4NL2A

Crystal structure of listeria monocytogenes hfq
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
73
structure length
73
Chain Sequence
MKQGGQGLQDYYLNQLRKEKILATVFLTNGFQLRGRVVSFDNFTVLLDVEGKQQLVFKHAISTFSPQKNVALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of U-rich RNA by Hfq from the Gram-positive pathogen Listeria monocytogenes.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Rna binding protein
molecule keywords Protein hfq
total genus 17
structure length 73
sequence length 73
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4nl2A00
5LJ5j 1WNLA 4DQ2A 4M7DA 5GANf 1D3BB 4C92B 1LOJA 3EFRA 1D3BA 3BFMA 1HK9A 4XU2A 5GAOm 4J6XA 4C92C 2RB6A 4EMHA 4PJOE 4WF2A 4J5YA 5GAOq 1I81A 3V7RA 4JRIA 2DTOA 1JRIA 4XTYA 3PGGA 3RUXA 2YHTA 4C8QF 4M75A 3JCMX 2DTHA 2QTXA 1BIAA 3FB9A 3L1AA 3L2ZA 4M78E 5LJ3f 3JB9H 1WPYA 2K57A 5GAMh 5GAMf 3RERA 1U1SA 4PNOA 3JCMc 4EMKA 5GAMg 4M75G 4N0AA 4A54A 3JCMP 4JRKA 4XTVA 4M77F 5DY9A 4NOYA 4N0AC 5LJ5f 3JB9F 1X01A 5LJ5g 4M75F 1WQWA 2DZCA 4PJOD 2DXTA 4C92G 4OP0A 4M77G 2VC8A 5GAN5 3JCMW 4PJOF 4QVCA 4X9DA 3RKYA 3INZA 4M75B 3SWNA 4M75E 3JCMh 4F7UA 5GANh 3JCMJ 3JB9G 5GAN2 1H641 1JBMA 5GMKm 3QUIA 1N9RA 5I21A 4PJOG 4M78G 3JCMV 1LJOA 4XQ3A 1B34A 2YLBA 4M77D 4MMKA 4QVDA 2VXEA 1YCYA 4XTUA 5GANg 3AHUA 3JB9J 2VXFA 4A53A 5CAIA 4M7DE 4C8QE 5LJ3d 4M7AC 5GMKe 5GAMj 4M7AD 4HA8A 4RCCA 2DJZA 1Y96A 4MMLA 3VU3C 5GANe 3GIBA 4XU0A 4EMGA 3BY7A 3EFSA 1KQ1A 4J6YA 2EJGA 5GANd 4C8QA 3RKWA 2FB7A 3HFNA 4C8QD 4HT9A 4M7DC 2E1HA 2EJ9A 3SWNC 4M7AG 3FJPA 3QHSA 1HXDA 4C92D 2DTIA 2Y90A 4X9CA 3QSUA 4M7DB 3JCMf 2EWNA 4C92F 3JB9D 2RD1A 5GAMe 5GMKj 3JCMQ 1KQ2A 4M7AF 4HT8A 3RKXA 2CGHA 4EMKB 4M78B 4F7UG 5LJ5e 5GAN7 3V7CA 4F7UE 5GAN3 4XTZA 5LJ5h 5GAMd 4M77A 4M78D 3QO3A 4C92A 4M78C 4M77B 4M7AB 4EMKC 4J6WA 4M78F 5GANj 4C8QB 4M7AA 3SB2A 3V8KA 3JCMe 1BIBA 3V7SA 5LJ3e 4M7DF 5LJ5d 5GAN8 3JB9I 2DZ9A 3M4GA 3BW1A 3JCMd 2JN0A 1I4K1 4NL2A 4JUVA 3SWNB 1MGQA 5GAOl 5GAOp 4PJOC 2DEQA 4XTWA 4M7AE 4Y91A 3V8LA 1I8FA 4C92E 4M77E 4M78A 3BDUA 1WQ7A 2DXUA 2YLCA 3HFOA 4M75C 5GAOr 4C8QG 2EAYA 1B34B 3JCMg 3HSBA 4M7DG 4XU1A 3RESA 4V2SA 1Y96B 2ZGWA 1I5LA 4JLIA 1U1TA 5GAN6 3V8JA 1M8VA 4PJOB 4RCBA 5LJ3j 1N9SA 4PJOA 2E64A 1TH7A 2RA2A 4F7UB 1M5Q1 4M77C 3JCMb 2DVEA 4M75D 5GMKi 5GAN4 5LJ3g 2FYKA 1LNXA 5LJ3h 4C8QC 4M7DD 3FIFA 2RM4A 2HNIA 4F7UF 5GMKh 4XU3A 2E41A 4NL3A 3RIRA 5GMKl 2E10A 2EJFA 2DKGA 2E65A 2I2LA 5GAOn 4XTXA
chains in the Genus database with same CATH superfamily
2M02A 2KQWA 3HHTB 1VQLA 3O8VA 5GAOq 1KD1R 1D0ZA 1U3OA 2DTHA 1KG1A 2BE9B 3J7AF 2JS0A 2YUOA 2KI7A 3MEAA 4JJDA 1N5ZA 4C5GA 2JMCA 1UJ0A 3WVEB 1VQ8A 2CT3A 2F2WA 2QXFA 4KBMB 3GNFB 3OYJA 2KY9A 3A1PA 2HQEA 3H8ZA 3MP6A 1YCYA 2K2VA 2RQRA 2A36A 3AHUA 2KXCA 2JUFA 4LNPA 2JNGA 3OQ5A 5LJ3d 4BACA 2QQRA 3CCQA 3BY7A 3M57A 3CMAA 4HT9A 4FYWB 1NE8A 4DOWA 1UTIA 1BYMA 2CP6A 2E6NA 2RD1A 1VQOA 1YJNQ 1PHTA 5I2SA 4IUPA 1EX4A 3A8LB 2EQMA 3QO3A 2CYZB 4C92A 3H0HA 4M78C 4C8QB 1ZSZB 2L3QA 1VQ9Q 2RJDA 1OULA 3QPHA 1YIJQ 4AFSC 3JSCA 1OX8A 4XK8E 4IUTA 4M75C 3HRUA 1F1BB 3OYFA 4WTOB 4FSSA 1M90R 1YJNT 3OS2A 4HVVA 3CCSA 2HAXA 2HNIA 1KC8C 1LVKA 2X3XD 1KC8U 2V26A 2ZPGB 3ZEHA 3PVLA 4DA4A 1OPKA 2BIVA 4YTLA 4NS5A 2RN8A 1KD1C 4J6XA 1ZLMA 1A0NB 2CSIA 4N4GA 4WF2A 3CMEA 1NZ9A 1P92A 2YHTA 1JO8A 2FPDA 4AFUC 2DNUA 3QJ6A 2JXBA 3CCJT 2KR3A 5A0GA 4RG8A 4J9EA 2DIGA 4N0AC 5CQYA 4JRPA 1VQMT 2RPNA 3CD6A 1JQQA 4ZTJA 5A0DA 1I5OB 5IN1A 2JTMA 3T9NA 4J9BA 4OMOA 8AT1B 4KULA 5D6XA 2MWOA 4II1A 2B86A 2R57A 2CZ1B 8ATCB 2E3HA 2YWWA 1MNDA 1PWTA 2DJZA 1Y96A 1EZZB 4AFQC 1JJ2A 3VRZA 5GANd 2BE7D 2RHYA 4AT1B 3JV3A 1KHIA 2YDLA 2EJ9A 5D6WA 2E6ZA 1QVFP 2YUQA 2HL5C 2CGHA 4KGXB 1JXOA 2DF6A 2QQSA 4JLGA 1D1BA 4L5GA 4M77B 4BE2A 4IIOA 3UT1A 3VS7A 3V7SA 1R0CB 2LX7A 2VKNA 1QQJA 2COZA 2LC4A 2KROA 1ZHIA 4PKCC 2XDDA 1B34B 3HSBA 4M7DG 1WYXA 2DBKA 2DL8A 1TUDA 2QK0A 2DM1A 3EHRA 3VS4A 1YBYA 3OBYA 4KH0B 3G6EA 1UE9A 2D6FA 3ZFJA 2E5QA 4HVUA 1QVGS 2E65A 1VQMA 1K0SA 4RMOA 1C6VX 3DB4A 3RBBB 3OYIA 2PNIA 4M7DF 2XU8A 2V8KA 3MCAB 2MCNA 1JB0E 3SD4A 1TSFA 1YCSB 2HZYA 2YUPA 1Y57A 3M53A 3QDRB 1LCKA 3RMSA 3OW2P 3MO8A 1BB9A 2OTLA 2EYXA 5KYWB 2OTJA 2QG9B 2VXFA 1VQOT 3G4SA 1QKXA 4RTYA 2P84A 1VQKA 1U5SA 4LDYA 3QBYA 5CIUA 1AWXA 2DD4A 2DVJA 1GFDA 1ABOA 2CSQA 2E1HA 2NYSA 4M7AG 5C6SA 3OBWA 3A8HB 1OZ3A 5AYFA 3JB9D 3X24B 3OYKA 2WSCE 2KDSA 2EVRA 1NJIU 3V7CA 4J9IA 3QWYA 1BBZA 5J3BA 4LDUA 3V8KA 2NUTB 1VQNT 3FDRA 3BW1A 5DLOA 1SRLA 3I55A 1ZA1B 5A2QE 2EFIA 1K73U 2RO0A 2O01E 4C92E 3HFOA 5FRNA 2KVQG 4HKEA 2J05A 4JPBW 1T0JA 2CP2A 1GXIE 1AEYA 3RDVA 1WLPB 4C8QC 4M7DD 4BDZA 2RM4A 5GMKh 2HEQA 1Y07A 3TSWA 3VRYA 1YWPA 1GBRA 4PJMA 3EH1A 4J9HA 2PVOB 4BI8B 2QEXA 2O9VA 2E3IA 2QDYB 2D0NA 5GAMf 1N6AA 1ZA2B 3CCVA 2QQAA 1S72A 1PNJA 4OGCA 2X4XA 3E1SA 3UATA 3FC3A 3HRTA 1SRMA 2DJQA 4F7UA 2BUDA 1SHFA 2HSEB 1FMVA 5D6YA 2HKQB 2CUBA 2VXEA 5L8RE 2COYA 2PZ1A 2QTVA 4BI3A 1OI1A 1YHQQ 1KFZA 2KT1A 1KQ1A 2X4JA 1UGVA 1C1AA 3QZ5B 3EG9B 1QWEA 1MV0B 3ZBDA 2O9SA 5KYUB 2EGAA 3AT1B 4X9CA 2SEMA 2VVKA 1SEMA 1ZX6A 2M16A 2YXYA 2XI9A 2DEUA 1M30A 3M0SA 2QYZA 5GANj 3C94A 2SRCA 3C95A 1BIBA 1BCMA 5KYXA 3I35A 4B6MA 3SWNB 1VYTA 2V8JA 1KIKA 4M7AE 2LQ8A 1YJ9A 2DL7A 1B7TA 1OU9A 4PJNA 2WACA 4JDSA 3ASKA 1Z9QA 3A8MB 3CC4Q 5LJ3j 1SHGA 1M2VB 1M5Q1 2CP5A 1ZSZC 3OA6A 4ORZA 2L2PA 4PLLA 2C0TA 2JTEA 1VQLQ 1OV3A 1SSFA 4O5VA 5FWCA 2P0PA 1IB8A 2DD5A 1VQ9T 5KE3A 2E70A 3EG0A 5GAOm 1GCQC 2KNBB 1M1FA 4C92C 2RK1A 2OAUA 3OB9A 1JRIA 4OMLA 1VQ7A 1TS9A 2OX7A 4E7KA 1UB4A 4ESRA 1YFNA 1RACB 4BY6C 2ROLA 5DY9A 2VASA 2K4YA 3NHNA 4J8OA 5LJ5g 5KH6A 3OYHA 4Y28E 4OP0A 2J6KA 1S1NA 1ARKA 3INZA 4HCZA 2D8HA 3L2RA 4MZTA 2PUOB 5GAN2 1WZOA 1OX9A 1XJWB 3CMAQ 3JCMV 4E7SA 2QQ9A 2NUPB 2MWPA 4AG1C 1T3LA 3FLGA 3WXMB 4J9FA 4RG2A 2EYWA 1QP2A 4RCCA 1VQ8T 2CZ6B 1VQOQ 4R0KA 3CCMT 4GLKA 2X35A 4J6YA 1GCPA 3VUZA 3CC2T 3G7ZA 4LXCA 2GQVA 3FJPA 1WX6A 2JJ9A 1VQ9A 4PJJA 5GJVB 3EGXB 1WJQA 4E6RA 2GCXA 2ZAEA 4IKFA 3RKXA 4EMKB 3LLRA 5LJ5h 4M77A 4M78D 2EYQA 3LX7A 5CKBA 1M1KU 2ZPIB 4QT7A 4J9GA 4C0FA 3UDCA 1YITA 1I4K1 3HRSA 2K3BA 2AIRB 4QQ6A 3M55A 3PFSA 2K3YA 3PT9A 1I5LA 1AZGB 4BDYA 1NPPA 4PJOA 1GBQA 1PSEA 2CT4A 4FYXB 2GFUA 2DFUA 2DVEA 3EHQA 5CO7A 2AT1B 1QCOA 5GMKl 1Q7YU 1RADB 4Y92A 3LWHA 4M7DA 1RAAB 4C92B 1LOJA 4FCYA 3CC2A 2FPEA 1Q82R 2YRCA 3QXEB 4KT0E 2QI2A 1MUZA 3L1AA 2COWA 2K57A 4B9XA 1AHJB 3GBQA 2D1XA 1ZUYA 4A54A 3JCMP 4JRKA 2ZPHB 4ELYC 3I9QA 1W4SA 1PRLC 4N4IA 2K79A 2JM9A 4M77G 1VQ4Q 2XDBA 4PJOF 3JB9G 4M75B 2LQWA 2DETA 2CP7A 1YJWT 1JBMA 2QAZA 5GMKm 4JJNK 4PJOG 1WXUA 2GFAA 4KRTA 4A4FA 1B07A 1XQHA 1RABB 3REBB 4A63B 3CPWS 2JVVA 3H6ZA 3CCLA 2LQKA 3OMGA 1ZBJA 1Q7YR 2K6DA 1KQSA 2JT4A 1M4ZA 2LRQA 2GTJA 4LDVA 3F70A 2QQBA 2L3SA 5HY6A 1YIJT 1OPLA 2Y90A 2V1RA 1UECA 1XNIA 