4NL2A

Crystal structure of listeria monocytogenes hfq
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
73
structure length
73
Chain Sequence
MKQGGQGLQDYYLNQLRKEKILATVFLTNGFQLRGRVVSFDNFTVLLDVEGKQQLVFKHAISTFSPQKNVALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of U-rich RNA by Hfq from the Gram-positive pathogen Listeria monocytogenes.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Rna binding protein
molecule keywords Protein hfq
total genus 17
structure length 73
sequence length 73
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4nl2A00
1BIAA 1YCYA 4RCBA 3SWNB 3JCMf 1D3BB 2E41A 5GAMe 1TH7A 4XU3A 4EMGA 4XU0A 5GANf 3JCMg 4M78F 4C92G 5I21A 1BIBA 1I5LA 5GANe 2ZGWA 5GMKm 1WQWA 2Y90A 5GAN3 4A53A 5LJ5e 4C92D 4XQ3A 1JRIA 2DZCA 1M5Q1 2RM4A 5LJ3d 4EMHA 2E1HA 3INZA 4M7DB 4XTUA 5GAMj 5LJ5f 4M7DE 2VXEA 4M75B 5CAIA 4A54A 1M8VA 5GMKe 1WPYA 5LJ3f 4NL3A 2E65A 3JCMh 2DJZA 4PNOA 4XU1A 3V7SA 2FB7A 5GAMf 4XTVA 3EFSA 1HXDA 2E10A 3JB9J 5GAN5 4PJOG 4M7DC 2RD1A 3QO3A 3BW1A 2VC8A 1D3BA 4NOYA 3JCMW 4M77F 4HA8A 4M7AF 2E64A 3PGGA 4C8QD 4F7UB 4C92B 4F7UF 3L2ZA 3BFMA 4C92C 5GAN8 3RERA 3QSUA 2DXUA 2EWNA 2DXTA 1LOJA 1Y96A 2VXFA 3BY7A 5LJ3j 3EFRA 1I4K1 1HK9A 2DZ9A 4J6YA 4MMKA 4DQ2A 2CGHA 5GAMd 5LJ3e 4OP0A 4MMLA 2DTIA 3RKYA 1WQ7A 4M7DA 3GIBA 4M75G 1U1TA 1KQ2A 4F7UA 4M78E 4M75F 1N9SA 3AHUA 4M77E 4M7AE 4Y91A 3JB9I 3JB9D 4PJOC 4XTZA 4XTWA 4EMKA 4M7DD 4M77C 3L1AA 4M7AC 5LJ3h 4C92A 1LNXA 1LJOA 4JLIA 4JRIA 2EAYA 4J6XA 3BDUA 4J5YA 4C8QC 4M77A 2RB6A 5GAN6 5GAOl 4M7AA 3JCMb 4PJOB 3RKWA 4F7UG 3JCMd 1X01A 3QUIA 4M75A 1N9RA 3JCMc 4C8QA 2YLCA 4M75E 2DTHA 3RESA 4M78G 4N0AA 1Y96B 1I81A 4M77B 3HFNA 4M75D 4WF2A 3FJPA 4M7AB 1WNLA 2JN0A 3FIFA 3V7RA 4C8QG 5GAN4 5GAOq 3JB9F 4XU2A 4PJOE 4NL2A 3JCMX 4M77D 4M7AD 5GAN7 4C8QF 4XTYA 3M4GA 3SWNA 4HT8A 4C92F 5GANj 5LJ5g 5GANh 4M78C 4F7UE 4X9DA 5GMKj 3FB9A 3JCMV 2EJGA 5GAOp 2EJFA 3JB9H 1MGQA 2I2LA 2DEQA 3RKXA 5GMKi 3V8LA 3JB9G 1KQ1A 5DY9A 1B34A 1H641 4QVCA 5GAOn 4J6WA 1B34B 3HSBA 4XTXA 5LJ5d 3V8KA 3JCMJ 4M75C 1I8FA 2K57A 5LJ3g 4JUVA 4PJOA 4M78B 4M7DF 2QTXA 4M77G 2FYKA 4QVDA 3RIRA 5GMKh 4HT9A 4C8QB 4M7AG 4PJOD 4N0AC 2YHTA 4PJOF 3JCMe 3JCMQ 4EMKB 2DVEA 3RUXA 5GANd 5GAOm 5GAMg 4M78D 5GMKl 3JCMP 4X9CA 4C92E 2DTOA 4RCCA 1U1SA 4M7DG 5GAOr 2YLBA 5GAMh 3V8JA 3QHSA 3SB2A 4M78A 4V2SA 5GAN2 1JBMA 2DKGA 2EJ9A 3VU3C 5LJ5h 5LJ5j 5GANg 3HFOA 3V7CA 2RA2A 2HNIA 4EMKC 4JRKA 4C8QE 3SWNC
chains in the Genus database with same CATH superfamily
1ZA2B 5GAMe 1K9MR 1IREB 3PT9A 3OYKA 5M9OA 1MV3A 3L2QA 3OYNA 2F1LA 4ZGDB 2E12A 3E19A 2X51A 1JRIA 2RPNA 1PSEA 2QYZA 2YDLA 3J81E 4EMHA 2P4TA 5HY6A 5GAMj 2RO0A 1HSQA 1OV3A 2JVVA 2YRCA 4E6RA 3TCJA 1TSFA 4DOVA 2QASA 1C1AA 2JTMA 5GAN8 3KBGA 1Q82R 2EWNA 3ZFJA 4PFPA 1SSHA 3X28B 4X34A 3J80E 3OYEA 4A63B 4LD9K 3VV0A 4LDUA 1OX9A 1NE8A 3ZL7C 2DO3A 3PIPA 2HZYA 3G4ST 2L3SA 3G71A 3QIIA 4M75A 2OTJA 1K0SA 1WJSA 3FLGA 4ZGEB 4FCYA 1RUWA 1PD0A 5GAN4 1E7OA 3CCRT 5CR2A 4M7AD 5KCHA 1WLPB 4ELYC 2J05A 1ZBJA 1NJIR 1YITQ 1XTDA 4JJBA 2AZSA 1LPLA 3REAB 1R8OB 3JCMJ 1YHQQ 3OYFA 3IQLA 1JJ2S 1Z9ZA 2K5IA 4JDSA 4MZPA 3DKMA 4EMKB 4JJDA 1O75A 5FU6B 1TTHB 1PNJA 3LX7A 1X6OA 2V8JA 3CCLA 2HD0A 1VQ6Q 1BYMA 5GANg 3GLXA 1YIJA 4C0GA 4BE2A 4C8QE 1YCYA 1A0NB 2A7YA 3M54A 3I56A 5IN1A 3EG3A 1M90C 1VOMA 5I21A 1WHJA 2RQUA 3UATA 2JXBA 1Y7XA 1SG5A 4PFZA 4RMOA 1X6GA 2LJ3A 1K4US 5C0MA 3CCJA 3EG9B 2KK4A 1UGPB 3OS5A 2LVMA 3JCMh 2CT3A 1EX4A 4XTVA 1Q81U 2DL5A 2QQSA 2IVWA 2ATCB 2ZAEA 2VC8A 4DBFA 1JJ2A 5A2QE 2ED1A 1UDLA 1UFFA 2LQ8A 2LQWA 4L6V5 3RKYA 3OYLA 4HCCA 3NGPA 1UEBA 3CC4Q 2CS7A 4FW2A 1M3AA 3G1JA 2LP5A 2V1QA 2EGEA 3JB9D 1NG2A 4C0FA 4N4IA 3KFVA 2ECZA 4C92A 1FXXA 3CMAT 2RHXA 3H9NA 4F17A 1ACMB 1KG1A 1N9RA 2KNBB 1OX8A 2YUQA 2QG9B 2QTVA 5FU7B 1OYXA 4A4HA 3FJPA 4C8QG 3FIFA 4L5GA 4XAXB 1YIJT 4C8QF 4C92F 2DIGA 2GTOA 5LJ5g 2RNAA 1H8KA 1VQOA 2HQHA 3PMTA 2I2LA 2DEQA 2DILA 3RKXA 2MMPA 2RHZA 4QVCA 2V8KA 1ZUKA 3CC2A 1KC8R 5LJ3g 2HSEB 4DBQA 3EFOB 3VS1A 5C6SA 2E3IA 3CCLT 5KYXB 2DIQA 5GAOr 1QP2A 1M1KU 2GQVA 3CCLQ 1VQ6A 2VKNA 2RA2A 3M58A 1N5ZA 1ZLMA 2D9TA 4AG2C 4DBHA 1RAGB 4RTTA 5CO7A 1BIBA 2LQKA 4BI3A 2VWFA 1BCMA 1YBYA 1NZ9A 1WFWA 2GFAA 4IUUA 4A54A 2M1HA 5LJ3f 4NL3A 5KYUB 5GAMf 4PNOA 1YI2Q 1PSFA 1HXDA 1MNEA 5IHNA 3C94A 4LUEA 2CREA 3NFCA 1D3BA 1UJYA 1KD1U 4F7UF 2DXUA 5HCKA 4J9CA 2LX9A 3NPFA 5GAMd 3OS1A 3G6EQ 1WHKA 1SEMA 4C0ZA 2GF7A 3A98A 3PVQA 3X25B 1WZOA 1N9SA 2FZKB 3LLRA 2F2WA 1JU5C 3LGFA 4FYXB 3L2VA 1PWTA 3JV3A 1AZGB 1Y07A 4J6XA 3CC7T 5CQYA 3OYMA 3RKWA 3CMAA 4CC2A 2ROTA 3SDZA 4XK8E 1JB0E 2K9GA 1I81A 1T0JA 2J6OA 3OW2P 4DEYA 4JS4A 2L3QA 3M4GA 2SEMA 5FLXE 2EPDA 2DRMA 3DB4A 2O9VA 2OAWA 3M0TA 5A0LA 1UGRB 2NUZA 3RDVA 4J7IA 5FROA 3OQ5A 2Z0WA 5FU7C 4GBQA 4J9HA 3RIRA 4PJOD 2YHTA 4ATOA 2M51A 1KQSS 3CC2Q 4Y92A 5IXBA 2ZPHB 4KGZB 1RLPC 5CKFA 5KYUA 3I55T 2DKGA 2EJ9A 2MIOA 3H0FA 2CP5A 3OYAA 3CCMA 3VS6A 1VYUA 2M9UA 1JO8A 3SWNC 3UT1A 1MMNA 2KGTA 2E41A 1B3QA 3QYGB 4OB0B 1PKSA 2A3LA 2FRWA 2ZGWA 2Y90A 1ARKA 3CBOA 1QCFA 4C92D 3I55Q 2F2VA 2WSEE 4GLMA 1TXQA 2XDDA 1T3SA 4IIOA 2LZ6B 4BY6C 2MPXC 2ZZDA 2CKKA 1WGSA 3QPHA 3VUBA 3MEWA 1W2BS 4J9GA 5GAN5 1B07A 4J9DA 5LL6S 4M7DC 3CCUT 1VQOT 1QMCA 5J26A 3S3MA 2QAZA 3BDLA 4OMFB 3CXCP 3DLLA 2DL8A 4DA4A 1KFZA 3EGUA 2QGFB 1VQNT 3M5AA 1NLOC 2GGRA 2DBMA 1H92A 3M53A 2JZ2A 1LNXA 4E7SA 2RB6A 1NPPA 4IURA 1X01A 2J06A 1K9AA 4C8QA 5KH6A 2RQWA 1AEYA 3QZ9B 2C0IA 4VUBA 1VQPA 2JN0A 3OSSC 2HMAA 4M77D 1OU8A 1YN8A 1Q7YC 4C5EA 3FB9A 2QK0A 1PKTA 1M2VA 1GL5A 1RACB 1KD1R 3HRTA 1GRIA 5GMKh 3EGDA 4PJOF 4II1A 5IHIA 2RHUA 5GAMg 2DF6A 1NM7A 4FSSA 2HQEA 3EG1A 3JSCA 2A08A 3CCJT 2VGMA 2CZ0B 4HCKA 3VUZA 4Z88A 5GAN2 4PLLA 5IT9E 4JRKA 1J3TA 1BIAA 3TSZA 2D6FA 2QGGA 1TH7A 1MNDA 4XU3A 3GNFB 4XU0A 2ZPEB 1QVGP 4CI0C 4MDWA 5GAN3 2RM4A 1GCPA 1MV0B 1OI1A 1M1KC 3QWXX 1ZX6A 4DBRA 3E2UA 4LUDA 3M0PA 3OY9A 2E10A 2DL4A 2KQWA 4OF1A 4RTYA 2RD1A 3LGLA 4M77F 2E64A 1VQ7Q 1FX7A 1K9MC 6AT1B 2E3HA 3BY7A 1I4K1 2RK1A 4DQ2A 2JOYA 5GJVB 5LJ3e 3CXCA 4M7DA 4F7UA 1QQJA 3CCEA 3JB9I 2NLUA 4XTZA 1UGSB 2EAYA 3HP9A 1M1FA 4AT1B 5KYWA 4F7UG 4DOWA 1Q81R 2YUOA 2XK0A 2EYYA 2MOXA 4KUIA 3D7SB 2QQRA 4ZTJA 1IGUA 2F5KA 2FO0A 1Q86R 2DPPB 4WCIA 5GJWB 3R6OA 4UC4A 2L8DA 2L3PA 4HXJA 1YJNT 4XTYA 4QVZA 3CC2T 5KYYB 2J7IA 2ROLA 5GANj 1N8RR 2RJFA 1WDXA 4FW1A 2EVRA 2L5QA 4E7JA 3REBB 2LNHB 5KYXA 3UF4A 4DEXA 1YJWQ 4Z89A 3M9QA 1GFCA 1ZSZC 1HJDA 4HKEA 4PJJA 3WVEB 3GF5A 2DVEA 1YP5A 5GAOm 2FPFA 1VQ9A 1KC8C 2LC4A 4E7IA 3BE3A 2AT1B 3QDRB 1DJ7B 4PL6A 2BIVA 1M1GA 2DK3A 2M16A 2GNCA 2JS0A 3QDFA 1IO6A 3VYGA 2YUNA 4BDYA 2DZCA 1M5Q1 3G4SQ 1SHFA 4M7DB 2QDYB 4XTUA 5GMKe 1X2QA 4LNPA 2AKLA 2RJEA 4P5NA 1LVKA 2DJZA 1U5SA 2ENMA 5IH2A 1K8AR 5IAYA 4ZTFA 1M3BA 2JW4A 1WXBA 4NOYA 2DA9A 1VQKQ 2LRQA 