4NL2A

Crystal structure of listeria monocytogenes hfq
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
73
structure length
73
Chain Sequence
MKQGGQGLQDYYLNQLRKEKILATVFLTNGFQLRGRVVSFDNFTVLLDVEGKQQLVFKHAISTFSPQKNVALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of U-rich RNA by Hfq from the Gram-positive pathogen Listeria monocytogenes.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Rna binding protein
molecule keywords Protein hfq
total genus 17
structure length 73
sequence length 73
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4nl2A00
4M77C 1HK9A 5LJ3g 5GANg 1Y96A 1M8VA 2EAYA 4C92B 4DQ2A 4QVDA 4F7UE 3V8KA 2RA2A 2Y90A 5GANh 2DKGA 4MMLA 3JCMX 4C92F 4M75B 3L1AA 1KQ1A 3INZA 3JB9J 3EFSA 4M7AD 1B34A 4HA8A 4M75C 5GAMe 3V8LA 4M75F 1WQWA 3BFMA 1BIBA 3JCMg 1N9SA 4X9DA 3FIFA 3V8JA 2ZGWA 3BY7A 3JCMh 1B34B 4RCBA 3V7CA 4M77B 2DTHA 4M78B 4QVCA 5LJ3j 2VXFA 4XTYA 3QHSA 4M7AG 2I2LA 4XTWA 4V2SA 2VC8A 4JUVA 1H641 5GAOp 3BW1A 4XTUA 3JCMV 1HXDA 5GAN3 1M5Q1 3RUXA 5I21A 1LJOA 4M7DB 4M78G 1JRIA 2E64A 5LJ3h 5LJ5e 4HT8A 2FB7A 3FB9A 4XU0A 3QSUA 4M7DF 4M77G 5GAN6 2E10A 3V7RA 3JCMc 1N9RA 3M4GA 5GMKl 2VXEA 3V7SA 2DVEA 4F7UB 5CAIA 4EMGA 2JN0A 1I8FA 4C92E 5GAOl 4MMKA 2EJGA 4C8QB 1WQ7A 3JCMJ 3JB9D 5GANf 4M7AA 3RESA 5GAOn 5GAMh 3JB9G 2HNIA 5DY9A 4M77E 3RIRA 5GAN5 2DXUA 4F7UA 4WF2A 1D3BA 4PJOG 4NOYA 5GANd 1I5LA 2DJZA 5LJ5g 4PNOA 1LNXA 4M75G 4N0AA 3RERA 1U1TA 5GAOm 4M78D 4M77D 1YCYA 4PJOE 4C8QD 4C92G 4M7DC 3JB9I 1I4K1 4M7DE 5GAN2 2EJFA 4C8QA 4M77A 3EFRA 2E41A 1MGQA 3HSBA 2CGHA 3JCMe 4C8QE 2DTOA 5GAMg 2RB6A 4C8QC 3SWNC 4RCCA 1X01A 4F7UF 4XTVA 3QUIA 2E65A 2EJ9A 3HFOA 1TH7A 3BDUA 3QO3A 4XQ3A 3RKWA 3SWNB 5GANj 4C8QF 4XU1A 4M77F 1WNLA 4EMKC 1KQ2A 4M7DD 4XU3A 5GANe 5LJ3e 2E1HA 5LJ5h 1Y96B 4N0AC 3RKXA 4C92A 5GAMf 3GIBA 4M7DG 5GMKj 4C92C 3JCMW 4J6WA 2YHTA 1JBMA 4A53A 4NL2A 3JCMf 4EMKA 4Y91A 4C8QG 3JCMb 5GAN8 5GAN4 2DZ9A 3AHUA 4M7AB 5LJ3d 4XTXA 5GAMd 5GAOr 4JRKA 4M75D 4F7UG 4PJOC 4X9CA 3JB9F 4HT9A 3FJPA 2DZCA 4J5YA 2YLBA 5GMKh 4M7AF 4C92D 1I81A 4M75A 1D3BB 3JCMQ 5LJ3f 2EWNA 3JCMd 1LOJA 5LJ5d 4M75E 3JB9H 4PJOA 2YLCA 2DEQA 4OP0A 3VU3C 5GAN7 3SB2A 4M7DA 4XTZA 1BIAA 5GMKm 3RKYA 4M78F 4PJOB 3PGGA 2RD1A 5GMKe 3JCMP 1WPYA 3HFNA 1U1SA 4JLIA 2DXTA 4PJOF 4M78C 4EMHA 5GAMj 2QTXA 4M78E 4PJOD 5LJ5f 4JRIA 4A54A 2RM4A 4M78A 2K57A 4XU2A 2DTIA 3SWNA 4J6YA 3L2ZA 4M7AC 4EMKB 2FYKA 5GMKi 4NL3A 4J6XA 4M7AE 5GAOq 5LJ5j
chains in the Genus database with same CATH superfamily
1E7OA 2CS7A 2DKGA 2KAFA 1PG5B 2R5MA 1K8AR 1BKBA 1GCPA 3WVEB 4C0FA 2D8JA 1VQ7T 1M9SA 1VQOT 4QT7A 1B3QA 1YHQA 3CCST 1VQ7A 1RI9A 1WZOA 2DD5A 1YHQQ 2K79A 2DD4A 2NUPB 4ME7A 3H6ZA 3QSUA 4B9XA 1UE9A 4TVRA 2XU8A 2LJ1A 4C0ZA 3L2VA 3P8DA 2QASA 1YJNT 1NE8A 1YJWQ 3HPWA 4HVWA 4M7AA 5GAMh 1HYOA 2RQRA 2QA4T 5GAN5 4QVZA 1X75C 4KUIA 2RQTA 4DBFA 4J9BA 1QP2A 4F16A 4LD9K 4A4EA 1KG1A 1IB8A 3NTHA 1X69A 2HEQA 3OYCA 3KUFA 1UJ0A 3R6NA 1W4SA 4J7IA 3FRNA 1KQSA 4MZTA 1MGQA 1KD1R 2L5QA 2CGHA 3CBOA 3SWNC 1X01A 2M1HA 2LX9A 1OX8A 2KVQG 2P0KA 1MV0B 2GGRA 4MZMA 2CZ6B 1ARKA 2KI7A 2VWFA 3C0CA 4A4HA 2C06A 3JCMf 5GAN8 1WHGA 4F17A 4FYXB 3CPWA 3JB9F 4HT9A 1ZUUA 2MWOA 2J6FA 1VQPA 3EFOA 1I81A 4C5IA 4E7JA 2EWNA 1M3AA 1ABOA 2DEQA 2RI2A 2LT4A 2RH2A 5LL6S 1BIAA 4L5GA 2FZCB 1R8OB 1JJ2S 2AHJB 5IXBA 1Q86C 2OX7A 1WPYA 3S6WA 1BK2A 5FLXE 4HXJA 1IREB 4JRIA 2YRVA 1BYMA 2M9UA 3EHRA 3URGA 1EFNA 2DTIA 2X3XD 4IIMA 1YITA 3CEYA 5FWBA 4BD3A 1JXOA 4FT2A 1UEBA 5LJ5j 1H8KA 1ZUYA 1PD0A 3VS4A 2YRDA 2EGAA 3V8LA 4K11A 4P5NA 4ELYC 2EGEA 1N9SA 2DJQA 2A37A 4AFUC 1T0JA 2CP2A 4R55A 4JJCA 2FO0A 1V1CA 5I21A 4M7DB 4M78G 3CMAA 2GTJA 1VQ8A 2AT1B 4J7FA 3M4YA 2PVOB 3CC7T 2ATCB 1X43A 2O2OA 3MEUA 2HDAA 5GAOn 4ZGDB 1ZBJA 3LWIA 2H3JA 5I22A 3EG9B 3M54A 3CCLA 3OYDA 4RTUA 3CC4Q 1IO6A 2IIMA 4N0AA 1NEBA 5CQXA 4ZTJA 3MEAA 4A4GA 4RTXA 5AT1B 3E2UA 3CCJT 2DYIA 2NUZA 2EQUA 2V1RA 4RCCA 2EQKA 2E65A 3QUIA 5FROA 2RMOA 2OTLQ 3OYMA 2D6FA 3SDZA 5GMKj 2O9SA 1OU9A 3PT9A 5DLQE 3MP1A 2HBWA 3CXCA 3C94A 1UG1A 4X9CA 3CMAT 4C92D 1KD1C 5CO7A 3CC2A 2AK5A 1D3BB 2XDPA 3JCMQ 2WSCE 2YUPA 2DLPA 3SFMA 1GL5A 5GAN7 4XTZA 4XK8E 2RK2A 2KQWA 3X25B 3C4SA 3HFNA 1UHFA 4PJOF 2JS2A 1YJWT 4J9FA 2JT4A 3CBMA 3EH1A 3CPWP 4KT0E 2QA4Q 4LDUA 1KHIA 5KE3A 4JRQA 4J9CA 1VQKA 2QA4A 4C0DC 1AWWA 4GLKA 4RTTA 1Y96A 1H3ZA 2V8IA 3M0PA 1M1KC 2AZVA 1K76A 3INZA 2V1QA 1QWFA 3I35A 2PNIA 3BFMA 2A3LA 2QXFA 1OZ3A 3V8JA 3TSWA 2VXFA 1Y07A 4JUVA 1M5Q1 1G83A 2FRWA 4FCYA 2OTJQ 3TQ7P 1C1AA 4PK4A 1Q81R 3G1JA 4F7UB 3M0QA 2DBMA 1YI2T 5DY9A 4OMQA 3R6OA 3VS0A 1LNXA 3ASKA 1W2BS 5M9OA 2RHYA 2KY9A 4M77D 4J9EA 4M7DC 2DIGA 1TUCA 1X6OA 1I4K1 2MWPA 1X2QA 1Q7YR 2ZPFB 1RACB 4C5GA 1RL2A 2FHDA 1OU8A 2LQWA 1KD1U 3HKSA 2CDTA 3META 5CVIA 1X6BA 2F5KA 3OW2S 3TEEA 4XTXA 4RTZA 4FYVB 4RTYA 3CCMQ 1VQ5A 2DA9A 2V26A 1IGUA 5KYUB 2P4RA 1VQ6A 4HVUA 1X27A 2DFUA 2B86A 2RQWA 5GMKm 2DL7A 3EG0A 1LCKA 4NS5A 1F1BB 4FW2A 2FVUA 2RD1A 1M8MA 3CCRA 2JTEA 1VA7A 2DF6A 4IURA 2B8AA 3PMIA 4BUGA 4DOVA 3O5ZA 1ZLMA 2DRMA 1C6VX 1OPLA 3Q1JA 5HKCA 1ZHIA 2WSEE 5L8RE 4LDVA 1Q81C 1R0CB 3BE3A 1WQWA 3OYYA 2CREA 2OI3A 1M2VB 5KYYA 3OYLA 2OTLT 4BI3A 2XI9A 4KGZB 4RG2A 2YUOA 3ZBDA 1MNDA 2E10A 2F2VA 1G3TA 2RI5A 3QPHA 1OOTA 3EG9A 4J9GA 4LDYA 2QGGA 4CRIA 3OS0A 4RUGA 3QWXX 2DRKA 2EJGA 3PNWC 3JCMJ 1JB0E 4OGEA 3A8LB 1G8XA 1G3SA 2MYSA 1QVFS 4KGXB 4C8QD 3JB9I 1YBYA 1M30A 1QVGS 2RN8A 2JTMA 4Z88A 5FU6B 2K7AA 4F14A 2BZYA 2FRYA 2VVKA 1TSFA 4XQ3A 4CC3A 1YJNA 4C8QF 1VQKT 1TUGB 2YT6A 1VQMA 2G3RA 1G3YA 1ZX6A 1X2KA 3NFCA 2HZYA 1ZSZC 4IUPA 3G4ST 8ATCB 1XNIA 1WA7A 3CCUQ 1RAHB 1K8AC 2RF0A 3MO8A 4JLGA 2JXBA 4MDXA 2YLCA 2D1XA 5KYUA 2X4XA 3NPFA 2CSIA 4FYYB 2AKKA 2ABLA 1W70A 2LZ6B 3FC3A 3CMEA 1ABQA 1BI2A 1D1BA 5GAMj 5KCOA 2ED1A 1V29B 2D0NA 2K57A 4OMOA 3PVQA 2JM9A 4M7AC 3CBPA 4J6XA 3TU4K 5GAOq 2KYBA 2K3YA 1MHNA 4BB7A 5LJ3g 2QQ9A 4N4HA 3T9NA 4JS5A 2YUNA 2LMJA 1AWXA 4RCBA 5LJ3j 2QEXT 3N5BB 4E2FB 1VQMT 3PMTA 2P0PA 3I56Q 1LJOA 2JVVA 3M0TA 5CIUA 4BDYA 1RUWA 5GMKl 2Z0WA 2CUBA 2HAXA 1U06A 1Z9QA 2EGCA 4LUEA 2F5TX 3RMSA 3UT1A 1VYTA 5HY6A 1NPPA 2QEXA 2X51A 3DKMA 5GANd 3G6ET 3CMET 2X4YA 2MK5A 2YSQA 2VV5A 4QQDA 5GAOm 3VS7A 2K2MA 3OYJA 3QZ9B 4D8DA 1AT1B 3JV3A 5IAYA 1UECA 3M55A 1VQNT 2COZA 2DBKA 3A98A 3QJYA 4F7UF 3DLLA 2ZCFB 4C0GA 2CH4A 4PJJA 4M77F 1OV3A 3QWYA 2DL5A 1Y0MA 3VRYA 3NTIA 2OAUA 1Q81U 2HKQB 4RKUE 3ULRB 2RPNA 1KQSS 2O4XB 1UHCA 2DZCA 6AT1B 4BE2A 2MAMA 1WGSA 1IXDA 2EW3A 1NPRA 4KH0B 3CPFA 2W10A 2LQ8A 1QWEA 3U23A 5A0GA 1UGQB 3EGXA 1ZA1B 1AEYA 1WLPB 2FZKB 1KJWA 3OSSC 1QP3A 2EPDA 1TUDA 3UDCA 2YXYA 3L2ZA 3I5SA 3H0IA 3H0HA 1FMWA 1MMDA 4C92B 4A4FA 3A8MB 4F7UE 2ZZDA 3L2QA 3CCEQ 4M75C 3FJ5A 2DXCA 2LNHB 3CCQA 2ECZA 2PQWA 2PTKA 2XK0A 4IUVA 3V7CA 4KGVB 3QG1A 1QMCA 4E7LA 2I2LA 2DMOA 3E9FA 