3REBB

Hiv-1 nef protein in complex with engineered hck-sh3 domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
59
structure length
59
Chain Sequence
DIIVVALYDYVSWSPDDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein Nef
publication title Molecular design, functional characterization and structural basis of a protein inhibitor against the HIV-1 pathogenicity factor Nef.
pubmed doi rcsb
source organism Hiv-1 m:b_arv2/sf2
molecule tags Protein binding
total genus 13
structure length 59
sequence length 59
chains with identical sequence D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3rebB00
3M0PA 4LNPA 1UGVA 1E6GA 1FMKA 1JQQA 3M0RA 2DL8A 1RLPC 1M27C 2MCNA 2ESWA 2EYZA 1UDLA 1GBQA 2JT4A 2J05A 2RPNA 2FRWA 4JZ3A 3TSWA 5IHIA 4AFSC 1WDXA 3EG0A 4GLMA 2P4RA 2HCKA 2GBQA 4LUEA 1AVZC 4DEXA 1UUEA 1GL5A 2YUQA 4JZ4A 4EIKA 1K76A 2RF0A 4AFZC 2OJ2A 2BZXA 2KXCA 2C0OA 1RUWA 1YCSB 2DRKA 4RTYA 1YP5A 1QLYA 3I35A 1W70A 2AZSA 2A36A 3UA7A 1ARKA 3NGPA 2KGTA 2JS2A 2L3QA 3M0QA 4J9HA 1ZUUA 1MUZA 4F16A 1X27A 2EGEA 5IXFA 2E5KA 1MV0B 4AG1C 1PRMC 2RN8A 1WI7A 2HDAA 2D1XA 1AEYA 1PWTA 3TVTA 4RTXA 2GTOA 1X2KA 2YUOA 2HSPA 5IHNA 2DE0X 1KSWA 1H92A 2CT3A 3UA6A 2LJ3A 1JEGA 2CSIA 4IIOA 3VS4A 2YDLA 2MIOA 2DA9A 4Y92A 2J7IA 4KRTA 1QKXA 3NHNA 1ZUKA 2LP5A 2JW4A 4RTVA 1T0HA 2CDTA 3THKA 2X3XD 2KRNA 1LCKA 4R0KA 2CT4A 3QWXX 4X1VA 2F2WA 1M3BA 2PNIA 3REBB 1IO6A 1I07A 2GTJA 2AZVA 4AFUC 4CC2A 1SHGA 2L3PA 2F2VA 2HEQA 4HVVA 1PKTA 1WA7A 1KFZA 1EFNA 2AKLA 1ABOA 1X6BA 4RUGA 5IH2A 1WYXA 2C0IA 2DF6A 1KJWA 1W6XA 1QCFA 1G83A 5HCKA 1GCQA 1UHCA 1U5SA 3VS2A 1I0CA 1S1NA 1JXOA 2JMAA 2PTKA 2K2MA 2KR3A 2O31A 2K6DA 2ROLA 1NYGA 2L3SA 2RMOA 1GBRA 2YSQA 2EGAA 2MOXA 2DBMA 1E6HA 1NEBA 4FSSA 2O2OA 2QDLA 1WXTA 2ENMA 3NMZC 1AWXA 5ECAA 1CKBA 1K9AA 1PKSA 1UTIA 2KE9A 3U23A 1VA7A 3VRYA 1KIKA 2RQTA 3EG2A 1UG1A 2JM9A 1OPKA 3O5ZA 5GJWB 2O88A 5FWBA 1QWEA 1Y0MA 2KRMA 2GNCA 3RNJA 2J6FA 3I5RA 1W1FA 2KNBB 3I9QA 2EYYA 1GRIA 2EVRA 1YWPA 2EQIA 2O9SA 1QWFA 4Z88A 4JJCA 4AG2C 2LQNA 3VS1A 3H0HA 1HSQA 2PZ1A 1X69A 2EPDA 3PVQA 2IIMA 2VKNA 2DL4A 2DJQA 3VS3A 2CUDA 3SEMA 1ABQA 2I0NA 4LUDA 2A28A 4ORZA 1RI9A 2ED0A 1FYNA 1UJYA 4LN2A 1CSKA 1ZLMA 2CUBA 1PNJA 4E6RA 3VRZA 1AOJA 1K1ZA 2JMCA 2FPFA 4M4ZA 1GCQC 4GBQA 1HJDA 1N5ZA 2EGCA 1V1CA 1QKWA 3M0UA 1WXBA 1GFCA 2D8HA 2K7AA 1SPKA 2AK5A 2EKHA 2DM1A 2ED1A 2DX1A 2D0NA 4ESRA 2VWFA 1AZEA 4HVWA 1OEBA 3R6NA 2JS0A 2LQWA 2J6KA 2VVKA 4RTUA 3QWYA 2FG0A 3A98A 1OPLA 2M0YA 1AWOA 4A63B 2LX7A 2LZ6B 3H41A 4OMNA 1Z9ZA 2KT8A 4RTTA 1M30A 1TUDA 1UECA 2XMFA 2DL7A 2FO0A 1BK2A 4J9EA 2EYXA 4D8DA 3TSZA 2L2PA 2OAWA 1ZUYA 3VS7A 1NLPC 1HD3A 2KROA 1WX6A 3M0SA 3M0TA 4F14A 3EG1A 2CH4W 2DL3A 2NWMA 4JJBA 3VS6A 2K3BA 3JV3A 1UE9A 2RQWA 2C0TA 1JO8A 1SSHA 1CKAA 1BB9A 1J3TA 1OOTA 1Z9QA 4CC4B 1JU5C 3H0FA 5EC7A 2KYMA 1SRLA 1K0XA 1T3LA 2K9GA 3CQTA 1UFFA 2A37A 2DILA 1OV3A 2BZ8A 1B07A 2SEMA 2KEAA 3C0CA 4ZNXA 4HVUA 1M8MA 3PVLA 4OMPA 2GQIA 3PE0A 4K11A 2JXBA 2RQUA 1NLOC 1BBZA 2YT6A 1PRLC 3EG3A 5IXBA 4RTWA 2DLPA 1SEMA 2CSQA 1TG0A 2LCSA 2A08A 2ABLA 1G2BA 1M3CA 2X3WD 4Z89A 1M3AA 2JM8A 3I5SA 3IQLA 2LJ0A 3SHWA 1NEGA 2DL5A 2ECZA 2JTEA 1VYUA 2RQRA 4J9GA 2KYBA 2BTTA 2J06A 2W10A 3EHQA 2O9VA 1I1JA 1B3QA 2K79A 4OMQA 4OMMA 1UJ0A 1MV3A 1BU1A 3EGUA 2F2XA 1JXMA 2RQVA 2YUNA 4J9CA 5GJVB 2DBKA 3UF4A 1Y57A 4QT7A 2OI3A 2AKKA 2G6FX 3KFVA 1VYTA 4CC7A 2H8HA 1T0JA 1X43A 2BZYA 2DRMA 2FPDA 2DNUA 2HBWA 2W0ZA 1YNZA 1WXUA 2EBPA 1WIEA 1UHFA 1XOVA 1AWWA 1GFDA 1SRMA 3ULRB 2EW3A 1PHTA 1VYVA 1H3HA 4F17A 4DEYA 1ZX6A 2YUPA 2KRSA 4JPBW 2KBTA 3FJ5A 4WCIA 3REAB 4Z8AA 4RTZA 1K0SA 1TUCA 1RLQC 2LMJA 2V1RA 3GBQA 2L0AA 3NPFA 1SHFA 2GGRA 2DVJA 1WLPB 2LJ1A 3RBBB 5I22A 1NM7A 2B86A 3LH5A 2J6OA 2KXDA 4HXJA 2RNAA 1AWJA 1X6GA 1X2QA 1ZSGA 2FEIA 5I11A 1AZGB 2LNHB 1U3OA 2SRCA 4IIMA 2M51A 2NUZA 1WFWA 1K4US 1T3SA 2DMOA 1U06A 3EHRA 1H8KA 4J9DA 1AD5A 4OMLA 4J9FA 1YWOA 2ROTA 4CC3A 4HCKA 4J9IA 1A0NB 2DYBA 4AFQC 2FPEA 3H0IA 2FRYA 2KT1A 1GCPA 2V1QA 5L23A 2CREA 5FWCA 3ZL7C 4JJDA 5FW9A 4OMOA 1YN8A 2D8JA 2CH4A 4D8KA 1ZBJA 4LE9A 3VS5A 4J9BA 1E7OA 1NYFA 1NG2A 2EYWA 5IHKA 3UATA 3VS0A
chains in the Genus database with same CATH superfamily
1G3YA 1RAEB 3M0PA 3RR6A 2HMAA 1JQQA 1S72T 1M2OA 2COZA 2DL8A 4XU2A 4DOVA 2X9HA 2QQAA 4PFPA 4F7UB 2DYIA 4BY6B 3A8HB 2A0FB 3TSWA 4A4HA 3CC4T 5D6WA 3CC2Q 1WDXA 1FXXA 4BE1A 3CPWA 3CD6T 3VJPA 4IUTA 2HQXA 5CKEA 1N27A 2E41A 4DEXA 1UUEA 2GFAA 2QG9B 1GL5A 4JZ4A 3QYHB 3JSCA 5A0DA 1FX7A 5DLOA 2OJ2A 4RTYA 2DEUA 1QLYA 1OI1A 1U1SA 3M9QA 1KG1A 5GAN6 3CBOA 1W70A 4XTXA 2LDMA 2KGTA 4J5YA 2JS2A 3M0QA 1FMVA 3JCMe 1K8AC 2KSSA 5C6SA 1MV0B 4AG1C 2CYZB 1N8RC 3A8LB 1VQ7T 3DKMA 1PWTA 4ZTFA 1D3BB 2M16A 2HSPA 5IHNA 1KSWA 3OYBA 3SWNC 3OYMA 3GOXA 1VQ5A 3D7SB 3OQ5A 3CCQA 2ZZDA 1WHMA 2LP5A 1T0HA 2CDTA 4R0KA 4DOWA 3JB9G 5GAN2 5GAN3 4M77B 4X1VA 4EMKA 3JCMJ 3EG9A 2QYZA 2L3PA 2F2VA 4C0DC 1PKTA 1WA7A 4M7AD 1IGQA 3OSVA 2LC4A 4RUGA 1ZSZA 3C94A 2BUDA 4EMHA 1VQ9T 3RKWA 3RUXA 2RHIA 4ZGJB 4E7LA 1YJNT 1R77A 2X4YA 1NJIR 3LX7A 1WGSA 2JMAA 5KCHA 3FDRA 5L8RE 2KAFA 1NYGA 1GBRA 3QKJA 1YHQT 5GAOl 1WHGA 2O2OA 3I55A 3G4SQ 1AWXA 2XD0A 1ZBXA 2EJ9A 3G71A 1G8XA 1UTIA 1YI2Q 5KYXB 1IREB 2JM9A 3O5ZA 2M9UA 4X34A 2RJFA 3DB3A 1MMAA 1QVFP 1QWEA 4M7DG 4FM4B 4TVRA 5FRNA 3CCLQ 3I9QA 4FSXA 2QEXA 3GF5A 2O9SA 3CCJQ 2DXBA 1QWFA 4M7AF 4II1A 2XICA 3H0HA 2DZ9A 4XTYA 3QZ5B 2PZ1A 4M78G 1X69A 2IIMA 3A5ZB 3M54A 3VS3A 1B34B 1R0BG 3EH1A 4C8QG 2GQVA 1ABQA 4LUDA 4ORZA 4F7UF 2EQKA 3OS2A 5CQYA 3CCUA 2ZAEA 3OYAA 1VQOQ 1KQ2A 1VQ6Q 2QAZA 3JCMb 1K1ZA 2FPFA 2RM4A 5DM7R 2ZPIB 3CMET 3CC7T 1YJ9A 1K8AR 3V8KA 2EQMA 2DFUA 4M77D 2AK5A 1N8RR 4AMCA 1M90C 2DX1A 1I5LA 1VOMA 3JCMP 1LPLA 4BY6C 8AT1B 2D6FA 3QBYA 1NE8A 2LQWA 2VVKA 3HFNA 4RTUA 3QWYA 2FG0A 1YJWT 1AWOA 4A63B 3S3OA 1M9SA 1HK9A 1KHIA 2A7YA 3H41A 3P8DA 4FW1A 4OMNA 3CD6Q 2QA4A 1TUDA 3OYJA 2DL7A 1BK2A 3TSZA 5KYYA 2HQHA 1YCYA 5CKFA 3CCST 4M7DE 5GAN7 3OYFA 4M7DA 1IGUA 4F14A 3EG1A 1WJRA 2DL3A 3EGDA 4JJBA 3FEOA 3RDVA 1C0MA 2RQWA 3MP6A 2C06A 1G3WA 1J3TA 1OOTA 3JCMX 1K8AU 4M78E 2VUBA 4M78A 5AT1B 1VQLT 2JOYA 3I56T 2BZ8A 3DB4A 2V26A 2I2LA 5GAOq 2YRCA 4ZNXA 4C8QE 4HVUA 4A4FA 4C8QA 1M8MA 2JUFA 3FIFA 