3REBB

Hiv-1 nef protein in complex with engineered hck-sh3 domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
59
structure length
59
Chain Sequence
b'DIIVVALYDYVSWSPDDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein Nef
publication title Molecular design, functional characterization and structural basis of a protein inhibitor against the HIV-1 pathogenicity factor Nef.
pubmed doi rcsb
source organism Hiv-1 m:b_arv2/sf2
molecule tags Protein binding
total genus 13
structure length 59
sequence length 59
chains with identical sequence D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3rebB00
1AWXA 1M27C 1QKXA 2GNCA 3VS1A 2J6OA 2PZ1A 1X2KA 1PHTA 2L3PA 2GTJA 3EG2A 2XMFA 1SSHA 1MV0B 2KEAA 1VA7A 1H3HA 4J9IA 2KBTA 5GJWB 3RBBB 3VRYA 2P4RA 1YWOA 1S1NA 2DNUA 2K79A 2RF0A 1NEGA 2JS2A 2MIOA 1MUZA 3EG1A 1UECA 2O88A 2KXDA 1WXTA 5I11A 1X69A 3I35A 1TUDA 2OI3A 2J05A 4AFUC 1U3OA 1I0CA 2JW4A 3TSWA 2DF6A 2CUBA 2BTTA 1I1JA 2E5KA 2DL7A 2EYYA 5FWCA 2KYMA 2J7IA 4F16A 3CQTA 1LCKA 2F2VA 4Z8AA 2ENMA 1E6GA 1JQQA 2RQRA 4LE9A 1X27A 1UHFA 2RQUA 1KIKA 2D1XA 2A08A 1WDXA 1CKAA 4J9BA 4RTUA 2DL3A 2HEQA 2SRCA 1UJ0A 1V1CA 2LP5A 4GBQA 1U5SA 2VWFA 2CREA 2FPFA 3M0PA 1GFDA 1BU1A 4F17A 1T0JA 2M51A 3M0TA 4M4ZA 1T0HA 1WI7A 4AFZC 2L3SA 5I22A 3TSZA 2JS0A 2KROA 4OMQA 1B3QA 3UA7A 4GLMA 1GCQA 1OOTA 4RTVA 1KFZA 2MCNA 4RTTA 3H0HA 3VS7A 3VS6A 2D8HA 4OMLA 1X6BA 1WA7A 1HSQA 1ABQA 4AG1C 2AKLA 4J9GA 1VYVA 4ESRA 2EW3A 2JMCA 2CT4A 3NHNA 2DVJA 3REBB 1KSWA 2HSPA 2LZ6B 2W10A 3UF4A 1JXOA 4J9FA 2DYBA 1JO8A 2DE0X 1SHFA 2RMOA 1AEYA 1W70A 1RI9A 4LNPA 2O9SA 2FRYA 1K1ZA 2RPNA 2VKNA 5HCKA 2A28A 1T3LA 1UUEA 2A37A 2O2OA 4D8KA 1XOVA 1QLYA 2JM9A 3SHWA 4K11A 2RQVA 3JV3A 3H0IA 1NLPC 2EGAA 2J06A 2KR3A 3VS5A 2JXBA 1Y57A 4JPBW 1T3SA 4JJCA 2LCSA 1X43A 2OAWA 4LUDA 2LMJA 2F2XA 2NWMA 4RTWA 3M0UA 1UJYA 2ECZA 1SEMA 2C0OA 1YN8A 2CT3A 4HCKA 2KRNA 2ROTA 3M0SA 1YCSB 2HCKA 2ROLA 2DLPA 1ZX6A 1WIEA 5EC7A 3PVLA 4OMPA 5FWBA 1A0NB 2V1RA 2A36A 1Z9ZA 2K7AA 2DL4A 2EBPA 2KT1A 4CC7A 2YT6A 1OV3A 4A63B 2KRSA 1NEBA 4E6RA 1FYNA 4DEXA 4J9DA 3RNJA 2BZXA 2BZ8A 1M3BA 3TVTA 4JZ4A 2EPDA 3GBQA 3O5ZA 3C0CA 2LJ1A 3LH5A 2DMOA 1K76A 2C0IA 3VS0A 1QWFA 2ED1A 1SRLA 2CH4W 4HVWA 2B86A 1SRMA 1GFCA 1UFFA 4HVUA 1NYFA 1NM7A 5ECAA 2HDAA 4LN2A 1JEGA 1BK2A 4WCIA 2J6FA 1J3TA 1W6XA 1WXBA 1E6HA 2EVRA 1ZSGA 1GRIA 1M30A 1OPKA 1G83A 1UG1A 1UGVA 2JM8A 2KGTA 3H0FA 4J9EA 2DL5A 2K3BA 2DM1A 1E7OA 2L2PA 1GCQC 2FO0A 2VVKA 1K4US 4D8DA 1HD3A 2EYZA 1K0XA 2FRWA 4OMMA 5GJVB 1ZBJA 2DRKA 2W0ZA 4CC4B 3R6NA 2CDTA 3M0QA 3I9QA 2KRMA 4ZNXA 1FMKA 2JTEA 1X6GA 1PKTA 2EGCA 2PTKA 4HVVA 2YUNA 3NMZC 4R0KA 1N5ZA 2F2WA 1IO6A 2O9VA 2DBMA 2GBQA 1NG2A 2AKKA 3KFVA 3U23A 3ULRB 3A98A 1QCFA 3PVQA 2CSIA 2JT4A 1ZUUA 2DX1A 4JZ3A 2KYBA 1ZUYA 4FSSA 2KT8A 1RLPC 1WLPB 3VS2A 4J9HA 1PRMC 1UE9A 4IIMA 3VRZA 2KXCA 2DA9A 2DJQA 2EGEA 3UA6A 3EG0A 2KNBB 4Y92A 3SEMA 5IHNA 1SPKA 2LQNA 3I5RA 2EQIA 3FJ5A 3VS3A 2AK5A 2DBKA 2ED0A 2K9GA 1EFNA 4ORZA 4DEYA 1AD5A 1AWWA 2CUDA 1TG0A 1K9AA 2YSQA 2J6KA 2RN8A 1OEBA 5IXBA 1NLOC 1AOJA 4RTYA 5FW9A 2RQWA 1JXMA 2L0AA 3PE0A 2OJ2A 1HJDA 2MOXA 2YUOA 3UATA 1U06A 1RUWA 1QWEA 4J9CA 2D0NA 2V1QA 1PNJA 1BBZA 1X2QA 1B07A 1RLQC 2O31A 4JJBA 3EHRA 2EKHA 3EHQA 4F14A 2CSQA 1M8MA 1VYTA 1I07A 3I5SA 1AWJA 4X1VA 3NGPA 1UDLA 3QWXX 2PNIA 1PWTA 2FPDA 2K6DA 5IHKA 2FG0A 4CC3A 2KE9A 3QWYA 2DRMA 1MV3A 1ABOA 2GGRA 2GTOA 2QDLA 5IH2A 2JMAA 2IIMA 2FEIA 2LNHB 2YUQA 1AZEA 1PRLC 1WFWA 1OPLA 4OMNA 1CSKA 2YDLA 3EG3A 1SHGA 1WYXA 3EGUA 1YWPA 1NYGA 1GL5A 1M3AA 4RUGA 2DL8A 2LJ0A 1ZUKA 1GBRA 4RTZA 5IHIA 1H8KA 1WXUA 2ESWA 4QT7A 4KRTA 2L3QA 4Z89A 1GCPA 2EYXA 1AVZC 2X3WD 5L23A 1UTIA 2YUPA 1TUCA 1JU5C 1Z9QA 2K2MA 1AZGB 2HBWA 4RTXA 4IIOA 4HXJA 2G6FX 2GQIA 2D8JA 3NPFA 3M0RA 2RQTA 1WX6A 4CC2A 3H41A 2EYWA 1W1FA 2LQWA 2M0YA 2C0TA 3VS4A 2SEMA 2FPEA 4AFQC 4OMOA 2BZYA 2LX7A 1M3CA 2H8HA 1YP5A 2RNAA 3ZL7C 1Y0MA 2LJ3A 2X3XD 2I0NA 5IXFA 3THKA 2DILA 1K0SA 1YNZA 1VYUA 1BB9A 3IQLA 4EIKA 1UHCA 1PKSA 1KJWA 1GBQA 2AZSA 1AWOA 4AG2C 4LUEA 2AZVA 2NUZA 1G2BA 4AFSC 2ABLA 3REAB 1ARKA 1QKWA 1CKBA 2CH4A 1H92A 4JJDA 4Z88A 1ZLMA
chains in the Genus database with same CATH superfamily
4M77A 1M5Q1 1M27C 1NJIU 5L8RE 1M90R 3VU3C 3VS1A 1X2KA 3PTAA 4M7DF 2QEXA 4UC4A 4M7AB 3PMTA 1VA7A 2RHIA 1YI2A 3VRYA 3RMQA 1FMWA 3D7SB 4F7UE 4IKFA 2DNUA 1VQ9T 1G3TA 5GMKm 1NEGA 4J7IA 3JCMW 1Q82R 1TUDA 1NPPA 3ZEHA 2DF6A 4KGXB 4PJOG 2DL7A 2EYYA 4HCCA 4YTLA 2QYZA 2MI6A 3HL8A 2RI3A 3S3MA 1UGRB 2ZAEA 4ZTFA 2F2VA 2OTJT 1X27A 1UHFA 3JCMf 2QA4A 1YJNQ 2E3HA 2A08A 1WDXA 4RTUA 2GF7A 2SRCA 4GBQA 1KG1A 1X01A 2QA4T 3M0PA 2M51A 4M4ZA 1T0HA 1WI7A 2PVDB 4A4EA 2XK0A 1QQJA 4AT1B 4C0FA 2K57A 4C8QA 4M77E 1FX7A 4GLMA 1GCQA 4ANJA 3GP8A 1UEBA 1KQSA 3OB9A 4JRIA 4PKCC 4RTVA 2VXEA 1YHQT 3ZBDA 1UB4A 1YJWA 3H0HA 4LD6A 4HT8A 2VASA 2A0FB 3HTRA 2RJCA 1X6BA 4XTVA 1MMGA 3TREA 3EG9A 5GAN4 2GQVA 1WHMA 4ESRA 4HT9A 2Y90A 3LH0A 2E12A 1IXDA 4MMLA 3I56A 3NHNA 2R5MA 3RKYA 1K73U 1KD1R 3L2QA 1VQ6Q 3S3OA 1M2VA 1MNEA 2W10A 1B34B 3J81E 2NUPA 3I56T 2IVWA 1AEYA 2O9SA 2FRYA 3OS2A 2BIVA 1M1GA 1K9MC 1T3LA 1UUEA 4IUVA 3DB4A 1QW1A 1XOVA 4PLIA 4JJNK 1MHNA 1R0BG 4ZGEB 1EIFA 3UWNA 1WQ7A 4M7DA 1PSEA 3JV3A 3H0IA 4C8QE 1NLPC 3CCQT 2J06A 2DXBA 1N8RR 3EFSA 3QJ6A 2HL3A 2OX7A 4RMOA 2LMJA 4IUPA 1VQ4T 2M16A 1W4SA 3X24B 4HCKA 4MDXA 1YCSB 4NOYA 5CVIA 1ZX6A 1WIEA 2WSEE 2RI5A 5FWBA 3CCMA 4FYWB 3OS0A 3JRZA 2KT1A 1D1BA 1EZZB 1NEBA 1VQ7A 2VB6A 3JB9H 4M78B 4DEXA 4J9DA 4E7HA 4WF2A 3TVTA 1BIAA 2LC4A 2DIQA 3QYHB 4R55A 3GBQA 4OVAA 1VQ7T 3C0CA 4NL2A 2DMOA 1P92A 1YBYA 3HRSA 2ED1A 5IN1A 1YCYA 1F1BB 4M7DE 3X26B 2B86A 1UFFA 2JVVA 3EGXA 1RAIB 4XTXA 3PIOA 2J6FA 2RI2A 2K5FA 1UGVA 2L2PA 2JUFA 4C5GA 2VVKA 1K4US 2MK5A 1SF9A 4LDUA 4OMMA 1W2BA 2DRKA 1Q86C 2X4JA 3R6NA 4BACA 5HK0A 4ZNXA 2JTEA 1X6GA 1WQWA 1MMNA 3A1PA 3CCRQ 2F2WA 2RO0A 2G3RA 3S3NA 2L5QA 1JBMA 3TEEA 2JZ2A 2AHJB 3KFVA 1Y07A 3A98A 3VV0A 1G5VA 5GAOr 2P0KA 4C92B 5LJ5j 1RAHB 3VYHB 3NTHA 2P84A 1M1KU 2Y4YA 4BY6B 2O01E 2CP7A 3M4YA 2A3LA 4FYYB 3A5ZB 2LT4A 2LVMA 2YXYA 5KH6A 4NL3A 4RCBA 3X25B 5IHNA 1SPKA 3VUBA 3AHUA 1ZSZB 1PM3A 1VQ8Q 2K9GA 1EFNA 5LJ5f 2ATCB 4OB2B 3VUZA 2J6KA 4M77D 3DLLA 