4RTYA

Crystal structure of the c-src-sh3 domain in complex with the high affinity peptide app12
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
58
structure length
58
Chain Sequence
MTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Proto-oncogene tyrosine-protein kinase Src
publication title Crystal structure of the c-Src-SH3 domain in complex with the high affinity peptide APP12
rcsb
source organism Gallus gallus
total genus 11
structure length 58
sequence length 58
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4rtyA00
2J7IA 1RLQC 1CKBA 3NHNA 2DBMA 1SPKA 5IHIA 3GBQA 4F17A 1XOVA 2O31A 1VYTA 2C0OA 1X2QA 4HVWA 4AFQC 2AZVA 1AWOA 1OEBA 1UUEA 1ABOA 3JV3A 1X2KA 3PVQA 4J9EA 2RQRA 1GBRA 5IHKA 2M0YA 2NUZA 1NYGA 2CUBA 2BTTA 2FPDA 3M0RA 1I1JA 1K0SA 1MV3A 4RTXA 4F14A 2EPDA 1WXBA 3TSWA 3UF4A 2L3QA 2LJ1A 1W1FA 4HVVA 2GQIA 3A98A 2YT6A 2O9SA 2PTKA 2XMFA 4Z8AA 2A08A 2O2OA 2LNHB 3IQLA 2DL8A 3QWYA 4J9DA 4AFUC 1KFZA 2KRSA 2SRCA 1B3QA 1JU5C 5FWBA 2EYZA 2OI3A 5FWCA 2BZYA 3M0QA 3VS4A 1K76A 1SHGA 5IH2A 1GCPA 1NLPC 1UECA 4J9FA 1PKTA 2C0TA 3SEMA 1A0NB 2VVKA 2ENMA 1GCQA 3M0PA 1GCQC 2LJ3A 2J6FA 2G6FX 2LQNA 1OV3A 1SRMA 1QWEA 2KR3A 1PRLC 2RN8A 2CUDA 2RQTA 2CT4A 3O5ZA 2DX1A 1Y57A 2KT8A 2HCKA 1NG2A 1T3SA 1NLOC 2CSQA 2KXCA 2YUQA 3M0TA 5L23A 4K11A 2CDTA 3I5SA 1BU1A 4RTUA 5HCKA 2YUNA 3THKA 4WCIA 2HSPA 2FO0A 2JXBA 1WA7A 1GL5A 4Y92A 3ULRB 2EW3A 1J3TA 1Y0MA 1WYXA 4HVUA 1UHCA 1WI7A 3H0HA 2DA9A 1AWXA 2CT3A 2DVJA 1X6BA 1N5ZA 1EFNA 1QKWA 3C0CA 3TSZA 2ABLA 1ZSGA 1FYNA 2RF0A 2FEIA 3NGPA 3VS5A 3CQTA 1W6XA 3FJ5A 1WXUA 4LUDA 2JW4A 1H92A 4RTZA 2AKLA 5GJVB 1MUZA 2D8HA 4D8KA 2EGCA 1T0HA 2K79A 1I07A 2F2WA 1E7OA 1TG0A 1QLYA 1IO6A 1X27A 2L3PA 2RQWA 1LCKA 5I22A 1M27C 2EVRA 2MIOA 1JO8A 1QWFA 1U3OA 2DJQA 2L3SA 1UJYA 2P4RA 4J9HA 2K3BA 1AVZC 2RPNA 4EIKA 3VS3A 2HEQA 1E6GA 2HBWA 1UE9A 3EG2A 4OMOA 1JQQA 2KBTA 2HDAA 4RTTA 1UGVA 1AOJA 1JXOA 4A63B 2ED1A 2BZ8A 2NWMA 1H8KA 1UTIA 2F2XA 3QWXX 4Z88A 4HCKA 2D1XA 2DMOA 1SSHA 2M51A 2PNIA 2L0AA 4RTYA 2J06A 2KRNA 2LX7A 3REAB 2MOXA 2KYMA 2IIMA 1QCFA 2AZSA 3EHQA 4RTWA 2EQIA 3EG0A 1NM7A 2LP5A 4RUGA 2CH4W 1KJWA 2F2VA 2PZ1A 1PWTA 4F16A 1OOTA 4GBQA 2JS0A 3I35A 4OMLA 5IHNA 1UJ0A 2K7AA 3NMZC 1YCSB 1RI9A 3ZL7C 2EYWA 2DYBA 1AWWA 2EYXA 2RNAA 1ZUYA 1MV0B 2EBPA 2W0ZA 4X1VA 3RNJA 4J9IA 3VRYA 1UDLA 2KEAA 1Z9QA 2YDLA 4JZ4A 1OPKA 4R0KA 2H8HA 1RUWA 2V1RA 2ESWA 3VS1A 1K0XA 3U23A 1ARKA 1B07A 2OAWA 3VS2A 1KIKA 1UFFA 2VWFA 2KNBB 2KXDA 3EHRA 1ZX6A 1X6GA 2DILA 1S1NA 3RBBB 1HD3A 1WXTA 3UA7A 1WFWA 2LMJA 1NEGA 1K4US 4KRTA 4LUEA 2LJ0A 4CC3A 2A36A 1VYVA 2GTJA 1GRIA 2A37A 1NEBA 4LNPA 5IXBA 5FW9A 4FSSA 5IXFA 2O88A 1X69A 1T0JA 4JJDA 2RQVA 1AD5A 1K1ZA 1GFCA 1ZBJA 1T3LA 4DEXA 3VS7A 2EKHA 3H0IA 4IIOA 1SRLA 1GBQA 2QDLA 1RLPC 3TVTA 2J6KA 1TUCA 2LCSA 2AKKA 1CKAA 2DL5A 2GNCA 1ZUKA 4ORZA 1NYFA 1U06A 4JZ3A 2CH4A 4D8DA 1M3CA 1WDXA 1K9AA 1X43A 2JTEA 4CC2A 1AEYA 3PVLA 2DF6A 2O9VA 1PNJA 1M3BA 2RQUA 2E5KA 1AWJA 4OMNA 2MCNA 1SEMA 2VKNA 1WX6A 4LE9A 1YWPA 4CC7A 2ROTA 1CSKA 2RMOA 3REBB 2YSQA 2BZXA 2X3XD 1AZGB 1YN8A 2DL7A 1GFDA 1UHFA 4ZNXA 3UATA 2JMAA 2JT4A 1PKSA 4JJBA 1AZEA 3UA6A 2DBKA 4QT7A 3VRZA 2FPEA 2L2PA 2X3WD 2V1QA 3PE0A 3H41A 4JJCA 5GJWB 4IIMA 4OMPA 2KRMA 2DM1A 4Z89A 1M8MA 2K2MA 3EG3A 1U5SA 2KT1A 2EGEA 1Z9ZA 3I9QA 2J6OA 2SEMA 1KSWA 1VYUA 1VA7A 1ABQA 1TUDA 1JEGA 1WLPB 1UG1A 2I0NA 2KE9A 4J9CA 2JS2A 4JPBW 4E6RA 1QKXA 4GLMA 1YNZA 1PRMC 1G2BA 1H3HA 2ED0A 2LQWA 1ZUUA 2D0NA 2FRWA 1YWOA 3EGUA 1BBZA 2EGAA 4OMQA 2EYYA 4CC4B 4OMMA 1ZLMA 2AK5A 1BK2A 2DRMA 1I0CA 2DE0X 2JM9A 1WIEA 4LN2A 2OJ2A 2CREA 2ECZA 4ESRA 3M0SA 1YP5A 2KGTA 1G83A 2DL3A 3I5RA 5I11A 1BB9A 2JM8A 3SHWA 3NPFA 2GBQA 3VS0A 1E6HA 2C0IA 2J05A 4DEYA 1HJDA 2FG0A 1FMKA 1HSQA 2DL4A 4AG1C 2YUPA 3EG1A 4J9GA 3VS6A 2GGRA 4HXJA 2K9GA 4J9BA 4AG2C 2DNUA 1PHTA 1M30A 2KYBA 5ECAA 4RTVA 5EC7A 2K6DA 2YUOA 1M3AA 1V1CA 1SHFA 3M0UA 1OPLA 1W70A 2DLPA 4AFZC 2CSIA 2B86A 2DRKA 1JXMA 2W10A 2LZ6B 2D8JA 3KFVA 4M4ZA 2FRYA 4AFSC 3R6NA 2JMCA 2FPFA 3LH5A 2GTOA 2ROLA 2A28A 3H0FA 2KROA
chains in the Genus database with same CATH superfamily
2J7IA 1YJWT 3AHUA 1CKBA 3NHNA 1GXIE 3HHTB 3G6EQ 2LCCA 2PVOB 1NJIU 5IHIA 1MGQA 4J7IA 4M77E 2OTJT 1QVGS 3HSBA 4ELYC 3CCUQ 4HVWA 4A4KA 5CAIA 3CMAA 5M9OA 2M02A 1PG5B 2RQRA 1ZSZA 1GBRA 1UGPB 4L59A 2A7YA 4KGXB 1NYGA 2BTTA 1YJNT 3M0RA 3SB2A 2JVVA 2JZ2A 1VQMT 4O6JA 2L3QA 1MNDA 2X4XA 2XI9A 1W1FA 3MEAA 3FDRA 2YT6A 5CIUA 2XMFA 1YBYA 2E3HA 2DFUA 2PQWA 5FLXE 1KQSS 2DL8A 3C12A 2DO3A 5A2QE 3MEUA 4LDXA 1K76A 2YRVA 1GCPA 1NLPC 2DYIA 3WVEB 1VQPT 4IURA 1X6OA 4J9FA 2HQEA 2LX9A 3MO8A 1QVGA 3CCMQ 2QEXT 4C5IA 2NUPA 3SD4A 1OV3A 1SRMA 2E10A 1PCXA 3J81E 2QASA 3FB9A 1SKUB 2RQTA 3O5ZA 2YRDA 4II1A 3RKYA 1KD1U 2EIFA 3PFSA 1I81A 4PFOA 3I5SA 4RTUA 2R5MA 4JDSA 2F1LA 3THKA 1M8VA 3CCVQ 2H3JA 1GL5A 4Y92A 4KUIA 3QHSA 4ZTFA 1MHNA 4M7DE 3G71Q 5C6SA 1WYXA 5LJ5d 4HVUA 2XIDA 4B9WA 1C6VX 2CT3A 1RL2A 1K9MU 4PFPA 4QQ6A 1X6BA 1M1KU 1N5ZA 1QKWA 4M7AB 2RJEA 1QVFA 3JCMh 3G6ET 2M1HA 2HKNA 2DAQA 5J26A 3VS5A 3S3MA 3CQTA 1W6XA 2JW4A 1W4SA 4BE2A 4C0FA 1UB4A 2K79A 1I07A 4XTYA 1ZQ1A 3O8VA 1X27A 4M7AF 1M27C 1U3OA 2DJQA 4ZGDB 4J9HA 1TS9A 1YITQ 2HEQA 3CCSA 3QIIA 1OU9A 2RHZA 4J5YA 4L6V5 4C8QD 4J8OA 3JCMJ 3RKXA 1H3ZA 3QPHA 4A4EA 3HTRA 2AT1B 2CP7A 4MDXA 4A54A 1UTIA 2COZA 1VQNA 4C0DB 3BDUA 4Z88A 2D1XA 1SSHA 5GMKi 2M0OA 3OYFA 4XTZA 2VGNA 2NUTA 2L0AA 5AYFA 3QG1A 3DLLA 2KRNA 1AT1B 2LX7A 1FMVA 2MOXA 3JSCA 2DJZA 3EFOB 2AZSA 3QDFA 3SWNC 3V7CA 3EG0A 1NM7A 1KJWA 1RACB 1PWTA 2JS0A 2X35A 4DOWA 4QVCA 3CMAQ 1RAEB 1UJ0A 2EQMA 3OYLA 1RI9A 4PJLA 3ZL7C 4C0ZA 3OYYA 2EYWA 2EYXA 2Y90A 3HFNA 3TCJA 1UDLA 4M7DA 3V8LA 3PT9A 4JZ4A 4R0KA 4C8QA 4C8QG 4R55A 2V1RA 3PMIA 1TH7A 3EGDA 1D09B 2K2VA 3U23A 1B07A 3H6ZA 2OAWA 3OMGA 5KYYA 2OTLA 1KIKA 1UFFA 1VQ7T 3T9NA 4J6XA 2DILA 1S1NA 4M77B 3UA7A 4C92C 2LMJA 3D7SB 4KRTA 2LJ0A 5IT9E 1VQ5A 4CC3A 1VYVA 3OW2P 4HCCA 3L1AA 1GRIA 1FXXA 5FW9A 1RAFB 5IXFA 1W2BP 1G3SA 4MZPA 1ZBJA 1YJWA 1U1SA 1WZOA 2A0FB 1D1CA 3EH2A 5LJ3g 4DA4A 2FZGB 2MMPA 4XU1A 3TVTA 2OTJA 1TUCA 3Q1JA 3QBYA 2DL5A 5HK0A 4GY5A 2C06A 3MEWA 1NYFA 1SF9A 3JCMX 4M77F 3S3OA 4D8DA 2ZPIB 1X43A 2JTEA 2YXYA 2F5KA 1YJNA 3EFSA 1PNJA 1M3BA 2RQUA 1VQMA 2E5KA 4DOVA 1SEMA 4CC7A 1OX9A 1BI2A 1VQ9T 4NL3A 1GFDA 3NTIA 1UHFA 4CI0C 2JT4A 3UA6A 5KE3A 2MWOA 2X3WD 3GOXA 3FC3A 3H41A 1VQPA 4OMPA 3EG9B 5LJ5f 1R77A 2DTIA 1M8MA 1VIEA 2DTOA 1Y7XA 3OYJA 2QGGA 1D0YA 3MEVA 2EGEA 2KY9A 2QEXA 2BIVA 2K5IA 5D6XA 4FYVB 1MMAA 1XJWB 1ABQA 1TUDA 4M7DB 1JEGA 1WLPB 2I0NA 3ZEHA 2V26A 2JS2A 4JPBW 4E6RA 5LJ3f 3CCSQ 1PRMC 2K5LA 2ED0A 3URGA 1ZUUA 2FRWA 3KUFA 4XU2A 4QVDA 2I2LA 1BBZA 4OMMA 1HYOA 4ME7A 1OYXA 3KBGA 4KBMB 2GQVA 3M4YA 3MPUB 4IUTA 1WIEA 2FVUA 3GF5A 3VV0A 2YLCA 3OW2S 1YP5A 2DL3A 3I5RA 2E41A 4M7DF 2JM8A 3KXTA 2XDPA 3NPFA 3G6EA 2R5AA 3CC7T 2FG0A 1WHHA 1YIJT 4FW2A 3JB9J 4WF2A 4EMKC 4GLKA 2M16A 2G3RA 3CPWP 3EG1A 4J9GA 2LDMA 3VS6A 1IHVA 4HXJA 1WNLA 4FU6A 4EMHA 5LJ5j 4AG2C 2RHYA 5EC7A 4M78E 4BI4A 2LTOA 1M2OA 3JCMg 3JCMP 1V1CA 2XICA 4RG8A 3OSSC 1W70A 3I55Q 2H3EB 4AFZC 2B86A 4Q5WA 2A3LA 5I2SA 2EWNA 4LD6A 2V8KA 4MMLA 3LH5A 4HA8A 2OTLQ 5LJ3j 5CKFA 5GMKm 3OW2A 2LQKA 5IN1A 1W2BA 4PJOC 1VQ5Q 3J7AF 4F17A 2QAZA 1N6AA 4N4IA 2LNVA 1ZHIA 1V76A 2EAYA 2VXFA 4ELZC 4P5NA 2AZVA 4C5GA 4FCYA 1YJWQ 2KAFA 2E4HA 3CC4T 3GIBA 1X2KA 5IHKA 2M0YA 2D6FA 2CUBA 2OTJQ 4NS5A 3AT1B 2XDDA 3QO3A 1K0SA 1MV3A 2YRCA 4F14A 1WXBA 3TSWA 1BI3A 5L8RE 1N8RR 1Q81U 2DERA 4HVVA 2K5FA 4Z8AA 4FYXB 4JS4A 1O9SA 3TEEA 1M2VA 2O2OA 1YJNQ 2RH2A 3QWYA 4J9DA 2QA4T 1WHGA 2K3YA 4E2FB 1VQMQ 1B3QA 2DZ9A 2EYZA 2RD1A 2O4XA 2HQXA 2P0QA 2BZYA 4RCCA 1UECA 2QG9B 4JRPA 4M75B 1IGUA 4Y91A 2E3IA 1PKTA 1TXQA 2C0TA 1VQOT 2ENMA 2P0PA 3JCMW 2DD5A 3EH1A 1N9SA 4OVAA 3UPUA 1B7TA 2ZZDA 4V2SA 2M9UA 3G1JA 1VQ7A 1Q7YC 3V7RA 4OB0B 1VQPQ 2RN8A 1TOVA 2DX1A 4E7SA 2KT8A 4AMCA 3CPWS 1NLOC 2CSQA 2KXCA 2YUQA 3M0TA 2QEXQ 4JJNK 3X25B 4K11A 1M5Q1 3BY7A 3L2ZA 4M78A 3ER0A 5LJ5h 3CCLT 5HCKA 3QJYA 4WCIA 2HSPA 3I55T 1OU8A 1J3TA 2CZ7B 3FRNA 3HRTA 1D0ZA 1UHCA 2KVQG 3ZBDA 6AT1B 1TWBA 1OQKA 2DVJA 2L3RA 3MP1A 4AT1B 5A0GA 1M90C 2JTFA 3LYIA 4ZTJA 1D0XA 4HKEA 2ABLA 4FSXA 5LJ3e 1FYNA 2RF0A 3RUXA 3QYHB 2DIGA 3NGPA 2COWA 4JUVA 3CEYA 5KYXA 2QQSA 4HT8A 2GFAA 2AKLA 2GF7A 1VQ9A 2EGCA 5GAOp 3CPWA 3GNFB 1VQ4T 3QUIA 2L3PA 2V8JA 1D1AA 4XU3A 1K8AR 1C1AA 2MIOA 5KCHA 1IZ6A 3PIOA 5GAN8 2P4RA 4EIKA 2RPNA 1YJ9T 1IHWA 2KQWA 3EG2A 3SFMA 2L89A 4MDWA 1Q82R 1UGVA 1AOJA 1JXOA 4OF1A 4A63B 2ED1A 2NWMA 4IUQA 2OX7A 5GANd 3TQ7P 4KULA 2KSSA 3LH0A 4HCKA 5FROA 4FL6A 1NPRA 1BIBA 2CZ0B 2PNIA 3MJXA 2J06A 3OYIA 4RCBA 2IIMA 2KK4A 2RI3A 1WGSA 2RI2A 1QVFS 2BUDA 3INZA 2CH4W 4JRKA 2Z0WA 4C92E 3LWHA 3VYHB 2DXBA 3NMZC 1YCSB 3DLMA 1Q86C 2E6NA 4M78B 2DYBA 3CCQT 2RNAA 4DBHA 1YHQT 1ZUYA 2W0ZA 2D0QB 3RNJA 1VQ8T 2KEAA 4M7AC 4X9DA 4QQGA 3CC2Q 2QDYB 4BB7A 3CC7A 2RI5A 1YIJA 2ESWA 2K4YA 4BE1A 2Y4YA 3VS1A 1K0XA 3EGXA 4IUVA 1QQJA 4JRIA 2KNBB 2KXDA 4C8QE 2DXUA 4JLGA 4EPCA 1QCOA 1ZBXA 1UGSB 1HD3A 1WXTA 2RA2A 4ATOA 5GAOr 4M78F 1U8RA 2A36A 2FZKB 1WJQA 2EQJA 2A37A 2F69A 4XTVA 1VQ7Q 2CZ6B 2O88A 3JCMe 1RAHB 3JAME 5GAMd 4JJDA 5HK3A 1AD5A 1K1ZA 1N8RC 4C92D 3SWNA 3QYGB 3VS7A 5C0MA 3I56T 4IIOA 1GBQA 1R0CB 2VUBA 2LT1A 2LCSA 2AKKA 5CK9A 2QQBA 1ZUKA 4C0DC 1KC8C 2ZPHB 5KH6A 1ZSZB 3CC4A 4JZ3A 3V8KA 2CH4A 3GP8A 1TU0B 1WDXA 1M3CA 4XAXB 3OYBA 2ZGWA 4CRIA 2DF6A 2O9VA 3UT1A 1AWJA 1WX6A 4LE9A 2YHTA 1YWPA 4QW2A 1K73R 1YI2T 2AIRB 3REBB 3CMET 2CGHA 1AZGB 3OQ5A 4E7LA 2E12A 5DM7R 3TU4K 4OB2B 4JJBA 1TUGB 5GAOq 2QA4A 3LLRA 4QT7A 4BDYA 3X28B 4C92A 4C92G 1BCMA 3PE0A 1NJIR 5GJWB 3JB9D 2EFIA 2KRMA 1VQ9Q 2NUPB 1VQOA 3EG3A 1U5SA 2KT1A 3VUZA 3I9QA 4IKFA 1VYUA 1VA7A 3CC2T 3JCMQ 2KE9A 5CR2A 4EMGA 4OB3B 3HKSA 3VKIA 2YWWA 9ATCB 1WQ7A 2CP5A 4M77C 3WVDB 4PJNA 3QZ9B 2LQWA 2FL7A 2D0NA 3HFOA 2LCLA 3EGUA 3CCLA 3UDCA 1SSFA 2FB7A 3I55A 2AK5A 1BK2A 1ZA2B 2DRMA 4X34A 3MP8A 2BKDN 4LN2A 4RMOA 3OYEA 2MAMA 4ESRA 1G83A 2KMTA 1G3YA 3CXCP 4OMFB 3JB9G 2GBQA 1WHLA 5LJ5g 1RAAB 1E6HA 2E6ZA 1VQLT 3LGLA 2J05A 4DEYA 1Q86U 2DXCA 2WSCE 5GANf 2PUKB 4PJMA 4AG1C 1XNIA 4BY6B 1Y71A 5FU6B 2K9GA 4J9BA 3HRSA 1PHTA 2KYBA 5ECAA 2XKOC 1KD1R 5GAMg 2YUOA 3EFRA 4DBQA 3CC7Q 1YIJQ 1SHFA 1RAIB 1VQ4A 1NBEB 3A1PA 1D3BA 3FIFA 4KH1B 2DRKA 2D8JA 1WQWA 3ASKA 3KFVA 2FRYA 2MI6A 4FYWB 2MYSA 1PD0A 4FIBA 2ROLA 1GCQC 1YJ9A 1N9RA 1RABB 2DKGA 1K9MR 5CKHA 3LW5E 2DIQA 1M1KR 1SPKA 2LVMA 3OYGA 4PLIA 4FW1A 5KE2A 1LPLA 1R0BG 2VB6A 4FT4A 2O31A 3OS1A 3V7SA 2NUTB 4M7DC 2E5QA 2LT4A 2CP6A 1X2QA 1AWOA 5KYWA 1OEBA 4PNOA 3QSUA 1UUEA 1XQHA 2CP3A 3JV3A 4F04B 3PVQA 5J3BA 4PJOD 1MMNA 1B34A 4O5VA 2NUZA 5DY9A 2FPDA 1Y96A 4A53A 1KC8U 1I1JA 4RTXA 4KGZB 3CC4Q 1FMWA 5GANj 2HQHA 1FWZA 2PTKA 2V8IA 1KQ1A 3CCQA 2A08A 3H8ZA 3OY9A 3CCRT 1YHQA 1P92A 2LNHB 4C8QB 4C92F 1V29B 5CVIA 5GAMf 1VQ8A 1KFZA 4PK4A 1JU5C 2DETA 4ZN3A 2OI3A 5DLOA 3EGDB 1M4ZA 3M0QA 5IH2A 3HL8A 3RERA 5AT1B 2HAXA 3SEMA 3PMTA 2L8DA 5KYYB 4E7IA 2EKOA 3M0PA 4OGCA 2LJ3A 8ATCB 2QA4Q 3P8DA 1X01A 4LD9K 4PJOG 1PRLC 3L2VA 1VQOQ 5CO7A 1W2BS 3RDVA 4C8QF 3WXMB 1MMDA 3OS0A 2QQRA 3M59A 4KH0B 2FO0A 1WA7A 4DQ2A 1K73C 3A8GB 4E7HA 3I56A 3HPWA 2XD0A 4ZGEB 3JB9F 2DA9A 4JLIA 1AWXA 3CCJT 3A8HB 3CCLQ 4XTUA 1EFNA 1G5VA 3C0CA 3CXCA 3TSZA 1ZSGA 3OYKA 2VXEA 2FEIA 2RJFA 2R57A 5GAMj 3A8LB 2E1HA 2HKQB 3FJ5A 1H92A 4RTZA 2XHCA 1YI2A 1MUZA 2D8HA 3CMEA 1T0HA 4J6WA 4XTWA 5IAYA 1QVPA 1E7OA 1TG0A 1QLYA 1HXDA 1Y96B 3META 2QYZA 4PKCC 5CKEA 4F7UG 4F7UA 1LCKA 4MZTA 2EVRA 1JO8A 1QWFA 3OYNA 1VQKT 1AVZC 4A4HA 3A8MB 3VS3A 5GANh 4M75C 1VQ4Q 1E6GA 2HBWA 3J80E 4J7FA 1JQQA 2HDAA 2PU9B 1WHMA 3CC2A 4Z02A 3PTAA 2BZ8A 2VASA 1H8KA 2F2XA 2HMAA 4BUGA 5CQXA 4BE0A 2DMOA 1YJ9Q 2LQ8A 2M51A 3OA6A 5FU7B 4YTLA 1LJOA 1Y07A 4RTYA 3CD6T 2WSEE 3OYHA 1H641 4PFZA 3REAB 2KYMA 1QCFA 2RM4A 4RUGA 1KD1C 2DPPB 2F2VA 3NTKA 1VIFA 2DK3A 2K3XA 2BE7D 3G4ST 2ZPFB 2IG0A 4PLLA 4X1VA 1PC0A 2X4JA 2QK0A 3OS2A 3PGGA 3VRYA 1VQLA 2YDLA 2E70A 1IXDA 3FLGA 1K9MC 3MHXA 1RUWA 4A4FA 1OZ3A 4EDUA 5GAOl 1KQSP 2RHIA 1LNXA 3CCQQ 1YHQQ 1JJ2P 1RI0A 3GNGA 1OZ2A 5LJ5e 1ARKA 1BKBA 4M7AD 1VQ8Q 2D9TA 1VOMA 4LDWA 5CKBA 5GMKh 1ZX6A 1X6GA 4N0AC 5GAMh 4LUEA 1LVKA 1OI1A 4QKUA 2ZPGB 5KCOA 3M55A 4E7KA 1BYMA 1NEBA 4LNPA 5IXBA 1JRIA 1T0JA 3RIRA 2CKKA 2EKHA 3OMCA 1LOJA 5GAN2 3BW1A 2QDLA 2J6KA 2JTMA 3DKMA 2GNCA 4OP0A 4B6MA 1U06A 3QZ5B 1NZ9A 4C5HA 1FX7A 3I56Q 3JB9H 4M7AA 4M7AG 1IB8A 