4NL2A

Crystal structure of listeria monocytogenes hfq
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
73
structure length
73
Chain Sequence
MKQGGQGLQDYYLNQLRKEKILATVFLTNGFQLRGRVVSFDNFTVLLDVEGKQQLVFKHAISTFSPQKNVALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein hfq
publication title Recognition of U-rich RNA by Hfq from the Gram-positive pathogen Listeria monocytogenes.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Rna binding protein
total genus 17
structure length 73
sequence length 73
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4nl2A00
2DXTA 1Y96B 2I2LA 4MMKA 3RIRA 1BIAA 2DKGA 5LJ5e 3QO3A 4M7DG 5GMKm 5GAMd 2E65A 2FB7A 3QUIA 5GMKj 5GAOr 3FIFA 5GAOq 2DEQA 2EJFA 4C8QG 3SWNA 3JB9D 4V2SA 4M7DE 1H641 4XTYA 5GAMe 4XU2A 4F7UA 3BDUA 3JCMb 4X9CA 4RCCA 1WQWA 5GMKh 4M7DC 3V8JA 4M7AC 4M75A 4XU1A 1HK9A 1X01A 4QVDA 1JRIA 4M7AD 3JB9F 5GANd 4M7AE 3JCMg 4M7DF 1KQ1A 2E1HA 3JCMP 1M5Q1 5GAN3 4M7AG 1MGQA 4M78A 5LJ5f 4J6WA 4C8QC 5GANe 2QTXA 4C92A 5LJ3h 4PJOA 4C8QD 3SWNB 4M7AF 4C8QE 4XTZA 2EAYA 1U1TA 4M77A 3PGGA 5GAMf 2DXUA 3EFRA 4XTWA 4F7UB 2Y90A 2VXEA 2DZ9A 3JCMh 1I5LA 2DTHA 3M4GA 4M75B 5GAOn 4JRKA 3JCMJ 3JB9H 4OP0A 4EMHA 2RB6A 2K57A 4PNOA 3EFSA 2E64A 2E10A 4C8QF 5GMKl 5LJ3g 3RKWA 2DZCA 3RESA 4DQ2A 2JN0A 3QHSA 4M77G 4A53A 4M78B 4Y91A 3JCMd 2RA2A 5LJ3j 4M75C 5GANf 5GAOp 4C92B 4NL2A 4M75D 1B34A 4XTXA 4PJOB 4J6XA 3JCMe 3JCMW 4MMLA 4F7UG 4EMGA 4A54A 3INZA 4M77B 2YLBA 4M7DA 4M75G 1LNXA 1HXDA 5GAOl 4C92C 2DTOA 3BFMA 4XTVA 4HA8A 3JCMX 4C92D 2VXFA 4EMKA 4QVCA 4J6YA 5GMKe 1LOJA 4XQ3A 4HT9A 2EWNA 4PJOD 3V7RA 4WF2A 4M78G 4M77C 5GAN4 3HFOA 2DTIA 2YHTA 4X9DA 1D3BA 2EJ9A 4M77D 5LJ3d 5GMKi 4M7AA 2HNIA 1LJOA 4M77E 3SWNC 1N9RA 4C92G 4PJOG 4N0AA 5CAIA 5I21A 1JBMA 2YLCA 3JB9J 1YCYA 1B34B 4HT8A 2ZGWA 3BW1A 3JB9I 1I8FA 5LJ3e 3JCMf 3HSBA 2VC8A 5GAMh 4XTUA 3V8LA 1WQ7A 4C8QA 1TH7A 3SB2A 4F7UE 3GIBA 2EJGA 4M77F 4M7DB 1WNLA 2RD1A 4M75E 5LJ5g 5GAN5 3FJPA 3HFNA 3L1AA 5GANj 1U1SA 3L2ZA 4EMKB 4JUVA 1M8VA 4M78C 5LJ5j 4M78D 4F7UF 2RM4A 3RUXA 3V7SA 4M78E 3JCMQ 4M7AB 1D3BB 1Y96A 2DJZA 2FYKA 3RKXA 5GAMg 3RKYA 5GAN2 4M7DD 4M75F 3JCMV 4PJOC 4XU3A 3FB9A 4C92E 4JLIA 5GANh 4EMKC 4PJOE 4JRIA 3RERA 4RCBA 3JCMc 5GAMj 4J5YA 5LJ3f 5GAN8 1KQ2A 5LJ5h 4NL3A 3JB9G 5GAN7 4M78F 3V7CA 4C8QB 4N0AC 4NOYA 4C92F 1I81A 3BY7A 3V8KA 5DY9A 2DVEA 4PJOF 1I4K1 5GAOm 4XU0A 5GAN6 3QSUA 2CGHA 5GANg 1WPYA 1BIBA 1N9SA 5LJ5d 3AHUA 2E41A 3VU3C
chains in the Genus database with same CATH superfamily
1VQLT 1IREB 1TXQA 2DKGA 4J7FA 1JXMA 3EG2A 4JJNK 4DEXA 2LT1A 3NGPA 1W1FA 2QK0A 2KMTA 4ZGDB 1N6AA 2M0OA 3C4SA 3IQLA 2LT4A 1G8XA 1X01A 2KDSA 3M58A 3S3OA 4FT2A 4DBQA 4DOVA 4QQ6A 3OYDA 1BKBA 3MJXA 3MP8A 5EG2A 2DXUA 4MZMA 3UATA 2VXEA 4HCKA 1Q7YR 5IT9E 2CZ7B 1TUCA 5IHIA 3CPFA 1V1CA 5KYNA 5LJ3j 3G71T 1UGSB 2KT8A 3Q1JA 7AT1B 2PUKB 1H3HA 2R57A 4A4GA 1B3QA 4E7KA 4ELZC 2EFIA 2CKKA 3V7RA 1RI9A 4M77C 5KYUB 3LH0A 4PFOA 5A2QE 4E6RA 2EQKA 3JCMf 1QVGA 1Q7YU 3LLRA 1TH7A 2ECZA 1X6BA 2QQRA 4C0DB 2XD0A 1Q86U 1WHGA 3FJPA 2NYSA 3PVQA 3OYLA 1V76A 2X4YA 5LJ5j 3PFSA 4FYYB 1M3CA 1W2BP 5GAN2 1K0SA 1OPLA 4M75F 2HSEB 2A7YA 2LNHB 1H92A 1XQHA 2QASA 5GAN7 1YITA 1A0NB 1KC8U 1G3TA 2COWA 2DF6A 2DVEA 4PJOF 1I4K1 1IB8A 2KSSA 2M0YA 5CO7A 3CMEA 3M53A 4FIBA 3META 4LDVA 3PVLA 2QA4T 2M51A 1O9SA 3FLGA 2O4XB 4EIKA 1OPKA 4IIOA 3GP8A 2D0NA 1M90C 2C0IA 5CIUA 1VQKA 1H641 2AZSA 2CP3A 2K3YA 2P4RA 2OAUA 4X1VA 1KQSS 4M7AC 4M75A 1RL2A 3VYHB 1K73U 1AZGB 1VQNQ 3HTRA 2GF7A 2RNAA 2LNVA 3MEWA 2KE9A 1QP3A 2CT4A 4PJOA 1TU0B 4ZGEB 4OB3B 3TEEA 2MWOA 3THKA 5GAMf 2KRSA 3NFCA 1QCOA 1SEMA 3A8LB 4DBFA 3OS5A 4VUBA 3I55T 1WLPB 3JRZA 2QGFB 3M0TA 1YBYA 1M1KR 2FO0A 5IN1A 2V26A 5GAOl 2DA9A 2DRKA 1NPRA 2XU8A 2EWNA 2K3XA 4HVUA 1BK2A 2L5QA 4UC4A 3QZ9B 1PD0A 3EGDA 1VQLA 4GY5A 1U8RA 4N0AA 2YLCA 1MV3A 4BI8B 2E6ZA 1Q81U 3JB9I 2EBPA 1EIFA 3M5AA 3ZBDA 3SB2A 4M7DB 4N4IA 1U1SA 2RJEA 3FDRA 2KVQG 1WZOA 2DJZA 4J7IA 3C12A 4PJJA 3MO8A 5DLQE 4C92E 4A4KA 1FXXA 1K8AR 4M4ZA 1M1KU 1MUZA 1RAEB 3GNGA 1IGUA 2XDDA 1UFFA 4M7DF 4A4HA 1VQ7T 5EC7A 5GAN6 1AHJB 2JS0A 3A8OB 1BI3A 2M9UA 3OYKA 1M1GA 3O5ZA 1S1NA 3DLLA 1YCSB 2QXFA 3G71A 2E4HA 5GAOq 8AT1B 2GCXA 2PUOB 3EH1A 2RN8A 4JJDA 2C06A 4RCCA 3VYGA 2L0AA 3NPFA 3REAB 2EQJA 2DERA 3EGXA 4ZGJB 4II1A 4IUTA 3CCQQ 2O9VA 3JCMP 1B07A 3E2UA 3TREA 1UGVA 2Z0WA 1YI2Q 2J6OA 1Q7YC 1PSEA 3J81E 3BE3A 1ZHIA 1PRLC 2HZYA 1M2VB 2QEXQ 3URGA 3VS3A 1U5SA 2L3QA 1M4ZA 2QEXT 4CRIA 3LH5A 5I2SA 4RTZA 3JSCA 2HBWA 4DEYA 4ZN3A 1G3YA 2ZZDA 4LNPA 2JOYA 1C6VX 3OYYA 5GAOp 1MHNA 1KC8C 2YXYA 4Z89A 3QDRB 3EG9A 3OSSC 5GAN8 4C92D 3NHNA 2O88A 1AD5A 4PFZA 5I11A 5FRMA 5FROA 4JZ3A 5HY6A 2QA4A 3LGLA 2LDMA 2WSCE 1D1AA 1ZSZA 3SFMA 4OMFB 2EYWA 3EFOB 2AKLA 1K73C 4E7JA 1QKXA 1M8VA 5FRNA 1YN8A 5FW9A 3QJYA 4F7UF 4M78E 3VUZA 1Y96A 2X51A 4PJOC 1VQMT 2OTLT 3OW2S 3FB9A 2H3EB 4GLMA 4XK8E 3RERA 4Y92A 4NL3A 4E7IA 1VQPA 2K3BA 1AVZC 1YJNA 2QTVA 1ZSGA 2P0QA 3AHUA 2E41A 1R0BG 3G6EQ 4CC7A 1M3AA 3FEOA 1T0JA 4FT4A 3I55A 4JLGA 1KD1R 1MMNA 3H41A 3SWNA 2CP7A 2MMPA 1IXDA 3CCRT 4JRQA 2DXCA 4F7UA 3G1JA 1WQWA 2HQHA 2DO3A 1DJ7B 4ELYC 2DL8A 4A4FA 1G5VA 2VGNA 4RTWA 1YJWQ 1Q81C 2D8JA 1WGSA 3CMAT 1YJWT 4C8QE 1KFZA 1VIFA 2JVVA 1KSWA 2P0PA 4JS4A 2KYMA 3JCMh 4AMCA 1I5LA 1U06A 4JRKA 1NYGA 4HVWA 1N8RR 1MMDA 2R5AA 1W6XA 3RESA 5KE2A 1KD1U 2MOXA 1M1KC 2P84A 2K7AA 1ARKA 5FLXE 2K5LA 4D6WA 2KT1A 3JCMW 4C0FA 1I0CA 4KGVB 4PFPA 3TSZA 4BE0A 1VQ7A 1RADB 2KXDA 1RACB 2ROLA 5LJ3d 1HJDA 3FRNA 1G3SA 5CAIA 1GFCA 1YJ9T 1X6GA 1B34B 2IVWA 4OGEA 2CYZB 2LX9A 2XG8D 1AZEA 2HL5C 4A4EA 3GIBA 2ABLA 5L8RE 2X3WD 3R6OA 1N8RU 2LC4A 1JJ2P 2B86A 4KUDK 3OYFA 3RDVA 3P8HA 1K8AC 1N27A 1HSQA 4M7DC 3JCMQ 1UHFA 1TUDA 2F1LA 3SHWA 2LQ8A 3S3NA 2QQAA 2DBMA 2LQKA 3TSWA 1LPLA 2DLPA 1I81A 1X69A 3VS4A 5GANg 1BIBA 2G6FX 5LJ5d 1M27C 2QEXA 1V29B 4PK4A 2EYYA 2WSEE 1IRXA 3QUIA 2A08A 1W2BA 2ROTA 3I5SA 1O75A 2DM1A 3CPWS 4XU2A 2QQ9A 5A0GA 4QT7A 1JRIA 4QVZA 4ZTJA 3OYEA 3L2UA 4JS5A 1NLOC 3I56T 1LVKA 2RO0A 3QIIA 1X75C 1BYMA 2FL7A 4M77A 4OMQA 1BCMA 4LD9K 4BACA 2CP2A 4EMHA 1G83A 2AKKA 2RB6A 4PNOA 4R0KA 2SEMA 5GMKl 4Z88A 5D6WA 3X26B 2JM8A 2MF2A 4A53A 4CC4B 1GXIE 1VQMA 1PKSA 2OTLA 1UUEA 4J9DA 1YITQ 4J6XA 2NUTB 3CCEQ 4LDWA 4QQGA 1EFNA 1JO8A 2X4XA 3CMEQ 4FL6A 1YITT 1HXDA 4C5HA 3CCET 1Y57A 4J9HA 2PNIA 4D8DA 1M1FA 3CMET 4HCBA 5GAN4 1PM3A 2A28A 1SSHA 1ZX6A 3M0PA 2IG0A 3SWNC 1LJOA 4M77E 4DA4A 4KULA 2RQTA 5LJ3e 4KRTA 4E7SA 2EJGA 3CCRA 5GAN5 4IUPA 3OYAA 3MPUB 2VUBA 4RG2A 1E6HA 1BI2A 1QWEA 4E47A 2FHDA 5CKDA 2FPEA 1NZ9A 1ZUYA 3CC4Q 3SD4A 3LW5E 3CMAA 2L2PA 3L2QA 3CC4T 2VGMA 3BY7A 5GAOm 2E3HA 3NTKA 1M30A 2MIOA 1KD1C 3E19A 3RMQA 3RIRA 2PQWA 2YUQA 2YUPA 2DYIA 5LJ5e 3DKMA 5GAOr 1PNJA 5IHKA 3R6NA 1E6GA 2C0OA 2COYA 2OJ2A 1YNZA 1I5OB 1K4US 