1NLOC 3CCET 1AOJA 2V8JA 2YWWA 4LDVA 5FW9A 1JXMA 2L0AA 1S72Q 2AT1B 3MEVA 3QZ5B 3I55A 1U06A 3QJYA 4FT4A 5CIUA 2V1QA 3JSCA 4BI8B 1RLQC 5KYXB 4OGCA 2LT1A 1Q7YC 4F14A 2VGNA 1M8MA 3C4SA 1DJ7B 3CC7A 1AWJA 3OYEA 3NGPA 2O4XA 2L3RA 3CC4A 1OU8A 1IZ6A 2M1HA 1FWZA 4J8OA 3MJXA 5IHKA 1M1FA 2FL7A 4B6MA 1D1AA 2YRCA 4CC3A 3P8BB 1FXXA 2KE9A 8AT1B 3QWYA 3RDVA 1MV3A 2GGRA 4DBRA 2EQMA 5AT1B 1VQNQ 3OS5A 1BCOA 4C8QD 2OTLQ 3G7ZA 1I4K1 3MP6A 2VYTA 1VQKA 1GL5A 2HSEB 1OULA 4FW2A 3V8JA 1ZUKA 3MP1A 1WXUA 3V8LA 4R56A 5J39A 3J80E 3PFSA 2X3WD 5FU7B 5J26A 5L23A 3CC2T 4M78C 1KQSP 1JU5C 1Z9QA 3VKIA 2K2MA 2DXCA 2HBWA 4IIOA 4HXJA 3E9FA 4P5NA 2GQIA 4M7AF 3NPFA 1D09B 3H9NA 4RKUE 4M75E 3AT1B 4ATOA 2EYWA 1PD1A 1XNIA 1JRIA 1LVKA 5FROA 2LTOA 3SDZA 3LX7A 2DIGA 1VQ5T 3G1JA 3CCUA 2FVUA 2DAQA 1Y0MA 3G71Q 2D6FA 1WGSA 2EQJA 2EQKA 4KBMB 4E7SA 1K0SA 1YNZA 3UPUA 1TXQA 1VIFA 1KHIA 2LX9A 1TH7A 2COYA 1TUGB 2QQRA 1UHCA 3CMEQ 1KJWA 2KVQG 2X4WA 2AZVA 2CYZB 5CKBA 3OQ5A 2CP0A 2XDPA 3DB3A 1VQMA 4KULA 3EGDA 2H3EB 3REAB 2XICA 3QDRB 3X20B 4JJDA 4Z88A 2R58A 2W0ZA 2I2LA 3OW2A 5KYNA 1KQSS 4N4GA 2XU8A 2GNCA 3OYCA 4BDZA 2CP2A 2PZ1A 4C92C 4DOVA 3L42A 2XMFA 1X6OA 1SSHA 1MV0B 1Y96B 5CKHA 3FB9A 4PJOF 2P4RA 4BY6C 2L8DA 1YWOA 1TSFA 4L6V5 2MIOA 3TU4K 4ELZC 1WXTA 1X69A 3ZFJA 1ZSZC 4AFUC 1M90U 1U3OA 1I0CA 2JW4A 2CUBA 1I1JA 1RAEB 2EKOA 5KYWB 2JJ9A 2VUBA 3INZA 4Z8AA 1E6GA 5EG2A 1Q81R 1KIKA 3OS1A 1KC8C 1CKAA 2DL3A 1U5SA 4B9XA 4C0DB 3WVEB 3OYYA 1GFDA 4PJMA 2K4YA 4EDUA 2NUTB 3N5BB 4QVDA 4M7AA 2RJFA 5I22A 3HFOA 1QP2A 2MPXC 2LNVA 2KROA 4OMQA 2ZPFB 3UA7A 4JRQA 2NLUA 2V8KA 5GANd 3C12A 1VQLA 1OOTA 2NYSA 1YJNT 4RTTA 2RHUA 2CGHA 4QQGA 1G3YA 3OSVA 3VS7A 3FC3A 3CCVQ 1W2BP 1ABQA 4V2SA 2LQ8A 1D0ZA 3HFNA 2AKLA 2EW3A 5DY9A 2CP3A 2DPPB 1OZ2A 2LZ6B 2ZPGB 4M78F 2OAUA 2DYBA 4PK4A 5CK9A 2DE0X 1SHFA 4O5VA 3CCSA 5HCKA 2A28A 3SB2A 1K9MR 2O2OA 4KGZB 2QXFA 2JM9A 1VQOA 2PQWA 4M7AE 3JCMP 5FU7C 1KD1U 1YITQ 2FYKA 1MMAA 2EGAA 1VQ6T 2RHXA 4PJOA 1Y57A 4JPBW 4B9WA 2DXUA 1T3SA 3QG1A 1N9SA 4JS5A 4X9DA 2F1LA 1W2BS 1VQ9A 2NWMA 2GCXA 3GNFB 5KYUB 1SEMA 2C0OA 2HBPA 4LXCA 1B34A 3M0SA 4M75D 2HCKA 4N4IA 3PVLA 4O6JA 5CQYA 4WTOB 4OMPA 1N8RU 5GMKi 2K7AA 1RAFB 4DBQA 4CC7A 4X9CA 2OTJA 2ZZDA 2KRSA 3SFMA 2ZPIB 2ZPBB 2MMPA 3G6EQ 1M3BA 2QGGA 1NBEB 1Q81C 1OX9A 3CMAQ 1TWBA 3O5ZA 4FYVB 1MNDA 3L2RA 3VS0A 2HQHA 4HCBA 1SRLA 1Q7YU 4L59A 2BE9B 4HVUA 2MYSA 1NM7A 5ECAA 4PJOE 2HDAA 3M55A 3TQ7P 3QHSA 1QMCA 5GAN3 4LN2A 1YHQA 1BK2A 1J3TA 1E6HA 1ZSGA 2M02A 3H0FA 5LJ5d 2K3BA 2DM1A 1YJ9Q 1Y71A 5GMKh 3G4SA 4D8DA 1HD3A 1K0XA 2FRWA 2RK1A 4M78A 4PFPA 2CDTA 3G4ST 1Q86R 2KRMA 4FW1A 2X4YA 4OB1B 5CAIA 1PKTA 2F69A 1UGQB 2AIRB 2E41A 2D9TA 1IO6A 1I5OB 1WHLA 3A8MB 2ZPHB 4E7KA 3CD6Q 3E1SA 4BUGA 1QCFA 4C0DC 3BDLA 5DLQE 1IB8A 1IRXA 1ZBXA 2DX1A 4JZ3A 3RIRA 2KAFA 3ASKA 1RLPC 3VS2A 3HPWA 3CCJQ 4IIMA 3CCQA 3VRZA 2KXCA 2DJQA 4M78G 1YIJQ 2EGEA 2KDSA 3CCRT 5LJ3d 5CR2A 3OSSC 4Y92A 3SEMA 2AK5A 2A7YA 4ORZA 1AD5A 1VQ4A 1U1TA 4RTYA 5KE2A 2CZ6B 2RQWA 3RR6A 3PE0A 1HJDA 2MOXA 3UATA 2QEXQ 4A4HA 4IURA 1RUWA 1YI2Q 2D0NA 1D0XA 1PNJA 5GANh 3JB9D 2IG0A 4JJBA 3OYHA 3KXTA 3OW2P 1VQ8T 1BI3A 3EHQA 3A8LB 1Q7YR 1BI1A 1VYTA 3I5SA 5IT9E 4X1VA 2E5QA 1UDLA 2XI9A 3BDUA 4C8QB 2PNIA 3QZ9B 1S72T 3M58A 4HCZA 1ZHIA 1WHHA 2K6DA 4FL6A 3QDFA 5C6SA 2L89A 3C95A 2QA4Q 1R77A 3JAME 4PLLA 2QDLA 4C92G 3OYBA 3CPWS 4M7AD 1OX8A 2YUQA 3EG9B 4JRKA 3JCMb 4RCCA 3A8GB 2EWNA 1QVGA 5D7UA 1WYXA 3H6ZA 3EGUA 5KYXA 3PNWC 1NYGA 1RAAB 2LJ0A 5IHIA 3FEOA 1JJ2A 4GY5A 1TU0B 1YFNA 1BCMA 4II1A 1YJWQ 4OB3B 2VXFA 4KRTA 2QK0A 2L3QA 2DZ9A 3OW2S 1GCPA 2EYXA 2M0OA 2HL5C 4IUUA 2OTLT 4ME7A 4F04B 1AZGB 2BE7D 2G6FX 3I56Q 3GNGA 3EFRA 4CC2A 1O9SA 3H41A 1W1FA 3EAEA 2E65A 5I2MA 3O8VA 3FLGA 5KCOA 2LX7A 3JB9J 3HSBA 4PJJA 2GFAA 2KSSA 1PSFA 2LJ3A 4JLIA 4A4FA 2I0NA 2QTXA 5IXFA 4ELYC 2HNIA 4MZTA 1AT1B 4GLKA 3CCEA 1BB9A 5D6XA 3IQLA 4PJOD 2FHDA 4EIKA 1OU9A 3RUXA 1NJIC 4Q5WA 4BD3A 2VV5A 1GBQA 1FMVA 3GLXA 2E4HA 4LUEA 2NUZA 5A0LA 3CPFA 4FT2A 3RKXA 3G71T 1ARKA 1QKWA 2DVEA 2HD0A 1U1SA 4EMGA 5LJ5h 1LPLA 1AWXA 5KCHA 3E19A 2HKNA 1LNXA 1O75A 1VUBA 4JDSA 3CCMQ 2J6OA 3EFOA 3CMET 2RH2A 3EG2A 2GTJA 4M77C 3EGXB 1TTHB 2KEAA 4J9IA 3OYMA 3RBBB 3M57A 1VQ7Q 1HK9A 3CCLQ 1MUZA 3EG1A 2O88A 1BYMA 2KXDA 2OI3A 2J05A 1XTDA 3TSWA 1H641 2BTTA 5HKCA 2E5KA 5FWCA 2J7IA 4F16A 3L2UA 3CQTA 3ER0A 2DEUA 4RG2A 2ENMA 4MDWA 5GAMd 2RQUA 4MMKA 1C0MA 5GAN8 1C6VX 2EJ9A 4J9BA 1KC8R 1UJ0A 2LP5A 5LJ3h 4RG8A 2FPFA 1BU1A 4F17A 4MZPA 1X75C 3CC2A 2MWOA 4C5EA 2L3SA 1Y96A 3LGLA 3TSZA 4FCYA 2QQAA 2RA2A 2RM4A 3E2UA 1Q81U 1K73C 1ACMB 2JNGA 2RB6A 3M5AA 4C8QC 1VQPA 4JS4A 3BY7A 1RACB 8ATCB 4ZN1A 2E3IA 4QW2A 3QIIA 2EJGA 5KYYA 1IGQA 2KY9A 1VQPT 2K3YA 1VQ5A 5KYWA 5KE3A 2Z0WA 1WA7A 1HSQA 4J6XA 4AMCA 4DBHA 4J9GA 4LDXA 5GANg 2CT4A 4DA4A 2LQKA 2DVJA 3REBB 3A8OB 4XQ3A 4EMKB 1KSWA 2QASA 2HSPA 4M7DD 3UF4A 2MF2A 3EH2A 2MWPA 3JCMQ 4J9FA 3CPWA 1JO8A 2RMOA 5IAYA 1W70A 1RI9A 5CCAA 3CCVT 2HQXA 4LNPA 3OYIA 2E1HA 4PL6A 1K1ZA 2RPNA 3PT9A 2DERA 4ZGDB 4J5YA 2DD5A 2O4XB 3JCMd 4J6YA 3WXMB 2CP6A 3CBMA 3MEAA 4K11A 2RQVA 4M75B 2P4TA 1BI2A 4BE0A 3I55Q 2VC8A 1V76A 2CZ0B 2KR3A 3VS5A 5DM7R 1QCNA 4PNOA 1D1CA 2ZCFB 1K9MU 2FZKB 5J3BA 2COWA 4RTWA 2R57A 3CC7Q 2PUOB 3M0UA 1UJYA 4DQ2A 3CBOA 1YN8A 2CT3A 2K2VA 3HRTA 5A0DA 1RADB 5DLOA 3CC4Q 2KRNA 3LW5E 2ROTA 3LYIA 5M9OA 2DLPA 1YITT 3H8ZA 1G8XA 1HXDA 2V1RA 1QVFS 4E7ZA 2DXTA 1QVPA 2EBPA 3M9QA 5GAOp 1ZA1B 2XDDA 4XU0A 1OV3A 4A63B 1FYNA 3FDRA 4PJLA 2IPOB 3OYJA 3M4GA 2BZ8A 4JZ4A 2EPDA 4E7IA 2DTOA 3GPLA 2LJ1A 4JUVA 1K76A 2C0IA 4OP0A 1VQKQ 4HVWA 1SRMA 1RAGB 1YJNA 4WCIA 1KQ1A 4JLGA 1N27A 1W6XA 2D0QB 1IGUA 2B8AA 2EVRA 1QVGP 1VIEA 1UG1A 2JM8A 3TCJA 1E7OA 2E10A 2HQEA 2C06A 2FO0A 3L1AA 3JB9G 1SG5A 1JJ2P 3OMCA 2KMTA 5GJVB 2QQ9A 2XIDA 4KH1B 4PFOA 4CI0C 3QBYA 1M1KC 3OYAA 3I9QA 4BDYA 1FMKA 3HHTB 4QQ6A 4HVVA 2PTKA 1NE8A 1N5ZA 1RABB 5A0GA 3OYLA 2O9VA 1NG2A 3CCUQ 2AKKA 1YJ9T 2V8IA 3PVQA 3JB9I 3HKSA 5LL6S 2KYBA 4KUIA 4FSSA 1Q86U 2KT8A 4J9HA 1PRMC 1UE9A 1VOMA 2XDBA 1ZA2B 2JN0A 1VQ6A 2DA9A 4IUQA 4XTYA 2KNBB 5CKFA 5GAMh 2RHYA 1VQMQ 3OY9A 2EQIA 3VS3A 2DBKA 2DETA 1BIBA 2PUKB 3CXCA 2PVGB 1TG0A 2DO3A 2E6ZA 1D3BB 1QVGS 2YSQA 2RN8A 1OEBA 3NFCA 