4RTYA

Crystal structure of the c-src-sh3 domain in complex with the high affinity peptide app12
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
58
structure length
58
Chain Sequence
MTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the c-Src-SH3 domain in complex with the high affinity peptide APP12
rcsb
source organism Gallus gallus
molecule tags Protein binding
molecule keywords Proto-oncogene tyrosine-protein kinase Src
total genus 11
structure length 58
sequence length 58
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4rtyA00
1UJYA 2J6FA 3TVTA 1NEGA 2CH4A 3REAB 1M3BA 2KYBA 2MCNA 3NMZC 1KIKA 2DL3A 1PWTA 2AK5A 3VRYA 3VS1A 2JW4A 1G83A 1GFCA 3TSZA 5IHKA 1LCKA 1T3SA 2K3BA 4LE9A 2W10A 2JS0A 2EYYA 2KRMA 1K1ZA 1T0JA 1ZBJA 2J05A 2GQIA 4CC7A 2JS2A 1I07A 3NHNA 3PE0A 2DYBA 1VYUA 1T0HA 1GCQC 2CT4A 4JJCA 1YCSB 1T3LA 4AG2C 1U06A 1J3TA 1AOJA 1CSKA 2BTTA 4JPBW 2L3SA 1RI9A 5GJWB 1GCPA 1X6BA 4CC4B 1SHFA 1WXTA 2DMOA 3I9QA 2JXBA 2QDLA 2B86A 1GL5A 3REBB 4EIKA 2A36A 1AWXA 3GBQA 2OJ2A 1FYNA 1MV3A 1BK2A 4Z8AA 2DJQA 4JJDA 1PRLC 4RTYA 3H0IA 1OPLA 2CSIA 1S1NA 2RQVA 1VA7A 2A28A 1AD5A 1M27C 1M3AA 3QWYA 1NLPC 2L2PA 2M51A 2O31A 4RUGA 4RTZA 3FJ5A 1UG1A 2DILA 1H8KA 2CSQA 1BBZA 2EGAA 2RMOA 2GGRA 1RUWA 3RBBB 4AFUC 2DNUA 1YWPA 1XOVA 2EYXA 1X69A 2F2VA 1X2KA 2VVKA 4GLMA 4LUEA 1GCQA 2F2XA 1OV3A 3IQLA 4A63B 1ZUUA 4DEXA 3I5SA 3RNJA 4E6RA 1NLOC 4HVUA 4F17A 2YUQA 1KJWA 1X6GA 2NWMA 2W0ZA 3SHWA 1X43A 2LZ6B 1Y57A 1ZUKA 2CDTA 4D8DA 3EG1A 2LX7A 2ED0A 4J9DA 2YT6A 2KT8A 1E7OA 2HBWA 2KBTA 2L3QA 1BU1A 3PVLA 1GRIA 1MV0B 1QLYA 1VYTA 2GBQA 1U5SA 4R0KA 1GBQA 2O9VA 2YDLA 4J9CA 1AWOA 1WI7A 1AWJA 4OMMA 4CC3A 2D1XA 1AWWA 2LQNA 2YUNA 1FMKA 1WDXA 2KXDA 4JZ4A 4OMLA 3ULRB 2FRYA 1K0XA 3A98A 2V1RA 2D8HA 1RLPC 1HJDA 2KR3A 2CUDA 2XMFA 2GTOA 1YP5A 2DL8A 2AZVA 2GTJA 1ABOA 1U3OA 2DL4A 3O5ZA 3JV3A 1M8MA 1RLQC 1WXBA 4OMOA 1UHCA 1UTIA 1CKBA 2RQRA 2HCKA 2DBMA 2K6DA 2K7AA 3M0UA 5IHIA 3SEMA 2KRSA 2DRKA 2RPNA 3UF4A 3U23A 5IXBA 2EQIA 1OPKA 2RQWA 2L3PA 1K0SA 1TUCA 1I1JA 5FW9A 2KYMA 1UE9A 1YN8A 5I11A 2RN8A 1UDLA 1WYXA 2ESWA 1UJ0A 1GFDA 3C0CA 4J9BA 1QWFA 2EGCA 1YWOA 1SSHA 1WFWA 2JMCA 3NPFA 1JO8A 2PTKA 2KRNA 1B07A 2LJ0A 4J9FA 1SPKA 4HVWA 1PKSA 1W70A 2NUZA 5FWBA 2EYZA 1KSWA 1ZLMA 2CUBA 2FG0A 4OMNA 2BZXA 4IIOA 4AFQC 3M0TA 3CQTA 2MOXA 2DE0X 2C0OA 2C0TA 4F16A 4ZNXA 3VS2A 3I35A 1JQQA 1X27A 3VS6A 1NG2A 2G6FX 2JMAA 2YUPA 3EG3A 2EW3A 2D0NA 2ENMA 1K76A 2E5KA 2FPDA 2C0IA 2AZSA 4Z88A 1UUEA 2K79A 2EGEA 2HEQA 1EFNA 4RTVA 2DX1A 1PRMC 2LJ1A 4J9EA 3M0RA 4WCIA 3QWXX 2J7IA 4M4ZA 3VS4A 1PKTA 1WLPB 4JZ3A 3UATA 4LNPA 1WIEA 2ROLA 4J9IA 4JJBA 2JTEA 1BB9A 3THKA 2EPDA 4F14A 1E6HA 