1NLPC

Structure of signal transduction protein, nmr, minimized average structure
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-SRC
publication title Molecular basis for the binding of SH3 ligands with non-peptide elements identified by combinatorial synthesis.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Complex (transferase/peptide)
total genus 8
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1996-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1nlpC00
1SHFA 2DBMA 2DMOA 1A0NB 3VS7A 1VYTA 1S1NA 1UGVA 1OV3A 2F2WA 1I07A 4JJCA 1AZEA 4AFZC 3EG0A 2EBPA 3REAB 2KRNA 3M0UA 1OPLA 2C0OA 1M30A 3H0HA 2RQWA 1UTIA 2DE0X 1AWXA 1JU5C 2ED0A 1PKSA 2DJQA 1ABOA 1HD3A 2EGEA 1M8MA 2RNAA 4Z88A 2KRSA 4OMLA 4EIKA 4A63B 1RUWA 2CH4W 3O5ZA 1UJ0A 2YUQA 4JPBW 1K9AA 2D0NA 1Z9QA 3TSWA 2W0ZA 1IO6A 1XOVA 1WLPB 4D8DA 3LH5A 3PVLA 2KT1A 2LQNA 3JV3A 5IHIA 1WXUA 2D8JA 2LJ0A 3A98A 1AOJA 2DNUA 5EC7A 1CKBA 1V1CA 1SRMA 1YN8A 2F2VA 1PRMC 3VS0A 2KRMA 3UA7A 1KFZA 4F16A 3M0RA 2JM8A 3EG3A 1B07A 1K76A 1UE9A 2EGCA 1GCQA 1T0JA 2DYBA 2E5KA 2CSQA 4GBQA 1JO8A 1W6XA 3H0IA 2LZ6B 2ECZA 3TSZA 4E6RA 1JEGA 1TUDA 2YT6A 2KYMA 4JJDA 1G83A 2GQIA 2NWMA 2JT4A 1ABQA 2RQTA 4CC4B 2VKNA 4RTTA 1Y0MA 1K0SA 2DL3A 4AFSC 1ZUUA 2FPDA 2V1RA 5FWBA 4GLMA 1WXBA 2A36A 4OMNA 1H92A 1PKTA 4HVUA 2K7AA 1U5SA 2KT8A 2IIMA 2YSQA 5IHNA 2JS2A 1X2KA 4RTUA 1WXTA 2JMCA 1OEBA 2KROA 2BTTA 1ZX6A 2DL8A 1NYFA 1AWOA 2X3XD 1SEMA 1OOTA 2ROLA 4ESRA 3M0TA 2KXDA 1M3CA 2KGTA 1NYGA 1OPKA 2I0NA 2J06A 2ENMA 2JTEA 2GTJA 4X1VA 2EYWA 1CKAA 1NM7A 1TG0A 4CC2A 2SEMA 2CT3A 2EQIA 1UFFA 2EYYA 3ZL7C 2RPNA 2CUDA 2CDTA 2EGAA 4OMQA 1W1FA 1QKXA 3ULRB 1U3OA 2JMAA 2M0YA 1BB9A 4RTWA 2YUNA 2K2MA 1T0HA 2ABLA 3I35A 2KYBA 1ZBJA 4F17A 4M4ZA 2K6DA 3EHQA 1N5ZA 2JW4A 2A28A 2A08A 2J7IA 1BBZA 1GBRA 3NGPA 1ARKA 1HSQA 1QCFA 4RTZA 1RLPC 2FEIA 2YUOA 2HBWA 1WIEA 4DEYA 2H8HA 2RQRA 3RNJA 2KR3A 1UUEA 4ORZA 2LCSA 2FG0A 2GBQA 3REBB 2EPDA 1CSKA 2LJ1A 4JJBA 2AZSA 2D8HA 3UATA 2EVRA 2GTOA 1X69A 2RF0A 1PNJA 2SRCA 1GBQA 2L3QA 1I0CA 5IH2A 4ZNXA 2FRWA 2P4RA 3R6NA 3U23A 2L3PA 2EW3A 2W10A 5IHKA 1YWPA 2L3SA 1J3TA 2J6FA 2HCKA 2B86A 2ESWA 1E6GA 1PRLC 1NLPC 3NHNA 3FJ5A 2FRYA 3QWYA 4J9IA 5GJWB 2RMOA 1QWFA 2LQWA 1VYVA 4K11A 2ED1A 4LE9A 1HJDA 2KE9A 2AKLA 1WA7A 2RQUA 4CC3A 3C0CA 1KIKA 2K9GA 4OMMA 1M3BA 1NLOC 3M0QA 1B3QA 1WDXA 1G2BA 1X43A 2JXBA 1YCSB 2K3BA 2EKHA 3UF4A 4HVWA 2LP5A 1SRLA 4LNPA 4J9CA 1I1JA 4QT7A 1E6HA 2L2PA 2A37A 2NUZA 4KRTA 2O31A 2DILA 2LNHB 4J9BA 3PE0A 1E7OA 3M0PA 1MUZA 1T3SA 2L0AA 1JXMA 1W70A 1EFNA 3EG1A 5FW9A 3VRZA 4IIMA 2LJ3A 4Y92A 2LMJA 2F2XA 4HXJA 1FMKA 4OMPA 2GGRA 3IQLA 1K1ZA 1ZUYA 4JZ3A 2HSPA 3I5RA 4AG2C 2MCNA 4DEXA 1AEYA 1BU1A 1WYXA 2EYXA 2CUBA 1H3HA 4J9HA 1QWEA 1QLYA 3I5SA 1ZLMA 3VS1A 2JS0A 2VWFA 2DRKA 1NEBA 5I22A 4LUDA 2CREA 1YP5A 1UECA 2KNBB 4IIOA 4RUGA 2HDAA 1WI7A 3NPFA 1UHCA 1MV3A 4OMOA 1LCKA 2MIOA 2DLPA 4HCKA 3VRYA 1AWWA 2KEAA 3H41A 2J05A 1Y57A 4Z89A 1X6BA 1X27A 2CH4A 1AWJA 3EGUA 3M0SA 2O9VA 2CT4A 1X6GA 3THKA 2AK5A 2V1QA 1VYUA 4LUEA 1H8KA 1GFDA 1JQQA 3UA6A 2RQVA 3KFVA 2BZ8A 2PTKA 3H0FA 1AZGB 1SPKA 2C0TA 1TUCA 5ECAA 2PZ1A 1UG1A 3VS5A 2DA9A 2LX7A 2J6KA 2J6OA 1GCPA 3GBQA 2XMFA 1AVZC 4RTXA 3QWXX 2O9SA 1GL5A 2C0IA 2DF6A 4AG1C 3VS2A 4RTVA 1T3LA 3I9QA 4WCIA 1ZSGA 5GJVB 5IXBA 1BK2A 2DBKA 5L23A 2OAWA 2G6FX 4LN2A 3TVTA 2QDLA 4AFQC 3RBBB 1NG2A 1KSWA 1YWOA 1FYNA 2K79A 2BZXA 2KBTA 2O2OA 2DL7A 2OJ2A 3SHWA 1AD5A 2YDLA 2HEQA 1SSHA 4RTYA 4HVVA 4JZ4A 4J9GA 2JM9A 1K4US 4R0KA 1UJYA 1YNZA 3CQTA 1ZUKA 1SHGA 1NEGA 2DL5A 2X3WD 3VS3A 2DL4A 2EYZA 4J9DA 1PHTA 2AKKA 3NMZC 4CC7A 2FO0A 1PWTA 3VS4A 4F14A 2DM1A 2KXCA 1M3AA 1VA7A 3SEMA 2M51A 2ROTA 2MOXA 2YUPA 5FWCA 5I11A 1MV0B 1RLQC 1GCQC 1UHFA 2AZVA 2D1XA 4FSSA 5IXFA 4Z8AA 2DVJA 2PNIA 2OI3A 2DRMA 2RN8A 4AFUC 1Z9ZA 2DX1A 2O88A 1WX6A 2FPFA 1RI9A 4J9FA 2VVKA 1KJWA 2FPEA 4D8KA 2GNCA 3EHRA 1U06A 1UDLA 2CSIA 1GFCA 1QKWA 1GRIA 3EG2A 1K0XA 4J9EA 3VS6A 1JXOA 3PVQA 5HCKA 1X2QA 2BZYA 1M27C 1WFWA
chains in the Genus database with same CATH superfamily
1RAIB 2DBMA 2E70A 2GF7A 4C8QA 1OV3A 4NS5A 4AFZC 2V8KA 1YCYA 3M0UA 2DTIA 3MCAB 2JVVA 1EIFA 4C0GA 3JCMP 1AWXA 1WQWA 4RCCA 1VQ5Q 2DJQA 1M8MA 2E41A 4KUDK 5GAN5 3RR6A 5KE3A 2QEXA 3MEVA 4EIKA 3CC7T 3ME9A 1RUWA 1UJ0A 3CMEQ 4M7DA 3BE3A 1K9MR 3RKXA 1M90R 4OB2B 5GAN6 4XU0A 1QQJA 3NTIA 3V7SA 1IO6A 4D8DA 4PJOE 5KCHA 4X9CA 5GAN8 3S3MA 4M7AG 3QYGB 5KE2A 2HAXA 2PU9B 5IHIA 2D8JA 1AOJA 3GP8A 1YBYA 4DA4A 1SRMA 2K3YA 2I2LA 2K5IA 3PIPA 1PRMC 3VS0A 2KRMA 2Y90A 4PLIA 3EFOB 2M1HA 2RI2A 4E7SA 4C0DB 5KCOA 3QJ6A 1VQ5A 5DM7R 1ZSZB 1VIEA 2CSQA 3LWHA 4GBQA 1M1GA 1PM3A 1Q86R 3CMEA 3H0IA 3GF5A 4E6RA 5M9OA 1JEGA 2YT6A 4X9DA 1YHQT 1YI2T 4LD9K 1QCOA 1NZ9A 1ABQA 2QGFB 2CZ0B 2O4XB 3CXCP 2WACA 3OYAA 4E7LA 1K0SA 4E7ZA 2FPDA 2V1RA 3HPWA 1IGQA 5GMKe 1OQKA 3G4SQ 4GLMA 4PFOA 4RMOA 1K9MC 2A7YA 3HHTB 1VQOT 1H92A 2DTOA 1N9RA 4PK4A 1VQ8Q 1PKTA 4XTUA 2OTLT 4PJNA 1U5SA 2IIMA 3A8MB 1WXTA 4C8QF 2BTTA 1ZQ1A 1LPLA 2X3XD 1OOTA 3QJYA 1WJRA 1M3CA 4M77A 2RK2A 5KH6A 5LJ5j 2ZAEA 4XU1A 3L42A 4CC2A 3G4SA 1WZOA 5CK9A 2CT3A 2QK0A 3A1PA 4JRIA 3X24B 5FLXE 4M7DF 3H9NA 3ULRB 2OAUA 2YUNA 1QW1A 1T0HA 5GMKi 3CCRT 1VQ8A 2XIDA 5C6SA 4LDXA 1LOJA 4F17A 2HBPA 2H3EB 2K6DA 4XK8E 1VQMT 2A08A 3EGDB 2HNIA 2J7IA 3OYIA 1GBRA 2XKOC 3JSCA 5KYXB 5J26A 4ANJA 1QCFA 5A2QE 2FEIA 4M78E 4BI4A 5LJ5h 4C8QG 4EPCA 2O01E 4NOYA 3V7CA 4IUTA 3VU3C 4JRKA 4ORZA 2D9TA 2GBQA 1CSKA 4DBHA 1R0BG 2D8HA 3UATA 4FYVB 3PTAA 2XI9A 2RJCA 3FIFA 2SRCA 3H6ZA 2L3QA 1HK9A 2HSEB 2PVOB 2EAYA 2FRWA 2P4RA 3R6NA 2EJGA 1RAFB 3ZBDA 5FRNA 1NJIR 2YWWA 2W10A 4M7DG 1YWPA 2F1LA 3GOXA 1KD1R 3JCMh 5FU7C 2VGMA 1IRXA 1PRLC 3HP9A 1D09B 3QWYA 1YIJT 2RMOA 1VYVA 3CPWS 3LW5E 4E47A 3RKWA 2KE9A 5GAMh 2YRCA 1WA7A 2RB6A 3BW1A 5GAOn 3CCLQ 1KQSS 1M3BA 4BDZA 1B3QA 2YLBA 4BY6C 3V8KA 3CEYA 2K3BA 3UF4A 2AIRB 1F1BB 4AMCA 2NUZA 3FLGA 4KRTA 2DILA 4N4HA 4ATOA 1E7OA 4LDWA 3VUZA 2MYSA 1H3ZA 2EKOA 2WSCE 1Q7YR 1ZSZA 2DZCA 4Y92A 3TCJA 4DBRA 2F2XA 4M77F 1P92A 1KC8U 2QASA 2JNGA 4XU2A 2HSPA 1VQ4Q 3I5RA 4L59A 5LJ3h 2Z0WA 2H3JA 2CUBA 3CCLA 4EMHA 1I8FA 1ZLMA 3G71Q 2VC8A 3CCJT 1NJIC 2P4TA 3JCMg 2VWFA 5LJ5f 2VV5A 