2XIDA 3AT1B 2CKKA 2ZPBB 2OJ2A 4FU6A 5LJ5e 1JRIA 2MOXA 2X9HA 3HRUA 1M90R 2FL7A 3MJXA 2RJEA 1OPKA 3G4SQ 4C92E 4MMKA 2GQVA 3M0RA 4JJBA 5GJVB 4LE9A 2D9TA 4M77E 3M9QA 4WF2A 1ZA2B 2DNUA 4PNOA 4GBQA 1OULA 1PC0A 4M7DE 1MNEA 3OMCA 7AT1B 2ZPGB 2QQAA 2QQSA 3EFRA 2VKNA 1NLPC 3QIIA 3D7SB 3KFVA 4OB1B 1M2OA 2QAZA 1M1FA 4J83A 1WJRA 1JBMA 2PZ1A 1FYNA 2JTFA 1PCXA 4RTVA 4RG8A 5J26A 3HHTB 4KRTA 2CUDA 1ACMB 3PFSA 1R77A 3HRSA 2P84A 2E4HA 1FWZA 3OYGA 3I56A 4M78F 3CC7Q 1VQNA 3EGDB 2M16A 2GF7A 3LLRA 1VQ4Q 1PRMC 3EGXB 1VQ4A 3ZFJA 2PU9B 1NBEB 4BACA 4JDSA 5IHIA 3G6EQ 3CMEQ 4IUUA 2DVJA 1WHJA 2LNVA 2QQRA 1HSQA 2A0FB 3RNJA 4KH1B 3GNGA 3CCJQ 2JMCA 1GCQA 3BY7A 3CC7A 2E12A 1VQNQ 2BE9B 2DTHA 4QVCA 2DE0X 4KBMB 3OS1A 3CCVT 3EH2A 4HT8A 1T0HA 2FB7A 2NUTB 1CKBA 4M7DF 4EMGA 1SHFA 1WQ7A 2RJCA 3JB9D 4HCZA 1W2BP 2NUPA 1QCFA 2R57A 4A63B 3CMAQ 1N5ZA 2ROLA 4HCKA 5KYXA 4F7UA 3OA6A 4ZGEB 1W1FA 2LQNA 3M57A 4QW2A 3A8HB 5HK3A 5CK9A 1U1TA 3OBYA 1YCYA 3I55Q 1A0NB 4DEXA 3SEMA 2V8KA 4E7SA 4KULA 2EJFA 5CR2A 1R0BG 1QQJA 3CC4A 3G71A 1MMGA 1VYUA 1K73R 2E3HA 2HQHA 1KC8C 2COWA 2FG0A 2PVGB 1QW1A 1W2BA 5LJ5h 4L59A 3ZEHA 3CCET 2K5LA 4A53A 3OYHA 4NL2A 2VGMA 4PKCC 3G7ZA 5D6YA 4X1VA 2EQMA 5DLOA 4M75D 4F7UG 1RLQC 5GMKh 1M1KR 5CKDA 3M58A 1PKSA 4M75E 2KSSA 2VYTA 3VKIA 2CP0A 3RKYA 1JJ2P 3J80E 2E5QA 4JLIA 2XKOC 2YWWA 2EYYA 3GBQA 4EMHA 5CKHA 1YI2Q 2RM4A 2ED0A 1D1AA 3EFOB 1UFFA 3SWNA 1GFDA 3P8HA 2Y4YA 2K9GA 4C5HA 4M7AE 1I07A 4DQ2A 2NUTA 3JB9J 2FPDA 1YFNA 4AT1B 2L3PA 1GXIE 1UJYA 3PIOA 4D8KA 4X9DA 1VQ5T 1WFWA 2F1LA 2K2VA 4HCBA 2CT3A 1Q86R 1OYXA 3CCEA 1XOVA 1XJWB 3EAEA 5IHNA 3PIPA 2A28A 3WVDB 2JZ2A 1PHTA 4OB0B 4FL6A 4CC7A 2YDLA 3H41A 3CCRQ 5GAOl 1KQSP 2KEAA 3QZ5B 2GBQA 2RI3A 3CCMT 3JRZA 2R5AA 2QG9B 4NOYA 3A8OB 3L42A 1D1CA 1RLPC 1VQPQ 3TCJA 3H9NA 1K4US 1XTDA 2R58A 4HKEA 1AVZC 3HFOA 3SWNB 1Y7XA 3OYFA 2RQUA 2JM8A 1VIEA 4XU3A 3HRTA 3LGLA 4J6WA 4Y92A 1Q7YU 3JCMb 3GLXA 1Y57A 5GAOr 3OMGA 2F2XA 4AMCA 4M7AF 1PNJA 1TS9A 1WXUA 4LUDA 3CCVQ 1WXTA 3EGDA 2O88A 1M3BA 1AHJB 4N4GA 3JCMd 5LJ5d 3CCVA 2IPOB 3UWNA 1G3WA 5HCKA 1IHVA 1M1GA 5EC7A 3VRZA 1ZQ1A 4OMFB 2C0IA 3X28B 1UGSB 2KMTA 3VYGA 1SF9A 4DA4A 2HMAA 2NYSA 4E7HA 2IG0A 1HK9A 1ZBXA 5KYYB 1BCMA 4R56A 3EFSA 2L89A 4M7AD 1YIJQ 1IGQA 2JJ9A 4M77B 4XTYA 4FSXA 2HBPA 1NJIR 2MMPA 4GY5A 1BU1A 2KRNA 3JCMV 3A5ZB 2I0NA 3MEVA 2KT8A 1GBRA 2E6NA 2DIQA 2AZSA 4FW1A 2ENMA 1OZ2A 4OF1A 3RDVA 2DO3A 2EQIA 1SKUB 1QKXA 3CCQT 2CZ7B 4OMMA 2MCNA 2QK0A 4EPCA 3CCLQ 1ZUKA 9ATCB 2COYA 4M78D 1OQKA 2BE7D 2BKDN 1LPLA 1YCSB 4ZTFA 2HL3A 5L23A 2EBPA 1C0MA 2A7YA 1YP5A 3HSBA 1JEGA 2WACA 5GAMg 1Q7YC 4IUQA 3RKWA 1TH7A 3QXEB 3QYGB 3S3MA 1BI0A 3F70A 1WI7A 1JO8A 2XDBA 3CD6A 1G5VA 2WSFE 1D0XA 5CKBA 5FU7C 4Y91A 1KC8U 3HTRA 2JMAA 5GAMd 2QEXQ 1D0ZA 2NLUA 4J5YA 1VQMQ 3RR6A 5A0DA 4JZ4A 3TVTA 3CC2Q 4E7ZA 4ZN3A 3CCRT 3J7AF 3TSZA 1SSFA 4O6JA 5A2QE 3MHXA 1WJSA 1GBQA 5KYNA 2BTTA 2O31A 5FU7B 5LJ5f 2RJFA 2JS0A 4PFZA 4JS4A 3LX7A 1WIEA 4F04B 2J6KA 5GMKi 2DM1A 2OTJA 2P0QA 2KR3A 2D0QB 2LJ0A 4LDXA 3V8KA 1YI2A 1JJ2A 3JAME 1KQ1A 2K4YA 2K3BA 4M75F 3VYHB 3E19A 1E6HA 2DEUA 3JCMh 1B34B 4BE0A 1VQ9Q 4ANJA 4M7AG 4LXCA 1N8RC 1YNZA 3X24B 4DBRA 1E6GA 3VS2A 3RBBB 1Q82U 4M77G 3MPUB 3PVLA 2VXEA 2J6OA 2DL4A 1T3LA 3ZL7C 3JB9G 4IUTA 3SHWA 2DXUA 3LH0A 2CSQA 1WJQA 2L2PA 2F69A 2DJZA 2P4TA 3CCSA 5A0LA 4C92G 4BY6B 3H8ZA 1AWJA 3QDFA 4VUBA 5GAN2 2K6DA 2XD0A 4C8QA 3QDRB 1H92A 2JNGA 4HVVA 4M7DD 1S1NA 1RAGB 2EJ9A 4EMKC 3OS5A 1VQLQ 3RKXA 4N0AC 1HJDA 2LP5A 4AFQC 1K9MC 4QQGA 1YIJT 2J06A 1TWBA 2EIFA 5LJ3d 1YIJA 3FLGA 2EKOA 3O8VA 5CQYA 4OVAA 1KIKA 3HP9A 1Q86U 1LOJA 2KE9A 5FRMA 2K5IA 2RHZA 4PFOA 3MP8A 3J81E 3EG2A 3HL8A 1K8AU 1U1SA 2KRSA 4LN2A 4HCCA 4ELZC 3MKDA 2CP7A 4ORZA 1BCOA 2QDYB 5GANh 4E6RA 1N27A 4UC4A 3JCMg 3CQTA 3BDLA 2VC8A 1K73U 5GAOp 1MMNA 3OYAA 2KK4A 4EIKA 1K73C 1I0CA 1UGPB 3GF5A 3LGFA 3M4GA 3V7SA 2ZPIB 5CAIA 3EGUA 1K1ZA 2JW4A 2O01E 3OBWA 2D8HA 1OI1A 3RESA 1QVFP 2LDMA 2HNIA 5KYWA 2E5KA 2RHIA 4Z02A 4ATOA 3RERA 1K9MR 2LX7A 2GFAA 2QGFB 5IHKA 1RAEB 4BDZA 2VUBA 1WHLA 1VQ4T 4QQ6A 4C8QE 2VB6A 5EG2A 4J9HA 2DETA 4XTVA 4E7KA 3QO3A 3VS1A 2PUKB 1ZSZA 3L2RA 2E1HA 5GAMf 4J8OA 4C92C 3I9QA 5KYXB 4EMKA 4C8QG 2J05A 2DZ9A 2H3EB 1YITQ 3AHUA 5DM7R 3VS5A 1RAFB 2GCXA 2EFIA 3JSCA 1NYGA 1YJ9A 1AWOA 2EKHA 1MMAA 1Q82C 3JCMP 3OW2A 3G71Q 1M27C 1GRIA 3EG1A 1NJIC 4BE1A 2CZ0B 2HCKA 2CP6A 2OAWA 1N8RR 1GCQC 1VYVA 4ESRA 4BI8B 1N6AA 4BI4A 5D6WA 1VQ8Q 5ECAA 5GANg 2EAYA 2XICA 4R0KA 4QVDA 1YJ9Q 3I55T 2A36A 5KH6A 3VV0A 4O5VA 4B6MA 2LVMA 3E1SA 3G6EA 3L2UA 1NZ9A 5FWCA 4DBQA 4V2SA 3RMQA 2NWMA 1EX4A 3SD4A 4XTUA 1AZEA 1KFZA 1VQLT 1GFCA 4XU0A 1B7TA 1UUEA 5GAN6 3DB3A 5C6SA 2EYZA 1VQOA 3NTKA 1KC8R 3UA7A 1T3SA 2JN0A 2X3WD 1P92A 3MCAB 4OB2B 1VOMA 2KNBB 2XMFA 5CKEA 3RIRA 4D6WA 2X4WA 3LWHA 2A08A 1JXMA 3LW5E 2QDLA 1UDLA 4OB3B 4M75G 4AFZC 2M02A 1K0SA 1M90U 4Z89A 1VQ7Q 1TOVA 3KBGA 1QVFA 3CCSQ 2V8JA 1YHQT 2XHCA 2HQXA 2MF2A 2GQIA 5GANe 3GIBA 1UB4A 1G2BA 1U5SA 3TREA 4KUDK 4AFSC 1VQ5Q 1FX7A 1YJNQ 4PJOC 1WX6A 2YLBA 1VQLA 1PSFA 3S3OA 1VQ6Q 3GNFB 2W0ZA 1JQQA 4PJOA 3JB9H 4J9IA 4WCIA 3VUBA 4M7DA 2RO0A 1BBZA 4N4IA 4LD6A 3CCUA 3CXCP 3H0FA 3EHQA 4M78C 4LDWA 2QTXA 3REAB 2HSEB 2L8DA 4OMNA 2QTVA 2ZPHB 4J6YA 4J9DA 2DPPB 2YUQA 1TU0B 4RMOA 2L3RA 1WHKA 4M77C 1O75A 1QCNA 2ZPEB 1TXQA 2EQJA 2KYMA 3I5RA 1WYXA 3JCMX 3UATA 2VGNA 2CYZB 1PKTA 1VQPT 3OW2P 1NM7A 4PFPA 2JOYA 4M78B 4MDWA 2L0AA 3QHSA 1NG2A 2FZGB 5KCHA 5IT9E 1DJ7B 1QLYA 3QKJA 4WTOB 1HXDA 3THKA 3RUXA 1M3CA 5LJ3h 1SPKA 3FB9A 4C0DB 1K9AA 3V7RA 2RQVA 2KXCA 3GOXA 2DVEA 2X35A 1YITT 2G6FX 1OEBA 4X34A 5IH2A 5GANf 2BIVA 1RAIB 2LCCA 2SRCA 3OYBA 4PJLA 1D3BA 4PJOG 1S72Q 4QKUA 2GNCA 1KHCA 1WXBA 3NMZC 4GLMA 3G71T 4JJDA 1PWTA 1XQHA 4RTWA 2FPFA 2M51A 2HSPA 3JCMe 3CPWS 2O4XA 4PJMA 1VQ8T 5CKFA 4YTLA 2CT4A 1LVKA 3JCMW 3OYNA 3PE0A 3LH5A 4M7AB 1AD5A 2CP3A 4ZGJB 1PM3A 3QJ6A 1K9MU 1MUZA 1IRXA 1WHHA 3X20B 4M75A 3CCMA 4AG1C 1SEMA 4E7IA 1PRLC 2GFUA 1BB9A 3OYEA 3VU3C 3OY9A 5C0MA 2JUFA 3ER0A 4PJOB 2C0OA 3PGGA 1MV3A 1RADB 2LC4A 1QKWA 2GTOA 2QI2A 2BZXA 2KDSA 1AZGB 1Q95G 3DLMA 2DX1A 2OTLA 3NHNA 3MP6A 2ROTA 3CCQQ 2AKLA 2RK1A 4IIOA 5KE2A 1SHGA 3CCLT 2DL3A 1YWOA 2PVDB 1RI0A 1M90C 2RA2A 1NJIU 4MMLA 1YJWA 2E3IA 4AG2C 3PTAA 3REBB 4MZPA 4Z8AA 2KRMA 3FIFA 2ZGWA 3DB4A 3ME9A 4PL6A 1EIFA 1QVPA 1KSWA 2IVWA 2J7IA 2M0OA 2QYZA 1M2VA 1NYFA 1OX9A 3M0SA 1N8RU 4CC2A 3OYKA 1K0XA 3C12A 2HKNA 2HL5C 1N9RA 3S3NA 3OQ5A 2LCSA 3M0UA 4C8QB 3CD6T 2H8HA 1VQ6T 1O9SA 3CC2T 2EYWA 4PJOE 2RHXA 1X6GA 4M77A 3CXCS 2E41A 1RABB 4C8QC 2K5FA 5J3BA 5GANj 4XU1A 1WNLA 2ESWA 1TTHB 1NEGA 4M7DG 2KROA 2OTJT 1Z9ZA 2YHTA 3OB9A 5D6XA 5GAN4 1SRLA 4JRKA 1VQ9T 4JJNK 3OYIA 1SSHA 1S72A 2BZ8A 5LJ3f 1VQ9A 3VS3A 1UGVA 4DEYA 5GMKe 1NLOC 2LJ3A 4PJOD 3UPUA 4FSSA 3P8BB 3EG3A 1I1JA 3UF4A 3M53A 