4NL2A

Crystal structure of listeria monocytogenes hfq
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
73
structure length
73
Chain Sequence
b'MKQGGQGLQDYYLNQLRKEKILATVFLTNGFQLRGRVVSFDNFTVLLDVEGKQQLVFKHAISTFSPQKNVALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein hfq
publication title Recognition of U-rich RNA by Hfq from the Gram-positive pathogen Listeria monocytogenes.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Rna binding protein
total genus 17
structure length 73
sequence length 73
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4nl2A00
3PGGA 4C92F 2DTHA 4M7DC 4C8QB 5GANh 1KQ2A 2E1HA 4M7DE 2DKGA 1Y96A 2EJGA 1M8VA 4M75G 4M7AA 4X9CA 5GMKi 4A53A 4MMKA 1LOJA 4MMLA 2RD1A 4NL2A 5GAMh 4M75D 4XTWA 1WPYA 4M78F 4PJOA 1X01A 2RB6A 1I5LA 4XTXA 3SWNB 2QTXA 3JB9F 4M7AF 4C8QD 1WQ7A 1YCYA 3QO3A 4XTYA 4QVDA 2I2LA 5GMKl 3V7RA 4PJOF 4M75E 2DJZA 5LJ5h 5GAN7 5LJ3f 4C8QC 5DY9A 3FB9A 5GAN2 4J6XA 5GAOp 5GMKm 2EJFA 3JCMP 4EMKC 3JCMW 4JRIA 5GANd 3SB2A 4M75B 2DTIA 5LJ3g 3M4GA 1N9SA 4F7UF 2E41A 1HK9A 4C8QA 5GMKh 5GAMd 3SWNC 3BDUA 1WQWA 2VC8A 3JB9H 4J6WA 3V7CA 3QHSA 3RKYA 1I8FA 4EMKB 2CGHA 2DTOA 2YLBA 5GMKe 4HA8A 4M77B 3JCMh 1JBMA 2VXFA 4C8QF 4DQ2A 4J6YA 5LJ5d 4OP0A 2FB7A 5GANe 5GAN4 4N0AC 5GAOl 3QSUA 4HT8A 3SWNA 4M7DA 1I4K1 2YHTA 3JCMQ 3V8JA 3RUXA 1HXDA 1JRIA 2DZCA 2E64A 4M75C 1D3BB 2FYKA 2JN0A 2ZGWA 4M77G 5GAMe 5GAOm 3GIBA 4WF2A 2E10A 4XU2A 4M7DF 5LJ3j 3BW1A 4M77D 4N0AA 3JCMX 3RKXA 3JB9I 4X9DA 3FIFA 3HFOA 5GAN6 5LJ5e 2RA2A 1KQ1A 1I81A 5CAIA 1WNLA 4QVCA 4M75A 3HFNA 4J5YA 4M77C 3RKWA 2EJ9A 4C92G 5GAOr 2K57A 1B34B 4M78B 3INZA 4M77E 4EMGA 3EFRA 3JCMd 1H641 4XTVA 3FJPA 3BY7A 4JLIA 2EAYA 4M75F 4EMKA 4M77A 4M78G 1LJOA 4JRKA 4C92E 5GANf 2DVEA 4XU1A 5LJ3h 5GAOn 3JB9G 4NOYA 4NL3A 4M78D 3VU3C 4M7AG 1LNXA 5GAN5 5GAMf 1M5Q1 2DXUA 4PJOG 5GAN8 3JB9D 4M7AD 3JCMe 5GANg 5LJ3e 2Y90A 2DXTA 4M78C 4C92B 4XU0A 3JCMV 4F7UB 3RERA 4PJOD 4M78E 3RESA 5I21A 4M7AC 2DEQA 5GAMg 2EWNA 4M7AE 3JCMc 2VXEA 2E65A 4PJOC 3L1AA 4HT9A 4F7UG 4PJOE 3V8LA 1B34A 4M78A 4A54A 1TH7A 2DZ9A 3V8KA 3JCMJ 5LJ5g 3L2ZA 4C92D 1Y96B 4JUVA 2RM4A 4Y91A 4PNOA 4M7AB 5LJ3d 1BIBA 3HSBA 1U1SA 4C8QG 4PJOB 3BFMA 4C92C 5GMKj 1U1TA 2HNIA 4F7UE 4XTUA 4M7DB 5GANj 4EMHA 3AHUA 1N9RA 5GAOq 4V2SA 3JCMb 4XQ3A 3JCMf 1BIAA 5GAMj 1MGQA 4M77F 1D3BA 4XTZA 4F7UA 3EFSA 4RCCA 4RCBA 4XU3A 3RIRA 4C8QE 4C92A 5GAN3 4M7DG 3JB9J 2YLCA 3QUIA 4M7DD 3V7SA 3JCMg 5LJ5f 5LJ5j
chains in the Genus database with same CATH superfamily
3QDRB 1WI7A 2KY9A 1Z9QA 3M0PA 1KQ2A 2LVMA 1MMNA 5EG2A 2LX7A 2XICA 4BB7A 6AT1B 2RNAA 4A53A 3U23A 3EG0A 3H0FA 4OB1B 2JJ9A 1NBEB 3GBQA 3G6EQ 1PHTA 4LNPA 3QO3A 4QVDA 1D09B 2B86A 3CC7A 4JDSA 4IUQA 2RHZA 2MPXC 3FB9A 3CC4T 2AT1B 2LQ8A 2K7AA 1O9SA 4QKUA 4IKFA 5GAMd 2XDBA 4EMKB 3H41A 3G4SA 2CGHA 4GLMA 1N5ZA 2FB7A 2LQWA 4CC3A 1ZHIA 5FU6B 2XK0A 2LQKA 2EW3A 1YITA 1PRLC 1IZ6A 2JZ2A 3A98A 3C0CA 1JRIA 4KULA 3V8JA 1VQLT 2E64A 4LE9A 4OB3B 1VQ4A 2PQWA 1QW1A 1IO6A 1Y71A 1KG1A 4C92G 2RPNA 4FSXA 3CCST 2EYWA 1AWXA 5CKFA 2DL8A 1RAHB 4HKEA 2HKNA 3RNJA 2XHCA 2CYZB 2QA4Q 3M0SA 2HSEB 1M5Q1 1PCXA 2KK4A 3MEUA 4DBFA 2DLPA 4Z89A 1M1FA 2Z0WA 5KE2A 5KH6A 4AFUC 5A2QE 4UC4A 4ZGJB 1JXOA 1M3CA 1MMGA 2J6KA 3V8KA 3M0UA 2NLUA 4RKUE 3VYGA 1UGPB 3CC2T 4M7AB 3PVLA 2BUDA 2KRSA 4PJOB 2X4JA 3MPUB 2CH4W 3P8DA 3WVEB 1X2QA 1N9RA 1YJWQ 2YT6A 4RG2A 2K5FA 5FU7C 1TXQA 4RCCA 4XU3A 2F2VA 2BZXA 1QQJA 1X6BA 4M7DC 3CCRT 4O6JA 4F17A 2DNUA 2RHYA 2LMJA 3SFMA 5D6WA 2ZPHB 2YUOA 1I5LA 1AEYA 4XTXA 1VQKT 2A3LA 1WQ7A 5LJ5h 1MMDA 2M02A 2EQIA 3EGXB 4PLIA 4ME7A 5GAN2 3LX7A 5GAOp 4J83A 5FLXE 3TQ7P 1R0BG 2HMAA 4C8QA 4J9CA 3CCVQ 2AHJB 3EH2A 3G6EA 3UDCA 2QASA 1ARKA 4HT8A 1FMKA 2GQIA 4CRIA 1QVFP 3J81E 4CI0C 3CXCA 1VYVA 3VRZA 1RLPC 2RA2A 1NPPA 2LNVA 4M77C 3CBPA 2LZ6B 2DX1A 3UF4A 3URGA 2HQEA 2LC4A 1VQ9T 1WHGA 2FG0A 2R5MA 1SEMA 2HEQA 4IUTA 4J7IA 1ZBXA 1CSKA 3QKJA 2DA9A 2X3WD 5GAN5 2FO0A 3CCJT 4HVUA 3CCMT 2JW4A 2ESWA 3CMAT 1V29B 4F04B 3I55T 3CCUT 2K3YA 4E7JA 1WJQA 1VQOQ 1KC8R 4FW1A 2QQSA 4MZMA 2RJDA 5LJ5g 1KIKA 5IHIA 1BI1A 1WIEA 3J7AF 1TUCA 2A7YA 2QA4A 4RG8A 4X34A 2E70A 1JJ2S 1SRLA 4C92A 1WA7A 3GPLA 4MDXA 2K6DA 4Y28E 1PRMC 2JM9A 4BI4A 5CAIA 3VS4A 1T0HA 1K1ZA 2K2MA 2OJ2A 2E1HA 4AFQC 3M54A 1Y96A 1OZ2A 1QVGP 2CP0A 3I56Q 5IH2A 1YJWA 2V8KA 1ZA2B 5I11A 1VYTA 2GGRA 2PUKB 3MEAA 3OQ5A 2GFAA 4OVAA 3HPWA 4LDWA 4EMKC 2CT4A 1E7OA 1K0XA 1U06A 2KGTA 1X27A 4R55A 2BIVA 3LGFA 3KBGA 5J26A 1I8FA 3LYIA 4KGZB 2ATCB 1GL5A 2KT1A 1JBMA 5LJ5d 2OTLT 1ACMB 4N0AC 4FYXB 4TVRA 1UUEA 5C6SA 1JQQA 4M75C 3S6WA 2HKQB 4L59A 3EGDB 2J06A 1S72Q 1KC8C 2D8JA 1FX7A 1X43A 1NLPC 3SEMA 2K57A 1Y57A 3CCVA 2HBPA 2C06A 2DAQA 4JLIA 4CC4B 2RN8A 1IB8A 1AOJA 2MIOA 4C0GA 1VQ6T 1Q81U 1PC0A 2WSEE 3CCEQ 2DXTA 1UHCA 1YFNA 3OW2S 1GCQA 4M7AC 1H92A 1YCSB 4PJOC 4LDVA 2QTVA 4JRPA 3G71Q 3VUZA 4ATOA 1N27A 3TSWA 3EG9A 4FYYB 2LQNA 1RADB 4HCBA 1MGQA 3CC7T 3C4SA 2D6FA 5CCAA 2XDPA 1U5SA 2VV5A 1X2KA 3HL8A 1VQOA 3QWXX 1KQSS 4XK8E 1YJ9T 3CCLQ 2X4YA 4AG2C 4BDYA 3O5ZA 2VUBA 4R56A 3FEOA 5AYFA 3E19A 1VA7A 1SF9A 4M75E 3H6ZA 1WXTA 3DKMA 4OMOA 5LJ3f 1I5OB 4PFPA 3CCUQ 1YIJA 1IREB 1G3TA 1YHQQ 3OYEA 1WGSA 1RUWA 2MYSA 3ME9A 2R57A 1WYXA 2VC8A 1QVPA 1IHWA 2J05A 2CUDA 2V1RA 5GMKe 2VXFA 5GAN4 4OP0A 5GAOl 2VWFA 1Q7YU 3OYAA 5GAMe 1WXUA 3JB9I 2P84A 4X9DA 2NUTB 2B8AA 4QVCA 4ELYC 4IUVA 1VIEA 3L2WA 1UHFA 1Q86U 1Q82R 8ATCB 4KUIA 2EGCA 5DLQE 3OYGA 4BY6B 4K11A 1IHVA 3THKA 2KI7A 5LJ3e 1S72A 3JCMV 1ZSGA 5ECAA 3VS3A 4JZ3A 2EQUA 3CPWP 2DRKA 4M78A 3E9GA 2X51A 4KUDK 4HCZA 3X20B 3UWNA 3HSBA 2DL5A 2MWOA 3GNFB 2HSPA 3UATA 1TG0A 1XOVA 3OSVA 3CCEA 3I5SA 1G3WA 4F7UA 3OS1A 1NZ9A 1GFCA 2CP6A 3VS2A 3QUIA 1BCOA 4GBQA 1ZUYA 1K9MU 1VQ7Q 3CBOA 3META 2ZPFB 1NPRA 2HBWA 2RI5A 2RJCA 3QG1A 5I2MA 1VQ6Q 1NJIU 3HHTB 2ZAEA 2PUOB 1VQNT 5HKCA 3M5AA 4XTYA 1B7TA 2DL4A 4F14A 1R77A 4ORZA 4A4KA 3VV0A 2GQVA 2YRVA 3X26B 3CCLA 1WHHA 1XNIA 3MP6A 5GMKh 2RQWA 1Q82C 1SKUB 1ABOA 1BU1A 2KSSA 2LJ3A 2PVGB 3M55A 4C8QF 5GAOq 5KYWB 3OS5A 4E7HA 2D1XA 2KNBB 2E10A 2V26A 4XU2A 3JCMX 2XKOC 2HAXA 2MI6A 3OYCA 1YJ9Q 1RABB 1VYUA 3OW2A 4AFZC 5EC7A 4C0DC 1H3ZA 4HCCA 5GANf 3LLRA 4QQGA 5D6XA 5LJ3h 4WCIA 3P8BB 5DLOA 4II1A 2DE0X 4CC7A 2X4XA 2KRNA 2FPFA 1ZX6A 1I0CA 5KYUA 1AWOA 1FYNA 3X28B 1UJYA 1Q81R 1JEGA 2VVKA 2DIGA 3L1AA 4LUDA 1CKAA 2K5LA 2CZ0B 2AKKA 3SDZA 2COWA 2M9UA 1OQKA 2JM8A 4M4ZA 5CKDA 1UE9A 1O75A 2KROA 2VGMA 1TWBA 2LCLA 4ANJA 4E6RA 2IG0A 2KR3A 3A8OB 5LJ5f 4AFSC 2R5AA 3H0HA 3PGGA 4C92F 3CD6T 4PFZA 2BE7D 2LDMA 4NS5A 4A4GA 3H8ZA 2RMOA 2DERA 1QLYA 4M75G 1D0ZA 2R58A 2BE9B 1M1KR 1WPYA 4J9FA 4ZN3A 3L42A 3FDRA 2DM1A 4KH0B 3V7RA 2DJZA 2GCXA 3RDVA 1T3LA 4PFOA 4FYVB 4LD6A 3GOXA 5LJ3g 3R6NA 1UTIA 4Y92A 1HK9A 1VQ7A 1BKBA 3SWNC 4RTUA 2EPDA 3QZ5B 4Z02A 3RKYA 