1NLPC

Structure of signal transduction protein, nmr, minimized average structure
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
b'TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-SRC
publication title Molecular basis for the binding of SH3 ligands with non-peptide elements identified by combinatorial synthesis.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Complex (transferase/peptide)
total genus 8
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1996-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1nlpC00
2B86A 2DLPA 2C0IA 3REAB 4JPBW 3M0SA 4HVUA 4J9BA 4RTUA 2V1QA 2HCKA 1U3OA 2CDTA 1SRMA 3VS1A 4J9HA 2C0OA 2YSQA 2DMOA 1NG2A 2DL8A 2FPDA 1QLYA 1S1NA 1K0SA 1ZSGA 2EGCA 1NEBA 2FPFA 2DNUA 2F2VA 2L3SA 2RQRA 1PWTA 1VYVA 1K0XA 2D1XA 2SEMA 2A08A 2LJ3A 1QKWA 4JZ3A 2KXDA 1JXMA 4R0KA 2JMAA 1NLOC 3EG2A 1SRLA 3H0HA 1M3BA 1H3HA 1T3SA 1X6GA 3VS5A 2DJQA 1M3AA 1WI7A 2ENMA 2F2WA 1TUDA 2X3XD 2J06A 1CKAA 1ZBJA 2KGTA 2OI3A 1KIKA 2DM1A 1JXOA 4AFQC 1HSQA 4ESRA 2KT1A 2GGRA 2EYYA 2CH4A 2EW3A 4OMMA 1ZUUA 1GCQA 1OOTA 2DBMA 2DE0X 3VRZA 1WXTA 3PE0A 4Y92A 4F14A 2EBPA 2C0TA 4FSSA 1T0HA 3EHQA 2HDAA 4JJBA 4JJCA 2SRCA 2LNHB 1H92A 1AZEA 2H8HA 2ED0A 1NYFA 2J7IA 2JS0A 1E7OA 4LNPA 2ROLA 3CQTA 2D0NA 2L2PA 2PZ1A 1N5ZA 4J9CA 1J3TA 4AG1C 1VYUA 1PRMC 2RQTA 3I35A 1M8MA 2F2XA 2DYBA 3R6NA 1HJDA 3H41A 1QWEA 2DL7A 3TSWA 4LUDA 1W70A 1OV3A 2JM8A 3NHNA 2CT4A 3RBBB 1Z9ZA 4E6RA 3M0TA 1M3CA 1IO6A 4OMNA 2E5KA 4CC4B 1B07A 4RTWA 1WXUA 4Z8AA 2O31A 1NLPC 5FWCA 1V1CA 2O2OA 1X27A 1YP5A 2FRYA 2OJ2A 3EGUA 3VS0A 1UJ0A 3SEMA 1MUZA 1T3LA 1UHCA 1AWOA 3FJ5A 1UHFA 3VS4A 2HEQA 2L0AA 1WX6A 2LMJA 1ARKA 4RTTA 3VS3A 1CSKA 1K76A 2CSQA 3UATA 1ZLMA 1G83A 2M51A 2LQWA 1FYNA 2LQNA 1GRIA 1ZX6A 1AOJA 1WYXA 5I22A 2RQWA 1UG1A 1GCPA 1U06A 1UTIA 2VWFA 4HCKA 3TSZA 1RI9A 1UFFA 2K79A 2A28A 1SEMA 3PVLA 1PRLC 2P4RA 2KYBA 5IHNA 4CC7A 1I07A 1MV0B 1OPLA 1AD5A 4HVWA 1RLPC 4A63B 2KEAA 2RF0A 2DL3A 2W0ZA 1GFDA 3I5RA 2RQVA 4HVVA 3EG1A 2CSIA 2KYMA 3IQLA 2MIOA 3M0QA 1U5SA 4DEXA 1MV3A 2FRWA 2DL5A 3VS2A 2L3QA 3EG3A 5FW9A 2OAWA 1UGVA 2RNAA 2A36A 3H0FA 3O5ZA 1BK2A 1WXBA 4RTVA 4RTYA 1TUCA 1UJYA 2DF6A 2MCNA 4KRTA 3THKA 4LE9A 2D8JA 2DVJA 2DX1A 3TVTA 2KRNA 4AG2C 1PKTA 1QKXA 1KJWA 1SHGA 2AZVA 2ROTA 5IHIA 1VA7A 1TG0A 3I9QA 2JT4A 1YWPA 1AWXA 1BBZA 2BZXA 1T0JA 2J6KA 2I0NA 2KRSA 4WCIA 3SHWA 2ESWA 2KNBB 2ABLA 4X1VA 1ZUYA 1X69A 1UECA 3I5SA 2FG0A 2YT6A 4J9IA 1G2BA 4AFSC 2KRMA 2O9VA 2DILA 4OMLA 5IXBA 2DRMA 5GJWB 4HXJA 1CKBA 3EG0A 4GLMA 1WDXA 2RMOA 4OMPA 4M4ZA 4QT7A 2W10A 1M30A 1GFCA 4JJDA 2LJ1A 1WLPB 2KR3A 3U23A 2CUBA 2A37A 3UA7A 1W1FA 2K6DA 1X43A 1WIEA 2GTOA 3VRYA 2AZSA 2AK5A 3GBQA 2VKNA 4CC3A 1SPKA 1PNJA 5GJVB 5ECAA 3VS6A 3ULRB 2RQUA 4ZNXA 4K11A 2K2MA 2PTKA 2NWMA 5I11A 2JW4A 2JM9A 2EPDA 2DRKA 2GBQA 4F16A 3JV3A 1K9AA 1YCSB 2KROA 1JU5C 1YWOA 1JO8A 1GBQA 1UUEA 4JZ4A 3REBB 1JQQA 3KFVA 2EVRA 1NYGA 2BZ8A 2LZ6B 1AWJA 2CT3A 2X3WD 1RUWA 1XOVA 5HCKA 2AKKA 1KSWA 1JEGA 2M0YA 2EYXA 2O88A 1Y0MA 4IIOA 1BU1A 2YDLA 5IHKA 3LH5A 2K9GA 2KBTA 1M27C 2K3BA 5L23A 5EC7A 2GNCA 1KFZA 4DEYA 2EYWA 1WA7A 1K4US 2DA9A 2LX7A 2AKLA 4D8DA 2DBKA 1ABOA 2BTTA 2MOXA 2VVKA 2RN8A 2CUDA 2J6FA 4Z88A 2K7AA 2FPEA 2DL4A 1AVZC 1UE9A 1QCFA 1WFWA 4IIMA 1AZGB 5FWBA 2YUOA 1RLQC 4J9EA 3PVQA 1ZUKA 3M0UA 3C0CA 2FEIA 2CH4W 4OMOA 5IH2A 1I0CA 2EQIA 2YUQA 1UDLA 2BZYA 5IXFA 3NGPA 2QDLA 2LCSA 2EGEA 4J9GA 3ZL7C 1HD3A 2GQIA 1NM7A 2IIMA 3M0PA 4Z89A 3H0IA 1QWFA 4RUGA 1Z9QA 1K1ZA 1GBRA 2G6FX 3NPFA 1OPKA 2LJ0A 4GBQA 1EFNA 4J9FA 2L3PA 2JXBA 2ED1A 2EKHA 3QWXX 1YN8A 2EYZA 2ECZA 2J05A 1E6GA 1H8KA 1X2QA 2JS2A 3M0RA 1W6XA 2CREA 2PNIA 4AFZC 2GTJA 2YUPA 1AWWA 2RPNA 1A0NB 1YNZA 1LCKA 3NMZC 1SSHA 2O9SA 3UF4A 2YUNA 4EIKA 3RNJA 2FO0A 2HSPA 1BB9A 2KXCA 1NEGA 2J6OA 4J9DA 1SHFA 2NUZA 1GL5A 1AEYA 1VYTA 4ORZA 2LP5A 2HBWA 1PKSA 4LUEA 4CC2A 3VS7A 2EGAA 1Y57A 4AFUC 4OMQA 2KE9A 4D8KA 3QWYA 2KT8A 1E6HA 3EHRA 4LN2A 1OEBA 2V1RA 4RTXA 4F17A 3UA6A 1PHTA 2D8HA 2JTEA 1I1JA 1X6BA 1GCQC 3A98A 1ABQA 1B3QA 2XMFA 4RTZA 1FMKA 1X2KA 2JMCA
chains in the Genus database with same CATH superfamily
5KYYA 3SD4A 5GAN6 3REAB 2FYKA 2R5MA 1PD0A 4RG8A 1R0BG 2RJEA 4BE2A 4Z02A 5HY6A 4HT8A 1NPPA 2HSEB 2V1QA 1OYXA 2HCKA 2X4YA 1SRMA 2Y4XA 2YSQA 3TREA 2DL8A 1QLYA 5LJ3j 1ZSGA 3CPWP 4LD6A 4PJOB 2VXFA 4M77F 1ZA1B 1PWTA 2EIFA 1TXQA 1RAIB 2HKQB 4N4HA 3T9NA 1K73R 4JZ3A 2KXDA 2CP3A 2X35A 3CC4T 4LD9K 3HL8A 4RCBA 1VQ8Q 1G8XA 1SRLA 2EQKA 5FU7C 3CC2Q 1M2VB 5LJ3f 3H0HA 2CP6A 3VS5A 1X6GA 1M3AA 1TUDA 2J06A 2MAMA 1CKAA 4E7JA 4PJOG 3S3NA 2A0FB 2XHCA 1F1BB 2L5QA 3L2VA 2EYYA 3JCMV 4OMMA 1Q7YR 1JBMA 4XQ3A 3QYHB 2C0TA 8AT1B 3CPFA 4JJCA 3JB9H 4IUPA 2ZPBB 5FU6C 2KI7A 5FRMA 2RB6A 3OYMA 3G6EQ 3JCMh 3MP8A 2X4XA 4RG2A 4ANJA 3JCMP 4R55A 1LNXA 4M77D 5L8RE 1M8MA 2F2XA 2DYBA 2WSFE 1KQ1A 4HKEA 4ELYC 2DETA 1YIJQ 3HRSA 3OYAA 4N4IA 3VYGA 1VQPA 3M0TA 2E5KA 1PM3A 4JUVA 3SWNC 2O31A 1IHVA 1ZQ1A 1NLPC 1TWBA 1YJNA 2AT1B 1FMWA 1XTDA 3I56T 1N6AA 1RAFB 4DBFA 2RH2A 3DB3A 3EGUA 1ZSZC 4PLLA 3VS0A 2QK0A 2FVUA 2LT4A 2H3EB 4X9DA 1FX7A 1AWOA 5DY9A 3OS5A 4XTZA 1YJWT 1VQKA 3FJPA 1UHFA 3VS4A 2HEQA 2RJDA 1WX6A 3META 3VS3A 2LCCA 1CSKA 1K76A 5KCOA 4A4KA 2LQWA 1OU9A 2PVGB 3V8JA 1GRIA 1WYXA 4OGEA 4M78B 1GCPA 2KDSA 2QGGA 2DO3A 3QO3A 4IURA 1FXXA 1YITQ 2A28A 2P4RA 4NL2A 2COYA 5DLQE 4HVWA 4M7DB 2DZ9A 4A63B 1R8OB 5LJ3h 4RMOA 2JVVA 2DL3A 2W0ZA 1GFDA 3EG1A 2CSIA 3CD6Q 1C6VX 3IQLA 3H9NA 4A53A 2ATCB 2FRWA 3VS2A 3CCLT 3EG3A 5I21A 1Q7YC 1UGVA 3JCMJ 5GAMe 1VQ7A 2M1HA 4C5GA 4OB2B 3G4SQ 1WXBA 4RTVA 1HYOA 1VQLA 2NUPA 2FZKB 3RMSA 2CZ0B 4M7DG 5CAIA 3I55A 1W2BA 1QKXA 1KD1R 4OVAA 4M7AE 1KJWA 2ROTA 2AZVA 2DIQA 1KK7A 2JT4A 1AWXA 2FB7A 4C8QB 4JLGA 3QDFA 2RHXA 5CQYA 2K5FA 5GANe 2NUTA 2LQ8A 3VJPA 1G2BA 4F04B 2Y4YA 1VUBA 2R58A 2LCLA 4M75F 4OMLA 1EIFA 3RR6A 4QW2A 2K5IA 1NPRA 3BDUA 3M57A 4QKUA 1OZ3A 3CCRA 4QT7A 2W10A 1G3YA 3CXCA 5GMKe 3CCJT 4JJDA 3CCMA 1X75C 3M59A 2CUBA 4Y28E 1OX9A 1VOMA 1XJWB 2AZSA 3OYCA 4FYVB 1WHLA 1YJ9T 3CBMA 3VS6A 3ULRB 5CKFA 1UGSB 3LX7A 3NTIA 4K11A 4ZNXA 2L3RA 4C5EA 2LC4A 2NWMA 1VQMQ 4FT2A 5EG2A 2QASA 2JM9A 1NJIU 2DRKA 2GBQA 1K9AA 3L2WA 3CCUT 3DLLA 3E2UA 3FIFA 3REBB 3L2ZA 