1W2BP

Trigger factor ribosome binding domain in complex with 50s
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title Trigger Factor in Complex with the Ribosome Forms a Molecular Cradle for Nascent Proteins
pubmed doi rcsb
source organism Escherichia coli
total genus 14
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1w2bP00
3I55Q 1Q86R 1VQOQ 1S72Q 3CCRQ 3OW2P 3G4SQ 1YI2Q 3CMEQ 1QVGP 3CPWP 3CCUQ 3CC4Q 1YJNQ 1YITQ 3I56Q 2QEXQ 1YJWQ 1VQ7Q 3CC2Q 1QVFP 3CCQQ 3CCSQ 1M90R 1K9MR 3CC7Q 3G71Q 1Q82R 3CMAQ 1N8RR 1KD1R 1JJ2P 1VQ8Q 2OTLQ 1VQLQ 1K8AR 1YIJQ 3CD6Q 1KC8R 1VQNQ 1VQ6Q 1KQSP 1Q81R 1M1KR 1Q7YR 1VQKQ 3CCEQ 3CXCP 1VQMQ 1VQ4Q 1NJIR 3G6EQ 1VQPQ 3CCJQ 3CCVQ 2OTJQ 1YHQQ 1K73R 1VQ9Q 1W2BP 2QA4Q 3CCLQ 1VQ5Q 1YJ9Q 3CCMQ
chains in the Genus database with same CATH superfamily
4BACA 1Y7XA 1X6GA 4JJCA 1VQMA 1OOTA 3RKXA 2A08A 1D0XA 4Z88A 1AZEA 5KYUB 5GAMh 2KXDA 3OYGA 1OPLA 4HKEA 2P0KA 2EYXA 1EZZB 2DNUA 4BD3A 3G7ZA 5DLOA 5GAN4 4WCIA 1BIAA 1NZ9A 2DAQA 4M77C 2DX1A 1WYXA 1NJIU 1J3TA 2JW4A 2HCKA 3OS0A 3TU4K 4PJMA 4N4HA 3A8MB 1G3SA 2RQRA 3H41A 3NHNA 1KC8C 4XTUA 1I1JA 1X01A 3QBYA 4OB2B 3OYMA 1AD5A 1P92A 5D6YA 3CCQA 1ZBJA 5KCOA 3RDVA 4J9FA 1YI2Q 3M54A 5GAOr 2DD4A 5C0MA 3LH5A 2RK2A 3CC4T 4C5HA 2LJ0A 2HQEA 4PFPA 2ZCFB 1VQ8T 2JS2A 3FJ5A 3CCSA 1M3AA 2HD0A 2RQUA 2QA4Q 3CCET 3CCMQ 1MV3A 1S72Q 3JB9J 1PM3A 2QDLA 3SWNB 4JPBW 2AIRB 3TEEA 1AOJA 3HFNA 1KK7A 3G4ST 1M90C 2BZYA 3NFCA 1N8RC 4BDYA 1SRMA 4RKUE 5CAIA 1M27C 2RI2A 2DTHA 3VKIA 3NMZC 3E19A 1U1TA 5GMKi 1K9MU 3M5AA 3SWNC 1VYUA 4J9DA 4BB7A 2LCLA 1Q86C 2J05A 3CBOA 2AHJB 1NE8A 2GTJA 4KRTA 2IG0A 1IREB 1HYOA 1M1FA 2DA9A 2FEIA 3BFMA 2NUTB 2DXBA 4JS5A 1VQPA 1QVFP 3PVQA 4M77F 4DBHA 2K5IA 2IVWA 3JCMg 1Y0MA 4XU2A 4F7UA 2RQWA 1TG0A 5LJ5g 4QVCA 3H0FA 3LYIA 4OMOA 1XNIA 2CT4A 2OTLA 2GFUA 3URGA 1UG1A 5FW9A 2E41A 3JV3A 1C6VX 4C92A 3MKDA 2E65A 2W0ZA 3OSSC 2L3QA 2DM1A 4DA4A 5J39A 3OYEA 2O31A 2X51A 4EMKC 1WPYA 5KYYA 4QVDA 1AWJA 4JS4A 2D8JA 2CP0A 1SHGA 1VQ7Q 2QDYB 2DFUA 2FPDA 1BIBA 2LNVA 3OYHA 1JJ2P 3JB9F 2ZPBB 3CPFA 4ZGDB 1ZSGA 4B9XA 1MGQA 2XG8D 2HQHA 3PE0A 1AWOA 8ATCB 4OMQA 2Y4YA 1CSKA 1YJNQ 3I55T 1IGQA 2RNAA 3OMCA 4C0FA 2K6DA 1Y96A 3M56A 4C0GA 2X4YA 2RB6A 1KD1R 1YWOA 1YI2A 1JXMA 5LL6S 3UF4A 4M75E 3RIRA 1Q7YC 2RN8A 2K57A 2LT4A 1KQSP 4KGZB 5HCKA 4N0AC 1GCQC 2GGRA 3C0CA 3LX7A 4Q5WA 5GJVB 4IUUA 1PCXA 2BE9B 2OI3A 4II1A 2BIVA 2DLPA 1E7OA 1X6BA 2HL3A 4AFSC 3EHRA 2EIFA 4OMPA 2QA4A 1HD3A 1WXBA 3CCUT 1S72A 1BU1A 4KH0B 1IZ6A 3BDLA 2EFIA 1NPPA 5L8RE 2L3PA 5GANf 1TSFA 4CC2A 1YWPA 3PIOA 4E7SA 2KY9A 2DYBA 5HK3A 4XTWA 1M5Q1 3HKSA 4FM4B 4KT0E 4BY6C 1EIFA 3REBB 4R0KA 1OULA 2VUBA 4PLLA 3PVLA 2HDAA 4JDSA 3QYHB 5LJ3g 1KD1U 3R6OA 2H3EB 4LD9K 1TS9A 1VQKT 2VASA 1QVGS 4IUPA 3RKYA 3OQ5A 2LQNA 4KH1B 3ASKA 1WXTA 3DLLA 2RHIA 5GAMd 1K8AC 2D9TA 1IHVA 5GAN3 2DETA 3EH2A 5GMKl 1U5SA 1ZBXA 1IRXA 3LWIA 1W4SA 2R57A 2KXCA 4LXCA 1IXDA 4J6WA 2KE9A 5DLQE 4M7DG 3JRZA 4DOVA 2DL5A 2MK5A 4RTZA 1FMVA 4M7DE 1VQ5A 1X43A 2RHXA 4ELZC 3V7SA 1RAEB 3LW5E 2DK3A 3EGUA 4M7DD 1X6OA 4C0DC 4J9IA 1VQ7A 5GANd 4M78G 2ENMA 1YHQQ 2EPDA 2EQJA 1Y07A 2RO0A 1VQMT 3TVTA 4M75C 3EG0A 5FU6C 2QQSA 4ZGEB 3G1JA 2XDBA 3BY7A 2D1XA 4XK8E 2QI2A 2KMTA 4ZNXA 4M78D 3QDRB 4OMNA 4E7LA 2BKDN 1D0YA 4DEXA 4PJOA 2VWFA 4XU0A 2DXCA 3G4SA 5GAOq 4AG2C 3CD6Q 4M7AG 4PK4A 4L5GA 3LGLA 2E5KA 4E47A 1QCFA 1QKWA 1E6GA 4M7AD 2AKLA 3H9NA 2ZGWA 3HHTB 1WHGA 3MP8A 3FC3A 2X9HA 2DEUA 4LDXA 1JB0E 3TSZA 4RCBA 4YTLA 2PUOB 1ZSZA 1XJWB 3CCQT 3AHUA 1BB9A 3ZBDA 2LNHB 5LJ5j 3QJ6A 3PIPA 3L2QA 3OW2A 5HKCA 1Z9ZA 3CBPA 5IAYA 1M2OA 1LJOA 3JSCA 3GOXA 3O8VA 5J26A 4GLMA 1BK2A 4FCYA 2KRNA 4UC4A 1FYNA 1WHJA 3HRTA 3CCST 2X3WD 2EAYA 1K9AA 2C06A 2OTJQ 1QVPA 3RNJA 3OYFA 2A0FB 4M7DB 1PSFA 2JN0A 3QHSA 2E5QA 5KCHA 4EIKA 1XTDA 1JBMA 3VS7A 3X26B 4M75F 4J9EA 4IIMA 4FU6A 3OA6A 4M78B 2CH4W 4PL6A 1HSQA 3HP9A 1K0SA 3SEMA 2DL4A 1QQJA 5KYXA 1VQPT 5A0GA 2HMAA 3GIBA 2EJ9A 2E70A 1JJ2A 4RTTA 3FRNA 2OAWA 2MWOA 2QQAA 3M4YA 1S1NA 4AFUC 3VRZA 3M0SA 4Y28E 4M7AB 2OTLT 3CCJQ 2NUPA 4J8OA 4HVWA 1WX6A 4KUDK 2GQIA 3KFVA 2DD5A 2FPEA 1NYGA 2IPOB 4JZ3A 2EGEA 4JLGA 4M77G 3L1AA 1M2VB 2CDTA 2OJ2A 1YHQA 3P8DA 2ROLA 5CQXA 3CC2Q 1ZHIA 2JTEA 3JCMe 2DE0X 4JUVA 