3REBB

Hiv-1 nef protein in complex with engineered hck-sh3 domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
59
structure length
59
Chain Sequence
b'DIIVVALYDYVSWSPDDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein Nef
molecule tags Protein binding
source organism Hiv-1 m:b_arv2/sf2
publication title Molecular design, functional characterization and structural basis of a protein inhibitor against the HIV-1 pathogenicity factor Nef.
pubmed doi rcsb
total genus 13
structure length 59
sequence length 59
chains with identical sequence D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3rebB00
1GCQC 2VKNA 4E6RA 3KFVA 1WXTA 4AG1C 2DBMA 3A98A 3NGPA 2CH4A 1S1NA 2PTKA 2K2MA 1GFCA 2H8HA 2EYXA 1Z9ZA 2JTEA 2YUOA 1VYUA 4OMOA 2RMOA 1M27C 4JPBW 2D1XA 2EQIA 1MV0B 2G6FX 1X6GA 2FRYA 2B86A 2EYYA 2NWMA 2DL4A 1XOVA 2YDLA 1LCKA 4DEXA 1WLPB 2K7AA 2RQVA 1GFDA 2YUNA 2F2WA 1QWFA 2DL3A 1OOTA 3EG0A 4HCKA 1CKBA 4JZ3A 4GBQA 2M51A 2JMCA 2LP5A 4OMLA 4ZNXA 1GBQA 2GNCA 2CUBA 2J7IA 1M30A 2MCNA 4J9EA 4RTVA 4WCIA 1K0SA 2MIOA 2AKLA 3REAB 3VS7A 1CKAA 3THKA 4CC3A 1BBZA 5I11A 4AFUC 3U23A 4Z8AA 3NPFA 1PRLC 2F2XA 1PRMC 1GRIA 1IO6A 1T0JA 2EGAA 1K0XA 3VS3A 4Z88A 1RLPC 3PE0A 2SRCA 2O9VA 2M0YA 2AK5A 2A36A 2K6DA 2HSPA 2JM9A 2RQWA 2A37A 2J05A 3EHRA 3VS1A 3O5ZA 2DILA 1X43A 1PNJA 1M8MA 2L3QA 1NYGA 3I5SA 1E6HA 2EPDA 3H0FA 4LNPA 1SEMA 2EBPA 2MOXA 1CSKA 3EG2A 3SEMA 1UG1A 1H3HA 3EGUA 2L0AA 2ROLA 2KR3A 1QCFA 1X6BA 1ARKA 1W1FA 2I0NA 2HCKA 1UJYA 4GLMA 2DL8A 2DRMA 1KSWA 2LQNA 1UJ0A 4LN2A 2CUDA 3C0CA 2EKHA 1SRLA 1KJWA 5FWCA 1U5SA 2L2PA 1BK2A 2FEIA 2HEQA 2CT4A 1AWXA 1J3TA 3I9QA 1YP5A 1QLYA 4OMQA 2O2OA 4J9HA 1SHFA 1EFNA 4X1VA 1K1ZA 1SSHA 3H41A 2EYZA 2CSQA 4DEYA 1WA7A 1K9AA 2KYMA 2YUPA 2DLPA 2JMAA 4D8DA 1BB9A 5GJWB 2ED1A 2DYBA 3QWXX 4KRTA 1ZUKA 4Y92A 2EVRA 1TUCA 2K9GA 1A0NB 1NYFA 1GCQA 1MV3A 3PVLA 5GJVB 3QWYA 1OV3A 2DX1A 4K11A 2LJ0A 5IXBA 4OMNA 1NLOC 1T3LA 2W0ZA 2QDLA 1WDXA 4RTWA 3NMZC 1NM7A 1TG0A 2DRKA 2KRSA 5HCKA 2W10A 3H0IA 1UHCA 1ZUUA 3VS2A 2ABLA 1WX6A 2LNHB 3M0TA 1X27A 1ZSGA 5IHNA 2A08A 2ROTA 2JS0A 1BU1A 1UTIA 2CT3A 2DF6A 1FYNA 4F17A 2XMFA 1WI7A 4JJCA 2FPDA 1PWTA 2ESWA 4RTTA 1G83A 3M0PA 1G2BA 2HDAA 1FMKA 1W70A 1T0HA 4AFZC 2DE0X 2DL7A 2V1RA 1JEGA 3I5RA 2ENMA 2C0OA 2DL5A 2RF0A 2DMOA 1PHTA 3EG1A 4LUEA 4CC2A 1I1JA 2DBKA 2CSIA 4M4ZA 2BZXA 1OPLA 1AVZC 2KGTA 3UA6A 3M0UA 5I22A 4AG2C 5ECAA 1NG2A 3I35A 1H92A 3TSZA 2KXDA 4CC4B 4J9CA 2A28A 2EYWA 2DJQA 2SEMA 1UHFA 1K4US 2V1QA 1WFWA 2LQWA 1UE9A 1YWPA 5IH2A 2GTOA 2L3PA 2J6FA 2RPNA 2KT8A 2IIMA 1UECA 4A63B 3M0QA 2C0TA 2LCSA 1SHGA 1RLQC 3H0HA 2BZ8A 2FPEA 2D8JA 2CDTA 2JT4A 2KXCA 2RQUA 4EIKA 1YNZA 3TSWA 2K79A 1AD5A 4RTUA 1QWEA 4F14A 5IXFA 1AWOA 2L3SA 3CQTA 4Z89A 1RI9A 2VWFA 4OMMA 1H8KA 2O31A 2DVJA 4J9GA 2FG0A 1M3AA 2JXBA 1I07A 3UATA 1WYXA 4IIOA 1KIKA 1X69A 1Y57A 1UDLA 2CREA 2FPFA 1KFZA 2E5KA 2DM1A 3PVQA 1VYTA 2GBQA 3EHQA 2D0NA 2RQTA 1JQQA 3NHNA 2KROA 1ABOA 3M0SA 2LJ1A 2AKKA 4IIMA 4RTYA 1YWOA 4HXJA 2O9SA 2KRNA 2PZ1A 2LX7A 2BZYA 2RQRA 1NEGA 4HVUA 1PKTA 2D8HA 1ZLMA 2O88A 5IHKA 3VS4A 1SPKA 1OEBA 2F2VA 1ZBJA 2HBWA 2KEAA 3M0RA 2GGRA 4D8KA 2KRMA 1E7OA 1K76A 2X3XD 2DNUA 2ECZA 2GQIA 4AFQC 2PNIA 4J9FA 2KNBB 4FSSA 1PKSA 2RN8A 1UGVA 2FRWA 1QKXA 1VA7A 2EW3A 1B07A 2VVKA 4LUDA 1YCSB 1JU5C 1HJDA 2NUZA 1OPKA 4RTZA 2BTTA 2AZSA 2K3BA 4JZ4A 3UF4A 1B3QA 3GBQA 3FJ5A 1AWWA 2KBTA 1GCPA 2LMJA 1AOJA 1E6GA 1HD3A 2LJ3A 2JW4A 1ZX6A 1V1CA 3LH5A 2GTJA 2KT1A 1I0CA 2YT6A 2JM8A 3SHWA 4CC7A 5FWBA 1ZUYA 4J9BA 1WXBA 4LE9A 4ESRA 2OAWA 2LZ6B 5L23A 1U06A 2J6KA 2KYBA 2OI3A 2P4RA 3REBB 1Y0MA 4J9IA 2EGCA 1JXMA 3EG3A 1AWJA 4HVWA 1RUWA 4RTXA 4QT7A 3R6NA 4J9DA 5FW9A 1T3SA 3ULRB 5IHIA 2DA9A 1ABQA 1JO8A 1SRMA 2YUQA 1VYVA 4ORZA 3VRYA 1TUDA 4R0KA 1M3BA 1WXUA 3UA7A 3VS0A 2KE9A 1X2KA 1JXOA 5EC7A 3IQLA 1M3CA 4JJDA 2JS2A 2C0IA 2YSQA 1YN8A 1N5ZA 2J06A 2EGEA 3RBBB 1QKWA 1U3OA 1UUEA 3RNJA 4F16A 2X3WD 3VRZA 1W6XA 4OMPA 1AZGB 2ED0A 4JJBA 3JV3A 1AZEA 1X2QA 1NEBA 1GBRA 3VS5A 1NLPC 3TVTA 2CH4W 1AEYA 2AZVA 3VS6A 1Z9QA 4AFSC 1GL5A 2RNAA 2J6OA 1MUZA 1WIEA 2OJ2A 4HVVA 3ZL7C 1HSQA 1UFFA 2FO0A 4RUGA
chains in the Genus database with same CATH superfamily
1GCQC 2VKNA 1Q86R 2RD1A 5GAOl 1D0YA 1R77A 2AIRB 1Q86C 2JTMA 2DBMA 2GFAA 1S1NA 2CP3A 2P0KA 4BI4A 1UGPB 1Q7YU 2K2VA 1M90R 1Z9ZA 2JTEA 5CCAA 3CCLA 1VQLA 1VYUA 4PJLA 2EQIA 2G6FX 1X6GA 3A8LB 2FRYA 1VQ9A 1ZSZA 2EYYA 1LCKA 1B7TA 3MKDA 3M55A 2K7AA 2RQVA 3OYYA 3G4SQ 4XTXA 1Q82C 3GOXA 1GFDA 3EGDA 2YRVA 2PVDB 1RL2A 5GANd 2HQXA 1YI2Q 4FSXA 2V26A 2JMCA 2DXCA 2LP5A 4OMLA 4M78C 2QQRA 4ZGJB 2GNCA 2CUBA 3HP9A 4WCIA 2MIOA 4Q5WA 4J7IA 3PNWC 3VS7A 3CCLQ 1W4SA 3UT1A 1RADB 3THKA 4CC3A 2QAZA 1PM3A 3RKYA 5I11A 3I55T 3U23A 5HKCA 2L3RA 3NPFA 1PRLC 3OSVA 5LJ5f 3L2UA 4LXCA 4YTLA 1WGSA 1T0JA 1RLPC 5GANg 2FZKB 1KD1R 1XTDA 1M5Q1 5LJ3e 2DTHA 5LJ3j 1AHJB 2K5FA 2LCLA 4EDUA 1X43A 4DBQA 2MK5A 3CCRA 4MMLA 1NYGA 3X24B 4MZMA 1E6HA 2QI2A 2EQMA 3H0FA 1VQ9Q 2YRCA 2RJEA 3G7ZA 4IUVA 2OTLT 1MMAA 2EBPA 4F7UA 1VQ9T 1VQKQ 1M1FA 1BIBA 1BI3A 4M7AE 3CBPA 1H3HA 1TTHB 2L0AA 2IVWA 4M77G 2P84A 2I0NA 4AMCA 2HCKA 4FCYA 1UJYA 4GLMA 3QYHB 4TVRA 2DRMA 2LVMA 4M7DE 1ZBXA 1QCNA 1KJWA 2RH2A 5FWCA 4FIBA 1U5SA 1BK2A 2CT4A 1K1ZA 2EIFA 2EYZA 3X25B 1WJQA 2KYMA 4B9WA 1ZHIA 4PK4A 3G4SA 3SWNA 1I5OB 5GAMe 4D8DA 1BB9A 5GJWB 4FL6A 2ED1A 1BI0A 1QQJA 2X9HA 8ATCB 3PGGA 1RAEB 1WNLA 1UGSB 4C92A 3ME9A 2ZPEB 3OYIA 1U8RA 2JNGA 2AHJB 4K11A 5GAN6 1KC8C 2DXTA 2YRDA 4OMNA 1VQ6Q 3DLMA 1NLOC 2FZCB 4RTWA 1TS9A 4XTWA 3NMZC 1NM7A 4C92G 3G4ST 1TG0A 5HCKA 3VS2A 2HBPA 2H3EB 4JS5A 1YITQ 1UTIA 1QCOA 1QVFA 4DA4A 5CQXA 5A0DA 4OGCA 4F7UF 3CC7A 4P5NA 1FMKA 1N27A 1W70A 3P8DA 4NS5A 1JEGA 2RF0A 2C0OA 2DTIA 3EG1A 2OTJT 2DBKA 1RAGB 4M4ZA 1OPLA 1IRXA 1AVZC 2FZGB 3JCMX 3A1PA 5I22A 4XTUA 1MHNA 2XDDA 2DXBA 5ECAA 2COZA 1YFNA 2CKKA 3BDUA 4KGVB 4ZTJA 4FYWB 5KYXB 2EYWA 2SEMA 1UHFA 4PJNA 4OB0B 1K8AR 1WFWA 1UE9A 1YWPA 2GTOA 2RPNA 1YJWA 1K9MC 4X9DA 5I21A 5C0MA 1D1AA 5KYWB 1VQ8T 4JRPA 1D1BA 4PFOA 4BE1A 3QO3A 4E7SA 2QDYB 2D8JA 3PIPA 4EIKA 4L6V5 2R58A 3MP8A 1NJIR 3VV0A 3M56A 4R56A 2L3SA 4Z89A 3VU3C 5GAN8 5KE3A 2DPPB 2D0QB 2XIDA 5CK9A 4EPCA 1M3AA 1I07A 3UATA 2QQAA 