2M1HA 2EPDA 1KQ2A 5GAN3 5GAN7 1KQSS 2GTOA 1G3WA 1VQ8Q 2EQKA 1G2BA 3RMQA 2JTFA 5GJWB 2EQJA 4ZGJB 2ENMA 1GFCA 1EIFA 3G6EQ 1X6OA 2DXUA 2XG8D 4C8QG 5IHIA 3I56T 1Y96B 4JLIA 4AFZC 1VQMQ 4PK4A 1C0MA 1YI2Q 1G3SA 2KRSA 2O4XA 1IGUA 4DBQA 3QZ9B 2A0FB 1Q81U 5KCOA 2RF0A 3VS6A 4XTXA 2HL3A 3MP8A 1YN8A 1IGQA 1IHVA 4MDXA 1D3BA 3OMCA 1YJWA 4J5YA 2QA4Q 1YIJA 2YUNA 1JEGA 4C8QF 3LGLA 4M75A 3FB9A 1QVPA 1ZSZA 2LZ6B 2B8AA 4PNOA 3X26B 2F5KA 3CCUQ 1W2BP 3EGDB 3SFMA 4RTXA 2RH2A 4FSXA 2DXBA 4O6JA 4DBRA 4QVCA 3G4SQ 3JCMh 4IUUA 4Z02A 5IT9E 2IG0A 4F04B 1KSWA 4PLIA 1UGSB 5I21A 2RQVA 2HD0A 1B34A 4RTVA 2MIOA 4DEYA 4J9CA 3CMEQ 2LNVA 5I22A 2AZSA 1ZSGA 2XKOC 1IZ6A 2FB7A 3EG9A 1B3QA 3SHWA 1YWOA 3S6WA 1M3AA 3I56A 4C92D 3MJXA 1QMCA 4LD9K 2EKHA 2QGFB 1JJ2S 4M7AF 4F7UG 1VYUA 1DJ7B 3TSZA 2KAFA 4C0DB 1K4US 2D9TA 4MZMA 1BCOA 4TVRA 3JCMe 1M3CA 5LJ3e 2DZ9A 1VQ5Q 1HD3A 1M8MA 5GAOp 4ME7A 1PKSA 3X25B 2A08A 3H41A 4E7JA 1K0XA 3BDUA 3E9GA 3UA7A 3HPWA 4IUQA 2C06A 5IAYA 1MNEA 2RA2A 2E12A 2MMPA 4M77C 2FYKA 1BI1A 3EH2A 1OOTA 1W2BA 1WHMA 2MF2A 2XICA 2EGCA 2E10A 2M0YA 4X1VA 3HKSA 1X2KA 3H0IA 3CXCP 1W70A 1PG5B 2EBPA 1X43A 3BDLA 3M4YA 2RB6A 2LCSA 3MHXA 1D0XA 3CPFA 3OYBA 3OSVA 5FW9A 2OAWA 1U8RA 3JB9H 1BIAA 1D0YA 1Y7XA 4M78E 3M0TA 4Q5WA 2PUKB 2DLPA 3PVQA 1U06A 2J7IA 4ELZC 2NWMA 3OS0A 1V1CA 1M1KC 1NLPC 1TOVA 2HQXA 2R5MA 3OYDA 1I07A 1WFWA 3EFOB 2LVMA 2HKNA 3O5ZA 2MI6A 2GBQA 1X2QA 3LH0A 3RKYA 2K5LA 2PTKA 4HXJA 3OW2A 3NFCA 4ZN1A 2RHUA 3MEUA 2YLBA 2H3EB 3WVDB 4QVDA 4E7HA 4PFPA 5GMKe 3VU3C 2O2OA 3CCJQ 1HYOA 3NGPA 4EMGA 1MMNA 4C8QA 1M90C 2NLUA 4HCCA 3G6ET 2O88A 1VQPQ 4HT8A 1X75C 3CC7Q 1Q86U 2DILA 3GOXA 5GAMd 4X34A 3QWXX 4LN2A 2OTLQ 2K5FA 3RNJA 1K73C 1AWWA 2ZPEB 2AZVA 1VQ5T 1MHNA 1RI9A 4Z88A 1VQKQ 1AD5A 3CBOA 4PJOB 4FU6A 3EGDA 2DIQA 3QKJA 1ZUUA 1NYFA 4M75D 1RLPC 3FIFA 3VS0A 3HTRA 2AKKA 2GF7A 1VQ7Q 5GAOn 5CKEA 1BI0A 5GANf 1GRIA 5FU7B 1X6GA 3NMZC 4PL6A 3L42A 1I81A 4CC7A 1Q82C 1K9MU 2V1QA 2DX1A 2RJCA 1QVFA 4XAXB 2QTXA 2JZ2A 1N8RC 3L2ZA 1WPYA 2FVUA 5FU7C 3EGUA 3M5AA 2XIDA 1K8AR 4IIMA 2DBMA 1FMKA 3DLMA 4RTUA 3PIPA 5GAN5 2M9UA 4RTWA 4FYYB 3PTAA 2DL4A 3L2WA 1NJIR 2L3RA 3OYYA 4F16A 2ED1A 2LQNA 7AT1B 4M78G 5HCKA 1H3HA 1V76A 3I55T 4OB2B 5CAIA 2KEAA 3P8BB 2BKDN 1PD1A 3EG2A 3GP8A 3OSSC 3R6NA 1WHGA 4QQDA 3LW5E 4FL6A 2GQIA 4RKUE 1OEBA 3SWNC 1VUBA 1D1AA 1OU8A 2KBTA 2KYBA 3VYHB 1S72Q 4OB1B 2RNAA 1FWZA 1ABQA 5LL6S 4M7AB 5KYYA 2HSPA 1PM3A 1G3YA 1WXBA 3ME9A 3LWIA 5AT1B 4HCKA 1UDLA 1K8AC 2XDPA 1FYNA 3FRNA 2A37A 2QGGA 5I11A 2RQUA 1K9MC 1VQ4T 4XU1A 1N8RR 2ZPBB 2E64A 4PJLA 2W10A 2HBPA 3A98A 1S72T 2A7YA 2J6OA 3MP1A 2EYYA 5C0MA 2JW4A 5LJ3h 1KJWA 4XU3A 3UA6A 1QLYA 1TG0A 2VWFA 4OF1A 5KYUA 1D3BB 3R6OA 1CSKA 2OTLT 3CCET 4RTTA 2VV5A 3VS3A 3OYEA 4A4EA 2W0ZA 1PC0A 2EGEA 1NBEB 1YJ9Q 3OW2S 1IXDA 3JCMc 4EMKA 1Q86R 5A0LA 3NTIA 2P0QA 1YI2T 3RR6A 4FT2A 2FPFA 2E5KA 1W1FA 6AT1B 2ED0A 3LGFA 4JZ3A 4C92G 1KHCA 4FIBA 4GY5A 4DBFA 1IO6A 2P4RA 3JCMJ 4J7IA 1H641 4MDWA 2MYSA 1QKWA 3QUIA 3A8GB 1AT1B 1LPLA 1X27A 2F1LA 4M77D 1RAEB 4XTUA 1RI0A 2ABLA 2L5QA 4M7AD 1VQNA 1KC8R 1MMGA 2FZGB 2PVDB 3HFNA 5HK3A 4K11A 1WJSA 4RUGA 1MMAA 4ZN3A 4M7DB 3GPLA 5CKHA 2KGTA 3M0QA 2RI2A 5FROA 1BU1A 3CPWP 2D8JA 1UHCA 1UEBA 2F5TX 2JOYA 4ATOA 4MZPA 2MOXA 1PKTA 3P8DA 4NL2A 4JUVA 1MGQA 3KBGA 1YI2A 1I8FA 4JS4A 2CZ0B 1NYGA 5GAOr 3VV0A 1VYVA 3CCRQ 1WGSA 1CKAA 2LT1A 4RCBA 1OYXA 1Q95G 5GMKi 1NJIC 1TUCA 1LNXA 4FYVB 1G83A 3VUBA 4B9WA 4F7UF 1YJWQ 3RIRA 1VQ6Q 2K5IA 2CREA 4WCIA 2X3WD 3CCVT 1W2BS 2EJFA 1FX7A 1H3ZA 3KUFA 1WHLA 2CP0A 4DOVA 3CCUA 4JRIA 2YT6A 3PGGA 2ESWA 2KYMA 2LP5A 3JCMX 2VGMA 3A8OB 4LDXA 4QQGA 4C0DC 3CCST 4JJBA 4N0AA 2WSEE 3ULRB 3CBPA 1MMDA 3EFOA 3MKDA 3SDZA 3QJYA 1WQWA 1RUWA 3M58A 1M3BA 2FRYA 5GANh 2K2MA 3X28B 4EDUA 2LTOA 1HSQA 2XHCA 2L8DA 1YITT 1QCFA 2EW3A 4MMKA 3CC2Q 1SPKA 5GANg 5IXBA 1RLQC 4BE0A 4C8QE 2K7AA 3LYIA 4N4HA 4EPCA 3GIBA 2H8HA 2P4TA 4DBHA 2RHXA 1YJ9T 2J6FA 1QWFA 4D6WA 4ANJA 4Z8AA 1WJRA 4CC3A 5HKCA 3JCMf 3C4SA 5GAMe 1K8AU 1E7OA 1R0BG 3TVTA 5DLQE 1VQ4A 1PCXA 2CUDA 4EMKC 2LCLA 3M4GA 1FXXA 1SSHA 3S3OA 2ROTA 2DO3A 3CXCS 3OYNA 2ZPFB 3CCLQ 4M78A 1WQ7A 2YLCA 2EAYA 3CCRT 3CCEQ 3V8JA 2XD0A 1N9SA 1YNZA 2Y4YA 2FL7A 2F2VA 1OQKA 3M56A 5CKFA 4GLMA 2XK0A 1NLOC 1IREB 1RAGB 3URGA 1TU0B 2G6FX 3E19A 4DQ2A 2YSQA 3BFMA 1HK9A 3VS1A 2FZKB 1UG1A 1GCQA 2G3RA 1RAHB 5FLXE 4GBQA 1NM7A 4OB0B 2AK5A 2EQUA 1ZUKA 3CCMQ 2CH4W 3RERA 1U1SA 2P0KA 4NOYA 1Q86C 5LJ5f 4ZGEB 3TCJA 1YJNA 4M75F 4CRIA 3DB3A 1XTDA 5KE2A 3L2QA 3G71Q 2LJ1A 4F14A 2CS7A 3UWNA 2FG0A 4DEXA 3OYLA 2DYIA 4BB7A 1AVZC 3DKMA 4JJCA 2PVGB 1X6BA 3JB9J 3MEVA 4J9DA 4HVWA 4OMPA 4MMLA 2QA4A 2DPPB 2E4HA 2RK2A 5CKDA 3CC7A 1G5VA 2X4WA 1KK7A 3RKWA 4KUDK 4C8QD 4M7DC 5EC7A 2A28A 2RHIA 3CCSQ 1HXDA 2DTIA 3HL8A 1YP5A 2KRMA 2QASA 3EGXA 3GF5A 4M78B 3M9QA 2FO0A 2OTJT 3CMET 5FWBA 2JS2A 2BZXA 4J6WA 3X20B 1E6HA 3DLLA 3SB2A 4OMNA 1M27C 2EYZA 4HCBA 1K76A 1UHFA 3V8LA 4F17A 4RTZA 4JZ4A 2FRWA 3PNWC 4AMCA 3TREA 3P8HA 2RMOA 2ZGWA 1U1TA 4FM4B 1UGPB 2NUTA 3JCMb 3FEOA 3I5RA 2VB6A 5LJ3g 5GAN4 3I56Q 4PFOA 2R5AA 1M90U 1G3TA 1MV3A 2DRMA 2LNHB 3TU4K 2QA4T 3ZL7C 2WSFE 3Q1JA 4FW2A 1VQ5A 4OMQA 1I1JA 2AHJB 3CCQT 1X69A 2MK5A 1UFFA 1NEGA 5GAMg 1OZ2A 2VGNA 4D8DA 2BTTA 3PE0A 4C0GA 4M77F 2LJ3A 1Y0MA 1X01A 2KK4A 5IHNA 3UPUA 5KCHA 3NTHA 4X9DA 2DAQA 2ECZA 2O31A 4L6V5 4JRQA 1ACMB 3JRZA 1WXTA 4CC4B 4A53A 1VQPT 3S3NA 4BD3A 3UF4A 2FEIA 4A4GA 5CK9A 1QCNA 4QVZA 1ZQ1A 2DXCA 2XMFA 2CP3A 5DM7R 1T0HA 3EAEA 1BKBA 3C0CA 2LDMA 1D09B 2DMOA 2LX9A 5GMKj 5CR2A 2KT8A 2JM8A 4LE9A 3CCQQ 2K9GA 5HK0A 4XTZA 2J06A 1H8KA 3BE3A 3QG1A 2HDAA 1V29B 1XOVA 3PIOA 1RL2A 3FJ5A 2RHZA 1TWBA 2EQIA 2YRDA 1JXMA 3IQLA 1IRXA 2V8IA 4XTWA 2O4XB 3MEWA 2IVWA 3JCMg 3PMTA 3CCJA 4V2SA 1ZBXA 3L2VA 1CKBA 5GAN6 1M8VA 2LCCA 2C0IA 2HQHA 3CD6T 4M4ZA 5KYWA 3U23A 4AG2C 1Q7YC 4EIKA 3M59A 1M2OA 1UGRB 1VQPA 2I2LA 3OS1A 3G4ST 4KGVB 2DE0X 4L59A 2OTJQ 2L0AA 4OVAA 3EFRA 2K3XA 5CQXA 3OS5A 1BI3A 3E9FA 3C12A 4PJOE 1VQ6T 1O75A 2RQTA 5FU6B 3QYHB 3RUXA 4E47A 3OYMA 2LMJA 1R77A 1PRMC 2DK3A 4E2FB 3META 2CH4A 3CQTA 5IXFA 2X51A 1WI7A 1R8OB 4PJOD 2KRNA 2BZ8A 3N5BB 1K73R 4CI0C 1SF9A 2PU9B 4M75E 1VQNQ 1VA7A 3OY9A 1LJOA 2IPOB 2NUPA 5M9OA 3CD6Q 1TUGB 2M51A 4M7AC 1WHKA 2JMAA 1WA7A 2HCKA 2CKKA 5GAMj 3LH5A 1H92A 1WHHA 2L89A 3G1JA 3EFSA 2EJGA 3REAB 4A4HA 1W6XA 3QHSA 2MAMA 3QSUA 2EWNA 2R58A 1FMWA 3NPFA 2GNCA 5LJ5e 3MPUB 1AWJA 2OI3A 4E7LA 3J81E 4ZGDB 4QW2A 4M78F 2HMAA 3JCMd 2QEXQ 2JN0A 4Y91A 3VS5A 4LUDA 1VQ6A 4D8KA 4J7FA 1Y71A 2DRKA 2IIMA 4F7UB 2QDLA 4BY6B 2NUZA 4LUEA 2M0OA 4A4KA 2KE9A 4NL3A 3L2UA 2OJ2A 3J80E 1NPRA 5LJ5j 3M0PA 4KGZB 2CDTA 4XU2A 4EMHA 3VKIA 2DTOA 4XTYA 5LJ3f 2DYBA 3OYCA 4R56A 1AOJA 1T3SA 2FHDA 4CC2A 4QKUA 1QVGP 4J83A 4PFZA 3H0FA 2DERA 3M0RA 1VQKT 3SWNA 5KYNA 1N27A 2EKOA 