1NM7A 3JRZA 4J9HA 5L8RE 3OYMA 3QSUA 5D6YA 1I07A 2Y4YA 4DOVA 1HSQA 1Q81C 3BW1A 1VQ8T 5LJ5e 1Q7YR 3FC3A 2M0OA 1VQ5Q 1GBQA 2DD4A 2P0PA 2CH4A 4J9IA 2I0NA 1WHMA 2X9HA 2EAYA 4KBMB 1YJNA 2M0YA 4M77A 2DXBA 3I5RA 2K79A 1M90U 1PD0A 4JJNK 3DB4A 1ZSZC 4XAXB 3RMSA 1QP2A 2ROTA 3GF5A 2D8HA 2Y90A 1Q86R 2ABLA 4M78E 5KYNA 4FSSA 2C0IA 2CS7A 2DEQA 2HCKA 1VIFA 3OB9A 2E12A 1B34A 4BUGA 3CXCP 5AT1B 1U8RA 2K3BA 1M1KC 2RM4A 5LJ3d 4MDWA 1KSWA 3A8HB 3PT9A 3BE3A 3OYJA 3BFMA 2MWPA 4F7UE 3JAME 1KD1U 1NEGA 2PZ1A 1V1CA 1VQPT 3AT1B 1TUDA 2FZCB 2RQRA 1EIFA 1WLPB 1YIJT 1QVFS 2ECZA 4C8QB 4BI8B 5GANh 2LRQA 1BCMA 1SRMA 2AZSA 2RQVA 1VQMA 2C0TA 5IN1A 5IT9E 1K4US 2RB6A 2AIRB 3TEEA 1K9MR 2GTJA 4X1VA 4BACA 2MMPA 2FPDA 1Q7YC 1NJIR 1EZZB 3HP9A 4J6XA 3JCMP 3PFSA 2BTTA 2RK1A 5IXBA 2RQTA 3G1JA 4OB2B 2DTIA 1IGQA 2QEXQ 1MHNA 3SHWA 1WHJA 3M0QA 1Q86C 4BDZA 1QWFA 1RLQC 1SHFA 3MEVA 4N0AA 4LXCA 1N8RU 1I81A 4M75A 5I22A 1KHIA 3HRUA 5GJVB 2ZPGB 2DYIA 3A1PA 5FW9A 3EFRA 1QMCA 4C5HA 1ZUUA 2NWMA 1M2VA 1QVGS 2DMOA 4RUGA 2DXUA 3UPUA 5HY6A 3A8GB 3C95A 5GANg 3L2UA 1J3TA 4C92B 2DRMA 3MJXA 1VQ5A 3FJ5A 4JPBW 2DZ9A 1Y96B 3HRSA 4JUVA 3HKSA 1M2OA 1K9MC 1LCKA 1U1SA 2V8JA 4KH1B 1XTDA 2LNHB 4ZNXA 2IPOB 4DBRA 2RJFA 1NJIC 4Q5WA 2BKDN 3JCMb 3JCMf 3CC4Q 2CP7A 2X4WA 1ZQ1A 5I2SA 2EYQA 2MF2A 2FVUA 4M7DE 2L3QA 1UGVA 4AMCA 4GLKA 4MMKA 1LOJA 5KYYA 2RO0A 3OYDA 1X01A 2F69A 2GNCA 1VQLQ 2QG9B 2NYSA 3PIOA 1OPLA 5DY9A 1U3OA 5GANd 4D8DA 4OGCA 3CCSQ 1JU5C 3JB9H 2JMCA 4OGEA 3M56A 2PVDB 1AD5A 3LH5A 2EQJA 1JO8A 2KBTA 2YDLA 2E6ZA 3L2RA 4IUUA 1Z9ZA 5GAOm 2ROLA 3GIBA 2JNGA 1GRIA 4VUBA 3WVDB 3M57A 4D8KA 2K5IA 2QEXA 4E7KA 2EJ9A 1SG5A 4M77E 4EMGA 5FU6C 2J6OA 3CC2Q 1D0XA 3CMET 5CKHA 2YRDA 2O2OA 1YI2T 4M78G 1LJOA 3EG9B 2ZZDA 1R8OB 2AK5A 1OEBA 1PSEA 2HZYA 1KJWA 1MV3A 3PIPA 3RERA 2HDAA 1RI9A 1NG2A 1AZGB 4FW2A 1I1JA 1T3SA 2IVWA 3QXEB 4F7UG 3CCRQ 2AZVA 2HL3A 3L2ZA 2OTJT 1X6GA 2XU8A 1GXIE 4JJCA 2VKNA 5GMKj 4Z88A 3OMGA 2QQBA 1C1AA 1VQKQ 2DETA 1FXXA 1TS9A 3VJPA 2X3XD 5CKBA 4V2SA 4LUEA 5GAMj 4JS4A 3CCQT 4RTTA 3JB9J 3VS6A 1WXBA 2RK2A 1KD1R 1LPLA 4N4GA 4FIBA 2QAZA 4DEXA 1YWPA 2XI9A 4E7IA 2CT3A 4NL2A 2JXBA 1A0NB 3CC4A 1BI0A 3REAB 1TSFA 1QKXA 2YUNA 2EJFA 2VB6A 2RQUA 4FU6A 2QDYB 2CDTA 1VQ9Q 1NE8A 3GP8A 1WQWA 3X24B 1OULA 1FMWA 3CPWS 3JCMh 4DQ2A 5KCOA 4WTOB 2LT1A 3G4ST 1VQLA 1G83A 2JT4A 3CCJQ 1YITT 3CCMQ 3CMAQ 4WF2A 1H8KA 3OBWA 1M27C 3I55Q 3RKXA 1VOMA 2V8IA 2O9VA 1BB9A 3Q1JA 1VQ4T 3HFOA 5GAN6 3CCSA 1BBZA 3ZFJA 4M78B 4BD3A 2FHDA 1H641 3I56A 3GNGA 1M3BA 2CP5A 5C0MA 3JB9G 2FZGB 2P0KA 2X35A 4RTVA 3QDFA 1KD1C 1QCOA 4F7UB 2CZ6B 2A36A 1R0CB 2QQRA 2EBPA 1D1AA 1W1FA 4M7AE 4DBHA 3OYKA 4OMFB 3OMCA 3RR6A 2QK0A 3TCJA 4PJOE 3CEYA 3NTKA 4A54A 3CC2A 1MMAA 1C0MA 2QQAA 2DBMA 5CK9A 3DB3A 3DLMA 3ER0A 4M7DG 7AT1B 1YP5A 3C12A 1UEBA 2ZCFB 5CO7A 3JCMg 4EIKA 3CCRA 1JJ2A 1M1GA 1KHCA 1N6AA 3CMEQ 2L3RA 2DKGA 2LCSA 2DXCA 2RD1A 1VQKA 2OTLQ 2IIMA 4M75D 3VYHB 2DFUA 4O5VA 1Q95G 4C8QD 5GMKl 1WX6A 5CKEA 2KDSA 2SEMA 1C6VX 2JS0A 1B07A 3IQLA 1G5VA 1OU8A 1W2BP 3VKIA 3O8VA 2OTJQ 2EGEA 3BDUA 2HL5C 3G71A 2DD5A 2LTOA 2W0ZA 3VS0A 3X25B 4LDYA 4FCYA 1UFFA 4KT0E 3SWNA 3G6ET 2YHTA 3OBYA 1HXDA 1D3BB 2FYKA 2JN0A 3OSSC 4M77G 5KYUB 2E3HA 1AVZC 1VQ9A 4QT7A 4J9EA 2ED0A 3INZA 3L2VA 2DYBA 3JCMd 1UGSB 3M0RA 3BY7A 4KGVB 4ZTFA 4M75F 4J8OA 2DVEA 5FWBA 5GAOn 3CCJA 3LWIA 1SSFA 2YWWA 3UA7A 2A28A 5L23A 2KRMA 3CMAA 1MUZA 1FMVA 3CC7Q 1MV0B 4KGXB 3I55A 3CCUA 4DOWA 2DL7A 2L3PA 3G7ZA 4C0ZA 1WZOA 2P4RA 2LX9A 3PMTA 1RAFB 1YHQA 2CP3A 1ZSZA 2EWNA 1E6GA 5FU7B 4ZGDB 2CREA 4C92D 4JS5A 1OZ3A 3QYGB 4M7DB 3EHQA 2A37A 1YITQ 1GFDA 2QA4T 1D3BA 2WSCE 1WHLA 3EG1A 5A0GA 3OYBA 1KK7A 1MNDA 2KXCA 5LJ5j 4HVWA 2H3JA 2NUPA 4ZGEB 3RBBB 2JTEA 1M8VA 4J7FA 1KQSA 4RTYA 3A8MB 1YJWT 1W6XA 1K73U 2RHUA 4MZTA 4QW2A 3S3MA 2E41A 5FWCA 1GBRA 4J6WA 1TTHB 2XIDA 3EH1A 2LCCA 3NFCA 4OMPA 4QVZA 4PL6A 4PJNA 3A8LB 2DTOA 2YLBA 4M77B 1V76A 3CXCS 3QBYA 5GANe 3P8HA 2RHXA 4OMLA 4M7DA 2K3XA 2JMAA 1YN8A 2F5KA 2OAWA 5J39A 1KC8U 1NEBA 4FL6A 1AZEA 3FIFA 4IURA 2PTKA 2JOYA 3RKWA 3QYHB 1B34B 4L5GA 1UGQB 4HXJA 3CCVT 1IGUA 3EFOA 3QIIA 1Y07A 3DLLA 1VQ6A 3MP8A 5CQYA 1SHGA 2F2XA 5IAYA 4M7AG 1PD1A 1XJWB 1LNXA 3D7SB 3KUFA 4OMQA 4PJOG 4A4EA 3QPHA 5I21A 4BE0A 2KAFA 2BZYA 5HCKA 1TH7A 2M1HA 2OX7A 4BY6C 4Z8AA 1OX9A 3E2UA 1FWZA 4J9DA 4JJBA 3CBMA 4XTUA 4EMHA 1VQNQ 4AG1C 5KYXB 3KXTA 3A5ZB 2A0FB 2JTMA 5A0LA 2YLCA 2YUPA 3RMQA 4JJDA 1YJ9A 1KFZA 2L0AA 1VQOT 1W4SA 4X9CA 5GMKi 3MEWA 1YNZA 3OYFA 3PVQA 3VS1A 4XTWA 1K8AU 2JUFA 2FL7A 1RL2A 2CSQA 4OMNA 4B6MA 2DF6A 4RTXA 5J3BA 2DBKA 4M75B 2GF7A 2MCNA 2MAMA 3CPFA 3NGPA 2O01E 2AKLA 4IIOA 2A08A 3I56T 1BYMA 1UG1A 1M2VB 2PVOB 3JCMQ 3RUXA 5KYXA 3M53A 1G3YA 3NTIA 2E5QA 1M8MA 3LW5E 4OMMA 1MNEA 2EVRA 4J5YA 2H8HA 1LVKA 1T0JA 1RAGB 4EMKA 3BDLA 4XU1A 5KCHA 4NOYA 4M78D 1NLOC 2DL3A 4CC2A 3TSZA 3RESA 3CQTA 2PNIA 2EQKA 2YUQA 1S72T 2M51A 4B9XA 3CD6Q 5FROA 2J7IA 3V8LA 2DO3A 1B3QA 2KXDA 4Y91A 4PNOA 1BIBA 8AT1B 2DEUA 5KYYB 1XQHA 3M58A 1U1TA 2L2PA 3AHUA 2FZKB 3UA6A 4RTWA 2L3SA 2KYMA 3CCET 2QGFB 1HYOA 2HQHA 4C5GA 3MO8A 4IUPA 4LD9K 2C0OA 5KE3A 1UJ0A 1OV3A 3LGLA 3G71T 4M7AA 1K76A 4J9BA 3ZL7C 4PJOA 4M78F 1VQNA 1G2BA 1TUGB 3T9NA 3WXMB 2RH2A 2K4YA 2LJ0A 1WJSA 1VQ8Q 4N4HA 2RI3A 4DEYA 5CR2A 1Q82U 3OS2A 1N9SA 4F7UF 1K73R 1K0SA 3CCLT 4LDXA 3QHSA 4E7ZA 5GJWB 1E6HA 1JXMA 5CVIA 5M9OA 3NTHA 4PJJA 2ZGWA 3EGXA 4HVVA 4A4HA 1UDLA 2K9GA 1BI2A 1EX4A 2CZ7B 1ZLMA 1YHQT 1S1NA 3HFNA 3NPFA 1NYGA 5FRNA 2EFIA 1YBYA 3FJPA 2COYA 4E47A 1ZA1B 3NHNA 1QCFA 5HK3A 4MZPA 2E3IA 4NL3A 4ZTJA 1VQPQ 3M4YA 5GAN8 3JB9D 3JCMe 2ED1A 2L8DA 2CUBA 3QJYA 4A63B 1YIJQ 2QGGA 1AHJB 2VXEA 4HT9A 4DA4A 3TVTA 3VRYA 1Y7XA 1AT1B 3M9QA 4FM4B 2F5TX 3GLXA 4FT2A 3I9QA 2L5QA 4GY5A 2FRYA 4XQ3A 2YRCA 2OI3A 3RIRA 2D9TA 1K73C 4J9GA 3CD6A 1M90R 4M7DD 1F1BB 2V1QA 3C94A 4JZ4A 3OYHA 3VUBA 1BK2A 2GFUA 1QVFA 2EYYA 1PWTA 1ZUKA 2QTXA 3JB9F 2XG8D 2DVJA 4HCKA 2I2LA 1NYFA 2P4TA 4C8QC 1K8AR 2SRCA 4A4FA 5GMKm 3JCMW 2F2WA 2XD0A 2FPEA 2MOXA 3VS5A 3QWYA 4PJMA 3TU4K 1YWOA 3M0TA 2RI2A 3JSCA 1VQ7T 2VGNA 3HTRA 4DBQA 1JJ2P 3REBB 3OYYA 1AWJA 4C0DB 2DZCA 3OA6A 1X6OA 2YXYA 2JTFA 4E7LA 1TU0B 4PLLA 3SD4A 1VQ8A 4M7DF 5LJ3j 4M77D 4P5NA 2EIFA 5IHKA 1KQ1A 2E4HA 4C5EA 3OYNA 2G3RA 2EYZA 3MP1A 2EKHA 4PK4A 5IHNA 3LWHA 4XTVA 2XDDA 1M9SA 2KEAA 1OPKA 3N5BB 4JRKA 4ZN1A 1BI3A 1UB4A 1YJNT 2QYZA 1WHKA 2COZA 4ELZC 5GAMf 1M90C 2QI2A 3EGDA 1GCPA 4OB0B 3EG3A 1QVGA 3EGUA 2QQ9A 3JCMc 3LH0A 1M1KU 1OX8A 1QP3A 2DILA 2DK3A 2L89A 2O88A 2ZPIB 1PSFA 4D6WA 2YSQA 1N8RR 2ENMA 2JVVA 1W2BS 2WACA 4KRTA 4PKCC 4C92C 1RAIB 1VQPA 4YTLA 1K8AC 3OS0A 2K2VA 2CKKA 4M77F 4IIMA 2VASA 3EFSA 1RAEB 2FRWA 4C8QE 1X75C 2ZPEB 1CKBA 4OF1A 1RACB 2DTHA 5FRMA 3ZBDA 4AT1B 2EJGA 1RAAB 3VS7A 4RTZA 4BE1A 1Y0MA 4QQDA 4MMLA 3ZEHA 3SWNB 3OW2P 1VQMT 