1D3BA 1X69A 1UDLA 2WSEE 3M58A 3PVQA 1M1KR 1VYTA 3V7RA 1VQMA 2GBQA 5GAN5 3CCQT 2VGMA 2JN0A 3R6OA 3URGA 1M90U 3JCMh 2KROA 4C5HA 3AT1B 1RABB 2CZ6B 5CKHA 5GMKe 2R5MA 2DEQA 2D8HA 1ZLMA 2LC4A 2O88A 4ELYC 2XDBA 4LD6A 2O4XB 3NFCA 3M54A 3M0RA 4A4FA 1E7OA 1K76A 2RI2A 3V8JA 1B34B 4XU3A 3BDLA 4FYYB 4UC4A 4FSSA 4DBHA 3G71A 4M75G 3Q1JA 4LUDA 2VGNA 1DJ7B 3MP1A 1OPKA 3CPWP 2X4JA 3JCMQ 1U1TA 4JZ4A 3OYDA 5CKDA 3GBQA 3FJ5A 3LLRA 2P4TA 1AOJA 2LJ3A 1VQOT 5CO7A 2QGGA 3L2RA 2DO3A 2X4WA 2JM8A 2B8AA 4N0AA 4EMKB 2EQKA 2ZPIB 4C92E 5L23A 2PUKB 3HPWA 4N4GA 1VQ7Q 3A8OB 4HVWA 1WHGA 1RUWA 3VUBA 1NJIU 3X28B 2L8DA 3R6NA 1Y7XA 4PJOF 4XK8E 3ULRB 2DA9A 2PVOB 3FC3A 2YUQA 2QA4Q 4E47A 2KI7A 1VYVA 3CMAA 1TUDA 3UA7A 3VS0A 1K9MR 3CD6T 4D6WA 5IAYA 1TOVA 5GAMh 3JCMP 4DOWA 1OX9A 3J81E 4A54A 1N5ZA 4XAXB 2GCXA 2J06A 3HFNA 1S72T 1QKWA 3JRZA 1UUEA 3E9FA 5GAOp 3JCMW 1MMNA 3VRZA 3G71T 1WJSA 4M7DG 1AZEA 3S3MA 3OMCA 2QGFB 3VYGA 2AZVA 4E7ZA 1Z9QA 1GL5A 1D0ZA 2E6NA 4HKEA 3HRTA 1QP2A 3ZEHA 3BFMA 4BE2A 2CP7A 2M16A 4LDUA 2DYIA 2D6FA 2DTOA 3CCVT 4M7DA 3QKJA 2BKDN 1R0CB 3A98A 3NGPA 2LRQA 3MEWA 1G3SA 2CH4A 3OYGA 2VYTA 3CC2T 2K2MA 4XU0A 1GFCA 4BUGA 2YUOA 5CKFA 4OMOA 4JPBW 1XQHA 3CCJQ 1MV0B 4KUDK 2V8IA 5C6SA 4E7LA 1YIJT 1W2BS 2DJZA 3JCMV 1C6VX 2YDLA 1HYOA 2K4YA 3JB9I 4RCCA 2RJFA 3QJYA 4C0DC 3LW5E 4PNOA 1VQPA 2ZCFB 4KGZB 4OB2B 2NUTA 1ZSZB 3CBOA 1QWFA 3EG0A 4HCKA 4XTYA 3OYJA 2PQWA 3E19A 2K3XA 1PD0A 4ME7A 4ZNXA 3HKSA 1OYXA 4J9EA 4KUIA 3REAB 4IUTA 4M75C 2EFIA 1BBZA 3JB9J 5GMKj 5KYXA 4AFUC 4ZTFA 3EFOB 1YITA 4Z8AA 1ACMB 2F2XA 5CAIA 2MMPA 1GRIA 3H6ZA 3CD6Q 4C5GA 1IO6A 4Z88A 2A0FB 9ATCB 3PE0A 1KG1A 5AYFA 5D6WA 3C4SA 2A36A 2JM9A 2A37A 2J05A 3EHRA 3FB9A 3QG1A 1KD1U 1PSFA 3M9QA 2DILA 1PNJA 4FYVB 1Q81C 3OS0A 1Q81R 2EPDA 5GMKm 3OYNA 2QASA 4M7AD 5CIUA 5FU7B 3EFRA 2MOXA 1VQNT 1JJ2S 1LPLA 3L42A 3HSBA 4GY5A 1CSKA 5DLOA 4PJOC 3EG2A 1X6OA 3SEMA 1KQ2A 1RAHB 2JZ2A 3VJPA 4BE0A 3JCMJ 1WQ7A 3CPWS 2K5IA 1RAAB 1KSWA 4N4IA 2H3JA 2RK2A 2EWNA 4J5YA 1WHLA 1UJ0A 3FDRA 2CUDA 2EKHA 1SRLA 1V29B 3I9QA 1YP5A 3L2VA 4OMQA 4M75A 2O2OA 4J9HA 3C94A 1H641 4X1VA 1SSHA 4DBRA 3H41A 1WA7A 1K9AA 2YUPA 4Z02A 1QVGA 4Y91A 2DYBA 3M59A 1TUCA 3CMET 4XU1A 2CZ0B 5LJ3f 4A4KA 3PVLA 4XTVA 5KH6A 2EJFA 2DX1A 4C8QB 4ZGEB 2LJ0A 4MDXA 3QDRB 5IXBA 2OTLQ 2NUTB 3G6EA 2JJ9A 4M77D 4Y28E 4CI0C 1X01A 4PL6A 1ZUUA 3CCEQ 1WPYA 5GAMj 3I56T 1X27A 1ZSGA 5IHNA 2A08A 3CC2Q 2ROTA 1BU1A 4XTZA 3OB9A 3RIRA 3CC7T 4M78E 3NTKA 2FPDA 1PWTA 4F7UE 1TXQA 5DY9A 2HDAA 3EGXA 4C8QG 1VQLQ 1P92A 1M2VB 4C5IA 2V1RA 1S72A 3NTIA 3I5RA 2DL5A 1PHTA 2QQBA 4CC2A 3OSSC 1I1JA 2RJDA 1M4ZA 1VQ7T 5GAN7 2BZXA 3LWHA 3GLXA 4PLLA 4JRIA 4L5GA 4WF2A 1M1KC 3M0UA 4AG2C 4A4GA 1NG2A 3TSZA 4J9CA 2A28A 1K9MU 2DJQA 3GNFB 1VQKA 1K4US 1D09B 3LYIA 5IH2A 4OF1A 2L3PA 2KT8A 5GAMg 2IIMA 2V8KA 1NJIC 4A63B 2KDSA 4PJOG 5GAOm 1FXXA 1SHGA 2M9UA 2HQHA 3H0HA 4C92C 2X35A 5D6XA 1X75C 2RJCA 2OTJQ 2WSFE 2ZPHB 3JCMc 1AD5A 3L1AA 3CCLT 4RTUA 4F14A 5IXFA 1VQ6T 1BCMA 4PJOA 1NPPA 1RI9A 1U1SA 2MPXC 4C8QF 1G5VA 1H3ZA 4J7FA 2M0OA 2VWFA 5KCOA 1H8KA 4MZPA 1SSFA 2DVJA 2FG0A 4LDXA 4IIOA 5LJ3d 3FJPA 1Y57A 1KIKA 2QXFA 3EFSA 2E5KA 1VQOQ 4LDWA 2QYZA 2CP6A 3G6EQ 1OU9A 1JQQA 3NHNA 4IURA 3GIBA 3O8VA 3ASKA 2VUBA 3UPUA 2E1HA 4C5EA 1YWOA 4HXJA 3OYKA 2O9SA 2KRNA 1NEGA 3S3OA 3MJXA 4OVAA 1QVFS 1OU8A 4JRKA 2VXFA 1TUGB 5IHKA 4PLIA 3L2ZA 1SPKA 1WHJA 4FW1A 2HBWA 2CZ1B 2GGRA 4D8KA 2DZCA 4ZN1A 2X3XD 3M53A 4FW2A 2DNUA 2ECZA 1YJ9T 3CD6A 3RDVA 2D9TA 1YHQT 4J9FA 1Y96B 3JB9H 1I8FA 1PKSA 1VQ5T 2ZPGB 1YJNT 1QVGS 2RN8A 2BIVA 2GFUA 1YI2A 1YJWT 2FRWA 1QKXA 1VA7A 2DAQA 4PKCC 4E2FB 1LNXA 1VQLT 1QMCA 4C0ZA 3S3NA 1RAIB 1B3QA 3PFSA 3N5BB 4MMKA 5KYYA 1YCYA 2RA2A 2DZ9A 2KT1A 3L2WA 4J8OA 3I55Q 1FMWA 2KMTA 3SHWA 4CC7A 3CMEA 4HT9A 1ZUYA 4J9BA 4LE9A 4ESRA 3X20B 1BCOA 3G1JA 1Y0MA 2EGCA 3CCSQ 4QQDA 1D1CA 1PC0A 1AWJA 1HXDA 2EYQA 2LT4A 3VUZA 1VQ6A 3CCST 3KUFA 1Q7YR 1PD1A 2RK1A 4RTXA 2NUPA 4GLKA 5FW9A 3HL8A 4E7KA 1KC8U 4M7DC 1ABQA 3UWNA 1JO8A 2CGHA 2EJGA 1YJ9Q 2LNVA 4ZN3A 4ORZA 4RG8A 1N8RC 3PT9A 2VASA 1SKUB 1M3BA 1WXUA 2IPOB 3D7SB 3CXCP 1JXOA 4PJMA 2ZGWA 5EC7A 1M3CA 1YN8A 4WTOB 2E5QA 4PFPA 3E1SA 3TREA 3DLLA 2ZPFB 1K73R 1AZGB 1BIAA 4JJBA 4M78F 3OYFA 1Y07A 1X2QA 1NEBA 2E65A 1NLPC 3J80E 3OYLA 1ZA2B 1O75A 2VC8A 1NE8A 4JJNK 2GF7A 1MUZA 2OJ2A 4HVVA 1FX7A 1HSQA 1UFFA 3CCMT 2K57A 2X51A 1VQOA 3LWIA 4AG1C 3CCUA 2YHTA 3G6ET 2DIQA 4KGXB 2E10A 1XNIA 4KH0B 2F1LA 2EYXA 1IXDA 3QSUA 3CCRQ 4QVCA 2RMOA 4A53A 1M27C 4N0AC 2K3YA 4M75D 1JJ2A 3T9NA 2NWMA 2DL4A 2QEXA 1YJ9A 1WLPB 1KQSS 2FYKA 2DETA 2M1HA 4F04B 3RERA 2BUDA 5LJ5e 4A4HA 3CC4A 2DERA 1OOTA 4EMHA 1LJOA 4FM4B 4JLIA 4QKUA 3RESA 2E12A 4R55A 1N9SA 4RCBA 3QPHA 1GBQA 3SWNC 1WHKA 3V8LA 2EJ9A 3CBMA 4C92F 2AKLA 1YIJA 1EX4A 3SB2A 4J6WA 1CKAA 1NPRA 5GAN3 2QTVA 3E9GA 4J6XA 4M75F 3CCMQ 5GANj 2QK0A 5DLQE 3RKXA 1BI1A 1PRMC 4C8QC 2HNIA 1K0XA 3CCSA 1VQMT 2SRCA 4MZTA 1D3BB 3OBWA 3OW2P 1OULA 2O9VA 3CEYA 5AT1B 1VIFA 2K6DA 4DQ2A 5GAOr 3MP6A 2RQWA 3VS1A 3S6WA 1Q81U 3MO8A 2OAUA 5J26A 4NL3A 3CCJA 1M8MA 1VQ4Q 2XG8D 5FU6B 1OI1A 2G3RA 3GP8A 3PMIA 5A2QE 2EKOA 4M78D 4LNPA 4NL2A 3P8HA 2F5KA 2HMAA 1GXIE 2NLUA 3OA6A 1UG1A 2EQJA 4BB7A 1NBEB 2ROLA 3KBGA 2KR3A 1KQ1A 4OP0A 2XKOC 1QCFA 2GQVA 1RAFB 2QQSA 4EMGA 5KYWA 3TCJA 5CVIA 1N8RR 3TEEA 3OYAA 1HK9A 1R8OB 5KE2A 5IN1A 1I5LA 2RHZA 3C0CA 3LGFA 3M5AA 2EAYA 2HEQA 1AWXA 4QQGA 7AT1B 2WACA 1V76A 1IHVA 1TSFA 2NUPB 4BDZA 4DEYA 4JUVA 4M78B 2DLPA 4PJOD 4CRIA 3ER0A 3GF5A 3CCVA 3CC4Q 4KRTA 4Y92A 5I2SA 2EVRA 2KY9A 3HRSA 3AHUA 1MV3A 3MEAA 5GJVB 4AT1B 2E3HA 1VQNA 1OV3A 2LQ8A 4X34A 1G3YA 3M4YA 1VQ5Q 4IUUA 3SDZA 2P0QA 2W0ZA 2QDLA 2E6ZA 4HCBA 2BE7D 2KRSA 1UHCA 1WX6A 2LNHB 3M0TA 3OYHA 3CXCA 3KXTA 3JCMf 1QW1A 3FRNA 4F17A 3DKMA 2XMFA 4KT0E 4JJCA 3EG9A 4FT2A 2ESWA 2YXYA 3ZBDA 4RTTA 5A0GA 3JAME 3M0PA 1G2BA 2FHDA 2VB6A 2QG9B 2DD5A 4FT4A 5GANf 2DE0X 3MEVA 2QA4T 5I2MA 2ENMA 1M1KU 2RHIA 5GMKl 2COWA 3SWNB 2CSIA 2DD4A 4E7HA 1LVKA 2HL5C 2KGTA 3UA6A 1OX8A 2QEXT 2JOYA 2E70A 3PIOA 1VQPQ 3I56Q 1H92A 3V7CA 2QQ9A 2KXDA 2FVUA 5KYUA 4C0FA 2RI5A 2V1QA 2LQWA 4NOYA 1VUBA 4RG2A 5LJ5d 3ZFJA 3H8ZA 5LL6S 2A7YA 4ATOA 1UB4A 3QYGB 4IUQA 3JCMe 2K5LA 1Q95G 3QHSA 3M0QA 5FRMA 