2RI5A 4LDWA 1K9MR 1QW1A 1JU5C 3E2UA 3OYAA 5FRMA 4XQ3A 1NEBA 3D7SB 2VUBA 1D1CA 2FZCB 4M7DE 2DA9A 3CCUT 1M2VA 9ATCB 3JAME 1UGQB 3GLXA 1KD1U 5FU6C 2EIFA 4VUBA 1KQSP 3H9NA 4XU0A 3QDFA 1Q81C 1VQ7T 1WDXA 3EG3A 4E7IA 4BE1A 2KMTA 3KXTA 2X9HA 4LD6A 5D7UA 1TTHB 1VIFA 4F7UE 4C0ZA 3VYGA 2H3JA 3CMAT 3CPWA 4FW1A 4OMFB 3CCLT 3CCEA 2ATCB 2ZZDA 3JB9I 2BZYA 3M54A 4KUIA 5GAOl 1E6GA 1J3TA 2RQWA 4M77E 2Z0WA 3TQ7P 2YRVA 1UJYA 3QIIA 1TH7A 3GNGA 1N8RU 4R55A 3I55Q 1AZEA 3S3MA 2AKLA 2QEXT 3I5SA 4IUVA 2E41A 2DKGA 3CEYA 1GL5A 1WNLA 2Y4XA 2I0NA 2RJFA 3CCMA 4C5HA 2F2XA 1YHQT 5I2MA 2KSSA 1SG5A 5IHKA 3NTKA 3V7RA 1WIEA 2LJ0A 2L3PA 2RI3A 3HP9A 5L23A 5GAMh 2ZCFB 3G71A 3M0UA 4M75G 3CCRA 3THKA 1O9SA 4XTVA 1AWOA 3ER0A 3JB9F 3TEEA 2MPXC 1WHJA 2DZCA 4KH1B 1M9SA 2DXTA 2VC8A 3JCMW 2PQWA 4OGEA 1VOMA 1UUEA 3A5ZB 2DL5A 2KXDA 4FT4A 1VQLT 5KYXB 1QVFS 1RAFB 1N9RA 2RJEA 1IHWA 1VIEA 3PMIA 1YITQ 3EG1A 4E7ZA 3CCVQ 1Q82U 1HJDA 5CCAA 3CC4T 4HA8A 1QP3A 4ZNXA 5GANe 4BI4A 4P5NA 3OYGA 3CXCA 2A3LA 1TXQA 4OB3B 4IURA 1G8XA 4C92F 1YHQA 3VJPA 3JCMQ 2HBWA 3VS2A 4BUGA 3CC7T 1I0CA 4OMMA 5EG2A 3SEMA 5KYYB 4M7AA 2DL3A 4C5EA 2D0QB 5LJ5d 5GAN8 3G71T 1RAIB 1BI2A 1K9AA 1Q81R 4PJOC 1M1KR 1JJ2P 2DEQA 1SKUB 4Z89A 3CBMA 2X4YA 3QYGB 5J39A 5CVIA 5J26A 5ECAA 2C0OA 2VYTA 3RESA 4ZTFA 4UC4A 4C5IA 5IH2A 1BK2A 1PSFA 2CZ7B 1PD0A 1EFNA 1M1GA 1QVGA 2GGRA 3KFVA 3CC4A 2LT4A 1K1ZA 1NG2A 2F69A 4JS5A 1Z9ZA
chains in the Genus database with same CATH topology
1BI0A 2DD5A 5GANf 1VQ9T 5KE3A 2KQWA 2E70A 5GAOm 3HHTB 1M1FA 4C92C 2WSFE 3Q1JA 1VQLA 2RK1A 3O8VA 5FU7B 2OAUA 5GAOq 4PL6A 1K9MU 3L42A 1I81A 1Q82C 1VQ5A 3OB9A 2RJCA 1JRIA 2AHJB 3CCQT 1QVFA 4XAXB 1VQ7A 2DTHA 2JZ2A 2QTXA 1N8RC 3L2ZA 1KG1A 3J7AF 1WPYA 5GAMg 1OZ2A 2FVUA 2VGNA 3MEAA 4E7KA 1UB4A 5FU7C 3M5AA 4C0GA 2XIDA 4BY6C 4M77F 5DY9A 4C5GA 2K4YA 4J8OA 1X01A 5LJ5g 5KH6A 2KK4A 3UPUA 5KCHA 3DLMA 3NTHA 3OYHA 4Y28E 3WVEB 3PIPA 4OP0A 1VQ8A 5GAN5 2M9UA 2QXFA 4X9DA 3INZA 4KBMB 3GNFB 2DAQA 4HCZA 3PTAA 4MZTA 2PUOB 4L6V5 3L2RA 3L2WA 2L3RA 5GAN2 3OYYA 3OYJA 2KY9A 3H8ZA 2HQEA 4JRQA 4M78G 3JCMV 3MP6A 3JRZA 1YCYA 3I55T 2QQ9A 2K2VA 3AHUA 2MWPA 2JUFA 4A53A 4OB2B 5CAIA 3S3NA 3WXMB 3FLGA 2BKDN 2JNGA 3OQ5A 3P8BB 4RG2A 5LJ3d 4A4GA 4BD3A 5CK9A 1QP2A 4RCCA 4BACA 1VQ8T 3GP8A 2CZ6B 3OSSC 4QVZA 1ZQ1A 2QQRA 3CCQA 3CCMT 4GLKA 2X35A 3BY7A 2DXCA 3M57A 4J6YA 4QQDA 3VUZA 3G7ZA 3LW5E 3EAEA 1BKBA 4FL6A 5DM7R 2GQVA 3CMAA 2LDMA 4HT9A 4RKUE 1NE8A 3SWNC 1VUBA 2LX9A 4DOWA 3FJPA 1BYMA 1VQ9A 3VYHB 2E6NA 2RD1A 5GMKj 1WJQA 5CR2A 1VQOA 2GCXA 4OB1B 5I2SA 1FWZA 3RKXA 4EMKB 5HK0A 4IKFA 4IUPA 4XTZA 3LLRA 5LJ5h 3JB9F 3A8LB 5LL6S 4M77A 2EQMA 3QO3A 2CYZB 4M78D 3QG1A 4M78C 2EYQA 4M7AB 4C92A 3LX7A 1V29B 4C8QB 5CKBA 1M1KU 1XOVA 3PIOA 1RL2A 1G3YA 3LWIA 3ME9A 2RHZA 2RJDA 2ZPIB 3QPHA 4C0FA 3UDCA 1YITA 1I4K1 3HRSA 4QQ6A 2V8IA 3JSCA 2O4XB 4XTWA 2XDPA 1K8AC 4XK8E 4IUTA 3M55A 3FRNA 3MEWA 3HRUA 2IVWA 3PFSA 4M75C 3OYFA 2K3YA 1K9MC 3JCMg 3PT9A 1VQ4T 3PMTA 4XU1A 3CCJA 4V2SA 1I5LA 1ZBXA 3L2VA 5GAN6 1M8VA 4BDYA 2LCCA 1NPPA 2ZPBB 4PJOA 2E64A 1PSEA 2HBPA 1YJNT 1S72T 2GFUA 2A7YA 3OS2A 3CD6T 2DVEA 3MP1A 5C0MA 5CO7A 5LJ3h 3CCSA 2HAXA 2HNIA 4XU3A 1Q7YC 1KC8C 5GMKl 3M59A 1Q7YU 2ZPGB 1UGRB 3ZEHA 1VQPA 1KC8U 2I2LA 4OF1A 3OS1A 3G4ST 4DA4A 3LWHA 4L59A 4M7DA 2BIVA 4OVAA 1D3BB 4C92B 1LOJA 3EFRA 4YTLA 3R6OA 4NS5A 3CC2A 2K3XA 5CQXA 3OS5A 2OTLT 1KD1C 1BI3A 4J6XA 3CCET 3E9FA 3C12A 2VV5A 4PJOE 4N4GA 1O75A 5FU6B 1VQ6T 4WF2A 3CMEA 3OYEA 3QXEB 4A4EA 1NZ9A 3QYHB 1P92A 2QI2A 4KT0E 3RUXA 4E47A 2YHTA 3OYMA 3L1AA 2DK3A 3OW2S 2K57A 4B9XA 3QJ6A 3JCMc 3META 1AHJB 4EMKA 3CCJT 5A0LA 3NTIA 2P0QA 4A54A 5A0GA 3JCMP 4JRKA 1YI2T 4FT2A 2ZPHB 4RG8A 4ELYC 2DIGA 4N0AC 1W4SA 5CQYA 4JRPA 1VQMT 4N4IA 3CD6A 1R8OB 3LGFA 4PJOD 3N5BB 4ZTJA 4C92G 1KHCA 5A0DA 4CI0C 4FIBA 4GY5A 4M77G 2XDBA 5IN1A 4PJOF 2JTMA 3T9NA 4J7IA 2PU9B 4M75B 4M75E 3JCMJ 3JB9G 1H641 4MDWA 1YJWT 1JBMA 4JJNK 5GMKm 3QUIA 3A8GB 4PJOG 3OY9A 2QA4T 2GFAA 4KULA 1LJOA 5D6XA 4M77D 2MWOA 4A4FA 5M9OA 1XQHA 4XTUA 4II1A 1RI0A 2R57A 2CZ1B 3CPWS 2JVVA 3H6ZA 3CCLA 2LQKA 4M7AC 2L5QA 3OMGA 5GAMj 2CKKA 4M7AD 1VQNA 2DJZA 1Y96A 1VQPT 1KQSA 2L89A 3EFSA 1JJ2A 2EJGA 1M4ZA 5GANd 2RHYA 2LRQA 4A4HA 2PVDB 3HFNA 1KHIA 5HK3A 4LDVA 3F70A 2EJ9A 2QQBA 5HY6A 1YIJT 1WJSA 3QHSA 5D6WA 2MAMA 2Y90A 4ZN3A 3QSUA 4M7DB 2EWNA 2E6ZA 1XNIA 2R58A 3GPLA 2M1HA 5CKHA 1KQ2A 2CGHA 5GAN7 5LJ5e 5GAN3 1KQSS 1G3WA 2RI2A 2QQSA 4JLGA 4E7LA 4L5GA 5FROA 2EQKA 4M77B 3J81E 4ZGDB 1UEBA 2F5TX 2JOYA 4QW2A 4M78F 3UT1A 4BE2A 4ATOA 4MZPA 3V7SA 3RMQA 2JTFA 3JCMd 3P8DA 2JN0A 4NL2A 2EQJA 4JUVA 1MGQA 4ZGJB 3KBGA 1YI2A 4Y91A 1I8FA 4JS4A 2LC4A 1EIFA 2CZ0B 1X6OA 2DXUA 2XG8D 1ZHIA 5GAOr 4C8QG 4PKCC 2XDDA 1B34B 3VV0A 3I56T 1VQ6A 3HSBA 4M7DG 1Y96B 1WGSA 4JLIA 2LT1A 4J7FA 1Y71A 4RCBA 4F7UB 1YBYA 1OYXA 4BY6B 1G3SA 3OBYA 5GMKi 1NJIC 2M0OA 1LNXA 3VUBA 4B9WA 4A4KA 3G6EA 2D6FA 4F7UF 3ZFJA 2O4XA 2E5QA 4NL3A 3RIRA 2K5IA 3L2UA 1QVGS 3CCVT 1W2BS 2EJFA 3QZ9B 2E65A 1VQMA 1Q81U 5KCOA 3J80E 4XTXA 1FX7A 4RMOA 1H3ZA 1NPRA 5LJ5j 3MP8A 3DB4A 4MDXA 1D3BA 3KUFA 4XU2A 4DOVA 3OMCA 3CC2T 3CCUA 4EMHA 3VKIA 1YJWA 3OYIA 4J5YA 1YIJA 4JRIA 2DTOA 4XTYA 3PGGA 4C8QF 3LGLA 4M75A 3JCMX 3FB9A 5LJ3f 1QVPA 3OYCA 4M7DF 2VGMA 3A8OB 4R56A 4LDXA 2XU8A 2V8KA 2B8AA 3MCAB 4PNOA 4QQGA 4C0DC 2FHDA 3CCST 3X26B 1JB0E 4N0AA 2WSEE 2F5KA 3CBPA 3SD4A 4J83A 3SDZA 3SFMA 3M53A 3QJYA 2RH2A 1WQWA 3QDRB 3M58A 4FSXA 2DXBA 3RMSA 4O6JA 1VQKT 4QVCA 3SWNA 5GANh 3JCMh 3MO8A 4IUUA 4Z02A 3X28B 4EDUA 5IT9E 1N27A 2EKOA 2IG0A 2LTOA 2OTLA 2RI5A 4LDWA 4PLIA 1UGSB 2L8DA 2XHCA 1QW1A 5I21A 3OYAA 2HD0A 1YITT 5FRMA 4XQ3A 1B34A 2OTJA 2VUBA 4MMKA 5GANg 2VXFA 4M7DE 4BE0A 1VQOT 4C8QE 3G4SA 3JAME 3CCUT 1UGQB 3LYIA 1VQKA 4N4HA 3GLXA 1KD1U 4EPCA 2EIFA 2LNVA 4LDYA 4VUBA 4XU0A 3QBYA 5FU6C 5CIUA 2P4TA 1Q81C 1VQ7T 2DD4A 2RHXA 1YJ9T 2XKOC 1IZ6A 2FB7A 4E7IA 1YJNA 2E1HA 4BE1A 2KMTA 3KXTA 4D6WA 4M7AG 5C6SA 3S6WA 3I56A 4C92D 3OBWA 4LD6A 3A8HB 4LD9K 1WJRA 1OZ3A 5HKCA 3JCMf 3C4SA 5AYFA 3JB9D 5GAMe 1K8AU 3X24B 3OYKA 2WSCE 2KDSA 1JJ2S 4M7AF 4F7UG 1NJIU 5DLQE 1VIFA 3V7CA 4C0ZA 4F7UE 3VYGA 3GIBA 1DJ7B 2H3JA 1VQ4A 2KAFA 4C0DB 4EMKC 3CMAT 2D9TA 4MZMA 5J3BA 3CPWA 4LDUA 4TVRA 4OMFB 3V8KA 3CCEA 3JCMe 3CCLT 5LJ3e 2ZZDA 3JB9I 1VQNT 2DZ9A 2LCLA 3BW1A 1FXXA 3FDRA 3M4GA 3M54A 4KUIA 5DLOA 3S3OA 5GAOl 5GAOp 3I55A 4ME7A 5A2QE 3X25B 2DO3A 3CXCS 2EFIA 1K73U 2RO0A 3OYNA 2O01E 2ZPFB 4C92E 4E7JA 4M77E 4M78A 3BDUA 1WQ7A 3E9GA 2YLCA 2KVQG 3HFOA 4HKEA 5FRNA 2EAYA 3HPWA 4IUQA 3CCRT 2YRVA 2C06A 3V8JA 2XD0A 5IAYA 1N9SA 3QIIA 1TH7A 2RA2A 3GNGA 2Y4YA 2FL7A 1N8RU 2E12A 1GXIE 2MMPA 4M77C 4R55A 3S3MA 3M56A 5CKFA 2FYKA 1BI1A 2QEXT 2XK0A 4C8QC 4BDZA 4M7DD 2RM4A 4IUVA 5GMKh 1W2BA 1IREB 2E41A 2MF2A 3URGA 2XICA 1Y07A 2E10A 3E19A 3HKSA 2DKGA 3CEYA 