4NL2A

Crystal structure of listeria monocytogenes hfq
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
73
structure length
73
Chain Sequence
MKQGGQGLQDYYLNQLRKEKILATVFLTNGFQLRGRVVSFDNFTVLLDVEGKQQLVFKHAISTFSPQKNVALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Protein hfq
publication title Recognition of U-rich RNA by Hfq from the Gram-positive pathogen Listeria monocytogenes.
pubmed doi rcsb
source organism Listeria monocytogenes
total genus 17
structure length 73
sequence length 73
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4nl2A00
3JCMX 4JRKA 4MMKA 4F7UB 4M7AC 2HNIA 3JB9J 4M75G 4M75F 1Y96A 4M78E 2E41A 2FYKA 4M7AD 4M7AA 4PJOG 4PJOF 4XTVA 5GANg 3JB9I 2E10A 1TH7A 1LNXA 3HFOA 4M7AB 4C8QF 5GMKe 5GANd 4M7DF 4M7DG 4WF2A 4PJOC 5LJ3g 5GAN5 3JCMQ 5GANh 5GAN6 5LJ3d 4C8QC 5LJ5g 3JCMd 1LOJA 4JLIA 4M75E 4M7DC 5LJ5d 1BIBA 5LJ3h 3V8LA 4F7UG 4F7UF 4C8QD 5LJ5h 4M7DD 4PJOB 4EMHA 4J6YA 5I21A 4C8QB 1D3BB 4J6XA 1KQ1A 5GAMf 5GAOn 5GAOq 5GANj 4M7DB 4EMGA 1X01A 4RCCA 1MGQA 5LJ3j 2YLBA 4M7AG 2E64A 1WQWA 1BIAA 1JRIA 3L2ZA 3RKXA 5LJ5j 4M7AF 3V7CA 3SWNC 2RB6A 2DJZA 4HA8A 5GAOl 3M4GA 2RD1A 4F7UE 5GMKi 4M77C 3V7RA 1Y96B 4V2SA 1JBMA 1N9SA 2DXTA 4JUVA 3RKYA 3SWNA 3JCMe 5GAMg 3SWNB 3JCMW 4HT8A 3BY7A 4M77D 4M77A 4QVCA 4NOYA 4M7AE 4C8QG 2JN0A 4M77B 4XU1A 5GAMh 1I8FA 2DTOA 4XTUA 4M7DE 4HT9A 4J6WA 5GMKl 1B34A 3JCMP 2CGHA 1HXDA 2DKGA 3JCMc 1B34B 3BFMA 3VU3C 4PJOE 2DEQA 2E65A 2Y90A 4JRIA 3FB9A 1U1TA 1WQ7A 2QTXA 3HFNA 4C8QE 2YLCA 4C92C 2EAYA 5GAN4 3FJPA 1M8VA 3QUIA 4M78A 5GAN3 4EMKC 3V8KA 3BW1A 1N9RA 4M77G 4M77F 3RIRA 4C92D 4C92A 2DTIA 2FB7A 2VC8A 3QHSA 4A53A 5GAOr 2VXFA 1I81A 4C92B 2DTHA 5GANe 4EMKA 3RESA 2RM4A 2YHTA 2EJ9A 3INZA 4XTWA 1U1SA 4EMKB 2DVEA 5CAIA 3JB9D 3RERA 4XU0A 4QVDA 5LJ3e 1KQ2A 5GAMd 4NL3A 5LJ5e 5DY9A 5GAN8 3HSBA 4XQ3A 4J5YA 4M77E 3JCMV 3FIFA 3V7SA 5GMKh 3AHUA 4XTXA 2EJFA 3SB2A 4M78F 4MMLA 3JCMb 2K57A 3GIBA 1YCYA 5GANf 2DZCA 3QO3A 4M78C 4C92G 4C92F 4NL2A 4XTYA 4N0AA 5GAMj 4XTZA 5LJ3f 3JCMf 5GMKj 5LJ5f 2EWNA 2VXEA 3RUXA 4M78D 2EJGA 3JB9G 1I5LA 3JB9F 3JB9H 3BDUA 1HK9A 1WPYA 2DXUA 4M78B 1H641 4RCBA 3QSUA 5GAMe 4M75C 4PNOA 4XU3A 2RA2A 1M5Q1 4XU2A 4Y91A 4C92E 5GAN7 4OP0A 5GMKm 4M75D 3JCMg 4M75A 4X9CA 4A54A 2DZ9A 4M75B 3EFSA 3JCMJ 4PJOD 3JCMh 4PJOA 3L1AA 4X9DA 1D3BA 4C8QA 4N0AC 1I4K1 4M7DA 4M78G 5GAN2 3EFRA 3V8JA 4DQ2A 2ZGWA 1LJOA 5GAOp 1WNLA 5GAOm 3RKWA 2I2LA 3PGGA 2E1HA 4F7UA
chains in the Genus database with same CATH superfamily
3D7SB 1TG0A 2KSSA 4M75F 2CDTA 2DO3A 1QMCA 4PJOG 2PVOB 3M0TA 3G4ST 1K9MU 2OTJA 3CCSA 4RTUA 4JLIA 4KGXB 1YWOA 1M3BA 1M30A 1WHKA 5I21A 1N27A 2LJ1A 1WJRA 1MV0B 4J6XA 4ZTJA 4BI3A 2J6KA 4L59A 1E6HA 1IREB 2FEIA 2DX1A 3SDZA 1VIEA 2DL4A 1N9SA 5EC7A 1Q7YR 2HBWA 2ED1A 5CCAA 3G4SA 4L6V5 3HRUA 4LDUA 3CCLA 5GMKl 2PVGB 1QCFA 1K73U 1WHMA 1NPPA 1WA7A 4II1A 2V8KA 1W2BS 2JNGA 3A8GB 5CKDA 3CC4Q 3FJ5A 4M77G 1M1FA 3RIRA 4PLIA 2VXFA 3UA6A 1IZ6A 3N5BB 1RACB 3INZA 2DVEA 3QYHB 5KYUA 1KQ2A 1X6OA 4NL3A 2BE9B 3EAEA 3FIFA 1YHQQ 1ABQA 3OYGA 4BE2A 2JOYA 2JM9A 3QO3A 2G3RA 5KE3A 4IIMA 5FU6B 3I55Q 2NWMA 3MEVA 2E5KA 1Q7YC 1PNJA 4XU2A 2DLPA 3OYFA 2YUOA 1OOTA 3JAME 3OYBA 1I1JA 2ED0A 2BZYA 2ESWA 4WTOB 2HAXA 1AWJA 4MZTA 3G71T 5FRMA 3JCMh 1GXIE 1W70A 3QWYA 1PM3A 2PUKB 2QQBA 1WI7A 3SFMA 1W1FA 1VQLQ 1G3TA 3MEWA 2M0YA 3QXEB 1SRMA 2JT4A 2KXCA 2COWA 1GCPA 3HFOA 5GMKe 2DYIA 4M7DF 5CKHA 1YWPA 1N5ZA 2LCLA 1VQ9T 3G71A 2EBPA 2LMJA 3OB9A 1M27C 3QG1A 5GAMf 2MMPA 1YFNA 1D0ZA 3MKDA 4ZGEB 1AWWA 2BUDA 1KC8C 2K2MA 2VGMA 4MZPA 1NE8A 2RD1A 3EGXB 4LN2A 5M9OA 5DLQE 2BZ8A 3M0UA 1PD1A 2RQUA 4JRQA 2F2WA 1VQ9A 3VU3C 2DMOA 3QDRB 5A0DA 4IUVA 1B7TA 2RH2A 4N4HA 4J9HA 2KYMA 5HY6A 2OTLT 2HL3A 2QGFB 1VQMT 3BW1A 3UDCA 1PSEA 2A37A 2NUPA 1BB9A 1RI0A 1TUCA 3RESA 3CD6Q 3PIPA 3LLRA 2YUQA 2FVUA 1Q82R 4DOVA 3JCMV 1M2VB 1K8AR 1G5VA 4LD6A 2EYXA 2QASA 2VXEA 4FM4B 1TU0B 2HSPA 3QZ9B 2OTLA 1VQMA 1Q81C 3RMQA 2XICA 1HYOA 1Y07A 3BE3A 3PVQA 2CSQA 4F17A 2QXFA 3C4SA 1YJWT 5KYWB 1D3BA 4N0AC 2JTFA 4J9GA 5GAN2 1OX8A 2GCXA 4LDVA 1C1AA 2DPPB 1X27A 1VQ8T 3JCMX 4N4GA 3UWNA 2O88A 3I9QA 5IXFA 2KRMA 4D8DA 2HQHA 1K8AC 4QQGA 2PTKA 1LOJA 4HCCA 2BIVA 5LJ3h 3CCJA 5L8RE 1ZUUA 2QDYB 1YJWA 5GANj 4EMGA 3A8MB 1ABOA 1YJNQ 4FSSA 2FRWA 3KUFA 3M4GA 1VQ8A 4M77C 4GLKA 4A4FA 2K6DA 3OS2A 4DBFA 2HZYA 2ZPEB 3LGFA 4N4IA 2XI9A 2XHCA 4IUQA 3VS1A 4M7AE 1M1KR 1V1CA 2D6FA 5KE2A 3LH0A 1D0XA 1D1CA 4AFUC 1AD5A 1JU5C 5KYYB 3UATA 4M78A 1UGVA 2PQWA 3CC4T 1SPKA 4DEXA 3GF5A 3OMCA 5D6WA 2ROTA 1J3TA 1VOMA 2LCSA 4FCYA 2LT1A 1KQSP 2HQXA 4IUUA 2CUBA 1YHQT 2KYBA 2GTJA 2YRCA 4XTZA 4J7FA 5CQYA 2DD4A 1KJWA 1WFWA 3BDUA 1ZBJA 3I55T 3FDRA 1H641 4FW2A 4PNOA 3DB3A 3CC4A 1AWOA 3CCRQ 4OGCA 1SG5A 3EFSA 1BU1A 4PJOA 2RHUA 2NUTB 1KHIA 4ZN1A 2JXBA 2C0TA 1RAGB 1WNLA 4UC4A 4C5IA 1YHQA 2Y4YA 4LE9A 4Y28E 1WJSA 2DVJA 2LT4A 2LP5A 3CCUQ 3OSSC 4Z89A 1VQLT 1G83A 1M9SA 3TVTA 3I55A 4KGZB 3SEMA 2P84A 4M7AB 2E3HA 2YRVA 4Q5WA 3CPWS 2F2XA 2A36A 1PG5B 5IT9E 3MO8A 4QT7A 2QAZA 5CQXA 4QQDA 3H6ZA 1OYXA 5D7UA 2VWFA 1K73R 3H0HA 4EPCA 3RKYA 1VQLA 4M77A 4NOYA 3UPUA 1FMVA 5GAMh 1WHHA 1K4US 1G3YA 4XTUA 4HT9A 1KC8U 3UF4A 3JCMP 2DKGA 2HKQB 3AT1B 2RQWA 4M7DE 1KSWA 5A0LA 2EW3A 1TUGB 2F5TX 1QCNA 2AIRB 5GAOr 3PMIA 2EGAA 2P0PA 1IO6A 3EG0A 1U06A 3CD6T 3FRNA 2DETA 4LNPA 1AZEA 4LUEA 1RI9A 3I35A 2QQ9A 1C6VX 1WPYA 5HK0A 3REBB 1SHGA 2RQTA 2ENMA 2RJEA 2RI5A 4JJNK 4X1VA 2XK0A 1NBEB 4PK4A 3CD6A 1M90U 1YJ9Q 2RO0A 1N8RC 3EFRA 1OULA 3LW5E 2CP0A 1E6GA 3OYJA 4AG2C 2I2LA 3EFOB 1W2BA 1TWBA 4BDZA 1O75A 2JM8A 1C0MA 2ZCFB 4QQ6A 4MDWA 2KRNA 2JMAA 2E4HA 4M7AD 3MPUB 4XTVA 1JJ2P 2IIMA 3A8OB 4OB2B 5LJ3d 2DIQA 2IPOB 3PNWC 4C0DB 4RUGA 1BI0A 2BTTA 2ZZDA 1RLQC 4M7DB 5GAOq 2G6FX 2RMOA 2PUOB 2X4YA 5J3BA 3CXCS 5LL6S 1YJNT 3E2UA 2LJ3A 2ZPBB 1Q86R 2OJ2A 4JUVA 2GQIA 2KQWA 3OBYA 4BY6C 2KBTA 2KVQG 2H3JA 4MDXA 1H92A 2IVWA 1Y57A 1H8KA 5ECAA 1VQNQ 1WZOA 3C0CA 1LCKA 2V1QA 4OGEA 8AT1B 3FB9A 1U1TA 4VUBA 3MP6A 1W6XA 1YITQ 1YIJQ 3OBWA 5GANe 2M1HA 2H8HA 1YJNA 1U1SA 1KFZA 2XU8A 2DXBA 5GAN8 2J05A 3HSBA 3OYLA 3ZL7C 3FLGA 1X2QA 1ZHIA 4XTXA 3VS5A 3OW2P 3P8DA 2DZCA 4NL2A 2DJQA 4IIOA 2DXUA 3I5SA 5GAN7 4HCZA 3QZ5B 2LCCA 1QVFS 2ZPIB 5I2SA 2O4XB 2CP2A 2VV5A 4X9CA 4ATOA 1OQKA 1KIKA 3CCRT 3OYIA 4C8QA 3EGDA 4M78G 2MPXC 2O31A 4AT1B 2KMTA 2X51A 2E1HA 2KNBB 4MMKA 3JB9J 2FPDA 1Y96A 1MMAA 2A28A 3J7AF 4ELYC 3CCUT 5GANg 7AT1B 1BI3A 2R58A 2M0OA 4WF2A 2QA4Q 1O9SA 2DRKA 2EIFA 5CKEA 1TOVA 1X69A 4F7UG 4M7DD 2KRSA 1BI1A 3CCRA 1PHTA 2KROA 4ZNXA 3QWXX 1X6GA 1ZSGA 4LDWA 3FEOA 4M7AF 2J6OA 3H41A 1JRIA 4LXCA 5KCHA 3A8LB 4K11A 2OAUA 3QDFA 5C6SA 3VYHB 4A4KA 2GNCA 1UDLA 1JQQA 4RTWA 3WVEB 3CCUA 4HCKA 2WSEE 2CGHA 3UT1A 2Z0WA 1VQOQ 5GAN3 1FMWA 4EMKC 4TVRA 3U23A 1EX4A 1N9RA 3I56Q 3HL8A 2NUPB 3KBGA 3RNJA 