1KQSA 2EWNA 5LJ5e 1G83A 3M0PA 3P8HA 4M77D 4XAXB 4P5NA 2K5LA 2QK0A 3EFSA 8AT1B 3CD6A 4Z8AA 1G3YA 3VYGA 1PD0A 3QXEB 4HCBA 2EW3A 2QEXQ 2MCNA 3L42A 3MPUB 4HVUA 1K9MC 3V7RA 1YN8A 2HQXA 2EJGA 1MMNA 2G3RA 3A8LB 3A5ZB 2B8AA 3V8LA 3V8KA 1K0XA 1Q81R 4RMOA 2JTFA 2LMJA 7AT1B 2KT8A 1W2BP 5LJ3j 3G71A 3UT1A 1T0JA 3GLXA 3QZ9B 4OMLA 4QT7A 3CCRQ 5EG2A 1PD1A 2XDPA 2P4RA 2QQBA 3QKJA 2OX7A 4JJDA 2ABLA 3ZFJA 2XK0A 3OYJA 1YI2T 3JB9G 3S3OA 1FMKA 2C0TA 1M4ZA 1RAHB 1M8MA 3C95A 5GAOm 3C4SA 5CK9A 2KAFA 3M0TA 3JB9D 2AZVA 2YXYA 1XQHA 4BI3A 5FLXE 1CKAA 2J06A 2QA4T 1JO8A 2ED0A 1HJDA 2C0OA 1S72T 2OTJA 1UFFA 2YWWA 1R8OB 1WJQA 1VQ6Q 4KUIA 2ZPGB 5D6XA 2RHZA 1IB8A 1UJ0A 4LN2A 2YSQA 5GMKj 2RF0A 1RI0A 4MDXA 4M77B 1YITQ 2YLBA 3MEVA 3QDFA 2RD1A 4X34A 3CCLA 3EG3A 1FMWA 4RTUA 5GAN7 1VIEA 2FRYA 4OB3B 2ATCB 2HSEB 3JCMb 3S3MA 2M51A 1IHWA 4DOWA 3CCJA 3UPUA 3I56Q 2EKHA 4EPCA 1OV3A 4K11A 4Y91A 3HTRA 1D1CA 2BZXA 1ARKA 3VS5A 2EQUA 1GCPA 4C8QE 1W70A 5LJ3e 3CXCP 2QAZA 4QQGA 5GANh 2LT1A 3CC2A 4CC3A 4PJOE 1KJWA 2K4YA 3KBGA 1U06A 1UHFA 1I07A 4F7UF 1T3SA 1H641 3SFMA 2KK4A 1VQ5T 4OMMA 1NLPC 2PVOB 3MJXA 1UGPB 2DJQA 1BI1A 2KEAA 4TVRA 4MZMA 4C5EA 1B7TA 3PGGA 4XTVA 3JCMJ 4QKUA 1VQ7T 1VQNQ 2RMOA 1YCSB 3M53A 2CP2A 4LNPA 2KRSA 1M3CA 1YJ9Q 2EGAA 1YP5A 3OW2S 4J7IA 2E6NA 2KRMA 1OZ3A 1NG2A 1OX8A 2RQVA 3MEWA 3WVEB 2P0QA 2NWMA 1KD1C 4M7AA 3CCRA 1TUDA 3BW1A 4E2FB 2B86A 1IGUA 4FIBA 2XICA 3QUIA 5FWBA 1WNLA 4A4GA 1ZA2B 3I35A 2VYTA 5GMKe 2JMAA 2HZYA 1M2VA 2EBPA 5I21A 1GBRA 1ZUUA 2F5KA 2RHUA 2CT3A 1BI3A 5CKHA 2DJZA 3EHQA 2O4XB 2HKNA 1PRLC 4E7ZA 1G8XA 1X75C 2CZ0B 1GBQA 4XQ3A 2VXEA 2CKKA 5HK0A 4PKCC 1YIJQ 2VV5A 4O6JA 1R0BG 3VS6A 4PNOA 3VRYA 2HAXA 1U1SA 3X25B 4IIOA 2JTMA 3RBBB 1WHHA 1VQ6A 2DYIA 4AFZC 4CC7A 2Y90A 2DMOA 4EMKB 4ORZA 1OX9A 4LDYA 2FG0A 1OI1A 3CBMA 4QQ6A 1QCOA 3EG2A 1I4K1 3JCMf 1WGSA 5IXFA 1YITA 5FWCA 1UEBA 5LJ5f 1WXUA 3J7AF 3META 2MI6A 1X27A 3A8OB 2CP3A 3CPWA 4DBFA 4C8QC 3MP1A 3NTHA 3DLMA 1UGVA 2GFAA 4PJOC 2SEMA 4IURA 4IUQA 3OY9A 3VS1A 1PG5B 1I5LA 3TQ7P 5AT1B 2QGGA 2HBWA 3LWHA 4J7FA 2CP5A 2DERA 2LDMA 2GTOA 4OP0A 3EFOB 4XTZA 5IH2A 1GFDA 5GJWB 1ABOA 1ZUKA 1N27A 3ULRB 2K3XA 4QVZA 1NBEB 3E9GA 4E7JA 1G3WA 2L3RA 1OU8A 4M75G 3WVDB 2PU9B 2MWPA 5CKDA 1U8RA 3UA6A 4RTWA 1W2BA 1RAFB 1VOMA 3ZEHA 4M75D 4OMFB 3FIFA 4KULA 1PKSA 3V7CA 5KYUA 1YHQT 1H8KA 4FT2A 4N4IA 3VUBA 3U23A 3UWNA 1RUWA 2CUBA 2QXFA 1BCOA 2VC8A 4XU1A 1YJ9A 3FEOA 1NEBA 5CCAA 3CCMA 3JCMd 2AZSA 2RA2A 2COZA 2JM9A 3OBYA 1MNDA 4WF2A 4BY6B 5LJ5d 4J9HA 4F16A 2L3SA 2OAUA 2GCXA 3CD6T 4KGXB 2MMPA 2P0PA 4HCKA 3VV0A 4RG2A 4ZGJB 1E6HA 2L2PA 3QPHA 3HSBA 2F1LA 3OYLA 2XU8A 4AMCA 2COYA 3MP6A 4FL6A 2PVDB 4F17A 4C8QF 1M1KR 1BI2A 2YHTA 4EDUA 5CR2A 3G71T 1VQ4Q 3SB2A 4PJOF 2DTIA 1K1ZA 1O9SA 2KBTA 1JEGA 1YIJA 1SF9A 3V8JA 2MF2A 2CP7A 3J81E 2D0NA 3SDZA 2RPNA 2JNGA 2LCCA 1TXQA 2O01E 2QTXA 4JRIA 2BTTA 4DBRA 5LJ3f 3SWNA 1WHKA 2CS7A 1VQ9Q 2GNCA 4RUGA 2QGFB 4C0DB 1X69A 2OTJT 4LUEA 1K4US 3JCMW 4M75B 1WZOA 5FU6B 3FLGA 1LVKA 3CC7Q 3CXCA 1KSWA 4D6WA 2KR3A 3I5RA 4A4EA 3HPWA 2NUTA 1SHFA 1F1BB 1M1KU 4OB0B 2O4XA 3OS1A 1B07A 4LD6A 1QVGP 3CCLT 2RH2A 5FRMA 2HBPA 1I81A 3X28B 1K76A 2DILA 1YJNA 3C12A 1Y71A 3VS3A 4OF1A 2FB7A 4EMKA 5DY9A 1MMAA 3H0HA 1G2BA 3A8HB 3MCAB 3CCJT 3CMEQ 3CCUQ 1RLQC 4AFQC 4R55A 2EJFA 1MMDA 4RTXA 1D3BB 1NEGA 3CC2T 5LJ3d 4A4FA 4BE1A 4L6V5 2I2LA 4RTYA 2V8IA 1WJSA 2CH4A 1QKXA 3OYAA 3S6WA 3L2UA 2LTOA 3DB4A 2CSQA 1QVFA 3SHWA 5CIUA 3VU3C 2HKQB 5GAOn 1TOVA 1BI0A 2M16A 5HY6A 2CYZB 3EFOA 1HXDA 2KGTA 2LJ1A 4F7UG 2JMCA 4N0AA 1WDXA 1GCQA 1MUZA 2DIGA 1VQOQ 1M8VA 4F7UE 3QYGB 4BE0A 1W1FA 1VQ4A 3QO3A 3M4GA 1KIKA 1Z9QA 2JJ9A 3CCRT 4Z02A 3JAME 3ER0A 2X35A 2RJFA 2J6OA 4C92E 1NJIC 2FZGB 2GQVA 1U3OA 2EYWA 2LJ3A 5CKBA 3E1SA 1PC0A 5CVIA 5GMKm 3CPWS 3L2ZA 4B6MA 4BI4A 3OYDA 1VQ9A 2AK5A 3NPFA 2LZ6B 1SPKA 2JVVA 2M9UA 2RJDA 4PFZA 1UB4A 3EH1A 1PHTA 3GNGA 2E12A 2KSSA 3X20B 1JXOA 3CC7A 1VQ6T 1FXXA 1MMGA 1QP2A 3NTKA 5AYFA 2LCSA 1TUGB 1SKUB 1PKTA 4O5VA 2EQKA 1NPRA 4ZTJA 3H6ZA 3MO8A 1YITT 1IO6A 4FSXA 3CMAQ 2JOYA 3EG1A 2LVMA 2DXUA 4OGCA 4OVAA 4OB1B 4KGVB 3CCVQ 2CZ7B 4NS5A 2HNIA 1RAGB 2YUPA 4E6RA 2RM4A 3FDRA 3P8BB 1V1CA 2KNBB 3CCQQ 3EGDB 3CMEA 2EQIA 4LUDA 1X2KA 5KYWB 4PJNA 2KYBA 1C0MA 5KH6A 