3EGUA 2AKKA 5EC7A 2EVRA 3M0SA 5IHNA 1SRLA 3UA7A 2ABLA 1SEMA 1TG0A 2X3XD 1B3QA 4ORZA 3VS3A 4KRTA 2CH4W 5L23A 2DLPA 3LH5A 4RTUA 3PVQA 1QCFA 1V1CA 1UECA 1KFZA 1G2BA 1Z9ZA 2D8JA 1NM7A 3H0HA 2DBKA 1OEBA 1UHFA 2RF0A 5IXFA 4AFZC 3ZL7C 1VYVA 1WXUA 4RTXA 1IO6A 1ZX6A 2EBPA 3EHRA 2LJ3A 4RTWA 2PZ1A 1H3HA 1PNJA 2VWFA 2CREA 1MUZA 1ARKA 2BZ8A 1N5ZA 4CC2A 1W6XA 1UFFA 1SRMA 2OI3A 4AG1C 2H8HA 3H0FA 1HSQA 1Z9QA 2FPFA 1JEGA 2A08A 2K9GA 1I0CA 2FO0A 2EKHA 2KT1A 4HXJA 4RTTA 2LCSA 2EYWA 1W1FA 1ZUYA 1PHTA 1X2QA 1UGVA 2L0AA 2CT3A 1AZEA 4LUDA 1JXMA 2JM8A 1M3CA 4Y92A 2A37A 2FEIA 1NYFA 1Y0MA 2JT4A 1WA7A 2M0YA 2PNIA 2KNBB 2VKNA 4J9GA 1E6GA 4ESRA 2P4RA 2DL7A 4J9HA 3VS5A 4D8KA 2KXCA 2DA9A 1JXOA 2RQTA 2KROA 2ROTA 5ECAA 1QKXA 2RQUA 3TSWA 4K11A 2KGTA 2FRWA 2JM9A 3NGPA 1YNZA 2O2OA 2O88A 4X1VA 2YUOA 4FSSA 2ED1A 2J6OA 1WX6A 2LMJA 4GBQA 1HD3A 4QT7A 1QWEA 2F2WA 2KE9A 3EHQA 2LQWA 2LP5A 2I0NA 3M0QA 2BZYA 1AZGB 2HSPA 4OMPA 2K2MA 2DM1A 1A0NB 2IIMA 2LNHB 2O9SA 2SRCA 4HVVA 2ECZA 2OAWA 5GJVB 2HDAA 1QKWA 5HCKA 3EG2A 1OOTA 1GBRA 2X3WD 1K9AA 1AVZC 1ABQA 2YSQA 2J06A 1NYGA 3VS7A 3H41A 2DF6A 4OMQA 3VRZA 2SEMA 4LN2A 4AFSC 4IIMA 1K4US 2AKLA 1ZSGA 2V1QA 4HCKA 1M30A 3I5RA 2J6KA 2FPEA 4Z89A 1CKAA 4DEYA 2KEAA 3UA6A 2DL5A 3M0PA 5I22A 1AEYA 5IH2A 3EG0A 2DRMA 1NEBA 2MIOA 2GNCA 2DVJA 1JU5C 1SHGA 1H92A 3VS0A 3R6NA 3KFVA 5FWCA 2RNAA 1TUDA
chains in the Genus database with same CATH superfamily
5HK3A 4LXCA 1NEGA 1KQ1A 2DETA 4PLLA 3G71T 4ATOA 1LOJA 5LJ3f 3OW2S 3UWNA 2D9TA 1G83A 1GFCA 3TSZA 1YJNQ 2E6NA 2W10A 4BDYA 4XTVA 4ZGEB 3OY9A 2MI6A 1RI0A 4CC7A 3X26B 2XG8D 1GCQC 3JSCA 1YCSB 1J3TA 2E41A 2QI2A 2MK5A 1CSKA 1GCPA 4CC4B 4X34A 4DQ2A 4QVZA 2GFAA 3KXTA 1XQHA 4PJOB 2JXBA 3UDCA 1GL5A 5C6SA 1AWXA 1BK2A 2DJQA 4JJDA 3I55T 1W2BS 4RTYA 3RKYA 1OPLA 4PLIA 2NUPA 1XNIA 3KBGA 5LJ3g 2D6FA 5KYWB 2X4YA 1Y07A 3JB9H 3CD6A 1VA7A 4XU1A 2A28A 1AD5A 3BY7A 2E3HA 3H8ZA 2M51A 2FZKB 4RTZA 3FJ5A 4XU0A 3J80E 1VQ4Q 1IRXA 1BBZA 1PC0A 1FMWA 2GGRA 1U1TA 3A8HB 2EYXA 3ER0A 4IUTA 2ZPFB 5GANj 3JRZA 1X2KA 2VVKA 2HAXA 4LUEA 1M5Q1 4PJOE 1JBMA 1GCQA 1TXQA 1OV3A 3RMQA 3IQLA 3GIBA 5GAOq 1PD0A 1VIFA 2YWWA 1JB0E 3HSBA 3RNJA 4J6XA 2LQ8A 4E6RA 1V29B 1YIJA 4F17A 3CCRT 2CYZB 2W0ZA 1RACB 3E9FA 2YLBA 1VOMA 4L5GA 4JS5A 4PJOC 3P8BB 4RCCA 3CD6T 3DB4A 4B9WA 1VQ5T 2ED0A 3OQ5A 1N9SA 2HBWA 3FIFA 2L3QA 3MO8A 4PFZA 3RESA 4M7AG 5GAOr 5FU7B 3EH1A 1MV0B 1IB8A 4N4HA 1QLYA 1VYTA 2VXEA 3L1AA 3CCVA 4PK4A 2KI7A 2I2LA 3CCJQ 4M75G 3M57A 5KE3A 1NPRA 1WDXA 5GMKl 4B9XA 4OMLA 2FZGB 1K0XA 3A98A 1C1AA 1RLPC 2DXBA 4YTLA 2KR3A 2CUDA 2XMFA 4EMKB 1U3OA 1RAFB 4M7AF 3JV3A 2DTHA 2LCCA 5LJ5j 1RLQC 2YLCA 4JLIA 2PU9B 1H3ZA 9ATCB 2HCKA 3MP1A 3LWIA 