1WNLA 4DQ2A 2Y4XA 2RJFA 3CCMA 2PVOB 4C5HA 1YHQT 3BFMA 1HK9A 3BDLA 2KSSA 3M4YA 5I2MA 4BI8B 2RB6A 3NTKA 2QEXA 3MHXA 3V7RA 3CPFA 2G3RA 3OYBA 3OSVA 2RI3A 2QDYB 5FLXE 1U8RA 3JB9H 1BIAA 1Y7XA 4OB0B 4M78E 2EQUA 3HP9A 4Q5WA 5GAMh 5GAMf 2ZCFB 1U1SA 2P0KA 2PUKB 3G71A 3RERA 3CCRA 4M75G 4ELZC 1N6AA 1O9SA 4XTVA 3OS0A 1M1KC 4NOYA 1Q86C 2HQXA 2R5MA 5LJ5f 3ER0A 2QQAA 3TEEA 3TCJA 4ZGEB 4M75F 2LVMA 4OGCA 3OYDA 3CCVA 2DZCA 2X4XA 1M9SA 3E1SA 4CRIA 2DXTA 3FC3A 1S72A 2MI6A 3HRTA 2VC8A 3JCMW 2PQWA 4OGEA 3LH0A 3DB3A 3RKYA 1XTDA 2K5LA 3A5ZB 5KE2A 4F7UA 3L2QA 2BUDA 2CS7A 4FT4A 3OW2A 3UWNA 3NFCA 4ZN1A 1VQLT 1QVFS 1N9RA 2RHUA 2RJEA 1VIEA 3MEUA 3PMIA 3OYLA 4BB7A 5D6YA 1Q82U 2YLBA 3WVDB 4QVDA 2VXEA 3DKMA 4E7HA 5CCAA 2PVGB 5L8RE 3JB9J 4BI3A 3MEVA 3CC4T 1OI1A 5GMKe 4HA8A 1QP3A 4MMLA 3VU3C 5GANe 2QA4A 2DPPB 2RK2A 4EMGA 5CKDA 3CC7A 4BI4A 1KQ1A 2X4JA 2X4WA 1G5VA 4P5NA 4C8QA 3RKWA 3OYGA 3CXCA 2A3LA 4KUDK 3QZ5B 4C8QD 4M7DC 1M90C 4OB3B 2NLUA 2RHIA 3ZBDA 4IURA 1HXDA 3G6ET 4HCCA 2DTIA 4X9CA 3HL8A 1YHQA 4C92F 3VJPA 3JCMQ 3GF5A 4HT8A 1X75C 4M78B 3M9QA 1Q86U 2M16A 4BUGA 5GAMd 3GOXA 3CMET 2OTJT 4X34A 3CC7T 5EG2A 2XI9A 4J6WA 5GANj 3X20B 4M7AA 3C94A 3SB2A 2K5FA 2D0QB 3C95A 4C5EA 3DLLA 1BIBA 1K73C 5LJ5d 5GAN8 2ZPEB 3G71T 1BI2A 4HCBA 3SWNB 1VQ5T 1MHNA 2V8JA 4PJOC 2DEQA 4M7AE 3V8LA 2LQ8A 3CBMA 1YJ9A 2X4YA 3QYGB 5J39A 5CVIA 5J26A 3PNWC 2VYTA 2WACA 3ASKA 3P8HA 4JDSA 2ZGWA 3RESA 3TREA 4ZTFA 1U1TA 4FM4B 1UGPB 3A8MB 3CBOA 4UC4A 4C5IA 4PJOB 4FU6A 5LJ3j 2DIQA 3QKJA 1M5Q1 3JCMb 3FEOA 4M75D 5GAN4 5LJ3g 1PSFA 3OA6A 4PLLA 2CZ7B 3FIFA 2R5AA 1M1GA 1M90U 1QVGA 1G3TA 2GF7A 3TU4K 2LT4A 1SSFA 2F69A 4JS5A 3CC4A 4O5VA 5GAOn 2P0PA 5CKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LJ5 j;  1WNL A;  4DQ2 A;  4M7D A;  5GAN f;  1D3B B;  4C92 B;  1LOJ A;  3EFR A;  1D3B A;  3BFM A;  1HK9 A;  4XU2 A;  5GAO m;  4J6X A;  4C92 C;  2RB6 A;  4EMH A;  4PJO E;  4WF2 A;  4J5Y A;  5GAO q;  1I81 A;  3V7R A;  4JRI A;  2DTO A;  1JRI A;  4XTY A;  3PGG A;  3RUX A;  2YHT A;  4C8Q F;  4M75 A;  3JCM X;  2DTH A;  2QTX A;  1BIA A;  3FB9 A;  3L1A A;  3L2Z A;  4M78 E;  5LJ3 f;  3JB9 H;  1WPY A;  2K57 A;  5GAM h;  5GAM f;  3RER A;  1U1S A;  4PNO A;  3JCM c;  4EMK A;  5GAM g;  4M75 G;  4N0A A;  4A54 A;  3JCM P;  4JRK A;  4XTV A;  4M77 F;  5DY9 A;  4NOY A;  4N0A C;  5LJ5 f;  3JB9 F;  1X01 A;  5LJ5 g;  4M75 F;  1WQW A;  2DZC A;  4PJO D;  2DXT A;  4C92 G;  4OP0 A;  4M77 G;  2VC8 A;  5GAN 5;  3JCM W;  4PJO F;  4QVC A;  4X9D A;  3RKY A;  3INZ A;  4M75 B;  3SWN A;  4M75 E;  3JCM h;  4F7U A;  5GAN h;  3JCM J;  3JB9 G;  5GAN 2;  1H64 1;  1JBM A;  5GMK m;  3QUI A;  1N9R A;  5I21 A;  4PJO G;  4M78 G;  3JCM V;  1LJO A;  4XQ3 A;  1B34 A;  2YLB A;  4M77 D;  4MMK A;  4QVD A;  2VXE A;  1YCY A;  4XTU A;  5GAN g;  3AHU A;  3JB9 J;  2VXF A;  4A53 A;  5CAI A;  4M7D E;  4C8Q E;  5LJ3 d;  4M7A C;  5GMK e;  5GAM j;  4M7A D;  4HA8 A;  4RCC A;  2DJZ A;  1Y96 A;  4MML A;  3VU3 C;  5GAN e;  3GIB A;  4XU0 A;  4EMG A;  3BY7 A;  3EFS A;  1KQ1 A;  4J6Y A;  2EJG A;  5GAN d;  4C8Q A;  3RKW A;  2FB7 A;  3HFN A;  4C8Q D;  4HT9 A;  4M7D C;  2E1H A;  2EJ9 A;  3SWN C;  4M7A G;  3FJP A;  3QHS A;  1HXD A;  4C92 D;  2DTI A;  2Y90 A;  4X9C A;  3QSU A;  4M7D B;  3JCM f;  2EWN A;  4C92 F;  3JB9 D;  2RD1 A;  5GAM e;  5GMK j;  3JCM Q;  1KQ2 A;  4M7A F;  4HT8 A;  3RKX A;  2CGH A;  4EMK B;  4M78 B;  4F7U G;  5LJ5 e;  5GAN 7;  3V7C A;  4F7U E;  5GAN 3;  4XTZ A;  5LJ5 h;  5GAM d;  4M77 A;  4M78 D;  3QO3 A;  4C92 A;  4M78 C;  4M77 B;  4M7A B;  4EMK C;  4J6W A;  4M78 F;  5GAN j;  4C8Q B;  4M7A A;  3SB2 A;  3V8K A;  3JCM e;  1BIB A;  3V7S A;  5LJ3 e;  4M7D F;  5LJ5 d;  5GAN 8;  3JB9 I;  2DZ9 A;  3M4G A;  3BW1 A;  3JCM d;  2JN0 A;  1I4K 1;  4NL2 A;  4JUV A;  3SWN B;  1MGQ A;  5GAO l;  5GAO p;  4PJO C;  2DEQ A;  4XTW A;  4M7A E;  4Y91 A;  3V8L A;  1I8F A;  4C92 E;  4M77 E;  4M78 A;  3BDU A;  1WQ7 A;  2DXU A;  2YLC A;  3HFO A;  4M75 C;  5GAO r;  4C8Q G;  2EAY A;  1B34 B;  3JCM g;  3HSB A;  4M7D G;  4XU1 A;  3RES A;  4V2S A;  1Y96 B;  2ZGW A;  1I5L A;  4JLI A;  1U1T A;  5GAN 6;  3V8J A;  1M8V A;  4PJO B;  4RCB A;  5LJ3 j;  1N9S A;  4PJO A;  2E64 A;  1TH7 A;  2RA2 A;  4F7U B;  1M5Q 1;  4M77 C;  3JCM b;  2DVE A;  4M75 D;  5GMK i;  5GAN 4;  5LJ3 g;  2FYK A;  1LNX A;  5LJ3 h;  4C8Q C;  4M7D D;  3FIF A;  2RM4 A;  2HNI A;  4F7U F;  5GMK h;  4XU3 A;  2E41 A;  4NL3 A;  3RIR A;  5GMK l;  2E10 A;  2EJF A;  2DKG A;  2E65 A;  2I2L A;  5GAO n;  4XTX A; 
#chains in the Genus database with same CATH topology
 2M02 A;  2KQW A;  3HHT B;  1VQL A;  3O8V A;  5GAO q;  1KD1 R;  1D0Z A;  1U3O A;  2DTH A;  1KG1 A;  2BE9 B;  3J7A F;  2JS0 A;  2YUO A;  2KI7 A;  3MEA A;  4JJD A;  1N5Z A;  4C5G A;  2JMC A;  1UJ0 A;  3WVE B;  1VQ8 A;  2CT3 A;  2F2W A;  2QXF A;  4KBM B;  3GNF B;  3OYJ A;  2KY9 A;  3A1P A;  2HQE A;  3H8Z A;  3MP6 A;  1YCY A;  2K2V A;  2RQR A;  2A36 A;  3AHU A;  2KXC A;  2JUF A;  4LNP A;  2JNG A;  3OQ5 A;  5LJ3 d;  4BAC A;  2QQR A;  3CCQ A;  3BY7 A;  3M57 A;  3CMA A;  4HT9 A;  4FYW B;  1NE8 A;  4DOW A;  1UTI A;  1BYM A;  2CP6 A;  2E6N A;  2RD1 A;  1VQO A;  1YJN Q;  1PHT A;  5I2S A;  4IUP A;  1EX4 A;  3A8L B;  2EQM A;  3QO3 A;  2CYZ B;  4C92 A;  3H0H A;  4M78 C;  4C8Q B;  1ZSZ B;  2L3Q A;  1VQ9 Q;  2RJD A;  1OUL A;  3QPH A;  1YIJ Q;  4AFS C;  3JSC A;  1OX8 A;  4XK8 E;  4IUT A;  4M75 C;  3HRU A;  1F1B B;  3OYF A;  4WTO B;  4FSS A;  1M90 R;  1YJN T;  3OS2 A;  4HVV A;  3CCS A;  2HAX A;  2HNI A;  1KC8 C;  1LVK A;  2X3X D;  1KC8 U;  2V26 A;  2ZPG B;  3ZEH A;  3PVL A;  4DA4 A;  1OPK A;  2BIV A;  4YTL A;  4NS5 A;  2RN8 A;  1KD1 C;  4J6X A;  1ZLM A;  1A0N B;  2CSI A;  4N4G A;  4WF2 A;  3CME A;  1NZ9 A;  1P92 A;  2YHT A;  1JO8 A;  2FPD A;  4AFU C;  2DNU A;  3QJ6 A;  2JXB A;  3CCJ T;  2KR3 A;  5A0G A;  4RG8 A;  4J9E A;  2DIG A;  4N0A C;  5CQY A;  4JRP A;  1VQM T;  2RPN A;  3CD6 A;  1JQQ A;  4ZTJ A;  5A0D A;  1I5O B;  5IN1 A;  2JTM A;  3T9N A;  4J9B A;  4OMO A;  8AT1 B;  4KUL A;  5D6X A;  2MWO A;  4II1 A;  2B86 A;  2R57 A;  2CZ1 B;  8ATC B;  2E3H A;  2YWW A;  1MND A;  1PWT A;  2DJZ A;  1Y96 A;  1EZZ B;  4AFQ C;  1JJ2 A;  3VRZ A;  5GAN d;  2BE7 D;  2RHY A;  4AT1 B;  3JV3 A;  1KHI A;  2YDL A;  2EJ9 A;  5D6W A;  2E6Z A;  1QVF P;  2YUQ A;  2HL5 C;  2CGH A;  4KGX B;  1JXO A;  2DF6 A;  2QQS A;  4JLG A;  1D1B A;  4L5G A;  4M77 B;  4BE2 A;  4IIO A;  3UT1 A;  3VS7 A;  3V7S A;  1R0C B;  2LX7 A;  2VKN A;  1QQJ A;  2COZ A;  2LC4 A;  2KRO A;  1ZHI A;  4PKC C;  2XDD A;  1B34 B;  3HSB A;  4M7D G;  1WYX A;  2DBK A;  2DL8 A;  1TUD A;  2QK0 A;  2DM1 A;  3EHR A;  3VS4 A;  1YBY A;  3OBY A;  4KH0 B;  3G6E A;  1UE9 A;  2D6F A;  3ZFJ A;  2E5Q A;  4HVU