1OI1A 3RKWA 1JJ2S 2XHCA 3RMSA 3CCJT 5LJ3g 2OJ2A 4F7UG 5GMKe 1OZ3A 3M53A 1YIJT 4J9CA 3MCAB 4XK8E 3FJPA 1BBZA 1B07A 4EMKC 3DKMA 5CKEA 4N0AC 2CSQA 2M9UA 3A8HB 1I07A 4EPCA 4Y91A 2LCCA 3V8KA 3QWXX 4C92F 1PWTA 2FPDA 2QEXT 1D0YA 1YI2T 2FG0A 3SWNB 1K8AC 3P8DA 4BB7A 1WJQA 5GMKj 5GAOl 4M75C 1RI0A 1WPYA 3GF5A 4PJNA 2FZGB 2KI7A 2XKOC 4TVRA 2GTOA 4D6WA 4XTUA 2JMAA 4M77G 2DFUA 2X51A 2LNHB 4C5HA 2DKGA 1XQHA 1NZ9A 4F7UB 3JCMJ 3BFMA 1WFWA 2QGFB 3OA6A 4OMNA 1CSKA 3JCMh 1IREB 2YDLA 5GAN7 1M3AA 2DL8A 1VQLQ 4OGEA 4RTZA 2LCLA 1H8KA 4QT7A 1WHJA 2CZ1B 4KT0E 1NPRA 1XJWB 5GANe 2YRDA 1UTIA 1TUCA 5GAOm 3P8HA 1QVFA 4QVZA 4XU3A 2D8JA 1M8VA 4DOWA 2RQTA 4PJOB 3HRUA 3E9GA 2LQWA 2M0YA 2C0TA 2SEMA 4M77B 1YJWT 2FPEA 2RD1A 4AFQC 4E7JA 2Y4XA 3MKDA 3CCRA 3QPHA 3S6WA 3CCSQ 2FZCB 3PMIA 4LD9K 1YP5A 2RNAA 4C8QG 3JCMc 2X3XD 3OYKA 5GANj 1VQOQ 3THKA 4FYXB 2DILA 3UT1A 3CPWP 1VYUA 4E7LA 5GAOn 3NTKA 2RJDA 4E2FB 2F5KA 3L2ZA 1NJIR 3EH1A 4KUDK 2AZSA 2DEQA 5FU6B 1AWOA 2H3JA 2P0PA 2CP5A 4A4GA 2KK4A 4EMHA 4M78E 1VQ8A 3L2WA 1VQ9Q 5GANf 2XD0A 4ZN3A 3MPUB 2PVOB 2PU9B 2DD4A 3QKJA 5FLXE 4C92A 2RJEA 3OYDA 2EIFA 1M90C 6AT1B 2KQWA 1QKXA 1S72A 4XU2A 1PHTA 2XG8D 2L3PA 5C0MA 2V26A 3OBWA 2OTJQ 1H3HA 2KBTA 5GJWB 2JOYA 1S1NA 3MEUA 2K79A 3DLMA 4XTZA 2RF0A 2E64A 3NTIA 1ZSZA 1G3SA 2JS2A 1UECA 1Q82C 4C0ZA 4M7DG 5I11A 3I35A 4E47A 3CCMT 2KYMA 2R5AA 3OBYA 1PCXA 3CCLA 1LCKA 2MAMA 3UDCA 1JQQA 2RQRA 3MP8A 4BI3A 4LE9A 7AT1B 3QUIA 4Z02A 2D1XA 5CO7A 1YHQQ 3CCLT 2DYIA 2HEQA 4JRPA 4CRIA 1V1CA 4LDWA 2VWFA 1M2VB 2CREA 3FRNA 1VQNA 2NUPB 1T0JA 1KHCA 3G4SQ 3M0TA 4M75F 5HK3A 2OTLA 4AFZC 4A4KA 4C92E 4A53A 2JS0A 1IHVA 5GAMg 1VQNT 1B3QA 5CKDA 4M7AC 1BI0A 3RESA 3LLRA 5LJ5e 1U8RA 1Y7XA 1K73R 4KGVB 1KC8U 1KFZA 2MCNA 4M7DB 4OB0B 1HYOA 3VS6A 2D8HA 4OMLA 3SWNC 3GIBA 5FRMA 4AG1C 3OMGA 1QP3A 1VYVA 1C1AA 3MO8A 2JMCA 2HMAA 1KD1C 3CCQQ 1JXOA 1KK7A 3QXEB 3CBPA 2GFUA 2YHTA 4BE1A 5CQXA 1I8FA 2E70A 4DBFA 2VKNA 1VQ4Q 2A37A 3GOXA 3RERA 4D8KA 5D6WA 3G71A 1QLYA 5LJ3e 3OYNA 3SHWA 1WNLA 4MZMA 4QQDA 5HY6A 3R6OA 4FSXA 1N8RC 3CXCP 1R8OB 2COZA 3CMEA 2JXBA 2EFIA 2HAXA 1R0CB 2RHZA 4JJCA 2LCSA 1X43A 2OAWA 4PJOC 4LUDA 3JCMg 2QDYB 3PGGA 3Q1JA 1BKBA 2EJFA 4N4HA 2X9HA 2F2XA 2ECZA 4EMKA 2E6NA 5A2QE 4VUBA 3BW1A 4N0AA 4X34A 2ROLA 1MGQA 5EC7A 5LJ3j 3I55T 1A0NB 2A36A 1Z9ZA 2DL4A 2YT6A 4BI4A 2F5TX 3JCMV 3MHXA 4E6RA 5I2SA 2FB7A 1N6AA 3RNJA 2BZXA 5FU6C 3CEYA 5D6YA 3CC7T 2QTVA 4M75A 2DK3A 2VGMA 3LH5A 3CC4T 5LJ3f 1QWFA 1ZQ1A 2YLBA 2CH4W 4HKEA 4NS5A 4FU6A 1GFCA 1QCOA 2EYQA 4J83A 9ATCB 1NYFA 3M54A 3JB9F 3CXCS 4M78D 3QYGB 3VJPA 1JEGA 5GAN6 2RK2A 2DZCA 4QVCA 2EQUA 1WXBA 1GRIA 1M30A 1OPKA 1G83A 2QAZA 2KGTA 4J9EA 1SSFA 2DL5A 1GCQC 1K8AU 1TOVA 4M75G 4XU1A 2EYZA 1TS9A 4FIBA 2BUDA 3QO3A 1EX4A 1VQKT 1ZBJA 3V7RA 4CC4B 4OF1A 1LJOA 2HZYA 3M0QA 1UGSB 3L2VA 4KH0B 1M1KR 2ZGWA 5AYFA 3KUFA 2DJZA 2EGCA 2YUNA 2YRVA 3NMZC 4R0KA 1QVFP 3OYFA 2CZ7B 4XAXB 3CCVA 3OYGA 2DBMA 2GBQA 2QI2A 3WVDB 3U23A 3M56A 3MEWA 3ULRB 3JCMX 2NUTA 1KQ2A 2CSIA 2JT4A 1PD0A 4C0GA 1ZUUA 2DTIA 3CCEQ 1ZUYA 3EFOB 1WLPB 1PG5B 4LDYA 3URGA 1WJRA 2QG9B 1N9RA 3UA6A 3EG0A 1OYXA 2LQNA 2JTFA 3I5RA 3FJ5A 4F7UF 2ED0A 3CCUT 4DEYA 1AWWA 2CUDA 4C92D 4M7DC 1K9AA 1I5LA 1JB0E 3ME9A 5IXBA 5GAOq 1SKUB 2WSFE 3M59A 2K5LA 1YITA 1I81A 1WHKA 3FIFA 2YUOA 2CS7A 1QWEA 3C94A 1X2QA 1VQMT 2O31A 5GAN2 3EHRA 2EKHA 2EAYA 1IHWA 2BKDN 3LGFA 1RL2A 1UGPB 1H3ZA 2P0QA 1WHGA 1OQKA 2JTMA 4FM4B 4M77F 3BE3A 3X28B 4Y28E 1G3WA 2YLCA 3META 1D3BA 1K8AR 2DRMA 4ZTJA 5KYYB 1ABOA 3G6EA 2HKQB 5IH2A 5GAMe 2IIMA 2FEIA 1AZEA 3CMAA 3CC2Q 1PRLC 5KYUA 3G6ET 1OPLA 3V7SA 4ZGJB 3VYGA 1M4ZA 1AHJB 3EG3A 1SHGA 1YWPA 3CMAT 1WJSA 2WACA 4RUGA 1Q82U 1M2OA 3HP9A 1VQPQ 1GBRA 1PC0A 2LDMA 3V7CA 2ESWA 2QQBA 4J6WA 4XTWA 4Z89A 1VQ5Q 4BE2A 1AVZC 2YUPA 2QQSA 1YJ9A 1B7TA 3KBGA 5LJ5g 3SWNA 2LRQA 5GAMj 4RTXA 3LWIA 1WZOA 3EGDB 4PFZA 3PIPA 3M0RA 5I21A 3QSUA 1M9SA 4C8QF 1WX6A 1VQLT 2WSCE 3F70A 2DTHA 3VS4A 1MMDA 5FRNA 4OMOA 4C5IA 4F7UA 4A54A 2BZYA 2K3XA 3T9NA 2X35A 4J7FA 4M7AG 1M3CA 2H8HA 3SD4A 5GAMf 3CD6A 3ZL7C 1Q95G 2X4XA 3LWHA 4IUTA 4L5GA 5GMKl 3CD6T 2ZPEB 3CCJA 1PKSA 4OMFB 1V29B 2K5IA 3JCMe 1GXIE 4AG2C 1YIJA 1G2BA 4HA8A 3J7AF 3CCST 4QKUA 4AFSC 2ABLA 5GAN5 1LOJA 2CKKA 1CKBA 2CH4A 1VQOT 1H92A 1ZLMA
chains in the Genus database with same CATH topology
1AWXA 1M27C 1QKXA 2GNCA 3VS1A 2J6OA 2PZ1A 1X2KA 1PHTA 2L3PA 2GTJA 3EG2A 2XMFA 1SSHA 1MV0B 2KEAA 1VA7A 1H3HA 4J9IA 2KBTA 5GJWB 3RBBB 3VRYA 2P4RA 1YWOA 1S1NA 2DNUA 2K79A 2RF0A 1NEGA 2JS2A 2MIOA 1MUZA 3EG1A 1UECA 2O88A 2KXDA 1WXTA 5I11A 1X69A 3I35A 1TUDA 2OI3A 2J05A 4AFUC 1U3OA 1I0CA 2JW4A 3TSWA 2DF6A 2CUBA 2BTTA 1I1JA 2E5KA 2DL7A 2EYYA 5FWCA 2KYMA 2J7IA 4F16A 3CQTA 1LCKA 2F2VA 4Z8AA 2ENMA 1E6GA 1JQQA 2RQRA 4LE9A 1X27A 1UHFA 2RQUA 1KIKA 2D1XA 2A08A 1WDXA 1CKAA 4J9BA 4RTUA 2DL3A 2HEQA 2SRCA 1UJ0A 1V1CA 2LP5A 4GBQA 1U5SA 2VWFA 2CREA 2FPFA 3M0PA 1GFDA 1BU1A 4F17A 1T0JA 2M51A 3M0TA 4M4ZA 1T0HA 1WI7A 4AFZC 2L3SA 5I22A 3TSZA 2JS0A 2KROA 4OMQA 1B3QA 3UA7A 4GLMA 1GCQA 1OOTA 4RTVA 1KFZA 2MCNA 4RTTA 3H0HA 3VS7A 3VS6A 2D8HA 4OMLA 1X6BA 1WA7A 1HSQA 1ABQA 4AG1C 2AKLA 4J9GA 1VYVA 4ESRA 2EW3A 2JMCA 2CT4A 3NHNA 2DVJA 3REBB 1KSWA 2HSPA 2LZ6B 2W10A 3UF4A 1JXOA 4J9FA 2DYBA 1JO8A 2DE0X 1SHFA 2RMOA 1AEYA 1W70A 1RI9A 4LNPA 2O9SA 2FRYA 1K1ZA 2RPNA 2VKNA 5HCKA 2A28A 1T3LA 1UUEA 2A37A 2O2OA 4D8KA 1XOVA 1QLYA 2JM9A 3SHWA 4K11A 2RQVA 3JV3A 3H0IA 1NLPC 2EGAA 2J06A 2KR3A 3VS5A 2JXBA 1Y57A 4JPBW 1T3SA 4JJCA 2LCSA 1X43A 2OAWA 4LUDA 2LMJA 2F2XA 2NWMA 4RTWA 3M0UA 1UJYA 2ECZA 1SEMA 2C0OA 1YN8A 2CT3A 4HCKA 2KRNA 2ROTA 3M0SA 1YCSB 2HCKA 2ROLA 2DLPA 1ZX6A 1WIEA 5EC7A 3PVLA 4OMPA 5FWBA 1A0NB 2V1RA 2A36A 1Z9ZA 2K7AA 2DL4A 2EBPA 2KT1A 4CC7A 2YT6A 1OV3A 4A63B 2KRSA 1NEBA 4E6RA 1FYNA 4DEXA 4J9DA 3RNJA 2BZXA 2BZ8A 1M3BA 3TVTA 4JZ4A 2EPDA 3GBQA 3O5ZA 3C0CA 2LJ1A 3LH5A 2DMOA 1K76A 2C0IA 3VS0A 1QWFA 2ED1A 1SRLA 2CH4W 4HVWA 2B86A 1SRMA 1GFCA 1UFFA 4HVUA 1NYFA 1NM7A 5ECAA 2HDAA 4LN2A 1JEGA 1BK2A 4WCIA 2J6FA 1J3TA 1W6XA 1WXBA 1E6HA 2EVRA 1ZSGA 1GRIA 1M30A 1OPKA 1G83A 1UG1A 1UGVA 2JM8A 2KGTA 3H0FA 4J9EA 2DL5A 2K3BA 2DM1A 1E7OA 2L2PA 1GCQC 2FO0A 2VVKA 1K4US 4D8DA 1HD3A 2EYZA 1K0XA 2FRWA 