4JRQA 1D1BA 1WDXA 1QKWA 1TOVA 1SSHA 3OYLA 2KVQG 5A0DA 1UGRB 2P0QA 5DM7R 2D0QB 3E1SA 3PNWC 2RHIA 3MHXA 3JV3A 3V7CA 1YI2Q 3E9FA 4J6YA 4JLGA 1QWEA 3EAEA 2HD0A 1G3SA 3EHRA 1PKSA 2ZPBB 4BE2A 1WFWA 1D1CA 3M59A 2XMFA 1P92A 1KQSP 2CSIA 2JS2A 1ZSZB 2GBQA 2EKOA 3OY9A 5GAOr 1M30A 1N8RC 1H3HA 4F16A 4PJLA 3OYIA 2KT8A 4C92E 1GCQC 1K9AA 2DIQA 2O31A 2D0NA 2CP2A 4M7AD 1M3AA 3CCQQ 2G6FX 4PJOD 4E2FB 3F70A 3H9NA 2NUTA 3R6OA 1AWWA 2NUPB 2QXFA 4C0FA 1VQ5T 4FT4A 5D7UA 2OAUA 4EDUA 3L2QA 2DJQA 2HNIA 5GANj 2EGAA 3CCMA 2VYTA 3S3NA 1BIAA 4EPCA 4XTZA 2RF0A 3ULRB 2EYXA 1G8XA 3V7SA 1SPKA 2KMTA 4R0KA 2PU9B 3PMIA 5CIUA 3FRNA 3KFVA 3TREA 2QDLA 4FYWB 1YJNQ 5GAMh 3NMZC 1PNJA 4ESRA 3G4SQ 2O4XB 1DJ7B 1PKTA 1OYXA 4M7AF 1IXDA 1YCYA 4PJOF 3UT1A 5GAN7 1HJDA 2DPPB 2BZ8A 4LN2A 1OOTA 1VQ4Q 4JRIA 3SB2A 3M4GA 4B9WA 2MK5A 3QZ9B 2E6NA 1UECA 3EG2A 3EFOB 1D0YA 1M4ZA 2J6FA 4HA8A 1IRXA 2H3EB 2LT4A 2E5KA 1I4K1 4BI3A 2NUZA 3CPWA 3H0IA 2CZ1B 2FEIA 2KYBA 3MCAB 2HQXA 2F1LA 4N4IA 1WNLA 3PTAA 1OU9A 3ASKA 1X69A 2QEXT 3CMEA 1YI2A 3J80E 2WSFE 1OI1A 4C5IA 2O9SA 2OTLA 1VQMQ 4E7SA 1PG5B 5KYWA 1PM3A 2O4XA 2LP5A 4LDUA 3VU3C 1QCNA 2EQMA 2KQWA 1W2BA 4M78C 4XU0A 4L6V5 2LJ1A 3I35A 3MKDA 5HK0A 5GAMg 1EFNA 2W10A 5IXFA 2E65A 1VUBA 4QQ6A 2M16A 3PE0A 2OTJA 3JCMJ 1W70A 1RI0A 2GTOA 5LL6S 2Y4XA 4C8QG 9ATCB 3S3OA 1ZBJA 1HD3A 1WJRA 1JB0E 1ABQA 3CCQA 3FLGA 2RJEA 4RCBA 5GAN3 3HRTA 3QJ6A 4RMOA 5CQXA 2KE9A
chains in the Genus database with same CATH topology
4FIBA 5A0DA 4IUPA 3QDRB 4LD9K 2KY9A 2XI9A 5KE3A 4E7IA 1KQ2A 1K9MU 2LVMA 5EG2A 1QVGA 3CBOA 3LGLA 3META 2ZPFB 1NPRA 2RI5A 2RJCA 2XICA 3QG1A 4BB7A 5I2MA 3G71T 4A53A 4M7AA 4NL2A 4PJOA 4OB1B 4M78F 1VQNA 1NJIU 3HHTB 3T9NA 2PUOB 1VQNT 5HKCA 3M5AA 3WXMB 2RH2A 3QO3A 4XTYA 4QVDA 2K4YA 3CC4A 3CC7A 1BI0A 4JDSA 1WJSA 4IUQA 2RHZA 3FB9A 3CC4T 4N4HA 2EJFA 2RI3A 2LQ8A 4FU6A 4A4KA 3VV0A 2QDYB 1O9SA 5CR2A 1Q82U 2GQVA 3OS2A 1NE8A 2YRVA 3X26B 1N9SA 4F7UF 3GP8A 1XNIA 3MP6A 3CCLA 5GMKh 4IKFA 5GAMd 1WQWA 2XDBA 3X24B 1Q82C 3CCLT 4LDXA 3QHSA 4EMKB 3G4SA 3CPWS 2KSSA 2CGHA 2PVGB 3M55A 5CVIA 3JCMh 4C8QF 4DQ2A 5KCOA 5M9OA 5GAOq 2FB7A 2LT1A 3G4ST 1ZHIA 3OS5A 2XK0A 2LQKA 5FU6B 3NTHA 1YITA 1VQLA 4E7HA 1IZ6A 2JZ2A 3V8JA 1JRIA 4KULA 1VQLT 1YITT 2E64A 2ZGWA 4A4HA 4OB3B 2E10A 3OBWA 4WF2A 1VQ4A 2PQWA 4XU2A 3JCMX 1BI2A 1QW1A 3RKXA 2V8IA 2XKOC 2HAXA 2CZ7B 3Q1JA 1VQ4T 3HFOA 5GAN6 2MI6A 3CCSA 1Y71A 1YHQT 3OYCA 4C92G 3HFNA 1KG1A 3ZFJA 4FSXA 5FRNA 4M78B 2EFIA 3CCST 3OW2A 4BD3A 5CKFA 2FHDA 1H641 1YBYA 3FJPA 4E47A 4C0DC 1H3ZA 4HKEA 3I56A 5HK3A 4HCCA 3GNGA 2XHCA 5GANf 4MZPA 3LLRA 4QQGA 5D6XA 2CYZB 5LJ3h 5C0MA 3JB9G 2P0KA 4NL3A 2X35A 4ZTJA 3M4YA 3P8BB 5DLOA 4II1A 1M5Q1 5GAN8 2KK4A 3MEUA 3JB9D 3JCMe 2X4XA 1KD1C 2L8DA 4F7UB 2CZ6B 3QJYA 2QQRA 1M1FA 5KE2A 5KH6A 4M7AE 1AHJB 3X28B 2VXEA 4OMFB 5A2QE 4UC4A 3OMCA 3OYKA 2DIGA 3L1AA 4HT9A 4DA4A 3TCJA 4ZGJB 4PJOE 2K5LA 3CEYA 2CZ0B 3NTKA 1Y7XA 3V8KA 4A54A 3CC2A 2NLUA 3SDZA 4RKUE 2M9UA 2QQAA 3M9QA 1UGPB 4FM4B 3VYGA 4M7AB 3CC2T 2F5TX 2BUDA 3GLXA 4FT2A 4PJOB 2X4JA 5CKDA 5CK9A 2L5QA 3DB3A 3P8DA 4GY5A 3WVEB 3DLMA 1O75A 1N9RA 2VGMA 4RG2A 2K5FA 3ER0A 5FU7C 4XQ3A 2LCLA 4RCCA 4XU3A 3RIRA 4M7DG 3C12A 2IG0A 2D9TA 1UEBA 3A8OB 1K73C 3CD6A 2ZCFB 4M7DD 5CO7A 3JCMg 5LJ5f 3CCRA 3C94A 2R5AA 3PGGA 1JJ2A 4C92F 3CD6T 1M1GA 2LDMA 4NS5A 3VUBA 3OYHA 4M7DC 1KHCA 1N6AA 4O6JA 4A4GA 3CCRT 2L3RA 3H8ZA 2RHYA 2DKGA 3SFMA 2GFUA 4M75G 2R58A 1QVFA 2DXCA 2RD1A 1VQKA 4M75D 5D6WA 1WPYA 2ZPHB 3VYHB 4O5VA 1I5LA 4XTXA 4ZN3A 2QTXA 1VQKT 3JB9F 3L42A 2XG8D 2A3LA 4C8QD 1WQ7A 3FDRA 5GMKl 5LJ5h 2I2LA 3V7RA 2DJZA 2GCXA 4PLIA 2P4TA 4C8QC 5CKEA 4ME7A 4A4FA 5GAN2 3LX7A 5GAOp 5GMKm 4LD6A 3JCMW 2KDSA 2XD0A 1G5VA 3GOXA 4J83A 5FLXE 5LJ3g 3VKIA 3O8VA 3TU4K 4C8QA 1HK9A 1VQ7A 1BKBA 3SWNC 3BDUA 3G71A 2RI2A 2DD5A 3JSCA 2LTOA 3QZ5B 2VGNA 4Z02A 3RKYA 1VQ7T 2AHJB 3JRZA 3G6EA 3UDCA 3OYYA 5L8RE 4LDYA 3X25B 3OYMA 3QSUA 5D6YA 4HT8A 4KT0E 3SWNA 3G6ET 2YHTA 3OBYA 4CRIA 1HXDA 4C0DB 2DZCA 3OA6A 1X6OA 1D3BB 2FYKA 2JN0A 2Y4YA 3OSSC 2JTFA 4M77G 4DOVA 4CI0C 3J81E 4PLLA 3SD4A 4E7LA 1Q81C 3CXCA 1VQ8A 4M7DF 5LJ3j 3BW1A 4M77D 4P5NA 2EIFA 1VQ8T 5LJ5e 1VQ9A 2RA2A 1KQ1A 3FC3A 1NPPA 2M0OA 2LNVA 4M77C 3CBPA 2DD4A 2P0PA 4C5EA 2G3RA 2HQEA 2LC4A 3INZA 3URGA 3OYNA 3L2VA 1VQ9T 2R5MA 3MP1A 3JCMd 1UGSB 3LWHA 4XTVA 3BY7A 4ZTFA 2EAYA 4M75F 2XDDA 4KBMB 1YJNA 1M9SA 4IUTA 3N5BB 1ZBXA 4J7IA 4J8OA 2DXBA 4M77A 4JRKA 4ZN1A 2DVEA 3QKJA 1BI3A 1UB4A 5GAOn 3CCJA 1YJNT 3LWIA 1SSFA 1M90U 4JJNK 3DB4A 4ELZC 4XAXB 3RMSA 5GAN5 1QP2A 5GAMf 3CCJT 3CMAA 3GF5A 1M90C 2QI2A 2Y90A 3I55A 3CCMT 3CCUA 4DOWA 4M78E 3CMAT 4C0ZA 3G7ZA 4OB0B 2LX9A 3PMTA 1V29B 3OB9A 2CS7A 2DEQA 3I55T 1VIFA 2EWNA 2QQ9A 3LH0A 3JCMc 3CCUT 1YHQA 1QP3A 2K3YA 4E7JA 5FU7B 1M1KU 1WJQA 2E12A 4ZGDB 2DK3A 2L89A 1B34A 2ZPIB 4BUGA 2QQSA 4MZMA 3JCMP 1PSFA 2RJDA 4D6WA 5LJ5g 1U8RA 4C92D 1M1KC 4JS5A 2RM4A 5LJ3d 4MDWA 3A8HB 1OZ3A 3PT9A 2JVVA 1W2BS 1BI1A 2WACA 3OYJA 3BFMA 4C92C 4PKCC 3J7AF 3QYGB 2A7YA 2MWPA 4F7UE 4M7DB 2QA4A 1VQPA 4RG8A 4YTLA 3JAME 1KD1U 1K8AC 3OS0A 4X34A 2QA4T 1VQPT 2E70A 2K2VA 1JJ2S 2CKKA 4M77F 1D3BA 2WSCE 3EFSA 4C92A 4C8QE 1EIFA 3GPLA 5A0GA 3OYBA 4MDXA 4Y28E 1X75C 2ZPEB 4BI4A 1YIJT 1QVFS 5CAIA 5LJ5j 2H3JA 4OF1A 4ZGEB 2DTHA 4C8QB 3ZBDA 4BI8B 5FRMA 5GANh 2LRQA 2E1HA 3M54A 1Y96A 2EJGA 1OZ2A 1M8VA 4J7FA 4BE1A 4QQDA 4MMLA 1VQMA 5IN1A 3ZEHA 5IT9E 2RB6A 3TEEA 1YJWA 3SWNB 2V8KA 3A8MB 1VQMT 1KQSA 4JRQA 1YJWT 4BACA 2MMPA 1K73U 1Q7YC 2RHUA 2PUKB 3MEAA 2KVQG 3HP9A 2GFAA 3OQ5A 3HPWA 1UGRB 4J6XA 4LDWA 4MZTA 2P0QA 3PFSA 4OVAA 2RK1A 4QW2A 4EMKC 4OB2B 5DM7R 3S3MA 2D0QB 3E1SA 2DTIA 3PNWC 2RHIA 1MHNA 2E41A 4R55A 3MHXA 2BIVA 3LGFA 4J6WA 3KBGA 5J26A 2XIDA 3V7CA 2LCCA 3NFCA 4QVZA 4PL6A 1I8FA 3LYIA 3A8LB 2DTOA 2YLBA 3E9FA 4M77B 1JBMA 3CXCS 5LJ5d 4J6YA 2OTLT 4JLGA 3QBYA 5GANe 3EAEA 2HD0A 3P8HA 2RHXA 4N0AC 4M7DA 4TVRA 1G3SA 4BDZA 1Q86C 2ZPBB 5C6SA 2K3XA 4M75C 4BE2A 2F5KA 1KC8U 3S6WA 5J39A 3M59A 4L59A 4FL6A 3MEVA 1P92A 4N0AA 1KC8C 3OYLA 1N8RU 3FIFA 4IURA 1I81A 1FX7A 4M75A 1KHIA 2JOYA 3HRUA 2EKOA 3QYHB 3RKWA 2K57A 2ZPGB 1B34B 3OY9A 4L5GA 5GAOr 1N8RC 3CCVA 3EFRA 1UGQB 2HBPA 4C5HA 2C06A 2DAQA 4JLIA 3CCVT 3QIIA 1Y07A 3DLLA 1VQ6A 3MP8A 5CQYA 3OYIA 4C92E 4C0GA 1VQ6T 5IAYA 4M7AG 1QVGS 2DIQA 1LNXA 3KUFA 1Q81U 2WSEE 2DXUA 4PJOG 4A4EA 4M7AD 3QPHA 3UPUA 5HY6A 3A8GB 3C95A 5GANg 2DXTA 3L2UA 4C92B 4PJOD 3OW2S 5I21A 4M7AC 4BE0A 2KAFA 3F70A 1VQ5A 3R6OA 4PJOC 4LDVA 2QXFA 4C0FA 1VQ5T 1TH7A 2DZ9A 2M1HA 4FT4A 4BY6C 4JRPA 2OAUA 1Y96B 3HRSA 4JUVA 4EDUA 3HKSA 3VUZA 1FWZA 1K9MC 4ATOA 1U1SA 2V8JA 1N27A 1XTDA 3L2QA 3CBMA 2HNIA 2RJFA 4XTUA 5GANj 4EMHA 3KXTA 3A5ZB 1NJIC 4Q5WA 2BKDN 3JCMb 3CCMA 2VYTA 3S3NA 3JCMf 4HCBA 1BIAA 4EPCA 1MGQA 2JTMA 4XTZA 5A0LA 3CC7T 3C4SA 2YLCA 2D6FA 3RMQA 2X4WA 