4RTYA

Crystal structure of the c-src-sh3 domain in complex with the high affinity peptide app12
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
58
structure length
58
Chain Sequence
MTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene tyrosine-protein kinase Src
publication title Crystal structure of the c-Src-SH3 domain in complex with the high affinity peptide APP12
rcsb
source organism Gallus gallus
molecule tags Protein binding
total genus 11
structure length 58
sequence length 58
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4rtyA00
2O9SA 4RTZA 3TSWA 1MV0B 2JS0A 3EHQA 2CT4A 4J9FA 1BU1A 1ARKA 2JTEA 2EGEA 2J6KA 5IH2A 2QDLA 3VS4A 2KR3A 2RQVA 3M0QA 1AWXA 2XMFA 2PNIA 2DBKA 4J9EA 2MOXA 4EIKA 3SEMA 4RTVA 4RTYA 1KIKA 2M0YA 2ED0A 2VWFA 5FW9A 4J9DA 2JT4A 1UFFA 2NUZA 2EYWA 1KFZA 1JQQA 1M3CA 1NG2A 4A63B 4WCIA 3EHRA 1GBRA 4JPBW 4JZ3A 1NEGA 1BK2A 1NYFA 4IIOA 1RLQC 1WDXA 2EVRA 1X2QA 4JJCA 2JMCA 2D8HA 1ZUYA 3VRZA 1X2KA 2P4RA 1JXOA 2LZ6B 1MV3A 2ED1A 5IHKA 1UDLA 2GQIA 2L3QA 4J9CA 3FJ5A 3TVTA 3VS7A 2DRKA 1SHGA 3NHNA 3ULRB 4R0KA 2YUPA 4J9HA 4ORZA 4JJBA 1B3QA 2ENMA 1AEYA 1M3AA 1B07A 2SRCA 1CKAA 1PNJA 1M3BA 2DX1A 2MIOA 2LJ0A 3M0UA 1WYXA 2AKKA 2B86A 2A08A 2KXCA 1TUDA 3IQLA 1EFNA 1JU5C 3UATA 2CH4A 4GLMA 2OAWA 2AKLA 4J9IA 2RN8A 2RPNA 3QWYA 4JZ4A 1HSQA 3NPFA 1W70A 3JV3A 4J9BA 1YCSB 2DF6A 1QWEA 2DLPA 3C0CA 1GBQA 1ZUUA 1SRMA 2O9VA 1J3TA 4M4ZA 2GTJA 2SEMA 1HJDA 1M30A 1YN8A 2PTKA 2HEQA 3A98A 2HCKA 4J9GA 1VYTA 1W6XA 2BTTA 1IO6A 2O31A 2ROTA 1W1FA 2O2OA 1CKBA 2VVKA 1S1NA 3UA6A 1AVZC 2J05A 1I0CA 2LX7A 2DRMA 1NM7A 1UTIA 4CC4B 2IIMA 2K3BA 1E7OA 1WXUA 2EKHA 2CUDA 2EYZA 2F2VA 1PHTA 1ZUKA 4HVVA 1YP5A 3CQTA 4F17A 2DILA 2YT6A 4CC2A 4F14A 1PKSA 4AFZC 1U5SA 2FRWA 2X3WD 1BB9A 1Z9QA 4GBQA 2CREA 2J6OA 4OMNA 1H3HA 1XOVA 1GCQA 2KRSA 2LJ1A 1YWOA 2RQUA 2VKNA 1GFCA 2ECZA 4LE9A 2A37A 3THKA 3REBB 1UHFA 1H92A 5IHIA 2L2PA 3VS0A 4LN2A 2LJ3A 2KRMA 4FSSA 2KGTA 1AD5A 3M0TA 1SSHA 1WXTA 2DM1A 1HD3A 4OMLA 2M51A 3M0RA 2FRYA 1GFDA 1X6GA 2JXBA 3VS5A 1GRIA 1JEGA 1OPKA 4OMPA 1G83A 2BZ8A 1K9AA 1RI9A 2GTOA 1I07A 2KBTA 1SRLA 1WFWA 1X69A 5IXFA 2JM9A 4HVUA 1RUWA 2DYBA 2J7IA 4ZNXA 3SHWA 1T0HA 2FEIA 4QT7A 2RQWA 1UGVA 2DA9A 2CT3A 4F16A 3RBBB 3LH5A 3PVQA 2KRNA 1CSKA 2OJ2A 5GJVB 1ZSGA 1K0SA 2GGRA 2DMOA 4Z89A 1BBZA 2FPDA 4CC7A 3O5ZA 2EYYA 1M8MA 1FYNA 1AZGB 1LCKA 3EG1A 2X3XD 4K11A 1SPKA 2V1QA 3EG2A 3NMZC 1WLPB 2LNHB 1T0JA 1AWWA 2DE0X 3EGUA 2RF0A 1PRLC 3PVLA 4RTUA 2YUQA 2FG0A 1AZEA 2KT8A 1OOTA 1YWPA 2CSIA 4OMMA 4OMOA 3PE0A 4RTTA 2YUNA 4AFSC 1GL5A 2DL4A 3H41A 3VS6A 2FPFA 4E6RA 2L0AA 1AWJA 1E6GA 2L3PA 4RUGA 2EQIA 1U06A 2RMOA 2YUOA 4HCKA 2H8HA 2GBQA 2FO0A 2C0IA 2CH4W 2GNCA 2RQTA 3EG0A 2AZVA 2ESWA 2C0TA 2D8JA 1NLPC 2W10A 4HVWA 4AFQC 3ZL7C 1UUEA 2EGCA 4LUDA 5ECAA 1WA7A 2CSQA 4Y92A 4X1VA 1UE9A 4CC3A 4RTXA 2RNAA 4LNPA 3M0SA 2JM8A 1MUZA 3VRYA 1G2BA 2I0NA 2LMJA 4HXJA 2KXDA 1KJWA 3EG3A 4IIMA 1OEBA 2A28A 4Z8AA 1FMKA 3REAB 3H0HA 2LCSA 1VYVA 2EW3A 2F2XA 1K4US 2KNBB 4OMQA 1RLPC 2LP5A 2CDTA 2KYBA 1WX6A 1QCFA 3VS3A 2AZSA 5EC7A 2LQNA 2DVJA 3U23A 1QWFA 2MCNA 2YDLA 4AFUC 1JO8A 2KROA 5FWBA 2J06A 2BZYA 4D8KA 2K2MA 1V1CA 1M27C 3KFVA 1Y0MA 2V1RA 2F2WA 1T3SA 2JMAA 2O88A 2KT1A 1K0XA 2NWMA 1WI7A 5IHNA 3I9QA 2D1XA 2CUBA 2RQRA 5GJWB 1OPLA 2D0NA 1E6HA 2EYXA 1UJYA 1Z9ZA 2K79A 2EGAA 2KYMA 1PWTA 1UECA 1UJ0A 1Y57A 2K7AA 2KE9A 3UF4A 1I1JA 5I11A 1QKWA 1X27A 3NGPA 5HCKA 5IXBA 2DJQA 2DNUA 4RTWA 1A0NB 4D8DA 5L23A 2W0ZA 2JW4A 2BZXA 5FWCA 2JS2A 1ZBJA 2LQWA 3GBQA 3I35A 2G6FX 5I22A 2EPDA 1VYUA 3I5RA 1ZLMA 4DEXA 2DBMA 2KEAA 1NLOC 1ZX6A 4DEYA 2E5KA 2HSPA 2YSQA 1K76A 1K1ZA 1VA7A 2AK5A 2EBPA 3R6NA 3RNJA 1WXBA 3H0IA 1YNZA 1GCQC 1TUCA 2OI3A 1AWOA 1NYGA 2ROLA 2L3SA 2K9GA 1PRMC 3I5SA 1NEBA 3M0PA 2PZ1A 1WIEA 4AG1C 4ESRA 2C0OA 1UG1A 4AG2C 1TG0A 1GCPA 1QKXA 4Z88A 2HDAA 4JJDA 3VS1A 2ABLA 2A36A 2K6DA 1QLYA 2J6FA 4KRTA 1U3OA 2FPEA 1X6BA 1T3LA 1UHCA 1OV3A 2DL3A 1AOJA 1N5ZA 3VS2A 4LUEA 1X43A 1SEMA 1SHFA 2DL5A 2HBWA 1KSWA 1ABQA 2DL7A 3QWXX 1JXMA 3TSZA 2DL8A 1PKTA 1H8KA 1ABOA 3UA7A 3H0FA
chains in the Genus database with same CATH superfamily
2Y4YA 4J7IA 3CCRQ 2O9SA 2E41A 1VQ8Q 3CPWA 3A1PA 2CT4A 4C92G 5IAYA 8AT1B 2LVMA 2EGEA 3WXMB 2J6KA 1GXIE 2HSEB 2JUFA 4M78A 3M0QA 1AWXA 5GANf 2EKOA 3SEMA 4RTYA 3NFCA 4M77A 5GMKe 1KK7A 2QGFB 2VWFA 1VQ7T 2RA2A 5FW9A 2QDYB 1VQPQ 3EFSA 5GAOn 3MJXA 2NUZA 4DOWA 3H9NA 4M75D 1JQQA 5GANe 1M3CA 4A63B 4WCIA 3D7SB 2XG8D 2YRDA 3EHRA 4Q5WA 1GBRA 4BY6B 1NEGA 2YLBA 1BK2A 4E47A 1Q82R 4IIOA 4CRIA 1RLQC 5KYUA 2RK2A 2EQUA 4C8QF 1JJ2P 3CD6Q 1X2QA 4QQGA 5CQXA 2D8HA 1TTHB 1ZBXA 2HD0A 3I56Q 3JAME 4M78B 2LZ6B 3QHSA 3QZ5B 1MV3A 2CYZB 4D6WA 1JRIA 4XTZA 1K73U 3FJ5A 4M77B 4N4HA 5LJ5j 2DRKA 4R0KA 3OW2S 4JJBA 2ENMA 7AT1B 1AEYA 3HL8A 1MGQA 3CCQQ 1M3BA 1OZ3A 4RCCA 2A08A 4C8QE 1TUDA 3V8JA 5CCAA 2BUDA 1OI1A 4GLMA 4J9IA 2RN8A 3MKDA 4PJLA 4FYVB 1W70A 4MDWA 2HZYA 4LDVA 4ANJA 3WVEB 4MZPA 2DLPA 1GBQA 1ZUUA 1ZSZA 2O9VA 3S3MA 1VIFA 3HSBA 2GTJA 4V2SA 5EG2A 3BW1A 3V7CA 1VQ9Q 2IPOB 1K9MU 2F5TX 1YN8A 4J6XA 2HEQA 2P0KA 4M7AG 2VXFA 1W6XA 3V7RA 1YI2Q 3BFMA 4PJOD 1W1FA 2O2OA 1YIJA 3CCJA 2QG9B 3PTAA 1W4SA 1X01A 3JB9D 1JJ2S 1D1CA 1AVZC 1RAIB 2I2LA 2JTFA 4JJNK 2QEXQ 3QDFA 2EAYA 1KHCA 2DRMA 3EFOA 3OYIA 1NM7A 4ELZC 1K8AR 2K3BA 1E7OA 2EKHA 2PUOB 2O01E 4A4FA 2OTJQ 1W2BA 2AHJB 1AHJB 1I5LA 2VB6A 2CREA 5GAMg 4MZTA 2XDDA 1MNEA 1WHJA 2LJ1A 1YFNA 1GFCA 1D0ZA 3EAEA 1YIJT 2MF2A 3CCJT 1VQNA 2V8IA 3LWHA 4M7DG 5FRMA 5CQYA 4LN2A 2LJ3A 2KGTA 4C5IA 1SSHA 2M02A 1WXTA 5D6XA 1HD3A 3EFOB 2M51A 1BI3A 3M4YA 5GAMj 3ER0A 2V8KA 1X6GA 2JXBA 3VS5A 2EQJA 3OS0A 4F7UA 1VQ6A 1OPKA 5GAN8 4HT8A 1WNLA 1K9AA 3CC2A 2O4XB 1WFWA 4VUBA 1VQLQ 2JM9A 3J81E 4HVUA 1WJQA 4BI4A 4KUDK 2Y90A 3LH0A 5LJ5h 3SHWA 3VJPA 1T0HA 5A2QE 1VQNT 1M2VA 4PFOA 1KD1R 3RKXA 5CK9A 4OF1A 2RQWA 2YWWA 1OX9A 1YBYA 3LH5A 1Q82C 3PVQA 3E2UA 5LJ5f 1O9SA 1YCYA 1K0SA 2KQWA 3TEEA 3SD4A 5CKHA 3HPWA 1S72Q 1MNDA 1M8MA 3CXCA 1LCKA 1V76A 2X3XD 1RADB 4K11A 3E9GA 2V1QA 2LNHB 5LJ5e 3NTHA 1VQMT 3EGUA 1PRLC 1NPPA 2H3EB 1H3ZA 4RTUA 3DB3A 1OOTA 1M2VB 4TVRA 4AFSC 1TU0B 3A5ZB 1VQKA 3L42A 1AWJA 2L0AA 3M53A 1U06A 2RMOA 3CCSQ 1JB0E 2H8HA 