1M1KU 3OSVA 1S72T 4C5EA 3VJPA 1M8VA 2HQEA 5FU6C 1Y71A 2Y90A 4C92F 4M75B 1RAAB 2F2WA 1B34A 1TG0A 5GAMe 1PD1A 3WXMB 4FT4A 4L6V5 3FEOA 3UA6A 1V76A 2FPEA 3M5AA 3NGPA 5GAN3 3MEWA 2DILA 1IHWA 3CCJA 2E64A 4B9WA 2XDDA 2EYXA 1ZSGA 4PLIA 1WHMA 5J39A 2KXDA 3E9GA 3X26B 1H3HA 4IKFA 1YWPA 1UTIA 2L3QA 2VASA 2AIRB 4FM4B 3L2WA 1I5LA 5LJ5g 1CKAA 3VUZA 4CC4B 3A1PA 5GJWB 1QCOA 4E47A 4II1A 1VQOQ 1M4ZA 2RB6A 1IZ6A 1UGRB 3BDUA 1BI3A 5FW9A 2LT1A 2KT1A 5KYWB 2EVRA 4JPBW 2ZAEA 3GP8A 2DERA 3VS6A 3FJPA 4LNPA 3GPLA 2RHUA 2Y4XA 1SRMA 1CSKA 2E6ZA 1FMVA 5I11A 3M59A 2KGTA 2L3SA 1J3TA 1FMKA 1FXXA 2MIOA 2KBTA 2QQBA 4M78E 2FEIA 2LCLA 4CI0C 3CD6Q 4JZ3A 4A54A 2SEMA 3IQLA 4XU2A 1SG5A 4EMKB 2FYKA 4NL3A 1PSEA 2YRCA 2RNAA 5IXFA 1VQKQ 3G4SA 1QVGP 3OS2A 3L1AA 4HA8A 4FIBA 1BIBA 2X4JA 5CCAA 1BI1A 2XG8D 3CCUT 4XTWA 3KXTA 1Q82R 1H641 1YN8A 3QYHB 3BW1A 2CH4W 2LRQA 4OMLA 4BY6C 2DK3A 1HD3A 3JCMc 2CZ1B 1I8FA 2HD0A 2PUOB 3C95A 2C0TA 2BUDA 4Q5WA 1QVGA 1EZZB 2LTOA 5I2SA 3A8GB 2DYBA 1I5OB 5FRNA 4EDUA 4A4KA 5HK0A 3LYIA 2DTOA 1ZSZB 3M56A 5AYFA 2CP5A 8AT1B 5IN1A 2DXBA 1B07A 1VUBA 1KQ2A 3I56T 1YJ9T 5LJ3e 4PLLA 1Y96B 4C92A 2RJDA 1VIFA 2K3XA 2DAQA 2MPXC 3I55A 4PJNA 4OMPA 1U8RA 5I2MA 4DOWA 1D09B 2E70A 3QBYA 4JRPA 4FYWB 4Y28E 4ZN1A 3CC4T 4OP0A 2DL8A 3SB2A 2O9VA 4M4ZA 4DBHA 1WDXA 2EYQA 2LQKA 1AOJA 2DXTA 4OGCA 3FDRA 1D0YA 1JU5C 5D7UA 2M0YA 1U3OA 1KK7A 4XAXB 4M78A 1W6XA 4ZNXA 2MI6A
chains in the Genus database with same CATH topology
2IG0A 4M77C 1HK9A 4BB7A 5LJ3g 1O75A 2ZPEB 2EQJA 2QQ9A 1ZBXA 2CS7A 2DKGA 3JCMX 2KAFA 4N4HA 2VGNA 2R5MA 3T9NA 4R56A 3EFSA 2L89A 4M7AD 2CYZB 4JS5A 1BKBA 3WVEB 1VQPT 4C0FA 1VQ7T 1M9SA 1VQOT 4RCBA 2JOYA 4M77B 4M78B 5LJ3j 2QEXT 4MDWA 3N5BB 4XTYA 3QHSA 2HBPA 3PMTA 4FSXA 3CCST 1VQMT 2MMPA 1VQ7A 2DD5A 2P0PA 5KCHA 4GY5A 5IT9E 1DJ7B 2DD4A 3QKJA 4ME7A 3H6ZA 3JCMV 1HXDA 3A5ZB 3RUXA 1LJOA 2JVVA 5LJ3h 4B9XA 3QSUA 5CIUA 3FB9A 3MEVA 4TVRA 2XU8A 4C0DB 4BDYA 3V7RA 5GMKl 3GOXA 2DVEA 2E6NA 2DIQA 4C0ZA 3L2VA 3P8DA 2HAXA 2X35A 1YITT 1OZ2A 4OF1A 1YJNT 1NE8A 2F5TX 4X34A 3RMSA 3HPWA 3UT1A 2BIVA 5GANf 5GAMh 2DO3A 4M7AA 5HY6A 2QA4T 2LCCA 1NPPA 5GAN5 4QVZA 1X75C 2QEXA 2CZ7B 4KUIA 3OYBA 3CCQT 1D3BA 4PJOG 3DKMA 5GANd 3G6ET 3CMET 1QP2A 2X4YA 4EPCA 4LD9K 2VV5A 4A4EA 1KG1A 3NTHA 4QQDA 5GAOm 4M78D 1KHCA 2BKDN 3OYCA 3OYJA 3QZ9B 3KUFA 3G71T 4ZTFA 1W4SA 4J7IA 3FRNA 1KQSA 1XQHA 5IAYA 2A7YA 4MZTA 3M55A 1VQNT 1MGQA 2L5QA 2CGHA 3JCMe 3CPWS 3HSBA 2WACA 3CBOA 3QJYA 5GAMg 3SWNC 4F7UF 1X01A 3DLLA 1Q7YC 2M1HA 2LX9A 2O4XA 2KVQG 1TH7A 4IUQA 2ZCFB 3QXEB 3QYGB 3RKWA 5CKFA 4C0GA 1VQ8T 2P0KA 4M77F 4YTLA 4MZMA 3S3MA 2CZ6B 1BI0A 3F70A 1G5VA 3NTIA 2XDBA 3CD6A 3JCMW 2WSFE 2OAUA 5CKBA 5FU7C 3OYNA 1Q81U 4A4HA 2C06A 4RKUE 3JCMf 1KQSS 4Y91A 5GAN8 1KC8U 2O4XB 4M7AB 5GAMd 4ZGJB 3QJ6A 3CPWA 1K9MU 3JB9F 2DZCA 2NLUA 2MWOA 4J5YA 4HT9A 5A0DA 2MAMA 4BE2A 1VQPA 1I81A 3X20B 4M75A 3CCMA 1WGSA 4C5IA 4E7IA 4E7JA 2EWNA 1NPRA 3CPFA 2GFUA 2LQ8A 4ZN3A 3OYEA 2DEQA 3VU3C 5A0GA 2RI2A 3OY9A 2LT4A 2RH2A 5LL6S 1BIAA 1UGQB 4L5GA 5C0MA 4RMOA 2JUFA 1R8OB 1SSFA 3ER0A 2AHJB 4O6JA 3MHXA 5A2QE 1WJSA 1Q86C 3PGGA 1JJ2S 4PJOB 1WPYA 2LC4A 3S6WA 2QI2A 5FLXE 5FU7B 2KDSA 5LJ5f 1IREB 2RJFA 4JRIA 2YRVA 1QP3A 3OSSC 1BYMA 2M9UA 3DLMA 4JS4A 3URGA 3LX7A 3UDCA 2OTLA 2DTIA 3L2ZA 3MP6A 1YITA 5GMKi 2RK1A 3CEYA 4BD3A 2OTJA 2P0QA 4FT2A 1UEBA 5KE2A 5LJ5j 2D0QB 3CCLT 4C92B 2PVDB 1RI0A 4A4FA 4LDXA 3A8MB 3V8KA 4F7UE 1YI2A 2RA2A 2ZZDA 1NJIU 4MMLA 1M90C 3JAME 1JJ2A 3L2QA 1KQ1A 3PTAA 1YJWA 2K4YA 4M75C 4MZPA 3V8LA 2DXCA 4M75F 3VYHB 3E19A 4P5NA 3CCQA 4ELYC 1N9SA 2PQWA 2XK0A 3FIFA 4IUVA 2ZGWA 3JCMh 1B34B 3V7CA 4BE0A 3DB4A 3ME9A 3QG1A 4PL6A 1EIFA 4M7AG 4E7LA 4R55A 1QVPA 2I2LA 1N8RC 3E9FA 2IVWA 2M0OA 2XIDA 2CKKA 4E7HA 2ZPBB 3X24B 5I21A 4M7DB 4FU6A 4M78G 1JRIA 5LJ5e 3CMAA 1N8RU 3HRUA 3OYKA 1Q82U 4M77G 1VQ8A 3C12A 4J7FA 1N9RA 2PVOB 2FL7A 3M4YA 3CC7T 2VXEA 2RJEA 3S3NA 4C92E 3OQ5A 4MMKA 2GQVA 4C8QB 3CD6T 3MEUA 5GAOn 4ZGDB 3LWIA 3JB9G 1VQ6T 2H3JA 4IUTA 1O9SA 2D9TA 4M77E 3M9QA 2DXUA 3M54A 3LH0A 4WF2A 3CC2T 3OYDA 3CCLA 1WJQA 2F69A 2DJZA 4PNOA 2P4TA 4N0AA 5CQXA 3CCSA 4ZTJA 5A0LA 4PJOE 3MEAA 4C92G 4BY6B 3H8ZA 4M7DE 3OMCA 4A4GA 2RHXA 4VUBA 5GAN2 2ZPGB 3CCJT 2QQAA 2QQSA 2XD0A 4C8QA 4M77A 3QDRB 3EFRA 3CXCS 2E41A 2EQUA 2JNGA 3QIIA 4C8QC 2K5FA 4RCCA 4M7DD 2EQKA 2E65A 2EJ9A 3QUIA 5J3BA 5FROA 5GANj 4XU1A 3OYMA 2D6FA 1WNLA 4EMKC 4OB1B 3OS5A 3SDZA 3RKXA 4N0AC 4M7DG 1M1FA 5GMKj 4J83A 2OTJT 1WJRA 1K9MC 2YHTA 1JBMA 4QQGA 1YIJT 3OB9A 2JTFA 3PT9A 5D6XA 5DLQE 5GAN4 2EIFA 3MP1A 3CXCA 5LJ3d 3C94A 4JRKA 1YIJA 4X9CA 4RG8A 1VQ9T 4JJNK 3OYIA 5J26A 3HHTB 3CMAT 4C92D 1KD1C 3FLGA 5CO7A 3CC2A 1S72A 1D3BB 2EKOA 2XDPA 3O8VA 5CQYA 4OVAA 5LJ3f 3JCMQ 1VQ9A 3HP9A 1Q86U 2WSCE 3PFSA 3HRSA 1LOJA 3SFMA 1FWZA 5GAN7 5FRMA 4XTZA 2K5IA 2RHZA 4XK8E 3OYGA 2RK2A 2KQWA 3MP8A 4M78F 3J81E 3I56A 3X25B 3HL8A 3C4SA 5GMKe 1K8AU 3HFNA 1VQNA 1U1SA 2M16A 2GF7A 4PJOF 1YJWT 4PJOD 3UPUA 3LLRA 3CCRT 3CBMA 3P8BB 4HCCA 4KT0E 1VQ4A 4LDUA 1KHIA 5KE3A 3ZFJA 2PU9B 4ELZC 3M53A 4JRQA 4BACA 1M1KU 4JDSA 1VQKA 2QA4A 4C0DC 3OSVA 4GLKA 4IUUA 1S72T 4C5EA 1Y96A 3VJPA 2LNVA 1M8VA 1H3ZA 2HQEA 2QQRA 2V8IA 1Y71A 5FU6C 2QDYB 2Y90A 5GANh 1M1KC 4C92F 4M75B 1N27A 3INZA 4UC4A 1B34A 5GAMe 3GNGA 3BFMA 3JCMg 2A3LA 2QXFA 1OZ3A 3V8JA 3CC7A 3BY7A 2E12A 3WXMB 3BDLA 4FT4A 2DTHA 4L6V5 3FEOA 4QVCA 2VXFA 1Y07A 2VC8A 1K73U 4KBMB 3OS1A 4JUVA 3CCVT 5GAOp 3M5AA 5GAN3 3MEWA 3OYAA 1M5Q1 2KK4A 2E64A 3CCJA 4HT8A 2FB7A 4B9WA 1K73C 4M7DF 1UGPB 3GF5A 3LGFA 2XDDA 3M4GA 3V7SA 4F7UB 2ZPIB 5CAIA 4EMGA 2O01E 3OBWA 4PLIA 1YI2T 5J39A 1WQ7A 2RJCA 1OI1A 3JB9D 3RESA 4HCZA 2R57A 2LDMA 2HNIA 3E9GA 5DY9A 3X26B 4IKFA 4F7UA 3OA6A 4ZGEB 2RHIA 3M57A 4FM4B 4QW2A 3R6OA 4Z02A 3L2WA 3A8HB 5LJ5g 1I5LA 4ATOA 1LNXA 3ASKA 3VUZA 5HK3A 5CK9A 1W2BS 3RERA 5M9OA 2RHYA 1U1TA 2KY9A 3OBYA 1YCYA 4M77D 2GFAA 4M7DC 2DIGA 1X6OA 4E47A 2V8KA 1I4K1 4BDZA 2MWPA 2VUBA 4KULA 2EJFA 4II1A 5CR2A 1VQ4T 2ZPFB 3CC4A 3G71A 4C5GA 4QQ6A 4C8QE 1M4ZA 5EG2A 1RL2A 2RB6A 1IZ6A 4XTVA 1KC8C 1UGRB 4E7KA 3BDUA 3QO3A 2FHDA 2PUKB 2PVGB 1BI3A 1QW1A 3L2RA 1W2BA 2E1HA 5LJ5h 1KD1U 3HKSA 4L59A 5GAMf 3META 2LT1A 4J8OA 5CVIA 3ZEHA 4C92C 2K5LA 3CCET 4A53A 2F5KA 3OYHA 4NL2A 2VGMA 4PKCC 4EMKA 3OW2S 3G7ZA 5D6YA 4C8QG 3GP8A 1YHQA 2DZ9A 2EQMA 3TEEA 5DLOA 3AHUA 4XTXA 5DM7R 4M75D 4F7UG 3FJPA 5GMKh 1VQ5A 5CKDA 2GCXA 2EFIA 3GPLA 3JSCA 1YJ9A 2RHUA 2Y4XA 3M58A 1VQ6A 4M75E 2KSSA 2E6ZA 2VYTA 3VKIA 3M59A 5GMKm 3RKYA 4NS5A 1Q82C 2FVUA 2RD1A 3J80E 3JCMP 3OW2A 1FXXA 2E5QA 3CCRA 2XKOC 4JLIA 4EMHA 5CKHA 2QQBA 4IURA 4M78E 2LCLA 4CI0C 2B8AA 1NJIC 4A54A 2RM4A 2CZ0B 3PMIA 4BUGA 4BE1A 4DOVA 4XU2A 3SWNA 4BI8B 3P8HA 2Y4YA 4EMKB 2FYKA 4NL3A 4C5HA 1N6AA 4BI4A 5D6WA 4M7AE 1PSEA 5GANg 2EAYA 2XICA 4DQ2A 3G4SA 4QVDA 3Q1JA 