4RTYA

Crystal structure of the c-src-sh3 domain in complex with the high affinity peptide app12
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
58
structure length
58
Chain Sequence
MTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene tyrosine-protein kinase Src
publication title Crystal structure of the c-Src-SH3 domain in complex with the high affinity peptide APP12
rcsb
source organism Gallus gallus
molecule tags Protein binding
total genus 11
structure length 58
sequence length 58
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4rtyA00
2YUNA 1T0JA 5FWBA 3TSZA 1K76A 1AWXA 1YCSB 2KGTA 2CH4A 1QCFA 2LJ3A 1QKXA 1GCQC 1Y0MA 2KROA 3EG1A 2DLPA 2CT4A 2D8HA 2J7IA 3M0QA 4LE9A 2LJ0A 3NPFA 3SHWA 3M0PA 2OJ2A 1RLQC 3I5SA 2D0NA 2KRSA 1MV0B 5IXBA 2BZXA 4J9GA 1QWEA 1ZSGA 1ZUKA 2YSQA 1PKSA 4D8KA 2YUQA 2X3WD 3EG0A 2KT8A 1GCPA 1ABQA 4KRTA 3FJ5A 4WCIA 1YN8A 1TUDA 2FRWA 2KEAA 1QKWA 1NG2A 2AZSA 2DILA 2BZ8A 2KBTA 5IHIA 2K7AA 1WXUA 2SEMA 1CKBA 4J9FA 1W70A 1QLYA 2EYWA 2DRMA 2J6OA 5EC7A 1Z9QA 1GCQA 2EW3A 3H0FA 2F2WA 4Z8AA 2CUDA 3EHRA 4AFQC 2DJQA 1MV3A 2GTJA 3H0IA 2DM1A 3ZL7C 1AD5A 1ZBJA 2RQWA 1NLOC 2D8JA 2F2XA 2DNUA 1FMKA 2V1QA 1WDXA 3VS6A 3IQLA 1OPLA 1AZEA 1CSKA 2SRCA 1GBQA 4OMOA 5FWCA 1XOVA 2J05A 4IIOA 1UJ0A 2DMOA 1NM7A 1X2QA 2GTOA 2GGRA 1UTIA 2E5KA 3VS1A 3SEMA 2CSIA 1EFNA 4JZ3A 2XMFA 1UFFA 2J06A 4R0KA 2AK5A 4ORZA 1U5SA 1W6XA 3EG3A 4JJDA 2ROLA 5GJWB 2MCNA 2KNBB 3I9QA 4M4ZA 2DL3A 1UECA 2KXDA 1H8KA 2A28A 3NMZC 4J9DA 2GBQA 2RMOA 3EGUA 5IHNA 1G2BA 1E6GA 2EYXA 3O5ZA 1VYVA 3I5RA 1E6HA 1PKTA 1JQQA 1TG0A 2M51A 2QDLA 2LQWA 1CKAA 4RTXA 2IIMA 2LJ1A 2PTKA 3NHNA 1KJWA 4K11A 2O2OA 2ROTA 2GNCA 1BB9A 4F16A 1GFDA 4F17A 1PRLC 1M27C 1PWTA 2LP5A 4HVWA 2DYBA 4LNPA 3M0SA 4RTTA 1VYUA 3EHQA 3VRYA 2K3BA 2F2VA 4CC7A 2CH4W 4HXJA 2MOXA 2A36A 2FPDA 2EGCA 2DL4A 2RPNA 2L0AA 2LZ6B 3QWXX 2C0TA 2K79A 1WIEA 1KSWA 2NWMA 3VS0A 3UA6A 2DX1A 1OEBA 1K0SA 2AKLA 2VVKA 4A63B 4AFSC 1T3LA 1WXBA 1PHTA 1JU5C 4EIKA 3REBB 2BTTA 2EYYA 2KYBA 1A0NB 4CC3A 1I07A 2CDTA 1AZGB 1PNJA 1X6BA 1OV3A 2L2PA 1WI7A 1SRLA 3LH5A 1U3OA 1SHFA 3REAB 1GFCA 1UHFA 2O9VA 3JV3A 4AFZC 3TVTA 4GBQA 5I22A 4GLMA 1M3BA 2DA9A 4J9EA 2BZYA 1W1FA 2O88A 2DE0X 1SRMA 3H0HA 1I0CA 3UF4A 2EYZA 2JS2A 1K1ZA 2W0ZA 1SEMA 4AFUC 1UHCA 4CC4B 2DL5A 1OOTA 2KE9A 2YUPA 1AWJA 2KRMA 4HVUA 3UATA 4E6RA 2ED0A 2VWFA 1YNZA 3VS7A 1AWWA 2L3QA 1X27A 2DBKA 3RBBB 4RTWA 4JJCA 2K9GA 2EGEA 4J9BA 2J6FA 2K6DA 1WA7A 2G6FX 2OAWA 3THKA 2KT1A 3VS4A 2ENMA 1YWPA 5FW9A 1WX6A 2P4RA 3C0CA 1MUZA 2CSQA 2EPDA 1H92A 2W10A 1J3TA 1KIKA 1K0XA 2EBPA 1AOJA 1E7OA 2RNAA 1UUEA 2FPEA 1K9AA 2J6KA 2FPFA 1UJYA 3EG2A 2EGAA 3PVLA 2RN8A 2I0NA 2L3SA 1GL5A 1SPKA 2YUOA 4Z88A 4LUEA 1UE9A 1JXMA 2LMJA 4RTZA 1S1NA 4IIMA 4RTYA 3VS3A 2FG0A 4ESRA 1GBRA 1WYXA 2EKHA 4RTUA 1HD3A 2LNHB 3VS5A 2O31A 4JJBA 2JTEA 4OMMA 4F14A 2AZVA 1YWOA 1ZUYA 3CQTA 3GBQA 4ZNXA 1M3AA 1JXOA 4DEXA 1NYFA 4OMNA 1AWOA 4RUGA 2FO0A 3KFVA 2KYMA 2JXBA 2ECZA 1BK2A 4FSSA 1UGVA 2RF0A 2B86A 3M0TA 1K4US 1BU1A 1LCKA 3NGPA 2LQNA 1M30A 5IXFA 2OI3A 2AKKA 2ED1A 4DEYA 2JM9A 3H41A 1X2KA 2DL7A 2CT3A 4J9CA 2RQRA 5IH2A 4X1VA 1B07A 1ZLMA 2DBMA 4HVVA 2YDLA 2KRNA 1NEGA 4OMQA 1AVZC 1GRIA 1X6GA 1I1JA 1T0HA 1FYNA 2RQVA 2GQIA 2DL8A 4OMPA 1HSQA 2C0IA 1AEYA 2CUBA 4D8DA 2JS0A 2X3XD 2LCSA 2K2MA 1YP5A 5ECAA 4J9IA 2JM8A 1WLPB 2EVRA 3PVQA 3RNJA 1NLPC 1TUCA 2HEQA 1M8MA 2A37A 4Y92A 4RTVA 2PNIA 4J9HA 3QWYA 1JO8A 1WXTA 3A98A 2V1RA 2ESWA 3UA7A 4Z89A 1SSHA 1V1CA 2L3PA 1NEBA 1SHGA 2VKNA 2A08A 2DVJA 5GJVB 2HDAA 3U23A 1B3QA 1G83A 2D1XA 2JT4A 2JMCA 1OPKA 1RI9A 2CREA 1ZUUA 1N5ZA 3M0RA 1RUWA 1NYGA 2JW4A 1WFWA 1VA7A 2H8HA 1ZX6A 2EQIA 1QWFA 1UDLA 4HCKA 4JZ4A 2HCKA 2DF6A 2C0OA 5I11A 3M0UA 2MIOA 3VRZA 3R6NA 4AG1C 1Z9ZA 4CC2A 1PRMC 4LN2A 5L23A 2YT6A 3I35A 1ABOA 1IO6A 1ARKA 2O9SA 1T3SA 4AG2C 2FRYA 2NUZA 1U06A 1HJDA 2KXCA 1RLPC 2M0YA 1JEGA 4OMLA 2RQUA 4QT7A 5IHKA 2HSPA 2ABLA 2JMAA 2HBWA 1KFZA 3ULRB 3PE0A 1X69A 4JPBW 2LX7A 3TSWA 2FEIA 1VYTA 2DRKA 2KR3A 1M3CA 1Y57A 3VS2A 1UG1A 5HCKA 4LUDA 1H3HA 1BBZA 1X43A 2PZ1A 2RQTA
chains in the Genus database with same CATH superfamily
2YUNA 1T0JA 4NS5A 5CVIA 2RI5A 3M54A 1M2VA 5HK3A 2OTLT 2KGTA 4N4IA 2CH4A 2RHXA 1QKXA 1GCQC 3JCMQ 2VASA 3EG1A 2CT4A 2CZ0B 2LJ0A 2XG8D 5GAN7 2OJ2A 1BCOA 1RLQC 4E7SA 1M8VA 2BZXA 3P8HA 4ATOA 5GANd 5KE2A 4D8KA 3CMAT 1QMCA 2QAZA 2HL5C 1VQ9A 1PCXA 3H8ZA 4KRTA 4OB0B 4F7UA 1OULA 3V8LA 3G6ET 4PJOF 2DPPB 4R55A 3EGXB 2FZCB 1QVGA 2M0OA 3OMGA 4M7DD 2DRMA 5EC7A 2VV5A 1D0YA 2E64A 5KYYB 1D1CA 3H0FA 2F2WA 3RMSA 2CUDA 3JCMP 3BY7A 4AFQC 3CCJQ 1EX4A 3H0IA 4ZTJA 3ZL7C 2DXTA 1OZ3A 3A1PA 5J26A 2G3RA 1W4SA 1HXDA 3M55A 1K9MC 1M4ZA 3CXCS 5LJ3g 2SRCA 2CZ7B 1MGQA 4JRIA 4OMOA 5FWCA 1XOVA 1U8RA 4PFZA 3VJPA 2GTOA 5GAOp 4M7DG 1UTIA 2JVVA 2QA4Q 2O4XB 4UC4A 3HTRA 1EFNA 1UFFA 1KG1A 2L3RA 1YIJA 1VQPQ 4LDWA 3OS2A 1XQHA 1Y71A 1H3ZA 3L1AA 2KSSA 4JJDA 5CQYA 1WHKA 3M59A 2ROLA 1M1GA 2K57A 5GJWB 4M4ZA 4OVAA 5KCHA 3P8BB 5GAOl 4C8QC 1VQ8Q 2DEQA 4J9DA 1MMGA 4QVCA 3CPWP 4XQ3A 3RR6A 2GBQA 5CKEA 3JB9H 3QUIA 2RMOA 5CQXA 1TTHB 4LDXA 2HBPA 5IHNA 2PVOB 1JB0E 1E6GA 2XU8A 3NFCA 3O5ZA 4ZN1A 1VQ7A 4LD6A 3CCJT 3MPUB 4N0AA 2COYA 4QVZA 2M51A 2QDLA 1GXIE 5FRNA 3C12A 1IGUA 3BDUA 1CKAA 2IIMA 2DD5A 3ER0A 3L2ZA 2COWA 1O75A 2XICA 2ROTA 3EG9B 4KBMB 1RACB 1GFDA 1PRLC 3CC7A 3EGDB 4HVWA 4ELZC 2DYBA 2QA4T 4RTTA 1WJSA 3JB9I 4CC7A 5GANf 2FPDA 2EGCA 3O8VA 1VQPT 2YRVA 3PIOA 2GFAA 5C0MA 2AT1B 5C6SA 2E3IA 3A8HB 3OYHA 1K0SA 2AKLA 4AFSC 1WXBA 4FL6A 4NL3A 3CCQQ 2GF7A 4RCBA 2KYBA 1VQ8T 3CCSQ 2DTOA 1G5VA 1TS9A 3FLGA 1RL2A 4PK4A 4DOWA 4HT9A 1K9MR 2DXCA 1OQKA 2L2PA 1WI7A 2DERA 1SRLA 1ZSZC 3LH5A 1U3OA 3ASKA 1QQJA 1GFCA 4KT0E 2K2VA 4AFZC 5KYUA 1WPYA 4GBQA 5I22A 1M3BA 2DJZA 3QYHB 4M75G 3CCLA 4ZN3A 1VQ5A 1YITQ 1SRMA 3H0HA 4FU6A 2JS2A 5GAN4 5CAIA 4AFUC 2D6FA 2VXEA 3GOXA 5CK9A 2DL5A 2VWFA 5GAMe 4KGZB 3DLLA 5EG2A 3ME9A 3CCQT 3QPHA 2EGEA 5L8RE 3CCST 1YJ9Q 1ZBXA 3VS4A 2KT1A 3NTHA 5CKFA 3QZ5B 1WX6A 1VQ6Q 1H92A 2EAYA 3PMIA 2CKKA 3HP9A 1J3TA 1KIKA 5HKCA 4IUTA 5KE3A 2RNAA 3M4GA 4FIBA 4ELYC 2FPEA 2J6KA 1X01A 3F70A 4FYYB 1PM3A 3JCMW 5GAOr 1BKBA 4LUEA 2EJ9A 1R77A 4M77C 2LMJA 1TUGB 2EKOA 