5CCAA 1ZQ1A 2XDPA 3V7SA 2VV5A 3HL8A 5I2SA 1VQOA 1YJ9A 2EYQA 2MF2A 2KMTA 2PU9B 3PMIA 1VQOT 4XK8E 1YJ9T 5CIUA 1KQSS 2FVUA 4M7DE 2X4YA 1W4SA 4BDYA 3FRNA 4X9CA 3TREA 5GMKi 4GLKA 3MEWA 4MMKA 1LOJA 5GAMh 3OYFA 4XTWA 2RO0A 2JUFA 2O4XB 2FL7A 1K8AU 3OYDA 1DJ7B 1X01A 2VUBA 4R56A 2F69A 3FEOA 1RL2A 5AYFA 1OYXA 4M7AF 3E19A 1YCYA 3PIOA 4PJOF 4M75E 3H6ZA 3UT1A 5GAN7 3DKMA 2DPPB 5LJ3f 5DY9A 1YIJA 1IREB 5J3BA 1G3TA 4JRIA 5GANd 3OYEA 1WGSA 3SB2A 4M75B 2GF7A 3M4GA 4OGCA 4B9WA 3ME9A 2R57A 3QZ9B 3JB9H 2VC8A 2E6NA 3M56A 4OGEA 1QVPA 2MAMA 2PVDB 3CPFA 2O01E 1M4ZA 5GMKe 4HA8A 2VXFA 5GAN4 3I56T 4OP0A 2EQJA 2LT4A 5GAOl 1BYMA 1I4K1 2PVOB 3JCMQ 3RUXA 1Q7YU 4BI3A 2E6ZA 3OYAA 5GAMe 3M53A 3L2RA 3CPWA 4IUUA 1G3YA 5GAOm 3GIBA 2JNGA 2CZ1B 3NTIA 4VUBA 3WVDB 3M57A 2E5QA 2HQXA 3LW5E 3MCAB 4N4IA 4X9DA 3JB9I 2K5IA 2QEXA 2B8AA 1WNLA 4QVCA 4J5YA 3PTAA 4ELYC 4E7KA 2EJ9A 3ASKA 4M77E 4EMGA 2QEXT 5FU6C 4IUVA 3CMEA 1YI2A 1VIEA 3J80E 2WSFE 3L2WA 1OI1A 4C5IA 3CMET 4EMKA 5CKHA 2OTLA 1YI2T 3BDLA 4M78G 1LJOA 1Q86U 4KUIA 5DLQE 4XU1A 2ZZDA 2O4XA 3OYGA 4BY6B 1R8OB 4LDUA 4NOYA 4M78D 3VU3C 5KCHA 2EQMA 2KQWA 1W2BA 1PSEA 3PIPA 5LJ3e 4M78C 3RERA 1S72A 4XU0A 3JCMV 4L6V5 3RESA 2EQKA 5HK0A 1S72T 5GAMg 4B9XA 2E65A 2EQUA 5FROA 1VUBA 2IVWA 3QXEB 4QQ6A 4F7UG 2M16A 3V8LA 4M78A 2OTJA 3E9GA 2DO3A 3JCMJ 4KUDK 3L2ZA 1RI0A 4Y91A 5LL6S 2OTJT 4PNOA 2XU8A 4HCZA 1BIBA 1GXIE 3X20B 3UWNA 3HSBA 2Y4XA 4C8QG 1XQHA 5GMKj 3OMGA 3M58A 3S3OA 1U1TA 2MWOA 2QQBA 3GNFB 3AHUA 1FXXA 3VJPA 1WJRA 1XOVA 5CKBA 1JB0E 3OSVA 3CCEA 4V2SA 3CCQA 1G3WA 5GAMj 3FLGA 4JS4A 4F7UA 2RJEA 3CCET 4RCBA 5GAN3 3OS1A 3HRTA 3CCQT 1NZ9A 3JB9J 4C5GA 2RK2A 3QUIA 4N4GA 3QJ6A 3MO8A 4RMOA 5CQXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PGG A;  4C92 F;  2DTH A;  4M7D C;  4C8Q B;  5GAN h;  1KQ2 A;  2E1H A;  4M7D E;  2DKG A;  1Y96 A;  2EJG A;  1M8V A;  4M75 G;  4M7A A;  4X9C A;  5GMK i;  4A53 A;  4MMK A;  1LOJ A;  4MML A;  2RD1 A;  4NL2 A;  5GAM h;  4M75 D;  4XTW A;  1WPY A;  4M78 F;  4PJO A;  1X01 A;  2RB6 A;  1I5L A;  4XTX A;  3SWN B;  2QTX A;  3JB9 F;  4M7A F;  4C8Q D;  1WQ7 A;  1YCY A;  3QO3 A;  4XTY A;  4QVD A;  2I2L A;  5GMK l;  3V7R A;  4PJO F;  4M75 E;  2DJZ A;  5LJ5 h;  5GAN 7;  5LJ3 f;  4C8Q C;  5DY9 A;  3FB9 A;  5GAN 2;  4J6X A;  5GAO p;  5GMK m;  2EJF A;  3JCM P;  4EMK C;  3JCM W;  4JRI A;  5GAN d;  3SB2 A;  4M75 B;  2DTI A;  5LJ3 g;  3M4G A;  1N9S A;  4F7U F;  2E41 A;  1HK9 A;  4C8Q A;  5GMK h;  5GAM d;  3SWN C;  3BDU A;  1WQW A;  2VC8 A;  3JB9 H;  4J6W A;  3V7C A;  3QHS A;  3RKY A;  1I8F A;  4EMK B;  2CGH A;  2DTO A;  2YLB A;  5GMK e;  4HA8 A;  4M77 B;  3JCM h;  1JBM A;  2VXF A;  4C8Q F;  4DQ2 A;  4J6Y A;  5LJ5 d;  4OP0 A;  2FB7 A;  5GAN e;  5GAN 4;  4N0A C;  5GAO l;  3QSU A;  4HT8 A;  3SWN A;  4M7D A;  1I4K 1;  2YHT A;  3JCM Q;  3V8J A;  3RUX A;  1HXD A;  1JRI A;  2DZC A;  2E64 A;  4M75 C;  1D3B B;  2FYK A;  2JN0 A;  2ZGW A;  4M77 G;  5GAM e;  5GAO m;  3GIB A;  4WF2 A;  2E10 A;  4XU2 A;  4M7D F;  5LJ3 j;  3BW1 A;  4M77 D;  4N0A A;  3JCM X;  3RKX A;  3JB9 I;  4X9D A;  3FIF A;  3HFO A;  5GAN 6;  5LJ5 e;  2RA2 A;  1KQ1 A;  1I81 A;  5CAI A;  1WNL A;  4QVC A;  4M75 A;  3HFN A;  4J5Y A;  4M77 C;  3RKW A;  2EJ9 A;  4C92 G;  5GAO r;  2K57 A;  1B34 B;  4M78 B;  3INZ A;  4M77 E;  4EMG A;  3EFR A;  3JCM d;  1H64 1;  4XTV A;  3FJP A;  3BY7 A;  4JLI A;  2EAY A;  4M75 F;  4EMK A;  4M77 A;  4M78 G;  1LJO A;  4JRK A;  4C92 E;  5GAN f;  2DVE A;  4XU1 A;  5LJ3 h;  5GAO n;  3JB9 G;  4NOY A;  4NL3 A;  4M78 D;  3VU3 C;  4M7A G;  1LNX A;  5GAN 5;  5GAM f;  1M5Q 1;  2DXU A;  4PJO G;  5GAN 8;  3JB9 D;  4M7A D;  3JCM e;  5GAN g;  5LJ3 e;  2Y90 A;  2DXT A;  4M78 C;  4C92 B;  4XU0 A;  3JCM V;  4F7U B;  3RER A;  4PJO D;  4M78 E;  3RES A;  5I21 A;  4M7A C;  2DEQ A;  5GAM g;  2EWN A;  4M7A E;  3JCM c;  2VXE A;  2E65 A;  4PJO C;  3L1A A;  4HT9 A;  4F7U G;  4PJO E;  3V8L A;  1B34 A;  4M78 A;  4A54 A;  1TH7 A;  2DZ9 A;  3V8K A;  3JCM J;  5LJ5 g;  3L2Z A;  4C92 D;  1Y96 B;  4JUV A;  2RM4 A;  4Y91 A;  4PNO A;  4M7A B;  5LJ3 d;  1BIB A;  3HSB A;  1U1S A;  4C8Q G;  4PJO B;  3BFM A;  4C92 C;  5GMK j;  1U1T A;  2HNI A;  4F7U E;  4XTU A;  4M7D B;  5GAN j;  4EMH A;  3AHU A;  1N9R A;  5GAO q;  4V2S A;  3JCM b;  4XQ3 A;  3JCM f;  1BIA A;  5GAM j;  1MGQ A;  4M77 F;  1D3B A;  4XTZ A;  4F7U A;  3EFS A;  4RCC A;  4RCB A;  4XU3 A;  3RIR A;  4C8Q E;  4C92 A;  5GAN 3;  4M7D G;  3JB9 J;  2YLC A;  3QUI A;  4M7D D;  3V7S A;  3JCM g;  5LJ5 f;  5LJ5 j; 
#chains in the Genus database with same CATH topology
 3QDR B;  1WI7 A;  2KY9 A;  1Z9Q A;  3M0P A;  1KQ2 A;  2LVM A;  1MMN A;  5EG2 A;  2LX7 A;  2XIC A;  4BB7 A;  6AT1 B;  2RNA A;  4A53 A;  3U23 A;  3EG0 A;  3H0F A;  4OB1 B;  2JJ9 A;  1NBE B;  3GBQ A;  3G6E Q;  1PHT A;  4LNP A;  3QO3 A;  4QVD A;  1D09 B;  2B86 A;  3CC7 A;  4JDS A;  4IUQ A;  2RHZ A;  2MPX C;  3FB9 A;  3CC4 T;  2AT1 B;  2LQ8 A;  2K7A A;  1O9S A;  4QKU A;  4IKF A;  5GAM d;  2XDB A;  4EMK B;  3H41 A;  3G4S A;  2CGH A;  4GLM A;  1N5Z A;  2FB7 A;  2LQW A;  4CC3 A;  1ZHI A;  5FU6 B;  2XK0 A;  2LQK A;  2EW3 A;  1YIT A;  1PRL C;  1IZ6 A;  2JZ2 A;  3A98 A;  3C0C A;  1JRI A;  4KUL A;  3V8J A;  1VQL T;  2E64 A;  4LE9 A;  4OB3 B;  1VQ4 A;  2PQW A;  1QW1 A;  1IO6 A;  1Y71 A;  1KG1 A;  4C92 G;  2RPN A;  4FSX A;  3CCS T;  2EYW A;  1AWX A;  5CKF A;  2DL8 A;  1RAH B;  4HKE A;  2HKN A;  3RNJ A;  2XHC A;  2CYZ B;  2QA4 Q;  3M0S A;  2HSE B;  1M5Q 1;  1PCX A;  2KK4 A;  3MEU A;  4DBF A;  2DLP A;  4Z89 A;  1M1F A;  2Z0W A;  5KE2 A;  5KH6 A;  4AFU C;  5A2Q E;  4UC4 A;  4ZGJ B;  1JXO A;  1M3C A;  1MMG A;  2J6K A;  3V8K A;  3M0U A;  2NLU A;  4RKU E;  3VYG A;  1UGP B;  3CC2 T;  4M7A B;  3PVL A;  2BUD A;  2KRS A;  4PJO B;  2X4J A;  3MPU B;  2CH4 W;  3P8D A;  3WVE B;  1X2Q A;  1N9R A;  1YJW Q;  2YT6 A;  4RG2 A;  2K5F A;  5FU7 C;  1TXQ A;  4RCC A;  4XU3 A;  2F2V A;  2BZX A;  1QQJ A;  1X6B A;  4M7D C;  3CCR T;  4O6J A;  4F17 A;  2DNU A;  2RHY A;  2LMJ A;  3SFM A;  5D6W A;  2ZPH B;  2YUO A;  1I5L A;  1AEY A;  4XTX A;  1VQK T;  2A3L A;  1WQ7 A;  5LJ5 h;  1MMD A;  2M02 A;  2EQI A;  3EGX B;  4PLI A;  4ME7 A;  5GAN 2;  3LX7 A;  5GAO p;  4J83 A;  5FLX E;  3TQ7 P;  1R0B G;  2HMA A;  4C8Q A;  4J9C A;  3CCV Q;  2AHJ B;  3EH2 A;  3G6E A;  3UDC A;  2QAS A;  1ARK A;  4HT8 A;  1FMK A;  2GQI A;  4CRI A;  1QVF P;  3J81 E;  4CI0 C;  3CXC A;  1VYV A;  3VRZ A;  1RLP C;  2RA2 A;  1NPP A;  2LNV A;  4M77 C;  3CBP A;  2LZ6 B;  2DX1 A;  3UF4 A;  3URG A;  2HQE A;  2LC4 A;  1VQ9 T;  1WHG A;  2FG0 A;  2R5M A;  1SEM A;  2HEQ A;  4IUT A;  4J7I A;  1ZBX A;  1CSK A;  3QKJ A;  2DA9 A;  2X3W D;  5GAN 5;  2FO0 A;  3CCJ T;  4HVU A;  3CCM T;  2JW4 A;  2ESW A;  