1WHJA 4IUVA 4M7AE 1VQLQ 1KQ1A 2HSPA 1IHWA 2LCCA 1NEGA 2L89A 1YJ9A 1KQSP 4C0GA 1N8RC 3PGGA 2K79A 4EDUA 4L5GA 3H0FA 2NUPB 4IURA 3JB9H 4OB1B 1TS9A 4JJBA 2JS2A 4QW2A 4AFZC 3GF5A 4B9XA 1AWOA 4C5EA 1D1BA 1X6OA 5D6YA 2FEIA 1E7OA 1K9MU 5GMKe 5KYXA 4X9DA 1OU8A 1OYXA 3G71Q 2GBQA 3OSVA 1Q86R 3JB9J 2JZ2A 3A8GB 1I8FA 2KEAA 2MCNA 3ZFJA 1RABB 2FZGB 2DL7A 3C0CA 3NTIA 1M8MA 1KC8R 1D3BB 1BCOA 2O01E 5I2MA 3PMTA 4OMMA 1RAFB 3I56A 2RF0A 2ZPBB 3CEYA 3EG0A 1VYVA 3QSUA 3I5RA 2K5FA 4F16A 2ESWA 2RHIA 1QMCA 2V8IA 5D6XA 2OI3A 1WJRA 1ZBXA 1KG1A 2FB7A 2AT1B 2DETA 5I22A 1K73R 3VS5A 1PHTA 3E1SA 2WSFE 2KAFA 1PSFA 4EPCA 1SRMA 4OMNA 3CCEA 3CXCS 5C6SA 1GBQA 1UECA 3E9FA 3RR6A 4PJLA 2QA4Q 1MGQA 4J6WA 2MI6A 5LJ3h 3CPWA 1FMVA 1WX6A 2QQBA 5FU6B 2EAYA 2MK5A 4E7HA 1NEBA 2HEQA 4PKCC 2DZCA 2KY9A 2RA2A 1JQQA 3MP6A 4J9IA 4O6JA 4C92B 4NL2A 3OYIA 1VQPQ 2KYBA 2E70A 1YJNQ 1QCNA 2COZA 4F14A 1VQPT 3CC4A 3BFMA 4XTVA 1RI0A 1Q81R 1YJNT 2K9GA 2YUNA 5C0MA 1PD1A 2FRWA 4C92G 3I55Q 1GCPA 3RMSA 2C0TA 1QP2A 2DILA 3KXTA 3OBYA 1TWBA 2O31A 2RD1A 4M75E 2KROA 3L1AA 2YSQA 2FPFA 1XJWB 1YWOA 4JUVA 2LMJA 1UTIA 1W70A 2CZ6B 2RM4A 3V7SA 1UB4A 3HPWA 1K1ZA 1EZZB 1EX4A 2DMOA 3RKYA 2O4XA 4PJOE 1Y7XA 1G3WA 2QGGA 2ZAEA 3N5BB 2BTTA 2QDLA 4ZTFA 4J9FA 1Q82U 2ZPIB 3OW2P 3HL8A 3MEVA 2FVUA 1JJ2A 1BU1A 1KK7A 1IZ6A 3QO3A 2RJCA 4V2SA 4LN2A 4P5NA 4HCCA 1TTHB 1K9MC 2EGCA 3G7ZA 3JCMb 3G4SQ 1ZUKA 4L59A 1VQ7Q 1WYXA 5KCHA 3ME9A 3V8JA 5GMKh 3QJ6A 3QXEB 3JCMg 3G4ST 2X4WA 2E1HA 1M5Q1 2E5KA 5GAN3 1TSFA 1YHQA 2KI7A 4HKEA 3MP1A 3MKDA 3L42A 2EYXA 3X28B 1PWTA 3M4GA 2E64A 2DL4A 2ZPEB 3M0UA 2CUBA 4M78B 1OV3A 3UT1A 1NBEB 1J3TA 4M75D 2DJQA 3MCAB 1UE9A 5A0LA 3CC7A 4F04B 2QG9B 4M7DA 4ANJA 4J9GA 1W4SA 3GNFB 1Q86C 4J83A 4PJMA 4XQ3A 4PJOD 2QI2A 3CCJA 4FYXB 3OYJA 4MDXA 4M78G 3KFVA 1ZSZB 1X2KA 3O8VA 1UGPB 3OS0A 1N9RA 1QQJA 1X2QA 1ABQA 2KGTA 2CUDA 1WIEA 3LGFA 2H8HA 5GAMg 3C94A 2LJ3A 2CDTA 4X34A 1VQ8T 4J9CA 3JB9G 2CT3A 4C8QB 4D8KA 4RTYA 2DD4A 1VA7A 1QVPA 2CGHA 4TVRA 5CKEA 1MMGA 2GFUA 2V1QA 3TVTA 2DXTA 3VUBA 1VQMQ 3TU4K 1YFNA 2OTLQ 1UGQB 2JMCA 4KH1B 1RAAB 1VQ5A 4C8QG 4C0DC 1CKBA 1CSKA 2LRQA 4PLIA 4XTYA 2DVJA 4FYVB 5J3BA 1RUWA 1UHCA 4MZTA 2ZPFB 4QVDA 4OGCA 4LD6A 2RQRA 5GANd 1RAGB 1SG5A 4JRPA 2LQNA 4BD3A 2J6KA 3CPWP 4AFQC 3CQTA 2G3RA 3OYNA 1OX9A 3CCRQ 3EFRA 3CXCA 2J05A 3JCMJ 2JTEA 4JZ4A 3OS1A 1D0ZA 3QPHA 2D8HA 3CMAQ 1NLPC 1WHHA 1ZQ1A 1Q82C 3VRZA 1BI0A 1IHVA 5CK9A 3H9NA 2YLBA 3EFOA 1YWPA 1HYOA 1PKTA 4C92C 3X25B 2K5IA 2HKQB 4FW1A 5CKFA 1KQSA 1X43A 1WDXA 4AG2C 3UPUA 2ZPGB 4LDYA 2NLUA 3BW1A 3OY9A 2VV5A 4XTUA 3CBMA 4F7UE 1WNLA 1SHFA 2LZ6B 3L2ZA 4JJCA 3VJPA 4M78D 2E12A 2LP5A 2V1RA 3G4SA 3HHTB 2FZCB 4JLIA 4AFUC 3J7AF 3OYBA 4JRIA 1YJ9Q 2FPDA 5GAMj 5LJ3f 2P4TA 2XHCA 2QYZA 3V7CA 2IIMA 1C0MA 3I9QA 2KQWA 1SSFA 1MNDA 1WI7A 3L2VA 2A36A 2GQVA 2I2LA 4F17A 4R55A 2KK4A 1D0XA 2BZ8A 3FIFA 3T9NA 5KYWB 3JB9D 2DFUA 3H8ZA 2LVMA 3CC2A 3CCMQ 4L6V5 2HQXA 1OX8A 2Y4XA 2D6FA 2DIGA 3CCMT 2YRVA 5LJ5f 1GCQA 5GANe 4C8QD 2YT6A 1QVGS 4N4HA 2DZ9A 3FC3A 2X35A 3L2RA 2J7IA 2X3XD 2E10A 1RLQC 4DQ2A 4LE9A 4M77G 5KYYB 2XKOC 5IXFA 2F5KA 1B34A 2EKOA 3I56Q 3VKIA 3PNWC 4HVVA 3M0SA 4RTTA 5IHNA 2I0NA 1VQ8A 2DX1A 5AT1B 2DK3A 3A8MB 2PVDB 1PCXA 4QVCA 2DAQA 4KUIA 2RI3A 3D7SB 3CBOA 3FJ5A 3PMIA 1MNEA 2EKHA 1AWXA 1PG5B 2D1XA 3OMCA 3KUFA 3GOXA 2HMAA 4ZN1A 2XK0A 1WQ7A 4CC3A 4RTVA 4ATOA 4EMKB 3EG3A 1WXBA 2GFAA 3DB3A 4M7AB 2RHUA 3JCMV 4Z8AA 3JAME 1D1CA 1S72A 2EW3A 2D0QB 4RMOA 3JCMc 1K0XA 4C5IA 1NG2A 2CZ0B 2JXBA 4LUEA 1VQ9T 1D09B 1FYNA 4E7ZA 1MV0B 3PT9A 3J80E 4M7AG 2GQIA 2NWMA 3GBQA 2EQMA 2F2XA 4ZNXA 2BIVA 2A0FB 3VS6A 4LXCA 4FYWB 2R58A 1SKUB 4LUDA 4AFSC 4OMLA 2EQUA 2KNBB 2MAMA 3BDUA 3OYMA 1UGRB 2W0ZA 3VS0A 4ORZA 3C95A 2ENMA 2HKNA 4E7LA 4IUUA 3LX7A 1LCKA 5CCAA 2B8AA 1M3BA 3OW2A 1Y0MA 2RHXA 1NPPA 2NUTA 4XAXB 1T0HA 3QWYA 1SF9A 3CXCP 4KBMB 1IGQA 2GTOA 3ZL7C 2VB6A 1D0YA 1AEYA 1OQKA 4AG1C 4K11A 1K9MR 3X20B 3PTAA 1XNIA 4RTUA 5DM7R 1TG0A 5GJWB 1GRIA 2LTOA 3OQ5A 2KR3A 5HKCA 3INZA 2QAZA 3E9GA 3U23A 5CKHA 4HA8A 1ZUUA 1UDLA 1K76A 3LWIA 1ABOA 2CREA 3OS2A 4DOWA 2DTIA 4M77D 4IKFA 1ZA2B 3HSBA 2HD0A 2V8KA 3OYGA 5L23A 2Y4YA 2VWFA 1VQ4T 1GCQC 2RMOA 1RAHB 1QVFS 2FYKA 3CCMA 1YHQQ 2CSIA 5GANh 2J6FA 3HRUA 1JB0E 1KQ2A 1YHQT 2BZXA 1Y07A 3PE0A 1I1JA 2YWWA 3CCVQ 1WPYA 3CCVT 5J39A 3OBWA 3TCJA 2DBKA 3CC7Q 3UF4A 5HK0A 1PRMC 3PIPA 5CQYA 3CC7T 2L8DA 3DB4A 3CCJQ 2DE0X 2NUPA 4M7AD 1KJWA 2RPNA 1PC0A 1JXOA 4J9BA 2GGRA 1P92A 3CCJT 3CCLA 2QQSA 3HRSA 4KGXB 2AK5A 3EAEA 2CZ1B 2ZPHB 3JV3A 1VQOA 2DTHA 1M9SA 3MEAA 4M75B 4OP0A 4R56A 2K57A 3ULRB 2LX7A 2DRMA 3QDFA 1KHIA 3NTHA 2RJFA 4OB0B 3QHSA 3JCMd 4Y91A 3A5ZB 4PJOB 1GFDA 9ATCB 3VS7A 4M75G 1LNXA 5GJVB 4ME7A 4AT1B 3CCSA 1X27A 1VQ9A 3MHXA 4WF2A 2K2VA 4WCIA 2RQUA 1D3BA 2PVOB 2HNIA 4PJOG 2XDBA 1VQ5Q 2EPDA 1WJQA 5KYUA 2EGEA 4BDZA 1Z9QA 3V8LA 1VQ5T 3MEUA 2XI9A 2BUDA 2RK1A 5IH2A 4CC2A 2FZKB 2QDYB 3RNJA 1AWWA 2KXCA 1QWFA 4GLKA 3RUXA 2PU9B 3EGDB 1Q82R 1G2BA 4RTXA 2NUZA 2OTJA 1NJIR 1UEBA 4EMKC 1R8OB 2BZYA 5FU7B 3HRTA 5LJ5h 1YIJQ 3M59A 4BY6B 2F5TX 4C92F 2KBTA 5DY9A 4QKUA 1YIJT 1NYFA 1VQNT 4GBQA 3QYGB 2CH4W 2RJDA 3WXMB 5GAMd 5GMKj 3HP9A 4OVAA 2R5MA 2JT4A 4Z02A 1QCFA 3LWHA 3ZEHA 3A98A 4HXJA 1VIEA 4C0ZA 3CD6Q 1NJIU 2HL3A 1WXUA 2BKDN 4O5VA 4BI3A 1SPKA 3M55A 3CD6T 2QTXA 4C92A 3OYCA 1KIKA 2VVKA 1OOTA 2EVRA 3I35A 2K6DA 1XOVA 2DIQA 4XTWA 1NE8A 3EGXB 2DD5A 5D7UA 1VQ4A 2F2VA 2VYTA 3S3MA 3RBBB 4LDXA 1N5ZA 2XIDA 1IO6A 2YRDA 3CBPA 3M0RA 3JCMe 2P0KA 4A54A 3M56A 5LL6S 4BI4A 2DTOA 2HDAA 1AT1B 3M9QA 2DL5A 2VXFA 4HT9A 4A63B 1T3LA 4FSXA 1TOVA 3CCUQ 2YHTA 3CCVA 4JPBW 5GMKi 4M7DG 1JBMA 1W2BS 3L2WA 3CCUT 4BB7A 3EG9B 3CC2Q 2ED1A 1WJSA 1XTDA 3CC2T 1WXTA 1JEGA 1QKWA 5M9OA 2X9HA 6AT1B 1JU5C 4J5YA 4YTLA 4M78F 5A0DA 3KBGA 4NOYA 3ASKA 5FWBA 2EIFA 4XU0A 1QVFA 1K8AU 3VS1A 2MYSA 4BUGA 2PZ1A 4LDUA 3CCQT 3EHQA 1UJ0A 1Y96B 1GBRA 1BIAA 3AT1B 4DBHA 5GMKm 1YI2T 2RI5A 2M02A 4PJNA 1VQ8Q 4PLLA 1VQ6Q 4M7DE 3M54A 5GAMe 1KHCA 1T3SA 1VQ6T 2JMAA 4XU1A 1M2OA 3JB9F 2JTMA 3EGUA 5IAYA 4M78A 4KGZB 8ATCB 5KCOA 3P8BB 3UWNA 3SWNB 4BE1A 1WHMA 4F7UB 4J8OA 2F2WA 2M16A 3VV0A 4J9EA 2AIRB 1H3ZA 4C8QF 2XICA 1M2VA 3RKWA 2JM9A 1R0CB 1S72Q 1QVGP 2DL3A 3VRYA 3UA6A 4M75C 1OULA 1OZ3A 5GANf 4BDYA 1RLPC 3F70A 2GTJA 1S72T 2CS7A 4F7UG 5ECAA 3P8DA 1VYUA 1UG1A 2HQEA 3JCMX 1B7TA 2FG0A 1YIJA 1U3OA 3HFOA 4WTOB 2W10A 1VQNA 5FU6C 5I21A 2K2MA 3OMGA 1ZLMA 2VC8A 5CVIA 4C8QA 2EQIA 2L3SA 2A3LA 2RK2A 1OEBA 5CQXA 2J06A 3WVEB 5FWCA 1NJIC 3G6ET 2O2OA 1BB9A 4M7DD 4QQDA 3CD6A 4OF1A 2AZVA 4N0AC 2FRYA 2VASA 5FU7C 3SEMA 3BDLA 3VU3C 4BY6C 2L3PA 2JNGA 2OX7A 2CH4A 3GLXA 1C1AA 2DEQA 3M57A 2PTKA 4FSSA 1BI1A 4KH0B 2X4JA 3QYHB 2LQWA 3HKSA 4RG8A 2CSQA 1FWZA 4B9WA 2XMFA 1H8KA 3DLMA 2DPPB 3LYIA 4OMPA 2DNUA 2H3JA 2YDLA 3CCUA 4FW2A 1TUGB 