3ZBDA 1Q95G 1YI2T 1Y71A 3M0QA 3VS3A 2LDMA 8ATCB 5CK9A 2EJFA 2MCNA 2DL5A 3RBBB 4OF1A 5GANf 1SHFA 3PTAA 3GOXA 1UG1A 2EYQA 3TCJA 1UFFA 5FWBA 4RKUE 3ER0A 3OYHA 2OAWA 1CKBA 1UJ0A 3OS0A 2FG0A 3Q1JA 3M58A 3X26B 4FT4A 1YN8A 3X25B 1NM7A 1YJ9T 5GAOp 3TU4K 4PL6A 1WHLA 2OI3A 1ZUYA 4C0FA 3S3NA 1N8RU 2FL7A 1CSKA 2ATCB 2QDLA 2JUFA 2JW4A 4EMHA 4AMCA 1YJ9A 1WIEA 1QW1A 2E64A 2LRQA 2RHZA 3SHWA 3ZFJA 2NUZA 2QTVA 2EPDA 1TUDA 1AT1B 2QEXQ 4PJJA 4HT8A 2DERA 2L8DA 1PCXA 5D6XA 3GNFB 3VS4A 2J6FA 3C94A 1R8OB 1HXDA 4OB3B 3FC3A 3BFMA 1VQNT 5D6YA 3M57A 2GFAA 1CKAA 4QW2A 1VIFA 3VV0A 3EH2A 1BKBA 1KD1R 3KFVA 1YITT 2E5QA 3NPFA 3OYKA 4EMKA 1YIJT 4B9XA 4BB7A 4RG2A 4CC2A 2O01E 3E9FA 4M77E 4PJMA 5KH6A 3E9GA 1OZ3A 4Z02A 3CPWA 4M78C 4C92G 4PFPA 2KXDA 1ZQ1A 1M90R 1VQNA 3G6EQ 3CC7Q 3THKA 1UGPB 3S3OA 1VQ5T 1KHCA 2E3IA 2YWWA 2RA2A 1YITA 5CVIA 4OP0A 3NMZC 1VQKQ 4J83A 1YIJA 3E19A 3JRZA 4FL6A 2PZ1A 2X3XD 2P4RA 2ZGWA 2M16A 4E7KA 2X4JA 3PT9A 1T3SA 3PGGA 3WVDB 2L3QA 2HQEA 4M75G 1KK7A 2FYKA 3NTHA 4PJOC 1PWTA 5GAN5 4PJNA 1EIFA 2QA4T 4PFOA 4A4GA 2R5AA 1BIBA 4C5EA 1PRMC 4PLLA 4DOWA 1VUBA 5LJ5h 1VYTA 1G8XA 1WHGA 2LX9A 2V8IA 1T0HA 1TXQA 4RCCA 5LJ3j 2YLBA 1WQWA 1BIAA 1RAEB 2RQVA 4QVZA 3L2UA 2CSIA 1Q82C 4FT2A 2O9VA 4C8QG 4CC4B 4M77B 1NJIR 1B07A 3A5ZB 1YP5A 3RMSA 2QA4A 5IHNA 2Y90A 3VUZA 4ME7A 3A98A 3GPLA 1M8VA 4BDYA 4J9FA 1VQOT 2B86A 1PD0A 1AHJB 4A53A 3QKJA 3URGA 2K3BA 4LUDA 3I56T 4RTTA 2RM4A 3M53A 3JB9D 4J9BA 4E7HA 4J9IA 2D0QB 1M8MA 2ABLA 2FZKB 4GLMA 5KYXB 1QKXA 3GP8A 2EGCA 1DJ7B 1X43A 2EJGA 1K76A 4PFZA 3MP1A 3GNGA 3EG2A 2EGEA 3CXCA 1VQOA 1M5Q1 4FIBA 1BBZA 1G2BA 1NJIC 1JJ2A 1K0XA 3I56A 2HDAA 4JRPA 2JS0A 2CP5A 2KR3A 4PJOD 3HRTA 2EQMA 1WGSA 5IHIA 3OYCA 2EYWA 3M55A 3ME9A 3H8ZA 4F7UA 2CZ0B 1LPLA 2HNIA 1QP3A 1N6AA 3SD4A 4J9DA 1Y0MA 3LGLA 1M1KC 4M7DG 4DEYA 1KQSS 2KT1A 1VYVA 3JCMd 3GBQA 3CCEQ 2XDBA 1D09B 1NZ9A 2C0IA 2V26A 1K9MR 1Q7YU 4J9EA 5FU7C 2DE0X 5GAOl 1GL5A 1JBMA 4FYYB 2QEXT 1BYMA 3JCMe 3IQLA 4M77D 3UA7A 1QVFA 2YXYA 1UHFA 2EKHA 5A0GA 1B34A 4WCIA 1RADB 2L5QA 3VRYA 1GFCA 4JZ4A 4BUGA 3HFNA 1VQPQ 4C92C 3L42A 5IHKA 3NHNA 3X20B 1X75C 2JVVA 2P4TA 3CCSQ 2VUBA 4KT0E 3PE0A 2YHTA 4FYVB 4RTXA 3RERA 1GCQA 1P92A 3EG1A 5DY9A 2LQWA 4FYXB 2QEXA 5KYWA 1OX9A 3M0SA 2GBQA 3V7SA 4M78F 3GIBA 2KAFA 3ZEHA 4AFQC 1WLPB 2E70A 4RG8A 3M9QA 1XQHA 3RUXA 3JB9F 3JB9H 3G6ET 5I2MA 1GFDA 4HXJA 5AT1B 2CKKA 3R6NA 4M75C 3CC7T 1NEGA 4BACA 3CCLQ 2EQIA 5CR2A 3JCMg 3HRSA 1YI2Q 1IGUA 4A54A 3QJYA 4R56A 4KBMB 1VQKT 4JDSA 3G1JA 1K9AA 3C95A 1XOVA 3L1AA 2P0QA 3META 1X2KA 2KGTA 1MMDA 2EQUA 1AVZC 1SSFA 5GAOm 1RAIB 1BK2A 3OMGA 1K73C 3LWIA 4AFSC 1QP2A 2E41A 1UECA 1WXTA 1S1NA 5HKCA 3G6EA 4PJOF 2VB6A 1LNXA 1OZ2A 2D1XA 5CKBA 4C8QC 5A2QE 3CCQQ 1ARKA 2MF2A 5LJ5d 1VQKA 2CYZB 4J6YA 5KYYA 4OMFB 1Q81U 5FWCA 1QVGP 4D6WA 4F16A 1NG2A 3SWNC 2VYTA 1OU8A 5EG2A 1QKWA 4XAXB 1EFNA 3MCAB 3NTIA 1NYGA 4BY6B 3PFSA 2QK0A 4OMOA 3CBMA 2EAYA 2L3RA 2A3LA 3M59A 2H3EB 3JV3A 4M77F 2BE7D 4C92A 3CCMQ 1K8AU 3F70A 1JJ2S 4OMNA 2EYZA 2LTOA 5LJ3e 1WHJA 4HKEA 2NUTA 2RHYA 4PKCC 1ZLMA 5GMKh 4A4HA 3SB2A 2AKLA 1G3WA 2DM1A 4XTYA 2EQJA 1T3LA 4RTYA 2XD0A 2AK5A 1U5SA 2EWNA 1I5LA 1U3OA 2RNAA 3QSUA 1QQJA 4E2FB 5J26A 4C5GA 1XNIA 4KH0B 4M75A 3C12A 3VS6A 5KYUB 1XTDA 3MEUA 2DRMA 1UGSB 4IUTA 3OYDA 3E1SA 4OMPA 2LQKA 2EKOA 2FZCB 5HK3A 4A63B 1I0CA 3PVLA 2F2VA 3CC2Q 4HA8A 5IXBA 1VQ5Q 1Q86C 2YSQA 2E6ZA 2DL3A 2JJ9A 3EGUA 2FZGB 1PKSA 1TH7A 1AEYA 3L2QA 2LNVA 3PMTA 5LJ3g 2EVRA 3JCMQ 4JJDA 5KYNA 4ESRA 3CCET 3OW2S 2K5IA 4M4ZA 2GTOA 2M51A 2XMFA 2RHIA 3NGPA 2C06A 2HD0A 1VQ4Q 4XK8E 4ZGJB 3RKXA 4JJBA 2CT3A 1PRLC 2BKDN 5I22A 4V2SA 3QYGB 3SWNA 3JCMW 2CP7A 2PNIA 1I8FA 3HP9A 3O5ZA 1G3SA 2LNHB 2COZA 2CH4W 2V8JA 3TQ7P 4BE0A 3CCEA 1AWXA 4RMOA 2E65A 4JRIA 3CBPA 1Z9ZA 1UJYA 2C0OA 1VQPT 1ACMB 4PJLA 2K3YA 1QCOA 3M4YA 3EG9A 1UE9A 2AZVA 4XTWA 4ELZC 4EMKB 3CCST 3S6WA 3LYIA 4QVDA 5GAMd 3CMEQ 1RLPC 1ZX6A 2DIGA 2DFUA 2VGNA 3JCMb 3CEYA 3G7ZA 4MMLA 2K2VA 5CO7A 6AT1B 2KE9A 5LJ3f 2MWPA 1BI2A 2COYA 2RK1A 4R55A 5CIUA 3VKIA 2DL8A 2X9HA 1VQPA 5GAMe 3L2RA 4Y91A 2K7AA 2D9TA 1WYXA 4CC3A 2M02A 3CCLT 2X4XA 2CP3A 2DZ9A 1ZSZC 5CKFA 1LVKA 4M7DA 2FO0A 3QBYA 2A08A 2RPNA 2FPFA 2EFIA 1WJQA 2RQRA 1W2BP 4LDYA 1SSHA 2X3WD 3TEEA 4M78E 5DLOA 4OMMA 4DBRA 4C8QF 1WDXA 3NTKA 1IRXA 1W4SA 2HL5C 1ZUKA 5FRNA 2NLUA 1VYUA 2ZPFB 3P8HA 3CCQT 4E47A 1YI2A 1D3BB 1KQ1A 1PC0A 2ECZA 2F5KA 3KXTA 2XDDA 2RB6A 4F7UE 5GMKi 2L0AA 2YUPA 3V7RA 1JO8A 2PVDB 3DKMA 5GAMg 2FPEA 1UUEA 4XU1A 5IN1A 4F04B 4C0GA 2DTOA 2JTMA 3M54A 4ZN3A 2SRCA 1FX7A 4Z8AA 1GRIA 3L2WA 1MNDA 4P5NA 4PJOE 1M4ZA 3WXMB 3CCQA 4FYWB 3OY9A 3HHTB 1Z9QA 3MHXA 1K0SA 2RJDA 2CZ7B 1KC8R 5IAYA 2LVMA 2DTIA 2VC8A 3QHSA 2DTHA 4R0KA 3CCMT 3QJ6A 2MK5A 2O4XA 4D8KA 2XG8D 4J5YA 4ORZA 1I5OB 4L5GA 1KQSA 2HBPA 2LQNA 2ZPGB 1NLOC 5FU6C 2LJ0A 1HSQA 2DAQA 1VQ7Q 3ASKA 4B9WA 2AHJB 3CQTA 2QI2A 1OI1A 1R77A 4M78B 3X28B 4RCBA 4JLGA 4BI8B 5GMKm 3A8HB 1IB8A 3CCMA 1M1GA 1MV3A 1MMGA 3TSWA 3GLXA 1ZSZA 4A4EA 1R0BG 1WXUA 2QGGA 1QWEA 2RK2A 4F7UB 1M3CA 1RABB 3CC2T 2F69A 2ZPHB 4E6RA 4JJCA 1OPLA 1Q81R 3JB9I 4B6MA 4MZMA 3BDLA 2GFUA 3S3MA 5GAN6 2XDPA 4RTZA 2K5FA 1UGQB 4PJOB 1Q86U 1VQ6Q 5GAOn 4EIKA 4KH1B 1EZZB 1MGQA 1KD1C 1NEBA 1RAFB 4M7AG 1VQ4T 1I07A 5LJ5j 2DJZA 2DBKA 2GGRA 3VS7A 2R57A 3QPHA 1QLYA 3CC2A 3H0IA 2OX7A 3BY7A 1VQ5A 2K5LA 4QVCA 4JZ3A 1HJDA 3MP8A 4J6WA 3LH5A 1E7OA 1B34B 1JEGA 1WQ7A 1M90C 4LD9K 1MUZA 4BE1A 3V8KA 4CI0C 2FB7A 1VQ4A 2CH4A 2JZ2A 1D1BA 1MNEA 2RJCA 4HVVA 1NYFA 4XU0A 3CCJT 3HKSA 1BCOA 1K1ZA 3CMET 4OB1B 5FLXE 4ANJA 3RR6A 3MEAA 4ZGDB 1A0NB 1AZGB 2KY9A 2DNUA 2YDLA 4M78D 5GJWB 5C0MA 2ROLA 1OPKA 2RJFA 3EG3A 4YTLA 1GCQC 4C92E 3CCVQ 3QIIA 2WSCE 3OYYA 5J39A 1UB4A 2B8AA 2M9UA 4QKUA 3OSVA 3CMEA 2W10A 1SEMA 2LZ6B 3V8JA 1R0CB 2FHDA 1WX6A 1QVGA 2LX7A 2O9SA 4O5VA 2D0NA 2WSFE 2KT8A 2A7YA 4JRKA 4ZTFA 2CP6A 2HEQA 1VA7A 2HKNA 3I5RA 4JS5A 5GANh 4M75E 1NPRA 1RAHB 3V8LA 1SKUB 3M56A 5FW9A 3DLLA 3J80E 3CMAQ 2E12A 2DA9A 1OU9A 4E7LA 2D8JA 2YRDA 3REAB 3EGXA 3VS2A 2DXTA 1T0JA 5FU7B 2CS7A 4C5HA 2O2OA 2JN0A 2JMCA 2D8HA 3M0RA 4HCBA 1FXXA 1NLPC 2DILA 1FMKA 2J06A 1SRLA 2QG9B 3OYNA 4C8QE 2KI7A 2YLCA 2ZAEA 4KUDK 2CREA 3FJPA 4KULA 1MHNA 3PIOA 4E7IA 4DBQA 4C92B 5CAIA 3L2VA 5IH2A 2VASA 4F14A 4XQ3A 1S72Q 1M2VA 2LQ8A 2VKNA 3CPWP 2K9GA 3OW2A 4N0AA 2DBMA 5GAMj 1VQ7T 4GBQA 2X35A 1SF9A 2AT1B 2OTJQ 4OVAA 2P0KA 1IXDA 3M0PA 4XU3A 2QQRA 3HTRA 4M75B 3J81E 1TSFA 4JS4A 2NYSA 4KGVB 5GJVB 4DBHA 1K9MC 4DQ2A 1LJOA 2RI2A 1HD3A 1VQ7A 1RUWA 4M7AC 1JB0E 2FRYA 2A0FB 3G4SQ 4AFZC 3EH1A 1H3HA 2YT6A 2E10A 1XJWB 2IG0A 4BD3A 4O6JA 1F1BB 2HCKA 2K79A 4F7UF 2KK4A 2L3PA 1N8RR 4C8QB 3EGDB 4J9CA 1VQ6T 1RAAB 1X01A 4E7SA 2PU9B 3LWHA 1YNZA 4BI4A 2KEAA 2CZ1B 1Y96B 1D1AA 3SWNB 3CC7A 1X6BA 3VJPA 3EHQA 2QYZA 1KD1U 4J8OA 1WXBA 2DF6A 