3CMA T;  1V29 B;  4F04 B;  3I55 T;  3CCU T;  2K3Y A;  4E7J A;  1WJQ A;  1VQO Q;  1KC8 R;  4FW1 A;  2QQS A;  4MZM A;  2RJD A;  5LJ5 g;  1KIK A;  5IHI A;  1BI1 A;  1WIE A;  3J7A F;  1TUC A;  2A7Y A;  2QA4 A;  4RG8 A;  4X34 A;  2E70 A;  1JJ2 S;  1SRL A;  4C92 A;  1WA7 A;  3GPL A;  4MDX A;  2K6D A;  4Y28 E;  1PRM C;  2JM9 A;  4BI4 A;  5CAI A;  3VS4 A;  1T0H A;  1K1Z A;  2K2M A;  2OJ2 A;  2E1H A;  4AFQ C;  3M54 A;  1Y96 A;  1OZ2 A;  1QVG P;  2CP0 A;  3I56 Q;  5IH2 A;  1YJW A;  2V8K A;  1ZA2 B;  5I11 A;  1VYT A;  2GGR A;  2PUK B;  3MEA A;  3OQ5 A;  2GFA A;  4OVA A;  3HPW A;  4LDW A;  4EMK C;  2CT4 A;  1E7O A;  1K0X A;  1U06 A;  2KGT A;  1X27 A;  4R55 A;  2BIV A;  3LGF A;  3KBG A;  5J26 A;  1I8F A;  3LYI A;  4KGZ B;  2ATC B;  1GL5 A;  2KT1 A;  1JBM A;  5LJ5 d;  2OTL T;  1ACM B;  4N0A C;  4FYX B;  4TVR A;  1UUE A;  5C6S A;  1JQQ A;  4M75 C;  3S6W A;  2HKQ B;  4L59 A;  3EGD B;  2J06 A;  1S72 Q;  1KC8 C;  2D8J A;  1FX7 A;  1X43 A;  1NLP C;  3SEM A;  2K57 A;  1Y57 A;  3CCV A;  2HBP A;  2C06 A;  2DAQ A;  4JLI A;  4CC4 B;  2RN8 A;  1IB8 A;  1AOJ A;  2MIO A;  4C0G A;  1VQ6 T;  1Q81 U;  1PC0 A;  2WSE E;  3CCE Q;  2DXT A;  1UHC A;  1YFN A;  3OW2 S;  1GCQ A;  4M7A C;  1H92 A;  1YCS B;  4PJO C;  4LDV A;  2QTV A;  4JRP A;  3G71 Q;  3VUZ A;  4ATO A;  1N27 A;  3TSW A;  3EG9 A;  4FYY B;  2LQN A;  1RAD B;  4HCB A;  1MGQ A;  3CC7 T;  3C4S A;  2D6F A;  5CCA A;  2XDP A;  1U5S A;  2VV5 A;  1X2K A;  3HL8 A;  1VQO A;  3QWX X;  1KQS S;  4XK8 E;  1YJ9 T;  3CCL Q;  2X4Y A;  4AG2 C;  4BDY A;  3O5Z A;  2VUB A;  4R56 A;  3FEO A;  5AYF A;  3E19 A;  1VA7 A;  1SF9 A;  4M75 E;  3H6Z A;  1WXT A;  3DKM A;  4OMO A;  5LJ3 f;  1I5O B;  4PFP A;  3CCU Q;  1YIJ A;  1IRE B;  1G3T A;  1YHQ Q;  3OYE A;  1WGS A;  1RUW A;  2MYS A;  3ME9 A;  2R57 A;  1WYX A;  2VC8 A;  1QVP A;  1IHW A;  2J05 A;  2CUD A;  2V1R A;  5GMK e;  2VXF A;  5GAN 4;  4OP0 A;  5GAO l;  2VWF A;  1Q7Y U;  3OYA A;  5GAM e;  1WXU A;  3JB9 I;  2P84 A;  4X9D A;  2NUT B;  2B8A A;  4QVC A;  4ELY C;  4IUV A;  1VIE A;  3L2W A;  1UHF A;  1Q86 U;  1Q82 R;  8ATC B;  4KUI A;  2EGC A;  5DLQ E;  3OYG A;  4BY6 B;  4K11 A;  1IHV A;  3THK A;  2KI7 A;  5LJ3 e;  1S72 A;  3JCM V;  1ZSG A;  5ECA A;  3VS3 A;  4JZ3 A;  2EQU A;  3CPW P;  2DRK A;  4M78 A;  3E9G A;  2X51 A;  4KUD K;  4HCZ A;  3X20 B;  3UWN A;  3HSB A;  2DL5 A;  2MWO A;  3GNF B;  2HSP A;  3UAT A;  1TG0 A;  1XOV A;  3OSV A;  3CCE A;  3I5S A;  1G3W A;  4F7U A;  3OS1 A;  1NZ9 A;  1GFC A;  2CP6 A;  3VS2 A;  3QUI A;  1BCO A;  4GBQ A;  1ZUY A;  1K9M U;  1VQ7 Q;  3CBO A;  3MET A;  2ZPF B;  1NPR A;  2HBW A;  2RI5 A;  2RJC A;  3QG1 A;  5I2M A;  1VQ6 Q;  1NJI U;  3HHT B;  2ZAE A;  2PUO B;  1VQN T;  5HKC A;  3M5A A;  4XTY A;  1B7T A;  2DL4 A;  4F14 A;  1R77 A;  4ORZ A;  4A4K A;  3VV0 A;  2GQV A;  2YRV A;  3X26 B;  3CCL A;  1WHH A;  1XNI A;  3MP6 A;  5GMK h;  2RQW A;  1Q82 C;  1SKU B;  1ABO A;  1BU1 A;  2KSS A;  2LJ3 A;  2PVG B;  3M55 A;  4C8Q F;  5GAO q;  5KYW B;  3OS5 A;  4E7H A;  2D1X A;  2KNB B;  2E10 A;  2V26 A;  4XU2 A;  3JCM X;  2XKO C;  2HAX A;  2MI6 A;  3OYC A;  1YJ9 Q;  1RAB B;  1VYU A;  3OW2 A;  4AFZ C;  5EC7 A;  4C0D C;  1H3Z A;  4HCC A;  5GAN f;  3LLR A;  4QQG A;  5D6X A;  5LJ3 h;  4WCI A;  3P8B B;  5DLO A;  4II1 A;  2DE0 X;  4CC7 A;  2X4X A;  2KRN A;  2FPF A;  1ZX6 A;  1I0C A;  5KYU A;  1AWO A;  1FYN A;  3X28 B;  1UJY A;  1Q81 R;  1JEG A;  2VVK A;  2DIG A;  3L1A A;  4LUD A;  1CKA A;  2K5L A;  2CZ0 B;  2AKK A;  3SDZ A;  2COW A;  2M9U A;  1OQK A;  2JM8 A;  4M4Z A;  5CKD A;  1UE9 A;  1O75 A;  2KRO A;  2VGM A;  1TWB A;  2LCL A;  4ANJ A;  4E6R A;  2IG0 A;  2KR3 A;  3A8O B;  5LJ5 f;  4AFS C;  2R5A A;  3H0H A;  3PGG A;  4C92 F;  3CD6 T;  4PFZ A;  2BE7 D;  2LDM A;  4NS5 A;  4A4G A;  3H8Z A;  2RMO A;  2DER A;  1QLY A;  4M75 G;  1D0Z A;  2R58 A;  2BE9 B;  1M1K R;  1WPY A;  4J9F A;  4ZN3 A;  3L42 A;  3FDR A;  2DM1 A;  4KH0 B;  3V7R A;  2DJZ A;  2GCX A;  3RDV A;  1T3L A;  4PFO A;  4FYV B;  4LD6 A;  3GOX A;  5LJ3 g;  3R6N A;  1UTI A;  4Y92 A;  1HK9 A;  1VQ7 A;  1BKB A;  3SWN C;  4RTU A;  2EPD A;  3QZ5 B;  4Z02 A;  3RKY A;  1NM7 A;  3JRZ A;  4J9H A;  5L8R E;  3OYM A;  3QSU A;  5D6Y A;  1I07 A;  2Y4Y A;  4DOV A;  1HSQ A;  1Q81 C;  3BW1 A;  1VQ8 T;  5LJ5 e;  1Q7Y R;  3FC3 A;  2M0O A;  1VQ5 Q;  1GBQ A;  2DD4 A;  2P0P A;  2CH4 A;  4J9I A;  2I0N A;  1WHM A;  2X9H A;  2EAY A;  4KBM B;  1YJN A;  2M0Y A;  4M77 A;  2DXB A;  3I5R A;  2K79 A;  1M90 U;  1PD0 A;  4JJN K;  3DB4 A;  1ZSZ C;  4XAX B;  3RMS A;  1QP2 A;  2ROT A;  3GF5 A;  2D8H A;  2Y90 A;  1Q86 R;  2ABL A;  4M78 E;  5KYN A;  4FSS A;  2C0I A;  2CS7 A;  2DEQ A;  2HCK A;  1VIF A;  3OB9 A;  2E12 A;  1B34 A;  4BUG A;  3CXC P;  5AT1 B;  1U8R A;  2K3B A;  1M1K C;  2RM4 A;  5LJ3 d;  4MDW A;  1KSW A;  3A8H B;  3PT9 A;  3BE3 A;  3OYJ A;  3BFM A;  2MWP A;  4F7U E;  3JAM E;  1KD1 U;  1NEG A;  2PZ1 A;  1V1C A;  1VQP T;  3AT1 B;  1TUD A;  2FZC B;  2RQR A;  1EIF A;  1WLP B;  1YIJ T;  1QVF S;  2ECZ A;  4C8Q B;  4BI8 B;  5GAN h;  2LRQ A;  1BCM A;  1SRM A;  2AZS A;  2RQV A;  1VQM A;  2C0T A;  5IN1 A;  5IT9 E;  1K4U S;  2RB6 A;  2AIR B;  3TEE A;  1K9M R;  2GTJ A;  4X1V A;  4BAC A;  2MMP A;  2FPD A;  1Q7Y C;  1NJI R;  1EZZ B;  3HP9 A;  4J6X A;  3JCM P;  3PFS A;  2BTT A;  2RK1 A;  5IXB A;  2RQT A;  3G1J A;  4OB2 B;  2DTI A;  1IGQ A;  2QEX Q;  1MHN A;  3SHW A;  1WHJ A;  3M0Q A;  1Q86 C;  4BDZ A;  1QWF A;  1RLQ C;  1SHF A;  3MEV A;  4N0A A;  4LXC A;  1N8R U;  1I81 A;  4M75 A;  5I22 A;  1KHI A;  3HRU A;  5GJV B;  2ZPG B;  2DYI A;  3A1P A;  5FW9 A;  3EFR A;  1QMC A;  4C5H A;  1ZUU A;  2NWM A;  1M2V A;  1QVG S;  2DMO A;  4RUG A;  2DXU A;  3UPU A;  5HY6 A;  3A8G B;  3C95 A;  5GAN g;  3L2U A;  1J3T A;  4C92 B;  2DRM A;  3MJX A;  1VQ5 A;  3FJ5 A;  4JPB W;  2DZ9 A;  1Y96 B;  3HRS A;  4JUV A;  3HKS A;  1M2O A;  1K9M C;  1LCK A;  1U1S A;  2V8J A;  4KH1 B;  1XTD A;  2LNH B;  4ZNX A;  2IPO B;  4DBR A;  2RJF A;  1NJI C;  4Q5W A;  2BKD N;  3JCM b;  3JCM f;  3CC4 Q;  2CP7 A;  2X4W A;  1ZQ1 A;  5I2S A;  2EYQ A;  2MF2 A;  2FVU A;  4M7D E;  2L3Q A;  1UGV A;  4AMC A;  4GLK A;  4MMK A;  1LOJ A;  5KYY A;  2RO0 A;  3OYD A;  1X01 A;  2F69 A;  2GNC A;  1VQL Q;  2QG9 B;  2NYS A;  3PIO A;  1OPL A;  5DY9 A;  1U3O A;  5GAN d;  4D8D A;  4OGC A;  3CCS Q;  1JU5 C;  3JB9 H;  2JMC A;  4OGE A;  3M56 A;  2PVD B;  1AD5 A;  3LH5 A;  2EQJ A;  1JO8 A;  2KBT A;  2YDL A;  2E6Z A;  3L2R A;  4IUU A;  1Z9Z A;  5GAO m;  2ROL A;  3GIB A;  2JNG A;  1GRI A;  4VUB A;  3WVD B;  3M57 A;  4D8K A;  2K5I A;  2QEX A;  4E7K A;  2EJ9 A;  1SG5 A;  4M77 E;  4EMG A;  5FU6 C;  2J6O A;  3CC2 Q;  1D0X A;  3CME T;  5CKH A;  2YRD A;  2O2O A;  1YI2 