2K5LA 1SF9A 2JNGA 3M0UA 4A53A 3OYDA 4C8QD 2IVWA 3U23A 2KAFA 3QZ9B 5IXBA 1OPKA 3BDUA 5CKDA 1I1JA 5DY9A 2VXFA 3P8DA 4BI8B 4LD9K 3QUIA 5I11A 1YHQT 2K3XA 3JB9F 1UJ0A 2E5QA 1QWFA 2RJCA 2IG0A 1R0BG 2K57A 4L6V5 1W4SA 1SPKA 3JCMh 1ZLMA 2RHYA 3M4YA 2PQWA 3N5BB 2A3LA 5LJ5e 2RK1A 2M16A 2DE0X 2C0TA 1WJQA 4F16A 1VQOQ 2BKDN 3OW2P 1VQNA 3VS2A 3EFOB 1WQWA 3VV0A 3VS6A 2VYTA 1NG2A 2CP7A 4WF2A 1VQMQ 5GAMh 1Q82U 2MWOA 4M77D 4J5YA 4RMOA 1UUEA 2QA4A 3L2ZA 2EGEA 3TCJA 4HCZA 4RTVA 4J9EA 1MGQA 3M0RA 1YJ9A 1LNXA 4C8QC 4Y28E 2MMPA 3S6WA 2J7IA 4M4ZA 2QG9B 2DEQA 3LH0A 1QVGP 2EPDA 3JAME 3ASKA 3M5AA 5IHNA 3UA7A 1YJNA 2ABLA 1K73U 3CMAT 5GANf 1SEMA 2CP3A 4DBQA 2CH4W 3WVEB 1RAAB 5D7UA 1BCOA 3LH5A 2XIDA 1QCFA 1VQ5A 1V1CA 5GANh 1G2BA 4GY5A 3LGLA 2EIFA 2RF0A 3ZL7C 1TTHB 5IAYA 1D0YA 1WXUA 4RTXA 2RK2A 3EHRA 2LJ3A 1WHGA 4M78G 2XK0A 1SG5A 4C8QF 3FRNA 1ARKA 4BUGA 1KQSA 2OI3A 4AG1C 3H0FA 3CMEQ 5CK9A 2A08A 4M7DB 4QQ6A 4C0FA 3I55Q 4M7AD 2K5IA 4M78B 4RTTA 5KYNA 1W1FA 1X2QA 3JCMQ 1D1BA 4LUDA 2OAUA 4XAXB 1JXMA 2QQSA 3PT9A 1WJSA 4ZN3A 2HNIA 3OYHA 5LJ5h 2COYA 4HA8A 3CC7Q 2M0YA 2PNIA 1TS9A 2KNBB 2VKNA 4J9GA 2Y4YA 4PJOF 2DZ9A 1NBEB 1ZHIA 5LJ3h 5D6YA 5HK0A 1YITQ 2DA9A 2MYSA 4A54A 5ECAA 1VQ8Q 2KGTA 5CKHA 2FRWA 3QBYA 4V2SA 4JUVA 1VQPQ 3OYFA 3CXCP 3CPWS 2YUOA 4QKUA 4PJNA 3BFMA 3CCST 4AT1B 3ZEHA 3V7RA 2KE9A 2LQWA 4C0GA 4MZMA 2E1HA 1BI2A 2HSPA 3RUXA 1K9MC 2EFIA 2GF7A 1A0NB 1Q7YU 4HVVA 2QDYB 6AT1B 3CCRQ 2HDAA 5HCKA 2HKQB 2F1LA 1AVZC 4RCBA 4M7DA 2RHZA 5AT1B 5C0MA 1Q86U 2YSQA 4M7AC 2GFUA 2OTJA 1QMCA 2DF6A 5CKEA 4OMQA 2NUTA 2EJGA 3CC2Q 1ZSGA 2EQJA 1K8AC 2JJ9A 2R5MA 5GANd 1CKAA 2M1HA 3M54A 4DEYA 2KEAA 3OMCA 5I22A 3CBPA 3EG0A 1VQ6T 3PMIA 2DRMA 3EGXA 1NEBA 2RHUA 1KHCA 2EJ9A 1S72A 2H3JA 3FDRA 3FEOA 1MMAA 3P8HA 2COWA 1G5VA 1O9SA 3CCLT 3OYKA 2AT1B 2VASA 5GMKj 4LD6A 4O6JA 3TVTA 3QYGB 2MCNA 5LL6S 3PMTA 1PWTA 2AK5A 4MMLA 3E9GA 2QXFA 1VQOA 4EPCA 1M90C 3INZA 5IHKA 1LCKA 4LE9A 1I81A 3E2UA 4KGZB 4A4HA 1KQ2A 2J05A 3SDZA 2GQIA 5LJ5d 1VUBA 2P0PA 1QVFP 1I07A 3NHNA 2HSEB 2PVDB 1M1KR 2CT4A 1EIFA 1U06A 1AOJA 3FLGA 1TUGB 2AIRB 2L3SA 1RI9A 1X6BA 3CPWP 1SSFA 1VQLT 2QDLA 2X4XA 3MJXA 3REBB 2QEXT 3RIRA 2OJ2A 1MV3A 1PRLC 3DKMA 2P84A 4KUIA 4J6WA 2DXTA 3A1PA 3I56Q 1Q81R 3DB3A 4E7JA 1M90R 3QKJA 4BY6B 1M3AA 1NLPC 4HKEA 3G71Q 2L2PA 3MEAA 5FU6C 1UG1A 1TSFA 3OS1A 1H8KA 4ME7A 4DOWA 1W2BA 3A8LB 2EGAA 1RUWA 1Q86R 1YIJQ 1YWPA 1D0XA 4CI0C 1XOVA 2M0OA 1Q95G 3UPUA 1X69A 5D6WA 4QW2A 1WGSA 1PD1A 2VUBA 1UGSB 3G7ZA 3CCSQ 5KE2A 2F2XA 2ATCB 1WQ7A 1K73C 1ZUUA 2ZPBB 3OSSC 3CCRA 3HKSA 5LJ3e 1RADB 1KJWA 3RKWA 2LT4A 1RAIB 2OTJT 4HCCA 2CDTA 1Y96A 4F7UE 3OYGA 5KCHA 2XDBA 4J9DA 1E7OA 5KYXB 2KBTA 1BI3A 1GRIA 