2L89A 1RACB 2QQBA 5I22A 1VQ7T 3MEUA 1Q81R 1M1KR 2CP6A 1S72T 1VQ6T 5GAMg 2CP7A 2JUFA 1UHCA 3QPHA 5CVIA 1JRIA 1LCKA 1R8OB 4JLGA 1AWWA 1YFNA 1Y57A 4M7AD 1X27A 1AWJA 3EGUA 3QIIA 2CT4A 2QQ9A 1VQ4A 1H8KA 4M77G 2QGGA 3V8LA 3CC7Q 5A0DA 1SG5A 1YJ9T 1PD1A 1N8RC 5GANh 4PFZA 4PJOA 1UG1A 3G71A 3FDRA 2LX7A 5CKHA 2J6KA 2M0OA 4B6MA 2X4YA 3P8DA 3CCET 3QWXX 2O9SA 1Y96B 2C0IA 4C92B 3VS2A 1QVGA 5FRMA 3OS5A 4WF2A 1WHKA 1ZSGA 4IURA 4N4IA 4HKEA 5GJVB 1OI1A 3PFSA 5LJ3g 2DBKA 1G5VA 5L23A 2OAWA 4AFQC 2EYQA 5HK3A 3LX7A 4II1A 2KBTA 2O2OA 3ZFJA 3A8LB 4IKFA 2DL7A 2OJ2A 3SHWA 2D0QB 2PUOB 1AD5A 3E9FA 2OTJT 2HEQA 3EGDA 4J9GA 1IB8A 1YNZA 3CC7A 3TEEA 1M1KC 1NE8A 1NEGA 4JLIA 2X3WD 3HL8A 3Q1JA 1N6AA 1YHQQ 4J9DA 1PHTA 3G6ET 1YI2Q 4QW2A 5I2MA 4TVRA 1VA7A 5DLQE 2BE9B 1RLQC 1VQPT 2K3XA 1UHFA 2D1XA 3RDVA 2DVJA 2RN8A 5GANg 1Z9ZA 3CCMT 1WX6A 2XDPA 3LWIA 2BKDN 1VQOQ 4EMKC 4C5EA 1PSEA 1UDLA 1GFCA 4XTYA 3SFMA 4J9EA 2OTLQ 4MMKA 1JXOA 3PVQA 4MMLA 2ZPBB 5LL6S 4MZMA 1YHQA 3R6OA 1VYTA 3JCMb 1YI2A 4JJCA 2V8IA 2EJ9A 2RO0A 2A3LA 2KRNA 1OPLA 1M30A 2IPOB 4OGCA 1OU8A 2RQWA 3OS0A 1UTIA 2DE0X 1QVPA 3MPUB 1MGQA 4IUUA 3JCMJ 1PKSA 1ABOA 4C0DC 2EGEA 2RNAA 3BDLA 3SWNA 4FM4B 4Z88A 2KRSA 5KYYB 3CMAT 4C8QD 2CH4W 3O5ZA 2YUQA 1VQOA 2GFUA 4UC4A 4PJOF 1OX8A 1KQ2A 4PL6A 4JJNK 4BD3A 2D0NA 3CCRQ 3TSWA 2OTLA 1MMDA 1D1CA 2CP5A 2OX7A 1YJNT 3E2UA 3PVLA 1VQMQ 1DJ7B 2YRVA 4M78A 3JV3A 3CPWA 5EC7A 1CKBA 1G3WA 3H8ZA 1YN8A 4PNOA 2DXCA 3MHXA 4MDWA 4M7DD 1KFZA 1EX4A 3M0RA 3EG3A 1B07A 1KQSA 2PUKB 4J5YA 3PMIA 2JN0A 1RL2A 2V8JA 3O8VA 1M8VA 2WSEE 2E5KA 1IHWA 3RUXA 4A4FA 1K9MU 2X35A 2LZ6B 1TUDA 3ZEHA 1M90U 4M77B 3HSBA 3CCRA 4BI3A 2KYMA 4JJDA 3GNFB 1G83A 2GQIA 2RQTA 4NL3A 3CC4T 1VQMA 3L2VA 4RTTA 1YIJQ 1Y0MA 2DL3A 1M1FA 1TU0B 1W4SA 3M57A 1TXQA 4B9WA 2CP2A 4V2SA 1TSFA 1XJWB 3I56T 1Y96A 4C92A 2JOYA 2DFUA 4OMNA 3JB9F 2RHYA 3UDCA 1MNDA 4HVUA 2L3RA 2KT8A 2YSQA 5I21A 5IHNA 4J7IA 1X2KA 2VASA 4C5GA 1OEBA 4ZTFA 3PNWC 2E6ZA 1YIJA 4ESRA 4BACA 3KUFA 2ZPFB 1OPKA 1D3BA 2FHDA 5DY9A 4X1VA 2EYWA 1CKAA 1NM7A 2SEMA 3E19A 3JAME 3OYFA 1HXDA 2EYYA 3DB4A 3V7RA 1BI0A 3CCJQ 2EGAA 1K73R 4OMQA 2HD0A 3JCMV 4RTWA 1M2VA 4WTOB 1TH7A 1VQLT 1VQ7Q 2E12A 3I35A 1O9SA 3VUBA 2C06A 4M77D 2ZCFB 1QP2A 3MO8A 5CQXA 3JB9G 3EHQA 4M78F 1S72Q 1VQ6Q 2RK1A 4M75E 5GMKl 1UGSB 3OYLA 4E7HA 3UWNA 3OBWA 3A8OB 3D7SB 1WHJA 1BKBA 5CKBA 1WIEA 2COWA 3TREA 3SDZA 1LVKA 4M7AC 3RNJA 1UUEA 4JJBA 2EVRA 3NTKA 4JS4A 2RF0A 3OMCA 3OSVA 1TUGB 1PNJA 4JDSA 2E3IA 2QQAA 4J83A 3CCJA 1Q82R 1YJWT 5IH2A 1SF9A 3OYKA 3C94A 3U23A 2XDBA 4KGZB 2EW3A 2MMPA 3CCEQ 1VQ7A 2B86A 5LJ5e 1S72A 2DIQA 1NLPC 1VQ6A 1M5Q1 5GJWB 4D6WA 5KYYA 2M16A 2YXYA 1MMAA 4M78G 1QVGS 4FYXB 4JUVA 1IHVA 4CC3A 3I55T 3C0CA 2RJEA 2RJFA 4C92F 4OMMA 2OTJQ 1NLOC 3M0QA 4IUPA 1G2BA 3L2WA 1G3TA 4ZTJA 2KQWA 2DXTA 4HVWA 1ZHIA 3SD4A 5EG2A 4J6YA 4L6V5 1M90C 3JCMe 4QT7A 4P5NA 3JRZA 3G6EQ 4J9BA 4CI0C 1NJIU 2XICA 3M0PA 4E7IA 3CCEA 4FL6A 2L0AA 4F7UE 1JXMA 5GAMe 5FW9A 2VYTA 2K5FA 1VQPQ 4HCBA 4HXJA 4M75B 4JS5A 4OMPA 4PJOB 5AT1B 2EQJA 2GGRA 1ZUYA 3CPFA 3CCMQ 4AG2C 3X28B 3INZA 4DEXA 3F70A 1X6OA 2X4WA 3CCQT 3QXEB 1KQSP 2OTJA 3VS1A 3L2ZA 4Y91A 1Q86C 2HL5C 2DRKA 1OYXA 2JJ9A 3M55A 4C92G 1MHNA 1QCNA 4LUDA 3LGLA 1YP5A 2EIFA 1UECA 2KNBB 1N8RU 4OB0B 1Y7XA 3G6EA 1WI7A 2LQ8A 3EG9A 4O6JA 1MV3A 1N9SA 2BE7D 4L5GA 2LTOA 1Q7YU 5LJ3e 4JRPA 2KEAA 1VQPA 4Z89A 3M0SA 4RKUE 3CCST 2V1QA 3CCMA 1VYUA 4LUEA 2RQVA 3CMAQ 2ZPHB 5GAMj 1WJSA 2PTKA 4C8QC 3H0FA 3P8HA 1AZGB 2C0TA 1TUCA 3CXCS 2FVUA 4A4KA 1FMVA 3HTRA 1YJNQ 4C5IA 3FEOA 1FMWA 2QXFA 1Q81U 4QQDA 3OYEA 2DF6A 5D7UA 1M1KU 1T3LA 2HKQB 2QDYB 4BE1A 1O75A 4LD6A 4LN2A 5J39A 3MEAA 4FCYA 4M7DC 4PJOD 2FZKB 4EMGA 3CD6Q 3C12A 5GANe 1SSHA 1BYMA 2WSFE 3MP6A 5L8RE 1K4US 4YTLA 3CMAA 4Y28E 3E1SA 4PJLA 5LJ3j 5D6WA 1OX9A 1ZUKA 2K2VA 8AT1B 3HRUA 3HFNA 4ELZC 2DL5A 4EMKA 1K8AR 3VS3A 1BCMA 2DL4A 4DOWA 2AKKA 4CC7A 3GIBA 2FO0A 1PWTA 1YJNA 2QQSA 4N0AA 2KXCA 4FYYB 3S3OA 2M51A 2YUPA 2MOXA 5FWCA 1GXIE 1MV0B 4LDVA 3SWNB 1WPYA 2KAFA 1XTDA 3RESA 3QUIA 2R5MA 2DO3A 2AZVA 4FSSA 2VB6A 4Z8AA 3RIRA 2OI3A 2HL3A 3EAEA 2DX1A 2P84A 1RI9A 5IN1A 2F5TX 4KUIA 2VVKA 1KJWA 3LH0A 3I56Q 3X20B 4D8KA 3CD6A 4M78B 3EG2A 2EQKA 1WFWA 1G3YA 5GAN2 3M9QA 3EFRA 1KD1C 5GMKm 1Y71A 3BDUA 1YITT 1I81A 5GANj 2K5LA 2F2WA 1AZEA 3EG0A 2EBPA 3CC4A 4OB3B 3DB3A 5FU6B 3URGA 3JB9D 1JJ2S 1VQ5T 1KG1A 3M5AA 3CC2T 2ZZDA 4A4GA 5D6XA 1U1SA 2XD0A 1HD3A 3M54A 4J8OA 2HQXA 4BI8B 3I56A 2FB7A 4M7DE 5D6YA 3J81E 1K9AA 3JCMf 3PMTA 2KDSA 1VQLQ 4M75A 1XOVA 1WLPB 3LH5A 2CP0A 1M2OA 1NPPA 3QZ5B 4M77C 2RI3A 2KT1A 5GAMf 1RI0A 1Q7YC 2CZ7B 1V1CA 2DJZA 2F2VA 2IG0A 3CCVT 4J6XA 3UA7A 2X4XA 3OYYA 2EGCA 4J7FA 2PVGB 1LNXA 3WVEB 1GCQA 1T0JA 4M78D 2QA4T 1YJWQ 4NL2A 2ECZA 1Q81C 1VQLA 1D3BB 2VXEA 2PVDB 2RJDA 4MZPA 2JT4A 8ATCB 1BIBA 4CC4B 3LYIA 5GAOl 1W2BS 2KVQG 5LJ3f 2DZ9A 3S3NA 1RAEB 2RI5A 2BIVA 2EFIA 3G4ST 1WNLA 4BE2A 5FWBA 1BI2A 4FSXA 1M2VB 3A5ZB 1WXBA 1X01A 3WXMB 3FRNA 1VQNT 3I55Q 1OU9A 3OYBA 2CZ1B 2A36A 2CP3A 2BUDA 5IT9E 2HZYA 1PC0A 4A4EA 5GAOq 3E9GA 2DTHA 1YJWA 5FU7B 2K7AA 4F7UA 2DK3A 2KROA 1ZX6A 3P8BB 2DL8A 2NUTB 3ER0A 1AWOA 1SEMA 4C92D 2K57A 2KGTA 1LJOA 2QTXA 1NYGA 4FW2A 4E7JA 3PGGA 2J06A 1I5LA 2ENMA 1ZA2B 2GTJA 4BY6B 4C0FA 5GANf 1PG5B 1UFFA 2XU8A 3I55A 2RH2A 5GAOp 4OGEA 3CCQQ 2JTFA 3OYHA 3CXCA 2CDTA 5KYWB 1AT1B 2X4JA 4QKUA 2M0YA 3HRSA 3FJPA 1ZSZC 2K2MA 4M75F 2ABLA 2KYBA 1XNIA 3EH1A 3G1JA 4M4ZA 2CYZB 7AT1B 1N5ZA 2DD4A 2JW4A 1OZ3A 4FIBA 1BBZA 3NGPA 1ARKA 2DAQA 5CR2A 3GNGA 2YUOA 2ZPIB 2HBWA 2K4YA 4DEYA 2H8HA 4VUBA 3CCSQ 2HKNA 2KR3A 3OSSC 2ZGWA 2RHUA 2LCSA 2FG0A 2EPDA 3C95A 2GTOA 3OYJA 5KYNA 2EQUA 3T9NA 3CCQA 1KQ1A 1I0CA 1K73U 3DLMA 1FWZA 4KH0B 2RHXA 2L3PA 4DOVA 1PCXA 4HA8A 3G7ZA 2L3SA 1SSFA 3QSUA 2J6FA 1J3TA 2DKGA 2R58A 2DEUA 3JB9J 2ESWA 3EFSA 2R5AA 3NHNA 4M75G 3FJ5A 2FRYA 4J9IA 4PJOG 1QWFA 3MJXA 4QVDA 4K11A 1WGSA 2ED1A 2QYZA 2F69A 3OBYA 1WHMA 2XK0A 4E2FB 2YLCA 2YHTA 2DETA 3CCSA 4FU6A 2XHCA 1KIKA 2K9GA 3CCUT 4PJJA 4GLKA 1WDXA 3EG9B 2JXBA 1YCSB 2EKHA 1MMNA 4PKCC 2LP5A 1VQ9T 3HRTA 4LNPA 4J9CA 4F7UF 1E6HA 2L2PA 2A37A 2LNHB 4A4HA 1MUZA 1T3SA 1Q86U 3OYGA 5CAIA 2E10A 1EFNA 2LJ3A 3OS2A 1JJ2A 3L1AA 3OB9A 1WHGA 