4OMMA 5GJVB 1ZBJA 2DRKA 2W0ZA 4CC4B 3R6NA 2CDTA 3M0QA 3I9QA 2KRMA 4ZNXA 1FMKA 2JTEA 1X6GA 1PKTA 2EGCA 2PTKA 4HVVA 2YUNA 3NMZC 4R0KA 1N5ZA 2F2WA 1IO6A 2O9VA 2DBMA 2GBQA 1NG2A 2AKKA 3KFVA 3U23A 3ULRB 3A98A 1QCFA 3PVQA 2CSIA 2JT4A 1ZUUA 2DX1A 4JZ3A 2KYBA 1ZUYA 4FSSA 2KT8A 1RLPC 1WLPB 3VS2A 4J9HA 1PRMC 1UE9A 4IIMA 3VRZA 2KXCA 2DA9A 2DJQA 2EGEA 3UA6A 3EG0A 2KNBB 4Y92A 3SEMA 5IHNA 1SPKA 2LQNA 3I5RA 2EQIA 3FJ5A 3VS3A 2AK5A 2DBKA 2ED0A 2K9GA 1EFNA 4ORZA 4DEYA 1AD5A 1AWWA 2CUDA 1TG0A 1K9AA 2YSQA 2J6KA 2RN8A 1OEBA 5IXBA 1NLOC 1AOJA 4RTYA 5FW9A 2RQWA 1JXMA 2L0AA 3PE0A 2OJ2A 1HJDA 2MOXA 2YUOA 3UATA 1U06A 1RUWA 1QWEA 4J9CA 2D0NA 2V1QA 1PNJA 1BBZA 1X2QA 1B07A 1RLQC 2O31A 4JJBA 3EHRA 2EKHA 3EHQA 4F14A 2CSQA 1M8MA 1VYTA 1I07A 3I5SA 1AWJA 4X1VA 3NGPA 1UDLA 3QWXX 2PNIA 1PWTA 2FPDA 2K6DA 5IHKA 2FG0A 4CC3A 2KE9A 3QWYA 2DRMA 1MV3A 1ABOA 2GGRA 2GTOA 2QDLA 5IH2A 2JMAA 2IIMA 2FEIA 2LNHB 2YUQA 1AZEA 1PRLC 1WFWA 1OPLA 4OMNA 1CSKA 2YDLA 3EG3A 1SHGA 1WYXA 3EGUA 1YWPA 1NYGA 1GL5A 1M3AA 4RUGA 2DL8A 2LJ0A 1ZUKA 1GBRA 4RTZA 5IHIA 1H8KA 1WXUA 2ESWA 4QT7A 4KRTA 2L3QA 4Z89A 1GCPA 2EYXA 1AVZC 2X3WD 5L23A 1UTIA 2YUPA 1TUCA 1JU5C 1Z9QA 2K2MA 1AZGB 2HBWA 4RTXA 4IIOA 4HXJA 2G6FX 2GQIA 2D8JA 3NPFA 3M0RA 2RQTA 1WX6A 4CC2A 3H41A 2EYWA 1W1FA 2LQWA 2M0YA 2C0TA 3VS4A 2SEMA 2FPEA 4AFQC 4OMOA 2BZYA 2LX7A 1M3CA 2H8HA 1YP5A 2RNAA 3ZL7C 1Y0MA 2LJ3A 2X3XD 2I0NA 5IXFA 3THKA 2DILA 1K0SA 1YNZA 1VYUA 1BB9A 3IQLA 4EIKA 1UHCA 1PKSA 1KJWA 1GBQA 2AZSA 1AWOA 4AG2C 4LUEA 2AZVA 2NUZA 1G2BA 4AFSC 2ABLA 3REAB 1ARKA 1QKWA 1CKBA 2CH4A 1H92A 4JJDA 4Z88A 1ZLMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AWX A;  1M27 C;  1QKX A;  2GNC A;  3VS1 A;  2J6O A;  2PZ1 A;  1X2K A;  1PHT A;  2L3P A;  2GTJ A;  3EG2 A;  2XMF A;  1SSH A;  1MV0 B;  2KEA A;  1VA7 A;  1H3H A;  4J9I A;  2KBT A;  5GJW B;  3RBB B;  3VRY A;  2P4R A;  1YWO A;  1S1N A;  2DNU A;  2K79 A;  2RF0 A;  1NEG A;  2JS2 A;  2MIO A;  1MUZ A;  3EG1 A;  1UEC A;  2O88 A;  2KXD A;  1WXT A;  5I11 A;  1X69 A;  3I35 A;  1TUD A;  2OI3 A;  2J05 A;  4AFU C;  1U3O A;  1I0C A;  2JW4 A;  3TSW A;  2DF6 A;  2CUB A;  2BTT A;  1I1J A;  2E5K A;  2DL7 A;  2EYY A;  5FWC A;  2KYM A;  2J7I A;  4F16 A;  3CQT A;  1LCK A;  2F2V A;  4Z8A A;  2ENM A;  1E6G A;  1JQQ A;  2RQR A;  4LE9 A;  1X27 A;  1UHF A;  2RQU A;  1KIK A;  2D1X A;  2A08 A;  1WDX A;  1CKA A;  4J9B A;  4RTU A;  2DL3 A;  2HEQ A;  2SRC A;  1UJ0 A;  1V1C A;  2LP5 A;  4GBQ A;  1U5S A;  2VWF A;  2CRE A;  2FPF A;  3M0P A;  1GFD A;  1BU1 A;  4F17 A;  1T0J A;  2M51 A;  3M0T A;  4M4Z A;  1T0H A;  1WI7 A;  4AFZ C;  2L3S A;  5I22 A;  3TSZ A;  2JS0 A;  2KRO A;  4OMQ A;  1B3Q A;  3UA7 A;  4GLM A;  1GCQ A;  1OOT A;  4RTV A;  1KFZ A;  2MCN A;  4RTT A;  3H0H A;  3VS7 A;  3VS6 A;  2D8H A;  4OML A;  1X6B A;  1WA7 A;  1HSQ A;  1ABQ A;  4AG1 C;  2AKL A;  4J9G A;  1VYV A;  4ESR A;  2EW3 A;  2JMC A;  2CT4 A;  3NHN A;  2DVJ A;  3REB B;  1KSW A;  2HSP A;  2LZ6 B;  2W10 A;  3UF4 A;  1JXO A;  4J9F A;  2DYB A;  1JO8 A;  2DE0 X;  1SHF A;  2RMO A;  1AEY A;  1W70 A;  1RI9 A;  4LNP A;  2O9S A;  2FRY A;  1K1Z A;  2RPN A;  2VKN A;  5HCK A;  2A28 A;  1T3L A;  1UUE A;  2A37 A;  2O2O A;  4D8K A;  1XOV A;  1QLY A;  2JM9 A;  3SHW A;  4K11 A;  2RQV A;  3JV3 A;  3H0I A;  1NLP C;  2EGA A;  2J06 A;  2KR3 A;  3VS5 A;  2JXB A;  1Y57 A;  4JPB W;  1T3S A;  4JJC A;  2LCS A;  1X43 A;  2OAW A;  4LUD A;  2LMJ A;  2F2X A;  2NWM A;  4RTW A;  3M0U A;  1UJY A;  2ECZ A;  1SEM A;  2C0O A;  1YN8 A;  2CT3 A;  4HCK A;  2KRN A;  2ROT A;  3M0S A;  1YCS B;  2HCK A;  2ROL A;  2DLP A;  1ZX6 A;  1WIE A;  5EC7 A;  3PVL A;  4OMP A;  5FWB A;  1A0N B;  2V1R A;  2A36 A;  1Z9Z A;  2K7A A;  2DL4 A;  2EBP A;  2KT1 A;  4CC7 A;  2YT6 A;  1OV3 A;  4A63 B;  2KRS A;  1NEB A;  4E6R A;  1FYN A;  4DEX A;  4J9D A;  3RNJ A;  2BZX A;  2BZ8 A;  1M3B A;  3TVT A;  4JZ4 A;  2EPD A;  3GBQ A;  3O5Z A;  3C0C A;  2LJ1 A;  3LH5 A;  2DMO A;  1K76 A;  2C0I A;  3VS0 A;  1QWF A;  2ED1 A;  1SRL A;  2CH4 W;  4HVW A;  2B86 A;  1SRM A;  1GFC A;  1UFF A;  4HVU A;  1NYF A;  1NM7 A;  5ECA A;  2HDA A;  4LN2 A;  1JEG A;  1BK2 A;  4WCI A;  2J6F A;  1J3T A;  1W6X A;  1WXB A;  1E6H A;  2EVR A;  1ZSG A;  1GRI A;  1M30 A;  1OPK A;  1G83 A;  1UG1 A;  1UGV A;  2JM8 A;  2KGT A;  3H0F A;  4J9E A;  2DL5 A;  2K3B A;  2DM1 A;  1E7O A;  2L2P A;  1GCQ C;  2FO0 A;  2VVK A;  1K4U S;  4D8D A;  1HD3 A;  2EYZ A;  1K0X A;  2FRW A;  4OMM A;  5GJV B;  1ZBJ A;  2DRK A;  2W0Z A;  4CC4 B;  3R6N A;  2CDT A;  3M0Q A;  3I9Q A;  2KRM A;  4ZNX A;  1FMK A;  2JTE A;  1X6G A;  1PKT A;  2EGC A;  2PTK A;  4HVV A;  2YUN A;  3NMZ C;  4R0K A;  1N5Z A;  2F2W A;  1IO6 A;  2O9V A;  2DBM A;  2GBQ A;  1NG2 A;  2AKK A;  3KFV A;  3U23 A;  3ULR B;  3A98 A;  1QCF A;  3PVQ A;  2CSI A;  2JT4 A;  1ZUU A;  2DX1 A;  4JZ3 A;  2KYB A;  1ZUY A;  4FSS A;  2KT8 A;  1RLP C;  1WLP B;  3VS2 A;  4J9H A;  1PRM C;  1UE9 A;  4IIM A;  3VRZ A;  2KXC A;  2DA9 A;  2DJQ A;  2EGE A;  3UA6 A;  3EG0 A;  2KNB B;  4Y92 A;  3SEM A;  5IHN A;  1SPK A;  2LQN A;  3I5R A;  2EQI A;  3FJ5 A;  3VS3 A;  2AK5 A;  2DBK A;  2ED0 A;  2K9G A;  1EFN A;  4ORZ A;  4DEY A;  1AD5 A;  1AWW A;  2CUD A;  1TG0 A;  1K9A A;  2YSQ A;  2J6K A;  2RN8 A;  1OEB A;  5IXB A;  1NLO C;  1AOJ A;  4RTY A;  5FW9 A;  2RQW A;  1JXM A;  2L0A A;  3PE0 A;  2OJ2 A;  1HJD A;  2MOX A;  2YUO A;  3UAT A;  1U06 A;  1RUW A;  1QWE A;  4J9C A;  2D0N A;  2V1Q A;  1PNJ A;  1BBZ A;  1X2Q A;  1B07 A;  1RLQ C;  2O31 A;  4JJB A;  3EHR A;  2EKH A;  3EHQ A;  4F14 A;  2CSQ A;  1M8M A;  1VYT A;  1I07 A;  3I5S A;  1AWJ A;  4X1V A;  3NGP A;  1UDL A;  3QWX X;  2PNI A;  1PWT A;  2FPD A;  2K6D A;  5IHK A;  2FG0 A;  4CC3 A;  2KE9 A;  3QWY A;  2DRM A;  1MV3 A;  1ABO A;  2GGR A;  2GTO A;  2QDL A;  5IH2 A;  2JMA A;  2IIM A;  2FEI A;  2LNH B;  2YUQ A;  1AZE A;  1PRL C;  1WFW A;  1OPL A;  4OMN A;  1CSK A;  2YDL A;  3EG3 A;  1SHG A;  1WYX A;  3EGU A;  1YWP A;  1NYG A;  1GL5 A;  1M3A A;  4RUG A;  2DL8 A;  2LJ0 A;  1ZUK A;  1GBR A;  4RTZ A;  5IHI A;  1H8K A;  1WXU A;  2ESW A;  4QT7 A;  4KRT A;  2L3Q A;  4Z89 A;  1GCP A;  2EYX A;  1AVZ C;  2X3W D;  5L23 A;  1UTI A;  2YUP A;  1TUC A;  1JU5 C;  1Z9Q A;  2K2M A;  1AZG B;  2HBW A;  4RTX A;  4IIO A;  4HXJ A;  2G6F X;  2GQI A;  2D8J A;  3NPF A;  3M0R A;  2RQT A;  1WX6 A;  4CC2 A;  3H41 A;  2EYW A;  1W1F A;  2LQW A;  2M0Y A;  2C0T A;  3VS4 A;  2SEM A;  2FPE A;  4AFQ C;  4OMO A;  2BZY A;  2LX7 A;  1M3C A;  2H8H A;  1YP5 A;  2RNA A;  3ZL7 C;  1Y0M A;  2LJ3 A;  2X3X D;  2I0N A;  5IXF A;  3THK A;  2DIL A;  1K0S A;  1YNZ A;  1VYU A;  1BB9 A;  3IQL A;  4EIK A;  1UHC A;  1PKS A;  1KJW A;  1GBQ A;  2AZS A;  1AWO A;  4AG2 C;  4LUE A;  2AZV A;  2NUZ A;  1G2B A;  4AFS C;  2ABL A;  3REA B;  1ARK A;  1QKW A;  1CKB A;  2CH4 A;  1H92 A;  4JJD A;  4Z88 A;  1ZLM A; 