2CT4A 1JXOA 2JTEA 4DA4A 3MJXA 2MIOA 2DEQA 5KYXA 1GBQA 3X24B 2QTXA 3VYGA 2QQSA 3EHRA 3OYEA 3QUIA 1VQ6A 1ZA2B 1UHCA 2R5MA 2W0ZA 4C92D 5L23A 5HCKA 3DLMA 1I81A 2SEMA 1IHWA 2EJ9A 3OQ5A 3EG9B 2RHXA 5LJ5e 3P8BB 9ATCB 4KRTA 5I11A 2K57A 1GBRA 1QVGS 2L89A 3JCMf 4OMLA 5GMKj 2DD5A 4OMQA 1Q82U 3DB4A 4X34A 3CXCP 1OV3A 1Y7XA 5FROA 2XIDA 2XKOC 3ULRB 3CCVT 1IGQA 3TSZA 3G71Q 1UTIA 4M75D 1D0YA 1QWFA 3JCMJ 4JPBW 2RN8A 2X4WA 4E7ZA 1V76A 1V29B 2BZXA 3OA6A 4E7JA 2DXCA 3RDVA 1FYNA 3VS0A 3RKWA 4EDUA 4GY5A 4Y92A 3T9NA 4C0ZA 3H0FA 2DYBA 1PKTA 1FWZA 2RF0A 4M7AA 1AOJA 1YBYA 4C0DC 5GANd 1H3ZA 2K3XA 2GF7A 2L3SA 1JXMA 1VQ9Q 2WACA 3CBOA 2J7IA 2MI6A 4M7DC 5LJ5g 3CCVA 3HPWA 2LC4A 1KG1A 4J7IA 4C8QD 3TREA 2DEUA 1M3AA 2K4YA 1BCMA 4CRIA 3CMAT 3L2ZA 1NJIU 3V7CA 2DL7A 2VVKA 2GQVA 3H9NA 2HSEB 1YCSB 3R6OA 5AYFA 4IKFA 3CPFA 3O8VA 3NFCA 1QVFP 2JS2A 3OS1A 2I0NA 4LDXA 2YUNA 1PSFA 4FU6A 4IURA 4RTVA 3JCMc 3A1PA 2OTLQ 1VQMQ 5GAN4 1MMNA 2DK3A 1B3QA 5DM7R 1M1KU 1ZA1B 4OB0B 2AZSA 1TS9A 3CMAA 3VUBA 1IHVA 3LX7A 3JSCA 2L2PA 1OEBA 2EYYA 2CZ6B 4HVUA 3M5AA 2EQKA 1S72T 3AHUA 2V1RA 4IUPA 2AKKA 4CC7A 1YCYA 1TTHB 2HMAA 4C92F 1U8RA 1M2OA 2MYSA 2MOXA 4FSXA 2MAMA 5LJ5f 3JB9G 4NS5A 1ZBXA 1HK9A 2F1LA 4FW1A 4Z88A 2OTJT 2Y4XA 3OYAA 3CCJQ 1UEBA 1UGRB 1RL2A 2CUDA 3OS5A 1QVPA 3OYMA 1YJWQ 2MWOA 4X9DA 4AG1C 1I4K1 2QQAA 2KDSA 1ZSZB 1S72A 3VRZA 1VQ8Q 2RI3A 4KUIA 2E6NA 3EFOA 4HVWA 5KCOA
chains in the Genus database with same CATH topology
1W2BA 2CZ0B 2RK2A 4F7UB 4BDZA 2KSSA 1O75A 2HNIA 3CC2T 2F69A 2ZPHB 1QP3A 1N6AA 4M75F 2ZCFB 4QQ6A 4MDWA 3SD4A 2DO3A 4M7AD 4PJOG 2PVOB 4XTVA 3JB9I 3LGLA 1M1KC 4M7DG 4MZMA 3G4ST 3A8OB 4OB2B 1K9MU 2OTJA 3BDLA 2GFUA 1KQSS 3CCSA 5GAN6 5LJ3d 3JCMd 3S3MA 2XDBA 4JLIA 2DIQA 3PNWC 2XDPA 4C0DB 2K5FA 1BI0A 1UGQB 1NZ9A 2ZZDA 4PJOB 5I21A 1Q86U 1N27A 1WJRA 4M7DB 4J6XA 4ZTJA 5GAOn 5GAOq 4BI3A 2PUOB 1MGQA 1Q7YU 1KD1C 4M7AG 4L59A 1VQ4T 2X4YA 1IREB 5J3BA 5LJ5j 3CXCS 2DJZA 5FU7C 5GAOl 5LL6S 1YJNT 2R57A 2ZPBB 3QPHA 3SDZA 1VIEA 3CC2A 1JBMA 1N9SA 4JUVA 2QEXT 1BYMA 3JCMe 3BY7A 4M77D 1VQ5A 2K5LA 2KQWA 3OBYA 4QVCA 4BY6C 1QVFA 2KVQG 2H3JA 4MDXA 2IVWA 5CCAA 3G4SA 4L6V5 3MP8A 3HRUA 4LDUA 3CCLA 4J6WA 5GMKl 5A0GA 1B34A 2PVGB 1K73U 1B34B 4OGEA 2L5QA 1NPPA 4II1A 2V8KA 3FB9A 1U1TA 1WQ7A 3HFNA 4BUGA 1W2BS 1M90C 4VUBA 4C92C 3L42A 3MP6A 4LD9K 4BE1A 2JNGA 3A8GB 3X20B 1X75C 5CKDA 3V8KA 4CI0C 4M77G 1M1FA 3RIRA 2FB7A 2JVVA 2P4TA 4PLIA 1VQ4A 2VXFA 2JZ2A 2VUBA 3OBWA 2M1HA 4KT0E 5GANe 1IZ6A 2RJCA 3N5BB 2YHTA 3INZA 1YJNA 1U1SA 2DVEA 3QYHB 3RERA 4XU0A 1KQ2A 2XU8A 1X6OA 4NL3A 1P92A 2DXBA 3CCJT 5DY9A 5GAN8 3HKSA 2QEXA 3HSBA 3EAEA 3CMET 4OB1B 3OYLA 5FLXE 3FLGA 3FIFA 3V7SA 1ZHIA 4XTXA 3MEAA 4M78F 2JOYA 3OYGA 4BE2A 3GIBA 2KAFA 3ZEHA 3P8DA 2DZCA 3QO3A 4ZGDB 2G3RA 2E70A 4NL2A 4RG8A 3M9QA 5KE3A 1XQHA 2KY9A 5FU6B 3RUXA 3JB9F 4M78D 5C0MA 3JB9H 2DXUA 3G6ET 5I2MA 3MEVA 2RJFA 4YTLA 3CC7T 2CKKA 5GAN7 4M75C 1Q7YC 4XU2A 4C92E 4BACA 4HCZA 3QZ5B 2LCCA 3OYFA 1QVFS 2HAXA 3JAME 2ZPIB 5I2SA 5CR2A 3OYBA 3QIIA 2O4XB 2WSCE 3HRSA 2VV5A 4X9CA 3OYYA 3JCMg 3QJYA 4A54A 5J39A 1UB4A 4KBMB 4MZTA 2B8AA 4R56A 4JDSA 3G71T 1VQKT 5FRMA 2M9UA 3JCMh 3CCRT 1GXIE 3C95A 1XOVA 3L1AA 4C8QA 3OSVA 3OYIA 2P0QA 3CMEA 3META 4M78G 3V8JA 2EQUA 2FHDA 2PUKB 1SSFA 5GAOm 1QVGA 2QQBA 4O5VA 2KMTA 2WSFE 2E1HA 2A7YA 3OMGA 1K73C 3SFMA 3LWIA 4JRKA 4MMKA 1QP2A 3JB9J 1G3TA 3MEWA 1Y96A 2E41A 3J7AF 4ZTFA 3QXEB 4ELYC 5HKCA 3G6EA 3CCUT 4PJOF 5GANg 3HFOA 5GMKe 1LNXA 4RMOA 4M7DF 1BI3A 1OZ2A 2R58A 2M0OA 4WF2A 5CKHA 5CKBA 4JS5A 1O9SA 5GANh 2LCLA 4C8QC 5A2QE 4M75E 2EIFA 1VQ9T 2MF2A 5LJ5d 1NPRA 5CKEA 1VQKA 3G71A 3V8LA 4F7UG 4M7DD 2CYZB 3OB9A 4J6YA 1BI1A 3M56A 3QG1A 5GAMf 2MMPA 3DLLA 3CCRA 3J80E 4OMFB 4ZGEB 2E12A 1Q81U 4LDWA 4D6WA 4E7LA 2BUDA 3FEOA 4M7AF 1KC8C 1JRIA 5KCHA 2VGMA 3A8LB 2VYTA 4MZPA 3SWNC 1NE8A 2OAUA 2RD1A 5M9OA 5C6SA 3VYHB 4A4KA 2DXTA 5DLQE 5FU7B 2CS7A 4C5HA 5EG2A 2JN0A 3WVEB 3CCUA 4XAXB 4JRQA 4HCBA 3MCAB 3NTIA 1FXXA 2CGHA 2WSEE 3PFSA 4BY6B 1VQ9A 4ATOA 3VU3C 3UT1A 3OYNA 4C8QE 3QDRB 5A0DA 3CBMA 2YLCA 2EAYA 4IUVA 4KUDK 2RH2A 3FJPA 4N4HA 2L3RA 5GAN3 4KULA 1MHNA 5HY6A 2A3LA 3PIOA 3M59A 4EMKC 4TVRA 3BW1A 1VQMT 3UDCA 1PSEA 1N9RA 4M77F 4C92A 3HL8A 4E7IA 1K8AU 1RI0A 4C92B 3F70A 3KBGA 3RESA 1JJ2S 3PIPA 2LTOA 3LLRA 5CAIA 3L2VA 5LJ3e 4M7DC 3ZBDA 2FVUA 4XQ3A 4DOVA 1YI2T 4HKEA 1Y71A 2RHYA 2LDMA 4PKCC 3JCMV 5CK9A 2LQ8A 5GMKh 4A4HA 2EJFA 3SB2A 1G3WA 4OF1A 5GANf 3OW2A 4XTYA 2EQJA 4N0AA 5GAMj 3PTAA 1VQ7T 3GOXA 4LD6A 1G5VA 2XD0A 2EWNA 2VXEA 1I5LA 2EYQA 4FM4B 2X35A 3QZ9B 3TCJA 3QSUA 4OVAA 2OTLA 2P0KA 1VQMA 1Q81C 4XU3A 4RKUE 3RMQA 2XICA 3ER0A 5J26A 2QQRA 4C5GA 1XNIA 3OYHA 4M75A 3C12A 1Y07A 4M75B 3J81E 1XTDA 3OS0A 3MEUA 3Q1JA 1UGSB 2QXFA 4IUTA 3M58A 3X26B 3C4SA 3OYDA 3E1SA 4FT4A 1YJWT 4JS4A 1D3BA 4N0AC 3X25B 2JTFA 2LQKA 1YJ9T 5GAN2 2EKOA 2GCXA 1K9MC 4LDVA 5HK3A 4DQ2A 5GAOp 1LJOA 3TU4K 2DPPB 4PL6A 1VQ8T 2RI2A 4HA8A 3JCMX 1VQ7A 4N4GA 4M7AC 1JB0E 3UWNA 1Q86C 2E6ZA 4C0FA 3S3NA 1N8RU 2FL7A 2E10A 1TH7A 3L2QA 2LNVA 3PMTA 2IG0A 5LJ3g 3JCMQ 1K8AC 4QQGA 2JUFA 1LOJA 4O6JA 4BD3A 4HCCA 2BIVA 5LJ3h 3CCJA 3CCET 5L8RE 3OW2S 2K5IA 4F7UF 2KK4A 4EMHA 2QDYB 4C8QB 1YJWA 2C06A 2RHIA 5GANj 2HD0A 1X01A 4EMGA 1YJ9A 1VQ6T 4XK8E 4ZGJB 3A8MB 2PU9B 1QW1A 3LWHA 2E64A 2LRQA 2RHZA 3RKXA 3ZFJA 4BI4A 3KUFA 3M4GA 1VQ8A 5GAOr 4M77C 2BKDN 4GLKA 2CZ1B 1Y96B 3QYGB 3SWNA 4A4FA 4HT8A 4V2SA 3JCMW 3SWNB 3OS2A 2ZPEB 3LGFA 2L8DA 4N4IA 2XI9A 2XHCA 4IUQA 3CC7A 4M7AE 3VJPA 5D6XA 3GNFB 2D6FA 1I8FA 3HP9A 5KE2A 3LH0A 1KD1U 3C94A 1G3SA 1R8OB 4J8OA 1HXDA 2V8JA 4OB3B 3FC3A 4DA4A 3BFMA 4BE0A 2DEQA 1VQNT 3CCEA 5D6YA 2E65A 3CBPA 3M57A 2GFAA 4JRIA 2QTXA 4QW2A 2QQSA 3VYGA 3X24B 3OYEA 1VIFA 3QUIA 4M78A 3VV0A 1BKBA 1VQPT 1VQ6A 2PQWA 2E5QA 2K3YA 2R5MA 4C92D 1YITT 3DLMA 3OYKA 1I81A 3CC4T 3M4YA 4EMKA 1YIJT 4B9XA 2EJ9A 4XTWA 4ELZC 3OQ5A 4EMKB 3CCST 3GF5A 2RHXA 3LYIA 3S6WA 4BB7A 4QVDA 5GAMd 4RG2A 5LJ5e 3OMCA 2O01E 5D6WA 3P8BB 3E9FA 4M77E 2LT1A 2DIGA 2HQXA 5KH6A 2VGNA 3JCMb 3CEYA 3G7ZA 4MMLA 3E9GA 1OZ3A 2K57A 4IUUA 4Z02A 2K2VA 3CPWA 5CO7A 1YHQT 4M78C 4C92G 1QVGS 2L89A 1ZQ1A 4XTZA 5LJ3f 3JCMf 4J7FA 2MWPA 5CQYA 1BI2A 2DD4A 2DD5A 5GMKj 1VQNA 2RK1A 4R55A 3BDUA 5CIUA 1Q82U 3VKIA 3I55T 1UGPB 3DB4A 4X34A 3FDRA 3S3OA 1H641 5FROA 1Y7XA 1VQ5T 1VQPA 1KHCA 4PNOA 5GAMe 2XIDA 2RA2A 2XKOC 3DB3A 2D9TA 4Y91A 5CVIA 4OP0A 1YITA 3CC4A 3CCVT 3CCLT 4J83A 4M75D 1YIJA 2X4XA 2DZ9A 3E19A 3JRZA 4OGCA 3EFSA 5CKFA 3JCMJ 4FL6A 4PJOA 2X4WA 2RHUA 1KHIA 1V29B 4M7DA 4ZN1A 3OA6A 4E7JA 3QBYA 2DXCA 2M16A 2ZGWA 1WNLA 4E7KA 4UC4A 2X4JA 2EFIA 3RKWA 1WJQA 4C5IA 1YHQA 4EDUA 2Y4YA 3PT9A 4Y28E 3PGGA 1WJSA 4GY5A 4LDYA 3WVDB 3T9NA 3TEEA 2LT4A 2HQEA 4M75G 4C0ZA 4M78E 1FWZA 2FYKA 3OSSC 1VQLT 1M9SA 5DLOA 3I55A 4M7AA 1YBYA 4M7AB 4C0DC 