1YITT 1R0CB 4RTYA 3VS3A 2P0PA 2EQMA 3OYYA 1YJWA 3M57A 1HD3A 2LNHB 3HHTB 4C8QD 2JTEA 4OMMA 4F14A 2AZVA 1ZUYA 5GAN3 1C6VX 1NYFA 3G1JA 4OMNA 5GAN8 2RK1A 2HKQB 4AT1B 4PJMA 2EQKA 3FJPA 2KDSA 1LCKA 1YJ9T 5A0LA 4M78G 3I56Q 1VQ6T 1ZA1B 4DEYA 3QG1A 1X2KA 1ZQ1A 2LT1A 2MI6A 1ZSZB 4JRQA 4C8QG 3G4SQ 1XTDA 2K5FA 5LJ5g 1ZLMA 4OB3B 3VUZA 1T0HA 3FEOA 4J83A 5KYXA 4OMPA 3PTAA 2CUBA 3LX7A 2DIQA 2X51A 3OYBA 3QJ6A 3HRTA 3TCJA 3OW2P 3CMEQ 5ECAA 3CXCA 5D6YA 4LDVA 2JM8A 1G3TA 2KAFA 1Q82U 3I55A 2HEQA 1M8MA 4B6MA 1JJ2S 4J7IA 3L2VA 2PNIA 3QWYA 3I56T 2V1RA 2MWPA 1VQ4Q 2ESWA 3JB9G 2QQ9A 4LDUA 3QJYA 4II1A 1SSHA 1D1BA 3D7SB 3GIBA 2QXFA 5GMKj 3G4ST 2XD0A 5I2MA 3RKWA 1G83A 3LGLA 1VQ9Q 2JT4A 5GMKm 6AT1B 1P92A 1QP2A 3M0RA 2JW4A 3NTKA 4M77B 4BE0A 4KUIA 2ZPFB 2K5IA 4PJOD 1ZX6A 2OTJA 3QDRB 1M90U 4M75F 4JUVA 1NZ9A 3M0UA 5FU7C 3R6NA 4CC2A 3CMET 1PRMC 3MO8A 5L23A 2YT6A 3I35A 2A7YA 2O9SA 3EGXA 1X75C 5DLQE 4XU0A 1KHCA 2E4HA 2R58A 3KBGA 3T9NA 1VQ4T 3CBPA 4M77D 5KYYA 1NBEB 1TSFA 3ULRB 4A4EA 4KGXB 2QEXA 4JPBW 2JZ2A 1QW1A 2E6NA 4PJOG 1VQLQ 3MP6A 5CCAA 8AT1B 5GANe 3VS2A 2KVQG 1UG1A 1Q82C 4J6WA 1VQ9T 2QGGA 2PZ1A 3OYGA 5GAN6 4KH0B 3QYGB 1O9SA 2V8KA 3TSZA 3X25B 3C94A 4MDWA 1K76A 1YJNA 2RM4A 2BIVA 4BE2A 1Q7YU 3L2RA 1Y0MA 1VUBA 2KROA 2J7IA 3NPFA 3SHWA 3M0PA 3I5SA 2D0NA 1MV0B 4E7HA 5IXBA 4J9GA 1QWEA 1ZUKA 2YSQA 3QBYA 1VQOQ 1PKSA 1UGSB 3JSCA 1ZHIA 3EG0A 1YI2A 4M7DC 1TH7A 2CGHA 1BIAA 4YTLA 2CP5A 2KEAA 3FB9A 4HT8A 1M1FA 4E7LA 2BZ8A 1VQLT 5IHIA 1RAIB 2DAQA 4J9FA 2FB7A 3OYAA 1QLYA 2BE9B 1Z9QA 1GCQA 3OA6A 2LTOA 2QYZA 1WHLA 2EFIA 2EW3A 1QVFP 1BI1A 4FYXB 5I21A 2GTJA 3EG9A 2DM1A 1ZBJA 2RQWA 2D8JA 4X34A 1FMKA 3EGDA 3RESA 3VS6A 3IQLA 2GFUA 1YBYA 3CCRA 1M9SA 3EH1A 1GBQA 5FU7B 2DTIA 1VQOT 2QTXA 2PVDB 2RB6A 4OF1A 4RG2A 2DMOA 3V7RA 2EQJA 1Q7YC 2RA2A 1BI0A 2E5KA 4KGVB 3SEMA 2CSIA 3EH2A 5CKDA 4JZ3A 1W2BP 2B8AA 1M1KU 2J06A 1Q82R 3OQ5A 2AK5A 1U5SA 1W6XA 3OSVA 4C0FA 4F7UF 5CIUA 1VQ5Q 5LJ3h 2MCNA 4C92A 2MMPA 2DL3A 1UECA 2QG9B 1VQKQ 1MMAA 1FX7A 3JB9F 2V8JA 3NMZC 2LT4A 2FHDA 4C5EA 1VQNA 3CCVA 2EYXA 2KMTA 5CKHA 4XU2A 1N9SA 3I5RA 2RI3A 1E6HA 1PKTA 1TG0A 3DLMA 2LQWA 3OYCA 4J7FA 1IRXA 3DKMA 2F1LA 2VC8A 3VV0A 4K11A 4M75C 3GP8A 4XK8E 3HSBA 2NUPB 1D09B 4F16A 1JRIA 5D6XA 1HYOA 2K4YA 3VRYA 2K3BA 1OU8A 4KUDK 1SF9A 2CH4W 4HXJA 2A36A 4M7DB 2RPNA 2L0AA 4WTOB 2K79A 3CC4A 1KSWA 4L5GA 3SDZA 2NWMA 3WVEB 2DX1A 1S72A 1VQ5T 3L2WA 3V7SA 4A54A 2VVKA 3CCMQ 1JU5C 2K5LA 1VQKT 3A8MB 3LWHA 2ZZDA 1KD1C 1JJ2A 1OX9A 4R56A 3RMQA 1I07A 1PNJA 1OV3A 1IHWA 3CPFA 4XU1A 1SHFA 4HCCA 2QQAA 5KYNA 4EPCA 2RK2A 3CPWS 1N9RA 1Q7YR 2ZPHB 1KQ2A 4V2SA 4HA8A 2HL3A 3PT9A 1R0BG 3LYIA 4DA4A 4M7AG 2L8DA 4M77E 4CC4B 4BE1A 2KE9A 4BACA 1AWJA 1YNZA 3VS7A 1KC8R 1NE8A 3CCMT 1X27A 3RBBB 3CD6A 2ZCFB 3OS5A 2CZ1B 3META 1ZSZA 5LJ5j 2RHUA 4J9BA 2K6DA 2YHTA 1WA7A 2QK0A 4XAXB 2OAWA 1YWPA 4XTVA 3CCEA 4M78C 2P4RA 3C0CA 2DFUA 3C4SA 1MUZA 2EPDA 1LVKA 4RG8A 2EBPA 1AOJA 2KY9A 4BY6C 1UUEA 1K9AA 2KI7A 1G3WA 5J3BA 3DB3A 4FYWB 2EGAA 4FM4B 4EMKA 2I0NA 2L3SA 1SPKA 1H641 4Z88A 3VKIA 5DM7R 1UE9A 5LJ3d 1JXMA 1S1NA 4CRIA 4IIMA 4M75B 3CC2A 4ESRA 1WYXA 2GCXA 3A8LB 5KCOA 2M02A 5A0GA 2O01E 1UGRB 4N4HA 1IHVA 4OGEA 1PG5B 3VS5A 1M3AA 1JXOA 1AWOA 3KFVA 2JXBA 1KD1R 3X24B 1BK2A 5GAOm 2NLUA 3M0TA 1K4US 4RCCA 1VIEA 5LL6S 4P5NA 1RABB 4M75D 2ZPEB 3MKDA 4HCZA 4XTUA 3V8KA 3TU4K 2AKKA 2F5KA 2ED1A 3H41A 3EFOB 1WHMA 3RKXA 2Y4XA 4M77A 4KH1B 2X35A 1XJWB 1K8AU 1Y96B 4OMQA 2VUBA 1TU0B 2Y90A 1BIBA 1U1SA 2RQVA 2AIRB 2GQIA 3S3MA 2DL8A 5FLXE 4GY5A 3GLXA 1YHQQ 4PJJA 2MAMA 2LCSA 1YP5A 2H3EB 3MEWA 3OYKA 2OTLA 4J9IA 1WLPB 4OMFB 5LJ5h 3PVQA 5GAOq 3RNJA 1PSFA 1RAHB 4HKEA 3OYNA 2D0QB 1KQSP 3G71A 1C1AA 4AMCA 2DZ9A 4MZTA 3JCMe 4NOYA 1WHGA 1WQWA 4M78B 2L3PA 1AHJB 1NEBA 3CMAA 4PJOC 1SHGA 1LPLA 4BY6B 2EYQA 3U23A 4ANJA 1B3QA 4MMLA 3QZ9B 2JMCA 1YI2Q 1IZ6A 1FXXA 4C8QB 2CREA 1N5ZA 2I2LA 3LWIA 4PFOA 7AT1B 1RUWA 4IUVA 4BUGA 5LJ3f 1YHQT 4HCKA 4JZ4A 1BCMA 4LXCA 2DF6A 5I11A 2MIOA 4AG1C 1Z9ZA 4M78D 3RKYA 1ARKA 2FRYA 2NUZA 2YXYA 4Y28E 4M7AF 1RLPC 2M0YA 1JEGA 2JJ9A 4QQ6A 4PFPA 5IHKA 4F7UB 2HSPA 3UWNA 2C06A 3QXEB 3E9FA 4DOVA 3OW2S 1Q86U 2DEUA 3CCRQ 2ZPGB 2FEIA 3BW1A 3BDLA 2VYTA 1G8XA 2DRKA 2KR3A 2YWWA 2YLBA 4EMGA 4M7DE 1Y57A 5HCKA 1H3HA 2OAUA 1X43A 1YI2T 2KQWA 2JN0A 1AWXA 2LJ3A 5CO7A 3JB9J 1N8RU 3VU3C 3H9NA 2DYIA 4BI3A 4LE9A 4PLLA 4ZGJB 3OYJA 3NTIA 3ZFJA 3JB9D 3CCJA 3R6OA 4MZPA 3L2UA 2E3HA 4QVDA 2X9HA 1GCPA 1ABQA 2FL7A 4JRPA 4WCIA 1YN8A 3HRSA 2FRWA 2P0QA 4C5IA 1QKWA 2HQXA 1NG2A 2AZSA 2DILA 3UT1A 2QTVA 4PL6A 2FYKA 2K7AA 4F7UG 1WGSA 1WXUA 2SEMA 2QA4A 1Y7XA 2XDPA 4PJOB 1VQPA 3LH0A 5LJ5d 2QASA 4QKUA 4Z8AA 4IUQA 3EHRA 2DJQA 3CC4Q 1QVPA 1Q86C 4O5VA 4B9WA 1AD5A 1WHHA 4Z02A 2NUPA 1S72Q 3HL8A 2F2XA 2DNUA 1VQ8A 5D7UA 3X20B 1F1BB 1OPLA 5GAMg 2HMAA 4E7IA 4M7DA 2J05A 4NL2A 3OYMA 3JRZA 4DBFA 1N8RC 1WJRA 4M75E 1KHIA 2XMFA 2HNIA 3EG3A 2E70A 3LGFA 1DJ7B 2KNBB 5GAN2 2XHCA 2E5QA 2KXDA 1H8KA 3X28B 2EQUA 3EGUA 4LD9K 4DBQA 1G2BA 3HRUA 3CC4T 1SSFA 2CS7A 3CCQA 1B7TA 1S72T 4ME7A 1JQQA 3QHSA 3CBOA 1I4K1 3CD6Q 3CCSA 5LJ3j 4C5HA 3NHNA 2RD1A 2A0FB 3FRNA 3L42A 4FW2A 1KJWA 4B9XA 1QVFS 3AHUA 3OYFA 2O2OA 3WXMB 1QVGP 5AYFA 4FT2A 1YIJQ 4FW1A 3CCEQ 4WF2A 1BI3A 2MPXC 1BB9A 4F17A 1M5Q1 1PWTA 1D3BB 4OB2B 3M0SA 1VYUA 1OX8A 2O4XA 2MOXA 2RHZA 4M7AC 2DL4A 2YLCA 5GMKe 2C0TA 1WIEA 3UA6A 1VQ7Q 3CC2Q 3OS0A 1PHTA 3REBB 2BTTA 2MWOA 2H3JA 1B34B 3JCMc 4C92F 4C0GA 1M90C 1W2BS 4CC3A 5KH6A 2CDTA 1X6BA 2DVEA 3TEEA 3MCAB 4M75A 5LJ5f 4L59A 3CD6T 1UHFA 1YJ9A 3JV3A 3DB4A 3CC7Q 4E2FB 4GLMA 4F04B 4M78E 4J9EA 1VQ6A 4PLIA 2YRCA 2JUFA 2O88A 1YIJT 3CCET 4ZGEB 2DE0X 2VGMA 3JCMJ 3UF4A 4J6XA 2EYZA 4X9DA 4JJNK 4C8QE 1K1ZA 2HSEB 1UHCA 5IN1A 5M9OA 5D6WA 1MMNA 4O6JA 4MMKA 1NPPA 1OOTA 3UATA 1K73U 4HVUA 4E6RA 1AWWA 1VQ7T 5KYWB 2L3QA 2MK5A 3CEYA 2DBKA 4RTWA 3CC2T 2E6ZA 2DXBA 2K9GA 3TREA 2RHIA 2J6FA 3EFSA 1I5LA 2MYSA 4BB7A 2XDBA 2ENMA 5HY6A 3E2UA 3JCMX 2CSQA 3CCLQ 5HK0A 4DQ2A 1E7OA 1Y07A 3OYIA 2E65A 2IPOB 2FPFA 3EG2A 3CC7T 5J39A 3RUXA 2HKNA 2CYZB 3G71Q 4ZTFA 4VUBA 3CCUA 1UGQB 4RTZA 4XTYA 3QIIA 3VYHB 1OI1A 2WACA 3WVDB 1GBRA 4PJLA 2M16A 2EKHA 3G4SA 4BI4A 2K3YA 3S3NA 2OX7A 2O31A 4FYVB 1Q95G 3CQTA 