1I81A 2DYIA 2FO0A 2HL5C 3ZEHA 4M77E 2CH4W 1KQSA 2GNCA 2M1HA 1Q81R 3RDVA 2ESWA 2XU8A 2W10A 4M78D 5ECAA 2EJFA 1WA7A 1VIEA 4CC3A 3HRSA 4LNPA 4PFZA 3M0SA 1SSFA 3AHUA 1VQ5T 3VRYA 2LMJA 1IGQA 3EG3A 1KJWA 2CP5A 2NUPA 3PT9A 2L8DA 2A28A 2HKQB 1VQKT 2JZ2A 3ZFJA 2MMPA 5KCHA 3PFSA 5LJ3f 5KYWA 2KAFA 1RLPC 3OYNA 1WX6A 2AZSA 5EC7A 1KHIA 1MMAA 1NJIR 1U8RA 3ZBDA 2MCNA 2YDLA 5I2SA 1JO8A 5J39A 1V1CA 1M27C 1BIAA 2V1RA 1XJWB 2EJ9A 2F2WA 1T3SA 2JMAA 2JNGA 5GAMh 1K8AC 1QVFP 1D0XA 4C92C 3FIFA 2RQRA 3S3NA 3JB9I 2D0NA 1E6HA 1D3BA 2NUPB 4FU6A 2EGAA 3OS5A 3CCVQ 3M56A 4C0DC 2K7AA 3CC4Q 3UF4A 1I1JA 3QJYA 2K3YA 5KYWB 5CR2A 3META 3CCUQ 2IVWA 2AT1B 3OB9A 5CAIA 3JB9J 2DNUA 4PNOA 3P8BB 4C5EA 1N8RR 2A3LA 2LQWA 3I35A 1VQOA 2EPDA 3VU3C 4JRKA 2DIGA 4DEXA 2DBMA 4NS5A 2LDMA 4J8OA 1QCNA 1D3BB 1K1ZA 1YJNQ 2EBPA 5AT1B 2L5QA 1TUCA 2OI3A 3OSSC 1EX4A 1QVPA 1KD1C 3OY9A 3CCLT 2L3SA 2K9GA 4P5NA 4OB1B 3I5SA 1NEBA 4QVZA 2B8AA 1TG0A 1GCPA 4PLLA 1M2OA 1M1GA 4OP0A 4N4GA 1QVFS 2J6FA 5GANg 4FCYA 1PD1A 1X6BA 2EWNA 2MWPA 1T3LA 2DL3A 3LYIA 3CCMQ 5CIUA 4GLKA 1AOJA 3VS2A 1X43A 4ME7A 3V8LA 2HBWA 1ABQA 4FT4A 3QWXX 2D6FA 1I5OB 2X4YA 1ABOA 3CPWP 5GANj 3UA7A 3G71Q 2E3HA 3I55A 4PFPA 3G1JA 2DD5A 2JS0A 3G6EQ 3EHQA 5HKCA 4M7AC 1R77A 3RERA 3OYAA 1SG5A 2DXCA 1WHHA 2BE7D 2KR3A 2RQVA 2CZ1B 1Q81C 2XMFA 3RUXA 1UB4A 4RG2A 4JRQA 4BI3A 2ZAEA 1KIKA 5GANd 3GP8A 2HBPA 2ZPFB 4J9DA 1UFFA 3VV0A 1KFZA 5CVIA 1P92A 1NYFA 4C8QG 2Y4XA 2OTLQ 3I55T 3MEUA 4FYWB 1QW1A 2DXTA 2EYQA 4IUVA 1WDXA 3JSCA 4J6WA 4BE2A 2JMCA 2DZ9A 1YJ9Q 1H641 4Y28E 3VRZA 1NJIC 1X2KA 4M7DC 2L3QA 3TVTA 1Q7YU 1SHGA 1FXXA 1WQ7A 3ULRB 3PMIA 4ZTFA 2V8JA 3QSUA 2KI7A 4O6JA 1B3QA 3V8KA 2E6NA 1B07A 2LNVA 3TREA 1CKAA 1PNJA 3X25B 3CPWS 1WYXA 4IUUA 1AT1B 2KXCA 4XU3A 2KK4A 2F1LA 1JU5C 2KVQG 3RIRA 2RJDA 2CH4A 2OAWA 4JZ4A 5GAOr 1RL2A 1HSQA 3M55A 1RAEB 4BB7A 3JV3A 1N8RC 2QA4Q 1IZ6A 1YCSB 2DIQA 2DF6A 1G3SA 1QWEA 2X4XA 4C92A 3MEWA 2IG0A 4M4ZA 4HCCA 4M75F 5I21A 1HYOA 2DJZA 1HJDA 2PTKA 3SWNC 5DY9A 3GNFB 1BI2A 4OB3B 3A98A 4J9GA 2BTTA 3L2VA 2VVKA 2KSSA 3LLRA 3QIIA 1LOJA 4IUTA 5GANh 5GAOl 2K5FA 2LX7A 3FJPA 1OQKA 4QKUA 1UTIA 3SB2A 4DBRA 4BDZA 4FYYB 4M75E 2Z0WA 2CUDA 4C92B 2F2VA 1PHTA 3MP8A 4HVVA 2GCXA 3CQTA 3RR6A 2DILA 2YT6A 4CC2A 4KULA 4F17A 1PKSA 1DJ7B 2DERA 1U5SA 2E10A 1Z9QA 4GBQA 1IRXA 2VYTA 4C0DB 2DFUA 1XOVA 2KRSA 4XU1A 4OMFB 2RQUA 2ECZA 4LE9A 3DKMA 4LDXA 2F5KA 5IHIA 3VS0A 3CCJQ 2CGHA 5IN1A 3RMSA 3OYCA 4B9WA 5LJ5g 8ATCB 3FEOA 5CKBA 3FRNA 1M8VA 2P4TA 2E5QA 1RI9A 2GTOA 2WACA 2KBTA 4LXCA 1Q81U 2DYBA 2J7IA 1SKUB 4PJOF 1IHVA 2PVGB 3BDLA 4QT7A 3JB9F 3HFNA 1OU9A 1MHNA 1UGVA 4ZGDB 2DXUA 2HKNA 4M77G 1CSKA 4M7AA 1BI1A 2OJ2A 5KYUB 2XICA 2GGRA 2DMOA 2FPDA 2E65A 1TSFA 5LJ5d 4CC7A 1M4ZA 1QCOA 3O5ZA 4FIBA 2EYYA 5FU7C 1VQ6Q 4EMGA 2CZ7B 3NMZC 1WLPB 4PJOE 2DE0X 3CC2Q 2MYSA 1ZA2B 2NYSA 1PSEA 3UT1A 4ZGEB 2YUQA 5GMKm 2FG0A 1WPYA 1AZEA 4N4IA 2CSIA 4OMMA 4NOYA 1GL5A 2FPFA 3QBYA 3KXTA 2L3PA 1VQ8A 2EQIA 2PVDB 3M9QA 5D6WA 2ATCB 5LJ3g 1KQSP 4LDUA 2QYZA 4M7AB 4C0FA 3ME9A 5GAN4 1YHQT 5FLXE 4J83A 4BUGA 3EG0A 1KC8R 3E19A 5M9OA 4M7DA 3G4ST 4HKEA 2M0OA 3GIBA 2RHXA 3ZL7C 4JRPA 4QVCA 1UUEA 1VQPA 5LJ3j 3LGLA 1PSFA 4X1VA 5GAN6 1ZSZB 1IXDA 1RACB 1BYMA 2KXDA 3OW2A 1OEBA 3CCRT 1O75A 1VQ8T 3H0HA 3MO8A 3EFRA 1IHWA 2LCSA 1VYVA 4DOVA 1K4US 3CD6A 3C94A 2LP5A 4J6YA 3I56A 3MEVA 1TH7A 2KYBA 5J3BA 3OYLA 2DVJA 3U23A 3UWNA 1QWFA 3T9NA 5GAOp 4NL2A 2J06A 3OYFA 3FDRA 2K2MA 3KFVA 1Y0MA 1VQPT 2M16A 2NWMA 4UC4A 5IHNA 2D1XA 4LD9K 3DLLA 2CUBA 3S6WA 3WVDB 4KT0E 3CCQA 1HK9A 3SWNA 2ZGWA 2LCLA 3L2ZA 4DQ2A 1VQMA 2LQ8A 1UECA 1UJ0A 3CD6T 3HTRA 1UGRB 2KE9A 3GF5A 4IKFA 1KQSS 3KUFA 5I11A 5GAMd 3S3OA 3I56T 1IGUA 5KYXA 1JJ2A 4D8DA 2LQKA 2BZXA 1QMCA 3OYHA 4C8QC 4M78F 2G6FX 3OYMA 3HHTB 5I22A 4FT2A 3I5RA 1VQ9A 1ZLMA 4F7UB 4M77F 2KEAA 3M58A 3CCQT 3A8LB 4C92D 2E5KA 4DEYA 3OYYA 1K76A 3EH1A 2XHCA 3SWNB 4KH0B 2MK5A 1VA7A 1Y07A 4MMLA 1YI2A 2FB7A 1WXBA 2VC8A 4KBMB 2RJCA 1GCQC 4A4EA 3QPHA 1AWOA 1NYGA 3MEAA 1MMGA 2K5IA 3OBWA 1VQ5A 3CMEQ 2QAZA 2QEXA 5KYXB 3L1AA 1TWBA 4M78E 4RMOA 4OGEA 3M0PA 4AMCA 2PZ1A 1YITQ 1WIEA 4AG1C 4ESRA 3J80E 2C06A 4QQ6A 3RKWA 2COZA 3OYEA 5KCOA 1QKXA 4Z88A 3JCMP 2XDPA 1VQ9T 2ABLA 4E7KA 3O8VA 1VQOQ 2K6DA 1QLYA 1U3OA 2H3JA 1UHCA 1YI2T 1N5ZA 4AT1B 4LUEA 1HXDA 4LD6A 5LJ3h 1SHFA 3JCMc 1BKBA 4E2FB 1RAAB 3PGGA 1KSWA 1M90R 2FZCB 2DKGA 2QEXT 1K73R 3C12A 3FC3A 4RTZA 4BDYA 1ARKA 5FU6C 2OTJT 4OB2B 3E1SA 5IH2A 3HP9A 1KC8C 6AT1B 1RI0A 4E7LA 5GMKi 2PNIA 1NPRA 4PK4A 2BKDN 4J9EA 2MOXA 1D09B 5FRNA 2QQBA 4RTVA 2X4WA 5LJ3e 1VOMA 2M0YA 4JS5A 4IUQA 3JCMJ 3CMAA 4CI0C 3LX7A 5I2MA 2QQAA 5FROA 4GY5A 2YHTA 2HMAA 3MP1A 4JZ3A 4F04B 2ZPEB 3I55Q 1K9MR 3MP6A 4XU2A 4NL3A 3LWIA 4EDUA 3EH2A 3CCLA 1QQJA 4M7AD 2X35A 2LT1A 5FU7B 2RHZA 2P4RA 4EPCA 1JXOA 5GAOm 2V26A 2ED1A 4HCZA 5IHKA 2R58A 2ZPBB 2CP6A 3CMAT 2ZZDA 2VASA 1VQ4Q 3TU4K 1M3AA 3CCSA 4BY6C 3DB4A 2DX1A 2MIOA 2LJ0A 2XD0A 4X9DA 3GLXA 2AKKA 5HK0A 2B86A 2A7YA 2DZCA 2YRVA 3CC7A 1FMVA 2FZKB 1QVGA 1S72T 3VYHB 3QWYA 3L2QA 4F7UF 2NLUA 2RO0A 4JDSA 2OX7A 3C4SA 1PG5B 2E4HA 4M75G 4A53A 4M7DD 4LDWA 4M77C 4WTOB 1Q82U 1OX8A 1TXQA 2DD4A 4JRIA 2RB6A 3CCST 2P0PA 2HCKA 3CC7T 2HQXA 3CBMA 1IO6A 5KE2A 1EZZB 2QTXA 2ROTA 2QI2A 1Q86R 4F7UE 1XTDA 1YJWQ 2CP2A 3UA6A 3HFOA 2HL3A 4ZTJA 2J05A 4RCBA 2YLCA 2JOYA 1KQ2A 3LGFA 3X26B 2M9UA 4C8QA 1PD0A 4CC4B 2FYKA 3A8MB 2EYZA 1G3TA 4F14A 2LTOA 4AFZC 1BB9A 4OMNA 1GCQA 1LNXA 2A37A 1VQ7Q 3M5AA 1M90C 1M5Q1 2RM4A 3UPUA 4KGXB 2LT4A 4QW2A 1K73C 2KRMA 4FSSA 2HAXA 4C8QB 2ZPGB 1ZHIA 2JN0A 3M0RA 2FRYA 1GFDA 3QDRB 1GRIA 1JEGA 2K57A 3CBPA 2GFAA 2K5LA 2FHDA 3JCMh 2BZ8A 4XTUA 3JRZA 1YJNA 2JTMA 4PJOG 2P0QA 1C0MA 1SRLA 4E7IA 3JB9G 1RUWA 2FZGB 2D9TA 1I8FA 3L2WA 1D1BA 1N9RA 5D6YA 2R5MA 4L6V5 3JCMf 2K2VA 2OAUA 1K8AU 1X75C 4XU0A 4F16A 2CT3A 4MDXA 3JB9H 2KRNA 4PLIA 2R5AA 1WJRA 1K9MC 1XNIA 2WSCE 3JCMe 4ELYC 1BBZA 2DO3A 1D0YA 1FYNA 1AZGB 3EG1A 4QQDA 3CCMA 1YJNT 1TS9A 2PU9B 1ZA1B 4KUIA 1T0JA 2CP0A 1G8XA 2GFUA 3OMCA 3L2RA 2RJFA 3PVLA 2QK0A 1XQHA 1WHLA 2KY9A 1M1FA 2KT8A 1D1AA 4OMOA 4DBQA 2YUNA 3G71A 1OZ2A 3H41A 3VS6A 2DETA 2LX9A 4PJJA 3X28B 1M1KR 4HCKA 5GAN2 2GBQA 4IUPA 2C0IA 2RI5A 4E7JA 2RQTA 5DM7R 2VUBA 