4BE0A 4IUVA 1VQKT 2DEQA 1K1ZA 1TOVA 2E3HA 1QVGP 4PJMA 2R57A 5GAN7 1AEYA 1BU1A 2D6FA 2EYXA 2YRDA 1QWEA 2COZA 2JS0A 4OMFB 3VJPA 4X34A 1QP3A 3QDRB 2GCXA 1KK7A 4IIOA 4KGVB 3M4YA 1YITQ 2HDAA 2IVWA 2B8AA 1AHJB 2LCCA 2LQKA 1RAGB 3AT1B 3NPFA 4OMOA 4F7UG 1V29B 1KHIA 3FC3A 3VRYA 4FT4A 2J05A 2VXFA 2FZGB 2P0QA 4ZGJB 1TS9A 4R56A 3CC2Q 2O9VA 4EMKB 1X6GA 1X75C 2AK5A 1ZBXA 1FX7A 1JQQA 3UA6A 1NBEB 3KFVA 6AT1B 5CKFA 2NUTA 2DERA 1QVFS 2QG9B 5ECAA 2PZ1A 1D0ZA 2DA9A 4XTVA 3JCMc 2QQRA 1YJ9Q 3GBQA 4RTXA 4RCBA 3OS1A 3UT1A 1W2BA 3VV0A 5GAOm 1GL5A 5DLOA 4RTVA 5KYUA 3OW2S 1YITA 5IXBA 3N5BB 4FT2A 3SWNC 3CCVQ 5KYWA 2PQWA 2G6FX 3MEWA 1JBMA 4KGXB 4LXCA 3M58A 3DLLA 1FYNA 3CC2A 1IREB 2MWPA 2YDLA 2RHIA 2Y4YA 3QHSA 3M56A 4OB1B 4JZ4A 1K73C 4M78C 4R0KA 1UJYA 2QA4Q 2DIGA 2EQMA 5C0MA 3QKJA 1YJ9A 1NPRA 3VS4A 1WHLA 2DM1A 1M3AA 3SEMA 2E1HA 4XQ3A 1KD1U 3SB2A 3EGXA 2CS7A 5FU6C 5IXFA 3CCVA 2PNIA 4AFUC 1TTHB 1VQNQ 1U1TA 3BFMA 4KT0E 3CPWP 1G8XA 2FPEA 3EHRA 2CSIA 1QKWA 3CBOA 1Q82C 1VUBA 1K0XA 3VS6A 3KBGA 5HCKA 2QA4A 1Y07A 2BZYA 2LRQA 4LDYA 1VOMA 1K8AU 4M7AE 1SHFA 2DMOA 1A0NB 3VS7A 2FZCB 4BB7A 1B34A 4A53A 1S1NA 5HY6A 3CBMA 2DYIA 1UGVA 1I07A 2KK4A 1EZZB 1QMCA 3REAB 4XAXB 4C92C 3VKIA 2C0OA 2RHZA 2NUPB 3H0HA 4E7KA 2HMAA 1JU5C 2ED0A 1VQNA 1N27A 4ZN3A 4OMLA 1C1AA 3PT9A 4A63B 5GMKj 4JPBW 2MPXC 5GAN3 3LLRA 2G3RA 4QQ6A 5CIUA 1Z9QA 1MNEA 2ZPEB 2M9UA 3HFOA 2W0ZA 5FROA 1BIAA 2X9HA 2NLUA 1UGQB 5I2SA 3QZ9B 1D1AA 2LQNA 1D0XA 1WXUA 3A98A 2LJ0A 2DNUA 4OF1A 3AHUA 2QAZA 3META 4ZGDB 1WQ7A 1RADB 2KY9A 3RKYA 3RMSA 1RAHB 4F16A 1M4ZA 2JM8A 1UE9A 1K76A 5CKEA 4M75D 4F7UB 1JJ2P 2KI7A 3MP8A 5GMKh 2FYKA 3QO3A 2AHJB 1C0MA 4KULA 4O5VA 9ATCB 2DYBA 3OMGA 4ZN1A 3DKMA 1JO8A 1W6XA 5CO7A 3TSZA 2E65A 1B7TA 2NWMA 5A0GA 1IZ6A 3VYHB 1MMGA 2VKNA 4M7AB 4DBQA 4OP0A 4AFSC 3CC4Q 1ZUUA 3OYMA 1D0YA 4XTZA 4Z02A 2QEXT 3L2UA 2LVMA 5J3BA 3CCUQ 3NFCA 4C92E 3TU4K 4XTWA 5HKCA 5GAN4 1N8RR 1VQ9Q 2GQVA 5LJ5g 3EFOA 3KXTA 4C5HA 2JS2A 3MKDA 4IUQA 4RTUA 2HQEA 2JMCA 1NYFA 4C0ZA 1FXXA 2ROLA 4C8QE 1W2BP 3M0TA 2KXDA 4BUGA 1BCOA 2X51A 1UGRB 2I0NA 3C4SA 4BDYA 5GAOr 3JCMX 1VQKQ 2JTEA 3PIOA 1C6VX 3UPUA 4PLLA 2O4XA 4ME7A 1TG0A 1I5OB 4OVAA 4J6WA 2EQIA 3OYNA 4HT8A 1QVFA 3ZL7C 2RPNA 3CCUA 2CUDA 3X25B 3CMET 1W1FA 1QKXA 2L5QA 1U3OA 2JMAA 3ASKA 1BB9A 1K8AC 1H641 4R55A 2VGNA 4F04B 1VQ9A 1ZBJA 3OW2A 1JB0E 2XG8D 3QYHB 2A28A 3TQ7P 3JCMQ 2NYSA 1HSQA 2LT4A 1I4K1 1RLPC 4RTZA 1UEBA 4DBFA 5AYFA 2RQRA 3VYGA 3RMQA 4ZGEB 1Q95G 1VQKA 1TWBA 3REBB 1D1BA 2LJ1A 2AZSA 4MZTA 3M59A 3J80E 1X69A 2Y4XA 1OULA 1GBQA 3JB9H 2CZ6B 3OYCA 4GY5A 2MWOA 4ZNXA 5LJ5d 2NUPA 2EWNA 4LDUA 2E64A 5IHKA 2L8DA 3QG1A 2HCKA 2LT1A 2CGHA 1E6GA 3S6WA 2LQWA 1KC8R 2JZ2A 3JCMW 4LE9A 1HJDA 2AKLA 3M53A 2RQUA 4C8QB 2KSSA 5KYXA 2VUBA 2DD5A 3JCMd 2HQHA 2DVEA 1X43A 1HYOA 4JRQA 1VQ8T 4PFPA 1SRLA 1I1JA 2LNVA 3FB9A 5GAMd 5CCAA 4FYWB 2O31A 4HCCA 3PE0A 4RG8A 1BI1A 1M9SA 3OQ5A 2LX9A 3OY9A 1W70A 4M7DB 3EG1A 3VRZA 4IIMA 1ZA1B 2LMJA 3HKSA 2FL7A 1FMKA 2ZPGB 2MAMA 2A0FB 3IQLA 4JZ3A 2MCNA 4M77E 2JTMA 1WYXA 2MI6A 1H3HA 4J9HA 2RM4A 5KYUB 1WHHA 2P0KA 1QLYA 3I5SA 2ATCB 2LDMA 4N0AC 4M7AA 2EJFA 2M02A 1NEBA 3BY7A 3CBPA 2CREA 1PSFA 4QVCA 1IXDA 4RUGA 4QQGA 1VIFA 5LJ3d 1KC8C 5CKDA 2CKKA 4ELYC 1V76A 1U8RA 2MIOA 2RD1A 2KMTA 2DLPA 4HCKA 5HK0A 3H41A 3QBYA 1X6BA 4EDUA 2CH4A 2MK5A 1R0CB 3THKA 5A0LA 1G3SA 3A8HB 1GFDA 1IGUA 2BZ8A 4DQ2A 3GPLA 1SPKA 1UB4A 3GLXA 2GFAA 3VS5A 3L2QA 3MP1A 2J6OA 1GCPA 3EGXB 2COYA 1BI3A 4XTXA 2XMFA 1AVZC 4CRIA 2P0PA 4AG1C 3V8JA 4RG2A 3I9QA 4WCIA 3A8GB 4QVZA 4B9XA 1BK2A 2MF2A 2V26A 4AT1B 5GANd 3TVTA 2QDLA 3RBBB 2DXUA 3CD6T 2LC4A 1RAAB 2E6NA 1NG2A 1KSWA 1YWOA 4HCZA 3L2RA 2K79A 2BZXA 2DPPB 2F5KA 4Q5WA 4M75C 1KHCA 1OZ2A 3CCLT 4PJOC 1B34B 4KH1B 2XDDA 3NTHA 4RTYA 4HVVA 2DXBA 2E4HA 1PD0A 2JM9A 2RA2A 4FW1A 2QI2A 3CQTA 1SHGA 2EYZA 4A54A 1QVFP 5CQYA 3NMZC 2QTVA 4F14A 1WJQA 1UGPB 1Q82U 1ACMB 1R77A 2ROTA 5I11A 3OW2P 1GCQC 3X26B 1SKUB 2AT1B 2DRMA 2LCLA 4XU3A 3M4GA 2O88A 2FPFA 1VQ4T 2QEXQ 3OA6A 4J9FA 3OYDA 5IAYA 3QDFA 4MDXA 2GNCA 3JB9I 1U06A 4KBMB 1XQHA 2E5QA 4M7AF 3G71T 4N4GA 1GRIA 3J7AF 3EH2A 3RERA 1X2QA 1M27C 1RABB 3WVDB 4HT9A 3LGFA
chains in the Genus database with same CATH topology
1SHFA 2DBMA 2DMOA 1A0NB 3VS7A 1VYTA 1S1NA 1UGVA 1OV3A 2F2WA 1I07A 4JJCA 1AZEA 4AFZC 3EG0A 2EBPA 3REAB 2KRNA 3M0UA 1OPLA 2C0OA 1M30A 3H0HA 2RQWA 1UTIA 2DE0X 1AWXA 1JU5C 2ED0A 1PKSA 2DJQA 1ABOA 1HD3A 2EGEA 1M8MA 2RNAA 4Z88A 2KRSA 4OMLA 4EIKA 4A63B 1RUWA 2CH4W 3O5ZA 1UJ0A 2YUQA 4JPBW 1K9AA 2D0NA 1Z9QA 3TSWA 2W0ZA 1IO6A 1XOVA 1WLPB 4D8DA 3LH5A 3PVLA 2KT1A 2LQNA 3JV3A 5IHIA 1WXUA 2D8JA 2LJ0A 3A98A 1AOJA 2DNUA 5EC7A 1CKBA 1V1CA 1SRMA 1YN8A 2F2VA 1PRMC 3VS0A 2KRMA 3UA7A 1KFZA 4F16A 3M0RA 2JM8A 3EG3A 1B07A 1K76A 1UE9A 2EGCA 1GCQA 1T0JA 2DYBA 2E5KA 2CSQA 4GBQA 1JO8A 1W6XA 3H0IA 2LZ6B 2ECZA 3TSZA 4E6RA 1JEGA 1TUDA 2YT6A 2KYMA 4JJDA 1G83A 2GQIA 2NWMA 2JT4A 1ABQA 2RQTA 4CC4B 2VKNA 4RTTA 1Y0MA 1K0SA 2DL3A 4AFSC 1ZUUA 2FPDA 2V1RA 5FWBA 4GLMA 1WXBA 2A36A 4OMNA 1H92A 1PKTA 4HVUA 2K7AA 1U5SA 2KT8A 2IIMA 2YSQA 5IHNA 2JS2A 1X2KA 4RTUA 1WXTA 2JMCA 1OEBA 2KROA 2BTTA 1ZX6A 2DL8A 1NYFA 1AWOA 2X3XD 1SEMA 1OOTA 2ROLA 4ESRA 3M0TA 2KXDA 1M3CA 2KGTA 1NYGA 1OPKA 2I0NA 2J06A 2ENMA 2JTEA 2GTJA 4X1VA 2EYWA 1CKAA 1NM7A 1TG0A 4CC2A 2SEMA 2CT3A 2EQIA 1UFFA 2EYYA 3ZL7C 2RPNA 2CUDA 2CDTA 2EGAA 4OMQA 1W1FA 1QKXA 3ULRB 1U3OA 2JMAA 2M0YA 1BB9A 4RTWA 2YUNA 2K2MA 1T0HA 2ABLA 3I35A 2KYBA 1ZBJA 4F17A 4M4ZA 2K6DA 3EHQA 1N5ZA 2JW4A 2A28A 2A08A 2J7IA 1BBZA 1GBRA 3NGPA 1ARKA 1HSQA 1QCFA 4RTZA 1RLPC 2FEIA 2YUOA 2HBWA 1WIEA 4DEYA 2H8HA 2RQRA 3RNJA 2KR3A 1UUEA 4ORZA 2LCSA 2FG0A 2GBQA 3REBB 2EPDA 1CSKA 2LJ1A 4JJBA 2AZSA 2D8HA 3UATA 2EVRA 2GTOA 1X69A 2RF0A 1PNJA 2SRCA 1GBQA 2L3QA 1I0CA 5IH2A 4ZNXA 2FRWA 2P4RA 3R6NA 3U23A 2L3PA 2EW3A 2W10A 5IHKA 1YWPA 2L3SA 1J3TA 2J6FA 2HCKA 2B86A 2ESWA 1E6GA 1PRLC 1NLPC 3NHNA 3FJ5A 2FRYA 3QWYA 4J9IA 5GJWB 2RMOA 1QWFA 2LQWA 1VYVA 4K11A 2ED1A 4LE9A 1HJDA 2KE9A 2AKLA 1WA7A 2RQUA 4CC3A 3C0CA 1KIKA 2K9GA 4OMMA 1M3BA 1NLOC 3M0QA 1B3QA 1WDXA 1G2BA 1X43A 2JXBA 1YCSB 2K3BA 2EKHA 3UF4A 4HVWA 2LP5A 1SRLA 4LNPA 4J9CA 1I1JA 4QT7A 1E6HA 2L2PA 2A37A 