1FMVA 5KE2A 2LZ6B 3OS2A 2ZGWA 3VV0A 1AWJA 4J6XA 5HCKA 2IVWA 1YI2A 1IB8A 1JEGA 1UB4A 4HCBA 3QZ9B 3JB9D 3PIOA 1Q81R 1WJSA 1Y0MA 5LJ5f 1VQNT 3QG1A 4XU3A 3OS0A 2K9GA 2V8JA 3CCQQ 5KYWB 2V8IA 2DEQA 2AIRB 1RAAB 2DAQA 1D1BA 2GFAA 2DA9A 2LX7A 2GCXA 2DBKA 3OYJA 1G5VA 3HFNA 2K3XA 2J6FA 4M77B 4Z88A 5J26A 1KD1C 1WFWA 2RI5A 1IZ6A 4JJNK 4J9EA 3SFMA 2XKOC 2CH4W 4OMOA 1ZSZA 3G71A 4PFPA 3MEAA 1RAHB 1M90U 3ZFJA 2QDLA 1QP2A 3M0PA 1WHGA 1M1GA 1M1KR 1QWFA 1VQ5T 2VGNA 3NTKA 4GBQA 2LX9A 2JXBA 3QWXX 2EKHA 5FU6B 4XU1A 5CKBA 2ECZA 2HNIA 5FROA 3M0RA 5KYXB 3CCLA 4R56A 4GLKA 1VQ8A 1SSFA 3CC2A 1AWWA 4FW1A 1A0NB 1SSHA 5GANg 1KG1A 2FO0A 3JCMX 4MMLA 3M55A 1I5LA 3SWNB 2GF7A 4MMKA 1GL5A 1AT1B 2CP0A 1N8RC 2COWA 4LUEA 3X26B 2DTOA 4ZGJB 3VKIA 5GAOp 3JCMc 4IKFA 8ATCB 3SB2A 2KE9A 5D7UA 3QUIA 2R57A 1S72Q 3J7AF 1WQ7A 3G6EA 3C94A 3EHRA 2V1RA 2HL3A 2JTEA 1B34A 1IREB 1X6BA 3MHXA 4OB3B 1B3QA 2XMFA 4BI4A 4RTZA 3OMCA 3V8LA 2C0IA 3KBGA 4LDYA 1YIJA 4JPBW 3EG9B 2BE7D 2EWNA 4HVUA 4BE0A 2ZPEB 4RTUA 4XK8E 4DBRA 3M54A 3OA6A 3VS1A 4J9HA 3WXMB 3PTAA 3CCSQ 1SG5A 5KYUA 2FPDA 4XTYA 3MCAB 3M56A 1NEBA 2WSEE 4X34A 5LJ5g 3HTRA 3TQ7P 3E19A 2RQRA 1VYVA 1K0XA 1WPYA 3S6WA 2A08A 4F7UG 4B6MA 4PJOE 2CZ7B 2JN0A 4C0FA 1JXMA 4R0KA 2CP5A 2DVEA 3QJYA 1C1AA 2MF2A 1FWZA 2DPPB 1H3HA 2DJQA 1VQNA 5I2SA 4C92G 2ENMA 5GAOn 2IG0A 1KIKA 1VQ9A 1YITA 1QMCA 2GGRA 4NS5A 1YHQQ 3M58A 2DXUA 2CH4A 2EW3A 1VQPT 1GCQA 1EZZB 2DBMA 2DE0X 3FC3A 3VU3C 2EBPA 2EYQA 1YJNT 3CD6A 1IXDA 4E2FB 3EFRA 3H8ZA 2SRCA 2LNHB 2ED0A 1YCYA 2E41A 4A4EA 3CQTA 2L2PA 3JCMe 1LVKA 1IGUA 1N5ZA 3JCMf 1VQKT 4FSXA 1J3TA 5IT9E 2DTIA 3G4SA 3JB9J 4M75B 1PRMC 2RQTA 3CC7Q 2O4XB 3R6NA 1WHKA 4N0AC 3CCEQ 3MEUA 1HJDA 4J6YA 2OTJQ 1VQ6Q 1Q86R 3H41A 2DXTA 4OF1A 3TSWA 5GAOr 1OV3A 3NHNA 2CT4A 5D6XA 2NLUA 1IO6A 4UC4A 3GNGA 1OQKA 1B07A 2PVDB 1WXUA 2QTVA 3PMTA 4Z8AA 1ZHIA 5FWCA 1V1CA 4PJOA 1X27A 2OJ2A 1U1SA 3OW2S 4M75G 4XAXB 1MMAA 1UJ0A 1X6OA 1KQSS 3SEMA 4KGVB 2P0QA 2BUDA 1H3ZA 2JUFA 3OBWA 5KCHA 4RTTA 3A8GB 3MPUB 2HBPA 2LQNA 3E1SA 2OX7A 1AOJA 1KC8C 1VQ7T 1UG1A 2CZ1B 4HCKA 2VWFA 1VQLT 2E5QA 4DBHA 5KH6A 2QQAA 4M78E 3I55T 1PRLC 2QGFB 4CC7A 1VQMA 4FYXB 1MV0B 1OPLA 2EJ9A 1K8AC 1AD5A 1RLPC 2KEAA 2QYZA 4JS4A 5LJ3e 3UDCA 4A54A 4M7DE 4PJJA 5CO7A 2E70A 3OS1A 1Y71A 2GFUA 2OAWA 2RNAA 3H0FA 3G7ZA 4HCZA 3OYHA 3CCRT 2C06A 3M53A 4KBMB 5KYYB 3CMEA 3CCVQ 3CCMT 2DX1A 3UPUA 3TVTA 2F5KA 4KT0E 3JAME 1RACB 3PIPA 3QXEB 3EGDA 1P92A 1RADB 2XDDA 3FDRA 2MI6A 2I0NA 3OYDA 1PC0A 2YHTA 4FM4B 3SHWA 4M7AC 1ZUYA 1X69A 2FG0A 2RJCA 4BB7A 4J9IA 1SKUB 1Q86C 5FRNA 1PSFA 2O9VA 5KE3A 1N8RU 2QA4Q 2DILA 2WACA 3WVEB 5A0GA 1MHNA 2FZGB 1CKBA 4OMPA 4FIBA 4M4ZA 3MJXA 2LJ1A 4BD3A 2O01E 4VUBA 3QHSA 1YI2T 4PK4A 2A3LA 3JCMg 1W1FA 2DEUA 4PFZA 3JCMb 3EFSA 3KXTA 3GBQA 3CBOA 4C5HA 1N9RA 1D3BA 1SPKA 5ECAA 1BI1A 3LH0A 4CRIA 1BIAA 4M7AD 3ER0A 4O5VA 2PTKA 2JW4A 3OYNA 4LDVA 4FU6A 1O75A 5CKDA 2E1HA 5GAMd 1YCSB 1JU5C 2RHUA 1JO8A 3EGXA 3BW1A 4BUGA 4DQ2A 1JQQA 3GNFB 2EVRA 2VASA 3CPWS 1TS9A 3LWHA 4HCCA 3V7SA 3BFMA 5GMKl 3OYBA 1VIEA 2X4JA 3URGA 2AKKA 1K73C 1BKBA 3LGLA 2RO0A 3G71T 2EYXA 1BU1A 1B7TA 2JOYA 1QQJA 5GANd 3L42A 2LQKA 5L23A 3RESA 2ZZDA 5EC7A 5DLOA 4EMKA 3C95A 4EDUA 1W2BP 1HK9A 2E6NA 2V8KA 4N0AA 4DEYA 2CGHA 1WA7A 3QYGB 1K9MU 4M78G 1TH7A 1TTHB 2QQ9A 2MOXA 2K7AA 2FPEA 5C0MA 1VQ8T 1AVZC 1QCFA 4IIMA 3CC2T 5FWBA 4YTLA 1RLQC 3PVQA 5GAMj 1ZUKA 4C92C 3C0CA 3LYIA 3EH2A 2FEIA 3BY7A 5LJ3g 5IH2A 1I0CA 1QVFS 3E9FA 1UDLA 2BZYA 5IXFA 3CCSA 2LCSA 2LTOA 4J9GA 2BE9B 4J8OA 3CXCP 3ZL7C 1HD3A 3MP1A 5GAN8 3H0IA 1K1ZA 1GBRA 3GP8A 4LXCA 1EFNA 2L3PA 1VQ5Q 3JB9F 2AHJB 4A4GA 1X2QA 3VUBA 2M02A 1W6XA 2CREA 5CKEA 1D1AA 2ZAEA 3G6ET 2RPNA 1D09B 1LCKA 3NMZC 5CR2A 4C0DB 4C8QG 2D0QB 2HQHA 1NEGA 2JTMA 1VQ4A 4ZTJA 1YIJT 1D1CA 5D6YA 3PGGA 2GQVA 2KVQG 1YHQA 3MO8A 2NUPB 3X24B 3VUZA 1VIFA 3RDVA 1Y57A 3HRTA 4AFUC 3HHTB 2LNVA 4PLIA 1KC8U 1E6HA 4A4FA 3R6OA 4LN2A 3FB9A 4LDXA 3UA6A 1PHTA 3LGFA 3FRNA 4DBQA 4EMGA 3CMAA 1GCQC 3J80E 1ABQA 3CC7A 5AYFA 2LVMA 1FMKA 2E65A 5GAOl 3L2RA 3OYEA 1K8AU 4M7AA 2OTJA 2CZ6B 2CKKA 4C5IA 5LJ5e 1VQ6A 4L59A 1X01A 3M0SA 1YBYA 5GAN7 2HKNA 5LL6S 4F7UE 3L2UA 1U3OA 3HPWA 4WTOB 3OYLA 1VQ9T 1YITT 5M9OA 1S1NA 3GOXA 4EMHA 5FU7B 3P8DA 2EFIA 5C6SA 2F2VA 4C92E 2YRCA 2L3SA 2D1XA 3A5ZB 1QKWA 2HQXA 3VYHB 4L6V5 3CD6T 4XTWA 4LDUA 2JMAA 4C0ZA 2DXCA 2DFUA 5HK0A 1M3BA 4PJOC 3RKXA 2RD1A 1PG5B 4QQ6A 3X20B 2X3XD 3G4ST 5GAMh 4ZGEB 2QEXQ 3V7RA 1BI3A 2OAUA 1JXOA 4M77G 4ZN3A 4AFQC 1HSQA 4ESRA 2KT1A 4II1A 1OOTA 1KHIA 1PCXA 3VRZA 1M8VA 1WXTA 3PE0A 2JZ2A 1VQPQ 2RI2A 1T0HA 2HDAA 5IN1A 4JJBA 1AZEA 1Y96A 4ZN1A 4GY5A 1NYFA 2JS0A 1E7OA 3OYGA 3JB9I 2PZ1A 4PJOD 3JCMQ 4ATOA 4A4HA 1VYUA 2KAFA 3I35A 4F7UA 1W4SA 3CCVA 3DB4A 1VQKQ 2IPOB 3X25B 3WVDB 1VQOQ 2OTLQ 4XTVA 2PQWA 2ZCFB 6AT1B 4M75E 2XICA 1ZSZB 2DL7A 3F70A 1W70A 1Y07A 4AMCA 1O9SA 1Z9ZA 2E3IA 4E6RA 2EJGA 1OULA 4OMNA 4CC4B 2NYSA 3PFSA 4C92A 4BDZA 4MZTA 3NFCA 2O2OA 1K73U 2HZYA 3FLGA 1YP5A 2V26A 1Q81C 1VQMT 2I2LA 2QA4A 4MZMA 5A0LA 2M9UA 4XTXA 1MGQA 1MUZA 1T3LA 1UHCA 5GMKi 2X4WA 2XG8D 4Q5WA 2X51A 2VC8A 4NL3A 2L0AA 5J39A 1ARKA 2MWPA 1GXIE 2CSQA 3PMIA 2P0KA 3UATA 2M51A 4PJNA 5A0DA 1ZX6A 2COZA 3A8MB 5I22A 3OYIA 1G3TA 3QZ5B 2RQWA 3CMET 1Q7YU 3M5AA 1QVGS 1RI9A 2EJFA 4ME7A 4J83A 2K79A 3OW2P 1VQLQ 3V8KA 1I07A 3I55Q 2K4YA 2MK5A 4M78C 3SDZA 4TVRA 3EH1A 1M1KC 3I5RA 4XU0A 4HVVA 2KYMA 3CC4Q 4NOYA 4X9CA 3M0QA 2MIOA 3L1AA 4ZTFA 1WZOA 3RERA 1JJ2S 1NJIR 4DEXA 1RAGB 2L3QA 4PKCC 1B34B 1R0CB 2A36A 4M7DC 4PNOA 2ZPGB 3O5ZA 3OW2A 4FYYB 1Q95G 1UJYA 4JRIA 2DF6A 1KQSA 2YLBA 4KRTA 3THKA 4LE9A 2YWWA 2DVJA 2KRNA 2RA2A 1ACMB 1QW1A 3HKSA 3G1JA 1QVPA 2DK3A 3J81E 1YWPA 4FYWB 1BBZA 1AHJB 4Y91A 2BZXA 2LT1A 2J6KA 5KYUB 2K3YA 4FT4A 3RIRA 2PU9B 2ESWA 2KNBB 4M78D 4X1VA 1UECA 3I5SA 3P8BB 2YT6A 3EFOA 5J3BA 3OBYA 2YRDA 4AFSC 5GAN3 2DD5A 2XK0A 5GJWB 3E9GA 4HXJA 4EMKC 3OSVA 2P0PA 4C8QC 1BI2A 4GLMA 1WHHA 1WDXA 4M7DD 1M30A 4OB1B 2QAZA 1WLPB 2KR3A 3U23A 3OMGA 2A37A 3RKYA 5A2QE 9ATCB 1WIEA 4BDYA 1U1TA 1M90R 2AK5A 3FEOA 4KULA 3O8VA 3ASKA 1PNJA 5GJVB 5CIUA 3JB9G 1TU0B 3PNWC 2KK4A 3KUFA 4D6WA 2HMAA 2RQUA 3I56Q 2K2MA 5GAN5 3H6ZA 1S72T 5I11A 2MYSA 4E7IA 3NTHA 1TOVA 2EPDA 