2C0TA 2LCSA 1RLQC 5GMKh 2KQWA 2FL7A 3DB4A 2KK4A 2JT4A 3CPFA 2RQUA 1K73U 5GANe 5J3BA 2OTLA 3C12A 3OS5A 3CQTA 5D7UA 1MNEA 1OZ2A 2CP5A 4C8QE 3INZA 1Y71A 5LJ3g 3CCEA 2VV5A 4F7UG 2XI9A 4M78G 3TQ7P 2JXBA 2LX9A 5GANh 1MMDA 4M7DB 2CREA 1KFZA 3JB9F 2DM1A 1G3TA 1IGUA 2LDMA 1VQ8Q 4M75B 3M0SA 5HY6A 1KD1C 3F70A 2AKKA 2PVGB 4RTYA 3RKWA 2PZ1A 5D6YA 2LX7A 2BZYA 1PKTA 2C06A 4HCZA 1M2VA 3CMAQ 4BD3A 3VS4A 3CCET 3EGXB 2KEAA 2KRMA 3A8HB 3QJ6A 4J6YA 2PNIA 1YJWQ 2KNBB 2DK3A 4J83A 5CR2A 3V8KA 2EW3A 3EGDB 3CC4T 2HKNA 2VVKA 1JU5C 1HJDA 2NUZA 1VOMA 3BY7A 4FYXB 2QA4A 2AZSA 2K3BA 1FWZA 3HHTB 3WXMB 1AWWA 4ZGDB 2LMJA 1KQSP 4C8QA 1HD3A 4M77B 2JW4A 2P0PA 4L59A 1V1CA 2MI6A 2GTJA 5KYUB 2FB7A 2MAMA 1WXBA 4EMKA 2OAWA 1YJNA 2LZ6B 4LDVA 2KYBA 2KSSA 2OI3A 3OYCA 1JXMA 3EG3A 2MWOA 3QXEB 2DEUA 5CKEA 4HA8A 4ELZC 2QEXQ 1O9SA 1KK7A 1WZOA 1T3SA 1N8RU 5EG2A 5HK3A 1M8VA 4XU2A 3EG9B 5GAN2 3VRYA 1YI2T 1I81A 6AT1B 2KE9A 2QTXA 4O6JA 3IQLA 3MHXA 1C1AA 4JJDA 2JUFA 2C0IA 2YSQA 2X4YA 4QW2A 2E4HA 2O4XA 2EGEA 3RBBB 1U3OA 3RNJA 2DXUA 2X3WD 1FMVA 3EH2A 1UGQB 4OMPA 1IGQA 3SFMA 3H9NA 3JV3A 4E7IA 1GBRA 3VS5A 3TVTA 2CH4W 3OYEA 4M7AA 1EZZB 3VS6A 4AFSC 2RNAA 2RO0A 3RMQA 1WIEA 1ZQ1A 2E41A 3A8GB 3DB3A 4RMOA 1VQKT 2RI3A 1RI0A 4RUGA 4M7AC 3GNGA 4E6RA 1QVGP 3KFVA 1WXTA 2WSCE 2HQEA 3HFOA 1IHWA 2PTKA 4BI3A 2HKQB 2IG0A 1Q86U 3CCQA 2H8HA 2XHCA 4JDSA 3TU4K 2OTJA 2D1XA 4EMKC 4VUBA 5LJ5h 2XK0A 2B86A 2PU9B 1G8XA 1XOVA 4DEXA 2XU8A 3CCRT 4HCCA 1K8AC 2YUNA 2F2WA 5LJ3h 2DL3A 1YJNQ 1Q82U 1CKBA 4JZ3A 1M1GA 4GBQA 2M51A 2M02A 2MF2A 2J7IA 1M30A 2MCNA 4RTVA 2A3LA 1K0SA 1VIEA 3FLGA 2ZPBB 1LOJA 2JVVA 1KHCA 1YITT 5J39A 3CCVQ 3QBYA 3QZ9B 2O01E 2OX7A 3CC2A 4M77C 3UDCA 2EGAA 3VS3A 2ATCB 2HL3A 4O5VA 2DVEA 2M0YA 2AK5A 2DKGA 5GAMd 4QQ6A 3X26B 2HSPA 2ZAEA 4II1A 3O5ZA 1S72Q 4DOVA 2L3QA 2Y4XA 3I5SA 2VXEA 3META 3BE3A 1SEMA 2CP0A 3SD4A 4BY6C 4PFZA 3EGUA 1MNDA 2RHXA 4C92B 1X6BA 1C0MA 1ARKA 1W1FA 4M7DD 2DL8A 3MEUA 2HAXA 1EIFA 1JRIA 1QVFP 2LQNA 3CC7Q 1BYMA 1BI2A 4BACA 4LN2A 4B9XA 5GAMf 5GAOn 4C0DB 3A5ZB 3CPWA 5LJ5j 1M9SA 2L2PA 2FEIA 4KULA 1ZSZC 1Q7YC 3V7SA 1J3TA 4M77F 1QLYA 1W2BP 1ZA1B 2R57A 5KYNA 1KQSA 1SHFA 3I56A 1EFNA 1MMGA 2CSQA 1KHIA 4C0GA 2F69A 4M75E 2JMAA 1NZ9A 4M78A 1QVPA 5KYYB 3CCMA 3QWXX 1ZUKA 1AT1B 1QP3A 2K9GA 1A0NB 1NYFA 1GCQA 1N6AA 3QWYA 1WQWA 3VYHB 4QVZA 2HZYA 4IKFA 3HTRA 1RACB 2LT1A 5GMKi 2RM4A 2YWWA 3OW2A 2CP2A 1M2OA 1T3LA 1WJRA 1WDXA 3LGLA 1UGRB 1IZ6A 3BW1A 4OB3B 1VQ4A 4PJJA 2DRKA 2RB6A 2W10A 3H0IA 4OMFB 1R0BG 3OS1A 2ABLA 5FROA 2JS0A 2CT3A 2DF6A 1FYNA 1YHQQ 1WI7A 1WHHA 1B34A 3A8MB 3OYBA 1G83A 5LJ5g 3FEOA 2CS7A 3P8BB 1PG5B 1JB0E 5FU7C 1T0HA 3CMEQ 4AFZC 2E3IA 3C95A 2DL7A 2JTFA 1IREB 1PCXA 3RMSA 2DMOA 4LUEA 4B6MA 3RR6A 3VKIA 1VQ4T 3RUXA 2CYZB 3PTAA 2PUOB 2X4XA 1WHMA 1JJ2P 2E64A 4C8QD 3NTHA 3I35A 4M7AB 5KCHA 4CC4B 3QDFA 2LCCA 3G71Q 4BDYA 2KAFA 2J6FA 3FIFA 1SF9A 3QUIA 1OQKA 1VQPT 3JCMb 1G3WA 1UECA 2XD0A 3OYMA 3HRUA 1K73C 2AT1B 5DM7R 3JB9G 2BZ8A 4FU6A 2FPEA 1OZ3A 1VQNQ 2CDTA 2KXCA 4XQ3A 1YNZA 1VQ5A 3TSWA 2K79A 3M57A 3OMGA 3J7AF 2ZZDA 2YLBA 1QWEA 1AWOA 2RHYA 1PSEA 2CZ7B 2R5AA 1TWBA 4OMMA 2O31A 1YHQA 4J9GA 4ANJA 2YLCA 3LX7A 2MWPA 1VQ7A 2V8JA 3OBYA 4KBMB 4C92D 1WYXA 4V2SA 2Y4YA 2FPFA 3OS2A 3MCAB 3EHQA 4PJOE 2D0NA 2NYSA 5L8RE 1N9RA 4A4EA 2RQTA 1KC8R 4QVDA 1ABOA 8AT1B 2LJ1A 5GAN4 4IIMA 3EH1A 3GPLA 4JLGA 1I4K1 2RQRA 4M77A 3CCJT 2F5TX 4HVUA 2EQUA 2LTOA 1OEBA 2F2VA 1ZBJA 3WVDB 4PJOB 4BI8B 1W2BA 1IB8A 1F1BB 2GQIA 4AFQC 2RHUA 3JSCA 4LD9K 1UGVA 1UEBA 4KH1B 3CMAT 4OB1B 5FU6C 4M7AF 1B07A 2Z0WA 3M4GA 1YCSB 5GAOq 4RTZA 3WVEB 1JBMA 2BTTA 3E2UA 3OW2S 2KVQG 3UF4A 1TU0B 4BY6B 4M7DF 2KBTA 1GCPA 1XJWB 4RKUE 1YIJQ 1D0XA 1E6GA 1Q82R 1ZX6A 5FLXE 3LH5A 1I0CA 5HK0A 2YT6A 3OQ5A 2L89A 5FWBA 4M77E 3CCUQ 3JCMd 5FRNA 2COYA 3CCQQ 1U06A 4M7AG 2J6KA 2DIGA 2P4RA 3REBB 4J9IA 5IT9E 1VQMQ 2LQKA 1VQ8A 1M90C 3QZ5B 3JCMg 2BE9B 4HT8A 2MYSA 1MGQA 2HD0A 4IUPA 4QT7A 2XICA 4J9DA 3CCUT 3MPUB 5IHIA 2L5QA 1SRMA 1SG5A 1TH7A 5A0LA 5CQYA 4R0KA 4OGEA 1X2KA 2XDPA 1K8AU 3I55A 2JS2A 4MDWA 4X9CA 4E7JA 5M9OA 2Y90A 4F7UB 5CKBA 2HSEB 4F16A 1Y96A 1W6XA 2ED0A 4N4HA 2I2LA 1BKBA 3CXCS 1AEYA 3EAEA 3PMTA 3QIIA 4LDYA 2J6OA 3JB9D 3ZL7C 3LH0A 3L2QA 1YBYA 3EFOA 4JRQA 4DBFA 2FO0A 3OY9A 4JS4A 2DFUA
chains in the Genus database with same CATH topology
1GCQC 2VKNA 4E6RA 3KFVA 1WXTA 4AG1C 2DBMA 3A98A 3NGPA 2CH4A 1S1NA 2PTKA 2K2MA 1GFCA 2H8HA 2EYXA 1Z9ZA 2JTEA 2YUOA 1VYUA 4OMOA 2RMOA 1M27C 4JPBW 2D1XA 2EQIA 1MV0B 2G6FX 1X6GA 2FRYA 2B86A 2EYYA 2NWMA 2DL4A 1XOVA 2YDLA 1LCKA 4DEXA 1WLPB 2K7AA 2RQVA 1GFDA 2YUNA 2F2WA 1QWFA 2DL3A 1OOTA 3EG0A 4HCKA 1CKBA 4JZ3A 4GBQA 2M51A 2JMCA 2LP5A 4OMLA 4ZNXA 1GBQA 2GNCA 2CUBA 2J7IA 1M30A 2MCNA 4J9EA 4RTVA 4WCIA 1K0SA 2MIOA 2AKLA 3REAB 3VS7A 1CKAA 3THKA 4CC3A 1BBZA 5I11A 4AFUC 3U23A 4Z8AA 3NPFA 1PRLC 2F2XA 1PRMC 1GRIA 1IO6A 1T0JA 2EGAA 1K0XA 3VS3A 4Z88A 1RLPC 3PE0A 2SRCA 2O9VA 2M0YA 2AK5A 2A36A 2K6DA 2HSPA 2JM9A 2RQWA 2A37A 2J05A 3EHRA 3VS1A 3O5ZA 2DILA 1X43A 1PNJA 1M8MA 2L3QA 1NYGA 3I5SA 1E6HA 2EPDA 3H0FA 4LNPA 1SEMA 2EBPA 2MOXA 1CSKA 3EG2A 3SEMA 1UG1A 1H3HA 3EGUA 2L0AA 2ROLA 2KR3A 1QCFA 1X6BA 1ARKA 1W1FA 2I0NA 2HCKA 1UJYA 4GLMA 2DL8A 2DRMA 1KSWA 2LQNA 1UJ0A 4LN2A 2CUDA 3C0CA 2EKHA 1SRLA 1KJWA 5FWCA 1U5SA 2L2PA 1BK2A 2FEIA 2HEQA 2CT4A 1AWXA 1J3TA 3I9QA 1YP5A 1QLYA 4OMQA 2O2OA 4J9HA 1SHFA 1EFNA 4X1VA 1K1ZA 1SSHA 3H41A 2EYZA 2CSQA 4DEYA 1WA7A 1K9AA 2KYMA 2YUPA 2DLPA 2JMAA 4D8DA 1BB9A 5GJWB 2ED1A 2DYBA 3QWXX 4KRTA 1ZUKA 4Y92A 2EVRA 1TUCA 2K9GA 1A0NB 1NYFA 1GCQA 1MV3A 3PVLA 5GJVB 3QWYA 1OV3A 2DX1A 4K11A 2LJ0A 5IXBA 4OMNA 1NLOC 1T3LA 2W0ZA 2QDLA 1WDXA 4RTWA 3NMZC 1NM7A 1TG0A 2DRKA 2KRSA 5HCKA 2W10A 3H0IA 1UHCA 1ZUUA 3VS2A 2ABLA 1WX6A 2LNHB 3M0TA 1X27A 1ZSGA 5IHNA 2A08A 2ROTA 2JS0A 1BU1A 1UTIA 2CT3A 2DF6A 1FYNA 4F17A 2XMFA 1WI7A 4JJCA 2FPDA 1PWTA 2ESWA 4RTTA 1G83A 3M0PA 1G2BA 2HDAA 1FMKA 1W70A 1T0HA 4AFZC 2DE0X 2DL7A 2V1RA 1JEGA 3I5RA 2ENMA 2C0OA 2DL5A 2RF0A 2DMOA 1PHTA 3EG1A 4LUEA 4CC2A 1I1JA 2DBKA 2CSIA 4M4ZA 2BZXA 1OPLA 1AVZC 2KGTA 3UA6A 3M0UA 5I22A 4AG2C 5ECAA 1NG2A 3I35A 1H92A 3TSZA 2KXDA 4CC4B 4J9CA 2A28A 2EYWA 2DJQA 2SEMA 1UHFA 1K4US 2V1QA 1WFWA 2LQWA 