4OMFB 1K9MU 4MDXA 1NLOC 1YI2A 1BI1A 4Q5WA 2EKOA 2K2VA 3V7CA 1UGQB 4RCCA 2RI2A 5FU6B 4M77F 3OW2P 2DD4A 4C92F 2X3WD 3E19A 5D6YA 1M3AA 3I5SA 3VV0A 1VQPQ 2LJ0A 2PVDB 1BI3A 2A3LA 1NEGA 3E9FA 1QW1A 2JTEA 3UPUA 3QO3A 2KYBA 3LWHA 3EHQA 3M5AA 3OYDA 2E10A 3N5BB 4M77C 2NUTB 1BU1A 3JCMW 2YRDA 3CXCA 1VQNQ 4C0FA 1WHKA 5GJVB 3UF4A 1JJ2S 1XTDA 2MPXC 1VYTA 3AHUA 1RAHB 2HKQB 2FPDA 2W0ZA 2EBPA 1WIEA 1VQ9Q 4OB1B 5IAYA 2R5MA 2QTVA 1SRMA 2R57A 3L2WA 1YJNQ 4E7KA 3OS0A 2OTJQ 1YIJQ 4DEYA 1VQKA 4JLIA 2KRSA 2PVGB 4WCIA 1NBEB 1K0SA 2WACA 2F5KA 2DIGA 2V1RA 4ZGDB 1S72A 3OMCA 2XDBA 1SHFA 1YHQQ 1WNLA 2LJ1A 2CP7A 4JLGA 2B86A 2RJEA 2FB7A 2OAUA 3FC3A 4HXJA 1XQHA 3CC4A 1ZSGA 3WVEB 2RHYA 3QSUA 4V2SA 1KD1R 3CD6A 1ACMB 2NUZA 2WSFE 4JRIA 1T3SA 4E2FB 1M90R 1U06A 1H8KA 1PD1A 4DQ2A 3A8MB 4IUUA 1AD5A 3CCRT 4HCKA 4AFQC 4XTUA 1GCPA 5L23A 2CREA 5FWCA 4MMLA 4D8KA 1WQ7A 1RACB 2GCXA 2GFUA 4J9BA 5IHKA 3QXEB 3UATA 3HP9A 5A0LA 3CCET 4MZTA 4IUVA 1UGVA 2AHJB 1Q7YC 5GMKh 2CP2A 2K5FA 1KQSA 1RLPC 1M27C 1UDLA 1LJOA 2XDDA 1NZ9A 4X9CA 2FRWA 4YTLA 4JZ3A 1YITQ 1FWZA 5FROA 1VQ7A 4GLMA 1GXIE 4MMKA 4RMOA 2DD5A 2HCKA 2GBQA 3OS5A 4B9WA 2HZYA 1M90U 3M4YA 4LUEA 2ZGWA 4KGZB 1Y96B 5GANj 2QXFA 5LJ5g 4BE2A 1K76A 2RF0A 3JB9I 4PL6A 1QVGA 3X24B 2KXCA 2OX7A 5GANe 2ZPBB 4C0ZA 3I35A 3DLMA 2FHDA 4PJOG 3QJ6A 3QIIA 1YJWQ 2LX9A 2QQSA 4C5EA 3CBPA 3OYNA 2G3RA 5LJ5f 1M4ZA 1ZUUA 1MUZA 3X20B 5LJ3g 2P0QA 4KUDK 5KH6A 3MJXA 4RTXA 1D3BA 5J26A 2YUOA 1VQ4Q 2X4XA 2LJ3A 4IIOA 2YDLA 4JJNK 2DVEA 2RK1A 3CCLT 2MIOA 1JJ2A 2DA9A 1TOVA 4Z02A 2VYTA 4Y92A 1UGPB 4FT4A 2J7IA 3S3NA 1YHQA 4KRTA 5LJ3f 1QKXA 1VQ8Q 1W2BP 3NHNA 2JW4A 5GAN8 3P8HA 4RTVA 2MWOA 2ATCB 3PT9A 3THKA 2K5IA 2EJFA 3QWXX 5FU6C 1M3BA 2EWNA 2PNIA 1IO6A 3SB2A 2GTJA 3OBWA 4NL2A 1SHGA 4JUVA 2HEQA 1C6VX 2XI9A 1ABOA 1VQOT 1VQ6T 4LDXA 5IH2A 3VKIA 1WYXA 4PJMA 2C0IA 2KMTA 4PLLA 3FJPA 1KJWA 4M7AB 4NL3A 1QCFA 3JB9F 2F5TX 2VB6A 5HCKA 2ZPEB 4XU1A 1S1NA 3JCMg 4X9DA 2PTKA 4QVCA 3S6WA 2K6DA 3MP1A 4PJOE 2ROLA 4LD6A 2CZ6B 4KGVB 4PJOA 4LDUA 2RMOA 4M78D 5A0GA 2MOXA 2FZKB 2QDLA 2ENMA 4N0AC 1WZOA 2JN0A 2EQJA 5I2SA 3JCMf 1G3SA 2F1LA 2KE9A 3U23A 4HCCA 1VA7A 2KK4A 2LCLA 1VQMA 2RHXA 5GJWB 2P84A 1Q7YR 1MMDA 1D09B 2ZPHB 4O5VA 1K73C 3NTKA 3CMEA 3CC7A 2MMPA 1Y0MA 2KRMA 2GNCA 1BI0A 2CGHA 4IUQA 2J6FA 1W1FA 1D1CA 3WXMB 1M2VB 4AT1B 3CCMQ 1EX4A 3BY7A 5KYUB 1WQWA 2COYA 4AG2C 3VS1A 1HSQA 2DK3A 8ATCB 3A8GB 5AYFA 4OGCA 3RERA 1D0ZA 2DL4A 4CRIA 2CUDA 3CPWP 3CCSA 3JCMQ 3C95A 1I81A 2A28A 3CCRQ 2NUPB 2DAQA 4M75G 3PMTA 2Y4YA 3HRUA 1K9MC 3CCVQ 3EFSA 2LQ8A 3JCMc 1ZLMA 3QPHA 4M78F 1Q7YU 3GP8A 1BCOA 1TS9A 1VQPT 4E6RA 4JS5A 2EYQA 1GCQC 1OULA 4GBQA 3SD4A 1N5ZA 3CCEQ 1VQLA 3QZ9B 3I56A 2XKOC 2ED1A 1SSFA 2D0NA 3E2UA 2VWFA 3TEEA 1OEBA 5CVIA 3R6NA 2RI3A 2JS0A 4XU0A 1VQNT 3OMGA 4C92B 3RMQA 3OW2S 1OPLA 1X6OA 2M0YA 3Q1JA 3JB9J 1U1TA 4QKUA 1UGRB 4GY5A 1M30A 4D8DA 4E7HA 1JB0E 5CKHA 3MEAA 5GAMg 4HT9A 4RG8A 6AT1B 3VS7A 2E70A 1NLPC 3NFCA 2OTJT 1YIJT 2LNVA 4C5HA 2CH4W 3S3MA 3JV3A 2E4HA 4J8OA 1ZHIA 1JO8A 3CEYA 1Z9QA 1QVFA 3BW1A 4PFZA 4ATOA 3H0FA 5EC7A 2EFIA 4KBMB 2HL3A 5GAMf 2K9GA 3CQTA 2A37A 4FIBA 2DTHA 1Y07A 2SEMA 2YHTA 2PVOB 3CC2A 4HCBA 4IUPA 2Z0WA 4OMPA 2MAMA 3M55A 3PE0A 2KQWA 2CP6A 4K11A 1BBZA 1W4SA 3EH2A 4M75E 1PRLC 2XIDA 4M75A 3EG3A 1RADB 2DLPA 1TUGB 4B9XA 4QQGA 2A08A 5KYNA 5EG2A 5GAMj 1M3CA 3TCJA 4L59A 4Z89A 2WSEE 2EQUA 5GAMe 3IQLA 2VXFA 3V7SA 2ECZA 2RQRA 3TREA 5IT9E 4HCZA 2BTTA 2J06A 2O9VA 5GANd 4OGEA 2LTOA 4OMQA 2E6NA 4MZMA 1MV3A 1K73R 4JRPA 3LGLA 3ZEHA 1JXMA 2QTXA 4J9CA 1QCNA 2DBKA 3AT1B 1YITT 1Y57A 1KK7A 2OI3A 4CC7A 1OU8A 1T0JA 1X43A 1YNZA 5J3BA 4M7AC 1RAIB 3MHXA 1XOVA 1H3HA 5KYWA 3OA6A 1Q86U 4F17A 4FU6A 1TTHB 1Q82U 2YUPA 3SFMA 4C92D 3REAB 3CCEA 4XAXB 1TUCA 1I8FA 1RLQC 4QQ6A 4KT0E 2VXEA 4XU3A 3NPFA 4ELYC 5GAOr 1YFNA 1K9MR 3L42A 5I22A 1WJQA 2KXDA 3VUZA 5LJ5d 1Q95G 1VIEA 1K73U 4EDUA 2CZ7B 5I11A 2O4XA 1AZGB 2DEQA 3INZA 2CP3A 2E64A 4IIMA 1WFWA 3EHRA 4IURA 4J9DA 1OZ2A 1M1GA 4LDYA 2OTLQ 3EG9B 2FZGB 2FPEA 3H0IA 1WHLA 2FRYA 2QI2A 1VQ4T 3HFOA 5FW9A 3LGFA 4OMOA 3MKDA 1YN8A 3SWNA 3PNWC 5LJ3d 1D0XA 3VUBA 2DXUA 3EGXA 1ZSZB 3OW2A 2JVVA 4ZN3A 1VQ8T 3G4SA 3MEVA 4LNPA 2E6ZA 2L3RA 2H3EB 1F1BB 2ESWA 1GBQA 2J05A 3CCQT 4E47A 1ZQ1A 1G5VA 3OYGA 3L2QA 5IHIA 1V29B 4AFSC 5DLQE 4O6JA 2P4RA 4DBHA 4RCBA 4C5GA 3CCLA 1AVZC 2IPOB 1TXQA 1W2BS 3G6ET 4OB3B 2EJGA 2YUQA 3CCJA 2ZCFB 4AFZC 2BZXA 2DRKA 1RUWA 1OX8A 1RAGB 1YP5A 3A1PA 2RJCA 4C92C 3GNGA 2E65A 3FB9A 2H3JA 3WVDB 2AZSA 1BYMA 4F7UG 2COWA 5D6XA 4OP0A 3JCMd 1OZ3A 2LCCA 4J6YA 1X27A 1VQOA 4BUGA 2EGEA 5IXFA 1VQ6A 2E5KA 1OQKA 1WI7A 5KE3A 2PUOB 1AEYA 4J7FA 3TVTA 4DBRA 2L89A 4PJOF 1X2KA 3QDFA 4PJLA 2F69A 5FU7B 3LWIA 2DE0X 1H92A 2CT3A 1JEGA 3VS4A 2K3YA 3G7ZA 1WPYA 5HK0A 3CCMT 3GPLA 2DXTA 2RA2A 1Y7XA 4PJNA 2X3XD 3VU3C 2QGFB 3H8ZA 1IHWA 2RK2A 3BE3A 1N9SA 1I4K1 2PQWA 3REBB 2AZVA 3RKXA 5GANg 2LT4A 4FYYB 2RO0A 2AKLA 3CCVT 2HSEB 4N4IA 5GAOp 1X6BA 3TQ7P 4M7AE 4J7IA 1W6XA 2K57A 2E1HA 5KYYB 3MO8A 3EFOA 1G83A 2QDYB 2XG8D 2V8IA 4M7DB 2V8KA 3VS2A 1JXOA 3HRSA 1M1KC 5LL6S 2K2MA 3EGDB 2KR3A 2RJDA 4F7UE 5GANf 4F7UA 3V8JA 1NPPA 2L3SA 3CPWS 1D0YA 2DBMA 1E6HA 1NEBA 4E7SA 3OYHA 4FSSA 4M77G 3NMZC 1TSFA 4M78B 1CKBA 1JBMA 3LW5E 1K9AA 4D6WA 1H641 1PKSA 2QASA 1V76A 2BE9B 3CMAT 3VRYA 1OPKA 4BACA 2V8JA 1VQPA 4DA4A 3OY9A 5FWBA 1IHVA 3RNJA 1HYOA 3I5RA 5GAMd 2RD1A 1GRIA 2EVRA 5IN1A 1PC0A 3JB9D 1VQNA 3QG1A 1MGQA 1R8OB 2ZPGB 2LQNA 3RIRA 1M1FA 3MEWA 2EPDA 2DIQA 1W2BA 2D9TA 4BB7A 2Y4XA 1VQ9A 3SEMA 1YJNA 3M53A 4ME7A 2OTJA 4LN2A 1YIJA 2JZ2A 2X35A 3HTRA 2CS7A 4QW2A 1ZSZC 3M58A 2CP5A 2E3HA 1PNJA 1QVGP 1AOJA 2JMCA 4M4ZA 1HJDA 2EGCA 2QQRA 1QKWA 3M0UA 1WXBA 1GFCA 2K7AA 4JDSA 3PTAA 2DM1A 3L2ZA 4M77E 1LNXA 4M77A 1VQ5Q 3KXTA 1AZEA 3PGGA 1M5Q1 4PFOA 2J6KA 3CCQQ 2RH2A 4RKUE 2XHCA 5I2MA 3A98A 1ZA1B 5CK9A 2LVMA 4LDWA 3ER0A 2HL5C 4GLKA 1UECA 4M7DD 4J9EA 3MCAB 2HNIA 4E7IA 2EYXA 1N6AA 2EIFA 3M59A 4XTWA 2VC8A 2OAWA 1HD3A 2M0OA 2KROA 3G6EQ 3M0SA 3M0TA 3VS6A 2PUKB 2DTOA 2K4YA 1UE9A 1AT1B 1SSHA 1CKAA 1Q86C 1UEBA 3KBGA 4CC4B 3J81E 4A53A 1Q82C 4E7ZA 1K0XA 1MMNA 5KE2A 1T3LA 2YLBA 4C8QD 1UFFA 2DILA 1OV3A 1YITA 1B07A 3C0CA 4A4EA 2L5QA 5KYXA 2GQIA 4J83A 5GAN4 