2FL7A 2AZVA 3J7AF 3CCMT 4FL6A 4A4GA 1LVKA 4HVWA 4YTLA 3TCJA 1KD1U 1TUGB 4LUDA 1W2BP 2CSQA 4Y92A 2RHIA 3OW2P 3P8HA 4DA4A 2RNAA 2DEQA 1G2BA 2I0NA 3PIPA 4HXJA 3G71T 3M4GA 2CKKA 2OTLA 4Z8AA 1FMKA 3REAB 3G6ET 2AIRB 2ZPHB 2VGNA 4E7HA 3SFMA 3OS1A 3C95A 3HRUA 1YJ9A 3A8OB 9ATCB 2CDTA 5CO7A 1Q86C 3INZA 3VS3A 2DAQA 1YIJQ 2KROA 1X6OA 4KGZB 5FWBA 2BZYA 1N27A 3QUIA 4A54A 4D8KA 4A4HA 2O88A 2GQVA 2KT1A 5AYFA 4N0AC 3N5BB 5D7UA 5GAN3 3I9QA 4WF2A 3BDUA 4HA8A 3VKIA 2YRCA 3QJ6A 3CCEA 1OPLA 2OTLT 2HNIA 4XTYA 4X34A 1Z9ZA 3MHXA 2K79A 2GF7A 3PNWC 1PWTA 1FX7A 5A0GA 2K4YA 1YJ9T 1WHKA 1QKWA 4LDYA 1X27A 5J26A 5HCKA 4J5YA 4M78G 1UGQB 5A0DA 2DJQA 4BACA 1VQNQ 2DPPB 5L23A 2QA4A 1M90U 5CKDA 5FWCA 2L3RA 4DBFA 4J7FA 3OA6A 3CXCP 1YHQA 1W2BS 4JLGA 4C5GA 3CCET 1PM3A 1ZX6A 4DBHA 3G4SA 2YSQA 2A0FB 2COWA 2WSFE 2AK5A 1NJIU 2RHYA 3RNJA 3H0IA 1WJSA 1VQMQ 4XTXA 3M57A 4BD3A 3OQ5A 4R56A 1PRMC 3CCRA 2QA4T 2C0OA 1ZQ1A 3MPUB 1M9SA 4AG2C 2E6ZA 4A4KA 1UGSB 2HDAA 1NBEB 4JJDA 4C8QD 4RKUE 3QZ9B 2R57A 1WHMA 4KRTA 2FPEA 1I4K1 3EG9A 3BY7A 1OV3A 4OGCA 3F70A 1WGSA 2EJGA 4M75C 1SEMA 1R8OB 3X20B 2DTIA 2DL5A 1WZOA 2CS7A 1N8RU 2LC4A 5CKFA 1PKTA 3M54A 1H8KA 1TOVA 1C6VX 1VQ5Q 4QVDA 2PUKB 3X24B 1Q7YR 3QYGB 1VQKQ 2PVOB 1M1KC 3NTIA 2RJEA 3TSWA 1MV0B 4J9FA 1BU1A 2JTEA 4C5HA 5LJ3d 2EIFA 3JCMW 3CXCS 3PIOA 2QDLA 3VS4A 4C92F 3EG9B 3RKYA 4M7DB 5GAN5 2DBKA 2P84A 2O4XA 4EIKA 4ZGJB 2ED0A 2RI2A 2JVVA 4HT9A 2JT4A 2EYWA 2QQ9A 1NG2A 1LJOA 1MMDA 4JPBW 4BI8B 4L59A 4Z02A 2RD1A 2EVRA 3NTKA 4EMHA 2MAMA 4C92E 2PQWA 4JJCA 1ZUYA 3FB9A 2QXFA 4OVAA 1Q86U 1NE8A 1UDLA 2GQIA 4J9CA 2QASA 3VS7A 3NHNA 2WSEE 1NZ9A 2HQHA 2ZCFB 1RAFB 3JCMV 4ZN1A 3CMAQ 2YUPA 4J9HA 4EMKC 4ORZA 5C6SA 3SDZA 3ASKA 4FW1A 1B34A 2SRCA 4L5GA 1U1TA 2YXYA 3M0UA 4PJOC 2RK1A 1QVGP 4RG8A 3CBOA 2MI6A 1Y7XA 3IQLA 1EFNA 4F7UG 1VQ6T 3UATA 2EQMA 2AKLA 2RPNA 3CCLQ 3CC2T 3NPFA 4J9BA 4N0AA 2CZ6B 2OTJA 4FSXA 3C0CA 1J3TA 1SRMA 1FMWA 2BIVA 2SEMA 1M30A 3LW5E 3OYDA 2RHUA 1B34B 3VUBA 1BIBA 1VYTA 2DTHA 3OYGA 2O31A 3AT1B 1CKBA 3CC7Q 4M7AF 1S1NA 2E64A 1I0CA 3TQ7P 4FYXB 4BE1A 3G7ZA 3OYKA 5KE3A 3URGA 2IIMA 4E7SA 2XKOC 1WXUA 2CP7A 1ZUKA 2XDBA 3M59A 2RH2A 1YP5A 2QTVA 4M77D 2CZ0B 3JCMQ 2KMTA 1VQLA 3L2UA 2FRWA 2D0QB 4MMKA 2X3WD 2J6OA 1H3HA 3QYHB 1QVGS 4M7AE 1YWOA 2VKNA 2EQKA 3JCMg 4JLIA 3THKA 4MZMA 3REBB 1UHFA 3E9FA 1H92A 2L2PA 2E12A 3QXEB 1G3WA 1AD5A 3M0TA 1Q7YC 2DM1A 4KGVB 4OMLA 3R6OA 3VUZA 4M7DF 3H8ZA 2EFIA 1S72A 4XAXB 5GMKl 3H6ZA 1M1KU 4OMPA 1N9SA 1G83A 4PKCC 1VQLT 3QO3A 1QP2A 1I07A 1X69A 5GAMf 5IXFA 4ZN3A 1PCXA 4M75A 4ZNXA 1OULA 2FEIA 3CMEA 4II1A 1N6AA 5L8RE 4XTVA 3RMQA 3CPFA 1YITA 3JCMd 3VYGA 2DA9A 4M7DE 3RBBB 5GAMe 2BE9B 2E70A 3PMTA 5GJVB 1ZSGA 2K3XA 4Z89A 3JCMb 4M78C 1IB8A 1R0BG 1VUBA 1SPKA 3EG2A 1AWWA 3P8DA 3GOXA 2RF0A 4M75B 5DLOA 3CMET 1G3YA 1YWPA 3OS2A 2E1HA 3PE0A 3DLMA 4XQ3A 4RTTA 1YITT 2X4JA 2L89A 4KH1B 2DL4A 4E6RA 1E6GA 2RI3A 4RUGA 5KH6A 2E3IA 1R0CB 2DVEA 2YUOA 2DTOA 2FVUA 5GAN7 3HRTA 1PC0A 1VQOT 1LPLA 4C0GA 2QQSA 1FWZA 4FM4B 3V7SA 5DLQE 5CKEA 2C0TA 2D8JA 1NLPC 1KQ1A 4AFQC 5HK3A 1U1SA 2EGCA 2ZPIB 1UE9A 5GMKj 4RTXA 2CP3A 4EMKA 2JM8A 1MUZA 3GPLA 4OB0B 4IIMA 3CCVA 4C0ZA 4PJOA 3CC4A 2XIDA 1OYXA 2EW3A 1ACMB 2F2XA 5HY6A 4PJMA 2QQRA 1BCMA 2KNBB 4OMQA 3CCUA 3KBGA 1Y71A 3RESA 1QCFA 1C1AA 3QKJA 2LQNA 3Q1JA 4AFUC 3EGDA 4XTWA 4B9XA 1VQ4A 1K0XA 1BI0A 1WI7A 1IREB 1Y96A 5KYYA 1ZSZC 4XK8E 1F1BB 2LCCA 5GJWB 4EMKB 1QVFA 1OU8A 2EYXA 3GNGA 3CCVT 4PL6A 1UJYA 2X9HA 4IURA 3BE3A 3CC4T 3A8HB 4E7ZA 1KC8U 4PJOB 2KYMA 2XI9A 1Y57A 4FW2A 5C0MA 3CCUT 2HQEA 2G3RA 3NGPA 5IXBA 2LRQA 4RTWA 1A0NB 5GAOq 3MCAB 1Q95G 2W0ZA 2JW4A 3EGDB 3JCMX 3CEYA 2JS2A 1ZBJA 1RABB 1V29B 3GBQA 1VQ4T 1B7TA 1UGPB 1VYUA 4BE0A 1Y96B 5KYYB 1NLOC 1RAHB 2HSPA 1RAGB 2VV5A 3CCEQ 3EGXA 2JJ9A 2KDSA 2VXEA 2NUTA 3R6NA 1MMNA 1BCOA 2QGGA 1YNZA 3OBYA 1YJWA 2MPXC 2ROLA 1G5VA 5A0LA 3A8GB 2MWOA 2VGMA 3G6EA 1UG1A 2DK3A 1SF9A 2DXBA 4HCBA 2X51A 5FU6B 1JBMA 1QP3A 3VS1A 4JS4A 2A36A 1EIFA 2F69A 3UDCA 4B6MA 2COYA 1YHQQ 1WHGA 2DEUA 1WQWA 4ATOA 5KYNA 4R55A 3HKSA 4PJNA 3EGXB 4X9CA 3G4SQ 3FLGA 1UEBA 2NUTB 2XK0A 4Y91A 1VQ7A 4O5VA 4JUVA 1YJWT 3OYBA 5GMKh 2DL7A 3OSVA 1JXMA 3TSZA 2DL8A 5LL6S 1KG1A 3QG1A 3OYJA 3H0FA 3OMGA 5IT9E
chains in the Genus database with same CATH topology
2O9SA 4RTZA 3TSWA 1MV0B 2JS0A 3EHQA 2CT4A 4J9FA 1BU1A 1ARKA 2JTEA 2EGEA 2J6KA 5IH2A 2QDLA 3VS4A 2KR3A 2RQVA 3M0QA 1AWXA 2XMFA 2PNIA 2DBKA 4J9EA 2MOXA 4EIKA 3SEMA 4RTVA 4RTYA 1KIKA 2M0YA 2ED0A 2VWFA 5FW9A 4J9DA 2JT4A 1UFFA 2NUZA 2EYWA 1KFZA 1JQQA 1M3CA 1NG2A 4A63B 4WCIA 3EHRA 1GBRA 4JPBW 4JZ3A 1NEGA 1BK2A 1NYFA 4IIOA 1RLQC 1WDXA 2EVRA 1X2QA 4JJCA 2JMCA 2D8HA 1ZUYA 3VRZA 1X2KA 2P4RA 1JXOA 2LZ6B 1MV3A 2ED1A 5IHKA 1UDLA 2GQIA 2L3QA 4J9CA 3FJ5A 3TVTA 3VS7A 2DRKA 1SHGA 3NHNA 3ULRB 4R0KA 2YUPA 4J9HA 4ORZA 4JJBA 1B3QA 2ENMA 1AEYA 1M3AA 1B07A 2SRCA 1CKAA 1PNJA 1M3BA 2DX1A 2MIOA 2LJ0A 3M0UA 1WYXA 2AKKA 2B86A 2A08A 2KXCA 1TUDA 3IQLA 1EFNA 1JU5C 3UATA 2CH4A 4GLMA 2OAWA 2AKLA 4J9IA 2RN8A 2RPNA 3QWYA 4JZ4A 1HSQA 3NPFA 1W70A 3JV3A 4J9BA 1YCSB 2DF6A 1QWEA 2DLPA 3C0CA 1GBQA 1ZUUA 1SRMA 2O9VA 1J3TA 4M4ZA 2GTJA 2SEMA 1HJDA 1M30A 1YN8A 2PTKA 2HEQA 3A98A 2HCKA 4J9GA 1VYTA 1W6XA 2BTTA 1IO6A 2O31A 2ROTA 1W1FA 2O2OA 1CKBA 2VVKA 1S1NA 3UA6A 1AVZC 2J05A 1I0CA 2LX7A 2DRMA 1NM7A 1UTIA 4CC4B 2IIMA 2K3BA 1E7OA 1WXUA 2EKHA 2CUDA 2EYZA 2F2VA 1PHTA 1ZUKA 4HVVA 1YP5A 3CQTA 4F17A 2DILA 2YT6A 4CC2A 4F14A 1PKSA 4AFZC 1U5SA 2FRWA 2X3WD 1BB9A 1Z9QA 4GBQA 2CREA 2J6OA 4OMNA 1H3HA 1XOVA 1GCQA 2KRSA 2LJ1A 1YWOA 2RQUA 2VKNA 1GFCA 2ECZA 4LE9A 2A37A 3THKA 3REBB 1UHFA 1H92A 5IHIA 2L2PA 3VS0A 4LN2A 2LJ3A 2KRMA 4FSSA 2KGTA 1AD5A 3M0TA 1SSHA 1WXTA 2DM1A 1HD3A 4OMLA 2M51A 3M0RA 2FRYA 1GFDA 1X6GA 2JXBA 3VS5A 1GRIA 1JEGA 1OPKA 4OMPA 1G83A 2BZ8A 1K9AA 1RI9A 2GTOA 1I07A 2KBTA 1SRLA 1WFWA 1X69A 5IXFA 2JM9A 4HVUA 1RUWA 2DYBA 2J7IA 4ZNXA 3SHWA 1T0HA 2FEIA 4QT7A 2RQWA 1UGVA 2DA9A 2CT3A 4F16A 3RBBB 3LH5A 3PVQA 2KRNA 1CSKA 2OJ2A 5GJVB 1ZSGA 1K0SA 2GGRA 2DMOA 4Z89A 1BBZA 2FPDA 4CC7A 3O5ZA 2EYYA 1M8MA 1FYNA 1AZGB 1LCKA 3EG1A 2X3XD 4K11A 1SPKA 2V1QA 3EG2A 3NMZC 1WLPB 2LNHB 1T0JA 1AWWA 2DE0X 3EGUA 2RF0A 1PRLC 3PVLA 4RTUA 2YUQA 2FG0A 