2BE9B 3EFRA 1OU9A 1FMVA 2PU9B 1AZEA 5CK9A 3GIBA 1U3OA 2KXDA 1KQ2A 1G3SA 4M75F 2HL5C 3CMEA 4LDYA 4M7DD 3CCRQ 4E7LA 4FYVB 1MUZA 1VQ5Q 3PVLA 3JCMb 2DXCA 3VS0A 3MEAA 2OJ2A 3EG9A 4PFOA 2NUTA 2DL7A 1BU1A 2QXFA 3VS2A 1JXMA 4N0AA 4WTOB 1VQ7T 3HKSA 1NEBA 1KQSA 1QVFS 2F69A 4EDUA 5L8RE 3SWNA 4GLKA 4M78C 1ZUUA 4X9DA 2LCSA 3X26B 2H8HA 3H6ZA 1YNZA 1D1AA 3V8LA 4JJCA 5LJ5d 8AT1B 2V1RA 3NHNA 5DLOA 3A8GB 4KRTA 2C0OA 2JJ9A 2RQRA 2M0OA 1G3TA 5GMKl 1KJWA 1SSFA 1AWOA 1JXOA 4C5GA 5GAMh 4BDZA 2DMOA 2Y4XA 1E6GA 2DAQA 5LJ5h 1RL2A 1NJIC 4PJNA 4EMKC 3CCVA 2O4XB 2XDPA 5GANf 1QKWA 1BK2A 3QJYA 2E6NA 4M78F 4AFUC 3HTRA 4ZGJB 1BKBA 2E6ZA 4HCBA 1XJWB 2CZ7B 3P8HA 2HSPA 3FC3A 3PE0A 4CC4B 3CCQA 1K8AU 4M75B 1P92A 2QEXA 1VQ9T 1R0CB 4BACA 4RUGA 1VQMQ 2CP7A 4FT2A 5IHKA 3H0IA 2RHIA 2RQTA 4TVRA 2LTOA 3JCMW 2YRVA 3TU4K 4FYWB 2CP0A 1KHCA 2DXTA 2ZPFB 1D1BA 2EFIA 4OMLA 3CPWP 1VQKA 3O8VA 3PMIA 4M78E 4RTUA 2HQXA 4FT4A 3MCAB 4M7AC 4E7ZA 3ZEHA 1G5VA 4QT7A 5D6YA 2FZCB 4C8QC 2EYZA 2PUKB 2EQJA 2CUDA 1W70A 5J3BA 2EGCA 3JAME 2EYQA 3X20B 3FJ5A 2HAXA 5AT1B 3V7RA 1Y0MA 1C6VX 3OMCA 2EIFA 1VQ6T 1KQSP 2MWOA 2ESWA 1S72A 5FRNA 5GANh 3EG2A 5KYYA 1YJNQ 2X4YA 1NYGA 3OYHA 3PNWC 1RAHB 4B9XA 2QTXA 4C8QB 1ZSGA 5GANd 3OBWA 1FMWA 2KI7A 1G3YA 3LH5A 3HRUA 1W6XA 2P0PA 4Y28E 1V29B 4LN2A 3CBMA 2PVDB 4RTVA 4B6MA 2YWWA 4J9BA 1IXDA 3ME9A 3U23A 3UA7A 1TUGB 1I5LA 4IKFA 3M59A 2GFUA 2BZYA 2XIDA 5CAIA 3OMGA 1YJ9T 5KYNA 1UHCA 2X9HA 3HL8A 2MF2A 4KBMB 3PIOA 2FEIA 5I2MA 4M7AF 4F7UB 3BFMA 3EFOA 2LT4A 2ZPBB 3EH2A 4KGXB 3LW5E 2DRKA 4MMKA 3CCEQ 4MMLA 1BI1A 4LDWA 3CCMT 2P0QA 1BI3A 4CC3A 2V8IA 2JM8A 3G6EA 4BY6B 1NYFA 5GAN6 3BDUA 2A37A 4M7AA 1TS9A 3RR6A 1R0BG 3FEOA 3RMSA 1T3LA 2KR3A 3UDCA 4HVUA 3CCSQ 4M77B 2XHCA 5A0GA 1X43A 2LX7A 2DEUA 2HKNA 1WA7A 1VQ4Q 3FDRA 1WI7A 1IRXA 1PC0A 2KRSA 2OTLA 4X1VA 2JUFA 2DVJA 3JCMV 3NMZC 2XG8D 4L59A 3HSBA 2R58A 2K57A 1E6HA 1D09B 2YUPA 4O6JA 4HT9A 2QEXT 3KUFA 4GY5A 3H41A 2O88A 4E47A 4M78D 1RABB 4FM4B 1RAEB 2K79A 1M2VB 1U1SA 1OOTA 1Q7YR 4M78A 2CDTA 2HDAA 2I0NA 5LJ5j 1N6AA 1KC8U 3CCRA 1RLQC 4MZMA 3MHXA 4LE9A 4RCBA 1VQLT 1VYVA 3M0UA 4KUDK 2QA4Q 1D0YA 4BE1A 4IUPA 4C92G 3A1PA 2G6FX 4R55A 1S72Q 4K11A 3HHTB 4RTXA 3CEYA 2FPEA 1M8VA 3RBBB 4JRQA 2OTLQ 3EFSA 3MP6A 2D0NA 2AK5A 4QKUA 2L0AA 3PTAA 3A8HB 4KH1B 2GCXA 1QVGA 3QSUA 4F16A 2DXBA 3MKDA 2NYSA 1HK9A 3OYCA 2KEAA 1CSKA 2XICA 4BI4A 2XD0A 3AHUA 1VQ5A 1B7TA 1W2BP 2X3WD 5GAOl 3E1SA 4JLGA 1T0HA 4CRIA 4BB7A 4PKCC 4M78G 3H8ZA 1F1BB 2PUOB 4XU2A 1KHIA 2FVUA 3I5SA 4E7HA 2RK2A 3CCMQ 4QW2A 2MK5A 2QQBA 5GMKi 3OA6A 5CCAA 4FU6A 2G3RA 4QVDA 2COWA 3OW2S 2KXCA 5IXFA 4R56A 2WSFE 3S6WA 1H3HA 2PNIA 3V8JA 3MP1A 1OQKA 1ZUYA 3CCSA 2KDSA 2HBWA 4CC7A 4O5VA 2A0FB 2EKHA 3OYGA 2NUPA 3EGXA 2KE9A 2DERA 2EQKA 3JCMf 2FRYA 2MCNA 5J39A 2VUBA 4A53A 2FPDA 1EIFA 4PLIA 2JS2A 2H3JA 5L23A 5KE2A 1I07A 1Q82C 2M02A 3RNJA 2ED0A 1YHQT 1NBEB 4IUVA 3G71Q 3L2ZA 2O4XA 1D1CA 2VXFA 3EAEA 3I56T 2CGHA 2X3XD 1UB4A 4J9IA 3OYYA 4OB2B 3L42A 1QVFP 4M77E 1BCOA 3SFMA 1M1KR 5ECAA 4M77C 1YI2A 2HBPA 2OI3A 2D0QB 3CXCS 2BE7D 2FG0A 1EFNA 4EIKA 3VRZA 3SD4A 3CCUA 4M75E 3OS2A 3URGA 2YRDA 3NTKA 1XOVA 1WNLA 1H3ZA 1MHNA 1GBRA 1WXTA 1MMGA 2KBTA 2JTFA 2IG0A 4KULA 1TOVA 1VQ4T 2BTTA 4A4FA 4Q5WA 1ABOA 2QEXQ 3JB9G 2NWMA 1H641 3ULRB 3CCQQ 3TREA 3C4SA 7AT1B 2FZGB 2KT8A 1I1JA 3OS0A 3N5BB 3S3OA 1UGVA 9ATCB 2E70A 4X9CA 4C92E 2DTOA 4KT0E 3MEUA 2DETA 3OYIA 4OGEA 1JBMA 4N4HA 2M0YA 1ZBXA 1RI9A 3OBYA 2W0ZA 3SWNB 4D8KA 5EC7A 4NS5A 1CKAA 1QP3A 2JMCA 3M0RA 2AIRB 1PG5B 3VKIA 2X35A 3E9FA 5GANe 3GP8A 1ABQA 3NTIA 1JQQA 5LJ5e 3L2RA 3M4YA 2H3EB 2IIMA 5LJ5f 3GPLA 2RF0A 3CC4T 1UHFA 5KYWB 3A8MB 2KVQG 3E9GA 1G3WA 3M57A 2L2PA 4A4GA 1QW1A 2K3YA 1TWBA 2DFUA 3RERA 3RMQA 3CCQT 3CC7A 2EQIA 2DZ9A 4J6YA 4OP0A 3CCVT 1GXIE 5DLQE 2EGAA 1VQ5T 1UTIA 2JM9A 4J9EA 5D6XA 2K5LA 4JRIA 4M77A 2RH2A 3VS4A 2X4WA 1Q95G 4PJOB 1TU0B 4Z8AA 2RJDA 2PVGB 4EPCA 2EYWA 3QZ5B 2A36A 3QYHB 4M7AB 3G71T 3HFNA 3JB9J 2LCCA 3JB9F 2CSIA 2QQ9A 4OMMA 5CKDA 2CT4A 4F7UE 1WX6A 2LQNA 3I35A 2JMAA 3J7AF 4HCZA 3I56Q 3JRZA 2XDBA 2COZA 1Q86U 2VASA 1VQLA 4F14A 2FYKA 3HRSA 1SF9A 1D0XA 5DM7R 1WHMA 3GNGA 3QBYA 3T9NA 1HYOA 2JTEA 4KGVB 4HVVA 2K6DA 2RMOA 4MZTA 3MO8A 3MPUB 1AWWA 3UPUA 2OX7A 1K9MU 2HL3A 1K73U 1K73R 1YJWT 1OULA 4D6WA 2E1HA 2P4RA 5CKHA 3GOXA 5D6WA 3MEVA 3X24B 1UGQB 1KK7A 3L2UA 1M2OA 1YCSB 3TQ7P 4OMPA 1VQ4A 5FU6C 2D8JA 3L2WA 2KYBA 3WXMB 1OZ2A 4Z02A 1Q86C 3S3NA 2ZCFB 1X75C 4LXCA 2DJQA 4M75G 4C0DB 4QQDA 2DM1A 4EMKA 3VYHB 4JLIA 1VIEA 2L3RA 3SHWA 4AFSC 2WACA 1OPLA 2PZ1A 2KYMA 1WXUA 2MYSA 2XU8A 1VQNA 3EG0A 2RJCA 1Y96B 2C0TA 4WF2A 2QA4A 2K3BA 1Q81C 2F2XA 2PVOB 3CCVQ 3UA6A 2QQAA 2VB6A 1YITA 1IB8A 2XKOC 5KCOA 3CD6A 1KQ1A 1B34A 2HCKA 4XTXA 4J9FA 1WHHA 1YJNA 2QA4T 3C95A 1UJ0A 3VS7A 1VQLQ 4RKUE 3JCMP 1OEBA 3EGXB 1BB9A 2P84A 1BI2A 1AD5A 1S72T 4V2SA 1VQNQ 2E5KA 1MMAA 1SPKA 1KSWA 1AOJA 2CP2A 3A5ZB 1M30A 5GMKm 1RADB 4B9WA 1VIFA 3CCUQ 1R77A 2L89A 1UG1A 4JZ4A 4FL6A 2ZPIB 1TG0A 4BE0A 1PCXA 1KIKA 1K1ZA 4A4EA 4RG2A 4XU1A 1FYNA 2X4JA 1FWZA 2CZ1B 3QWYA 1D0ZA 2JNGA 1I5OB 4BD3A 2D8HA 2C06A 3A8LB 1VQ8T 4C8QD 1U8RA 3EHQA 1LOJA 1Y96A 1VQPQ 4OB3B 2DL3A 2KY9A 1WQ7A 4ESRA 1U1TA 2DD5A 4M7AE 3P8DA 4AFQC 1LJOA 3CBPA 2RI5A 2K2MA 3PFSA 2W10A 3CPWS 3EH1A 2DX1A 4IIMA 3QUIA 1QCNA 2OAUA 2FHDA 2YLCA 2DTHA 4OMOA 1RI0A 2AHJB 2DBKA 3LYIA 1LCKA 4LDVA 2BZ8A 5FWCA 4PJOE 3JCMX 1SKUB 4R0KA 4E7KA 1OPKA 1RAFB 3I9QA 2KRMA 1QVFA 2K7AA 1W2BA 3TVTA 2EJFA 3Q1JA 2EQUA 3A8OB 1SHGA 4J6WA 1WIEA 5AYFA 1M90R 1I8FA 2RN8A 1K0XA 4M77G 2MAMA 3JCMQ 3RUXA 1U06A 3CD6T 3M0QA 4ZN3A 2LDMA 1M3CA 2O01E 2YXYA 1VYTA 2CYZB 1JEGA 2KAFA 2CSQA 2CUBA 2CH4A 3QG1A 1N8RC 2GBQA 3V7CA 1IGQA 1IZ6A 3CMEQ 4C0DC 4PJOC 1D3BB 4C5HA 2KMTA 1KD1C 1JJ2P 3LWHA 4IUQA 4OMQA 4KH0B 1WJQA 1TUDA 2MI6A 5LJ3d 3INZA 4RG8A 1WYXA 4M7DE 4C5IA 1S1NA 1QCOA 4A4KA 1UECA 4YTLA 1I0CA 1YHQA 1V76A 3HPWA 4FYYB 1XQHA 4PJOG 3QXEB 5A0DA 3QO3A 1AT1B 3CC4A 2CH4W 4C92B 1WHLA 4PJLA 4C92C 2KT1A 1C0MA 1AHJB 5FRMA 1IHWA 2LJ0A 4ME7A 2OTLT 2NUPB 2QI2A 5CKBA 2VYTA 1AWJA 3TEEA 2YT6A 1WHGA 3I55A 5HKCA 2K3XA 2R5MA 2D1XA 1N8RU 1PRLC 3L1AA 2QDLA 1VQMA 1VUBA 4JPBW 1UUEA 2KROA 2NUTB 3WVDB 3LWIA 2LCLA 1ZSZA 2SRCA 2KSSA 3OB9A 3CC7Q 2LJ1A 3I5RA 2FL7A 4J83A 4M75D 1VQ8Q 4MDXA 3AT1B 3CCJQ 4FIBA 5GAN7 1NLPC 4OVAA 1QWEA 5CKEA 1NJIU 3QJ6A 1PD1A 1HD3A 3THKA 1MGQA 1MMDA 5CIUA 3EHRA 2X4XA 1ZHIA 1B34B 3V8KA 4HVWA 4JUVA 4M78B 1QVGS 2GTJA 4N4GA 2XI9A 4QQGA 2DD4A 5D7UA 4BUGA 4J8OA 1PHTA 2YLBA 3G7ZA 2VV5A 3QHSA 3ASKA 1RAAB 1Y71A 1ZQ1A 3HFOA 2LT1A 1GCQA 2DE0X 3SEMA 3OYBA 3CPFA 4LDXA 2E5QA 2HKQB 4QQ6A 2RQVA 1VQOQ 2CP3A 1VQ8A 1CKBA 2DYBA 1XNIA 4E2FB 1Q7YU 1YWOA 2LNVA 5KE3A 4ZNXA 1YJ9Q 4RTWA 3VS3A 3CCET 2FB7A 2O2OA 2R57A 4D8DA 1M90U 4HA8A 1K76A 2GQIA 1AVZC 1SRMA 2VVKA 3MP8A 4ORZA 