3A8HB 2E12A 1M2OA 1M2VA 2VGMA 1YJWQ 1GBQA 4JZ4A 1UUEA 2CS7A 2JJ9A 2RJFA 3ZEHA 5IAYA 2CT3A 5GAN2 1KQ2A 4J6WA 2X3WD 1RUWA 1XOVA 4KUIA 1EX4A 4MDWA 5CKHA 1KD1U 2B8AA 2DYIA 4V2SA 1Q82R 3JRZA 4IIOA 2YDLA 2XDBA 2CYZB 3CCST 3GIBA 3G71Q 5I2MA 1M27C 1NJIC 3TEEA 5HK3A 2CP7A 2G3RA 2QQSA 2DJZA 2EYWA 2CP2A 5HKCA 1ZBXA 4MZPA 3UWNA 2KY9A 3RUXA 2RN8A 3OY9A 2DL4A 1UE9A 3L2QA 4M7AF 3CCLQ 3M0UA 1UGPB 4E7HA 3CCQA 1NE8A 2YUQA 4M77C 3P8HA 2E3HA 3M9QA 2GQIA 1NM7A 1VQ4T 4PFOA 3CPWA 2M16A 2Z0WA 1Z9QA 2G6FX 4MDXA 1YHQT 1OPKA 4ZGDB 4J9FA 1MNDA 1MMDA 4C8QE 1V76A 2J05A 2QI2A 2JS2A 1V29B 2QQRA 1RABB 2GTJA 2EAYA 4OB0B 1YNZA 3DKMA 2QDYB 2Y90A 1M90C 1UGRB 4L5GA 3UF4A 2YUNA 4EIKA 1QVFP 2LDMA 2DXBA 2DKGA 3CMAT 2HSPA 2QEXA 1BB9A 2BIVA 1Q81U 3CC7T 3INZA 4M78A 3RMQA 3CCJQ 2KXCA 3CCET 2J6OA 4KH0B 4J9DA 2OTJT 2DERA 3UT1A 1VQ6T 1IHWA 3LWIA 1AEYA 3C12A 1XNIA 2QQBA 4ORZA 2PUOB 2K2VA 2HBWA 1PKSA 4JS5A 1YJ9Q 3CBPA 4CC2A 4M7DA 2QXFA 3EGDB 3HSBA 2RHZA 4OMQA 1QVFA 1OI1A 2R5AA 1RL2A 2EQJA 1PSEA 3CCUQ 4JRPA 1Q82C 1ZA2B 2YLCA 1N27A 4F7UF 1X2KA 4KGXB 1G83A 2JMCA 1LPLA 1MNEA 1VQOA 2OTLA 2MMPA 2HL5C 1WQWA 3S3OA 2B86A 2DLPA 1G3SA 4PJMA 1M1KU 4B9WA 3GF5A 1I8FA 2EQUA 4J9BA 4JRQA 2CDTA 3HRUA 3TCJA 1VQNQ 2C0OA 4C92F 4C8QA 1S72A 2DMOA 3V7CA 1NG2A 2QTXA 4BI3A 3EAEA 2A7YA 2JNGA 2YXYA 1K0SA 2EGCA 2BKDN 1VQ9Q 2FPFA 2DNUA 1D3BB 1DJ7B 2SEMA 1D0XA 1LOJA 2LJ3A 1M1FA 3LW5E 1OU8A 3OYFA 3LLRA 1NLOC 4M77E 4QQDA 1OX8A 3EG2A 1NZ9A 4PJLA 7AT1B 1BI0A 4E7KA 1T3SA 3EGXB 5CVIA 3QSUA 2F5TX 4N4GA 1WI7A 1I5OB 2F2WA 2DTHA 2FZCB 2YRVA 1BIBA 4XTUA 1ZBJA 2KGTA 3C4SA 3CCVT 2RHIA 1SF9A 2OI3A 5GAMf 2DM1A 1I4K1 3QIIA 4E7ZA 1I81A 1R77A 4E7LA 5GANj 2L89A 1ZUUA 1YFNA 2E4HA 4F14A 4Y92A 1RAEB 4EMKB 4FSSA 3EHQA 3CC4A 2F1LA 2ZPFB 1KHCA 3MEWA 1H92A 2H8HA 4C92D 5LJ5d 2QA4T 2J7IA 4LNPA 5GANf 2ROLA 5GMKj 2D0NA 4BY6C 4J9CA 2L8DA 4AG1C 1D0ZA 1D0YA 2D6FA 4BI8B 1QWEA 4RKUE 4LUDA 5KYWA 2JM8A 3RBBB 2RI3A 1M3CA 2P84A 4RTWA 1QCOA 4M75C 2HD0A 5GMKm 4PL6A 1WHMA 2FRYA 2NUTB 1OZ2A 4M77A 2VXEA 1IRXA 5D6WA 1MMGA 4P5NA 2DIGA 2MPXC 3CCEA 3FJ5A 1W2BS 4KH1B 4ELZC 2LMJA 4DOWA 1N8RR 4O6JA 5LJ5j 1ZLMA 2EQMA 1M4ZA 1FYNA 3OYYA 3MKDA 1XQHA 4B9XA 1U06A 2E64A 2M0OA 1UTIA 2VV5A 4PJOF 3TSZA 3S3MA 1UFFA 3HFOA 4M75D 2HQEA 1SEMA 3PVLA 4OMFB 2RM4A 2XU8A 2VB6A 3CMEQ 3OQ5A 3I56A 1JB0E 3QKJA 2KYBA 5IHNA 4QQGA 5KYXA 3M4GA 1HXDA 3A8LB 1TUGB 4JDSA 3M4YA 3CXCS 1WGSA 3QPHA 1YJWA 2RF0A 3DLMA 2RQVA 4DA4A 3BDLA 3TU4K 3OSSC 1U5SA 1MV3A 2ZPIB 2DL5A 1G3WA 4J7IA 2MWOA 5FW9A 1Q86U 3SWNA 1BK2A 1QVGP 4FW2A 4RTYA 1TUCA 4M7AB 2MCNA 2D8JA 4AG2C 5GAN4 1PKTA 5KYNA 1SHGA 4RCCA 5IHIA 4KGZB 1VA7A 1TG0A 3I9QA 2XDPA 1UEBA 1T0JA 1BYMA 1QCNA 2KRSA 5GAMg 3Q1JA 1C0MA 4WCIA 3N5BB 5GANh 2ABLA 3BE3A 2XD0A 2KMTA 1JJ2P 1JRIA 3ZBDA 1YJNQ 4E47A 2KRMA 1QVGA 3AHUA 2XIDA 4M7AG 5IXBA 2DRMA 1M5Q1 1K9MR 3EG0A 1PD1A 2RMOA 3EG9A 5GMKh 1NBEB 1Y7XA 3RKWA 1GFCA 1WNLA 4IUVA 4IUUA 4C0GA 1WHJA 2XI9A 4IUQA 5AT1B 3UA7A 1Q82U 4OP0A 2K6DA 1JJ2A 1X43A 2GTOA 3VRYA 3CEYA 2VKNA 2RHYA 4CC3A 4XU2A 3OB9A 3HP9A 5GAOm 2H3JA 4OGCA 4WF2A 2K57A 2PVOB 5CK9A 4F16A 3JV3A 3GLXA 1H641 4FCYA 2KROA 1YWOA 4E7SA 3KFVA 1NYGA 2BZ8A 4J7FA 1Y96B 3CCJA 4M78F 3AT1B 4QVCA 1KSWA 1VQ7Q 2M0YA 5LJ5h 2X9HA 4F7UB 4DOVA 2O88A 1QP3A 2E6ZA 3CCQT 1YJ9A 5IHKA 1LJOA 3LH5A 1KQSP 3MEVA 4M7DF 2KBTA 2K3BA 3JCMd 2E10A 2GNCA 1KFZA 4AT1B 4C92B 1N9SA 1RI0A 1K4US 2P4TA 3CCUA 2AKLA 4D8DA 4HA8A 2LRQA 1ABOA 2ZPHB 2BTTA 1KC8R 5DM7R 1BCMA 2VVKA 2CUDA 4KUDK 4M75A 1AZGB 2YUOA 2O4XA 3OYKA 2RK1A 4J5YA 2HAXA 5CQXA 2FHDA 3A1PA 3CCRQ 2EQIA 4IUTA 3GPLA 5CCAA 2QEXT 2PUKB 1K8AR 2QG9B 4FL6A 3NGPA 3CCMQ 2DD4A 2DZCA 4C8QF 2EGEA 4BACA 2IIMA 4Z89A 3X28B 2FL7A 4RUGA 3PT9A 2D9TA 1K9MC 3NPFA 1U8RA 2LJ0A 1VQ4Q 3A8OB 5FLXE 2ED1A 1YN8A 2EYZA 1TSFA 3D7SB 1MMNA 2RK2A 3QDRB 4BY6B 1E6GA 1H8KA 4EPCA 5GAOq 2PNIA 4AFZC 1M9SA 2YUPA 4QVDA 4QVZA 1IGQA 2O9SA 4JRKA 2KSSA 3ME9A 2JTFA 3RNJA 4BE1A 1WJRA 2F69A 1VQOT 2OTLT 3CMAQ 1SHFA 1UGQB 2NUZA 2VUBA 3JSCA 4CI0C 1YI2Q 1VQ5A 1VYTA 2KQWA 3QBYA 5LJ3d 3JCMW 2LP5A 4C0DC 4LDWA 3VS7A 2EGAA 2VYTA 2WSCE 2K5LA 4HT9A 4D8KA 3QWYA 1BCOA 2KT8A 3MP6A 4C8QD 1OEBA 4RTXA 4F17A 2D8HA 3EFOB 1I1JA 1WJQA 3A98A 2EKOA 3QJ6A 4JLIA
chains in the Genus database with same CATH topology
2B86A 2DLPA 2C0IA 3REAB 4JPBW 3M0SA 4HVUA 4J9BA 4RTUA 2V1QA 2HCKA 1U3OA 2CDTA 1SRMA 3VS1A 4J9HA 2C0OA 2YSQA 2DMOA 1NG2A 2DL8A 2FPDA 1QLYA 1S1NA 1K0SA 1ZSGA 2EGCA 1NEBA 2FPFA 2DNUA 2F2VA 2L3SA 2RQRA 1PWTA 1VYVA 1K0XA 2D1XA 2SEMA 2A08A 2LJ3A 1QKWA 4JZ3A 2KXDA 1JXMA 4R0KA 2JMAA 1NLOC 3EG2A 1SRLA 3H0HA 1M3BA 1H3HA 1T3SA 1X6GA 3VS5A 2DJQA 1M3AA 1WI7A 2ENMA 2F2WA 1TUDA 2X3XD 2J06A 1CKAA 1ZBJA 2KGTA 2OI3A 1KIKA 2DM1A 1JXOA 4AFQC 1HSQA 4ESRA 2KT1A 2GGRA 2EYYA 2CH4A 2EW3A 4OMMA 1ZUUA 1GCQA 1OOTA 2DBMA 2DE0X 3VRZA 1WXTA 3PE0A 4Y92A 4F14A 2EBPA 2C0TA 4FSSA 1T0HA 3EHQA 2HDAA 4JJBA 4JJCA 2SRCA 2LNHB 1H92A 1AZEA 2H8HA 2ED0A 1NYFA 2J7IA 2JS0A 1E7OA 4LNPA 2ROLA 3CQTA 2D0NA 2L2PA 2PZ1A 1N5ZA 4J9CA 1J3TA 4AG1C 1VYUA 1PRMC 2RQTA 3I35A 1M8MA 2F2XA 2DYBA 3R6NA 1HJDA 3H41A 1QWEA 2DL7A 3TSWA 4LUDA 1W70A 1OV3A 2JM8A 3NHNA 2CT4A 3RBBB 1Z9ZA 4E6RA 3M0TA 1M3CA 1IO6A 4OMNA 2E5KA 4CC4B 1B07A 4RTWA 1WXUA 4Z8AA 2O31A 1NLPC 5FWCA 1V1CA 2O2OA 1X27A 1YP5A 2FRYA 2OJ2A 3EGUA 3VS0A 1UJ0A 3SEMA 1MUZA 1T3LA 1UHCA 1AWOA 3FJ5A 1UHFA 3VS4A 2HEQA 2L0AA 1WX6A 2LMJA 1ARKA 4RTTA 3VS3A 1CSKA 1K76A 2CSQA 3UATA 1ZLMA 1G83A 2M51A 2LQWA 1FYNA 2LQNA 1GRIA 1ZX6A 1AOJA 1WYXA 5I22A 2RQWA 1UG1A 1GCPA 1U06A 1UTIA 2VWFA 4HCKA 3TSZA 1RI9A 1UFFA 2K79A 2A28A 1SEMA 3PVLA 1PRLC 2P4RA 2KYBA 5IHNA 4CC7A 1I07A 1MV0B 1OPLA 1AD5A 4HVWA 1RLPC 4A63B 2KEAA 2RF0A 2DL3A 2W0ZA 1GFDA 3I5RA 2RQVA 4HVVA 3EG1A 2CSIA 2KYMA 3IQLA 2MIOA 3M0QA 1U5SA 4DEXA 1MV3A 2FRWA 2DL5A 3VS2A 2L3QA 3EG3A 5FW9A 2OAWA 1UGVA 2RNAA 2A36A 3H0FA 3O5ZA 1BK2A 1WXBA 4RTVA 4RTYA 1TUCA 1UJYA 2DF6A 2MCNA 4KRTA 3THKA 4LE9A 2D8JA 2DVJA 2DX1A 3TVTA 2KRNA 4AG2C 1PKTA 1QKXA 1KJWA 1SHGA 2AZVA 2ROTA 5IHIA 1VA7A 1TG0A 3I9QA 2JT4A 1YWPA 1AWXA 1BBZA 2BZXA 1T0JA 2J6KA 2I0NA 2KRSA 4WCIA 3SHWA 2ESWA 2KNBB 2ABLA 4X1VA 1ZUYA 1X69A 1UECA 3I5SA 2FG0A 2YT6A 4J9IA 1G2BA 4AFSC 2KRMA 2O9VA 2DILA 4OMLA 5IXBA 