3F70A 2GCXA 2NLUA 3PVLA 1QMCA 4OMNA 2QI2A 2VKNA 4IUPA 2IVWA 2RJCA 1NPPA 1M2VB 2BZXA 2X3XD 1YN8A 2YLBA 2DL7A 4F7UF 4ZNXA 2O4XB 3CCRA 4MZMA 1PKSA 4M78C 2VV5A 2DBKA 3PNWC 1EZZB 2FHDA 1OULA 3RMQA 4NOYA 3LGFA 3HP9A 1YI2Q 3CMEQ 4IIMA 2DM1A 3MP6A 4Z89A 4JRQA 5GAN3 1M9SA 2J6OA 2SEMA 1KSWA 1PSFA 5J39A 3CCEQ 1UG1A 4J9CA 2QTVA 2DTHA 2ATCB 3LX7A 3M54A 1G2BA 1VQ6A 1H3HA 2P0KA 2DVEA 2XDBA 1JJ2S 1Q81R 3FEOA 4XK8E 2EGAA 4OMQA 2EYYA 5D6YA 3OBYA 3OYCA 4E7ZA 2LC4A 4IUUA 4ANJA 4M77D 2DE0X 2RO0A 2JM9A 3EFOA 2OJ2A 2ECZA 3VYGA 1BIAA 3JCMV 3CCJA 4R56A 1BCOA 5FRMA 5I11A 3ZFJA 1BB9A 4FYYB 3E19A 1I8FA 5KYNA 1ZSZC 2C0IA 2HD0A 1WPYA 3HRUA 5KYXB 4DBFA 1FMKA 2B8AA 3OSVA 3OYDA 1Q7YU 3M53A 4HCBA 2GGRA 1S72T 2X4YA 1KQSA 1QCNA 5EG2A 4RTVA 2XK0A 2K6DA 1VQLQ 2DXTA 3EAEA 5GAN5 1JJ2A 2L5QA 4BI3A 2Y4XA 1JXMA 2EJFA 2LZ6B 2HNIA 4M4ZA 3A8OB 3MKDA 4MMKA 3R6NA 4M77A 4M77G 2DZCA 2FPFA 1KHIA 2JMCA 2VYTA 5KYUA 5LL6S 1ACMB 3GPLA 5LJ3d 2GTOA 1VQKA 1MNEA 2ZPBB 2A28A 2X9HA 3CCUT 3H0FA 3C95A 2KROA 1RLQC 1ZA1B 3P8HA 4DBRA 3E9FA 2DBMA 3E2UA 1M90U 3GBQA 4QVZA 1XOVA 2BE9B 1VYTA 2X4WA 3E1SA 3NTHA 2C0OA 3QJ6A 4AFQC 3DB3A 1ABOA 1UGQB 4BI8B 5GANg 3CD6A 3CCET 4J9EA 1R8OB 1TSFA 4M7DD 4LXCA 2HL5C 1NE8A 2EPDA 2JNGA 2CZ1B 3UF4A 1KHCA 2LJ1A 3BE3A 2GQIA 3A98A 2O9SA 3G4SA 3CCMT 1HK9A 3IQLA 1I5OB 1KK7A 4AFUC 2KRSA 2SRCA 5FWBA 5I2MA 4E47A 2MF2A 3L2UA 5FWCA 3VS4A 1SHGA 2EYQA 3EGXB 5GAOn 3QDRB 2HZYA 1A0NB 3E9GA 2VVKA 3VUBA 4LDUA 1GCQA 3CCRQ 3EG9A 2RK1A 2J6FA 4BY6C 2HBPA 4OB1B 3UWNA 2G6FX 2LQNA 3OYMA 5FU6C 4WTOB 2QQAA 3CBPA 2JOYA 1QWEA 2KR3A 3CCVT 1QP2A 4PJJA 7AT1B 3X24B 8AT1B 1PM3A 2CUDA 2CT4A 4N4GA 4BD3A 4M7DG 1Y57A 2EJ9A 2HCKA 3G71T 1NG2A 1T3SA 5GAN6 5L23A 1K8AC 3GLXA 2CDTA 1BU1A 2QGFB 4KGVB 3SWNB 2YUNA 2WACA 2DEUA 2JXBA 4PJOE 4Y28E 2QQ9A 1WJRA 3ULRB 2EW3A 5D7UA 1Y0MA 1Q82C 3V8JA 4RG2A 1VQ6Q 1WI7A 1UEBA 3H0HA 3P8BB 1PD1A 3ME9A 3CBMA 5KYUB 1JBMA 2RB6A 2KDSA 2KI7A 4E7JA 3JRZA 4J6YA 2RK2A 4M75E 1XTDA 1MMGA 3C4SA 2P4TA 2QXFA 3M58A 2PVGB 3RR6A 1WHJA 1YCYA 3M5AA 3CCJQ 5DLQE 3JCMd 3CPFA 2DD4A 1WXUA 4LUDA 4KUDK 5GJVB 3M56A 2AHJB 4D8KA 1YITT 3VU3C 2K57A 5CQYA 1Q7YR 4JS5A 4LDYA 2FZCB 1VUBA 4C92B 2F2WA 1WHKA 4LDVA 1IO6A 1Q81C 1N8RU 4C8QC 2RQWA 4C5EA 1C0MA 5I22A 4D6WA 1QP3A 1O75A 2L3SA 1UJYA 2K3BA 5D6WA 1BI0A 1UE9A 4N4HA 2NYSA 3DB4A 4OMOA 2KBTA 4EMKA 4RTTA 4F7UE 3N5BB 3QWXX 1YFNA 3L2WA 1VQKQ 4M75D 1G8XA 2E65A 2R58A 3L2QA 1PSEA 1M90R 3CMAT 1RAGB 4ZGJB 4BDZA 2PVDB 1D1BA 4RTWA 3EHQA 2EQIA 2LP5A 3PIPA 3X26B 2PZ1A 4F16A 1OOTA 4GBQA 3I35A 3CXCS 3JCMb 4KT0E 3RKWA 4OMLA 5IHNA 2RHUA 2K7AA 3S6WA 3CD6Q 2RJDA 4XU0A 2LRQA 3C94A 1AWWA 3G7ZA 4PJOA 2EBPA 1MV0B 4QQDA 4J9IA 3CBOA 5GAN4 4FM4B 2MK5A 1Z9QA 1OPKA 1VQ6T 4NL2A 2H8HA 3BFMA 1VQNQ 2OAUA 4UC4A 3G4SQ 4M75A 4M75G 1S72A 2HL3A 3VS2A 3NFCA 1D3BB 1X75C 3R6OA 2VWFA 4XTXA 3EHRA 4B9XA 2F5TX 3RBBB 3OBWA 1WFWA 3FJPA 1NEGA 1K4US 1NJIC 2EJGA 2GTJA 3H9NA 4RKUE 2VGMA 5GMKj 2COYA 4FSSA 3QXEB 3CCUA 1F1BB 1Q95G 4PL6A 1X69A 1OX8A 2RQVA 1GFCA 1T3LA 1G3WA 1BI1A 4OGEA 4DEXA 4FT2A 1K8AU 3H0IA 1SRLA 1QW1A 1AHJB 2XU8A 1RLPC 2HSEB 1Q86R 5KYWB 4X9CA 1N27A 1CKAA 4ORZA 1EX4A 1JB0E 1B34B 3JCMc 2PUOB 1Q82U 4VUBA 5FU7C 3CCEA 1K9AA 2JUFA 4EMKB 4HT9A 2X51A 4CC2A 1AEYA 1M1GA 2CS7A 5A0DA 4L5GA 3X20B 1UGRB 2MCNA 5HY6A 2ROTA 1CSKA 2CYZB 2RMOA 2XG8D 2EQUA 2YSQA 5GANe 4M7AE 2E64A 3UATA 3CCMA 2CP2A 2JMAA 5GAN7 3SDZA 2FYKA 2O01E 1AZEA 3VRZA 2FPEA 5GAOm 2L2PA 4N0AA 1SG5A 3BDLA 2V1QA 2JJ9A 1QVGP 4JJCA 2WSFE 4HCZA 2K2MA 2P84A 3CCST 3RESA 4M78D 1Z9ZA 4PJOB 5CCAA 5GMKl 5FRNA 3L2RA 3CCVA 1VQNT 3LWIA 2JN0A 3OB9A 1I5LA 1QKXA 4GLMA 1KC8R 3G71A 1YNZA 3JCMf 2MWPA 1IRXA 3M57A 1YWOA 2GFUA 1IGQA 1U1TA 4C0GA 1I4K1 4TVRA 4CC4B 1ZLMA 3OYAA 1M1KC 1EIFA 2CP0A 1I0CA 2QTXA 2ZPEB 3A5ZB 2CREA 3JB9I 1QVFP 4PJOF 2ZAEA 3M0SA 2KGTA 4A4GA 1WJSA 3SHWA 3VS0A 3S3NA 1IREB 4M78G 5GMKe 1G3TA 3MCAB 1HJDA 3QKJA 4J83A 4M75F 2DEQA 5GAMe 1HSQA 2DL4A 3RMSA 1TTHB 2YUPA 2ZCFB 2VC8A 3TREA 2DNUA 1M30A 1M3AA 2MPXC 1YITA 2OTLT 1DJ7B 5A0LA 1RADB 5CKDA 2IPOB 1KQ2A 2RHXA 4F7UB 4BACA 3M0UA 1OPLA 5LJ3h 2DLPA 4XQ3A 2CSIA 2EQKA 2W10A 1K73U 1M1FA 1S72Q 1VQ5T 3L42A 4AFSC 3OS5A 5I21A 3M4GA 3VJPA 1KG1A 3M9QA 4ZN1A 5HKCA
chains in the Genus database with same CATH topology
2J7IA 1RLQC 1CKBA 3NHNA 2DBMA 1SPKA 5IHIA 3GBQA 4F17A 1XOVA 2O31A 1VYTA 2C0OA 1X2QA 4HVWA 4AFQC 2AZVA 1AWOA 1OEBA 1UUEA 1ABOA 3JV3A 1X2KA 3PVQA 4J9EA 2RQRA 1GBRA 5IHKA 2M0YA 2NUZA 1NYGA 2CUBA 2BTTA 2FPDA 3M0RA 1I1JA 1K0SA 1MV3A 4RTXA 4F14A 2EPDA 1WXBA 3TSWA 3UF4A 2L3QA 2LJ1A 1W1FA 4HVVA 2GQIA 3A98A 2YT6A 2O9SA 2PTKA 2XMFA 4Z8AA 2A08A 2O2OA 2LNHB 3IQLA 2DL8A 3QWYA 4J9DA 4AFUC 1KFZA 2KRSA 2SRCA 1B3QA 1JU5C 5FWBA 2EYZA 2OI3A 5FWCA 2BZYA 3M0QA 3VS4A 1K76A 1SHGA 5IH2A 1GCPA 1NLPC 1UECA 4J9FA 1PKTA 2C0TA 3SEMA 1A0NB 2VVKA 2ENMA 1GCQA 3M0PA 1GCQC 2LJ3A 2J6FA 2G6FX 2LQNA 1OV3A 1SRMA 1QWEA 2KR3A 1PRLC 2RN8A 2CUDA 2RQTA 2CT4A 3O5ZA 2DX1A 1Y57A 2KT8A 2HCKA 1NG2A 1T3SA 1NLOC 2CSQA 2KXCA 2YUQA 3M0TA 5L23A 4K11A 2CDTA 3I5SA 1BU1A 4RTUA 5HCKA 2YUNA 3THKA 4WCIA 2HSPA 2FO0A 2JXBA 1WA7A 1GL5A 4Y92A 3ULRB 2EW3A 1J3TA 1Y0MA 1WYXA 4HVUA 1UHCA 1WI7A 3H0HA 2DA9A 1AWXA 2CT3A 2DVJA 1X6BA 1N5ZA 1EFNA 1QKWA 3C0CA 3TSZA 2ABLA 1ZSGA 1FYNA 2RF0A 2FEIA 3NGPA 3VS5A 3CQTA 1W6XA 3FJ5A 1WXUA 4LUDA 2JW4A 1H92A 4RTZA 2AKLA 5GJVB 1MUZA 2D8HA 4D8KA 2EGCA 1T0HA 2K79A 1I07A 2F2WA 1E7OA 1TG0A 1QLYA 1IO6A 1X27A 2L3PA 2RQWA 1LCKA 5I22A 1M27C 2EVRA 2MIOA 1JO8A 1QWFA 1U3OA 2DJQA 2L3SA 1UJYA 2P4RA 4J9HA 2K3BA 1AVZC 2RPNA 4EIKA 3VS3A 2HEQA 1E6GA 2HBWA 1UE9A 3EG2A 4OMOA 1JQQA 2KBTA 2HDAA 4RTTA 1UGVA 1AOJA 1JXOA 4A63B 2ED1A 2BZ8A 2NWMA 1H8KA 1UTIA 2F2XA 3QWXX 4Z88A 4HCKA 2D1XA 2DMOA 1SSHA 2M51A 2PNIA 2L0AA 4RTYA 2J06A 2KRNA 2LX7A 3REAB 2MOXA 2KYMA 2IIMA 1QCFA 2AZSA 3EHQA 4RTWA 2EQIA 3EG0A 1NM7A 2LP5A 4RUGA 2CH4W 1KJWA 2F2VA 2PZ1A 1PWTA 4F16A 1OOTA 4GBQA 2JS0A 3I35A 4OMLA 5IHNA 1UJ0A 2K7AA 3NMZC 1YCSB 1RI9A 3ZL7C 2EYWA 2DYBA 1AWWA 2EYXA 2RNAA 1ZUYA 1MV0B 2EBPA 2W0ZA 4X1VA 3RNJA 4J9IA 3VRYA 1UDLA 2KEAA 1Z9QA 2YDLA 4JZ4A 1OPKA 4R0KA 2H8HA 1RUWA 2V1RA 2ESWA 3VS1A 1K0XA 3U23A 1ARKA 1B07A 2OAWA 3VS2A 1KIKA 1UFFA 2VWFA 2KNBB 2KXDA 3EHRA 