1X2KA 1RAIB 2DTIA 1PM3A 2P0KA 2B8AA 1EZZB 4ANJA 3O5ZA 3CQTA 2CZ6B 4Y91A 2B86A 2O9SA 3M0SA 2PTKA 4XTWA 1YIJQ 5LJ3h 2F5TX 2Y4YA 3CCST 2DLPA 3FRNA 2EKOA 4PK4A 3JCMc 4JRPA 3G4SA 3C12A 3CMET 3RESA 2KRNA 1VQKT 1IHVA 2AKKA 2BUDA 4NL2A 3P8BB 1QLYA 1YITT 1M4ZA 1M8MA 4HT8A 3QKJA 1V1CA 3CD6Q 5FW9A 4AMCA 1W4SA 5GAOp 2EYXA 5DY9A 5GAOn 1GCQC 2COYA 1OZ3A 1TUCA 2K4YA 4LD6A 3MJXA 1G83A 4JJNK 3VRYA 1Y57A 1Z9QA 2DNUA 3LH0A 1M9SA 1VA7A 4AFZC 1YWPA 2VGNA 4RCCA 1FMKA 2V26A 4FSXA 3SB2A 2K5FA 3VU3C 3OYJA 3F70A 3ZBDA 2HNIA 3R6NA 1G2BA 4EMGA 3G6ET 1ZA1B 1VQPT 3JCMg 1NEGA 4J7FA 2ABLA 4M4ZA 1WQWA 2XMFA 3META 4XQ3A 1QVPA 1W1FA 2J6FA 4ELZC 2VXEA 1YI2T 1NPRA 1YFNA 8ATCB 1WPYA 1GFDA 4PJMA 2DYIA 2E65A 1G8XA 3V7SA 4BI8B 1YJ9A 3BW1A 1PRMC 3C0CA 4PJOA 2A28A 3PGGA 2J6KA 1GBQA 4ZN1A 2BZXA 2ZPGB 1BI0A 2EQMA 1M27C 1O9SA 5LJ3j 1X69A 5EG2A 1VQMT 1K73C 1Q82U 3VJPA 2YSQA 4OGCA 3OYDA 4JS5A 3CPWA 3OSVA 1QWFA 2EW3A 1QKXA 2HEQA 3EGDB 1UE9A 2OTJQ 1VQ7A 4J5YA 5CVIA 1WJRA 2JT4A 4OMNA 1AWXA 2PQWA 5I22A 3JCMd 4AG1C 2LMJA 2WSCE 2O31A 5HK3A 4JZ3A 1ZSZB 3KXTA 3TSWA 1BBZA 5GAOq 3OW2A 2RHYA 2AZVA 3M56A 4RTZA 4IUTA 5FWBA 2MWPA 3H0HA 5GMKj 2EJGA 3JB9H 5I11A 3ER0A 4OB1B 2CP6A 5I2SA 4M75C 3UWNA 3DLMA 2E4HA 3VS5A 4M7DF 1X27A 4M7AG 2IPOB 1N27A 4N0AC 3JCMe 2RI3A 3GBQA 1VQ9Q 2BKDN 3CMAQ 2OTJT 4M7DG 4F04B 3M55A 5CQXA 2EBPA 1K8AC 1X6BA 2K2VA 5HK0A 1SRLA 2R5AA 3DB3A 1YJWA 2RI2A 3NTHA
chains in the Genus database with same CATH topology
1BIAA 4RCBA 5GAMe 2D6FA 1IREB 4KUDK 1TH7A 3PT9A 4XU3A 3GNFB 4XU0A 3A5ZB 5M9OA 3OYKA 4BE1A 2ZPEB 3L2QA 4IUPA 4C92G 3OYNA 4ZGDB 4CI0C 2E12A 5GMKm 3E19A 4MDWA 4B9WA 1VIFA 5GAN3 4R55A 2L89A 1JRIA 1PSEA 3HHTB 3J81E 2RM4A 4FL6A 4EMHA 2P4TA 2ZPIB 3CEYA 5HY6A 5GAMj 4BE0A 1OI1A 2RO0A 1M1KC 1M8VA 4A4EA 2JVVA 4JRQA 4RG2A 4XU1A 3OY9A 3EFSA 2E10A 2X4JA 3MP6A 1FWZA 2CZ1B 2KQWA 4OF1A 3TCJA 3PTAA 2RD1A 2JNGA 3A8HB 4BD3A 3LGLA 4DOVA 4M77F 2GCXA 2C06A 2E64A 3A8LB 4C8QD 1VQ8T 2JTMA 1QVGA 5GAN8 3QSUA 3KBGA 1FX7A 2DXBA 2EWNA 1U8RA 1K9MC 1LOJA 3ZFJA 1Y96A 3BY7A 1I4K1 4X34A 1HK9A 2RK1A 3X28B 4DQ2A 3J80E 2JOYA 3OYCA 4OB3B 5LJ3e 3OYEA 2KY9A 4LD9K 3CXCA 1WQ7A 2XICA 3VV0A 1Q86C 4BI4A 2XD0A 4M7DA 4LDUA 1U1TA 1NE8A 2DD5A 4F7UA 3CCEA 2DO3A 3AHUA 4M7AE 3JB9I 2NLUA 3PIPA 3P8DA 4XTZA 3G4ST 1VQ5A 1LJOA 1UGSB 2EAYA 2RI5A 3CBPA 5GAOl 3G71A 3HP9A 1M1FA 3PFSA 3CPWS 3E1SA 3QIIA 4F7UG 3QUIA 4JLGA 4M75A 4DOWA 4CRIA 2OAUA 2OTJA 2FHDA 2XK0A 4BB7A 2YLCA 4KUIA 4PKCC 1WJSA 2QQRA 2DTHA 4ZTJA 3FLGA 4M78G 2F5KA 4ZGEB 3H8ZA 1RI0A 2DPPB 5GAN4 2AHJB 2PUOB 3LYIA 3R6OA 4LDVA 1KHIA 2L8DA 4UC4A 2FVUA 4XU2A 5CR2A 3JCMX 3CCRT 4M7AD 5KCHA 4E7KA 1YJNT 4XTYA 4E7HA 4QVZA 3CC2T 4ELYC 5GANj 1QVFA 2RK2A 1W2BA 4QW2A 2RJFA 2EJFA 2QQBA 3Q1JA 1XTDA 2EQUA 5GMKi 2L5QA 3A8OB 4J6WA 3OA6A 5AYFA 4E7JA 5CCAA 1R8OB 3JCMJ 1I8FA 4FU6A 3M9QA 3OYFA 1JJ2S 4M77G 2G3RA 4QVDA 2MAMA 4HKEA 2K5IA 4JDSA 3WVEB 3GF5A 4MZPA 2DVEA 3DKMA 3RUXA 4EMKB 1O75A 5FU6B 4ZN3A 3JCMQ 5GAOm 3CD6T 2LDMA 2O01E 3OW2S 1VQ9A 1KC8C 2CYZB 4R56A 3LX7A 2LC4A 2WSFE 4E7IA 1X6OA 2V8JA 3S6WA 3CCLA 2HD0A 2KAFA 3MP1A 3V8JA 3QDRB 3CCSA 1DJ7B 2KDSA 5GANg 1BYMA 3QG1A 4PL6A 2BIVA 3GLXA 1N8RC 1M1GA 3V7CA 1IZ6A 4O5VA 1YIJA 3OYGA 2DK3A 4C0GA 4BE2A 4C8QE 4C0DC 2M16A 4PJOC 1YCYA 2EQKA 3JCMf 2A7YA 1D3BB 3M54A 4C5HA 3I56A 5IN1A 2KMTA 1KD1C 1M90C 3LWHA 4IUQA 5I21A 5J39A 1Y7XA 3VYGA 1WJQA 2VUBA 4A53A 4RMOA 4BDYA 2DZCA 1EIFA 1M5Q1 2MI6A 4PLIA 5C0MA 5LJ3d 3CCJA 3INZA 2H3JA 4RG8A 2QDYB 4XTUA 4M7DB 4M7DE 4C5IA 5KE2A 2KK4A 5GMKe 1UGPB 4A4KA 2RJEA 3OS5A 4P5NA 4YTLA 1YHQA 1Q82C 2LVMA 3JCMh 2DJZA 4XTVA 5IAYA 4ZTFA 3HPWA 1XQHA 1Q81U 2QQSA 4PJOG 2IVWA 3QXEB 5A0DA 1YHQT 3QO3A 2VC8A 4NOYA 3CC4A 4IUVA 4C92B 3L2ZA 4C92C 2O4XA 5A2QE 1JJ2A 2LRQA 1AHJB 2VXFA 5FRMA 3EFRA 3EAEA 2LQ8A 3I56T 2CGHA 4ME7A 2OTLT 1UB4A 4L6V5 3RKYA 2PU9B 2QI2A 5CKBA 5CK9A 3OYLA 4HCCA 3GIBA 3OYYA 2VYTA 1UEBA 4OB2B 2CS7A 3L42A 3TEEA 1G3SA 1KQ2A 4M75F 4M77E 3I55A 5HKCA 2K3XA 3SFMA 2R5MA 3JB9D 4C0FA 4N4IA 3CMEA 4LDYA 4M7DD 4E7LA 1N8RU 4M77C 3L1AA 2HBPA 1YI2A 2D0QB 4C92A 1FXXA 3CXCS 3CMAT 1VQMA 2RHXA 1VUBA 3JCMb 2DXCA 1KG1A 3MEAA 1N9RA 3SD4A 3WVDB 3LWIA 2LCLA 3CCUA 2QXFA 4M75E 3OS2A 2KSSA 3OB9A 3URGA 3NTKA 4N0AA 5FU7B 2FL7A 1OYXA 1XOVA 4J83A 4M75D 3FJPA 4A4HA 1WNLA 3HKSA 3FIFA 4C8QG 1H3ZA 4L5GA 4XAXB 1KQSA 1MHNA 1YIJT 4MDXA 4FIBA 5GAN7 4C8QF 1QVFS 2F69A 4EDUA 5L8RE 3SWNA 4C92F 4GLKA 2DIGA 5LJ5g 4M78C 4OVAA 2JTFA 4X9DA 5CKEA 1VQOA 3QJ6A 1NJIU 2IG0A 3X26B 4KULA 3H6ZA 3PMTA 1VQ4T 4A4FA 1MGQA 2I2LA 2DEQA 4Q5WA 5CIUA 2MMPA 2RHZA 3RKXA 3V8LA 4QVCA 1H641 3JB9G 2X4XA 1ZHIA 2V8KA 3TREA 1B34B 3C4SA 5LJ5d 3V8KA 3CC2A 5LJ3g 4JUVA 4M78B 1QVGS 5DLOA 3A8GB 3S3OA 3OS0A 3N5BB 4N4GA 2M0OA 2XI9A 1G3TA 5GMKl 4QQGA 5C6SA 2E70A 4X9CA 1SSFA 2DD4A 2DTOA 4C92E 3CCLT 4PJOE 2DIQA 4KT0E 3MEUA 4BUGA 4C5GA 4J8OA 5GAOr 1QP2A 2YLBA 5GAMh 3G7ZA 3OYIA 2VV5A 3QHSA 2Y4XA 4BDZA 4OGEA 1M1KU 2DAQA 1JBMA 5LJ5h 3ASKA 1RL2A 4N4HA 1NJIC 1Y71A 1ZQ1A 2GQVA 3HFOA 1VQ6A 2LT1A 2RA2A 1ZBXA 4EMKC 3CCVA 2O4XB 3OBYA 3M58A 2XDPA 3SWNB 5GANf 2D9TA 3CPFA 3OYBA 4LDXA 4NS5A 3QJYA 1QP3A 2E5QA 2E6NA 4M78F 5CO7A 1BIBA 2LQKA 1BKBA 2E6ZA 2X35A 3E9FA 4QQ6A 3VKIA 5GANe 4ZGJB 3GP8A 3NTIA 1VQ8A 2CZ7B 4BI3A 3P8HA 5LJ5e 1XNIA 3L2RA 3M4YA 1Q7YU 1YBYA 1NZ9A 3FC3A 2LNVA 5KE3A 3CCQA 5LJ5f 3GPLA 1K8AU 2GFAA 4IUUA 4M75B 4A54A 3CC4T 1P92A 2M1HA 2QEXA 5LJ3f 1VQ9T 3A8MB 4NL3A 2KVQG 3E9GA 4BACA 5GAMf 4PNOA 3CCET 2FB7A 1G3WA 1PSFA 4FT2A 1HXDA 3M57A 4A4GA 2RHIA 3C94A 2R57A 4TVRA 1QW1A 2K3YA 2LTOA 1D3BA 3NFCA 3JCMW 1M90U 1VQLT 4HA8A 1KD1U 2YRVA 4F7UF 3RERA 3TU4K 3RMQA 3CCQT 2DXUA 3MP8A 1KHCA 2DXTA 2ZPFB 2LX9A 3OS1A 4J6YA 2DZ9A 2EFIA 5GAMd 3CC7A 4OP0A 2DTIA 2P0KA 4C0ZA 2B8AA 2GF7A 3CCVT 1GXIE 3X25B 5DLQE 3O8VA 1VQKA 1VQ5T 2CZ6B 3PMIA 4M78E 1N9SA 4Y91A 2HQXA 3LLRA 4FT4A 3L2VA 3LGFA 4XTWA 3MCAB 4M7AC 5D6XA 3ZEHA 5LJ3h 2K5LA 1G5VA 5D6YA 1Y07A 4JRIA 4J6XA 2F5TX 4C8QC 4M77A 2RH2A 2Y4YA 3CCST 2X4WA 3CC7T 4PJOB 2PUKB 3FRNA 2EKOA 2EQJA 5CQYA 3OYMA 3RKWA 2RJDA 5J3BA 2PVGB 3JCMc 3JAME 3CMAA 4JRPA 3SDZA 2EYQA 4XK8E 3X20B 4EPCA 3G4SA 2HAXA 3C12A 3QZ5B 3CMET 3RESA 1JB0E 3QYHB 1I81A 4M7AB 3HFNA 3V7RA 2LCCA 3G71T 3JB9J 1VQKT 3JB9F 2QQ9A 2BUDA 3OMCA 4NL2A 2EIFA 1VQ6T 3P8BB 2MWOA 1M4ZA 3M4GA 4JS4A 1YITT 1S72A 4HT8A 5FRNA 3QKJA 5FLXE 5GANh 5CKDA 4F7UE 3DB4A 1W4SA 3J7AF 5GAOp 4HCZA 2X4YA 3JRZA 5A0LA 2XDBA 1UGRB 5DY9A 5GAOn 3OYHA 3PNWC 1OZ3A 4J7IA 5FROA 1Q86U 3OQ5A 4B9XA 4LD6A 2K4YA 1VQLA 5FU7C 2QTXA 2FYKA 3HRSA 3RIRA 4JJNK 4C8QB 4PJOD 5DM7R 3LH0A 2YHTA 1M9SA 5GANd 3GNGA 3OBWA 4ATOA 1KQSS 1G3YA 2VGNA 2ZPHB 3QBYA 4RCCA 3T9NA 4FSXA 3HRUA 5CKFA 2P0PA 3SB2A 2K5FA 3I55T 2DKGA 4Y28E 2EJ9A 3VU3C 3OYJA 1V29B 3CBMA 3F70A 3ZBDA 2HNIA 3OYAA 4MZTA 3MO8A 3CCMA 2PVDB 2M9UA 3UPUA 3SWNC 