4ZNXA 3GBQA 1D0XA 4PKCC 4DEXA 4M7AB 4RUGA 2KYMA 1M90R 5GANg 2ECZA 5A0DA 4FSSA 2CP0A 4M78A 1NJIU 2RF0A 3OMCA 4BI8B 2B86A 4A4HA 3NGPA 2LQNA 1BI2A 1QCOA 3MP8A 1NPRA 3CMEA 5IXFA 3KXTA 2E12A 4C8QA 1OZ2A 3CCLT 3INZA 2DL7A 3SD4A 3ZBDA 2ATCB 1K73C 2CT3A 4FT4A 4J9CA 3S3OA 2XDDA 1MNDA 2RQRA 5IH2A 1M2OA 2DO3A 5AT1B 4BDYA 4X1VA 3JAME 1YJWQ 1B07A 2F69A 2QQBA 1VQ4A 4HVVA 4M7AD 3BFMA 2YDLA 2KRNA 3G71T 2NUTB 1NEGA 1AVZC 3HKSA 1GRIA 1M1KC 1X6GA 1I1JA 4C0DC 4PJOE 3M4YA 1LNXA 1SKUB 3OYEA 2C0IA 3PMTA 1AEYA 2JS0A 2X3XD 2PQWA 4IKFA 4JS5A 5IT9E 3OYDA 1VQMA 3MHXA 1IREB 1NLPC 1TUCA 4IUUA 2A37A 4RTVA 1RI0A 1PC0A 3SB2A 4J9HA 1WXTA 3A98A 2HQHA 2IG0A 1G3YA 3QO3A 1IGQA 1U1TA 4C92C 3UA7A 4Z89A 1V1CA 4J6YA 4LDYA 2A08A 2RI2A 2DVJA 3MEUA 5GJVB 1NJIC 1YJWT 4M77F 3MJXA 1OPKA 2RJFA 1RI9A 2CP6A 2EJFA 1ZUUA 1WQ7A 1NYGA 3PFSA 3SWNC 1VQLA 1WFWA 4GLKA 1VA7A 2PVGB 2E41A 4A53A 4FSXA 4FCYA 3I55Q 4J5YA 3QSUA 4MZMA 2C0OA 1RAAB 3CBMA 2V26A 4LN2A 1IO6A 1QVFA 1FMVA 1U06A 2KXCA 5DY9A 2A3LA 4X9CA 4QQDA 4OMLA 2RQUA 4QT7A 1K73R 4PJOA 2CP3A 2WSEE 2RJEA 3J81E 3S6WA 1VOMA 1KFZA 3PE0A 3J80E 1X69A 2LX7A 1VQOA 1C0MA 2LVMA 3JCMV 4XU3A 1WJQA 1QCNA 1M1KR 3JCMb 3A8GB 1KQSS 4LUDA 2OTJQ 1BBZA 3EFRA 2EWNA 1UEBA 3CXCP 4JLGA 5GAMj 5FWBA 3A8OB 4N4GA 4Y91A 1W2BA 2PU9B 4JS4A 1YCSB 2P0KA 1BYMA 4QQGA 1QCFA 3KUFA 2X4YA 1WZOA 4C0DB 2DZCA 3I55T 2DKGA 1I8FA 2DLPA 2D8HA 3M0QA 1OU9A 1LJOA 1WNLA 4HCBA 4XTXA 4OP0A 2XIDA 2X4WA 3G7ZA 8ATCB 3L2QA 3SFMA 2KRSA 2ZGWA 5LJ5e 1RAGB 1D1AA 1ZSGA 2JTMA 2QEXQ 3H6ZA 3VYGA 2YUQA 5I2SA 2X3WD 3PNWC 2QQRA 2KT8A 2HD0A 3FJ5A 4RKUE 1UGPB 4A4GA 1TUDA 1TOVA 1NJIR 2QQSA 1Q81U 4IUPA 2KBTA 4C92B 1YJNQ 1N6AA 1IXDA 1CKBA 2OTJT 1W70A 2EYWA 2J6OA 1MMDA 3GF5A 4BDZA 2EJGA 2LC4A 2CP7A 2LRQA 2JNGA 4PJNA 1MV3A 1ACMB 1VQKA 3SWNB 4EMKC 1NLOC 2FZKB 3MEAA 5A2QE 2V1QA 3GNFB 1D3BA 1WDXA 3G6EA 3M5AA 1AZEA 1CSKA 1M2VB 4N0AC 1I5OB 2CZ6B 1HK9A 4C92D 3RIRA 2QEXT 3QDFA 2XI9A 4IIOA 1UJ0A 1NM7A 1X2QA 2GQVA 2GGRA 2XKOC 2X4XA 1YCYA 3VS1A 1B34A 1FWZA 4EMHA 2LQ8A 4R0KA 1K8AC 4ORZA 5GMKi 1YJNT 3JCMh 2IVWA 3I9QA 2ZPIB 5GAMh 2BE7D 4E7KA 2M9UA 4MDXA 2A28A 5FU6C 4M7AE 3PIPA 1X6OA 2L5QA 1JBMA 4C92G 4E7ZA 5FRMA 2RJDA 3CCMA 1VYVA 4DBRA 1Q81C 2WSFE 3RDVA 2LNVA 1UB4A 4RTXA 2LJ1A 2PTKA 2JOYA 2R57A 2FVUA 2RJCA 3OB9A 2WSCE 2RHYA 4CI0C 2GNCA 1VIFA 3UPUA 4M7DF 5KYWA 1M27C 2LP5A 4LNPA 2NYSA 2F5TX 3EHQA 1R8OB 2F2VA 2LZ6B 3QWXX 3CPWA 3QKJA 1PD0A 3VS0A 1VQNQ 3CCVQ 1OEBA 2RO0A 3CCUQ 2D9TA 4A63B 1T3LA 4DBHA 4EIKA 2DETA 3E1SA 2ZAEA 4TVRA 2EYYA 1MNEA 1A0NB 4D6WA 5GAOn 3CCRT 1AZGB 3E9GA 1KQ1A 3REAB 2O9VA 2BUDA 4EMKB 3TVTA 2HQEA 2DA9A 2BZYA 1W1FA 4C0ZA 2QDYB 3FIFA 5GANj 5CKBA 2LQKA 1V76A 5GMKl 4M7AA 2LDMA 3M56A 1I0CA 1K8AR 3FDRA 2W0ZA 2CP2A 4JLIA 1SEMA 2DD4A 3JCMg 2AHJB 2LX9A 2MF2A 3M9QA 2YUPA 2KRMA 5CR2A 3CCVT 1QVGS 1VQNT 2ED0A 2Z0WA 2Y4YA 3CCUT 1AT1B 4JJCA 1PD1A 4C5GA 3TQ7P 2QGFB 3C95A 3GPLA 1Q81R 3PGGA 2G6FX 2BKDN 3THKA 5FU6B 5FW9A 2NUTA 5GAN5 3HFNA 4XTZA 1G3SA 2W10A 1YFNA 1K0XA 1VQMQ 1UJYA 3UDCA 4OB1B 3PVLA 2RN8A 2QI2A 3OBWA 3VUBA 1GL5A 1KQSA 2YUOA 3JCMd 3MEVA 2RH2A 2KK4A 5GAMd 3RERA 2COZA 2FG0A 3AT1B 3OBYA 3MP1A 2M1HA 4RTUA 5KYUB 1IB8A 1JJ2P 2R5MA 4JDSA 1RAEB 4JJBA 1YWOA 1D0ZA 2K3XA 2FO0A 2V8IA 3J7AF 3OS1A 2X4JA 5FROA 1UGVA 3EAEA 1MHNA 1YHQA 1BU1A 2YRDA 1SG5A 1M30A 2E1HA 3V7CA 2OI3A 1YITA 3BE3A 2JM9A 1EZZB 1FMWA 1VQMT 1Q86R 4E47A 2HAXA 5GANh 2DBMA 2P84A 2EIFA 4M77G 4C92E 3E19A 1V29B 1FYNA 4A4FA 3OYLA 3V8JA 3M58A 2DK3A 1HSQA 1KC8U 3GNGA 4D8DA 3Q1JA 3ZEHA 2P4TA 2K2MA 4JRKA 3URGA 1EIFA 1N8RR 5GMKh 2EVRA 3LW5E 1TXQA 2XK0A 5IAYA 3FC3A 1PSEA 4QW2A 4Q5WA 2E10A 2VXFA 4Y92A 4XTWA 2DTHA 4M78F 4EDUA 1JO8A 2HZYA 2LCLA 5LJ3e 4PNOA 2ZPBB 4A4KA 3HFOA 3EFOA 4C8QF 4BD3A 3P8DA 2VKNA 2FZGB 5DLOA 2HDAA 2D1XA 1LOJA 3A5ZB 1RAFB 1OYXA 1Y96A 3OW2A 1XNIA 1I81A 1RADB 2OTLQ 2H8HA 4F7UE 3JCMf 2EQIA 1QWFA 1UDLA 5GAMf 2R5AA 2PUKB 1KD1U 2DXUA 9ATCB 2HCKA 3I56A 4OGCA 3X26B 3VRZA 4L6V5 3M53A 1ZA2B 1N27A 3OSSC 1KK7A 1ABOA 1WHJA 5KYXB 1T3SA 2PUOB 4KULA 4ZGDB 4AG2C 2LCCA 1HJDA 3CMAQ 4J8OA 2JTFA 2ABLA 1KC8C 2VB6A 2DIGA 4RMOA 3N5BB 2JMAA 2HBWA 3HPWA 3G6EQ 2VGNA 4E7JA 3TSWA 1VYTA 1QP3A 1TWBA 2L89A 4IURA 1M3CA 3LLRA 3OY9A 1K9MU 3SWNA 2RQTA
chains in the Genus database with same CATH topology
2YUNA 1T0JA 5FWBA 3TSZA 1K76A 1AWXA 1YCSB 2KGTA 2CH4A 1QCFA 2LJ3A 1QKXA 1GCQC 1Y0MA 2KROA 3EG1A 2DLPA 2CT4A 2D8HA 2J7IA 3M0QA 4LE9A 2LJ0A 3NPFA 3SHWA 3M0PA 2OJ2A 1RLQC 3I5SA 2D0NA 2KRSA 1MV0B 5IXBA 2BZXA 4J9GA 1QWEA 1ZSGA 1ZUKA 2YSQA 1PKSA 4D8KA 2YUQA 2X3WD 3EG0A 2KT8A 1GCPA 1ABQA 4KRTA 3FJ5A 4WCIA 1YN8A 1TUDA 2FRWA 2KEAA 1QKWA 1NG2A 2AZSA 2DILA 2BZ8A 2KBTA 5IHIA 2K7AA 1WXUA 2SEMA 1CKBA 4J9FA 1W70A 1QLYA 2EYWA 2DRMA 2J6OA 5EC7A 1Z9QA 1GCQA 2EW3A 3H0FA 2F2WA 4Z8AA 2CUDA 3EHRA 4AFQC 2DJQA 1MV3A 2GTJA 3H0IA 2DM1A 3ZL7C 1AD5A 1ZBJA 2RQWA 1NLOC 2D8JA 2F2XA 2DNUA 1FMKA 2V1QA 1WDXA 3VS6A 3IQLA 1OPLA 1AZEA 1CSKA 2SRCA 1GBQA 4OMOA 5FWCA 1XOVA 2J05A 4IIOA 1UJ0A 2DMOA 1NM7A 1X2QA 2GTOA 2GGRA 1UTIA 2E5KA 3VS1A 3SEMA 2CSIA 1EFNA 4JZ3A 2XMFA 1UFFA 2J06A 4R0KA 2AK5A 4ORZA 1U5SA 1W6XA 3EG3A 4JJDA 2ROLA 5GJWB 2MCNA 2KNBB 3I9QA 4M4ZA 2DL3A 1UECA 2KXDA 1H8KA 2A28A 3NMZC 4J9DA 2GBQA 2RMOA 3EGUA 5IHNA 1G2BA 1E6GA 2EYXA 3O5ZA 1VYVA 3I5RA 1E6HA 1PKTA 1JQQA 1TG0A 2M51A 2QDLA 2LQWA 1CKAA 4RTXA 2IIMA 2LJ1A 2PTKA 3NHNA 1KJWA 4K11A 2O2OA 2ROTA 2GNCA 1BB9A 4F16A 1GFDA 4F17A 1PRLC 1M27C 1PWTA 2LP5A 4HVWA 2DYBA 4LNPA 3M0SA 4RTTA 1VYUA 3EHQA 3VRYA 2K3BA 2F2VA 4CC7A 2CH4W 4HXJA 2MOXA 2A36A 2FPDA 2EGCA 2DL4A 2RPNA 2L0AA 2LZ6B 3QWXX 2C0TA 2K79A 1WIEA 1KSWA 2NWMA 3VS0A 3UA6A 2DX1A 1OEBA 1K0SA 2AKLA 2VVKA 4A63B 4AFSC 1T3LA 1WXBA 1PHTA 1JU5C 4EIKA 3REBB 2BTTA 2EYYA 2KYBA 1A0NB 4CC3A 1I07A 2CDTA 1AZGB 1PNJA 1X6BA 1OV3A 2L2PA 1WI7A 1SRLA 3LH5A 1U3OA 1SHFA 3REAB 1GFCA 1UHFA 2O9VA 3JV3A 4AFZC 3TVTA 4GBQA 5I22A 4GLMA 1M3BA 2DA9A 4J9EA 2BZYA 1W1FA 2O88A 2DE0X 1SRMA 3H0HA 1I0CA 3UF4A 2EYZA 2JS2A 1K1ZA 2W0ZA 1SEMA 4AFUC 1UHCA 4CC4B 2DL5A 1OOTA 2KE9A 2YUPA 1AWJA 2KRMA 4HVUA 3UATA 4E6RA 2ED0A 2VWFA 1YNZA 3VS7A 1AWWA 2L3QA 1X27A 2DBKA 3RBBB 4RTWA 4JJCA 2K9GA 2EGEA 4J9BA 2J6FA 2K6DA 1WA7A 2G6FX 2OAWA 3THKA 2KT1A 3VS4A 