1AZEA 2KT8A 1OOTA 1YWPA 2CSIA 4OMMA 4OMOA 3PE0A 4RTTA 2YUNA 4AFSC 1GL5A 2DL4A 3H41A 3VS6A 2FPFA 4E6RA 2L0AA 1AWJA 1E6GA 2L3PA 4RUGA 2EQIA 1U06A 2RMOA 2YUOA 4HCKA 2H8HA 2GBQA 2FO0A 2C0IA 2CH4W 2GNCA 2RQTA 3EG0A 2AZVA 2ESWA 2C0TA 2D8JA 1NLPC 2W10A 4HVWA 4AFQC 3ZL7C 1UUEA 2EGCA 4LUDA 5ECAA 1WA7A 2CSQA 4Y92A 4X1VA 1UE9A 4CC3A 4RTXA 2RNAA 4LNPA 3M0SA 2JM8A 1MUZA 3VRYA 1G2BA 2I0NA 2LMJA 4HXJA 2KXDA 1KJWA 3EG3A 4IIMA 1OEBA 2A28A 4Z8AA 1FMKA 3REAB 3H0HA 2LCSA 1VYVA 2EW3A 2F2XA 1K4US 2KNBB 4OMQA 1RLPC 2LP5A 2CDTA 2KYBA 1WX6A 1QCFA 3VS3A 2AZSA 5EC7A 2LQNA 2DVJA 3U23A 1QWFA 2MCNA 2YDLA 4AFUC 1JO8A 2KROA 5FWBA 2J06A 2BZYA 4D8KA 2K2MA 1V1CA 1M27C 3KFVA 1Y0MA 2V1RA 2F2WA 1T3SA 2JMAA 2O88A 2KT1A 1K0XA 2NWMA 1WI7A 5IHNA 3I9QA 2D1XA 2CUBA 2RQRA 5GJWB 1OPLA 2D0NA 1E6HA 2EYXA 1UJYA 1Z9ZA 2K79A 2EGAA 2KYMA 1PWTA 1UECA 1UJ0A 1Y57A 2K7AA 2KE9A 3UF4A 1I1JA 5I11A 1QKWA 1X27A 3NGPA 5HCKA 5IXBA 2DJQA 2DNUA 4RTWA 1A0NB 4D8DA 5L23A 2W0ZA 2JW4A 2BZXA 5FWCA 2JS2A 1ZBJA 2LQWA 3GBQA 3I35A 2G6FX 5I22A 2EPDA 1VYUA 3I5RA 1ZLMA 4DEXA 2DBMA 2KEAA 1NLOC 1ZX6A 4DEYA 2E5KA 2HSPA 2YSQA 1K76A 1K1ZA 1VA7A 2AK5A 2EBPA 3R6NA 3RNJA 1WXBA 3H0IA 1YNZA 1GCQC 1TUCA 2OI3A 1AWOA 1NYGA 2ROLA 2L3SA 2K9GA 1PRMC 3I5SA 1NEBA 3M0PA 2PZ1A 1WIEA 4AG1C 4ESRA 2C0OA 1UG1A 4AG2C 1TG0A 1GCPA 1QKXA 4Z88A 2HDAA 4JJDA 3VS1A 2ABLA 2A36A 2K6DA 1QLYA 2J6FA 4KRTA 1U3OA 2FPEA 1X6BA 1T3LA 1UHCA 1OV3A 2DL3A 1AOJA 1N5ZA 3VS2A 4LUEA 1X43A 1SEMA 1SHFA 2DL5A 2HBWA 1KSWA 1ABQA 2DL7A 3QWXX 1JXMA 3TSZA 2DL8A 1PKTA 1H8KA 1ABOA 3UA7A 3H0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O9S A;  4RTZ A;  3TSW A;  1MV0 B;  2JS0 A;  3EHQ A;  2CT4 A;  4J9F A;  1BU1 A;  1ARK A;  2JTE A;  2EGE A;  2J6K A;  5IH2 A;  2QDL A;  3VS4 A;  2KR3 A;  2RQV A;  3M0Q A;  1AWX A;  2XMF A;  2PNI A;  2DBK A;  4J9E A;  2MOX A;  4EIK A;  3SEM A;  4RTV A;  4RTY A;  1KIK A;  2M0Y A;  2ED0 A;  2VWF A;  5FW9 A;  4J9D A;  2JT4 A;  1UFF A;  2NUZ A;  2EYW A;  1KFZ A;  1JQQ A;  1M3C A;  1NG2 A;  4A63 B;  4WCI A;  3EHR A;  1GBR A;  4JPB W;  4JZ3 A;  1NEG A;  1BK2 A;  1NYF A;  4IIO A;  1RLQ C;  1WDX A;  2EVR A;  1X2Q A;  4JJC A;  2JMC A;  2D8H A;  1ZUY A;  3VRZ A;  1X2K A;  2P4R A;  1JXO A;  2LZ6 B;  1MV3 A;  2ED1 A;  5IHK A;  1UDL A;  2GQI A;  2L3Q A;  4J9C A;  3FJ5 A;  3TVT A;  3VS7 A;  2DRK A;  1SHG A;  3NHN A;  3ULR B;  4R0K A;  2YUP A;  4J9H A;  4ORZ A;  4JJB A;  1B3Q A;  2ENM A;  1AEY A;  1M3A A;  1B07 A;  2SRC A;  1CKA A;  1PNJ A;  1M3B A;  2DX1 A;  2MIO A;  2LJ0 A;  3M0U A;  1WYX A;  2AKK A;  2B86 A;  2A08 A;  2KXC A;  1TUD A;  3IQL A;  1EFN A;  1JU5 C;  3UAT A;  2CH4 A;  4GLM A;  2OAW A;  2AKL A;  4J9I A;  2RN8 A;  2RPN A;  3QWY A;  4JZ4 A;  1HSQ A;  3NPF A;  1W70 A;  3JV3 A;  4J9B A;  1YCS B;  2DF6 A;  1QWE A;  2DLP A;  3C0C A;  1GBQ A;  1ZUU A;  1SRM A;  2O9V A;  1J3T A;  4M4Z A;  2GTJ A;  2SEM A;  1HJD A;  1M30 A;  1YN8 A;  2PTK A;  2HEQ A;  3A98 A;  2HCK A;  4J9G A;  1VYT A;  1W6X A;  2BTT A;  1IO6 A;  2O31 A;  2ROT A;  1W1F A;  2O2O A;  1CKB A;  2VVK A;  1S1N A;  3UA6 A;  1AVZ C;  2J05 A;  1I0C A;  2LX7 A;  2DRM A;  1NM7 A;  1UTI A;  4CC4 B;  2IIM A;  2K3B A;  1E7O A;  1WXU A;  2EKH A;  2CUD A;  2EYZ A;  2F2V A;  1PHT A;  1ZUK A;  4HVV A;  1YP5 A;  3CQT A;  4F17 A;  2DIL A;  2YT6 A;  4CC2 A;  4F14 A;  1PKS A;  4AFZ C;  1U5S A;  2FRW A;  2X3W D;  1BB9 A;  1Z9Q A;  4GBQ A;  2CRE A;  2J6O A;  4OMN A;  1H3H A;  1XOV A;  1GCQ A;  2KRS A;  2LJ1 A;  1YWO A;  2RQU A;  2VKN A;  1GFC A;  2ECZ A;  4LE9 A;  2A37 A;  3THK A;  3REB B;  1UHF A;  1H92 A;  5IHI A;  2L2P A;  3VS0 A;  4LN2 A;  2LJ3 A;  2KRM A;  4FSS A;  2KGT A;  1AD5 A;  3M0T A;  1SSH A;  1WXT A;  2DM1 A;  1HD3 A;  4OML A;  2M51 A;  3M0R A;  2FRY A;  1GFD A;  1X6G A;  2JXB A;  3VS5 A;  1GRI A;  1JEG A;  1OPK A;  4OMP A;  1G83 A;  2BZ8 A;  1K9A A;  1RI9 A;  2GTO A;  1I07 A;  2KBT A;  1SRL A;  1WFW A;  1X69 A;  5IXF A;  2JM9 A;  4HVU A;  1RUW A;  2DYB A;  2J7I A;  4ZNX A;  3SHW A;  1T0H A;  2FEI A;  4QT7 A;  2RQW A;  1UGV A;  2DA9 A;  2CT3 A;  4F16 A;  3RBB B;  3LH5 A;  3PVQ A;  2KRN A;  1CSK A;  2OJ2 A;  5GJV B;  1ZSG A;  1K0S A;  2GGR A;  2DMO A;  4Z89 A;  1BBZ A;  2FPD A;  4CC7 A;  3O5Z A;  2EYY A;  1M8M A;  1FYN A;  1AZG B;  1LCK A;  3EG1 A;  2X3X D;  4K11 A;  1SPK A;  2V1Q A;  3EG2 A;  3NMZ C;  1WLP B;  2LNH B;  1T0J A;  1AWW A;  2DE0 X;  3EGU A;  2RF0 A;  1PRL C;  3PVL A;  4RTU A;  2YUQ A;  2FG0 A;  1AZE A;  2KT8 A;  1OOT A;  1YWP A;  2CSI A;  4OMM A;  4OMO A;  3PE0 A;  4RTT A;  2YUN A;  4AFS C;  1GL5 A;  2DL4 A;  3H41 A;  3VS6 A;  2FPF A;  4E6R A;  2L0A A;  1AWJ A;  1E6G A;  2L3P A;  4RUG A;  2EQI A;  1U06 A;  2RMO A;  2YUO A;  4HCK A;  2H8H A;  2GBQ A;  2FO0 A;  2C0I A;  2CH4 W;  2GNC A;  2RQT A;  3EG0 A;  2AZV A;  2ESW A;  2C0T A;  2D8J A;  1NLP C;  2W10 A;  4HVW A;  4AFQ C;  3ZL7 C;  1UUE A;  2EGC A;  4LUD A;  5ECA A;  1WA7 A;  2CSQ A;  4Y92 A;  4X1V A;  1UE9 A;  4CC3 A;  4RTX A;  2RNA A;  4LNP A;  3M0S A;  2JM8 A;  1MUZ A;  3VRY A;  1G2B A;  2I0N A;  2LMJ A;  4HXJ A;  2KXD A;  1KJW A;  3EG3 A;  4IIM A;  1OEB A;  2A28 A;  4Z8A A;  1FMK A;  3REA B;  3H0H A;  2LCS A;  1VYV A;  2EW3 A;  2F2X A;  1K4U S;  2KNB B;  4OMQ A;  1RLP C;  2LP5 A;  2CDT A;  2KYB A;  1WX6 A;  1QCF A;  3VS3 A;  2AZS A;  5EC7 A;  2LQN A;  2DVJ A;  3U23 A;  1QWF A;  2MCN A;  2YDL A;  4AFU C;  1JO8 A;  2KRO A;  5FWB A;  2J06 A;  2BZY A;  4D8K A;  2K2M A;  1V1C A;  1M27 C;  3KFV A;  1Y0M A;  2V1R A;  2F2W A;  1T3S A;  2JMA A;  2O88 A;  2KT1 A;  1K0X A;  2NWM A;  1WI7 A;  5IHN A;  3I9Q A;  2D1X A;  2CUB A;  2RQR A;  5GJW B;  1OPL A;  2D0N A;  1E6H A;  2EYX A;  1UJY A;  1Z9Z A;  2K79 A;  2EGA A;  2KYM A;  1PWT A;  1UEC A;  1UJ0 A;  1Y57 A;  2K7A A;  2KE9 A;  3UF4 A;  1I1J A;  5I11 A;  1QKW A;  1X27 A;  3NGP A;  5HCK A;  5IXB A;  2DJQ A;  2DNU A;  4RTW A;  1A0N B;  4D8D A;  5L23 A;  2W0Z A;  2JW4 A;  2BZX A;  5FWC A;  2JS2 A;  1ZBJ A;  2LQW A;  3GBQ A;  3I35 A;  2G6F X;  5I22 A;  2EPD A;  1VYU A;  3I5R A;  1ZLM A;  4DEX A;  2DBM A;  2KEA A;  1NLO C;  1ZX6 A;  4DEY A;  2E5K A;  2HSP A;  2YSQ A;  1K76 A;  1K1Z A;  1VA7 A;  2AK5 A;  2EBP A;  3R6N A;  3RNJ A;  1WXB A;  3H0I A;  1YNZ A;  1GCQ C;  1TUC A;  2OI3 A;  1AWO A;  1NYG A;  2ROL A;  2L3S A;  2K9G A;  1PRM C;  3I5S A;  1NEB A;  3M0P A;  2PZ1 A;  1WIE A;  4AG1 C;  4ESR A;  2C0O A;  1UG1 A;  4AG2 C;  1TG0 A;  1GCP A;  1QKX A;  4Z88 A;  2HDA A;  4JJD A;  3VS1 A;  2ABL A;  2A36 A;  2K6D A;  1QLY A;  2J6F A;  4KRT A;  1U3O A;  2FPE A;  1X6B A;  1T3L A;  1UHC A;  1OV3 A;  2DL3 A;  1AOJ A;  1N5Z A;  3VS2 A;  4LUE A;  1X43 A;  1SEM A;  1SHF A;  2DL5 A;  2HBW A;  1KSW A;  1ABQ A;  2DL7 A;  3QWX X;  1JXM A;  3TSZ A;  2DL8 A;  1PKT A;  1H8K A;  1ABO A;  3UA7 A;  3H0F A; 