1ZX6A 1X6GA 2DILA 1S1NA 3RBBB 1HD3A 1WXTA 3UA7A 1WFWA 2LMJA 1NEGA 1K4US 4KRTA 4LUEA 2LJ0A 4CC3A 2A36A 1VYVA 2GTJA 1GRIA 2A37A 1NEBA 4LNPA 5IXBA 5FW9A 4FSSA 5IXFA 2O88A 1X69A 1T0JA 4JJDA 2RQVA 1AD5A 1K1ZA 1GFCA 1ZBJA 1T3LA 4DEXA 3VS7A 2EKHA 3H0IA 4IIOA 1SRLA 1GBQA 2QDLA 1RLPC 3TVTA 2J6KA 1TUCA 2LCSA 2AKKA 1CKAA 2DL5A 2GNCA 1ZUKA 4ORZA 1NYFA 1U06A 4JZ3A 2CH4A 4D8DA 1M3CA 1WDXA 1K9AA 1X43A 2JTEA 4CC2A 1AEYA 3PVLA 2DF6A 2O9VA 1PNJA 1M3BA 2RQUA 2E5KA 1AWJA 4OMNA 2MCNA 1SEMA 2VKNA 1WX6A 4LE9A 1YWPA 4CC7A 2ROTA 1CSKA 2RMOA 3REBB 2YSQA 2BZXA 2X3XD 1AZGB 1YN8A 2DL7A 1GFDA 1UHFA 4ZNXA 3UATA 2JMAA 2JT4A 1PKSA 4JJBA 1AZEA 3UA6A 2DBKA 4QT7A 3VRZA 2FPEA 2L2PA 2X3WD 2V1QA 3PE0A 3H41A 4JJCA 5GJWB 4IIMA 4OMPA 2KRMA 2DM1A 4Z89A 1M8MA 2K2MA 3EG3A 1U5SA 2KT1A 2EGEA 1Z9ZA 3I9QA 2J6OA 2SEMA 1KSWA 1VYUA 1VA7A 1ABQA 1TUDA 1JEGA 1WLPB 1UG1A 2I0NA 2KE9A 4J9CA 2JS2A 4JPBW 4E6RA 1QKXA 4GLMA 1YNZA 1PRMC 1G2BA 1H3HA 2ED0A 2LQWA 1ZUUA 2D0NA 2FRWA 1YWOA 3EGUA 1BBZA 2EGAA 4OMQA 2EYYA 4CC4B 4OMMA 1ZLMA 2AK5A 1BK2A 2DRMA 1I0CA 2DE0X 2JM9A 1WIEA 4LN2A 2OJ2A 2CREA 2ECZA 4ESRA 3M0SA 1YP5A 2KGTA 1G83A 2DL3A 3I5RA 5I11A 1BB9A 2JM8A 3SHWA 3NPFA 2GBQA 3VS0A 1E6HA 2C0IA 2J05A 4DEYA 1HJDA 2FG0A 1FMKA 1HSQA 2DL4A 4AG1C 2YUPA 3EG1A 4J9GA 3VS6A 2GGRA 4HXJA 2K9GA 4J9BA 4AG2C 2DNUA 1PHTA 1M30A 2KYBA 5ECAA 4RTVA 5EC7A 2K6DA 2YUOA 1M3AA 1V1CA 1SHFA 3M0UA 1OPLA 1W70A 2DLPA 4AFZC 2CSIA 2B86A 2DRKA 1JXMA 2W10A 2LZ6B 2D8JA 3KFVA 4M4ZA 2FRYA 4AFSC 3R6NA 2JMCA 2FPFA 3LH5A 2GTOA 2ROLA 2A28A 3H0FA 2KROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J7I A;  1RLQ C;  1CKB A;  3NHN A;  2DBM A;  1SPK A;  5IHI A;  3GBQ A;  4F17 A;  1XOV A;  2O31 A;  1VYT A;  2C0O A;  1X2Q A;  4HVW A;  4AFQ C;  2AZV A;  1AWO A;  1OEB A;  1UUE A;  1ABO A;  3JV3 A;  1X2K A;  3PVQ A;  4J9E A;  2RQR A;  1GBR A;  5IHK A;  2M0Y A;  2NUZ A;  1NYG A;  2CUB A;  2BTT A;  2FPD A;  3M0R A;  1I1J A;  1K0S A;  1MV3 A;  4RTX A;  4F14 A;  2EPD A;  1WXB A;  3TSW A;  3UF4 A;  2L3Q A;  2LJ1 A;  1W1F A;  4HVV A;  2GQI A;  3A98 A;  2YT6 A;  2O9S A;  2PTK A;  2XMF A;  4Z8A A;  2A08 A;  2O2O A;  2LNH B;  3IQL A;  2DL8 A;  3QWY A;  4J9D A;  4AFU C;  1KFZ A;  2KRS A;  2SRC A;  1B3Q A;  1JU5 C;  5FWB A;  2EYZ A;  2OI3 A;  5FWC A;  2BZY A;  3M0Q A;  3VS4 A;  1K76 A;  1SHG A;  5IH2 A;  1GCP A;  1NLP C;  1UEC A;  4J9F A;  1PKT A;  2C0T A;  3SEM A;  1A0N B;  2VVK A;  2ENM A;  1GCQ A;  3M0P A;  1GCQ C;  2LJ3 A;  2J6F A;  2G6F X;  2LQN A;  1OV3 A;  1SRM A;  1QWE A;  2KR3 A;  1PRL C;  2RN8 A;  2CUD A;  2RQT A;  2CT4 A;  3O5Z A;  2DX1 A;  1Y57 A;  2KT8 A;  2HCK A;  1NG2 A;  1T3S A;  1NLO C;  2CSQ A;  2KXC A;  2YUQ A;  3M0T A;  5L23 A;  4K11 A;  2CDT A;  3I5S A;  1BU1 A;  4RTU A;  5HCK A;  2YUN A;  3THK A;  4WCI A;  2HSP A;  2FO0 A;  2JXB A;  1WA7 A;  1GL5 A;  4Y92 A;  3ULR B;  2EW3 A;  1J3T A;  1Y0M A;  1WYX A;  4HVU A;  1UHC A;  1WI7 A;  3H0H A;  2DA9 A;  1AWX A;  2CT3 A;  2DVJ A;  1X6B A;  1N5Z A;  1EFN A;  1QKW A;  3C0C A;  3TSZ A;  2ABL A;  1ZSG A;  1FYN A;  2RF0 A;  2FEI A;  3NGP A;  3VS5 A;  3CQT A;  1W6X A;  3FJ5 A;  1WXU A;  4LUD A;  2JW4 A;  1H92 A;  4RTZ A;  2AKL A;  5GJV B;  1MUZ A;  2D8H A;  4D8K A;  2EGC A;  1T0H A;  2K79 A;  1I07 A;  2F2W A;  1E7O A;  1TG0 A;  1QLY A;  1IO6 A;  1X27 A;  2L3P A;  2RQW A;  1LCK A;  5I22 A;  1M27 C;  2EVR A;  2MIO A;  1JO8 A;  1QWF A;  1U3O A;  2DJQ A;  2L3S A;  1UJY A;  2P4R A;  4J9H A;  2K3B A;  1AVZ C;  2RPN A;  4EIK A;  3VS3 A;  2HEQ A;  1E6G A;  2HBW A;  1UE9 A;  3EG2 A;  4OMO A;  1JQQ A;  2KBT A;  2HDA A;  4RTT A;  1UGV A;  1AOJ A;  1JXO A;  4A63 B;  2ED1 A;  2BZ8 A;  2NWM A;  1H8K A;  1UTI A;  2F2X A;  3QWX X;  4Z88 A;  4HCK A;  2D1X A;  2DMO A;  1SSH A;  2M51 A;  2PNI A;  2L0A A;  4RTY A;  2J06 A;  2KRN A;  2LX7 A;  3REA B;  2MOX A;  2KYM A;  2IIM A;  1QCF A;  2AZS A;  3EHQ A;  4RTW A;  2EQI A;  3EG0 A;  1NM7 A;  2LP5 A;  4RUG A;  2CH4 W;  1KJW A;  2F2V A;  2PZ1 A;  1PWT A;  4F16 A;  1OOT A;  4GBQ A;  2JS0 A;  3I35 A;  4OML A;  5IHN A;  1UJ0 A;  2K7A A;  3NMZ C;  1YCS B;  1RI9 A;  3ZL7 C;  2EYW A;  2DYB A;  1AWW A;  2EYX A;  2RNA A;  1ZUY A;  1MV0 B;  2EBP A;  2W0Z A;  4X1V A;  3RNJ A;  4J9I A;  3VRY A;  1UDL A;  2KEA A;  1Z9Q A;  2YDL A;  4JZ4 A;  1OPK A;  4R0K A;  2H8H A;  1RUW A;  2V1R A;  2ESW A;  3VS1 A;  1K0X A;  3U23 A;  1ARK A;  1B07 A;  2OAW A;  3VS2 A;  1KIK A;  1UFF A;  2VWF A;  2KNB B;  2KXD A;  3EHR A;  1ZX6 A;  1X6G A;  2DIL A;  1S1N A;  3RBB B;  1HD3 A;  1WXT A;  3UA7 A;  1WFW A;  2LMJ A;  1NEG A;  1K4U S;  4KRT A;  4LUE A;  2LJ0 A;  4CC3 A;  2A36 A;  1VYV A;  2GTJ A;  1GRI A;  2A37 A;  1NEB A;  4LNP A;  5IXB A;  5FW9 A;  4FSS A;  5IXF A;  2O88 A;  1X69 A;  1T0J A;  4JJD A;  2RQV A;  1AD5 A;  1K1Z A;  1GFC A;  1ZBJ A;  1T3L A;  4DEX A;  3VS7 A;  2EKH A;  3H0I A;  4IIO A;  1SRL A;  1GBQ A;  2QDL A;  1RLP C;  3TVT A;  2J6K A;  1TUC A;  2LCS A;  2AKK A;  1CKA A;  2DL5 A;  2GNC A;  1ZUK A;  4ORZ A;  1NYF A;  1U06 A;  4JZ3 A;  2CH4 A;  4D8D A;  1M3C A;  1WDX A;  1K9A A;  1X43 A;  2JTE A;  4CC2 A;  1AEY A;  3PVL A;  2DF6 A;  2O9V A;  1PNJ A;  1M3B A;  2RQU A;  2E5K A;  1AWJ A;  4OMN A;  2MCN A;  1SEM A;  2VKN A;  1WX6 A;  4LE9 A;  1YWP A;  4CC7 A;  2ROT A;  1CSK A;  2RMO A;  3REB B;  2YSQ A;  2BZX A;  2X3X D;  1AZG B;  1YN8 A;  2DL7 A;  1GFD A;  1UHF A;  4ZNX A;  3UAT A;  2JMA A;  2JT4 A;  1PKS A;  4JJB A;  1AZE A;  3UA6 A;  2DBK A;  4QT7 A;  3VRZ A;  2FPE A;  2L2P A;  2X3W D;  2V1Q A;  3PE0 A;  3H41 A;  4JJC A;  5GJW B;  4IIM A;  4OMP A;  2KRM A;  2DM1 A;  4Z89 A;  1M8M A;  2K2M A;  3EG3 A;  1U5S A;  2KT1 A;  2EGE A;  1Z9Z A;  3I9Q A;  2J6O A;  2SEM A;  1KSW A;  1VYU A;  1VA7 A;  1ABQ A;  1TUD A;  1JEG A;  1WLP B;  1UG1 A;  2I0N A;  2KE9 A;  4J9C A;  2JS2 A;  4JPB W;  4E6R A;  1QKX A;  4GLM A;  1YNZ A;  1PRM C;  1G2B A;  1H3H A;  2ED0 A;  2LQW A;  1ZUU A;  2D0N A;  2FRW A;  1YWO A;  3EGU A;  1BBZ A;  2EGA A;  4OMQ A;  2EYY A;  4CC4 B;  4OMM A;  1ZLM A;  2AK5 A;  1BK2 A;  2DRM A;  1I0C A;  2DE0 X;  2JM9 A;  1WIE A;  4LN2 A;  2OJ2 A;  2CRE A;  2ECZ A;  4ESR A;  3M0S A;  1YP5 A;  2KGT A;  1G83 A;  2DL3 A;  3I5R A;  5I11 A;  1BB9 A;  2JM8 A;  3SHW A;  3NPF A;  2GBQ A;  3VS0 A;  1E6H A;  2C0I A;  2J05 A;  4DEY A;  1HJD A;  2FG0 A;  1FMK A;  1HSQ A;  2DL4 A;  4AG1 C;  2YUP A;  3EG1 A;  4J9G A;  3VS6 A;  2GGR A;  4HXJ A;  2K9G A;  4J9B A;  4AG2 C;  2DNU A;  1PHT A;  1M30 A;  2KYB A;  5ECA A;  4RTV A;  5EC7 A;  2K6D A;  2YUO A;  1M3A A;  1V1C A;  1SHF A;  3M0U A;  1OPL A;  1W70 A;  2DLP A;  4AFZ C;  2CSI A;  2B86 A;  2DRK A;  1JXM A;  2W10 A;  2LZ6 B;  2D8J A;  3KFV A;  4M4Z A;  2FRY A;  4AFS C;  3R6N A;  2JMC A;  2FPF A;  3LH5 A;  2GTO A;  2ROL A;  2A28 A;  3H0F A;  2KRO A; 