3OYHA 1FMKA 2E5QA 1BBZA 2RI2A 1CKAA 3A8HB 2VKNA 2ATCB 3A1PA 2HCKA 2BE9B 3GPLA 2JN0A 3QKJA 1VUBA 5CKBA 3VS2A 2O9SA 4C5GA 4FM4B 4M77B 2EYQA 2AHJB 5J26A 3X24B 1Q95G 4N4GA 2HBPA 1ZA1B 4J6YA 3NMZC 1OI1A 1QLYA 1FMWA 3CCQA 5HCKA 3EG1A 2ZCFB 4HT8A 2ZGWA 1YI2A 2OAWA 1OU9A 4PL6A 5GAMh 2LJ1A 4M77F 2RHZA 3WVDB 4RKUE 2RQVA 4M78C 1VQ6A 5AYFA 5HK3A 1I07A 5KE3A 3RKXA 3CCLQ 4XU3A 3M0QA 3QG1A 1WHKA 4FU6A 4RCBA 2MPXC 3CCLT 5KYWA 1RAIB 1AWJA 4OMOA 1VQOQ 4B6MA 1R77A 4KT0E 4RUGA 3PIOA 4MDWA 1QVFP 4FCYA 2CP6A 2ED0A 1ZSZC 1VQOT 5CR2A 2HAXA 4MMKA 5IXBA 2YUOA 1F1BB 1ZBJA 2E65A 2GNCA 3M4YA 3S6WA 2EJFA 1WFWA 1QW1A 2JTFA 2K4YA 2XDPA 1AOJA 4CI0C 4X9CA 2DYBA 3CCSQ 1OZ2A 1VQ9Q 1M90R 1HK9A 2A37A 2CP5A 2E3IA 1VYTA 2RQWA 3CCST 1SRLA 2L3RA 3UDCA 1FX7A 5KYYA 1Z9ZA 2F69A 4C8QC 1GL5A 4Q5WA 4MZPA 1VOMA 4M7AF 3QWXX 4XTZA 1U1TA 4NS5A 5DLOA 2E6NA 2JJ9A 2Y90A 2LJ0A 1HD3A 5GAOn 2MWPA 3EFSA 5LJ3g 1MMAA 1NM7A 2OTJQ 1VQKQ 3G6EA 3SDZA 4ESRA 2CP0A 4XTXA 2OTJT 1VQKT 3TQ7P 2DXBA 4MMLA 4EMGA 2EYZA 4Y28E 2WACA 3H0HA 1M90U 2KRNA 4IIMA 4HCZA 4IUQA 3UA7A 2D9TA 4EMKA 2IPOB 1LOJA 3EH2A 1JJ2S 2M1HA 4BE2A 4M7AA 2EJ9A 1WA7A 1YP5A 1YJWA 3EHRA 1YCYA 2JW4A 3H0IA 2KRMA 2LCSA 2BE7D 3QBYA 1ACMB 5LJ5g 2JUFA 5GANj 3HFNA 2LCLA 2DEUA 2YRCA 3QZ5B 2PVGB 5KYXB 2RH2A 2RHYA 1WHLA 3ER0A 4JDSA 2V8JA 3REBB 3OB9A 3OA6A 2EGAA 5KH6A 1SHGA 3V8KA 4OB2B 1UJYA 1K9AA 1Y71A 1N9SA 4E2FB 1VQ4Q 3H6ZA 4DBRA 2SRCA
chains in the Genus database with same CATH topology
2QEXA 1V29B 1VQLT 2DXTA 1IREB 2DKGA 4J7FA 3VUBA 3TU4K 1UGQB 2RJDA 2WSEE 3WXMB 5GAMd 4JJNK 5GMKj 3QUIA 3HP9A 4OVAA 1VQ5A 1W2BA 4C8QG 4C0DC 2LT1A 2R5MA 2LRQA 4Z02A 1O75A 3CPWS 2KMTA 4ZGDB 4PLIA 4XTYA 1N6AA 3ZEHA 3LWHA 4XU2A 2QQ9A 2M0OA 3C4SA 2LT4A 5J3BA 4MZTA 5A0GA 2KDSA 1X01A 2ZPFB 3M58A 1JRIA 4OGCA 4QVDA 4QVZA 3S3OA 1VIEA 4FT2A 4LD6A 4C0ZA 4DOVA 5GANd 1NJIU 4JRPA 4QQ6A 4BD3A 2BKDN 4O5VA 4BI3A 3OYEA 4ZTJA 3M55A 3L2UA 3OYDA 4JS5A 3CD6T 2QTXA 4C92A 3OYCA 3QIIA 1BKBA 2RO0A 3I56T 3MP8A 2G3RA 3OYNA 1X75C 1BYMA 2FL7A 4M77A 5EG2A 1XOVA 2DXUA 2DIQA 3EFRA 4MZMA 4XTWA 1NE8A 2VXEA 3CXCA 4LD9K 4BACA 5IT9E 2CZ7B 3JCMJ 4EMHA 2RB6A 4PNOA 3CPFA 5GMKl 2DD5A 1VQ4A 2VYTA 5D6WA 3X26B 2MF2A 3S3MA 4A53A 1GXIE 5LJ3j 3G71T 1VQMA 3OS1A 1UGSB 2OTLA 4LDXA 3QPHA 3Q1JA 2XIDA 1ZQ1A 2PUKB 3CBPA 4J6XA 1Q82C 2R57A 4A4GA 3JCMe 4E7KA 4LDWA 1BI0A 2P0KA 4A54A 5CK9A 4QQGA 4ELZC 2YLBA 3M56A 2X4XA 4FL6A 5LL6S 1YITT 1HXDA 4BI4A 4C92C 2DTOA 4C5HA 3CCET 3X25B 2K5IA 3M9QA 2EFIA 2VXFA 5CKFA 1KQSA 4HT9A 2CKKA 4FSXA 3V7RA 3CMET 1M1FA 4HCBA 4M77C 5GAN4 2YHTA 3LH0A 3CCVA 5GMKi 2IG0A 3SWNC 1LJOA 4M77E 4M7DG 4DA4A 4KULA 3UPUA 1JBMA 5A2QE 2EQKA 2ZPGB 4LDYA 2NLUA 1W2BS 3L2WA 3CCUT 3BW1A 4BB7A 5LJ3e 3OY9A 2VV5A 3JCMf 1QVGA 4XTUA 1Q7YU 3CBMA 3LLRA 1TH7A 4F7UE 2EJGA 2QQRA 1WNLA 4C0DB 3CCRA 2XD0A 1Q86U 5GAN5 3FJPA 4IUPA 3OYAA 2VUBA 3L2ZA 1WJSA 1XTDA 4RG2A 3OYLA 2X4YA 3CC2T 3VJPA 5LJ5j 4M78D 1BI2A 3PFSA 4E47A 2E12A 5GAN2 2FHDA 3G4SA 3HHTB 4M75F 5CKDA 5M9OA 1NZ9A 4JLIA 3J7AF 3OYBA 2A7YA 4JRIA 5GAMj 4J5YA 4YTLA 2P4TA 5LJ3f 1XQHA 2XHCA 3LW5E 3SD4A 5GAN7 3CMAA 4M78F 3V7CA 1YITA 1KC8U 1G3TA 3L2QA 5A0DA 3KBGA 3CC4T 2VGMA 4NOYA 3ASKA 3BY7A 2DVEA 2EIFA 1I4K1 2KSSA 4XU0A 5CO7A 4PJOF 5GAOm 3CMEA 2KQWA 3M53A 1K8AU 1QVFA 4FIBA 3META 3NTKA 1SSFA 4LDVA 4BUGA 1KD1C 4LDUA 3E19A 2GQVA 3RMQA 3L2VA 3CCQT 1Y96B 2I2LA 3RIRA 4R55A 1BIAA 2PQWA 2QA4T 1O9SA 2KK4A 2O4XB 3FLGA 5LJ5e 3DKMA 5GMKm 5GAOr 1YI2T 2RI5A 3FIFA 3GP8A 3T9NA 3JB9D 1M90C 4PLLA 5CIUA 3H8ZA 1VQKA 3M54A 1H641 4M7DE 2LVMA 5GAMe 1KHCA 3CC2A 2K3YA 2OAUA 1VQ6T 4L6V5 2HQXA 1KQSS 4M7AC 4M75A 2Y4XA 4XU1A 2D6FA 1RL2A 3VYHB 1K73U 3JB9F 4IUVA 4M7AE 2DIGA 3CCMT 2GF7A 2JTMA 1KQ1A 2YRVA 2LNVA 3MEWA 5IAYA 4M78A 5LJ5f 2LCCA 5GANe 5KCOA 3P8BB 1QP3A 4PJOA 4C8QD 2L89A 3UWNA 3SWNB 1YJ9A 1QVGS 4BE1A 4ZGEB 4OB3B 3TEEA 2MWOA 4C0GA 1N8RC 5GAMf 3PGGA 4N4HA 4F7UB 4EDUA 4L5GA 2DZ9A 4J8OA 2M16A 3NFCA 3FC3A 2X35A 3VV0A 3L2RA 4IURA 1H3ZA 3JB9H 4OB1B 4C8QF 2XICA 2E10A 3RKWA 4DQ2A 3A8LB 3OS5A 4M77G 4VUBA 3I55T 2XKOC 4M75C 3JRZA 1OZ3A 4BDYA 4QW2A 2F5KA 5GANf 1B34A 2EKOA 3F70A 3VKIA 3GF5A 3PNWC 1S72T 4B9XA 2CS7A 4C5EA 4F7UG 1VQ8A 1YBYA 3P8DA 1X6OA 5D6YA 5IN1A 2DK3A 3A8MB 2PVDB 5GAOl 2HQEA 1NPRA 1K9MU 3JCMX 4QVCA 5GMKe 2DAQA 2XU8A 4KUIA 1YIJA 2EWNA 2K3XA 2RI3A 3CBOA 2L5QA 3PMIA 4UC4A 3QZ9B 3HFOA 4X9DA 1VQNA 1VQLA 4GY5A 5FU6C 1OYXA 3OMCA 4N0AA 3OSVA 5I21A 2YLCA 1U8RA 3JB9J 2JZ2A 3KUFA 2E6ZA 4BI8B 1Q81U 3A8GB 3JB9I 1I8FA 3GOXA 3OMGA 4ZN1A 1EIFA 3M5AA 2VC8A 2XK0A 5CVIA 3ZFJA 3ZBDA 1WQ7A 4C8QA 3SB2A 4M7DB 2A3LA 2RK2A 4ATOA 4N4IA 5CQXA 3WVEB 1U1SA 4EMKB 1NJIC 3NTIA 2RJEA 2GFAA 3FDRA 2KVQG 3G6ET 3DB3A 1D3BB 4M7AB 2DJZA 2RHUA 4J7IA 3C12A 4M7DD 3JCMV 3JAME 3MO8A 5DLQE 4QQDA 4C92E 2O01E 5I2MA 4A4KA 1S72A 1FXXA 3PMTA 2D0QB 4RMOA 1QVFS 3JCMc 3CD6A 3I56A 1M1KU 4OF1A 4C5IA 2ZPBB 3GNGA 2CZ0B 2XDDA 3CEYA 4N0AC 4M7DF 3QSUA 4A4HA 1VQ7T 5GAN6 5FU7C 1VQ9T 2K5FA 1AHJB 2RHIA 3A8OB 1BI3A 3PT9A 3J80E 3BDLA 4M7AG 3VU3C 2M9UA 2EQMA 2V8IA 4BY6C 5D6XA 2BIVA 2JNGA 3OYKA 1M1GA 3DLLA 2R58A 1WJRA 3GLXA 1ZBXA 2QXFA 2FB7A 3G71A 1KG1A 5GAOq 2DEQA 2GCXA 3M57A 2PUOB 1BI1A 2EQUA 3E1SA 2X4JA 3QYHB 2WSFE 2MAMA 3BDUA 3HKSA 4RG8A 2KAFA 3OYMA 1FWZA 1PSFA 1UGRB 4RCCA 4B9WA 2C06A 3VYGA 4EPCA 3DLMA 3C95A 3CCEA 3CXCS 2EQJA 5C6SA 4E7LA 4IUUA 2DPPB 4ZGJB 4II1A 3LYIA 3LX7A 3E9FA 4IUTA 5CCAA 3JCMP 2B8AA 1MGQA 3OW2A 2H3JA 3TREA 4J6WA 2MI6A 2RHXA 5LJ3h 1NPPA 3CPWA 1PSEA 1Q7YC 2QQBA 3J81E 3CCUA 5FU6B 2EAYA 4XAXB 1ZHIA 3URGA 4KBMB 3OYHA 4E7HA 2E5QA 2RI2A 1M4ZA 2QEXT 4CRIA 4PKCC 2DZCA 3A8HB 2KY9A 3GPLA 5I2SA 2JN0A 3JSCA 4ZN3A 2RA2A 1G3YA 2ZZDA 3QKJA 2JOYA 3MP6A 1VUBA 3OYYA 1MHNA 4O6JA 4NL2A 5CKBA 3X20B 1XNIA 4C92B 5DM7R 5GAOp 3OYIA 3PTAA 1KC8C 3QDRB 2LTOA 3OQ5A 4C5GA 5HKCA 4FM4B 2E70A 3INZA 4M77B 2EYQA 2AHJB 3E9GA 3OSSC 5J26A 3X24B 1VQPT 3CC4A 4N4GA 3BFMA 2HBPA 4XTVA 5CKHA 4HA8A 5GAN8 4C92D 1RI0A 4J6YA 1YJNT 3LWIA 3OS2A 4DOWA 2DTIA 5FRMA 1OI1A 4M77D 5FROA 5C0MA 3CCQA 4C92G 5HY6A 2QA4A 4IKFA 3RMSA 3LGLA 2ZCFB 2LDMA 1QP2A 2WSCE 2ZGWA 4HT8A 1YI2A 3KXTA 4PL6A 3HSBA 3OBYA 5GAMh 3SFMA 4OMFB 2HD0A 4M77F 2RHZA 2RD1A 2V8KA 4M75E 1K73C 3L1AA 3OYGA 4E7JA 3WVDB 2Y4YA 4RKUE 4JUVA 5FRNA 1M8VA 4M78C 1VQ4T 1VQ6A 3QJYA 5AYFA 5HK3A 2CZ6B 4F7UF 2RM4A 3V7SA 1UB4A 4M78E 3HPWA 3VUZA 1Y96A 2FYKA 3RKXA 5KE3A 1VQMT 2OTLT 3RKYA 3CCMA 3OW2S 4PJOC 2O4XA 4XU3A 3FB9A 3QG1A 5GANh 3HRUA 1JB0E 4PJOE 4XK8E 4FU6A 3RERA 1Y7XA 4RCBA 1G3WA 1KQ2A 3CCLT 3N5BB 4NL3A 1YHQT 1Y07A 4E7IA 1VQPA 4ZTFA 1Q82U 1YJNA 4KT0E 3PIOA 2ZPIB 4MDWA 1WPYA 2P0QA 1VQOT 3AHUA 2E41A 5CR2A 3HL8A 5GMKh 3CCVT 3MEVA 2HAXA 2FVUA 4MMKA 5J39A 3FEOA 1JJ2A 3OBWA 4FT4A 3TCJA 1IZ6A 3QO3A 3I55A 2E65A 3M4YA 2RJCA 4JLGA 3S6WA 2EJFA 3SWNA 1QW1A 2MMPA 2JTFA 4V2SA 4P5NA 