5HKCA 1ZHIA 2WSEE 5L8RE 3OS2A 4LDVA 3I55T 1Q81C 3L1AA 3JB9J 4HA8A 4FIBA 5KH6A 1MHNA 3VV0A 1GXIE 1WQWA 3PIOA 1BIBA 4O5VA 4X9DA 2LVMA 1VQ5T 2X4JA 3E1SA 3OYYA 5CCAA 3G6EA 3L2UA 1NZ9A 1BI1A 2XG8D 3CCUT 2K2VA 4XTWA 3KXTA 4HCBA 4V2SA 3RMQA 1H641 1OYXA 3QYHB 3OYLA 3SD4A 1XOVA 3BW1A 4XTUA 3CCEA 3EAEA 4BI3A 3PIPA 2OTLT 2XI9A 3WVDB 2JZ2A 1VQLT 2LRQA 4BY6C 4OB0B 2DK3A 4RG2A 4XU0A 3ZBDA 4FL6A 5GAN6 2E10A 2RI5A 1G3TA 3QPHA 3JCMc 2CZ1B 3DB3A 5C6SA 1VQOA 3NTKA 5GAOl 2JN0A 1I8FA 1P92A 2HD0A 2PUOB 3C95A 3MCAB 4LDYA 4OB2B 4CRIA 2EJGA 3OS0A 3QZ5B 2BUDA 3PNWC 4Q5WA 3JCMJ 1QVGA 2RI3A 3CCMT 1JB0E 4OGEA 3A8LB 3JRZA 1G3SA 2R5AA 5CKEA 3RIRA 4PJOA 1QVFS 4D6WA 2LTOA 2X4WA 3LWHA 4NOYA 5I2SA 3LW5E 3A8OB 3L42A 4OB3B 4M75G 4C8QD 3J7AF 1M90U 3A8GB 3JB9I 5FRNA 4EDUA 4A4KA 5HK0A 1YBYA 3TCJA 1QVGS 2JTMA 3LYIA 5FU6B 1XTDA 2DTOA 2R58A 3KBGA 3M56A 5AYFA 1QVFA 4HKEA 2V8JA 3HFOA 3SWNB 2XHCA 1Y7XA 2HQXA 4XQ3A 5IN1A 3OYFA 1YHQT 1YJNA 2DXBA 4C8QF 1VUBA 1VQKT 3I56T 2MF2A 1VQMA 1KQ2A 1VIEA 2G3RA 1G3YA 4XU3A 4PLLA 5GANe 5LJ3e 1Y96B 1YJ9T 4C92A 3GIBA 3HRTA 2RJDA 3LGLA 4J6WA 1UB4A 3NFCA 3TREA 1Q7YU 4KUDK 1VIFA 4IUPA 3JCMb 3GLXA 2K3XA 3G4ST 1FX7A 2DAQA 1XNIA 5GAOr 3I55A 4PJOC 3OMGA 4M7AF 2YLBA 1U8RA 1K8AC 1VQLA 1PSFA 3S3OA 3GNFB 5I2MA 4DOWA 3MO8A 2E70A 1AHJB 3QBYA 4JLGA 4N4GA 3JCMd 5LJ5d 3CCVA 4JRPA 4Y28E 4ZN1A 3CC4T 2YLCA 3JB9H 4MDXA 4OP0A 3VUBA 3SB2A 3UWNA 2RO0A 2X4XA 1G3WA 4M7DA 4N4IA 4LD6A 1M1GA 2EYQA 2LQKA 3FC3A 3CMEA 3CCUA 1ZQ1A 1BI2A 2DXTA 5GAMj 4M78C 4OMFB 4LDWA 4OGCA 3FDRA 5KCOA 2QTXA 3X28B 2L8DA 1V29B 4XAXB 1UGSB 2KMTA 2ZPHB 2K57A 4M78A 3VYGA 4J6YA 4DA4A 4M7AC 3CBPA 4J6XA 2DPPB 5GAOq 3TU4K 2K3YA 2MI6A 2L3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M77 C;  1HK9 A;  5LJ3 g;  5GAN g;  1Y96 A;  1M8V A;  2EAY A;  4C92 B;  4DQ2 A;  4QVD A;  4F7U E;  3V8K A;  2RA2 A;  2Y90 A;  5GAN h;  2DKG A;  4MML A;  3JCM X;  4C92 F;  4M75 B;  3L1A A;  1KQ1 A;  3INZ A;  3JB9 J;  3EFS A;  4M7A D;  1B34 A;  4HA8 A;  4M75 C;  5GAM e;  3V8L A;  4M75 F;  1WQW A;  3BFM A;  1BIB A;  3JCM g;  1N9S A;  4X9D A;  3FIF A;  3V8J A;  2ZGW A;  3BY7 A;  3JCM h;  1B34 B;  4RCB A;  3V7C A;  4M77 B;  2DTH A;  4M78 B;  4QVC A;  5LJ3 j;  2VXF A;  4XTY A;  3QHS A;  4M7A G;  2I2L A;  4XTW A;  4V2S A;  2VC8 A;  4JUV A;  1H64 1;  5GAO p;  3BW1 A;  4XTU A;  3JCM V;  1HXD A;  5GAN 3;  1M5Q 1;  3RUX A;  5I21 A;  1LJO A;  4M7D B;  4M78 G;  1JRI A;  2E64 A;  5LJ3 h;  5LJ5 e;  4HT8 A;  2FB7 A;  3FB9 A;  4XU0 A;  3QSU A;  4M7D F;  4M77 G;  5GAN 6;  2E10 A;  3V7R A;  3JCM c;  1N9R A;  3M4G A;  5GMK l;  2VXE A;  3V7S A;  2DVE A;  4F7U B;  5CAI A;  4EMG A;  2JN0 A;  1I8F A;  4C92 E;  5GAO l;  4MMK A;  2EJG A;  4C8Q B;  1WQ7 A;  3JCM J;  3JB9 D;  5GAN f;  4M7A A;  3RES A;  5GAO n;  5GAM h;  3JB9 G;  2HNI A;  5DY9 A;  4M77 E;  3RIR A;  5GAN 5;  2DXU A;  4F7U A;  4WF2 A;  1D3B A;  4PJO G;  4NOY A;  5GAN d;  1I5L A;  2DJZ A;  5LJ5 g;  4PNO A;  1LNX A;  4M75 G;  4N0A A;  3RER A;  1U1T A;  5GAO m;  4M78 D;  4M77 D;  1YCY A;  4PJO E;  4C8Q D;  4C92 G;  4M7D C;  3JB9 I;  1I4K 1;  4M7D E;  5GAN 2;  2EJF A;  4C8Q A;  4M77 A;  3EFR A;  2E41 A;  1MGQ A;  3HSB A;  2CGH A;  3JCM e;  4C8Q E;  2DTO A;  5GAM g;  2RB6 A;  4C8Q C;  3SWN C;  4RCC A;  1X01 A;  4F7U F;  4XTV A;  3QUI A;  2E65 A;  2EJ9 A;  3HFO A;  1TH7 A;  3BDU A;  3QO3 A;  4XQ3 A;  3RKW A;  3SWN B;  5GAN j;  4C8Q F;  4XU1 A;  4M77 F;  1WNL A;  4EMK C;  1KQ2 A;  4M7D D;  4XU3 A;  5GAN e;  5LJ3 e;  2E1H A;  5LJ5 h;  1Y96 B;  4N0A C;  3RKX A;  4C92 A;  5GAM f;  3GIB A;  4M7D G;  5GMK j;  4C92 C;  3JCM W;  4J6W A;  2YHT A;  1JBM A;  4A53 A;  4NL2 A;  3JCM f;  4EMK A;  4Y91 A;  4C8Q G;  3JCM b;  5GAN 8;  5GAN 4;  2DZ9 A;  3AHU A;  4M7A B;  5LJ3 d;  4XTX A;  5GAM d;  5GAO r;  4JRK A;  4M75 D;  4F7U G;  4PJO C;  4X9C A;  3JB9 F;  4HT9 A;  3FJP A;  2DZC A;  4J5Y A;  2YLB A;  5GMK h;  4M7A F;  4C92 D;  1I81 A;  4M75 A;  1D3B B;  3JCM Q;  5LJ3 f;  2EWN A;  3JCM d;  1LOJ A;  5LJ5 d;  4M75 E;  3JB9 H;  4PJO A;  2YLC A;  2DEQ A;  4OP0 A;  3VU3 C;  5GAN 7;  3SB2 A;  4M7D A;  4XTZ A;  1BIA A;  5GMK m;  3RKY A;  4M78 F;  4PJO B;  3PGG A;  2RD1 A;  5GMK e;  3JCM P;  1WPY A;  3HFN A;  1U1S A;  4JLI A;  2DXT A;  4PJO F;  4M78 C;  4EMH A;  5GAM j;  2QTX A;  4M78 E;  4PJO D;  5LJ5 f;  4JRI A;  4A54 A;  2RM4 A;  4M78 A;  2K57 A;  4XU2 A;  2DTI A;  3SWN A;  4J6Y A;  3L2Z A;  4M7A C;  4EMK B;  2FYK A;  5GMK i;  4NL3 A;  4J6X A;  4M7A E;  5GAO q;  5LJ5 j; 
#chains in the Genus database with same CATH topology
 1E7O A;  2CS7 A;  2DKG A;  2KAF A;  1PG5 B;  2R5M A;  1K8A R;  1BKB A;  1GCP A;  3WVE B;  4C0F A;  2D8J A;  1VQ7 T;  1M9S A;  1VQO T;  4QT7 A;  1B3Q A;  1YHQ A;  3CCS T;  1VQ7 A;  1RI9 A;  1WZO A;  2DD5 A;  1YHQ Q;  2K79 A;  2DD4 A;  2NUP B;  4ME7 A;  3H6Z A;  3QSU A;  4B9X A;  1UE9 A;  4TVR A;  2XU8 A;  2LJ1 A;  4C0Z A;  3L2V A;  3P8D A;  2QAS A;  1YJN T;  1NE8 A;  1YJW Q;  3HPW A;  4HVW A;  4M7A A;  5GAM h;  1HYO A;  2RQR A;  2QA4 T;  5GAN 5;  4QVZ A;  1X75 C;  4KUI A;  2RQT A;  4DBF A;  4J9B A;  1QP2 A;  4F16 A;  4LD9 K;  4A4E A;  1KG1 A;  1IB8 A;  3NTH A;  1X69 A;  2HEQ A;  3OYC A;  3KUF A;  1UJ0 A;  3R6N A;  1W4S A;  4J7I A;  3FRN A;  1KQS A;  4MZT A;  1MGQ A;  1KD1 R;  2L5Q A;  2CGH A;  3CBO A;  3SWN C;  1X01 A;  2M1H A;  2LX9 A;  1OX8 A;  2KVQ G;  2P0K A;  1MV0 B;  2GGR A;  4MZM A;  2CZ6 B;  1ARK A;  2KI7 A;  2VWF A;  3C0C A;  4A4H A;  2C06 A;  3JCM f;  5GAN 8;  1WHG A;  4F17 A;  4FYX B;  3CPW A;  3JB9 F;  4HT9 A;  1ZUU A;  2MWO A;  2J6F A;  1VQP A;  3EFO A;  1I81 A;  4C5I A;  4E7J A;  2EWN A;  1M3A A;  1ABO A;  2DEQ A;  2RI2 A;  2LT4 A;  2RH2 A;  5LL6 S;  1BIA A;  4L5G A;  2FZC B;  1R8O B;  1JJ2 S;  2AHJ B;  5IXB A;  1Q86 C;  2OX7 A;  1WPY A;  3S6W A;  1BK2 A;  5FLX E;  4HXJ A;  1IRE B;  4JRI A;  2YRV A;  1BYM A;  2M9U A;  3EHR A;  3URG A;  1EFN A;  2DTI A;  2X3X D;  4IIM A;  1YIT A;  3CEY A;  5FWB A;  4BD3 A;  1JXO A;  4FT2 A;  1UEB A;  5LJ5 j;  1H8K A;  1ZUY A;  1PD0 A;  3VS4 A;  2YRD A;  2EGA A;  3V8L A;  4K11 A;  4P5N A;  4ELY C;  2EGE A;  1N9S A;  2DJQ A;  2A37 A;  4AFU C;  1T0J A;  2CP2 A;  4R55 A;  4JJC A;  2FO0 A;  1V1C A;  5I21 A;  4M7D B;  4M78 G;  3CMA A;  2GTJ A;  1VQ8 A;  2AT1 B;  4J7F A;  3M4Y A;  2PVO B;  3CC7 T;  2ATC B;  1X43 A;  2O2O A;  3MEU A;  2HDA A;  5GAO n;  4ZGD B;  1ZBJ A;  3LWI A;  2H3J A;  5I22 A;  3EG9 B;  3M54 A;  3CCL A;  3OYD A;  4RTU A;  3CC4 Q;  1IO6 A;  2IIM A;  4N0A A;  1NEB A;  5CQX A;  4ZTJ A;  3MEA A;  4A4G A;  4RTX A;  5AT1 B;  3E2U A;  3CCJ T;  2DYI A;  2NUZ A;  2EQU A;  2V1R A;  4RCC A;  2EQK A;  2E65 A;  3QUI A;  5FRO A;  2RMO A;  2OTL Q;  3OYM A;  2D6F A;  3SDZ A;  5GMK j;  2O9S A;  1OU9 A;  3PT9 A;  5DLQ E;  3MP1 A;  2HBW A;  3CXC A;  3C94 A;  1UG1 A;  4X9C A;  3CMA T;  4C92 D;  1KD1 C;  5CO7 A;  3CC2 A;  2AK5 A;  1D3B B;  2XDP A;  3JCM Q;  2WSC E;  2YUP A;  2DLP A;  3SFM A;  1GL5 A;  5GAN 7;  4XTZ A;  4XK8 E;  2RK2 A;  2KQW A;  3X25 B;  3C4S A;  3HFN A;  1UHF A;  4PJO F;  2JS2 A;  1YJW T;  4J9F A;  2JT4 A;  3CBM A;  3EH1 A;  3CPW P;  4KT0 E;  2QA4 Q;  4LDU A;  1KHI A;  5KE3 A;  4JRQ A;  4J9C A;  1VQK A;  2QA4 A;  4C0D C;  1AWW A;  4GLK A;  4RTT A;  1Y96 A;  1H3Z A;  2V8I A;  3M0P A;  1M1K C;  2AZV A;  1K76 A;  3INZ A;  2V1Q A;  1QWF A;  3I35 A;  2PNI A;  3BFM A;  2A3L A;  2QXF A;  1OZ3 A;  3V8J A;  3TSW A;  2VXF A;  1Y07 A;  4JUV A;  1M5Q 1;  1G83 A;  2FRW A;  4FCY A;  2OTJ Q;  3TQ7 P;  1C1A A;  4PK4 A;  1Q81 R;  3G1J A;  4F7U B;  3M0Q A;  2DBM A;  1YI2 T;  5DY9 A;  4OMQ A;  3R6O A;  3VS0 A;  1LNX A;  3ASK A;  1W2B S;  5M9O A;  2RHY A;  2KY9 A;  4M77 D;  4J9E A;  4M7D C;  2DIG A;  1TUC A;  1X6O A;  1I4K 1;  2MWP A;  1X2Q A;  1Q7Y R;  2ZPF B;  1RAC B;  4C5G A;  1RL2 A;  2FHD A;  1OU8 A;  2LQW A;  1KD1 U;  3HKS A;  2CDT A;  3MET A;  5CVI A;  1X6B A;  2F5K A;  3OW2 S;  3TEE A;  4XTX A;  4RTZ A;  4FYV B;  4RTY A;  3CCM Q;  1VQ5 A;  2DA9 A;  2V26 A;  1IGU A;  5KYU B;  2P4R A;  1VQ6 A;  4HVU A;  1X27 A;  2DFU A;  2B86 A;  2RQW A;  5GMK m;  2DL7 A;  3EG0 A;  1LCK A;  4NS5 A;  1F1B B;  4FW2 A;  2FVU A;  2RD1 A;  1M8M A;  3CCR A;  2JTE A;  1VA7 A;  2DF6 A;  4IUR A;  2B8A A;  3PMI A;  4BUG A;  4DOV A;  3O5Z A;  1ZLM A;  2DRM A;  1C6V X;  1OPL A;  3Q1J A;  5HKC A;  1ZHI A;  2WSE E;  5L8R E;  4LDV A;  1Q81 C;  1R0C B;  3BE3 A;  1WQW A;  3OYY A;  2CRE A;  2OI3 A;  1M2V B;  5KYY A;  3OYL A;  2OTL T;  4BI3 A;  2XI9 A;  4KGZ B;  4RG2 A;  2YUO A;  3ZBD A;  1MND A;  2E10 A;  2F2V A;  1G3T A;  2RI5 A;  3QPH A;  1OOT A;  3EG9 A;  4J9G A;  4LDY A;  2QGG A;  4CRI A;  3OS0 A;  4RUG A;  3QWX X;  2DRK A;  2EJG A;  3PNW C;  3JCM J;  1JB0 E;  4OGE A;  3A8L B;  1G8X A;  1G3S A;  2MYS A;  1QVF S;  4KGX B;  4C8Q D;  3JB9 I;  1YBY A;  1M30 A;  1QVG S;  2RN8 A;  2JTM A;  4Z88 A;  5FU6 B;  2K7A A;  4F14 A;  2BZY A;  2FRY A;  2VVK A;  1TSF A;  4XQ3 A;  4CC3 A;  1YJN A;  4C8Q F;  1VQK T;  1TUG B;  2YT6 A;  1VQM A;  2G3R A;  1G3Y A;  1ZX6 A;  1X2K A;  3NFC A;  2HZY A;  1ZSZ C;  4IUP A;  3G4S T;  8ATC B;  1XNI A;  1WA7 A;  3CCU Q;  1RAH B;  1K8A C;  2RF0 A;  3MO8 A;  4JLG A;  2JXB A;  4MDX A;  2YLC A;  2D1X A;  5KYU A;  2X4X A;  3NPF A;  2CSI A;  4FYY B;  2AKK A;  2ABL A;  1W70 A;  2LZ6 B;  3FC3 A;  3CME A;  1ABQ A;  1BI2 A;  1D1B A;  5GAM j;  5KCO A;  2ED1 A;  1V29 B;  2D0N A;  2K57 A;  4OMO A;  3PVQ A;  2JM9 A;  4M7A C;  3CBP A;  4J6X A;  3TU4 K;  5GAO q;  2KYB A;  2K3Y A;  1MHN A;  4BB7 A;  5LJ3 g;  2QQ9 A;  4N4H A;  3T9N A;  4JS5 A;  2YUN A;  2LMJ A;  1AWX A;  4RCB A;  5LJ3 j;  2QEX T;  3N5B B;  4E2F B;  1VQM T;  3PMT A;  2P0P A;  3I56 Q;  1LJO A;  2JVV A;  3M0T A;  5CIU A;  4BDY A;  1RUW A;  5GMK l;  2Z0W A;  2CUB A;  2HAX A;  1U06 A;  1Z9Q A;  2EGC A;  4LUE A;  2F5T X;  3RMS A;  3UT1 A;  1VYT A;  5HY6 A;  1NPP A;  2QEX A;  2X51 A;  3DKM A;  5GAN d;  3G6E T;  3CME T;  2X4Y A;  2MK5 A;  2YSQ A;  2VV5 A;  4QQD A;  5GAO m;  3VS7 A;  2K2M A;  3OYJ A;  3QZ9 B;  4D8D A;  1AT1 B;  3JV3 A;  5IAY A;  1UEC A;  3M55 A;  1VQN T;  2COZ A;  2DBK A;  3A98 A;  3QJY A;  4F7U F;  3DLL A;  2ZCF B;  4C0G A;  2CH4 A;  4PJJ A;  4M77 F;  1OV3 A;  3QWY A;  2DL5 A;  1Y0M A;  3VRY A;  3NTI A;  2OAU A;  1Q81 U;  2HKQ B;  4RKU E;  3ULR B;  2RPN A;  1KQS S;  2O4X B;  1UHC A;  2DZC A;  6AT1 B;  4BE2 A;  2MAM A;  1WGS A;  1IXD A;  2EW3 A;  1NPR A;  4KH0 B;  3CPF A;  2W10 A;  2LQ8 A;  1QWE A;  3U23 A;  5A0G A;  1UGQ B;  3EGX A;  1ZA1 B;  1AEY A;  1WLP B;  2FZK B;  1KJW A;  3OSS C;  1QP3 A;  2EPD A;  1TUD A;  3UDC A;  2YXY A;  3L2Z A;  3I5S A;  3H0I A;  3H0H A;  1FMW A;  1MMD A;  4C92 B;  4A4F A;  3A8M B;  4F7U E;  2ZZD A;  3L2Q A;  3CCE Q;  4M75 C;  3FJ5 A;  2DXC A;  2LNH B;  3CCQ A;  2ECZ A;  2PQW A;  2PTK A;  2XK0 A;  4IUV A;  3V7C A;  4KGV B;  3QG1 A;  1QMC A;  4E7L A;  2I2L A;  2DMO A;  3E9F A;  2XID A;  3AT1 B;  2CKK A;  2ZPB B;  2OJ2 A;  4FU6 A;  5LJ5 e;  1JRI A;  2MOX A;  2X9H A;  3HRU A;  1M90 R;  2FL7 A;  3MJX A;  2RJE A;  1OPK A;  3G4S Q;  4C92 E;  4MMK A;  2GQV A;  3M0R A;  4JJB A;  5GJV B;  4LE9 A;  2D9T A;  4M77 E;  3M9Q A;  4WF2 A;  1ZA2 B;  2DNU A;  4PNO A;  4GBQ A;  1OUL A;  1PC0 A;  4M7D E;  1MNE A;  3OMC A;  7AT1 B;  2ZPG B;  2QQA A;  2QQS A;  3EFR A;  2VKN A;  1NLP C;  3QII A;  3D7S B;  3KFV A;  4OB1 B;  1M2O A;  2QAZ A;  1M1F A;  4J83 A;  1WJR A;  1JBM A;  2PZ1 A;  1FYN A;  2JTF A;  1PCX A;  4RTV A;  4RG8 A;  5J26 A;  3HHT B;  4KRT A;  2CUD A;  1ACM B;  3PFS A;  1R77 A;  3HRS A;  2P84 A;  2E4H A;  1FWZ A;  3OYG A;  3I56 A;  4M78 F;  3CC7 Q;  1VQN A;  3EGD B;  2M16 A;  2GF7 A;  3LLR A;  1VQ4 Q;  1PRM C;  3EGX B;  1VQ4 A;  3ZFJ A;  2PU9 B;  1NBE B;  4BAC A;  4JDS A;  5IHI A;  3G6E Q;  3CME Q;  4IUU A;  2DVJ A;  1WHJ A;  2LNV A;  2QQR A;  1HSQ A;  2A0F B;  3RNJ A;  4KH1 B;  3GNG A;  3CCJ Q;  2JMC A;  1GCQ A;  3BY7 A;  3CC7 A;  2E12 A;  1VQN Q;  2BE9 B;  2DTH A;  4QVC A;  2DE0 X;  4KBM B;  3OS1 A;  3CCV T;  3EH2 A;  4HT8 A;  1T0H A;  2FB7 A;  2NUT B;  1CKB A;  4M7D F;  4EMG A;  1SHF A;  1WQ7 A;  2RJC A;  3JB9 D;  4HCZ A;  1W2B P;  2NUP A;  1QCF A;  2R57 A;  4A63 B;  3CMA Q;  1N5Z A;  2ROL A;  4HCK A;  5KYX A;  4F7U A;  3OA6 A;  4ZGE B;  1W1F A;  2LQN A;  3M57 A;  4QW2 A;  3A8H B;  5HK3 A;  5CK9 A;  1U1T A;  3OBY A;  1YCY A;  3I55 Q;  1A0N B;  4DEX A;  3SEM A;  2V8K A;  4E7S A;  4KUL A;  2EJF A;  5CR2 A;  1R0B G;  1QQJ A;  3CC4 A;  3G71 A;  1MMG A;  1VYU A;  1K73 R;  2E3H A;  2HQH A;  1KC8 C;  2COW A;  2FG0 A;  2PVG B;  1QW1 A;  1W2B A;  5LJ5 h;  4L59 A;  3ZEH A;  3CCE T;  2K5L A;  4A53 A;  3OYH A;  4NL2 A;  2VGM A;  4PKC C;  3G7Z A;  5D6Y A;  4X1V A;  2EQM A;  5DLO A;  4M75 D;  4F7U G;  1RLQ C;  5GMK h;  1M1K R;  5CKD A;  3M58 A;  1PKS A;  4M75 E;  2KSS A;  2VYT A;  3VKI A;  2CP0 A;  3RKY A;  1JJ2 P;  3J80 E;  2E5Q A;  4JLI A;  2XKO C;  2YWW A;  2EYY A;  3GBQ A;  4EMH A;  5CKH A;  1YI2 Q;  2RM4 A;  2ED0 A;  1D1A A;  3EFO B;  1UFF A;  3SWN A;  1GFD A;  3P8H A;  2Y4Y A;  2K9G A;  4C5H A;  4M7A E;  1I07 A;  4DQ2 A;  2NUT A;  3JB9 J;  2FPD A;  1YFN A;  4AT1 B;  2L3P A;  1GXI E;  1UJY A;  3PIO A;  4D8K A;  4X9D A;  1VQ5 T;  1WFW A;  2F1L A;  2K2V A;  4HCB A;  2CT3 A;  1Q86 R;  1OYX A;  3CCE A;  1XOV A;  1XJW B;  3EAE A;  5IHN A;  3PIP A;  2A28 A;  3WVD B;  2JZ2 A;  1PHT A;  4OB0 B;  4FL6 A;  4CC7 A;  2YDL A;  3H41 A;  3CCR Q;  5GAO l;  1KQS P;  2KEA A;  3QZ5 