2DRMA 5GJWB 4HXJA 1CKBA 3EG0A 4GLMA 1WDXA 2RMOA 4OMPA 4M4ZA 4QT7A 2W10A 1M30A 1GFCA 4JJDA 2LJ1A 1WLPB 2KR3A 3U23A 2CUBA 2A37A 3UA7A 1W1FA 2K6DA 1X43A 1WIEA 2GTOA 3VRYA 2AZSA 2AK5A 3GBQA 2VKNA 4CC3A 1SPKA 1PNJA 5GJVB 5ECAA 3VS6A 3ULRB 2RQUA 4ZNXA 4K11A 2K2MA 2PTKA 2NWMA 5I11A 2JW4A 2JM9A 2EPDA 2DRKA 2GBQA 4F16A 3JV3A 1K9AA 1YCSB 2KROA 1JU5C 1YWOA 1JO8A 1GBQA 1UUEA 4JZ4A 3REBB 1JQQA 3KFVA 2EVRA 1NYGA 2BZ8A 2LZ6B 1AWJA 2CT3A 2X3WD 1RUWA 1XOVA 5HCKA 2AKKA 1KSWA 1JEGA 2M0YA 2EYXA 2O88A 1Y0MA 4IIOA 1BU1A 2YDLA 5IHKA 3LH5A 2K9GA 2KBTA 1M27C 2K3BA 5L23A 5EC7A 2GNCA 1KFZA 4DEYA 2EYWA 1WA7A 1K4US 2DA9A 2LX7A 2AKLA 4D8DA 2DBKA 1ABOA 2BTTA 2MOXA 2VVKA 2RN8A 2CUDA 2J6FA 4Z88A 2K7AA 2FPEA 2DL4A 1AVZC 1UE9A 1QCFA 1WFWA 4IIMA 1AZGB 5FWBA 2YUOA 1RLQC 4J9EA 3PVQA 1ZUKA 3M0UA 3C0CA 2FEIA 2CH4W 4OMOA 5IH2A 1I0CA 2EQIA 2YUQA 1UDLA 2BZYA 5IXFA 3NGPA 2QDLA 2LCSA 2EGEA 4J9GA 3ZL7C 1HD3A 2GQIA 1NM7A 2IIMA 3M0PA 4Z89A 3H0IA 1QWFA 4RUGA 1Z9QA 1K1ZA 1GBRA 2G6FX 3NPFA 1OPKA 2LJ0A 4GBQA 1EFNA 4J9FA 2L3PA 2JXBA 2ED1A 2EKHA 3QWXX 1YN8A 2EYZA 2ECZA 2J05A 1E6GA 1H8KA 1X2QA 2JS2A 3M0RA 1W6XA 2CREA 2PNIA 4AFZC 2GTJA 2YUPA 1AWWA 2RPNA 1A0NB 1YNZA 1LCKA 3NMZC 1SSHA 2O9SA 3UF4A 2YUNA 4EIKA 3RNJA 2FO0A 2HSPA 1BB9A 2KXCA 1NEGA 2J6OA 4J9DA 1SHFA 2NUZA 1GL5A 1AEYA 1VYTA 4ORZA 2LP5A 2HBWA 1PKSA 4LUEA 4CC2A 3VS7A 2EGAA 1Y57A 4AFUC 4OMQA 2KE9A 4D8KA 3QWYA 2KT8A 1E6HA 3EHRA 4LN2A 1OEBA 2V1RA 4RTXA 4F17A 3UA6A 1PHTA 2D8HA 2JTEA 1I1JA 1X6BA 1GCQC 3A98A 1ABQA 1B3QA 2XMFA 4RTZA 1FMKA 1X2KA 2JMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B86 A;  2DLP A;  2C0I A;  3REA B;  4JPB W;  3M0S A;  4HVU A;  4J9B A;  4RTU A;  2V1Q A;  2HCK A;  1U3O A;  2CDT A;  1SRM A;  3VS1 A;  4J9H A;  2C0O A;  2YSQ A;  2DMO A;  1NG2 A;  2DL8 A;  2FPD A;  1QLY A;  1S1N A;  1K0S A;  1ZSG A;  2EGC A;  1NEB A;  2FPF A;  2DNU A;  2F2V A;  2L3S A;  2RQR A;  1PWT A;  1VYV A;  1K0X A;  2D1X A;  2SEM A;  2A08 A;  2LJ3 A;  1QKW A;  4JZ3 A;  2KXD A;  1JXM A;  4R0K A;  2JMA A;  1NLO C;  3EG2 A;  1SRL A;  3H0H A;  1M3B A;  1H3H A;  1T3S A;  1X6G A;  3VS5 A;  2DJQ A;  1M3A A;  1WI7 A;  2ENM A;  2F2W A;  1TUD A;  2X3X D;  2J06 A;  1CKA A;  1ZBJ A;  2KGT A;  2OI3 A;  1KIK A;  2DM1 A;  1JXO A;  4AFQ C;  1HSQ A;  4ESR A;  2KT1 A;  2GGR A;  2EYY A;  2CH4 A;  2EW3 A;  4OMM A;  1ZUU A;  1GCQ A;  1OOT A;  2DBM A;  2DE0 X;  3VRZ A;  1WXT A;  3PE0 A;  4Y92 A;  4F14 A;  2EBP A;  2C0T A;  4FSS A;  1T0H A;  3EHQ A;  2HDA A;  4JJB A;  4JJC A;  2SRC A;  2LNH B;  1H92 A;  1AZE A;  2H8H A;  2ED0 A;  1NYF A;  2J7I A;  2JS0 A;  1E7O A;  4LNP A;  2ROL A;  3CQT A;  2D0N A;  2L2P A;  2PZ1 A;  1N5Z A;  4J9C A;  1J3T A;  4AG1 C;  1VYU A;  1PRM C;  2RQT A;  3I35 A;  1M8M A;  2F2X A;  2DYB A;  3R6N A;  1HJD A;  3H41 A;  1QWE A;  2DL7 A;  3TSW A;  4LUD A;  1W70 A;  1OV3 A;  2JM8 A;  3NHN A;  2CT4 A;  3RBB B;  1Z9Z A;  4E6R A;  3M0T A;  1M3C A;  1IO6 A;  4OMN A;  2E5K A;  4CC4 B;  1B07 A;  4RTW A;  1WXU A;  4Z8A A;  2O31 A;  1NLP C;  5FWC A;  1V1C A;  2O2O A;  1X27 A;  1YP5 A;  2FRY A;  2OJ2 A;  3EGU A;  3VS0 A;  1UJ0 A;  3SEM A;  1MUZ A;  1T3L A;  1UHC A;  1AWO A;  3FJ5 A;  1UHF A;  3VS4 A;  2HEQ A;  2L0A A;  1WX6 A;  2LMJ A;  1ARK A;  4RTT A;  3VS3 A;  1CSK A;  1K76 A;  2CSQ A;  3UAT A;  1ZLM A;  1G83 A;  2M51 A;  2LQW A;  1FYN A;  2LQN A;  1GRI A;  1ZX6 A;  1AOJ A;  1WYX A;  5I22 A;  2RQW A;  1UG1 A;  1GCP A;  1U06 A;  1UTI A;  2VWF A;  4HCK A;  3TSZ A;  1RI9 A;  1UFF A;  2K79 A;  2A28 A;  1SEM A;  3PVL A;  1PRL C;  2P4R A;  2KYB A;  5IHN A;  4CC7 A;  1I07 A;  1MV0 B;  1OPL A;  1AD5 A;  4HVW A;  1RLP C;  4A63 B;  2KEA A;  2RF0 A;  2DL3 A;  2W0Z A;  1GFD A;  3I5R A;  2RQV A;  4HVV A;  3EG1 A;  2CSI A;  2KYM A;  3IQL A;  2MIO A;  3M0Q A;  1U5S A;  4DEX A;  1MV3 A;  2FRW A;  2DL5 A;  3VS2 A;  2L3Q A;  3EG3 A;  5FW9 A;  2OAW A;  1UGV A;  2RNA A;  2A36 A;  3H0F A;  3O5Z A;  1BK2 A;  1WXB A;  4RTV A;  4RTY A;  1TUC A;  1UJY A;  2DF6 A;  2MCN A;  4KRT A;  3THK A;  4LE9 A;  2D8J A;  2DVJ A;  2DX1 A;  3TVT A;  2KRN A;  4AG2 C;  1PKT A;  1QKX A;  1KJW A;  1SHG A;  2AZV A;  2ROT A;  5IHI A;  1VA7 A;  1TG0 A;  3I9Q A;  2JT4 A;  1YWP A;  1AWX A;  1BBZ A;  2BZX A;  1T0J A;  2J6K A;  2I0N A;  2KRS A;  4WCI A;  3SHW A;  2ESW A;  2KNB B;  2ABL A;  4X1V A;  1ZUY A;  1X69 A;  1UEC A;  3I5S A;  2FG0 A;  2YT6 A;  4J9I A;  1G2B A;  4AFS C;  2KRM A;  2O9V A;  2DIL A;  4OML A;  5IXB A;  2DRM A;  5GJW B;  4HXJ A;  1CKB A;  3EG0 A;  4GLM A;  1WDX A;  2RMO A;  4OMP A;  4M4Z A;  4QT7 A;  2W10 A;  1M30 A;  1GFC A;  4JJD A;  2LJ1 A;  1WLP B;  2KR3 A;  3U23 A;  2CUB A;  2A37 A;  3UA7 A;  1W1F A;  2K6D A;  1X43 A;  1WIE A;  2GTO A;  3VRY A;  2AZS A;  2AK5 A;  3GBQ A;  2VKN A;  4CC3 A;  1SPK A;  1PNJ A;  5GJV B;  5ECA A;  3VS6 A;  3ULR B;  2RQU A;  4ZNX A;  4K11 A;  2K2M A;  2PTK A;  2NWM A;  5I11 A;  2JW4 A;  2JM9 A;  2EPD A;  2DRK A;  2GBQ A;  4F16 A;  3JV3 A;  1K9A A;  1YCS B;  2KRO A;  1JU5 C;  1YWO A;  1JO8 A;  1GBQ A;  1UUE A;  4JZ4 A;  3REB B;  1JQQ A;  3KFV A;  2EVR A;  1NYG A;  2BZ8 A;  2LZ6 B;  1AWJ A;  2CT3 A;  2X3W D;  1RUW A;  1XOV A;  5HCK A;  2AKK A;  1KSW A;  1JEG A;  2M0Y A;  2EYX A;  2O88 A;  1Y0M A;  4IIO A;  1BU1 A;  2YDL A;  5IHK A;  3LH5 A;  2K9G A;  2KBT A;  1M27 C;  2K3B A;  5L23 A;  5EC7 A;  2GNC A;  1KFZ A;  4DEY A;  2EYW A;  1WA7 A;  1K4U S;  2DA9 A;  2LX7 A;  2AKL A;  4D8D A;  2DBK A;  1ABO A;  2BTT A;  2MOX A;  2VVK A;  2RN8 A;  2CUD A;  2J6F A;  4Z88 A;  2K7A A;  2FPE A;  2DL4 A;  1AVZ C;  1UE9 A;  1QCF A;  1WFW A;  4IIM A;  1AZG B;  5FWB A;  2YUO A;  1RLQ C;  4J9E A;  3PVQ A;  1ZUK A;  3M0U A;  3C0C A;  2FEI A;  2CH4 W;  4OMO A;  5IH2 A;  1I0C A;  2EQI A;  2YUQ A;  1UDL A;  2BZY A;  5IXF A;  3NGP A;  2QDL A;  2LCS A;  2EGE A;  4J9G A;  3ZL7 C;  1HD3 A;  2GQI A;  1NM7 A;  2IIM A;  3M0P A;  4Z89 A;  3H0I A;  1QWF A;  4RUG A;  1Z9Q A;  1K1Z A;  1GBR A;  2G6F X;  3NPF A;  1OPK A;  2LJ0 A;  4GBQ A;  1EFN A;  4J9F A;  2L3P A;  2JXB A;  2ED1 A;  2EKH A;  3QWX X;  1YN8 A;  2EYZ A;  2ECZ A;  2J05 A;  1E6G A;  1H8K A;  1X2Q A;  2JS2 A;  3M0R A;  1W6X A;  2CRE A;  2PNI A;  4AFZ C;  2GTJ A;  2YUP A;  1AWW A;  2RPN A;  1A0N B;  1YNZ A;  1LCK A;  3NMZ C;  1SSH A;  2O9S A;  3UF4 A;  2YUN A;  4EIK A;  3RNJ A;  2FO0 A;  2HSP A;  1BB9 A;  2KXC A;  1NEG A;  2J6O A;  4J9D A;  1SHF A;  2NUZ A;  1GL5 A;  1AEY A;  1VYT A;  4ORZ A;  2LP5 A;  2HBW A;  1PKS A;  4LUE A;  4CC2 A;  3VS7 A;  2EGA A;  1Y57 A;  4AFU C;  4OMQ A;  2KE9 A;  4D8K A;  3QWY A;  2KT8 A;  1E6H A;  3EHR A;  4LN2 A;  1OEB A;  2V1R A;  4RTX A;  4F17 A;  3UA6 A;  1PHT A;  2D8H A;  2JTE A;  1I1J A;  1X6B A;  1GCQ C;  3A98 A;  1ABQ A;  1B3Q A;  2XMF A;  4RTZ A;  1FMK A;  1X2K A;  2JMC A; 