#chains in the Genus database with same CATH topology
 2J7I A;  1YJW T;  3AHU A;  1CKB A;  3NHN A;  1GXI E;  3HHT B;  3G6E Q;  2LCC A;  2PVO B;  1NJI U;  5IHI A;  1MGQ A;  4J7I A;  4M77 E;  2OTJ T;  1QVG S;  3HSB A;  4ELY C;  3CCU Q;  4HVW A;  4A4K A;  5CAI A;  3CMA A;  5M9O A;  2M02 A;  1PG5 B;  2RQR A;  1ZSZ A;  1GBR A;  1UGP B;  4L59 A;  2A7Y A;  4KGX B;  1NYG A;  2BTT A;  1YJN T;  3M0R A;  3SB2 A;  2JVV A;  2JZ2 A;  1VQM T;  4O6J A;  2L3Q A;  1MND A;  2X4X A;  2XI9 A;  1W1F A;  3MEA A;  3FDR A;  2YT6 A;  5CIU A;  2XMF A;  1YBY A;  2E3H A;  2DFU A;  2PQW A;  5FLX E;  1KQS S;  2DL8 A;  3C12 A;  2DO3 A;  5A2Q E;  3MEU A;  4LDX A;  1K76 A;  2YRV A;  1GCP A;  1NLP C;  2DYI A;  3WVE B;  1VQP T;  4IUR A;  1X6O A;  4J9F A;  2HQE A;  2LX9 A;  3MO8 A;  1QVG A;  3CCM Q;  2QEX T;  4C5I A;  2NUP A;  3SD4 A;  1OV3 A;  1SRM A;  2E10 A;  1PCX A;  3J81 E;  2QAS A;  3FB9 A;  1SKU B;  2RQT A;  3O5Z A;  2YRD A;  4II1 A;  3RKY A;  1KD1 U;  2EIF A;  3PFS A;  1I81 A;  4PFO A;  3I5S A;  4RTU A;  2R5M A;  4JDS A;  2F1L A;  3THK A;  1M8V A;  3CCV Q;  2H3J A;  1GL5 A;  4Y92 A;  4KUI A;  3QHS A;  4ZTF A;  1MHN A;  4M7D E;  3G71 Q;  5C6S A;  1WYX A;  5LJ5 d;  4HVU A;  2XID A;  4B9W A;  1C6V X;  2CT3 A;  1RL2 A;  1K9M U;  4PFP A;  4QQ6 A;  1X6B A;  1M1K U;  1N5Z A;  1QKW A;  4M7A B;  2RJE A;  1QVF A;  3JCM h;  3G6E T;  2M1H A;  2HKN A;  2DAQ A;  5J26 A;  3VS5 A;  3S3M A;  3CQT A;  1W6X A;  2JW4 A;  1W4S A;  4BE2 A;  4C0F A;  1UB4 A;  2K79 A;  1I07 A;  4XTY A;  1ZQ1 A;  3O8V A;  1X27 A;  4M7A F;  1M27 C;  1U3O A;  2DJQ A;  4ZGD B;  4J9H A;  1TS9 A;  1YIT Q;  2HEQ A;  3CCS A;  3QII A;  1OU9 A;  2RHZ A;  4J5Y A;  4L6V 5;  4C8Q D;  4J8O A;  3JCM J;  3RKX A;  1H3Z A;  3QPH A;  4A4E A;  3HTR A;  2AT1 B;  2CP7 A;  4MDX A;  4A54 A;  1UTI A;  2COZ A;  1VQN A;  4C0D B;  3BDU A;  4Z88 A;  2D1X A;  1SSH A;  5GMK i;  2M0O A;  3OYF A;  4XTZ A;  2VGN A;  2NUT A;  2L0A A;  5AYF A;  3QG1 A;  3DLL A;  2KRN A;  1AT1 B;  2LX7 A;  1FMV A;  2MOX A;  3JSC A;  2DJZ A;  3EFO B;  2AZS A;  3QDF A;  3SWN C;  3V7C A;  3EG0 A;  1NM7 A;  1KJW A;  1RAC B;  1PWT A;  2JS0 A;  2X35 A;  4DOW A;  4QVC A;  3CMA Q;  1RAE B;  1UJ0 A;  2EQM A;  3OYL A;  1RI9 A;  4PJL A;  3ZL7 C;  4C0Z A;  3OYY A;  2EYW A;  2EYX A;  2Y90 A;  3HFN A;  3TCJ A;  1UDL A;  4M7D A;  3V8L A;  3PT9 A;  4JZ4 A;  4R0K A;  4C8Q A;  4C8Q G;  4R55 A;  2V1R A;  3PMI A;  1TH7 A;  3EGD A;  1D09 B;  2K2V A;  3U23 A;  1B07 A;  3H6Z A;  2OAW A;  3OMG A;  5KYY A;  2OTL A;  1KIK A;  1UFF A;  1VQ7 T;  3T9N A;  4J6X A;  2DIL A;  1S1N A;  4M77 B;  3UA7 A;  4C92 C;  2LMJ A;  3D7S B;  4KRT A;  2LJ0 A;  5IT9 E;  1VQ5 A;  4CC3 A;  1VYV A;  3OW2 P;  4HCC A;  3L1A A;  1GRI A;  1FXX A;  5FW9 A;  1RAF B;  5IXF A;  1W2B P;  1G3S A;  4MZP A;  1ZBJ A;  1YJW A;  1U1S A;  1WZO A;  2A0F B;  1D1C A;  3EH2 A;  5LJ3 g;  4DA4 A;  2FZG B;  2MMP A;  4XU1 A;  3TVT A;  2OTJ A;  1TUC A;  3Q1J A;  3QBY A;  2DL5 A;  5HK0 A;  4GY5 A;  2C06 A;  3MEW A;  1NYF A;  1SF9 A;  3JCM X;  4M77 F;  3S3O A;  4D8D A;  2ZPI B;  1X43 A;  2JTE A;  2YXY A;  2F5K A;  1YJN A;  3EFS A;  1PNJ A;  1M3B A;  2RQU A;  1VQM A;  2E5K A;  4DOV A;  1SEM A;  4CC7 A;  1OX9 A;  1BI2 A;  1VQ9 T;  4NL3 A;  1GFD A;  3NTI A;  1UHF A;  4CI0 C;  2JT4 A;  3UA6 A;  5KE3 A;  2MWO A;  2X3W D;  3GOX A;  3FC3 A;  3H41 A;  1VQP A;  4OMP A;  3EG9 B;  5LJ5 f;  1R77 A;  2DTI A;  1M8M A;  1VIE A;  2DTO A;  1Y7X A;  3OYJ A;  2QGG A;  1D0Y A;  3MEV A;  2EGE A;  2KY9 A;  2QEX A;  2BIV A;  2K5I A;  5D6X A;  4FYV B;  1MMA A;  1XJW B;  1ABQ A;  1TUD A;  4M7D B;  1JEG A;  1WLP B;  2I0N A;  3ZEH A;  2V26 A;  2JS2 A;  4JPB W;  4E6R A;  5LJ3 f;  3CCS Q;  1PRM C;  2K5L A;  2ED0 A;  3URG A;  1ZUU A;  2FRW A;  3KUF A;  4XU2 A;  4QVD A;  2I2L A;  1BBZ A;  4OMM A;  1HYO A;  4ME7 A;  1OYX A;  3KBG A;  4KBM B;  2GQV A;  3M4Y A;  3MPU B;  4IUT A;  1WIE A;  2FVU A;  3GF5 A;  3VV0 A;  2YLC A;  3OW2 S;  1YP5 A;  2DL3 A;  3I5R A;  2E41 A;  4M7D F;  2JM8 A;  3KXT A;  2XDP A;  3NPF A;  3G6E A;  2R5A A;  3CC7 T;  2FG0 A;  1WHH A;  1YIJ T;  4FW2 A;  3JB9 J;  4WF2 A;  4EMK C;  4GLK A;  2M16 A;  2G3R A;  3CPW P;  3EG1 A;  4J9G A;  2LDM A;  3VS6 A;  1IHV A;  4HXJ A;  1WNL A;  4FU6 A;  4EMH A;  5LJ5 j;  4AG2 C;  2RHY A;  5EC7 A;  4M78 E;  4BI4 A;  2LTO A;  1M2O A;  3JCM g;  3JCM P;  1V1C A;  2XIC A;  4RG8 A;  3OSS C;  1W70 A;  3I55 Q;  2H3E B;  4AFZ C;  2B86 A;  4Q5W A;  2A3L A;  5I2S A;  2EWN A;  4LD6 A;  2V8K A;  4MML A;  3LH5 A;  4HA8 A;  2OTL Q;  5LJ3 j;  5CKF A;  5GMK m;  3OW2 A;  2LQK A;  5IN1 A;  1W2B A;  4PJO C;  1VQ5 Q;  3J7A F;  4F17 A;  2QAZ A;  1N6A A;  4N4I A;  2LNV A;  1ZHI A;  1V76 A;  2EAY A;  2VXF A;  4ELZ C;  4P5N A;  2AZV A;  4C5G A;  4FCY A;  1YJW Q;  2KAF A;  2E4H A;  3CC4 T;  3GIB A;  1X2K A;  5IHK A;  2M0Y A;  2D6F A;  2CUB A;  2OTJ Q;  4NS5 A;  3AT1 B;  2XDD A;  3QO3 A;  1K0S A;  1MV3 A;  2YRC A;  4F14 A;  1WXB A;  3TSW A;  1BI3 A;  5L8R E;  1N8R R;  1Q81 U;  2DER A;  4HVV A;  2K5F A;  4Z8A A;  4FYX B;  4JS4 A;  1O9S A;  3TEE A;  1M2V A;  2O2O A;  1YJN Q;  2RH2 A;  3QWY A;  4J9D A;  2QA4 T;  1WHG A;  2K3Y A;  4E2F B;  1VQM Q;  1B3Q A;  2DZ9 A;  2EYZ A;  2RD1 A;  2O4X A;  2HQX A;  2P0Q A;  2BZY A;  4RCC A;  1UEC A;  2QG9 B;  4JRP A;  4M75 B;  1IGU A;  4Y91 A;  2E3I A;  1PKT A;  1TXQ A;  2C0T A;  1VQO T;  2ENM A;  2P0P A;  3JCM W;  2DD5 A;  3EH1 A;  1N9S A;  4OVA A;  3UPU A;  1B7T A;  