#chains in the Genus database with same CATH topology
 4M77 A;  1M5Q 1;  1M27 C;  1NJI U;  5L8R E;  1M90 R;  3VU3 C;  3VS1 A;  1X2K A;  3PTA A;  4M7D F;  2QEX A;  4UC4 A;  4M7A B;  3PMT A;  1VA7 A;  2RHI A;  1YI2 A;  3VRY A;  3RMQ A;  1FMW A;  3D7S B;  4F7U E;  4IKF A;  2DNU A;  1VQ9 T;  1G3T A;  5GMK m;  1NEG A;  4J7I A;  3JCM W;  1Q82 R;  1TUD A;  1NPP A;  3ZEH A;  2DF6 A;  4KGX B;  4PJO G;  2DL7 A;  2EYY A;  4HCC A;  4YTL A;  2QYZ A;  2MI6 A;  3HL8 A;  2RI3 A;  3S3M A;  1UGR B;  2ZAE A;  4ZTF A;  2F2V A;  2OTJ T;  1X27 A;  1UHF A;  3JCM f;  2QA4 A;  1YJN Q;  2E3H A;  2A08 A;  1WDX A;  4RTU A;  2GF7 A;  2SRC A;  4GBQ A;  1KG1 A;  1X01 A;  2QA4 T;  3M0P A;  2M51 A;  4M4Z A;  1T0H A;  1WI7 A;  2PVD B;  4A4E A;  2XK0 A;  1QQJ A;  4AT1 B;  4C0F A;  2K57 A;  4C8Q A;  4M77 E;  1FX7 A;  4GLM A;  1GCQ A;  4ANJ A;  3GP8 A;  1UEB A;  1KQS A;  3OB9 A;  4JRI A;  4PKC C;  4RTV A;  2VXE A;  1YHQ T;  3ZBD A;  1UB4 A;  1YJW A;  3H0H A;  4LD6 A;  4HT8 A;  2VAS A;  2A0F B;  3HTR A;  2RJC A;  1X6B A;  4XTV A;  1MMG A;  3TRE A;  3EG9 A;  5GAN 4;  2GQV A;  1WHM A;  4ESR A;  4HT9 A;  2Y90 A;  3LH0 A;  2E12 A;  1IXD A;  4MML A;  3I56 A;  3NHN A;  2R5M A;  3RKY A;  1K73 U;  1KD1 R;  3L2Q A;  1VQ6 Q;  3S3O A;  1M2V A;  1MNE A;  2W10 A;  1B34 B;  3J81 E;  2NUP A;  3I56 T;  2IVW A;  1AEY A;  2O9S A;  2FRY A;  3OS2 A;  2BIV A;  1M1G A;  1K9M C;  1T3L A;  1UUE A;  4IUV A;  3DB4 A;  1QW1 A;  1XOV A;  4PLI A;  4JJN K;  1MHN A;  1R0B G;  4ZGE B;  1EIF A;  3UWN A;  1WQ7 A;  4M7D A;  1PSE A;  3JV3 A;  3H0I A;  4C8Q E;  1NLP C;  3CCQ T;  2J06 A;  2DXB A;  1N8R R;  3EFS A;  3QJ6 A;  2HL3 A;  2OX7 A;  4RMO A;  2LMJ A;  4IUP A;  1VQ4 T;  2M16 A;  1W4S A;  3X24 B;  4HCK A;  4MDX A;  1YCS B;  4NOY A;  5CVI A;  1ZX6 A;  1WIE A;  2WSE E;  2RI5 A;  5FWB A;  3CCM A;  4FYW B;  3OS0 A;  3JRZ A;  2KT1 A;  1D1B A;  1EZZ B;  1NEB A;  1VQ7 A;  2VB6 A;  3JB9 H;  4M78 B;  4DEX A;  4J9D A;  4E7H A;  4WF2 A;  3TVT A;  1BIA A;  2LC4 A;  2DIQ A;  3QYH B;  4R55 A;  3GBQ A;  4OVA A;  1VQ7 T;  3C0C A;  4NL2 A;  2DMO A;  1P92 A;  1YBY A;  3HRS A;  2ED1 A;  5IN1 A;  1YCY A;  1F1B B;  4M7D E;  3X26 B;  2B86 A;  1UFF A;  2JVV A;  3EGX A;  1RAI B;  4XTX A;  3PIO A;  2J6F A;  2RI2 A;  2K5F A;  1UGV A;  2L2P A;  2JUF A;  4C5G A;  2VVK A;  1K4U S;  2MK5 A;  1SF9 A;  4LDU A;  4OMM A;  1W2B A;  2DRK A;  1Q86 C;  2X4J A;  3R6N A;  4BAC A;  5HK0 A;  4ZNX A;  2JTE A;  1X6G A;  1WQW A;  1MMN A;  3A1P A;  3CCR Q;  2F2W A;  2RO0 A;  2G3R A;  3S3N A;  2L5Q A;  1JBM A;  3TEE A;  2JZ2 A;  2AHJ B;  3KFV A;  1Y07 A;  3A98 A;  3VV0 A;  1G5V A;  5GAO r;  2P0K A;  4C92 B;  5LJ5 j;  1RAH B;  3VYH B;  3NTH A;  2P84 A;  1M1K U;  2Y4Y A;  4BY6 B;  2O01 E;  2CP7 A;  3M4Y A;  2A3L A;  4FYY B;  3A5Z B;  2LT4 A;  2LVM A;  2YXY A;  5KH6 A;  4NL3 A;  4RCB A;  3X25 B;  5IHN A;  1SPK A;  3VUB A;  3AHU A;  1ZSZ B;  1PM3 A;  1VQ8 Q;  2K9G A;  1EFN A;  5LJ5 f;  2ATC B;  4OB2 B;  3VUZ A;  2J6K A;  4M77 D;  3DLL A;  1NLO C;  3CCE T;  1AOJ A;  2V8J A;  2YWW A;  4LDV A;  5FW9 A;  1JXM A;  2L0A A;  1S72 Q;  2AT1 B;  3MEV A;  3QZ5 B;  3I55 A;  1U06 A;  3QJY A;  4FT4 A;  5CIU A;  2V1Q A;  3JSC A;  4BI8 B;  1RLQ C;  5KYX B;  4OGC A;  2LT1 A;  1Q7Y C;  4F14 A;  2VGN A;  1M8M A;  3C4S A;  1DJ7 B;  3CC7 A;  1AWJ A;  3OYE A;  3NGP A;  2O4X A;  2L3R A;  3CC4 A;  1OU8 A;  1IZ6 A;  2M1H A;  1FWZ A;  4J8O A;  3MJX A;  5IHK A;  1M1F A;  2FL7 A;  4B6M A;  1D1A A;  2YRC A;  4CC3 A;  3P8B B;  1FXX A;  2KE9 A;  8AT1 B;  3QWY A;  3RDV A;  1MV3 A;  2GGR A;  4DBR A;  2EQM A;  5AT1 B;  1VQN Q;  3OS5 A;  1BCO A;  4C8Q D;  2OTL Q;  3G7Z A;  1I4K 1;  3MP6 A;  2VYT A;  1VQK A;  1GL5 A;  2HSE B;  1OUL A;  4FW2 A;  3V8J A;  1ZUK A;  3MP1 A;  1WXU A;  3V8L A;  4R56 A;  5J39 A;  3J80 E;  3PFS A;  2X3W D;  5FU7 B;  5J26 A;  5L23 A;  3CC2 T;  4M78 C;  1KQS P;  1JU5 C;  1Z9Q A;  3VKI A;  2K2M A;  2DXC A;  2HBW A;  4IIO A;  4HXJ A;  3E9F A;  4P5N A;  2GQI A;  4M7A F;  3NPF A;  1D09 B;  3H9N A;  4RKU E;  4M75 E;  3AT1 B;  4ATO A;  2EYW A;  1PD1 A;  1XNI A;  1JRI A;  1LVK A;  5FRO A;  2LTO A;  3SDZ A;  3LX7 A;  2DIG A;  1VQ5 T;  3G1J A;  3CCU A;  2FVU A;  2DAQ A;  1Y0M A;  3G71 Q;  2D6F A;  1WGS A;  2EQJ A;  2EQK A;  4KBM B;  4E7S A;  1K0S A;  1YNZ A;  3UPU A;  1TXQ A;  1VIF A;  1KHI A;  2LX9 A;  1TH7 A;  2COY A;  1TUG B;  2QQR A;  1UHC A;  3CME Q;  1KJW A;  2KVQ G;  2X4W A;  2AZV A;  2CYZ B;  5CKB A;  3OQ5 A;  2CP0 A;  2XDP A;  3DB3 A;  1VQM A;  4KUL A;  3EGD A;  2H3E B;  3REA B;  2XIC A;  3QDR B;  3X20 B;  4JJD A;  4Z88 A;  2R58 A;  2W0Z A;  2I2L A;  3OW2 A;  5KYN A;  1KQS S;  4N4G A;  2XU8 A;  2GNC A;  3OYC A;  4BDZ A;  2CP2 A;  2PZ1 A;  4C92 C;  4DOV A;  3L42 A;  2XMF A;  1X6O A;  1SSH A;  1MV0 B;  1Y96 B;  5CKH A;  3FB9 A;  4PJO F;  2P4R A;  4BY6 C;  2L8D A;  1YWO A;  1TSF A;  4L6V 5;  2MIO A;  3TU4 K;  4ELZ C;  1WXT A;  1X69 A;  3ZFJ A;  1ZSZ C;  4AFU C;  1M90 U;  1U3O A;  1I0C A;  2JW4 A;  2CUB A;  1I1J A;  1RAE B;  2EKO A;  5KYW B;  2JJ9 A;  2VUB A;  3INZ A;  4Z8A A;  1E6G A;  5EG2 A;  1Q81 R;  1KIK A;  3OS1 A;  1KC8 C;  1CKA A;  2DL3 A;  1U5S A;  4B9X A;  4C0D B;  3WVE B;  3OYY A;  1GFD A;  4PJM A;  2K4Y A;  4EDU A;  2NUT B;  3N5B B;  4QVD A;  4M7A A;  2RJF A;  5I22 A;  3HFO A;  1QP2 A;  2MPX C;  2LNV A;  2KRO A;  4OMQ A;  2ZPF B;  3UA7 A;  4JRQ A;  2NLU A;  2V8K A;  5GAN d;  3C12 A;  1VQL A;  