5HK0A 2K4YA 4HCCA 1K9MC 2XDPA 3CCRT 3G7ZA 2DXCA 4CI0C 4JRQA 4F7UA 3JCMb 3PIPA 5CQYA 4L59A 4X9CA 3CC7T 2L8DA 1OZ2A 1WQWA 3DB4A 5KCHA 3ME9A 2DO3A 3V8JA 1DJ7B 3QJ6A 1HK9A 3QXEB 4ELYC 4M7AD 3JCMg 3G4ST 4A4FA 2X4WA 3CCST 1G5VA 3UDCA 2L3RA 2VGNA 1FX7A 1P92A 1M5Q1 2E1HA 5GAN3 3CCJT 1Q81C 3CCLA 2F69A 1YHQA 2QQSA 4C8QC 4HKEA 3HRSA 3MP1A 4Q5WA 4MZPA 1WGSA 3CMAT 3EAEA 4M7AF 1YJWT 4C8QE 4XTZA 3L42A 1U1TA 1VIFA 2CZ1B 2JVVA 4NS5A 2ZPHB 5DLOA 2P0PA 2E6NA 4JS4A 2Y90A 3JCMh 3X28B 1VQOA 1I5LA 2DTHA 1M9SA 3M4GA 3MEAA 4M75B 4JRKA 5GAOn 2MWPA 4OP0A 4R56A 2K57A 3EFSA 2E64A 5LJ3g 2R5AA 2ZPEB 1KHIA 3RESA 3NTHA 2RJFA 4OB0B 5KE2A 3QHSA 3G6EA 4M78B 3SDZA 4Y91A 3JCMd 3A5ZB 1KD1U 1M1KC 3UT1A 4M75D 3MCAB 4XTXA 4PJOB 5FLXE 2K5LA 4D6WA 1VQKT 2OTJT 2DXBA 3JCMW 4MMLA 4EMGA 4Y28E 4C0FA 5A0LA 3CC7A 2WACA 1M90U 4M7DA 4M75G 1LNXA 4HCZA 4IUQA 4ME7A 2D9TA 1W4SA 3GNFB 4BE0A 4EMKA 3CCSA 1Q86C 1VQ7A 4J83A 1LOJA 4XQ3A 1VQ9A 2QI2A 3CCJA 4PJOD 3MHXA 4WF2A 2K2VA 3OYJA 4MDXA 4M78G 1JJ2S 2M1HA 4BE2A 4M7AA 1D3BA 2EJ9A 2PVOB 5LJ3d 3O8VA 1UGPB 2HNIA 3OS0A 1N9RA 1G3SA 3FRNA 4PJOG 5CAIA 1YJWA 2XDBA 1WJQA 1YJ9T 1YCYA 1B34B 2IVWA 4OGEA 2CYZB 2LX9A 4BDZA 2XG8D 3V8LA 1VQ5T 3MEUA 4A4EA 3GIBA 5L8RE 2XI9A 3QBYA 2BUDA 5LJ5g 2JUFA 2RK1A 3R6OA 2LC4A 3HFNA 5GANj 1N8RU 3OYFA 4KUDK 2LCLA 3P8HA 2QDYB 3QZ5B 2PVGB 3LGFA 1K8AC 1N27A 2RH2A 2RHYA 4GLKA 3RUXA 4M7DC 3JCMQ 2PU9B 5GAMg 3C94A 3ER0A 2OTJA 1UEBA 4EMKC 1R8OB 4JDSA 2V8JA 5FU7B 3HRTA 2LQ8A 3S3NA 4X34A 1VQ8T 5LJ5h 2QQAA 3JB9G 3OB9A 3OA6A 3M59A 4C8QB 4BY6B 5KH6A 2LQKA 2DD4A 2F5TX 1I81A 3V8KA 4C92F 5DY9A 4OB2B 1QVPA 2CGHA 1YIJT 5GANg 1Y71A 1BIBA 1N9SA 5LJ5d 4TVRA 3H6ZA 5CKEA 2GFUA 1VQNT 3QYGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DXT A;  1Y96 B;  2I2L A;  4MMK A;  3RIR A;  1BIA A;  2DKG A;  5LJ5 e;  3QO3 A;  4M7D G;  5GMK m;  5GAM d;  2E65 A;  2FB7 A;  3QUI A;  5GMK j;  5GAO r;  3FIF A;  5GAO q;  2DEQ A;  2EJF A;  4C8Q G;  3SWN A;  3JB9 D;  4V2S A;  4M7D E;  1H64 1;  4XTY A;  5GAM e;  4XU2 A;  4F7U A;  3BDU A;  3JCM b;  4X9C A;  4RCC A;  1WQW A;  5GMK h;  4M7D C;  3V8J A;  4M7A C;  4M75 A;  4XU1 A;  1HK9 A;  1X01 A;  4QVD A;  1JRI A;  4M7A D;  3JB9 F;  5GAN d;  4M7A E;  3JCM g;  4M7D F;  1KQ1 A;  2E1H A;  3JCM P;  1M5Q 1;  5GAN 3;  4M7A G;  1MGQ A;  4M78 A;  5LJ5 f;  4J6W A;  4C8Q C;  5GAN e;  2QTX A;  4C92 A;  5LJ3 h;  4PJO A;  4C8Q D;  3SWN B;  4M7A F;  4C8Q E;  4XTZ A;  2EAY A;  1U1T A;  4M77 A;  3PGG A;  5GAM f;  2DXU A;  3EFR A;  4XTW A;  4F7U B;  2Y90 A;  2VXE A;  2DZ9 A;  3JCM h;  1I5L A;  2DTH A;  3M4G A;  4M75 B;  5GAO n;  4JRK A;  3JCM J;  3JB9 H;  4OP0 A;  4EMH A;  2RB6 A;  2K57 A;  4PNO A;  3EFS A;  2E64 A;  2E10 A;  4C8Q F;  5GMK l;  5LJ3 g;  3RKW A;  2DZC A;  3RES A;  4DQ2 A;  2JN0 A;  3QHS A;  4M77 G;  4A53 A;  4M78 B;  4Y91 A;  3JCM d;  2RA2 A;  5LJ3 j;  4M75 C;  5GAN f;  5GAO p;  4C92 B;  4NL2 A;  4M75 D;  1B34 A;  4XTX A;  4PJO B;  4J6X A;  3JCM e;  3JCM W;  4MML A;  4F7U G;  4EMG A;  4A54 A;  3INZ A;  4M77 B;  2YLB A;  4M7D A;  4M75 G;  1LNX A;  1HXD A;  5GAO l;  4C92 C;  2DTO A;  3BFM A;  4XTV A;  4HA8 A;  3JCM X;  4C92 D;  2VXF A;  4EMK A;  4QVC A;  4J6Y A;  5GMK e;  1LOJ A;  4XQ3 A;  4HT9 A;  2EWN A;  4PJO D;  3V7R A;  4WF2 A;  4M78 G;  4M77 C;  5GAN 4;  3HFO A;  2DTI A;  2YHT A;  4X9D A;  1D3B A;  2EJ9 A;  4M77 D;  5LJ3 d;  5GMK i;  4M7A A;  2HNI A;  1LJO A;  4M77 E;  3SWN C;  1N9R A;  4C92 G;  4PJO G;  4N0A A;  5CAI A;  5I21 A;  1JBM A;  2YLC A;  3JB9 J;  1YCY A;  1B34 B;  4HT8 A;  2ZGW A;  3BW1 A;  3JB9 I;  1I8F A;  5LJ3 e;  3JCM f;  3HSB A;  2VC8 A;  5GAM h;  4XTU A;  3V8L A;  1WQ7 A;  4C8Q A;  1TH7 A;  3SB2 A;  4F7U E;  3GIB A;  2EJG A;  4M77 F;  4M7D B;  1WNL A;  2RD1 A;  4M75 E;  5LJ5 g;  5GAN 5;  3FJP A;  3HFN A;  3L1A A;  5GAN j;  1U1S A;  3L2Z A;  4EMK B;  4JUV A;  1M8V A;  4M78 C;  5LJ5 j;  4M78 D;  4F7U F;  2RM4 A;  3RUX A;  3V7S A;  4M78 E;  3JCM Q;  4M7A B;  1D3B B;  1Y96 A;  2DJZ A;  2FYK A;  3RKX A;  5GAM g;  3RKY A;  5GAN 2;  4M7D D;  4M75 F;  3JCM V;  4PJO C;  4XU3 A;  3FB9 A;  4C92 E;  4JLI A;  5GAN h;  4EMK C;  4PJO E;  4JRI A;  3RER A;  4RCB A;  3JCM c;  5GAM j;  4J5Y A;  5LJ3 f;  5GAN 8;  1KQ2 A;  5LJ5 h;  4NL3 A;  3JB9 G;  5GAN 7;  4M78 F;  3V7C A;  4C8Q B;  4N0A C;  4NOY A;  4C92 F;  1I81 A;  3BY7 A;  3V8K A;  5DY9 A;  2DVE A;  4PJO F;  1I4K 1;  5GAO m;  4XU0 A;  5GAN 6;  3QSU A;  2CGH A;  5GAN g;  1WPY A;  1BIB A;  1N9S A;  5LJ5 d;  3AHU A;  2E41 A;  3VU3 C; 
#chains in the Genus database with same CATH topology
 1VQL T;  1IRE B;  1TXQ A;  2DKG A;  4J7F A;  1JXM A;  3EG2 A;  4JJN K;  4DEX A;  2LT1 A;  3NGP A;  1W1F A;  2QK0 A;  2KMT A;  4ZGD B;  1N6A A;  2M0O A;  3C4S A;  3IQL A;  2LT4 A;  1G8X A;  1X01 A;  2KDS A;  3M58 A;  3S3O A;  4FT2 A;  4DBQ A;  4DOV A;  4QQ6 A;  3OYD A;  1BKB A;  3MJX A;  3MP8 A;  5EG2 A;  2DXU A;  4MZM A;  3UAT A;  2VXE A;  4HCK A;  1Q7Y R;  5IT9 E;  2CZ7 B;  1TUC A;  5IHI A;  3CPF A;  1V1C A;  5KYN A;  5LJ3 j;  3G71 T;  1UGS B;  2KT8 A;  3Q1J A;  7AT1 B;  2PUK B;  1H3H A;  2R57 A;  4A4G A;  1B3Q A;  4E7K A;  4ELZ C;  2EFI A;  2CKK A;  3V7R A;  1RI9 A;  4M77 C;  5KYU B;  3LH0 A;  4PFO A;  5A2Q E;  4E6R A;  2EQK A;  3JCM f;  1QVG A;  1Q7Y U;  3LLR A;  1TH7 A;  2ECZ A;  1X6B A;  2QQR A;  4C0D B;  2XD0 A;  1Q86 U;  1WHG A;  3FJP A;  2NYS A;  3PVQ A;  3OYL A;  1V76 A;  2X4Y A;  5LJ5 j;  3PFS A;  4FYY B;  1M3C A;  1W2B P;  5GAN 2;  1K0S A;  1OPL A;  4M75 F;  2HSE B;  2A7Y A;  2LNH B;  1H92 A;  1XQH A;  2QAS A;  5GAN 7;  1YIT A;  1A0N B;  1KC8 U;  1G3T A;  2COW A;  2DF6 A;  2DVE A;  4PJO F;  1I4K 1;  1IB8 A;  2KSS A;  2M0Y A;  5CO7 A;  3CME A;  3M53 A;  4FIB A;  3MET A;  4LDV A;  3PVL A;  2QA4 T;  2M51 A;  1O9S A;  3FLG A;  2O4X B;  4EIK A;  1OPK A;  4IIO A;  3GP8 A;  2D0N A;  1M90 C;  2C0I A;  5CIU A;  1VQK A;  1H64 1;  2AZS A;  2CP3 A;  2K3Y A;  2P4R A;  2OAU A;  4X1V A;  1KQS S;  4M7A C;  4M75 A;  1RL2 A;  3VYH B;  1K73 U;  1AZG B;  1VQN Q;  3HTR A;  2GF7 A;  2RNA A;  2LNV A;  3MEW A;  2KE9 A;  1QP3 A;  2CT4 A;  4PJO A;  1TU0 B;  4ZGE B;  4OB3 B;  3TEE A;  2MWO A;  3THK A;  5GAM f;  2KRS A;  3NFC A;  1QCO A;  1SEM A;  3A8L B;  4DBF A;  3OS5 A;  4VUB A;  3I55 T;  1WLP B;  3JRZ A;  2QGF B;  3M0T A;  1YBY A;  1M1K R;  2FO0 A;  5IN1 A;  2V26 A;  5GAO l;  2DA9 A;  2DRK A;  1NPR A;  2XU8 A;  2EWN A;  2K3X A;  4HVU A;  1BK2 A;  2L5Q A;  4UC4 A;  3QZ9 B;  1PD0 A;  3EGD A;  1VQL A;  4GY5 A;  1U8R A;  4N0A A;  2YLC A;  1MV3 A;  4BI8 B;  2E6Z A;  1Q81 U;  3JB9 I;  2EBP A;  1EIF A;  3M5A A;  3ZBD A;  3SB2 A;  4M7D B;  4N4I A;  1U1S A;  2RJE A;  3FDR A;  2KVQ G;  1WZO A;  2DJZ A;  4J7I A;  3C12 A;  4PJJ A;  