#chains in the Genus database with same CATH topology
 5KYY A;  3SD4 A;  5GAN 6;  3REA B;  2FYK A;  2R5M A;  1PD0 A;  4RG8 A;  1R0B G;  2RJE A;  4BE2 A;  4Z02 A;  5HY6 A;  4HT8 A;  1NPP A;  2HSE B;  2V1Q A;  1OYX A;  2HCK A;  2X4Y A;  1SRM A;  2Y4X A;  2YSQ A;  3TRE A;  2DL8 A;  1QLY A;  5LJ3 j;  1ZSG A;  3CPW P;  4LD6 A;  4PJO B;  2VXF A;  4M77 F;  1ZA1 B;  1PWT A;  2EIF A;  1TXQ A;  1RAI B;  2HKQ B;  4N4H A;  3T9N A;  1K73 R;  4JZ3 A;  2KXD A;  2CP3 A;  2X35 A;  3CC4 T;  4LD9 K;  3HL8 A;  4RCB A;  1VQ8 Q;  1G8X A;  1SRL A;  2EQK A;  5FU7 C;  3CC2 Q;  1M2V B;  5LJ3 f;  3H0H A;  2CP6 A;  3VS5 A;  1X6G A;  1M3A A;  1TUD A;  2J06 A;  2MAM A;  1CKA A;  4E7J A;  4PJO G;  3S3N A;  2A0F B;  2XHC A;  1F1B B;  2L5Q A;  3L2V A;  2EYY A;  3JCM V;  4OMM A;  1Q7Y R;  1JBM A;  4XQ3 A;  3QYH B;  2C0T A;  8AT1 B;  3CPF A;  4JJC A;  3JB9 H;  4IUP A;  2ZPB B;  5FU6 C;  2KI7 A;  5FRM A;  2RB6 A;  3OYM A;  3G6E Q;  3JCM h;  3MP8 A;  2X4X A;  4RG2 A;  4ANJ A;  3JCM P;  4R55 A;  1LNX A;  4M77 D;  5L8R E;  1M8M A;  2F2X A;  2DYB A;  2WSF E;  1KQ1 A;  4HKE A;  4ELY C;  2DET A;  1YIJ Q;  3HRS A;  3OYA A;  4N4I A;  3VYG A;  1VQP A;  3M0T A;  2E5K A;  1PM3 A;  4JUV A;  3SWN C;  2O31 A;  1IHV A;  1ZQ1 A;  1NLP C;  1TWB A;  1YJN A;  2AT1 B;  1FMW A;  1XTD A;  3I56 T;  1N6A A;  1RAF B;  4DBF A;  2RH2 A;  3DB3 A;  3EGU A;  1ZSZ C;  4PLL A;  3VS0 A;  2QK0 A;  2FVU A;  2LT4 A;  2H3E B;  4X9D A;  1FX7 A;  1AWO A;  5DY9 A;  3OS5 A;  4XTZ A;  1YJW T;  1VQK A;  3FJP A;  1UHF A;  3VS4 A;  2HEQ A;  2RJD A;  1WX6 A;  3MET A;  3VS3 A;  2LCC A;  1CSK A;  1K76 A;  5KCO A;  4A4K A;  2LQW A;  1OU9 A;  2PVG B;  3V8J A;  1GRI A;  1WYX A;  4OGE A;  4M78 B;  1GCP A;  2KDS A;  2QGG A;  2DO3 A;  3QO3 A;  4IUR A;  1FXX A;  1YIT Q;  2A28 A;  2P4R A;  4NL2 A;  2COY A;  5DLQ E;  4HVW A;  4M7D B;  2DZ9 A;  4A63 B;  1R8O B;  5LJ3 h;  4RMO A;  2JVV A;  2DL3 A;  2W0Z A;  1GFD A;  3EG1 A;  2CSI A;  3CD6 Q;  1C6V X;  3IQL A;  3H9N A;  4A53 A;  2ATC B;  2FRW A;  3VS2 A;  3CCL T;  3EG3 A;  5I21 A;  1Q7Y C;  1UGV A;  3JCM J;  5GAM e;  1VQ7 A;  2M1H A;  4C5G A;  4OB2 B;  3G4S Q;  1WXB A;  4RTV A;  1HYO A;  1VQL A;  2NUP A;  2FZK B;  3RMS A;  2CZ0 B;  4M7D G;  5CAI A;  3I55 A;  1W2B A;  1QKX A;  1KD1 R;  4OVA A;  4M7A E;  1KJW A;  2ROT A;  2AZV A;  2DIQ A;  1KK7 A;  2JT4 A;  1AWX A;  2FB7 A;  4C8Q B;  4JLG A;  3QDF A;  2RHX A;  5CQY A;  2K5F A;  5GAN e;  2NUT A;  2LQ8 A;  3VJP A;  1G2B A;  4F04 B;  2Y4Y A;  1VUB A;  2R58 A;  2LCL A;  4M75 F;  4OML A;  1EIF A;  3RR6 A;  4QW2 A;  2K5I A;  1NPR A;  3BDU A;  3M57 A;  4QKU A;  1OZ3 A;  3CCR A;  4QT7 A;  2W10 A;  1G3Y A;  3CXC A;  5GMK e;  3CCJ T;  4JJD A;  3CCM A;  1X75 C;  3M59 A;  2CUB A;  4Y28 E;  1OX9 A;  1VOM A;  1XJW B;  2AZS A;  3OYC A;  4FYV B;  1WHL A;  1YJ9 T;  3CBM A;  3VS6 A;  3ULR B;  5CKF A;  1UGS B;  3LX7 A;  3NTI A;  4K11 A;  4ZNX A;  2L3R A;  4C5E A;  2LC4 A;  2NWM A;  1VQM Q;  4FT2 A;  5EG2 A;  2QAS A;  2JM9 A;  1NJI U;  2DRK A;  2GBQ A;  1K9A A;  3L2W A;  3CCU T;  3DLL A;  3E2U A;  3FIF A;  3REB B;  3L2Z A;  1FMV A;  5KE2 A;  2LZ6 B;  3OS2 A;  2ZGW A;  3VV0 A;  1AWJ A;  4J6X A;  5HCK A;  2IVW A;  1YI2 A;  1IB8 A;  1JEG A;  1UB4 A;  4HCB A;  3QZ9 B;  3JB9 D;  3PIO A;  1Q81 R;  1WJS A;  1Y0M A;  5LJ5 f;  1VQN T;  3QG1 A;  4XU3 A;  3OS0 A;  2K9G A;  2V8J A;  3CCQ Q;  5KYW B;  2V8I A;  2DEQ A;  2AIR B;  1RAA B;  2DAQ A;  1D1B A;  2GFA A;  2DA9 A;  2LX7 A;  2GCX A;  2DBK A;  3OYJ A;  1G5V A;  3HFN A;  2K3X A;  2J6F A;  4M77 B;  4Z88 A;  5J26 A;  1KD1 C;  1WFW A;  2RI5 A;  1IZ6 A;  4JJN K;  4J9E A;  3SFM A;  2XKO C;  2CH4 W;  4OMO A;  1ZSZ A;  3G71 A;  4PFP A;  3MEA A;  1RAH B;  1M90 U;  3ZFJ A;  2QDL A;  1QP2 A;  3M0P A;  1WHG A;  1M1G A;  1M1K R;  1QWF A;  1VQ5 T;  2VGN A;  3NTK A;  4GBQ A;  2LX9 A;  2JXB A;  3QWX X;  2EKH A;  5FU6 B;  4XU1 A;  5CKB A;  2ECZ A;  2HNI A;  5FRO A;  3M0R A;  5KYX B;  3CCL A;  4R56 A;  4GLK A;  1VQ8 A;  1SSF A;  3CC2 A;  1AWW A;  4FW1 A;  1A0N B;  1SSH A;  5GAN g;  1KG1 A;  2FO0 A;  3JCM X;  4MML A;  3M55 A;  1I5L A;  3SWN B;  2GF7 A;  4MMK A;  1GL5 A;  1AT1 B;  2CP0 A;  1N8R C;  2COW A;  4LUE A;  3X26 B;  2DTO A;  4ZGJ B;  3VKI A;  5GAO p;  3JCM c;  4IKF A;  8ATC B;  3SB2 A;  2KE9 A;  5D7U A;  3QUI A;  2R57 A;  1S72 Q;  3J7A F;  1WQ7 A;  3G6E A;  3C94 A;  3EHR A;  2V1R A;  2HL3 A;  2JTE A;  1B34 A;  1IRE B;  1X6B A;  3MHX A;  4OB3 B;  1B3Q A;  2XMF A;  4BI4 A;  4RTZ A;  3OMC A;  3V8L A;  2C0I A;  3KBG A;  4LDY A;  1YIJ A;  4JPB W;  3EG9 B;  2BE7 D;  2EWN A;  4HVU A;  4BE0 A;  2ZPE B;  4RTU A;  4XK8 E;  4DBR A;  3M54 A;  3OA6 A;  3VS1 A;  4J9H A;  3WXM B;  3PTA A;  3CCS Q;  1SG5 A;  5KYU A;  2FPD A;  4XTY A;  3MCA B;  3M56 A;  1NEB A;  2WSE E;  4X34 A;  5LJ5 g;  3HTR A;  3TQ7 P;  3E19 A;  2RQR A;  1VYV A;  1K0X A;  1WPY A;  3S6W A;  2A08 A;  4F7U G;  4B6M A;  4PJO E;  2CZ7 B;  2JN0 A;  4C0F A;  1JXM A;  4R0K A;  2CP5 A;  2DVE A;  3QJY A;  1C1A A;  2MF2 A;  1FWZ A;  2DPP B;  1H3H A;  2DJQ A;  1VQN A;  5I2S A;  4C92 G;  2ENM A;  5GAO n;  2IG0 A;  1KIK A;  1VQ9 A;  1YIT A;  1QMC A;  2GGR A;  4NS5 A;  1YHQ Q;  3M58 A;  2DXU A;  2CH4 A;  2EW3 A;  1VQP T;  1GCQ A;  1EZZ B;  2DBM A;  2DE0 X;  3FC3 A;  3VU3 C;  2EBP A;  2EYQ A;  1YJN T;  3CD6 A;  1IXD A;  4E2F B;  3EFR A;  3H8Z A;  2SRC A;  2LNH B;  2ED0 A;  1YCY A;  2E41 A;  4A4E A;  3CQT A;  2L2P A;  3JCM e;  1LVK A;  1IGU A;  