5GANd 1H3ZA 4C8QF 2K3XA 2GF7A 3NTKA 3NTHA 4PJOC 5GAN5 2WACA 3CBOA 2YRVA 1W4SA 2MI6A 1EIFA 5LJ5g 3CCVA 5FRNA 2QA4T 4Q5WA 3HPWA 2LC4A 4A4GA 2R5AA 1KG1A 2NLUA 2ZPFB 1BIBA 4C5EA 3P8HA 4DOWA 4PLLA 3CPWS 3CCQT 4E47A 4J7IA 1VUBA 4C8QD 5LJ5h 1YI2A 3TREA 2LX9A 5IT9E 1D3BB 3MO8A 1KQ1A 2V8IA 5CQXA 4QQDA 3H6ZA 1OYXA 2K4YA 4RCCA 2F5KA 4F7UA 3KXTA 4CRIA 2XDDA 5LJ3j 2YLBA 1WQWA 1BIAA 3L2ZA 3CMAT 1NJIU 3V7CA 2RB6A 2GQVA 4F7UE 5GMKi 3V7RA 4QVZA 4EPCA 3L2RA 2PVDB 3DKMA 3R6OA 5AYFA 3RKYA 5GAMg 3L2UA 4IKFA 3CPFA 3O8VA 1VQLA 1Q82C 3NFCA 4FT2A 4M77A 4NOYA 4C8QG 3OS1A 3UPUA 4M77B 4XU1A 5IN1A 3A5ZB 5GAMh 4C0GA 2DTOA 4LDXA 2JTMA 1G3YA 3M54A 4ZN3A 1PSFA 4XTUA 4HT9A 1FX7A 4FU6A 1KC8U 4IURA 3JCMP 3RMSA 2DKGA 3L2WA 2QA4A 3JCMc 4P5NA 4PJOE 1M4ZA 2Y90A 3WXMB 3CCQA 4M7DE 3VUZA 4ME7A 3GPLA 5GAN4 3OY9A 3HHTB 1M8VA 5A0LA 3MHXA 2DK3A 4BDYA 2RJDA 5DM7R 4OB0B 2CZ7B 1VQOT 1M1KU 2OTLT 5IAYA 2LVMA 2F5TX 2DTIA 1AHJB 2VC8A 3QHSA 4A53A 3CMAA 3PMIA 3QKJA 3URGA 2DTHA 3VUBA 3I56T 3LX7A 2RM4A 3M53A 3QJ6A 3CCMT 2O4XA 3JB9D 2P0PA 2XG8D 3JSCA 3CD6T 4E7HA 2CZ6B 4J5YA 2D0QB 3M5AA 4L5GA 2EQKA 1S72T 2HBPA 1KQSA 3AHUA 3FRNA 4IUPA 2ZPGB 5FU6C 2DAQA 1YCYA 3ASKA 4B9WA 4C92F 1U8RA 2AHJB 4FSXA 2QQ9A 3GP8A 2MAMA 2QI2A 5LJ5f 3JB9G 1DJ7B 1OI1A 2EJGA 4NS5A 1ZBXA 1HK9A 1WPYA 4M78B 5HK0A 3MP1A 3GNGA 3X28B 4RCBA 3CXCA 4JLGA 1VQOA 1M5Q1 4FIBA 4BI8B 2OTJT 2RJEA 2Y4XA 3OYAA 1NJIC 1JJ2A 2RI5A 1UEBA 1UGRB 5GMKm 1RL2A 3A8HB 3I56A 4JJNK 2XK0A 3OS5A 1QVPA 3CCMA 3OYMA 1M1GA 3CD6A 4JRPA 1M90U 4PJOD 2RO0A 3GLXA 2MWOA 3HRTA 4X9DA 1N8RC 1I4K1 4A4EA 2QQAA 2EQMA 1WGSA 3EFRA 2KDSA 1S72A 3OYCA 3LW5E 2RI3A 4KUIA 3M55A 3OYJA 2E6NA 2I2LA 5KCOA 3ME9A 3H8ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JCM X;  4JRK A;  4MMK A;  4F7U B;  4M7A C;  2HNI A;  3JB9 J;  4M75 G;  4M75 F;  1Y96 A;  4M78 E;  2E41 A;  2FYK A;  4M7A D;  4M7A A;  4PJO G;  4PJO F;  4XTV A;  5GAN g;  3JB9 I;  2E10 A;  1TH7 A;  1LNX A;  3HFO A;  4M7A B;  4C8Q F;  5GMK e;  5GAN d;  4M7D F;  4M7D G;  4WF2 A;  4PJO C;  5LJ3 g;  5GAN 5;  3JCM Q;  5GAN h;  5GAN 6;  5LJ3 d;  4C8Q C;  5LJ5 g;  3JCM d;  1LOJ A;  4JLI A;  4M75 E;  4M7D C;  5LJ5 d;  1BIB A;  5LJ3 h;  3V8L A;  4F7U G;  4F7U F;  4C8Q D;  5LJ5 h;  4M7D D;  4PJO B;  4EMH A;  4J6Y A;  5I21 A;  4C8Q B;  1D3B B;  4J6X A;  1KQ1 A;  5GAM f;  5GAO n;  5GAO q;  5GAN j;  4M7D B;  4EMG A;  1X01 A;  4RCC A;  1MGQ A;  5LJ3 j;  2YLB A;  4M7A G;  2E64 A;  1WQW A;  1BIA A;  1JRI A;  3L2Z A;  3RKX A;  5LJ5 j;  4M7A F;  3V7C A;  3SWN C;  2RB6 A;  2DJZ A;  4HA8 A;  5GAO l;  3M4G A;  2RD1 A;  4F7U E;  5GMK i;  4M77 C;  3V7R A;  1Y96 B;  4V2S A;  1JBM A;  1N9S A;  2DXT A;  4JUV A;  3RKY A;  3SWN A;  3JCM e;  5GAM g;  3SWN B;  3JCM W;  4HT8 A;  3BY7 A;  4M77 D;  4M77 A;  4QVC A;  4NOY A;  4M7A E;  4C8Q G;  2JN0 A;  4M77 B;  4XU1 A;  5GAM h;  1I8F A;  2DTO A;  4XTU A;  4M7D E;  4HT9 A;  4J6W A;  5GMK l;  1B34 A;  3JCM P;  2CGH A;  1HXD A;  2DKG A;  3JCM c;  1B34 B;  3BFM A;  3VU3 C;  4PJO E;  2DEQ A;  2E65 A;  2Y90 A;  4JRI A;  3FB9 A;  1U1T A;  1WQ7 A;  2QTX A;  3HFN A;  4C8Q E;  2YLC A;  4C92 C;  2EAY A;  5GAN 4;  3FJP A;  1M8V A;  3QUI A;  4M78 A;  5GAN 3;  4EMK C;  3V8K A;  3BW1 A;  1N9R A;  4M77 G;  4M77 F;  3RIR A;  4C92 D;  4C92 A;  2DTI A;  2FB7 A;  2VC8 A;  3QHS A;  4A53 A;  5GAO r;  2VXF A;  1I81 A;  4C92 B;  2DTH A;  5GAN e;  4EMK A;  3RES A;  2RM4 A;  2YHT A;  2EJ9 A;  3INZ A;  4XTW A;  1U1S A;  4EMK B;  2DVE A;  5CAI A;  3JB9 D;  3RER A;  4XU0 A;  4QVD A;  5LJ3 e;  1KQ2 A;  5GAM d;  4NL3 A;  5LJ5 e;  5DY9 A;  5GAN 8;  3HSB A;  4XQ3 A;  4J5Y A;  4M77 E;  3JCM V;  3FIF A;  3V7S A;  5GMK h;  3AHU A;  4XTX A;  2EJF A;  3SB2 A;  4M78 F;  4MML A;  3JCM b;  2K57 A;  3GIB A;  1YCY A;  5GAN f;  2DZC A;  3QO3 A;  4M78 C;  4C92 G;  4C92 F;  4NL2 A;  4XTY A;  4N0A A;  5GAM j;  4XTZ A;  5LJ3 f;  3JCM f;  5GMK j;  5LJ5 f;  2EWN A;  2VXE A;  3RUX A;  4M78 D;  2EJG A;  3JB9 G;  1I5L A;  3JB9 F;  3JB9 H;  3BDU A;  1HK9 A;  1WPY A;  2DXU A;  4M78 B;  1H64 1;  4RCB A;  3QSU A;  5GAM e;  4M75 C;  4PNO A;  4XU3 A;  2RA2 A;  1M5Q 1;  4XU2 A;  4Y91 A;  4C92 E;  5GAN 7;  4OP0 A;  5GMK m;  4M75 D;  3JCM g;  4M75 A;  4X9C A;  4A54 A;  2DZ9 A;  4M75 B;  3EFS A;  3JCM J;  4PJO D;  3JCM h;  4PJO A;  3L1A A;  4X9D A;  1D3B A;  4C8Q A;  4N0A C;  1I4K 1;  4M7D A;  4M78 G;  5GAN 2;  3EFR A;  3V8J A;  4DQ2 A;  2ZGW A;  1LJO A;  5GAO p;  1WNL A;  5GAO m;  3RKW A;  2I2L A;  3PGG A;  2E1H A;  4F7U A; 
#chains in the Genus database with same CATH topology
 3D7S B;  1TG0 A;  2KSS A;  4M75 F;  2CDT A;  2DO3 A;  1QMC A;  4PJO G;  2PVO B;  3M0T A;  3G4S T;  1K9M U;  2OTJ A;  3CCS A;  4RTU A;  4JLI A;  4KGX B;  1YWO A;  1M3B A;  1M30 A;  1WHK A;  5I21 A;  1N27 A;  2LJ1 A;  1WJR A;  1MV0 B;  4J6X A;  4ZTJ A;  4BI3 A;  2J6K A;  4L59 A;  1E6H A;  1IRE B;  2FEI A;  2DX1 A;  3SDZ A;  1VIE A;  2DL4 A;  1N9S A;  5EC7 A;  1Q7Y R;  2HBW A;  2ED1 A;  5CCA A;  3G4S A;  4L6V 5;  3HRU A;  4LDU A;  3CCL A;  5GMK l;  2PVG B;  1QCF A;  1K73 U;  1WHM A;  1NPP A;  1WA7 A;  4II1 A;  2V8K A;  1W2B S;  2JNG A;  3A8G B;  5CKD A;  3CC4 Q;  3FJ5 A;  4M77 G;  1M1F A;  3RIR A;  4PLI A;  2VXF A;  3UA6 A;  1IZ6 A;  3N5B B;  1RAC B;  3INZ A;  2DVE A;  3QYH B;  5KYU A;  1KQ2 A;  1X6O A;  4NL3 A;  2BE9 B;  3EAE A;  3FIF A;  1YHQ Q;  1ABQ A;  3OYG A;  4BE2 A;  2JOY A;  2JM9 A;  3QO3 A;  2G3R A;  5KE3 A;  4IIM A;  5FU6 B;  3I55 Q;  2NWM A;  3MEV A;  2E5K A;  1Q7Y C;  1PNJ A;  4XU2 A;  2DLP A;  3OYF A;  2YUO A;  1OOT A;  3JAM E;  3OYB A;  1I1J A;  2ED0 A;  2BZY A;  2ESW A;  4WTO B;  2HAX A;  1AWJ A;  4MZT A;  3G71 T;  5FRM A;  3JCM h;  1GXI E;  1W70 A;  3QWY A;  1PM3 A;  2PUK B;  2QQB A;  1WI7 A;  3SFM A;  1W1F A;  1VQL Q;  1G3T A;  3MEW A;  2M0Y A;  3QXE B;  1SRM A;  2JT4 A;  2KXC A;  2COW A;  1GCP A;  3HFO A;  5GMK e;  2DYI A;  4M7D F;  5CKH A;  1YWP A;  1N5Z A;  2LCL A;  1VQ9 T;  3G71 A;  2EBP A;  2LMJ A;  3OB9 A;  1M27 C;  3QG1 A;  5GAM f;  2MMP A;  1YFN A;  1D0Z A;  3MKD A;  4ZGE B;  1AWW A;  2BUD A;  1KC8 C;  2K2M A;  2VGM A;  4MZP A;  1NE8 A;  2RD1 A;  3EGX B;  4LN2 A;  5M9O A;  5DLQ E;  2BZ8 A;  3M0U A;  1PD1 A;  2RQU A;  4JRQ A;  2F2W A;  1VQ9 A;  3VU3 C;  2DMO A;  3QDR B;  5A0D A;  4IUV A;  1B7T A;  2RH2 A;  4N4H A;  4J9H A;  2KYM A;  5HY6 A;  2OTL T;  2HL3 A;  2QGF B;  1VQM T;  3BW1 A;  3UDC A;  1PSE A;  2A37 A;  2NUP A;  1BB9 A;  1RI0 A;  1TUC A;  3RES A;  3CD6 Q;  3PIP A;  3LLR A;  2YUQ A;  2FVU A;  1Q82 R;  4DOV A;  3JCM V;  1M2V B;  1K8A R;  1G5V A;  4LD6 A;  2EYX A;  2QAS A;  2VXE A;  4FM4 B;  1TU0 B;  2HSP A;  3QZ9 B;  2OTL A;  1VQM A;  1Q81 C;  3RMQ A;  2XIC A;  1HYO A;  1Y07 A;  3BE3 