1UE9A 1YWPA 5IH2A 2GTOA 2L3PA 2J6FA 2RPNA 2KT8A 2IIMA 1UECA 4A63B 3M0QA 2C0TA 2LCSA 1SHGA 1RLQC 3H0HA 2BZ8A 2FPEA 2D8JA 2CDTA 2JT4A 2KXCA 2RQUA 4EIKA 1YNZA 3TSWA 2K79A 1AD5A 4RTUA 1QWEA 4F14A 5IXFA 1AWOA 2L3SA 3CQTA 4Z89A 1RI9A 2VWFA 4OMMA 1H8KA 2O31A 2DVJA 4J9GA 2FG0A 1M3AA 2JXBA 1I07A 3UATA 1WYXA 4IIOA 1KIKA 1X69A 1Y57A 1UDLA 2CREA 2FPFA 1KFZA 2E5KA 2DM1A 3PVQA 1VYTA 2GBQA 3EHQA 2D0NA 2RQTA 1JQQA 3NHNA 2KROA 1ABOA 3M0SA 2LJ1A 2AKKA 4IIMA 4RTYA 1YWOA 4HXJA 2O9SA 2KRNA 2PZ1A 2LX7A 2BZYA 2RQRA 1NEGA 4HVUA 1PKTA 2D8HA 1ZLMA 2O88A 5IHKA 3VS4A 1SPKA 1OEBA 2F2VA 1ZBJA 2HBWA 2KEAA 3M0RA 2GGRA 4D8KA 2KRMA 1E7OA 1K76A 2X3XD 2DNUA 2ECZA 2GQIA 4AFQC 2PNIA 4J9FA 2KNBB 4FSSA 1PKSA 2RN8A 1UGVA 2FRWA 1QKXA 1VA7A 2EW3A 1B07A 2VVKA 4LUDA 1YCSB 1JU5C 1HJDA 2NUZA 1OPKA 4RTZA 2BTTA 2AZSA 2K3BA 4JZ4A 3UF4A 1B3QA 3GBQA 3FJ5A 1AWWA 2KBTA 1GCPA 2LMJA 1AOJA 1E6GA 1HD3A 2LJ3A 2JW4A 1ZX6A 1V1CA 3LH5A 2GTJA 2KT1A 1I0CA 2YT6A 2JM8A 3SHWA 4CC7A 5FWBA 1ZUYA 4J9BA 1WXBA 4LE9A 4ESRA 2OAWA 2LZ6B 5L23A 1U06A 2J6KA 2KYBA 2OI3A 2P4RA 3REBB 1Y0MA 4J9IA 2EGCA 1JXMA 3EG3A 1AWJA 4HVWA 1RUWA 4RTXA 4QT7A 3R6NA 4J9DA 5FW9A 1T3SA 3ULRB 5IHIA 2DA9A 1ABQA 1JO8A 1SRMA 2YUQA 1VYVA 4ORZA 3VRYA 1TUDA 4R0KA 1M3BA 1WXUA 3UA7A 3VS0A 2KE9A 1X2KA 1JXOA 5EC7A 3IQLA 1M3CA 4JJDA 2JS2A 2C0IA 2YSQA 1YN8A 1N5ZA 2J06A 2EGEA 3RBBB 1QKWA 1U3OA 1UUEA 3RNJA 4F16A 2X3WD 3VRZA 1W6XA 4OMPA 1AZGB 2ED0A 4JJBA 3JV3A 1AZEA 1X2QA 1NEBA 1GBRA 3VS5A 1NLPC 3TVTA 2CH4W 1AEYA 2AZVA 3VS6A 1Z9QA 4AFSC 1GL5A 2RNAA 2J6OA 1MUZA 1WIEA 2OJ2A 4HVVA 3ZL7C 1HSQA 1UFFA 2FO0A 4RUGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GCQ C;  2VKN A;  4E6R A;  3KFV A;  1WXT A;  4AG1 C;  2DBM A;  3A98 A;  3NGP A;  2CH4 A;  1S1N A;  2PTK A;  2K2M A;  1GFC A;  2H8H A;  2EYX A;  1Z9Z A;  2JTE A;  2YUO A;  1VYU A;  4OMO A;  2RMO A;  1M27 C;  4JPB W;  2D1X A;  2EQI A;  1MV0 B;  2G6F X;  1X6G A;  2FRY A;  2B86 A;  2EYY A;  2NWM A;  2DL4 A;  1XOV A;  2YDL A;  1LCK A;  4DEX A;  1WLP B;  2K7A A;  2RQV A;  1GFD A;  2YUN A;  2F2W A;  1QWF A;  2DL3 A;  1OOT A;  3EG0 A;  4HCK A;  1CKB A;  4JZ3 A;  4GBQ A;  2M51 A;  2JMC A;  2LP5 A;  4OML A;  4ZNX A;  1GBQ A;  2GNC A;  2CUB A;  2J7I A;  1M30 A;  2MCN A;  4J9E A;  4RTV A;  4WCI A;  1K0S A;  2MIO A;  2AKL A;  3REA B;  3VS7 A;  1CKA A;  3THK A;  4CC3 A;  1BBZ A;  5I11 A;  4AFU C;  3U23 A;  4Z8A A;  3NPF A;  1PRL C;  2F2X A;  1PRM C;  1GRI A;  1IO6 A;  1T0J A;  2EGA A;  1K0X A;  3VS3 A;  4Z88 A;  1RLP C;  3PE0 A;  2SRC A;  2O9V A;  2M0Y A;  2AK5 A;  2A36 A;  2K6D A;  2HSP A;  2JM9 A;  2RQW A;  2A37 A;  2J05 A;  3EHR A;  3VS1 A;  3O5Z A;  2DIL A;  1X43 A;  1PNJ A;  1M8M A;  2L3Q A;  1NYG A;  3I5S A;  1E6H A;  2EPD A;  3H0F A;  4LNP A;  1SEM A;  2EBP A;  2MOX A;  1CSK A;  3EG2 A;  3SEM A;  1UG1 A;  1H3H A;  3EGU A;  2L0A A;  2ROL A;  2KR3 A;  1QCF A;  1X6B A;  1ARK A;  1W1F A;  2I0N A;  2HCK A;  1UJY A;  4GLM A;  2DL8 A;  2DRM A;  1KSW A;  2LQN A;  1UJ0 A;  4LN2 A;  2CUD A;  3C0C A;  2EKH A;  1SRL A;  1KJW A;  5FWC A;  1U5S A;  2L2P A;  1BK2 A;  2FEI A;  2HEQ A;  2CT4 A;  1AWX A;  1J3T A;  3I9Q A;  1YP5 A;  1QLY A;  4OMQ A;  2O2O A;  4J9H A;  1SHF A;  1EFN A;  4X1V A;  1K1Z A;  1SSH A;  3H41 A;  2EYZ A;  2CSQ A;  4DEY A;  1WA7 A;  1K9A A;  2KYM A;  2YUP A;  2DLP A;  2JMA A;  4D8D A;  1BB9 A;  5GJW B;  2ED1 A;  2DYB A;  3QWX X;  4KRT A;  1ZUK A;  4Y92 A;  2EVR A;  1TUC A;  2K9G A;  1A0N B;  1NYF A;  1GCQ A;  1MV3 A;  3PVL A;  5GJV B;  3QWY A;  1OV3 A;  2DX1 A;  4K11 A;  2LJ0 A;  5IXB A;  4OMN A;  1NLO C;  1T3L A;  2W0Z A;  2QDL A;  1WDX A;  4RTW A;  3NMZ C;  1NM7 A;  1TG0 A;  2DRK A;  2KRS A;  5HCK A;  2W10 A;  3H0I A;  1UHC A;  1ZUU A;  3VS2 A;  2ABL A;  1WX6 A;  2LNH B;  3M0T A;  1X27 A;  1ZSG A;  5IHN A;  2A08 A;  2ROT A;  2JS0 A;  1BU1 A;  1UTI A;  2CT3 A;  2DF6 A;  1FYN A;  4F17 A;  2XMF A;  1WI7 A;  4JJC A;  2FPD A;  1PWT A;  2ESW A;  4RTT A;  1G83 A;  3M0P A;  1G2B A;  2HDA A;  1FMK A;  1W70 A;  1T0H A;  4AFZ C;  2DE0 X;  2DL7 A;  2V1R A;  1JEG A;  3I5R A;  2ENM A;  2C0O A;  2DL5 A;  2RF0 A;  2DMO A;  1PHT A;  3EG1 A;  4LUE A;  4CC2 A;  1I1J A;  2DBK A;  2CSI A;  4M4Z A;  2BZX A;  1OPL A;  1AVZ C;  2KGT A;  3UA6 A;  3M0U A;  5I22 A;  4AG2 C;  5ECA A;  1NG2 A;  3I35 A;  1H92 A;  3TSZ A;  2KXD A;  4CC4 B;  4J9C A;  2A28 A;  2EYW A;  2DJQ A;  2SEM A;  1UHF A;  1K4U S;  2V1Q A;  1WFW A;  2LQW A;  1UE9 A;  1YWP A;  5IH2 A;  2GTO A;  2L3P A;  2J6F A;  2RPN A;  2KT8 A;  2IIM A;  1UEC A;  4A63 B;  3M0Q A;  2C0T A;  2LCS A;  1SHG A;  1RLQ C;  3H0H A;  2BZ8 A;  2FPE A;  2D8J A;  2CDT A;  2JT4 A;  2KXC A;  2RQU A;  4EIK A;  1YNZ A;  3TSW A;  2K79 A;  1AD5 A;  4RTU A;  1QWE A;  4F14 A;  5IXF A;  1AWO A;  2L3S A;  3CQT A;  4Z89 A;  1RI9 A;  2VWF A;  4OMM A;  1H8K A;  2O31 A;  2DVJ A;  4J9G A;  2FG0 A;  1M3A A;  2JXB A;  1I07 A;  3UAT A;  1WYX A;  4IIO A;  1KIK A;  1X69 A;  1Y57 A;  1UDL A;  2CRE A;  2FPF A;  1KFZ A;  2E5K A;  2DM1 A;  3PVQ A;  1VYT A;  2GBQ A;  3EHQ A;  2D0N A;  2RQT A;  1JQQ A;  3NHN A;  2KRO A;  1ABO A;  3M0S A;  2LJ1 A;  2AKK A;  4IIM A;  4RTY A;  1YWO A;  4HXJ A;  2O9S A;  2KRN A;  2PZ1 A;  2LX7 A;  2BZY A;  2RQR A;  1NEG A;  4HVU A;  1PKT A;  2D8H A;  1ZLM A;  2O88 A;  5IHK A;  3VS4 A;  1SPK A;  1OEB A;  2F2V A;  1ZBJ A;  2HBW A;  2KEA A;  3M0R A;  2GGR A;  4D8K A;  2KRM A;  1E7O A;  1K76 A;  2X3X D;  2DNU A;  2ECZ A;  2GQI A;  4AFQ C;  2PNI A;  4J9F A;  2KNB B;  4FSS A;  1PKS A;  2RN8 A;  1UGV A;  2FRW A;  1QKX A;  1VA7 A;  2EW3 A;  1B07 A;  2VVK A;  4LUD A;  1YCS B;  1JU5 C;  1HJD A;  2NUZ A;  1OPK A;  4RTZ A;  2BTT A;  2AZS A;  2K3B A;  4JZ4 A;  3UF4 A;  1B3Q A;  3GBQ A;  3FJ5 A;  1AWW A;  2KBT A;  1GCP A;  2LMJ A;  1AOJ A;  1E6G A;  1HD3 A;  2LJ3 A;  2JW4 A;  1ZX6 A;  1V1C A;  3LH5 A;  2GTJ A;  2KT1 A;  1I0C A;  2YT6 A;  2JM8 A;  3SHW A;  4CC7 A;  5FWB A;  1ZUY A;  4J9B A;  1WXB A;  4LE9 A;  4ESR A;  2OAW A;  2LZ6 B;  5L23 A;  1U06 A;  2J6K A;  2KYB A;  2OI3 A;  2P4R A;  3REB B;  1Y0M A;  4J9I A;  2EGC A;  1JXM A;  3EG3 A;  1AWJ A;  4HVW A;  1RUW A;  4RTX A;  4QT7 A;  3R6N A;  4J9D A;  5FW9 A;  1T3S A;  3ULR B;  5IHI A;  2DA9 A;  1ABQ A;  1JO8 A;  1SRM A;  2YUQ A;  1VYV A;  4ORZ A;  3VRY A;  1TUD A;  4R0K A;  1M3B A;  1WXU A;  3UA7 A;  3VS0 A;  2KE9 A;  1X2K A;  1JXO A;  5EC7 A;  3IQL A;  1M3C A;  4JJD A;  2JS2 A;  2C0I A;  2YSQ A;  1YN8 A;  1N5Z A;  2J06 A;  2EGE A;  3RBB B;  1QKW A;  1U3O A;  1UUE A;  3RNJ A;  4F16 A;  2X3W D;  3VRZ A;  1W6X A;  4OMP A;  1AZG B;  2ED0 A;  4JJB A;  3JV3 A;  1AZE A;  1X2Q A;  1NEB A;  1GBR A;  3VS5 A;  1NLP C;  3TVT A;  2CH4 W;  1AEY A;  2AZV A;  3VS6 A;  1Z9Q A;  4AFS C;  1GL5 A;  2RNA A;  2J6O A;  1MUZ A;  1WIE A;  2OJ2 A;  4HVV A;  3ZL7 C;  1HSQ A;  1UFF A;  2FO0 A;  4RUG A; 