3TREA 4F7UB 3VS2A 3MEUA 4E7HA 5I11A 3M0RA 3OYCA 2O9SA 4R56A 4RTVA 2RI3A 4M75A 4DBQA 1VA7A 1O75A 2D0QB 2ZZDA 2P4TA 3CCSQ 4CI0C 3JCMh 3GF5A 5LJ5h 1R0CB 3TSWA 1D09B 2DTOA 5IHNA 1N9SA 1JQQA 2HEQA 4PFOA 5C6SA 2XMFA 2QQ9A 4A4KA 1X2QA 2XIDA 1D1AA 4JJNK 2BE7D 2DZ9A 1WFWA 1YJ9T 3EGXB 5FU7C 4C92C 1WLPB 3CCMT 2K3YA 3RUXA 3D7SB 1V76A 4MZTA 1OEBA 5KYYB 1BYMA 4IUVA 5GAN8 2DVJA 1SSHA 5IT9E 4FT4A 2HSPA 4X9DA 1VQOA 1M1GA 4FW2A 2DIQA 3A1PA 1N5ZA 3JCMP 2VVKA 5IXBA 1VQPQ 5FROA 4FYVB 4N4GA 2KDSA 2ZPHB 3JCMX 1KQ1A 1Q81U 2FZKB 3HRSA 1QCNA 4MMLA 2DRKA 1B3QA 2O2OA 5IHIA 1RL2A 1Y96B 1I0CA 1G3TA 3RERA 1GXIE 1AWXA 1YIJT 2XDDA 4X9CA 5GAN6 1QVGA 2YRVA 2LQKA 1UECA 2F69A 1FX7A 2R58A 4XU3A 3JCMV 1ZA1B 4C8QG 5CO7A 4HCCA 2FRWA 4PJOG 4ZN1A 4X1VA 2QYZA 3NGPA 3E2UA 5L23A 2D8HA 4M7DA 3J80E 3CMAA 4C8QD 1I8FA 1GL5A 2KI7A 2DL8A 2FYKA 1TTHB 3QZ5B 3VJPA 4PJOD 4BI8B 1EX4A 3CCVA 1TH7A 3OYKA 2NYSA 1K9MR 3RMQA 1SG5A 1B34B 2JXBA 4M78A 5FRNA 1T0HA 3LGFA 1H3HA 4C92F 2EQMA 2QEXA 4JZ4A 2M0OA 1M3BA 1K73R 1OQKA 3WXMB 3QSUA 3OBWA 4ANJA 2G6FX 2M1HA 2A7YA 2J7IA 4E7IA 3VS4A 4C5IA 4D8KA 1VYVA 3OMGA 2HL5C 3OYBA 3GBQA 2I0NA 2CP6A 2YT6A 4DEYA 1QVFS 1YJWQ 2MIOA 2X4XA 2DZCA 2RK1A 1YJNT 1Q82R 1VQLQ 4J9GA 3OSVA 1C1AA 4EMHA 1RADB 5LJ3h 2FL7A 2JUFA 4VUBA 1WA7A 1WIEA 2DXTA 3G6EQ 1T3LA 4MDWA 1BCMA 1LCKA 4FYWB 3JCMQ 2X4JA 4NL3A 1UGQB 3IQLA 4JJBA 4F04B 2E3IA 2ZPIB 2PQWA 1UGSB 2RQTA 3F70A 2D6FA 2VXFA 5I22A 3I9QA 3O5ZA 5A2QE 3HRUA 3SD4A 4BUGA 3OW2P 2CGHA 2CSIA 1K73U 3EGDA 2YUQA 4AT1B 2RI5A 2SRCA 4HCZA 5KYWA 4C8QB 1JJ2S 1M1KC 1QP3A 4PJOB 2XHCA 3UATA 3OYNA 3RR6A 1Q82U 4B9WA 4CC4B 2BZ8A 1R77A 5GMKh 3X24B 3KUFA 1VQ4T 2PUKB 5GAOp 2AT1B 4HA8A 1ZX6A 1N6AA 2ED1A 1V29B 2KQWA 2DBKA 1ABQA 2M0YA 2DKGA 3FJPA 3LLRA 4L59A 2DEQA 2LQWA 2RHYA 2A37A 1KC8R 1KQSS 3M0QA 4JRQA 5ECAA 4NOYA 6AT1B 3I56A 1YCYA 1PRMC 4BDZA 3EGXA 1ZSZB 3BDUA 3L2WA 1VQ5Q 4AG1C 1RLPC 4MZPA 2AKKA 2Y4XA 1YBYA 1VQ9T 2FZCB 3CC4Q 4F14A 3R6NA 4LDVA 2L8DA 1D1BA 2X4WA 1AEYA 1SEMA 1BKBA 5GAMg 1VQ8Q 2PVGB 1ZSZC 4RG8A 1AVZC 3CC7T 3CCEQ 2WSCE 3EAEA 3GP8A 2KROA 2C0IA 4M77A 4QQDA 2QQRA 3QJYA 4GY5A 2V1QA 3G4SQ 1VQNA 3KXTA 1WHMA 2JM8A 4V2SA 2E1HA 1D0ZA 5GAMf 2DF6A 1M90R 1KHCA 4J6YA 3LH0A 1N8RR 1QLYA 4ME7A 1KFZA 2ESWA 2DL7A 2QG9B 4J83A 2WSFE 3MHXA 1YJWA 3M59A 5GANg 5CKFA 1HK9A 2JZ2A 1Y57A 1KC8U 1VQLA 2F2WA 1Q86R 2V26A 3QWXX 2E4HA 2ROTA 3HL8A 3G6EA 3L2RA 4C5GA 1MHNA 5KYXB 2YRCA 3CMET 1KQ2A 3S3NA 5IHKA 3RKWA 1LPLA 4GLKA 5KE2A 4NL2A 2NUPB 3A98A 4JLIA 1BBZA 2PZ1A 2V8JA 2WACA 3EG9B 3REAB 1B34A 5GAN5 3VYHB 5A0LA 3PNWC 2X3XD 2MYSA 1AWWA 1NLOC 1JRIA 2H3JA 4HXJA 2K7AA 2E10A 4MMKA 1M90U 2JT4A 2A3LA 5CQYA 1N8RU 4KBMB 4GBQA 2RJCA 3TCJA 1YFNA 3CQTA 3NTIA 2NLUA 2A36A 2F5TX 1VQOT 2CREA 2CZ6B 2QTVA 1Q86U 2F2XA 3JB9H 3UA7A 4ELYC 3DKMA 3UDCA 2GF7A 1AZGB 1MNEA 4FSSA 3QG1A 2K2MA 2DO3A 1OU9A 1LNXA 1XOVA 1QW1A 2EYZA 3I55Q 2RJEA 2EYQA 4QW2A 2VGNA 4PJLA 4LE9A 4HT8A 3PFSA 3PMTA 2V1RA 3CEYA 4FYXB 3ME9A 1VIFA 2MAMA 2IIMA 1PNJA 3MEAA 4A4HA 3GPLA 3OS5A 1QWFA 4JRKA 2EGCA 1WQWA 4Z89A 2DPPB 4D8DA 3CC4A 3DB3A 4EMGA 4Y92A 1Q7YR 1AHJB 3PT9A 4A63B 2J6KA 2KYMA 1RABB 2DVEA 2XKOC 2L89A 2ZPFB 3M58A 3JB9I 1VQ8A 4M78E 2FHDA 2K5FA 3CCEA 4C8QA 2MOXA 1UJYA 2E6ZA 1GFCA 1RACB 2P84A 5KE3A 2O88A 2ZAEA 5DM7R 2V8KA 3CMAT 4M7AE 1RAIB 3H0IA 4XTYA 3CCVT 3BE3A 1VYTA 2W10A 5KYNA 2DRMA 3G71Q 2VKNA 2QEXT 1TWBA 1Q81C 2YUOA 1VQKQ 5GAN2 2BUDA 5IN1A 4DQ2A 1EFNA 3M55A 1WHLA 2EYYA 2L0AA 2WSEE 1Q7YU 3C94A 3H8ZA 2YDLA 2QASA 2O9VA 1QMCA 4J9CA 2FVUA 5GAOl 4ATOA 2F2VA 1ACMB 1G5VA 1M9SA 4RCCA 1I5OB 1ZLMA 4LDUA 4C92G 1K8AR 2L5QA 1NYFA 2KVQG 1RAAB 1NM7A 1JU5C 2PNIA 1WQ7A 2VGMA 4C92D 4IKFA 4J9BA 1H92A 2CUDA 3FB9A 3RESA 4M4ZA 5EC7A 5CKEA 1M30A 1PWTA 2LRQA 5GAMj 3AT1B 1MV0B 1VQMQ 2YLCA 4M7DC 1ZUYA 5J3BA 1KG1A 1Q95G 4ESRA 2LP5A 2K2VA 3CCLQ 4ZTFA 3A8GB 2JS0A 3M0UA 1UGRB 4C0ZA 2M02A 1KHIA 2J6FA 4LDWA 4BE2A 1LOJA 2XI9A 3GNFB 3I55A 4M78C 2DL3A 1A0NB 1UE9A 2EKOA 2K79A 4OGEA 1W2BS 1K8AU 1W6XA 4JRPA 3EG9A 1UTIA 1VUBA 5GANj 4HT9A 3HFOA 4FYYB 4PJJA 1TU0B 3E9FA 4HVVA 4IUTA 3OS2A 3CPWP 1CKBA 3THKA 3VUZA 3PTAA 2A28A 4M7AC 4M77E 2E3HA 4CRIA 5A0DA 2K9GA 3I56T 1WI7A 3CCUA 2K3BA 2GBQA 4J5YA 2EVRA 5I2SA 1OPKA 1DJ7B 1WJRA 1SRLA 3PMIA 1GRIA 1OYXA 2FO0A 2R5AA 3I5SA 2R5MA 3JCMc 4PLIA 3T9NA 1AT1B 3INZA 2Z0WA 5D6WA 5FU7B 4C92B 1UDLA 1FWZA 2LX7A 2VB6A 4A53A 2ZPEB 1TUCA 3Q1JA 1K73C 3EFRA 1VQNT 2ECZA 3QWYA 3OB9A 4A54A 1UUEA 1VQKA 1OZ2A 2MPXC 1RI9A 4M7DF 2LX9A 5GAMe 2YUNA 4E7KA 1Q82C 1N9RA 1QWEA 2COWA 5D7UA 3RMSA 2CZ1B 1YJWT 2NUZA 1H3ZA 1PSEA 2PTKA 2XD0A 1NJIR 1VQLT 5M9OA 1ZQ1A 2LC4A 3L2VA 4M78F 3OYIA 3G6ET 1SSFA 2FPFA 2YRDA 3ZL7C 5I2MA 3OYYA 3N5BB 2DBMA 1YNZA 4FW1A 4J6XA 1D3BA 4ZN3A 4WTOB 1UHCA 2OTLQ 3M9QA 2H8HA 3CXCS 2E64A 5GANe 3VS0A 9ATCB 2KT1A 3M57A 2LQ8A 3QIIA 4M7AF 4XTXA