A;  3PVQ A;  2CSQ A;  4F17 A;  2QXF A;  3C4S A;  1YJW T;  5KYW B;  1D3B A;  4N0A C;  2JTF A;  4J9G A;  5GAN 2;  1OX8 A;  2GCX A;  4LDV A;  1C1A A;  2DPP B;  1X27 A;  1VQ8 T;  3JCM X;  4N4G A;  3UWN A;  2O88 A;  3I9Q A;  5IXF A;  2KRM A;  4D8D A;  2HQH A;  1K8A C;  4QQG A;  2PTK A;  1LOJ A;  4HCC A;  2BIV A;  5LJ3 h;  3CCJ A;  5L8R E;  1ZUU A;  2QDY B;  1YJW A;  5GAN j;  4EMG A;  3A8M B;  1ABO A;  1YJN Q;  4FSS A;  2FRW A;  3KUF A;  3M4G A;  1VQ8 A;  4M77 C;  4GLK A;  4A4F A;  2K6D A;  3OS2 A;  4DBF A;  2HZY A;  2ZPE B;  3LGF A;  4N4I A;  2XI9 A;  2XHC A;  4IUQ A;  3VS1 A;  4M7A E;  1M1K R;  1V1C A;  2D6F A;  5KE2 A;  3LH0 A;  1D0X A;  1D1C A;  4AFU C;  1AD5 A;  1JU5 C;  5KYY B;  3UAT A;  4M78 A;  1UGV A;  2PQW A;  3CC4 T;  1SPK A;  4DEX A;  3GF5 A;  3OMC A;  5D6W A;  2ROT A;  1J3T A;  1VOM A;  2LCS A;  4FCY A;  2LT1 A;  1KQS P;  2HQX A;  4IUU A;  2CUB A;  1YHQ T;  2KYB A;  2GTJ A;  2YRC A;  4XTZ A;  4J7F A;  5CQY A;  2DD4 A;  1KJW A;  1WFW A;  3BDU A;  1ZBJ A;  3I55 T;  3FDR A;  1H64 1;  4FW2 A;  4PNO A;  3DB3 A;  3CC4 A;  1AWO A;  3CCR Q;  4OGC A;  1SG5 A;  3EFS A;  1BU1 A;  4PJO A;  2RHU A;  2NUT B;  1KHI A;  4ZN1 A;  2JXB A;  2C0T A;  1RAG B;  1WNL A;  4UC4 A;  4C5I A;  1YHQ A;  2Y4Y A;  4LE9 A;  4Y28 E;  1WJS A;  2DVJ A;  2LT4 A;  2LP5 A;  3CCU Q;  3OSS C;  4Z89 A;  1VQL T;  1G83 A;  1M9S A;  3TVT A;  3I55 A;  4KGZ B;  3SEM A;  2P84 A;  4M7A B;  2E3H A;  2YRV A;  4Q5W A;  3CPW S;  2F2X A;  2A36 A;  1PG5 B;  5IT9 E;  3MO8 A;  4QT7 A;  2QAZ A;  5CQX A;  4QQD A;  3H6Z A;  1OYX A;  5D7U A;  2VWF A;  1K73 R;  3H0H A;  4EPC A;  3RKY A;  1VQL A;  4M77 A;  4NOY A;  3UPU A;  1FMV A;  5GAM h;  1WHH A;  1K4U S;  1G3Y A;  4XTU A;  4HT9 A;  1KC8 U;  3UF4 A;  3JCM P;  2DKG A;  2HKQ B;  3AT1 B;  2RQW A;  4M7D E;  1KSW A;  5A0L A;  2EW3 A;  1TUG B;  2F5T X;  1QCN A;  2AIR B;  5GAO r;  3PMI A;  2EGA A;  2P0P A;  1IO6 A;  3EG0 A;  1U06 A;  3CD6 T;  3FRN A;  2DET A;  4LNP A;  1AZE A;  4LUE A;  1RI9 A;  3I35 A;  2QQ9 A;  1C6V X;  1WPY A;  5HK0 A;  3REB B;  1SHG A;  2RQT A;  2ENM A;  2RJE A;  2RI5 A;  4JJN K;  4X1V A;  2XK0 A;  1NBE B;  4PK4 A;  3CD6 A;  1M90 U;  1YJ9 Q;  2RO0 A;  1N8R C;  3EFR A;  1OUL A;  3LW5 E;  2CP0 A;  1E6G A;  3OYJ A;  4AG2 C;  2I2L A;  3EFO B;  1W2B A;  1TWB A;  4BDZ A;  1O75 A;  2JM8 A;  1C0M A;  2ZCF B;  4QQ6 A;  4MDW A;  2KRN A;  2JMA A;  2E4H A;  4M7A D;  3MPU B;  4XTV A;  1JJ2 P;  2IIM A;  3A8O B;  4OB2 B;  5LJ3 d;  2DIQ A;  2IPO B;  3PNW C;  4C0D B;  4RUG A;  1BI0 A;  2BTT A;  2ZZD A;  1RLQ C;  4M7D B;  5GAO q;  2G6F X;  2RMO A;  2PUO B;  2X4Y A;  5J3B A;  3CXC S;  5LL6 S;  1YJN T;  3E2U A;  2LJ3 A;  2ZPB B;  1Q86 R;  2OJ2 A;  4JUV A;  2GQI A;  2KQW A;  3OBY A;  4BY6 C;  2KBT A;  2KVQ G;  2H3J A;  4MDX A;  1H92 A;  2IVW A;  1Y57 A;  1H8K A;  5ECA A;  1VQN Q;  1WZO A;  3C0C A;  1LCK A;  2V1Q A;  4OGE A;  8AT1 B;  3FB9 A;  1U1T A;  4VUB A;  3MP6 A;  1W6X A;  1YIT Q;  1YIJ Q;  3OBW A;  5GAN e;  2M1H A;  2H8H A;  1YJN A;  1U1S A;  1KFZ A;  2XU8 A;  2DXB A;  5GAN 8;  2J05 A;  3HSB A;  3OYL A;  3ZL7 C;  3FLG A;  1X2Q A;  1ZHI A;  4XTX A;  3VS5 A;  3OW2 P;  3P8D A;  2DZC A;  4NL2 A;  2DJQ A;  4IIO A;  2DXU A;  3I5S A;  5GAN 7;  4HCZ A;  3QZ5 B;  2LCC A;  1QVF S;  2ZPI B;  5I2S A;  2O4X B;  2CP2 A;  2VV5 A;  4X9C A;  4ATO A;  1OQK A;  1KIK A;  3CCR T;  3OYI A;  4C8Q A;  3EGD A;  4M78 G;  2MPX C;  2O31 A;  4AT1 B;  2KMT A;  2X51 A;  2E1H A;  2KNB B;  4MMK A;  3JB9 J;  2FPD A;  1Y96 A;  1MMA A;  2A28 A;  3J7A F;  4ELY C;  3CCU T;  5GAN g;  7AT1 B;  1BI3 A;  2R58 A;  2M0O A;  4WF2 A;  2QA4 Q;  1O9S A;  2DRK A;  2EIF A;  5CKE A;  1TOV A;  1X69 A;  4F7U G;  4M7D D;  2KRS A;  1BI1 A;  3CCR A;  1PHT A;  2KRO A;  4ZNX A;  3QWX X;  1X6G A;  1ZSG A;  4LDW A;  3FEO A;  4M7A F;  2J6O A;  3H41 A;  1JRI A;  4LXC A;  5KCH A;  3A8L B;  4K11 A;  2OAU A;  3QDF A;  5C6S A;  3VYH B;  4A4K A;  2GNC A;  1UDL A;  1JQQ A;  4RTW A;  3WVE B;  3CCU A;  4HCK A;  2WSE E;  2CGH A;  3UT1 A;  2Z0W A;  1VQO Q;  5GAN 3;  1FMW A;  4EMK C;  4TVR A;  3U23 A;  1EX4 A;  1N9R A;  3I56 Q;  3HL8 A;  2NUP B;  3KBG A;  3RNJ A;  3ZBD A;  1Q95 G;  1YI2 T;  1Y71 A;  3M0Q A;  3VS3 A;  2LDM A;  8ATC B;  5CK9 A;  2EJF A;  2MCN A;  2DL5 A;  3RBB B;  4OF1 A;  5GAN f;  1SHF A;  3PTA A;  3GOX A;  1UG1 A;  2EYQ A;  3TCJ A;  1UFF A;  5FWB A;  4RKU E;  3ER0 A;  3OYH A;  2OAW A;  1CKB A;  1UJ0 A;  3OS0 A;  2FG0 A;  3Q1J A;  3M58 A;  3X26 B;  4FT4 A;  1YN8 A;  3X25 B;  1NM7 A;  1YJ9 T;  5GAO p;  3TU4 K;  4PL6 A;  1WHL A;  2OI3 A;  1ZUY A;  4C0F A;  3S3N A;  1N8R U;  2FL7 A;  1CSK A;  2ATC B;  2QDL A;  2JUF A;  2JW4 A;  4EMH A;  4AMC A;  1YJ9 A;  1WIE A;  1QW1 A;  2E64 A;  2LRQ A;  2RHZ A;  3SHW A;  3ZFJ A;  2NUZ A;  2QTV A;  2EPD A;  1TUD A;  1AT1 B;  2QEX Q;  4PJJ A;  4HT8 A;  2DER A;  2L8D A;  1PCX A;  5D6X A;  3GNF B;  3VS4 A;  2J6F A;  3C94 A;  1R8O B;  1HXD A;  4OB3 B;  3FC3 A;  3BFM A;  1VQN T;  5D6Y A;  3M57 A;  2GFA A;  1CKA A;  4QW2 A;  1VIF A;  3VV0 A;  3EH2 A;  1BKB A;  1KD1 R;  3KFV A;  1YIT T;  2E5Q A;  3NPF A;  3OYK A;  4EMK A;  1YIJ T;  4B9X A;  4BB7 A;  4RG2 A;  4CC2 A;  2O01 E;  3E9F A;  4M77 E;  4PJM A;  5KH6 A;  3E9G A;  1OZ3 A;  4Z02 A;  3CPW A;  4M78 C;  4C92 G;  4PFP A;  2KXD A;  1ZQ1 A;  1M90 R;  1VQN A;  3G6E Q;  3CC7 Q;  3THK A;  1UGP B;  3S3O A;  1VQ5 T;  1KHC A;  2E3I A;  2YWW A;  2RA2 A;  1YIT A;  5CVI A;  4OP0 A;  3NMZ C;  1VQK Q;  4J83 A;  1YIJ A;  3E19 A;  3JRZ A;  4FL6 A;  2PZ1 A;  2X3X D;  2P4R A;  2ZGW A;  2M16 A;  4E7K A;  2X4J A;  3PT9 A;  1T3S A;  3PGG A;  3WVD B;  2L3Q A;  2HQE A;  4M75 G;  1KK7 A;  2FYK A;  3NTH A;  4PJO C;  1PWT A;  5GAN 5;  4PJN A;  1EIF A;  2QA4 T;  4PFO A;  4A4G A;  2R5A A;  1BIB A;  4C5E A;  1PRM C;  4PLL A;  4DOW A;  1VUB A;  5LJ5 h;  1VYT A;  1G8X A;  1WHG A;  2LX9 A;  2V8I A;  1T0H A;  1TXQ A;  4RCC A;  5LJ3 j;  2YLB A;  1WQW A;  1BIA A;  1RAE B;  2RQV A;  4QVZ A;  3L2U A;  2CSI A;  1Q82 C;  4FT2 A;  2O9V A;  4C8Q G;  4CC4 B;  4M77 B;  1NJI R;  1B07 A;  3A5Z B;  1YP5 A;  3RMS A;  2QA4 A;  5IHN A;  2Y90 A;  3VUZ A;  4ME7 A;  3A98 A;  3GPL A;  1M8V A;  4BDY A;  4J9F A;  1VQO T;  2B86 A;  1PD0 A;  1AHJ B;  4A53 A;  3QKJ A;  3URG A;  2K3B A;  4LUD A;  3I56 T;  4RTT A;  2RM4 A;  3M53 A;  3JB9 D;  4J9B A;  4E7H A;  4J9I A;  2D0Q B;  1M8M A;  2ABL A;  2FZK B;  4GLM A;  5KYX B;  1QKX A;  3GP8 A;  2EGC A;  1DJ7 B;  1X43 A;  2EJG A;  1K76 A;  4PFZ A;  3MP1 A;  3GNG A;  3EG2 A;  2EGE A;  3CXC A;  1VQO A;  1M5Q 1;  4FIB A;  1BBZ A;  1G2B A;  1NJI C;  1JJ2 A;  1K0X A;  3I56 A;  2HDA A;  4JRP A;  2JS0 A;  2CP5 A;  2KR3 A;  4PJO D;  3HRT A;  2EQM A;  1WGS A;  