2ZZD A;  4V2S A;  2M9U A;  3G1J A;  1VQ7 A;  1Q7Y C;  3V7R A;  4OB0 B;  1VQP Q;  2RN8 A;  1TOV A;  2DX1 A;  4E7S A;  2KT8 A;  4AMC A;  3CPW S;  1NLO C;  2CSQ A;  2KXC A;  2YUQ A;  3M0T A;  2QEX Q;  4JJN K;  3X25 B;  4K11 A;  1M5Q 1;  3BY7 A;  3L2Z A;  4M78 A;  3ER0 A;  5LJ5 h;  3CCL T;  5HCK A;  3QJY A;  4WCI A;  2HSP A;  3I55 T;  1OU8 A;  1J3T A;  2CZ7 B;  3FRN A;  3HRT A;  1D0Z A;  1UHC A;  2KVQ G;  3ZBD A;  6AT1 B;  1TWB A;  1OQK A;  2DVJ A;  2L3R A;  3MP1 A;  4AT1 B;  5A0G A;  1M90 C;  2JTF A;  3LYI A;  4ZTJ A;  1D0X A;  4HKE A;  2ABL A;  4FSX A;  5LJ3 e;  1FYN A;  2RF0 A;  3RUX A;  3QYH B;  2DIG A;  3NGP A;  2COW A;  4JUV A;  3CEY A;  5KYX A;  2QQS A;  4HT8 A;  2GFA A;  2AKL A;  2GF7 A;  1VQ9 A;  2EGC A;  5GAO p;  3CPW A;  3GNF B;  1VQ4 T;  3QUI A;  2L3P A;  2V8J A;  1D1A A;  4XU3 A;  1K8A R;  1C1A A;  2MIO A;  5KCH A;  1IZ6 A;  3PIO A;  5GAN 8;  2P4R A;  4EIK A;  2RPN A;  1YJ9 T;  1IHW A;  2KQW A;  3EG2 A;  3SFM A;  2L89 A;  4MDW A;  1Q82 R;  1UGV A;  1AOJ A;  1JXO A;  4OF1 A;  4A63 B;  2ED1 A;  2NWM A;  4IUQ A;  2OX7 A;  5GAN d;  3TQ7 P;  4KUL A;  2KSS A;  3LH0 A;  4HCK A;  5FRO A;  4FL6 A;  1NPR A;  1BIB A;  2CZ0 B;  2PNI A;  3MJX A;  2J06 A;  3OYI A;  4RCB A;  2IIM A;  2KK4 A;  2RI3 A;  1WGS A;  2RI2 A;  1QVF S;  2BUD A;  3INZ A;  2CH4 W;  4JRK A;  2Z0W A;  4C92 E;  3LWH A;  3VYH B;  2DXB A;  3NMZ C;  1YCS B;  3DLM A;  1Q86 C;  2E6N A;  4M78 B;  2DYB A;  3CCQ T;  2RNA A;  4DBH A;  1YHQ T;  1ZUY A;  2W0Z A;  2D0Q B;  3RNJ A;  1VQ8 T;  2KEA A;  4M7A C;  4X9D A;  4QQG A;  3CC2 Q;  2QDY B;  4BB7 A;  3CC7 A;  2RI5 A;  1YIJ A;  2ESW A;  2K4Y A;  4BE1 A;  2Y4Y A;  3VS1 A;  1K0X A;  3EGX A;  4IUV A;  1QQJ A;  4JRI A;  2KNB B;  2KXD A;  4C8Q E;  2DXU A;  4JLG A;  4EPC A;  1QCO A;  1ZBX A;  1UGS B;  1HD3 A;  1WXT A;  2RA2 A;  4ATO A;  5GAO r;  4M78 F;  1U8R A;  2A36 A;  2FZK B;  1WJQ A;  2EQJ A;  2A37 A;  2F69 A;  4XTV A;  1VQ7 Q;  2CZ6 B;  2O88 A;  3JCM e;  1RAH B;  3JAM E;  5GAM d;  4JJD A;  5HK3 A;  1AD5 A;  1K1Z A;  1N8R C;  4C92 D;  3SWN A;  3QYG B;  3VS7 A;  5C0M A;  3I56 T;  4IIO A;  1GBQ A;  1R0C B;  2VUB A;  2LT1 A;  2LCS A;  2AKK A;  5CK9 A;  2QQB A;  1ZUK A;  4C0D C;  1KC8 C;  2ZPH B;  5KH6 A;  1ZSZ B;  3CC4 A;  4JZ3 A;  3V8K A;  2CH4 A;  3GP8 A;  1TU0 B;  1WDX A;  1M3C A;  4XAX B;  3OYB A;  2ZGW A;  4CRI A;  2DF6 A;  2O9V A;  3UT1 A;  1AWJ A;  1WX6 A;  4LE9 A;  2YHT A;  1YWP A;  4QW2 A;  1K73 R;  1YI2 T;  2AIR B;  3REB B;  3CME T;  2CGH A;  1AZG B;  3OQ5 A;  4E7L A;  2E12 A;  5DM7 R;  3TU4 K;  4OB2 B;  4JJB A;  1TUG B;  5GAO q;  2QA4 A;  3LLR A;  4QT7 A;  4BDY A;  3X28 B;  4C92 A;  4C92 G;  1BCM A;  3PE0 A;  1NJI R;  5GJW B;  3JB9 D;  2EFI A;  2KRM A;  1VQ9 Q;  2NUP B;  1VQO A;  3EG3 A;  1U5S A;  2KT1 A;  3VUZ A;  3I9Q A;  4IKF A;  1VYU A;  1VA7 A;  3CC2 T;  3JCM Q;  2KE9 A;  5CR2 A;  4EMG A;  4OB3 B;  3HKS A;  3VKI A;  2YWW A;  9ATC B;  1WQ7 A;  2CP5 A;  4M77 C;  3WVD B;  4PJN A;  3QZ9 B;  2LQW A;  2FL7 A;  2D0N A;  3HFO A;  2LCL A;  3EGU A;  3CCL A;  3UDC A;  1SSF A;  2FB7 A;  3I55 A;  2AK5 A;  1BK2 A;  1ZA2 B;  2DRM A;  4X34 A;  3MP8 A;  2BKD N;  4LN2 A;  4RMO A;  3OYE A;  2MAM A;  4ESR A;  1G83 A;  2KMT A;  1G3Y A;  3CXC P;  4OMF B;  3JB9 G;  2GBQ A;  1WHL A;  5LJ5 g;  1RAA B;  1E6H A;  2E6Z A;  1VQL T;  3LGL A;  2J05 A;  4DEY A;  1Q86 U;  2DXC A;  2WSC E;  5GAN f;  2PUK B;  4PJM A;  4AG1 C;  1XNI A;  4BY6 B;  1Y71 A;  5FU6 B;  2K9G A;  4J9B A;  3HRS A;  1PHT A;  2KYB A;  5ECA A;  2XKO C;  1KD1 R;  5GAM g;  2YUO A;  3EFR A;  4DBQ A;  3CC7 Q;  1YIJ Q;  1SHF A;  1RAI B;  1VQ4 A;  1NBE B;  3A1P A;  1D3B A;  3FIF A;  4KH1 B;  2DRK A;  2D8J A;  1WQW A;  3ASK A;  3KFV A;  2FRY A;  2MI6 A;  4FYW B;  2MYS A;  1PD0 A;  4FIB A;  2ROL A;  1GCQ C;  1YJ9 A;  1N9R A;  1RAB B;  2DKG A;  1K9M R;  5CKH A;  3LW5 E;  2DIQ A;  1M1K R;  1SPK A;  2LVM A;  3OYG A;  4PLI A;  4FW1 A;  5KE2 A;  1LPL A;  1R0B G;  2VB6 A;  4FT4 A;  2O31 A;  3OS1 A;  3V7S A;  2NUT B;  4M7D C;  2E5Q A;  2LT4 A;  2CP6 A;  1X2Q A;  1AWO A;  5KYW A;  1OEB A;  4PNO A;  3QSU A;  1UUE A;  1XQH A;  2CP3 A;  3JV3 A;  4F04 B;  3PVQ A;  5J3B A;  4PJO D;  1MMN A;  1B34 A;  4O5V A;  2NUZ A;  5DY9 A;  2FPD A;  1Y96 A;  4A53 A;  1KC8 U;  1I1J A;  4RTX A;  4KGZ B;  3CC4 Q;  1FMW A;  5GAN j;  2HQH A;  1FWZ A;  2PTK A;  2V8I A;  1KQ1 A;  3CCQ A;  2A08 A;  3H8Z A;  3OY9 A;  3CCR T;  1YHQ A;  1P92 A;  2LNH B;  4C8Q B;  4C92 F;  1V29 B;  5CVI A;  5GAM f;  1VQ8 A;  1KFZ A;  4PK4 A;  1JU5 C;  2DET A;  4ZN3 A;  2OI3 A;  5DLO A;  3EGD B;  1M4Z A;  3M0Q A;  5IH2 A;  3HL8 A;  3RER A;  5AT1 B;  2HAX A;  3SEM A;  3PMT A;  2L8D A;  5KYY B;  4E7I A;  2EKO A;  3M0P A;  4OGC A;  2LJ3 A;  8ATC B;  2QA4 Q;  3P8D A;  1X01 A;  4LD9 K;  4PJO G;  1PRL C;  3L2V A;  1VQO Q;  5CO7 A;  1W2B S;  3RDV A;  4C8Q F;  3WXM B;  1MMD A;  3OS0 A;  2QQR A;  3M59 A;  4KH0 B;  2FO0 A;  1WA7 A;  4DQ2 A;  1K73 C;  3A8G B;  4E7H A;  3I56 A;  3HPW A;  2XD0 A;  4ZGE B;  3JB9 F;  2DA9 A;  4JLI A;  1AWX A;  3CCJ T;  3A8H B;  3CCL Q;  4XTU A;  1EFN A;  1G5V A;  3C0C A;  3CXC A;  3TSZ A;  1ZSG A;  3OYK A;  2VXE A;  2FEI A;  2RJF A;  2R57 A;  5GAM j;  3A8L B;  2E1H A;  2HKQ B;  3FJ5 A;  1H92 A;  4RTZ A;  2XHC A;  1YI2 A;  1MUZ A;  2D8H A;  3CME A;  1T0H A;  4J6W A;  4XTW A;  5IAY A;  1QVP A;  1E7O A;  1TG0 A;  1QLY A;  1HXD A;  1Y96 B;  3MET A;  2QYZ A;  4PKC C;  5CKE A;  4F7U G;  4F7U A;  1LCK A;  4MZT A;  2EVR A;  1JO8 A;  1QWF A;  3OYN A;  1VQK T;  1AVZ C;  4A4H A;  3A8M B;  3VS3 A;  5GAN h;  4M75 C;  1VQ4 Q;  1E6G A;  2HBW A;  3J80 E;  4J7F A;  1JQQ A;  2HDA A;  2PU9 B;  1WHM A;  3CC2 A;  4Z02 A;  3PTA A;  2BZ8 A;  2VAS A;  1H8K A;  2F2X A;  2HMA A;  4BUG A;  5CQX A;  4BE0 A;  2DMO A;  1YJ9 Q;  2LQ8 A;  2M51 A;  3OA6 A;  5FU7 B;  4YTL A;  1LJO A;  1Y07 A;  4RTY A;  3CD6 T;  2WSE E;  3OYH A;  1H64 1;  4PFZ A;  3REA B;  2KYM A;  1QCF A;  2RM4 A;  4RUG A;  1KD1 C;  2DPP B;  2F2V A;  3NTK A;  1VIF A;  2DK3 A;  2K3X A;  2BE7 D;  3G4S T;  2ZPF B;  2IG0 A;  4PLL A;  4X1V A;  1PC0 A;  2X4J A;  2QK0 A;  3OS2 