3UT1A 1K9MU 2E41A 3ME9A 4EMGA 3G6ET 1VQPT 3JCMg 3QYGB 4OB0B 4J7FA 1K73U 2A3LA 1I5LA 4IKFA 2ZGWA 1YJWT 1WQWA 2Y90A 3M59A 3CBOA 2GFUA 4C92D 3META 4XQ3A 1QVPA 2WSEE 2XIDA 2XDDA 4D6WA 2E1HA 5CKHA 3GOXA 5D6WA 3MEVA 2VXEA 4BY6C 1NPRA 4ELZC 5CAIA 3OMGA 2ZZDA 1WPYA 1YI2T 2CKKA 3X24B 1WGSA 1UGQB 1YJ9T 2E65A 3QPHA 3V7SA 3MEWA 3VUBA 1W2BS 3HL8A 3L2UA 5GAN5 2MF2A 4BI8B 4KBMB 3PIOA 5LL6S 4M7DC 1YJ9A 1VQ4A 3BW1A 5FU6C 5I2MA 3CCUT 4M7AF 3L2WA 4PJOA 3PGGA 3WXMB 4F7UB 1VQOT 1OZ2A 3BFMA 5J26A 2LT4A 4ZN1A 3S3MA 2ZPBB 3BDLA 2ZPGB 4OMFB 4Z02A 1BI0A 2EQMA 1O9SA 3LW5E 5LJ3j 5EG2A 3S3NA 2ZCFB 4MMKA 3DLLA 4DA4A 1X75C 1VQMT 1K73C 4MMLA 1Q82U 1BI1A 3VJPA 4OGCA 4LDWA 3CCMT 2P0QA 1BI3A 4M75G 4C0DB 3OYDA 2V8IA 4JS5A 4QQDA 3G6EA 3CPWA 3M5AA 3OSVA 4BY6B 1VQNT 3M53A 4EMKA 3VYHB 4HCBA 2JZ2A 1LNXA 1VIEA 4JLIA 5GAN6 1VQ7A 3BDUA 4J5YA 4M7AA 2RB6A 1NPPA 4IURA 2L3RA 1WJRA 5CVIA 3FEOA 3RMSA 2PQWA 3JCMd 1X01A 2WACA 2WSCE 4C8QA 5KH6A 4V2SA 3QZ9B 5HK3A 1VQ7T 3UDCA 4VUBA 2XU8A 1VQNA 1VQPA 2RJCA 1Y96B 4M77B 4WF2A 2XHCA 5A0GA 3KXTA 2JN0A 3OSSC 2QA4A 5GAOq 3OW2A 4M77D 2RHYA 1Q81C 3M56A 3FDRA 1Q7YC 4IUTA 2MWPA 2PVOB 4C5EA 5GMKj 2QQAA 2OTLA 2JUFA 3FB9A 2EJGA 3JCMV 1YITA 3JB9H 2XKOC 3ER0A 5KCOA 3CD6A 1KQ1A 1B34A 4OB1B 2XG8D 4L59A 3HSBA 4XTXA 2R58A 5I2SA 4M75C 2K57A 3UWNA 3HRTA 3DLMA 4O6JA 1YJNA 4M7DF 4HT9A 4M7AG 5GMKh 2QEXT 2QA4T 3C95A 1N27A 3KUFA 4GY5A 4N0AC 4PJOF 4II1A 3JCMe 4RKUE 4E47A 2RHUA 5GAMg 4M78D 3JCMP 2RI3A 2BKDN 4FM4B 2HQEA 3JSCA 2OTJT 1BI2A 1U1SA 4M7DG 3CCJT 2VGMA 3M55A 2CZ0B 4M78A 5CQXA 3VUZA 5GAN2 1S72T 1K8AC 2K2VA 5HK0A 5LJ5j 2R5AA 3DB3A 4PLLA 5IT9E 1N6AA 1YJWA 1KC8U 3CCRA 4JRKA 4MZMA 2RI2A 3NTHA 3MHXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BIA A;  1YCY A;  4RCB A;  3SWN B;  3JCM f;  1D3B B;  2E41 A;  5GAM e;  1TH7 A;  4XU3 A;  4EMG A;  4XU0 A;  5GAN f;  3JCM g;  4M78 F;  4C92 G;  5I21 A;  1BIB A;  1I5L A;  5GAN e;  2ZGW A;  5GMK m;  1WQW A;  2Y90 A;  5GAN 3;  4A53 A;  5LJ5 e;  4C92 D;  4XQ3 A;  1JRI A;  2DZC A;  1M5Q 1;  2RM4 A;  5LJ3 d;  4EMH A;  2E1H A;  3INZ A;  4M7D B;  4XTU A;  5GAM j;  5LJ5 f;  4M7D E;  2VXE A;  4M75 B;  5CAI A;  4A54 A;  1M8V A;  5GMK e;  1WPY A;  5LJ3 f;  4NL3 A;  2E65 A;  3JCM h;  2DJZ A;  4PNO A;  4XU1 A;  3V7S A;  2FB7 A;  5GAM f;  4XTV A;  3EFS A;  1HXD A;  2E10 A;  3JB9 J;  5GAN 5;  4PJO G;  4M7D C;  2RD1 A;  3QO3 A;  3BW1 A;  2VC8 A;  1D3B A;  4NOY A;  3JCM W;  4M77 F;  4HA8 A;  4M7A F;  2E64 A;  3PGG A;  4C8Q D;  4F7U B;  4C92 B;  4F7U F;  3L2Z A;  3BFM A;  4C92 C;  5GAN 8;  3RER A;  3QSU A;  2DXU A;  2EWN A;  2DXT A;  1LOJ A;  1Y96 A;  2VXF A;  3BY7 A;  5LJ3 j;  3EFR A;  1I4K 1;  1HK9 A;  2DZ9 A;  4J6Y A;  4MMK A;  4DQ2 A;  2CGH A;  5GAM d;  5LJ3 e;  4OP0 A;  4MML A;  2DTI A;  3RKY A;  1WQ7 A;  4M7D A;  3GIB A;  4M75 G;  1U1T A;  1KQ2 A;  4F7U A;  4M78 E;  4M75 F;  1N9S A;  3AHU A;  4M77 E;  4M7A E;  4Y91 A;  3JB9 I;  3JB9 D;  4PJO C;  4XTZ A;  4XTW A;  4EMK A;  4M7D D;  4M77 C;  3L1A A;  4M7A C;  5LJ3 h;  4C92 A;  1LNX A;  1LJO A;  4JLI A;  4JRI A;  2EAY A;  4J6X A;  3BDU A;  4J5Y A;  4C8Q C;  4M77 A;  2RB6 A;  5GAN 6;  5GAO l;  4M7A A;  3JCM b;  4PJO B;  3RKW A;  4F7U G;  3JCM d;  1X01 A;  3QUI A;  4M75 A;  1N9R A;  3JCM c;  4C8Q A;  2YLC A;  4M75 E;  2DTH A;  3RES A;  4M78 G;  4N0A A;  1Y96 B;  1I81 A;  4M77 B;  3HFN A;  4M75 D;  4WF2 A;  3FJP A;  4M7A B;  1WNL A;  2JN0 A;  3FIF A;  3V7R A;  4C8Q G;  5GAN 4;  5GAO q;  3JB9 F;  4XU2 A;  4PJO E;  4NL2 A;  3JCM X;  4M77 D;  4M7A D;  5GAN 7;  4C8Q F;  4XTY A;  3M4G A;  3SWN A;  4HT8 A;  4C92 F;  5GAN j;  5LJ5 g;  5GAN h;  4M78 C;  4F7U E;  4X9D A;  5GMK j;  3FB9 A;  3JCM V;  2EJG A;  5GAO p;  2EJF A;  3JB9 H;  1MGQ A;  2I2L A;  2DEQ A;  3RKX A;  5GMK i;  3V8L A;  3JB9 G;  1KQ1 A;  5DY9 A;  1B34 A;  1H64 1;  4QVC A;  5GAO n;  4J6W A;  1B34 B;  3HSB A;  4XTX A;  5LJ5 d;  3V8K A;  3JCM J;  4M75 C;  1I8F A;  2K57 A;  5LJ3 g;  4JUV A;  4PJO A;  4M78 B;  4M7D F;  2QTX A;  4M77 G;  2FYK A;  4QVD A;  3RIR A;  5GMK h;  4HT9 A;  4C8Q B;  4M7A G;  4PJO D;  4N0A C;  2YHT A;  4PJO F;  3JCM e;  3JCM Q;  4EMK B;  2DVE A;  3RUX A;  5GAN d;  5GAO m;  5GAM g;  4M78 D;  5GMK l;  3JCM P;  4X9C A;  4C92 E;  2DTO A;  4RCC A;  1U1S A;  4M7D G;  5GAO r;  2YLB A;  5GAM h;  3V8J A;  3QHS A;  3SB2 A;  4M78 A;  4V2S A;  5GAN 2;  1JBM A;  2DKG A;  2EJ9 A;  3VU3 C;  5LJ5 h;  5LJ5 j;  5GAN g;  3HFO A;  3V7C A;  2RA2 A;  2HNI A;  4EMK C;  4JRK A;  4C8Q E;  3SWN C; 
#chains in the Genus database with same CATH topology
 1ZA2 B;  5GAM e;  1K9M R;  1IRE B;  3PT9 A;  3OYK A;  5M9O A;  1MV3 A;  3L2Q A;  3OYN A;  2F1L A;  4ZGD B;  2E12 A;  3E19 A;  2X51 A;  1JRI A;  2RPN A;  1PSE A;  2QYZ A;  2YDL A;  3J81 E;  4EMH A;  2P4T A;  5HY6 A;  5GAM j;  2RO0 A;  1HSQ A;  1OV3 A;  2JVV A;  2YRC A;  4E6R A;  3TCJ A;  1TSF A;  4DOV A;  2QAS A;  1C1A A;  2JTM A;  5GAN 8;  3KBG A;  1Q82 R;  2EWN A;  3ZFJ A;  4PFP A;  1SSH A;  3X28 B;  4X34 A;  3J80 E;  3OYE A;  4A63 B;  4LD9 K;  3VV0 A;  4LDU A;  1OX9 A;  1NE8 A;  3ZL7 C;  2DO3 A;  3PIP A;  2HZY A;  3G4S T;  2L3S A;  3G71 A;  3QII A;  4M75 A;  2OTJ A;  1K0S A;  1WJS A;  3FLG A;  4ZGE B;  4FCY A;  1RUW A;  1PD0 A;  5GAN 4;  1E7O A;  3CCR T;  5CR2 A;  4M7A D;  5KCH A;  1WLP B;  4ELY C;  2J05 A;  1ZBJ A;  1NJI R;  1YIT Q;  1XTD A;  4JJB A;  2AZS A;  1LPL A;  3REA B;  1R8O B;  3JCM J;  1YHQ Q;  3OYF A;  3IQL A;  1JJ2 S;  1Z9Z A;  2K5I A;  4JDS A;  4MZP A;  3DKM A;  4EMK B;  4JJD A;  1O75 A;  5FU6 B;  1TTH B;  1PNJ A;  3LX7 A;  1X6O A;  2V8J A;  3CCL A;  2HD0 A;  1VQ6 Q;  1BYM A;  5GAN g;  3GLX A;  1YIJ A;  4C0G A;  4BE2 A;  4C8Q E;  1YCY A;  1A0N B;  2A7Y A;  3M54 A;  3I56 A;  5IN1 A;  3EG3 A;  1M90 C;  1VOM A;  5I21 A;  1WHJ A;  2RQU A;  3UAT A;  2JXB A;  1Y7X A;  1SG5 A;  4PFZ A;  4RMO A;  1X6G A;  2LJ3 A;  1K4U S;  5C0M A;  3CCJ A;  3EG9 B;  2KK4 A;  1UGP B;  3OS5 A;  2LVM A;  3JCM h;  2CT3 A;  1EX4 A;  4XTV A;  1Q81 U;  2DL5 A;  2QQS A;  2IVW A;  2ATC B;  2ZAE A;  2VC8 A;  4DBF A;  1JJ2 A;  5A2Q E;  2ED1 A;  1UDL A;  1UFF A;  2LQ8 A;  2LQW A;  4L6V 5;  3RKY A;  3OYL A;  4HCC A;  3NGP A;  1UEB A;  3CC4 Q;  2CS7 A;  4FW2 A;  1M3A A;  3G1J A;  2LP5 A;  2V1Q A;  2EGE A;  3JB9 D;  1NG2 A;  4C0F A;  4N4I A;  3KFV A;  2ECZ A;  4C92 A;  1FXX A;  3CMA T;  2RHX A;  3H9N A;  4F17 A;  1ACM B;  1KG1 A;  1N9R A;  2KNB B;  1OX8 A;  2YUQ A;  2QG9 B;  2QTV A;  5FU7 B;  1OYX A;  4A4H A;  3FJP A;  4C8Q G;  3FIF A;  4L5G A;  4XAX B;  1YIJ T;  4C8Q F;  4C92 F;  2DIG A;  2GTO A;  5LJ5 g;  2RNA A;  1H8K A;  1VQO A;  2HQH A;  3PMT A;  2I2L A;  2DEQ A;  2DIL A;  3RKX A;  2MMP A;  2RHZ A;  4QVC A;  2V8K A;  1ZUK A;  3CC2 