1OOT A;  2NYS A;  1YJN T;  4RTT A;  2RHU A;  2CGH A;  4QQG A;  1G3Y A;  3OSV A;  3VS7 A;  3FC3 A;  3CCV Q;  1W2B P;  1ABQ A;  4V2S A;  2LQ8 A;  1D0Z A;  3HFN A;  2AKL A;  2EW3 A;  5DY9 A;  2CP3 A;  2DPP B;  1OZ2 A;  2LZ6 B;  2ZPG B;  4M78 F;  2OAU A;  2DYB A;  4PK4 A;  5CK9 A;  2DE0 X;  1SHF A;  4O5V A;  3CCS A;  5HCK A;  2A28 A;  3SB2 A;  1K9M R;  2O2O A;  4KGZ B;  2QXF A;  2JM9 A;  1VQO A;  2PQW A;  4M7A E;  3JCM P;  5FU7 C;  1KD1 U;  1YIT Q;  2FYK A;  1MMA A;  2EGA A;  1VQ6 T;  2RHX A;  4PJO A;  1Y57 A;  4JPB W;  4B9W A;  2DXU A;  1T3S A;  3QG1 A;  1N9S A;  4JS5 A;  4X9D A;  2F1L A;  1W2B S;  1VQ9 A;  2NWM A;  2GCX A;  3GNF B;  5KYU B;  1SEM A;  2C0O A;  2HBP A;  4LXC A;  1B34 A;  3M0S A;  4M75 D;  2HCK A;  4N4I A;  3PVL A;  4O6J A;  5CQY A;  4WTO B;  4OMP A;  1N8R U;  5GMK i;  2K7A A;  1RAF B;  4DBQ A;  4CC7 A;  4X9C A;  2OTJ A;  2ZZD A;  2KRS A;  3SFM A;  2ZPI B;  2ZPB B;  2MMP A;  3G6E Q;  1M3B A;  2QGG A;  1NBE B;  1Q81 C;  1OX9 A;  3CMA Q;  1TWB A;  3O5Z A;  4FYV B;  1MND A;  3L2R A;  3VS0 A;  2HQH A;  4HCB A;  1SRL A;  1Q7Y U;  4L59 A;  2BE9 B;  4HVU A;  2MYS A;  1NM7 A;  5ECA A;  4PJO E;  2HDA A;  3M55 A;  3TQ7 P;  3QHS A;  1QMC A;  5GAN 3;  4LN2 A;  1YHQ A;  1BK2 A;  1J3T A;  1E6H A;  1ZSG A;  2M02 A;  3H0F A;  5LJ5 d;  2K3B A;  2DM1 A;  1YJ9 Q;  1Y71 A;  5GMK h;  3G4S A;  4D8D A;  1HD3 A;  1K0X A;  2FRW A;  2RK1 A;  4M78 A;  4PFP A;  2CDT A;  3G4S T;  1Q86 R;  2KRM A;  4FW1 A;  2X4Y A;  4OB1 B;  5CAI A;  1PKT A;  2F69 A;  1UGQ B;  2AIR B;  2E41 A;  2D9T A;  1IO6 A;  1I5O B;  1WHL A;  3A8M B;  2ZPH B;  4E7K A;  3CD6 Q;  3E1S A;  4BUG A;  1QCF A;  4C0D C;  3BDL A;  5DLQ E;  1IB8 A;  1IRX A;  1ZBX A;  2DX1 A;  4JZ3 A;  3RIR A;  2KAF A;  3ASK A;  1RLP C;  3VS2 A;  3HPW A;  3CCJ Q;  4IIM A;  3CCQ A;  3VRZ A;  2KXC A;  2DJQ A;  4M78 G;  1YIJ Q;  2EGE A;  2KDS A;  3CCR T;  5LJ3 d;  5CR2 A;  3OSS C;  4Y92 A;  3SEM A;  2AK5 A;  2A7Y A;  4ORZ A;  1AD5 A;  1VQ4 A;  1U1T A;  4RTY A;  5KE2 A;  2CZ6 B;  2RQW A;  3RR6 A;  3PE0 A;  1HJD A;  2MOX A;  3UAT A;  2QEX Q;  4A4H A;  4IUR A;  1RUW A;  1YI2 Q;  2D0N A;  1D0X A;  1PNJ A;  5GAN h;  3JB9 D;  2IG0 A;  4JJB A;  3OYH A;  3KXT A;  3OW2 P;  1VQ8 T;  1BI3 A;  3EHQ A;  3A8L B;  1Q7Y R;  1BI1 A;  1VYT A;  3I5S A;  5IT9 E;  4X1V A;  2E5Q A;  1UDL A;  2XI9 A;  3BDU A;  4C8Q B;  2PNI A;  3QZ9 B;  1S72 T;  3M58 A;  4HCZ A;  1ZHI A;  1WHH A;  2K6D A;  4FL6 A;  3QDF A;  5C6S A;  2L89 A;  3C95 A;  2QA4 Q;  1R77 A;  3JAM E;  4PLL A;  2QDL A;  4C92 G;  3OYB A;  3CPW S;  4M7A D;  1OX8 A;  2YUQ A;  3EG9 B;  4JRK A;  3JCM b;  4RCC A;  3A8G B;  2EWN A;  1QVG A;  5D7U A;  1WYX A;  3H6Z A;  3EGU A;  5KYX A;  3PNW C;  1NYG A;  1RAA B;  2LJ0 A;  5IHI A;  3FEO A;  1JJ2 A;  4GY5 A;  1TU0 B;  1YFN A;  1BCM A;  4II1 A;  1YJW Q;  4OB3 B;  2VXF A;  4KRT A;  2QK0 A;  2L3Q A;  2DZ9 A;  3OW2 S;  1GCP A;  2EYX A;  2M0O A;  2HL5 C;  4IUU A;  2OTL T;  4ME7 A;  4F04 B;  1AZG B;  2BE7 D;  2G6F X;  3I56 Q;  3GNG A;  3EFR A;  4CC2 A;  1O9S A;  3H41 A;  1W1F A;  3EAE A;  2E65 A;  5I2M A;  3O8V A;  3FLG A;  5KCO A;  2LX7 A;  3JB9 J;  3HSB A;  4PJJ A;  2GFA A;  2KSS A;  1PSF A;  2LJ3 A;  4JLI A;  4A4F A;  2I0N A;  2QTX A;  5IXF A;  4ELY C;  2HNI A;  4MZT A;  1AT1 B;  4GLK A;  3CCE A;  1BB9 A;  5D6X A;  3IQL A;  4PJO D;  2FHD A;  4EIK A;  1OU9 A;  3RUX A;  1NJI C;  4Q5W A;  4BD3 A;  2VV5 A;  1GBQ A;  1FMV A;  3GLX A;  2E4H A;  4LUE A;  2NUZ A;  5A0L A;  3CPF A;  4FT2 A;  3RKX A;  3G71 T;  1ARK A;  1QKW A;  2DVE A;  2HD0 A;  1U1S A;  4EMG A;  5LJ5 h;  1LPL A;  1AWX A;  5KCH A;  3E19 A;  2HKN A;  1LNX A;  1O75 A;  1VUB A;  4JDS A;  3CCM Q;  2J6O A;  3EFO A;  3CME T;  2RH2 A;  3EG2 A;  2GTJ A;  4M77 C;  3EGX B;  1TTH B;  2KEA A;  4J9I A;  3OYM A;  3RBB B;  3M57 A;  1VQ7 Q;  1HK9 A;  3CCL Q;  1MUZ A;  3EG1 A;  2O88 A;  1BYM A;  2KXD A;  2OI3 A;  2J05 A;  1XTD A;  3TSW A;  1H64 1;  2BTT A;  5HKC A;  2E5K A;  5FWC A;  2J7I A;  4F16 A;  3L2U A;  3CQT A;  3ER0 A;  2DEU A;  4RG2 A;  2ENM A;  4MDW A;  5GAM d;  2RQU A;  4MMK A;  1C0M A;  5GAN 8;  1C6V X;  2EJ9 A;  4J9B A;  1KC8 R;  1UJ0 A;  2LP5 A;  5LJ3 h;  4RG8 A;  2FPF A;  1BU1 A;  4F17 A;  4MZP A;  1X75 C;  3CC2 A;  2MWO A;  4C5E A;  2L3S A;  1Y96 A;  3LGL A;  3TSZ A;  4FCY A;  2QQA A;  2RA2 A;  2RM4 A;  3E2U A;  1Q81 U;  1K73 C;  1ACM B;  2JNG A;  2RB6 A;  3M5A A;  4C8Q C;  1VQP A;  4JS4 A;  3BY7 A;  1RAC B;  8ATC B;  4ZN1 A;  2E3I A;  4QW2 A;  3QII A;  2EJG A;  5KYY A;  1IGQ A;  2KY9 A;  1VQP T;  2K3Y A;  1VQ5 A;  5KYW A;  5KE3 A;  2Z0W A;  1WA7 A;  1HSQ A;  4J6X A;  4AMC A;  4DBH A;  4J9G A;  4LDX A;  5GAN g;  2CT4 A;  4DA4 A;  2LQK A;  2DVJ A;  3REB B;  3A8O B;  4XQ3 A;  4EMK B;  1KSW A;  2QAS A;  2HSP A;  4M7D D;  3UF4 A;  2MF2 A;  3EH2 A;  2MWP A;  3JCM Q;  4J9F A;  3CPW A;  1JO8 A;  2RMO A;  5IAY A;  1W70 A;  1RI9 A;  5CCA A;  3CCV T;  2HQX A;  4LNP A;  3OYI A;  2E1H A;  4PL6 A;  1K1Z A;  2RPN A;  3PT9 A;  2DER A;  4ZGD B;  4J5Y A;  2DD5 A;  2O4X B;  3JCM d;  4J6Y A;  3WXM B;  2CP6 A;  3CBM A;  3MEA A;  4K11 A;  2RQV A;  4M75 B;  2P4T A;  1BI2 A;  4BE0 A;  3I55 Q;  2VC8 A;  1V76 A;  2CZ0 B;  2KR3 A;  3VS5 A;  5DM7 R;  1QCN A;  4PNO A;  1D1C A;  2ZCF B;  1K9M U;  2FZK B;  5J3B A;  2COW A;  4RTW A;  2R57 A;  3CC7 Q;  2PUO B;  3M0U A;  1UJY A;  4DQ2 A;  3CBO A;  1YN8 A;  2CT3 A;  2K2V A;  3HRT A;  5A0D A;  1RAD B;  5DLO A;  3CC4 Q;  2KRN A;  3LW5 E;  2ROT A;  3LYI A;  5M9O A;  2DLP A;  1YIT T;  3H8Z A;  1G8X A;  1HXD A;  2V1R A;  1QVF S;  4E7Z A;  2DXT A;  1QVP A;  2EBP A;  3M9Q A;  5GAO p;  1ZA1 B;  2XDD A;  4XU0 A;  1OV3 A;  4A63 B;  1FYN A;  3FDR A;  4PJL A;  2IPO B;  3OYJ A;  3M4G A;  2BZ8 A;  4JZ4 A;  2EPD A;  4E7I A;  2DTO A;  3GPL A;  2LJ1 A;  4JUV A;  1K76 A;  2C0I A;  4OP0 A;  1VQK Q;  4HVW A;  1SRM A;  1RAG B;  1YJN A;  4WCI A;  1KQ1 A;  4JLG A;  1N27 A;  1W6X A;  2D0Q B;  1IGU A;  2B8A A;  2EVR A;  1QVG P;  1VIE A;  1UG1 A;  2JM8 A;  3TCJ A;  1E7O A;  2E10 A;  2HQE A;  2C06 A;  2FO0 A;  3L1A A;  3JB9 G;  1SG5 A;  1JJ2 P;  3OMC A;  2KMT A;  5GJV B;  2QQ9 