A;  1QVG S;  2E65 A;  1VQM A;  1K0S A;  4RMO A;  1C6V X;  3DB4 A;  3RBB B;  3OYI A;  2PNI A;  4M7D F;  2XU8 A;  2V8K A;  3MCA B;  2MCN A;  1JB0 E;  3SD4 A;  1TSF A;  1YCS B;  2HZY A;  2YUP A;  1Y57 A;  3M53 A;  3QDR B;  1LCK A;  3RMS A;  3OW2 P;  3MO8 A;  1BB9 A;  2OTL A;  2EYX A;  5KYW B;  2OTJ A;  2QG9 B;  2VXF A;  1VQO T;  3G4S A;  1QKX A;  4RTY A;  2P84 A;  1VQK A;  1U5S A;  4LDY A;  3QBY A;  5CIU A;  1AWX A;  2DD4 A;  2DVJ A;  1GFD A;  1ABO A;  2CSQ A;  2E1H A;  2NYS A;  4M7A G;  5C6S A;  3OBW A;  3A8H B;  1OZ3 A;  5AYF A;  3JB9 D;  3X24 B;  3OYK A;  2WSC E;  2KDS A;  2EVR A;  1NJI U;  3V7C A;  4J9I A;  3QWY A;  1BBZ A;  5J3B A;  4LDU A;  3V8K A;  2NUT B;  1VQN T;  3FDR A;  3BW1 A;  5DLO A;  1SRL A;  3I55 A;  1ZA1 B;  5A2Q E;  2EFI A;  1K73 U;  2RO0 A;  2O01 E;  4C92 E;  3HFO A;  5FRN A;  2KVQ G;  4HKE A;  2J05 A;  4JPB W;  1T0J A;  2CP2 A;  1GXI E;  1AEY A;  3RDV A;  1WLP B;  4C8Q C;  4M7D D;  4BDZ A;  2RM4 A;  5GMK h;  2HEQ A;  1Y07 A;  3TSW A;  3VRY A;  1YWP A;  1GBR A;  4PJM A;  3EH1 A;  4J9H A;  2PVO B;  4BI8 B;  2QEX A;  2O9V A;  2E3I A;  2QDY B;  2D0N A;  5GAM f;  1N6A A;  1ZA2 B;  3CCV A;  2QQA A;  1S72 A;  1PNJ A;  4OGC A;  2X4X A;  3E1S A;  3UAT A;  3FC3 A;  3HRT A;  1SRM A;  2DJQ A;  4F7U A;  2BUD A;  1SHF A;  2HSE B;  1FMV A;  5D6Y A;  2HKQ B;  2CUB A;  2VXE A;  5L8R E;  2COY A;  2PZ1 A;  2QTV A;  4BI3 A;  1OI1 A;  1YHQ Q;  1KFZ A;  2KT1 A;  1KQ1 A;  2X4J A;  1UGV A;  1C1A A;  3QZ5 B;  3EG9 B;  1QWE A;  1MV0 B;  3ZBD A;  2O9S A;  5KYU B;  2EGA A;  3AT1 B;  4X9C A;  2SEM A;  2VVK A;  1SEM A;  1ZX6 A;  2M16 A;  2YXY A;  2XI9 A;  2DEU A;  1M30 A;  3M0S A;  2QYZ A;  5GAN j;  3C94 A;  2SRC A;  3C95 A;  1BIB A;  1BCM A;  5KYX A;  3I35 A;  4B6M A;  3SWN B;  1VYT A;  2V8J A;  1KIK A;  4M7A E;  2LQ8 A;  1YJ9 A;  2DL7 A;  1B7T A;  1OU9 A;  4PJN A;  2WAC A;  4JDS A;  3ASK A;  1Z9Q A;  3A8M B;  3CC4 Q;  5LJ3 j;  1SHG A;  1M2V B;  1M5Q 1;  2CP5 A;  1ZSZ C;  3OA6 A;  4ORZ A;  2L2P A;  4PLL A;  2C0T A;  2JTE A;  1VQL Q;  1OV3 A;  1SSF A;  4O5V A;  5FWC A;  2P0P A;  1IB8 A;  2DD5 A;  1VQ9 T;  5KE3 A;  2E70 A;  3EG0 A;  5GAO m;  1GCQ C;  2KNB B;  1M1F A;  4C92 C;  2RK1 A;  2OAU A;  3OB9 A;  1JRI A;  4OML A;  1VQ7 A;  1TS9 A;  2OX7 A;  4E7K A;  1UB4 A;  4ESR A;  1YFN A;  1RAC B;  4BY6 C;  2ROL A;  5DY9 A;  2VAS A;  2K4Y A;  3NHN A;  4J8O A;  5LJ5 g;  5KH6 A;  3OYH A;  4Y28 E;  4OP0 A;  2J6K A;  1S1N A;  1ARK A;  3INZ A;  4HCZ A;  2D8H A;  3L2R A;  4MZT A;  2PUO B;  5GAN 2;  1WZO A;  1OX9 A;  1XJW B;  3CMA Q;  3JCM V;  4E7S A;  2QQ9 A;  2NUP B;  2MWP A;  4AG1 C;  1T3L A;  3FLG A;  3WXM B;  4J9F A;  4RG2 A;  2EYW A;  1QP2 A;  4RCC A;  1VQ8 T;  2CZ6 B;  1VQO Q;  4R0K A;  3CCM T;  4GLK A;  2X35 A;  4J6Y A;  1GCP A;  3VUZ A;  3CC2 T;  3G7Z A;  4LXC A;  2GQV A;  3FJP A;  1WX6 A;  2JJ9 A;  1VQ9 A;  4PJJ A;  5GJV B;  3EGX B;  1WJQ A;  4E6R A;  2GCX A;  2ZAE A;  4IKF A;  3RKX A;  4EMK B;  3LLR A;  5LJ5 h;  4M77 A;  4M78 D;  2EYQ A;  3LX7 A;  5CKB A;  1M1K U;  2ZPI B;  4QT7 A;  4J9G A;  4C0F A;  3UDC A;  1YIT A;  1I4K 1;  3HRS A;  2K3B A;  2AIR B;  4QQ6 A;  3M55 A;  3PFS A;  2K3Y A;  3PT9 A;  1I5L A;  1AZG B;  4BDY A;  1NPP A;  4PJO A;  1GBQ A;  1PSE A;  2CT4 A;  4FYX B;  2GFU A;  2DFU A;  2DVE A;  3EHQ A;  5CO7 A;  2AT1 B;  1QCO A;  5GMK l;  1Q7Y U;  1RAD B;  4Y92 A;  3LWH A;  4M7D A;  1RAA B;  4C92 B;  1LOJ A;  4FCY A;  3CC2 A;  2FPE A;  1Q82 R;  2YRC A;  3QXE B;  4KT0 E;  2QI2 A;  1MUZ A;  3L1A A;  2COW A;  2K57 A;  4B9X A;  1AHJ B;  3GBQ A;  2D1X A;  1ZUY A;  4A54 A;  3JCM P;  4JRK A;  2ZPH B;  4ELY C;  3I9Q A;  1W4S A;  1PRL C;  4N4I A;  2K79 A;  2JM9 A;  4M77 G;  1VQ4 Q;  2XDB A;  4PJO F;  3JB9 G;  4M75 B;  2LQW A;  2DET A;  2CP7 A;  1YJW T;  1JBM A;  2QAZ A;  5GMK m;  4JJN K;  4PJO G;  1WXU A;  2GFA A;  4KRT A;  4A4F A;  1B07 A;  1XQH A;  1RAB B;  3REB B;  4A63 B;  3CPW S;  2JVV A;  3H6Z A;  3CCL A;  2LQK A;  3OMG A;  1ZBJ A;  1Q7Y R;  2K6D A;  1KQS A;  2JT4 A;  1M4Z A;  2LRQ A;  2GTJ A;  4LDV A;  3F70 A;  2QQB A;  2L3S A;  5HY6 A;  1YIJ T;  1OPL A;  2Y90 A;  2V1R A;  1UEC A;  1XNI A;  2M1H A;  2EPD A;  1KQ2 A;  5GAN 3;  5GAN 7;  1KQS S;  2GTO A;  1G3W A;  1VQ8 Q;  2EQK A;  1G2B A;  3RMQ A;  2JTF A;  5GJW B;  2EQJ A;  4ZGJ B;  2ENM A;  1GFC A;  1EIF A;  3G6E Q;  1X6O A;  2DXU A;  2XG8 D;  4C8Q G;  5IHI A;  3I56 T;  1Y96 B;  4JLI A;  4AFZ C;  1VQM Q;  4PK4 A;  1C0M A;  1YI2 Q;  1G3S A;  2KRS A;  2O4X A;  1IGU A;  4DBQ A;  3QZ9 B;  2A0F B;  1Q81 U;  5KCO A;  2RF0 A;  3VS6 A;  4XTX A;  2HL3 A;  3MP8 A;  1YN8 A;  1IGQ A;  1IHV A;  4MDX A;  1D3B A;  3OMC A;  1YJW A;  4J5Y A;  2QA4 Q;  1YIJ A;  2YUN A;  1JEG A;  4C8Q F;  3LGL A;  4M75 A;  3FB9 A;  1QVP A;  1ZSZ A;  2LZ6 B;  2B8A A;  4PNO A;  3X26 B;  2F5K A;  3CCU Q;  1W2B P;  3EGD B;  3SFM A;  4RTX A;  2RH2 A;  4FSX A;  2DXB A;  4O6J A;  4DBR A;  4QVC A;  3G4S Q;  3JCM h;  4IUU A;  4Z02 A;  5IT9 E;  2IG0 A;  4F04 B;  1KSW A;  4PLI A;  1UGS B;  5I21 A;  2RQV A;  2HD0 A;  1B34 A;  4RTV A;  2MIO A;  4DEY A;  4J9C A;  3CME Q;  2LNV A;  5I22 A;  2AZS A;  1ZSG A;  2XKO C;  1IZ6 A;  2FB7 A;  3EG9 A;  1B3Q A;  3SHW A;  1YWO A;  3S6W A;  1M3A A;  3I56 A;  4C92 D;  3MJX A;  1QMC A;  4LD9 K;  2EKH A;  2QGF B;  1JJ2 S;  4M7A F;  4F7U G;  1VYU A;  1DJ7 B;  3TSZ A;  2KAF A;  4C0D B;  1K4U S;  2D9T A;  4MZM A;  1BCO A;  4TVR A;  3JCM e;  1M3C A;  5LJ3 e;  2DZ9 A;  1VQ5 Q;  1HD3 A;  1M8M A;  5GAO p;  4ME7 A;  1PKS A;  3X25 B;  2A08 A;  3H41 A;  4E7J A;  1K0X A;  3BDU A;  3E9G A;  3UA7 A;  3HPW A;  4IUQ A;  2C06 A;  5IAY A;  1MNE A;  2RA2 A;  2E12 A;  2MMP A;  4M77 C;  2FYK A;  1BI1 A;  3EH2 A;  1OOT A;  1W2B A;  1WHM A;  2MF2 A;  2XIC A;  2EGC A;  2E10 A;  2M0Y A;  4X1V A;  3HKS A;  1X2K A;  3H0I A;  3CXC P;  1W70 A;  1PG5 B;  2EBP A;  1X43 A;  3BDL A;  3M4Y A;  2RB6 A;  2LCS A;  3MHX A;  1D0X A;  3CPF A;  3OYB A;  3OSV A;  5FW9 A;  2OAW A;  1U8R A;  3JB9 H;  1BIA A;  1D0Y A;  1Y7X A;  4M78 E;  3M0T A;  4Q5W A;  2PUK B;  2DLP A;  3PVQ A;  1U06 A;  2J7I A;  4ELZ C;  2NWM A;  3OS0 A;  1V1C A;  1M1K C;  1NLP C;  1TOV A;  2HQX A;  2R5M A;  3OYD A;  1I07 A;  1WFW A;  3EFO B;  2LVM A;  2HKN A;  3O5Z A;  2MI6 A;  2GBQ A;  1X2Q A;  3LH0 A;  3RKY A;  2K5L A;  2PTK A;  4HXJ A;  3OW2 A;  3NFC A;  4ZN1 A;  2RHU A;  3MEU A;  2YLB A;  2H3E B;  3WVD B;  4QVD A;  4E7H A;  4PFP A;  5GMK e;  3VU3 C;  2O2O A;  3CCJ Q;  1HYO A;  3NGP A;  4EMG A;  1MMN A;  4C8Q A;  1M90 C;  2NLU A;  4HCC A;  3G6E T;  2O88 A;  1VQP Q;  4HT8 A;  1X75 C;  3CC7 Q;  1Q86 U;  2DIL A;  3GOX A;  5GAM d;  4X34 A;  3QWX X;  4LN2 A;  2OTL Q;  2K5F A;  3RNJ A;  1K73 C;  1AWW