1N5Z A;  3JCM f;  1VQK T;  4FSX A;  1J3T A;  5IT9 E;  2DTI A;  3G4S A;  3JB9 J;  4M75 B;  1PRM C;  2RQT A;  3CC7 Q;  2O4X B;  3R6N A;  1WHK A;  4N0A C;  3CCE Q;  3MEU A;  1HJD A;  4J6Y A;  2OTJ Q;  1VQ6 Q;  1Q86 R;  3H41 A;  2DXT A;  4OF1 A;  3TSW A;  5GAO r;  1OV3 A;  3NHN A;  2CT4 A;  5D6X A;  2NLU A;  1IO6 A;  4UC4 A;  3GNG A;  1OQK A;  1B07 A;  2PVD B;  1WXU A;  2QTV A;  3PMT A;  4Z8A A;  1ZHI A;  5FWC A;  1V1C A;  4PJO A;  1X27 A;  2OJ2 A;  1U1S A;  3OW2 S;  4M75 G;  4XAX B;  1MMA A;  1UJ0 A;  1X6O A;  1KQS S;  3SEM A;  4KGV B;  2P0Q A;  2BUD A;  1H3Z A;  2JUF A;  3OBW A;  5KCH A;  4RTT A;  3A8G B;  3MPU B;  2HBP A;  2LQN A;  3E1S A;  2OX7 A;  1AOJ A;  1KC8 C;  1VQ7 T;  1UG1 A;  2CZ1 B;  4HCK A;  2VWF A;  1VQL T;  2E5Q A;  4DBH A;  5KH6 A;  2QQA A;  4M78 E;  3I55 T;  1PRL C;  2QGF B;  4CC7 A;  1VQM A;  4FYX B;  1MV0 B;  1OPL A;  2EJ9 A;  1K8A C;  1AD5 A;  1RLP C;  2KEA A;  2QYZ A;  4JS4 A;  5LJ3 e;  3UDC A;  4A54 A;  4M7D E;  4PJJ A;  5CO7 A;  2E70 A;  3OS1 A;  1Y71 A;  2GFU A;  2OAW A;  2RNA A;  3H0F A;  3G7Z A;  4HCZ A;  3OYH A;  3CCR T;  2C06 A;  3M53 A;  4KBM B;  5KYY B;  3CME A;  3CCV Q;  3CCM T;  2DX1 A;  3UPU A;  3TVT A;  2F5K A;  4KT0 E;  3JAM E;  1RAC B;  3PIP A;  3QXE B;  3EGD A;  1P92 A;  1RAD B;  2XDD A;  3FDR A;  2MI6 A;  2I0N A;  3OYD A;  1PC0 A;  2YHT A;  4FM4 B;  3SHW A;  4M7A C;  1ZUY A;  1X69 A;  2FG0 A;  2RJC A;  4BB7 A;  4J9I A;  1SKU B;  1Q86 C;  5FRN A;  1PSF A;  2O9V A;  5KE3 A;  1N8R U;  2QA4 Q;  2DIL A;  2WAC A;  3WVE B;  5A0G A;  1MHN A;  2FZG B;  1CKB A;  4OMP A;  4FIB A;  4M4Z A;  3MJX A;  2LJ1 A;  4BD3 A;  2O01 E;  4VUB A;  3QHS A;  1YI2 T;  4PK4 A;  2A3L A;  3JCM g;  1W1F A;  2DEU A;  4PFZ A;  3JCM b;  3EFS A;  3KXT A;  3GBQ A;  3CBO A;  4C5H A;  1N9R A;  1D3B A;  1SPK A;  5ECA A;  1BI1 A;  3LH0 A;  4CRI A;  1BIA A;  4M7A D;  3ER0 A;  4O5V A;  2PTK A;  2JW4 A;  3OYN A;  4LDV A;  4FU6 A;  1O75 A;  5CKD A;  2E1H A;  5GAM d;  1YCS B;  1JU5 C;  2RHU A;  1JO8 A;  3EGX A;  3BW1 A;  4BUG A;  4DQ2 A;  1JQQ A;  3GNF B;  2EVR A;  2VAS A;  3CPW S;  1TS9 A;  3LWH A;  4HCC A;  3V7S A;  3BFM A;  5GMK l;  3OYB A;  1VIE A;  2X4J A;  3URG A;  2AKK A;  1K73 C;  1BKB A;  3LGL A;  2RO0 A;  3G71 T;  2EYX A;  1BU1 A;  1B7T A;  2JOY A;  1QQJ A;  5GAN d;  3L42 A;  2LQK A;  5L23 A;  3RES A;  2ZZD A;  5EC7 A;  5DLO A;  4EMK A;  3C95 A;  4EDU A;  1W2B P;  1HK9 A;  2E6N A;  2V8K A;  4N0A A;  4DEY A;  2CGH A;  1WA7 A;  3QYG B;  1K9M U;  4M78 G;  1TH7 A;  1TTH B;  2QQ9 A;  2MOX A;  2K7A A;  2FPE A;  5C0M A;  1VQ8 T;  1AVZ C;  1QCF A;  4IIM A;  3CC2 T;  5FWB A;  4YTL A;  1RLQ C;  3PVQ A;  5GAM j;  1ZUK A;  4C92 C;  3C0C A;  3LYI A;  3EH2 A;  2FEI A;  3BY7 A;  5LJ3 g;  5IH2 A;  1I0C A;  1QVF S;  3E9F A;  1UDL A;  2BZY A;  5IXF A;  3CCS A;  2LCS A;  2LTO A;  4J9G A;  2BE9 B;  4J8O A;  3CXC P;  3ZL7 C;  1HD3 A;  3MP1 A;  5GAN 8;  3H0I A;  1K1Z A;  1GBR A;  3GP8 A;  4LXC A;  1EFN A;  2L3P A;  1VQ5 Q;  3JB9 F;  2AHJ B;  4A4G A;  1X2Q A;  3VUB A;  2M02 A;  1W6X A;  2CRE A;  5CKE A;  1D1A A;  2ZAE A;  3G6E T;  2RPN A;  1D09 B;  1LCK A;  3NMZ C;  5CR2 A;  4C0D B;  4C8Q G;  2D0Q B;  2HQH A;  1NEG A;  2JTM A;  1VQ4 A;  4ZTJ A;  1YIJ T;  1D1C A;  5D6Y A;  3PGG A;  2GQV A;  2KVQ G;  1YHQ A;  3MO8 A;  2NUP B;  3X24 B;  3VUZ A;  1VIF A;  3RDV A;  1Y57 A;  3HRT A;  4AFU C;  3HHT B;  2LNV A;  4PLI A;  1KC8 U;  1E6H A;  4A4F A;  3R6O A;  4LN2 A;  3FB9 A;  4LDX A;  3UA6 A;  1PHT A;  3LGF A;  3FRN A;  4DBQ A;  4EMG A;  3CMA A;  1GCQ C;  3J80 E;  1ABQ A;  3CC7 A;  5AYF A;  2LVM A;  1FMK A;  2E65 A;  5GAO l;  3L2R A;  3OYE A;  1K8A U;  4M7A A;  2OTJ A;  2CZ6 B;  2CKK A;  4C5I A;  5LJ5 e;  1VQ6 A;  4L59 A;  1X01 A;  3M0S A;  1YBY A;  5GAN 7;  2HKN A;  5LL6 S;  4F7U E;  3L2U A;  1U3O A;  3HPW A;  4WTO B;  3OYL A;  1VQ9 T;  1YIT T;  5M9O A;  1S1N A;  3GOX A;  4EMH A;  5FU7 B;  3P8D A;  2EFI A;  5C6S A;  2F2V A;  4C92 E;  2YRC A;  2L3S A;  2D1X A;  3A5Z B;  1QKW A;  2HQX A;  3VYH B;  4L6V 5;  3CD6 T;  4XTW A;  4LDU A;  2JMA A;  4C0Z A;  2DXC A;  2DFU A;  5HK0 A;  1M3B A;  4PJO C;  3RKX A;  2RD1 A;  1PG5 B;  4QQ6 A;  3X20 B;  2X3X D;  3G4S T;  5GAM h;  4ZGE B;  2QEX Q;  3V7R A;  1BI3 A;  2OAU A;  1JXO A;  4M77 G;  4ZN3 A;  4AFQ C;  1HSQ A;  4ESR A;  2KT1 A;  4II1 A;  1OOT A;  1KHI A;  1PCX A;  3VRZ A;  1M8V A;  1WXT A;  3PE0 A;  2JZ2 A;  1VQP Q;  2RI2 A;  1T0H A;  2HDA A;  5IN1 A;  4JJB A;  1AZE A;  1Y96 A;  4ZN1 A;  4GY5 A;  1NYF A;  2JS0 A;  1E7O A;  3OYG A;  3JB9 I;  2PZ1 A;  4PJO D;  3JCM Q;  4ATO A;  4A4H A;  1VYU A;  2KAF A;  3I35 A;  4F7U A;  1W4S A;  3CCV A;  3DB4 A;  1VQK Q;  2IPO B;  3X25 B;  3WVD B;  1VQO Q;  2OTL Q;  4XTV A;  2PQW A;  2ZCF B;  6AT1 B;  4M75 E;  2XIC A;  1ZSZ B;  2DL7 A;  3F70 A;  1W70 A;  1Y07 A;  4AMC A;  1O9S A;  1Z9Z A;  2E3I A;  4E6R A;  2EJG A;  1OUL A;  4OMN A;  4CC4 B;  2NYS A;  3PFS A;  4C92 A;  4BDZ A;  4MZT A;  3NFC A;  2O2O A;  1K73 U;  2HZY A;  3FLG A;  1YP5 A;  2V26 A;  1Q81 C;  1VQM T;  2I2L A;  2QA4 A;  4MZM A;  5A0L A;  2M9U A;  4XTX A;  1MGQ A;  1MUZ A;  1T3L A;  1UHC A;  5GMK i;  2X4W A;  2XG8 D;  4Q5W A;  2X51 A;  2VC8 A;  4NL3 A;  2L0A A;  5J39 A;  1ARK A;  2MWP A;  1GXI E;  2CSQ A;  3PMI A;  2P0K A;  3UAT A;  2M51 A;  4PJN A;  5A0D A;  1ZX6 A;  2COZ A;  3A8M B;  5I22 A;  3OYI A;  1G3T A;  3QZ5 B;  2RQW A;  3CME T;  1Q7Y U;  3M5A A;  1QVG S;  1RI9 A;  2EJF A;  4ME7 A;  4J83 A;  2K79 A;  3OW2 P;  1VQL Q;  3V8K A;  1I07 A;  3I55 Q;  2K4Y A;  2MK5 A;  4M78 C;  3SDZ A;  4TVR A;  3EH1 A;  1M1K C;  3I5R A;  4XU0 A;  4HVV A;  2KYM A;  3CC4 Q;  4NOY A;  4X9C A;  3M0Q A;  2MIO A;  3L1A A;  4ZTF A;  1WZO A;  3RER A;  1JJ2 S;  1NJI R;  4DEX A;  1RAG B;  2L3Q A;  4PKC C;  1B34 B;  1R0C B;  2A36 A;  4M7D C;  4PNO A;  2ZPG B;  3O5Z A;  3OW2 A;  4FYY B;  1Q95 G;  1UJY A;  4JRI A;  2DF6 A;  1KQS A;  2YLB A;  4KRT A;  3THK A;  4LE9 A;  2YWW A;  2DVJ A;  2KRN A;  2RA2 A;  1ACM B;  1QW1 A;  3HKS A;  3G1J A;  1QVP A;  2DK3 A;  3J81 E;  1YWP A;  4FYW B;  1BBZ A;  1AHJ B;  4Y91 A;  2BZX A;  2LT1 A;  2J6K