5IHI A;  3OYC A;  2EYW A;  3M55 A;  3ME9 A;  3H8Z A;  4F7U A;  2CZ0 B;  1LPL A;  2HNI A;  1QP3 A;  1N6A A;  3SD4 A;  4J9D A;  1Y0M A;  3LGL A;  1M1K C;  4M7D G;  4DEY A;  1KQS S;  2KT1 A;  1VYV A;  3JCM d;  3GBQ A;  3CCE Q;  2XDB A;  1D09 B;  1NZ9 A;  2C0I A;  2V26 A;  1K9M R;  1Q7Y U;  4J9E A;  5FU7 C;  2DE0 X;  5GAO l;  1GL5 A;  1JBM A;  4FYY B;  2QEX T;  1BYM A;  3JCM e;  3IQL A;  4M77 D;  3UA7 A;  1QVF A;  2YXY A;  1UHF A;  2EKH A;  5A0G A;  1B34 A;  4WCI A;  1RAD B;  2L5Q A;  3VRY A;  1GFC A;  4JZ4 A;  4BUG A;  3HFN A;  1VQP Q;  4C92 C;  3L42 A;  5IHK A;  3NHN A;  3X20 B;  1X75 C;  2JVV A;  2P4T A;  3CCS Q;  2VUB A;  4KT0 E;  3PE0 A;  2YHT A;  4FYV B;  4RTX A;  3RER A;  1GCQ A;  1P92 A;  3EG1 A;  5DY9 A;  2LQW A;  4FYX B;  2QEX A;  5KYW A;  1OX9 A;  3M0S A;  2GBQ A;  3V7S A;  4M78 F;  3GIB A;  2KAF A;  3ZEH A;  4AFQ C;  1WLP B;  2E70 A;  4RG8 A;  3M9Q A;  1XQH A;  3RUX A;  3JB9 F;  3JB9 H;  3G6E T;  5I2M A;  1GFD A;  4HXJ A;  5AT1 B;  2CKK A;  3R6N A;  4M75 C;  3CC7 T;  1NEG A;  4BAC A;  3CCL Q;  2EQI A;  5CR2 A;  3JCM g;  3HRS A;  1YI2 Q;  1IGU A;  4A54 A;  3QJY A;  4R56 A;  4KBM B;  1VQK T;  4JDS A;  3G1J A;  1K9A A;  3C95 A;  1XOV A;  3L1A A;  2P0Q A;  3MET A;  1X2K A;  2KGT A;  1MMD A;  2EQU A;  1AVZ C;  1SSF A;  5GAO m;  1RAI B;  1BK2 A;  3OMG A;  1K73 C;  3LWI A;  4AFS C;  1QP2 A;  2E41 A;  1UEC A;  1WXT A;  1S1N A;  5HKC A;  3G6E A;  4PJO F;  2VB6 A;  1LNX A;  1OZ2 A;  2D1X A;  5CKB A;  4C8Q C;  5A2Q E;  3CCQ Q;  1ARK A;  2MF2 A;  5LJ5 d;  1VQK A;  2CYZ B;  4J6Y A;  5KYY A;  4OMF B;  1Q81 U;  5FWC A;  1QVG P;  4D6W A;  4F16 A;  1NG2 A;  3SWN C;  2VYT A;  1OU8 A;  5EG2 A;  1QKW A;  4XAX B;  1EFN A;  3MCA B;  3NTI A;  1NYG A;  4BY6 B;  3PFS A;  2QK0 A;  4OMO A;  3CBM A;  2EAY A;  2L3R A;  2A3L A;  3M59 A;  2H3E B;  3JV3 A;  4M77 F;  2BE7 D;  4C92 A;  3CCM Q;  1K8A U;  3F70 A;  1JJ2 S;  4OMN A;  2EYZ A;  2LTO A;  5LJ3 e;  1WHJ A;  4HKE A;  2NUT A;  2RHY A;  4PKC C;  1ZLM A;  5GMK h;  4A4H A;  3SB2 A;  2AKL A;  1G3W A;  2DM1 A;  4XTY A;  2EQJ A;  1T3L A;  4RTY A;  2XD0 A;  2AK5 A;  1U5S A;  2EWN A;  1I5L A;  1U3O A;  2RNA A;  3QSU A;  1QQJ A;  4E2F B;  5J26 A;  4C5G A;  1XNI A;  4KH0 B;  4M75 A;  3C12 A;  3VS6 A;  5KYU B;  1XTD A;  3MEU A;  2DRM A;  1UGS B;  4IUT A;  3OYD A;  3E1S A;  4OMP A;  2LQK A;  2EKO A;  2FZC B;  5HK3 A;  4A63 B;  1I0C A;  3PVL A;  2F2V A;  3CC2 Q;  4HA8 A;  5IXB A;  1VQ5 Q;  1Q86 C;  2YSQ A;  2E6Z A;  2DL3 A;  2JJ9 A;  3EGU A;  2FZG B;  1PKS A;  1TH7 A;  1AEY A;  3L2Q A;  2LNV A;  3PMT A;  5LJ3 g;  2EVR A;  3JCM Q;  4JJD A;  5KYN A;  4ESR A;  3CCE T;  3OW2 S;  2K5I A;  4M4Z A;  2GTO A;  2M51 A;  2XMF A;  2RHI A;  3NGP A;  2C06 A;  2HD0 A;  1VQ4 Q;  4XK8 E;  4ZGJ B;  3RKX A;  4JJB A;  2CT3 A;  1PRL C;  2BKD N;  5I22 A;  4V2S A;  3QYG B;  3SWN A;  3JCM W;  2CP7 A;  2PNI A;  1I8F A;  3HP9 A;  3O5Z A;  1G3S A;  2LNH B;  2COZ A;  2CH4 W;  2V8J A;  3TQ7 P;  4BE0 A;  3CCE A;  1AWX A;  4RMO A;  2E65 A;  4JRI A;  3CBP A;  1Z9Z A;  1UJY A;  2C0O A;  1VQP T;  1ACM B;  4PJL A;  2K3Y A;  1QCO A;  3M4Y A;  3EG9 A;  1UE9 A;  2AZV A;  4XTW A;  4ELZ C;  4EMK B;  3CCS T;  3S6W A;  3LYI A;  4QVD A;  5GAM d;  3CME Q;  1RLP C;  1ZX6 A;  2DIG A;  2DFU A;  2VGN A;  3JCM b;  3CEY A;  3G7Z A;  4MML A;  2K2V A;  5CO7 A;  6AT1 B;  2KE9 A;  5LJ3 f;  2MWP A;  1BI2 A;  2COY A;  2RK1 A;  4R55 A;  5CIU A;  3VKI A;  2DL8 A;  2X9H A;  1VQP A;  5GAM e;  3L2R A;  4Y91 A;  2K7A A;  2D9T A;  1WYX A;  4CC3 A;  2M02 A;  3CCL T;  2X4X A;  2CP3 A;  2DZ9 A;  1ZSZ C;  5CKF A;  1LVK A;  4M7D A;  2FO0 A;  3QBY A;  2A08 A;  2RPN A;  2FPF A;  2EFI A;  1WJQ A;  2RQR A;  1W2B P;  4LDY A;  1SSH A;  2X3W D;  3TEE A;  4M78 E;  5DLO A;  4OMM A;  4DBR A;  4C8Q F;  1WDX A;  3NTK A;  1IRX A;  1W4S A;  2HL5 C;  1ZUK A;  5FRN A;  2NLU A;  1VYU A;  2ZPF B;  3P8H A;  3CCQ T;  4E47 A;  1YI2 A;  1D3B B;  1KQ1 A;  1PC0 A;  2ECZ A;  2F5K A;  3KXT A;  2XDD A;  2RB6 A;  4F7U E;  5GMK i;  2L0A A;  2YUP A;  3V7R A;  1JO8 A;  2PVD B;  3DKM A;  5GAM g;  2FPE A;  1UUE A;  4XU1 A;  5IN1 A;  4F04 B;  4C0G A;  2DTO A;  2JTM A;  3M54 A;  4ZN3 A;  2SRC A;  1FX7 A;  4Z8A A;  1GRI A;  3L2W A;  1MND A;  4P5N A;  4PJO E;  1M4Z A;  3WXM B;  3CCQ A;  4FYW B;  3OY9 A;  3HHT B;  1Z9Q A;  3MHX A;  1K0S A;  2RJD A;  2CZ7 B;  1KC8 R;  5IAY A;  2LVM A;  2DTI A;  2VC8 A;  3QHS A;  2DTH A;  4R0K A;  3CCM T;  3QJ6 A;  2MK5 A;  2O4X A;  4D8K A;  2XG8 D;  4J5Y A;  4ORZ A;  1I5O B;  4L5G A;  1KQS A;  2HBP A;  2LQN A;  2ZPG B;  1NLO C;  5FU6 C;  2LJ0 A;  1HSQ A;  2DAQ A;  1VQ7 Q;  3ASK A;  4B9W A;  2AHJ B;  3CQT A;  2QI2 A;  1OI1 A;  1R77 A;  4M78 B;  3X28 B;  4RCB A;  4JLG A;  4BI8 B;  5GMK m;  3A8H B;  1IB8 A;  3CCM A;  1M1G A;  1MV3 A;  1MMG A;  3TSW A;  3GLX A;  1ZSZ A;  4A4E A;  1R0B G;  1WXU A;  2QGG A;  1QWE A;  2RK2 A;  4F7U B;  1M3C A;  1RAB B;  3CC2 T;  2F69 A;  2ZPH B;  4E6R A;  4JJC A;  1OPL A;  1Q81 R;  3JB9 I;  4B6M A;  4MZM A;  3BDL A;  2GFU A;  3S3M A;  5GAN 6;  2XDP A;  4RTZ A;  2K5F A;  1UGQ B;  4PJO B;  1Q86 U;  1VQ6 Q;  5GAO n;  4EIK A;  4KH1 B;  1EZZ B;  1MGQ A;  1KD1 C;  1NEB A;  1RAF B;  4M7A G;  1VQ4 T;  1I07 A;  5LJ5 j;  2DJZ A;  2DBK A;  2GGR A;  3VS7 A;  2R57 A;  3QPH A;  1QLY A;  3CC2 A;  3H0I A;  2OX7 A;  3BY7 A;  1VQ5 A;  2K5L A;  4QVC A;  4JZ3 A;  1HJD A;  3MP8 A;  4J6W A;  3LH5 A;  1E7O A;  1B34 B;  1JEG A;  1WQ7 A;  1M90 C;  4LD9 K;  1MUZ A;  4BE1 A;  3V8K A;  4CI0 C;  2FB7 A;  1VQ4 A;  2CH4 A;  2JZ2 A;  1D1B A;  1MNE A;  2RJC A;  4HVV A;  1NYF A;  4XU0 A;  3CCJ T;  3HKS A;  1BCO A;  1K1Z A;  3CME T;  4OB1 B;  5FLX E;  4ANJ A;  3RR6 A;  3MEA A;  4ZGD B;  1A0N B;  1AZG B;  2KY9 A;  2DNU A;  2YDL A;  4M78 D;  5GJW B;  5C0M A;  2ROL A;  1OPK A;  2RJF A;  3EG3 A;  4YTL A;  1GCQ C;  4C92 E;  3CCV Q;  3QII A;  2WSC E;  3OYY A;  5J39 A;  1UB4 A;  2B8A A;  2M9U A;  4QKU A;  3OSV A;  3CME A;  2W10 A;  1SEM A;  2LZ6 B;  3V8J A;  1R0C B;  2FHD A;  1WX6 A;  1QVG A;  2LX7 A;  2O9S A;  4O5V A;  2D0N A;  2WSF E;  2KT8 A;  2A7Y A;  4JRK A;  4ZTF A;  2CP6 A;  2HEQ A;  1VA7 A;  2HKN A;  3I5R A;  4JS5 A;  5GAN h;  4M75 E;  1NPR A;  1RAH B;  3V8L A;  1SKU B;  3M56 A;  5FW9 A;  3DLL A;  3J80 E;  3CMA Q;  2E12 A;  2DA9 A;  1OU9 A;  4E7L A;  2D8J A;  2YRD A;  3REA B;  3EGX A;  3VS2 A;  2DXT A;  1T0J A;  5FU7 B;  2CS7 A;  4C5H A;  2O2O A;  2JN0 A;  2JMC A;  2D8H A;  3M0R A;  4HCB A;  1FXX A;  1NLP C;  2DIL A;  1FMK A;  2J06 A;  1SRL A;  2QG9 B;  3OYN A;  4C8Q E;  2KI7 A;  2YLC A;  2ZAE A;  4KUD K;  2CRE A;  3FJP A;  4KUL A;  1MHN A;  3PIO A;  4E7I A;  4DBQ A;  4C92 B;  5CAI A;  3L2V A;  5IH2 A;  2VAS A;  