#chains in the Genus database with same CATH topology
 1GCQ C;  2VKN A;  1Q86 R;  2RD1 A;  5GAO l;  1D0Y A;  1R77 A;  2AIR B;  1Q86 C;  2JTM A;  2DBM A;  2GFA A;  1S1N A;  2CP3 A;  2P0K A;  4BI4 A;  1UGP B;  1Q7Y U;  2K2V A;  1M90 R;  1Z9Z A;  2JTE A;  5CCA A;  3CCL A;  1VQL A;  1VYU A;  4PJL A;  2EQI A;  2G6F X;  1X6G A;  3A8L B;  2FRY A;  1VQ9 A;  1ZSZ A;  2EYY A;  1LCK A;  1B7T A;  3MKD A;  3M55 A;  2K7A A;  2RQV A;  3OYY A;  3G4S Q;  4XTX A;  1Q82 C;  3GOX A;  1GFD A;  3EGD A;  2YRV A;  2PVD B;  1RL2 A;  5GAN d;  2HQX A;  1YI2 Q;  4FSX A;  2V26 A;  2JMC A;  2DXC A;  2LP5 A;  4OML A;  4M78 C;  2QQR A;  4ZGJ B;  2GNC A;  2CUB A;  3HP9 A;  4WCI A;  2MIO A;  4Q5W A;  4J7I A;  3PNW C;  3VS7 A;  3CCL Q;  1W4S A;  3UT1 A;  1RAD B;  3THK A;  4CC3 A;  2QAZ A;  1PM3 A;  3RKY A;  5I11 A;  3I55 T;  3U23 A;  5HKC A;  2L3R A;  3NPF A;  1PRL C;  3OSV A;  5LJ5 f;  3L2U A;  4LXC A;  4YTL A;  1WGS A;  1T0J A;  1RLP C;  5GAN g;  2FZK B;  1KD1 R;  1XTD A;  1M5Q 1;  5LJ3 e;  2DTH A;  5LJ3 j;  1AHJ B;  2K5F A;  2LCL A;  4EDU A;  1X43 A;  4DBQ A;  2MK5 A;  3CCR A;  4MML A;  1NYG A;  3X24 B;  4MZM A;  1E6H A;  2QI2 A;  2EQM A;  3H0F A;  1VQ9 Q;  2YRC A;  2RJE A;  3G7Z A;  4IUV A;  2OTL T;  1MMA A;  2EBP A;  4F7U A;  1VQ9 T;  1VQK Q;  1M1F A;  1BIB A;  1BI3 A;  4M7A E;  3CBP A;  1H3H A;  1TTH B;  2L0A A;  2IVW A;  4M77 G;  2P84 A;  2I0N A;  4AMC A;  2HCK A;  4FCY A;  1UJY A;  4GLM A;  3QYH B;  4TVR A;  2DRM A;  2LVM A;  4M7D E;  1ZBX A;  1QCN A;  1KJW A;  2RH2 A;  5FWC A;  4FIB A;  1U5S A;  1BK2 A;  2CT4 A;  1K1Z A;  2EIF A;  2EYZ A;  3X25 B;  1WJQ A;  2KYM A;  4B9W A;  1ZHI A;  4PK4 A;  3G4S A;  3SWN A;  1I5O B;  5GAM e;  4D8D A;  1BB9 A;  5GJW B;  4FL6 A;  2ED1 A;  1BI0 A;  1QQJ A;  2X9H A;  8ATC B;  3PGG A;  1RAE B;  1WNL A;  1UGS B;  4C92 A;  3ME9 A;  2ZPE B;  3OYI A;  1U8R A;  2JNG A;  2AHJ B;  4K11 A;  5GAN 6;  1KC8 C;  2DXT A;  2YRD A;  4OMN A;  1VQ6 Q;  3DLM A;  1NLO C;  2FZC B;  4RTW A;  1TS9 A;  4XTW A;  3NMZ C;  1NM7 A;  4C92 G;  3G4S T;  1TG0 A;  5HCK A;  3VS2 A;  2HBP A;  2H3E B;  4JS5 A;  1YIT Q;  1UTI A;  1QCO A;  1QVF A;  4DA4 A;  5CQX A;  5A0D A;  4OGC A;  4F7U F;  3CC7 A;  4P5N A;  1FMK A;  1N27 A;  1W70 A;  3P8D A;  4NS5 A;  1JEG A;  2RF0 A;  2C0O A;  2DTI A;  3EG1 A;  2OTJ T;  2DBK A;  1RAG B;  4M4Z A;  1OPL A;  1IRX A;  1AVZ C;  2FZG B;  3JCM X;  3A1P A;  5I22 A;  4XTU A;  1MHN A;  2XDD A;  2DXB A;  5ECA A;  2COZ A;  1YFN A;  2CKK A;  3BDU A;  4KGV B;  4ZTJ A;  4FYW B;  5KYX B;  2EYW A;  2SEM A;  1UHF A;  4PJN A;  4OB0 B;  1K8A R;  1WFW A;  1UE9 A;  1YWP A;  2GTO A;  2RPN A;  1YJW A;  1K9M C;  4X9D A;  5I21 A;  5C0M A;  1D1A A;  5KYW B;  1VQ8 T;  4JRP A;  1D1B A;  4PFO A;  4BE1 A;  3QO3 A;  4E7S A;  2QDY B;  2D8J A;  3PIP A;  4EIK A;  4L6V 5;  2R58 A;  3MP8 A;  1NJI R;  3VV0 A;  3M56 A;  4R56 A;  2L3S A;  4Z89 A;  3VU3 C;  5GAN 8;  5KE3 A;  2DPP B;  2D0Q B;  2XID A;  5CK9 A;  4EPC A;  1M3A A;  1I07 A;  3UAT A;  2QQA A;  1D3B A;  1X69 A;  1UDL A;  2WSE E;  3M58 A;  3PVQ A;  1M1K R;  1VYT A;  3V7R A;  1VQM A;  2GBQ A;  5GAN 5;  3CCQ T;  2VGM A;  2JN0 A;  3R6O A;  3URG A;  1M90 U;  3JCM h;  2KRO A;  4C5H A;  3AT1 B;  1RAB B;  2CZ6 B;  5CKH A;  5GMK e;  2R5M A;  2DEQ A;  2D8H A;  1ZLM A;  2LC4 A;  2O88 A;  4ELY C;  2XDB A;  4LD6 A;  2O4X B;  3NFC A;  3M54 A;  3M0R A;  4A4F A;  1E7O A;  1K76 A;  2RI2 A;  3V8J A;  1B34 B;  4XU3 A;  3BDL A;  4FYY B;  4UC4 A;  4FSS A;  4DBH A;  3G71 A;  4M75 G;  3Q1J A;  4LUD A;  2VGN A;  1DJ7 B;  3MP1 A;  1OPK A;  3CPW P;  2X4J A;  3JCM Q;  1U1T A;  4JZ4 A;  3OYD A;  5CKD A;  3GBQ A;  3FJ5 A;  3LLR A;  2P4T A;  1AOJ A;  2LJ3 A;  1VQO T;  5CO7 A;  2QGG A;  3L2R A;  2DO3 A;  2X4W A;  2JM8 A;  2B8A A;  4N0A A;  4EMK B;  2EQK A;  2ZPI B;  4C92 E;  5L23 A;  2PUK B;  3HPW A;  4N4G A;  1VQ7 Q;  3A8O B;  4HVW A;  1WHG A;  1RUW A;  3VUB A;  1NJI U;  3X28 B;  2L8D A;  3R6N A;  1Y7X A;  4PJO F;  4XK8 E;  3ULR B;  2DA9 A;  2PVO B;  3FC3 A;  2YUQ A;  2QA4 Q;  4E47 A;  2KI7 A;  1VYV A;  3CMA A;  1TUD A;  3UA7 A;  3VS0 A;  1K9M R;  3CD6 T;  4D6W A;  5IAY A;  1TOV A;  5GAM h;  3JCM P;  4DOW A;  1OX9 A;  3J81 E;  4A54 A;  1N5Z A;  4XAX B;  2GCX A;  2J06 A;  3HFN A;  1S72 T;  1QKW A;  3JRZ A;  1UUE A;  3E9F A;  5GAO p;  3JCM W;  1MMN A;  3VRZ A;  3G71 T;  1WJS A;  4M7D G;  1AZE A;  3S3M A;  3OMC A;  2QGF B;  3VYG A;  2AZV A;  4E7Z A;  1Z9Q A;  1GL5 A;  1D0Z A;  2E6N A;  4HKE A;  3HRT A;  1QP2 A;  3ZEH A;  3BFM A;  4BE2 A;  2CP7 A;  2M16 A;  4LDU A;  2DYI A;  2D6F A;  2DTO A;  3CCV T;  4M7D A;  3QKJ A;  2BKD N;  1R0C B;  3A98 A;  3NGP A;  2LRQ A;  3MEW A;  1G3S A;  2CH4 A;  3OYG A;  2VYT A;  3CC2 T;  2K2M A;  4XU0 A;  1GFC A;  4BUG A;  2YUO A;  5CKF A;  4OMO A;  4JPB W;  1XQH A;  3CCJ Q;  1MV0 B;  4KUD K;  2V8I A;  5C6S A;  4E7L A;  1YIJ T;  1W2B S;  2DJZ A;  3JCM V;  1C6V X;  2YDL A;  1HYO A;  2K4Y A;  3JB9 I;  4RCC A;  2RJF A;  3QJY A;  4C0D C;  3LW5 E;  4PNO A;  1VQP A;  2ZCF B;  4KGZ B;  4OB2 B;  2NUT A;  1ZSZ B;  3CBO A;  1QWF A;  3EG0 A;  4HCK A;  4XTY A;  3OYJ A;  2PQW A;  3E19 A;  2K3X A;  1PD0 A;  4ME7 A;  4ZNX A;  3HKS A;  1OYX A;  4J9E A;  4KUI A;  3REA B;  4IUT A;  4M75 C;  2EFI A;  1BBZ A;  3JB9 J;  5GMK j;  5KYX A;  4AFU C;  4ZTF A;  3EFO B;  1YIT A;  4Z8A A;  1ACM B;  2F2X A;  5CAI A;  2MMP A;  1GRI A;  3H6Z A;  3CD6 Q;  4C5G A;  1IO6 A;  4Z88 A;  