3MEUA 2JXBA 3JB9H 4XTVA 3HL8A 4J6WA 1M1KR 3EFRA 3I55Q 1WHJA 4BDYA 2HD0A 3QUIA 4C0GA 5FU7C 3GLXA 2OTLT 3X26B 1SEMA 2CSQA 1TG0A 3ME9A 2LCSA 3G71Q 2LRQA 1G2BA 4XQ3A 2E5QA 4F04B 1MNEA 3ZBDA 2BKDN 1KQ1A 3SHWA 1VYUA 3ASKA 2MK5A 5CO7A 3T9NA 1YJWA 2W10A 4MDWA 1BCMA 1I1JA 4M7DF 4FT2A 1B3QA 3BDUA 2ZPFB 4OMMA 1UJ0A 1B34A 2K5LA 2QEXQ 3EGUA 2CZ0B 1KHCA 2F2XA 2IVWA 1SKUB 2G6FX 3A8OB 2H8HA 4PK4A 4OF1A 2DRMA 2DNUA 4BDZA 1M1KU 3L1AA 1VQ4A 3GIBA 1GFDA 3ULRB 4M7DC 1UB4A 1VYVA 4QVZA 1QVPA 3M57A 2MI6A 4C8QF 1QMCA 2P0KA 4XK8E 1QQJA 1OU9A 3BFMA 3CCUQ 1VQ8A 2KBTA 3FJ5A 4JRQA 1TWBA 4Z8AA 1Y71A 5GAOn 4QQDA 2P0PA 3C12A 2LMJA 3GBQA 2VV5A 2QQ9A 3QDRB 2DVJA 1WLPB 5GANh 2NLUA 1YJ9Q 1NM7A 2VGMA 4M78C 2J6OA 2YRVA 2X4WA 4LXCA 3UWNA 4FYWB 3HRTA 4FCYA 1X6GA 4C8QC 2FEIA 4KGXB 2DO3A 3QHSA 2LNHB 3CMAQ 1O75A 3X25B 5M9OA 1JRIA 1N9RA 3HSBA 3OSSC 2DXCA 3DLLA 4E7JA 4LD9K 3G6EA 4C5IA 2ROTA 4J9IA 1BIAA 2DYBA 2QA4Q 2KT1A 2V1QA 5GMKi 3ZL7C 3L2RA 4J6XA 3ZFJA 4LE9A 3VS5A 4BI4A 3META 1NYFA 3NTIA 2CZ1B 2DPPB 3VS0A 4BI3A 1EIFA 4RG2A 5GMKm 4NOYA 1WJSA 2DTIA 3E9GA 1E6GA 2O01E 1FMKA 3M0RA 1B7TA 3QJYA 2IG0A 5LJ5h 4WTOB 4R55A 1UGSB 3URGA 3H6ZA 4FL6A 2MCNA 2EYZA 4PJOB 2JT4A 3PFSA 3OYKA 2DZCA 4XTZA 2RPNA 2AT1B 1Q86R 3EG0A 1Q82R 2R5AA 1TU0B 3UDCA 4FW2A 1U8RA 3CCMA 4EIKA 5HKCA 3CXCS 5CIUA 5LJ3h 2HBPA 3RMSA 3MP8A 1PSEA 2BE7D 2C0OA 1YCSB 2NUTA 4A4KA 2RHUA 1VIFA 5CKBA 3OBYA 3C4SA 5DY9A 3OYIA 1NJIU 2A36A 3UA7A 3MPUB 3V8LA 4N0AA 1ARKA 3NGPA 2LQKA 4IKFA 3CCRA 1BIBA 1EZZB 2L3QA 1VUBA 4J9HA 4F16A 3CCVA 1PRMC 3GNFB 4JS4A 1BKBA 2RN8A 2FZCB 2M1HA 2HDAA 2D1XA 1KC8C 1RL2A 4L6V5 2GTOA 7AT1B 1D1BA 3UA6A 2CSIA 3BDLA 1IRXA 4MZPA 1SG5A 2D0QB 3G1JA 5GMKj 3JAME 1VQMT 4A54A 3OYEA 1VQKQ 1KD1C 5GMKe 5CAIA 1PD0A 2FVUA 1X75C 1ZUKA 5I21A 3HHTB 1S72Q 2KRNA 1LCKA 2CT4A 3CMAA 3JCMh 1Q81C 2F2WA 2YLCA 1RAFB 1I07A 4BI8B 4EMKB 4AFUC 1XNIA 3CC4Q 4CC2A 4P5NA 1G3TA 4HVVA 1KFZA 2RB6A 1EFNA 3X28B 1OYXA 1R0CB 2DF6A 1XJWB 1KQSS 4NS5A 1GCQA 1UHCA 1U5SA 3OS1A 1I0CA 1RABB 2YXYA 4PJOD 3CBMA 4KUIA 4BD3A 2O31A 2DJZA 5CQXA 1OX9A 1VQ5T 2YSQA 2EGAA 3L2VA 3SDZA 3OYCA 3PIPA 1WXTA 3NTHA 1N8RU 5ECAA 5CR2A 2WSCE 2DETA 2AIRB 4R56A 1LOJA 1QVGS 3UT1A 2KY9A 1KIKA 2RQTA 3EG2A 1UG1A 1Y96A 1ZA2B 5CKDA 1VQ7Q 2CKKA 4M7AG 2O88A 4M75B 3V7RA 1MMGA 4VUBA 1C1AA 5GAOm 4CI0C 3VYGA 3LH0A 1LVKA 2FL7A 2KNBB 3RESA 1BI2A 2EYYA 2E12A 1YWPA 2EQIA 2GF7A 5A2QE 1WHHA 4KULA 4Z88A 4JJCA 1PSFA 2HQEA 4EMGA 3R6OA 3PVQA 4PKCC 4OB2B 1PCXA 1YBYA 2VKNA 1IZ6A 2DKGA 3EAEA 2DJQA 2Y90A 3I55T 4EPCA 1MNDA 2FYKA 4PLIA 4WF2A 4B6MA 2CP0A 2I0NA 1RI9A 2ED0A 1FYNA 1UJYA 4N4HA 1CSKA 3CC2T 3G71T 1M8VA 4ANJA 4ZTJA 1NPRA 2JJ9A 2CUBA 3VRZA 2MWPA 2MF2A 2P4TA 2KVQG 5KYWB 1V1CA 3CXCP 3O8VA 5GAMh 2D8HA 3PIOA 1SPKA 2EKHA 4L5GA 4ESRA 2QEXT 5KCOA 4PJOC 1KC8R 3LLRA 4HVWA 4ZN1A 1DJ7B 2L8DA 2LX7A 2LZ6B 1FMWA 3JRZA 2BIVA 2OTLA 5CCAA 1Z9ZA 2KT8A 3LYIA 4RTTA 2XMFA 2FO0A 3J80E 3JCMV 2L2PA 4M7AA 2PU9B 2HKNA 2O4XB 2QGGA 2QQBA 1ZUYA 4Y91A 2K3XA 1WX6A 1QP2A 2NYSA 3VYHB 3QYGB 4JRKA 2XDPA 4OB0B 3CCUT 2NWMA 4QVDA 2K3BA 5GAN5 1Q81R 5FLXE 3RKYA 2C0TA 3OYLA 4PJJA 2JTFA 3TU4K 3CPFA 1BB9A 1JU5C 2KYMA 3SWNB 1YJ9T 3HPWA 3EGXB 1SRLA 4A4GA 2YWWA 1TH7A 4C92G 1SF9A 2VGNA 4N4GA 2KEAA 1KC8U 1I5OB 3PVLA 4M75D 4C8QB 3L2UA 2RQUA 2YT6A 2B8AA 5J39A 1IXDA 5IXBA 4RTWA 2RHZA 1QP3A 2QA4T 1RAAB 1KD1U 4ZGEB 2ABLA 4C0DB 1RI0A 4KH0B 1M2VA 3OB9A 2JM8A 1VQMQ 5KYUA 1D1AA 3M56A 5FRMA 3CMEQ 3CC7Q 1Q81U 2DL5A 1KQSP 2KDSA 4J9GA 1H3ZA 3KUFA 4PNOA 2K79A 1IB8A 4ELZC 3P8BB 3HKSA 4OVAA 4EMKC 2RQVA 2YUNA 4DBFA 2JNGA 2NUPA 3G4ST 2MYSA 2XU8A 4QT7A 4LDVA 3FRNA 3KFVA 2AKKA 5HY6A 2BZYA 2HBWA 4UC4A 3J7AF 1WXUA 1YI2T 1UHFA 1HXDA 1AWWA 3CCSQ 2VASA 2EW3A 1PHTA 2M02A 1PM3A 2LT1A 5D7UA 4FYXB 1ZX6A 4Y28E 4JPBW 2EAYA 2RI5A 4M75F 4RTZA 4HKEA 4C92E 4HA8A 2L0AA 3H9NA 4C92A 2GGRA 3FLGA 2X4JA 1X01A 5LJ5j 3RBBB 4DBQA 3F70A 3CCJT 2E3IA 1AHJB 3LH5A 3OYYA 1QCOA 1VQLQ 2RNAA 1AWJA 3I56Q 5LJ5e 1P92A 5C0MA 1X2QA 2DERA 5HK3A 1U3OA 2R58A 3E1SA 2SRCA 1NJIC 2XK0A 2HAXA 2M51A 5GMKl 4M75C 1K4US 2DMOA 1QVFS 1MHNA 1JJ2P 4OMLA 4J9FA 1O9SA 1YWOA 4BE0A 4CC3A 4HT8A 1A0NB 9ATCB 2X51A 5LJ3j 4KH1B 4JJDA 2JTMA 2KI7A 2D8JA 3M4GA 2CH4A 2QK0A 1PG5B 1ZBJA 4FYVB 5LJ3e 1VQKT 1E7OA 1NG2A 2EYWA 3EFOB 3PMIA
chains in the Genus database with same CATH topology
3M0PA 4LNPA 1UGVA 1E6GA 1FMKA 1JQQA 3M0RA 2DL8A 1RLPC 1M27C 2MCNA 2ESWA 2EYZA 1UDLA 1GBQA 2JT4A 2J05A 2RPNA 2FRWA 4JZ3A 3TSWA 5IHIA 4AFSC 1WDXA 3EG0A 4GLMA 2P4RA 2HCKA 2GBQA 4LUEA 1AVZC 4DEXA 1UUEA 1GL5A 2YUQA 4JZ4A 4EIKA 1K76A 2RF0A 4AFZC 2OJ2A 2BZXA 2KXCA 2C0OA 1RUWA 1YCSB 2DRKA 4RTYA 1YP5A 1QLYA 3I35A 1W70A 2AZSA 2A36A 3UA7A 1ARKA 3NGPA 2KGTA 2JS2A 2L3QA 3M0QA 4J9HA 1ZUUA 1MUZA 4F16A 1X27A 2EGEA 5IXFA 2E5KA 1MV0B 4AG1C 1PRMC 2RN8A 1WI7A 2HDAA 2D1XA 1AEYA 1PWTA 3TVTA 4RTXA 2GTOA 1X2KA 2YUOA 2HSPA 5IHNA 2DE0X 1KSWA 1H92A 2CT3A 3UA6A 2LJ3A 1JEGA 2CSIA 4IIOA 3VS4A 2YDLA 2MIOA 2DA9A 4Y92A 2J7IA 4KRTA 1QKXA 3NHNA 1ZUKA 2LP5A 2JW4A 4RTVA 1T0HA 2CDTA 3THKA 2X3XD 2KRNA 1LCKA 4R0KA 2CT4A 3QWXX 4X1VA 2F2WA 1M3BA 2PNIA 3REBB 1IO6A 1I07A 2GTJA 2AZVA 4AFUC 4CC2A 1SHGA 2L3PA 2F2VA 2HEQA 4HVVA 1PKTA 1WA7A 1KFZA 1EFNA 2AKLA 1ABOA 1X6BA 4RUGA 5IH2A 1WYXA 2C0IA 2DF6A 1KJWA 1W6XA 1QCFA 1G83A 5HCKA 1GCQA 1UHCA 1U5SA 3VS2A 1I0CA 1S1NA 1JXOA 2JMAA 2PTKA 2K2MA 2KR3A 2O31A 2K6DA 2ROLA 1NYGA 2L3SA 2RMOA 1GBRA 2YSQA 2EGAA 2MOXA 2DBMA 1E6HA 1NEBA 4FSSA 2O2OA 2QDLA 1WXTA 2ENMA 3NMZC 1AWXA 5ECAA 1CKBA 1K9AA 1PKSA 1UTIA 2KE9A 3U23A 1VA7A 3VRYA 1KIKA 2RQTA 3EG2A 1UG1A 2JM9A 1OPKA 3O5ZA 5GJWB 2O88A 5FWBA 1QWEA 1Y0MA 2KRMA 2GNCA 3RNJA 2J6FA 3I5RA 1W1FA 2KNBB 3I9QA 2EYYA 1GRIA 2EVRA 1YWPA 2EQIA 2O9SA 1QWFA 4Z88A 4JJCA 4AG2C 2LQNA 3VS1A 3H0HA 1HSQA 2PZ1A 1X69A 2EPDA 3PVQA 2IIMA 2VKNA 2DL4A 2DJQA 3VS3A 2CUDA 3SEMA 1ABQA 2I0NA 4LUDA 2A28A 4ORZA 1RI9A 2ED0A 1FYNA 1UJYA 4LN2A 1CSKA 1ZLMA 2CUBA 1PNJA 4E6RA 3VRZA 1AOJA 1K1ZA 2JMCA 2FPFA 4M4ZA 1GCQC 4GBQA 1HJDA 1N5ZA 2EGCA 1V1CA 1QKWA 3M0UA 1WXBA 1GFCA 2D8HA 2K7AA 1SPKA 2AK5A 2EKHA 2DM1A 2ED1A 2DX1A 2D0NA 4ESRA 2VWFA 1AZEA 4HVWA 1OEBA 3R6NA 2JS0A 2LQWA 2J6KA 2VVKA 4RTUA 3QWYA 2FG0A 3A98A 1OPLA 2M0YA 1AWOA 4A63B 2LX7A 2LZ6B 