A;  2ZPE B;  2AZV A;  1VQ5 T;  1MHN A;  1RI9 A;  4Z88 A;  1VQK Q;  1AD5 A;  3CBO A;  4PJO B;  4FU6 A;  3EGD A;  2DIQ A;  3QKJ A;  1ZUU A;  1NYF A;  4M75 D;  1RLP C;  3FIF A;  3VS0 A;  3HTR A;  2AKK A;  2GF7 A;  1VQ7 Q;  5GAO n;  5CKE A;  1BI0 A;  5GAN f;  1GRI A;  5FU7 B;  1X6G A;  3NMZ C;  4PL6 A;  3L42 A;  1I81 A;  4CC7 A;  1Q82 C;  1K9M U;  2V1Q A;  2DX1 A;  2RJC A;  1QVF A;  4XAX B;  2QTX A;  2JZ2 A;  1N8R C;  3L2Z A;  1WPY A;  2FVU A;  5FU7 C;  3EGU A;  3M5A A;  2XID A;  1K8A R;  4IIM A;  2DBM A;  1FMK A;  3DLM A;  4RTU A;  3PIP A;  5GAN 5;  2M9U A;  4RTW A;  4FYY B;  3PTA A;  2DL4 A;  3L2W A;  1NJI R;  2L3R A;  3OYY A;  4F16 A;  2ED1 A;  2LQN A;  7AT1 B;  4M78 G;  5HCK A;  1H3H A;  1V76 A;  3I55 T;  4OB2 B;  5CAI A;  2KEA A;  3P8B B;  2BKD N;  1PD1 A;  3EG2 A;  3GP8 A;  3OSS C;  3R6N A;  1WHG A;  4QQD A;  3LW5 E;  4FL6 A;  2GQI A;  4RKU E;  1OEB A;  3SWN C;  1VUB A;  1D1A A;  1OU8 A;  2KBT A;  2KYB A;  3VYH B;  1S72 Q;  4OB1 B;  2RNA A;  1FWZ A;  1ABQ A;  5LL6 S;  4M7A B;  5KYY A;  2HSP A;  1PM3 A;  1G3Y A;  1WXB A;  3ME9 A;  3LWI A;  5AT1 B;  4HCK A;  1UDL A;  1K8A C;  2XDP A;  1FYN A;  3FRN A;  2A37 A;  2QGG A;  5I11 A;  2RQU A;  1K9M C;  1VQ4 T;  4XU1 A;  1N8R R;  2ZPB B;  2E64 A;  4PJL A;  2W10 A;  2HBP A;  3A98 A;  1S72 T;  2A7Y A;  2J6O A;  3MP1 A;  2EYY A;  5C0M A;  2JW4 A;  5LJ3 h;  1KJW A;  4XU3 A;  3UA6 A;  1QLY A;  1TG0 A;  2VWF A;  4OF1 A;  5KYU A;  1D3B B;  3R6O A;  1CSK A;  2OTL T;  3CCE T;  4RTT A;  2VV5 A;  3VS3 A;  3OYE A;  4A4E A;  2W0Z A;  1PC0 A;  2EGE A;  1NBE B;  1YJ9 Q;  3OW2 S;  1IXD A;  3JCM c;  4EMK A;  1Q86 R;  5A0L A;  3NTI A;  2P0Q A;  1YI2 T;  3RR6 A;  4FT2 A;  2FPF A;  2E5K A;  1W1F A;  6AT1 B;  2ED0 A;  3LGF A;  4JZ3 A;  4C92 G;  1KHC A;  4FIB A;  4GY5 A;  4DBF A;  1IO6 A;  2P4R A;  3JCM J;  4J7I A;  1H64 1;  4MDW A;  2MYS A;  1QKW A;  3QUI A;  3A8G B;  1AT1 B;  1LPL A;  1X27 A;  2F1L A;  4M77 D;  1RAE B;  4XTU A;  1RI0 A;  2ABL A;  2L5Q A;  4M7A D;  1VQN A;  1KC8 R;  1MMG A;  2FZG B;  2PVD B;  3HFN A;  5HK3 A;  4K11 A;  1WJS A;  4RUG A;  1MMA A;  4ZN3 A;  4M7D B;  3GPL A;  5CKH A;  2KGT A;  3M0Q A;  2RI2 A;  5FRO A;  1BU1 A;  3CPW P;  2D8J A;  1UHC A;  1UEB A;  2F5T X;  2JOY A;  4ATO A;  4MZP A;  2MOX A;  1PKT A;  3P8D A;  4NL2 A;  4JUV A;  1MGQ A;  3KBG A;  1YI2 A;  1I8F A;  4JS4 A;  2CZ0 B;  1NYG A;  5GAO r;  3VV0 A;  1VYV A;  3CCR Q;  1WGS A;  1CKA A;  2LT1 A;  4RCB A;  1OYX A;  1Q95 G;  5GMK i;  1NJI C;  1TUC A;  1LNX A;  4FYV B;  1G83 A;  3VUB A;  4B9W A;  4F7U F;  1YJW Q;  3RIR A;  1VQ6 Q;  2K5I A;  2CRE A;  4WCI A;  2X3W D;  3CCV T;  1W2B S;  2EJF A;  1FX7 A;  1H3Z A;  3KUF A;  1WHL A;  2CP0 A;  4DOV A;  3CCU A;  4JRI A;  2YT6 A;  3PGG A;  2ESW A;  2KYM A;  2LP5 A;  3JCM X;  2VGM A;  3A8O B;  4LDX A;  4QQG A;  4C0D C;  3CCS T;  4JJB A;  4N0A A;  2WSE E;  3ULR B;  3CBP A;  1MMD A;  3EFO A;  3MKD A;  3SDZ A;  3QJY A;  1WQW A;  1RUW A;  3M58 A;  1M3B A;  2FRY A;  5GAN h;  2K2M A;  3X28 B;  4EDU A;  2LTO A;  1HSQ A;  2XHC A;  2L8D A;  1YIT T;  1QCF A;  2EW3 A;  4MMK A;  3CC2 Q;  1SPK A;  5GAN g;  5IXB A;  1RLQ C;  4BE0 A;  4C8Q E;  2K7A A;  3LYI A;  4N4H A;  4EPC A;  3GIB A;  2H8H A;  2P4T A;  4DBH A;  2RHX A;  1YJ9 T;  2J6F A;  1QWF A;  4D6W A;  4ANJ A;  4Z8A A;  1WJR A;  4CC3 A;  5HKC A;  3JCM f;  3C4S A;  5GAM e;  1K8A U;  1E7O A;  1R0B G;  3TVT A;  5DLQ E;  1VQ4 A;  1PCX A;  2CUD A;  4EMK C;  2LCL A;  3M4G A;  1FXX A;  1SSH A;  3S3O A;  2ROT A;  2DO3 A;  3CXC S;  3OYN A;  2ZPF B;  3CCL Q;  4M78 A;  1WQ7 A;  2YLC A;  2EAY A;  3CCR T;  3CCE Q;  3V8J A;  2XD0 A;  1N9S A;  1YNZ A;  2Y4Y A;  2FL7 A;  2F2V A;  1OQK A;  3M56 A;  5CKF A;  4GLM A;  2XK0 A;  1NLO C;  1IRE B;  1RAG B;  3URG A;  1TU0 B;  2G6F X;  3E19 A;  4DQ2 A;  2YSQ A;  3BFM A;  1HK9 A;  3VS1 A;  2FZK B;  1UG1 A;  1GCQ A;  2G3R A;  1RAH B;  5FLX E;  4GBQ A;  1NM7 A;  4OB0 B;  2AK5 A;  2EQU A;  1ZUK A;  3CCM Q;  2CH4 W;  3RER A;  1U1S A;  2P0K A;  4NOY A;  1Q86 C;  5LJ5 f;  4ZGE B;  3TCJ A;  1YJN A;  4M75 F;  4CRI A;  3DB3 A;  1XTD A;  5KE2 A;  3L2Q A;  3G71 Q;  2LJ1 A;  4F14 A;  2CS7 A;  3UWN A;  2FG0 A;  4DEX A;  3OYL A;  2DYI A;  4BB7 A;  1AVZ C;  3DKM A;  4JJC A;  2PVG B;  1X6B A;  3JB9 J;  3MEV A;  4J9D A;  4HVW A;  4OMP A;  4MML A;  2QA4 A;  2DPP B;  2E4H A;  2RK2 A;  5CKD A;  3CC7 A;  1G5V A;  2X4W A;  1KK7 A;  3RKW A;  4KUD K;  4C8Q D;  4M7D C;  5EC7 A;  2A28 A;  2RHI A;  3CCS Q;  1HXD A;  2DTI A;  3HL8 A;  1YP5 A;  2KRM A;  2QAS A;  3EGX A;  3GF5 A;  4M78 B;  3M9Q A;  2FO0 A;  2OTJ T;  3CME T;  5FWB A;  2JS2 A;  2BZX A;  4J6W A;  3X20 B;  1E6H A;  3DLL A;  3SB2 A;  4OMN A;  1M27 C;  2EYZ A;  4HCB A;  1K76 A;  1UHF A;  3V8L A;  4F17 A;  4RTZ A;  4JZ4 A;  2FRW A;  3PNW C;  4AMC A;  3TRE A;  3P8H A;  2RMO A;  2ZGW A;  1U1T A;  4FM4 B;  1UGP B;  2NUT A;  3JCM b;  3FEO A;  3I5R A;  2VB6 A;  5LJ3 g;  5GAN 4;  3I56 Q;  4PFO A;  2R5A A;  1M90 U;  1G3T A;  1MV3 A;  2DRM A;  2LNH B;  3TU4 K;  2QA4 T;  3ZL7 C;  2WSF E;  3Q1J A;  4FW2 A;  1VQ5 A;  4OMQ A;  1I1J A;  2AHJ B;  3CCQ T;  1X69 A;  2MK5 A;  1UFF A;  1NEG A;  5GAM g;  1OZ2 A;  2VGN A;  4D8D A;  2BTT A;  3PE0 A;  4C0G A;  4M77 F;  2LJ3 A;  1Y0M A;  1X01 A;  2KK4 A;  5IHN A;  3UPU A;  5KCH A;  3NTH A;  4X9D A;  2DAQ A;  2ECZ A;  2O31 A;  4L6V 5;  4JRQ A;  1ACM B;  3JRZ A;  1WXT A;  4CC4 B;  4A53 A;  1VQP T;  3S3N A;  4BD3 A;  3UF4 A;  2FEI A;  4A4G A;  5CK9 A;  1QCN A;  4QVZ A;  1ZQ1 A;  2DXC A;  2XMF A;  2CP3 A;  5DM7 R;  1T0H A;  3EAE A;  1BKB A;  3C0C A;  2LDM A;  1D09 B;  2DMO A;  2LX9 A;  5GMK j;  5CR2 A;  2KT8 A;  2JM8 A;  4LE9 A;  3CCQ Q;  2K9G A;  5HK0 A;  4XTZ A;  2J06 A;  1H8K A;  3BE3 A;  3QG1 A;  2HDA A;  1V29 B;  1XOV A;  3PIO A;  1RL2 A;  3FJ5 A;  2RHZ A;  1TWB A;  2EQI A;  2YRD A;  1JXM A;  3IQL A;  1IRX A;  2V8I A;  4XTW A;  2O4X B;  3MEW A;  2IVW A;  3JCM g;  3PMT A;  3CCJ A;  4V2S A;  1ZBX A;  3L2V A;  1CKB A;  5GAN 6;  1M8V A;  2LCC A;  2C0I A;  2HQH A;  3CD6 T;  4M4Z A;  5KYW A;  3U23 A;  4AG2 C;  1Q7Y C;  4EIK A;  3M59 A;  1M2O A;  1UGR B;  1VQP A;  2I2L A;  3OS1 A;  3G4S T;  4KGV B;  2DE0 X;  4L59 A;  2OTJ Q;  2L0A A;  4OVA A;  3EFR A;  2K3X A;  5CQX A;  3OS5 A;  1BI3 A;  3E9F A;  3C12 A;  4PJO E;  1VQ6 T;  1O75 A;  2RQT A;  5FU6 B;  3QYH B;  3RUX A;  4E47 A;  3OYM A;  2LMJ A;  1R77 A;  1PRM C;  2DK3 A;  4E2F B;  3MET A;  2CH4 A;  3CQT A;  5IXF A;  2X51 A;  1WI7 A;  1R8O B;  4PJO D;  2KRN A;  2BZ8 A;  3N5B B;  1K73 R;  4CI0 C;  1SF9 A;  2PU9 B;  4M75 E;  1VQN Q;  1VA7 A;  3OY9 A;  1LJO A;  2IPO B;  2NUP A;  5M9O A;  3CD6 Q;  1TUG B;  2M51 A;  4M7A C;  1WHK A;  2JMA A;  1WA7 A;  