A;  3PGG A;  3VRY A;  1VQL A;  2YDL A;  2E70 A;  1IXD A;  3FLG A;  1K9M C;  3MHX A;  1RUW A;  4A4F A;  1OZ3 A;  4EDU A;  5GAO l;  1KQS P;  2RHI A;  1LNX A;  3CCQ Q;  1YHQ Q;  1JJ2 P;  1RI0 A;  3GNG A;  1OZ2 A;  5LJ5 e;  1ARK A;  1BKB A;  4M7A D;  1VQ8 Q;  2D9T A;  1VOM A;  4LDW A;  5CKB A;  5GMK h;  1ZX6 A;  1X6G A;  4N0A C;  5GAM h;  4LUE A;  1LVK A;  1OI1 A;  4QKU A;  2ZPG B;  5KCO A;  3M55 A;  4E7K A;  1BYM A;  1NEB A;  4LNP A;  5IXB A;  1JRI A;  1T0J A;  3RIR A;  2CKK A;  2EKH A;  3OMC A;  1LOJ A;  5GAN 2;  3BW1 A;  2QDL A;  2J6K A;  2JTM A;  3DKM A;  2GNC A;  4OP0 A;  4B6M A;  1U06 A;  3QZ5 B;  1NZ9 A;  4C5H A;  1FX7 A;  3I56 Q;  3JB9 H;  4M7A A;  4M7A G;  1IB8 A;  3F70 A;  2GCX A;  2NLU A;  3PVL A;  1QMC A;  4OMN A;  2QI2 A;  2VKN A;  4IUP A;  2IVW A;  2RJC A;  1NPP A;  1M2V B;  2BZX A;  2X3X D;  1YN8 A;  2YLB A;  2DL7 A;  4F7U F;  4ZNX A;  2O4X B;  3CCR A;  4MZM A;  1PKS A;  4M78 C;  2VV5 A;  2DBK A;  3PNW C;  1EZZ B;  2FHD A;  1OUL A;  3RMQ A;  4NOY A;  3LGF A;  3HP9 A;  1YI2 Q;  3CME Q;  4IIM A;  2DM1 A;  3MP6 A;  4Z89 A;  4JRQ A;  5GAN 3;  1M9S A;  2J6O A;  2SEM A;  1KSW A;  1PSF A;  5J39 A;  3CCE Q;  1UG1 A;  4J9C A;  2QTV A;  2DTH A;  2ATC B;  3LX7 A;  3M54 A;  1G2B A;  1VQ6 A;  1H3H A;  2P0K A;  2DVE A;  2XDB A;  1JJ2 S;  1Q81 R;  3FEO A;  4XK8 E;  2EGA A;  4OMQ A;  2EYY A;  5D6Y A;  3OBY A;  3OYC A;  4E7Z A;  2LC4 A;  4IUU A;  4ANJ A;  4M77 D;  2DE0 X;  2RO0 A;  2JM9 A;  3EFO A;  2OJ2 A;  2ECZ A;  3VYG A;  1BIA A;  3JCM V;  3CCJ A;  4R56 A;  1BCO A;  5FRM A;  5I11 A;  3ZFJ A;  1BB9 A;  4FYY B;  3E19 A;  1I8F A;  5KYN A;  1ZSZ C;  2C0I A;  2HD0 A;  1WPY A;  3HRU A;  5KYX B;  4DBF A;  1FMK A;  2B8A A;  3OSV A;  3OYD A;  1Q7Y U;  3M53 A;  4HCB A;  2GGR A;  1S72 T;  2X4Y A;  1KQS A;  1QCN A;  5EG2 A;  4RTV A;  2XK0 A;  2K6D A;  1VQL Q;  2DXT A;  3EAE A;  5GAN 5;  1JJ2 A;  2L5Q A;  4BI3 A;  2Y4X A;  1JXM A;  2EJF A;  2LZ6 B;  2HNI A;  4M4Z A;  3A8O B;  3MKD A;  4MMK A;  3R6N A;  4M77 A;  4M77 G;  2DZC A;  2FPF A;  1KHI A;  2JMC A;  2VYT A;  5KYU A;  5LL6 S;  1ACM B;  3GPL A;  5LJ3 d;  2GTO A;  1VQK A;  1MNE A;  2ZPB B;  2A28 A;  2X9H A;  3CCU T;  3H0F A;  3C95 A;  2KRO A;  1RLQ C;  1ZA1 B;  3P8H A;  4DBR A;  3E9F A;  2DBM A;  3E2U A;  1M90 U;  3GBQ A;  4QVZ A;  1XOV A;  2BE9 B;  1VYT A;  2X4W A;  3E1S A;  3NTH A;  2C0O A;  3QJ6 A;  4AFQ C;  3DB3 A;  1ABO A;  1UGQ B;  4BI8 B;  5GAN g;  3CD6 A;  3CCE T;  4J9E A;  1R8O B;  1TSF A;  4M7D D;  4LXC A;  2HL5 C;  1NE8 A;  2EPD A;  2JNG A;  2CZ1 B;  3UF4 A;  1KHC A;  2LJ1 A;  3BE3 A;  2GQI A;  3A98 A;  2O9S A;  3G4S A;  3CCM T;  1HK9 A;  3IQL A;  1I5O B;  1KK7 A;  4AFU C;  2KRS A;  2SRC A;  5FWB A;  5I2M A;  4E47 A;  2MF2 A;  3L2U A;  5FWC A;  3VS4 A;  1SHG A;  2EYQ A;  3EGX B;  5GAO n;  3QDR B;  2HZY A;  1A0N B;  3E9G A;  2VVK A;  3VUB A;  4LDU A;  1GCQ A;  3CCR Q;  3EG9 A;  2RK1 A;  2J6F A;  4BY6 C;  2HBP A;  4OB1 B;  3UWN A;  2G6F X;  2LQN A;  3OYM A;  5FU6 C;  4WTO B;  2QQA A;  3CBP A;  2JOY A;  1QWE A;  2KR3 A;  3CCV T;  1QP2 A;  4PJJ A;  7AT1 B;  3X24 B;  8AT1 B;  1PM3 A;  2CUD A;  2CT4 A;  4N4G A;  4BD3 A;  4M7D G;  1Y57 A;  2EJ9 A;  2HCK A;  3G71 T;  1NG2 A;  1T3S A;  5GAN 6;  5L23 A;  1K8A C;  3GLX A;  2CDT A;  1BU1 A;  2QGF B;  4KGV B;  3SWN B;  2YUN A;  2WAC A;  2DEU A;  2JXB A;  4PJO E;  4Y28 E;  2QQ9 A;  1WJR A;  3ULR B;  2EW3 A;  5D7U A;  1Y0M A;  1Q82 C;  3V8J A;  4RG2 A;  1VQ6 Q;  1WI7 A;  1UEB A;  3H0H A;  3P8B B;  1PD1 A;  3ME9 A;  3CBM A;  5KYU B;  1JBM A;  2RB6 A;  2KDS A;  2KI7 A;  4E7J A;  3JRZ A;  4J6Y A;  2RK2 A;  4M75 E;  1XTD A;  1MMG A;  3C4S A;  2P4T A;  2QXF A;  3M58 A;  2PVG B;  3RR6 A;  1WHJ A;  1YCY A;  3M5A A;  3CCJ Q;  5DLQ E;  3JCM d;  3CPF A;  2DD4 A;  1WXU A;  4LUD A;  4KUD K;  5GJV B;  3M56 A;  2AHJ B;  4D8K A;  1YIT T;  3VU3 C;  2K57 A;  5CQY A;  1Q7Y R;  4JS5 A;  4LDY A;  2FZC B;  1VUB A;  4C92 B;  2F2W A;  1WHK A;  4LDV A;  1IO6 A;  1Q81 C;  1N8R U;  4C8Q C;  2RQW A;  4C5E A;  1C0M A;  5I22 A;  4D6W A;  1QP3 A;  1O75 A;  2L3S A;  1UJY A;  2K3B A;  5D6W A;  1BI0 A;  1UE9 A;  4N4H A;  2NYS A;  3DB4 A;  4OMO A;  2KBT A;  4EMK A;  4RTT A;  4F7U E;  3N5B B;  3QWX X;  1YFN A;  3L2W A;  1VQK Q;  4M75 D;  1G8X A;  2E65 A;  2R58 A;  3L2Q A;  1PSE A;  1M90 R;  3CMA T;  1RAG B;  4ZGJ B;  4BDZ A;  2PVD B;  1D1B A;  4RTW A;  3EHQ A;  2EQI A;  2LP5 A;  3PIP A;  3X26 B;  2PZ1 A;  4F16 A;  1OOT A;  4GBQ A;  3I35 A;  3CXC S;  3JCM b;  4KT0 E;  3RKW A;  4OML A;  5IHN A;  2RHU A;  2K7A A;  3S6W A;  3CD6 Q;  2RJD A;  4XU0 A;  2LRQ A;  3C94 A;  1AWW A;  3G7Z A;  4PJO A;  2EBP A;  1MV0 B;  4QQD A;  4J9I A;  3CBO A;  5GAN 4;  4FM4 B;  2MK5 A;  1Z9Q A;  1OPK A;  1VQ6 T;  4NL2 A;  2H8H A;  3BFM A;  1VQN Q;  2OAU A;  4UC4 A;  3G4S Q;  4M75 A;  4M75 G;  1S72 A;  2HL3 A;  3VS2 A;  3NFC A;  1D3B B;  1X75 C;  3R6O A;  2VWF A;  4XTX A;  3EHR A;  4B9X A;  2F5T X;  3RBB B;  3OBW A;  1WFW A;  3FJP A;  1NEG A;  1K4U S;  1NJI C;  2EJG A;  2GTJ A;  3H9N A;  4RKU E;  2VGM A;  5GMK j;  2COY A;  4FSS A;  3QXE B;  3CCU A;  1F1B B;  1Q95 G;  4PL6 A;  1X69 A;  1OX8 A;  2RQV A;  1GFC A;  1T3L A;  1G3W A;  1BI1 A;  4OGE A;  4DEX A;  4FT2 A;  1K8A U;  3H0I A;  1SRL A;  1QW1 A;  1AHJ B;  2XU8 A;  1RLP C;  2HSE B;  1Q86 R;  5KYW B;  4X9C A;  1N27 A;  1CKA A;  4ORZ A;  1EX4 A;  1JB0 E;  1B34 B;  3JCM c;  2PUO B;  1Q82 U;  4VUB A;  5FU7 C;  3CCE A;  1K9A A;  2JUF A;  4EMK B;  4HT9 A;  2X51 A;  4CC2 A;  1AEY A;  1M1G A;  2CS7 A;  5A0D A;  4L5G A;  3X20 B;  1UGR B;  2MCN A;  5HY6 A;  2ROT A;  1CSK A;  2CYZ B;  2RMO A;  2XG8 D;  2EQU A;  2YSQ A;  5GAN e;  4M7A E;  2E64 A;  3UAT A;  3CCM A;  2CP2 A;  2JMA A;  5GAN 7;  3SDZ A;  2FYK A;  2O01 E;  1AZE A;  3VRZ A;  2FPE A;  5GAO m;  2L2P A;  4N0A A;  1SG5 A;  3BDL A;  2V1Q A;  2JJ9 A;  1QVG P;  4JJC A;  2WSF E;  4HCZ A;  2K2M A;  2P84 A;  3CCS T;  3RES A;  4M78 D;  1Z9Z A;  4PJO B;  5CCA A;  5GMK l;  5FRN A;  3L2R A;  3CCV A;  1VQN T;  3LWI A;  2JN0 A;  3OB9 A;  1I5L A;  1QKX A;  4GLM A;  1KC8 R;  3G71 A;  1YNZ A;  3JCM f;  2MWP A;  1IRX A;  3M57 A;  1YWO A;  2GFU A;  1IGQ A;  1U1T A;  4C0G A;  1I4K 1;  4TVR A;  4CC4 B;  1ZLM A;  3OYA A;  1M1K C;  1EIF A;  2CP0 A;  1I0C A;  2QTX A;  2ZPE B;  3A5Z B;  2CRE A;  3JB9 I;  1QVF P;  4PJO F;  2ZAE A;  3M0S A;  2KGT A;  4A4G A;  1WJS A;  3SHW A;  3VS0 A;  3S3N A;  1IRE B;  4M78 G;  5GMK e;  1G3T A;  3MCA B;  1HJD A;  3QKJ A;  4J83 A;  4M75 F;  2DEQ A;  5GAM e;  1HSQ A;  2DL4 A;  3RMS A;  1TTH B;  2YUP A;  2ZCF B;  2VC8 A;  3TRE A;  2DNU A;  1M30 A;  1M3A A;  2MPX C;  1YIT A;  2OTL T;  1DJ7 B;  5A0L A;  1RAD B;  5CKD A;  2IPO B;  1KQ2 A;  2RHX A;  4F7U B;  4BAC A;  3M0U A;  1OPL A;  5LJ3 h;  2DLP A;  4XQ3 A;  2CSI A;  2EQK A;  2W10 A;  1K73 U;  1M1F A;  1S72 Q;  1VQ5 T;  3L42 A;  4AFS C;  3OS5 A;  5I21 A;  3M4G A;  3VJP A;  1KG1 A;  3M9Q A;  4ZN1 A;  5HKC A; 