3H41A 4OMNA 1Z9ZA 2KT8A 4RTTA 1M30A 1TUDA 1UECA 2XMFA 2DL7A 2FO0A 1BK2A 4J9EA 2EYXA 4D8DA 3TSZA 2L2PA 2OAWA 1ZUYA 3VS7A 1NLPC 1HD3A 2KROA 1WX6A 3M0SA 3M0TA 4F14A 3EG1A 2CH4W 2DL3A 2NWMA 4JJBA 3VS6A 2K3BA 3JV3A 1UE9A 2RQWA 2C0TA 1JO8A 1SSHA 1CKAA 1BB9A 1J3TA 1OOTA 1Z9QA 4CC4B 1JU5C 3H0FA 5EC7A 2KYMA 1SRLA 1K0XA 1T3LA 2K9GA 3CQTA 1UFFA 2A37A 2DILA 1OV3A 2BZ8A 1B07A 2SEMA 2KEAA 3C0CA 4ZNXA 4HVUA 1M8MA 3PVLA 4OMPA 2GQIA 3PE0A 4K11A 2JXBA 2RQUA 1NLOC 1BBZA 2YT6A 1PRLC 3EG3A 5IXBA 4RTWA 2DLPA 1SEMA 2CSQA 1TG0A 2LCSA 2A08A 2ABLA 1G2BA 1M3CA 2X3WD 4Z89A 1M3AA 2JM8A 3I5SA 3IQLA 2LJ0A 3SHWA 1NEGA 2DL5A 2ECZA 2JTEA 1VYUA 2RQRA 4J9GA 2KYBA 2BTTA 2J06A 2W10A 3EHQA 2O9VA 1I1JA 1B3QA 2K79A 4OMQA 4OMMA 1UJ0A 1MV3A 1BU1A 3EGUA 2F2XA 1JXMA 2RQVA 2YUNA 4J9CA 5GJVB 2DBKA 3UF4A 1Y57A 4QT7A 2OI3A 2AKKA 2G6FX 3KFVA 1VYTA 4CC7A 2H8HA 1T0JA 1X43A 2BZYA 2DRMA 2FPDA 2DNUA 2HBWA 2W0ZA 1YNZA 1WXUA 2EBPA 1WIEA 1UHFA 1XOVA 1AWWA 1GFDA 1SRMA 3ULRB 2EW3A 1PHTA 1VYVA 1H3HA 4F17A 4DEYA 1ZX6A 2YUPA 2KRSA 4JPBW 2KBTA 3FJ5A 4WCIA 3REAB 4Z8AA 4RTZA 1K0SA 1TUCA 1RLQC 2LMJA 2V1RA 3GBQA 2L0AA 3NPFA 1SHFA 2GGRA 2DVJA 1WLPB 2LJ1A 3RBBB 5I22A 1NM7A 2B86A 3LH5A 2J6OA 2KXDA 4HXJA 2RNAA 1AWJA 1X6GA 1X2QA 1ZSGA 2FEIA 5I11A 1AZGB 2LNHB 1U3OA 2SRCA 4IIMA 2M51A 2NUZA 1WFWA 1K4US 1T3SA 2DMOA 1U06A 3EHRA 1H8KA 4J9DA 1AD5A 4OMLA 4J9FA 1YWOA 2ROTA 4CC3A 4HCKA 4J9IA 1A0NB 2DYBA 4AFQC 2FPEA 3H0IA 2FRYA 2KT1A 1GCPA 2V1QA 5L23A 2CREA 5FWCA 3ZL7C 4JJDA 5FW9A 4OMOA 1YN8A 2D8JA 2CH4A 4D8KA 1ZBJA 4LE9A 3VS5A 4J9BA 1E7OA 1NYFA 1NG2A 2EYWA 5IHKA 3UATA 3VS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M0P A;  4LNP A;  1UGV A;  1E6G A;  1FMK A;  1JQQ A;  3M0R A;  2DL8 A;  1RLP C;  1M27 C;  2MCN A;  2ESW A;  2EYZ A;  1UDL A;  1GBQ A;  2JT4 A;  2J05 A;  2RPN A;  2FRW A;  4JZ3 A;  3TSW A;  5IHI A;  4AFS C;  1WDX A;  3EG0 A;  4GLM A;  2P4R A;  2HCK A;  2GBQ A;  4LUE A;  1AVZ C;  4DEX A;  1UUE A;  1GL5 A;  2YUQ A;  4JZ4 A;  4EIK A;  1K76 A;  2RF0 A;  4AFZ C;  2OJ2 A;  2BZX A;  2KXC A;  2C0O A;  1RUW A;  1YCS B;  2DRK A;  4RTY A;  1YP5 A;  1QLY A;  3I35 A;  1W70 A;  2AZS A;  2A36 A;  3UA7 A;  1ARK A;  3NGP A;  2KGT A;  2JS2 A;  2L3Q A;  3M0Q A;  4J9H A;  1ZUU A;  1MUZ A;  4F16 A;  1X27 A;  2EGE A;  5IXF A;  2E5K A;  1MV0 B;  4AG1 C;  1PRM C;  2RN8 A;  1WI7 A;  2HDA A;  2D1X A;  1AEY A;  1PWT A;  3TVT A;  4RTX A;  2GTO A;  1X2K A;  2YUO A;  2HSP A;  5IHN A;  2DE0 X;  1KSW A;  1H92 A;  2CT3 A;  3UA6 A;  2LJ3 A;  1JEG A;  2CSI A;  4IIO A;  3VS4 A;  2YDL A;  2MIO A;  2DA9 A;  4Y92 A;  2J7I A;  4KRT A;  1QKX A;  3NHN A;  1ZUK A;  2LP5 A;  2JW4 A;  4RTV A;  1T0H A;  2CDT A;  3THK A;  2X3X D;  2KRN A;  1LCK A;  4R0K A;  2CT4 A;  3QWX X;  4X1V A;  2F2W A;  1M3B A;  2PNI A;  3REB B;  1IO6 A;  1I07 A;  2GTJ A;  2AZV A;  4AFU C;  4CC2 A;  1SHG A;  2L3P A;  2F2V A;  2HEQ A;  4HVV A;  1PKT A;  1WA7 A;  1KFZ A;  1EFN A;  2AKL A;  1ABO A;  1X6B A;  4RUG A;  5IH2 A;  1WYX A;  2C0I A;  2DF6 A;  1KJW A;  1W6X A;  1QCF A;  1G83 A;  5HCK A;  1GCQ A;  1UHC A;  1U5S A;  3VS2 A;  1I0C A;  1S1N A;  1JXO A;  2JMA A;  2PTK A;  2K2M A;  2KR3 A;  2O31 A;  2K6D A;  2ROL A;  1NYG A;  2L3S A;  2RMO A;  1GBR A;  2YSQ A;  2EGA A;  2MOX A;  2DBM A;  1E6H A;  1NEB A;  4FSS A;  2O2O A;  2QDL A;  1WXT A;  2ENM A;  3NMZ C;  1AWX A;  5ECA A;  1CKB A;  1K9A A;  1PKS A;  1UTI A;  2KE9 A;  3U23 A;  1VA7 A;  3VRY A;  1KIK A;  2RQT A;  3EG2 A;  1UG1 A;  2JM9 A;  1OPK A;  3O5Z A;  5GJW B;  2O88 A;  5FWB A;  1QWE A;  1Y0M A;  2KRM A;  2GNC A;  3RNJ A;  2J6F A;  3I5R A;  1W1F A;  2KNB B;  3I9Q A;  2EYY A;  1GRI A;  2EVR A;  1YWP A;  2EQI A;  2O9S A;  1QWF A;  4Z88 A;  4JJC A;  4AG2 C;  2LQN A;  3VS1 A;  3H0H A;  1HSQ A;  2PZ1 A;  1X69 A;  2EPD A;  3PVQ A;  2IIM A;  2VKN A;  2DL4 A;  2DJQ A;  3VS3 A;  2CUD A;  3SEM A;  1ABQ A;  2I0N A;  4LUD A;  2A28 A;  4ORZ A;  1RI9 A;  2ED0 A;  1FYN A;  1UJY A;  4LN2 A;  1CSK A;  1ZLM A;  2CUB A;  1PNJ A;  4E6R A;  3VRZ A;  1AOJ A;  1K1Z A;  2JMC A;  2FPF A;  4M4Z A;  1GCQ C;  4GBQ A;  1HJD A;  1N5Z A;  2EGC A;  1V1C A;  1QKW A;  3M0U A;  1WXB A;  1GFC A;  2D8H A;  2K7A A;  1SPK A;  2AK5 A;  2EKH A;  2DM1 A;  2ED1 A;  2DX1 A;  2D0N A;  4ESR A;  2VWF A;  1AZE A;  4HVW A;  1OEB A;  3R6N A;  2JS0 A;  2LQW A;  2J6K A;  2VVK A;  4RTU A;  3QWY A;  2FG0 A;  3A98 A;  1OPL A;  2M0Y A;  1AWO A;  4A63 B;  2LX7 A;  2LZ6 B;  3H41 A;  4OMN A;  1Z9Z A;  2KT8 A;  4RTT A;  1M30 A;  1TUD A;  1UEC A;  2XMF A;  2DL7 A;  2FO0 A;  1BK2 A;  4J9E A;  2EYX A;  4D8D A;  3TSZ A;  2L2P A;  2OAW A;  1ZUY A;  3VS7 A;  1NLP C;  1HD3 A;  2KRO A;  1WX6 A;  3M0S A;  3M0T A;  4F14 A;  3EG1 A;  2CH4 W;  2DL3 A;  2NWM A;  4JJB A;  3VS6 A;  2K3B A;  3JV3 A;  1UE9 A;  2RQW A;  2C0T A;  1JO8 A;  1SSH A;  1CKA A;  1BB9 A;  1J3T A;  1OOT A;  1Z9Q A;  4CC4 B;  1JU5 C;  3H0F A;  5EC7 A;  2KYM A;  1SRL A;  1K0X A;  1T3L A;  2K9G A;  3CQT A;  1UFF A;  2A37 A;  2DIL A;  1OV3 A;  2BZ8 A;  1B07 A;  2SEM A;  2KEA A;  3C0C A;  4ZNX A;  4HVU A;  1M8M A;  3PVL A;  4OMP A;  2GQI A;  3PE0 A;  4K11 A;  2JXB A;  2RQU A;  1NLO C;  1BBZ A;  2YT6 A;  1PRL C;  3EG3 A;  5IXB A;  4RTW A;  2DLP A;  1SEM A;  2CSQ A;  1TG0 A;  2LCS A;  2A08 A;  2ABL A;  1G2B A;  1M3C A;  2X3W D;  4Z89 A;  1M3A A;  2JM8 A;  3I5S A;  3IQL A;  2LJ0 A;  3SHW A;  1NEG A;  2DL5 A;  2ECZ A;  2JTE A;  1VYU A;  2RQR A;  4J9G A;  2KYB A;  2BTT A;  2J06 A;  2W10 A;  3EHQ A;  2O9V A;  1I1J A;  1B3Q A;  2K79 A;  4OMQ A;  4OMM A;  1UJ0 A;  1MV3 A;  1BU1 A;  3EGU A;  2F2X A;  1JXM A;  2RQV A;  2YUN A;  4J9C A;  5GJV B;  2DBK A;  3UF4 A;  1Y57 A;  4QT7 A;  2OI3 A;  2AKK A;  2G6F X;  3KFV A;  1VYT A;  4CC7 A;  2H8H A;  1T0J A;  1X43 A;  2BZY A;  2DRM A;  2FPD A;  2DNU A;  2HBW A;  2W0Z A;  1YNZ A;  1WXU A;  2EBP A;  1WIE A;  1UHF A;  1XOV A;  1AWW A;  1GFD A;  1SRM A;  3ULR B;  2EW3 A;  1PHT A;  1VYV A;  1H3H A;  4F17 A;  4DEY A;  1ZX6 A;  2YUP A;  2KRS A;  4JPB W;  2KBT A;  3FJ5 A;  4WCI A;  3REA B;  4Z8A A;  4RTZ A;  1K0S A;  1TUC A;  1RLQ C;  2LMJ A;  2V1R A;  3GBQ A;  2L0A A;  3NPF A;  1SHF A;  2GGR A;  2DVJ A;  1WLP B;  2LJ1 A;  3RBB B;  5I22 A;  1NM7 A;  2B86 A;  3LH5 A;  2J6O A;  2KXD A;  4HXJ A;  2RNA A;  1AWJ A;  1X6G A;  1X2Q A;  1ZSG A;  2FEI A;  5I11 A;  1AZG B;  2LNH B;  1U3O A;  2SRC A;  4IIM A;  2M51 A;  2NUZ A;  1WFW A;  1K4U S;  1T3S A;  2DMO A;  1U06 A;  3EHR A;  1H8K A;  4J9D A;  1AD5 A;  4OML A;  4J9F A;  1YWO A;  2ROT A;  4CC3 A;  4HCK A;  4J9I A;  1A0N B;  2DYB A;  4AFQ C;  2FPE A;  3H0I A;  2FRY A;  2KT1 A;  1GCP A;  2V1Q A;  5L23 A;  2CRE A;  5FWC A;  3ZL7 C;  4JJD A;  5FW9 A;  4OMO A;  1YN8 A;  2D8J A;  2CH4 A;  4D8K A;  1ZBJ A;  4LE9 A;  3VS5 A;  4J9B A;  1E7O A;  1NYF A;  1NG2 A;  2EYW A;  5IHK A;  3UAT A;  3VS0 A; 