A;  2XID A;  4KH1 B;  4PFO A;  4CI0 C;  3QBY A;  1M1K C;  3OYA A;  3I9Q A;  4BDY A;  1FMK A;  3HHT B;  4QQ6 A;  4HVV A;  2PTK A;  1NE8 A;  1N5Z A;  1RAB B;  5A0G A;  3OYL A;  2O9V A;  1NG2 A;  3CCU Q;  2AKK A;  1YJ9 T;  2V8I A;  3PVQ A;  3JB9 I;  3HKS A;  5LL6 S;  2KYB A;  4KUI A;  4FSS A;  1Q86 U;  2KT8 A;  4J9H A;  1PRM C;  1UE9 A;  1VOM A;  2XDB A;  1ZA2 B;  2JN0 A;  1VQ6 A;  2DA9 A;  4IUQ A;  4XTY A;  2KNB B;  5CKF A;  5GAM h;  2RHY A;  1VQM Q;  3OY9 A;  2EQI A;  3VS3 A;  2DBK A;  2DET A;  1BIB A;  2PUK B;  3CXC A;  2PVG B;  1TG0 A;  2DO3 A;  2E6Z A;  1D3B B;  1QVG S;  2YSQ A;  2RN8 A;  1OEB A;  3NFC A;  1OI1 A;  3RKW A;  1JJ2 S;  2XHC A;  3RMS A;  3CCJ T;  5LJ3 g;  2OJ2 A;  4F7U G;  5GMK e;  1OZ3 A;  3M53 A;  1YIJ T;  4J9C A;  3MCA B;  4XK8 E;  3FJP A;  1BBZ A;  1B07 A;  4EMK C;  3DKM A;  5CKE A;  4N0A C;  2CSQ A;  2M9U A;  3A8H B;  1I07 A;  4EPC A;  4Y91 A;  2LCC A;  3V8K A;  3QWX X;  4C92 F;  1PWT A;  2FPD A;  2QEX T;  1D0Y A;  1YI2 T;  2FG0 A;  3SWN B;  1K8A C;  3P8D A;  4BB7 A;  1WJQ A;  5GMK j;  5GAO l;  4M75 C;  1RI0 A;  1WPY A;  3GF5 A;  4PJN A;  2FZG B;  2KI7 A;  2XKO C;  4TVR A;  2GTO A;  4D6W A;  4XTU A;  2JMA A;  4M77 G;  2DFU A;  2X51 A;  2LNH B;  4C5H A;  2DKG A;  1XQH A;  1NZ9 A;  4F7U B;  3JCM J;  3BFM A;  1WFW A;  2QGF B;  3OA6 A;  4OMN A;  1CSK A;  3JCM h;  1IRE B;  2YDL A;  5GAN 7;  1M3A A;  2DL8 A;  1VQL Q;  4OGE A;  4RTZ A;  2LCL A;  1H8K A;  4QT7 A;  1WHJ A;  2CZ1 B;  4KT0 E;  1NPR A;  1XJW B;  5GAN e;  2YRD A;  1UTI A;  1TUC A;  5GAO m;  3P8H A;  1QVF A;  4QVZ A;  4XU3 A;  2D8J A;  1M8V A;  4DOW A;  2RQT A;  4PJO B;  3HRU A;  3E9G A;  2LQW A;  2M0Y A;  2C0T A;  2SEM A;  4M77 B;  1YJW T;  2FPE A;  2RD1 A;  4AFQ C;  4E7J A;  2Y4X A;  3MKD A;  3CCR A;  3QPH A;  3S6W A;  3CCS Q;  2FZC B;  3PMI A;  4LD9 K;  1YP5 A;  2RNA A;  4C8Q G;  3JCM c;  2X3X D;  3OYK A;  5GAN j;  1VQO Q;  3THK A;  4FYX B;  2DIL A;  3UT1 A;  3CPW P;  1VYU A;  4E7L A;  5GAO n;  3NTK A;  2RJD A;  4E2F B;  2F5K A;  3L2Z A;  1NJI R;  3EH1 A;  4KUD K;  2AZS A;  2DEQ A;  5FU6 B;  1AWO A;  2H3J A;  2P0P A;  2CP5 A;  4A4G A;  2KK4 A;  4EMH A;  4M78 E;  1VQ8 A;  3L2W A;  1VQ9 Q;  5GAN f;  2XD0 A;  4ZN3 A;  3MPU B;  2PVO B;  2PU9 B;  2DD4 A;  3QKJ A;  5FLX E;  4C92 A;  2RJE A;  3OYD A;  2EIF A;  1M90 C;  6AT1 B;  2KQW A;  1QKX A;  1S72 A;  4XU2 A;  1PHT A;  2XG8 D;  2L3P A;  5C0M A;  2V26 A;  3OBW A;  2OTJ Q;  1H3H A;  2KBT A;  5GJW B;  2JOY A;  1S1N A;  3MEU A;  2K79 A;  3DLM A;  4XTZ A;  2RF0 A;  2E64 A;  3NTI A;  1ZSZ A;  1G3S A;  2JS2 A;  1UEC A;  1Q82 C;  4C0Z A;  4M7D G;  5I11 A;  3I35 A;  4E47 A;  3CCM T;  2KYM A;  2R5A A;  3OBY A;  1PCX A;  3CCL A;  1LCK A;  2MAM A;  3UDC A;  1JQQ A;  2RQR A;  3MP8 A;  4BI3 A;  4LE9 A;  7AT1 B;  3QUI A;  4Z02 A;  2D1X A;  5CO7 A;  1YHQ Q;  3CCL T;  2DYI A;  2HEQ A;  4JRP A;  4CRI A;  1V1C A;  4LDW A;  2VWF A;  1M2V B;  2CRE A;  3FRN A;  1VQN A;  2NUP B;  1T0J A;  1KHC A;  3G4S Q;  3M0T A;  4M75 F;  5HK3 A;  2OTL A;  4AFZ C;  4A4K A;  4C92 E;  4A53 A;  2JS0 A;  1IHV A;  5GAM g;  1VQN T;  1B3Q A;  5CKD A;  4M7A C;  1BI0 A;  3RES A;  3LLR A;  5LJ5 e;  1U8R A;  1Y7X A;  1K73 R;  4KGV B;  1KC8 U;  1KFZ A;  2MCN A;  4M7D B;  4OB0 B;  1HYO A;  3VS6 A;  2D8H A;  4OML A;  3SWN C;  3GIB A;  5FRM A;  4AG1 C;  3OMG A;  1QP3 A;  1VYV A;  1C1A A;  3MO8 A;  2JMC A;  2HMA A;  1KD1 C;  3CCQ Q;  1JXO A;  1KK7 A;  3QXE B;  3CBP A;  2GFU A;  2YHT A;  4BE1 A;  5CQX A;  1I8F A;  2E70 A;  4DBF A;  2VKN A;  1VQ4 Q;  2A37 A;  3GOX A;  3RER A;  4D8K A;  5D6W A;  3G71 A;  1QLY A;  5LJ3 e;  3OYN A;  3SHW A;  1WNL A;  4MZM A;  4QQD A;  5HY6 A;  3R6O A;  4FSX A;  1N8R C;  3CXC P;  1R8O B;  2COZ A;  3CME A;  2JXB A;  2EFI A;  2HAX A;  1R0C B;  2RHZ A;  4JJC A;  2LCS A;  1X43 A;  2OAW A;  4PJO C;  4LUD A;  3JCM g;  2QDY B;  3PGG A;  3Q1J A;  1BKB A;  2EJF A;  4N4H A;  2X9H A;  2F2X A;  2ECZ A;  4EMK A;  2E6N A;  5A2Q E;  4VUB A;  3BW1 A;  4N0A A;  4X34 A;  2ROL A;  1MGQ A;  5EC7 A;  5LJ3 j;  3I55 T;  1A0N B;  2A36 A;  1Z9Z A;  2DL4 A;  2YT6 A;  4BI4 A;  2F5T X;  3JCM V;  3MHX A;  4E6R A;  5I2S A;  2FB7 A;  1N6A A;  3RNJ A;  2BZX A;  5FU6 C;  3CEY A;  5D6Y A;  3CC7 T;  2QTV A;  4M75 A;  2DK3 A;  2VGM A;  3LH5 A;  3CC4 T;  5LJ3 f;  1QWF A;  1ZQ1 A;  2YLB A;  2CH4 W;  4HKE A;  4NS5 A;  4FU6 A;  1GFC A;  1QCO A;  2EYQ A;  4J83 A;  9ATC B;  1NYF A;  3M54 A;  3JB9 F;  3CXC S;  4M78 D;  3QYG B;  3VJP A;  1JEG A;  5GAN 6;  2RK2 A;  2DZC A;  4QVC A;  2EQU A;  1WXB A;  1GRI A;  1M30 A;  1OPK A;  1G83 A;  2QAZ A;  2KGT A;  4J9E A;  1SSF A;  2DL5 A;  1GCQ C;  1K8A U;  1TOV A;  4M75 G;  4XU1 A;  2EYZ A;  1TS9 A;  4FIB A;  2BUD A;  3QO3 A;  1EX4 A;  1VQK T;  1ZBJ A;  3V7R A;  4CC4 B;  4OF1 A;  1LJO A;  2HZY A;  3M0Q A;  1UGS B;  3L2V A;  4KH0 B;  1M1K R;  2ZGW A;  5AYF A;  3KUF A;  2DJZ A;  2EGC A;  2YUN A;  2YRV A;  3NMZ C;  4R0K A;  1QVF P;  3OYF A;  2CZ7 B;  4XAX B;  3CCV A;  3OYG A;  2DBM A;  2GBQ A;  2QI2 A;  3WVD B;  3U23 A;  3M56 A;  3MEW A;  3ULR B;  3JCM X;  2NUT A;  1KQ2 A;  2CSI A;  2JT4 A;  1PD0 A;  4C0G A;  1ZUU A;  2DTI A;  3CCE Q;  1ZUY A;  3EFO B;  1WLP B;  1PG5 B;  4LDY A;  3URG A;  1WJR A;  2QG9 B;  1N9R A;  3UA6 A;  3EG0 A;  1OYX A;  2LQN A;  2JTF A;  3I5R A;  3FJ5 A;  4F7U F;  2ED0 A;  3CCU T;  4DEY A;  1AWW A;  2CUD A;  4C92 D;  4M7D C;  1K9A A;  1I5L A;  1JB0 E;  3ME9 A;  5IXB A;  5GAO q;  1SKU B;  2WSF E;  3M59 A;  2K5L A;  1YIT A;  1I81 A;  1WHK A;  3FIF A;  2YUO A;  2CS7 A;  1QWE A;  3C94 A;  1X2Q A;  1VQM T;  2O31 A;  5GAN 2;  3EHR A;  2EKH A;  2EAY A;  1IHW A;  2BKD N;  3LGF A;  1RL2 A;  1UGP B;  1H3Z A;  2P0Q A;  1WHG A;  1OQK A;  2JTM A;  4FM4 B;  4M77 F;  3BE3 A;  3X28 B;  4Y28 E;  1G3W A;  2YLC A;  3MET A;  1D3B A;  1K8A R;  2DRM A;  4ZTJ A;  5KYY B;  1ABO A;  3G6E A;  2HKQ B;  5IH2 A;  5GAM e;  2IIM A;  2FEI A;  1AZE A;  3CMA A;  3CC2 Q;  1PRL C;  5KYU A;  3G6E T;  1OPL A;  3V7S A;  4ZGJ B;  3VYG A;  1M4Z A;  1AHJ B;  3EG3 A;  1SHG A;  1YWP A;  3CMA T;  1WJS A;  2WAC A;  4RUG A;  1Q82 U;  1M2O A;  3HP9 A;  1VQP Q;  1GBR A;  1PC0 A;  2LDM A;  3V7C A;  2ESW A;  2QQB A;  4J6W A;  4XTW A;  4Z89 A;  1VQ5 Q;  4BE2 A;  1AVZ C;  2YUP A;  2QQS A;  1YJ9 A;  1B7T A;  3KBG A;  5LJ5 g;  3SWN A;  2LRQ A;  5GAM j;  4RTX A;  3LWI A;  1WZO A;  3EGD B;  4PFZ A;  3PIP A;  3M0R A;  5I21 A;  3QSU A;  1M9S A;  4C8Q F;  1WX6 A;  1VQL T;  2WSC E;  3F70 A;  2DTH A;  3VS4 A;  1MMD A;  5FRN A;  4OMO A;  4C5I A;  4F7U A;  4A54 A;  2BZY A;  2K3X A;  3T9N A;  2X35 A;  4J7F A;  4M7A G;  1M3C A;  2H8H A;  3SD4 A;  5GAM f;  3CD6 A;  3ZL7 C;  1Q95 G;  2X4X A;  3LWH A;  4IUT A;  4L5G A;  5GMK l;  3CD6 T;  2ZPE B;  3CCJ A;  1PKS A;  4OMF B;  1V29 B;  2K5I A;  3JCM e;  1GXI E;  4AG2 C;  1YIJ A;  1G2B A;  4HA8 A;  3J7A F;  3CCS T;  4QKU A;  4AFS C;  2ABL A;  5GAN 5;  1LOJ A;  2CKK A;  1CKB A;  2CH4 A;  1VQO T;  1H92 A;  1ZLM A; 