2A0F B;  9ATC B;  3PE0 A;  1KG1 A;  5AYF A;  5D6W A;  3C4S A;  2A36 A;  2JM9 A;  2A37 A;  2J05 A;  3EHR A;  3FB9 A;  3QG1 A;  1KD1 U;  1PSF A;  3M9Q A;  2DIL A;  1PNJ A;  4FYV B;  1Q81 C;  3OS0 A;  1Q81 R;  2EPD A;  5GMK m;  3OYN A;  2QAS A;  4M7A D;  5CIU A;  5FU7 B;  3EFR A;  2MOX A;  1VQN T;  1JJ2 S;  1LPL A;  3L42 A;  3HSB A;  4GY5 A;  1CSK A;  5DLO A;  4PJO C;  3EG2 A;  1X6O A;  3SEM A;  1KQ2 A;  1RAH B;  2JZ2 A;  3VJP A;  4BE0 A;  3JCM J;  1WQ7 A;  3CPW S;  2K5I A;  1RAA B;  1KSW A;  4N4I A;  2H3J A;  2RK2 A;  2EWN A;  4J5Y A;  1WHL A;  1UJ0 A;  3FDR A;  2CUD A;  2EKH A;  1SRL A;  1V29 B;  3I9Q A;  1YP5 A;  3L2V A;  4OMQ A;  4M75 A;  2O2O A;  4J9H A;  3C94 A;  1H64 1;  4X1V A;  1SSH A;  4DBR A;  3H41 A;  1WA7 A;  1K9A A;  2YUP A;  4Z02 A;  1QVG A;  4Y91 A;  2DYB A;  3M59 A;  1TUC A;  3CME T;  4XU1 A;  2CZ0 B;  5LJ3 f;  4A4K A;  3PVL A;  4XTV A;  5KH6 A;  2EJF A;  2DX1 A;  4C8Q B;  4ZGE B;  2LJ0 A;  4MDX A;  3QDR B;  5IXB A;  2OTL Q;  2NUT B;  3G6E A;  2JJ9 A;  4M77 D;  4Y28 E;  4CI0 C;  1X01 A;  4PL6 A;  1ZUU A;  3CCE Q;  1WPY A;  5GAM j;  3I56 T;  1X27 A;  1ZSG A;  5IHN A;  2A08 A;  3CC2 Q;  2ROT A;  1BU1 A;  4XTZ A;  3OB9 A;  3RIR A;  3CC7 T;  4M78 E;  3NTK A;  2FPD A;  1PWT A;  4F7U E;  1TXQ A;  5DY9 A;  2HDA A;  3EGX A;  4C8Q G;  1VQL Q;  1P92 A;  1M2V B;  4C5I A;  2V1R A;  1S72 A;  3NTI A;  3I5R A;  2DL5 A;  1PHT A;  2QQB A;  4CC2 A;  3OSS C;  1I1J A;  2RJD A;  1M4Z A;  1VQ7 T;  5GAN 7;  2BZX A;  3LWH A;  3GLX A;  4PLL A;  4JRI A;  4L5G A;  4WF2 A;  1M1K C;  3M0U A;  4AG2 C;  4A4G A;  1NG2 A;  3TSZ A;  4J9C A;  2A28 A;  1K9M U;  2DJQ A;  3GNF B;  1VQK A;  1K4U S;  1D09 B;  3LYI A;  5IH2 A;  4OF1 A;  2L3P A;  2KT8 A;  5GAM g;  2IIM A;  2V8K A;  1NJI C;  4A63 B;  2KDS A;  4PJO G;  5GAO m;  1FXX A;  1SHG A;  2M9U A;  2HQH A;  3H0H A;  4C92 C;  2X35 A;  5D6X A;  1X75 C;  2RJC A;  2OTJ Q;  2WSF E;  2ZPH B;  3JCM c;  1AD5 A;  3L1A A;  3CCL T;  4RTU A;  4F14 A;  5IXF A;  1VQ6 T;  1BCM A;  4PJO A;  1NPP A;  1RI9 A;  1U1S A;  2MPX C;  4C8Q F;  1G5V A;  1H3Z A;  4J7F A;  2M0O A;  2VWF A;  5KCO A;  1H8K A;  4MZP A;  1SSF A;  2DVJ A;  2FG0 A;  4LDX A;  4IIO A;  5LJ3 d;  3FJP A;  1Y57 A;  1KIK A;  2QXF A;  3EFS A;  2E5K A;  1VQO Q;  4LDW A;  2QYZ A;  2CP6 A;  3G6E Q;  1OU9 A;  1JQQ A;  3NHN A;  4IUR A;  3GIB A;  3O8V A;  3ASK A;  2VUB A;  3UPU A;  2E1H A;  4C5E A;  1YWO A;  4HXJ A;  3OYK A;  2O9S A;  2KRN A;  1NEG A;  3S3O A;  3MJX A;  4OVA A;  1QVF S;  1OU8 A;  4JRK A;  2VXF A;  1TUG B;  5IHK A;  4PLI A;  3L2Z A;  1SPK A;  1WHJ A;  4FW1 A;  2HBW A;  2CZ1 B;  2GGR A;  4D8K A;  2DZC A;  4ZN1 A;  2X3X D;  3M53 A;  4FW2 A;  2DNU A;  2ECZ A;  1YJ9 T;  3CD6 A;  3RDV A;  2D9T A;  1YHQ T;  4J9F A;  1Y96 B;  3JB9 H;  1I8F A;  1PKS A;  1VQ5 T;  2ZPG B;  1YJN T;  1QVG S;  2RN8 A;  2BIV A;  2GFU A;  1YI2 A;  1YJW T;  2FRW A;  1QKX A;  1VA7 A;  2DAQ A;  4PKC C;  4E2F B;  1LNX A;  1VQL T;  1QMC A;  4C0Z A;  3S3N A;  1RAI B;  1B3Q A;  3PFS A;  3N5B B;  4MMK A;  5KYY A;  1YCY A;  2RA2 A;  2DZ9 A;  2KT1 A;  3L2W A;  4J8O A;  3I55 Q;  1FMW A;  2KMT A;  3SHW A;  4CC7 A;  3CME A;  4HT9 A;  1ZUY A;  4J9B A;  4LE9 A;  4ESR A;  3X20 B;  1BCO A;  3G1J A;  1Y0M A;  2EGC A;  3CCS Q;  4QQD A;  1D1C A;  1PC0 A;  1AWJ A;  1HXD A;  2EYQ A;  2LT4 A;  3VUZ A;  1VQ6 A;  3CCS T;  3KUF A;  1Q7Y R;  1PD1 A;  2RK1 A;  4RTX A;  2NUP A;  4GLK A;  5FW9 A;  3HL8 A;  4E7K A;  1KC8 U;  4M7D C;  1ABQ A;  3UWN A;  1JO8 A;  2CGH A;  2EJG A;  1YJ9 Q;  2LNV A;  4ZN3 A;  4ORZ A;  4RG8 A;  1N8R C;  3PT9 A;  2VAS A;  1SKU B;  1M3B A;  1WXU A;  2IPO B;  3D7S B;  3CXC P;  1JXO A;  4PJM A;  2ZGW A;  5EC7 A;  1M3C A;  1YN8 A;  4WTO B;  2E5Q A;  4PFP A;  3E1S A;  3TRE A;  3DLL A;  2ZPF B;  1K73 R;  1AZG B;  1BIA A;  4JJB A;  4M78 F;  3OYF A;  1Y07 A;  1X2Q A;  1NEB A;  2E65 A;  1NLP C;  3J80 E;  3OYL A;  1ZA2 B;  1O75 A;  2VC8 A;  1NE8 A;  4JJN K;  2GF7 A;  1MUZ A;  2OJ2 A;  4HVV A;  1FX7 A;  1HSQ A;  1UFF A;  3CCM T;  2K57 A;  2X51 A;  1VQO A;  3LWI A;  4AG1 C;  3CCU A;  2YHT A;  3G6E T;  2DIQ A;  4KGX B;  2E10 A;  1XNI A;  4KH0 B;  2F1L A;  2EYX A;  1IXD A;  3QSU A;  3CCR Q;  4QVC A;  2RMO A;  4A53 A;  1M27 C;  4N0A C;  2K3Y A;  4M75 D;  1JJ2 A;  3T9N A;  2NWM A;  2DL4 A;  2QEX A;  1YJ9 A;  1WLP B;  1KQS S;  2FYK A;  2DET A;  2M1H A;  4F04 B;  3RER A;  2BUD A;  5LJ5 e;  4A4H A;  3CC4 A;  2DER A;  1OOT A;  4EMH A;  1LJO A;  4FM4 B;  4JLI A;  4QKU A;  3RES A;  2E12 A;  4R55 A;  1N9S A;  4RCB A;  3QPH A;  1GBQ A;  3SWN C;  1WHK A;  3V8L A;  2EJ9 A;  3CBM A;  4C92 F;  2AKL A;  1YIJ A;  1EX4 A;  3SB2 A;  4J6W A;  1CKA A;  1NPR A;  5GAN 3;  2QTV A;  3E9G A;  4J6X A;  4M75 F;  3CCM Q;  5GAN j;  2QK0 A;  5DLQ E;  3RKX A;  1BI1 A;  1PRM C;  4C8Q C;  2HNI A;  1K0X A;  3CCS A;  1VQM T;  2SRC A;  4MZT A;  1D3B B;  3OBW A;  3OW2 P;  1OUL A;  2O9V A;  3CEY A;  5AT1 B;  1VIF A;  2K6D A;  4DQ2 A;  5GAO r;  3MP6 A;  2RQW A;  3VS1 A;  3S6W A;  1Q81 U;  3MO8 A;  2OAU A;  5J26 A;  4NL3 A;  3CCJ A;  1M8M A;  1VQ4 Q;  2XG8 D;  5FU6 B;  1OI1 A;  2G3R A;  3GP8 A;  3PMI A;  5A2Q E;  2EKO A;  4M78 D;  4LNP A;  4NL2 A;  3P8H A;  2F5K A;  2HMA A;  1GXI E;  2NLU A;  3OA6 A;  1UG1 A;  2EQJ A;  4BB7 A;  1NBE B;  2ROL A;  3KBG A;  2KR3 A;  1KQ1 A;  4OP0 A;  2XKO C;  1QCF A;  2GQV A;  1RAF B;  2QQS A;  4EMG A;  5KYW A;  3TCJ A;  5CVI A;  1N8R R;  3TEE A;  3OYA A;  1HK9 A;  1R8O B;  5KE2 A;  5IN1 A;  1I5L A;  2RHZ A;  3C0C A;  3LGF A;  3M5A A;  2EAY A;  2HEQ A;  1AWX A;  4QQG A;  7AT1 B;  2WAC A;  1V76 A;  1IHV A;  1TSF A;  2NUP B;  4BDZ A;  4DEY A;  4JUV A;  4M78 B;  2DLP A;  4PJO D;  4CRI A;  3ER0 A;  3GF5 A;  3CCV A;  3CC4 Q;  4KRT A;  4Y92 A;  5I2S A;  2EVR A;  2KY9 A;  3HRS A;  3AHU A;  1MV3 A;  3MEA A;  5GJV B;  4AT1 B;  2E3H A;  1VQN A;  1OV3 A;  2LQ8 A;  4X34 A;  1G3Y A;  3M4Y A;  1VQ5 Q;  4IUU A;  3SDZ A;  2P0Q A;  2W0Z A;  2QDL A;  2E6Z A;  4HCB A;  2BE7 D;  2KRS A;  1UHC A;  1WX6 A;  2LNH B;  3M0T A;  3OYH A;  3CXC A;  3KXT A;  3JCM f;  1QW1 A;  3FRN A;  4F17 A;  3DKM A;  2XMF A;  4KT0 E;  4JJC