#chains in the Genus database with same CATH topology
 1G3Y A;  1RAE B;  3M0P A;  3RR6 A;  2HMA A;  1JQQ A;  1S72 T;  1M2O A;  2COZ A;  2DL8 A;  4XU2 A;  4DOV A;  2X9H A;  2QQA A;  4PFP A;  4F7U B;  2DYI A;  4BY6 B;  3A8H B;  2A0F B;  3TSW A;  4A4H A;  3CC4 T;  5D6W A;  3CC2 Q;  1WDX A;  1FXX A;  4BE1 A;  3CPW A;  3CD6 T;  3VJP A;  4IUT A;  2HQX A;  5CKE A;  1N27 A;  2E41 A;  4DEX A;  1UUE A;  2GFA A;  2QG9 B;  1GL5 A;  4JZ4 A;  3QYH B;  3JSC A;  5A0D A;  1FX7 A;  5DLO A;  2OJ2 A;  4RTY A;  2DEU A;  1QLY A;  1OI1 A;  1U1S A;  3M9Q A;  1KG1 A;  5GAN 6;  3CBO A;  1W70 A;  4XTX A;  2LDM A;  2KGT A;  4J5Y A;  2JS2 A;  3M0Q A;  1FMV A;  3JCM e;  1K8A C;  2KSS A;  5C6S A;  1MV0 B;  4AG1 C;  2CYZ B;  1N8R C;  3A8L B;  1VQ7 T;  3DKM A;  1PWT A;  4ZTF A;  1D3B B;  2M16 A;  2HSP A;  5IHN A;  1KSW A;  3OYB A;  3SWN C;  3OYM A;  3GOX A;  1VQ5 A;  3D7S B;  3OQ5 A;  3CCQ A;  2ZZD A;  1WHM A;  2LP5 A;  1T0H A;  2CDT A;  4R0K A;  4DOW A;  3JB9 G;  5GAN 2;  5GAN 3;  4M77 B;  4X1V A;  4EMK A;  3JCM J;  3EG9 A;  2QYZ A;  2L3P A;  2F2V A;  4C0D C;  1PKT A;  1WA7 A;  4M7A D;  1IGQ A;  3OSV A;  2LC4 A;  4RUG A;  1ZSZ A;  3C94 A;  2BUD A;  4EMH A;  1VQ9 T;  3RKW A;  3RUX A;  2RHI A;  4ZGJ B;  4E7L A;  1YJN T;  1R77 A;  2X4Y A;  1NJI R;  3LX7 A;  1WGS A;  2JMA A;  5KCH A;  3FDR A;  5L8R E;  2KAF A;  1NYG A;  1GBR A;  3QKJ A;  1YHQ T;  5GAO l;  1WHG A;  2O2O A;  3I55 A;  3G4S Q;  1AWX A;  2XD0 A;  1ZBX A;  2EJ9 A;  3G71 A;  1G8X A;  1UTI A;  1YI2 Q;  5KYX B;  1IRE B;  2JM9 A;  3O5Z A;  2M9U A;  4X34 A;  2RJF A;  3DB3 A;  1MMA A;  1QVF P;  1QWE A;  4M7D G;  4FM4 B;  4TVR A;  5FRN A;  3CCL Q;  3I9Q A;  4FSX A;  2QEX A;  3GF5 A;  2O9S A;  3CCJ Q;  2DXB A;  1QWF A;  4M7A F;  4II1 A;  2XIC A;  3H0H A;  2DZ9 A;  4XTY A;  3QZ5 B;  2PZ1 A;  4M78 G;  1X69 A;  2IIM A;  3A5Z B;  3M54 A;  3VS3 A;  1B34 B;  1R0B G;  3EH1 A;  4C8Q G;  2GQV A;  1ABQ A;  4LUD A;  4ORZ A;  4F7U F;  2EQK A;  3OS2 A;  5CQY A;  3CCU A;  2ZAE A;  3OYA A;  1VQO Q;  1KQ2 A;  1VQ6 Q;  2QAZ A;  3JCM b;  1K1Z A;  2FPF A;  2RM4 A;  5DM7 R;  2ZPI B;  3CME T;  3CC7 T;  1YJ9 A;  1K8A R;  3V8K A;  2EQM A;  2DFU A;  4M77 D;  2AK5 A;  1N8R R;  4AMC A;  1M90 C;  2DX1 A;  1I5L A;  1VOM A;  3JCM P;  1LPL A;  4BY6 C;  8AT1 B;  2D6F A;  3QBY A;  1NE8 A;  2LQW A;  2VVK A;  3HFN A;  4RTU A;  3QWY A;  2FG0 A;  1YJW T;  1AWO A;  4A63 B;  3S3O A;  1M9S A;  1HK9 A;  1KHI A;  2A7Y A;  3H41 A;  3P8D A;  4FW1 A;  4OMN A;  3CD6 Q;  2QA4 A;  1TUD A;  3OYJ A;  2DL7 A;  1BK2 A;  3TSZ A;  5KYY A;  2HQH A;  1YCY A;  5CKF A;  3CCS T;  4M7D E;  5GAN 7;  3OYF A;  4M7D A;  1IGU A;  4F14 A;  3EG1 A;  1WJR A;  2DL3 A;  3EGD A;  4JJB A;  3FEO A;  3RDV A;  1C0M A;  2RQW A;  3MP6 A;  2C06 A;  1G3W A;  1J3T A;  1OOT A;  3JCM X;  1K8A U;  4M78 E;  2VUB A;  4M78 A;  5AT1 B;  1VQL T;  2JOY A;  3I56 T;  2BZ8 A;  3DB4 A;  2V26 A;  2I2L A;  5GAO q;  2YRC A;  4ZNX A;  4C8Q E;  4HVU A;  4A4F A;  4C8Q A;  1M8M A;  2JUF A;  3FIF A;  4OMF B;  1K9M U;  4MDX A;  1NLO C;  1YI2 A;  1BI1 A;  4Q5W A;  2EKO A;  2K2V A;  3V7C A;  1UGQ B;  4RCC A;  2RI2 A;  5FU6 B;  4M77 F;  3OW2 P;  2DD4 A;  4C92 F;  2X3W D;  3E19 A;  5D6Y A;  1M3A A;  3I5S A;  3VV0 A;  1VQP Q;  2LJ0 A;  2PVD B;  1BI3 A;  2A3L A;  1NEG A;  3E9F A;  1QW1 A;  2JTE A;  3UPU A;  3QO3 A;  2KYB A;  3LWH A;  3EHQ A;  3M5A A;  3OYD A;  2E10 A;  3N5B B;  4M77 C;  2NUT B;  1BU1 A;  3JCM W;  2YRD A;  3CXC A;  1VQN Q;  4C0F A;  1WHK A;  5GJV B;  3UF4 A;  1JJ2 S;  1XTD A;  2MPX C;  1VYT A;  3AHU A;  1RAH B;  2HKQ B;  2FPD A;  2W0Z A;  2EBP A;  1WIE A;  1VQ9 Q;  4OB1 B;  5IAY A;  2R5M A;  2QTV A;  1SRM A;  2R57 A;  3L2W A;  1YJN Q;  4E7K A;  3OS0 A;  2OTJ Q;  1YIJ Q;  4DEY A;  1VQK A;  4JLI A;  2KRS A;  2PVG B;  4WCI A;  1NBE B;  1K0S A;  2WAC A;  2F5K A;  2DIG A;  2V1R A;  4ZGD B;  1S72 A;  3OMC A;  2XDB A;  1SHF A;  1YHQ Q;  1WNL A;  2LJ1 A;  2CP7 A;  4JLG A;  2B86 A;  2RJE A;  2FB7 A;  2OAU A;  3FC3 A;  4HXJ A;  1XQH A;  3CC4 A;  1ZSG A;  3WVE B;  2RHY A;  3QSU A;  4V2S A;  1KD1 R;  3CD6 A;  1ACM B;  2NUZ A;  2WSF E;  4JRI A;  1T3S A;  4E2F B;  1M90 R;  1U06 A;  1H8K A;  1PD1 A;  4DQ2 A;  3A8M B;  4IUU A;  1AD5 A;  3CCR T;  4HCK A;  4AFQ C;  4XTU A;  1GCP A;  5L23 A;  2CRE A;  5FWC A;  4MML A;  4D8K A;  1WQ7 A;  1RAC B;  2GCX A;  2GFU A;  4J9B A;  5IHK A;  3QXE B;  3UAT A;  3HP9 A;  5A0L A;  3CCE T;  4MZT A;  4IUV A;  1UGV A;  2AHJ B;  1Q7Y C;  5GMK h;  2CP2 A;  2K5F A;  1KQS A;  1RLP C;  1M27 C;  1UDL A;  1LJO A;  2XDD A;  1NZ9 A;  4X9C A;  2FRW A;  4YTL A;  4JZ3 A;  1YIT Q;  1FWZ A;  5FRO A;  1VQ7 A;  4GLM A;  1GXI E;  4MMK A;  4RMO A;  2DD5 A;  2HCK A;  2GBQ A;  3OS5 A;  4B9W A;  2HZY A;  1M90 U;  3M4Y A;  4LUE A;  2ZGW A;  4KGZ B;  1Y96 B;  5GAN j;  2QXF A;  5LJ5 g;  4BE2 A;  1K76 A;  2RF0 A;  3JB9 I;  4PL6 A;  1QVG A;  3X24 B;  2KXC A;  2OX7 A;  5GAN e;  2ZPB B;  4C0Z A;  3I35 A;  3DLM A;  2FHD A;  4PJO G;  3QJ6 A;  3QII A;  1YJW Q;  2LX9 A;  2QQS A;  4C5E A;  3CBP A;  3OYN A;  2G3R A;  5LJ5 f;  1M4Z A;  1ZUU A;  1MUZ A;  3X20 B;  5LJ3 g;  2P0Q A;  4KUD K;  5KH6 A;  3MJX A;  4RTX A;  1D3B A;  5J26 A;  2YUO A;  1VQ4 Q;  2X4X A;  2LJ3 A;  4IIO A;  2YDL A;  4JJN K;  2DVE A;  2RK1 A;  3CCL T;  2MIO A;  1JJ2 A;  2DA9 A;  1TOV A;  4Z02 A;  2VYT A;  4Y92 A;  1UGP B;  4FT4 A;  2J7I A;  3S3N A;  1YHQ A;  4KRT A;  5LJ3 f;  1QKX A;  1VQ8 Q;  