4F14 A;  4XQ3 A;  1S72 Q;  1M2V A;  2LQ8 A;  2VKN A;  3CPW P;  2K9G A;  3OW2 A;  4N0A A;  2DBM A;  5GAM j;  1VQ7 T;  4GBQ A;  2X35 A;  1SF9 A;  2AT1 B;  2OTJ Q;  4OVA A;  2P0K A;  1IXD A;  3M0P A;  4XU3 A;  2QQR A;  3HTR A;  4M75 B;  3J81 E;  1TSF A;  4JS4 A;  2NYS A;  4KGV B;  5GJV B;  4DBH A;  1K9M C;  4DQ2 A;  1LJO A;  2RI2 A;  1HD3 A;  1VQ7 A;  1RUW A;  4M7A C;  1JB0 E;  2FRY A;  2A0F B;  3G4S Q;  4AFZ C;  3EH1 A;  1H3H A;  2YT6 A;  2E10 A;  1XJW B;  2IG0 A;  4BD3 A;  4O6J A;  1F1B B;  2HCK A;  2K79 A;  4F7U F;  2KK4 A;  2L3P A;  1N8R R;  4C8Q B;  3EGD B;  4J9C A;  1VQ6 T;  1RAA B;  1X01 A;  4E7S A;  2PU9 B;  3LWH A;  1YNZ A;  4BI4 A;  2KEA A;  2CZ1 B;  1Y96 B;  1D1A A;  3SWN B;  3CC7 A;  1X6B A;  3VJP A;  3EHQ A;  2QYZ A;  1KD1 U;  4J8O A;  1WXB A;  2DF6 A;  2CT4 A;  1JXO A;  2JTE A;  4DA4 A;  3MJX A;  2MIO A;  2DEQ A;  5KYX A;  1GBQ A;  3X24 B;  2QTX A;  3VYG A;  2QQS A;  3EHR A;  3OYE A;  3QUI A;  1VQ6 A;  1ZA2 B;  1UHC A;  2R5M A;  2W0Z A;  4C92 D;  5L23 A;  5HCK A;  3DLM A;  1I81 A;  2SEM A;  1IHW A;  2EJ9 A;  3OQ5 A;  3EG9 B;  2RHX A;  5LJ5 e;  3P8B B;  9ATC B;  4KRT A;  5I11 A;  2K57 A;  1GBR A;  1QVG S;  2L89 A;  3JCM f;  4OML A;  5GMK j;  2DD5 A;  4OMQ A;  1Q82 U;  3DB4 A;  4X34 A;  3CXC P;  1OV3 A;  1Y7X A;  5FRO A;  2XID A;  2XKO C;  3ULR B;  3CCV T;  1IGQ A;  3TSZ A;  3G71 Q;  1UTI A;  4M75 D;  1D0Y A;  1QWF A;  3JCM J;  4JPB W;  2RN8 A;  2X4W A;  4E7Z A;  1V76 A;  1V29 B;  2BZX A;  3OA6 A;  4E7J A;  2DXC A;  3RDV A;  1FYN A;  3VS0 A;  3RKW A;  4EDU A;  4GY5 A;  4Y92 A;  3T9N A;  4C0Z A;  3H0F A;  2DYB A;  1PKT A;  1FWZ A;  2RF0 A;  4M7A A;  1AOJ A;  1YBY A;  4C0D C;  5GAN d;  1H3Z A;  2K3X A;  2GF7 A;  2L3S A;  1JXM A;  1VQ9 Q;  2WAC A;  3CBO A;  2J7I A;  2MI6 A;  4M7D C;  5LJ5 g;  3CCV A;  3HPW A;  2LC4 A;  1KG1 A;  4J7I A;  4C8Q D;  3TRE A;  2DEU A;  1M3A A;  2K4Y A;  1BCM A;  4CRI A;  3CMA T;  3L2Z A;  1NJI U;  3V7C A;  2DL7 A;  2VVK A;  2GQV A;  3H9N A;  2HSE B;  1YCS B;  3R6O A;  5AYF A;  4IKF A;  3CPF A;  3O8V A;  3NFC A;  1QVF P;  2JS2 A;  3OS1 A;  2I0N A;  4LDX A;  2YUN A;  1PSF A;  4FU6 A;  4IUR A;  4RTV A;  3JCM c;  3A1P A;  2OTL Q;  1VQM Q;  5GAN 4;  1MMN A;  2DK3 A;  1B3Q A;  5DM7 R;  1M1K U;  1ZA1 B;  4OB0 B;  2AZS A;  1TS9 A;  3CMA A;  3VUB A;  1IHV A;  3LX7 A;  3JSC A;  2L2P A;  1OEB A;  2EYY A;  2CZ6 B;  4HVU A;  3M5A A;  2EQK A;  1S72 T;  3AHU A;  2V1R A;  4IUP A;  2AKK A;  4CC7 A;  1YCY A;  1TTH B;  2HMA A;  4C92 F;  1U8R A;  1M2O A;  2MYS A;  2MOX A;  4FSX A;  2MAM A;  5LJ5 f;  3JB9 G;  4NS5 A;  1ZBX A;  1HK9 A;  2F1L A;  4FW1 A;  4Z88 A;  2OTJ T;  2Y4X A;  3OYA A;  3CCJ Q;  1UEB A;  1UGR B;  1RL2 A;  2CUD A;  3OS5 A;  1QVP A;  3OYM A;  1YJW Q;  2MWO A;  4X9D A;  4AG1 C;  1I4K 1;  2QQA A;  2KDS A;  1ZSZ B;  1S72 A;  3VRZ A;  1VQ8 Q;  2RI3 A;  4KUI A;  2E6N A;  3EFO A;  4HVW A;  5KCO A; 
#chains in the Genus database with same CATH homology
 1W2B A;  2CZ0 B;  2RK2 A;  4F7U B;  4BDZ A;  2KSS A;  1O75 A;  2HNI A;  3CC2 T;  2F69 A;  2ZPH B;  1QP3 A;  1N6A A;  4M75 F;  2ZCF B;  4QQ6 A;  4MDW A;  3SD4 A;  2DO3 A;  4M7A D;  4PJO G;  2PVO B;  4XTV A;  3JB9 I;  3LGL A;  1M1K C;  4M7D G;  4MZM A;  3G4S T;  3A8O B;  4OB2 B;  1K9M U;  2OTJ A;  3BDL A;  2GFU A;  1KQS S;  3CCS A;  5GAN 6;  5LJ3 d;  3JCM d;  3S3M A;  2XDB A;  4JLI A;  2DIQ A;  3PNW C;  2XDP A;  4C0D B;  2K5F A;  1BI0 A;  1UGQ B;  1NZ9 A;  2ZZD A;  4PJO B;  5I21 A;  1Q86 U;  1N27 A;  1WJR A;  4M7D B;  4J6X A;  4ZTJ A;  5GAO n;  5GAO q;  4BI3 A;  2PUO B;  1MGQ A;  1Q7Y U;  1KD1 C;  4M7A G;  4L59 A;  1VQ4 T;  2X4Y A;  1IRE B;  5J3B A;  5LJ5 j;  3CXC S;  2DJZ A;  5FU7 C;  5GAO l;  5LL6 S;  1YJN T;  2R57 A;  2ZPB B;  3QPH A;  3SDZ A;  1VIE A;  3CC2 A;  1JBM A;  1N9S A;  4JUV A;  2QEX T;  1BYM A;  3JCM e;  3BY7 A;  4M77 D;  1VQ5 A;  2K5L A;  2KQW A;  3OBY A;  4QVC A;  4BY6 C;  1QVF A;  2KVQ G;  2H3J A;  4MDX A;  2IVW A;  5CCA A;  3G4S A;  4L6V 5;  3MP8 A;  3HRU A;  4LDU A;  3CCL A;  4J6W A;  5GMK l;  5A0G A;  1B34 A;  2PVG B;  1K73 U;  1B34 B;  4OGE A;  2L5Q A;  1NPP A;  4II1 A;  2V8K A;  3FB9 A;  1U1T A;  1WQ7 A;  3HFN A;  4BUG A;  1W2B S;  1M90 C;  4VUB A;  4C92 C;  3L42 A;  3MP6 A;  4LD9 K;  4BE1 A;  2JNG A;  3A8G B;  3X20 B;  1X75 C;  5CKD A;  3V8K A;  4CI0 C;  4M77 G;  1M1F A;  3RIR A;  2FB7 A;  2JVV A;  2P4T A;  4PLI A;  1VQ4 A;  2VXF A;  2JZ2 A;  2VUB A;  3OBW A;  2M1H A;  4KT0 E;  5GAN e;  1IZ6 A;  2RJC A;  3N5B B;  2YHT A;  3INZ A;  1YJN A;  1U1S A;  2DVE A;  3QYH B;  3RER A;  4XU0 A;  1KQ2 A;  2XU8 A;  1X6O A;  4NL3 A;  1P92 A;  2DXB A;  3CCJ T;  5DY9 A;  5GAN 8;  3HKS A;  2QEX A;  3HSB A;  3EAE A;  3CME T;  4OB1 B;  3OYL A;  5FLX E;  3FLG A;  3FIF A;  3V7S A;  1ZHI A;  4XTX A;  3MEA A;  4M78 F;  2JOY A;  3OYG A;  4BE2 A;  3GIB A;  2KAF A;  3ZEH A;  3P8D A;  2DZC A;  3QO3 A;  4ZGD B;  2G3R A;  2E70 A;  4NL2 A;  4RG8 A;  3M9Q A;  5KE3 A;  1XQH A;  2KY9 A;  5FU6 B;  3RUX A;  3JB9 F;  4M78 D;  5C0M A;  3JB9 H;  2DXU A;  3G6E T;  5I2M A;  3MEV A;  2RJF A;  4YTL A;  3CC7 T;  2CKK A;  5GAN 7;  4M75 C;  1Q7Y C;  4XU2 A;  4C92 E;  4BAC A;  4HCZ A;  3QZ5 B;  2LCC A;  3OYF A;  1QVF S;  2HAX A;  3JAM E;  2ZPI B;  5I2S A;  5CR2 A;  3OYB A;  3QII A;  2O4X B;  2WSC E;  3HRS A;  2VV5 A;  4X9C A;  3OYY A;  3JCM g;  3QJY A;  4A54 A;  5J39 A;  1UB4 A;  4KBM B;  4MZT A;  2B8A A;  4R56 A;  4JDS A;  3G71 T;  1VQK T;  5FRM A;  2M9U A;  3JCM h;  3CCR T;  1GXI E;  3C95 A;  1XOV A;  3L1A A;  4C8Q A;  3OSV A;  3OYI A;  2P0Q A;  3CME A;  3MET A;  4M78 G;  3V8J A;  2EQU A;  2FHD A;  2PUK B;  1SSF A;  5GAO m;  1QVG A;  2QQB A;  4O5V A;  2KMT A;  2WSF E;  2E1H A;  2A7Y A;  3OMG A;  1K73 C;  3SFM A;  3LWI A;  4JRK A;  4MMK A;  1QP2 A;  3JB9 J;  1G3T A;  3MEW A;  1Y96 A;  2E41 A;  3J7A F;  4ZTF A;  3QXE B;  4ELY C;  5HKC A;  3G6E A;  3CCU T;  4PJO F;  5GAN g;  3HFO A;  5GMK e;  1LNX A;  4RMO A;  4M7D F;  1BI3 A;  1OZ2 A;  2R58 A;  2M0O A;  4WF2 A;  5CKH A;  5CKB A;  4JS5 A;  1O9S A;  5GAN h;  2LCL A;  4C8Q C;  5A2Q E;  4M75 E;  2EIF A;  1VQ9 T;  2MF2 A;  5LJ5 d;  1NPR A;  5CKE A;  1VQK A;  3G71 A;  3V8L A;  4F7U G;  4M7D D;  2CYZ B;  3OB9 A;  4J6Y A;  1BI1 A;  3M56 A;  3QG1 A;  5GAM f;  2MMP A;  3DLL A;  3CCR A;  3J80 E;  4OMF B;  4ZGE B;  2E12 A;  1Q81 U;  4LDW A;  4D6W A;  4E7L A;  2BUD A;  3FEO A;  4M7A F;  1KC8 C;  1JRI A;  5KCH A;  2VGM A;  3A8L B;  2VYT A;  4MZP A;  3SWN C;  1NE8 A;  2OAU A;  2RD1 A;  5M9O A;  5C6S A;  3VYH B;  4A4K A;  2DXT A;  5DLQ E;  5FU7 B;  2CS7 A;  4C5H A;  5EG2 A;  2JN0 A;  3WVE B;  3CCU A;  4XAX B;  4JRQ A;  4HCB A;  3MCA B;  3NTI A;  1FXX A;  2CGH A;  2WSE E;  3PFS