chains in the Genus database with same CATH topology
3I55Q 1Q86R 1VQOQ 1S72Q 3CCRQ 3OW2P 3G4SQ 1YI2Q 3CMEQ 1QVGP 3CPWP 3CCUQ 3CC4Q 1YJNQ 1YITQ 3I56Q 2QEXQ 1YJWQ 1VQ7Q 3CC2Q 1QVFP 3CCQQ 3CCSQ 1M90R 1K9MR 3CC7Q 3G71Q 1Q82R 3CMAQ 1N8RR 1KD1R 1JJ2P 1VQ8Q 2OTLQ 1VQLQ 1K8AR 1YIJQ 3CD6Q 1KC8R 1VQNQ 1VQ6Q 1KQSP 1Q81R 1M1KR 1Q7YR 1VQKQ 3CCEQ 3CXCP 1VQMQ 1VQ4Q 1NJIR 3G6EQ 1VQPQ 3CCJQ 3CCVQ 2OTJQ 1YHQQ 1K73R 1VQ9Q 1W2BP 2QA4Q 3CCLQ 1VQ5Q 1YJ9Q 3CCMQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I55 Q;  1Q86 R;  1VQO Q;  1S72 Q;  3CCR Q;  3OW2 P;  3G4S Q;  1YI2 Q;  3CME Q;  1QVG P;  3CPW P;  3CCU Q;  3CC4 Q;  1YJN Q;  1YIT Q;  3I56 Q;  2QEX Q;  1YJW Q;  1VQ7 Q;  3CC2 Q;  1QVF P;  3CCQ Q;  3CCS Q;  1M90 R;  1K9M R;  3CC7 Q;  3G71 Q;  1Q82 R;  3CMA Q;  1N8R R;  1KD1 R;  1JJ2 P;  1VQ8 Q;  2OTL Q;  1VQL Q;  1K8A R;  1YIJ Q;  3CD6 Q;  1KC8 R;  1VQN Q;  1VQ6 Q;  1KQS P;  1Q81 R;  1M1K R;  1Q7Y R;  1VQK Q;  3CCE Q;  3CXC P;  1VQM Q;  1VQ4 Q;  1NJI R;  3G6E Q;  1VQP Q;  3CCJ Q;  3CCV Q;  2OTJ Q;  1YHQ Q;  1K73 R;  1VQ9 Q;  1W2B P;  2QA4 Q;  3CCL Q;  1VQ5 Q;  1YJ9 Q;  3CCM Q; 
#chains in the Genus database with same CATH topology
 4BAC A;  1Y7X A;  1X6G A;  4JJC A;  1VQM A;  1OOT A;  3RKX A;  2A08 A;  1D0X A;  4Z88 A;  1AZE A;  5KYU B;  5GAM h;  2KXD A;  3OYG A;  1OPL A;  4HKE A;  2P0K A;  2EYX A;  1EZZ B;  2DNU A;  4BD3 A;  3G7Z A;  5DLO A;  5GAN 4;  4WCI A;  1BIA A;  1NZ9 A;  2DAQ A;  4M77 C;  2DX1 A;  1WYX A;  1NJI U;  1J3T A;  2JW4 A;  2HCK A;  3OS0 A;  3TU4 K;  4PJM A;  4N4H A;  3A8M B;  1G3S A;  2RQR A;  3H41 A;  3NHN A;  1KC8 C;  4XTU A;  1I1J A;  1X01 A;  3QBY A;  4OB2 B;  3OYM A;  1AD5 A;  1P92 A;  5D6Y A;  3CCQ A;  1ZBJ A;  5KCO A;  3RDV A;  4J9F A;  1YI2 Q;  3M54 A;  5GAO r;  2DD4 A;  5C0M A;  3LH5 A;  2RK2 A;  3CC4 T;  4C5H A;  2LJ0 A;  2HQE A;  4PFP A;  2ZCF B;  1VQ8 T;  2JS2 A;  3FJ5 A;  3CCS A;  1M3A A;  2HD0 A;  2RQU A;  2QA4 Q;  3CCE T;  3CCM Q;  1MV3 A;  1S72 Q;  3JB9 J;  1PM3 A;  2QDL A;  3SWN B;  4JPB W;  2AIR B;  3TEE A;  1AOJ A;  3HFN A;  1KK7 A;  3G4S T;  1M90 C;  2BZY A;  3NFC A;  1N8R C;  4BDY A;  1SRM A;  4RKU E;  5CAI A;  1M27 C;  2RI2 A;  2DTH A;  3VKI A;  3NMZ C;  3E19 A;  1U1T A;  5GMK i;  1K9M U;  3M5A A;  3SWN C;  1VYU A;  4J9D A;  4BB7 A;  2LCL A;  1Q86 C;  2J05 A;  3CBO A;  2AHJ B;  1NE8 A;  2GTJ A;  4KRT A;  2IG0 A;  1IRE B;  1HYO A;  1M1F A;  2DA9 A;  2FEI A;  3BFM A;  2NUT B;  2DXB A;  4JS5 A;  1VQP A;  1QVF P;  3PVQ A;  4M77 F;  4DBH A;  2K5I A;  2IVW A;  3JCM g;  1Y0M A;  4XU2 A;  4F7U A;  2RQW A;  1TG0 A;  5LJ5 g;  4QVC A;  3H0F A;  3LYI A;  4OMO A;  1XNI A;  2CT4 A;  2OTL A;  2GFU A;  3URG A;  1UG1 A;  5FW9 A;  2E41 A;  3JV3 A;  1C6V X;  4C92 A;  3MKD A;  2E65 A;  2W0Z A;  3OSS C;  2L3Q A;  2DM1 A;  4DA4 A;  5J39 A;  3OYE A;  2O31 A;  2X51 A;  4EMK C;  1WPY A;  5KYY A;  4QVD A;  1AWJ A;  4JS4 A;  2D8J A;  2CP0 A;  1SHG A;  1VQ7 Q;  2QDY B;  2DFU A;  2FPD A;  1BIB A;  2LNV A;  3OYH A;  1JJ2 P;  3JB9 F;  2ZPB B;  3CPF A;  4ZGD B;  1ZSG A;  4B9X A;  1MGQ A;  2XG8 D;  2HQH A;  3PE0 A;  1AWO A;  8ATC B;  4OMQ A;  2Y4Y A;  1CSK A;  1YJN Q;  3I55 T;  1IGQ A;  2RNA A;  3OMC A;  4C0F A;  2K6D A;  1Y96 A;  3M56 A;  4C0G A;  2X4Y A;  2RB6 A;  1KD1 R;  1YWO A;  1YI2 A;  1JXM A;  5LL6 S;  3UF4 A;  4M75 E;  3RIR A;  1Q7Y C;  2RN8 A;  2K57 A;  2LT4 A;  1KQS P;  4KGZ B;  5HCK A;  4N0A C;  1GCQ C;  2GGR A;  3C0C A;  3LX7 A;  4Q5W A;  5GJV B;  4IUU A;  1PCX A;  2BE9 B;  2OI3 A;  4II1 A;  2BIV A;  2DLP A;  1E7O A;  1X6B A;  2HL3 A;  4AFS C;  3EHR A;  2EIF A;  4OMP A;  2QA4 A;  