1W2B P;  3NHN A;  2JW4 A;  5GAN 8;  3P8H A;  4RTV A;  2MWO A;  2ATC B;  3PT9 A;  3THK A;  2K5I A;  2EJF A;  3QWX X;  5FU6 C;  1M3B A;  2EWN A;  2PNI A;  1IO6 A;  3SB2 A;  2GTJ A;  3OBW A;  4NL2 A;  1SHG A;  4JUV A;  2HEQ A;  1C6V X;  2XI9 A;  1ABO A;  1VQO T;  1VQ6 T;  4LDX A;  5IH2 A;  3VKI A;  1WYX A;  4PJM A;  2C0I A;  2KMT A;  4PLL A;  3FJP A;  1KJW A;  4M7A B;  4NL3 A;  1QCF A;  3JB9 F;  2F5T X;  2VB6 A;  5HCK A;  2ZPE B;  4XU1 A;  1S1N A;  3JCM g;  4X9D A;  2PTK A;  4QVC A;  3S6W A;  2K6D A;  3MP1 A;  4PJO E;  2ROL A;  4LD6 A;  2CZ6 B;  4KGV B;  4PJO A;  4LDU A;  2RMO A;  4M78 D;  5A0G A;  2MOX A;  2FZK B;  2QDL A;  2ENM A;  4N0A C;  1WZO A;  2JN0 A;  2EQJ A;  5I2S A;  3JCM f;  1G3S A;  2F1L A;  2KE9 A;  3U23 A;  4HCC A;  1VA7 A;  2KK4 A;  2LCL A;  1VQM A;  2RHX A;  5GJW B;  2P84 A;  1Q7Y R;  1MMD A;  1D09 B;  2ZPH B;  4O5V A;  1K73 C;  3NTK A;  3CME A;  3CC7 A;  2MMP A;  1Y0M A;  2KRM A;  2GNC A;  1BI0 A;  2CGH A;  4IUQ A;  2J6F A;  1W1F A;  1D1C A;  3WXM B;  1M2V B;  4AT1 B;  3CCM Q;  1EX4 A;  3BY7 A;  5KYU B;  1WQW A;  2COY A;  4AG2 C;  3VS1 A;  1HSQ A;  2DK3 A;  8ATC B;  3A8G B;  5AYF A;  4OGC A;  3RER A;  1D0Z A;  2DL4 A;  4CRI A;  2CUD A;  3CPW P;  3CCS A;  3JCM Q;  3C95 A;  1I81 A;  2A28 A;  3CCR Q;  2NUP B;  2DAQ A;  4M75 G;  3PMT A;  2Y4Y A;  3HRU A;  1K9M C;  3CCV Q;  3EFS A;  2LQ8 A;  3JCM c;  1ZLM A;  3QPH A;  4M78 F;  1Q7Y U;  3GP8 A;  1BCO A;  1TS9 A;  1VQP T;  4E6R A;  4JS5 A;  2EYQ A;  1GCQ C;  1OUL A;  4GBQ A;  3SD4 A;  1N5Z A;  3CCE Q;  1VQL A;  3QZ9 B;  3I56 A;  2XKO C;  2ED1 A;  1SSF A;  2D0N A;  3E2U A;  2VWF A;  3TEE A;  1OEB A;  5CVI A;  3R6N A;  2RI3 A;  2JS0 A;  4XU0 A;  1VQN T;  3OMG A;  4C92 B;  3RMQ A;  3OW2 S;  1OPL A;  1X6O A;  2M0Y A;  3Q1J A;  3JB9 J;  1U1T A;  4QKU A;  1UGR B;  4GY5 A;  1M30 A;  4D8D A;  4E7H A;  1JB0 E;  5CKH A;  3MEA A;  5GAM g;  4HT9 A;  4RG8 A;  6AT1 B;  3VS7 A;  2E70 A;  1NLP C;  3NFC A;  2OTJ T;  1YIJ T;  2LNV A;  4C5H A;  2CH4 W;  3S3M A;  3JV3 A;  2E4H A;  4J8O A;  1ZHI A;  1JO8 A;  3CEY A;  1Z9Q A;  1QVF A;  3BW1 A;  4PFZ A;  4ATO A;  3H0F A;  5EC7 A;  2EFI A;  4KBM B;  2HL3 A;  5GAM f;  2K9G A;  3CQT A;  2A37 A;  4FIB A;  2DTH A;  1Y07 A;  2SEM A;  2YHT A;  2PVO B;  3CC2 A;  4HCB A;  4IUP A;  2Z0W A;  4OMP A;  2MAM A;  3M55 A;  3PE0 A;  2KQW A;  2CP6 A;  4K11 A;  1BBZ A;  1W4S A;  3EH2 A;  4M75 E;  1PRL C;  2XID A;  4M75 A;  3EG3 A;  1RAD B;  2DLP A;  1TUG B;  4B9X A;  4QQG A;  2A08 A;  5KYN A;  5EG2 A;  5GAM j;  1M3C A;  3TCJ A;  4L59 A;  4Z89 A;  2WSE E;  2EQU A;  5GAM e;  3IQL A;  2VXF A;  3V7S A;  2ECZ A;  2RQR A;  3TRE A;  5IT9 E;  4HCZ A;  2BTT A;  2J06 A;  2O9V A;  5GAN d;  4OGE A;  2LTO A;  4OMQ A;  2E6N A;  4MZM A;  1MV3 A;  1K73 R;  4JRP A;  3LGL A;  3ZEH A;  1JXM A;  2QTX A;  4J9C A;  1QCN A;  2DBK A;  3AT1 B;  1YIT T;  1Y57 A;  1KK7 A;  2OI3 A;  4CC7 A;  1OU8 A;  1T0J A;  1X43 A;  1YNZ A;  5J3B A;  4M7A C;  1RAI B;  3MHX A;  1XOV A;  1H3H A;  5KYW A;  3OA6 A;  1Q86 U;  4F17 A;  4FU6 A;  1TTH B;  1Q82 U;  2YUP A;  3SFM A;  4C92 D;  3REA B;  3CCE A;  4XAX B;  1TUC A;  1I8F A;  1RLQ C;  4QQ6 A;  4KT0 E;  2VXE A;  4XU3 A;  3NPF A;  4ELY C;  5GAO r;  1YFN A;  1K9M R;  3L42 A;  5I22 A;  1WJQ A;  2KXD A;  3VUZ A;  5LJ5 d;  1Q95 G;  1VIE A;  1K73 U;  4EDU A;  2CZ7 B;  5I11 A;  2O4X A;  1AZG B;  2DEQ A;  3INZ A;  2CP3 A;  2E64 A;  4IIM A;  1WFW A;  3EHR A;  4IUR A;  4J9D A;  1OZ2 A;  1M1G A;  4LDY A;  2OTL Q;  3EG9 B;  2FZG B;  2FPE A;  3H0I A;  1WHL A;  2FRY A;  2QI2 A;  1VQ4 T;  3HFO A;  5FW9 A;  3LGF A;  4OMO A;  3MKD A;  1YN8 A;  3SWN A;  3PNW C;  5LJ3 d;  1D0X A;  3VUB A;  2DXU A;  3EGX A;  1ZSZ B;  3OW2 A;  2JVV A;  4ZN3 A;  1VQ8 T;  3G4S A;  3MEV A;  4LNP A;  2E6Z A;  2L3R A;  2H3E B;  1F1B B;  2ESW A;  1GBQ A;  2J05 A;  3CCQ T;  4E47 A;  1ZQ1 A;  1G5V A;  3OYG A;  3L2Q A;  5IHI A;  1V29 B;  4AFS C;  5DLQ E;  4O6J A;  2P4R A;  4DBH A;  4RCB A;  4C5G A;  3CCL A;  1AVZ C;  2IPO B;  1TXQ A;  1W2B S;  3G6E T;  4OB3 B;  2EJG A;  2YUQ A;  3CCJ A;  2ZCF B;  4AFZ C;  2BZX A;  2DRK A;  1RUW A;  1OX8 A;  1RAG B;  1YP5 A;  3A1P A;  2RJC A;  4C92 C;  3GNG A;  2E65 A;  3FB9 A;  2H3J A;  3WVD B;  2AZS A;  1BYM A;  4F7U G;  2COW A;  5D6X A;  4OP0 A;  3JCM d;  1OZ3 A;  2LCC A;  4J6Y A;  1X27 A;  1VQO A;  4BUG A;  2EGE A;  5IXF A;  1VQ6 A;  2E5K A;  1OQK A;  1WI7 A;  5KE3 A;  2PUO B;  1AEY A;  4J7F A;  3TVT A;  4DBR A;  2L89 A;  4PJO F;  1X2K A;  3QDF A;  4PJL A;  2F69 A;  5FU7 B;  3LWI A;  2DE0 X;  1H92 A;  2CT3 A;  1JEG A;  3VS4 A;  2K3Y A;  3G7Z A;  1WPY A;  5HK0 A;  3CCM T;  3GPL A;  2DXT A;  2RA2 A;  1Y7X A;  4PJN A;  2X3X D;  3VU3 C;  2QGF B;  3H8Z A;  1IHW A;  2RK2 A;  3BE3 A;  1N9S A;  1I4K 1;  2PQW A;  3REB B;  2AZV A;  3RKX A;  5GAN g;  2LT4 A;  4FYY B;  2RO0 A;  2AKL A;  3CCV T;  2HSE B;  4N4I A;  5GAO p;  1X6B A;  3TQ7 P;  4M7A E;  4J7I A;  1W6X A;  2K57 A;  2E1H A;  5KYY B;  3MO8 A;  3EFO A;  1G83 A;  2QDY B;  2XG8 D;  2V8I A;  4M7D B;  2V8K A;  3VS2 A;  1JXO A;  3HRS A;  1M1K C;  5LL6 S;  2K2M A;  3EGD B;  2KR3 A;  2RJD A;  4F7U E;  5GAN f;  4F7U A;  3V8J A;  1NPP A;  2L3S A;  3CPW S;  1D0Y A;  2DBM A;  1E6H A;  1NEB A;  4E7S A;  3OYH A;  4FSS A;  4M77 G;  3NMZ C;  1TSF A;  4M78 B;  1CKB A;  1JBM A;  3LW5 E;  1K9A A;  4D6W A;  1H64 1;  1PKS A;  2QAS A;  1V76 A;  2BE9 B;  3CMA T;  3VRY A;  1OPK A;  4BAC A;  2V8J A;  1VQP A;  4DA4 A;  3OY9 A;  5FWB A;  1IHV A;  3RNJ A;  1HYO A;  3I5R A;  5GAM d;  2RD1 A;  1GRI A;  2EVR A;  5IN1 A;  1PC0 A;  3JB9 D;  1VQN A;  3QG1 A;  1MGQ A;  1R8O B;  2ZPG B;  2LQN A;  3RIR A;  1M1F A;  3MEW A;  2EPD A;  2DIQ A;  1W2B A;  2D9T A;  4BB7 A;  2Y4X A;  1VQ9 A;  3SEM A;  1YJN A;  3M53 A;  4ME7 A;  2OTJ A;  4LN2 A;  1YIJ A;  2JZ2 A;  2X35 A;  3HTR A;  2CS7 A;  4QW2 A;  1ZSZ C;  3M58 A;  2CP5 A;  2E3H A;  1PNJ A;  1QVG P;  1AOJ A;  2JMC A;  4M4Z A;  1HJD A;  2EGC A;  2QQR A;  1QKW A;  3M0U A;  1WXB A;  1GFC A;  2K7A A;  4JDS A;  3PTA A;  2DM1 A;  3L2Z A;  4M77 E;  1LNX A;  4M77 A;  1VQ5 Q;  3KXT A;  1AZE A;  3PGG A;  1M5Q 