A;  3EG9 A;  4FT2 A;  2ESW A;  2YXY A;  3ZBD A;  4RTT A;  5A0G A;  3JAM E;  3M0P A;  1G2B A;  2FHD A;  2VB6 A;  2QG9 B;  2DD5 A;  4FT4 A;  5GAN f;  2DE0 X;  3MEV A;  2QA4 T;  5I2M A;  2ENM A;  1M1K U;  2RHI A;  5GMK l;  2COW A;  3SWN B;  2CSI A;  2DD4 A;  4E7H A;  1LVK A;  2HL5 C;  2KGT A;  3UA6 A;  1OX8 A;  2QEX T;  2JOY A;  2E70 A;  3PIO A;  1VQP Q;  3I56 Q;  1H92 A;  3V7C A;  2QQ9 A;  2KXD A;  2FVU A;  5KYU A;  4C0F A;  2RI5 A;  2V1Q A;  2LQW A;  4NOY A;  1VUB A;  4RG2 A;  5LJ5 d;  3ZFJ A;  3H8Z A;  5LL6 S;  2A7Y A;  4ATO A;  1UB4 A;  3QYG B;  4IUQ A;  3JCM e;  2K5L A;  1Q95 G;  3QHS A;  3M0Q A;  5FRM A;  2C0T A;  2LCS A;  1RLQ C;  5GMK h;  2KQW A;  2FL7 A;  3DB4 A;  2KK4 A;  2JT4 A;  3CPF A;  2RQU A;  1K73 U;  5GAN e;  5J3B A;  2OTL A;  3C12 A;  3OS5 A;  3CQT A;  5D7U A;  1MNE A;  1OZ2 A;  2CP5 A;  4C8Q E;  3INZ A;  1Y71 A;  5LJ3 g;  3CCE A;  2VV5 A;  4F7U G;  2XI9 A;  4M78 G;  3TQ7 P;  2JXB A;  2LX9 A;  5GAN h;  1MMD A;  4M7D B;  2CRE A;  1KFZ A;  3JB9 F;  2DM1 A;  1G3T A;  1IGU A;  2LDM A;  1VQ8 Q;  4M75 B;  3M0S A;  5HY6 A;  1KD1 C;  3F70 A;  2AKK A;  2PVG B;  4RTY A;  3RKW A;  2PZ1 A;  5D6Y A;  2LX7 A;  2BZY A;  1PKT A;  2C06 A;  4HCZ A;  1M2V A;  3CMA Q;  4BD3 A;  3VS4 A;  3CCE T;  3EGX B;  2KEA A;  2KRM A;  3A8H B;  3QJ6 A;  4J6Y A;  2PNI A;  1YJW Q;  2KNB B;  2DK3 A;  4J83 A;  5CR2 A;  3V8K A;  2EW3 A;  3EGD B;  3CC4 T;  2HKN A;  2VVK A;  1JU5 C;  1HJD A;  2NUZ A;  1VOM A;  3BY7 A;  4FYX B;  2QA4 A;  2AZS A;  2K3B A;  1FWZ A;  3HHT B;  3WXM B;  1AWW A;  4ZGD B;  2LMJ A;  1KQS P;  4C8Q A;  1HD3 A;  4M77 B;  2JW4 A;  2P0P A;  4L59 A;  1V1C A;  2MI6 A;  2GTJ A;  5KYU B;  2FB7 A;  2MAM A;  1WXB A;  4EMK A;  2OAW A;  1YJN A;  2LZ6 B;  4LDV A;  2KYB A;  2KSS A;  2OI3 A;  3OYC A;  1JXM A;  3EG3 A;  2MWO A;  3QXE B;  2DEU A;  5CKE A;  4HA8 A;  4ELZ C;  2QEX Q;  1O9S A;  1KK7 A;  1WZO A;  1T3S A;  1N8R U;  5EG2 A;  5HK3 A;  1M8V A;  4XU2 A;  3EG9 B;  5GAN 2;  3VRY A;  1YI2 T;  1I81 A;  6AT1 B;  2KE9 A;  2QTX A;  4O6J A;  3IQL A;  3MHX A;  1C1A A;  4JJD A;  2JUF A;  2C0I A;  2YSQ A;  2X4Y A;  4QW2 A;  2E4H A;  2O4X A;  2EGE A;  3RBB B;  1U3O A;  3RNJ A;  2DXU A;  2X3W D;  1FMV A;  3EH2 A;  1UGQ B;  4OMP A;  1IGQ A;  3SFM A;  3H9N A;  3JV3 A;  4E7I A;  1GBR A;  3VS5 A;  3TVT A;  2CH4 W;  3OYE A;  4M7A A;  1EZZ B;  3VS6 A;  4AFS C;  2RNA A;  2RO0 A;  3RMQ A;  1WIE A;  1ZQ1 A;  2E41 A;  3A8G B;  3DB3 A;  4RMO A;  1VQK T;  2RI3 A;  1RI0 A;  4RUG A;  4M7A C;  3GNG A;  4E6R A;  1QVG P;  3KFV A;  1WXT A;  2WSC E;  2HQE A;  3HFO A;  1IHW A;  2PTK A;  4BI3 A;  2HKQ B;  2IG0 A;  1Q86 U;  3CCQ A;  2H8H A;  2XHC A;  4JDS A;  3TU4 K;  2OTJ A;  2D1X A;  4EMK C;  4VUB A;  5LJ5 h;  2XK0 A;  2B86 A;  2PU9 B;  1G8X A;  1XOV A;  4DEX A;  2XU8 A;  3CCR T;  4HCC A;  1K8A C;  2YUN A;  2F2W A;  5LJ3 h;  2DL3 A;  1YJN Q;  1Q82 U;  1CKB A;  4JZ3 A;  1M1G A;  4GBQ A;  2M51 A;  2M02 A;  2MF2 A;  2J7I A;  1M30 A;  2MCN A;  4RTV A;  2A3L A;  1K0S A;  1VIE A;  3FLG A;  2ZPB B;  1LOJ A;  2JVV A;  1KHC A;  1YIT T;  5J39 A;  3CCV Q;  3QBY A;  3QZ9 B;  2O01 E;  2OX7 A;  3CC2 A;  4M77 C;  3UDC A;  2EGA A;  3VS3 A;  2ATC B;  2HL3 A;  4O5V A;  2DVE A;  2M0Y A;  2AK5 A;  2DKG A;  5GAM d;  4QQ6 A;  3X26 B;  2HSP A;  2ZAE A;  4II1 A;  3O5Z A;  1S72 Q;  4DOV A;  2L3Q A;  2Y4X A;  3I5S A;  2VXE A;  3MET A;  3BE3 A;  1SEM A;  2CP0 A;  3SD4 A;  4BY6 C;  4PFZ A;  3EGU A;  1MND A;  2RHX A;  4C92 B;  1X6B A;  1C0M A;  1ARK A;  1W1F A;  4M7D D;  2DL8 A;  3MEU A;  2HAX A;  1EIF A;  1JRI A;  1QVF P;  2LQN A;  3CC7 Q;  1BYM A;  1BI2 A;  4BAC A;  4LN2 A;  4B9X A;  5GAM f;  5GAO n;  4C0D B;  3A5Z B;  3CPW A;  5LJ5 j;  1M9S A;  2L2P A;  2FEI A;  4KUL A;  1ZSZ C;  1Q7Y C;  3V7S A;  1J3T A;  4M77 F;  1QLY A;  1W2B P;  1ZA1 B;  2R57 A;  5KYN A;  1KQS A;  1SHF A;  3I56 A;  1EFN A;  1MMG A;  2CSQ A;  1KHI A;  4C0G A;  2F69 A;  4M75 E;  2JMA A;  1NZ9 A;  4M78 A;  1QVP A;  5KYY B;  3CCM A;  3QWX X;  1ZUK A;  1AT1 B;  1QP3 A;  2K9G A;  1A0N B;  1NYF A;  1GCQ A;  1N6A A;  3QWY A;  1WQW A;  3VYH B;  4QVZ A;  2HZY A;  4IKF A;  3HTR A;  1RAC B;  2LT1 A;  5GMK i;  2RM4 A;  2YWW A;  3OW2 A;  2CP2 A;  1M2O A;  1T3L A;  1WJR A;  1WDX A;  3LGL A;  1UGR B;  1IZ6 A;  3BW1 A;  4OB3 B;  1VQ4 A;  4PJJ A;  2DRK A;  2RB6 A;  2W10 A;  3H0I A;  4OMF B;  1R0B G;  3OS1 A;  2ABL A;  5FRO A;  2JS0 A;  2CT3 A;  2DF6 A;  1FYN A;  1YHQ Q;  1WI7 A;  1WHH A;  1B34 A;  3A8M B;  3OYB A;  1G83 A;  5LJ5 g;  3FEO A;  2CS7 A;  3P8B B;  1PG5 B;  1JB0 E;  5FU7 C;  1T0H A;  3CME Q;  4AFZ C;  2E3I A;  3C95 A;  2DL7 A;  2JTF A;  1IRE B;  1PCX A;  3RMS A;  2DMO A;  4LUE A;  4B6M A;  3RR6 A;  3VKI A;  1VQ4 T;  3RUX A;  2CYZ B;  3PTA A;  2PUO B;  2X4X A;  1WHM A;  1JJ2 P;  2E64 A;  4C8Q D;  3NTH A;  3I35 A;  4M7A B;  5KCH A;  4CC4 B;  3QDF A;  2LCC A;  3G71 Q;  4BDY A;  2KAF A;  2J6F A;  3FIF A;  1SF9 A;  3QUI A;  1OQK A;  1VQP T;  3JCM b;  1G3W A;  1UEC A;  2XD0 A;  3OYM A;  3HRU A;  1K73 C;  2AT1 B;  5DM7 R;  3JB9 G;  2BZ8 A;  4FU6 A;  2FPE A;  1OZ3 A;  1VQN Q;  2CDT A;  2KXC A;  4XQ3 A;  1YNZ A;  1VQ5 A;  3TSW A;  2K79 A;  3M57 A;  3OMG A;  3J7A F;  2ZZD A;  2YLB A;  1QWE A;  1AWO A;  2RHY A;  1PSE A;  2CZ7 B;  2R5A A;  1TWB A;  4OMM A;  2O31 A;  1YHQ A;  4J9G A;  4ANJ A;  2YLC A;  3LX7 A;  2MWP A;  1VQ7 A;  2V8J A;  3OBY A;  4KBM B;  4C92 D;  1WYX A;  4V2S A;  2Y4Y A;  2FPF A;  3OS2 A;  3MCA B;  3EHQ A;  4PJO E;  2D0N A;  2NYS A;  5L8R E;  1N9R A;  4A4E A;  2RQT A;  1KC8 R;  4QVD A;  1ABO A;  8AT1 B;  2LJ1 A;  5GAN 4;  4IIM A;  3EH1 A;  3GPL A;  4JLG A;  1I4K 1;  2RQR A;  4M77 A;  3CCJ T;  2F5T X;  4HVU A;  2EQU A;  2LTO A;  1OEB A;  2F2V A;  1ZBJ A;  3WVD B;  4PJO B;  4BI8 B;  1W2B A;  1IB8 A;  1F1B B;  2GQI A;  4AFQ C;  2RHU A;  3JSC A;  4LD9 K;  1UGV A;  1UEB A;  4KH1 B;  3CMA T;  4OB1 B;  5FU6 C;  4M7A F;  1B07 A;  2Z0W A;  3M4G A;  1YCS B;  5GAO q;  4RTZ A;  3WVE B;  1JBM A;  2BTT A;  3E2U A;  3OW2 S;  2KVQ G;  3UF4 A;  1TU0 B;  4BY6 B;  4M7D F;  2KBT A;  1GCP A;  1XJW B;  4RKU E;  1YIJ Q;  1D0X A;  1E6G A;  1Q82 R;  1ZX6 A;  5FLX E;  3LH5 A;  1I0C A;  5HK0 A;  2YT6 A;  3OQ5 A;  2L89 A;  5FWB A;  4M77 E;  3CCU Q;  3JCM d;  5FRN A;  2COY A;  3CCQ Q;  1U06 A;  4M7A G;  2J6K A;  2DIG A;  2P4R A;  3REB B;  4J9I A;  5IT9 E;  1VQM Q;  2LQK A;  1VQ8 A;  1M90 C;  3QZ5 B;  3JCM g;  2BE9 B;  4HT8 A;  2MYS A;  1MGQ A;  2HD0 A;  4IUP A;  4QT7 A;  2XIC A;  4J9D A;  3CCU T;  3MPU B;  5IHI A;  2L5Q A;  1SRM A;  1SG5 A;  1TH7 A;  5A0L A;  5CQY A;  4R0K A;  4OGE A;  1X2K A;  2XDP A;  1K8A U;  3I55 A;  2JS2 A;  4MDW A;  4X9C A;  4E7J A;  5M9O A;  2Y90 A;  4F7U B;  5CKB A;  2HSE B;  4F16 A;  1Y96 A;  1W6X A;  2ED0 A;  4N4H A;  2I2L A;  1BKB A;  3CXC S;  1AEY A;  3EAE A;  3PMT A;  3QII A;  4LDY A;  2J6O A;  3JB9 D;  3ZL7 C;  3LH0 A;  3L2Q A;  1YBY A;  3EFO A;  4JRQ A;  4DBF A;  2FO0 A;  3OY9 A;  4JS4 A;  2DFU A; 