1HD3 A;  1WXB A;  3CCU T;  1S72 A;  1BU1 A;  4KH0 B;  1IZ6 A;  3BDL A;  2EFI A;  1NPP A;  5L8R E;  2L3P A;  5GAN f;  1TSF A;  4CC2 A;  1YWP A;  3PIO A;  4E7S A;  2KY9 A;  2DYB A;  5HK3 A;  4XTW A;  1M5Q 1;  3HKS A;  4FM4 B;  4KT0 E;  4BY6 C;  1EIF A;  3REB B;  4R0K A;  1OUL A;  2VUB A;  4PLL A;  3PVL A;  2HDA A;  4JDS A;  3QYH B;  5LJ3 g;  1KD1 U;  3R6O A;  2H3E B;  4LD9 K;  1TS9 A;  1VQK T;  2VAS A;  1QVG S;  4IUP A;  3RKY A;  3OQ5 A;  2LQN A;  4KH1 B;  3ASK A;  1WXT A;  3DLL A;  2RHI A;  5GAM d;  1K8A C;  2D9T A;  1IHV A;  5GAN 3;  2DET A;  3EH2 A;  5GMK l;  1U5S A;  1ZBX A;  1IRX A;  3LWI A;  1W4S A;  2R57 A;  2KXC A;  4LXC A;  1IXD A;  4J6W A;  2KE9 A;  5DLQ E;  4M7D G;  3JRZ A;  4DOV A;  2DL5 A;  2MK5 A;  4RTZ A;  1FMV A;  4M7D E;  1VQ5 A;  1X43 A;  2RHX A;  4ELZ C;  3V7S A;  1RAE B;  3LW5 E;  2DK3 A;  3EGU A;  4M7D D;  1X6O A;  4C0D C;  4J9I A;  1VQ7 A;  5GAN d;  4M78 G;  2ENM A;  1YHQ Q;  2EPD A;  2EQJ A;  1Y07 A;  2RO0 A;  1VQM T;  3TVT A;  4M75 C;  3EG0 A;  5FU6 C;  2QQS A;  4ZGE B;  3G1J A;  2XDB A;  3BY7 A;  2D1X A;  4XK8 E;  2QI2 A;  2KMT A;  4ZNX A;  4M78 D;  3QDR B;  4OMN A;  4E7L A;  2BKD N;  1D0Y A;  4DEX A;  4PJO A;  2VWF A;  4XU0 A;  2DXC A;  3G4S A;  5GAO q;  4AG2 C;  3CD6 Q;  4M7A G;  4PK4 A;  4L5G A;  3LGL A;  2E5K A;  4E47 A;  1QCF A;  1QKW A;  1E6G A;  4M7A D;  2AKL A;  3H9N A;  2ZGW A;  3HHT B;  1WHG A;  3MP8 A;  3FC3 A;  2X9H A;  2DEU A;  4LDX A;  1JB0 E;  3TSZ A;  4RCB A;  4YTL A;  2PUO B;  1ZSZ A;  1XJW B;  3CCQ T;  3AHU A;  1BB9 A;  3ZBD A;  2LNH B;  5LJ5 j;  3QJ6 A;  3PIP A;  3L2Q A;  3OW2 A;  5HKC A;  1Z9Z A;  3CBP A;  5IAY A;  1M2O A;  1LJO A;  3JSC A;  3GOX A;  3O8V A;  5J26 A;  4GLM A;  1BK2 A;  4FCY A;  2KRN A;  4UC4 A;  1FYN A;  1WHJ A;  3HRT A;  3CCS T;  2X3W D;  2EAY A;  1K9A A;  2C06 A;  2OTJ Q;  1QVP A;  3RNJ A;  3OYF A;  2A0F B;  4M7D B;  1PSF A;  2JN0 A;  3QHS A;  2E5Q A;  5KCH A;  4EIK A;  1XTD A;  1JBM A;  3VS7 A;  3X26 B;  4M75 F;  4J9E A;  4IIM A;  4FU6 A;  3OA6 A;  4M78 B;  2CH4 W;  4PL6 A;  1HSQ A;  3HP9 A;  1K0S A;  3SEM A;  2DL4 A;  1QQJ A;  5KYX A;  1VQP T;  5A0G A;  2HMA A;  3GIB A;  2EJ9 A;  2E70 A;  1JJ2 A;  4RTT A;  3FRN A;  2OAW A;  2MWO A;  2QQA A;  3M4Y A;  1S1N A;  4AFU C;  3VRZ A;  3M0S A;  4Y28 E;  4M7A B;  2OTL T;  3CCJ Q;  2NUP A;  4J8O A;  4HVW A;  1WX6 A;  4KUD K;  2GQI A;  3KFV A;  2DD5 A;  2FPE A;  1NYG A;  2IPO B;  4JZ3 A;  2EGE A;  4JLG A;  4M77 G;  3L1A A;  1M2V B;  2CDT A;  2OJ2 A;  1YHQ A;  3P8D A;  2ROL A;  5CQX A;  3CC2 Q;  1ZHI A;  2JTE A;  3JCM e;  2DE0 X;  4JUV A;  1KQS A;  2EWN A;  5LJ5 e;  1G83 A;  3M0P A;  3P8H A;  4M77 D;  4XAX B;  4P5N A;  2K5L A;  2QK0 A;  3EFS A;  8AT1 B;  3CD6 A;  4Z8A A;  1G3Y A;  3VYG A;  1PD0 A;  3QXE B;  4HCB A;  2EW3 A;  2QEX Q;  2MCN A;  3L42 A;  3MPU B;  4HVU A;  1K9M C;  3V7R A;  1YN8 A;  2HQX A;  2EJG A;  1MMN A;  2G3R A;  3A8L B;  3A5Z B;  2B8A A;  3V8L A;  3V8K A;  1K0X A;  1Q81 R;  4RMO A;  2JTF A;  2LMJ A;  7AT1 B;  2KT8 A;  1W2B P;  5LJ3 j;  3G71 A;  3UT1 A;  1T0J A;  3GLX A;  3QZ9 B;  4OML A;  4QT7 A;  3CCR Q;  5EG2 A;  1PD1 A;  2XDP A;  2P4R A;  2QQB A;  3QKJ A;  2OX7 A;  4JJD A;  2ABL A;  3ZFJ A;  2XK0 A;  3OYJ A;  1YI2 T;  3JB9 G;  3S3O A;  1FMK A;  2C0T A;  1M4Z A;  1RAH B;  1M8M A;  3C95 A;  5GAO m;  3C4S A;  5CK9 A;  2KAF A;  3M0T A;  3JB9 D;  2AZV A;  2YXY A;  1XQH A;  4BI3 A;  5FLX E;  1CKA A;  2J06 A;  2QA4 T;  1JO8 A;  2ED0 A;  1HJD A;  2C0O A;  1S72 T;  2OTJ A;  1UFF A;  2YWW A;  1R8O B;  1WJQ A;  1VQ6 Q;  4KUI A;  2ZPG B;  5D6X A;  2RHZ A;  1IB8 A;  1UJ0 A;  4LN2 A;  2YSQ A;  5GMK j;  2RF0 A;  1RI0 A;  4MDX A;  4M77 B;  1YIT Q;  2YLB A;  3MEV A;  3QDF A;  2RD1 A;  4X34 A;  3CCL A;  3EG3 A;  1FMW A;  4RTU A;  5GAN 7;  1VIE A;  2FRY A;  4OB3 B;  2ATC B;  2HSE B;  3JCM b;  3S3M A;  2M51 A;  1IHW A;  4DOW A;  3CCJ A;  3UPU A;  3I56 Q;  2EKH A;  4EPC A;  1OV3 A;  4K11 A;  4Y91 A;  3HTR A;  1D1C A;  2BZX A;  1ARK A;  3VS5 A;  2EQU A;  1GCP A;  4C8Q E;  1W70 A;  5LJ3 e;  3CXC P;  2QAZ A;  4QQG A;  5GAN h;  2LT1 A;  3CC2 A;  4CC3 A;  4PJO E;  1KJW A;  2K4Y A;  3KBG A;  1U06 A;  1UHF A;  1I07 A;  