1;  4PFO A;  2J6K A;  3CCQ Q;  2RH2 A;  4RKU E;  2XHC A;  5I2M A;  3A98 A;  1ZA1 B;  5CK9 A;  2LVM A;  4LDW A;  3ER0 A;  2HL5 C;  4GLK A;  1UEC A;  4M7D D;  4J9E A;  3MCA B;  2HNI A;  4E7I A;  2EYX A;  1N6A A;  2EIF A;  3M59 A;  4XTW A;  2VC8 A;  2OAW A;  1HD3 A;  2M0O A;  2KRO A;  3G6E Q;  3M0S A;  3M0T A;  3VS6 A;  2PUK B;  2DTO A;  2K4Y A;  1UE9 A;  1AT1 B;  1SSH A;  1CKA A;  1Q86 C;  1UEB A;  3KBG A;  4CC4 B;  3J81 E;  4A53 A;  1Q82 C;  4E7Z A;  1K0X A;  1MMN A;  5KE2 A;  1T3L A;  2YLB A;  4C8Q D;  1UFF A;  2DIL A;  1OV3 A;  1YIT A;  1B07 A;  3C0C A;  4A4E A;  2L5Q A;  5KYX A;  2GQI A;  4J83 A;  5GAN 4;  3MEU A;  2JXB A;  3JB9 H;  4XTV A;  3HL8 A;  4J6W A;  1M1K R;  3EFR A;  3I55 Q;  1WHJ A;  4BDY A;  2HD0 A;  3QUI A;  4C0G A;  5FU7 C;  3GLX A;  2OTL T;  3X26 B;  1SEM A;  2CSQ A;  1TG0 A;  3ME9 A;  2LCS A;  3G71 Q;  2LRQ A;  1G2B A;  4XQ3 A;  2E5Q A;  4F04 B;  1MNE A;  3ZBD A;  2BKD N;  1KQ1 A;  3SHW A;  1VYU A;  3ASK A;  2MK5 A;  5CO7 A;  3T9N A;  1YJW A;  2W10 A;  4MDW A;  1BCM A;  1I1J A;  4M7D F;  4FT2 A;  1B3Q A;  3BDU A;  2ZPF B;  4OMM A;  1UJ0 A;  1B34 A;  2K5L A;  2QEX Q;  3EGU A;  2CZ0 B;  1KHC A;  2F2X A;  2IVW A;  1SKU B;  2G6F X;  3A8O B;  2H8H A;  4PK4 A;  4OF1 A;  2DRM A;  2DNU A;  4BDZ A;  1M1K U;  3L1A A;  1VQ4 A;  3GIB A;  1GFD A;  3ULR B;  4M7D C;  1UB4 A;  1VYV A;  4QVZ A;  1QVP A;  3M57 A;  2MI6 A;  4C8Q F;  1QMC A;  2P0K A;  4XK8 E;  1QQJ A;  1OU9 A;  3BFM A;  3CCU Q;  1VQ8 A;  2KBT A;  3FJ5 A;  4JRQ A;  1TWB A;  4Z8A A;  1Y71 A;  5GAO n;  4QQD A;  2P0P A;  3C12 A;  2LMJ A;  3GBQ A;  2VV5 A;  2QQ9 A;  3QDR B;  2DVJ A;  1WLP B;  5GAN h;  2NLU A;  1YJ9 Q;  1NM7 A;  2VGM A;  4M78 C;  2J6O A;  2YRV A;  2X4W A;  4LXC A;  3UWN A;  4FYW B;  3HRT A;  4FCY A;  1X6G A;  4C8Q C;  2FEI A;  4KGX B;  2DO3 A;  3QHS A;  2LNH B;  3CMA Q;  1O75 A;  3X25 B;  5M9O A;  1JRI A;  1N9R A;  3HSB A;  3OSS C;  2DXC A;  3DLL A;  4E7J A;  4LD9 K;  3G6E A;  4C5I A;  2ROT A;  4J9I A;  1BIA A;  2DYB A;  2QA4 Q;  2KT1 A;  2V1Q A;  5GMK i;  3ZL7 C;  3L2R A;  4J6X A;  3ZFJ A;  4LE9 A;  3VS5 A;  4BI4 A;  3MET A;  1NYF A;  3NTI A;  2CZ1 B;  2DPP B;  3VS0 A;  4BI3 A;  1EIF A;  4RG2 A;  5GMK m;  4NOY A;  1WJS A;  2DTI A;  3E9G A;  1E6G A;  2O01 E;  1FMK A;  3M0R A;  1B7T A;  3QJY A;  2IG0 A;  5LJ5 h;  4WTO B;  4R55 A;  1UGS B;  3URG A;  3H6Z A;  4FL6 A;  2MCN A;  2EYZ A;  4PJO B;  2JT4 A;  3PFS A;  3OYK A;  2DZC A;  4XTZ A;  2RPN A;  2AT1 B;  1Q86 R;  3EG0 A;  1Q82 R;  2R5A A;  1TU0 B;  3UDC A;  4FW2 A;  1U8R A;  3CCM A;  4EIK A;  5HKC A;  3CXC S;  5CIU A;  5LJ3 h;  2HBP A;  3RMS A;  3MP8 A;  1PSE A;  2BE7 D;  2C0O A;  1YCS B;  2NUT A;  4A4K A;  2RHU A;  1VIF A;  5CKB A;  3OBY A;  3C4S A;  5DY9 A;  3OYI A;  1NJI U;  2A36 A;  3UA7 A;  3MPU B;  3V8L A;  4N0A A;  1ARK A;  3NGP A;  2LQK A;  4IKF A;  3CCR A;  1BIB A;  1EZZ B;  2L3Q A;  1VUB A;  4J9H A;  4F16 A;  3CCV A;  1PRM C;  3GNF B;  4JS4 A;  1BKB A;  2RN8 A;  2FZC B;  2M1H A;  2HDA A;  2D1X A;  1KC8 C;  1RL2 A;  4L6V 5;  2GTO A;  7AT1 B;  1D1B A;  3UA6 A;  2CSI A;  3BDL A;  1IRX A;  4MZP A;  1SG5 A;  2D0Q B;  3G1J A;  5GMK j;  3JAM E;  1VQM T;  4A54 A;  3OYE A;  1VQK Q;  1KD1 C;  5GMK e;  5CAI A;  1PD0 A;  2FVU A;  1X75 C;  1ZUK A;  5I21 A;  3HHT B;  1S72 Q;  2KRN A;  1LCK A;  2CT4 A;  3CMA A;  3JCM h;  1Q81 C;  2F2W A;  2YLC A;  1RAF B;  1I07 A;  4BI8 B;  4EMK B;  4AFU C;  1XNI A;  3CC4 Q;  4CC2 A;  4P5N A;  1G3T A;  4HVV A;  1KFZ A;  2RB6 A;  1EFN A;  3X28 B;  1OYX A;  1R0C B;  2DF6 A;  1XJW B;  1KQS S;  4NS5 A;  1GCQ A;  1UHC A;  1U5S A;  3OS1 A;  1I0C A;  1RAB B;  2YXY A;  4PJO D;  3CBM A;  4KUI A;  4BD3 A;  2O31 A;  2DJZ A;  5CQX A;  1OX9 A;  1VQ5 T;  2YSQ A;  2EGA A;  3L2V A;  3SDZ A;  3OYC A;  3PIP A;  1WXT A;  3NTH A;  1N8R U;  5ECA A;  5CR2 A;  2WSC E;  2DET A;  2AIR B;  4R56 A;  1LOJ A;  1QVG S;  3UT1 A;  2KY9 A;  1KIK A;  2RQT A;  3EG2 A;  1UG1 A;  1Y96 A;  1ZA2 B;  5CKD A;  1VQ7 Q;  2CKK A;  4M7A G;  2O88 A;  4M75 B;  3V7R A;  1MMG A;  4VUB A;  1C1A A;  5GAO m;  4CI0 C;  3VYG A;  3LH0 A;  1LVK A;  2FL7 A;  2KNB B;  3RES A;  1BI2 A;  2EYY A;  2E12 A;  1YWP A;  2EQI A;  2GF7 A;  5A2Q E;  1WHH A;  4KUL A;  4Z88 A;  4JJC A;  1PSF A;  2HQE A;  4EMG A;  3R6O A;  3PVQ A;  4PKC C;  4OB2 B;  1PCX A;  1YBY A;  2VKN A;  1IZ6 A;  2DKG A;  3EAE A;  2DJQ A;  2Y90 A;  3I55 T;  4EPC A;  1MND A;  2FYK A;  4PLI A;  4WF2 A;  4B6M A;  2CP0 A;  2I0N A;  1RI9 A;  2ED0 A;  1FYN A;  1UJY A;  4N4H A;  1CSK A;  3CC2 T;  3G71 T;  1M8V A;  4ANJ A;  4ZTJ A;  1NPR A;  2JJ9 A;  2CUB A;  3VRZ A;  2MWP A;  2MF2 A;  2P4T A;  2KVQ G;  5KYW B;  1V1C A;  3CXC P;  3O8V A;  5GAM h;  2D8H A;  3PIO A;  1SPK A;  2EKH A;  4L5G A;  4ESR A;  2QEX T;  5KCO A;  4PJO C;  1KC8 R;  3LLR A;  4HVW A;  4ZN1 A;  1DJ7 B;  2L8D A;  2LX7 A;  2LZ6 B;  1FMW A;  3JRZ A;  2BIV A;  2OTL A;  5CCA A;  1Z9Z A;  2KT8 A;  3LYI A;  4RTT A;  2XMF A;  2FO0 A;  3J80 E;  3JCM V;  2L2P A;  4M7A A;  2PU9 B;  2HKN A;  2O4X B;  2QGG A;  2QQB A;  1ZUY A;  4Y91 A;  2K3X A;  1WX6 A;  1QP2 A;  2NYS A;  3VYH B;  3QYG B;  4JRK A;  2XDP A;  4OB0 B;  3CCU T;  2NWM A;  4QVD A;  2K3B A;  5GAN 5;  1Q81 R;  5FLX E;  3RKY A;  2C0T A;  3OYL A;  4PJJ A;  2JTF A;  3TU4 K;  3CPF A;  1BB9 A;  1JU5 C;  2KYM A;  3SWN B;  1YJ9 T;  3HPW A;  3EGX B;  1SRL A;  4A4G A;  2YWW A;  1TH7 A;  4C92 G;  1SF9 A;  2VGN A;  4N4G A;  2KEA A;  1KC8 U;  1I5O B;  3PVL A;  4M75 D;  4C8Q B;  3L2U A;  2RQU A;  2YT6 A;  2B8A A;  5J39 A;  1IXD A;  5IXB A;  4RTW A;  2RHZ A;  1QP3 A;  2QA4 T;  1RAA B;  1KD1 U;  4ZGE B;  2ABL A;  4C0D B;  1RI0 A;  4KH0 B;  1M2V A;  3OB9 A;  2JM8 A;  1VQM Q;  5KYU A;  1D1A A;  3M56 A;  5FRM A;  3CME Q;  3CC7 Q;  1Q81 U;  2DL5 A;  1KQS P;  2KDS A;  4J9G A;  1H3Z A;  3KUF A;  4PNO A;  2K79 A;  1IB8 A;  4ELZ C;  3P8B B;  3HKS A;  4OVA A;  4EMK C;  2RQV A;  2YUN A;  4DBF A;  2JNG A;  2NUP A;  3G4S T;  2MYS A;  2XU8 A;  4QT7 A;  4LDV A;  3FRN A;  3KFV A;  2AKK A;  5HY6 A;  2BZY A;  2HBW A;  4UC4 A;  3J7A F;  1WXU A;  1YI2 T;  1UHF A;  1HXD A;  1AWW A;  3CCS Q;  2VAS A;  2EW3 A;  1PHT A;  2M02 A;  1PM3 A;  2LT1 A;  5D7U A;  4FYX B;  1ZX6 A;  4Y28 E;  4JPB W;  2EAY A;  2RI5 A;  4M75 F;  4RTZ A;  4HKE A;  4C92 E;  4HA8 A;  2L0A A;  3H9N A;  4C92 A;  2GGR A;  3FLG A;  2X4J A;  1X01 A;  5LJ5 j;  3RBB B;  4DBQ A;  3F70 A;  3CCJ T;  2E3I A;  1AHJ B;  3LH5 A;  3OYY A;  1QCO A;  1VQL Q;  2RNA A;  1AWJ A;  3I56 Q;  5LJ5 e;  1P92 A;  5C0M A;  1X2Q A;  2DER A;  5HK3 A;  1U3O A;  2R58 A;  3E1S A;  2SRC A;  1NJI C;  2XK0 A;  2HAX A;  2M51 A;  5GMK l;  4M75 C;  1K4U S;  2DMO A;  1QVF S;  1MHN A;  1JJ2 P;  4OML A;  4J9F A;  1O9S A;  1YWO A;  4BE0 A;  4CC3 A;  4HT8 A;  1A0N B;  9ATC B;  2X51 A;  5LJ3 j;  4KH1 B;  4JJD A;  2JTM A;  2KI7 A;  2D8J A;  3M4G A;  2CH4 A;  2QK0 A;  1PG5 B;  1ZBJ A;  4FYV B;  5LJ3 e;  1VQK T;  1E7O A;  1NG2 A;  2EYW A;  3EFO B;  3PMI A; 