3MO8 A;  5DLQ E;  4C92 E;  4A4K A;  1FXX A;  1K8A R;  4M4Z A;  1M1K U;  1MUZ A;  1RAE B;  3GNG A;  1IGU A;  2XDD A;  1UFF A;  4M7D F;  4A4H A;  1VQ7 T;  5EC7 A;  5GAN 6;  1AHJ B;  2JS0 A;  3A8O B;  1BI3 A;  2M9U A;  3OYK A;  1M1G A;  3O5Z A;  1S1N A;  3DLL A;  1YCS B;  2QXF A;  3G71 A;  2E4H A;  5GAO q;  8AT1 B;  2GCX A;  2PUO B;  3EH1 A;  2RN8 A;  4JJD A;  2C06 A;  4RCC A;  3VYG A;  2L0A A;  3NPF A;  3REA B;  2EQJ A;  2DER A;  3EGX A;  4ZGJ B;  4II1 A;  4IUT A;  3CCQ Q;  2O9V A;  3JCM P;  1B07 A;  3E2U A;  3TRE A;  1UGV A;  2Z0W A;  1YI2 Q;  2J6O A;  1Q7Y C;  1PSE A;  3J81 E;  3BE3 A;  1ZHI A;  1PRL C;  2HZY A;  1M2V B;  2QEX Q;  3URG A;  3VS3 A;  1U5S A;  2L3Q A;  1M4Z A;  2QEX T;  4CRI A;  3LH5 A;  5I2S A;  4RTZ A;  3JSC A;  2HBW A;  4DEY A;  4ZN3 A;  1G3Y A;  2ZZD A;  4LNP A;  2JOY A;  1C6V X;  3OYY A;  5GAO p;  1MHN A;  1KC8 C;  2YXY A;  4Z89 A;  3QDR B;  3EG9 A;  3OSS C;  5GAN 8;  4C92 D;  3NHN A;  2O88 A;  1AD5 A;  4PFZ A;  5I11 A;  5FRM A;  5FRO A;  4JZ3 A;  5HY6 A;  2QA4 A;  3LGL A;  2LDM A;  2WSC E;  1D1A A;  1ZSZ A;  3SFM A;  4OMF B;  2EYW A;  3EFO B;  2AKL A;  1K73 C;  4E7J A;  1QKX A;  1M8V A;  5FRN A;  1YN8 A;  5FW9 A;  3QJY A;  4F7U F;  4M78 E;  3VUZ A;  1Y96 A;  2X51 A;  4PJO C;  1VQM T;  2OTL T;  3OW2 S;  3FB9 A;  2H3E B;  4GLM A;  4XK8 E;  3RER A;  4Y92 A;  4NL3 A;  4E7I A;  1VQP A;  2K3B A;  1AVZ C;  1YJN A;  2QTV A;  1ZSG A;  2P0Q A;  3AHU A;  2E41 A;  1R0B G;  3G6E Q;  4CC7 A;  1M3A A;  3FEO A;  1T0J A;  4FT4 A;  3I55 A;  4JLG A;  1KD1 R;  1MMN A;  3H41 A;  3SWN A;  2CP7 A;  2MMP A;  1IXD A;  3CCR T;  4JRQ A;  2DXC A;  4F7U A;  3G1J A;  1WQW A;  2HQH A;  2DO3 A;  1DJ7 B;  4ELY C;  2DL8 A;  4A4F A;  1G5V A;  2VGN A;  4RTW A;  1YJW Q;  1Q81 C;  2D8J A;  1WGS A;  3CMA T;  1YJW T;  4C8Q E;  1KFZ A;  1VIF A;  2JVV A;  1KSW A;  2P0P A;  4JS4 A;  2KYM A;  3JCM h;  4AMC A;  1I5L A;  1U06 A;  4JRK A;  1NYG A;  4HVW A;  1N8R R;  1MMD A;  2R5A A;  1W6X A;  3RES A;  5KE2 A;  1KD1 U;  2MOX A;  1M1K C;  2P84 A;  2K7A A;  1ARK A;  5FLX E;  2K5L A;  4D6W A;  2KT1 A;  3JCM W;  4C0F A;  1I0C A;  4KGV B;  4PFP A;  3TSZ A;  4BE0 A;  1VQ7 A;  1RAD B;  2KXD A;  1RAC B;  2ROL A;  5LJ3 d;  1HJD A;  3FRN A;  1G3S A;  5CAI A;  1GFC A;  1YJ9 T;  1X6G A;  1B34 B;  2IVW A;  4OGE A;  2CYZ B;  2LX9 A;  2XG8 D;  1AZE A;  2HL5 C;  4A4E A;  3GIB A;  2ABL A;  5L8R E;  2X3W D;  3R6O A;  1N8R U;  2LC4 A;  1JJ2 P;  2B86 A;  4KUD K;  3OYF A;  3RDV A;  3P8H A;  1K8A C;  1N27 A;  1HSQ A;  4M7D C;  3JCM Q;  1UHF A;  1TUD A;  2F1L A;  3SHW A;  2LQ8 A;  3S3N A;  2QQA A;  2DBM A;  2LQK A;  3TSW A;  1LPL A;  2DLP A;  1I81 A;  1X69 A;  3VS4 A;  5GAN g;  1BIB A;  2G6F X;  5LJ5 d;  1M27 C;  2QEX A;  1V29 B;  4PK4 A;  2EYY A;  2WSE E;  1IRX A;  3QUI A;  2A08 A;  1W2B A;  2ROT A;  3I5S A;  1O75 A;  2DM1 A;  3CPW S;  4XU2 A;  2QQ9 A;  5A0G A;  4QT7 A;  1JRI A;  4QVZ A;  4ZTJ A;  3OYE A;  3L2U A;  4JS5 A;  1NLO C;  3I56 T;  1LVK A;  2RO0 A;  3QII A;  1X75 C;  1BYM A;  2FL7 A;  4M77 A;  4OMQ A;  1BCM A;  4LD9 K;  4BAC A;  2CP2 A;  4EMH A;  1G83 A;  2AKK A;  2RB6 A;  4PNO A;  4R0K A;  2SEM A;  5GMK l;  4Z88 A;  5D6W A;  3X26 B;  2JM8 A;  2MF2 A;  4A53 A;  4CC4 B;  1GXI E;  1VQM A;  1PKS A;  2OTL A;  1UUE A;  4J9D A;  1YIT Q;  4J6X A;  2NUT B;  3CCE Q;  4LDW A;  4QQG A;  1EFN A;  1JO8 A;  2X4X A;  3CME Q;  4FL6 A;  1YIT T;  1HXD A;  4C5H A;  3CCE T;  1Y57 A;  4J9H A;  2PNI A;  4D8D A;  1M1F A;  3CME T;  4HCB A;  5GAN 4;  1PM3 A;  2A28 A;  1SSH A;  1ZX6 A;  3M0P A;  2IG0 A;  3SWN C;  1LJO A;  4M77 E;  4DA4 A;  4KUL A;  2RQT A;  5LJ3 e;  4KRT A;  4E7S A;  2EJG A;  3CCR A;  5GAN 5;  4IUP A;  3OYA A;  3MPU B;  2VUB A;  4RG2 A;  1E6H A;  1BI2 A;  1QWE A;  4E47 A;  2FHD A;  5CKD A;  2FPE A;  1NZ9 A;  1ZUY A;  3CC4 Q;  3SD4 A;  3LW5 E;  3CMA A;  2L2P A;  3L2Q A;  3CC4 T;  2VGM A;  3BY7 A;  5GAO m;  2E3H A;  3NTK A;  1M30 A;  2MIO A;  1KD1 C;  3E19 A;  3RMQ A;  3RIR A;  2PQW A;  2YUQ A;  2YUP A;  2DYI A;  5LJ5 e;  3DKM A;  5GAO r;  1PNJ A;  5IHK A;  3R6N A;  1E6G A;  2C0O A;  2COY A;  2OJ2 A;  1YNZ A;  1I5O B;  1K4U S;  1WHJ A;  4IUV A;  4M7A E;  1VQL Q;  1KQ1 A;  2HSP A;  1IHW A;  2LCC A;  1NEG A;  2L89 A;  1YJ9 A;  1KQS P;  4C0G A;  1N8R C;  3PGG A;  2K79 A;  4EDU A;  4L5G A;  3H0F A;  2NUP B;  4IUR A;  3JB9 H;  4OB1 B;  1TS9 A;  4JJB A;  2JS2 A;  4QW2 A;  4AFZ C;  3GF5 A;  4B9X A;  1AWO A;  4C5E A;  1D1B A;  1X6O A;  5D6Y A;  2FEI A;  1E7O A;  1K9M U;  5GMK e;  5KYX A;  4X9D A;  1OU8 A;  1OYX A;  3G71 Q;  2GBQ A;  3OSV A;  1Q86 R;  3JB9 J;  2JZ2 A;  3A8G B;  1I8F A;  2KEA A;  2MCN A;  3ZFJ A;  1RAB B;  2FZG B;  2DL7 A;  3C0C A;  3NTI A;  1M8M A;  1KC8 R;  1D3B B;  1BCO A;  2O01 E;  5I2M A;  3PMT A;  4OMM A;  1RAF B;  3I56 A;  2RF0 A;  2ZPB B;  3CEY A;  3EG0 A;  1VYV A;  3QSU A;  3I5R A;  2K5F A;  4F16 A;  2ESW A;  2RHI A;  1QMC A;  2V8I A;  5D6X A;  2OI3 A;  1WJR A;  1ZBX A;  1KG1 A;  2FB7 A;  2AT1 B;  2DET A;  5I22 A;  1K73 R;  3VS5 A;  1PHT A;  3E1S A;  2WSF E;  2KAF A;  1PSF A;  4EPC A;  1SRM A;  4OMN A;  3CCE A;  3CXC S;  5C6S A;  1GBQ A;  1UEC A;  3E9F A;  3RR6 A;  4PJL A;  2QA4 Q;  1MGQ A;  4J6W A;  2MI6 A;  5LJ3 h;  3CPW A;  1FMV A;  1WX6 A;  2QQB A;  5FU6 B;  2EAY A;  2MK5 A;  4E7H A;  1NEB A;  2HEQ A;  4PKC C;  2DZC A;  2KY9 A;  2RA2 A;  1JQQ A;  3MP6 A;  4J9I A;  4O6J A;  4C92 B;  4NL2 A;  3OYI A;  1VQP Q;  2KYB A;  2E70 A;  1YJN Q;  1QCN A;  2COZ A;  4F14 A;  1VQP T;  3CC4 A;  3BFM A;  4XTV A;  1RI0 A;  1Q81 R;  1YJN T;  2K9G A;  2YUN A;  5C0M A;  1PD1 A;  2FRW A;  4C92 G;  3I55 Q;  1GCP A;  3RMS A;  2C0T A;  1QP2 A;  2DIL A;  3KXT A;  3OBY A;  1TWB A;  2O31 A;  2RD1 A;  4M75 E;  2KRO A;  3L1A A;  2YSQ A;  2FPF A;  1XJW B;  1YWO A;  4JUV A;  2LMJ A;  1UTI A;  1W70 A;  2CZ6 B;  2RM4 A;  3V7S A;  1UB4 A;  3HPW A;  1K1Z A;  1EZZ B;  1EX4 A;  2DMO A;  3RKY A;  2O4X A;  4PJO E;  1Y7X A;  1G3W A;  2QGG A;  2ZAE A;  3N5B B;  2BTT A;  2QDL A;  4ZTF A;  4J9F A;  1Q82 U;  2ZPI B;  3OW2 P;  3HL8 A;  3MEV A;  2FVU A;  1JJ2 A;  1BU1 A;  1KK7 A;  1IZ6 A;  3QO3 A;  2RJC A;  4V2S A;  4LN2 A;  4P5N A;  4HCC A;  1TTH B;  1K9M C;  2EGC A;  3G7Z A;  3JCM b;  3G4S Q;  1ZUK A;  4L59 A;  1VQ7 Q;  1WYX A;  5KCH A;  3ME9 A;  3V8J A;  5GMK h;  3QJ6 A;  3QXE B;  3JCM g;  3G4S T;  2X4W A;  2E1H A;  1M5Q 1;  2E5K A;  5GAN 3;  1TSF A;  1YHQ A;  2KI7 A;  4HKE A;  3MP1 A;  3MKD A;  3L42 A;  2EYX A;  3X28 B;  1PWT A;  3M4G A;  2E64 A;  2DL4 A;  2ZPE B;  3M0U A;  2CUB A;  4M78 B;  1OV3 A;  3UT1 A;  1NBE B;  1J3T A;  4M75 D;  2DJQ A;  3MCA B;  1UE9 A;  5A0L A;  3CC7 A;  4F04 B;  2QG9 B;  4M7D A;  4ANJ A;  4J9G A;  1W4S