B;  2GBQ A;  2RI3 A;  3CCM T;  3JRZ A;  2R5A A;  2QG9 B;  4NOY A;  3A8O B;  3L42 A;  1D1C A;  1RLP C;  1VQP Q;  3TCJ A;  3H9N A;  1K4U S;  1XTD A;  2R58 A;  4HKE A;  1AVZ C;  3HFO A;  3SWN B;  1Y7X A;  3OYF A;  2RQU A;  2JM8 A;  1VIE A;  4XU3 A;  3HRT A;  3LGL A;  4J6W A;  4Y92 A;  1Q7Y U;  3JCM b;  3GLX A;  1Y57 A;  5GAO r;  3OMG A;  2F2X A;  4AMC A;  4M7A F;  1PNJ A;  1TS9 A;  1WXU A;  4LUD A;  3CCV Q;  1WXT A;  3EGD A;  2O88 A;  1M3B A;  1AHJ B;  4N4G A;  3JCM d;  5LJ5 d;  3CCV A;  2IPO B;  3UWN A;  1G3W A;  5HCK A;  1IHV A;  1M1G A;  5EC7 A;  3VRZ A;  1ZQ1 A;  4OMF B;  2C0I A;  3X28 B;  1UGS B;  2KMT A;  3VYG A;  1SF9 A;  4DA4 A;  2HMA A;  2NYS A;  4E7H A;  2IG0 A;  1HK9 A;  1ZBX A;  5KYY B;  1BCM A;  4R56 A;  3EFS A;  2L89 A;  4M7A D;  1YIJ Q;  1IGQ A;  2JJ9 A;  4M77 B;  4XTY A;  4FSX A;  2HBP A;  1NJI R;  2MMP A;  4GY5 A;  1BU1 A;  2KRN A;  3JCM V;  3A5Z B;  2I0N A;  3MEV A;  2KT8 A;  1GBR A;  2E6N A;  2DIQ A;  2AZS A;  4FW1 A;  2ENM A;  1OZ2 A;  4OF1 A;  3RDV A;  2DO3 A;  2EQI A;  1SKU B;  1QKX A;  3CCQ T;  2CZ7 B;  4OMM A;  2MCN A;  2QK0 A;  4EPC A;  3CCL Q;  1ZUK A;  9ATC B;  2COY A;  4M78 D;  1OQK A;  2BE7 D;  2BKD N;  1LPL A;  1YCS B;  4ZTF A;  2HL3 A;  5L23 A;  2EBP A;  1C0M A;  2A7Y A;  1YP5 A;  3HSB A;  1JEG A;  2WAC A;  5GAM g;  1Q7Y C;  4IUQ A;  3RKW A;  1TH7 A;  3QXE B;  3QYG B;  3S3M A;  1BI0 A;  3F70 A;  1WI7 A;  1JO8 A;  2XDB A;  3CD6 A;  1G5V A;  2WSF E;  1D0X A;  5CKB A;  5FU7 C;  4Y91 A;  1KC8 U;  3HTR A;  2JMA A;  5GAM d;  2QEX Q;  1D0Z A;  2NLU A;  4J5Y A;  1VQM Q;  3RR6 A;  5A0D A;  4JZ4 A;  3TVT A;  3CC2 Q;  4E7Z A;  4ZN3 A;  3CCR T;  3J7A F;  3TSZ A;  1SSF A;  4O6J A;  5A2Q E;  3MHX A;  1WJS A;  1GBQ A;  5KYN A;  2BTT A;  2O31 A;  5FU7 B;  5LJ5 f;  2RJF A;  2JS0 A;  4PFZ A;  4JS4 A;  3LX7 A;  1WIE A;  4F04 B;  2J6K A;  5GMK i;  2DM1 A;  2OTJ A;  2P0Q A;  2KR3 A;  2D0Q B;  2LJ0 A;  4LDX A;  3V8K A;  1YI2 A;  1JJ2 A;  3JAM E;  1KQ1 A;  2K4Y A;  2K3B A;  4M75 F;  3VYH B;  3E19 A;  1E6H A;  2DEU A;  3JCM h;  1B34 B;  4BE0 A;  1VQ9 Q;  4ANJ A;  4M7A G;  4LXC A;  1N8R C;  1YNZ A;  3X24 B;  4DBR A;  1E6G A;  3VS2 A;  3RBB B;  1Q82 U;  4M77 G;  3MPU B;  3PVL A;  2VXE A;  2J6O A;  2DL4 A;  1T3L A;  3ZL7 C;  3JB9 G;  4IUT A;  3SHW A;  2DXU A;  3LH0 A;  2CSQ A;  1WJQ A;  2L2P A;  2F69 A;  2DJZ A;  2P4T A;  3CCS A;  5A0L A;  4C92 G;  4BY6 B;  3H8Z A;  1AWJ A;  3QDF A;  4VUB A;  5GAN 2;  2K6D A;  2XD0 A;  4C8Q A;  3QDR B;  1H92 A;  2JNG A;  4HVV A;  4M7D D;  1S1N A;  1RAG B;  2EJ9 A;  4EMK C;  3OS5 A;  1VQL Q;  3RKX A;  4N0A C;  1HJD A;  2LP5 A;  4AFQ C;  1K9M C;  4QQG A;  1YIJ T;  2J06 A;  1TWB A;  2EIF A;  5LJ3 d;  1YIJ A;  3FLG A;  2EKO A;  3O8V A;  5CQY A;  4OVA A;  1KIK A;  3HP9 A;  1Q86 U;  1LOJ A;  2KE9 A;  5FRM A;  2K5I A;  2RHZ A;  4PFO A;  3MP8 A;  3J81 E;  3EG2 A;  3HL8 A;  1K8A U;  1U1S A;  2KRS A;  4LN2 A;  4HCC A;  4ELZ C;  3MKD A;  2CP7 A;  4ORZ A;  1BCO A;  2QDY B;  5GAN h;  4E6R A;  1N27 A;  4UC4 A;  3JCM g;  3CQT A;  3BDL A;  2VC8 A;  1K73 U;  5GAO p;  1MMN A;  3OYA A;  2KK4 A;  4EIK A;  1K73 C;  1I0C A;  1UGP B;  3GF5 A;  3LGF A;  3M4G A;  3V7S A;  2ZPI B;  5CAI A;  3EGU A;  1K1Z A;  2JW4 A;  2O01 E;  3OBW A;  2D8H A;  1OI1 A;  3RES A;  1QVF P;  2LDM A;  2HNI A;  5KYW A;  2E5K A;  2RHI A;  4Z02 A;  4ATO A;  3RER A;  1K9M R;  2LX7 A;  2GFA A;  2QGF B;  5IHK A;  1RAE B;  4BDZ A;  2VUB A;  1WHL A;  1VQ4 T;  4QQ6 A;  4C8Q E;  2VB6 A;  5EG2 A;  4J9H A;  2DET A;  4XTV A;  4E7K A;  3QO3 A;  3VS1 A;  2PUK B;  1ZSZ A;  3L2R A;  2E1H A;  5GAM f;  4J8O A;  4C92 C;  3I9Q A;  5KYX B;  4EMK A;  4C8Q G;  2J05 A;  2DZ9 A;  2H3E B;  1YIT Q;  3AHU A;  5DM7 R;  3VS5 A;  1RAF B;  2GCX A;  2EFI A;  3JSC A;  1NYG A;  1YJ9 A;  1AWO A;  2EKH A;  1MMA A;  1Q82 C;  3JCM P;  3OW2 A;  3G71 Q;  1M27 C;  1GRI A;  3EG1 A;  1NJI C;  4BE1 A;  2CZ0 B;  2HCK A;  2CP6 A;  2OAW A;  1N8R R;  1GCQ C;  1VYV A;  4ESR A;  4BI8 B;  1N6A A;  4BI4 A;  5D6W A;  1VQ8 Q;  5ECA A;  5GAN g;  2EAY A;  2XIC A;  4R0K A;  4QVD A;  1YJ9 Q;  3I55 T;  2A36 A;  5KH6 A;  3VV0 A;  4O5V A;  4B6M A;  2LVM A;  3E1S A;  3G6E A;  3L2U A;  1NZ9 A;  5FWC A;  4DBQ A;  4V2S A;  3RMQ A;  2NWM A;  1EX4 A;  3SD4 A;  4XTU A;  1AZE A;  1KFZ A;  1VQL T;  1GFC A;  4XU0 A;  1B7T A;  1UUE A;  5GAN 6;  3DB3 A;  5C6S A;  2EYZ A;  1VQO A;  3NTK A;  1KC8 R;  3UA7 A;  1T3S A;  2JN0 A;  2X3W D;  1P92 A;  3MCA B;  4OB2 B;  1VOM A;  2KNB B;  2XMF A;  5CKE A;  3RIR A;  4D6W A;  2X4W A;  3LWH A;  2A08 A;  1JXM A;  3LW5 E;  2QDL A;  1UDL A;  4OB3 B;  4M75 G;  4AFZ C;  2M02 A;  1K0S A;  1M90 U;  4Z89 A;  1VQ7 Q;  1TOV A;  3KBG A;  1QVF A;  3CCS Q;  2V8J A;  1YHQ T;  2XHC A;  2HQX A;  2MF2 A;  2GQI A;  5GAN e;  3GIB A;  1UB4 A;  1G2B A;  1U5S A;  3TRE A;  4KUD K;  4AFS C;  1VQ5 Q;  1FX7 A;  1YJN Q;  4PJO C;  1WX6 A;  2YLB A;  1VQL A;  1PSF A;  3S3O A;  1VQ6 Q;  3GNF B;  2W0Z A;  1JQQ A;  4PJO A;  3JB9 H;  4J9I A;  4WCI A;  3VUB A;  4M7D A;  2RO0 A;  1BBZ A;  4N4I A;  4LD6 A;  3CCU A;  3CXC P;  3H0F A;  3EHQ A;  4M78 C;  4LDW A;  2QTX A;  3REA B;  2HSE B;  2L8D A;  4OMN A;  2QTV A;  2ZPH B;  4J6Y A;  4J9D A;  2DPP B;  2YUQ A;  1TU0 B;  4RMO A;  2L3R A;  1WHK A;  4M77 C;  1O75 A;  1QCN A;  2ZPE B;  1TXQ A;  2EQJ A;  2KYM A;  3I5R A;  1WYX A;  3JCM X;  3UAT A;  2VGN A;  2CYZ B;  1PKT A;  1VQP T;  3OW2 P;  1NM7 A;  4PFP A;  2JOY A;  4M78 B;  4MDW A;  2L0A A;  3QHS A;  1NG2 A;  2FZG B;  5KCH A;  5IT9 E;  1DJ7 B;  1QLY A;  3QKJ A;  4WTO B;  1HXD A;  3THK A;  3RUX A;  1M3C A;  5LJ3 h;  1SPK A;  3FB9 A;  4C0D B;  1K9A A;  3V7R A;  2RQV A;  2KXC A;  3GOX A;  2DVE A;  2X35 A;  1YIT T;  2G6F X;  1OEB A;  4X34 A;  5IH2 A;  5GAN f;  2BIV A;  1RAI B;  2LCC A;  2SRC A;  3OYB A;  4PJL A;  1D3B A;  4PJO G;  1S72 Q;  4QKU A;  2GNC A;  1KHC A;  1WXB A;  3NMZ C;  4GLM A;  3G71 T;  4JJD A;  1PWT A;  1XQH A;  4RTW A;  2FPF A;  2M51 A;  2HSP A;  3JCM e;  3CPW S;  2O4X A;  4PJM A;  1VQ8 T;  5CKF A;  4YTL A;  2CT4 A;  1LVK A;  3JCM W;  3OYN A;  3PE0 A;  3LH5 A;  4M7A B;  1AD5 A;  2CP3 A;  4ZGJ B;  1PM3 A;  3QJ6 A;  1K9M U;  1MUZ A;  1IRX A;  1WHH A;  3X20 B;  4M75 A;  3CCM A;  4AG1 C;  1SEM A;  4E7I A;  1PRL C;  2GFU A;  1BB9 A;  3OYE A;  3VU3 C;  3OY9 A;  5C0M A;  2JUF A;  3ER0 A;  4PJO B;  2C0O A;  3PGG A;  1MV3 A;  1RAD B;  2LC4 A;  1QKW A;  2GTO A;  2QI2 A;  2BZX A;  2KDS A;  1AZG B;  1Q95 G;  3DLM A;  2DX1 A;  2OTL A;  3NHN A;  3MP6 A;  2ROT A;  3CCQ Q;  2AKL A;  2RK1 A;  4IIO A;  5KE2 A;  1SHG A;  3CCL T;  2DL3 A;  1YWO A;  2PVD B;  1RI0 A;  1M90 C;  2RA2 A;  1NJI U;  4MML A;  1YJW A;  2E3I A;  4AG2 C;  3PTA A;  3REB B;  4MZP A;  