4F7U F;  1T3S A;  1H64 1;  3SFM A;  2KK4 A;  1VQ5 T;  4OMM A;  1NLP C;  2PVO B;  3MJX A;  1UGP B;  2DJQ A;  1BI1 A;  2KEA A;  4TVR A;  4MZM A;  4C5E A;  1B7T A;  3PGG A;  4XTV A;  3JCM J;  4QKU A;  1VQ7 T;  1VQN Q;  2RMO A;  1YCS B;  3M53 A;  2CP2 A;  4LNP A;  2KRS A;  1M3C A;  1YJ9 Q;  2EGA A;  1YP5 A;  3OW2 S;  4J7I A;  2E6N A;  2KRM A;  1OZ3 A;  1NG2 A;  1OX8 A;  2RQV A;  3MEW A;  3WVE B;  2P0Q A;  2NWM A;  1KD1 C;  4M7A A;  3CCR A;  1TUD A;  3BW1 A;  4E2F B;  2B86 A;  1IGU A;  4FIB A;  2XIC A;  3QUI A;  5FWB A;  1WNL A;  4A4G A;  1ZA2 B;  3I35 A;  2VYT A;  5GMK e;  2JMA A;  2HZY A;  1M2V A;  2EBP A;  5I21 A;  1GBR A;  1ZUU A;  2F5K A;  2RHU A;  2CT3 A;  1BI3 A;  5CKH A;  2DJZ A;  3EHQ A;  2O4X B;  2HKN A;  1PRL C;  4E7Z A;  1G8X A;  1X75 C;  2CZ0 B;  1GBQ A;  4XQ3 A;  2VXE A;  2CKK A;  5HK0 A;  4PKC C;  1YIJ Q;  2VV5 A;  4O6J A;  1R0B G;  3VS6 A;  4PNO A;  3VRY A;  2HAX A;  1U1S A;  3X25 B;  4IIO A;  2JTM A;  3RBB B;  1WHH A;  1VQ6 A;  2DYI A;  4AFZ C;  4CC7 A;  2Y90 A;  2DMO A;  4EMK B;  4ORZ A;  1OX9 A;  4LDY A;  2FG0 A;  1OI1 A;  3CBM A;  4QQ6 A;  1QCO A;  3EG2 A;  1I4K 1;  3JCM f;  1WGS A;  5IXF A;  1YIT A;  5FWC A;  1UEB A;  5LJ5 f;  1WXU A;  3J7A F;  3MET A;  2MI6 A;  1X27 A;  3A8O B;  2CP3 A;  3CPW A;  4DBF A;  4C8Q C;  3MP1 A;  3NTH A;  3DLM A;  1UGV A;  2GFA A;  4PJO C;  2SEM A;  4IUR A;  4IUQ A;  3OY9 A;  3VS1 A;  1PG5 B;  1I5L A;  3TQ7 P;  5AT1 B;  2QGG A;  2HBW A;  3LWH A;  4J7F A;  2CP5 A;  2DER A;  2LDM A;  2GTO A;  4OP0 A;  3EFO B;  4XTZ A;  5IH2 A;  1GFD A;  5GJW B;  1ABO A;  1ZUK A;  1N27 A;  3ULR B;  2K3X A;  4QVZ A;  1NBE B;  3E9G A;  4E7J A;  1G3W A;  2L3R A;  1OU8 A;  4M75 G;  3WVD B;  2PU9 B;  2MWP A;  5CKD A;  1U8R A;  3UA6 A;  4RTW A;  1W2B A;  1RAF B;  1VOM A;  3ZEH A;  4M75 D;  4OMF B;  3FIF A;  4KUL A;  1PKS A;  3V7C A;  5KYU A;  1YHQ T;  1H8K A;  4FT2 A;  4N4I A;  3VUB A;  3U23 A;  3UWN A;  1RUW A;  2CUB A;  2QXF A;  1BCO A;  2VC8 A;  4XU1 A;  1YJ9 A;  3FEO A;  1NEB A;  5CCA A;  3CCM A;  3JCM d;  2AZS A;  2RA2 A;  2COZ A;  2JM9 A;  3OBY A;  1MND A;  4WF2 A;  4BY6 B;  5LJ5 d;  4J9H A;  4F16 A;  2L3S A;  2OAU A;  2GCX A;  3CD6 T;  4KGX B;  2MMP A;  2P0P A;  4HCK A;  3VV0 A;  4RG2 A;  4ZGJ B;  1E6H A;  2L2P A;  3QPH A;  3HSB A;  2F1L A;  3OYL A;  2XU8 A;  4AMC A;  2COY A;  3MP6 A;  4FL6 A;  2PVD B;  4F17 A;  4C8Q F;  1M1K R;  1BI2 A;  2YHT A;  4EDU A;  5CR2 A;  3G71 T;  1VQ4 Q;  3SB2 A;  4PJO F;  2DTI A;  1K1Z A;  1O9S A;  2KBT A;  1JEG A;  1YIJ A;  1SF9 A;  3V8J A;  2MF2 A;  2CP7 A;  3J81 E;  2D0N A;  3SDZ A;  2RPN A;  2JNG A;  2LCC A;  1TXQ A;  2O01 E;  2QTX A;  4JRI A;  2BTT A;  4DBR A;  5LJ3 f;  3SWN A;  1WHK A;  2CS7 A;  1VQ9 Q;  2GNC A;  4RUG A;  2QGF B;  4C0D B;  1X69 A;  2OTJ T;  4LUE A;  1K4U S;  3JCM W;  4M75 B;  1WZO A;  5FU6 B;  3FLG A;  1LVK A;  3CC7 Q;  3CXC A;  1KSW A;  4D6W A;  2KR3 A;  3I5R A;  4A4E A;  3HPW A;  2NUT A;  1SHF A;  1F1B B;  1M1K U;  4OB0 B;  2O4X A;  3OS1 A;  1B07 A;  4LD6 A;  1QVG P;  3CCL T;  2RH2 A;  5FRM A;  2HBP A;  1I81 A;  3X28 B;  1K76 A;  2DIL A;  1YJN A;  3C12 A;  1Y71 A;  3VS3 A;  4OF1 A;  2FB7 A;  4EMK A;  5DY9 A;  1MMA A;  3H0H A;  1G2B A;  3A8H B;  3MCA B;  3CCJ T;  3CME Q;  3CCU Q;  1RLQ C;  4AFQ C;  4R55 A;  2EJF A;  1MMD A;  4RTX A;  1D3B B;  1NEG A;  3CC2 T;  5LJ3 d;  4A4F A;  4BE1 A;  4L6V 5;  2I2L A;  4RTY A;  2V8I A;  1WJS A;  2CH4 A;  1QKX A;  3OYA A;  3S6W A;  3L2U A;  2LTO A;  3DB4 A;  2CSQ A;  1QVF A;  3SHW A;  5CIU A;  3VU3 C;  2HKQ B;  5GAO n;  1TOV A;  1BI0 A;  2M16 A;  5HY6 A;  2CYZ B;  3EFO A;  1HXD A;  2KGT A;  2LJ1 A;  4F7U G;  2JMC A;  4N0A A;  1WDX A;  1GCQ A;  1MUZ A;  2DIG A;  1VQO Q;  1M8V A;  4F7U E;  3QYG B;  4BE0 A;  1W1F A;  1VQ4 A;  3QO3 A;  3M4G A;  1KIK A;  1Z9Q A;  2JJ9 A;  3CCR T;  4Z02 A;  3JAM E;  3ER0 A;  2X35 A;  2RJF A;  2J6O A;  4C92 E;  1NJI C;  2FZG B;  2GQV A;  1U3O A;  2EYW A;  2LJ3 A;  5CKB A;  3E1S A;  1PC0 A;  5CVI A;  5GMK m;  3CPW S;  3L2Z A;  4B6M A;  4BI4 A;  3OYD A;  1VQ9 A;  2AK5 A;  3NPF A;  2LZ6 B;  1SPK A;  2JVV A;  2M9U A;  2RJD A;  4PFZ A;  1UB4 A;  3EH1 A;  1PHT A;  3GNG A;  2E12 A;  