2HCK A;  2CKK A;  5GAM j;  3LH5 A;  1H92 A;  1WHH A;  2L89 A;  3G1J A;  3EFS A;  2EJG A;  3REA B;  4A4H A;  1W6X A;  3QHS A;  2MAM A;  3QSU A;  2EWN A;  2R58 A;  1FMW A;  3NPF A;  2GNC A;  5LJ5 e;  3MPU B;  1AWJ A;  2OI3 A;  4E7L A;  3J81 E;  4ZGD B;  4QW2 A;  4M78 F;  2HMA A;  3JCM d;  2QEX Q;  2JN0 A;  4Y91 A;  3VS5 A;  4LUD A;  1VQ6 A;  4D8K A;  4J7F A;  1Y71 A;  2DRK A;  2IIM A;  4F7U B;  2QDL A;  4BY6 B;  2NUZ A;  4LUE A;  2M0O A;  4A4K A;  2KE9 A;  4NL3 A;  3L2U A;  2OJ2 A;  3J80 E;  1NPR A;  5LJ5 j;  3M0P A;  4KGZ B;  2CDT A;  4XU2 A;  4EMH A;  3VKI A;  2DTO A;  4XTY A;  5LJ3 f;  2DYB A;  3OYC A;  4R56 A;  1AOJ A;  1T3S A;  2FHD A;  4CC2 A;  4QKU A;  1QVG P;  4J83 A;  4PFZ A;  3H0F A;  2DER A;  3M0R A;  1VQK T;  3SWN A;  5KYN A;  1N27 A;  2EKO A;  2RI5 A;  4LDW A;  1K9M R;  1QW1 A;  1JU5 C;  3E2U A;  3OYA A;  5FRM A;  4XQ3 A;  1NEB A;  3D7S B;  2VUB A;  1D1C A;  2FZC B;  4M7D E;  2DA9 A;  3CCU T;  1M2V A;  9ATC B;  3JAM E;  1UGQ B;  3GLX A;  1KD1 U;  5FU6 C;  2EIF A;  4VUB A;  1KQS P;  3H9N A;  4XU0 A;  3QDF A;  1Q81 C;  1VQ7 T;  1WDX A;  3EG3 A;  4E7I A;  4BE1 A;  2KMT A;  3KXT A;  2X9H A;  4LD6 A;  5D7U A;  1TTH B;  1VIF A;  4F7U E;  4C0Z A;  3VYG A;  2H3J A;  3CMA T;  3CPW A;  4FW1 A;  4OMF B;  3CCL T;  3CCE A;  2ATC B;  2ZZD A;  3JB9 I;  2BZY A;  3M54 A;  4KUI A;  5GAO l;  1E6G A;  1J3T A;  2RQW A;  4M77 E;  2Z0W A;  3TQ7 P;  2YRV A;  1UJY A;  3QII A;  1TH7 A;  3GNG A;  1N8R U;  4R55 A;  3I55 Q;  1AZE A;  3S3M A;  2AKL A;  2QEX T;  3I5S A;  4IUV A;  2E41 A;  2DKG A;  3CEY A;  1GL5 A;  1WNL A;  2Y4X A;  2I0N A;  2RJF A;  3CCM A;  4C5H A;  2F2X A;  1YHQ T;  5I2M A;  2KSS A;  1SG5 A;  5IHK A;  3NTK A;  3V7R A;  1WIE A;  2LJ0 A;  2L3P A;  2RI3 A;  3HP9 A;  5L23 A;  5GAM h;  2ZCF B;  3G71 A;  3M0U A;  4M75 G;  3CCR A;  3THK A;  1O9S A;  4XTV A;  1AWO A;  3ER0 A;  3JB9 F;  3TEE A;  2MPX C;  1WHJ A;  2DZC A;  4KH1 B;  1M9S A;  2DXT A;  2VC8 A;  3JCM W;  2PQW A;  4OGE A;  1VOM A;  1UUE A;  3A5Z B;  2DL5 A;  2KXD A;  4FT4 A;  1VQL T;  5KYX B;  1QVF S;  1RAF B;  1N9R A;  2RJE A;  1IHW A;  1VIE A;  3PMI A;  1YIT Q;  3EG1 A;  4E7Z A;  3CCV Q;  1Q82 U;  1HJD A;  5CCA A;  3CC4 T;  4HA8 A;  1QP3 A;  4ZNX A;  5GAN e;  4BI4 A;  4P5N A;  3OYG A;  3CXC A;  2A3L A;  1TXQ A;  4OB3 B;  4IUR A;  1G8X A;  4C92 F;  1YHQ A;  3VJP A;  3JCM Q;  2HBW A;  3VS2 A;  4BUG A;  3CC7 T;  1I0C A;  4OMM A;  5EG2 A;  3SEM A;  5KYY B;  4M7A A;  2DL3 A;  4C5E A;  2D0Q B;  5LJ5 d;  5GAN 8;  3G71 T;  1RAI B;  1BI2 A;  1K9A A;  1Q81 R;  4PJO C;  1M1K R;  1JJ2 P;  2DEQ A;  1SKU B;  4Z89 A;  3CBM A;  2X4Y A;  3QYG B;  5J39 A;  5CVI A;  5J26 A;  5ECA A;  2C0O A;  2VYT A;  3RES A;  4ZTF A;  4UC4 A;  4C5I A;  5IH2 A;  1BK2 A;  1PSF A;  2CZ7 B;  1PD0 A;  1EFN A;  1M1G A;  1QVG A;  2GGR A;  3KFV A;  3CC4 A;  2LT4 A;  1K1Z A;  1NG2 A;  2F69 A;  4JS5 A;  1Z9Z A; 
#chains in the Genus database with same CATH homology
 1BI0 A;  2DD5 A;  5GAN f;  1VQ9 T;  5KE3 A;  2KQW A;  2E70 A;  5GAO m;  3HHT B;  1M1F A;  4C92 C;  2WSF E;  3Q1J A;  1VQL A;  2RK1 A;  3O8V A;  5FU7 B;  2OAU A;  5GAO q;  4PL6 A;  1K9M U;  3L42 A;  1I81 A;  1Q82 C;  1VQ5 A;  3OB9 A;  2RJC A;  1JRI A;  2AHJ B;  3CCQ T;  1QVF A;  4XAX B;  1VQ7 A;  2DTH A;  2JZ2 A;  2QTX A;  1N8R C;  3L2Z A;  1KG1 A;  3J7A F;  1WPY A;  5GAM g;  1OZ2 A;  2FVU A;  2VGN A;  3MEA A;  4E7K A;  1UB4 A;  5FU7 C;  3M5A A;  4C0G A;  2XID A;  4BY6 C;  4M77 F;  5DY9 A;  4C5G A;  2K4Y A;  4J8O A;  1X01 A;  5LJ5 g;  5KH6 A;  2KK4 A;  3UPU A;  5KCH A;  3DLM A;  3NTH A;  3OYH A;  4Y28 E;  3WVE B;  3PIP A;  4OP0 A;  1VQ8 A;  5GAN 5;  2M9U A;  2QXF A;  4X9D A;  3INZ A;  4KBM B;  3GNF B;  2DAQ A;  4HCZ A;  3PTA A;  4MZT A;  2PUO B;  4L6V 5;  3L2R A;  3L2W A;  2L3R A;  5GAN 2;  3OYY A;  3OYJ A;  2KY9 A;  3H8Z A;  2HQE A;  4JRQ A;  4M78 G;  3JCM V;  3MP6 A;  3JRZ A;  1YCY A;  3I55 T;  2QQ9 A;  2K2V A;  3AHU A;  2MWP A;  2JUF A;  4A53 A;  4OB2 B;  5CAI A;  3S3N A;  3WXM B;  3FLG A;  2BKD N;  2JNG A;  3OQ5 A;  3P8B B;  4RG2 A;  5LJ3 d;  4A4G A;  4BD3 A;  5CK9 A;  1QP2 A;  4RCC A;  4BAC A;  1VQ8 T;  3GP8 A;  2CZ6 B;  3OSS C;  4QVZ A;  1ZQ1 A;  2QQR A;  3CCQ A;  3CCM T;  4GLK A;  2X35 A;  3BY7 A;  2DXC A;  3M57 A;  4J6Y A;  4QQD A;  3VUZ A;  3G7Z A;  3LW5 E;  3EAE A;  1BKB A;  4FL6 A;  5DM7 R;  2GQV A;  3CMA A;  2LDM A;  4HT9 A;  4RKU E;  1NE8 A;  3SWN C;  1VUB A;  2LX9 A;  4DOW A;  3FJP A;  1BYM A;  1VQ9 A;  3VYH B;  2E6N A;  2RD1 A;  5GMK j;  1WJQ A;  5CR2 A;  1VQO A;  2GCX A;  4OB1 B;  5I2S A;  1FWZ A;  3RKX A;  4EMK B;  5HK0 A;  4IKF A;  4IUP A;  4XTZ A;  3LLR A;  5LJ5 h;  3JB9 F;  3A8L B;  5LL6 S;  4M77 A;  2EQM A;  3QO3 A;  2CYZ B;  4M78 D;  3QG1 A;  4M78 C;  2EYQ A;  4M7A B;  4C92 A;  3LX7 A;  1V29 B;  4C8Q B;  5CKB A;  1M1K U;  1XOV A;  3PIO A;  1RL2 A;  1G3Y A;  3LWI A;  3ME9 A;  2RHZ A;  2RJD A;  2ZPI B;  3QPH A;  4C0F A;  3UDC A;  1YIT A;  1I4K 1;  3HRS A;  4QQ6 A;  2V8I A;  3JSC A;  2O4X B;  4XTW A;  2XDP A;  1K8A C;  4XK8 E;  4IUT A;  3M55 A;  3FRN A;  3MEW A;  3HRU A;  2IVW A;  3PFS A;  4M75 C;  3OYF A;  2K3Y A;  1K9M C;  3JCM g;  3PT9 A;  1VQ4 T;  3PMT A;  4XU1 A;  3CCJ A;  4V2S A;  1I5L A;  1ZBX A;  3L2V A;  5GAN 6;  1M8V A;  4BDY A;  2LCC A;  1NPP A;  2ZPB B;  4PJO A;  2E64 A;  1PSE A;  2HBP A;  1YJN T;  1S72 T;  2GFU A;  2A7Y A;  3OS2 A;  3CD6 T;  2DVE A;  3MP1 A;  5C0M A;  5CO7 A;  5LJ3 h;  3CCS A;  2HAX A;  2HNI A;  4XU3 A;  1Q7Y C;  1KC8 C;  5GMK l;  3M59 A;  1Q7Y U;  2ZPG B;  1UGR B;  3ZEH A;  1VQP A;  1KC8 U;  2I2L A;  4OF1 A;  3OS1 A;  3G4S T;  4DA4 A;  3LWH A;  4L59 A;  4M7D A;  2BIV A;  4OVA A;  1D3B B;  4C92 B;  1LOJ A;  3EFR A;  4YTL A;  3R6O A;  4NS5 A;  3CC2 A;  2K3X A;  5CQX A;  3OS5 A;  2OTL T;  1KD1 C;  1BI3 A;  4J6X A;  3CCE T;  3E9F A;  3C12 A;  2VV5 A;  4PJO E;  4N4G A;  1O75 A;  5FU6 B;  1VQ6 T;  4WF2 A;  3CME A;  3OYE A;  3QXE B;  4A4E A;  1NZ9 A;  3QYH B;  1P92 A;  2QI2 A;  4KT0 E;  3RUX A;  4E47 A;  2YHT A;  3OYM A;  3L1A A;  2DK3 A;  3OW2 S;  2K57 A;  4B9X A;  3QJ6 A;  3JCM c;  3MET A;  1AHJ B;  4EMK A;  3CCJ T;  5A0L A;  3NTI A;  2P0Q A;  4A54 A;  5A0G A;  3JCM P;  4JRK A;  1YI2 T;  4FT2 A;  2ZPH B;  4RG8 A;  4ELY C;  2DIG A;  4N0A C;  1W4S A;  5CQY A;  4JRP A;  1VQM T;  4N4I A;  3CD6 A;  1R8O B;  3LGF A;  4PJO D;  3N5B B;  4ZTJ A;  4C92 G;  1KHC A;  5A0D A;  4CI0 C;  4FIB A;  4GY5 A;  4M77 G;  2XDB A;  5IN1 A;  4PJO F;  2JTM A;  3T9N A;  4J7I A;  2PU9 B;  4M75 B;  4M75 E;  3JCM J;  3JB9 G;  1H64 1;  4MDW A;  1YJW T;  1JBM A;  4JJN K;  5GMK m;  3QUI A;  3A8G B;  4PJO G;  3OY9 A;  2QA4 T;  2GFA A;  4KUL A;  1LJO A;  5D6X A;  4M77 D;  