#chains in the Genus database with same CATH homology
 2J7I A;  1RLQ C;  1CKB A;  3NHN A;  2DBM A;  1SPK A;  5IHI A;  3GBQ A;  4F17 A;  1XOV A;  2O31 A;  1VYT A;  2C0O A;  1X2Q A;  4HVW A;  4AFQ C;  2AZV A;  1AWO A;  1OEB A;  1UUE A;  1ABO A;  3JV3 A;  1X2K A;  3PVQ A;  4J9E A;  2RQR A;  1GBR A;  5IHK A;  2M0Y A;  2NUZ A;  1NYG A;  2CUB A;  2BTT A;  2FPD A;  3M0R A;  1I1J A;  1K0S A;  1MV3 A;  4RTX A;  4F14 A;  2EPD A;  1WXB A;  3TSW A;  3UF4 A;  2L3Q A;  2LJ1 A;  1W1F A;  4HVV A;  2GQI A;  3A98 A;  2YT6 A;  2O9S A;  2PTK A;  2XMF A;  4Z8A A;  2A08 A;  2O2O A;  2LNH B;  3IQL A;  2DL8 A;  3QWY A;  4J9D A;  4AFU C;  1KFZ A;  2KRS A;  2SRC A;  1B3Q A;  1JU5 C;  5FWB A;  2EYZ A;  2OI3 A;  5FWC A;  2BZY A;  3M0Q A;  3VS4 A;  1K76 A;  1SHG A;  5IH2 A;  1GCP A;  1NLP C;  1UEC A;  4J9F A;  1PKT A;  2C0T A;  3SEM A;  1A0N B;  2VVK A;  2ENM A;  1GCQ A;  3M0P A;  1GCQ C;  2LJ3 A;  2J6F A;  2G6F X;  2LQN A;  1OV3 A;  1SRM A;  1QWE A;  2KR3 A;  1PRL C;  2RN8 A;  2CUD A;  2RQT A;  2CT4 A;  3O5Z A;  2DX1 A;  1Y57 A;  2KT8 A;  2HCK A;  1NG2 A;  1T3S A;  1NLO C;  2CSQ A;  2KXC A;  2YUQ A;  3M0T A;  5L23 A;  4K11 A;  2CDT A;  3I5S A;  1BU1 A;  4RTU A;  5HCK A;  2YUN A;  3THK A;  4WCI A;  2HSP A;  2FO0 A;  2JXB A;  1WA7 A;  1GL5 A;  4Y92 A;  3ULR B;  2EW3 A;  1J3T A;  1Y0M A;  1WYX A;  4HVU A;  1UHC A;  1WI7 A;  3H0H A;  2DA9 A;  1AWX A;  2CT3 A;  2DVJ A;  1X6B A;  1N5Z A;  1EFN A;  1QKW A;  3C0C A;  3TSZ A;  2ABL A;  1ZSG A;  1FYN A;  2RF0 A;  2FEI A;  3NGP A;  3VS5 A;  3CQT A;  1W6X A;  3FJ5 A;  1WXU A;  4LUD A;  2JW4 A;  1H92 A;  4RTZ A;  2AKL A;  5GJV B;  1MUZ A;  2D8H A;  4D8K A;  2EGC A;  1T0H A;  2K79 A;  1I07 A;  2F2W A;  1E7O A;  1TG0 A;  1QLY A;  1IO6 A;  1X27 A;  2L3P A;  2RQW A;  1LCK A;  5I22 A;  1M27 C;  2EVR A;  2MIO A;  1JO8 A;  1QWF A;  1U3O A;  2DJQ A;  2L3S A;  1UJY A;  2P4R A;  4J9H A;  2K3B A;  1AVZ C;  2RPN A;  4EIK A;  3VS3 A;  2HEQ A;  1E6G A;  2HBW A;  1UE9 A;  3EG2 A;  4OMO A;  1JQQ A;  2KBT A;  2HDA A;  4RTT A;  1UGV A;  1AOJ A;  1JXO A;  4A63 B;  2ED1 A;  2BZ8 A;  2NWM A;  1H8K A;  1UTI A;  2F2X A;  3QWX X;  4Z88 A;  4HCK A;  2D1X A;  2DMO A;  1SSH A;  2M51 A;  2PNI A;  2L0A A;  4RTY A;  2J06 A;  2KRN A;  2LX7 A;  3REA B;  2MOX A;  2KYM A;  2IIM A;  1QCF A;  2AZS A;  3EHQ A;  4RTW A;  2EQI A;  3EG0 A;  1NM7 A;  2LP5 A;  4RUG A;  2CH4 W;  1KJW A;  2F2V A;  2PZ1 A;  1PWT A;  4F16 A;  1OOT A;  4GBQ A;  2JS0 A;  3I35 A;  4OML A;  5IHN A;  1UJ0 A;  2K7A A;  3NMZ C;  1YCS B;  1RI9 A;  3ZL7 C;  2EYW A;  2DYB A;  1AWW A;  2EYX A;  2RNA A;  1ZUY A;  1MV0 B;  2EBP A;  2W0Z A;  4X1V A;  3RNJ A;  4J9I A;  3VRY A;  1UDL A;  2KEA A;  1Z9Q A;  2YDL A;  4JZ4 A;  1OPK A;  4R0K A;  2H8H A;  1RUW A;  2V1R A;  2ESW A;  3VS1 A;  1K0X A;  3U23 A;  1ARK A;  1B07 A;  2OAW A;  3VS2 A;  1KIK A;  1UFF A;  2VWF A;  2KNB B;  2KXD A;  3EHR A;  1ZX6 A;  1X6G A;  2DIL A;  1S1N A;  3RBB B;  1HD3 A;  1WXT A;  3UA7 A;  1WFW A;  2LMJ A;  1NEG A;  1K4U S;  4KRT A;  4LUE A;  2LJ0 A;  4CC3 A;  2A36 A;  1VYV A;  2GTJ A;  1GRI A;  2A37 A;  1NEB A;  4LNP A;  5IXB A;  5FW9 A;  4FSS A;  5IXF A;  2O88 A;  1X69 A;  1T0J A;  4JJD A;  2RQV A;  1AD5 A;  1K1Z A;  1GFC A;  1ZBJ A;  1T3L A;  4DEX A;  3VS7 A;  2EKH A;  3H0I A;  4IIO A;  1SRL A;  1GBQ A;  2QDL A;  1RLP C;  3TVT A;  2J6K A;  1TUC A;  2LCS A;  2AKK A;  1CKA A;  2DL5 A;  2GNC A;  1ZUK A;  4ORZ A;  1NYF A;  1U06 A;  4JZ3 A;  2CH4 A;  4D8D A;  1M3C A;  1WDX A;  1K9A A;  1X43 A;  2JTE A;  4CC2 A;  1AEY A;  3PVL A;  2DF6 A;  2O9V A;  1PNJ A;  1M3B A;  2RQU A;  2E5K A;  1AWJ A;  4OMN A;  2MCN A;  1SEM A;  2VKN A;  1WX6 A;  4LE9 A;  1YWP A;  4CC7 A;  2ROT A;  1CSK A;  2RMO A;  3REB B;  2YSQ A;  2BZX A;  2X3X D;  1AZG B;  1YN8 A;  2DL7 A;  1GFD A;  1UHF A;  4ZNX A;  3UAT A;  2JMA A;  2JT4 A;  1PKS A;  4JJB A;  1AZE A;  3UA6 A;  2DBK A;  4QT7 A;  3VRZ A;  2FPE A;  2L2P A;  2X3W D;  2V1Q A;  3PE0 A;  3H41 A;  4JJC A;  5GJW B;  4IIM A;  4OMP A;  2KRM A;  2DM1 A;  4Z89 A;  1M8M A;  2K2M A;  3EG3 A;  1U5S A;  2KT1 A;  2EGE A;  1Z9Z A;  3I9Q A;  2J6O A;  2SEM A;  1KSW A;  1VYU A;  1VA7 A;  1ABQ A;  1TUD A;  1JEG A;  1WLP B;  1UG1 A;  2I0N A;  2KE9 A;  4J9C A;  2JS2 A;  4JPB W;  4E6R A;  1QKX A;  4GLM A;  1YNZ A;  1PRM C;  1G2B A;  1H3H A;  2ED0 A;  2LQW A;  1ZUU A;  2D0N A;  2FRW A;  1YWO A;  3EGU A;  1BBZ A;  2EGA A;  4OMQ A;  2EYY A;  4CC4 B;  4OMM A;  1ZLM A;  2AK5 A;  1BK2 A;  2DRM A;  1I0C A;  2DE0 X;  2JM9 A;  1WIE A;  4LN2 A;  2OJ2 A;  2CRE A;  2ECZ A;  4ESR A;  3M0S A;  1YP5 A;  2KGT A;  1G83 A;  2DL3 A;  3I5R A;  5I11 A;  1BB9 A;  2JM8 A;  3SHW A;  3NPF A;  2GBQ A;  3VS0 A;  1E6H A;  2C0I A;  2J05 A;  4DEY A;  1HJD A;  2FG0 A;  1FMK A;  1HSQ A;  2DL4 A;  4AG1 C;  2YUP A;  3EG1 A;  4J9G A;  3VS6 A;  2GGR A;  4HXJ A;  2K9G A;  4J9B A;  4AG2 C;  2DNU A;  1PHT A;  1M30 A;  2KYB A;  5ECA A;  4RTV A;  5EC7 A;  2K6D A;  2YUO A;  1M3A A;  1V1C A;  1SHF A;  3M0U A;  1OPL A;  1W70 A;  2DLP A;  4AFZ C;  2CSI A;  2B86 A;  2DRK A;  1JXM A;  2W10 A;  2LZ6 B;  2D8J A;  3KFV A;  4M4Z A;  2FRY A;  4AFS C;  3R6N A;  2JMC A;  2FPF A;  3LH5 A;  2GTO A;  2ROL A;  2A28 A;  3H0F A;  2KRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...