2KSS A;  3X20 B;  1JXO A;  3CC7 A;  1VQ6 T;  1FXX A;  1MMG A;  1QP2 A;  3NTK A;  5AYF A;  2LCS A;  1TUG B;  1SKU B;  1PKT A;  4O5V A;  2EQK A;  1NPR A;  4ZTJ A;  3H6Z A;  3MO8 A;  1YIT T;  1IO6 A;  4FSX A;  3CMA Q;  2JOY A;  3EG1 A;  2LVM A;  2DXU A;  4OGC A;  4OVA A;  4OB1 B;  4KGV B;  3CCV Q;  2CZ7 B;  4NS5 A;  2HNI A;  1RAG B;  2YUP A;  4E6R A;  2RM4 A;  3FDR A;  3P8B B;  1V1C A;  2KNB B;  3CCQ Q;  3EGD B;  3CME A;  2EQI A;  4LUD A;  1X2K A;  5KYW B;  4PJN A;  2KYB A;  1C0M A;  5KH6 A;  3TRE A;  4F7U B;  3VS2 A;  3MEU A;  4E7H A;  5I11 A;  3M0R A;  3OYC A;  2O9S A;  4R56 A;  4RTV A;  2RI3 A;  4M75 A;  4DBQ A;  1VA7 A;  1O75 A;  2D0Q B;  2ZZD A;  2P4T A;  3CCS Q;  4CI0 C;  3JCM h;  3GF5 A;  5LJ5 h;  1R0C B;  3TSW A;  1D09 B;  2DTO A;  5IHN A;  1N9S A;  1JQQ A;  2HEQ A;  4PFO A;  5C6S A;  2XMF A;  2QQ9 A;  4A4K A;  1X2Q A;  2XID A;  1D1A A;  4JJN K;  2BE7 D;  2DZ9 A;  1WFW A;  1YJ9 T;  3EGX B;  5FU7 C;  4C92 C;  1WLP B;  3CCM T;  2K3Y A;  3RUX A;  3D7S B;  1V76 A;  4MZT A;  1OEB A;  5KYY B;  1BYM A;  4IUV A;  5GAN 8;  2DVJ A;  1SSH A;  5IT9 E;  4FT4 A;  2HSP A;  4X9D A;  1VQO A;  1M1G A;  4FW2 A;  2DIQ A;  3A1P A;  1N5Z A;  3JCM P;  2VVK A;  5IXB A;  1VQP Q;  5FRO A;  4FYV B;  4N4G A;  2KDS A;  2ZPH B;  3JCM X;  1KQ1 A;  1Q81 U;  2FZK B;  3HRS A;  1QCN A;  4MML A;  2DRK A;  1B3Q A;  2O2O A;  5IHI A;  1RL2 A;  1Y96 B;  1I0C A;  1G3T A;  3RER A;  1GXI E;  1AWX A;  1YIJ T;  2XDD A;  4X9C A;  5GAN 6;  1QVG A;  2YRV A;  2LQK A;  1UEC A;  2F69 A;  1FX7 A;  2R58 A;  4XU3 A;  3JCM V;  1ZA1 B;  4C8Q G;  5CO7 A;  4HCC A;  2FRW A;  4PJO G;  4ZN1 A;  4X1V A;  2QYZ A;  3NGP A;  3E2U A;  5L23 A;  2D8H A;  4M7D A;  3J80 E;  3CMA A;  4C8Q D;  1I8F A;  1GL5 A;  2KI7 A;  2DL8 A;  2FYK A;  1TTH B;  3QZ5 B;  3VJP A;  4PJO D;  4BI8 B;  1EX4 A;  3CCV A;  1TH7 A;  3OYK A;  2NYS A;  1K9M R;  3RMQ A;  1SG5 A;  1B34 B;  2JXB A;  4M78 A;  5FRN A;  1T0H A;  3LGF A;  1H3H A;  4C92 F;  2EQM A;  2QEX A;  4JZ4 A;  2M0O A;  1M3B A;  1K73 R;  1OQK A;  3WXM B;  3QSU A;  3OBW A;  4ANJ A;  2G6F X;  2M1H A;  2A7Y A;  2J7I A;  4E7I A;  3VS4 A;  4C5I A;  4D8K A;  1VYV A;  3OMG A;  2HL5 C;  3OYB A;  3GBQ A;  2I0N A;  2CP6 A;  2YT6 A;  4DEY A;  1QVF S;  1YJW Q;  2MIO A;  2X4X A;  2DZC A;  2RK1 A;  1YJN T;  1Q82 R;  1VQL Q;  4J9G A;  3OSV A;  1C1A A;  4EMH A;  1RAD B;  5LJ3 h;  2FL7 A;  2JUF A;  4VUB A;  1WA7 A;  1WIE A;  2DXT A;  3G6E Q;  1T3L A;  4MDW A;  1BCM A;  1LCK A;  4FYW B;  3JCM Q;  2X4J A;  4NL3 A;  1UGQ B;  3IQL A;  4JJB A;  4F04 B;  2E3I A;  2ZPI B;  2PQW A;  1UGS B;  2RQT A;  3F70 A;  2D6F A;  2VXF A;  5I22 A;  3I9Q A;  3O5Z A;  5A2Q E;  3HRU A;  3SD4 A;  4BUG A;  3OW2 P;  2CGH A;  2CSI A;  1K73 U;  3EGD A;  2YUQ A;  4AT1 B;  2RI5 A;  2SRC A;  4HCZ A;  5KYW A;  4C8Q B;  1JJ2 S;  1M1K C;  1QP3 A;  4PJO B;  2XHC A;  3UAT A;  3OYN A;  3RR6 A;  1Q82 U;  4B9W A;  4CC4 B;  2BZ8 A;  1R77 A;  5GMK h;  3X24 B;  3KUF A;  1VQ4 T;  2PUK B;  5GAO p;  2AT1 B;  4HA8 A;  1ZX6 A;  1N6A A;  2ED1 A;  1V29 B;  2KQW A;  2DBK A;  1ABQ A;  2M0Y A;  2DKG A;  3FJP A;  3LLR A;  4L59 A;  2DEQ A;  2LQW A;  2RHY A;  2A37 A;  1KC8 R;  1KQS S;  3M0Q A;  4JRQ A;  5ECA A;  4NOY A;  6AT1 B;  3I56 A;  1YCY A;  1PRM C;  4BDZ A;  3EGX A;  1ZSZ B;  3BDU A;  3L2W A;  1VQ5 Q;  4AG1 C;  1RLP C;  4MZP A;  2AKK A;  2Y4X A;  1YBY A;  1VQ9 T;  2FZC B;  3CC4 Q;  4F14 A;  3R6N A;  4LDV A;  2L8D A;  1D1B A;  2X4W A;  1AEY A;  1SEM A;  1BKB A;  5GAM g;  1VQ8 Q;  2PVG B;  1ZSZ C;  4RG8 A;  1AVZ C;  3CC7 T;  3CCE Q;  2WSC E;  3EAE A;  3GP8 A;  2KRO A;  2C0I A;  4M77 A;  4QQD A;  2QQR A;  3QJY A;  4GY5 A;  2V1Q A;  3G4S Q;  1VQN A;  3KXT A;  1WHM A;  2JM8 A;  4V2S A;  2E1H A;  1D0Z A;  5GAM f;  2DF6 A;  1M90 R;  1KHC A;  4J6Y A;  3LH0 A;  1N8R R;  1QLY A;  4ME7 A;  1KFZ A;  2ESW A;  2DL7 A;  2QG9 B;  4J83 A;  2WSF E;  3MHX A;  1YJW A;  3M59 A;  5GAN g;  5CKF A;  1HK9 A;  2JZ2 A;  1Y57 A;  1KC8 U;  1VQL A;  2F2W A;  1Q86 R;  2V26 A;  3QWX X;  2E4H A;  2ROT A;  3HL8 A;  3G6E A;  3L2R A;  4C5G A;  1MHN A;  5KYX B;  2YRC A;  3CME T;  1KQ2 A;  3S3N A;  5IHK A;  3RKW A;  1LPL A;  4GLK A;  5KE2 A;  