3OA6A 1YJ9Q 1EZZB 1U5SA 4R56A 2QK0A 3PIOA 4DBFA 1VQ7Q 4MDWA 2YDLA 5GMKh 3E19A 5EG2A 1YJWT 5CCAA 4J9CA 2RHIA 1AWJA 4C92D 1AWWA 1KD1C 2V8KA 8AT1B 1KK7A 3VUZA 1FMKA 2P4TA 2KQWA 4JZ4A 2DPPB 3DLMA 3H6ZA 2XHCA 2P0QA 1YP5A 2RM4A 1KC8C 2QQ9A 5LJ3j 1VIEA 2DL4A 1BIBA 1Q82C 1IHVA 2K2VA 2XU8A 4F7UB 3CCJT 1M8MA 1M2VA 2HQHA 2CZ6B 4OMOA 3CC7T 1UTIA 1CKBA 3GP8A 3V7CA 1OX9A 1PM3A 2DBMA 2K6DA 2K7AA 1QVGS 4OB1B 1B34A 1YITT 4M7DF 2DRKA 2DD5A 2RPNA 2L3PA 1K0SA 1TUCA 4F7UG 2V26A 1K9MU 2KMTA 2KYMA 1VQPT 1VQLQ 2QYZA 1UE9A 1M1KU 1YN8A 2QASA 1WYXA 2XICA 4E7HA 2RH2A 1Q81U 3V8JA 4ELYC 3G4ST 1NJIC 3CCVT 3VUBA 4FIBA 1SSHA 4QVCA 1WFWA 2JMCA 1JO8A 5KYWA 2KRNA 1N9RA 2E3IA 4J83A 3PGGA 5CR2A 4J9FA 4JRIA 3V8LA 3G6ET 1PKSA 2CUBA 2FG0A 2CZ1B 4M7DC 1M90U 4IIOA 2JVVA 3M0TA 3CQTA 5D6XA 3V7SA 4ZNXA 1BIAA 1X27A 1YIJT 1TWBA 1OU8A 2NLUA 3SWNC 4OGCA 2G6FX 2DERA 2DAQA 2YUPA 2EW3A 2ENMA 2F69A 1K76A 1RAGB 2FPDA 2AZSA 3CCUT 2K79A 4C5HA 3JCMJ 1M4ZA 3CCUA 2DK3A 3JCMX 2ZPIB 2ZAEA 1I8FA 4PJMA 2QEXA 1VQOT 3EH2A 1QQJA 4M78D 3VS4A 1PKTA 1WLPB 4JZ3A 1QVFA 1WIEA 2ROLA 4J9IA 4JJBA 4BI4A 3L2WA 4C92G 2CZ7B 1OULA 5KYUA 4VUBA 1ZBXA 4OB2B 2X3XD 1B3QA 4ORZA 3VS3A 3VU3C 1MMNA 4KRTA 2EQMA 1YCYA 2LDMA 2DLPA 5I21A 4RTUA 4E2FB 4KT0E 5IT9E 2RO0A 2YRDA 1NM7A 1OEBA 1U1SA 2HKNA 3QJ6A 5IXFA 4Z02A 3VYGA 4ZTJA 1VQ7T 2EBPA 4ZGDB 3EFSA 4N4GA 1H3HA 3HFOA 4OP0A 3CMAQ 5GAMg 4FT2A 4IUPA 5IN1A 1X6OA 2G3RA 4MDXA 4PFOA 1VQNT 2B8AA 4XTYA 3SD4A 3CCMA 3G1JA 3MCAB 2KT1A 1PSFA 3CXCS 1PHTA 5M9OA 5LJ5f 1MNEA 3I55A 2L0AA 2KY9A 2JZ2A 4R55A 1M3CA 1D0ZA 1EX4A 4M77G 2LC4A 4Y92A 3CC7A 4KGXB 2FEIA 1VQMA 3OBYA 4NL2A 1OU9A 1E6GA 3S3MA 2P4RA 2RHXA 2KXCA 1K9MR 1JXOA 3ME9A 4ZN1A 4QQDA 3TSWA 2ZCFB 2IPOB 2ZPEB 4C5EA 3NGPA 5I2SA 2JTFA 4FSSA 1VQNQ 3M53A 1YJWA 2LQKA 2F2WA 3OBWA 2I0NA 3HRUA 5CAIA 2K2MA 4EMHA 2DM1A 1ZSZB 2IIMA 2LNHB 2SRCA 2D0QB 2CP0A 1BCMA 2CP2A 2OAWA 1KC8U 2A7YA 1QKWA 3L2VA 4PJOG 1YI2A 1OYXA 3A8OB 2OTJQ 1NJIU 2DEUA 1ABQA 2DD4A 3RERA 3VS7A 2VGNA 2V8JA 2DO3A 3FB9A 3VRZA 5KYYA 3GNGA 1I5OB 3TU4K 3OYMA 2V1QA 4E7IA 3I5RA 1M2OA 2M02A 5KH6A 3CCUQ 1MHNA 3JB9I 2HL3A 1D09B 3HRSA 1QP2A 5GAN4 4BI3A 1WHKA 3F70A 4EDUA 4M7AE 1TH7A 3EAEA 5CKBA 4BD3A 1PSEA 3MEWA 4M7DG 3RDVA 1OI1A 3NFCA 4P5NA 4J7FA 1YI2T 2JOYA 3OB9A 3R6NA 5FWCA 2FYKA 1TUDA 4M75D 2GCXA 1IZ6A 2J6FA 1SKUB 3LYIA 2LTOA 3OS5A 3G4SA 1U8RA 1I5LA 1M3BA 1KIKA 2DL3A 3LW5E 2WSCE 3VRYA 4EMGA 4BDZA 2KVQG 2ZGWA 4MMKA 3VS1A 2JW4A 2KRMA 1K1ZA 3GPLA 1ZBJA 2K5FA 1O75A 2QA4T 4MZPA 1LJOA 2JS2A 2QQAA 3EG9B 1VQKA 1Q81C 4M78C 3CMAA 1T0HA 2R58A 3L2UA 4AG2C 3Q1JA 5DLOA 2BE7D 4N0AA 5GJWB 2BTTA 4JPBW 4M7AB 1SHFA 2RI3A 1WXTA 2DMOA 2RJFA 5GANg 2B86A 3L42A 3PIPA 2A36A 3GBQA 