2NUZA 4KRTA 2O31A 2DILA 2LNHB 4J9BA 3PE0A 1E7OA 3M0PA 1MUZA 1T3SA 2L0AA 1JXMA 1W70A 1EFNA 3EG1A 5FW9A 3VRZA 4IIMA 2LJ3A 4Y92A 2LMJA 2F2XA 4HXJA 1FMKA 4OMPA 2GGRA 3IQLA 1K1ZA 1ZUYA 4JZ3A 2HSPA 3I5RA 4AG2C 2MCNA 4DEXA 1AEYA 1BU1A 1WYXA 2EYXA 2CUBA 1H3HA 4J9HA 1QWEA 1QLYA 3I5SA 1ZLMA 3VS1A 2JS0A 2VWFA 2DRKA 1NEBA 5I22A 4LUDA 2CREA 1YP5A 1UECA 2KNBB 4IIOA 4RUGA 2HDAA 1WI7A 3NPFA 1UHCA 1MV3A 4OMOA 1LCKA 2MIOA 2DLPA 4HCKA 3VRYA 1AWWA 2KEAA 3H41A 2J05A 1Y57A 4Z89A 1X6BA 1X27A 2CH4A 1AWJA 3EGUA 3M0SA 2O9VA 2CT4A 1X6GA 3THKA 2AK5A 2V1QA 1VYUA 4LUEA 1H8KA 1GFDA 1JQQA 3UA6A 2RQVA 3KFVA 2BZ8A 2PTKA 3H0FA 1AZGB 1SPKA 2C0TA 1TUCA 5ECAA 2PZ1A 1UG1A 3VS5A 2DA9A 2LX7A 2J6KA 2J6OA 1GCPA 3GBQA 2XMFA 1AVZC 4RTXA 3QWXX 2O9SA 1GL5A 2C0IA 2DF6A 4AG1C 3VS2A 4RTVA 1T3LA 3I9QA 4WCIA 1ZSGA 5GJVB 5IXBA 1BK2A 2DBKA 5L23A 2OAWA 2G6FX 4LN2A 3TVTA 2QDLA 4AFQC 3RBBB 1NG2A 1KSWA 1YWOA 1FYNA 2K79A 2BZXA 2KBTA 2O2OA 2DL7A 2OJ2A 3SHWA 1AD5A 2YDLA 2HEQA 1SSHA 4RTYA 4HVVA 4JZ4A 4J9GA 2JM9A 1K4US 4R0KA 1UJYA 1YNZA 3CQTA 1ZUKA 1SHGA 1NEGA 2DL5A 2X3WD 3VS3A 2DL4A 2EYZA 4J9DA 1PHTA 2AKKA 3NMZC 4CC7A 2FO0A 1PWTA 3VS4A 4F14A 2DM1A 2KXCA 1M3AA 1VA7A 3SEMA 2M51A 2ROTA 2MOXA 2YUPA 5FWCA 5I11A 1MV0B 1RLQC 1GCQC 1UHFA 2AZVA 2D1XA 4FSSA 5IXFA 4Z8AA 2DVJA 2PNIA 2OI3A 2DRMA 2RN8A 4AFUC 1Z9ZA 2DX1A 2O88A 1WX6A 2FPFA 1RI9A 4J9FA 2VVKA 1KJWA 2FPEA 4D8KA 2GNCA 3EHRA 1U06A 1UDLA 2CSIA 1GFCA 1QKWA 1GRIA 3EG2A 1K0XA 4J9EA 3VS6A 1JXOA 3PVQA 5HCKA 1X2QA 2BZYA 1M27C 1WFWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SHF A;  2DBM A;  2DMO A;  1A0N B;  3VS7 A;  1VYT A;  1S1N A;  1UGV A;  1OV3 A;  2F2W A;  1I07 A;  4JJC A;  1AZE A;  4AFZ C;  3EG0 A;  2EBP A;  3REA B;  2KRN A;  3M0U A;  1OPL A;  2C0O A;  1M30 A;  3H0H A;  2RQW A;  1UTI A;  2DE0 X;  1AWX A;  1JU5 C;  2ED0 A;  1PKS A;  2DJQ A;  1ABO A;  1HD3 A;  2EGE A;  1M8M A;  2RNA A;  4Z88 A;  2KRS A;  4OML A;  4EIK A;  4A63 B;  1RUW A;  2CH4 W;  3O5Z A;  1UJ0 A;  2YUQ A;  4JPB W;  1K9A A;  2D0N A;  1Z9Q A;  3TSW A;  2W0Z A;  1IO6 A;  1XOV A;  1WLP B;  4D8D A;  3LH5 A;  3PVL A;  2KT1 A;  2LQN A;  3JV3 A;  5IHI A;  1WXU A;  2D8J A;  2LJ0 A;  3A98 A;  1AOJ A;  2DNU A;  5EC7 A;  1CKB A;  1V1C A;  1SRM A;  1YN8 A;  2F2V A;  1PRM C;  3VS0 A;  2KRM A;  3UA7 A;  1KFZ A;  4F16 A;  3M0R A;  2JM8 A;  3EG3 A;  1B07 A;  1K76 A;  1UE9 A;  2EGC A;  1GCQ A;  1T0J A;  2DYB A;  2E5K A;  2CSQ A;  4GBQ A;  1JO8 A;  1W6X A;  3H0I A;  2LZ6 B;  2ECZ A;  3TSZ A;  4E6R A;  1JEG A;  1TUD A;  2YT6 A;  2KYM A;  4JJD A;  1G83 A;  2GQI A;  2NWM A;  2JT4 A;  1ABQ A;  2RQT A;  4CC4 B;  2VKN A;  4RTT A;  1Y0M A;  1K0S A;  2DL3 A;  4AFS C;  1ZUU A;  2FPD A;  2V1R A;  5FWB A;  4GLM A;  1WXB A;  2A36 A;  4OMN A;  1H92 A;  1PKT A;  4HVU A;  2K7A A;  1U5S A;  2KT8 A;  2IIM A;  2YSQ A;  5IHN A;  2JS2 A;  1X2K A;  4RTU A;  1WXT A;  2JMC A;  1OEB A;  2KRO A;  2BTT A;  1ZX6 A;  2DL8 A;  1NYF A;  1AWO A;  2X3X D;  1SEM A;  1OOT A;  2ROL A;  4ESR A;  3M0T A;  2KXD A;  1M3C A;  2KGT A;  1NYG A;  1OPK A;  2I0N A;  2J06 A;  2ENM A;  2JTE A;  2GTJ A;  4X1V A;  2EYW A;  1CKA A;  1NM7 A;  1TG0 A;  4CC2 A;  2SEM A;  2CT3 A;  2EQI A;  1UFF A;  2EYY A;  3ZL7 C;  2RPN A;  2CUD A;  2CDT A;  2EGA A;  4OMQ A;  1W1F A;  1QKX A;  3ULR B;  1U3O A;  2JMA A;  2M0Y A;  1BB9 A;  4RTW A;  2YUN A;  2K2M A;  1T0H A;  2ABL A;  3I35 A;  2KYB A;  1ZBJ A;  4F17 A;  4M4Z A;  2K6D A;  3EHQ A;  1N5Z A;  2JW4 A;  2A28 A;  2A08 A;  2J7I A;  1BBZ A;  1GBR A;  3NGP A;  1ARK A;  1HSQ A;  1QCF A;  4RTZ A;  1RLP C;  2FEI A;  2YUO A;  2HBW A;  1WIE A;  4DEY A;  2H8H A;  2RQR A;  3RNJ A;  2KR3 A;  1UUE A;  4ORZ A;  2LCS A;  2FG0 A;  2GBQ A;  3REB B;  2EPD A;  1CSK A;  2LJ1 A;  4JJB A;  2AZS A;  2D8H A;  3UAT A;  2EVR A;  2GTO A;  1X69 A;  2RF0 A;  1PNJ A;  2SRC A;  1GBQ A;  2L3Q A;  1I0C A;  5IH2 A;  4ZNX A;  2FRW A;  2P4R A;  3R6N A;  3U23 A;  2L3P A;  2EW3 A;  2W10 A;  5IHK A;  1YWP A;  2L3S A;  1J3T A;  2J6F A;  2HCK A;  2B86 A;  2ESW A;  1E6G A;  1PRL C;  1NLP C;  3NHN A;  3FJ5 A;  2FRY A;  3QWY A;  4J9I A;  5GJW B;  2RMO A;  1QWF A;  2LQW A;  1VYV A;  4K11 A;  2ED1 A;  4LE9 A;  1HJD A;  2KE9 A;  2AKL A;  1WA7 A;  2RQU A;  4CC3 A;  3C0C A;  1KIK A;  2K9G A;  4OMM A;  1M3B A;  1NLO C;  3M0Q A;  1B3Q A;  1WDX A;  1G2B A;  1X43 A;  2JXB A;  1YCS B;  2K3B A;  2EKH A;  3UF4 A;  4HVW A;  2LP5 A;  1SRL A;  4LNP A;  4J9C A;  1I1J A;  4QT7 A;  1E6H A;  2L2P A;  2A37 A;  2NUZ A;  4KRT A;  2O31 A;  2DIL A;  2LNH B;  4J9B A;  3PE0 A;  1E7O A;  3M0P A;  1MUZ A;  1T3S A;  2L0A A;  1JXM A;  1W70 A;  1EFN A;  3EG1 A;  5FW9 A;  3VRZ A;  4IIM A;  2LJ3 A;  4Y92 A;  2LMJ A;  2F2X A;  4HXJ A;  1FMK A;  4OMP A;  2GGR A;  3IQL A;  1K1Z A;  1ZUY A;  4JZ3 A;  2HSP A;  3I5R A;  4AG2 C;  2MCN A;  4DEX A;  1AEY A;  1BU1 A;  1WYX A;  2EYX A;  2CUB A;  1H3H A;  4J9H A;  1QWE A;  1QLY A;  3I5S A;  1ZLM A;  3VS1 A;  2JS0 A;  2VWF A;  2DRK A;  1NEB A;  5I22 A;  4LUD A;  2CRE A;  1YP5 A;  1UEC A;  2KNB B;  4IIO A;  4RUG A;  2HDA A;  1WI7 A;  3NPF A;  1UHC A;  1MV3 A;  4OMO A;  1LCK A;  2MIO A;  2DLP A;  4HCK A;  3VRY A;  1AWW A;  2KEA A;  3H41 A;  2J05 A;  1Y57 A;  4Z89 A;  1X6B A;  1X27 A;  2CH4 A;  1AWJ A;  3EGU A;  3M0S A;  2O9V A;  2CT4 A;  1X6G A;  3THK A;  2AK5 A;  2V1Q A;  1VYU A;  4LUE A;  1H8K A;  1GFD A;  1JQQ A;  3UA6 A;  2RQV A;  3KFV A;  2BZ8 A;  2PTK A;  3H0F A;  1AZG B;  1SPK A;  2C0T A;  1TUC A;  5ECA A;  2PZ1 A;  1UG1 A;  3VS5 A;  2DA9 A;  2LX7 A;  2J6K A;  2J6O A;  1GCP A;  3GBQ A;  2XMF A;  1AVZ C;  4RTX A;  3QWX X;  2O9S A;  1GL5 A;  2C0I A;  2DF6 A;  4AG1 C;  3VS2 A;  4RTV A;  1T3L A;  3I9Q A;  4WCI A;  1ZSG A;  5GJV B;  5IXB A;  1BK2 A;  2DBK A;  5L23 A;  2OAW A;  2G6F X;  4LN2 A;  3TVT A;  2QDL A;  4AFQ C;  3RBB B;  1NG2 A;  1KSW A;  1YWO A;  1FYN A;  2K79 A;  2BZX A;  2KBT A;  2O2O A;  2DL7 A;  2OJ2 A;  3SHW A;  1AD5 A;  2YDL A;  2HEQ A;  1SSH A;  4RTY A;  4HVV A;  4JZ4 A;  4J9G A;  2JM9 A;  1K4U S;  4R0K A;  1UJY A;  1YNZ A;  3CQT A;  1ZUK A;  1SHG A;  1NEG A;  2DL5 A;  2X3W D;  3VS3 A;  2DL4 A;  2EYZ A;  4J9D A;  1PHT A;  2AKK A;  3NMZ C;  4CC7 A;  2FO0 A;  1PWT A;  3VS4 A;  4F14 A;  2DM1 A;  2KXC A;  1M3A A;  1VA7 A;  3SEM A;  2M51 A;  2ROT A;  2MOX A;  2YUP A;  5FWC A;  5I11 A;  1MV0 B;  1RLQ C;  1GCQ C;  1UHF A;  2AZV A;  2D1X A;  4FSS A;  5IXF A;  4Z8A A;  2DVJ A;  2PNI A;  2OI3 A;  2DRM A;  2RN8 A;  4AFU C;  1Z9Z A;  2DX1 A;  2O88 A;  1WX6 A;  2FPF A;  1RI9 A;  4J9F A;  2VVK A;  1KJW A;  2FPE A;  4D8K A;  2GNC A;  3EHR A;  1U06 A;  1UDL A;  2CSI A;  1GFC A;  1QKW A;  1GRI A;  3EG2 A;  1K0X A;  4J9E A;  3VS6 A;  1JXO A;  3PVQ A;  5HCK A;  1X2Q A;  2BZY A;  1M27 C;  1WFW A; 