2MWO A;  4A4F A;  5M9O A;  1XQH A;  4XTU A;  4II1 A;  1RI0 A;  2R57 A;  2CZ1 B;  3CPW S;  2JVV A;  3H6Z A;  3CCL A;  2LQK A;  4M7A C;  2L5Q A;  3OMG A;  5GAM j;  2CKK A;  4M7A D;  1VQN A;  2DJZ A;  1Y96 A;  1VQP T;  1KQS A;  2L89 A;  3EFS A;  1JJ2 A;  2EJG A;  1M4Z A;  5GAN d;  2RHY A;  2LRQ A;  4A4H A;  2PVD B;  3HFN A;  1KHI A;  5HK3 A;  4LDV A;  3F70 A;  2EJ9 A;  2QQB A;  5HY6 A;  1YIJ T;  1WJS A;  3QHS A;  5D6W A;  2MAM A;  2Y90 A;  4ZN3 A;  3QSU A;  4M7D B;  2EWN A;  2E6Z A;  1XNI A;  2R58 A;  3GPL A;  2M1H A;  5CKH A;  1KQ2 A;  2CGH A;  5GAN 7;  5LJ5 e;  5GAN 3;  1KQS S;  1G3W A;  2RI2 A;  2QQS A;  4JLG A;  4E7L A;  4L5G A;  5FRO A;  2EQK A;  4M77 B;  3J81 E;  4ZGD B;  1UEB A;  2F5T X;  2JOY A;  4QW2 A;  4M78 F;  3UT1 A;  4BE2 A;  4ATO A;  4MZP A;  3V7S A;  3RMQ A;  2JTF A;  3JCM d;  3P8D A;  2JN0 A;  4NL2 A;  2EQJ A;  4JUV A;  1MGQ A;  4ZGJ B;  3KBG A;  1YI2 A;  4Y91 A;  1I8F A;  4JS4 A;  2LC4 A;  1EIF A;  2CZ0 B;  1X6O A;  2DXU A;  2XG8 D;  1ZHI A;  5GAO r;  4C8Q G;  4PKC C;  2XDD A;  1B34 B;  3VV0 A;  3I56 T;  1VQ6 A;  3HSB A;  4M7D G;  1Y96 B;  1WGS A;  4JLI A;  2LT1 A;  4J7F A;  1Y71 A;  4RCB A;  4F7U B;  1YBY A;  1OYX A;  4BY6 B;  1G3S A;  3OBY A;  5GMK i;  1NJI C;  2M0O A;  1LNX A;  3VUB A;  4B9W A;  4A4K A;  3G6E A;  2D6F A;  4F7U F;  3ZFJ A;  2O4X A;  2E5Q A;  4NL3 A;  3RIR A;  2K5I A;  3L2U A;  1QVG S;  3CCV T;  1W2B S;  2EJF A;  3QZ9 B;  2E65 A;  1VQM A;  1Q81 U;  5KCO A;  3J80 E;  4XTX A;  1FX7 A;  4RMO A;  1H3Z A;  1NPR A;  5LJ5 j;  3MP8 A;  3DB4 A;  4MDX A;  1D3B A;  3KUF A;  4XU2 A;  4DOV A;  3OMC A;  3CC2 T;  3CCU A;  4EMH A;  3VKI A;  1YJW A;  3OYI A;  4J5Y A;  1YIJ A;  4JRI A;  2DTO A;  4XTY A;  3PGG A;  4C8Q F;  3LGL A;  4M75 A;  3JCM X;  3FB9 A;  5LJ3 f;  1QVP A;  3OYC A;  4M7D F;  2VGM A;  3A8O B;  4R56 A;  4LDX A;  2XU8 A;  2V8K A;  2B8A A;  3MCA B;  4PNO A;  4QQG A;  4C0D C;  2FHD A;  3CCS T;  3X26 B;  1JB0 E;  4N0A A;  2WSE E;  2F5K A;  3CBP A;  3SD4 A;  4J83 A;  3SDZ A;  3SFM A;  3M53 A;  3QJY A;  2RH2 A;  1WQW A;  3QDR B;  3M58 A;  4FSX A;  2DXB A;  3RMS A;  4O6J A;  1VQK T;  4QVC A;  3SWN A;  5GAN h;  3JCM h;  3MO8 A;  4IUU A;  4Z02 A;  3X28 B;  4EDU A;  5IT9 E;  1N27 A;  2EKO A;  2IG0 A;  2LTO A;  2OTL A;  2RI5 A;  4LDW A;  4PLI A;  1UGS B;  2L8D A;  2XHC A;  1QW1 A;  5I21 A;  3OYA A;  2HD0 A;  1YIT T;  5FRM A;  4XQ3 A;  1B34 A;  2OTJ A;  2VUB A;  4MMK A;  5GAN g;  2VXF A;  4M7D E;  4BE0 A;  1VQO T;  4C8Q E;  3G4S A;  3JAM E;  3CCU T;  1UGQ B;  3LYI A;  1VQK A;  4N4H A;  3GLX A;  1KD1 U;  4EPC A;  2EIF A;  2LNV A;  4LDY A;  4VUB A;  4XU0 A;  3QBY A;  5FU6 C;  5CIU A;  2P4T A;  1Q81 C;  1VQ7 T;  2DD4 A;  2RHX A;  1YJ9 T;  2XKO C;  1IZ6 A;  2FB7 A;  4E7I A;  1YJN A;  2E1H A;  4BE1 A;  2KMT A;  3KXT A;  4D6W A;  4M7A G;  5C6S A;  3S6W A;  3I56 A;  4C92 D;  3OBW A;  4LD6 A;  3A8H B;  4LD9 K;  1WJR A;  1OZ3 A;  5HKC A;  3JCM f;  3C4S A;  5AYF A;  3JB9 D;  5GAM e;  1K8A U;  3X24 B;  3OYK A;  2WSC E;  2KDS A;  1JJ2 S;  4M7A F;  4F7U G;  1NJI U;  5DLQ E;  1VIF A;  3V7C A;  4C0Z A;  4F7U E;  3VYG A;  3GIB A;  1DJ7 B;  2H3J A;  1VQ4 A;  2KAF A;  4C0D B;  4EMK C;  3CMA T;  2D9T A;  4MZM A;  5J3B A;  3CPW A;  4LDU A;  4TVR A;  4OMF B;  3V8K A;  3CCE A;  3JCM e;  3CCL T;  5LJ3 e;  2ZZD A;  3JB9 I;  1VQN T;  2DZ9 A;  2LCL A;  3BW1 A;  1FXX A;  3FDR A;  3M4G A;  3M54 A;  4KUI A;  5DLO A;  3S3O A;  5GAO l;  5GAO p;  3I55 A;  4ME7 A;  5A2Q E;  3X25 B;  2DO3 A;  3CXC S;  2EFI A;  1K73 U;  2RO0 A;  3OYN A;  2O01 E;  2ZPF B;  4C92 E;  4E7J A;  4M77 E;  4M78 A;  3BDU A;  1WQ7 A;  3E9G A;  2YLC A;  2KVQ G;  3HFO A;  4HKE A;  5FRN A;  2EAY A;  3HPW A;  4IUQ A;  3CCR T;  2YRV A;  2C06 A;  3V8J A;  2XD0 A;  5IAY A;  1N9S A;  3QII A;  1TH7 A;  2RA2 A;  3GNG A;  2Y4Y A;  2FL7 A;  1N8R U;  2E12 A;  1GXI E;  2MMP A;  4M77 C;  4R55 A;  3S3M A;  3M56 A;  5CKF A;  2FYK A;  1BI1 A;  2QEX T;  2XK0 A;  4C8Q C;  4BDZ A;  4M7D D;  2RM4 A;  4IUV A;  5GMK h;  1W2B A;  1IRE B;  2E41 A;  2MF2 A;  3URG A;  2XIC A;  1Y07 A;  2E10 A;  3E19 A;  3HKS A;  2DKG A;  3CEY A;  1WNL A;  4DQ2 A;  2Y4X A;  2RJF A;  3CCM A;  2PVO B;  4C5H A;  1YHQ T;  3BFM A;  1HK9 A;  3BDL A;  2KSS A;  3M4Y A;  5I2M A;  4BI8 B;  2RB6 A;  3NTK A;  2QEX A;  3MHX A;  3V7R A;  3CPF A;  2G3R A;  3OYB A;  3OSV A;  2RI3 A;  2QDY B;  5FLX E;  1U8R A;  3JB9 H;  1BIA A;  1Y7X A;  4OB0 B;  4M78 E;  2EQU A;  3HP9 A;  4Q5W A;  5GAM h;  5GAM f;  2ZCF B;  1U1S A;  2P0K A;  2PUK B;  3G71 A;  3RER A;  3CCR A;  4M75 G;  4ELZ C;  1N6A A;  1O9S A;  4XTV A;  3OS0 A;  1M1K C;  4NOY A;  1Q86 C;  2HQX A;  2R5M A;  5LJ5 f;  3ER0 A;  2QQA A;  3TEE A;  3TCJ A;  4ZGE B;  4M75 F;  2LVM A;  4OGC A;  3OYD A;  3CCV A;  2DZC A;  2X4X A;  1M9S A;  3E1S A;  4CRI A;  2DXT A;  3FC3 A;  1S72 A;  2MI6 A;  3HRT A;  2VC8 A;  3JCM W;  2PQW A;  4OGE A;  3LH0 A;  3DB3 A;  3RKY A;  1XTD A;  2K5L A;  3A5Z B;  5KE2 A;  4F7U A;  3L2Q A;  2BUD A;  2CS7 A;  4FT4 A;  3OW2 A;  3UWN A;  3NFC A;  4ZN1 A;  1VQL T;  1QVF S;  1N9R A;  2RHU A;  2RJE A;  1VIE A;  3MEU A;  3PMI A;  3OYL A;  4BB7 A;  5D6Y A;  1Q82 U;  2YLB A;  3WVD B;  4QVD A;  2VXE A;  3DKM A;  4E7H A;  5CCA A;  2PVG B;  5L8R E;  3JB9 J;  4BI3 A;  3MEV A;  3CC4 T;  1OI1 A;  5GMK e;  4HA8 A;  1QP3 A;  4MML A;  3VU3 C;  5GAN e;  2QA4 A;  2DPP B;  2RK2 A;  4EMG A;  5CKD A;  3CC7 A;  4BI4 A;  1KQ1 A;  2X4J A;  2X4W A;  1G5V A;  4P5N A;  4C8Q A;  3RKW A;  3OYG A;  3CXC A;  2A3L A;  4KUD K;  3QZ5 B;  4C8Q D;  4M7D C;  1M90 C;  4OB3 B;  2NLU A;  2RHI A;  3ZBD A;  4IUR A;  1HXD A;  3G6E T;  4HCC A;  2DTI A;  4X9C A;  3HL8 A;  1YHQ A;  4C92 F;  3VJP A;  3JCM Q;  3GF5 A;  4HT8 A;  1X75 C;  4M78 B;  3M9Q A;  1Q86 U;  2M16 A;  4BUG A;  5GAM d;  3GOX A;  3CME T;  2OTJ T;  4X34 A;  3CC7 T;  5EG2 A;  2XI9 A;  4J6W A;  5GAN j;  3X20 B;  4M7A A;  3C94 A;  3SB2 A;  2K5F A;  2D0Q B;  3C95 A;  4C5E A;  3DLL A;  1BIB A;  1K73 C;  5LJ5 d;  5GAN 8;  2ZPE B;  3G71 T;  1BI2 A;  4HCB A;  3SWN B;  1VQ5 T;  1MHN A;  2V8J A;  4PJO C;  2DEQ A;  4M7A E;  3V8L A;  2LQ8 A;  3CBM A;  1YJ9 A;  2X4Y A;  3QYG B;  5J39 A;  5CVI A;  5J26 A;  3PNW C;  2VYT A;  2WAC A;  3ASK A;  3P8H A;  4JDS A;  2ZGW A;  3RES A;  3TRE A;  4ZTF A;  1U1T A;  4FM4 B;  1UGP B;  3A8M B;  3CBO A;  4UC4 A;  4C5I A;  4PJO B;  4FU6 A;  5LJ3 j;  2DIQ A;  3QKJ A;  1M5Q 1;  3JCM b;  3FEO A;  4M75 D;  5GAN 4;  5LJ3 g;  1PSF A;  3OA6 A;  4PLL A;  2CZ7 B;  3FIF A;  2R5A A;  1M1G A;  1M90 U;  1QVG A;  1G3T A;  2GF7 A;  3TU4 K;  2LT4 A;  1SSF A;  2F69 A;  4JS5 A;  3CC4 A;  4O5V A;  5GAO n;  2P0P A;  5CKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...