#chains in the Genus database with same CATH homology
 1AWX A;  1M27 C;  1QKX A;  2GNC A;  3VS1 A;  2J6O A;  2PZ1 A;  1X2K A;  1PHT A;  2L3P A;  2GTJ A;  3EG2 A;  2XMF A;  1SSH A;  1MV0 B;  2KEA A;  1VA7 A;  1H3H A;  4J9I A;  2KBT A;  5GJW B;  3RBB B;  3VRY A;  2P4R A;  1YWO A;  1S1N A;  2DNU A;  2K79 A;  2RF0 A;  1NEG A;  2JS2 A;  2MIO A;  1MUZ A;  3EG1 A;  1UEC A;  2O88 A;  2KXD A;  1WXT A;  5I11 A;  1X69 A;  3I35 A;  1TUD A;  2OI3 A;  2J05 A;  4AFU C;  1U3O A;  1I0C A;  2JW4 A;  3TSW A;  2DF6 A;  2CUB A;  2BTT A;  1I1J A;  2E5K A;  2DL7 A;  2EYY A;  5FWC A;  2KYM A;  2J7I A;  4F16 A;  3CQT A;  1LCK A;  2F2V A;  4Z8A A;  2ENM A;  1E6G A;  1JQQ A;  2RQR A;  4LE9 A;  1X27 A;  1UHF A;  2RQU A;  1KIK A;  2D1X A;  2A08 A;  1WDX A;  1CKA A;  4J9B A;  4RTU A;  2DL3 A;  2HEQ A;  2SRC A;  1UJ0 A;  1V1C A;  2LP5 A;  4GBQ A;  1U5S A;  2VWF A;  2CRE A;  2FPF A;  3M0P A;  1GFD A;  1BU1 A;  4F17 A;  1T0J A;  2M51 A;  3M0T A;  4M4Z A;  1T0H A;  1WI7 A;  4AFZ C;  2L3S A;  5I22 A;  3TSZ A;  2JS0 A;  2KRO A;  4OMQ A;  1B3Q A;  3UA7 A;  4GLM A;  1GCQ A;  1OOT A;  4RTV A;  1KFZ A;  2MCN A;  4RTT A;  3H0H A;  3VS7 A;  3VS6 A;  2D8H A;  4OML A;  1X6B A;  1WA7 A;  1HSQ A;  1ABQ A;  4AG1 C;  2AKL A;  4J9G A;  1VYV A;  4ESR A;  2EW3 A;  2JMC A;  2CT4 A;  3NHN A;  2DVJ A;  3REB B;  1KSW A;  2HSP A;  2LZ6 B;  2W10 A;  3UF4 A;  1JXO A;  4J9F A;  2DYB A;  1JO8 A;  2DE0 X;  1SHF A;  2RMO A;  1AEY A;  1W70 A;  1RI9 A;  4LNP A;  2O9S A;  2FRY A;  1K1Z A;  2RPN A;  2VKN A;  5HCK A;  2A28 A;  1T3L A;  1UUE A;  2A37 A;  2O2O A;  4D8K A;  1XOV A;  1QLY A;  2JM9 A;  3SHW A;  4K11 A;  2RQV A;  3JV3 A;  3H0I A;  1NLP C;  2EGA A;  2J06 A;  2KR3 A;  3VS5 A;  2JXB A;  1Y57 A;  4JPB W;  1T3S A;  4JJC A;  2LCS A;  1X43 A;  2OAW A;  4LUD A;  2LMJ A;  2F2X A;  2NWM A;  4RTW A;  3M0U A;  1UJY A;  2ECZ A;  1SEM A;  2C0O A;  1YN8 A;  2CT3 A;  4HCK A;  2KRN A;  2ROT A;  3M0S A;  1YCS B;  2HCK A;  2ROL A;  2DLP A;  1ZX6 A;  1WIE A;  5EC7 A;  3PVL A;  4OMP A;  5FWB A;  1A0N B;  2V1R A;  2A36 A;  1Z9Z A;  2K7A A;  2DL4 A;  2EBP A;  2KT1 A;  4CC7 A;  2YT6 A;  1OV3 A;  4A63 B;  2KRS A;  1NEB A;  4E6R A;  1FYN A;  4DEX A;  4J9D A;  3RNJ A;  2BZX A;  2BZ8 A;  1M3B A;  3TVT A;  4JZ4 A;  2EPD A;  3GBQ A;  3O5Z A;  3C0C A;  2LJ1 A;  3LH5 A;  2DMO A;  1K76 A;  2C0I A;  3VS0 A;  1QWF A;  2ED1 A;  1SRL A;  2CH4 W;  4HVW A;  2B86 A;  1SRM A;  1GFC A;  1UFF A;  4HVU A;  1NYF A;  1NM7 A;  5ECA A;  2HDA A;  4LN2 A;  1JEG A;  1BK2 A;  4WCI A;  2J6F A;  1J3T A;  1W6X A;  1WXB A;  1E6H A;  2EVR A;  1ZSG A;  1GRI A;  1M30 A;  1OPK A;  1G83 A;  1UG1 A;  1UGV A;  2JM8 A;  2KGT A;  3H0F A;  4J9E A;  2DL5 A;  2K3B A;  2DM1 A;  1E7O A;  2L2P A;  1GCQ C;  2FO0 A;  2VVK A;  1K4U S;  4D8D A;  1HD3 A;  2EYZ A;  1K0X A;  2FRW A;  4OMM A;  5GJV B;  1ZBJ A;  2DRK A;  2W0Z A;  4CC4 B;  3R6N A;  2CDT A;  3M0Q A;  3I9Q A;  2KRM A;  4ZNX A;  1FMK A;  2JTE A;  1X6G A;  1PKT A;  2EGC A;  2PTK A;  4HVV A;  2YUN A;  3NMZ C;  4R0K A;  1N5Z A;  2F2W A;  1IO6 A;  2O9V A;  2DBM A;  2GBQ A;  1NG2 A;  2AKK A;  3KFV A;  3U23 A;  3ULR B;  3A98 A;  1QCF A;  3PVQ A;  2CSI A;  2JT4 A;  1ZUU A;  2DX1 A;  4JZ3 A;  2KYB A;  1ZUY A;  4FSS A;  2KT8 A;  1RLP C;  1WLP B;  3VS2 A;  4J9H A;  1PRM C;  1UE9 A;  4IIM A;  3VRZ A;  2KXC A;  2DA9 A;  2DJQ A;  2EGE A;  3UA6 A;  3EG0 A;  2KNB B;  4Y92 A;  3SEM A;  5IHN A;  1SPK A;  2LQN A;  3I5R A;  2EQI A;  3FJ5 A;  3VS3 A;  2AK5 A;  2DBK A;  2ED0 A;  2K9G A;  1EFN A;  4ORZ A;  4DEY A;  1AD5 A;  1AWW A;  2CUD A;  1TG0 A;  1K9A A;  2YSQ A;  2J6K A;  2RN8 A;  1OEB A;  5IXB A;  1NLO C;  1AOJ A;  4RTY A;  5FW9 A;  2RQW A;  1JXM A;  2L0A A;  3PE0 A;  2OJ2 A;  1HJD A;  2MOX A;  2YUO A;  3UAT A;  1U06 A;  1RUW A;  1QWE A;  4J9C A;  2D0N A;  2V1Q A;  1PNJ A;  1BBZ A;  1X2Q A;  1B07 A;  1RLQ C;  2O31 A;  4JJB A;  3EHR A;  2EKH A;  3EHQ A;  4F14 A;  2CSQ A;  1M8M A;  1VYT A;  1I07 A;  3I5S A;  1AWJ A;  4X1V A;  3NGP A;  1UDL A;  3QWX X;  2PNI A;  1PWT A;  2FPD A;  2K6D A;  5IHK A;  2FG0 A;  4CC3 A;  2KE9 A;  3QWY A;  2DRM A;  1MV3 A;  1ABO A;  2GGR A;  2GTO A;  2QDL A;  5IH2 A;  2JMA A;  2IIM A;  2FEI A;  2LNH B;  2YUQ A;  1AZE A;  1PRL C;  1WFW A;  1OPL A;  4OMN A;  1CSK A;  2YDL A;  3EG3 A;  1SHG A;  1WYX A;  3EGU A;  1YWP A;  1NYG A;  1GL5 A;  1M3A A;  4RUG A;  2DL8 A;  2LJ0 A;  1ZUK A;  1GBR A;  4RTZ A;  5IHI A;  1H8K A;  1WXU A;  2ESW A;  4QT7 A;  4KRT A;  2L3Q A;  4Z89 A;  1GCP A;  2EYX A;  1AVZ C;  2X3W D;  5L23 A;  1UTI A;  2YUP A;  1TUC A;  1JU5 C;  1Z9Q A;  2K2M A;  1AZG B;  2HBW A;  4RTX A;  4IIO A;  4HXJ A;  2G6F X;  2GQI A;  2D8J A;  3NPF A;  3M0R A;  2RQT A;  1WX6 A;  4CC2 A;  3H41 A;  2EYW A;  1W1F A;  2LQW A;  2M0Y A;  2C0T A;  3VS4 A;  2SEM A;  2FPE A;  4AFQ C;  4OMO A;  2BZY A;  2LX7 A;  1M3C A;  2H8H A;  1YP5 A;  2RNA A;  3ZL7 C;  1Y0M A;  2LJ3 A;  2X3X D;  2I0N A;  5IXF A;  3THK A;  2DIL A;  1K0S A;  1YNZ A;  1VYU A;  1BB9 A;  3IQL A;  4EIK A;  1UHC A;  1PKS A;  1KJW A;  1GBQ A;  2AZS A;  1AWO A;  4AG2 C;  4LUE A;  2AZV A;  2NUZ A;  1G2B A;  4AFS C;  2ABL A;  3REA B;  1ARK A;  1QKW A;  1CKB A;  2CH4 A;  1H92 A;  4JJD A;  4Z88 A;  1ZLM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...