4Z8AA 1AHJB 5GAMd 4A4KA 3NTKA 3FC3A 3CC2T 1QVFS 2O4XA 2E70A 2CSIA 5CQXA 1Y71A 3CCLQ 4OMFB 1S1NA 2RQVA 4J7IA 4BACA 4CRIA 1M27C 3LGFA 3G6EQ 5J39A 4PL6A 3CCQQ 1ZQ1A 2DIQA 4RUGA 1Q7YC 3SWNA 1ACMB 1VQ6Q 3VYHB 2RI5A 5GAOn 1N27A 3CCLA 4KBMB 3PNWC 1IREB 3RBBB 1WZOA 4AFUC 4A4EA 3JCMP 4C92B 2XDPA 1BI1A 2RA2A 4BE0A 1Q82R 5L8RE 5LJ5g 3DLLA 2EJFA 2FB7A 4C5GA 1RL2A 1G3YA 3PFSA 3H9NA 2CP5A 4N0AC 1C0MA 4A63B 1IGQA 5GAN5 3C95A 4J8OA 4DEXA 5HKCA 1NLOC 4HVUA 1FWZA 3G71A 2LCLA 3TEEA 3ZFJA 3M4GA 2NWMA 2X4JA 3SHWA 4OVAA 1X43A 2O01E 1ZUKA 3CCET 2DZCA 4D8DA 1OZ2A 4M75A 4C8QE 2LX7A 1HK9A 2KT8A 1BU1A 1D3BB 3PVLA 3QZ5B 4UC4A 2DIGA 1WNLA 1GBQA 2O9VA 1VQ9A 5FROA 4FYVB 3X20B 1AWOA 4M77B 3V8KA 1WI7A 4OMMA 3X24B 1VQKT 2YRVA 4FM4B 2ZPHB 4J6YA 3JCMW 3OYEA 2RJEA 2FRYA 3SB2A 2CKKA 1QVGA 2V1RA 3EGDA 2D8HA 1VQ9Q 1KG1A 4XTXA 2GTOA 3CEYA 2DL8A 3CBMA 1BKBA 2GTJA 1ABOA 1G8XA 5CIUA 4C8QB 1G3SA 3M58A 1WXBA 1XTDA 2HL5C 1VQLA 2MPXC 1KHIA 2RQRA 3AT1B 3PTAA 5J26A 2DYIA 3QDRB 4XTUA 2KRSA 3OYCA 3LLRA 3UF4A 2MWPA 2QTXA 1YITA 2RQWA 3C4SA 4OF1A 4F04B 4Q5WA 1Y96B 2HD0A 1RABB 2XD0A 2HQEA 1VQKQ 1UDLA 3CCJA 1K73R 3BW1A 2JN0A 1HYOA 1B7TA 1YJ9T 2R57A 1H641 1YWOA 2EGCA 2QGGA 4XQ3A 3NPFA 5I2MA 1QP3A 5GAN2 4HT9A 2PTKA 4JLGA 4RG8A 5FLXE 2X4WA 3EFRA 1XJWB 3EGDB 4HVWA 5FWBA 2EYZA 2FVUA 1TU0B 3GLXA 2LRQA 2DTIA 4FSXA 2Y4XA 2BZXA 3OYBA 4AFQC 3QYHB 2KDSA 3A8MB 1MMGA 2HMAA 4BY6C 2CGHA 1JQQA 3GOXA 5GAMe 1S72T 3S3OA 1X75C 3EG3A 3CBOA 3WVDB 1D3BA 4Z88A 1PCXA 2HEQA 3JCMc 4ANJA 2K4YA 2Y90A 4WCIA 2DKGA 3QWXX 3TREA 1R8OB 2VC8A 3UATA 5GAN6 4LNPA 2LVMA 3NTIA 2PVOB 2L89A 3HTRA 4F14A 1E6HA 2BUDA 1VQMT 1V76A 2YHTA 5EC7A 2EVRA 2ZPGB 2EAYA 1SRLA 3GNFB 1TG0A 1WJRA 3CXCA 4XTZA 4RKUE 4DBRA 3CCSA 5L23A 3UT1A 3CMET 1GXIE 4QQGA 2GQVA 4OGEA 2D8JA 2DBKA 4AFZC 3X28B 1RAHB 1NPPA 1VYVA 1IO6A 2V8IA 4RTWA 2PZ1A 3OYNA 4XU3A 1UGQB 2VWFA 4ELZC 1N5ZA 1YFNA 4CC2A 1W6XA 1UFFA 5KCOA 3QG1A 3J7AF 3CCMQ 1UEBA 1TOVA 1HSQA 4M77E 1Z9QA 4JRPA 1M8VA 2FPFA 1JEGA 2PUKB 2FO0A 4HCBA 3EGXB 4HXJA 5J3BA 5A0GA 2LCSA 2EYWA 1ZUYA 1UGVA 4E47A 4PKCC 4FCYA 1NYFA 2JT4A 1WA7A 3TQ7P 3HPWA 3OYJA 2X35A 4M7DD 1OZ3A 3JCMb 4J9HA 4D8KA 2KROA 4JRQA 3OMGA 2RQUA 4KH0B 3HL8A 2HQXA 3L2QA 1YNZA 2O2OA 4LDVA 2L8DA 5KYUB 3CC2A 4X1VA 2ED1A 3CCMT 2CS7A 4GBQA 1HD3A 2F5KA 3VJPA 4BE2A 4BE1A 1QCOA 2LT1A 3EHQA 3M0QA 1PG5B 2LP5A 4L59A 1YJNT 4OMPA 5CKFA 3I56A 1LVKA 3AHUA 2EKOA 3RMSA 1OOTA 5FU7C 1GBRA 1K9AA 4DA4A 3CCEQ 3CPWA 4C5IA 2J06A 3D7SB 3WXMB 3H41A 3HRTA 5DM7R 4MZTA 2LNVA 4LN2A 1S72Q 4IIMA 1K4US 2AKLA 4HCKA 2EQKA 1M30A 2J6KA 2FPEA 4F7UF 4Z89A 4M7DE 1M1FA 3JB9J 5KYYB 3JCMV 3QHSA 1VQ8A 2EQUA 1HXDA 2E12A 3UA6A 4LDYA 3M0PA 1ZA1B 5IH2A 5LJ3d 