#chains in the Genus database with same CATH homology
 3M0P A;  4LNP A;  1UGV A;  1E6G A;  1FMK A;  1JQQ A;  3M0R A;  2DL8 A;  1RLP C;  1M27 C;  2MCN A;  2ESW A;  2EYZ A;  1UDL A;  1GBQ A;  2JT4 A;  2J05 A;  2RPN A;  2FRW A;  4JZ3 A;  3TSW A;  5IHI A;  4AFS C;  1WDX A;  3EG0 A;  4GLM A;  2P4R A;  2HCK A;  2GBQ A;  4LUE A;  1AVZ C;  4DEX A;  1UUE A;  1GL5 A;  2YUQ A;  4JZ4 A;  4EIK A;  1K76 A;  2RF0 A;  4AFZ C;  2OJ2 A;  2BZX A;  2KXC A;  2C0O A;  1RUW A;  1YCS B;  2DRK A;  4RTY A;  1YP5 A;  1QLY A;  3I35 A;  1W70 A;  2AZS A;  2A36 A;  3UA7 A;  1ARK A;  3NGP A;  2KGT A;  2JS2 A;  2L3Q A;  3M0Q A;  4J9H A;  1ZUU A;  1MUZ A;  4F16 A;  1X27 A;  2EGE A;  5IXF A;  2E5K A;  1MV0 B;  4AG1 C;  1PRM C;  2RN8 A;  1WI7 A;  2HDA A;  2D1X A;  1AEY A;  1PWT A;  3TVT A;  4RTX A;  2GTO A;  1X2K A;  2YUO A;  2HSP A;  5IHN A;  2DE0 X;  1KSW A;  1H92 A;  2CT3 A;  3UA6 A;  2LJ3 A;  1JEG A;  2CSI A;  4IIO A;  3VS4 A;  2YDL A;  2MIO A;  2DA9 A;  4Y92 A;  2J7I A;  4KRT A;  1QKX A;  3NHN A;  1ZUK A;  2LP5 A;  2JW4 A;  4RTV A;  1T0H A;  2CDT A;  3THK A;  2X3X D;  2KRN A;  1LCK A;  4R0K A;  2CT4 A;  3QWX X;  4X1V A;  2F2W A;  1M3B A;  2PNI A;  3REB B;  1IO6 A;  1I07 A;  2GTJ A;  2AZV A;  4AFU C;  4CC2 A;  1SHG A;  2L3P A;  2F2V A;  2HEQ A;  4HVV A;  1PKT A;  1WA7 A;  1KFZ A;  1EFN A;  2AKL A;  1ABO A;  1X6B A;  4RUG A;  5IH2 A;  1WYX A;  2C0I A;  2DF6 A;  1KJW A;  1W6X A;  1QCF A;  1G83 A;  5HCK A;  1GCQ A;  1UHC A;  1U5S A;  3VS2 A;  1I0C A;  1S1N A;  1JXO A;  2JMA A;  2PTK A;  2K2M A;  2KR3 A;  2O31 A;  2K6D A;  2ROL A;  1NYG A;  2L3S A;  2RMO A;  1GBR A;  2YSQ A;  2EGA A;  2MOX A;  2DBM A;  1E6H A;  1NEB A;  4FSS A;  2O2O A;  2QDL A;  1WXT A;  2ENM A;  3NMZ C;  1AWX A;  5ECA A;  1CKB A;  1K9A A;  1PKS A;  1UTI A;  2KE9 A;  3U23 A;  1VA7 A;  3VRY A;  1KIK A;  2RQT A;  3EG2 A;  1UG1 A;  2JM9 A;  1OPK A;  3O5Z A;  5GJW B;  2O88 A;  5FWB A;  1QWE A;  1Y0M A;  2KRM A;  2GNC A;  3RNJ A;  2J6F A;  3I5R A;  1W1F A;  2KNB B;  3I9Q A;  2EYY A;  1GRI A;  2EVR A;  1YWP A;  2EQI A;  2O9S A;  1QWF A;  4Z88 A;  4JJC A;  4AG2 C;  2LQN A;  3VS1 A;  3H0H A;  1HSQ A;  2PZ1 A;  1X69 A;  2EPD A;  3PVQ A;  2IIM A;  2VKN A;  2DL4 A;  2DJQ A;  3VS3 A;  2CUD A;  3SEM A;  1ABQ A;  2I0N A;  4LUD A;  2A28 A;  4ORZ A;  1RI9 A;  2ED0 A;  1FYN A;  1UJY A;  4LN2 A;  1CSK A;  1ZLM A;  2CUB A;  1PNJ A;  4E6R A;  3VRZ A;  1AOJ A;  1K1Z A;  2JMC A;  2FPF A;  4M4Z A;  1GCQ C;  4GBQ A;  1HJD A;  1N5Z A;  2EGC A;  1V1C A;  1QKW A;  3M0U A;  1WXB A;  1GFC A;  2D8H A;  2K7A A;  1SPK A;  2AK5 A;  2EKH A;  2DM1 A;  2ED1 A;  2DX1 A;  2D0N A;  4ESR A;  2VWF A;  1AZE A;  4HVW A;  1OEB A;  3R6N A;  2JS0 A;  2LQW A;  2J6K A;  2VVK A;  4RTU A;  3QWY A;  2FG0 A;  3A98 A;  1OPL A;  2M0Y A;  1AWO A;  4A63 B;  2LX7 A;  2LZ6 B;  3H41 A;  4OMN A;  1Z9Z A;  2KT8 A;  4RTT A;  1M30 A;  1TUD A;  1UEC A;  2XMF A;  2DL7 A;  2FO0 A;  1BK2 A;  4J9E A;  2EYX A;  4D8D A;  3TSZ A;  2L2P A;  2OAW A;  1ZUY A;  3VS7 A;  1NLP C;  1HD3 A;  2KRO A;  1WX6 A;  3M0S A;  3M0T A;  4F14 A;  3EG1 A;  2CH4 W;  2DL3 A;  2NWM A;  4JJB A;  3VS6 A;  2K3B A;  3JV3 A;  1UE9 A;  2RQW A;  2C0T A;  1JO8 A;  1SSH A;  1CKA A;  1BB9 A;  1J3T A;  1OOT A;  1Z9Q A;  4CC4 B;  1JU5 C;  3H0F A;  5EC7 A;  2KYM A;  1SRL A;  1K0X A;  1T3L A;  2K9G A;  3CQT A;  1UFF A;  2A37 A;  2DIL A;  1OV3 A;  2BZ8 A;  1B07 A;  2SEM A;  2KEA A;  3C0C A;  4ZNX A;  4HVU A;  1M8M A;  3PVL A;  4OMP A;  2GQI A;  3PE0 A;  4K11 A;  2JXB A;  2RQU A;  1NLO C;  1BBZ A;  2YT6 A;  1PRL C;  3EG3 A;  5IXB A;  4RTW A;  2DLP A;  1SEM A;  2CSQ A;  1TG0 A;  2LCS A;  2A08 A;  2ABL A;  1G2B A;  1M3C A;  2X3W D;  4Z89 A;  1M3A A;  2JM8 A;  3I5S A;  3IQL A;  2LJ0 A;  3SHW A;  1NEG A;  2DL5 A;  2ECZ A;  2JTE A;  1VYU A;  2RQR A;  4J9G A;  2KYB A;  2BTT A;  2J06 A;  2W10 A;  3EHQ A;  2O9V A;  1I1J A;  1B3Q A;  2K79 A;  4OMQ A;  4OMM A;  1UJ0 A;  1MV3 A;  1BU1 A;  3EGU A;  2F2X A;  1JXM A;  2RQV A;  2YUN A;  4J9C A;  5GJV B;  2DBK A;  3UF4 A;  1Y57 A;  4QT7 A;  2OI3 A;  2AKK A;  2G6F X;  3KFV A;  1VYT A;  4CC7 A;  2H8H A;  1T0J A;  1X43 A;  2BZY A;  2DRM A;  2FPD A;  2DNU A;  2HBW A;  2W0Z A;  1YNZ A;  1WXU A;  2EBP A;  1WIE A;  1UHF A;  1XOV A;  1AWW A;  1GFD A;  1SRM A;  3ULR B;  2EW3 A;  1PHT A;  1VYV A;  1H3H A;  4F17 A;  4DEY A;  1ZX6 A;  2YUP A;  2KRS A;  4JPB W;  2KBT A;  3FJ5 A;  4WCI A;  3REA B;  4Z8A A;  4RTZ A;  1K0S A;  1TUC A;  1RLQ C;  2LMJ A;  2V1R A;  3GBQ A;  2L0A A;  3NPF A;  1SHF A;  2GGR A;  2DVJ A;  1WLP B;  2LJ1 A;  3RBB B;  5I22 A;  1NM7 A;  2B86 A;  3LH5 A;  2J6O A;  2KXD A;  4HXJ A;  2RNA A;  1AWJ A;  1X6G A;  1X2Q A;  1ZSG A;  2FEI A;  5I11 A;  1AZG B;  2LNH B;  1U3O A;  2SRC A;  4IIM A;  2M51 A;  2NUZ A;  1WFW A;  1K4U S;  1T3S A;  2DMO A;  1U06 A;  3EHR A;  1H8K A;  4J9D A;  1AD5 A;  4OML A;  4J9F A;  1YWO A;  2ROT A;  4CC3 A;  4HCK A;  4J9I A;  1A0N B;  2DYB A;  4AFQ C;  2FPE A;  3H0I A;  2FRY A;  2KT1 A;  1GCP A;  2V1Q A;  5L23 A;  2CRE A;  5FWC A;  3ZL7 C;  4JJD A;  5FW9 A;  4OMO A;  1YN8 A;  2D8J A;  2CH4 A;  4D8K A;  1ZBJ A;  4LE9 A;  3VS5 A;  4J9B A;  1E7O A;  1NYF A;  1NG2 A;  2EYW A;  5IHK A;  3UAT A;  3VS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...