#chains in the Genus database with same CATH topology
 1RAI B;  2DBM A;  2E70 A;  2GF7 A;  4C8Q A;  1OV3 A;  4NS5 A;  4AFZ C;  2V8K A;  1YCY A;  3M0U A;  2DTI A;  3MCA B;  2JVV A;  1EIF A;  4C0G A;  3JCM P;  1AWX A;  1WQW A;  4RCC A;  1VQ5 Q;  2DJQ A;  1M8M A;  2E41 A;  4KUD K;  5GAN 5;  3RR6 A;  5KE3 A;  2QEX A;  3MEV A;  4EIK A;  3CC7 T;  3ME9 A;  1RUW A;  1UJ0 A;  3CME Q;  4M7D A;  3BE3 A;  1K9M R;  3RKX A;  1M90 R;  4OB2 B;  5GAN 6;  4XU0 A;  1QQJ A;  3NTI A;  3V7S A;  1IO6 A;  4D8D A;  4PJO E;  5KCH A;  4X9C A;  5GAN 8;  3S3M A;  4M7A G;  3QYG B;  5KE2 A;  2HAX A;  2PU9 B;  5IHI A;  2D8J A;  1AOJ A;  3GP8 A;  1YBY A;  4DA4 A;  1SRM A;  2K3Y A;  2I2L A;  2K5I A;  3PIP A;  1PRM C;  3VS0 A;  2KRM A;  2Y90 A;  4PLI A;  3EFO B;  2M1H A;  2RI2 A;  4E7S A;  4C0D B;  5KCO A;  3QJ6 A;  1VQ5 A;  5DM7 R;  1ZSZ B;  1VIE A;  2CSQ A;  3LWH A;  4GBQ A;  1M1G A;  1PM3 A;  1Q86 R;  3CME A;  3H0I A;  3GF5 A;  4E6R A;  5M9O A;  1JEG A;  2YT6 A;  4X9D A;  1YHQ T;  1YI2 T;  4LD9 K;  1QCO A;  1NZ9 A;  1ABQ A;  2QGF B;  2CZ0 B;  2O4X B;  3CXC P;  2WAC A;  3OYA A;  4E7L A;  1K0S A;  4E7Z A;  2FPD A;  2V1R A;  3HPW A;  1IGQ A;  5GMK e;  1OQK A;  3G4S Q;  4GLM A;  4PFO A;  4RMO A;  1K9M C;  2A7Y A;  3HHT B;  1VQO T;  1H92 A;  2DTO A;  1N9R A;  4PK4 A;  1VQ8 Q;  1PKT A;  4XTU A;  2OTL T;  4PJN A;  1U5S A;  2IIM A;  3A8M B;  1WXT A;  4C8Q F;  2BTT A;  1ZQ1 A;  1LPL A;  2X3X D;  1OOT A;  3QJY A;  1WJR A;  1M3C A;  4M77 A;  2RK2 A;  5KH6 A;  5LJ5 j;  2ZAE A;  4XU1 A;  3L42 A;  4CC2 A;  3G4S A;  1WZO A;  5CK9 A;  2CT3 A;  2QK0 A;  3A1P A;  4JRI A;  3X24 B;  5FLX E;  4M7D F;  3H9N A;  3ULR B;  2OAU A;  2YUN A;  1QW1 A;  1T0H A;  5GMK i;  3CCR T;  1VQ8 A;  2XID A;  5C6S A;  4LDX A;  1LOJ A;  4F17 A;  2HBP A;  2H3E B;  2K6D A;  4XK8 E;  1VQM T;  2A08 A;  3EGD B;  2HNI A;  2J7I A;  3OYI A;  1GBR A;  2XKO C;  3JSC A;  5KYX B;  5J26 A;  4ANJ A;  1QCF A;  5A2Q E;  2FEI A;  4M78 E;  4BI4 A;  5LJ5 h;  4C8Q G;  4EPC A;  2O01 E;  4NOY A;  3V7C A;  4IUT A;  3VU3 C;  4JRK A;  4ORZ A;  2D9T A;  2GBQ A;  1CSK A;  4DBH A;  1R0B G;  2D8H A;  3UAT A;  4FYV B;  3PTA A;  2XI9 A;  2RJC A;  3FIF A;  2SRC A;  3H6Z A;  2L3Q A;  1HK9 A;  2HSE B;  2PVO B;  2EAY A;  2FRW A;  2P4R A;  3R6N A;  2EJG A;  1RAF B;  3ZBD A;  5FRN A;  1NJI R;  2YWW A;  2W10 A;  4M7D G;  1YWP A;  2F1L A;  3GOX A;  1KD1 R;  3JCM h;  5FU7 C;  2VGM A;  1IRX A;  1PRL C;  3HP9 A;  1D09 B;  3QWY A;  1YIJ T;  2RMO A;  1VYV A;  3CPW S;  3LW5 E;  4E47 A;  3RKW A;  2KE9 A;  5GAM h;  2YRC A;  1WA7 A;  2RB6 A;  3BW1 A;  5GAO n;  3CCL Q;  1KQS S;  1M3B A;  4BDZ A;  1B3Q A;  2YLB A;  4BY6 C;  3V8K A;  3CEY A;  2K3B A;  3UF4 A;  2AIR B;  1F1B B;  4AMC A;  2NUZ A;  3FLG A;  4KRT A;  2DIL A;  4N4H A;  4ATO A;  1E7O A;  4LDW A;  3VUZ A;  2MYS A;  1H3Z A;  2EKO A;  2WSC E;  1Q7Y R;  1ZSZ A;  2DZC A;  4Y92 A;  3TCJ A;  4DBR A;  2F2X A;  4M77 F;  1P92 A;  1KC8 U;  2QAS A;  2JNG A;  4XU2 A;  2HSP A;  1VQ4 Q;  3I5R A;  4L59 A;  5LJ3 h;  2Z0W A;  2H3J A;  2CUB A;  3CCL A;  4EMH A;  1I8F A;  1ZLM A;  3G71 Q;  2VC8 A;  3CCJ T;  1NJI C;  2P4T A;  3JCM g;  2VWF A;  5LJ5 f;  2VV5 A;  2L89 A;  1RAC B;  2QQB A;  5I22 A;  1VQ7 T;  3MEU A;  1Q81 R;  1M1K R;  2CP6 A;  1S72 T;  1VQ6 T;  5GAM g;  2CP7 A;  2JUF A;  1UHC A;  3QPH A;  5CVI A;  1JRI A;  1LCK A;  1R8O B;  4JLG A;  1AWW A;  1YFN A;  1Y57 A;  4M7A D;  1X27 A;  1AWJ A;  3EGU A;  3QII A;  2CT4 A;  2QQ9 A;  1VQ4 A;  1H8K A;  4M77 G;  2QGG A;  3V8L A;  3CC7 Q;  5A0D A;  1SG5 A;  1YJ9 T;  1PD1 A;  1N8R C;  5GAN h;  4PFZ A;  4PJO A;  1UG1 A;  3G71 A;  3FDR A;  2LX7 A;  5CKH A;  2J6K A;  2M0O A;  4B6M A;  2X4Y A;  3P8D A;  3CCE T;  3QWX X;  2O9S A;  1Y96 B;  2C0I A;  4C92 B;  3VS2 A;  1QVG A;  5FRM A;  3OS5 A;  4WF2 A;  1WHK A;  1ZSG A;  4IUR A;  4N4I A;  4HKE A;  5GJV B;  1OI1 A;  3PFS A;  5LJ3 g;  2DBK A;  1G5V A;  5L23 A;  2OAW A;  4AFQ C;  2EYQ A;  5HK3 A;  3LX7 A;  4II1 A;  2KBT A;  2O2O A;  3ZFJ A;  3A8L B;  4IKF A;  2DL7 A;  2OJ2 A;  3SHW A;  2D0Q B;  2PUO B;  1AD5 A;  3E9F A;  2OTJ T;  2HEQ A;  3EGD A;  4J9G A;  1IB8 A;  1YNZ A;  3CC7 A;  3TEE A;  1M1K C;  1NE8 A;  1NEG A;  4JLI A;  2X3W D;  3HL8 A;  3Q1J A;  1N6A A;  1YHQ Q;  4J9D A;  1PHT A;  3G6E T;  1YI2 Q;  4QW2 A;  5I2M A;  4TVR A;  1VA7 A;  5DLQ E;  2BE9 B;  1RLQ C;  1VQP T;  2K3X A;  1UHF A;  2D1X A;  3RDV A;  2DVJ A;  2RN8 A;  5GAN g;  1Z9Z A;  3CCM T;  1WX6 A;  2XDP A;  3LWI A;  2BKD N;  1VQO Q;  4EMK C;  4C5E A;  1PSE A;  1UDL A;  1GFC A;  4XTY A;  3SFM A;  4J9E A;  2OTL Q;  4MMK A;  1JXO A;  3PVQ A;  4MML A;  2ZPB B;  5LL6 S;  4MZM A;  1YHQ A;  3R6O A;  1VYT A;  3JCM b;  1YI2 A;  4JJC A;  2V8I A;  2EJ9 A;  2RO0 A;  2A3L A;  2KRN A;  1OPL A;  1M30 A;  2IPO B;  4OGC A;  1OU8 A;  2RQW A;  3OS0 A;  1UTI A;  2DE0 X;  1QVP A;  3MPU B;  1MGQ A;  4IUU A;  3JCM J;  1PKS A;  1ABO A;  4C0D C;  2EGE A;  2RNA A;  3BDL A;  3SWN A;  4FM4 B;  4Z88 A;  2KRS A;  5KYY B;  3CMA T;  4C8Q D;  2CH4 W;  3O5Z A;  2YUQ A;  1VQO A;  2GFU A;  4UC4 A;  4PJO F;  1OX8 A;  1KQ2 A;  4PL6 A;  4JJN K;  4BD3 A;  2D0N A;  3CCR Q;  3TSW A;  2OTL A;  1MMD A;  1D1C A;  2CP5 A;  2OX7 A;  1YJN T;  3E2U A;  3PVL A;  1VQM Q;  1DJ7 B;  2YRV A;  4M78 A;  3JV3 A;  3CPW A;  5EC7 A;  1CKB A;  1G3W A;  3H8Z A;  1YN8 A;  4PNO A;  2DXC A;  3MHX A;  4MDW A;  4M7D D;  1KFZ A;  1EX4 A;  3M0R A;  3EG3 A;  1B07 A;  1KQS A;  2PUK B;  4J5Y A;  3PMI A;  2JN0 A;  1RL2 