2ENMA 1YWPA 5FW9A 1WX6A 2P4RA 3C0CA 1MUZA 2CSQA 2EPDA 1H92A 2W10A 1J3TA 1KIKA 1K0XA 2EBPA 1AOJA 1E7OA 2RNAA 1UUEA 2FPEA 1K9AA 2J6KA 2FPFA 1UJYA 3EG2A 2EGAA 3PVLA 2RN8A 2I0NA 2L3SA 1GL5A 1SPKA 2YUOA 4Z88A 4LUEA 1UE9A 1JXMA 2LMJA 4RTZA 1S1NA 4IIMA 4RTYA 3VS3A 2FG0A 4ESRA 1GBRA 1WYXA 2EKHA 4RTUA 1HD3A 2LNHB 3VS5A 2O31A 4JJBA 2JTEA 4OMMA 4F14A 2AZVA 1YWOA 1ZUYA 3CQTA 3GBQA 4ZNXA 1M3AA 1JXOA 4DEXA 1NYFA 4OMNA 1AWOA 4RUGA 2FO0A 3KFVA 2KYMA 2JXBA 2ECZA 1BK2A 4FSSA 1UGVA 2RF0A 2B86A 3M0TA 1K4US 1BU1A 1LCKA 3NGPA 2LQNA 1M30A 5IXFA 2OI3A 2AKKA 2ED1A 4DEYA 2JM9A 3H41A 1X2KA 2DL7A 2CT3A 4J9CA 2RQRA 5IH2A 4X1VA 1B07A 1ZLMA 2DBMA 4HVVA 2YDLA 2KRNA 1NEGA 4OMQA 1AVZC 1GRIA 1X6GA 1I1JA 1T0HA 1FYNA 2RQVA 2GQIA 2DL8A 4OMPA 1HSQA 2C0IA 1AEYA 2CUBA 4D8DA 2JS0A 2X3XD 2LCSA 2K2MA 1YP5A 5ECAA 4J9IA 2JM8A 1WLPB 2EVRA 3PVQA 3RNJA 1NLPC 1TUCA 2HEQA 1M8MA 2A37A 4Y92A 4RTVA 2PNIA 4J9HA 3QWYA 1JO8A 1WXTA 3A98A 2V1RA 2ESWA 3UA7A 4Z89A 1SSHA 1V1CA 2L3PA 1NEBA 1SHGA 2VKNA 2A08A 2DVJA 5GJVB 2HDAA 3U23A 1B3QA 1G83A 2D1XA 2JT4A 2JMCA 1OPKA 1RI9A 2CREA 1ZUUA 1N5ZA 3M0RA 1RUWA 1NYGA 2JW4A 1WFWA 1VA7A 2H8HA 1ZX6A 2EQIA 1QWFA 1UDLA 4HCKA 4JZ4A 2HCKA 2DF6A 2C0OA 5I11A 3M0UA 2MIOA 3VRZA 3R6NA 4AG1C 1Z9ZA 4CC2A 1PRMC 4LN2A 5L23A 2YT6A 3I35A 1ABOA 1IO6A 1ARKA 2O9SA 1T3SA 4AG2C 2FRYA 2NUZA 1U06A 1HJDA 2KXCA 1RLPC 2M0YA 1JEGA 4OMLA 2RQUA 4QT7A 5IHKA 2HSPA 2ABLA 2JMAA 2HBWA 1KFZA 3ULRB 3PE0A 1X69A 4JPBW 2LX7A 3TSWA 2FEIA 1VYTA 2DRKA 2KR3A 1M3CA 1Y57A 3VS2A 1UG1A 5HCKA 4LUDA 1H3HA 1BBZA 1X43A 2PZ1A 2RQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YUN A;  1T0J A;  5FWB A;  3TSZ A;  1K76 A;  1AWX A;  1YCS B;  2KGT A;  2CH4 A;  1QCF A;  2LJ3 A;  1QKX A;  1GCQ C;  1Y0M A;  2KRO A;  3EG1 A;  2DLP A;  2CT4 A;  2D8H A;  2J7I A;  3M0Q A;  4LE9 A;  2LJ0 A;  3NPF A;  3SHW A;  3M0P A;  2OJ2 A;  1RLQ C;  3I5S A;  2D0N A;  2KRS A;  1MV0 B;  5IXB A;  2BZX A;  4J9G A;  1QWE A;  1ZSG A;  1ZUK A;  2YSQ A;  1PKS A;  4D8K A;  2YUQ A;  2X3W D;  3EG0 A;  2KT8 A;  1GCP A;  1ABQ A;  4KRT A;  3FJ5 A;  4WCI A;  1YN8 A;  1TUD A;  2FRW A;  2KEA A;  1QKW A;  1NG2 A;  2AZS A;  2DIL A;  2BZ8 A;  2KBT A;  5IHI A;  2K7A A;  1WXU A;  2SEM A;  1CKB A;  4J9F A;  1W70 A;  1QLY A;  2EYW A;  2DRM A;  2J6O A;  5EC7 A;  1Z9Q A;  1GCQ A;  2EW3 A;  3H0F A;  2F2W A;  4Z8A A;  2CUD A;  3EHR A;  4AFQ C;  2DJQ A;  1MV3 A;  2GTJ A;  3H0I A;  2DM1 A;  3ZL7 C;  1AD5 A;  1ZBJ A;  2RQW A;  1NLO C;  2D8J A;  2F2X A;  2DNU A;  1FMK A;  2V1Q A;  1WDX A;  3VS6 A;  3IQL A;  1OPL A;  1AZE A;  1CSK A;  2SRC A;  1GBQ A;  4OMO A;  5FWC A;  1XOV A;  2J05 A;  4IIO A;  1UJ0 A;  2DMO A;  1NM7 A;  1X2Q A;  2GTO A;  2GGR A;  1UTI A;  2E5K A;  3VS1 A;  3SEM A;  2CSI A;  1EFN A;  4JZ3 A;  2XMF A;  1UFF A;  2J06 A;  4R0K A;  2AK5 A;  4ORZ A;  1U5S A;  1W6X A;  3EG3 A;  4JJD A;  2ROL A;  5GJW B;  2MCN A;  2KNB B;  3I9Q A;  4M4Z A;  2DL3 A;  1UEC A;  2KXD A;  1H8K A;  2A28 A;  3NMZ C;  4J9D A;  2GBQ A;  2RMO A;  3EGU A;  5IHN A;  1G2B A;  1E6G A;  2EYX A;  3O5Z A;  1VYV A;  3I5R A;  1E6H A;  1PKT A;  1JQQ A;  1TG0 A;  2M51 A;  2QDL A;  2LQW A;  1CKA A;  4RTX A;  2IIM A;  2LJ1 A;  2PTK A;  3NHN A;  1KJW A;  4K11 A;  2O2O A;  2ROT A;  2GNC A;  1BB9 A;  4F16 A;  1GFD A;  4F17 A;  1PRL C;  1M27 C;  1PWT A;  2LP5 A;  4HVW A;  2DYB A;  4LNP A;  3M0S A;  4RTT A;  1VYU A;  3EHQ A;  3VRY A;  2K3B A;  2F2V A;  4CC7 A;  2CH4 W;  4HXJ A;  2MOX A;  2A36 A;  2FPD A;  2EGC A;  2DL4 A;  2RPN A;  2L0A A;  2LZ6 B;  3QWX X;  2C0T A;  2K79 A;  1WIE A;  1KSW A;  2NWM A;  3VS0 A;  3UA6 A;  2DX1 A;  1OEB A;  1K0S A;  2AKL A;  2VVK A;  4A63 B;  4AFS C;  1T3L A;  1WXB A;  1PHT A;  1JU5 C;  4EIK A;  3REB B;  2BTT A;  2EYY A;  2KYB A;  1A0N B;  4CC3 A;  1I07 A;  2CDT A;  1AZG B;  1PNJ A;  1X6B A;  1OV3 A;  2L2P A;  1WI7 A;  1SRL A;  3LH5 A;  1U3O A;  1SHF A;  3REA B;  1GFC A;  1UHF A;  2O9V A;  3JV3 A;  4AFZ C;  3TVT A;  4GBQ A;  5I22 A;  4GLM A;  1M3B A;  2DA9 A;  4J9E A;  2BZY A;  1W1F A;  2O88 A;  2DE0 X;  1SRM A;  3H0H A;  1I0C A;  3UF4 A;  2EYZ A;  2JS2 A;  1K1Z A;  2W0Z A;  1SEM A;  4AFU C;  1UHC A;  4CC4 B;  2DL5 A;  1OOT A;  2KE9 A;  2YUP A;  1AWJ A;  2KRM A;  4HVU A;  3UAT A;  4E6R A;  2ED0 A;  2VWF A;  1YNZ A;  3VS7 A;  1AWW A;  2L3Q A;  1X27 A;  2DBK A;  3RBB B;  4RTW A;  4JJC A;  2K9G A;  2EGE A;  4J9B A;  2J6F A;  2K6D A;  1WA7 A;  2G6F X;  2OAW A;  3THK A;  2KT1 A;  3VS4 A;  2ENM A;  1YWP A;  5FW9 A;  1WX6 A;  2P4R A;  3C0C A;  1MUZ A;  2CSQ A;  2EPD A;  1H92 A;  2W10 A;  1J3T A;  1KIK A;  1K0X A;  2EBP A;  1AOJ A;  1E7O A;  2RNA A;  1UUE A;  2FPE A;  1K9A A;  2J6K A;  2FPF A;  1UJY A;  3EG2 A;  2EGA A;  3PVL A;  2RN8 A;  2I0N A;  2L3S A;  1GL5 A;  1SPK A;  2YUO A;  4Z88 A;  4LUE A;  1UE9 A;  1JXM A;  2LMJ A;  4RTZ A;  1S1N A;  4IIM A;  4RTY A;  3VS3 A;  2FG0 A;  4ESR A;  1GBR A;  1WYX A;  2EKH A;  4RTU A;  1HD3 A;  2LNH B;  3VS5 A;  2O31 A;  4JJB A;  2JTE A;  4OMM A;  4F14 A;  2AZV A;  1YWO A;  1ZUY A;  3CQT A;  3GBQ A;  4ZNX A;  1M3A A;  1JXO A;  4DEX A;  1NYF A;  4OMN A;  1AWO A;  4RUG A;  2FO0 A;  3KFV A;  2KYM A;  2JXB A;  2ECZ A;  1BK2 A;  4FSS A;  1UGV A;  2RF0 A;  2B86 A;  3M0T A;  1K4U S;  1BU1 A;  1LCK A;  3NGP A;  2LQN A;  1M30 A;  5IXF A;  2OI3 A;  2AKK A;  2ED1 A;  4DEY A;  2JM9 A;  3H41 A;  1X2K A;  2DL7 A;  2CT3 A;  4J9C A;  2RQR A;  5IH2 A;  4X1V A;  1B07 A;  1ZLM A;  2DBM A;  4HVV A;  2YDL A;  2KRN A;  1NEG A;  4OMQ A;  1AVZ C;  1GRI A;  1X6G A;  1I1J A;  1T0H A;  1FYN A;  2RQV A;  2GQI A;  2DL8 A;  4OMP A;  1HSQ A;  2C0I A;  1AEY A;  2CUB A;  4D8D A;  2JS0 A;  2X3X D;  2LCS A;  2K2M A;  1YP5 A;  5ECA A;  4J9I A;  2JM8 A;  1WLP B;  2EVR A;  3PVQ A;  3RNJ A;  1NLP C;  1TUC A;  2HEQ A;  1M8M A;  2A37 A;  4Y92 A;  4RTV A;  2PNI A;  4J9H A;  3QWY A;  1JO8 A;  1WXT A;  3A98 A;  2V1R A;  2ESW A;  3UA7 A;  4Z89 A;  1SSH A;  1V1C A;  2L3P A;  1NEB A;  1SHG A;  2VKN A;  2A08 A;  2DVJ A;  5GJV B;  2HDA A;  3U23 A;  1B3Q A;  1G83 A;  2D1X A;  2JT4 A;  2JMC A;  1OPK A;  1RI9 A;  2CRE A;  1ZUU A;  1N5Z A;  3M0R A;  1RUW A;  1NYG A;  2JW4 A;  1WFW A;  1VA7 A;  2H8H A;  1ZX6 A;  2EQI A;  1QWF A;  1UDL A;  4HCK A;  4JZ4 A;  2HCK A;  2DF6 A;  2C0O A;  5I11 A;  3M0U A;  2MIO A;  3VRZ A;  3R6N A;  4AG1 C;  1Z9Z A;  4CC2 A;  1PRM C;  4LN2 A;  5L23 A;  2YT6 A;  3I35 A;  1ABO A;  1IO6 A;  1ARK A;  2O9S A;  1T3S A;  4AG2 C;  2FRY A;  2NUZ A;  1U06 A;  1HJD A;  2KXC A;  1RLP C;  2M0Y A;  1JEG A;  4OML A;  2RQU A;  4QT7 A;  5IHK A;  2HSP A;  2ABL A;  2JMA A;  2HBW A;  1KFZ A;  3ULR B;  3PE0 A;  1X69 A;  4JPB W;  2LX7 A;  3TSW A;  2FEI A;  1VYT A;  2DRK A;  2KR3 A;  1M3C A;  1Y57 A;  3VS2 A;  1UG1 A;  5HCK A;  4LUD A;  1H3H A;  1BBZ A;  1X43 A;  2PZ1 A;  2RQT A; 