A;  1KC8 R;  5LJ3 g;  2HSE B;  4DBQ A;  3EFO B;  3VS1 A;  5C6S A;  2E3I A;  3CCL T;  5KYX B;  2DIQ A;  5GAO r;  1QP2 A;  1M1K U;  2GQV A;  3CCL Q;  1VQ6 A;  2VKN A;  2RA2 A;  3M58 A;  1N5Z A;  1ZLM A;  2D9T A;  4AG2 C;  4DBH A;  1RAG B;  4RTT A;  5CO7 A;  1BIB A;  2LQK A;  4BI3 A;  2VWF A;  1BCM A;  1YBY A;  1NZ9 A;  1WFW A;  2GFA A;  4IUU A;  4A54 A;  2M1H A;  5LJ3 f;  4NL3 A;  5KYU B;  5GAM f;  4PNO A;  1YI2 Q;  1PSF A;  1HXD A;  1MNE A;  5IHN A;  3C94 A;  4LUE A;  2CRE A;  3NFC A;  1D3B A;  1UJY A;  1KD1 U;  4F7U F;  2DXU A;  5HCK A;  4J9C A;  2LX9 A;  3NPF A;  5GAM d;  3OS1 A;  3G6E Q;  1WHK A;  1SEM A;  4C0Z A;  2GF7 A;  3A98 A;  3PVQ A;  3X25 B;  1WZO A;  1N9S A;  2FZK B;  3LLR A;  2F2W A;  1JU5 C;  3LGF A;  4FYX B;  3L2V A;  1PWT A;  3JV3 A;  1AZG B;  1Y07 A;  4J6X A;  3CC7 T;  5CQY A;  3OYM A;  3RKW A;  3CMA A;  4CC2 A;  2ROT A;  3SDZ A;  4XK8 E;  1JB0 E;  2K9G A;  1I81 A;  1T0J A;  2J6O A;  3OW2 P;  4DEY A;  4JS4 A;  2L3Q A;  3M4G A;  2SEM A;  5FLX E;  2EPD A;  2DRM A;  3DB4 A;  2O9V A;  2OAW A;  3M0T A;  5A0L A;  1UGR B;  2NUZ A;  3RDV A;  4J7I A;  5FRO A;  3OQ5 A;  2Z0W A;  5FU7 C;  4GBQ A;  4J9H A;  3RIR A;  4PJO D;  2YHT A;  4ATO A;  2M51 A;  1KQS S;  3CC2 Q;  4Y92 A;  5IXB A;  2ZPH B;  4KGZ B;  1RLP C;  5CKF A;  5KYU A;  3I55 T;  2DKG A;  2EJ9 A;  2MIO A;  3H0F A;  2CP5 A;  3OYA A;  3CCM A;  3VS6 A;  1VYU A;  2M9U A;  1JO8 A;  3SWN C;  3UT1 A;  1MMN A;  2KGT A;  2E41 A;  1B3Q A;  3QYG B;  4OB0 B;  1PKS A;  2A3L A;  2FRW A;  2ZGW A;  2Y90 A;  1ARK A;  3CBO A;  1QCF A;  4C92 D;  3I55 Q;  2F2V A;  2WSE E;  4GLM A;  1TXQ A;  2XDD A;  1T3S A;  4IIO A;  2LZ6 B;  4BY6 C;  2MPX C;  2ZZD A;  2CKK A;  1WGS A;  3QPH A;  3VUB A;  3MEW A;  1W2B S;  4J9G A;  5GAN 5;  1B07 A;  4J9D A;  5LL6 S;  4M7D C;  3CCU T;  1VQO T;  1QMC A;  5J26 A;  3S3M A;  2QAZ A;  3BDL A;  4OMF B;  3CXC P;  3DLL A;  2DL8 A;  4DA4 A;  1KFZ A;  3EGU A;  2QGF B;  1VQN T;  3M5A A;  1NLO C;  2GGR A;  2DBM A;  1H92 A;  3M53 A;  2JZ2 A;  1LNX A;  4E7S A;  2RB6 A;  1NPP A;  4IUR A;  1X01 A;  2J06 A;  1K9A A;  4C8Q A;  5KH6 A;  2RQW A;  1AEY A;  3QZ9 B;  2C0I A;  4VUB A;  1VQP A;  2JN0 A;  3OSS C;  2HMA A;  4M77 D;  1OU8 A;  1YN8 A;  1Q7Y C;  4C5E A;  3FB9 A;  2QK0 A;  1PKT A;  1M2V A;  1GL5 A;  1RAC B;  1KD1 R;  3HRT A;  1GRI A;  5GMK h;  3EGD A;  4PJO F;  4II1 A;  5IHI A;  2RHU A;  5GAM g;  2DF6 A;  1NM7 A;  4FSS A;  2HQE A;  3EG1 A;  3JSC A;  2A08 A;  3CCJ T;  2VGM A;  2CZ0 B;  4HCK A;  3VUZ A;  4Z88 A;  5GAN 2;  4PLL A;  5IT9 E;  4JRK A;  1J3T A;  1BIA A;  3TSZ A;  2D6F A;  2QGG A;  1TH7 A;  1MND A;  4XU3 A;  3GNF B;  4XU0 A;  2ZPE B;  1QVG P;  4CI0 C;  4MDW A;  5GAN 3;  2RM4 A;  1GCP A;  1MV0 B;  1OI1 A;  1M1K C;  3QWX X;  1ZX6 A;  4DBR A;  3E2U A;  4LUD A;  3M0P A;  3OY9 A;  2E10 A;  2DL4 A;  2KQW A;  4OF1 A;  4RTY A;  2RD1 A;  3LGL A;  4M77 F;  2E64 A;  1VQ7 Q;  1FX7 A;  1K9M C;  6AT1 B;  2E3H A;  3BY7 A;  1I4K 1;  2RK1 A;  4DQ2 A;  2JOY A;  5GJV B;  5LJ3 e;  3CXC A;  4M7D A;  4F7U A;  1QQJ A;  3CCE A;  3JB9 I;  2NLU A;  4XTZ A;  1UGS B;  2EAY A;  3HP9 A;  1M1F A;  4AT1 B;  5KYW A;  4F7U G;  4DOW A;  1Q81 R;  2YUO A;  2XK0 A;  2EYY A;  2MOX A;  4KUI A;  3D7S B;  2QQR A;  4ZTJ A;  1IGU A;  2F5K A;  2FO0 A;  1Q86 R;  2DPP B;  4WCI A;  5GJW B;  3R6O A;  4UC4 A;  2L8D A;  2L3P A;  4HXJ A;  1YJN T;  4XTY A;  4QVZ A;  3CC2 T;  5KYY B;  2J7I A;  2ROL A;  5GAN j;  1N8R R;  2RJF A;  1WDX A;  4FW1 A;  2EVR A;  2L5Q A;  4E7J A;  3REB B;  2LNH B;  5KYX A;  3UF4 A;  4DEX A;  1YJW Q;  4Z89 A;  3M9Q A;  1GFC A;  1ZSZ C;  1HJD A;  4HKE A;  4PJJ A;  3WVE B;  3GF5 A;  2DVE A;  1YP5 A;  5GAO m;  2FPF A;  1VQ9 A;  1KC8 C;  2LC4 A;  4E7I A;  3BE3 A;  2AT1 B;  3QDR B;  1DJ7 B;  4PL6 A;  2BIV A;  1M1G A;  2DK3 A;  2M16 A;  2GNC A;  2JS0 A;  3QDF A;  1IO6 A;  3VYG A;  2YUN A;  4BDY A;  2DZC A;  1M5Q 1;  3G4S Q;  1SHF A;  4M7D B;  2QDY B;  4XTU A;  5GMK e;  1X2Q A;  4LNP A;  2AKL A;  2RJE A;  4P5N A;  1LVK A;  2DJZ A;  1U5S A;  2ENM A;  5IH2 A;  1K8A R;  5IAY A;  4ZTF A;  1M3B A;  2JW4 A;  1WXB A;  4NOY A;  2DA9 A;  1VQK Q;  2LRQ A;  2BE9 B;  3EFR A;  1OU9 A;  1FMV A;  2PU9 B;  1AZE A;  5CK9 A;  3GIB A;  1U3O A;  2KXD A;  1KQ2 A;  1G3S A;  4M75 F;  2HL5 C;  3CME A;  4LDY A;  4M7D D;  3CCR Q;  4E7L A;  4FYV B;  1MUZ A;  1VQ5 Q;  3PVL A;  3JCM b;  2DXC A;  3VS0 A;  3MEA A;  2OJ2 A;  3EG9 A;  4PFO A;  2NUT A;  2DL7 A;  1BU1 A;  2QXF A;  3VS2 A;  1JXM A;  4N0A A;  4WTO B;  1VQ7 T;  3HKS A;  1NEB A;  1KQS A;  1QVF S;  2F69 A;  4EDU A;  5L8R E;  3SWN A;  4GLK A;  4M78 C;  1ZUU A;  4X9D A;  2LCS A;  3X26 B;  2H8H A;  3H6Z A;  1YNZ A;  1D1A A;  3V8L A;  4JJC A;  5LJ5 d;  8AT1 B;  2V1R A;  3NHN A;  5DLO A;  3A8G B;  4KRT A;  2C0O A;  2JJ9 A;  2RQR A;  2M0O A;  1G3T A;  5GMK l;  1KJW A;  1SSF A;  1AWO A;  1JXO A;  4C5G A;  5GAM h;  4BDZ A;  2DMO A;  2Y4X A;  1E6G A;  2DAQ A;  5LJ5 h;  1RL2 A;  1NJI C;  4PJN A;  4EMK C;  3CCV A;  2O4X B;  2XDP A;  5GAN f;  1QKW A;  1BK2 A;  3QJY A;  2E6N A;  4M78 F;  4AFU C;  3HTR A;  4ZGJ B;  1BKB A;  2E6Z A;  4HCB A;  1XJW B;  2CZ7 B;  3P8H A;  2HSP A;  3FC3 A;  3PE0 A;  4CC4 B;  3CCQ A;  1K8A U;  4M75 B;  1P92 A;  2QEX A;  1VQ9 T;  1R0C B;  4BAC A;  4RUG A;  1VQM Q;  2CP7 A;  4FT2 A;  5IHK A;  3H0I A;  2RHI A;  2RQT A;  4TVR A;  2LTO A;  3JCM W;  2YRV A;  3TU4 K;  4FYW B;  2CP0 A;  1KHC A;  2DXT A;  2ZPF B;  1D1B A;  2EFI A;  4OML A;  3CPW P;  1VQK A;  3O8V A;  3PMI A;  4M78 E;  4RTU A;  2HQX A;  4FT4 A;  3MCA B;  4M7A C;  4E7Z A;  3ZEH A;  1G5V A;  4QT7 A;  5D6Y A;  2FZC B;  4C8Q C;  2EYZ A;  2PUK B;  2EQJ A;  2CUD A;  1W70 A;  5J3B A;  2EGC A;  3JAM E;  2EYQ A;  3X20 B;  3FJ5 A;  2HAX A;  5AT1 B;  3V7R A;  1Y0M A;  1C6V X;  3OMC A;  2EIF A;  1VQ6 T;  1KQS P;  2MWO A;  2ESW A;  1S72 A;  5FRN A;  5GAN h;  3EG2 A;  5KYY A;  1YJN Q;  2X4Y A;  1NYG A;  3OYH A;  3PNW C;  1RAH B;  4B9X A;  2QTX A;  4C8Q B;  1ZSG A;  5GAN d;  3OBW A;  1FMW A;  2KI7 A;  1G3Y A;  3LH5 A;  3HRU A;  1W6X A;  2P0P A;  4Y28 E;  1V29 B;  4LN2 A;  3CBM A;  2PVD B;  4RTV A;  4B6M A;  2YWW A;  4J9B A;  1IXD A;  3ME9 A;  3U23 A;  3UA7 A;  1TUG B;  1I5L A;  4IKF A;  3M59 A;  2GFU A;  2BZY A;  2XID A;  5CAI A;  3OMG A;  1YJ9 T;  5KYN A;  1UHC A;  2X9H A;  3HL8 A;  2MF2 A;  4KBM B;  3PIO A;  2FEI A;  5I2M A;  4M7A F;  4F7U B;  3BFM A;  3EFO A;  2LT4 A;  2ZPB B;  3EH2 A;  4KGX B;  3LW5 E;  2DRK A;  4MMK A;  3CCE Q;  4MML A;  1BI1 A;  4LDW A;  3CCM T;  2P0Q A;  1BI3 A;  4CC3 A;  2V8I A;  2JM8 A;  3G6E A;  4BY6 B;  1NYF A;  5GAN 6;  3BDU A;  2A37 A;  4M7A A;  1TS9 A;  3RR6 A;  1R0B G;  3FEO A;  3RMS A;  1T3L A;  2KR3 