4Z8A A;  2KRM A;  3FIF A;  2ZGW A;  3DB4 A;  3ME9 A;  4PL6 A;  1EIF A;  1QVP A;  1KSW A;  2IVW A;  2J7I A;  2M0O A;  2QYZ A;  1M2V A;  1NYF A;  1OX9 A;  3M0S A;  1N8R U;  4CC2 A;  3OYK A;  1K0X A;  3C12 A;  2HKN A;  2HL5 C;  1N9R A;  3S3N A;  3OQ5 A;  2LCS A;  3M0U A;  4C8Q B;  3CD6 T;  2H8H A;  1VQ6 T;  1O9S A;  3CC2 T;  2EYW A;  4PJO E;  2RHX A;  1X6G A;  4M77 A;  3CXC S;  2E41 A;  1RAB B;  4C8Q C;  2K5F A;  5J3B A;  5GAN j;  4XU1 A;  1WNL A;  2ESW A;  1TTH B;  1NEG A;  4M7D G;  2KRO A;  2OTJ T;  1Z9Z A;  2YHT A;  3OB9 A;  5D6X A;  5GAN 4;  1SRL A;  4JRK A;  1VQ9 T;  4JJN K;  3OYI A;  1SSH A;  1S72 A;  2BZ8 A;  5LJ3 f;  1VQ9 A;  3VS3 A;  1UGV A;  4DEY A;  5GMK e;  1NLO C;  2LJ3 A;  4PJO D;  3UPU A;  4FSS A;  3P8B B;  3EG3 A;  1I1J A;  3UF4 A;  3M53 A;  1M1K U;  3OSV A;  1S72 T;  4C5E A;  3VJP A;  1M8V A;  2HQE A;  5FU6 C;  1Y71 A;  2Y90 A;  4C92 F;  4M75 B;  1RAA B;  2F2W A;  1B34 A;  1TG0 A;  5GAM e;  1PD1 A;  3WXM B;  4FT4 A;  4L6V 5;  3FEO A;  3UA6 A;  1V76 A;  2FPE A;  3M5A A;  3NGP A;  5GAN 3;  3MEW A;  2DIL A;  1IHW A;  3CCJ A;  2E64 A;  4B9W A;  2XDD A;  2EYX A;  1ZSG A;  4PLI A;  1WHM A;  5J39 A;  2KXD A;  3E9G A;  3X26 B;  1H3H A;  4IKF A;  1YWP A;  1UTI A;  2L3Q A;  2VAS A;  2AIR B;  4FM4 B;  3L2W A;  1I5L A;  5LJ5 g;  1CKA A;  3VUZ A;  4CC4 B;  3A1P A;  5GJW B;  1QCO A;  4E47 A;  4II1 A;  1VQO Q;  1M4Z A;  2RB6 A;  1IZ6 A;  1UGR B;  3BDU A;  1BI3 A;  5FW9 A;  2LT1 A;  2KT1 A;  5KYW B;  2EVR A;  4JPB W;  2ZAE A;  3GP8 A;  2DER A;  3VS6 A;  3FJP A;  4LNP A;  3GPL A;  2RHU A;  2Y4X A;  1SRM A;  1CSK A;  2E6Z A;  1FMV A;  5I11 A;  3M59 A;  2KGT A;  2L3S A;  1J3T A;  1FMK A;  1FXX A;  2MIO A;  2KBT A;  2QQB A;  4M78 E;  2FEI A;  2LCL A;  4CI0 C;  3CD6 Q;  4JZ3 A;  4A54 A;  2SEM A;  3IQL A;  4XU2 A;  1SG5 A;  4EMK B;  2FYK A;  4NL3 A;  1PSE A;  2YRC A;  2RNA A;  5IXF A;  1VQK Q;  3G4S A;  1QVG P;  3OS2 A;  3L1A A;  4HA8 A;  4FIB A;  1BIB A;  2X4J A;  5CCA A;  1BI1 A;  2XG8 D;  3CCU T;  4XTW A;  3KXT A;  1Q82 R;  1H64 1;  1YN8 A;  3QYH B;  3BW1 A;  2CH4 W;  2LRQ A;  4OML A;  4BY6 C;  2DK3 A;  1HD3 A;  3JCM c;  2CZ1 B;  1I8F A;  2HD0 A;  2PUO B;  3C95 A;  2C0T A;  2BUD A;  4Q5W A;  1QVG A;  1EZZ B;  2LTO A;  5I2S A;  3A8G B;  2DYB A;  1I5O B;  5FRN A;  4EDU A;  4A4K A;  5HK0 A;  3LYI A;  2DTO A;  1ZSZ B;  3M56 A;  5AYF A;  2CP5 A;  8AT1 B;  5IN1 A;  2DXB A;  1B07 A;  1VUB A;  1KQ2 A;  3I56 T;  1YJ9 T;  5LJ3 e;  4PLL A;  1Y96 B;  4C92 A;  2RJD A;  1VIF A;  2K3X A;  2DAQ A;  2MPX C;  3I55 A;  4PJN A;  4OMP A;  1U8R A;  5I2M A;  4DOW A;  1D09 B;  2E70 A;  3QBY A;  4JRP A;  4FYW B;  4Y28 E;  4ZN1 A;  3CC4 T;  4OP0 A;  2DL8 A;  3SB2 A;  2O9V A;  4M4Z A;  4DBH A;  1WDX A;  2EYQ A;  2LQK A;  1AOJ A;  2DXT A;  4OGC A;  3FDR A;  1D0Y A;  1JU5 C;  5D7U A;  2M0Y A;  1U3O A;  1KK7 A;  4XAX B;  4M78 A;  1W6X A;  4ZNX A;  2MI6 A; 
#chains in the Genus database with same CATH homology
 2IG0 A;  4M77 C;  1HK9 A;  4BB7 A;  5LJ3 g;  1O75 A;  2ZPE B;  2EQJ A;  2QQ9 A;  1ZBX A;  2CS7 A;  2DKG A;  3JCM X;  2KAF A;  4N4H A;  2VGN A;  2R5M A;  3T9N A;  4R56 A;  3EFS A;  2L89 A;  4M7A D;  2CYZ B;  4JS5 A;  1BKB A;  3WVE B;  1VQP T;  4C0F A;  1VQ7 T;  1M9S A;  1VQO T;  4RCB A;  2JOY A;  4M77 B;  4M78 B;  5LJ3 j;  2QEX T;  4MDW A;  3N5B B;  4XTY A;  3QHS A;  2HBP A;  3PMT A;  4FSX A;  3CCS T;  1VQM T;  2MMP A;  1VQ7 A;  2DD5 A;  2P0P A;  5KCH A;  4GY5 A;  5IT9 E;  1DJ7 B;  2DD4 A;  3QKJ A;  4ME7 A;  3H6Z A;  3JCM V;  1HXD A;  3A5Z B;  3RUX A;  1LJO A;  2JVV A;  5LJ3 h;  4B9X A;  3QSU A;  5CIU A;  3FB9 A;  3MEV A;  4TVR A;  2XU8 A;  4C0D B;  4BDY A;  3V7R A;  5GMK l;  3GOX A;  2DVE A;  2E6N A;  2DIQ A;  4C0Z A;  3L2V A;  3P8D A;  2HAX A;  2X35 A;  1YIT T;  1OZ2 A;  4OF1 A;  1YJN T;  1NE8 A;  2F5T X;  4X34 A;  3RMS A;  3HPW A;  3UT1 A;  2BIV A;  5GAN f;  5GAM h;  2DO3 A;  4M7A A;  5HY6 A;  2QA4 T;  2LCC A;  1NPP A;  5GAN 5;  4QVZ A;  1X75 C;  2QEX A;  2CZ7 B;  4KUI A;  3OYB A;  3CCQ T;  1D3B A;  4PJO G;  3DKM A;  5GAN d;  3G6E T;  3CME T;  1QP2 A;  2X4Y A;  4EPC A;  4LD9 K;  2VV5 A;  4A4E A;  1KG1 A;  3NTH A;  4QQD A;  5GAO m;  4M78 D;  1KHC A;  2BKD N;  3OYC A;  3OYJ A;  3QZ9 B;  3KUF A;  3G71 T;  4ZTF A;  1W4S A;  4J7I A;  3FRN A;  1KQS A;  1XQH A;  5IAY A;  2A7Y A;  4MZT A;  3M55 A;  1VQN T;  1MGQ A;  2L5Q A;  2CGH A;  3JCM e;  3CPW S;  3HSB A;  2WAC A;  3CBO A;  3QJY A;  5GAM g;  3SWN C;  4F7U F;  1X01 A;  3DLL A;  1Q7Y C;  2M1H A;  2LX9 A;  2O4X A;  2KVQ G;  1TH7 A;  4IUQ A;  2ZCF B;  3QXE B;  3QYG B;  3RKW A;  5CKF A;  4C0G A;  1VQ8 T;  2P0K A;  4M77 F;  4YTL A;  4MZM A;  3S3M A;  2CZ6 B;  1BI0 A;  3F70 A;  1G5V A;  3NTI A;  2XDB A;  3CD6 A;  3JCM W;  2WSF E;  2OAU A;  5CKB A;  5FU7 C;  3OYN A;  1Q81 U;  4A4H A;  2C06 A;  4RKU E;  3JCM f;  1KQS S;  4Y91 A;  5GAN 8;  1KC8 U;  2O4X B;  4M7A B;  5GAM d;  4ZGJ B;  3QJ6 A;  3CPW A;  1K9M U;  3JB9 F;  2DZC A;  2NLU A;  2MWO A;  4J5Y A;  4HT9 A;  5A0D A;  2MAM A;  4BE2 A;  1VQP A;  1I81 A;  3X20 B;  4M75 A;  3CCM A;  1WGS A;  4C5I A;  4E7I A;  4E7J A;  2EWN A;  1NPR A;  3CPF A;  2GFU A;  2LQ8 A;  4ZN3 A;  3OYE A;  2DEQ A;  3VU3 C;  5A0G A;  2RI2 A;  3OY9 A;  2LT4 A;  2RH2 A;  5LL6 S;  1BIA A;  1UGQ B;  4L5G A;  5C0M A;  4RMO A;  2JUF A;  1R8O B;  1SSF A;  3ER0 A;  2AHJ B;  4O6J A;  3MHX A;  5A2Q E;  1WJS A;  1Q86 C;  3PGG A;  1JJ2 S;  4PJO B;  1WPY A;  2LC4 A;  3S6W A;  2QI2 A;  5FLX E;  5FU7 B;  2KDS A;  5LJ5 f;  1IRE B;  2RJF A;  4JRI A;  2YRV A;  1QP3 A;  3OSS C;  1BYM A;  2M9U A;  3DLM A;  4JS4 A;  3URG A;  3LX7 A;  3UDC A;  2OTL A;  2DTI A;  3L2Z A;  3MP6 A;  1YIT A;  5GMK i;  2RK1 A;  3CEY A;  4BD3 A;  2OTJ A;  2P0Q A;  4FT2 A;  1UEB A;  5KE2 A;  5LJ5 j;  2D0Q B;  3CCL T;  4C92 B;  2PVD B;  1RI0 A;  4A4F A;  4LDX A;  3A8M B;  3V8K A;  4F7U E;  1YI2 A;  2RA2 A;  2ZZD A;  1NJI U;  4MML A;  1M90 C;  3JAM E;  1JJ2 A;  3L2Q A;  1KQ1 A;  3PTA A;  1YJW A;  2K4Y A;  4M75 C;  4MZP A;  3V8L A;  2DXC A;  4M75 F;  3VYH B;  3E19 A;  4P5N A;  3CCQ A;  4ELY C;  1N9S A;  2PQW A;  2XK0 A;  3FIF A;  4IUV A;  2ZGW A;  3JCM h;  1B34 B;  3V7C A;  4BE0 A;  3DB4 A;  3ME9 A;  3QG1 A;  4PL6 A;  1EIF A;  4M7A G;  4E7L A;  4R55 A;  1QVP A;  2I2L A;  1N8R C;  3E9F A;  2IVW A;  2M0O A;  2XID A;  2CKK A;  4E7H A;  2ZPB B;  3X24 B;  5I21 A;  4M7D B;  4FU6 A;  4M78 G;  1JRI A;  5LJ5 e;  3CMA A;  1N8R U;  3HRU A;  3OYK A;  1Q82 U;  4M77 G;  1VQ8 A;  3C12 A;  4J7F A;  1N9R A;  2PVO B;  2FL7 A;  3M4Y A;  3CC7 T;  2VXE A;  2RJE A;  3S3N A;  4C92 E;  3OQ5 A;  4MMK A;  2GQV A;  4C8Q B;  3CD6 T;  3MEU A;  5GAO n;  4ZGD B;  3LWI A;  3JB9 G;  1VQ6 T;  2H3J A;  