#chains in the Genus database with same CATH topology
 2YUN A;  1T0J A;  4NS5 A;  5CVI A;  2RI5 A;  3M54 A;  1M2V A;  5HK3 A;  2OTL T;  2KGT A;  4N4I A;  2CH4 A;  2RHX A;  1QKX A;  1GCQ C;  3JCM Q;  2VAS A;  3EG1 A;  2CT4 A;  2CZ0 B;  2LJ0 A;  2XG8 D;  5GAN 7;  2OJ2 A;  1BCO A;  1RLQ C;  4E7S A;  1M8V A;  2BZX A;  3P8H A;  4ATO A;  5GAN d;  5KE2 A;  4D8K A;  3CMA T;  1QMC A;  2QAZ A;  2HL5 C;  1VQ9 A;  1PCX A;  3H8Z A;  4KRT A;  4OB0 B;  4F7U A;  1OUL A;  3V8L A;  3G6E T;  4PJO F;  2DPP B;  4R55 A;  3EGX B;  2FZC B;  1QVG A;  2M0O A;  3OMG A;  4M7D D;  2DRM A;  5EC7 A;  2VV5 A;  1D0Y A;  2E64 A;  5KYY B;  1D1C A;  3H0F A;  2F2W A;  3RMS A;  2CUD A;  3JCM P;  3BY7 A;  4AFQ C;  3CCJ Q;  1EX4 A;  3H0I A;  4ZTJ A;  3ZL7 C;  2DXT A;  1OZ3 A;  3A1P A;  5J26 A;  2G3R A;  1W4S A;  1HXD A;  3M55 A;  1K9M C;  1M4Z A;  3CXC S;  5LJ3 g;  2SRC A;  2CZ7 B;  1MGQ A;  4JRI A;  4OMO A;  5FWC A;  1XOV A;  1U8R A;  4PFZ A;  3VJP A;  2GTO A;  5GAO p;  4M7D G;  1UTI A;  2JVV A;  2QA4 Q;  2O4X B;  4UC4 A;  3HTR A;  1EFN A;  1UFF A;  1KG1 A;  2L3R A;  1YIJ A;  1VQP Q;  4LDW A;  3OS2 A;  1XQH A;  1Y71 A;  1H3Z A;  3L1A A;  2KSS A;  4JJD A;  5CQY A;  1WHK A;  3M59 A;  2ROL A;  1M1G A;  2K57 A;  5GJW B;  4M4Z A;  4OVA A;  5KCH A;  3P8B B;  5GAO l;  4C8Q C;  1VQ8 Q;  2DEQ A;  4J9D A;  1MMG A;  4QVC A;  3CPW P;  4XQ3 A;  3RR6 A;  2GBQ A;  5CKE A;  3JB9 H;  3QUI A;  2RMO A;  5CQX A;  1TTH B;  4LDX A;  2HBP A;  5IHN A;  2PVO B;  1JB0 E;  1E6G A;  2XU8 A;  3NFC A;  3O5Z A;  4ZN1 A;  1VQ7 A;  4LD6 A;  3CCJ T;  3MPU B;  4N0A A;  2COY A;  4QVZ A;  2M51 A;  2QDL A;  1GXI E;  5FRN A;  3C12 A;  1IGU A;  3BDU A;  1CKA A;  2IIM A;  2DD5 A;  3ER0 A;  3L2Z A;  2COW A;  1O75 A;  2XIC A;  2ROT A;  3EG9 B;  4KBM B;  1RAC B;  1GFD A;  1PRL C;  3CC7 A;  3EGD B;  4HVW A;  4ELZ C;  2DYB A;  2QA4 T;  4RTT A;  1WJS A;  3JB9 I;  4CC7 A;  5GAN f;  2FPD A;  2EGC A;  3O8V A;  1VQP T;  2YRV A;  3PIO A;  2GFA A;  5C0M A;  2AT1 B;  5C6S A;  2E3I A;  3A8H B;  3OYH A;  1K0S A;  2AKL A;  4AFS C;  1WXB A;  4FL6 A;  4NL3 A;  3CCQ Q;  2GF7 A;  4RCB A;  2KYB A;  1VQ8 T;  3CCS Q;  2DTO A;  1G5V A;  1TS9 A;  3FLG A;  1RL2 A;  4PK4 A;  4DOW A;  4HT9 A;  1K9M R;  2DXC A;  1OQK A;  2L2P A;  1WI7 A;  2DER A;  1SRL A;  1ZSZ C;  3LH5 A;  1U3O A;  3ASK A;  1QQJ A;  1GFC A;  4KT0 E;  2K2V A;  4AFZ C;  5KYU A;  1WPY A;  4GBQ A;  5I22 A;  1M3B A;  2DJZ A;  3QYH B;  4M75 G;  3CCL A;  4ZN3 A;  1VQ5 A;  1YIT Q;  1SRM A;  3H0H A;  4FU6 A;  2JS2 A;  5GAN 4;  5CAI A;  4AFU C;  2D6F A;  2VXE A;  3GOX A;  5CK9 A;  2DL5 A;  2VWF A;  5GAM e;  4KGZ B;  3DLL A;  5EG2 A;  3ME9 A;  3CCQ T;  3QPH A;  2EGE A;  5L8R E;  3CCS T;  1YJ9 Q;  1ZBX A;  3VS4 A;  2KT1 A;  3NTH A;  5CKF A;  3QZ5 B;  1WX6 A;  1VQ6 Q;  1H92 A;  2EAY A;  3PMI A;  2CKK A;  3HP9 A;  1J3T A;  1KIK A;  5HKC A;  4IUT A;  5KE3 A;  2RNA A;  3M4G A;  4FIB A;  4ELY C;  2FPE A;  2J6K A;  1X01 A;  3F70 A;  4FYY B;  1PM3 A;  3JCM W;  5GAO r;  1BKB A;  4LUE A;  2EJ9 A;  1R77 A;  4M77 C;  2LMJ A;  1TUG B;  2EKO A;  1YIT T;  1R0C B;  4RTY A;  3VS3 A;  2P0P A;  2EQM A;  3OYY A;  1YJW A;  3M57 A;  1HD3 A;  2LNH B;  3HHT B;  4C8Q D;  2JTE A;  4OMM A;  4F14 A;  2AZV A;  1ZUY A;  5GAN 3;  1C6V X;  1NYF A;  3G1J A;  4OMN A;  5GAN 8;  2RK1 A;  2HKQ B;  4AT1 B;  4PJM A;  2EQK A;  3FJP A;  2KDS A;  1LCK A;  1YJ9 T;  5A0L A;  4M78 G;  3I56 Q;  1VQ6 T;  1ZA1 B;  4DEY A;  3QG1 A;  1X2K A;  1ZQ1 A;  2LT1 A;  2MI6 A;  1ZSZ B;  4JRQ A;  4C8Q G;  3G4S Q;  1XTD A;  2K5F A;  5LJ5 g;  1ZLM A;  4OB3 B;  3VUZ A;  1T0H A;  3FEO A;  4J83 A;  5KYX A;  4OMP A;  3PTA A;  2CUB A;  3LX7 A;  2DIQ A;  2X51 A;  3OYB A;  3QJ6 A;  3HRT A;  3TCJ A;  3OW2 P;  3CME Q;  5ECA A;  3CXC A;  5D6Y A;  4LDV A;  2JM8 A;  1G3T A;  2KAF A;  1Q82 U;  3I55 A;  2HEQ A;  1M8M A;  4B6M A;  1JJ2 S;  4J7I A;  3L2V A;  2PNI A;  3QWY A;  3I56 T;  2V1R A;  2MWP A;  1VQ4 Q;  2ESW A;  3JB9 G;  2QQ9 A;  4LDU A;  3QJY A;  4II1 A;  1SSH A;  1D1B A;  3D7S B;  3GIB A;  2QXF A;  5GMK j;  3G4S T;  2XD0 A;  5I2M A;  3RKW A;  1G83 A;  3LGL A;  1VQ9 Q;  2JT4 A;  5GMK m;  6AT1 B;  1P92 A;  1QP2 A;  3M0R A;  2JW4 A;  3NTK A;  4M77 B;  4BE0 A;  4KUI A;  2ZPF B;  2K5I A;  4PJO D;  1ZX6 A;  2OTJ A;  3QDR B;  1M90 U;  4M75 F;  4JUV A;  1NZ9 A;  3M0U A;  5FU7 C;  3R6N A;  4CC2 A;  3CME T;  1PRM C;  3MO8 A;  5L23 A;  2YT6 A;  3I35 A;  2A7Y A;  2O9S A;  3EGX A;  1X75 C;  5DLQ E;  4XU0 A;  1KHC A;  2E4H A;  2R58 A;  3KBG A;  3T9N A;  1VQ4 T;  3CBP A;  4M77 D;  5KYY A;  1NBE B;  1TSF A;  3ULR B;  4A4E A;  4KGX B;  2QEX A;  4JPB W;  2JZ2 A;  1QW1 A;  2E6N A;  4PJO G;  1VQL Q;  3MP6 A;  5CCA A;  8AT1 B;  5GAN e;  3VS2 A;  2KVQ G;  1UG1 A;  1Q82 C;  4J6W A;  1VQ9 T;  2QGG A;  2PZ1 A;  3OYG A;  5GAN 6;  4KH0 B;  3QYG B;  1O9S A;  2V8K A;  3TSZ A;  3X25 B;  3C94 A;  4MDW A;  1K76 A;  1YJN A;  2RM4 A;  2BIV A;  4BE2 A;  1Q7Y U;  3L2R A;  1Y0M A;  1VUB A;  2KRO A;  2J7I A;  3NPF A;  3SHW A;  3M0P A;  3I5S A;  2D0N A;  1MV0 B;  4E7H A;  5IXB A;  4J9G A;  1QWE A;  1ZUK A;  2YSQ A;  3QBY A;  1VQO Q;  1PKS A;  1UGS B;  3JSC A;  1ZHI A;  3EG0 A;  1YI2 A;  4M7D C;  1TH7 A;  2CGH A;  1BIA A;  4YTL A;  2CP5 A;  2KEA A;  3FB9 A;  4HT8 A;  1M1F A;  4E7L A;  2BZ8 A;  1VQL T;  5IHI A;  1RAI B;  2DAQ A;  4J9F A;  2FB7 A;  3OYA A;  1QLY A;  2BE9 B;  1Z9Q A;  1GCQ A;  3OA6 A;  2LTO A;  2QYZ A;  1WHL A;  2EFI A;  2EW3 A;  