A;  5KYU B;  2K3Y A;  4FT4 A;  3RIR A;  2PU9 B;  2ESW A;  2KNB B;  4M78 D;  4X1V A;  1UEC A;  3I5S A;  3P8B B;  2YT6 A;  3EFO A;  5J3B A;  3OBY A;  2YRD A;  4AFS C;  5GAN 3;  2DD5 A;  2XK0 A;  5GJW B;  3E9G A;  4HXJ A;  4EMK C;  3OSV A;  2P0P A;  4C8Q C;  1BI2 A;  4GLM A;  1WHH A;  1WDX A;  4M7D D;  1M30 A;  4OB1 B;  2QAZ A;  1WLP B;  2KR3 A;  3U23 A;  3OMG A;  2A37 A;  3RKY A;  5A2Q E;  9ATC B;  1WIE A;  4BDY A;  1U1T A;  1M90 R;  2AK5 A;  3FEO A;  4KUL A;  3O8V A;  3ASK A;  1PNJ A;  5GJV B;  5CIU A;  3JB9 G;  1TU0 B;  3PNW C;  2KK4 A;  3KUF A;  4D6W A;  2HMA A;  2RQU A;  3I56 Q;  2K2M A;  5GAN 5;  3H6Z A;  1S72 T;  5I11 A;  2MYS A;  4E7I A;  3NTH A;  1TOV A;  2EPD A;  3A8H B;  2E12 A;  1M2O A;  1M2V A;  2VGM A;  1YJW Q;  1GBQ A;  4JZ4 A;  1UUE A;  2CS7 A;  2JJ9 A;  2RJF A;  3ZEH A;  5IAY A;  2CT3 A;  5GAN 2;  1KQ2 A;  4J6W A;  2X3W D;  1RUW A;  1XOV A;  4KUI A;  1EX4 A;  4MDW A;  5CKH A;  1KD1 U;  2B8A A;  2DYI A;  4V2S A;  1Q82 R;  3JRZ A;  4IIO A;  2YDL A;  2XDB A;  2CYZ B;  3CCS T;  3GIB A;  3G71 Q;  5I2M A;  1M27 C;  1NJI C;  3TEE A;  5HK3 A;  2CP7 A;  2G3R A;  2QQS A;  2DJZ A;  2EYW A;  2CP2 A;  5HKC A;  1ZBX A;  4MZP A;  3UWN A;  2KY9 A;  3RUX A;  2RN8 A;  3OY9 A;  2DL4 A;  1UE9 A;  3L2Q A;  4M7A F;  3CCL Q;  3M0U A;  1UGP B;  4E7H A;  3CCQ A;  1NE8 A;  2YUQ A;  4M77 C;  3P8H A;  2E3H A;  3M9Q A;  2GQI A;  1NM7 A;  1VQ4 T;  4PFO A;  3CPW A;  2M16 A;  2Z0W A;  1Z9Q A;  2G6F X;  4MDX A;  1YHQ T;  1OPK A;  4ZGD B;  4J9F A;  1MND A;  1MMD A;  4C8Q E;  1V76 A;  2J05 A;  2QI2 A;  2JS2 A;  1V29 B;  2QQR A;  1RAB B;  2GTJ A;  2EAY A;  4OB0 B;  1YNZ A;  3DKM A;  2QDY B;  2Y90 A;  1M90 C;  1UGR B;  4L5G A;  3UF4 A;  2YUN A;  4EIK A;  1QVF P;  2LDM A;  2DXB A;  2DKG A;  3CMA T;  2HSP A;  2QEX A;  1BB9 A;  2BIV A;  1Q81 U;  3CC7 T;  3INZ A;  4M78 A;  3RMQ A;  3CCJ Q;  2KXC A;  3CCE T;  2J6O A;  4KH0 B;  4J9D A;  2OTJ T;  2DER A;  3UT1 A;  1VQ6 T;  1IHW A;  3LWI A;  1AEY A;  3C12 A;  1XNI A;  2QQB A;  4ORZ A;  2PUO B;  2K2V A;  2HBW A;  1PKS A;  4JS5 A;  1YJ9 Q;  3CBP A;  4CC2 A;  4M7D A;  2QXF A;  3EGD B;  3HSB A;  2RHZ A;  4OMQ A;  1QVF A;  1OI1 A;  2R5A A;  1RL2 A;  2EQJ A;  1PSE A;  3CCU Q;  4JRP A;  1Q82 C;  1ZA2 B;  2YLC A;  1N27 A;  4F7U F;  1X2K A;  4KGX B;  1G83 A;  2JMC A;  1LPL A;  1MNE A;  1VQO A;  2OTL A;  2MMP A;  2HL5 C;  1WQW A;  3S3O A;  2B86 A;  2DLP A;  1G3S A;  4PJM A;  1M1K U;  4B9W A;  3GF5 A;  1I8F A;  2EQU A;  4J9B A;  4JRQ A;  2CDT A;  3HRU A;  3TCJ A;  1VQN Q;  2C0O A;  4C92 F;  4C8Q A;  1S72 A;  2DMO A;  3V7C A;  1NG2 A;  2QTX A;  4BI3 A;  3EAE A;  2A7Y A;  2JNG A;  2YXY A;  1K0S A;  2EGC A;  2BKD N;  1VQ9 Q;  2FPF A;  2DNU A;  1D3B B;  1DJ7 B;  2SEM A;  1D0X A;  1LOJ A;  2LJ3 A;  1M1F A;  3LW5 E;  1OU8 A;  3OYF A;  3LLR A;  1NLO C;  4M77 E;  4QQD A;  1OX8 A;  3EG2 A;  1NZ9 A;  4PJL A;  7AT1 B;  1BI0 A;  4E7K A;  1T3S A;  3EGX B;  5CVI A;  3QSU A;  2F5T X;  4N4G A;  1WI7 A;  1I5O B;  2F2W A;  2DTH A;  2FZC B;  2YRV A;  1BIB A;  4XTU A;  1ZBJ A;  2KGT A;  3C4S A;  3CCV T;  2RHI A;  1SF9 A;  2OI3 A;  5GAM f;  2DM1 A;  1I4K 1;  3QII A;  4E7Z A;  1I81 A;  1R77 A;  4E7L A;  5GAN j;  2L89 A;  1ZUU A;  1YFN A;  2E4H A;  4F14 A;  4Y92 A;  1RAE B;  4EMK B;  4FSS A;  3EHQ A;  3CC4 A;  2F1L A;  2ZPF B;  1KHC A;  3MEW A;  1H92 A;  2H8H A;  4C92 D;  5LJ5 d;  2QA4 T;  2J7I A;  4LNP A;  5GAN f;  2ROL A;  5GMK j;  2D0N A;  4BY6 C;  4J9C A;  2L8D A;  4AG1 C;  1D0Z A;  1D0Y A;  2D6F A;  4BI8 B;  1QWE A;  4RKU E;  4LUD A;  5KYW A;  2JM8 A;  3RBB B;  2RI3 A;  1M3C A;  2P84 A;  4RTW A;  1QCO A;  4M75 C;  2HD0 A;  5GMK m;  4PL6 A;  1WHM A;  2FRY A;  2NUT B;  1OZ2 A;  4M77 A;  2VXE A;  1IRX A;  5D6W A;  1MMG A;  4P5N A;  2DIG A;  2MPX C;  3CCE A;  3FJ5 A;  1W2B S;  4KH1 B;  4ELZ C;  2LMJ A;  4DOW A;  1N8R R;  4O6J A;  5LJ5 j;  1ZLM A;  2EQM A;  1M4Z A;  1FYN A;  3OYY A;  3MKD A;  1XQH A;  4B9X A;  1U06 A;  2E64 A;  2M0O A;  1UTI A;  2VV5 A;  4PJO F;  3TSZ A;  3S3M A;  1UFF A;  3HFO A;  4M75 D;  2HQE A;  1SEM A;  3PVL A;  4OMF B;  2RM4 A;  2XU8 A;  2VB6 A;  3CME Q;  3OQ5 A;  3I56 A;  1JB0 E;  3QKJ A;  2KYB A;  5IHN A;  4QQG A;  5KYX A;  3M4G A;  1HXD A;  3A8L B;  1TUG B;  4JDS A;  3M4Y A;  3CXC S;  1WGS A;  3QPH A;  1YJW A;  2RF0 A;  3DLM A;  2RQV A;  4DA4 A;  3BDL A;  3TU4 K;  3OSS C;  1U5S A;  1MV3 A;  2ZPI B;  2DL5 A;  1G3W A;  4J7I A;  2MWO A;  5FW9 A;  1Q86 U;  3SWN A;  1BK2 A;  1QVG P;  4FW2 A;  4RTY A;  1TUC A;  4M7A B;  2MCN A;  2D8J A;  4AG2 C;  5GAN 4;  1PKT A;  5KYN A;  1SHG A;  4RCC A;  5IHI A;  4KGZ B;  1VA7 A;  1TG0 A;  3I9Q A;  2XDP A;  1UEB A;  1T0J A;  1BYM A;  1QCN A;  2KRS A;  5GAM g;  3Q1J A;  1C0M A;  4WCI A;  3N5B B;  5GAN h;  2ABL A;  3BE3 A;  2XD0 A;  2KMT A;  1JJ2 P;  1JRI A;  3ZBD A;  1YJN Q;  4E47 A;  2KRM A;  1QVG A;  3AHU A;  2XID A;  4M7A G;  5IXB A;  2DRM A;  1M5Q 1;  1K9M R;  3EG0 A;  1PD1 A;  2RMO A;  3EG9 A;  5GMK h;  1NBE B;  1Y7X A;  3RKW A;  1GFC A;  1WNL A;  4IUV A;  4IUU A;  4C0G A;  1WHJ A;  2XI9 A;  4IUQ A;  5AT1 B;  3UA7 A;  1Q82 U;  4OP0 A;  2K6D A;  1JJ2 A;  1X43 A;  2GTO A;  3VRY A;  3CEY A;  2VKN A;  2RHY A;  4CC3 A;  4XU2 A;  3OB9 A;  3HP9 A;  5GAO m;  2H3J A;  4OGC A;  4WF2 A;  2K57 A;  2PVO B;  5CK9 A;  4F16 A;  3JV3 A;  3GLX A;  1H64 1;  4FCY A;  2KRO A;  1YWO A;  4E7S A;  3KFV A;  1NYG A;  2BZ8 A;  4J7F A;  1Y96 B;  3CCJ A;  4M78 F;  3AT1 B;  4QVC A;  1KSW A;  1VQ7 Q;  2M0Y A;  5LJ5 h;  2X9H A;  4F7U B;  4DOV A;  2O88 A;  1QP3 A;  2E6Z A;  3CCQ T;  1YJ9 A;  5IHK A;  1LJO A;  3LH5 A;  1KQS P;  3MEV A;  4M7D F;  2KBT A;  2K3B A;  3JCM d;  2E10 A;  2GNC A;  1KFZ A;  4AT1 B;  4C92 B;  1N9S A;  1RI0 A;  1K4U S;  2P4T A;  3CCU A;  2AKL A;  4D8D A;  4HA8 A;  2LRQ A;  1ABO A;  2ZPH B;  2BTT A;  1KC8 R;  5DM7 R;  1BCM A;  2VVK A;  2CUD A;  4KUD K;  4M75 A;  1AZG B;  2YUO A;  2O4X A;  3OYK A;  2RK1 A;  4J5Y A;  2HAX A;  5CQX A;  2FHD A;  3A1P A;  3CCR Q;  2EQI A;  4IUT A;  3GPL A;  5CCA A;  2QEX T;  2PUK B;  1K8A R;  2QG9 B;  4FL6 A;  3NGP A;  3CCM Q;  2DD4 A;  2DZC A;  4C8Q F;  2EGE A;  4BAC A;  2IIM A;  4Z89 A;  3X28 B;  2FL7 A;  4RUG A;  3PT9 A;  2D9T A;  1K9M C;  3NPF A;  1U8R A;  2LJ0 A;  1VQ4 Q;  3A8O B;  5FLX E;  2ED1 A;  1YN8 A;  2EYZ A;  1TSF A;  3D7S B;  1MMN A;  2RK2 A;  3QDR B;  4BY6 B;  1E6G A;  1H8K A;  4EPC A;  5GAO q;  2PNI A;  4AFZ C;  1M9S A;  2YUP A;  4QVD A;  4QVZ A;  1IGQ A;  2O9S A;  4JRK A;  2KSS A;  3ME9 A;  2JTF A;  3RNJ A;  4BE1 A;  1WJR A;  2F69 A;  1VQO T;  2OTL T;  3CMA Q;  1SHF A;  1UGQ B;  2NUZ A;  2VUB A;  3JSC A;  4CI0 C;  1YI2 Q;  1VQ5 A;  1VYT A;  2KQW A;  3QBY A;  5LJ3 d;  3JCM W;  2LP5 A;  4C0D C;  4LDW A;  3VS7 A;  2EGA A;  2VYT A;  2WSC E;  2K5L A;  4HT9 A;  4D8K A;  3QWY A;  1BCO A;  2KT8 A;  3MP6 A;  4C8Q D;  1OEB A;  4RTX A;  4F17 A;  2D8H A;  3EFO B;  1I1J A;  1WJQ A;  3A98 A;  2EKO A;  3QJ6 A;  4JLI A; 