A;  2V8J A;  3O8V A;  1M8V A;  2WSE E;  2E5K A;  1IHW A;  3RUX A;  4A4F A;  1K9M U;  2X35 A;  2LZ6 B;  1TUD A;  3ZEH A;  1M90 U;  4M77 B;  3HSB A;  3CCR A;  4BI3 A;  2KYM A;  4JJD A;  3GNF B;  1G83 A;  2GQI A;  2RQT A;  4NL3 A;  3CC4 T;  1VQM A;  3L2V A;  4RTT A;  1YIJ Q;  1Y0M A;  2DL3 A;  1M1F A;  1TU0 B;  1W4S A;  3M57 A;  1TXQ A;  4B9W A;  2CP2 A;  4V2S A;  1TSF A;  1XJW B;  3I56 T;  1Y96 A;  4C92 A;  2JOY A;  2DFU A;  4OMN A;  3JB9 F;  2RHY A;  3UDC A;  1MND A;  4HVU A;  2L3R A;  2KT8 A;  2YSQ A;  5I21 A;  5IHN A;  4J7I A;  1X2K A;  2VAS A;  4C5G A;  1OEB A;  4ZTF A;  3PNW C;  2E6Z A;  1YIJ A;  4ESR A;  4BAC A;  3KUF A;  2ZPF B;  1OPK A;  1D3B A;  2FHD A;  5DY9 A;  4X1V A;  2EYW A;  1CKA A;  1NM7 A;  2SEM A;  3E19 A;  3JAM E;  3OYF A;  1HXD A;  2EYY A;  3DB4 A;  3V7R A;  1BI0 A;  3CCJ Q;  2EGA A;  1K73 R;  4OMQ A;  2HD0 A;  3JCM V;  4RTW A;  1M2V A;  4WTO B;  1TH7 A;  1VQL T;  1VQ7 Q;  2E12 A;  3I35 A;  1O9S A;  3VUB A;  2C06 A;  4M77 D;  2ZCF B;  1QP2 A;  3MO8 A;  5CQX A;  3JB9 G;  3EHQ A;  4M78 F;  1S72 Q;  1VQ6 Q;  2RK1 A;  4M75 E;  5GMK l;  1UGS B;  3OYL A;  4E7H A;  3UWN A;  3OBW A;  3A8O B;  3D7S B;  1WHJ A;  1BKB A;  5CKB A;  1WIE A;  2COW A;  3TRE A;  3SDZ A;  1LVK A;  4M7A C;  3RNJ A;  1UUE A;  4JJB A;  2EVR A;  3NTK A;  4JS4 A;  2RF0 A;  3OMC A;  3OSV A;  1TUG B;  1PNJ A;  4JDS A;  2E3I A;  2QQA A;  4J83 A;  3CCJ A;  1Q82 R;  1YJW T;  5IH2 A;  1SF9 A;  3OYK A;  3C94 A;  3U23 A;  2XDB A;  4KGZ B;  2EW3 A;  2MMP A;  3CCE Q;  1VQ7 A;  2B86 A;  5LJ5 e;  1S72 A;  2DIQ A;  1NLP C;  1VQ6 A;  1M5Q 1;  5GJW B;  4D6W A;  5KYY A;  2M16 A;  2YXY A;  1MMA A;  4M78 G;  1QVG S;  4FYX B;  4JUV A;  1IHV A;  4CC3 A;  3I55 T;  3C0C A;  2RJE A;  2RJF A;  4C92 F;  4OMM A;  2OTJ Q;  1NLO C;  3M0Q A;  4IUP A;  1G2B A;  3L2W A;  1G3T A;  4ZTJ A;  2KQW A;  2DXT A;  4HVW A;  1ZHI A;  3SD4 A;  5EG2 A;  4J6Y A;  4L6V 5;  1M90 C;  3JCM e;  4QT7 A;  4P5N A;  3JRZ A;  3G6E Q;  4J9B A;  4CI0 C;  1NJI U;  2XIC A;  3M0P A;  4E7I A;  3CCE A;  4FL6 A;  2L0A A;  4F7U E;  1JXM A;  5GAM e;  5FW9 A;  2VYT A;  2K5F A;  1VQP Q;  4HCB A;  4HXJ A;  4M75 B;  4JS5 A;  4OMP A;  4PJO B;  5AT1 B;  2EQJ A;  2GGR A;  1ZUY A;  3CPF A;  3CCM Q;  4AG2 C;  3X28 B;  3INZ A;  4DEX A;  3F70 A;  1X6O A;  2X4W A;  3CCQ T;  3QXE B;  1KQS P;  2OTJ A;  3VS1 A;  3L2Z A;  4Y91 A;  1Q86 C;  2HL5 C;  2DRK A;  1OYX A;  2JJ9 A;  3M55 A;  4C92 G;  1MHN A;  1QCN A;  4LUD A;  3LGL A;  1YP5 A;  2EIF A;  1UEC A;  2KNB B;  1N8R U;  4OB0 B;  1Y7X A;  3G6E A;  1WI7 A;  2LQ8 A;  3EG9 A;  4O6J A;  1MV3 A;  1N9S A;  2BE7 D;  4L5G A;  2LTO A;  1Q7Y U;  5LJ3 e;  4JRP A;  2KEA A;  1VQP A;  4Z89 A;  3M0S A;  4RKU E;  3CCS T;  2V1Q A;  3CCM A;  1VYU A;  4LUE A;  2RQV A;  3CMA Q;  2ZPH B;  5GAM j;  1WJS A;  2PTK A;  4C8Q C;  3H0F A;  3P8H A;  1AZG B;  2C0T A;  1TUC A;  3CXC S;  2FVU A;  4A4K A;  1FMV A;  3HTR A;  1YJN Q;  4C5I A;  3FEO A;  1FMW A;  2QXF A;  1Q81 U;  4QQD A;  3OYE A;  2DF6 A;  5D7U A;  1M1K U;  1T3L A;  2HKQ B;  2QDY B;  4BE1 A;  1O75 A;  4LD6 A;  4LN2 A;  5J39 A;  3MEA A;  4FCY A;  4M7D C;  4PJO D;  2FZK B;  4EMG A;  3CD6 Q;  3C12 A;  5GAN e;  1SSH A;  1BYM A;  2WSF E;  3MP6 A;  5L8R E;  1K4U S;  4YTL A;  3CMA A;  4Y28 E;  3E1S A;  4PJL A;  5LJ3 j;  5D6W A;  1OX9 A;  1ZUK A;  2K2V A;  8AT1 B;  3HRU A;  3HFN A;  4ELZ C;  2DL5 A;  4EMK A;  1K8A R;  3VS3 A;  1BCM A;  2DL4 A;  4DOW A;  2AKK A;  4CC7 A;  3GIB A;  2FO0 A;  1PWT A;  1YJN A;  2QQS A;  4N0A A;  2KXC A;  4FYY B;  3S3O A;  2M51 A;  2YUP A;  2MOX A;  5FWC A;  1GXI E;  1MV0 B;  4LDV A;  3SWN B;  1WPY A;  2KAF A;  1XTD A;  3RES A;  3QUI A;  2R5M A;  2DO3 A;  2AZV A;  4FSS A;  2VB6 A;  4Z8A A;  3RIR A;  2OI3 A;  2HL3 A;  3EAE A;  2DX1 A;  2P84 A;  1RI9 A;  5IN1 A;  2F5T X;  4KUI A;  2VVK A;  1KJW A;  3LH0 A;  3I56 Q;  3X20 B;  4D8K A;  3CD6 A;  4M78 B;  3EG2 A;  2EQK A;  1WFW A;  1G3Y A;  5GAN 2;  3M9Q A;  3EFR A;  1KD1 C;  5GMK m;  1Y71 A;  3BDU A;  1YIT T;  1I81 A;  5GAN j;  2K5L A;  2F2W A;  1AZE A;  3EG0 A;  2EBP A;  3CC4 A;  4OB3 B;  3DB3 A;  5FU6 B;  3URG A;  3JB9 D;  1JJ2 S;  1VQ5 T;  1KG1 A;  3M5A A;  3CC2 T;  2ZZD A;  4A4G A;  5D6X A;  1U1S A;  2XD0 A;  1HD3 A;  3M54 A;  4J8O A;  2HQX A;  4BI8 B;  3I56 A;  2FB7 A;  4M7D E;  5D6Y A;  3J81 E;  1K9A A;  3JCM f;  3PMT A;  2KDS A;  1VQL Q;  4M75 A;  1XOV A;  1WLP B;  3LH5 A;  2CP0 A;  1M2O A;  1NPP A;  3QZ5 B;  4M77 C;  2RI3 A;  2KT1 A;  5GAM f;  1RI0 A;  1Q7Y C;  2CZ7 B;  1V1C A;  2DJZ A;  2F2V A;  2IG0 A;  3CCV T;  4J6X A;  3UA7 A;  2X4X A;  3OYY A;  2EGC A;  4J7F A;  2PVG B;  1LNX A;  3WVE B;  1GCQ A;  1T0J A;  4M78 D;  2QA4 T;  1YJW Q;  4NL2 A;  2ECZ A;  1Q81 C;  1VQL A;  1D3B B;  2VXE A;  2PVD B;  2RJD A;  4MZP A;  2JT4 A;  8ATC B;  1BIB A;  4CC4 B;  3LYI A;  5GAO l;  1W2B S;  2KVQ G;  5LJ3 f;  2DZ9 A;  3S3N A;  1RAE B;  2RI5 A;  2BIV A;  2EFI A;  3G4S T;  1WNL A;  4BE2 A;  5FWB A;  1BI2 A;  4FSX A;  1M2V B;  3A5Z B;  1WXB A;  1X01 A;  3WXM B;  3FRN A;  1VQN T;  3I55 Q;  1OU9 A;  3OYB A;  2CZ1 B;  2A36 A;  2CP3 A;  2BUD A;  5IT9 E;  2HZY A;  1PC0 A;  4A4E A;  5GAO q;  3E9G A;  2DTH A;  1YJW A;  5FU7 B;  2K7A A;  4F7U A;  2DK3 A;  2KRO A;  1ZX6 A;  3P8B B;  2DL8 A;  2NUT B;  3ER0 A;  1AWO A;  1SEM A;  4C92 D;  2K57 A;  2KGT A;  1LJO A;  2QTX A;  1NYG A;  4FW2 A;  4E7J A;  3PGG A;  2J06 A;  1I5L A;  2ENM A;  1ZA2 B;  2GTJ A;  4BY6 B;  4C0F A;  5GAN f;  1PG5 B;  1UFF A;  2XU8 A;  3I55 A;  2RH2 A;  5GAO p;  4OGE A;  3CCQ Q;  2JTF A;  3OYH A;  3CXC A;  2CDT A;  5KYW B;  1AT1 B;  2X4J A;  4QKU A;  2M0Y A;  3HRS A;  3FJP A;  1ZSZ C;  2K2M A;  4M75 F;  2ABL A;  2KYB A;  1XNI A;  3EH1 A;  3G1J A;  4M4Z A;  2CYZ B;  7AT1 B;  1N5Z A;  2DD4 A;  2JW4 A;  1OZ3 A;  4FIB A;  1BBZ A;  3NGP A;  1ARK A;  2DAQ A;  5CR2 A;  3GNG A;  2YUO A;  2ZPI B;  2HBW A;  2K4Y A;  4DEY A;  2H8H A;  4VUB A;  3CCS Q;  2HKN A;  2KR3 A;  3OSS C;  2ZGW A;  2RHU A;  2LCS A;  2FG0 A;  2EPD A;  3C95 A;  2GTO A;  3OYJ A;  5KYN A;  2EQU A;  3T9N A;  3CCQ A;  1KQ1 A;  1I0C A;  1K73 U;  