1QVF P;  1BI1 A;  4FYX B;  5I21 A;  2GTJ A;  3EG9 A;  2DM1 A;  1ZBJ A;  2RQW A;  2D8J A;  4X34 A;  1FMK A;  3EGD A;  3RES A;  3VS6 A;  3IQL A;  2GFU A;  1YBY A;  3CCR A;  1M9S A;  3EH1 A;  1GBQ A;  5FU7 B;  2DTI A;  1VQO T;  2QTX A;  2PVD B;  2RB6 A;  4OF1 A;  4RG2 A;  2DMO A;  3V7R A;  2EQJ A;  1Q7Y C;  2RA2 A;  1BI0 A;  2E5K A;  4KGV B;  3SEM A;  2CSI A;  3EH2 A;  5CKD A;  4JZ3 A;  1W2B P;  2B8A A;  1M1K U;  2J06 A;  1Q82 R;  3OQ5 A;  2AK5 A;  1U5S A;  1W6X A;  3OSV A;  4C0F A;  4F7U F;  5CIU A;  1VQ5 Q;  5LJ3 h;  2MCN A;  4C92 A;  2MMP A;  2DL3 A;  1UEC A;  2QG9 B;  1VQK Q;  1MMA A;  1FX7 A;  3JB9 F;  2V8J A;  3NMZ C;  2LT4 A;  2FHD A;  4C5E A;  1VQN A;  3CCV A;  2EYX A;  2KMT A;  5CKH A;  4XU2 A;  1N9S A;  3I5R A;  2RI3 A;  1E6H A;  1PKT A;  1TG0 A;  3DLM A;  2LQW A;  3OYC A;  4J7F A;  1IRX A;  3DKM A;  2F1L A;  2VC8 A;  3VV0 A;  4K11 A;  4M75 C;  3GP8 A;  4XK8 E;  3HSB A;  2NUP B;  1D09 B;  4F16 A;  1JRI A;  5D6X A;  1HYO A;  2K4Y A;  3VRY A;  2K3B A;  1OU8 A;  4KUD K;  1SF9 A;  2CH4 W;  4HXJ A;  2A36 A;  4M7D B;  2RPN A;  2L0A A;  4WTO B;  2K79 A;  3CC4 A;  1KSW A;  4L5G A;  3SDZ A;  2NWM A;  3WVE B;  2DX1 A;  1S72 A;  1VQ5 T;  3L2W A;  3V7S A;  4A54 A;  2VVK A;  3CCM Q;  1JU5 C;  2K5L A;  1VQK T;  3A8M B;  3LWH A;  2ZZD A;  1KD1 C;  1JJ2 A;  1OX9 A;  4R56 A;  3RMQ A;  1I07 A;  1PNJ A;  1OV3 A;  1IHW A;  3CPF A;  4XU1 A;  1SHF A;  4HCC A;  2QQA A;  5KYN A;  4EPC A;  2RK2 A;  3CPW S;  1N9R A;  1Q7Y R;  2ZPH B;  1KQ2 A;  4V2S A;  4HA8 A;  2HL3 A;  3PT9 A;  1R0B G;  3LYI A;  4DA4 A;  4M7A G;  2L8D A;  4M77 E;  4CC4 B;  4BE1 A;  2KE9 A;  4BAC A;  1AWJ A;  1YNZ A;  3VS7 A;  1KC8 R;  1NE8 A;  3CCM T;  1X27 A;  3RBB B;  3CD6 A;  2ZCF B;  3OS5 A;  2CZ1 B;  3MET A;  1ZSZ A;  5LJ5 j;  2RHU A;  4J9B A;  2K6D A;  2YHT A;  1WA7 A;  2QK0 A;  4XAX B;  2OAW A;  1YWP A;  4XTV A;  3CCE A;  4M78 C;  2P4R A;  3C0C A;  2DFU A;  3C4S A;  1MUZ A;  2EPD A;  1LVK A;  4RG8 A;  2EBP A;  1AOJ A;  2KY9 A;  4BY6 C;  1UUE A;  1K9A A;  2KI7 A;  1G3W A;  5J3B A;  3DB3 A;  4FYW B;  2EGA A;  4FM4 B;  4EMK A;  2I0N A;  2L3S A;  1SPK A;  1H64 1;  4Z88 A;  3VKI A;  5DM7 R;  1UE9 A;  5LJ3 d;  1JXM A;  1S1N A;  4CRI A;  4IIM A;  4M75 B;  3CC2 A;  4ESR A;  1WYX A;  2GCX A;  3A8L B;  5KCO A;  2M02 A;  5A0G A;  2O01 E;  1UGR B;  4N4H A;  1IHV A;  4OGE A;  1PG5 B;  3VS5 A;  1M3A A;  1JXO A;  1AWO A;  3KFV A;  2JXB A;  1KD1 R;  3X24 B;  1BK2 A;  5GAO m;  2NLU A;  3M0T A;  1K4U S;  4RCC A;  1VIE A;  5LL6 S;  4P5N A;  1RAB B;  4M75 D;  2ZPE B;  3MKD A;  4HCZ A;  4XTU A;  3V8K A;  3TU4 K;  2AKK A;  2F5K A;  2ED1 A;  3H41 A;  3EFO B;  1WHM A;  3RKX A;  2Y4X A;  4M77 A;  4KH1 B;  2X35 A;  1XJW B;  1K8A U;  1Y96 B;  4OMQ A;  2VUB A;  1TU0 B;  2Y90 A;  1BIB A;  1U1S A;  2RQV A;  2AIR B;  2GQI A;  3S3M A;  2DL8 A;  5FLX E;  4GY5 A;  3GLX A;  1YHQ Q;  4PJJ A;  2MAM A;  2LCS A;  1YP5 A;  2H3E B;  3MEW A;  3OYK A;  2OTL A;  4J9I A;  1WLP B;  4OMF B;  5LJ5 h;  3PVQ A;  5GAO q;  3RNJ A;  1PSF A;  1RAH B;  4HKE A;  3OYN A;  2D0Q B;  1KQS P;  3G71 A;  1C1A A;  4AMC A;  2DZ9 A;  4MZT A;  3JCM e;  4NOY A;  1WHG A;  1WQW A;  4M78 B;  2L3P A;  1AHJ B;  1NEB A;  3CMA A;  4PJO C;  1SHG A;  1LPL A;  4BY6 B;  2EYQ A;  3U23 A;  4ANJ A;  1B3Q A;  4MML A;  3QZ9 B;  2JMC A;  1YI2 Q;  1IZ6 A;  1FXX A;  4C8Q B;  2CRE A;  1N5Z A;  2I2L A;  3LWI A;  4PFO A;  7AT1 B;  1RUW A;  4IUV A;  4BUG A;  5LJ3 f;  1YHQ T;  4HCK A;  4JZ4 A;  1BCM A;  4LXC A;  2DF6 A;  5I11 A;  2MIO A;  4AG1 C;  1Z9Z A;  4M78 D;  3RKY A;  1ARK A;  2FRY A;  2NUZ A;  2YXY A;  4Y28 E;  4M7A F;  1RLP C;  2M0Y A;  1JEG A;  2JJ9 A;  4QQ6 A;  4PFP A;  5IHK A;  4F7U B;  2HSP A;  3UWN A;  2C06 A;  3QXE B;  3E9F A;  4DOV A;  3OW2 S;  1Q86 U;  2DEU A;  3CCR Q;  2ZPG B;  2FEI A;  3BW1 A;  3BDL A;  2VYT A;  1G8X A;  2DRK A;  2KR3 A;  2YWW A;  2YLB A;  4EMG A;  4M7D E;  1Y57 A;  5HCK A;  1H3H A;  2OAU A;  1X43 A;  1YI2 T;  2KQW A;  2JN0 A;  1AWX A;  2LJ3 A;  5CO7 A;  3JB9 J;  1N8R U;  3VU3 C;  3H9N A;  2DYI A;  4BI3 A;  4LE9 A;  4PLL A;  4ZGJ B;  3OYJ A;  3NTI A;  3ZFJ A;  3JB9 D;  3CCJ A;  3R6O A;  4MZP A;  3L2U A;  2E3H A;  4QVD A;  2X9H A;  1GCP A;  1ABQ A;  2FL7 A;  4JRP A;  4WCI A;  1YN8 A;  3HRS A;  2FRW A;  2P0Q A;  4C5I A;  1QKW A;  2HQX A;  1NG2 A;  2AZS A;  2DIL A;  3UT1 A;  2QTV A;  4PL6 A;  2FYK A;  2K7A A;  4F7U G;  1WGS A;  1WXU A;  2SEM A;  2QA4 A;  1Y7X A;  2XDP A;  4PJO B;  1VQP A;  3LH0 A;  5LJ5 d;  2QAS A;  4QKU A;  4Z8A A;  4IUQ A;  3EHR A;  2DJQ A;  3CC4 Q;  1QVP A;  1Q86 C;  4O5V A;  4B9W A;  1AD5 A;  1WHH A;  4Z02 A;  2NUP A;  1S72 Q;  3HL8 A;  2F2X A;  2DNU A;  1VQ8 A;  5D7U A;  3X20 B;  1F1B B;  1OPL A;  5GAM g;  2HMA A;  4E7I A;  4M7D A;  2J05 A;  4NL2 A;  3OYM A;  3JRZ A;  4DBF A;  1N8R C;  1WJR A;  4M75 E;  1KHI A;  2XMF A;  2HNI A;  3EG3 A;  2E70 A;  3LGF A;  1DJ7 B;  2KNB B;  5GAN 2;  2XHC A;  2E5Q A;  2KXD A;  1H8K A;  3X28 B;  2EQU A;  3EGU A;  4LD9 K;  4DBQ A;  1G2B A;  3HRU A;  3CC4 T;  1SSF A;  2CS7 A;  3CCQ A;  1B7T A;  1S72 T;  4ME7 A;  1JQQ A;  3QHS A;  3CBO A;  1I4K 1;  3CD6 Q;  3CCS A;  5LJ3 j;  4C5H A;  3NHN A;  2RD1 A;  2A0F B;  3FRN A;  3L42 A;  4FW2 A;  1KJW A;  4B9X A;  1QVF S;  3AHU A;  3OYF A;  2O2O A;  3WXM B;  1QVG P;  5AYF A;  4FT2 A;  1YIJ Q;  4FW1 A;  3CCE Q;  4WF2 A;  1BI3 A;  2MPX C;  1BB9 A;  4F17 A;  1M5Q 1;  1PWT A;  1D3B B;  4OB2 B;  3M0S A;  1VYU A;  1OX8 A;  2O4X A;  2MOX A;  2RHZ A;  4M7A C;  2DL4 A;  2YLC A;  5GMK e;  2C0T A;  1WIE A;  3UA6 A;  1VQ7 Q;  3CC2 Q;  3OS0 A;  1PHT A;  3REB B;  2BTT A;  2MWO A;  2H3J A;  1B34 B;  3JCM c;  4C92 F;  4C0G A;  1M90 C;  1W2B S;  4CC3 A;  5KH6 A;  2CDT A;  1X6B A;  2DVE A;  3TEE A;  3MCA B;  4M75 A;  5LJ5 f;  4L59 A;  3CD6 T;  1UHF A;  1YJ9 A;  3JV3 A;  3DB4 A;  3CC7 Q;  4E2F B;  4GLM A;  4F04 B;  4M78 E;  4J9E A;  1VQ6 A;  4PLI A;  2YRC A;  2JUF A;  2O88 A;  1YIJ T;  3CCE T;  4ZGE B;  2DE0 X;  2VGM A;  3JCM J;  3UF4 A;  4J6X A;  2EYZ A;  4X9D A;  4JJN K;  4C8Q E;  1K1Z A;  2HSE B;  1UHC A;  5IN1 A;  5M9O A;  5D6W A;  1MMN A;  