4IUT A;  1O9S A;  2D9T A;  4M77 E;  3M9Q A;  2DXU A;  3M54 A;  3LH0 A;  4WF2 A;  3CC2 T;  3OYD A;  3CCL A;  1WJQ A;  2F69 A;  2DJZ A;  4PNO A;  2P4T A;  4N0A A;  5CQX A;  3CCS A;  4ZTJ A;  5A0L A;  4PJO E;  3MEA A;  4C92 G;  4BY6 B;  3H8Z A;  4M7D E;  3OMC A;  4A4G A;  2RHX A;  4VUB A;  5GAN 2;  2ZPG B;  3CCJ T;  2QQA A;  2QQS A;  2XD0 A;  4C8Q A;  4M77 A;  3QDR B;  3EFR A;  3CXC S;  2E41 A;  2EQU A;  2JNG A;  3QII A;  4C8Q C;  2K5F A;  4RCC A;  4M7D D;  2EQK A;  2E65 A;  2EJ9 A;  3QUI A;  5J3B A;  5FRO A;  5GAN j;  4XU1 A;  3OYM A;  2D6F A;  1WNL A;  4EMK C;  4OB1 B;  3OS5 A;  3SDZ A;  3RKX A;  4N0A C;  4M7D G;  1M1F A;  5GMK j;  4J83 A;  2OTJ T;  1WJR A;  1K9M C;  2YHT A;  1JBM A;  4QQG A;  1YIJ T;  3OB9 A;  2JTF A;  3PT9 A;  5D6X A;  5DLQ E;  5GAN 4;  2EIF A;  3MP1 A;  3CXC A;  5LJ3 d;  3C94 A;  4JRK A;  1YIJ A;  4X9C A;  4RG8 A;  1VQ9 T;  4JJN K;  3OYI A;  5J26 A;  3HHT B;  3CMA T;  4C92 D;  1KD1 C;  3FLG A;  5CO7 A;  3CC2 A;  1S72 A;  1D3B B;  2EKO A;  2XDP A;  3O8V A;  5CQY A;  4OVA A;  5LJ3 f;  3JCM Q;  1VQ9 A;  3HP9 A;  1Q86 U;  2WSC E;  3PFS A;  3HRS A;  1LOJ A;  3SFM A;  1FWZ A;  5GAN 7;  5FRM A;  4XTZ A;  2K5I A;  2RHZ A;  4XK8 E;  3OYG A;  2RK2 A;  2KQW A;  3MP8 A;  4M78 F;  3J81 E;  3I56 A;  3X25 B;  3HL8 A;  3C4S A;  5GMK e;  1K8A U;  3HFN A;  1VQN A;  1U1S A;  2M16 A;  2GF7 A;  4PJO F;  1YJW T;  4PJO D;  3UPU A;  3LLR A;  3CCR T;  3CBM A;  3P8B B;  4HCC A;  4KT0 E;  1VQ4 A;  4LDU A;  1KHI A;  5KE3 A;  3ZFJ A;  2PU9 B;  4ELZ C;  3M53 A;  4JRQ A;  4BAC A;  1M1K U;  4JDS A;  1VQK A;  2QA4 A;  4C0D C;  3OSV A;  4GLK A;  4IUU A;  1S72 T;  4C5E A;  1Y96 A;  3VJP A;  2LNV A;  1M8V A;  1H3Z A;  2HQE A;  2QQR A;  2V8I A;  1Y71 A;  5FU6 C;  2QDY B;  2Y90 A;  5GAN h;  1M1K C;  4C92 F;  4M75 B;  1N27 A;  3INZ A;  4UC4 A;  1B34 A;  5GAM e;  3GNG A;  3BFM A;  3JCM g;  2A3L A;  2QXF A;  1OZ3 A;  3V8J A;  3CC7 A;  3BY7 A;  2E12 A;  3WXM B;  3BDL A;  4FT4 A;  2DTH A;  4L6V 5;  3FEO A;  4QVC A;  2VXF A;  1Y07 A;  2VC8 A;  1K73 U;  4KBM B;  3OS1 A;  4JUV A;  3CCV T;  5GAO p;  3M5A A;  5GAN 3;  3MEW A;  3OYA A;  1M5Q 1;  2KK4 A;  2E64 A;  3CCJ A;  4HT8 A;  2FB7 A;  4B9W A;  1K73 C;  4M7D F;  1UGP B;  3GF5 A;  3LGF A;  2XDD A;  3M4G A;  3V7S A;  4F7U B;  2ZPI B;  5CAI A;  4EMG A;  2O01 E;  3OBW A;  4PLI A;  1YI2 T;  5J39 A;  1WQ7 A;  2RJC A;  1OI1 A;  3JB9 D;  3RES A;  4HCZ A;  2R57 A;  2LDM A;  2HNI A;  3E9G A;  5DY9 A;  3X26 B;  4IKF A;  4F7U A;  3OA6 A;  4ZGE B;  2RHI A;  3M57 A;  4FM4 B;  4QW2 A;  3R6O A;  4Z02 A;  3L2W A;  3A8H B;  5LJ5 g;  1I5L A;  4ATO A;  1LNX A;  3ASK A;  3VUZ A;  5HK3 A;  5CK9 A;  1W2B S;  3RER A;  5M9O A;  2RHY A;  1U1T A;  2KY9 A;  3OBY A;  1YCY A;  4M77 D;  2GFA A;  4M7D C;  2DIG A;  1X6O A;  4E47 A;  2V8K A;  1I4K 1;  4BDZ A;  2MWP A;  2VUB A;  4KUL A;  2EJF A;  4II1 A;  5CR2 A;  1VQ4 T;  2ZPF B;  3CC4 A;  3G71 A;  4C5G A;  4QQ6 A;  4C8Q E;  1M4Z A;  5EG2 A;  1RL2 A;  2RB6 A;  1IZ6 A;  4XTV A;  1KC8 C;  1UGR B;  4E7K A;  3BDU A;  3QO3 A;  2FHD A;  2PUK B;  2PVG B;  1BI3 A;  1QW1 A;  3L2R A;  1W2B A;  2E1H A;  5LJ5 h;  1KD1 U;  3HKS A;  4L59 A;  5GAM f;  3MET A;  2LT1 A;  4J8O A;  5CVI A;  3ZEH A;  4C92 C;  2K5L A;  3CCE T;  4A53 A;  2F5K A;  3OYH A;  4NL2 A;  2VGM A;  4PKC C;  4EMK A;  3OW2 S;  3G7Z A;  5D6Y A;  4C8Q G;  3GP8 A;  1YHQ A;  2DZ9 A;  2EQM A;  3TEE A;  5DLO A;  3AHU A;  4XTX A;  5DM7 R;  4M75 D;  4F7U G;  3FJP A;  5GMK h;  1VQ5 A;  5CKD A;  2GCX A;  2EFI A;  3GPL A;  3JSC A;  1YJ9 A;  2RHU A;  2Y4X A;  3M58 A;  1VQ6 A;  4M75 E;  2KSS A;  2E6Z A;  2VYT A;  3VKI A;  3M59 A;  5GMK m;  3RKY A;  4NS5 A;  1Q82 C;  2FVU A;  2RD1 A;  3J80 E;  3JCM P;  3OW2 A;  1FXX A;  2E5Q A;  3CCR A;  2XKO C;  4JLI A;  4EMH A;  5CKH A;  2QQB A;  4IUR A;  4M78 E;  2LCL A;  4CI0 C;  2B8A A;  1NJI C;  4A54 A;  2RM4 A;  2CZ0 B;  3PMI A;  4BUG A;  4BE1 A;  4DOV A;  4XU2 A;  3SWN A;  4BI8 B;  3P8H A;  2Y4Y A;  4EMK B;  2FYK A;  4NL3 A;  4C5H A;  1N6A A;  4BI4 A;  5D6W A;  4M7A E;  1PSE A;  5GAN g;  2EAY A;  2XIC A;  4DQ2 A;  3G4S A;  4QVD A;  3Q1J A;  5HKC A;  1ZHI A;  2WSE E;  5L8R E;  3OS2 A;  4LDV A;  3I55 T;  1Q81 C;  3L1A A;  3JB9 J;  4HA8 A;  4FIB A;  5KH6 A;  1MHN A;  3VV0 A;  1GXI E;  1WQW A;  3PIO A;  1BIB A;  4O5V A;  4X9D A;  2LVM A;  1VQ5 T;  2X4J A;  3E1S A;  3OYY A;  5CCA A;  3G6E A;  3L2U A;  1NZ9 A;  1BI1 A;  2XG8 D;  3CCU T;  2K2V A;  4XTW A;  3KXT A;  4HCB A;  4V2S A;  3RMQ A;  1H64 1;  1OYX A;  3QYH B;  3OYL A;  3SD4 A;  1XOV A;  3BW1 A;  4XTU A;  3CCE A;  3EAE A;  4BI3 A;  3PIP A;  2OTL T;  2XI9 A;  3WVD B;  2JZ2 A;  1VQL T;  2LRQ A;  4BY6 C;  4OB0 B;  2DK3 A;  4RG2 A;  4XU0 A;  3ZBD A;  4FL6 A;  5GAN 6;  2E10 A;  2RI5 A;  1G3T A;  3QPH A;  3JCM c;  2CZ1 B;  3DB3 A;  5C6S A;  1VQO A;  3NTK A;  5GAO l;  2JN0 A;  1I8F A;  1P92 A;  2HD0 A;  2PUO B;  3C95 A;  3MCA B;  4LDY A;  4OB2 B;  4CRI A;  2EJG A;  3OS0 A;  3QZ5 B;  2BUD A;  3PNW C;  4Q5W A;  3JCM J;  1QVG A;  2RI3 A;  3CCM T;  1JB0 E;  4OGE A;  3A8L B;  3JRZ A;  1G3S A;  2R5A A;  5CKE A;  3RIR A;  4PJO A;  1QVF S;  4D6W A;  2LTO A;  2X4W A;  3LWH A;  4NOY A;  5I2S A;  3LW5 E;  3A8O B;  3L42 A;  4OB3 B;  4M75 G;  4C8Q D;  3J7A F;  1M90 U;  3A8G B;  3JB9 I;  5FRN A;  4EDU A;  4A4K A;  5HK0 A;  1YBY A;  3TCJ A;  1QVG S;  2JTM A;  3LYI A;  5FU6 B;  1XTD A;  2DTO A;  2R58 A;  3KBG A;  3M56 A;  5AYF A;  1QVF A;  4HKE A;  2V8J A;  3HFO A;  3SWN B;  2XHC A;  1Y7X A;  2HQX A;  4XQ3 A;  5IN1 A;  3OYF A;  1YHQ T;  1YJN A;  2DXB A;  4C8Q F;  1VUB A;  1VQK T;  3I56 T;  2MF2 A;  1VQM A;  1KQ2 A;  1VIE A;  2G3R A;  1G3Y A;  4XU3 A;  4PLL A;  5GAN e;  5LJ3 e;  1Y96 B;  1YJ9 T;  4C92 A;  3GIB A;  3HRT A;  2RJD A;  3LGL A;  4J6W A;  1UB4 A;  3NFC A;  3TRE A;  1Q7Y U;  4KUD K;  1VIF A;  4IUP A;  3JCM b;  3GLX A;  2K3X A;  3G4S T;  1FX7 A;  2DAQ A;  1XNI A;  5GAO r;  3I55 A;  4PJO C;  3OMG A;  4M7A F;  2YLB A;  1U8R A;  1K8A C;  1VQL A;  1PSF A;  3S3O A;  3GNF B;  5I2M A;  4DOW A;  3MO8 A;  2E70 A;  1AHJ B;  3QBY A;  4JLG A;  4N4G A;  3JCM d;  5LJ5 d;  3CCV A;  4JRP A;  4Y28 E;  4ZN1 A;  3CC4 T;  2YLC A;  3JB9 H;  4MDX A;  4OP0 A;  3VUB A;  3SB2 A;  3UWN A;  2RO0 A;  2X4X A;  1G3W A;  4M7D A;  4N4I A;  4LD6 A;  1M1G A;  2EYQ A;  2LQK A;  3FC3 A;  3CME A;  3CCU A;  1ZQ1 A;  1BI2 A;  2DXT A;  5GAM j;  4M78 C;  4OMF B;  4LDW A;  4OGC A;  3FDR A;  5KCO A;  2QTX A;  3X28 B;  2L8D A;  1V29 B;  4XAX B;  1UGS B;  2KMT A;  2ZPH B;  2K57 A;  4M78 A;  3VYG A;  4J6Y A;  4DA4 A;  4M7A C;  3CBP A;  4J6X A;  2DPP B;  5GAO q;  3TU4 K;  2K3Y A;  2MI6 A;  2L3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...