A;  3GNF B;  1Q86 C;  4J83 A;  4PJM A;  4XQ3 A;  4PJO D;  2QI2 A;  3CCJ A;  4FYX B;  3OYJ A;  4MDX A;  4M78 G;  3KFV A;  1ZSZ B;  1X2K A;  3O8V A;  1UGP B;  3OS0 A;  1N9R A;  1QQJ A;  1X2Q A;  1ABQ A;  2KGT A;  2CUD A;  1WIE A;  3LGF A;  2H8H A;  5GAM g;  3C94 A;  2LJ3 A;  2CDT A;  4X34 A;  1VQ8 T;  4J9C A;  3JB9 G;  2CT3 A;  4C8Q B;  4D8K A;  4RTY A;  2DD4 A;  1VA7 A;  1QVP A;  2CGH A;  4TVR A;  5CKE A;  1MMG A;  2GFU A;  2V1Q A;  3TVT A;  2DXT A;  3VUB A;  1VQM Q;  3TU4 K;  1YFN A;  2OTL Q;  1UGQ B;  2JMC A;  4KH1 B;  1RAA B;  1VQ5 A;  4C8Q G;  4C0D C;  1CKB A;  1CSK A;  2LRQ A;  4PLI A;  4XTY A;  2DVJ A;  4FYV B;  5J3B A;  1RUW A;  1UHC A;  4MZT A;  2ZPF B;  4QVD A;  4OGC A;  4LD6 A;  2RQR A;  5GAN d;  1RAG B;  1SG5 A;  4JRP A;  2LQN A;  4BD3 A;  2J6K A;  3CPW P;  4AFQ C;  3CQT A;  2G3R A;  3OYN A;  1OX9 A;  3CCR Q;  3EFR A;  3CXC A;  2J05 A;  3JCM J;  2JTE A;  4JZ4 A;  3OS1 A;  1D0Z A;  3QPH A;  2D8H A;  3CMA Q;  1NLP C;  1WHH A;  1ZQ1 A;  1Q82 C;  3VRZ A;  1BI0 A;  1IHV A;  5CK9 A;  3H9N A;  2YLB A;  3EFO A;  1YWP A;  1HYO A;  1PKT A;  4C92 C;  3X25 B;  2K5I A;  2HKQ B;  4FW1 A;  5CKF A;  1KQS A;  1X43 A;  1WDX A;  4AG2 C;  3UPU A;  2ZPG B;  4LDY A;  2NLU A;  3BW1 A;  3OY9 A;  2VV5 A;  4XTU A;  3CBM A;  4F7U E;  1WNL A;  1SHF A;  2LZ6 B;  3L2Z A;  4JJC A;  3VJP A;  4M78 D;  2E12 A;  2LP5 A;  2V1R A;  3G4S A;  3HHT B;  2FZC B;  4JLI A;  4AFU C;  3J7A F;  3OYB A;  4JRI A;  1YJ9 Q;  2FPD A;  5GAM j;  5LJ3 f;  2P4T A;  2XHC A;  2QYZ A;  3V7C A;  2IIM A;  1C0M A;  3I9Q A;  2KQW A;  1SSF A;  1MND A;  1WI7 A;  3L2V A;  2A36 A;  2GQV A;  2I2L A;  4F17 A;  4R55 A;  2KK4 A;  1D0X A;  2BZ8 A;  3FIF A;  3T9N A;  5KYW B;  3JB9 D;  2DFU A;  3H8Z A;  2LVM A;  3CC2 A;  3CCM Q;  4L6V 5;  2HQX A;  1OX8 A;  2Y4X A;  2D6F A;  2DIG A;  3CCM T;  2YRV A;  5LJ5 f;  1GCQ A;  5GAN e;  4C8Q D;  2YT6 A;  1QVG S;  4N4H A;  2DZ9 A;  3FC3 A;  2X35 A;  3L2R A;  2J7I A;  2X3X D;  2E10 A;  1RLQ C;  4DQ2 A;  4LE9 A;  4M77 G;  5KYY B;  2XKO C;  5IXF A;  2F5K A;  1B34 A;  2EKO A;  3I56 Q;  3VKI A;  3PNW C;  4HVV A;  3M0S A;  4RTT A;  5IHN A;  2I0N A;  1VQ8 A;  2DX1 A;  5AT1 B;  2DK3 A;  3A8M B;  2PVD B;  1PCX A;  4QVC A;  2DAQ A;  4KUI A;  2RI3 A;  3D7S B;  3CBO A;  3FJ5 A;  3PMI A;  1MNE A;  2EKH A;  1AWX A;  1PG5 B;  2D1X A;  3OMC A;  3KUF A;  3GOX A;  2HMA A;  4ZN1 A;  2XK0 A;  1WQ7 A;  4CC3 A;  4RTV A;  4ATO A;  4EMK B;  3EG3 A;  1WXB A;  2GFA A;  3DB3 A;  4M7A B;  2RHU A;  3JCM V;  4Z8A A;  3JAM E;  1D1C A;  1S72 A;  2EW3 A;  2D0Q B;  4RMO A;  3JCM c;  1K0X A;  4C5I A;  1NG2 A;  2CZ0 B;  2JXB A;  4LUE A;  1VQ9 T;  1D09 B;  1FYN A;  4E7Z A;  1MV0 B;  3PT9 A;  3J80 E;  4M7A G;  2GQI A;  2NWM A;  3GBQ A;  2EQM A;  2F2X A;  4ZNX A;  2BIV A;  2A0F B;  3VS6 A;  4LXC A;  4FYW B;  2R58 A;  1SKU B;  4LUD A;  4AFS C;  4OML A;  2EQU A;  2KNB B;  2MAM A;  3BDU A;  3OYM A;  1UGR B;  2W0Z A;  3VS0 A;  4ORZ A;  3C95 A;  2ENM A;  2HKN A;  4E7L A;  4IUU A;  3LX7 A;  1LCK A;  5CCA A;  2B8A A;  1M3B A;  3OW2 A;  1Y0M A;  2RHX A;  1NPP A;  2NUT A;  4XAX B;  1T0H A;  3QWY A;  1SF9 A;  3CXC P;  4KBM B;  1IGQ A;  2GTO A;  3ZL7 C;  2VB6 A;  1D0Y A;  1AEY A;  1OQK A;  4AG1 C;  4K11 A;  1K9M R;  3X20 B;  3PTA A;  1XNI A;  4RTU A;  5DM7 R;  1TG0 A;  5GJW B;  1GRI A;  2LTO A;  3OQ5 A;  2KR3 A;  5HKC A;  3INZ A;  2QAZ A;  3E9G A;  3U23 A;  5CKH A;  4HA8 A;  1ZUU A;  1UDL A;  1K76 A;  3LWI A;  1ABO A;  2CRE A;  3OS2 A;  4DOW A;  2DTI A;  4M77 D;  4IKF A;  1ZA2 B;  3HSB A;  2HD0 A;  2V8K A;  3OYG A;  5L23 A;  2Y4Y A;  2VWF A;  1VQ4 T;  1GCQ C;  2RMO A;  1RAH B;  1QVF S;  2FYK A;  3CCM A;  1YHQ Q;  2CSI A;  5GAN h;  2J6F A;  3HRU A;  1JB0 E;  1KQ2 A;  1YHQ T;  2BZX A;  1Y07 A;  3PE0 A;  1I1J A;  2YWW A;  3CCV Q;  1WPY A;  3CCV T;  5J39 A;  3OBW A;  3TCJ A;  2DBK A;  3CC7 Q;  3UF4 A;  5HK0 A;  1PRM C;  3PIP A;  5CQY A;  3CC7 T;  2L8D A;  3DB4 A;  3CCJ Q;  2DE0 X;  2NUP A;  4M7A D;  1KJW A;  2RPN A;  1PC0 A;  1JXO A;  4J9B A;  2GGR A;  1P92 A;  3CCJ T;  3CCL A;  2QQS A;  3HRS A;  4KGX B;  2AK5 A;  3EAE A;  2CZ1 B;  2ZPH B;  3JV3 A;  1VQO A;  2DTH A;  1M9S A;  3MEA A;  4M75 B;  4OP0 A;  4R56 A;  2K57 A;  3ULR B;  2LX7 A;  2DRM A;  3QDF A;  1KHI A;  3NTH A;  2RJF A;  4OB0 B;  3QHS A;  3JCM d;  4Y91 A;  3A5Z B;  4PJO B;  1GFD A;  9ATC B;  3VS7 A;  4M75 G;  1LNX A;  5GJV B;  4ME7 A;  4AT1 B;  3CCS A;  1X27 A;  1VQ9 A;  3MHX A;  4WF2 A;  2K2V A;  4WCI A;  2RQU A;  1D3B A;  2PVO B;  2HNI A;  4PJO G;  2XDB A;  1VQ5 Q;  2EPD A;  1WJQ A;  5KYU A;  2EGE A;  4BDZ A;  1Z9Q A;  3V8L A;  1VQ5 T;  3MEU A;  2XI9 A;  2BUD A;  2RK1 A;  5IH2 A;  4CC2 A;  2FZK B;  2QDY B;  3RNJ A;  1AWW A;  2KXC A;  1QWF A;  4GLK A;  3RUX A;  2PU9 B;  3EGD B;  1Q82 R;  1G2B A;  4RTX A;  2NUZ A;  2OTJ A;  1NJI R;  1UEB A;  4EMK C;  1R8O B;  2BZY A;  5FU7 B;  3HRT A;  5LJ5 h;  1YIJ Q;  3M59 A;  4BY6 B;  2F5T X;  4C92 F;  2KBT A;  5DY9 A;  4QKU A;  1YIJ T;  1NYF A;  1VQN T;  4GBQ A;  3QYG B;  2CH4 W;  2RJD A;  3WXM B;  5GAM d;  5GMK j;  3HP9 A;  4OVA A;  2R5M A;  2JT4 A;  4Z02 A;  1QCF A;  3LWH A;  3ZEH A;  3A98 A;  4HXJ A;  1VIE A;  4C0Z A;  3CD6 Q;  1NJI U;  2HL3 A;  1WXU A;  2BKD N;  4O5V A;  4BI3 A;  1SPK A;  3M55 A;  3CD6 T;  2QTX A;  4C92 A;  3OYC A;  1KIK A;  2VVK A;  1OOT A;  2EVR A;  3I35 A;  2K6D A;  1XOV A;  2DIQ A;  4XTW A;  1NE8 A;  3EGX B;  2DD5 A;  5D7U A;  1VQ4 A;  2F2V A;  2VYT A;  3S3M A;  3RBB B;  4LDX A;  1N5Z A;  2XID A;  1IO6 A;  2YRD A;  3CBP A;  3M0R A;  3JCM e;  2P0K A;  4A54 A;  3M56 A;  5LL6 S;  4BI4 A;  2DTO A;  2HDA A;  1AT1 B;  3M9Q A;  2DL5 A;  2VXF A;  4HT9 A;  4A63 B;  1T3L A;  4FSX A;  1TOV A;  3CCU Q;  2YHT A;  3CCV A;  4JPB W;  5GMK i;  4M7D G;  1JBM A;  1W2B S;  3L2W A;  3CCU T;  4BB7 A;  3EG9 B;  3CC2 Q;  2ED1 A;  1WJS A;  1XTD A;  3CC2 T;  1WXT A;  1JEG A;  1QKW A;  5M9O A;  2X9H A;  6AT1 B;  1JU5 C;  4J5Y A;  4YTL A;  4M78 F;  5A0D A;  3KBG A;  4NOY A;  3ASK A;  5FWB A;  2EIF A;  4XU0 A;  1QVF A;  1K8A U;  3VS1 A;  2MYS A;  4BUG A;  2PZ1 A;  4LDU A;  3CCQ T;  3EHQ A;  1UJ0 A;  1Y96 B;  1GBR A;  1BIA A;  3AT1 B;  4DBH A;  5GMK m;  1YI2 T;  2RI5 A;  2M02 A;  4PJN A;  1VQ8 Q;  4PLL A;  1VQ6 Q;  4M7D E;  3M54 A;  5GAM e;  1KHC A;  1T3S A;  1VQ6 T;  2JMA A;  4XU1 A;  1M2O A;  3JB9 F;  2JTM A;  3EGU A;  5IAY A;  4M78 A;  4KGZ B;  8ATC B;  5KCO A;  3P8B B;  3UWN A;  3SWN B;  4BE1 A;  1WHM A;  4F7U B;  4J8O A;  2F2W A;  2M16 A;  3VV0 A;  4J9E A;  2AIR B;  1H3Z A;  4C8Q F;  2XIC A;  1M2V A;  3RKW A;  2JM9 A;  1R0C B;  1S72 Q;  1QVG P;  2DL3 A;  3VRY A;  3UA6 A;  4M75 C;  1OUL A;  1OZ3 A;  5GAN f;  4BDY A;  1RLP C;  3F70 A;  