4M78A 2RD1A 3RR6A 4DBHA 2VGMA 2GNCA 3T9NA 2DVJA 1JU5C 3RKXA 3J81E 3HHTB 3KFVA 2X9HA 3JCMd 1UJYA 2OTLT 2CH4A 1QW1A 4X9CA 3REAB 4FT4A 2KYBA 3A5ZB 3NMZC 1KQSS 1FMVA 3MEUA 2MF2A 2C06A 2DFUA 4XTWA 1D1AA 2AHJB 1T3SA 2K3BA 3QXEB 2JS0A 4Y91A 2EYYA 1B34B 2DJZA 1MMDA 1T0JA 3M56A 3PE0A 2DYBA 1X01A 1VYUA 4JJCA 2FZCB 4LDXA 1T3LA 1JJ2P 1F1BB 2RJDA 1Q86C 1JRIA 3I9QA 2K3YA 2XDDA 4EIKA 1FYNA 4PJLA 2BE9B 3H0IA 2P0KA 4C0DC 4M75F 5CO7A 2YXYA 1D1CA 4IUQA 3QWYA 2O31A 5AYFA 5A2QE 4C0ZA 2DTOA 4JDSA 1VQ5Q 2DILA 5GAMf 2CSQA 2QEXQ 2EYQA 3LX7A 4A4FA 1WHHA 1ZSZC 3EFOA 1YI2Q 3M9QA 4M75C 2RMOA 1UGPB 4TVRA 2DNUA 1I4K1 3CPFA 1OX8A 2F2VA 4FL6A 3OYYA 2DVEA 4GLMA 2FL7A 3SFMA 2VB6A 2KK4A 3JCMe 1WPYA 2PUOB 3I5SA 4C8QA 1Q7YR 3QO3A 2YUQA 1X6GA 3BDLA 1YJWQ 4WTOB 2Z0WA 4OB0B 2LZ6B 1VQ7A 1Y57A 1G3TA 3QDFA 2EWNA 3OYAA 3EG1A 5GAOp 4KULA 4N4IA 2YT6A 1KC8R 5GAOl 4JS4A 4M77A 1R77A 3CCVQ 5GMKi 4LDWA 1BI0A 3I56T 4KGVB 2GBQA 4R0KA 4M78E 1BYMA 2HBPA 1VQPA 2QTVA 4FU6A 1AT1B 1JJ2S 1NE8A 7AT1B 3OYIA 3X25B 1QVPA 1NJIR 2WSEE 2HZYA 2QGFB 4CC3A 2D1XA 2LQNA 4EMKA 2YUNA 3HFNA 3MEVA 4M75B 2KXDA 4FYYB 3ULRB 5GAOm 3BE3A 3OYLA 3OS0A 1HJDA 3MHXA 2BIVA 2L5QA 2AZVA 2OTLQ 4PJJA 3O5ZA 4D6WA 2JUFA 1N8RC 3JCMg 1UHCA 2A0FB 2YRCA 3G4SQ 5GAN3 1FXXA 5IHIA 3SEMA 5GANe 2JTMA 3CC4A 2XI9A 3G6EA 4PJOD 4C92A 8ATCB 2EQIA 3MKDA 4FW1A 1UGRB 5FW9A 5FU6B 5FRNA 2RN8A 3MP6A 1M2VB 2ESWA 3SWNB 4F7UA 4BB7A 4E7KA 1GFDA 3C0CA 4J9BA 1VQ9T 3OSVA 4C92E 3M59A 4FW2A 3MP8A 1B07A 2O4XB 2LJ0A 1W70A 2NUZA 4M78F 3CMEA 1KSWA 2OX7A 4OMNA 1G3WA 3CC4Q 1R0CB 1KD1U 2MOXA 1WHLA 4M7AA 2C0OA 1Y7XA 2NUTB 3R6OA 3MPUB 2DXCA 3I35A 2COZA 2JMAA 1M1GA 3EG9A 2D0NA 1WHMA 2KSSA 2E5KA 2C0IA 1ZA2B 4O5VA 3CCQA 5KYXA 1EFNA 2X51A 1N8RR 4LDUA 2DX1A 1PRMC 2LJ1A 1DJ7B 1IGUA 3NTHA 2NUPB 5GAMj 1OQKA 2WSFE 2JTEA 1BB9A 3THKA 3OS2A 3EGUA 2AKKA 3M0SA 2OTLA 4PJOA 3A8GB 1N6AA 3L2RA 4A4GA 3CD6Q 2QQBA 4M77F 3CC4T 2VV5A 5A0DA 4XK8E 1K8AU 1M9SA 3QPHA 3PVQA 4EMKC 1UECA 1KFZA 2FHDA 1Z9ZA 2E4HA 3H0HA 2L3RA 2DXUA 1UHFA 3URGA 3QSUA 4IUVA 5FRMA 1ZX6A 1VQ8T 1QCNA 1PNJA 4RG2A 5CVIA 2CREA 1MUZA 5GMKm 4PNOA 2BZ8A 2ZZDA 4FYXB 4M75E 1RAEB 1SRMA 4ZGJB 2E64A 5A0LA 2H8HA 4DOVA 3KUFA 4JRKA 2K9GA 1I0CA 2EKHA 1LPLA 4M77C 3JB9D 4OB3B 3OW2A 3LWHA 2CT3A 1AZEA 1NZ9A 3GF5A 1FX7A 1ZSZA 2JM8A 4E7ZA 3HP9A 1VQ4A 2A37A 3C94A 1YBYA 1KQSP 1Y0MA 4KH1B 4C92F 1VQ4T 4IURA 4ESRA 1JJ2A 2DL7A 3VS5A 4QVDA 1VQ6A 2RQTA 2CP6A 4NS5A 2ROTA 3VKIA 3JCMf 1QKXA 1W2BP 2H3EB 4K11A 2RB6A 2CZ0B 2JM9A 2RI2A 1WHJA 4NL3A 4XU2A 4KUDK 2O88A 3M55A 1YHQQ 2J6OA 1WX6A 2LMJA 4QT7A 1QWEA 2NYSA 2BZYA 2E65A 2MAMA 1AZGB 2O9SA 3QIIA 2ECZA 5GJVB 4JJNK 2WACA 4X9DA 2M9UA 1IHWA 4E7LA 3EG2A 4AMCA 5HY6A 2X3WD 2F5TX 4C92C 3E1SA 2E10A 3O8VA 3QJYA 4II1A 4GLKA 3CCEA 1NYGA 3META 3JB9G 4E7SA 4IUUA 4C0DB 5GAN7 3C12A 2SEMA 5GMKe 4AFSC 2QQRA 1YHQA 4PFPA 1MNDA 1IXDA 1K8AR 2XKOC 4ZTFA 4HT8A 1P92A 4IKFA 3ZBDA 5DLQE 4FYWB 3S3NA 4NOYA 2R5AA 3CCQT 2PVGB 2DL5A 2QAZA 2LX9A 1M1KC 1AEYA 2MIOA 1UB4A 1C6VX 1N8RU 4C8QG 1SHGA 2QA4Q 1H92A 3VS0A 3FJPA 5CQYA 2RNAA 5GAN8 2E6ZA 4B6MA 1KD1R