A;  4BY6 B;  1VQ9 A;  4ATO A;  3VU3 C;  3UT1 A;  3OYN A;  4C8Q E;  3QDR B;  5A0D A;  3CBM A;  2YLC A;  2EAY A;  4IUV A;  4KUD K;  2RH2 A;  3FJP A;  4N4H A;  2L3R A;  5GAN 3;  4KUL A;  1MHN A;  5HY6 A;  2A3L A;  3PIO A;  3M59 A;  4EMK C;  4TVR A;  3BW1 A;  1VQM T;  3UDC A;  1PSE A;  1N9R A;  4M77 F;  4C92 A;  3HL8 A;  4E7I A;  1K8A U;  1RI0 A;  4C92 B;  3F70 A;  3KBG A;  3RES A;  1JJ2 S;  3PIP A;  2LTO A;  3LLR A;  5CAI A;  3L2V A;  5LJ3 e;  4M7D C;  3ZBD A;  2FVU A;  4XQ3 A;  4DOV A;  1YI2 T;  4HKE A;  1Y71 A;  2RHY A;  2LDM A;  4PKC C;  3JCM V;  5CK9 A;  2LQ8 A;  5GMK h;  4A4H A;  2EJF A;  3SB2 A;  1G3W A;  4OF1 A;  5GAN f;  3OW2 A;  4XTY A;  2EQJ A;  4N0A A;  5GAM j;  3PTA A;  1VQ7 T;  3GOX A;  4LD6 A;  1G5V A;  2XD0 A;  2EWN A;  2VXE A;  1I5L A;  2EYQ A;  4FM4 B;  2X35 A;  3QZ9 B;  3TCJ A;  3QSU A;  4OVA A;  2OTL A;  2P0K A;  1VQM A;  1Q81 C;  4XU3 A;  4RKU E;  3RMQ A;  2XIC A;  3ER0 A;  5J26 A;  2QQR A;  4C5G A;  1XNI A;  3OYH A;  4M75 A;  3C12 A;  1Y07 A;  4M75 B;  3J81 E;  1XTD A;  3OS0 A;  3MEU A;  3Q1J A;  1UGS B;  2QXF A;  4IUT A;  3M58 A;  3X26 B;  3C4S A;  3OYD A;  3E1S A;  4FT4 A;  1YJW T;  4JS4 A;  1D3B A;  4N0A C;  3X25 B;  2JTF A;  2LQK A;  1YJ9 T;  5GAN 2;  2EKO A;  2GCX A;  1K9M C;  4LDV A;  5HK3 A;  4DQ2 A;  5GAO p;  1LJO A;  3TU4 K;  2DPP B;  4PL6 A;  1VQ8 T;  2RI2 A;  4HA8 A;  3JCM X;  1VQ7 A;  4N4G A;  4M7A C;  1JB0 E;  3UWN A;  1Q86 C;  2E6Z A;  4C0F A;  3S3N A;  1N8R U;  2FL7 A;  2E10 A;  1TH7 A;  3L2Q A;  2LNV A;  3PMT A;  2IG0 A;  5LJ3 g;  3JCM Q;  1K8A C;  4QQG A;  2JUF A;  1LOJ A;  4O6J A;  4BD3 A;  4HCC A;  2BIV A;  5LJ3 h;  3CCJ A;  3CCE T;  5L8R E;  3OW2 S;  2K5I A;  4F7U F;  2KK4 A;  4EMH A;  2QDY B;  4C8Q B;  1YJW A;  2C06 A;  2RHI A;  5GAN j;  2HD0 A;  1X01 A;  4EMG A;  1YJ9 A;  1VQ6 T;  4XK8 E;  4ZGJ B;  3A8M B;  2PU9 B;  1QW1 A;  3LWH A;  2E64 A;  2LRQ A;  2RHZ A;  3RKX A;  3ZFJ A;  4BI4 A;  3KUF A;  3M4G A;  1VQ8 A;  5GAO r;  4M77 C;  2BKD N;  4GLK A;  2CZ1 B;  1Y96 B;  3QYG B;  3SWN A;  4A4F A;  4HT8 A;  4V2S A;  3JCM W;  3SWN B;  3OS2 A;  2ZPE B;  3LGF A;  2L8D A;  4N4I A;  2XI9 A;  2XHC A;  4IUQ A;  3CC7 A;  4M7A E;  3VJP A;  5D6X A;  3GNF B;  2D6F A;  1I8F A;  3HP9 A;  5KE2 A;  3LH0 A;  1KD1 U;  3C94 A;  1G3S A;  1R8O B;  4J8O A;  1HXD A;  2V8J A;  4OB3 B;  3FC3 A;  4DA4 A;  3BFM A;  4BE0 A;  2DEQ A;  1VQN T;  3CCE A;  5D6Y A;  2E65 A;  3CBP A;  3M57 A;  2GFA A;  4JRI A;  2QTX A;  4QW2 A;  2QQS A;  3VYG A;  3X24 B;  3OYE A;  1VIF A;  3QUI A;  4M78 A;  3VV0 A;  1BKB A;  1VQP T;  1VQ6 A;  2PQW A;  2E5Q A;  2K3Y A;  2R5M A;  4C92 D;  1YIT T;  3DLM A;  3OYK A;  1I81 A;  3CC4 T;  3M4Y A;  4EMK A;  1YIJ T;  4B9X A;  2EJ9 A;  4XTW A;  4ELZ C;  3OQ5 A;  4EMK B;  3CCS T;  3GF5 A;  2RHX A;  3LYI A;  3S6W A;  4BB7 A;  4QVD A;  5GAM d;  4RG2 A;  5LJ5 e;  3OMC A;  2O01 E;  5D6W A;  3P8B B;  3E9F A;  4M77 E;  2LT1 A;  2DIG A;  2HQX A;  5KH6 A;  2VGN A;  3JCM b;  3CEY A;  3G7Z A;  4MML A;  3E9G A;  1OZ3 A;  2K57 A;  4IUU A;  4Z02 A;  2K2V A;  3CPW A;  5CO7 A;  1YHQ T;  4M78 C;  4C92 G;  1QVG S;  2L89 A;  1ZQ1 A;  4XTZ A;  5LJ3 f;  3JCM f;  4J7F A;  2MWP A;  5CQY A;  1BI2 A;  2DD4 A;  2DD5 A;  5GMK j;  1VQN A;  2RK1 A;  4R55 A;  3BDU A;  5CIU A;  1Q82 U;  3VKI A;  3I55 T;  1UGP B;  3DB4 A;  4X34 A;  3FDR A;  3S3O A;  1H64 1;  5FRO A;  1Y7X A;  1VQ5 T;  1VQP A;  1KHC A;  4PNO A;  5GAM e;  2XID A;  2RA2 A;  2XKO C;  3DB3 A;  2D9T A;  4Y91 A;  5CVI A;  4OP0 A;  1YIT A;  3CC4 A;  3CCV T;  3CCL T;  4J83 A;  4M75 D;  1YIJ A;  2X4X A;  2DZ9 A;  3E19 A;  3JRZ A;  4OGC A;  3EFS A;  5CKF A;  3JCM J;  4FL6 A;  4PJO A;  2X4W A;  2RHU A;  1KHI A;  1V29 B;  4M7D A;  4ZN1 A;  3OA6 A;  4E7J A;  3QBY A;  2DXC A;  2M16 A;  2ZGW A;  1WNL A;  4E7K A;  4UC4 A;  2X4J A;  2EFI A;  3RKW A;  1WJQ A;  4C5I A;  1YHQ A;  4EDU A;  2Y4Y A;  3PT9 A;  4Y28 E;  3PGG A;  1WJS A;  4GY5 A;  4LDY A;  3WVD B;  3T9N A;  3TEE A;  2LT4 A;  2HQE A;  4M75 G;  4C0Z A;  4M78 E;  1FWZ A;  2FYK A;  3OSS C;  1VQL T;  1M9S A;  5DLO A;  3I55 A;  4M7A A;  1YBY A;  4M7A B;  4C0D C;  5GAN d;  1H3Z A;  4C8Q F;  2K3X A;  2GF7 A;  3NTK A;  3NTH A;  4PJO C;  5GAN 5;  2WAC A;  3CBO A;  2YRV A;  1W4S A;  2MI6 A;  1EIF A;  5LJ5 g;  3CCV A;  5FRN A;  2QA4 T;  4Q5W A;  3HPW A;  2LC4 A;  4A4G A;  2R5A A;  1KG1 A;  2NLU A;  2ZPF B;  1BIB A;  4C5E A;  3P8H A;  4DOW A;  4PLL A;  3CPW S;  3CCQ T;  4E47 A;  4J7I A;  1VUB A;  4C8Q D;  5LJ5 h;  1YI2 A;  3TRE A;  2LX9 A;  5IT9 E;  1D3B B;  3MO8 A;  1KQ1 A;  2V8I A;  5CQX A;  4QQD A;  3H6Z A;  1OYX A;  2K4Y A;  4RCC A;  2F5K A;  4F7U A;  3KXT A;  4CRI A;  2XDD A;  5LJ3 j;  2YLB A;  1WQW A;  1BIA A;  3L2Z A;  3CMA T;  1NJI U;  3V7C A;  2RB6 A;  2GQV A;  4F7U E;  5GMK i;  3V7R A;  4QVZ A;  4EPC A;  3L2R A;  2PVD B;  3DKM A;  3R6O A;  5AYF A;  3RKY A;  5GAM g;  3L2U A;  4IKF A;  3CPF A;  3O8V A;  1VQL A;  1Q82 C;  3NFC A;  4FT2 A;  4M77 A;  4NOY A;  4C8Q G;  3OS1 A;  3UPU A;  4M77 B;  4XU1 A;  5IN1 A;  3A5Z B;  5GAM h;  4C0G A;  2DTO A;  4LDX A;  2JTM A;  1G3Y A;  3M54 A;  4ZN3 A;  1PSF A;  4XTU A;  4HT9 A;  1FX7 A;  4FU6 A;  1KC8 U;  4IUR A;  3JCM P;  3RMS A;  2DKG A;  3L2W A;  2QA4 A;  3JCM c;  4P5N A;  4PJO E;  1M4Z A;  2Y90 A;  3WXM B;  3CCQ A;  4M7D E;  3VUZ A;  4ME7 A;  3GPL A;  5GAN 4;  3OY9 A;  3HHT B;  1M8V A;  5A0L A;  3MHX A;  2DK3 A;  4BDY A;  2RJD A;  5DM7 R;  4OB0 B;  2CZ7 B;  1VQO T;  1M1K U;  2OTL T;  5IAY A;  2LVM A;  2F5T X;  2DTI A;  1AHJ B;  2VC8 A;  3QHS A;  4A53 A;  3CMA A;  3PMI A;  3QKJ A;  3URG A;  2DTH A;  3VUB A;  3I56 T;  3LX7 A;  2RM4 A;  3M53 A;  3QJ6 A;  3CCM T;  2O4X A;  3JB9 D;  2P0P A;  2XG8 D;  3JSC A;  3CD6 T;  4E7H A;  2CZ6 B;  4J5Y A;  2D0Q B;  3M5A A;  4L5G A;  2EQK A;  1S72 T;  2HBP A;  1KQS A;  3AHU A;  3FRN A;  4IUP A;  2ZPG B;  5FU6 C;  2DAQ A;  1YCY A;  3ASK A;  4B9W A;  4C92 F;  1U8R A;  2AHJ B;  4FSX A;  2QQ9 A;  3GP8 A;  2MAM A;  2QI2 A;  5LJ5 f;  3JB9 G;  1DJ7 B;  1OI1 A;  2EJG A;  4NS5 A;  1ZBX A;  1HK9 A;  1WPY A;  4M78 B;  5HK0 A;  3MP1 A;  3GNG A;  3X28 B;  4RCB A;  3CXC A;  4JLG A;  1VQO A;  1M5Q 1;  4FIB A;  4BI8 B;  2OTJ T;  2RJE A;  2Y4X A;  3OYA A;  1NJI C;  1JJ2 A;  2RI5 A;  1UEB A;  1UGR B;  5GMK m;  1RL2 A;  3A8H B;  3I56 A;  4JJN K;  2XK0 A;  3OS5 A;  1QVP A;  3CCM A;  3OYM A;  1M1G A;  3CD6 A;  4JRP A;  1M90 U;  4PJO D;  2RO0 A;  3GLX A;  2MWO A;  3HRT A;  4X9D A;  1N8R C;  1I4K 1;  4A4E A;  2QQA A;  2EQM A;  1WGS A;  3EFR A;  2KDS A;  1S72 A;  3OYC A;  3LW5 E;  2RI3 A;  4KUI A;  3M55 A;  3OYJ A;  2E6N A;  2I2L A;  5KCO A;  3ME9 A;  3H8Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...