4O6J A;  4MMK A;  1NPP A;  1OOT A;  3UAT A;  1K73 U;  4HVU A;  4E6R A;  1AWW A;  1VQ7 T;  5KYW B;  2L3Q A;  2MK5 A;  3CEY A;  2DBK A;  4RTW A;  3CC2 T;  2E6Z A;  2DXB A;  2K9G A;  3TRE A;  2RHI A;  2J6F A;  3EFS A;  1I5L A;  2MYS A;  4BB7 A;  2XDB A;  2ENM A;  5HY6 A;  3E2U A;  3JCM X;  2CSQ A;  3CCL Q;  5HK0 A;  4DQ2 A;  1E7O A;  1Y07 A;  3OYI A;  2E65 A;  2IPO B;  2FPF A;  3EG2 A;  3CC7 T;  5J39 A;  3RUX A;  2HKN A;  2CYZ B;  3G71 Q;  4ZTF A;  4VUB A;  3CCU A;  1UGQ B;  4RTZ A;  4XTY A;  3QII A;  3VYH B;  1OI1 A;  2WAC A;  3WVD B;  1GBR A;  4PJL A;  2M16 A;  2EKH A;  3G4S A;  4BI4 A;  2K3Y A;  3S3N A;  2OX7 A;  2O31 A;  4FYV B;  1Q95 G;  3CQT A;  4ZNX A;  3GBQ A;  1D0X A;  4PKC C;  4DEX A;  4M7A B;  4RUG A;  2KYM A;  1M90 R;  5GAN g;  2ECZ A;  5A0D A;  4FSS A;  2CP0 A;  4M78 A;  1NJI U;  2RF0 A;  3OMC A;  4BI8 B;  2B86 A;  4A4H A;  3NGP A;  2LQN A;  1BI2 A;  1QCO A;  3MP8 A;  1NPR A;  3CME A;  5IXF A;  3KXT A;  2E12 A;  4C8Q A;  1OZ2 A;  3CCL T;  3INZ A;  2DL7 A;  3SD4 A;  3ZBD A;  2ATC B;  1K73 C;  2CT3 A;  4FT4 A;  4J9C A;  3S3O A;  2XDD A;  1MND A;  2RQR A;  5IH2 A;  1M2O A;  2DO3 A;  5AT1 B;  4BDY A;  4X1V A;  3JAM E;  1YJW Q;  1B07 A;  2F69 A;  2QQB A;  1VQ4 A;  4HVV A;  4M7A D;  3BFM A;  2YDL A;  2KRN A;  3G71 T;  2NUT B;  1NEG A;  1AVZ C;  3HKS A;  1GRI A;  1M1K C;  1X6G A;  1I1J A;  4C0D C;  4PJO E;  3M4Y A;  1LNX A;  1SKU B;  3OYE A;  2C0I A;  3PMT A;  1AEY A;  2JS0 A;  2X3X D;  2PQW A;  4IKF A;  4JS5 A;  5IT9 E;  3OYD A;  1VQM A;  3MHX A;  1IRE B;  1NLP C;  1TUC A;  4IUU A;  2A37 A;  4RTV A;  1RI0 A;  1PC0 A;  3SB2 A;  4J9H A;  1WXT A;  3A98 A;  2HQH A;  2IG0 A;  1G3Y A;  3QO3 A;  1IGQ A;  1U1T A;  4C92 C;  3UA7 A;  4Z89 A;  1V1C A;  4J6Y A;  4LDY A;  2A08 A;  2RI2 A;  2DVJ A;  3MEU A;  5GJV B;  1NJI C;  1YJW T;  4M77 F;  3MJX A;  1OPK A;  2RJF A;  1RI9 A;  2CP6 A;  2EJF A;  1ZUU A;  1WQ7 A;  1NYG A;  3PFS A;  3SWN C;  1VQL A;  1WFW A;  4GLK A;  1VA7 A;  2PVG B;  2E41 A;  4A53 A;  4FSX A;  4FCY A;  3I55 Q;  4J5Y A;  3QSU A;  4MZM A;  2C0O A;  1RAA B;  3CBM A;  2V26 A;  4LN2 A;  1IO6 A;  1QVF A;  1FMV A;  1U06 A;  2KXC A;  5DY9 A;  2A3L A;  4X9C A;  4QQD A;  4OML A;  2RQU A;  4QT7 A;  1K73 R;  4PJO A;  2CP3 A;  2WSE E;  2RJE A;  3J81 E;  3S6W A;  1VOM A;  1KFZ A;  3PE0 A;  3J80 E;  1X69 A;  2LX7 A;  1VQO A;  1C0M A;  2LVM A;  3JCM V;  4XU3 A;  1WJQ A;  1QCN A;  1M1K R;  3JCM b;  3A8G B;  1KQS S;  4LUD A;  2OTJ Q;  1BBZ A;  3EFR A;  2EWN A;  1UEB A;  3CXC P;  4JLG A;  5GAM j;  5FWB A;  3A8O B;  4N4G A;  4Y91 A;  1W2B A;  2PU9 B;  4JS4 A;  1YCS B;  2P0K A;  1BYM A;  4QQG A;  1QCF A;  3KUF A;  2X4Y A;  1WZO A;  4C0D B;  2DZC A;  3I55 T;  2DKG A;  1I8F A;  2DLP A;  2D8H A;  3M0Q A;  1OU9 A;  1LJO A;  1WNL A;  4HCB A;  4XTX A;  4OP0 A;  2XID A;  2X4W A;  3G7Z A;  8ATC B;  3L2Q A;  3SFM A;  2KRS A;  2ZGW A;  5LJ5 e;  1RAG B;  1D1A A;  1ZSG A;  2JTM A;  2QEX Q;  3H6Z A;  3VYG A;  2YUQ A;  5I2S A;  2X3W D;  3PNW C;  2QQR A;  2KT8 A;  2HD0 A;  3FJ5 A;  4RKU E;  1UGP B;  4A4G A;  1TUD A;  1TOV A;  1NJI R;  2QQS A;  1Q81 U;  4IUP A;  2KBT A;  4C92 B;  1YJN Q;  1N6A A;  1IXD A;  1CKB A;  2OTJ T;  1W70 A;  2EYW A;  2J6O A;  1MMD A;  3GF5 A;  4BDZ A;  2EJG A;  2LC4 A;  2CP7 A;  2LRQ A;  2JNG A;  4PJN A;  1MV3 A;  1ACM B;  1VQK A;  3SWN B;  4EMK C;  1NLO C;  2FZK B;  3MEA A;  5A2Q E;  2V1Q A;  3GNF B;  1D3B A;  1WDX A;  3G6E A;  3M5A A;  1AZE A;  1CSK A;  1M2V B;  4N0A C;  1I5O B;  2CZ6 B;  1HK9 A;  4C92 D;  3RIR A;  2QEX T;  3QDF A;  2XI9 A;  4IIO A;  1UJ0 A;  1NM7 A;  1X2Q A;  2GQV A;  2GGR A;  2XKO C;  2X4X A;  1YCY A;  3VS1 A;  1B34 A;  1FWZ A;  4EMH A;  2LQ8 A;  4R0K A;  1K8A C;  4ORZ A;  5GMK i;  1YJN T;  3JCM h;  2IVW A;  3I9Q A;  2ZPI B;  5GAM h;  2BE7 D;  4E7K A;  2M9U A;  4MDX A;  2A28 A;  5FU6 C;  4M7A E;  3PIP A;  1X6O A;  2L5Q A;  1JBM A;  4C92 G;  4E7Z A;  5FRM A;  2RJD A;  3CCM A;  1VYV A;  4DBR A;  1Q81 C;  2WSF E;  3RDV A;  2LNV A;  1UB4 A;  4RTX A;  2LJ1 A;  2PTK A;  2JOY A;  2R57 A;  2FVU A;  2RJC A;  3OB9 A;  2WSC E;  2RHY A;  4CI0 C;  2GNC A;  1VIF A;  3UPU A;  4M7D F;  5KYW A;  1M27 C;  2LP5 A;  4LNP A;  2NYS A;  2F5T X;  3EHQ A;  1R8O B;  2F2V A;  2LZ6 B;  3QWX X;  3CPW A;  3QKJ A;  1PD0 A;  3VS0 A;  1VQN Q;  3CCV Q;  1OEB A;  2RO0 A;  3CCU Q;  2D9T A;  4A63 B;  1T3L A;  4DBH A;  4EIK A;  2DET A;  3E1S A;  2ZAE A;  4TVR A;  2EYY A;  1MNE A;  1A0N B;  4D6W A;  5GAO n;  3CCR T;  1AZG B;  3E9G A;  1KQ1 A;  3REA B;  2O9V A;  2BUD A;  4EMK B;  3TVT A;  2HQE A;  2DA9 A;  2BZY A;  1W1F A;  4C0Z A;  2QDY B;  3FIF A;  5GAN j;  5CKB A;  2LQK A;  1V76 A;  5GMK l;  4M7A A;  2LDM A;  3M56 A;  1I0C A;  1K8A R;  3FDR A;  2W0Z A;  2CP2 A;  4JLI A;  1SEM A;  2DD4 A;  3JCM g;  2AHJ B;  2LX9 A;  2MF2 A;  3M9Q A;  2YUP A;  2KRM A;  5CR2 A;  3CCV T;  1QVG S;  1VQN T;  2ED0 A;  2Z0W A;  2Y4Y A;  3CCU T;  1AT1 B;  4JJC A;  1PD1 A;  4C5G A;  3TQ7 P;  2QGF B;  3C95 A;  3GPL A;  1Q81 R;  3PGG A;  2G6F X;  2BKD N;  3THK A;  5FU6 B;  5FW9 A;  2NUT A;  5GAN 5;  3HFN A;  4XTZ A;  1G3S A;  2W10 A;  1YFN A;  1K0X A;  1VQM Q;  1UJY A;  3UDC A;  4OB1 B;  3PVL A;  2RN8 A;  2QI2 A;  3OBW A;  3VUB A;  1GL5 A;  1KQS A;  2YUO A;  3JCM d;  3MEV A;  2RH2 A;  2KK4 A;  5GAM d;  3RER A;  2COZ A;  2FG0 A;  3AT1 B;  3OBY A;  3MP1 A;  2M1H A;  4RTU A;  5KYU B;  1IB8 A;  1JJ2 P;  2R5M A;  4JDS A;  1RAE B;  4JJB A;  1YWO A;  1D0Z A;  2K3X A;  2FO0 A;  2V8I A;  3J7A F;  3OS1 A;  2X4J A;  5FRO A;  1UGV A;  3EAE A;  1MHN A;  1YHQ A;  1BU1 A;  2YRD A;  1SG5 A;  1M30 A;  2E1H A;  3V7C A;  2OI3 A;  1YIT A;  3BE3 A;  2JM9 A;  1EZZ B;  1FMW A;  1VQM T;  1Q86 R;  4E47 A;  2HAX A;  5GAN h;  2DBM A;  2P84 A;  2EIF A;  4M77 G;  4C92 E;  3E19 A;  1V29 B;  1FYN A;  4A4F A;  3OYL A;  3V8J A;  3M58 A;  2DK3 A;  1HSQ A;  1KC8 U;  3GNG A;  4D8D A;  3Q1J A;  3ZEH A;  2P4T A;  2K2M A;  4JRK A;  3URG A;  1EIF A;  1N8R R;  5GMK h;  2EVR A;  3LW5 E;  1TXQ A;  2XK0 A;  5IAY A;  3FC3 A;  1PSE A;  4QW2 A;  4Q5W A;  2E10 A;  2VXF A;  4Y92 A;  4XTW A;  2DTH A;  4M78 F;  4EDU A;  1JO8 A;  2HZY A;  2LCL A;  5LJ3 e;  4PNO A;  2ZPB B;  4A4K A;  3HFO A;  3EFO A;  4C8Q F;  4BD3 A;  3P8D A;  2VKN A;  2FZG B;  5DLO A;  2HDA A;  2D1X A;  1LOJ A;  3A5Z B;  1RAF B;  1OYX A;  1Y96 A;  3OW2 A;  1XNI A;  1I81 A;  1RAD B;  2OTL Q;  2H8H A;  4F7U E;  3JCM f;  2EQI A;  1QWF A;  1UDL A;  5GAM f;  2R5A A;  2PUK B;  1KD1 U;  2DXU A;  9ATC B;  2HCK A;  3I56 A;  4OGC A;  3X26 B;  3VRZ A;  4L6V 5;  3M53 A;  1ZA2 B;  1N27 A;  3OSS C;  1KK7 A;  1ABO A;  1WHJ A;  5KYX B;  1T3S A;  2PUO B;  4KUL A;  4ZGD B;  4AG2 C;  2LCC A;  1HJD A;  3CMA Q;  4J8O A;  2JTF A;  2ABL A;  1KC8 C;  2VB6 A;  2DIG A;  4RMO A;  3N5B B;  2JMA A;  2HBW A;  3HPW A;  3G6E Q;  2VGN A;  4E7J A;  3TSW A;  1VYT A;  1QP3 A;  1TWB A;  2L89 A;  4IUR A;  1M3C A;  3LLR A;  3OY9 A;  1K9M U;  3SWN A;  2RQT A; 