chains in the Genus database with same CATH topology
1UJYA 2J6FA 3TVTA 1NEGA 2CH4A 3REAB 1M3BA 2KYBA 2MCNA 3NMZC 1KIKA 2DL3A 1PWTA 2AK5A 3VRYA 3VS1A 2JW4A 1G83A 1GFCA 3TSZA 5IHKA 1LCKA 1T3SA 2K3BA 4LE9A 2W10A 2JS0A 2EYYA 2KRMA 1K1ZA 1T0JA 1ZBJA 2J05A 2GQIA 4CC7A 2JS2A 1I07A 3NHNA 3PE0A 2DYBA 1VYUA 1T0HA 1GCQC 2CT4A 4JJCA 1YCSB 1T3LA 4AG2C 1U06A 1J3TA 1AOJA 1CSKA 2BTTA 4JPBW 2L3SA 1RI9A 5GJWB 1GCPA 1X6BA 4CC4B 1SHFA 1WXTA 2DMOA 3I9QA 2JXBA 2QDLA 2B86A 1GL5A 3REBB 4EIKA 2A36A 1AWXA 3GBQA 2OJ2A 1FYNA 1MV3A 1BK2A 4Z8AA 2DJQA 4JJDA 1PRLC 4RTYA 3H0IA 1OPLA 2CSIA 1S1NA 2RQVA 1VA7A 2A28A 1AD5A 1M27C 1M3AA 3QWYA 1NLPC 2L2PA 2M51A 2O31A 4RUGA 4RTZA 3FJ5A 1UG1A 2DILA 1H8KA 2CSQA 1BBZA 2EGAA 2RMOA 2GGRA 1RUWA 3RBBB 4AFUC 2DNUA 1YWPA 1XOVA 2EYXA 1X69A 2F2VA 1X2KA 2VVKA 4GLMA 4LUEA 1GCQA 2F2XA 1OV3A 3IQLA 4A63B 1ZUUA 4DEXA 3I5SA 3RNJA 4E6RA 1NLOC 4HVUA 4F17A 2YUQA 1KJWA 1X6GA 2NWMA 2W0ZA 3SHWA 1X43A 2LZ6B 1Y57A 1ZUKA 2CDTA 4D8DA 3EG1A 2LX7A 2ED0A 4J9DA 2YT6A 2KT8A 1E7OA 2HBWA 2KBTA 2L3QA 1BU1A 3PVLA 1GRIA 1MV0B 1QLYA 1VYTA 2GBQA 1U5SA 4R0KA 1GBQA 2O9VA 2YDLA 4J9CA 1AWOA 1WI7A 1AWJA 4OMMA 4CC3A 2D1XA 1AWWA 2LQNA 2YUNA 1FMKA 1WDXA 2KXDA 4JZ4A 4OMLA 3ULRB 2FRYA 1K0XA 3A98A 2V1RA 2D8HA 1RLPC 1HJDA 2KR3A 2CUDA 2XMFA 2GTOA 1YP5A 2DL8A 2AZVA 2GTJA 1ABOA 1U3OA 2DL4A 3O5ZA 3JV3A 1M8MA 1RLQC 1WXBA 4OMOA 1UHCA 1UTIA 1CKBA 2RQRA 2HCKA 2DBMA 2K6DA 2K7AA 3M0UA 5IHIA 3SEMA 2KRSA 2DRKA 2RPNA 3UF4A 3U23A 5IXBA 2EQIA 1OPKA 2RQWA 2L3PA 1K0SA 1TUCA 1I1JA 5FW9A 2KYMA 1UE9A 1YN8A 5I11A 2RN8A 1UDLA 1WYXA 2ESWA 1UJ0A 1GFDA 3C0CA 4J9BA 1QWFA 2EGCA 1YWOA 1SSHA 1WFWA 2JMCA 3NPFA 1JO8A 2PTKA 2KRNA 1B07A 2LJ0A 4J9FA 1SPKA 4HVWA 1PKSA 1W70A 2NUZA 5FWBA 2EYZA 1KSWA 1ZLMA 2CUBA 2FG0A 4OMNA 2BZXA 4IIOA 4AFQC 3M0TA 3CQTA 2MOXA 2DE0X 2C0OA 2C0TA 4F16A 4ZNXA 3VS2A 3I35A 1JQQA 1X27A 3VS6A 1NG2A 2G6FX 2JMAA 2YUPA 3EG3A 2EW3A 2D0NA 2ENMA 1K76A 2E5KA 2FPDA 2C0IA 2AZSA 4Z88A 1UUEA 2K79A 2EGEA 2HEQA 1EFNA 4RTVA 2DX1A 1PRMC 2LJ1A 4J9EA 3M0RA 4WCIA 3QWXX 2J7IA 4M4ZA 3VS4A 1PKTA 1WLPB 4JZ3A 3UATA 4LNPA 1WIEA 2ROLA 4J9IA 4JJBA 2JTEA 1BB9A 3THKA 2EPDA 4F14A 1E6HA 3EGUA 2AKKA 5EC7A 2EVRA 3M0SA 5IHNA 1SRLA 3UA7A 2ABLA 1SEMA 1TG0A 2X3XD 1B3QA 4ORZA 3VS3A 4KRTA 2CH4W 5L23A 2DLPA 3LH5A 4RTUA 3PVQA 1QCFA 