A;  3UDC A;  4HVU A;  3CCS Q;  4M77 B;  2XHC A;  5A0G A;  1X43 A;  2LX7 A;  2DEU A;  2HKN A;  1WA7 A;  1VQ4 Q;  3FDR A;  1WI7 A;  1IRX A;  1PC0 A;  2KRS A;  2OTL A;  4X1V A;  2JUF A;  2DVJ A;  3JCM V;  3NMZ C;  2XG8 D;  4L59 A;  3HSB A;  2R58 A;  2K57 A;  1E6H A;  1D09 B;  2YUP A;  4O6J A;  4HT9 A;  2QEX T;  3KUF A;  4GY5 A;  3H41 A;  2O88 A;  4E47 A;  4M78 D;  1RAB B;  4FM4 B;  1RAE B;  2K79 A;  1M2V B;  1U1S A;  1OOT A;  1Q7Y R;  4M78 A;  2CDT A;  2HDA A;  2I0N A;  5LJ5 j;  1N6A A;  1KC8 U;  3CCR A;  1RLQ C;  4MZM A;  3MHX A;  4LE9 A;  4RCB A;  1VQL T;  1VYV A;  3M0U A;  4KUD K;  2QA4 Q;  1D0Y A;  4BE1 A;  4IUP A;  4C92 G;  3A1P A;  2G6F X;  4R55 A;  1S72 Q;  4K11 A;  3HHT B;  4RTX A;  3CEY A;  2FPE A;  1M8V A;  3RBB B;  4JRQ A;  2OTL Q;  3EFS A;  3MP6 A;  2D0N A;  2AK5 A;  4QKU A;  2L0A A;  3PTA A;  3A8H B;  4KH1 B;  2GCX A;  1QVG A;  3QSU A;  4F16 A;  2DXB A;  3MKD A;  2NYS A;  1HK9 A;  3OYC A;  2KEA A;  1CSK A;  2XIC A;  4BI4 A;  2XD0 A;  3AHU A;  1VQ5 A;  1B7T A;  1W2B P;  2X3W D;  5GAO l;  3E1S A;  4JLG A;  1T0H A;  4CRI A;  4BB7 A;  4PKC C;  4M78 G;  3H8Z A;  1F1B B;  2PUO B;  4XU2 A;  1KHI A;  2FVU A;  3I5S A;  4E7H A;  2RK2 A;  3CCM Q;  4QW2 A;  2MK5 A;  2QQB A;  5GMK i;  3OA6 A;  5CCA A;  4FU6 A;  2G3R A;  4QVD A;  2COW A;  3OW2 S;  2KXC A;  5IXF A;  4R56 A;  2WSF E;  3S6W A;  1H3H A;  2PNI A;  3V8J A;  3MP1 A;  1OQK A;  1ZUY A;  3CCS A;  2KDS A;  2HBW A;  4CC7 A;  4O5V A;  2A0F B;  2EKH A;  3OYG A;  2NUP A;  3EGX A;  2KE9 A;  2DER A;  2EQK A;  3JCM f;  2FRY A;  2MCN A;  5J39 A;  2VUB A;  4A53 A;  2FPD A;  1EIF A;  4PLI A;  2JS2 A;  2H3J A;  5L23 A;  5KE2 A;  1I07 A;  1Q82 C;  2M02 A;  3RNJ A;  2ED0 A;  1YHQ T;  1NBE B;  4IUV A;  3G71 Q;  3L2Z A;  2O4X A;  1D1C A;  2VXF A;  3EAE A;  3I56 T;  2CGH A;  2X3X D;  1UB4 A;  4J9I A;  3OYY A;  4OB2 B;  3L42 A;  1QVF P;  4M77 E;  1BCO A;  3SFM A;  1M1K R;  5ECA A;  4M77 C;  1YI2 A;  2HBP A;  2OI3 A;  2D0Q B;  3CXC S;  2BE7 D;  2FG0 A;  1EFN A;  4EIK A;  3VRZ A;  3SD4 A;  3CCU A;  4M75 E;  3OS2 A;  3URG A;  2YRD A;  3NTK A;  1XOV A;  1WNL A;  1H3Z A;  1MHN A;  1GBR A;  1WXT A;  1MMG A;  2KBT A;  2JTF A;  2IG0 A;  4KUL A;  1TOV A;  1VQ4 T;  2BTT A;  4A4F A;  4Q5W A;  1ABO A;  2QEX Q;  3JB9 G;  2NWM A;  1H64 1;  3ULR B;  3CCQ Q;  3TRE A;  3C4S A;  7AT1 B;  2FZG B;  2KT8 A;  1I1J A;  3OS0 A;  3N5B B;  3S3O A;  1UGV A;  9ATC B;  2E70 A;  4X9C A;  4C92 E;  2DTO A;  4KT0 E;  3MEU A;  2DET A;  3OYI A;  4OGE A;  1JBM A;  4N4H A;  2M0Y A;  1ZBX A;  1RI9 A;  3OBY A;  2W0Z A;  3SWN B;  4D8K A;  5EC7 A;  4NS5 A;  1CKA A;  1QP3 A;  2JMC A;  3M0R A;  2AIR B;  1PG5 B;  3VKI A;  2X35 A;  3E9F A;  5GAN e;  3GP8 A;  1ABQ A;  3NTI A;  1JQQ A;  5LJ5 e;  3L2R A;  3M4Y A;  2H3E B;  2IIM A;  5LJ5 f;  3GPL A;  2RF0 A;  3CC4 T;  1UHF A;  5KYW B;  3A8M B;  2KVQ G;  3E9G A;  1G3W A;  3M57 A;  2L2P A;  4A4G A;  1QW1 A;  2K3Y A;  1TWB A;  2DFU A;  3RER A;  3RMQ A;  3CCQ T;  3CC7 A;  2EQI A;  2DZ9 A;  4J6Y A;  4OP0 A;  3CCV T;  1GXI E;  5DLQ E;  2EGA A;  1VQ5 T;  1UTI A;  2JM9 A;  4J9E A;  5D6X A;  2K5L A;  4JRI A;  4M77 A;  2RH2 A;  3VS4 A;  2X4W A;  1Q95 G;  4PJO B;  1TU0 B;  4Z8A A;  2RJD A;  2PVG B;  4EPC A;  2EYW A;  3QZ5 B;  2A36 A;  3QYH B;  4M7A B;  3G71 T;  3HFN A;  3JB9 J;  2LCC A;  3JB9 F;  2CSI A;  2QQ9 A;  4OMM A;  5CKD A;  2CT4 A;  4F7U E;  1WX6 A;  2LQN A;  3I35 A;  2JMA A;  3J7A F;  4HCZ A;  3I56 Q;  3JRZ A;  2XDB A;  2COZ A;  1Q86 U;  2VAS A;  1VQL A;  4F14 A;  2FYK A;  3HRS A;  1SF9 A;  1D0X A;  5DM7 R;  1WHM A;  3GNG A;  3QBY A;  3T9N A;  1HYO A;  2JTE A;  4KGV B;  4HVV A;  2K6D A;  2RMO A;  4MZT A;  3MO8 A;  3MPU B;  1AWW A;  3UPU A;  2OX7 A;  1K9M U;  2HL3 A;  1K73 U;  1K73 R;  1YJW T;  1OUL A;  4D6W A;  2E1H A;  2P4R A;  5CKH A;  3GOX A;  5D6W A;  3MEV A;  3X24 B;  1UGQ B;  1KK7 A;  3L2U A;  1M2O A;  1YCS B;  3TQ7 P;  4OMP A;  1VQ4 A;  5FU6 C;  2D8J A;  3L2W A;  2KYB A;  3WXM B;  1OZ2 A;  4Z02 A;  1Q86 C;  3S3N A;  2ZCF B;  1X75 C;  4LXC A;  2DJQ A;  4M75 G;  4C0D B;  4QQD A;  2DM1 A;  4EMK A;  3VYH B;  4JLI A;  1VIE A;  2L3R A;  3SHW A;  4AFS C;  2WAC A;  1OPL A;  2PZ1 A;  2KYM A;  1WXU A;  2MYS A;  2XU8 A;  1VQN A;  3EG0 A;  2RJC A;  1Y96 B;  2C0T A;  4WF2 A;  2QA4 A;  2K3B A;  1Q81 C;  2F2X A;  2PVO B;  3CCV Q;  3UA6 A;  2QQA A;  2VB6 A;  1YIT A;  1IB8 A;  2XKO C;  5KCO A;  3CD6 A;  1KQ1 A;  1B34 A;  2HCK A;  4XTX A;  4J9F A;  1WHH A;  1YJN A;  2QA4 T;  3C95 A;  1UJ0 A;  3VS7 A;  1VQL Q;  4RKU E;  3JCM P;  1OEB A;  3EGX B;  1BB9 A;  2P84 A;  1BI2 A;  1AD5 A;  1S72 T;  4V2S A;  1VQN Q;  2E5K A;  1MMA A;  1SPK A;  1KSW A;  1AOJ A;  2CP2 A;  3A5Z B;  1M30 A;  5GMK m;  1RAD B;  4B9W A;  1VIF A;  3CCU Q;  1R77 A;  2L89 A;  1UG1 A;  4JZ4 A;  4FL6 A;  2ZPI B;  1TG0 A;  4BE0 A;  1PCX A;  1KIK A;  1K1Z A;  4A4E A;  4RG2 A;  4XU1 A;  1FYN A;  2X4J A;  1FWZ A;  2CZ1 B;  3QWY A;  1D0Z A;  2JNG A;  1I5O B;  4BD3 A;  2D8H A;  2C06 A;  3A8L B;  1VQ8 T;  4C8Q D;  1U8R A;  3EHQ A;  1LOJ A;  1Y96 A;  1VQP Q;  4OB3 B;  2DL3 A;  2KY9 A;  1WQ7 A;  4ESR A;  1U1T A;  2DD5 A;  4M7A E;  3P8D A;  4AFQ C;  1LJO A;  3CBP A;  2RI5 A;  2K2M A;  3PFS A;  2W10 A;  3CPW S;  3EH1 A;  2DX1 A;  4IIM A;  3QUI A;  1QCN A;  2OAU A;  2FHD A;  2YLC A;  2DTH A;  4OMO A;  1RI0 A;  2AHJ B;  2DBK A;  3LYI A;  1LCK A;  4LDV A;  2BZ8 A;  5FWC A;  4PJO E;  3JCM X;  1SKU B;  4R0K A;  4E7K A;  1OPK A;  1RAF B;  3I9Q A;  2KRM A;  1QVF A;  2K7A A;  1W2B A;  3TVT A;  2EJF A;  3Q1J A;  2EQU A;  3A8O B;  1SHG A;  4J6W A;  1WIE A;  5AYF A;  1M90 R;  1I8F A;  2RN8 A;  1K0X A;  4M77 G;  2MAM A;  3JCM Q;  3RUX A;  1U06 A;  3CD6 T;  3M0Q A;  4ZN3 A;  2LDM A;  1M3C A;  2O01 E;  2YXY A;  1VYT A;  2CYZ B;  1JEG A;  2KAF A;  2CSQ A;  2CUB A;  2CH4 A;  3QG1 A;  1N8R C;  2GBQ A;  3V7C A;  1IGQ A;  1IZ6 A;  3CME Q;  4C0D C;  4PJO C;  1D3B B;  4C5H A;  2KMT A;  1KD1 C;  1JJ2 P;  3LWH A;  4IUQ A;  4OMQ A;  4KH0 B;  1WJQ A;  1TUD A;  2MI6 A;  5LJ3 d;  3INZ A;  4RG8 A;  1WYX A;  4M7D E;  4C5I A;  1S1N A;  1QCO A;  4A4K A;  1UEC A;  4YTL A;  1I0C A;  1YHQ A;  1V76 A;  3HPW A;  4FYY B;  1XQH A;  4PJO G;  3QXE B;  5A0D A;  3QO3 A;  1AT1 B;  3CC4 A;  2CH4 W;  4C92 B;  1WHL A;  4PJL A;  4C92 C;  2KT1 A;  1C0M A;  1AHJ B;  5FRM A;  1IHW A;  2LJ0 A;  4ME7 A;  2OTL T;  2NUP B;  2QI2 A;  5CKB A;  2VYT A;  1AWJ A;  3TEE A;  2YT6 A;  1WHG A;  3I55 A;  5HKC A;  2K3X A;  2R5M A;  2D1X A;  1N8R U;  1PRL C;  3L1A A;  2QDL A;  1VQM A;  1VUB A;  4JPB W;  1UUE A;  2KRO A;  2NUT B;  3WVD B;  3LWI A;  2LCL A;  1ZSZ A;  2SRC A;  2KSS A;  3OB9 A;  3CC7 Q;  2LJ1 A;  3I5R A;  2FL7 A;  4J83 A;  4M75 D;  