#chains in the Genus database with same CATH topology
 2Y4Y A;  4J7I A;  3CCR Q;  2O9S A;  2E41 A;  1VQ8 Q;  3CPW A;  3A1P A;  2CT4 A;  4C92 G;  5IAY A;  8AT1 B;  2LVM A;  2EGE A;  3WXM B;  2J6K A;  1GXI E;  2HSE B;  2JUF A;  4M78 A;  3M0Q A;  1AWX A;  5GAN f;  2EKO A;  3SEM A;  4RTY A;  3NFC A;  4M77 A;  5GMK e;  1KK7 A;  2QGF B;  2VWF A;  1VQ7 T;  2RA2 A;  5FW9 A;  2QDY B;  1VQP Q;  3EFS A;  5GAO n;  3MJX A;  2NUZ A;  4DOW A;  3H9N A;  4M75 D;  1JQQ A;  5GAN e;  1M3C A;  4A63 B;  4WCI A;  3D7S B;  2XG8 D;  2YRD A;  3EHR A;  4Q5W A;  1GBR A;  4BY6 B;  1NEG A;  2YLB A;  1BK2 A;  4E47 A;  1Q82 R;  4IIO A;  4CRI A;  1RLQ C;  5KYU A;  2RK2 A;  2EQU A;  4C8Q F;  1JJ2 P;  3CD6 Q;  1X2Q A;  4QQG A;  5CQX A;  2D8H A;  1TTH B;  1ZBX A;  2HD0 A;  3I56 Q;  3JAM E;  4M78 B;  2LZ6 B;  3QHS A;  3QZ5 B;  1MV3 A;  2CYZ B;  4D6W A;  1JRI A;  4XTZ A;  1K73 U;  3FJ5 A;  4M77 B;  4N4H A;  5LJ5 j;  2DRK A;  4R0K A;  3OW2 S;  4JJB A;  2ENM A;  7AT1 B;  1AEY A;  3HL8 A;  1MGQ A;  3CCQ Q;  1M3B A;  1OZ3 A;  4RCC A;  2A08 A;  4C8Q E;  1TUD A;  3V8J A;  5CCA A;  2BUD A;  1OI1 A;  4GLM A;  4J9I A;  2RN8 A;  3MKD A;  4PJL A;  4FYV B;  1W70 A;  4MDW A;  2HZY A;  4LDV A;  4ANJ A;  3WVE B;  4MZP A;  2DLP A;  1GBQ A;  1ZUU A;  1ZSZ A;  2O9V A;  3S3M A;  1VIF A;  3HSB A;  2GTJ A;  4V2S A;  5EG2 A;  3BW1 A;  3V7C A;  1VQ9 Q;  2IPO B;  1K9M U;  2F5T X;  1YN8 A;  4J6X A;  2HEQ A;  2P0K A;  4M7A G;  2VXF A;  1W6X A;  3V7R A;  1YI2 Q;  3BFM A;  4PJO D;  1W1F A;  2O2O A;  1YIJ A;  3CCJ A;  2QG9 B;  3PTA A;  1W4S A;  1X01 A;  3JB9 D;  1JJ2 S;  1D1C A;  1AVZ C;  1RAI B;  2I2L A;  2JTF A;  4JJN K;  2QEX Q;  3QDF A;  2EAY A;  1KHC A;  2DRM A;  3EFO A;  3OYI A;  1NM7 A;  4ELZ C;  1K8A R;  2K3B A;  1E7O A;  2EKH A;  2PUO B;  2O01 E;  4A4F A;  2OTJ Q;  1W2B A;  2AHJ B;  1AHJ B;  1I5L A;  2VB6 A;  2CRE A;  5GAM g;  4MZT A;  2XDD A;  1MNE A;  1WHJ A;  2LJ1 A;  1YFN A;  1GFC A;  1D0Z A;  3EAE A;  1YIJ T;  2MF2 A;  3CCJ T;  1VQN A;  2V8I A;  3LWH A;  4M7D G;  5FRM A;  5CQY A;  4LN2 A;  2LJ3 A;  2KGT A;  4C5I A;  1SSH A;  2M02 A;  1WXT A;  5D6X A;  1HD3 A;  3EFO B;  2M51 A;  1BI3 A;  3M4Y A;  5GAM j;  3ER0 A;  2V8K A;  1X6G A;  2JXB A;  3VS5 A;  2EQJ A;  3OS0 A;  4F7U A;  1VQ6 A;  1OPK A;  5GAN 8;  4HT8 A;  1WNL A;  1K9A A;  3CC2 A;  2O4X B;  1WFW A;  4VUB A;  1VQL Q;  2JM9 A;  3J81 E;  4HVU A;  1WJQ A;  4BI4 A;  4KUD K;  2Y90 A;  3LH0 A;  5LJ5 h;  3SHW A;  3VJP A;  1T0H A;  5A2Q E;  1VQN T;  1M2V A;  4PFO A;  1KD1 R;  3RKX A;  5CK9 A;  4OF1 A;  2RQW A;  2YWW A;  1OX9 A;  1YBY A;  3LH5 A;  1Q82 C;  3PVQ A;  3E2U A;  5LJ5 f;  1O9S A;  1YCY A;  1K0S A;  2KQW A;  3TEE A;  3SD4 A;  5CKH A;  3HPW A;  1S72 Q;  1MND A;  1M8M A;  3CXC A;  1LCK A;  1V76 A;  2X3X D;  1RAD B;  4K11 A;  3E9G A;  2V1Q A;  2LNH B;  5LJ5 e;  3NTH A;  1VQM T;  3EGU A;  1PRL C;  1NPP A;  2H3E B;  1H3Z A;  4RTU A;  3DB3 A;  1OOT A;  1M2V B;  4TVR A;  4AFS C;  1TU0 B;  3A5Z B;  1VQK A;  3L42 A;  1AWJ A;  2L0A A;  3M53 A;  1U06 A;  2RMO A;  3CCS Q;  1JB0 E;  2H8H A;  1I81 A;  2DYI A;  2FO0 A;  2HL5 C;  3ZEH A;  4M77 E;  2CH4 W;  1KQS A;  2GNC A;  2M1H A;  1Q81 R;  3RDV A;  2ESW A;  2XU8 A;  2W10 A;  4M78 D;  5ECA A;  2EJF A;  1WA7 A;  1VIE A;  4CC3 A;  3HRS A;  4LNP A;  4PFZ A;  3M0S A;  1SSF A;  3AHU A;  1VQ5 T;  3VRY A;  2LMJ A;  1IGQ A;  3EG3 A;  1KJW A;  2CP5 A;  2NUP A;  3PT9 A;  2L8D A;  2A28 A;  2HKQ B;  1VQK T;  2JZ2 A;  3ZFJ A;  2MMP A;  5KCH A;  3PFS A;  5LJ3 f;  5KYW A;  2KAF A;  1RLP C;  3OYN A;  1WX6 A;  2AZS A;  5EC7 A;  1KHI A;  1MMA A;  1NJI R;  1U8R A;  3ZBD A;  2MCN A;  2YDL A;  5I2S A;  1JO8 A;  5J39 A;  1V1C A;  1M27 C;  1BIA A;  2V1R A;  1XJW B;  2EJ9 A;  2F2W A;  1T3S A;  2JMA A;  2JNG A;  5GAM h;  1K8A C;  1QVF P;  1D0X A;  4C92 C;  3FIF A;  2RQR A;  3S3N A;  3JB9 I;  2D0N A;  1E6H A;  1D3B A;  2NUP B;  4FU6 A;  2EGA A;  3OS5 A;  3CCV Q;  3M56 A;  4C0D C;  2K7A A;  3CC4 Q;  3UF4 A;  1I1J A;  3QJY A;  2K3Y A;  5KYW B;  5CR2 A;  3MET A;  3CCU Q;  2IVW A;  2AT1 B;  3OB9 A;  5CAI A;  3JB9 J;  2DNU A;  4PNO A;  3P8B B;  4C5E A;  1N8R R;  2A3L A;  2LQW A;  3I35 A;  1VQO A;  2EPD A;  3VU3 C;  4JRK A;  2DIG A;  4DEX A;  2DBM A;  4NS5 A;  2LDM A;  4J8O A;  1QCN A;  1D3B B;  1K1Z A;  1YJN Q;  2EBP A;  5AT1 B;  2L5Q A;  1TUC A;  2OI3 A;  3OSS C;  1EX4 A;  1QVP A;  1KD1 C;  3OY9 A;  3CCL T;  2L3S A;  2K9G A;  4P5N A;  4OB1 B;  3I5S A;  1NEB A;  4QVZ A;  2B8A A;  1TG0 A;  1GCP A;  4PLL A;  1M2O A;  1M1G A;  4OP0 A;  4N4G A;  1QVF S;  2J6F A;  5GAN g;  4FCY A;  1PD1 A;  1X6B A;  2EWN A;  2MWP A;  1T3L A;  2DL3 A;  3LYI A;  3CCM Q;  5CIU A;  4GLK A;  1AOJ A;  3VS2 A;  1X43 A;  4ME7 A;  3V8L A;  2HBW A;  1ABQ A;  4FT4 A;  3QWX X;  2D6F A;  1I5O B;  2X4Y A;  1ABO A;  3CPW P;  5GAN j;  3UA7 A;  3G71 Q;  2E3H A;  3I55 A;  4PFP A;  3G1J A;  2DD5 A;  2JS0 A;  3G6E Q;  3EHQ A;  5HKC A;  4M7A C;  1R77 A;  3RER A;  3OYA A;  1SG5 A;  2DXC A;  1WHH A;  2BE7 D;  2KR3 A;  2RQV A;  2CZ1 B;  1Q81 C;  2XMF A;  3RUX A;  1UB4 A;  4RG2 A;  4JRQ A;  4BI3 A;  2ZAE A;  1KIK A;  5GAN d;  3GP8 A;  2HBP A;  2ZPF B;  4J9D A;  1UFF A;  3VV0 A;  1KFZ A;  5CVI A;  1P92 A;  1NYF A;  4C8Q G;  2Y4X A;  2OTL Q;  3I55 T;  3MEU A;  4FYW B;  1QW1 A;  2DXT A;  2EYQ A;  4IUV A;  1WDX A;  3JSC A;  4J6W A;  4BE2 A;  2JMC A;  2DZ9 A;  1YJ9 Q;  1H64 1;  4Y28 E;  3VRZ A;  1NJI C;  1X2K A;  4M7D C;  2L3Q A;  