2GTJ A;  1S72 T;  2CS7 A;  4F7U G;  5ECA A;  3P8D A;  1VYU A;  1UG1 A;  2HQE A;  3JCM X;  1B7T A;  2FG0 A;  1YIJ A;  1U3O A;  3HFO A;  4WTO B;  2W10 A;  1VQN A;  5FU6 C;  5I21 A;  2K2M A;  3OMG A;  1ZLM A;  2VC8 A;  5CVI A;  4C8Q A;  2EQI A;  2L3S A;  2A3L A;  2RK2 A;  1OEB A;  5CQX A;  2J06 A;  3WVE B;  5FWC A;  1NJI C;  3G6E T;  2O2O A;  1BB9 A;  4M7D D;  4QQD A;  3CD6 A;  4OF1 A;  2AZV A;  4N0A C;  2FRY A;  2VAS A;  5FU7 C;  3SEM A;  3BDL A;  3VU3 C;  4BY6 C;  2L3P A;  2JNG A;  2OX7 A;  2CH4 A;  3GLX A;  1C1A A;  2DEQ A;  3M57 A;  2PTK A;  4FSS A;  1BI1 A;  4KH0 B;  2X4J A;  3QYH B;  2LQW A;  3HKS A;  4RG8 A;  2CSQ A;  1FWZ A;  4B9W A;  2XMF A;  1H8K A;  3DLM A;  2DPP B;  3LYI A;  4OMP A;  2DNU A;  2H3J A;  2YDL A;  3CCU A;  4FW2 A;  1TUG B;  3OYH A;  1FMK A;  2E5Q A;  1BBZ A;  2RI2 A;  1CKA A;  3A8H B;  2VKN A;  2ATC B;  3A1P A;  2HCK A;  2BE9 B;  3GPL A;  2JN0 A;  3QKJ A;  1VUB A;  5CKB A;  3VS2 A;  2O9S A;  4C5G A;  4FM4 B;  4M77 B;  2EYQ A;  2AHJ B;  5J26 A;  3X24 B;  1Q95 G;  4N4G A;  2HBP A;  1ZA1 B;  4J6Y A;  3NMZ C;  1OI1 A;  1QLY A;  1FMW A;  3CCQ A;  5HCK A;  3EG1 A;  2ZCF B;  4HT8 A;  2ZGW A;  1YI2 A;  2OAW A;  1OU9 A;  4PL6 A;  5GAM h;  2LJ1 A;  4M77 F;  2RHZ A;  3WVD B;  4RKU E;  2RQV A;  4M78 C;  1VQ6 A;  5AYF A;  5HK3 A;  1I07 A;  5KE3 A;  3RKX A;  3CCL Q;  4XU3 A;  3M0Q A;  3QG1 A;  1WHK A;  4FU6 A;  4RCB A;  2MPX C;  3CCL T;  5KYW A;  1RAI B;  1AWJ A;  4OMO A;  1VQO Q;  4B6M A;  1R77 A;  4KT0 E;  4RUG A;  3PIO A;  4MDW A;  1QVF P;  4FCY A;  2CP6 A;  2ED0 A;  1ZSZ C;  1VQO T;  5CR2 A;  2HAX A;  4MMK A;  5IXB A;  2YUO A;  1F1B B;  1ZBJ A;  2E65 A;  2GNC A;  3M4Y A;  3S6W A;  2EJF A;  1WFW A;  1QW1 A;  2JTF A;  2K4Y A;  2XDP A;  1AOJ A;  4CI0 C;  4X9C A;  2DYB A;  3CCS Q;  1OZ2 A;  1VQ9 Q;  1M90 R;  1HK9 A;  2A37 A;  2CP5 A;  2E3I A;  1VYT A;  2RQW A;  3CCS T;  1SRL A;  2L3R A;  3UDC A;  1FX7 A;  5KYY A;  1Z9Z A;  2F69 A;  4C8Q C;  1GL5 A;  4Q5W A;  4MZP A;  1VOM A;  4M7A F;  3QWX X;  4XTZ A;  1U1T A;  4NS5 A;  5DLO A;  2E6N A;  2JJ9 A;  2Y90 A;  2LJ0 A;  1HD3 A;  5GAO n;  2MWP A;  3EFS A;  5LJ3 g;  1MMA A;  1NM7 A;  2OTJ Q;  1VQK Q;  3G6E A;  3SDZ A;  4ESR A;  2CP0 A;  4XTX A;  2OTJ T;  1VQK T;  3TQ7 P;  2DXB A;  4MML A;  4EMG A;  2EYZ A;  4Y28 E;  2WAC A;  3H0H A;  1M90 U;  2KRN A;  4IIM A;  4HCZ A;  4IUQ A;  3UA7 A;  2D9T A;  4EMK A;  2IPO B;  1LOJ A;  3EH2 A;  1JJ2 S;  2M1H A;  4BE2 A;  4M7A A;  2EJ9 A;  1WA7 A;  1YP5 A;  1YJW A;  3EHR A;  1YCY A;  2JW4 A;  3H0I A;  2KRM A;  2LCS A;  2BE7 D;  3QBY A;  1ACM B;  5LJ5 g;  2JUF A;  5GAN j;  3HFN A;  2LCL A;  2DEU A;  2YRC A;  3QZ5 B;  2PVG B;  5KYX B;  2RH2 A;  2RHY A;  1WHL A;  3ER0 A;  4JDS A;  2V8J A;  3REB B;  3OB9 A;  3OA6 A;  2EGA A;  5KH6 A;  1SHG A;  3V8K A;  4OB2 B;  1UJY A;  1K9A A;  1Y71 A;  1N9S A;  4E2F B;  1VQ4 Q;  3H6Z A;  4DBR A;  2SRC A; 
#chains in the Genus database with same CATH homology
 2QEX A;  1V29 B;  1VQL T;  2DXT A;  1IRE B;  2DKG A;  4J7F A;  3VUB A;  3TU4 K;  1UGQ B;  2RJD A;  2WSE E;  3WXM B;  5GAM d;  4JJN K;  5GMK j;  3QUI A;  3HP9 A;  4OVA A;  1VQ5 A;  1W2B A;  4C8Q G;  4C0D C;  2LT1 A;  2R5M A;  2LRQ A;  4Z02 A;  1O75 A;  3CPW S;  2KMT A;  4ZGD B;  4PLI A;  4XTY A;  1N6A A;  3ZEH A;  3LWH A;  4XU2 A;  2QQ9 A;  2M0O A;  3C4S A;  2LT4 A;  5J3B A;  4MZT A;  5A0G A;  2KDS A;  1X01 A;  2ZPF B;  3M58 A;  1JRI A;  4OGC A;  4QVD A;  4QVZ A;  3S3O A;  1VIE A;  4FT2 A;  4LD6 A;  4C0Z A;  4DOV A;  5GAN d;  1NJI U;  4JRP A;  4QQ6 A;  4BD3 A;  2BKD N;  4O5V A;  4BI3 A;  3OYE A;  4ZTJ A;  3M55 A;  3L2U A;  3OYD A;  4JS5 A;  3CD6 T;  2QTX A;  4C92 A;  3OYC A;  3QII A;  1BKB A;  2RO0 A;  3I56 T;  3MP8 A;  2G3R A;  3OYN A;  1X75 C;  1BYM A;  2FL7 A;  4M77 A;  5EG2 A;  1XOV A;  2DXU A;  2DIQ A;  3EFR A;  4MZM A;  4XTW A;  1NE8 A;  2VXE A;  3CXC A;  4LD9 K;  4BAC A;  5IT9 E;  2CZ7 B;  3JCM J;  4EMH A;  2RB6 A;  4PNO A;  3CPF A;  5GMK l;  2DD5 A;  1VQ4 A;  2VYT A;  5D6W A;  3X26 B;  2MF2 A;  3S3M A;  4A53 A;  1GXI E;  5LJ3 j;  3G71 T;  1VQM A;  3OS1 A;  1UGS B;  2OTL A;  4LDX A;  3QPH A;  3Q1J A;  2XID A;  1ZQ1 A;  2PUK B;  3CBP A;  4J6X A;  1Q82 C;  2R57 A;  4A4G A;  3JCM e;  4E7K A;  4LDW A;  1BI0 A;  2P0K A;  4A54 A;  5CK9 A;  4QQG A;  4ELZ C;  2YLB A;  3M56 A;  2X4X A;  4FL6 A;  5LL6 S;  1YIT T;  1HXD A;  4BI4 A;  4C92 C;  2DTO A;  4C5H A;  3CCE T;  3X25 B;  2K5I A;  3M9Q A;  2EFI A;  2VXF A;  5CKF A;  1KQS A;  4HT9 A;  2CKK A;  4FSX A;  3V7R A;  3CME T;  1M1F A;  4HCB A;  4M77 C;  5GAN 4;  2YHT A;  3LH0 A;  3CCV A;  5GMK i;  2IG0 A;  3SWN C;  1LJO A;  4M77 E;  4M7D G;  4DA4 A;  4KUL A;  3UPU A;  1JBM A;  5A2Q E;  2EQK A;  2ZPG B;  4LDY A;  2NLU A;  1W2B S;  3L2W A;  3CCU T;  3BW1 A;  4BB7 A;  5LJ3 e;  3OY9 A;  2VV5 A;  3JCM f;  1QVG A;  4XTU A;  1Q7Y U;  3CBM A;  3LLR A;  1TH7 A;  4F7U E;  2EJG A;  2QQR A;  1WNL A;  4C0D B;  3CCR A;  2XD0 A;  1Q86 U;  5GAN 5;  3FJP A;  4IUP A;  3OYA A;  2VUB A;  3L2Z A;  1WJS A;  1XTD A;  4RG2 A;  3OYL A;  2X4Y A;  3CC2 T;  3VJP A;  5LJ5 j;  4M78 D;  1BI2 A;  3PFS A;  4E47 A;  2E12 A;  5GAN 2;  2FHD A;  3G4S A;  3HHT B;  4M75 F;  5CKD A;  5M9O A;  1NZ9 A;  4JLI A;  3J7A F;  3OYB A;  2A7Y A;  4JRI A;  5GAM j;  4J5Y A;  4YTL A;  2P4T A;  5LJ3 f;  1XQH A;  2XHC A;  3LW5 E;  3SD4 A;  5GAN 7;  3CMA A;  4M78 F;  3V7C A;  1YIT A;  1KC8 U;  1G3T A;  3L2Q A;  5A0D A;  3KBG A;  3CC4 T;  2VGM A;  4NOY A;  3ASK A;  3BY7 A;  2DVE A;  2EIF A;  1I4K 1;  2KSS A;  4XU0 A;  5CO7 A;  4PJO F;  5GAO m;  3CME A;  2KQW A;  3M53 A;  1K8A U;  1QVF A;  4FIB A;  3MET A;  3NTK A;  1SSF A;  4LDV A;  4BUG A;  1KD1 C;  4LDU A;  3E19 A;  2GQV A;  3RMQ A;  3L2V A;  3CCQ T;  1Y96 B;  2I2L A;  3RIR A;  4R55 A;  1BIA A;  2PQW A;  2QA4 T;  1O9S A;  2KK4 A;  2O4X B;  3FLG A;  5LJ5 e;  3DKM A;  5GMK m;  5GAO r;  1YI2 T;  2RI5 A;  3FIF A;  3GP8 A;  3T9N A;  3JB9 D;  1M90 C;  4PLL A;  5CIU A;  3H8Z A;  1VQK A;  3M54 A;  1H64 1;  4M7D E;  2LVM A;  5GAM e;  1KHC A;  3CC2 A;  2K3Y A;  2OAU A;  1VQ6 T;  4L6V 5;  2HQX A;  1KQS S;  4M7A C;  4M75 A;  2Y4X A;  4XU1 A;  2D6F A;  1RL2 A;  3VYH B;  1K73 U;  3JB9 F;  4IUV A;  4M7A E;  2DIG A;  3CCM T;  2GF7 A;  2JTM A;  1KQ1 A;  2YRV A;  2LNV A;  3MEW A;  5IAY A;  4M78 A;  5LJ5 f;  2LCC A;  5GAN e;  5KCO A;  3P8B B;  1QP3 A;  4PJO A;  4C8Q D;  2L89 A;  3UWN A;  3SWN B;  1YJ9 A;  1QVG S;  4BE1 A;  4ZGE B;  4OB3 B;  3TEE A;  2MWO A;  4C0G A;  1N8R C;  5GAM f;  3PGG A;  4N4H A;  4F7U B;  4EDU A;  4L5G A;  2DZ9 A;  4J8O A;  2M16 A;  3NFC A;  3FC3 A;  2X35 A;  3VV0 A;  3L2R A;  4IUR A;  1H3Z A;  3JB9 H;  4OB1 B;  4C8Q F;  2XIC A;  2E10 A;  