T;  4M78 G;  1LJO A;  3EG9 B;  2ZZD A;  1R8O B;  2AK5 A;  1OEB A;  1PSE A;  2HZY A;  1KJW A;  1MV3 A;  3PIP A;  3RER A;  2HDA A;  1RI9 A;  1NG2 A;  1AZG B;  4FW2 A;  1I1J A;  1T3S A;  2IVW A;  3QXE B;  4F7U G;  3CCR Q;  2AZV A;  2HL3 A;  3L2Z A;  2OTJ T;  1X6G A;  2XU8 A;  1GXI E;  4JJC A;  2VKN A;  5GMK j;  4Z88 A;  3OMG A;  2QQB A;  1C1A A;  1VQK Q;  2DET A;  1FXX A;  1TS9 A;  3VJP A;  2X3X D;  5CKB A;  4V2S A;  4LUE A;  5GAM j;  4JS4 A;  3CCQ T;  4RTT A;  3JB9 J;  3VS6 A;  1WXB A;  2RK2 A;  1KD1 R;  1LPL A;  4N4G A;  4FIB A;  2QAZ A;  4DEX A;  1YWP A;  2XI9 A;  4E7I A;  2CT3 A;  4NL2 A;  2JXB A;  1A0N B;  3CC4 A;  1BI0 A;  3REA B;  1TSF A;  1QKX A;  2YUN A;  2EJF A;  2VB6 A;  2RQU A;  4FU6 A;  2QDY B;  2CDT A;  1VQ9 Q;  1NE8 A;  3GP8 A;  1WQW A;  3X24 B;  1OUL A;  1FMW A;  3CPW S;  3JCM h;  4DQ2 A;  5KCO A;  4WTO B;  2LT1 A;  3G4S T;  1VQL A;  1G83 A;  2JT4 A;  3CCJ Q;  1YIT T;  3CCM Q;  3CMA Q;  4WF2 A;  1H8K A;  3OBW A;  1M27 C;  3I55 Q;  3RKX A;  1VOM A;  2V8I A;  2O9V A;  1BB9 A;  3Q1J A;  1VQ4 T;  3HFO A;  5GAN 6;  3CCS A;  1BBZ A;  3ZFJ A;  4M78 B;  4BD3 A;  2FHD A;  1H64 1;  3I56 A;  3GNG A;  1M3B A;  2CP5 A;  5C0M A;  3JB9 G;  2FZG B;  2P0K A;  2X35 A;  4RTV A;  3QDF A;  1KD1 C;  1QCO A;  4F7U B;  2CZ6 B;  2A36 A;  1R0C B;  2QQR A;  2EBP A;  1D1A A;  1W1F A;  4M7A E;  4DBH A;  3OYK A;  4OMF B;  3OMC A;  3RR6 A;  2QK0 A;  3TCJ A;  4PJO E;  3CEY A;  3NTK A;  4A54 A;  3CC2 A;  1MMA A;  1C0M A;  2QQA A;  2DBM A;  5CK9 A;  3DB3 A;  3DLM A;  3ER0 A;  4M7D G;  7AT1 B;  1YP5 A;  3C12 A;  1UEB A;  2ZCF B;  5CO7 A;  3JCM g;  4EIK A;  3CCR A;  1JJ2 A;  1M1G A;  1KHC A;  1N6A A;  3CME Q;  2L3R A;  2DKG A;  2LCS A;  2DXC A;  2RD1 A;  1VQK A;  2OTL Q;  2IIM A;  4M75 D;  3VYH B;  2DFU A;  4O5V A;  1Q95 G;  4C8Q D;  5GMK l;  1WX6 A;  5CKE A;  2KDS A;  2SEM A;  1C6V X;  2JS0 A;  1B07 A;  3IQL A;  1G5V A;  1OU8 A;  1W2B P;  3VKI A;  3O8V A;  2OTJ Q;  2EGE A;  3BDU A;  2HL5 C;  3G71 A;  2DD5 A;  2LTO A;  2W0Z A;  3VS0 A;  3X25 B;  4LDY A;  4FCY A;  1UFF A;  4KT0 E;  3SWN A;  3G6E T;  2YHT A;  3OBY A;  1HXD A;  1D3B B;  2FYK A;  2JN0 A;  3OSS C;  4M77 G;  5KYU B;  2E3H A;  1AVZ C;  1VQ9 A;  4QT7 A;  4J9E A;  2ED0 A;  3INZ A;  3L2V A;  2DYB A;  3JCM d;  1UGS B;  3M0R A;  3BY7 A;  4KGV B;  4ZTF A;  4M75 F;  4J8O A;  2DVE A;  5FWB A;  5GAO n;  3CCJ A;  3LWI A;  1SSF A;  2YWW A;  3UA7 A;  2A28 A;  5L23 A;  2KRM A;  3CMA A;  1MUZ A;  1FMV A;  3CC7 Q;  1MV0 B;  4KGX B;  3I55 A;  3CCU A;  4DOW A;  2DL7 A;  2L3P A;  3G7Z A;  4C0Z A;  1WZO A;  2P4R A;  2LX9 A;  3PMT A;  1RAF B;  1YHQ A;  2CP3 A;  1ZSZ A;  2EWN A;  1E6G A;  5FU7 B;  4ZGD B;  2CRE A;  4C92 D;  4JS5 A;  1OZ3 A;  3QYG B;  4M7D B;  3EHQ A;  2A37 A;  1YIT Q;  1GFD A;  2QA4 T;  1D3B A;  2WSC E;  1WHL A;  3EG1 A;  5A0G A;  3OYB A;  1KK7 A;  1MND A;  2KXC A;  5LJ5 j;  4HVW A;  2H3J A;  2NUP A;  4ZGE B;  3RBB B;  2JTE A;  1M8V A;  4J7F A;  1KQS A;  4RTY A;  3A8M B;  1YJW T;  1W6X A;  1K73 U;  2RHU A;  4MZT A;  4QW2 A;  3S3M A;  2E41 A;  5FWC A;  1GBR A;  4J6W A;  1TTH B;  2XID A;  3EH1 A;  2LCC A;  3NFC A;  4OMP A;  4QVZ A;  4PL6 A;  4PJN A;  3A8L B;  2DTO A;  2YLB A;  4M77 B;  1V76 A;  3CXC S;  3QBY A;  5GAN e;  3P8H A;  2RHX A;  4OML A;  4M7D A;  2K3X A;  2JMA A;  1YN8 A;  2F5K A;  2OAW A;  5J39 A;  1KC8 U;  1NEB A;  4FL6 A;  1AZE A;  3FIF A;  4IUR A;  2PTK A;  2JOY A;  3RKW A;  3QYH B;  1B34 B;  4L5G A;  1UGQ B;  4HXJ A;  3CCV T;  1IGU A;  3EFO A;  3QII A;  1Y07 A;  3DLL A;  1VQ6 A;  3MP8 A;  5CQY A;  1SHG A;  2F2X A;  5IAY A;  4M7A G;  1PD1 A;  1XJW B;  1LNX A;  3D7S B;  3KUF A;  4OMQ A;  4PJO G;  4A4E A;  3QPH A;  5I21 A;  4BE0 A;  2KAF A;  2BZY A;  5HCK A;  1TH7 A;  2M1H A;  2OX7 A;  4BY6 C;  4Z8A A;  1OX9 A;  3E2U A;  1FWZ A;  4J9D A;  4JJB A;  3CBM A;  4XTU A;  4EMH A;  1VQN Q;  4AG1 C;  5KYX B;  3KXT A;  3A5Z B;  2A0F B;  2JTM A;  5A0L A;  2YLC A;  2YUP A;  3RMQ A;  4JJD A;  1YJ9 A;  1KFZ A;  2L0A A;  1VQO T;  1W4S A;  4X9C A;  5GMK i;  3MEW A;  1YNZ A;  3OYF A;  3PVQ A;  3VS1 A;  4XTW A;  1K8A U;  2JUF A;  2FL7 A;  1RL2 A;  2CSQ A;  4OMN A;  4B6M A;  2DF6 A;  4RTX A;  5J3B A;  2DBK A;  4M75 B;  2GF7 A;  2MCN A;  2MAM A;  3CPF A;  3NGP A;  2O01 E;  2AKL A;  4IIO A;  2A08 A;  3I56 T;  1BYM A;  1UG1 A;  1M2V B;  2PVO B;  3JCM Q;  3RUX A;  5KYX A;  3M53 A;  1G3Y A;  3NTI A;  2E5Q A;  1M8M A;  3LW5 E;  4OMM A;  1MNE A;  2EVR A;  4J5Y A;  2H8H A;  1LVK A;  1T0J A;  1RAG B;  4EMK A;  3BDL A;  4XU1 A;  5KCH A;  4NOY A;  4M78 D;  1NLO C;  2DL3 A;  4CC2 A;  3TSZ A;  3RES A;  3CQT A;  2PNI A;  2EQK A;  2YUQ A;  1S72 T;  2M51 A;  4B9X A;  3CD6 Q;  5FRO A;  2J7I A;  3V8L A;  2DO3 A;  1B3Q A;  2KXD A;  4Y91 A;  4PNO A;  1BIB A;  8AT1 B;  2DEU A;  5KYY B;  1XQH A;  3M58 A;  1U1T A;  2L2P A;  3AHU A;  2FZK B;  3UA6 A;  4RTW A;  2L3S A;  2KYM A;  3CCE T;  2QGF B;  1HYO A;  2HQH A;  4C5G A;  3MO8 A;  4IUP A;  4LD9 K;  2C0O A;  5KE3 A;  1UJ0 A;  1OV3 A;  3LGL A;  3G71 T;  4M7A A;  1K76 A;  4J9B A;  3ZL7 C;  4PJO A;  4M78 F;  1VQN A;  1G2B A;  1TUG B;  3T9N A;  3WXM B;  2RH2 A;  2K4Y A;  2LJ0 A;  1WJS A;  1VQ8 Q;  4N4H A;  2RI3 A;  4DEY A;  5CR2 A;  1Q82 U;  3OS2 A;  1N9S A;  4F7U F;  1K73 R;  1K0S A;  3CCL T;  4LDX A;  3QHS A;  4E7Z A;  5GJW B;  1E6H A;  1JXM A;  5CVI A;  5M9O A;  3NTH A;  4PJJ A;  2ZGW A;  3EGX A;  4HVV A;  4A4H A;  1UDL A;  2K9G A;  1BI2 A;  1EX4 A;  2CZ7 B;  1ZLM A;  1YHQ T;  1S1N A;  3HFN A;  3NPF A;  1NYG A;  5FRN A;  2EFI A;  1YBY A;  3FJP A;  2COY A;  4E47 A;  1ZA1 B;  3NHN A;  1QCF A;  5HK3 A;  4MZP A;  2E3I A;  4NL3 A;  4ZTJ A;  1VQP Q;  3M4Y A;  5GAN 8;  3JB9 D;  3JCM e;  2ED1 A;  2L8D A;  2CUB A;  3QJY A;  4A63 B;  1YIJ Q;  2QGG A;  1AHJ B;  2VXE A;  4HT9 A;  4DA4 A;  3TVT A;  3VRY A;  1Y7X A;  1AT1 B;  3M9Q A;  4FM4 B;  2F5T X;  3GLX A;  4FT2 A;  3I9Q A;  2L5Q A;  4GY5 A;  2FRY A;  4XQ3 A;  2YRC A;  2OI3 A;  3RIR A;  2D9T A;  1K73 C;  4J9G A;  3CD6 A;  1M90 R;  4M7D D;  1F1B B;  2V1Q A;  3C94 A;  4JZ4 A;  3OYH A;  3VUB A;  1BK2 A;  2GFU A;  1QVF A;  2EYY A;  1PWT A;  1ZUK A;  2QTX A;  3JB9 F;  2XG8 D;  2DVJ A;  4HCK A;  2I2L A;  1NYF A;  2P4T A;  4C8Q C;  1K8A R;  2SRC A;  4A4F A;  5GMK m;  3JCM W;  2F2W A;  2XD0 A;  2FPE A;  2MOX A;  3VS5 A;  3QWY A;  4PJM A;  3TU4 K;  1YWO A;  3M0T A;  2RI2 A;  3JSC A;  1VQ7 T;  2VGN A;  3HTR A;  4DBQ A;  1JJ2 P;  3REB B;  3OYY A;  1AWJ A;  4C0D B;  2DZC A;  3OA6 A;  1X6O A;  2YXY A;  2JTF A;  4E7L A;  1TU0 B;  4PLL A;  3SD4 A;  1VQ8 A;  4M7D F;  5LJ3 j;  4M77 D;  4P5N A;  2EIF A;  5IHK A;  1KQ1 A;  2E4H A;  4C5E A;  3OYN A;  2G3R A;  2EYZ A;  3MP1 A;  2EKH A;  