1VQ8 Q;  4MDX A;  3AT1 B;  3CCJ Q;  4FIB A;  5GAN 7;  1NLP C;  4OVA A;  1QWE A;  5CKE A;  1NJI U;  3QJ6 A;  1PD1 A;  1HD3 A;  3THK A;  1MGQ A;  1MMD A;  5CIU A;  3EHR A;  2X4X A;  1ZHI A;  1B34 B;  3V8K A;  4HVW A;  4JUV A;  4M78 B;  1QVG S;  2GTJ A;  4N4G A;  2XI9 A;  4QQG A;  2DD4 A;  5D7U A;  4BUG A;  4J8O A;  1PHT A;  2YLB A;  3G7Z A;  2VV5 A;  3QHS A;  3ASK A;  1RAA B;  1Y71 A;  1ZQ1 A;  3HFO A;  2LT1 A;  1GCQ A;  2DE0 X;  3SEM A;  3OYB A;  3CPF A;  4LDX A;  2E5Q A;  2HKQ B;  4QQ6 A;  2RQV A;  1VQO Q;  2CP3 A;  1VQ8 A;  1CKB A;  2DYB A;  1XNI A;  4E2F B;  1Q7Y U;  1YWO A;  2LNV A;  5KE3 A;  4ZNX A;  1YJ9 Q;  4RTW A;  3VS3 A;  3CCE T;  2FB7 A;  2O2O A;  2R57 A;  4D8D A;  1M90 U;  4HA8 A;  1K76 A;  2GQI A;  1AVZ C;  1SRM A;  2VVK A;  3MP8 A;  4ORZ A;  1X2K A;  1RAI B;  2DTI A;  1PM3 A;  2P0K A;  2B8A A;  1EZZ B;  4ANJ A;  3O5Z A;  3CQT A;  2CZ6 B;  4Y91 A;  2B86 A;  2O9S A;  3M0S A;  2PTK A;  4XTW A;  1YIJ Q;  5LJ3 h;  2F5T X;  2Y4Y A;  3CCS T;  2DLP A;  3FRN A;  2EKO A;  4PK4 A;  3JCM c;  4JRP A;  3G4S A;  3C12 A;  3CME T;  3RES A;  2KRN A;  1VQK T;  1IHV A;  2AKK A;  2BUD A;  4NL2 A;  3P8B B;  1QLY A;  1YIT T;  1M4Z A;  1M8M A;  4HT8 A;  3QKJ A;  1V1C A;  3CD6 Q;  5FW9 A;  4AMC A;  1W4S A;  5GAO p;  2EYX A;  5DY9 A;  5GAO n;  1GCQ C;  2COY A;  1OZ3 A;  1TUC A;  2K4Y A;  4LD6 A;  3MJX A;  1G83 A;  4JJN K;  3VRY A;  1Y57 A;  1Z9Q A;  2DNU A;  3LH0 A;  1M9S A;  1VA7 A;  4AFZ C;  1YWP A;  2VGN A;  4RCC A;  1FMK A;  2V26 A;  4FSX A;  3SB2 A;  2K5F A;  3VU3 C;  3OYJ A;  3F70 A;  3ZBD A;  2HNI A;  3R6N A;  1G2B A;  4EMG A;  3G6E T;  1ZA1 B;  1VQP T;  3JCM g;  1NEG A;  4J7F A;  2ABL A;  4M4Z A;  1WQW A;  2XMF A;  3MET A;  4XQ3 A;  1QVP A;  1W1F A;  2J6F A;  4ELZ C;  2VXE A;  1YI2 T;  1NPR A;  1YFN A;  8ATC B;  1WPY A;  1GFD A;  4PJM A;  2DYI A;  2E65 A;  1G8X A;  3V7S A;  4BI8 B;  1YJ9 A;  3BW1 A;  1PRM C;  3C0C A;  4PJO A;  2A28 A;  3PGG A;  2J6K A;  1GBQ A;  4ZN1 A;  2BZX A;  2ZPG B;  1BI0 A;  2EQM A;  1M27 C;  1O9S A;  5LJ3 j;  1X69 A;  5EG2 A;  1VQM T;  1K73 C;  1Q82 U;  3VJP A;  2YSQ A;  4OGC A;  3OYD A;  4JS5 A;  3CPW A;  3OSV A;  1QWF A;  2EW3 A;  1QKX A;  2HEQ A;  3EGD B;  1UE9 A;  2OTJ Q;  1VQ7 A;  4J5Y A;  5CVI A;  1WJR A;  2JT4 A;  4OMN A;  1AWX A;  2PQW A;  5I22 A;  3JCM d;  4AG1 C;  2LMJ A;  2WSC E;  2O31 A;  5HK3 A;  4JZ3 A;  1ZSZ B;  3KXT A;  3TSW A;  1BBZ A;  5GAO q;  3OW2 A;  2RHY A;  2AZV A;  3M56 A;  4RTZ A;  4IUT A;  5FWB A;  2MWP A;  3H0H A;  5GMK j;  2EJG A;  3JB9 H;  5I11 A;  3ER0 A;  4OB1 B;  2CP6 A;  5I2S A;  4M75 C;  3UWN A;  3DLM A;  2E4H A;  3VS5 A;  4M7D F;  1X27 A;  4M7A G;  2IPO B;  1N27 A;  4N0A C;  3JCM e;  2RI3 A;  3GBQ A;  1VQ9 Q;  2BKD N;  3CMA Q;  2OTJ T;  4M7D G;  4F04 B;  3M55 A;  5CQX A;  2EBP A;  1K8A C;  1X6B A;  2K2V A;  5HK0 A;  1SRL A;  2R5A A;  3DB3 A;  1YJW A;  2RI2 A;  3NTH A; 
#chains in the Genus database with same CATH homology
 1BIA A;  4RCB A;  5GAM e;  2D6F A;  1IRE B;  4KUD K;  1TH7 A;  3PT9 A;  4XU3 A;  3GNF B;  4XU0 A;  3A5Z B;  5M9O A;  3OYK A;  4BE1 A;  2ZPE B;  3L2Q A;  4IUP A;  4C92 G;  3OYN A;  4ZGD B;  4CI0 C;  2E12 A;  5GMK m;  3E19 A;  4MDW A;  4B9W A;  1VIF A;  5GAN 3;  4R55 A;  2L89 A;  1JRI A;  1PSE A;  3HHT B;  3J81 E;  2RM4 A;  4FL6 A;  4EMH A;  2P4T A;  2ZPI B;  3CEY A;  5HY6 A;  5GAM j;  4BE0 A;  1OI1 A;  2RO0 A;  1M1K C;  1M8V A;  4A4E A;  2JVV A;  4JRQ A;  4RG2 A;  4XU1 A;  3OY9 A;  3EFS A;  2E10 A;  2X4J A;  3MP6 A;  1FWZ A;  2CZ1 B;  2KQW A;  4OF1 A;  3TCJ A;  3PTA A;  2RD1 A;  2JNG A;  3A8H B;  4BD3 A;  3LGL A;  4DOV A;  4M77 F;  2GCX A;  2C06 A;  2E64 A;  3A8L B;  4C8Q D;  1VQ8 T;  2JTM A;  1QVG A;  5GAN 8;  3QSU A;  3KBG A;  1FX7 A;  2DXB A;  2EWN A;  1U8R A;  1K9M C;  1LOJ A;  3ZFJ A;  1Y96 A;  3BY7 A;  1I4K 1;  4X34 A;  1HK9 A;  2RK1 A;  3X28 B;  4DQ2 A;  3J80 E;  2JOY A;  3OYC A;  4OB3 B;  5LJ3 e;  3OYE A;  2KY9 A;  4LD9 K;  3CXC A;  1WQ7 A;  2XIC A;  3VV0 A;  1Q86 C;  4BI4 A;  2XD0 A;  4M7D A;  4LDU A;  1U1T A;  1NE8 A;  2DD5 A;  4F7U A;  3CCE A;  2DO3 A;  3AHU A;  4M7A E;  3JB9 I;  2NLU A;  3PIP A;  3P8D A;  4XTZ A;  3G4S T;  1VQ5 A;  1LJO A;  1UGS B;  2EAY A;  2RI5 A;  3CBP A;  5GAO l;  3G71 A;  3HP9 A;  1M1F A;  3PFS A;  3CPW S;  3E1S A;  3QII A;  4F7U G;  3QUI A;  4JLG A;  4M75 A;  4DOW A;  4CRI A;  2OAU A;  2OTJ A;  2FHD A;  2XK0 A;  4BB7 A;  2YLC A;  4KUI A;  4PKC C;  1WJS A;  2QQR A;  2DTH A;  4ZTJ A;  3FLG A;  4M78 G;  2F5K A;  4ZGE B;  3H8Z A;  1RI0 A;  2DPP B;  5GAN 4;  2AHJ B;  2PUO B;  3LYI A;  3R6O A;  4LDV A;  1KHI A;  2L8D A;  4UC4 A;  2FVU A;  4XU2 A;  5CR2 A;  3JCM X;  3CCR T;  4M7A D;  5KCH A;  4E7K A;  1YJN T;  4XTY A;  4E7H A;  4QVZ A;  3CC2 T;  4ELY C;  5GAN j;  1QVF A;  2RK2 A;  1W2B A;  4QW2 A;  2RJF A;  2EJF A;  2QQB A;  3Q1J A;  1XTD A;  2EQU A;  5GMK i;  2L5Q A;  3A8O B;  4J6W A;  3OA6 A;  5AYF A;  4E7J A;  5CCA A;  1R8O B;  3JCM J;  1I8F A;  4FU6 A;  3M9Q A;  3OYF A;  1JJ2 S;  4M77 G;  2G3R A;  4QVD A;  2MAM A;  4HKE A;  2K5I A;  4JDS A;  3WVE B;  3GF5 A;  4MZP A;  2DVE A;  3DKM A;  3RUX A;  4EMK B;  1O75 A;  5FU6 B;  4ZN3 A;  3JCM Q;  5GAO m;  3CD6 T;  2LDM A;  2O01 E;  3OW2 S;  1VQ9 A;  1KC8 C;  2CYZ B;  4R56 A;  3LX7 A;  2LC4 A;  2WSF E;  4E7I A;  1X6O A;  2V8J A;  3S6W A;  3CCL A;  2HD0 A;  2KAF A;  3MP1 A;  3V8J A;  3QDR B;  3CCS A;  1DJ7 B;  2KDS A;  5GAN g;  1BYM A;  3QG1 A;  4PL6 A;  2BIV A;  3GLX A;  1N8R C;  1M1G A;  3V7C A;  1IZ6 A;  4O5V A;  1YIJ A;  3OYG A;  2DK3 A;  4C0G A;  4BE2 A;  4C8Q E;  4C0D C;  2M16 A;  4PJO C;  1YCY A;  2EQK A;  3JCM f;  2A7Y A;  1D3B B;  3M54 A;  4C5H A;  3I56 A;  5IN1 A;  2KMT A;  1KD1 C;  1M90 C;  3LWH A;  4IUQ A;  5I21 A;  5J39 A;  1Y7X A;  3VYG A;  1WJQ A;  2VUB A;  4A53 A;  4RMO A;  4BDY A;  2DZC A;  1EIF A;  1M5Q 1;  2MI6 A;  4PLI A;  5C0M A;  5LJ3 d;  3CCJ A;  3INZ A;  2H3J A;  4RG8 A;  2QDY B;  4XTU A;  4M7D B;  4M7D E;  4C5I A;  5KE2 A;  2KK4 A;  5GMK e;  1UGP B;  4A4K A;  2RJE A;  3OS5 A;  4P5N A;  4YTL A;  1YHQ A;  1Q82 C;  2LVM A;  3JCM h;  2DJZ A;  4XTV A;  5IAY A;  4ZTF A;  3HPW A;  1XQH A;  1Q81 U;  2QQS A;  4PJO G;  2IVW A;  3QXE B;  5A0D A;  1YHQ T;  3QO3 A;  2VC8 A;  4NOY A;  3CC4 A;  4IUV A;  4C92 B;  3L2Z A;  4C92 C;  2O4X A;  5A2Q E;  1JJ2 A;  2LRQ A;  1AHJ B;  2VXF A;  5FRM A;  3EFR A;  3EAE A;  2LQ8 A;  3I56 T;  2CGH A;  4ME7 A;  2OTL T;  1UB4 A;  4L6V 5;  3RKY A;  2PU9 B;  2QI2 A;  5CKB A;  5CK9 A;  3OYL A;  4HCC A;  3GIB A;  3OYY A;  2VYT A;  1UEB A;  4OB2 B;  2CS7 A;  3L42 A;  3TEE A;  1G3S A;  1KQ2 A;  4M75 F;  4M77 E;  3I55 A;  5HKC A;  2K3X A;  3SFM A;  2R5M A;  3JB9 D;  4C0F A;  4N4I