#chains in the Genus database with same CATH homology
 2B86 A;  2DLP A;  2C0I A;  3REA B;  4JPB W;  3M0S A;  4HVU A;  4J9B A;  4RTU A;  2V1Q A;  2HCK A;  1U3O A;  2CDT A;  1SRM A;  3VS1 A;  4J9H A;  2C0O A;  2YSQ A;  2DMO A;  1NG2 A;  2DL8 A;  2FPD A;  1QLY A;  1S1N A;  1K0S A;  1ZSG A;  2EGC A;  1NEB A;  2FPF A;  2DNU A;  2F2V A;  2L3S A;  2RQR A;  1PWT A;  1VYV A;  1K0X A;  2D1X A;  2SEM A;  2A08 A;  2LJ3 A;  1QKW A;  4JZ3 A;  2KXD A;  1JXM A;  4R0K A;  2JMA A;  1NLO C;  3EG2 A;  1SRL A;  3H0H A;  1M3B A;  1H3H A;  1T3S A;  1X6G A;  3VS5 A;  2DJQ A;  1M3A A;  1WI7 A;  2ENM A;  2F2W A;  1TUD A;  2X3X D;  2J06 A;  1CKA A;  1ZBJ A;  2KGT A;  2OI3 A;  1KIK A;  2DM1 A;  1JXO A;  4AFQ C;  1HSQ A;  4ESR A;  2KT1 A;  2GGR A;  2EYY A;  2CH4 A;  2EW3 A;  4OMM A;  1ZUU A;  1GCQ A;  1OOT A;  2DBM A;  2DE0 X;  3VRZ A;  1WXT A;  3PE0 A;  4Y92 A;  4F14 A;  2EBP A;  2C0T A;  4FSS A;  1T0H A;  3EHQ A;  2HDA A;  4JJB A;  4JJC A;  2SRC A;  2LNH B;  1H92 A;  1AZE A;  2H8H A;  2ED0 A;  1NYF A;  2J7I A;  2JS0 A;  1E7O A;  4LNP A;  2ROL A;  3CQT A;  2D0N A;  2L2P A;  2PZ1 A;  1N5Z A;  4J9C A;  1J3T A;  4AG1 C;  1VYU A;  1PRM C;  2RQT A;  3I35 A;  1M8M A;  2F2X A;  2DYB A;  3R6N A;  1HJD A;  3H41 A;  1QWE A;  2DL7 A;  3TSW A;  4LUD A;  1W70 A;  1OV3 A;  2JM8 A;  3NHN A;  2CT4 A;  3RBB B;  1Z9Z A;  4E6R A;  3M0T A;  1M3C A;  1IO6 A;  4OMN A;  2E5K A;  4CC4 B;  1B07 A;  4RTW A;  1WXU A;  4Z8A A;  2O31 A;  1NLP C;  5FWC A;  1V1C A;  2O2O A;  1X27 A;  1YP5 A;  2FRY A;  2OJ2 A;  3EGU A;  3VS0 A;  1UJ0 A;  3SEM A;  1MUZ A;  1T3L A;  1UHC A;  1AWO A;  3FJ5 A;  1UHF A;  3VS4 A;  2HEQ A;  2L0A A;  1WX6 A;  2LMJ A;  1ARK A;  4RTT A;  3VS3 A;  1CSK A;  1K76 A;  2CSQ A;  3UAT A;  1ZLM A;  1G83 A;  2M51 A;  2LQW A;  1FYN A;  2LQN A;  1GRI A;  1ZX6 A;  1AOJ A;  1WYX A;  5I22 A;  2RQW A;  1UG1 A;  1GCP A;  1U06 A;  1UTI A;  2VWF A;  4HCK A;  3TSZ A;  1RI9 A;  1UFF A;  2K79 A;  2A28 A;  1SEM A;  3PVL A;  1PRL C;  2P4R A;  2KYB A;  5IHN A;  4CC7 A;  1I07 A;  1MV0 B;  1OPL A;  1AD5 A;  4HVW A;  1RLP C;  4A63 B;  2KEA A;  2RF0 A;  2DL3 A;  2W0Z A;  1GFD A;  3I5R A;  2RQV A;  4HVV A;  3EG1 A;  2CSI A;  2KYM A;  3IQL A;  2MIO A;  3M0Q A;  1U5S A;  4DEX A;  1MV3 A;  2FRW A;  2DL5 A;  3VS2 A;  2L3Q A;  3EG3 A;  5FW9 A;  2OAW A;  1UGV A;  2RNA A;  2A36 A;  3H0F A;  3O5Z A;  1BK2 A;  1WXB A;  4RTV A;  4RTY A;  1TUC A;  1UJY A;  2DF6 A;  2MCN A;  4KRT A;  3THK A;  4LE9 A;  2D8J A;  2DVJ A;  2DX1 A;  3TVT A;  2KRN A;  4AG2 C;  1PKT A;  1QKX A;  1KJW A;  1SHG A;  2AZV A;  2ROT A;  5IHI A;  1VA7 A;  1TG0 A;  3I9Q A;  2JT4 A;  1YWP A;  1AWX A;  1BBZ A;  2BZX A;  1T0J A;  2J6K A;  2I0N A;  2KRS A;  4WCI A;  3SHW A;  2ESW A;  2KNB B;  2ABL A;  4X1V A;  1ZUY A;  1X69 A;  1UEC A;  3I5S A;  2FG0 A;  2YT6 A;  4J9I A;  1G2B A;  4AFS C;  2KRM A;  2O9V A;  2DIL A;  4OML A;  5IXB A;  2DRM A;  5GJW B;  4HXJ A;  1CKB A;  3EG0 A;  4GLM A;  1WDX A;  2RMO A;  4OMP A;  4M4Z A;  4QT7 A;  2W10 A;  1M30 A;  1GFC A;  4JJD A;  2LJ1 A;  1WLP B;  2KR3 A;  3U23 A;  2CUB A;  2A37 A;  3UA7 A;  1W1F A;  2K6D A;  1X43 A;  1WIE A;  2GTO A;  3VRY A;  2AZS A;  2AK5 A;  3GBQ A;  2VKN A;  4CC3 A;  1SPK A;  1PNJ A;  5GJV B;  5ECA A;  3VS6 A;  3ULR B;  2RQU A;  4ZNX A;  4K11 A;  2K2M A;  2PTK A;  2NWM A;  5I11 A;  2JW4 A;  2JM9 A;  2EPD A;  2DRK A;  2GBQ A;  4F16 A;  3JV3 A;  1K9A A;  1YCS B;  2KRO A;  1JU5 C;  1YWO A;  1JO8 A;  1GBQ A;  1UUE A;  4JZ4 A;  3REB B;  1JQQ A;  3KFV A;  2EVR A;  1NYG A;  2BZ8 A;  2LZ6 B;  1AWJ A;  2CT3 A;  2X3W D;  1RUW A;  1XOV A;  5HCK A;  2AKK A;  1KSW A;  1JEG A;  2M0Y A;  2EYX A;  2O88 A;  1Y0M A;  4IIO A;  1BU1 A;  2YDL A;  5IHK A;  3LH5 A;  2K9G A;  2KBT A;  1M27 C;  2K3B A;  5L23 A;  5EC7 A;  2GNC A;  1KFZ A;  4DEY A;  2EYW A;  1WA7 A;  1K4U S;  2DA9 A;  2LX7 A;  2AKL A;  4D8D A;  2DBK A;  1ABO A;  2BTT A;  2MOX A;  2VVK A;  2RN8 A;  2CUD A;  2J6F A;  4Z88 A;  2K7A A;  2FPE A;  2DL4 A;  1AVZ C;  1UE9 A;  1QCF A;  1WFW A;  4IIM A;  1AZG B;  5FWB A;  2YUO A;  1RLQ C;  4J9E A;  3PVQ A;  1ZUK A;  3M0U A;  3C0C A;  2FEI A;  2CH4 W;  4OMO A;  5IH2 A;  1I0C A;  2EQI A;  2YUQ A;  1UDL A;  2BZY A;  5IXF A;  3NGP A;  2QDL A;  2LCS A;  2EGE A;  4J9G A;  3ZL7 C;  1HD3 A;  2GQI A;  1NM7 A;  2IIM A;  3M0P A;  4Z89 A;  3H0I A;  1QWF A;  4RUG A;  1Z9Q A;  1K1Z A;  1GBR A;  2G6F X;  3NPF A;  1OPK A;  2LJ0 A;  4GBQ A;  1EFN A;  4J9F A;  2L3P A;  2JXB A;  2ED1 A;  2EKH A;  3QWX X;  1YN8 A;  2EYZ A;  2ECZ A;  2J05 A;  1E6G A;  1H8K A;  1X2Q A;  2JS2 A;  3M0R A;  1W6X A;  2CRE A;  2PNI A;  4AFZ C;  2GTJ A;  2YUP A;  1AWW A;  2RPN A;  1A0N B;  1YNZ A;  1LCK A;  3NMZ C;  1SSH A;  2O9S A;  3UF4 A;  2YUN A;  4EIK A;  3RNJ A;  2FO0 A;  2HSP A;  1BB9 A;  2KXC A;  1NEG A;  2J6O A;  4J9D A;  1SHF A;  2NUZ A;  1GL5 A;  1AEY A;  1VYT A;  4ORZ A;  2LP5 A;  2HBW A;  1PKS A;  4LUE A;  4CC2 A;  3VS7 A;  2EGA A;  1Y57 A;  4AFU C;  4OMQ A;  2KE9 A;  4D8K A;  3QWY A;  2KT8 A;  1E6H A;  3EHR A;  4LN2 A;  1OEB A;  2V1R A;  4RTX A;  4F17 A;  3UA6 A;  1PHT A;  2D8H A;  2JTE A;  1I1J A;  1X6B A;  1GCQ C;  3A98 A;  1ABQ A;  1B3Q A;  2XMF A;  4RTZ A;  1FMK A;  1X2K A;  2JMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...