4PK4 A;  5IHN A;  3LWH A;  4XTV A;  2XDD A;  1M9S A;  2KEA A;  1OPK A;  3N5B B;  4JRK A;  4ZN1 A;  1BI3 A;  1UB4 A;  1YJN T;  2QYZ A;  1WHK A;  2COZ A;  4ELZ C;  5GAM f;  1M90 C;  2QI2 A;  3EGD A;  1GCP A;  4OB0 B;  3EG3 A;  1QVG A;  3EGU A;  2QQ9 A;  3JCM c;  3LH0 A;  1M1K U;  1OX8 A;  1QP3 A;  2DIL A;  2DK3 A;  2L89 A;  2O88 A;  2ZPI B;  1PSF A;  4D6W A;  2YSQ A;  1N8R R;  2ENM A;  2JVV A;  1W2B S;  2WAC A;  4KRT A;  4PKC C;  4C92 C;  1RAI B;  1VQP A;  4YTL A;  1K8A C;  3OS0 A;  2K2V A;  2CKK A;  4M77 F;  4IIM A;  2VAS A;  3EFS A;  1RAE B;  2FRW A;  4C8Q E;  1X75 C;  2ZPE B;  1CKB A;  4OF1 A;  1RAC B;  2DTH A;  5FRM A;  3ZBD A;  4AT1 B;  2EJG A;  1RAA B;  3VS7 A;  4RTZ A;  4BE1 A;  1Y0M A;  4QQD A;  4MML A;  3ZEH A;  3SWN B;  3OW2 P;  1VQM T;  4JRQ A;  1D1B A;  1WDX A;  1QKW A;  1TOV A;  1SSH A;  3OYL A;  2KVQ G;  5A0D A;  1UGR B;  2P0Q A;  5DM7 R;  2D0Q B;  3E1S A;  3PNW C;  2RHI A;  3MHX A;  3JV3 A;  3V7C A;  1YI2 Q;  3E9F A;  4J6Y A;  4JLG A;  1QWE A;  3EAE A;  2HD0 A;  1G3S A;  3EHR A;  1PKS A;  2ZPB B;  4BE2 A;  1WFW A;  1D1C A;  3M59 A;  2XMF A;  1P92 A;  1KQS P;  2CSI A;  2JS2 A;  1ZSZ B;  2GBQ A;  2EKO A;  3OY9 A;  5GAO r;  1M30 A;  1N8R C;  1H3H A;  4F16 A;  4PJL A;  3OYI A;  2KT8 A;  4C92 E;  1GCQ C;  1K9A A;  2DIQ A;  2O31 A;  2D0N A;  2CP2 A;  4M7A D;  1M3A A;  3CCQ Q;  2G6F X;  4PJO D;  4E2F B;  3F70 A;  3H9N A;  2NUT A;  3R6O A;  1AWW A;  2NUP B;  2QXF A;  4C0F A;  1VQ5 T;  4FT4 A;  5D7U A;  2OAU A;  4EDU A;  3L2Q A;  2DJQ A;  2HNI A;  5GAN j;  2EGA A;  3CCM A;  2VYT A;  3S3N A;  1BIA A;  4EPC A;  4XTZ A;  2RF0 A;  3ULR B;  2EYX A;  1G8X A;  3V7S A;  1SPK A;  2KMT A;  4R0K A;  2PU9 B;  3PMI A;  5CIU A;  3FRN A;  3KFV A;  3TRE A;  2QDL A;  4FYW B;  1YJN Q;  5GAM h;  3NMZ C;  1PNJ A;  4ESR A;  3G4S Q;  2O4X B;  1DJ7 B;  1PKT A;  1OYX A;  4M7A F;  1IXD A;  1YCY A;  4PJO F;  3UT1 A;  5GAN 7;  1HJD A;  2DPP B;  2BZ8 A;  4LN2 A;  1OOT A;  1VQ4 Q;  4JRI A;  3SB2 A;  3M4G A;  4B9W A;  2MK5 A;  3QZ9 B;  2E6N A;  1UEC A;  3EG2 A;  3EFO B;  1D0Y A;  1M4Z A;  2J6F A;  4HA8 A;  1IRX A;  2H3E B;  2LT4 A;  2E5K A;  1I4K 1;  4BI3 A;  2NUZ A;  3CPW A;  3H0I A;  2CZ1 B;  2FEI A;  2KYB A;  3MCA B;  2HQX A;  2F1L A;  4N4I A;  1WNL A;  3PTA A;  1OU9 A;  3ASK A;  1X69 A;  2QEX T;  3CME A;  1YI2 A;  3J80 E;  2WSF E;  1OI1 A;  4C5I A;  2O9S A;  2OTL A;  1VQM Q;  4E7S A;  1PG5 B;  5KYW A;  1PM3 A;  2O4X A;  2LP5 A;  4LDU A;  3VU3 C;  1QCN A;  2EQM A;  2KQW A;  1W2B A;  4M78 C;  4XU0 A;  4L6V 5;  2LJ1 A;  3I35 A;  3MKD A;  5HK0 A;  5GAM g;  1EFN A;  2W10 A;  5IXF A;  2E65 A;  1VUB A;  4QQ6 A;  2M16 A;  3PE0 A;  2OTJ A;  3JCM J;  1W70 A;  1RI0 A;  2GTO A;  5LL6 S;  2Y4X A;  4C8Q G;  9ATC B;  3S3O A;  1ZBJ A;  1HD3 A;  1WJR A;  1JB0 E;  1ABQ A;  3CCQ A;  3FLG A;  2RJE A;  4RCB A;  5GAN 3;  3HRT A;  3QJ6 A;  4RMO A;  5CQX A;  2KE9 A; 
#chains in the Genus database with same CATH homology
 4FIB A;  5A0D A;  4IUP A;  3QDR B;  4LD9 K;  2KY9 A;  2XI9 A;  5KE3 A;  4E7I A;  1KQ2 A;  1K9M U;  2LVM A;  5EG2 A;  1QVG A;  3CBO A;  3LGL A;  3MET A;  2ZPF B;  1NPR A;  2RI5 A;  2RJC A;  2XIC A;  3QG1 A;  4BB7 A;  5I2M A;  3G71 T;  4A53 A;  4M7A A;  4NL2 A;  4PJO A;  4OB1 B;  4M78 F;  1VQN A;  1NJI U;  3HHT B;  3T9N A;  2PUO B;  1VQN T;  5HKC A;  3M5A A;  3WXM B;  2RH2 A;  3QO3 A;  4XTY A;  4QVD A;  2K4Y A;  3CC4 A;  3CC7 A;  1BI0 A;  4JDS A;  1WJS A;  4IUQ A;  2RHZ A;  3FB9 A;  3CC4 T;  4N4H A;  2EJF A;  2RI3 A;  2LQ8 A;  4FU6 A;  4A4K A;  3VV0 A;  2QDY B;  1O9S A;  5CR2 A;  1Q82 U;  2GQV A;  3OS2 A;  1NE8 A;  2YRV A;  3X26 B;  1N9S A;  4F7U F;  3GP8 A;  1XNI A;  3MP6 A;  3CCL A;  5GMK h;  4IKF A;  5GAM d;  1WQW A;  2XDB A;  3X24 B;  1Q82 C;  3CCL T;  4LDX A;  3QHS A;  4EMK B;  3G4S A;  3CPW S;  2KSS A;  2CGH A;  2PVG B;  3M55 A;  5CVI A;  3JCM h;  4C8Q F;  4DQ2 A;  5KCO A;  5M9O A;  5GAO q;  2FB7 A;  2LT1 A;  3G4S T;  1ZHI A;  3OS5 A;  2XK0 A;  2LQK A;  5FU6 B;  3NTH A;  1YIT A;  1VQL A;  4E7H A;  1IZ6 A;  2JZ2 A;  3V8J A;  1JRI A;  4KUL A;  1VQL T;  1YIT T;  2E64 A;  2ZGW A;  4A4H A;  4OB3 B;  2E10 A;  3OBW A;  4WF2 A;  1VQ4 A;  2PQW A;  4XU2 A;  3JCM X;  1BI2 A;  1QW1 A;  3RKX A;  2V8I A;  2XKO C;  2HAX A;  2CZ7 B;  3Q1J A;  1VQ4 T;  3HFO A;  5GAN 6;  2MI6 A;  3CCS A;  1Y71 A;  1YHQ T;  3OYC A;  4C92 G;  3HFN A;  1KG1 A;  3ZFJ A;  4FSX A;  5FRN A;  4M78 B;  2EFI A;  3CCS T;  3OW2 A;  4BD3 A;  5CKF A;  2FHD A;  1H64 1;  1YBY A;  3FJP A;  4E47 A;  4C0D C;  1H3Z A;  4HKE A;  3I56 A;  5HK3 A;  4HCC A;  3GNG A;  2XHC A;  5GAN f;  4MZP A;  3LLR A;  4QQG A;  5D6X A;  2CYZ B;  5LJ3 h;  5C0M A;  3JB9 G;  2P0K A;  4NL3 A;  2X35 A;  4ZTJ A;  3M4Y A;  3P8B B;  5DLO A;  4II1 A;  1M5Q 1;  5GAN 8;  2KK4 A;  3MEU A;  3JB9 D;  3JCM e;  2X4X A;  1KD1 C;  2L8D A;  4F7U B;  2CZ6 B;  3QJY A;  2QQR A;  1M1F A;  5KE2 A;  5KH6 A;  4M7A E;  1AHJ B;  3X28 B;  2VXE A;  4OMF B;  5A2Q E;  4UC4 A;  3OMC A;  3OYK A;  2DIG A;  3L1A A;  4HT9 A;  4DA4 A;  3TCJ A;  4ZGJ B;  4PJO E;  2K5L A;  3CEY A;  2CZ0 B;  3NTK A;  1Y7X A;  3V8K A;  4A54 A;  3CC2 A;  2NLU A;  3SDZ A;  4RKU E;  2M9U A;  2QQA A;  3M9Q A;  1UGP B;  4FM4 B;  3VYG A;  4M7A B;  3CC2 T;  2F5T X;  2BUD A;  3GLX A;  4FT2 A;  4PJO B;  2X4J A;  5CKD A;  5CK9 A;  2L5Q A;  3DB3 A;  3P8D A;  4GY5 A;  3WVE B;  3DLM A;  1O75 A;  1N9R A;  2VGM A;  4RG2 A;  2K5F A;  3ER0 A;  5FU7 C;  4XQ3 A;  2LCL A;  4RCC A;  4XU3 A;  3RIR A;  4M7D G;  3C12 A;  2IG0 A;  2D9T A;  1UEB A;  3A8O B;  1K73 C;  3CD6 A;  2ZCF B;  4M7D D;  5CO7 A;  3JCM g;  5LJ5 f;  3CCR A;  3C94 A;  2R5A A;  3PGG A;  1JJ2 A;  4C92 F;  3CD6 T;  1M1G A;  2LDM A;  4NS5 A;  3VUB A;  3OYH A;  4M7D C;  1KHC A;  1N6A A;  4O6J A;  4A4G A;  3CCR T;  2L3R A;  3H8Z A;  2RHY A;  2DKG A;  3SFM A;  2GFU A;  4M75 G;  2R58 A;  1QVF A;  2DXC A;  2RD1 A;  1VQK A;  4M75 D;  5D6W A;  1WPY A;  2ZPH B;  3VYH B;  4O5V A;  1I5L A;  4XTX A;  4ZN3 A;  2QTX A;  1VQK T;  3JB9 F;  3L42 A;  2XG8 D;  2A3L A;  4C8Q D;  1WQ7 A;  3FDR A;  5GMK l;  5LJ5 h;  2I2L A;  3V7R A;  2DJZ A;  2GCX A;  4PLI A;  2P4T A;  4C8Q C;  5CKE A;  4ME7 A;  4A4F A;  5GAN 2;  3LX7 A;  5GAO p;  5GMK m;  4LD6 A;  3JCM W;  2KDS A;  2XD0 A;  1G5V A;  3GOX A;  4J83 A;  5FLX E;  5LJ3 g;  3VKI A;  3O8V A;  3TU4 K;  4C8Q A;  1HK9 A;  1VQ7 A;  1BKB A;  3SWN C;  3BDU A;  3G71 A;  2RI2 A;  2DD5 A;  3JSC A;  2LTO A;  3QZ5 B;  2VGN A;  4Z02 A;  3RKY A;  1VQ7 T;  2AHJ B;  3JRZ A;  3G6E A;  3UDC A;  3OYY A;  5L8R E;  4LDY A;  3X25 B;  3OYM A;  3QSU A;  5D6Y A;  4HT8 A;  4KT0 E;  3SWN A;  3G6E T;  2YHT A;  3OBY A;  4CRI A;  1HXD A;  4C0D B;  2DZC A;  3OA6 A;  1X6O A;  