3RKW A;  4DQ2 A;  3A8L B;  3OS5 A;  4M77 G;  4VUB A;  3I55 T;  2XKO C;  4M75 C;  3JRZ A;  1OZ3 A;  4BDY A;  4QW2 A;  2F5K A;  5GAN f;  1B34 A;  2EKO A;  3F70 A;  3VKI A;  3GF5 A;  3PNW C;  1S72 T;  4B9X A;  2CS7 A;  4C5E A;  4F7U G;  1VQ8 A;  1YBY A;  3P8D A;  1X6O A;  5D6Y A;  5IN1 A;  2DK3 A;  3A8M B;  2PVD B;  5GAO l;  2HQE A;  1NPR A;  1K9M U;  3JCM X;  4QVC A;  5GMK e;  2DAQ A;  2XU8 A;  4KUI A;  1YIJ A;  2EWN A;  2K3X A;  2RI3 A;  3CBO A;  2L5Q A;  3PMI A;  4UC4 A;  3QZ9 B;  3HFO A;  4X9D A;  1VQN A;  1VQL A;  4GY5 A;  5FU6 C;  1OYX A;  3OMC A;  4N0A A;  3OSV A;  5I21 A;  2YLC A;  1U8R A;  3JB9 J;  2JZ2 A;  3KUF A;  2E6Z A;  4BI8 B;  1Q81 U;  3A8G B;  3JB9 I;  1I8F A;  3GOX A;  3OMG A;  4ZN1 A;  1EIF A;  3M5A A;  2VC8 A;  2XK0 A;  5CVI A;  3ZFJ A;  3ZBD A;  1WQ7 A;  4C8Q A;  3SB2 A;  4M7D B;  2A3L A;  2RK2 A;  4ATO A;  4N4I A;  5CQX A;  3WVE B;  1U1S A;  4EMK B;  1NJI C;  3NTI A;  2RJE A;  2GFA A;  3FDR A;  2KVQ G;  3G6E T;  3DB3 A;  1D3B B;  4M7A B;  2DJZ A;  2RHU A;  4J7I A;  3C12 A;  4M7D D;  3JCM V;  3JAM E;  3MO8 A;  5DLQ E;  4QQD A;  4C92 E;  2O01 E;  5I2M A;  4A4K A;  1S72 A;  1FXX A;  3PMT A;  2D0Q B;  4RMO A;  1QVF S;  3JCM c;  3CD6 A;  3I56 A;  1M1K U;  4OF1 A;  4C5I A;  2ZPB B;  3GNG A;  2CZ0 B;  2XDD A;  3CEY A;  4N0A C;  4M7D F;  3QSU A;  4A4H A;  1VQ7 T;  5GAN 6;  5FU7 C;  1VQ9 T;  2K5F A;  1AHJ B;  2RHI A;  3A8O B;  1BI3 A;  3PT9 A;  3J80 E;  3BDL A;  4M7A G;  3VU3 C;  2M9U A;  2EQM A;  2V8I A;  4BY6 C;  5D6X A;  2BIV A;  2JNG A;  3OYK A;  1M1G A;  3DLL A;  2R58 A;  1WJR A;  3GLX A;  1ZBX A;  2QXF A;  2FB7 A;  3G71 A;  1KG1 A;  5GAO q;  2DEQ A;  2GCX A;  3M57 A;  2PUO B;  1BI1 A;  2EQU A;  3E1S A;  2X4J A;  3QYH B;  2WSF E;  2MAM A;  3BDU A;  3HKS A;  4RG8 A;  2KAF A;  3OYM A;  1FWZ A;  1PSF A;  1UGR B;  4RCC A;  4B9W A;  2C06 A;  3VYG A;  4EPC A;  3DLM A;  3C95 A;  3CCE A;  3CXC S;  2EQJ A;  5C6S A;  4E7L A;  4IUU A;  2DPP B;  4ZGJ B;  4II1 A;  3LYI A;  3LX7 A;  3E9F A;  4IUT A;  5CCA A;  3JCM P;  2B8A A;  1MGQ A;  3OW2 A;  2H3J A;  3TRE A;  4J6W A;  2MI6 A;  2RHX A;  5LJ3 h;  1NPP A;  3CPW A;  1PSE A;  1Q7Y C;  2QQB A;  3J81 E;  3CCU A;  5FU6 B;  2EAY A;  4XAX B;  1ZHI A;  3URG A;  4KBM B;  3OYH A;  4E7H A;  2E5Q A;  2RI2 A;  1M4Z A;  2QEX T;  4CRI A;  4PKC C;  2DZC A;  3A8H B;  2KY9 A;  3GPL A;  5I2S A;  2JN0 A;  3JSC A;  4ZN3 A;  2RA2 A;  1G3Y A;  2ZZD A;  3QKJ A;  2JOY A;  3MP6 A;  1VUB A;  3OYY A;  1MHN A;  4O6J A;  4NL2 A;  5CKB A;  3X20 B;  1XNI A;  4C92 B;  5DM7 R;  5GAO p;  3OYI A;  3PTA A;  1KC8 C;  3QDR B;  2LTO A;  3OQ5 A;  4C5G A;  5HKC A;  4FM4 B;  2E70 A;  3INZ A;  4M77 B;  2EYQ A;  2AHJ B;  3E9G A;  3OSS C;  5J26 A;  3X24 B;  1VQP T;  3CC4 A;  4N4G A;  3BFM A;  2HBP A;  4XTV A;  5CKH A;  4HA8 A;  5GAN 8;  4C92 D;  1RI0 A;  4J6Y A;  1YJN T;  3LWI A;  3OS2 A;  4DOW A;  2DTI A;  5FRM A;  1OI1 A;  4M77 D;  5FRO A;  5C0M A;  3CCQ A;  4C92 G;  5HY6 A;  2QA4 A;  4IKF A;  3RMS A;  3LGL A;  2ZCF B;  2LDM A;  1QP2 A;  2WSC E;  2ZGW A;  4HT8 A;  1YI2 A;  3KXT A;  4PL6 A;  3HSB A;  3OBY A;  5GAM h;  3SFM A;  4OMF B;  2HD0 A;  4M77 F;  2RHZ A;  2RD1 A;  2V8K A;  4M75 E;  1K73 C;  3L1A A;  3OYG A;  4E7J A;  3WVD B;  2Y4Y A;  4RKU E;  4JUV A;  5FRN A;  1M8V A;  4M78 C;  1VQ4 T;  1VQ6 A;  3QJY A;  5AYF A;  5HK3 A;  2CZ6 B;  4F7U F;  2RM4 A;  3V7S A;  1UB4 A;  4M78 E;  3HPW A;  3VUZ A;  1Y96 A;  2FYK A;  3RKX A;  5KE3 A;  1VQM T;  2OTL T;  3RKY A;  3CCM A;  3OW2 S;  4PJO C;  2O4X A;  4XU3 A;  3FB9 A;  3QG1 A;  5GAN h;  3HRU A;  1JB0 E;  4PJO E;  4XK8 E;  4FU6 A;  3RER A;  1Y7X A;  4RCB A;  1G3W A;  1KQ2 A;  3CCL T;  3N5B B;  4NL3 A;  1YHQ T;  1Y07 A;  4E7I A;  1VQP A;  4ZTF A;  1Q82 U;  1YJN A;  4KT0 E;  3PIO A;  2ZPI B;  4MDW A;  1WPY A;  2P0Q A;  1VQO T;  3AHU A;  2E41 A;  5CR2 A;  3HL8 A;  5GMK h;  3CCV T;  3MEV A;  2HAX A;  2FVU A;  4MMK A;  5J39 A;  3FEO A;  1JJ2 A;  3OBW A;  4FT4 A;  3TCJ A;  1IZ6 A;  3QO3 A;  3I55 A;  2E65 A;  3M4Y A;  2RJC A;  4JLG A;  3S6W A;  2EJF A;  3SWN A;  1QW1 A;  2MMP A;  2JTF A;  4V2S A;  4P5N A;  5HK0 A;  2K4Y A;  4HCC A;  1K9M C;  2XDP A;  3CCR T;  3G7Z A;  2DXC A;  4CI0 C;  4JRQ A;  4F7U A;  3JCM b;  3PIP A;  5CQY A;  4L59 A;  4X9C A;  3CC7 T;  2L8D A;  1OZ2 A;  1WQW A;  3DB4 A;  5KCH A;  3ME9 A;  2DO3 A;  3V8J A;  1DJ7 B;  3QJ6 A;  1HK9 A;  3QXE B;  4ELY C;  4M7A D;  3JCM g;  3G4S T;  4A4F A;  2X4W A;  3CCS T;  1G5V A;  3UDC A;  2L3R A;  2VGN A;  1FX7 A;  1P92 A;  1M5Q 1;  2E1H A;  5GAN 3;  3CCJ T;  1Q81 C;  3CCL A;  2F69 A;  1YHQ A;  2QQS A;  4C8Q C;  4HKE A;  3HRS A;  3MP1 A;  4Q5W A;  4MZP A;  1WGS A;  3CMA T;  3EAE A;  4M7A F;  1YJW T;  4C8Q E;  4XTZ A;  3L42 A;  1U1T A;  1VIF A;  2CZ1 B;  2JVV A;  4NS5 A;  2ZPH B;  5DLO A;  2P0P A;  2E6N A;  4JS4 A;  2Y90 A;  3JCM h;  3X28 B;  1VQO A;  1I5L A;  2DTH A;  1M9S A;  3M4G A;  3MEA A;  4M75 B;  4JRK A;  5GAO n;  2MWP A;  4OP0 A;  4R56 A;  2K57 A;  3EFS A;  2E64 A;  5LJ3 g;  2R5A A;  2ZPE B;  1KHI A;  3RES A;  3NTH A;  2RJF A;  4OB0 B;  5KE2 A;  3QHS A;  3G6E A;  4M78 B;  3SDZ A;  4Y91 A;  3JCM d;  3A5Z B;  1KD1 U;  1M1K C;  3UT1 A;  4M75 D;  3MCA B;  4XTX A;  4PJO B;  5FLX E;  2K5L A;  4D6W A;  1VQK T;  2OTJ T;  2DXB A;  3JCM W;  4MML A;  4EMG A;  4Y28 E;  4C0F A;  5A0L A;  3CC7 A;  2WAC A;  1M90 U;  4M7D A;  4M75 G;  1LNX A;  4HCZ A;  4IUQ A;  4ME7 A;  2D9T A;  1W4S A;  3GNF B;  4BE0 A;  4EMK A;  3CCS A;  1Q86 C;  1VQ7 A;  4J83 A;  1LOJ A;  4XQ3 A;  1VQ9 A;  2QI2 A;  3CCJ A;  4PJO D;  3MHX A;  4WF2 A;  2K2V A;  3OYJ A;  4MDX A;  4M78 G;  1JJ2 S;  2M1H A;  4BE2 A;  4M7A A;  1D3B A;  2EJ9 A;  2PVO B;  5LJ3 d;  3O8V A;  1UGP B;  2HNI A;  3OS0 A;  1N9R A;  1G3S A;  3FRN A;  4PJO G;  5CAI A;  1YJW A;  2XDB A;  1WJQ A;  1YJ9 T;  1YCY A;  1B34 B;  2IVW A;  4OGE A;  2CYZ B;  2LX9 A;  4BDZ A;  2XG8 D;  3V8L A;  1VQ5 T;  3MEU A;  4A4E A;  3GIB A;  5L8R E;  2XI9 A;  3QBY A;  2BUD A;  5LJ5 g;  2JUF A;  2RK1 A;  3R6O A;  2LC4 A;  3HFN A;  5GAN j;  1N8R U;  3OYF A;  4KUD K;  2LCL A;  3P8H A;  2QDY B;  3QZ5 B;  2PVG B;  3LGF A;  1K8A C;  1N27 A;  2RH2 A;  2RHY A;  4GLK A;  3RUX A;  4M7D C;  3JCM Q;  2PU9 B;  5GAM g;  3C94 A;  3ER0 A;  2OTJ A;  1UEB A;  4EMK C;  1R8O B;  4JDS A;  2V8J A;  5FU7 B;  3HRT A;  2LQ8 A;  3S3N A;  4X34 A;  1VQ8 T;  5LJ5 h;  2QQA A;  3JB9 G;  3OB9 A;  3OA6 A;  3M59 A;  4C8Q B;  4BY6 B;  5KH6 A;  2LQK A;  2DD4 A;  2F5T X;  1I81 A;  3V8K A;  4C92 F;  5DY9 A;  4OB2 B;  1QVP A;  2CGH A;  1YIJ T;  5GAN g;  1Y71 A;  1BIB A;  1N9S A;  5LJ5 d;  4TVR A;  3H6Z A;  5CKE A;  2GFU A;  1VQN T;  3QYG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...