A;  1PSE A;  2C0I A;  4X34 A;  1K0X A;  1R0C B;  2PQW A;  4BE0 A;  2L2P A;  3RKY A;  5GAM g;  5HY6 A;  1Q82 R;  4AFZ C;  4F7U G;  1V76 A;  1RAI B;  4BUG A;  4QVC A;  2XU8 A;  1BI1 A;  1BIB A;  4CI0 C;  1K73 C;  1VQ6 Q;  4EIK A;  1VQ7 Q;  3V7C A;  5KYX B;  1KD1 U;  1IGU A;  3S6W A;  1EX4 A;  2PUO B;  5FLX E;  2K3B A;  4C0Z A;  2CH4 A;  1SHF A;  2EIF A;  2MOX A;  3G6E A;  1RL2 A;  2RHI A;  1MNE A;  4BDY A;  1N8R C;  4GBQ A;  1S72 T;  1PKT A;  1VQ6 A;  3CPW S;  2DTI A;  3E19 A;  2DRM A;  1M5Q 1;  2FO0 A;  1TH7 A;  3I5R A;  2C06 A;  3NTI A;  5CKH A;  5GJV B;  1VOM A;  4M75 C;  1WJR A;  1I5L A;  2YRD A;  2YRC A;  2QGF B;  4M7D D;  1WZO A;  2HL3 A;  1K73 R;  1D1A A;  5FWC A;  4FL6 A;  3CCS T;  1G3S A;  3PVL A;  2HSE B;  2EQK A;  3D7S B;  1TOV A;  2DET A;  3M58 A;  4OMN A;  1OPL A;  4R0K A;  3M0Q A;  3UA6 A;  1PWT A;  3CCE Q;  1XOV A;  2CDT A;  1M1K U;  3U23 A;  2NUP B;  4ZN1 A;  2DIL A;  3PE0 A;  2RK2 A;  2CUD A;  1N8R R;  1OQK A;  4M77 F;  5GAN j;  2RI2 A;  4OB3 B;  4PJO E;  2EKH A;  2ENM A;  4PKC C;  1VQK A;  3CCV Q;  2A37 A;  4J9C A;  2K5L A;  4M77 C;  3RER A;  3M9Q A;  6AT1 B;  4EPC A;  5LJ5 j;  3VV0 A;  3QDR B;  1PSF A;  4Z88 A;  4C8Q D;  4M7D B;  1XJW B;  3VUB A;  4IUU A;  1N27 A;  1KJW A;  1BCM A;  1Y96 A;  1BCO A;  5GAN f;  1RAB B;  2NUT A;  2K2V A;  2QA4 T;  3VYH B;  2XDP A;  1QCF A;  3EGD B;  4ME7 A;  2OTJ T;  3I55 A;  1N6A A;  3MP8 A;  3Q1J A;  5LJ5 f;  5KE2 A;  1RAC B;  1UGQ B;  1VYV A;  3M4Y A;  1YNZ A;  1VQM Q;  4J9E A;  1JJ2 S;  1WHG A;  5I22 A;  5KH6 A;  1YCY A;  3LYI A;  2L89 A;  2RHY A;  1PM3 A;  2M9U A;  3REA B;  2PVO B;  4JZ3 A;  1D09 B;  4N4G A;  1H3Z A;  2OJ2 A;  2K3Y A;  1VUB A;  3EH1 A;  4C8Q B;  2MCN A;  3UDC A;  4RTX A;  2WSC E;  2FHD A;  4BY6 B;  4M7A A;  3V8K A;  1B07 A;  2A28 A;  4J7F A;  5FU7 B;  1WHK A;  1ZA1 B;  1WXT A;  1D0X A;  4C5I A;  5J39 A;  2O4X B;  1UG1 A;  1YHQ Q;  2F2X A;  2HCK A;  1QVP A;  3GBQ A;  2CZ1 B;  3JAM E;  4ORZ A;  3VS7 A;  3CEY A;  2SEM A;  1UEB A;  2V1Q A;  2QEX T;  1U06 A;  4QQD A;  3LLR A;  2ATC B;  4FW1 A;  2XDD A;  1RAD B;  2LQK A;  1QVG P;  1QQJ A;  2OAU A;  2RF0 A;  1K8A R;  2QYZ A;  2VB6 A;  1SRM A;  4NL2 A;  2KEA A;  3CC4 T;  4HCC A;  5GAN h;  4JRP A;  3LH0 A;  1KHC A;  2KE9 A;  2IIM A;  3SHW A;  4LDX A;  5D7U A;  2DXT A;  2H3E B;  5GJW B;  2PVG B;  2ZAE A;  1T0H A;  3M5A A;  1W70 A;  3J7A F;  2DX1 A;  3GOX A;  4II1 A;  4JJN K;  4QKU A;  5A0D A;  4PLI A;  1PHT A;  3NGP A;  1YIJ Q;  2RK1 A;  2COY A;  4DBR A;  3E9G A;  1W2B A;  2DVE A;  3PT9 A;  3CD6 T;  1YWO A;  1D3B B;  1O75 A;  2ECZ A;  5IT9 E;  1PG5 B;  2D8H A;  1ZBX A;  2WSE E;  4FW2 A;  3CCU Q;  2M0O A;  1NM7 A;  2P0K A;  1AT1 B;  3CCM T;  4C92 F;  3PMT A;  1BI0 A;  2P84 A;  5CCA A;  2M0Y A;  1Q7Y C;  1VQ9 A;  5CKE A;  2JOY A;  1YP5 A;  4OMQ A;  2DJQ A;  1VQ4 Q;  1VQ5 T;  1IZ6 A;  1IGQ A;  4OMP A;  4PJN A;  3CME Q;  5GAO l;  2QQA A;  4M7D F;  4EMG A;  2LCL A;  4JS5 A;  1QP2 A;  2VKN A;  3CC7 Q;  1UGR B;  2FRW A;  3G4S A;  4F14 A;  2WAC A;  4ZN3 A;  4M7D C;  2LX9 A;  2L3P A;  4M75 E;  4OMM A;  1VQN T;  3JB9 H;  3RMQ A;  4IIO A;  4XU3 A; 
#chains in the Genus database with same CATH homology
 3CCL Q;  1YJN Q;  1YJW Q;  1VQP Q;  1Q81 R;  1VQ9 Q;  1K73 R;  1VQK Q;  3CCV Q;  3CCR Q;  1KD1 R;  1VQ4 Q;  3I55 Q;  3CME Q;  3CPW P;  1YIT Q;  3CCU Q;  1QVF P;  1M1K R;  3I56 Q;  3CCM Q;  1VQL Q;  3CC2 Q;  1VQ6 Q;  1VQO Q;  1NJI R;  3CXC P;  3CMA Q;  1M90 R;  3CC7 Q;  1S72 Q;  3CCJ Q;  3CC4 Q;  1VQM Q;  3G4S Q;  1YJ9 Q;  1QVG P;  1Q86 R;  1VQ7 Q;  1VQN Q;  1YI2 Q;  3CCE Q;  1JJ2 P;  1Q7Y R;  3G71 Q;  1K8A R;  1KQS P;  2QA4 Q;  1W2B P;  3CCQ Q;  1YIJ Q;  2OTL Q;  3CD6 Q;  1N8R R;  1KC8 R;  3CCS Q;  1YHQ Q;  2QEX Q;  1K9M R;  2OTJ Q;  3G6E Q;  1Q82 R;  1VQ5 Q;  3OW2 P;  1VQ8 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...