1D3B B;  2FYK A;  2JN0 A;  2Y4Y A;  3OSS C;  2JTF A;  4M77 G;  4DOV A;  4CI0 C;  3J81 E;  4PLL A;  3SD4 A;  4E7L A;  1Q81 C;  3CXC A;  1VQ8 A;  4M7D F;  5LJ3 j;  3BW1 A;  4M77 D;  4P5N A;  2EIF A;  1VQ8 T;  5LJ5 e;  1VQ9 A;  2RA2 A;  1KQ1 A;  3FC3 A;  1NPP A;  2M0O A;  2LNV A;  4M77 C;  3CBP A;  2DD4 A;  2P0P A;  4C5E A;  2G3R A;  2HQE A;  2LC4 A;  3INZ A;  3URG A;  3OYN A;  3L2V A;  1VQ9 T;  2R5M A;  3MP1 A;  3JCM d;  1UGS B;  3LWH A;  4XTV A;  3BY7 A;  4ZTF A;  2EAY A;  4M75 F;  2XDD A;  4KBM B;  1YJN A;  1M9S A;  4IUT A;  3N5B B;  1ZBX A;  4J7I A;  4J8O A;  2DXB A;  4M77 A;  4JRK A;  4ZN1 A;  2DVE A;  3QKJ A;  1BI3 A;  1UB4 A;  5GAO n;  3CCJ A;  1YJN T;  3LWI A;  1SSF A;  1M90 U;  4JJN K;  3DB4 A;  4ELZ C;  4XAX B;  3RMS A;  5GAN 5;  1QP2 A;  5GAM f;  3CCJ T;  3CMA A;  3GF5 A;  1M90 C;  2QI2 A;  2Y90 A;  3I55 A;  3CCM T;  3CCU A;  4DOW A;  4M78 E;  3CMA T;  4C0Z A;  3G7Z A;  4OB0 B;  2LX9 A;  3PMT A;  1V29 B;  3OB9 A;  2CS7 A;  2DEQ A;  3I55 T;  1VIF A;  2EWN A;  2QQ9 A;  3LH0 A;  3JCM c;  3CCU T;  1YHQ A;  1QP3 A;  2K3Y A;  4E7J A;  5FU7 B;  1M1K U;  1WJQ A;  2E12 A;  4ZGD B;  2DK3 A;  2L89 A;  1B34 A;  2ZPI B;  4BUG A;  2QQS A;  4MZM A;  3JCM P;  1PSF A;  2RJD A;  4D6W A;  5LJ5 g;  1U8R A;  4C92 D;  1M1K C;  4JS5 A;  2RM4 A;  5LJ3 d;  4MDW A;  3A8H B;  1OZ3 A;  3PT9 A;  2JVV A;  1W2B S;  1BI1 A;  2WAC A;  3OYJ A;  3BFM A;  4C92 C;  4PKC C;  3J7A F;  3QYG B;  2A7Y A;  2MWP A;  4F7U E;  4M7D B;  2QA4 A;  1VQP A;  4RG8 A;  4YTL A;  3JAM E;  1KD1 U;  1K8A C;  3OS0 A;  4X34 A;  2QA4 T;  1VQP T;  2E70 A;  2K2V A;  1JJ2 S;  2CKK A;  4M77 F;  1D3B A;  2WSC E;  3EFS A;  4C92 A;  4C8Q E;  1EIF A;  3GPL A;  5A0G A;  3OYB A;  4MDX A;  4Y28 E;  1X75 C;  2ZPE B;  4BI4 A;  1YIJ T;  1QVF S;  5CAI A;  5LJ5 j;  2H3J A;  4OF1 A;  4ZGE B;  2DTH A;  4C8Q B;  3ZBD A;  4BI8 B;  5FRM A;  5GAN h;  2LRQ A;  2E1H A;  3M54 A;  1Y96 A;  2EJG A;  1OZ2 A;  1M8V A;  4J7F A;  4BE1 A;  4QQD A;  4MML A;  1VQM A;  5IN1 A;  3ZEH A;  5IT9 E;  2RB6 A;  3TEE A;  1YJW A;  3SWN B;  2V8K A;  3A8M B;  1VQM T;  1KQS A;  4JRQ A;  1YJW T;  4BAC A;  2MMP A;  1K73 U;  1Q7Y C;  2RHU A;  2PUK B;  3MEA A;  2KVQ G;  3HP9 A;  2GFA A;  3OQ5 A;  3HPW A;  1UGR B;  4J6X A;  4LDW A;  4MZT A;  2P0Q A;  3PFS A;  4OVA A;  2RK1 A;  4QW2 A;  4EMK C;  4OB2 B;  5DM7 R;  3S3M A;  2D0Q B;  3E1S A;  2DTI A;  3PNW C;  2RHI A;  1MHN A;  2E41 A;  4R55 A;  3MHX A;  2BIV A;  3LGF A;  4J6W A;  3KBG A;  5J26 A;  2XID A;  3V7C A;  2LCC A;  3NFC A;  4QVZ A;  4PL6 A;  1I8F A;  3LYI A;  3A8L B;  2DTO A;  2YLB A;  3E9F A;  4M77 B;  1JBM A;  3CXC S;  5LJ5 d;  4J6Y A;  2OTL T;  4JLG A;  3QBY A;  5GAN e;  3EAE A;  2HD0 A;  3P8H A;  2RHX A;  4N0A C;  4M7D A;  4TVR A;  1G3S A;  4BDZ A;  1Q86 C;  2ZPB B;  5C6S A;  2K3X A;  4M75 C;  4BE2 A;  2F5K A;  1KC8 U;  3S6W A;  5J39 A;  3M59 A;  4L59 A;  4FL6 A;  3MEV A;  1P92 A;  4N0A A;  1KC8 C;  3OYL A;  1N8R U;  3FIF A;  4IUR A;  1I81 A;  1FX7 A;  4M75 A;  1KHI A;  2JOY A;  3HRU A;  2EKO A;  3QYH B;  3RKW A;  2K57 A;  2ZPG B;  1B34 B;  3OY9 A;  4L5G A;  5GAO r;  1N8R C;  3CCV A;  3EFR A;  1UGQ B;  2HBP A;  4C5H A;  2C06 A;  2DAQ A;  4JLI A;  3CCV T;  3QII A;  1Y07 A;  3DLL A;  1VQ6 A;  3MP8 A;  5CQY A;  3OYI A;  4C92 E;  4C0G A;  1VQ6 T;  5IAY A;  4M7A G;  1QVG S;  2DIQ A;  1LNX A;  3KUF A;  1Q81 U;  2WSE E;  2DXU A;  4PJO G;  4A4E A;  4M7A D;  3QPH A;  3UPU A;  5HY6 A;  3A8G B;  3C95 A;  5GAN g;  2DXT A;  3L2U A;  4C92 B;  4PJO D;  3OW2 S;  5I21 A;  4M7A C;  4BE0 A;  2KAF A;  3F70 A;  1VQ5 A;  3R6O A;  4PJO C;  4LDV A;  2QXF A;  4C0F A;  1VQ5 T;  1TH7 A;  2DZ9 A;  2M1H A;  4FT4 A;  4BY6 C;  4JRP A;  2OAU A;  1Y96 B;  3HRS A;  4JUV A;  4EDU A;  3HKS A;  3VUZ A;  1FWZ A;  1K9M C;  4ATO A;  1U1S A;  2V8J A;  1N27 A;  1XTD A;  3L2Q A;  3CBM A;  2HNI A;  2RJF A;  4XTU A;  5GAN j;  4EMH A;  3KXT A;  3A5Z B;  1NJI C;  4Q5W A;  2BKD N;  3JCM b;  3CCM A;  2VYT A;  3S3N A;  3JCM f;  4HCB A;  1BIA A;  4EPC A;  1MGQ A;  2JTM A;  4XTZ A;  5A0L A;  3CC7 T;  3C4S A;  2YLC A;  2D6F A;  3RMQ A;  2X4W A;  5CCA A;  1ZQ1 A;  2XDP A;  3V7S A;  2VV5 A;  3HL8 A;  5I2S A;  1VQO A;  1YJ9 A;  2EYQ A;  2MF2 A;  2KMT A;  2PU9 B;  3PMI A;  1VQO T;  4XK8 E;  1YJ9 T;  5CIU A;  1KQS S;  2FVU A;  4M7D E;  2X4Y A;  1W4S A;  4BDY A;  3FRN A;  4X9C A;  3TRE A;  5GMK i;  4GLK A;  3MEW A;  4MMK A;  1LOJ A;  5GAM h;  3OYF A;  4XTW A;  2RO0 A;  2JUF A;  2O4X B;  2FL7 A;  1K8A U;  3OYD A;  1DJ7 B;  1X01 A;  2VUB A;  4R56 A;  2F69 A;  3FEO A;  1RL2 A;  5AYF A;  1OYX A;  4M7A F;  3E19 A;  1YCY A;  3PIO A;  4PJO F;  4M75 E;  3H6Z A;  3UT1 A;  5GAN 7;  3DKM A;  2DPP B;  5LJ3 f;  5DY9 A;  1YIJ A;  1IRE B;  5J3B A;  1G3T A;  4JRI A;  5GAN d;  3OYE A;  1WGS A;  3SB2 A;  4M75 B;  2GF7 A;  3M4G A;  4OGC A;  4B9W A;  3ME9 A;  2R57 A;  3QZ9 B;  3JB9 H;  2VC8 A;  2E6N A;  3M56 A;  4OGE A;  1QVP A;  2MAM A;  2PVD B;  3CPF A;  2O01 E;  1M4Z A;  5GMK e;  4HA8 A;  2VXF A;  5GAN 4;  3I56 T;  4OP0 A;  2EQJ A;  2LT4 A;  5GAO l;  1BYM A;  1I4K 1;  2PVO B;  3JCM Q;  3RUX A;  1Q7Y U;  4BI3 A;  2E6Z A;  3OYA A;  5GAM e;  3M53 A;  3L2R A;  3CPW A;  4IUU A;  1G3Y A;  5GAO m;  3GIB A;  2JNG A;  2CZ1 B;  3NTI A;  4VUB A;  3WVD B;  3M57 A;  2E5Q A;  2HQX A;  3LW5 E;  3MCA B;  4N4I A;  4X9D A;  3JB9 I;  2K5I A;  2QEX A;  2B8A A;  1WNL A;  4QVC A;  4J5Y A;  3PTA A;  4ELY C;  4E7K A;  2EJ9 A;  3ASK A;  4M77 E;  4EMG A;  2QEX T;  5FU6 C;  4IUV A;  3CME A;  1YI2 A;  1VIE A;  3J80 E;  2WSF E;  3L2W A;  1OI1 A;  4C5I A;  3CME T;  4EMK A;  5CKH A;  2OTL A;  1YI2 T;  3BDL A;  4M78 G;  1LJO A;  1Q86 U;  4KUI A;  5DLQ E;  4XU1 A;  2ZZD A;  2O4X A;  3OYG A;  4BY6 B;  1R8O B;  4LDU A;  4NOY A;  4M78 D;  3VU3 C;  5KCH A;  2EQM A;  2KQW A;  1W2B A;  1PSE A;  3PIP A;  5LJ3 e;  4M78 C;  3RER A;  1S72 A;  4XU0 A;  3JCM V;  4L6V 5;  3RES A;  2EQK A;  5HK0 A;  1S72 T;  5GAM g;  4B9X A;  2E65 A;  2EQU A;  5FRO A;  1VUB A;  2IVW A;  3QXE B;  4QQ6 A;  4F7U G;  2M16 A;  3V8L A;  4M78 A;  2OTJ A;  3E9G A;  2DO3 A;  3JCM J;  4KUD K;  3L2Z A;  1RI0 A;  4Y91 A;  5LL6 S;  2OTJ T;  4PNO A;  2XU8 A;  4HCZ A;  1BIB A;  1GXI E;  3X20 B;  3UWN A;  3HSB A;  2Y4X A;  4C8Q G;  1XQH A;  5GMK j;  3OMG A;  3M58 A;  3S3O A;  1U1T A;  2MWO A;  2QQB A;  3GNF B;  3AHU A;  1FXX A;  3VJP A;  1WJR A;  1XOV A;  5CKB A;  1JB0 E;  3OSV A;  3CCE A;  4V2S A;  3CCQ A;  1G3W A;  5GAM j;  3FLG A;  4JS4 A;  4F7U A;  2RJE A;  3CCE T;  4RCB A;  5GAN 3;  3OS1 A;  3HRT A;  3CCQ T;  1NZ9 A;  3JB9 J;  4C5G A;  2RK2 A;  3QUI A;  4N4G A;  3QJ6 A;  3MO8 A;  4RMO A;  5CQX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...