3TVT A;  1Q7Y U;  1SHG A;  1FXX A;  1WQ7 A;  3ULR B;  3PMI A;  4ZTF A;  2V8J A;  3QSU A;  2KI7 A;  4O6J A;  1B3Q A;  3V8K A;  2E6N A;  1B07 A;  2LNV A;  3TRE A;  1CKA A;  1PNJ A;  3X25 B;  3CPW S;  1WYX A;  4IUU A;  1AT1 B;  2KXC A;  4XU3 A;  2KK4 A;  2F1L A;  1JU5 C;  2KVQ G;  3RIR A;  2RJD A;  2CH4 A;  2OAW A;  4JZ4 A;  5GAO r;  1RL2 A;  1HSQ A;  3M55 A;  1RAE B;  4BB7 A;  3JV3 A;  1N8R C;  2QA4 Q;  1IZ6 A;  1YCS B;  2DIQ A;  2DF6 A;  1G3S A;  1QWE A;  2X4X A;  4C92 A;  3MEW A;  2IG0 A;  4M4Z A;  4HCC A;  4M75 F;  5I21 A;  1HYO A;  2DJZ A;  1HJD A;  2PTK A;  3SWN C;  5DY9 A;  3GNF B;  1BI2 A;  4OB3 B;  3A98 A;  4J9G A;  2BTT A;  3L2V A;  2VVK A;  2KSS A;  3LLR A;  3QII A;  1LOJ A;  4IUT A;  5GAN h;  5GAO l;  2K5F A;  2LX7 A;  3FJP A;  1OQK A;  4QKU A;  1UTI A;  3SB2 A;  4DBR A;  4BDZ A;  4FYY B;  4M75 E;  2Z0W A;  2CUD A;  4C92 B;  2F2V A;  1PHT A;  3MP8 A;  4HVV A;  2GCX A;  3CQT A;  3RR6 A;  2DIL A;  2YT6 A;  4CC2 A;  4KUL A;  4F17 A;  1PKS A;  1DJ7 B;  2DER A;  1U5S A;  2E10 A;  1Z9Q A;  4GBQ A;  1IRX A;  2VYT A;  4C0D B;  2DFU A;  1XOV A;  2KRS A;  4XU1 A;  4OMF B;  2RQU A;  2ECZ A;  4LE9 A;  3DKM A;  4LDX A;  2F5K A;  5IHI A;  3VS0 A;  3CCJ Q;  2CGH A;  5IN1 A;  3RMS A;  3OYC A;  4B9W A;  5LJ5 g;  8ATC B;  3FEO A;  5CKB A;  3FRN A;  1M8V A;  2P4T A;  2E5Q A;  1RI9 A;  2GTO A;  2WAC A;  2KBT A;  4LXC A;  1Q81 U;  2DYB A;  2J7I A;  1SKU B;  4PJO F;  1IHV A;  2PVG B;  3BDL A;  4QT7 A;  3JB9 F;  3HFN A;  1OU9 A;  1MHN A;  1UGV A;  4ZGD B;  2DXU A;  2HKN A;  4M77 G;  1CSK A;  4M7A A;  1BI1 A;  2OJ2 A;  5KYU B;  2XIC A;  2GGR A;  2DMO A;  2FPD A;  2E65 A;  1TSF A;  5LJ5 d;  4CC7 A;  1M4Z A;  1QCO A;  3O5Z A;  4FIB A;  2EYY A;  5FU7 C;  1VQ6 Q;  4EMG A;  2CZ7 B;  3NMZ C;  1WLP B;  4PJO E;  2DE0 X;  3CC2 Q;  2MYS A;  1ZA2 B;  2NYS A;  1PSE A;  3UT1 A;  4ZGE B;  2YUQ A;  5GMK m;  2FG0 A;  1WPY A;  1AZE A;  4N4I A;  2CSI A;  4OMM A;  4NOY A;  1GL5 A;  2FPF A;  3QBY A;  3KXT A;  2L3P A;  1VQ8 A;  2EQI A;  2PVD B;  3M9Q A;  5D6W A;  2ATC B;  5LJ3 g;  1KQS P;  4LDU A;  2QYZ A;  4M7A B;  4C0F A;  3ME9 A;  5GAN 4;  1YHQ T;  5FLX E;  4J83 A;  4BUG A;  3EG0 A;  1KC8 R;  3E19 A;  5M9O A;  4M7D A;  3G4S T;  4HKE A;  2M0O A;  3GIB A;  2RHX A;  3ZL7 C;  4JRP A;  4QVC A;  1UUE A;  1VQP A;  5LJ3 j;  3LGL A;  1PSF A;  4X1V A;  5GAN 6;  1ZSZ B;  1IXD A;  1RAC B;  1BYM A;  2KXD A;  3OW2 A;  1OEB A;  3CCR T;  1O75 A;  1VQ8 T;  3H0H A;  3MO8 A;  3EFR A;  1IHW A;  2LCS A;  1VYV A;  4DOV A;  1K4U S;  3CD6 A;  3C94 A;  2LP5 A;  4J6Y A;  3I56 A;  3MEV A;  1TH7 A;  2KYB A;  5J3B A;  3OYL A;  2DVJ A;  3U23 A;  3UWN A;  1QWF A;  3T9N A;  5GAO p;  4NL2 A;  2J06 A;  3OYF A;  3FDR A;  2K2M A;  3KFV A;  1Y0M A;  1VQP T;  2M16 A;  2NWM A;  4UC4 A;  5IHN A;  2D1X A;  4LD9 K;  3DLL A;  2CUB A;  3S6W A;  3WVD B;  4KT0 E;  3CCQ A;  1HK9 A;  3SWN A;  2ZGW A;  2LCL A;  3L2Z A;  4DQ2 A;  1VQM A;  2LQ8 A;  1UEC A;  1UJ0 A;  3CD6 T;  3HTR A;  1UGR B;  2KE9 A;  3GF5 A;  4IKF A;  1KQS S;  3KUF A;  5I11 A;  5GAM d;  3S3O A;  3I56 T;  1IGU A;  5KYX A;  1JJ2 A;  4D8D A;  2LQK A;  2BZX A;  1QMC A;  3OYH A;  4C8Q C;  4M78 F;  2G6F X;  3OYM A;  3HHT B;  5I22 A;  4FT2 A;  3I5R A;  1VQ9 A;  1ZLM A;  4F7U B;  4M77 F;  2KEA A;  3M58 A;  3CCQ T;  3A8L B;  4C92 D;  2E5K A;  4DEY A;  3OYY A;  1K76 A;  3EH1 A;  2XHC A;  3SWN B;  4KH0 B;  2MK5 A;  1VA7 A;  1Y07 A;  4MML A;  1YI2 A;  2FB7 A;  1WXB A;  2VC8 A;  4KBM B;  2RJC A;  1GCQ C;  4A4E A;  3QPH A;  1AWO A;  1NYG A;  3MEA A;  1MMG A;  2K5I A;  3OBW A;  1VQ5 A;  3CME Q;  2QAZ A;  2QEX A;  5KYX B;  3L1A A;  1TWB A;  4M78 E;  4RMO A;  4OGE A;  3M0P A;  4AMC A;  2PZ1 A;  1YIT Q;  1WIE A;  4AG1 C;  4ESR A;  3J80 E;  2C06 A;  4QQ6 A;  3RKW A;  2COZ A;  3OYE A;  5KCO A;  1QKX A;  4Z88 A;  3JCM P;  2XDP A;  1VQ9 T;  2ABL A;  4E7K A;  3O8V A;  1VQO Q;  2K6D A;  1QLY A;  1U3O A;  2H3J A;  1UHC A;  1YI2 T;  1N5Z A;  4AT1 B;  4LUE A;  1HXD A;  4LD6 A;  5LJ3 h;  1SHF A;  3JCM c;  1BKB A;  4E2F B;  1RAA B;  3PGG A;  1KSW A;  1M90 R;  2FZC B;  2DKG A;  2QEX T;  1K73 R;  3C12 A;  3FC3 A;  4RTZ A;  4BDY A;  1ARK A;  5FU6 C;  2OTJ T;  4OB2 B;  3E1S A;  5IH2 A;  3HP9 A;  1KC8 C;  6AT1 B;  1RI0 A;  4E7L A;  5GMK i;  2PNI A;  1NPR A;  4PK4 A;  2BKD N;  4J9E A;  2MOX A;  1D09 B;  5FRN A;  2QQB A;  4RTV A;  2X4W A;  5LJ3 e;  1VOM A;  2M0Y A;  4JS5 A;  4IUQ A;  3JCM J;  3CMA A;  4CI0 C;  3LX7 A;  5I2M A;  2QQA A;  5FRO A;  4GY5 A;  2YHT A;  2HMA A;  3MP1 A;  4JZ3 A;  4F04 B;  2ZPE B;  3I55 Q;  1K9M R;  3MP6 A;  4XU2 A;  4NL3 A;  3LWI A;  4EDU A;  3EH2 A;  3CCL A;  1QQJ A;  4M7A D;  2X35 A;  2LT1 A;  5FU7 B;  2RHZ A;  2P4R A;  4EPC A;  1JXO A;  5GAO m;  2V26 A;  2ED1 A;  4HCZ A;  5IHK A;  2R58 A;  2ZPB B;  2CP6 A;  3CMA T;  2ZZD A;  2VAS A;  1VQ4 Q;  3TU4 K;  1M3A A;  3CCS A;  4BY6 C;  3DB4 A;  2DX1 A;  2MIO A;  2LJ0 A;  2XD0 A;  4X9D A;  3GLX A;  2AKK A;  5HK0 A;  2B86 A;  2A7Y A;  2DZC A;  2YRV A;  3CC7 A;  1FMV A;  2FZK B;  1QVG A;  1S72 T;  3VYH B;  3QWY A;  3L2Q A;  4F7U F;  2NLU A;  2RO0 A;  4JDS A;  2OX7 A;  3C4S A;  1PG5 B;  2E4H A;  4M75 G;  4A53 A;  4M7D D;  4LDW A;  4M77 C;  4WTO B;  1Q82 U;  1OX8 A;  1TXQ A;  2DD4 A;  4JRI A;  2RB6 A;  3CCS T;  2P0P A;  2HCK A;  3CC7 T;  2HQX A;  3CBM A;  1IO6 A;  5KE2 A;  1EZZ B;  2QTX A;  2ROT A;  2QI2 A;  1Q86 R;  4F7U E;  1XTD A;  1YJW Q;  2CP2 A;  3UA6 A;  3HFO A;  2HL3 A;  4ZTJ A;  2J05 A;  4RCB A;  2YLC A;  2JOY A;  1KQ2 A;  3LGF A;  3X26 B;  2M9U A;  4C8Q A;  1PD0 A;  4CC4 B;  2FYK A;  3A8M B;  2EYZ A;  1G3T A;  4F14 A;  2LTO A;  4AFZ C;  1BB9 A;  4OMN A;  1GCQ A;  1LNX A;  2A37 A;  1VQ7 Q;  3M5A A;  1M90 C;  1M5Q 1;  2RM4 A;  3UPU A;  4KGX B;  2LT4 A;  4QW2 A;  1K73 C;  2KRM A;  4FSS A;  2HAX A;  4C8Q B;  2ZPG B;  1ZHI A;  2JN0 A;  3M0R A;  2FRY A;  1GFD A;  3QDR B;  1GRI A;  1JEG A;  2K57 A;  3CBP A;  2GFA A;  2K5L A;  2FHD A;  3JCM h;  2BZ8 A;  4XTU A;  3JRZ A;  1YJN A;  2JTM A;  4PJO G;  2P0Q A;  1C0M A;  1SRL A;  4E7I A;  3JB9 G;  1RUW A;  2FZG B;  2D9T A;  1I8F A;  3L2W A;  1D1B A;  