A;  3CME A;  4LDY A;  4M7D D;  4E7L A;  1N8R U;  4M77 C;  3L1A A;  2HBP A;  1YI2 A;  2D0Q B;  4C92 A;  1FXX A;  3CXC S;  3CMA T;  1VQM A;  2RHX A;  1VUB A;  3JCM b;  2DXC A;  1KG1 A;  3MEA A;  1N9R A;  3SD4 A;  3WVD B;  3LWI A;  2LCL A;  3CCU A;  2QXF A;  4M75 E;  3OS2 A;  2KSS A;  3OB9 A;  3URG A;  3NTK A;  4N0A A;  5FU7 B;  2FL7 A;  1OYX A;  1XOV A;  4J83 A;  4M75 D;  3FJP A;  4A4H A;  1WNL A;  3HKS A;  3FIF A;  4C8Q G;  1H3Z A;  4L5G A;  4XAX B;  1KQS A;  1MHN A;  1YIJ T;  4MDX A;  4FIB A;  5GAN 7;  4C8Q F;  1QVF S;  2F69 A;  4EDU A;  5L8R E;  3SWN A;  4C92 F;  4GLK A;  2DIG A;  5LJ5 g;  4M78 C;  4OVA A;  2JTF A;  4X9D A;  5CKE A;  1VQO A;  3QJ6 A;  1NJI U;  2IG0 A;  3X26 B;  4KUL A;  3H6Z A;  3PMT A;  1VQ4 T;  4A4F A;  1MGQ A;  2I2L A;  2DEQ A;  4Q5W A;  5CIU A;  2MMP A;  2RHZ A;  3RKX A;  3V8L A;  4QVC A;  1H64 1;  3JB9 G;  2X4X A;  1ZHI A;  2V8K A;  3TRE A;  1B34 B;  3C4S A;  5LJ5 d;  3V8K A;  3CC2 A;  5LJ3 g;  4JUV A;  4M78 B;  1QVG S;  5DLO A;  3A8G B;  3S3O A;  3OS0 A;  3N5B B;  4N4G A;  2M0O A;  2XI9 A;  1G3T A;  5GMK l;  4QQG A;  5C6S A;  2E70 A;  4X9C A;  1SSF A;  2DD4 A;  2DTO A;  4C92 E;  3CCL T;  4PJO E;  2DIQ A;  4KT0 E;  3MEU A;  4BUG A;  4C5G A;  4J8O A;  5GAO r;  1QP2 A;  2YLB A;  5GAM h;  3G7Z A;  3OYI A;  2VV5 A;  3QHS A;  2Y4X A;  4BDZ A;  4OGE A;  1M1K U;  2DAQ A;  1JBM A;  5LJ5 h;  3ASK A;  1RL2 A;  4N4H A;  1NJI C;  1Y71 A;  1ZQ1 A;  2GQV A;  3HFO A;  1VQ6 A;  2LT1 A;  2RA2 A;  1ZBX A;  4EMK C;  3CCV A;  2O4X B;  3OBY A;  3M58 A;  2XDP A;  3SWN B;  5GAN f;  2D9T A;  3CPF A;  3OYB A;  4LDX A;  4NS5 A;  3QJY A;  1QP3 A;  2E5Q A;  2E6N A;  4M78 F;  5CO7 A;  1BIB A;  2LQK A;  1BKB A;  2E6Z A;  2X35 A;  3E9F A;  4QQ6 A;  3VKI A;  5GAN e;  4ZGJ B;  3GP8 A;  3NTI A;  1VQ8 A;  2CZ7 B;  4BI3 A;  3P8H A;  5LJ5 e;  1XNI A;  3L2R A;  3M4Y A;  1Q7Y U;  1YBY A;  1NZ9 A;  3FC3 A;  2LNV A;  5KE3 A;  3CCQ A;  5LJ5 f;  3GPL A;  1K8A U;  2GFA A;  4IUU A;  4M75 B;  4A54 A;  3CC4 T;  1P92 A;  2M1H A;  2QEX A;  5LJ3 f;  1VQ9 T;  3A8M B;  4NL3 A;  2KVQ G;  3E9G A;  4BAC A;  5GAM f;  4PNO A;  3CCE T;  2FB7 A;  1G3W A;  1PSF A;  4FT2 A;  1HXD A;  3M57 A;  4A4G A;  2RHI A;  3C94 A;  2R57 A;  4TVR A;  1QW1 A;  2K3Y A;  2LTO A;  1D3B A;  3NFC A;  3JCM W;  1M90 U;  1VQL T;  4HA8 A;  1KD1 U;  2YRV A;  4F7U F;  3RER A;  3TU4 K;  3RMQ A;  3CCQ T;  2DXU A;  3MP8 A;  1KHC A;  2DXT A;  2ZPF B;  2LX9 A;  3OS1 A;  4J6Y A;  2DZ9 A;  2EFI A;  5GAM d;  3CC7 A;  4OP0 A;  2DTI A;  2P0K A;  4C0Z A;  2B8A A;  2GF7 A;  3CCV T;  1GXI E;  3X25 B;  5DLQ E;  3O8V A;  1VQK A;  1VQ5 T;  2CZ6 B;  3PMI A;  4M78 E;  1N9S A;  4Y91 A;  2HQX A;  3LLR A;  4FT4 A;  3L2V A;  3LGF A;  4XTW A;  3MCA B;  4M7A C;  5D6X A;  3ZEH A;  5LJ3 h;  2K5L A;  1G5V A;  5D6Y A;  1Y07 A;  4JRI A;  4J6X A;  2F5T X;  4C8Q C;  4M77 A;  2RH2 A;  2Y4Y A;  3CCS T;  2X4W A;  3CC7 T;  4PJO B;  2PUK B;  3FRN A;  2EKO A;  2EQJ A;  5CQY A;  3OYM A;  3RKW A;  2RJD A;  5J3B A;  2PVG B;  3JCM c;  3JAM E;  3CMA A;  4JRP A;  3SDZ A;  2EYQ A;  4XK8 E;  3X20 B;  4EPC A;  3G4S A;  2HAX A;  3C12 A;  3QZ5 B;  3CME T;  3RES A;  1JB0 E;  3QYH B;  1I81 A;  4M7A B;  3HFN A;  3V7R A;  2LCC A;  3G71 T;  3JB9 J;  1VQK T;  3JB9 F;  2QQ9 A;  2BUD A;  3OMC A;  4NL2 A;  2EIF A;  1VQ6 T;  3P8B B;  2MWO A;  1M4Z A;  3M4G A;  4JS4 A;  1YIT T;  1S72 A;  4HT8 A;  5FRN A;  3QKJ A;  5FLX E;  5GAN h;  5CKD A;  4F7U E;  3DB4 A;  1W4S A;  3J7A F;  5GAO p;  4HCZ A;  2X4Y A;  3JRZ A;  5A0L A;  2XDB A;  1UGR B;  5DY9 A;  5GAO n;  3OYH A;  3PNW C;  1OZ3 A;  4J7I A;  5FRO A;  1Q86 U;  3OQ5 A;  4B9X A;  4LD6 A;  2K4Y A;  1VQL A;  5FU7 C;  2QTX A;  2FYK A;  3HRS A;  3RIR A;  4JJN K;  4C8Q B;  4PJO D;  5DM7 R;  3LH0 A;  2YHT A;  1M9S A;  5GAN d;  3GNG A;  3OBW A;  4ATO A;  1KQS S;  1G3Y A;  2VGN A;  2ZPH B;  3QBY A;  4RCC A;  3T9N A;  4FSX A;  3HRU A;  5CKF A;  2P0P A;  3SB2 A;  2K5F A;  3I55 T;  2DKG A;  4Y28 E;  2EJ9 A;  3VU3 C;  3OYJ A;  1V29 B;  3CBM A;  3F70 A;  3ZBD A;  2HNI A;  3OYA A;  4MZT A;  3MO8 A;  3CCM A;  2PVD B;  2M9U A;  3UPU A;  3SWN C;  3UT1 A;  1K9M U;  2E41 A;  3ME9 A;  4EMG A;  3G6E T;  1VQP T;  3JCM g;  3QYG B;  4OB0 B;  4J7F A;  1K73 U;  2A3L A;  1I5L A;  4IKF A;  2ZGW A;  1YJW T;  1WQW A;  2Y90 A;  3M59 A;  3CBO A;  2GFU A;  4C92 D;  3MET A;  4XQ3 A;  1QVP A;  2WSE E;  2XID A;  2XDD A;  4D6W A;  2E1H A;  5CKH A;  3GOX A;  5D6W A;  3MEV A;  2VXE A;  4BY6 C;  1NPR A;  4ELZ C;  5CAI A;  3OMG A;  2ZZD A;  1WPY A;  1YI2 T;  2CKK A;  3X24 B;  1WGS A;  1UGQ B;  1YJ9 T;  2E65 A;  3QPH A;  3V7S A;  3MEW A;  3VUB A;  1W2B S;  3HL8 A;  3L2U A;  5GAN 5;  2MF2 A;  4BI8 B;  4KBM B;  3PIO A;  5LL6 S;  4M7D C;  1YJ9 A;  1VQ4 A;  3BW1 A;  5FU6 C;  5I2M A;  3CCU T;  4M7A F;  3L2W A;  4PJO A;  3PGG A;  3WXM B;  4F7U B;  1VQO T;  1OZ2 A;  3BFM A;  5J26 A;  2LT4 A;  4ZN1 A;  3S3M A;  2ZPB B;  3BDL A;  2ZPG B;  4OMF B;  4Z02 A;  1BI0 A;  2EQM A;  1O9S A;  3LW5 E;  5LJ3 j;  5EG2 A;  3S3N A;  2ZCF B;  4MMK A;  3DLL A;  4DA4 A;  1X75 C;  1VQM T;  1K73 C;  4MML A;  1Q82 U;  1BI1 A;  3VJP A;  4OGC A;  4LDW A;  3CCM T;  2P0Q A;  1BI3 A;  4M75 G;  4C0D B;  3OYD A;  2V8I A;  4JS5 A;  4QQD A;  3G6E A;  3CPW A;  3M5A A;  3OSV A;  4BY6 B;  1VQN T;  3M53 A;  4EMK A;  3VYH B;  4HCB A;  2JZ2 A;  1LNX A;  1VIE A;  4JLI A;  5GAN 6;  1VQ7 A;  3BDU A;  4J5Y A;  4M7A A;  2RB6 A;  1NPP A;  4IUR A;  2L3R A;  1WJR A;  5CVI A;  3FEO A;  3RMS A;  2PQW A;  3JCM d;  1X01 A;  2WAC A;  2WSC E;  4C8Q A;  5KH6 A;  4V2S A;  3QZ9 B;  5HK3 A;  1VQ7 T;  3UDC A;  4VUB A;  2XU8 A;  1VQN A;  1VQP A;  2RJC A;  1Y96 B;  4M77 B;  4WF2 A;  2XHC A;  5A0G A;  3KXT A;  2JN0 A;  3OSS C;  2QA4 A;  5GAO q;  3OW2 A;  4M77 D;  2RHY A;  1Q81 C;  3M56 A;  3FDR A;  1Q7Y C;  4IUT A;  2MWP A;  2PVO B;  4C5E A;  5GMK j;  2QQA A;  2OTL A;  2JUF A;  3FB9 A;  2EJG A;  3JCM V;  1YIT A;  3JB9 H;  2XKO C;  3ER0 A;  5KCO A;  3CD6 A;  1KQ1 A;  1B34 A;  4OB1 B;  2XG8 D;  4L59 A;  3HSB A;  4XTX A;  2R58 A;  5I2S A;  4M75 C;  2K57 A;  3UWN A;  3HRT A;  3DLM A;  4O6J A;  1YJN A;  4M7D F;  4HT9 A;  4M7A G;  5GMK h;  2QEX T;  2QA4 T;  3C95 A;  1N27 A;  3KUF A;  4GY5 A;  4N0A C;  4PJO F;  4II1 A;  3JCM e;  4RKU E;  4E47 A;  2RHU A;  5GAM g;  4M78 D;  3JCM P;  2RI3 A;  2BKD N;  4FM4 B;  2HQE A;  3JSC A;  2OTJ T;  1BI2 A;  1U1S A;  4M7D G;  3CCJ T;  2VGM A;  3M55 A;  2CZ0 B;  4M78 A;  5CQX A;  3VUZ A;  5GAN 2;  1S72 T;  1K8A C;  2K2V A;  5HK0 A;  5LJ5 j;  2R5A A;  3DB3 A;  4PLL A;  5IT9 E;  1N6A A;  1YJW A;  1KC8 U;  3CCR A;  4JRK A;  4MZM A;  2RI2 A;  3NTH A;  3MHX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...