#chains in the Genus database with same CATH homology
 1GCQ C;  2VKN A;  4E6R A;  3KFV A;  1WXT A;  4AG1 C;  2DBM A;  3A98 A;  3NGP A;  2CH4 A;  1S1N A;  2PTK A;  2K2M A;  1GFC A;  2H8H A;  2EYX A;  1Z9Z A;  2JTE A;  2YUO A;  1VYU A;  4OMO A;  2RMO A;  1M27 C;  4JPB W;  2D1X A;  2EQI A;  1MV0 B;  2G6F X;  1X6G A;  2FRY A;  2B86 A;  2EYY A;  2NWM A;  2DL4 A;  1XOV A;  2YDL A;  1LCK A;  4DEX A;  1WLP B;  2K7A A;  2RQV A;  1GFD A;  2YUN A;  2F2W A;  1QWF A;  2DL3 A;  1OOT A;  3EG0 A;  4HCK A;  1CKB A;  4JZ3 A;  4GBQ A;  2M51 A;  2JMC A;  2LP5 A;  4OML A;  4ZNX A;  1GBQ A;  2GNC A;  2CUB A;  2J7I A;  1M30 A;  2MCN A;  4J9E A;  4RTV A;  4WCI A;  1K0S A;  2MIO A;  2AKL A;  3REA B;  3VS7 A;  1CKA A;  3THK A;  4CC3 A;  1BBZ A;  5I11 A;  4AFU C;  3U23 A;  4Z8A A;  3NPF A;  1PRL C;  2F2X A;  1PRM C;  1GRI A;  1IO6 A;  1T0J A;  2EGA A;  1K0X A;  3VS3 A;  4Z88 A;  1RLP C;  3PE0 A;  2SRC A;  2O9V A;  2M0Y A;  2AK5 A;  2A36 A;  2K6D A;  2HSP A;  2JM9 A;  2RQW A;  2A37 A;  2J05 A;  3EHR A;  3VS1 A;  3O5Z A;  2DIL A;  1X43 A;  1PNJ A;  1M8M A;  2L3Q A;  1NYG A;  3I5S A;  1E6H A;  2EPD A;  3H0F A;  4LNP A;  1SEM A;  2EBP A;  2MOX A;  1CSK A;  3EG2 A;  3SEM A;  1UG1 A;  1H3H A;  3EGU A;  2L0A A;  2ROL A;  2KR3 A;  1QCF A;  1X6B A;  1ARK A;  1W1F A;  2I0N A;  2HCK A;  1UJY A;  4GLM A;  2DL8 A;  2DRM A;  1KSW A;  2LQN A;  1UJ0 A;  4LN2 A;  2CUD A;  3C0C A;  2EKH A;  1SRL A;  1KJW A;  5FWC A;  1U5S A;  2L2P A;  1BK2 A;  2FEI A;  2HEQ A;  2CT4 A;  1AWX A;  1J3T A;  3I9Q A;  1YP5 A;  1QLY A;  4OMQ A;  2O2O A;  4J9H A;  1SHF A;  1EFN A;  4X1V A;  1K1Z A;  1SSH A;  3H41 A;  2EYZ A;  2CSQ A;  4DEY A;  1WA7 A;  1K9A A;  2KYM A;  2YUP A;  2DLP A;  2JMA A;  4D8D A;  1BB9 A;  5GJW B;  2ED1 A;  2DYB A;  3QWX X;  4KRT A;  1ZUK A;  4Y92 A;  2EVR A;  1TUC A;  2K9G A;  1A0N B;  1NYF A;  1GCQ A;  1MV3 A;  3PVL A;  5GJV B;  3QWY A;  1OV3 A;  2DX1 A;  4K11 A;  2LJ0 A;  5IXB A;  4OMN A;  1NLO C;  1T3L A;  2W0Z A;  2QDL A;  1WDX A;  4RTW A;  3NMZ C;  1NM7 A;  1TG0 A;  2DRK A;  2KRS A;  5HCK A;  2W10 A;  3H0I A;  1UHC A;  1ZUU A;  3VS2 A;  2ABL A;  1WX6 A;  2LNH B;  3M0T A;  1X27 A;  1ZSG A;  5IHN A;  2A08 A;  2ROT A;  2JS0 A;  1BU1 A;  1UTI A;  2CT3 A;  2DF6 A;  1FYN A;  4F17 A;  2XMF A;  1WI7 A;  4JJC A;  2FPD A;  1PWT A;  2ESW A;  4RTT A;  1G83 A;  3M0P A;  1G2B A;  2HDA A;  1FMK A;  1W70 A;  1T0H A;  4AFZ C;  2DE0 X;  2DL7 A;  2V1R A;  1JEG A;  3I5R A;  2ENM A;  2C0O A;  2DL5 A;  2RF0 A;  2DMO A;  1PHT A;  3EG1 A;  4LUE A;  4CC2 A;  1I1J A;  2DBK A;  2CSI A;  4M4Z A;  2BZX A;  1OPL A;  1AVZ C;  2KGT A;  3UA6 A;  3M0U A;  5I22 A;  4AG2 C;  5ECA A;  1NG2 A;  3I35 A;  1H92 A;  3TSZ A;  2KXD A;  4CC4 B;  4J9C A;  2A28 A;  2EYW A;  2DJQ A;  2SEM A;  1UHF A;  1K4U S;  2V1Q A;  1WFW A;  2LQW A;  1UE9 A;  1YWP A;  5IH2 A;  2GTO A;  2L3P A;  2J6F A;  2RPN A;  2KT8 A;  2IIM A;  1UEC A;  4A63 B;  3M0Q A;  2C0T A;  2LCS A;  1SHG A;  1RLQ C;  3H0H A;  2BZ8 A;  2FPE A;  2D8J A;  2CDT A;  2JT4 A;  2KXC A;  2RQU A;  4EIK A;  1YNZ A;  3TSW A;  2K79 A;  1AD5 A;  4RTU A;  1QWE A;  4F14 A;  5IXF A;  1AWO A;  2L3S A;  3CQT A;  4Z89 A;  1RI9 A;  2VWF A;  4OMM A;  1H8K A;  2O31 A;  2DVJ A;  4J9G A;  2FG0 A;  1M3A A;  2JXB A;  1I07 A;  3UAT A;  1WYX A;  4IIO A;  1KIK A;  1X69 A;  1Y57 A;  1UDL A;  2CRE A;  2FPF A;  1KFZ A;  2E5K A;  2DM1 A;  3PVQ A;  1VYT A;  2GBQ A;  3EHQ A;  2D0N A;  2RQT A;  1JQQ A;  3NHN A;  2KRO A;  1ABO A;  3M0S A;  2LJ1 A;  2AKK A;  4IIM A;  4RTY A;  1YWO A;  4HXJ A;  2O9S A;  2KRN A;  2PZ1 A;  2LX7 A;  2BZY A;  2RQR A;  1NEG A;  4HVU A;  1PKT A;  2D8H A;  1ZLM A;  2O88 A;  5IHK A;  3VS4 A;  1SPK A;  1OEB A;  2F2V A;  1ZBJ A;  2HBW A;  2KEA A;  3M0R A;  2GGR A;  4D8K A;  2KRM A;  1E7O A;  1K76 A;  2X3X D;  2DNU A;  2ECZ A;  2GQI A;  4AFQ C;  2PNI A;  4J9F A;  2KNB B;  4FSS A;  1PKS A;  2RN8 A;  1UGV A;  2FRW A;  1QKX A;  1VA7 A;  2EW3 A;  1B07 A;  2VVK A;  4LUD A;  1YCS B;  1JU5 C;  1HJD A;  2NUZ A;  1OPK A;  4RTZ A;  2BTT A;  2AZS A;  2K3B A;  4JZ4 A;  3UF4 A;  1B3Q A;  3GBQ A;  3FJ5 A;  1AWW A;  2KBT A;  1GCP A;  2LMJ A;  1AOJ A;  1E6G A;  1HD3 A;  2LJ3 A;  2JW4 A;  1ZX6 A;  1V1C A;  3LH5 A;  2GTJ A;  2KT1 A;  1I0C A;  2YT6 A;  2JM8 A;  3SHW A;  4CC7 A;  5FWB A;  1ZUY A;  4J9B A;  1WXB A;  4LE9 A;  4ESR A;  2OAW A;  2LZ6 B;  5L23 A;  1U06 A;  2J6K A;  2KYB A;  2OI3 A;  2P4R A;  3REB B;  1Y0M A;  4J9I A;  2EGC A;  1JXM A;  3EG3 A;  1AWJ A;  4HVW A;  1RUW A;  4RTX A;  4QT7 A;  3R6N A;  4J9D A;  5FW9 A;  1T3S A;  3ULR B;  5IHI A;  2DA9 A;  1ABQ A;  1JO8 A;  1SRM A;  2YUQ A;  1VYV A;  4ORZ A;  3VRY A;  1TUD A;  4R0K A;  1M3B A;  1WXU A;  3UA7 A;  3VS0 A;  2KE9 A;  1X2K A;  1JXO A;  5EC7 A;  3IQL A;  1M3C A;  4JJD A;  2JS2 A;  2C0I A;  2YSQ A;  1YN8 A;  1N5Z A;  2J06 A;  2EGE A;  3RBB B;  1QKW A;  1U3O A;  1UUE A;  3RNJ A;  4F16 A;  2X3W D;  3VRZ A;  1W6X A;  4OMP A;  1AZG B;  2ED0 A;  4JJB A;  3JV3 A;  1AZE A;  1X2Q A;  1NEB A;  1GBR A;  3VS5 A;  1NLP C;  3TVT A;  2CH4 W;  1AEY A;  2AZV A;  3VS6 A;  1Z9Q A;  4AFS C;  1GL5 A;  2RNA A;  2J6O A;  1MUZ A;  1WIE A;  2OJ2 A;  4HVV A;  3ZL7 C;  1HSQ A;  1UFF A;  2FO0 A;  4RUG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...