3DLM A;  1FWZ A;  4KH0 B;  2RHX A;  2L3P A;  4DOV A;  1PCX A;  4HA8 A;  3G7Z A;  2L3S A;  1SSF A;  3QSU A;  2J6F A;  1J3T A;  2DKG A;  2R58 A;  2DEU A;  3JB9 J;  2ESW A;  3EFS A;  2R5A A;  3NHN A;  4M75 G;  3FJ5 A;  2FRY A;  4J9I A;  4PJO G;  1QWF A;  3MJX A;  4QVD A;  4K11 A;  1WGS A;  2ED1 A;  2QYZ A;  2F69 A;  3OBY A;  1WHM A;  2XK0 A;  4E2F B;  2YLC A;  2YHT A;  2DET A;  3CCS A;  4FU6 A;  2XHC A;  1KIK A;  2K9G A;  3CCU T;  4PJJ A;  4GLK A;  1WDX A;  3EG9 B;  2JXB A;  1YCS B;  2EKH A;  1MMN A;  4PKC C;  2LP5 A;  1VQ9 T;  3HRT A;  4LNP A;  4J9C A;  4F7U F;  1E6H A;  2L2P A;  2A37 A;  2LNH B;  4A4H A;  1MUZ A;  1T3S A;  1Q86 U;  3OYG A;  5CAI A;  2E10 A;  1EFN A;  2LJ3 A;  3OS2 A;  1JJ2 A;  3L1A A;  3OB9 A;  1WHG A;  4BE0 A;  4IUV A;  1VQK T;  2DEQ A;  1K1Z A;  1TOV A;  2E3H A;  1QVG P;  4PJM A;  2R57 A;  5GAN 7;  1AEY A;  1BU1 A;  2D6F A;  2EYX A;  2YRD A;  1QWE A;  2COZ A;  2JS0 A;  4OMF B;  3VJP A;  4X34 A;  1QP3 A;  3QDR B;  2GCX A;  1KK7 A;  4IIO A;  4KGV B;  3M4Y A;  1YIT Q;  2HDA A;  2IVW A;  2B8A A;  1AHJ B;  2LCC A;  2LQK A;  1RAG B;  3AT1 B;  3NPF A;  4OMO A;  4F7U G;  1V29 B;  1KHI A;  3FC3 A;  3VRY A;  4FT4 A;  2J05 A;  2VXF A;  2FZG B;  2P0Q A;  4ZGJ B;  1TS9 A;  4R56 A;  3CC2 Q;  2O9V A;  4EMK B;  1X6G A;  1X75 C;  2AK5 A;  1ZBX A;  1FX7 A;  1JQQ A;  3UA6 A;  1NBE B;  3KFV A;  6AT1 B;  5CKF A;  2NUT A;  2DER A;  1QVF S;  2QG9 B;  5ECA A;  2PZ1 A;  1D0Z A;  2DA9 A;  4XTV A;  3JCM c;  2QQR A;  1YJ9 Q;  3GBQ A;  4RTX A;  4RCB A;  3OS1 A;  3UT1 A;  1W2B A;  3VV0 A;  5GAO m;  1GL5 A;  5DLO A;  4RTV A;  5KYU A;  3OW2 S;  1YIT A;  5IXB A;  3N5B B;  4FT2 A;  3SWN C;  3CCV Q;  5KYW A;  2PQW A;  2G6F X;  3MEW A;  1JBM A;  4KGX B;  4LXC A;  3M58 A;  3DLL A;  1FYN A;  3CC2 A;  1IRE B;  2MWP A;  2YDL A;  2RHI A;  2Y4Y A;  3QHS A;  3M56 A;  4OB1 B;  4JZ4 A;  1K73 C;  4M78 C;  4R0K A;  1UJY A;  2QA4 Q;  2DIG A;  2EQM A;  5C0M A;  3QKJ A;  1YJ9 A;  1NPR A;  3VS4 A;  1WHL A;  2DM1 A;  1M3A A;  3SEM A;  2E1H A;  4XQ3 A;  1KD1 U;  3SB2 A;  3EGX A;  2CS7 A;  5FU6 C;  5IXF A;  3CCV A;  2PNI A;  4AFU C;  1TTH B;  1VQN Q;  1U1T A;  3BFM A;  4KT0 E;  3CPW P;  1G8X A;  2FPE A;  3EHR A;  2CSI A;  1QKW A;  3CBO A;  1Q82 C;  1VUB A;  1K0X A;  3VS6 A;  3KBG A;  5HCK A;  2QA4 A;  1Y07 A;  2BZY A;  2LRQ A;  4LDY A;  1VOM A;  1K8A U;  4M7A E;  1SHF A;  2DMO A;  1A0N B;  3VS7 A;  2FZC B;  4BB7 A;  1B34 A;  4A53 A;  1S1N A;  5HY6 A;  3CBM A;  2DYI A;  1UGV A;  1I07 A;  2KK4 A;  1EZZ B;  1QMC A;  3REA B;  4XAX B;  4C92 C;  3VKI A;  2C0O A;  2RHZ A;  2NUP B;  3H0H A;  4E7K A;  2HMA A;  1JU5 C;  2ED0 A;  1VQN A;  1N27 A;  4ZN3 A;  4OML A;  1C1A A;  3PT9 A;  4A63 B;  5GMK j;  4JPB W;  2MPX C;  5GAN 3;  3LLR A;  2G3R A;  4QQ6 A;  5CIU A;  1Z9Q A;  1MNE A;  2ZPE B;  2M9U A;  3HFO A;  2W0Z A;  5FRO A;  1BIA A;  2X9H A;  2NLU A;  1UGQ B;  5I2S A;  3QZ9 B;  1D1A A;  2LQN A;  1D0X A;  1WXU A;  3A98 A;  2LJ0 A;  2DNU A;  4OF1 A;  3AHU A;  2QAZ A;  3MET A;  4ZGD B;  1WQ7 A;  1RAD B;  2KY9 A;  3RKY A;  3RMS A;  1RAH B;  4F16 A;  1M4Z A;  2JM8 A;  1UE9 A;  1K76 A;  5CKE A;  4M75 D;  4F7U B;  1JJ2 P;  2KI7 A;  3MP8 A;  5GMK h;  2FYK A;  3QO3 A;  2AHJ B;  1C0M A;  4KUL A;  4O5V A;  9ATC B;  2DYB A;  3OMG A;  4ZN1 A;  3DKM A;  1JO8 A;  1W6X A;  5CO7 A;  3TSZ A;  2E65 A;  1B7T A;  2NWM A;  5A0G A;  1IZ6 A;  3VYH B;  1MMG A;  2VKN A;  4M7A B;  4DBQ A;  4OP0 A;  4AFS C;  3CC4 Q;  1ZUU A;  3OYM A;  1D0Y A;  4XTZ A;  4Z02 A;  2QEX T;  3L2U A;  2LVM A;  5J3B A;  3CCU Q;  3NFC A;  4C92 E;  3TU4 K;  4XTW A;  5HKC A;  5GAN 4;  1N8R R;  1VQ9 Q;  2GQV A;  5LJ5 g;  3EFO A;  3KXT A;  4C5H A;  2JS2 A;  3MKD A;  4IUQ A;  4RTU A;  2HQE A;  2JMC A;  1NYF A;  4C0Z A;  1FXX A;  2ROL A;  4C8Q E;  1W2B P;  3M0T A;  2KXD A;  4BUG A;  1BCO A;  2X51 A;  1UGR B;  2I0N A;  3C4S A;  4BDY A;  5GAO r;  3JCM X;  1VQK Q;  2JTE A;  3PIO A;  1C6V X;  3UPU A;  4PLL A;  2O4X A;  4ME7 A;  1TG0 A;  1I5O B;  4OVA A;  4J6W A;  2EQI A;  3OYN A;  4HT8 A;  1QVF A;  3ZL7 C;  2RPN A;  3CCU A;  2CUD A;  3X25 B;  3CME T;  1W1F A;  1QKX A;  2L5Q A;  1U3O A;  2JMA A;  3ASK A;  1BB9 A;  1K8A C;  1H64 1;  4R55 A;  2VGN A;  4F04 B;  1VQ9 A;  1ZBJ A;  3OW2 A;  1JB0 E;  2XG8 D;  3QYH B;  2A28 A;  3TQ7 P;  3JCM Q;  2NYS A;  1HSQ A;  2LT4 A;  1I4K 1;  1RLP C;  4RTZ A;  1UEB A;  4DBF A;  5AYF A;  2RQR A;  3VYG A;  3RMQ A;  4ZGE B;  1Q95 G;  1VQK A;  1TWB A;  3REB B;  1D1B A;  2LJ1 A;  2AZS A;  4MZT A;  3M59 A;  3J80 E;  1X69 A;  2Y4X A;  1OUL A;  1GBQ A;  3JB9 H;  2CZ6 B;  3OYC A;  4GY5 A;  2MWO A;  4ZNX A;  5LJ5 d;  2NUP A;  2EWN A;  4LDU A;  2E64 A;  5IHK A;  2L8D A;  3QG1 A;  2HCK A;  2LT1 A;  2CGH A;  1E6G A;  3S6W A;  2LQW A;  1KC8 R;  2JZ2 A;  3JCM W;  4LE9 A;  1HJD A;  2AKL A;  3M53 A;  2RQU A;  4C8Q B;  2KSS A;  5KYX A;  2VUB A;  2DD5 A;  3JCM d;  2HQH A;  2DVE A;  1X43 A;  1HYO A;  4JRQ A;  1VQ8 T;  4PFP A;  1SRL A;  1I1J A;  2LNV A;  3FB9 A;  5GAM d;  5CCA A;  4FYW B;  2O31 A;  4HCC A;  3PE0 A;  4RG8 A;  1BI1 A;  1M9S A;  3OQ5 A;  2LX9 A;  3OY9 A;  1W70 A;  4M7D B;  3EG1 A;  3VRZ A;  4IIM A;  1ZA1 B;  2LMJ A;  3HKS A;  2FL7 A;  1FMK A;  2ZPG B;  2MAM A;  2A0F B;  3IQL A;  4JZ3 A;  2MCN A;  4M77 E;  2JTM A;  1WYX A;  2MI6 A;  1H3H A;  4J9H A;  2RM4 A;  5KYU B;  1WHH A;  2P0K A;  1QLY A;  3I5S A;  2ATC B;  2LDM A;  4N0A C;  4M7A A;  2EJF A;  2M02 A;  1NEB A;  3BY7 A;  3CBP A;  2CRE A;  1PSF A;  4QVC A;  1IXD A;  4RUG A;  4QQG A;  1VIF A;  5LJ3 d;  1KC8 C;  5CKD A;  2CKK A;  4ELY C;  1V76 A;  1U8R A;  2MIO A;  2RD1 A;  2KMT A;  2DLP A;  4HCK A;  5HK0 A;  3H41 A;  3QBY A;  1X6B A;  4EDU A;  2CH4 A;  2MK5 A;  1R0C B;  3THK A;  5A0L A;  1G3S A;  3A8H B;  1GFD A;  1IGU A;  2BZ8 A;  4DQ2 A;  3GPL A;  1SPK A;  1UB4 A;  3GLX A;  2GFA A;  3VS5 A;  3L2Q A;  3MP1 A;  2J6O A;  1GCP A;  3EGX B;  2COY A;  1BI3 A;  4XTX A;  2XMF A;  1AVZ C;  4CRI A;  2P0P A;  4AG1 C;  3V8J A;  4RG2 A;  3I9Q A;  4WCI A;  3A8G B;  4QVZ A;  4B9X A;  1BK2 A;  2MF2 A;  2V26 A;  4AT1 B;  5GAN d;  3TVT A;  2QDL A;  3RBB B;  2DXU A;  3CD6 T;  2LC4 A;  1RAA B;  2E6N A;  1NG2 A;  1KSW A;  1YWO A;  4HCZ A;  3L2R A;  2K79 A;  2BZX A;  2DPP B;  2F5K A;  4Q5W A;  4M75 C;  1KHC A;  1OZ2 A;  3CCL T;  4PJO C;  1B34 B;  4KH1 B;  2XDD A;  3NTH A;  4RTY A;  4HVV A;  2DXB A;  2E4H A;  1PD0 A;  2JM9 A;  2RA2 A;  4FW1 A;  2QI2 A;  3CQT A;  1SHG A;  2EYZ A;  4A54 A;  1QVF P;  5CQY A;  3NMZ C;  2QTV A;  4F14 A;  1WJQ A;  1UGP B;  1Q82 U;  1ACM B;  1R77 A;  2ROT A;  5I11 A;  3OW2 P;  1GCQ C;  3X26 B;  1SKU B;  2AT1 B;  2DRM A;  2LCL A;  4XU3 A;  3M4G A;  2O88 A;  2FPF A;  1VQ4 T;  2QEX Q;  3OA6 A;  4J9F A;  3OYD A;  5IAY A;  3QDF A;  4MDX A;  2GNC A;  3JB9 I;  1U06 A;  4KBM B;  1XQH A;  2E5Q A;  4M7A F;  3G71 T;  4N4G A;  1GRI A;  3J7A F;  3EH2 A;  3RER A;  1X2Q A;  1M27 C;  1RAB B;  3WVD B;  4HT9 A;  3LGF A; 