1N9R A;  5D6Y A;  2R5M A;  4L6V 5;  3JCM f;  2K2V A;  2OAU A;  1K8A U;  1X75 C;  4XU0 A;  4F16 A;  2CT3 A;  4MDX A;  3JB9 H;  2KRN A;  4PLI A;  2R5A A;  1WJR A;  1K9M C;  1XNI A;  2WSC E;  3JCM e;  4ELY C;  1BBZ A;  2DO3 A;  1D0Y A;  1FYN A;  1AZG B;  3EG1 A;  4QQD A;  3CCM A;  1YJN T;  1TS9 A;  2PU9 B;  1ZA1 B;  4KUI A;  1T0J A;  2CP0 A;  1G8X A;  2GFU A;  3OMC A;  3L2R A;  2RJF A;  3PVL A;  2QK0 A;  1XQH A;  1WHL A;  2KY9 A;  1M1F A;  2KT8 A;  1D1A A;  4OMO A;  4DBQ A;  2YUN A;  3G71 A;  1OZ2 A;  3H41 A;  3VS6 A;  2DET A;  2LX9 A;  4PJJ A;  3X28 B;  1M1K R;  4HCK A;  5GAN 2;  2GBQ A;  4IUP A;  2C0I A;  2RI5 A;  4E7J A;  2RQT A;  5DM7 R;  2VUB A;  2FL7 A;  2AZV A;  3J7A F;  3CCM T;  4FL6 A;  4A4G A;  1LVK A;  4HVW A;  4YTL A;  3TCJ A;  1KD1 U;  1TUG B;  4LUD A;  1W2B P;  2CSQ A;  4Y92 A;  2RHI A;  3OW2 P;  3P8H A;  4DA4 A;  2RNA A;  2DEQ A;  1G2B A;  2I0N A;  3PIP A;  4HXJ A;  3G71 T;  3M4G A;  2CKK A;  2OTL A;  4Z8A A;  1FMK A;  3REA B;  3G6E T;  2AIR B;  2ZPH B;  2VGN A;  4E7H A;  3SFM A;  3OS1 A;  3C95 A;  3HRU A;  1YJ9 A;  3A8O B;  9ATC B;  2CDT A;  5CO7 A;  1Q86 C;  3INZ A;  3VS3 A;  2DAQ A;  1YIJ Q;  2KRO A;  1X6O A;  4KGZ B;  5FWB A;  2BZY A;  1N27 A;  3QUI A;  4A54 A;  4D8K A;  4A4H A;  2O88 A;  2GQV A;  2KT1 A;  5AYF A;  4N0A C;  3N5B B;  5D7U A;  5GAN 3;  3I9Q A;  4WF2 A;  3BDU A;  4HA8 A;  3VKI A;  2YRC A;  3QJ6 A;  3CCE A;  1OPL A;  2OTL T;  2HNI A;  4XTY A;  4X34 A;  1Z9Z A;  3MHX A;  2K79 A;  2GF7 A;  3PNW C;  1PWT A;  1FX7 A;  5A0G A;  2K4Y A;  1YJ9 T;  1WHK A;  1QKW A;  4LDY A;  1X27 A;  5J26 A;  5HCK A;  4J5Y A;  4M78 G;  1UGQ B;  5A0D A;  2DJQ A;  4BAC A;  1VQN Q;  2DPP B;  5L23 A;  2QA4 A;  1M90 U;  5CKD A;  5FWC A;  2L3R A;  4DBF A;  4J7F A;  3OA6 A;  3CXC P;  1YHQ A;  1W2B S;  4JLG A;  4C5G A;  3CCE T;  1PM3 A;  1ZX6 A;  4DBH A;  3G4S A;  2YSQ A;  2A0F B;  2COW A;  2WSF E;  2AK5 A;  1NJI U;  2RHY A;  3RNJ A;  3H0I A;  1WJS A;  1VQM Q;  4XTX A;  3M57 A;  4BD3 A;  3OQ5 A;  4R56 A;  1PRM C;  3CCR A;  2QA4 T;  2C0O A;  1ZQ1 A;  3MPU B;  1M9S A;  4AG2 C;  2E6Z A;  4A4K A;  1UGS B;  2HDA A;  1NBE B;  4JJD A;  4C8Q D;  4RKU E;  3QZ9 B;  2R57 A;  1WHM A;  4KRT A;  2FPE A;  1I4K 1;  3EG9 A;  3BY7 A;  1OV3 A;  4OGC A;  3F70 A;  1WGS A;  2EJG A;  4M75 C;  1SEM A;  1R8O B;  3X20 B;  2DTI A;  2DL5 A;  1WZO A;  2CS7 A;  1N8R U;  2LC4 A;  5CKF A;  1PKT A;  3M54 A;  1H8K A;  1TOV A;  1C6V X;  1VQ5 Q;  4QVD A;  2PUK B;  3X24 B;  1Q7Y R;  3QYG B;  1VQK Q;  2PVO B;  1M1K C;  3NTI A;  2RJE A;  3TSW A;  1MV0 B;  4J9F A;  1BU1 A;  2JTE A;  4C5H A;  5LJ3 d;  2EIF A;  3JCM W;  3CXC S;  3PIO A;  2QDL A;  3VS4 A;  4C92 F;  3EG9 B;  3RKY A;  4M7D B;  5GAN 5;  2DBK A;  2P84 A;  2O4X A;  4EIK A;  4ZGJ B;  2ED0 A;  2RI2 A;  2JVV A;  4HT9 A;  2JT4 A;  2EYW A;  2QQ9 A;  1NG2 A;  1LJO A;  1MMD A;  4JPB W;  4BI8 B;  4L59 A;  4Z02 A;  2RD1 A;  2EVR A;  3NTK A;  4EMH A;  2MAM A;  4C92 E;  2PQW A;  4JJC A;  1ZUY A;  3FB9 A;  2QXF A;  4OVA A;  1Q86 U;  1NE8 A;  1UDL A;  2GQI A;  4J9C A;  2QAS A;  3VS7 A;  3NHN A;  2WSE E;  1NZ9 A;  2HQH A;  2ZCF B;  1RAF B;  3JCM V;  4ZN1 A;  3CMA Q;  2YUP A;  4J9H A;  4EMK C;  4ORZ A;  5C6S A;  3SDZ A;  3ASK A;  4FW1 A;  1B34 A;  2SRC A;  4L5G A;  1U1T A;  2YXY A;  3M0U A;  4PJO C;  2RK1 A;  1QVG P;  4RG8 A;  3CBO A;  2MI6 A;  1Y7X A;  3IQL A;  1EFN A;  4F7U G;  1VQ6 T;  3UAT A;  2EQM A;  2AKL A;  2RPN A;  3CCL Q;  3CC2 T;  3NPF A;  4J9B A;  4N0A A;  2CZ6 B;  2OTJ A;  4FSX A;  3C0C A;  1J3T A;  1SRM A;  1FMW A;  2BIV A;  2SEM A;  1M30 A;  3LW5 E;  3OYD A;  2RHU A;  1B34 B;  3VUB A;  1BIB A;  1VYT A;  2DTH A;  3OYG A;  2O31 A;  3AT1 B;  1CKB A;  3CC7 Q;  4M7A F;  1S1N A;  2E64 A;  1I0C A;  3TQ7 P;  4FYX B;  4BE1 A;  3G7Z A;  3OYK A;  5KE3 A;  3URG A;  2IIM A;  4E7S A;  2XKO C;  1WXU A;  2CP7 A;  1ZUK A;  2XDB A;  3M59 A;  2RH2 A;  1YP5 A;  2QTV A;  4M77 D;  2CZ0 B;  3JCM Q;  2KMT A;  1VQL A;  3L2U A;  2FRW A;  2D0Q B;  4MMK A;  2X3W D;  2J6O A;  1H3H A;  3QYH B;  1QVG S;  4M7A E;  1YWO A;  2VKN A;  2EQK A;  3JCM g;  4JLI A;  3THK A;  4MZM A;  3REB B;  1UHF A;  3E9F A;  1H92 A;  2L2P A;  2E12 A;  3QXE B;  1G3W A;  1AD5 A;  3M0T A;  1Q7Y C;  2DM1 A;  4KGV B;  4OML A;  3R6O A;  3VUZ A;  4M7D F;  3H8Z A;  2EFI A;  1S72 A;  4XAX B;  5GMK l;  3H6Z A;  1M1K U;  4OMP A;  1N9S A;  1G83 A;  4PKC C;  1VQL T;  3QO3 A;  1QP2 A;  1I07 A;  1X69 A;  5GAM f;  5IXF A;  4ZN3 A;  1PCX A;  4M75 A;  4ZNX A;  1OUL A;  2FEI A;  3CME A;  4II1 A;  1N6A A;  5L8R E;  4XTV A;  3RMQ A;  3CPF A;  1YIT A;  3JCM d;  3VYG A;  2DA9 A;  4M7D E;  3RBB B;  5GAM e;  2BE9 B;  2E70 A;  3PMT A;  5GJV B;  1ZSG A;  2K3X A;  4Z89 A;  3JCM b;  4M78 C;  1IB8 A;  1R0B G;  1VUB A;  1SPK A;  3EG2 A;  1AWW A;  3P8D A;  3GOX A;  2RF0 A;  4M75 B;  5DLO A;  3CME T;  1G3Y A;  1YWP A;  3OS2 A;  2E1H A;  3PE0 A;  3DLM A;  4XQ3 A;  4RTT A;  1YIT T;  2X4J A;  2L89 A;  4KH1 B;  2DL4 A;  4E6R A;  1E6G A;  2RI3 A;  4RUG A;  5KH6 A;  2E3I A;  1R0C B;  2DVE A;  2YUO A;  2DTO A;  2FVU A;  5GAN 7;  3HRT A;  1PC0 A;  1VQO T;  1LPL A;  4C0G A;  2QQS A;  1FWZ A;  4FM4 B;  3V7S A;  5DLQ E;  5CKE A;  2C0T A;  2D8J A;  1NLP C;  1KQ1 A;  4AFQ C;  5HK3 A;  1U1S A;  2EGC A;  2ZPI B;  1UE9 A;  5GMK j;  4RTX A;  2CP3 A;  4EMK A;  2JM8 A;  1MUZ A;  3GPL A;  4OB0 B;  4IIM A;  3CCV A;  4C0Z A;  4PJO A;  3CC4 A;  2XID A;  1OYX A;  2EW3 A;  1ACM B;  2F2X A;  5HY6 A;  4PJM A;  2QQR A;  1BCM A;  2KNB B;  4OMQ A;  3CCU A;  3KBG A;  1Y71 A;  3RES A;  1QCF A;  1C1A A;  3QKJ A;  2LQN A;  3Q1J A;  4AFU C;  3EGD A;  4XTW A;  4B9X A;  1VQ4 A;  1K0X A;  1BI0 A;  1WI7 A;  1IRE B;  1Y96 A;  5KYY A;  1ZSZ C;  4XK8 E;  1F1B B;  2LCC A;  5GJW B;  4EMK B;  1QVF A;  1OU8 A;  2EYX A;  3GNG A;  3CCV T;  4PL6 A;  1UJY A;  2X9H A;  4IUR A;  3BE3 A;  3CC4 T;  3A8H B;  4E7Z A;  1KC8 U;  4PJO B;  2KYM A;  2XI9 A;  1Y57 A;  4FW2 A;  5C0M A;  3CCU T;  2HQE A;  2G3R A;  3NGP A;  5IXB A;  2LRQ A;  4RTW A;  1A0N B;  5GAO q;  3MCA B;  1Q95 G;  2W0Z A;  2JW4 A;  3EGD B;  3JCM X;  3CEY A;  2JS2 A;  1ZBJ A;  1RAB B;  1V29 B;  3GBQ A;  1VQ4 T;  1B7T A;  1UGP B;  1VYU A;  4BE0 A;  1Y96 B;  5KYY B;  1NLO C;  1RAH B;  2HSP A;  1RAG B;  2VV5 A;  3CCE Q;  3EGX A;  2JJ9 A;  2KDS A;  2VXE A;  2NUT A;  3R6N A;  1MMN A;  1BCO A;  2QGG A;  1YNZ A;  3OBY A;  1YJW A;  2MPX C;  2ROL A;  1G5V A;  5A0L A;  3A8G B;  2MWO A;  2VGM A;  3G6E A;  1UG1 A;  2DK3 A;  1SF9 A;  2DXB A;  4HCB A;  2X51 A;  5FU6 B;  1JBM A;  1QP3 A;  3VS1 A;  4JS4 A;  2A36 A;  1EIF A;  2F69 A;  3UDC A;  4B6M A;  2COY A;  1YHQ Q;  1WHG A;  2DEU A;  1WQW A;  4ATO A;  5KYN A;  4R55 A;  3HKS A;  4PJN A;  3EGX B;  4X9C A;  3G4S Q;  3FLG A;  1UEB A;  2NUT B;  2XK0 A;  4Y91 A;  1VQ7 A;  4O5V A;  4JUV A;  1YJW T;  3OYB A;  5GMK h;  2DL7 A;  3OSV A;  1JXM A;  3TSZ A;  2DL8 A;  5LL6 S;  1KG1 A;  3QG1 A;  3OYJ A;  3H0F A;  3OMG A;  5IT9 E; 