#chains in the Genus database with same CATH homology
 2YUN A;  1T0J A;  5FWB A;  3TSZ A;  1K76 A;  1AWX A;  1YCS B;  2KGT A;  2CH4 A;  1QCF A;  2LJ3 A;  1QKX A;  1GCQ C;  1Y0M A;  2KRO A;  3EG1 A;  2DLP A;  2CT4 A;  2D8H A;  2J7I A;  3M0Q A;  4LE9 A;  2LJ0 A;  3NPF A;  3SHW A;  3M0P A;  2OJ2 A;  1RLQ C;  3I5S A;  2D0N A;  2KRS A;  1MV0 B;  5IXB A;  2BZX A;  4J9G A;  1QWE A;  1ZSG A;  1ZUK A;  2YSQ A;  1PKS A;  4D8K A;  2YUQ A;  2X3W D;  3EG0 A;  2KT8 A;  1GCP A;  1ABQ A;  4KRT A;  3FJ5 A;  4WCI A;  1YN8 A;  1TUD A;  2FRW A;  2KEA A;  1QKW A;  1NG2 A;  2AZS A;  2DIL A;  2BZ8 A;  2KBT A;  5IHI A;  2K7A A;  1WXU A;  2SEM A;  1CKB A;  4J9F A;  1W70 A;  1QLY A;  2EYW A;  2DRM A;  2J6O A;  5EC7 A;  1Z9Q A;  1GCQ A;  2EW3 A;  3H0F A;  2F2W A;  4Z8A A;  2CUD A;  3EHR A;  4AFQ C;  2DJQ A;  1MV3 A;  2GTJ A;  3H0I A;  2DM1 A;  3ZL7 C;  1AD5 A;  1ZBJ A;  2RQW A;  1NLO C;  2D8J A;  2F2X A;  2DNU A;  1FMK A;  2V1Q A;  1WDX A;  3VS6 A;  3IQL A;  1OPL A;  1AZE A;  1CSK A;  2SRC A;  1GBQ A;  4OMO A;  5FWC A;  1XOV A;  2J05 A;  4IIO A;  1UJ0 A;  2DMO A;  1NM7 A;  1X2Q A;  2GTO A;  2GGR A;  1UTI A;  2E5K A;  3VS1 A;  3SEM A;  2CSI A;  1EFN A;  4JZ3 A;  2XMF A;  1UFF A;  2J06 A;  4R0K A;  2AK5 A;  4ORZ A;  1U5S A;  1W6X A;  3EG3 A;  4JJD A;  2ROL A;  5GJW B;  2MCN A;  2KNB B;  3I9Q A;  4M4Z A;  2DL3 A;  1UEC A;  2KXD A;  1H8K A;  2A28 A;  3NMZ C;  4J9D A;  2GBQ A;  2RMO A;  3EGU A;  5IHN A;  1G2B A;  1E6G A;  2EYX A;  3O5Z A;  1VYV A;  3I5R A;  1E6H A;  1PKT A;  1JQQ A;  1TG0 A;  2M51 A;  2QDL A;  2LQW A;  1CKA A;  4RTX A;  2IIM A;  2LJ1 A;  2PTK A;  3NHN A;  1KJW A;  4K11 A;  2O2O A;  2ROT A;  2GNC A;  1BB9 A;  4F16 A;  1GFD A;  4F17 A;  1PRL C;  1M27 C;  1PWT A;  2LP5 A;  4HVW A;  2DYB A;  4LNP A;  3M0S A;  4RTT A;  1VYU A;  3EHQ A;  3VRY A;  2K3B A;  2F2V A;  4CC7 A;  2CH4 W;  4HXJ A;  2MOX A;  2A36 A;  2FPD A;  2EGC A;  2DL4 A;  2RPN A;  2L0A A;  2LZ6 B;  3QWX X;  2C0T A;  2K79 A;  1WIE A;  1KSW A;  2NWM A;  3VS0 A;  3UA6 A;  2DX1 A;  1OEB A;  1K0S A;  2AKL A;  2VVK A;  4A63 B;  4AFS C;  1T3L A;  1WXB A;  1PHT A;  1JU5 C;  4EIK A;  3REB B;  2BTT A;  2EYY A;  2KYB A;  1A0N B;  4CC3 A;  1I07 A;  2CDT A;  1AZG B;  1PNJ A;  1X6B A;  1OV3 A;  2L2P A;  1WI7 A;  1SRL A;  3LH5 A;  1U3O A;  1SHF A;  3REA B;  1GFC A;  1UHF A;  2O9V A;  3JV3 A;  4AFZ C;  3TVT A;  4GBQ A;  5I22 A;  4GLM A;  1M3B A;  2DA9 A;  4J9E A;  2BZY A;  1W1F A;  2O88 A;  2DE0 X;  1SRM A;  3H0H A;  1I0C A;  3UF4 A;  2EYZ A;  2JS2 A;  1K1Z A;  2W0Z A;  1SEM A;  4AFU C;  1UHC A;  4CC4 B;  2DL5 A;  1OOT A;  2KE9 A;  2YUP A;  1AWJ A;  2KRM A;  4HVU A;  3UAT A;  4E6R A;  2ED0 A;  2VWF A;  1YNZ A;  3VS7 A;  1AWW A;  2L3Q A;  1X27 A;  2DBK A;  3RBB B;  4RTW A;  4JJC A;  2K9G A;  2EGE A;  4J9B A;  2J6F A;  2K6D A;  1WA7 A;  2G6F X;  2OAW A;  3THK A;  2KT1 A;  3VS4 A;  2ENM A;  1YWP A;  5FW9 A;  1WX6 A;  2P4R A;  3C0C A;  1MUZ A;  2CSQ A;  2EPD A;  1H92 A;  2W10 A;  1J3T A;  1KIK A;  1K0X A;  2EBP A;  1AOJ A;  1E7O A;  2RNA A;  1UUE A;  2FPE A;  1K9A A;  2J6K A;  2FPF A;  1UJY A;  3EG2 A;  2EGA A;  3PVL A;  2RN8 A;  2I0N A;  2L3S A;  1GL5 A;  1SPK A;  2YUO A;  4Z88 A;  4LUE A;  1UE9 A;  1JXM A;  2LMJ A;  4RTZ A;  1S1N A;  4IIM A;  4RTY A;  3VS3 A;  2FG0 A;  4ESR A;  1GBR A;  1WYX A;  2EKH A;  4RTU A;  1HD3 A;  2LNH B;  3VS5 A;  2O31 A;  4JJB A;  2JTE A;  4OMM A;  4F14 A;  2AZV A;  1YWO A;  1ZUY A;  3CQT A;  3GBQ A;  4ZNX A;  1M3A A;  1JXO A;  4DEX A;  1NYF A;  4OMN A;  1AWO A;  4RUG A;  2FO0 A;  3KFV A;  2KYM A;  2JXB A;  2ECZ A;  1BK2 A;  4FSS A;  1UGV A;  2RF0 A;  2B86 A;  3M0T A;  1K4U S;  1BU1 A;  1LCK A;  3NGP A;  2LQN A;  1M30 A;  5IXF A;  2OI3 A;  2AKK A;  2ED1 A;  4DEY A;  2JM9 A;  3H41 A;  1X2K A;  2DL7 A;  2CT3 A;  4J9C A;  2RQR A;  5IH2 A;  4X1V A;  1B07 A;  1ZLM A;  2DBM A;  4HVV A;  2YDL A;  2KRN A;  1NEG A;  4OMQ A;  1AVZ C;  1GRI A;  1X6G A;  1I1J A;  1T0H A;  1FYN A;  2RQV A;  2GQI A;  2DL8 A;  4OMP A;  1HSQ A;  2C0I A;  1AEY A;  2CUB A;  4D8D A;  2JS0 A;  2X3X D;  2LCS A;  2K2M A;  1YP5 A;  5ECA A;  4J9I A;  2JM8 A;  1WLP B;  2EVR A;  3PVQ A;  3RNJ A;  1NLP C;  1TUC A;  2HEQ A;  1M8M A;  2A37 A;  4Y92 A;  4RTV A;  2PNI A;  4J9H A;  3QWY A;  1JO8 A;  1WXT A;  3A98 A;  2V1R A;  2ESW A;  3UA7 A;  4Z89 A;  1SSH A;  1V1C A;  2L3P A;  1NEB A;  1SHG A;  2VKN A;  2A08 A;  2DVJ A;  5GJV B;  2HDA A;  3U23 A;  1B3Q A;  1G83 A;  2D1X A;  2JT4 A;  2JMC A;  1OPK A;  1RI9 A;  2CRE A;  1ZUU A;  1N5Z A;  3M0R A;  1RUW A;  1NYG A;  2JW4 A;  1WFW A;  1VA7 A;  2H8H A;  1ZX6 A;  2EQI A;  1QWF A;  1UDL A;  4HCK A;  4JZ4 A;  2HCK A;  2DF6 A;  2C0O A;  5I11 A;  3M0U A;  2MIO A;  3VRZ A;  3R6N A;  4AG1 C;  1Z9Z A;  4CC2 A;  1PRM C;  4LN2 A;  5L23 A;  2YT6 A;  3I35 A;  1ABO A;  1IO6 A;  1ARK A;  2O9S A;  1T3S A;  4AG2 C;  2FRY A;  2NUZ A;  1U06 A;  1HJD A;  2KXC A;  1RLP C;  2M0Y A;  1JEG A;  4OML A;  2RQU A;  4QT7 A;  5IHK A;  2HSP A;  2ABL A;  2JMA A;  2HBW A;  1KFZ A;  3ULR B;  3PE0 A;  1X69 A;  4JPB W;  2LX7 A;  3TSW A;  2FEI A;  1VYT A;  2DRK A;  2KR3 A;  1M3C A;  1Y57 A;  3VS2 A;  1UG1 A;  5HCK A;  4LUD A;  1H3H A;  1BBZ A;  1X43 A;  2PZ1 A;  2RQT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...