#chains in the Genus database with same CATH homology
 1SHF A;  2DBM A;  2DMO A;  1A0N B;  3VS7 A;  1VYT A;  1S1N A;  1UGV A;  1OV3 A;  2F2W A;  1I07 A;  4JJC A;  1AZE A;  4AFZ C;  3EG0 A;  2EBP A;  3REA B;  2KRN A;  3M0U A;  1OPL A;  2C0O A;  1M30 A;  3H0H A;  2RQW A;  1UTI A;  2DE0 X;  1AWX A;  1JU5 C;  2ED0 A;  1PKS A;  2DJQ A;  1ABO A;  1HD3 A;  2EGE A;  1M8M A;  2RNA A;  4Z88 A;  2KRS A;  4OML A;  4EIK A;  4A63 B;  1RUW A;  2CH4 W;  3O5Z A;  1UJ0 A;  2YUQ A;  4JPB W;  1K9A A;  2D0N A;  1Z9Q A;  3TSW A;  2W0Z A;  1IO6 A;  1XOV A;  1WLP B;  4D8D A;  3LH5 A;  3PVL A;  2KT1 A;  2LQN A;  3JV3 A;  5IHI A;  1WXU A;  2D8J A;  2LJ0 A;  3A98 A;  1AOJ A;  2DNU A;  5EC7 A;  1CKB A;  1V1C A;  1SRM A;  1YN8 A;  2F2V A;  1PRM C;  3VS0 A;  2KRM A;  3UA7 A;  1KFZ A;  4F16 A;  3M0R A;  2JM8 A;  3EG3 A;  1B07 A;  1K76 A;  1UE9 A;  2EGC A;  1GCQ A;  1T0J A;  2DYB A;  2E5K A;  2CSQ A;  4GBQ A;  1JO8 A;  1W6X A;  3H0I A;  2LZ6 B;  2ECZ A;  3TSZ A;  4E6R A;  1JEG A;  1TUD A;  2YT6 A;  2KYM A;  4JJD A;  1G83 A;  2GQI A;  2NWM A;  2JT4 A;  1ABQ A;  2RQT A;  4CC4 B;  2VKN A;  4RTT A;  1Y0M A;  1K0S A;  2DL3 A;  4AFS C;  1ZUU A;  2FPD A;  2V1R A;  5FWB A;  4GLM A;  1WXB A;  2A36 A;  4OMN A;  1H92 A;  1PKT A;  4HVU A;  2K7A A;  1U5S A;  2KT8 A;  2IIM A;  2YSQ A;  5IHN A;  2JS2 A;  1X2K A;  4RTU A;  1WXT A;  2JMC A;  1OEB A;  2KRO A;  2BTT A;  1ZX6 A;  2DL8 A;  1NYF A;  1AWO A;  2X3X D;  1SEM A;  1OOT A;  2ROL A;  4ESR A;  3M0T A;  2KXD A;  1M3C A;  2KGT A;  1NYG A;  1OPK A;  2I0N A;  2J06 A;  2ENM A;  2JTE A;  2GTJ A;  4X1V A;  2EYW A;  1CKA A;  1NM7 A;  1TG0 A;  4CC2 A;  2SEM A;  2CT3 A;  2EQI A;  1UFF A;  2EYY A;  3ZL7 C;  2RPN A;  2CUD A;  2CDT A;  2EGA A;  4OMQ A;  1W1F A;  1QKX A;  3ULR B;  1U3O A;  2JMA A;  2M0Y A;  1BB9 A;  4RTW A;  2YUN A;  2K2M A;  1T0H A;  2ABL A;  3I35 A;  2KYB A;  1ZBJ A;  4F17 A;  4M4Z A;  2K6D A;  3EHQ A;  1N5Z A;  2JW4 A;  2A28 A;  2A08 A;  2J7I A;  1BBZ A;  1GBR A;  3NGP A;  1ARK A;  1HSQ A;  1QCF A;  4RTZ A;  1RLP C;  2FEI A;  2YUO A;  2HBW A;  1WIE A;  4DEY A;  2H8H A;  2RQR A;  3RNJ A;  2KR3 A;  1UUE A;  4ORZ A;  2LCS A;  2FG0 A;  2GBQ A;  3REB B;  2EPD A;  1CSK A;  2LJ1 A;  4JJB A;  2AZS A;  2D8H A;  3UAT A;  2EVR A;  2GTO A;  1X69 A;  2RF0 A;  1PNJ A;  2SRC A;  1GBQ A;  2L3Q A;  1I0C A;  5IH2 A;  4ZNX A;  2FRW A;  2P4R A;  3R6N A;  3U23 A;  2L3P A;  2EW3 A;  2W10 A;  5IHK A;  1YWP A;  2L3S A;  1J3T A;  2J6F A;  2HCK A;  2B86 A;  2ESW A;  1E6G A;  1PRL C;  1NLP C;  3NHN A;  3FJ5 A;  2FRY A;  3QWY A;  4J9I A;  5GJW B;  2RMO A;  1QWF A;  2LQW A;  1VYV A;  4K11 A;  2ED1 A;  4LE9 A;  1HJD A;  2KE9 A;  2AKL A;  1WA7 A;  2RQU A;  4CC3 A;  3C0C A;  1KIK A;  2K9G A;  4OMM A;  1M3B A;  1NLO C;  3M0Q A;  1B3Q A;  1WDX A;  1G2B A;  1X43 A;  2JXB A;  1YCS B;  2K3B A;  2EKH A;  3UF4 A;  4HVW A;  2LP5 A;  1SRL A;  4LNP A;  4J9C A;  1I1J A;  4QT7 A;  1E6H A;  2L2P A;  2A37 A;  2NUZ A;  4KRT A;  2O31 A;  2DIL A;  2LNH B;  4J9B A;  3PE0 A;  1E7O A;  3M0P A;  1MUZ A;  1T3S A;  2L0A A;  1JXM A;  1W70 A;  1EFN A;  3EG1 A;  5FW9 A;  3VRZ A;  4IIM A;  2LJ3 A;  4Y92 A;  2LMJ A;  2F2X A;  4HXJ A;  1FMK A;  4OMP A;  2GGR A;  3IQL A;  1K1Z A;  1ZUY A;  4JZ3 A;  2HSP A;  3I5R A;  4AG2 C;  2MCN A;  4DEX A;  1AEY A;  1BU1 A;  1WYX A;  2EYX A;  2CUB A;  1H3H A;  4J9H A;  1QWE A;  1QLY A;  3I5S A;  1ZLM A;  3VS1 A;  2JS0 A;  2VWF A;  2DRK A;  1NEB A;  5I22 A;  4LUD A;  2CRE A;  1YP5 A;  1UEC A;  2KNB B;  4IIO A;  4RUG A;  2HDA A;  1WI7 A;  3NPF A;  1UHC A;  1MV3 A;  4OMO A;  1LCK A;  2MIO A;  2DLP A;  4HCK A;  3VRY A;  1AWW A;  2KEA A;  3H41 A;  2J05 A;  1Y57 A;  4Z89 A;  1X6B A;  1X27 A;  2CH4 A;  1AWJ A;  3EGU A;  3M0S A;  2O9V A;  2CT4 A;  1X6G A;  3THK A;  2AK5 A;  2V1Q A;  1VYU A;  4LUE A;  1H8K A;  1GFD A;  1JQQ A;  3UA6 A;  2RQV A;  3KFV A;  2BZ8 A;  2PTK A;  3H0F A;  1AZG B;  1SPK A;  2C0T A;  1TUC A;  5ECA A;  2PZ1 A;  1UG1 A;  3VS5 A;  2DA9 A;  2LX7 A;  2J6K A;  2J6O A;  1GCP A;  3GBQ A;  2XMF A;  1AVZ C;  4RTX A;  3QWX X;  2O9S A;  1GL5 A;  2C0I A;  2DF6 A;  4AG1 C;  3VS2 A;  4RTV A;  1T3L A;  3I9Q A;  4WCI A;  1ZSG A;  5GJV B;  5IXB A;  1BK2 A;  2DBK A;  5L23 A;  2OAW A;  2G6F X;  4LN2 A;  3TVT A;  2QDL A;  4AFQ C;  3RBB B;  1NG2 A;  1KSW A;  1YWO A;  1FYN A;  2K79 A;  2BZX A;  2KBT A;  2O2O A;  2DL7 A;  2OJ2 A;  3SHW A;  1AD5 A;  2YDL A;  2HEQ A;  1SSH A;  4RTY A;  4HVV A;  4JZ4 A;  4J9G A;  2JM9 A;  1K4U S;  4R0K A;  1UJY A;  1YNZ A;  3CQT A;  1ZUK A;  1SHG A;  1NEG A;  2DL5 A;  2X3W D;  3VS3 A;  2DL4 A;  2EYZ A;  4J9D A;  1PHT A;  2AKK A;  3NMZ C;  4CC7 A;  2FO0 A;  1PWT A;  3VS4 A;  4F14 A;  2DM1 A;  2KXC A;  1M3A A;  1VA7 A;  3SEM A;  2M51 A;  2ROT A;  2MOX A;  2YUP A;  5FWC A;  5I11 A;  1MV0 B;  1RLQ C;  1GCQ C;  1UHF A;  2AZV A;  2D1X A;  4FSS A;  5IXF A;  4Z8A A;  2DVJ A;  2PNI A;  2OI3 A;  2DRM A;  2RN8 A;  4AFU C;  1Z9Z A;  2DX1 A;  2O88 A;  1WX6 A;  2FPF A;  1RI9 A;  4J9F A;  2VVK A;  1KJW A;  2FPE A;  4D8K A;  2GNC A;  3EHR A;  1U06 A;  1UDL A;  2CSI A;  1GFC A;  1QKW A;  1GRI A;  3EG2 A;  1K0X A;  4J9E A;  3VS6 A;  1JXO A;  3PVQ A;  5HCK A;  1X2Q A;  2BZY A;  1M27 C;  1WFW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...