#chains in the Genus database with same CATH homology
 2O9S A;  4RTZ A;  3TSW A;  1MV0 B;  2JS0 A;  3EHQ A;  2CT4 A;  4J9F A;  1BU1 A;  1ARK A;  2JTE A;  2EGE A;  2J6K A;  5IH2 A;  2QDL A;  3VS4 A;  2KR3 A;  2RQV A;  3M0Q A;  1AWX A;  2XMF A;  2PNI A;  2DBK A;  4J9E A;  2MOX A;  4EIK A;  3SEM A;  4RTV A;  4RTY A;  1KIK A;  2M0Y A;  2ED0 A;  2VWF A;  5FW9 A;  4J9D A;  2JT4 A;  1UFF A;  2NUZ A;  2EYW A;  1KFZ A;  1JQQ A;  1M3C A;  1NG2 A;  4A63 B;  4WCI A;  3EHR A;  1GBR A;  4JPB W;  4JZ3 A;  1NEG A;  1BK2 A;  1NYF A;  4IIO A;  1RLQ C;  1WDX A;  2EVR A;  1X2Q A;  4JJC A;  2JMC A;  2D8H A;  1ZUY A;  3VRZ A;  1X2K A;  2P4R A;  1JXO A;  2LZ6 B;  1MV3 A;  2ED1 A;  5IHK A;  1UDL A;  2GQI A;  2L3Q A;  4J9C A;  3FJ5 A;  3TVT A;  3VS7 A;  2DRK A;  1SHG A;  3NHN A;  3ULR B;  4R0K A;  2YUP A;  4J9H A;  4ORZ A;  4JJB A;  1B3Q A;  2ENM A;  1AEY A;  1M3A A;  1B07 A;  2SRC A;  1CKA A;  1PNJ A;  1M3B A;  2DX1 A;  2MIO A;  2LJ0 A;  3M0U A;  1WYX A;  2AKK A;  2B86 A;  2A08 A;  2KXC A;  1TUD A;  3IQL A;  1EFN A;  1JU5 C;  3UAT A;  2CH4 A;  4GLM A;  2OAW A;  2AKL A;  4J9I A;  2RN8 A;  2RPN A;  3QWY A;  4JZ4 A;  1HSQ A;  3NPF A;  1W70 A;  3JV3 A;  4J9B A;  1YCS B;  2DF6 A;  1QWE A;  2DLP A;  3C0C A;  1GBQ A;  1ZUU A;  1SRM A;  2O9V A;  1J3T A;  4M4Z A;  2GTJ A;  2SEM A;  1HJD A;  1M30 A;  1YN8 A;  2PTK A;  2HEQ A;  3A98 A;  2HCK A;  4J9G A;  1VYT A;  1W6X A;  2BTT A;  1IO6 A;  2O31 A;  2ROT A;  1W1F A;  2O2O A;  1CKB A;  2VVK A;  1S1N A;  3UA6 A;  1AVZ C;  2J05 A;  1I0C A;  2LX7 A;  2DRM A;  1NM7 A;  1UTI A;  4CC4 B;  2IIM A;  2K3B A;  1E7O A;  1WXU A;  2EKH A;  2CUD A;  2EYZ A;  2F2V A;  1PHT A;  1ZUK A;  4HVV A;  1YP5 A;  3CQT A;  4F17 A;  2DIL A;  2YT6 A;  4CC2 A;  4F14 A;  1PKS A;  4AFZ C;  1U5S A;  2FRW A;  2X3W D;  1BB9 A;  1Z9Q A;  4GBQ A;  2CRE A;  2J6O A;  4OMN A;  1H3H A;  1XOV A;  1GCQ A;  2KRS A;  2LJ1 A;  1YWO A;  2RQU A;  2VKN A;  1GFC A;  2ECZ A;  4LE9 A;  2A37 A;  3THK A;  3REB B;  1UHF A;  1H92 A;  5IHI A;  2L2P A;  3VS0 A;  4LN2 A;  2LJ3 A;  2KRM A;  4FSS A;  2KGT A;  1AD5 A;  3M0T A;  1SSH A;  1WXT A;  2DM1 A;  1HD3 A;  4OML A;  2M51 A;  3M0R A;  2FRY A;  1GFD A;  1X6G A;  2JXB A;  3VS5 A;  1GRI A;  1JEG A;  1OPK A;  4OMP A;  1G83 A;  2BZ8 A;  1K9A A;  1RI9 A;  2GTO A;  1I07 A;  2KBT A;  1SRL A;  1WFW A;  1X69 A;  5IXF A;  2JM9 A;  4HVU A;  1RUW A;  2DYB A;  2J7I A;  4ZNX A;  3SHW A;  1T0H A;  2FEI A;  4QT7 A;  2RQW A;  1UGV A;  2DA9 A;  2CT3 A;  4F16 A;  3RBB B;  3LH5 A;  3PVQ A;  2KRN A;  1CSK A;  2OJ2 A;  5GJV B;  1ZSG A;  1K0S A;  2GGR A;  2DMO A;  4Z89 A;  1BBZ A;  2FPD A;  4CC7 A;  3O5Z A;  2EYY A;  1M8M A;  1FYN A;  1AZG B;  1LCK A;  3EG1 A;  2X3X D;  4K11 A;  1SPK A;  2V1Q A;  3EG2 A;  3NMZ C;  1WLP B;  2LNH B;  1T0J A;  1AWW A;  2DE0 X;  3EGU A;  2RF0 A;  1PRL C;  3PVL A;  4RTU A;  2YUQ A;  2FG0 A;  1AZE A;  2KT8 A;  1OOT A;  1YWP A;  2CSI A;  4OMM A;  4OMO A;  3PE0 A;  4RTT A;  2YUN A;  4AFS C;  1GL5 A;  2DL4 A;  3H41 A;  3VS6 A;  2FPF A;  4E6R A;  2L0A A;  1AWJ A;  1E6G A;  2L3P A;  4RUG A;  2EQI A;  1U06 A;  2RMO A;  2YUO A;  4HCK A;  2H8H A;  2GBQ A;  2FO0 A;  2C0I A;  2CH4 W;  2GNC A;  2RQT A;  3EG0 A;  2AZV A;  2ESW A;  2C0T A;  2D8J A;  1NLP C;  2W10 A;  4HVW A;  4AFQ C;  3ZL7 C;  1UUE A;  2EGC A;  4LUD A;  5ECA A;  1WA7 A;  2CSQ A;  4Y92 A;  4X1V A;  1UE9 A;  4CC3 A;  4RTX A;  2RNA A;  4LNP A;  3M0S A;  2JM8 A;  1MUZ A;  3VRY A;  1G2B A;  2I0N A;  2LMJ A;  4HXJ A;  2KXD A;  1KJW A;  3EG3 A;  4IIM A;  1OEB A;  2A28 A;  4Z8A A;  1FMK A;  3REA B;  3H0H A;  2LCS A;  1VYV A;  2EW3 A;  2F2X A;  1K4U S;  2KNB B;  4OMQ A;  1RLP C;  2LP5 A;  2CDT A;  2KYB A;  1WX6 A;  1QCF A;  3VS3 A;  2AZS A;  5EC7 A;  2LQN A;  2DVJ A;  3U23 A;  1QWF A;  2MCN A;  2YDL A;  4AFU C;  1JO8 A;  2KRO A;  5FWB A;  2J06 A;  2BZY A;  4D8K A;  2K2M A;  1V1C A;  1M27 C;  3KFV A;  1Y0M A;  2V1R A;  2F2W A;  1T3S A;  2JMA A;  2O88 A;  2KT1 A;  1K0X A;  2NWM A;  1WI7 A;  5IHN A;  3I9Q A;  2D1X A;  2CUB A;  2RQR A;  5GJW B;  1OPL A;  2D0N A;  1E6H A;  2EYX A;  1UJY A;  1Z9Z A;  2K79 A;  2EGA A;  2KYM A;  1PWT A;  1UEC A;  1UJ0 A;  1Y57 A;  2K7A A;  2KE9 A;  3UF4 A;  1I1J A;  5I11 A;  1QKW A;  1X27 A;  3NGP A;  5HCK A;  5IXB A;  2DJQ A;  2DNU A;  4RTW A;  1A0N B;  4D8D A;  5L23 A;  2W0Z A;  2JW4 A;  2BZX A;  5FWC A;  2JS2 A;  1ZBJ A;  2LQW A;  3GBQ A;  3I35 A;  2G6F X;  5I22 A;  2EPD A;  1VYU A;  3I5R A;  1ZLM A;  4DEX A;  2DBM A;  2KEA A;  1NLO C;  1ZX6 A;  4DEY A;  2E5K A;  2HSP A;  2YSQ A;  1K76 A;  1K1Z A;  1VA7 A;  2AK5 A;  2EBP A;  3R6N A;  3RNJ A;  1WXB A;  3H0I A;  1YNZ A;  1GCQ C;  1TUC A;  2OI3 A;  1AWO A;  1NYG A;  2ROL A;  2L3S A;  2K9G A;  1PRM C;  3I5S A;  1NEB A;  3M0P A;  2PZ1 A;  1WIE A;  4AG1 C;  4ESR A;  2C0O A;  1UG1 A;  4AG2 C;  1TG0 A;  1GCP A;  1QKX A;  4Z88 A;  2HDA A;  4JJD A;  3VS1 A;  2ABL A;  2A36 A;  2K6D A;  1QLY A;  2J6F A;  4KRT A;  1U3O A;  2FPE A;  1X6B A;  1T3L A;  1UHC A;  1OV3 A;  2DL3 A;  1AOJ A;  1N5Z A;  3VS2 A;  4LUE A;  1X43 A;  1SEM A;  1SHF A;  2DL5 A;  2HBW A;  1KSW A;  1ABQ A;  2DL7 A;  3QWX X;  1JXM A;  3TSZ A;  2DL8 A;  1PKT A;  1H8K A;  1ABO A;  3UA7 A;  3H0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...