4NL2 A;  2NUP B;  3A98 A;  4JLI A;  1BBZ A;  2PZ1 A;  2V8J A;  2WAC A;  3EG9 B;  3REA B;  1B34 A;  5GAN 5;  3VYH B;  5A0L A;  3PNW C;  2X3X D;  2MYS A;  1AWW A;  1NLO C;  1JRI A;  2H3J A;  4HXJ A;  2K7A A;  2E10 A;  4MMK A;  1M90 U;  2JT4 A;  2A3L A;  5CQY A;  1N8R U;  4KBM B;  4GBQ A;  2RJC A;  3TCJ A;  1YFN A;  3CQT A;  3NTI A;  2NLU A;  2A36 A;  2F5T X;  1VQO T;  2CRE A;  2CZ6 B;  2QTV A;  1Q86 U;  2F2X A;  3JB9 H;  3UA7 A;  4ELY C;  3DKM A;  3UDC A;  2GF7 A;  1AZG B;  1MNE A;  4FSS A;  3QG1 A;  2K2M A;  2DO3 A;  1OU9 A;  1LNX A;  1XOV A;  1QW1 A;  2EYZ A;  3I55 Q;  2RJE A;  2EYQ A;  4QW2 A;  2VGN A;  4PJL A;  4LE9 A;  4HT8 A;  3PFS A;  3PMT A;  2V1R A;  3CEY A;  4FYX B;  3ME9 A;  1VIF A;  2MAM A;  2IIM A;  1PNJ A;  3MEA A;  4A4H A;  3GPL A;  3OS5 A;  1QWF A;  4JRK A;  2EGC A;  1WQW A;  4Z89 A;  2DPP B;  4D8D A;  3CC4 A;  3DB3 A;  4EMG A;  4Y92 A;  1Q7Y R;  1AHJ B;  3PT9 A;  4A63 B;  2J6K A;  2KYM A;  1RAB B;  2DVE A;  2XKO C;  2L89 A;  2ZPF B;  3M58 A;  3JB9 I;  1VQ8 A;  4M78 E;  2FHD A;  2K5F A;  3CCE A;  4C8Q A;  2MOX A;  1UJY A;  2E6Z A;  1GFC A;  1RAC B;  2P84 A;  5KE3 A;  2O88 A;  2ZAE A;  5DM7 R;  2V8K A;  3CMA T;  4M7A E;  1RAI B;  3H0I A;  4XTY A;  3CCV T;  3BE3 A;  1VYT A;  2W10 A;  5KYN A;  2DRM A;  3G71 Q;  2VKN A;  2QEX T;  1TWB A;  1Q81 C;  2YUO A;  1VQK Q;  5GAN 2;  2BUD A;  5IN1 A;  4DQ2 A;  1EFN A;  3M55 A;  1WHL A;  2EYY A;  2L0A A;  2WSE E;  1Q7Y U;  3C94 A;  3H8Z A;  2YDL A;  2QAS A;  2O9V A;  1QMC A;  4J9C A;  2FVU A;  5GAO l;  4ATO A;  2F2V A;  1ACM B;  1G5V A;  1M9S A;  4RCC A;  1I5O B;  1ZLM A;  4LDU A;  4C92 G;  1K8A R;  2L5Q A;  1NYF A;  2KVQ G;  1RAA B;  1NM7 A;  1JU5 C;  2PNI A;  1WQ7 A;  2VGM A;  4C92 D;  4IKF A;  4J9B A;  1H92 A;  2CUD A;  3FB9 A;  3RES A;  4M4Z A;  5EC7 A;  5CKE A;  1M30 A;  1PWT A;  2LRQ A;  5GAM j;  3AT1 B;  1MV0 B;  1VQM Q;  2YLC A;  4M7D C;  1ZUY A;  5J3B A;  1KG1 A;  1Q95 G;  4ESR A;  2LP5 A;  2K2V A;  3CCL Q;  4ZTF A;  3A8G B;  2JS0 A;  3M0U A;  1UGR B;  4C0Z A;  2M02 A;  1KHI A;  2J6F A;  4LDW A;  4BE2 A;  1LOJ A;  2XI9 A;  3GNF B;  3I55 A;  4M78 C;  2DL3 A;  1A0N B;  1UE9 A;  2EKO A;  2K79 A;  4OGE A;  1W2B S;  1K8A U;  1W6X A;  4JRP A;  3EG9 A;  1UTI A;  1VUB A;  5GAN j;  4HT9 A;  3HFO A;  4FYY B;  4PJJ A;  1TU0 B;  3E9F A;  4HVV A;  4IUT A;  3OS2 A;  3CPW P;  1CKB A;  3THK A;  3VUZ A;  3PTA A;  2A28 A;  4M7A C;  4M77 E;  2E3H A;  4CRI A;  5A0D A;  2K9G A;  3I56 T;  1WI7 A;  3CCU A;  2K3B A;  2GBQ A;  4J5Y A;  2EVR A;  5I2S A;  1OPK A;  1DJ7 B;  1WJR A;  1SRL A;  3PMI A;  1GRI A;  1OYX A;  2FO0 A;  2R5A A;  3I5S A;  2R5M A;  3JCM c;  4PLI A;  3T9N A;  1AT1 B;  3INZ A;  2Z0W A;  5D6W A;  5FU7 B;  4C92 B;  1UDL A;  1FWZ A;  2LX7 A;  2VB6 A;  4A53 A;  2ZPE B;  1TUC A;  3Q1J A;  1K73 C;  3EFR A;  1VQN T;  2ECZ A;  3QWY A;  3OB9 A;  4A54 A;  1UUE A;  1VQK A;  1OZ2 A;  2MPX C;  1RI9 A;  4M7D F;  2LX9 A;  5GAM e;  2YUN A;  4E7K A;  1Q82 C;  1N9R A;  1QWE A;  2COW A;  5D7U A;  3RMS A;  2CZ1 B;  1YJW T;  2NUZ A;  1H3Z A;  1PSE A;  2PTK A;  2XD0 A;  1NJI R;  1VQL T;  5M9O A;  1ZQ1 A;  2LC4 A;  3L2V A;  4M78 F;  3OYI A;  3G6E T;  1SSF A;  2FPF A;  2YRD A;  3ZL7 C;  5I2M A;  3OYY A;  3N5B B;  2DBM A;  1YNZ A;  4FW1 A;  4J6X A;  1D3B A;  4ZN3 A;  4WTO B;  1UHC A;  2OTL Q;  3M9Q A;  2H8H A;  3CXC S;  2E64 A;  5GAN e;  3VS0 A;  9ATC B;  2KT1 A;  3M57 A;  2LQ8 A;  3QII A;  4M7A F;  4XTX A; 
#chains in the Genus database with same CATH homology
 3I55 Q;  1Q86 R;  1VQO Q;  1S72 Q;  3CCR Q;  3OW2 P;  3G4S Q;  1YI2 Q;  3CME Q;  1QVG P;  3CPW P;  3CCU Q;  3CC4 Q;  1YJN Q;  1YIT Q;  3I56 Q;  2QEX Q;  1YJW Q;  1VQ7 Q;  3CC2 Q;  1QVF P;  3CCQ Q;  3CCS Q;  1M90 R;  1K9M R;  3CC7 Q;  3G71 Q;  1Q82 R;  3CMA Q;  1N8R R;  1KD1 R;  1JJ2 P;  1VQ8 Q;  2OTL Q;  1VQL Q;  1K8A R;  1YIJ Q;  3CD6 Q;  1KC8 R;  1VQN Q;  1VQ6 Q;  1KQS P;  1Q81 R;  1M1K R;  1Q7Y R;  1VQK Q;  3CCE Q;  3CXC P;  1VQM Q;  1VQ4 Q;  1NJI R;  3G6E Q;  1VQP Q;  3CCJ Q;  3CCV Q;  2OTJ Q;  1YHQ Q;  1K73 R;  1VQ9 Q;  1W2B P;  2QA4 Q;  3CCL Q;  1VQ5 Q;  1YJ9 Q;  3CCM Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...