1V1CA 1UECA 1KFZA 1G2BA 1Z9ZA 2D8JA 1NM7A 3H0HA 2DBKA 1OEBA 1UHFA 2RF0A 5IXFA 4AFZC 3ZL7C 1VYVA 1WXUA 4RTXA 1IO6A 1ZX6A 2EBPA 3EHRA 2LJ3A 4RTWA 2PZ1A 1H3HA 1PNJA 2VWFA 2CREA 1MUZA 1ARKA 2BZ8A 1N5ZA 4CC2A 1W6XA 1UFFA 1SRMA 2OI3A 4AG1C 2H8HA 3H0FA 1HSQA 1Z9QA 2FPFA 1JEGA 2A08A 2K9GA 1I0CA 2FO0A 2EKHA 2KT1A 4HXJA 4RTTA 2LCSA 2EYWA 1W1FA 1ZUYA 1PHTA 1X2QA 1UGVA 2L0AA 2CT3A 1AZEA 4LUDA 1JXMA 2JM8A 1M3CA 4Y92A 2A37A 2FEIA 1NYFA 1Y0MA 2JT4A 1WA7A 2M0YA 2PNIA 2KNBB 2VKNA 4J9GA 1E6GA 4ESRA 2P4RA 2DL7A 4J9HA 3VS5A 4D8KA 2KXCA 2DA9A 1JXOA 2RQTA 2KROA 2ROTA 5ECAA 1QKXA 2RQUA 3TSWA 4K11A 2KGTA 2FRWA 2JM9A 3NGPA 1YNZA 2O2OA 2O88A 4X1VA 2YUOA 4FSSA 2ED1A 2J6OA 1WX6A 2LMJA 4GBQA 1HD3A 4QT7A 1QWEA 2F2WA 2KE9A 3EHQA 2LQWA 2LP5A 2I0NA 3M0QA 2BZYA 1AZGB 2HSPA 4OMPA 2K2MA 2DM1A 1A0NB 2IIMA 2LNHB 2O9SA 2SRCA 4HVVA 2ECZA 2OAWA 5GJVB 2HDAA 1QKWA 5HCKA 3EG2A 1OOTA 1GBRA 2X3WD 1K9AA 1AVZC 1ABQA 2YSQA 2J06A 1NYGA 3VS7A 3H41A 2DF6A 4OMQA 3VRZA 2SEMA 4LN2A 4AFSC 4IIMA 1K4US 2AKLA 1ZSGA 2V1QA 4HCKA 1M30A 3I5RA 2J6KA 2FPEA 4Z89A 1CKAA 4DEYA 2KEAA 3UA6A 2DL5A 3M0PA 5I22A 1AEYA 5IH2A 3EG0A 2DRMA 1NEBA 2MIOA 2GNCA 2DVJA 1JU5C 1SHGA 1H92A 3VS0A 3R6NA 3KFVA 5FWCA 2RNAA 1TUDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UJY A;  2J6F A;  3TVT A;  1NEG A;  2CH4 A;  3REA B;  1M3B A;  2KYB A;  2MCN A;  3NMZ C;  1KIK A;  2DL3 A;  1PWT A;  2AK5 A;  3VRY A;  3VS1 A;  2JW4 A;  1G83 A;  1GFC A;  3TSZ A;  5IHK A;  1LCK A;  1T3S A;  2K3B A;  4LE9 A;  2W10 A;  2JS0 A;  2EYY A;  2KRM A;  1K1Z A;  1T0J A;  1ZBJ A;  2J05 A;  2GQI A;  4CC7 A;  2JS2 A;  1I07 A;  3NHN A;  3PE0 A;  2DYB A;  1VYU A;  1T0H A;  1GCQ C;  2CT4 A;  4JJC A;  1YCS B;  1T3L A;  4AG2 C;  1U06 A;  1J3T A;  1AOJ A;  1CSK A;  2BTT A;  4JPB W;  2L3S A;  1RI9 A;  5GJW B;  1GCP A;  1X6B A;  4CC4 B;  1SHF A;  1WXT A;  2DMO A;  3I9Q A;  2JXB A;  2QDL A;  2B86 A;  1GL5 A;  3REB B;  4EIK A;  2A36 A;  1AWX A;  3GBQ A;  2OJ2 A;  1FYN A;  1MV3 A;  1BK2 A;  4Z8A A;  2DJQ A;  4JJD A;  1PRL C;  4RTY A;  3H0I A;  1OPL A;  2CSI A;  1S1N A;  2RQV A;  1VA7 A;  2A28 A;  1AD5 A;  1M27 C;  1M3A A;  3QWY A;  1NLP C;  2L2P A;  2M51 A;  2O31 A;  4RUG A;  4RTZ A;  3FJ5 A;  1UG1 A;  2DIL A;  1H8K A;  2CSQ A;  1BBZ A;  2EGA A;  2RMO A;  2GGR A;  1RUW A;  3RBB B;  4AFU C;  2DNU A;  1YWP A;  1XOV A;  2EYX A;  1X69 A;  2F2V A;  1X2K A;  2VVK A;  4GLM A;  4LUE A;  1GCQ A;  2F2X A;  1OV3 A;  3IQL A;  4A63 B;  1ZUU A;  4DEX A;  3I5S A;  3RNJ A;  4E6R A;  1NLO C;  4HVU A;  4F17 A;  2YUQ A;  1KJW A;  1X6G A;  2NWM A;  2W0Z A;  3SHW A;  1X43 A;  2LZ6 B;  1Y57 A;  1ZUK A;  2CDT A;  4D8D A;  3EG1 A;  2LX7 A;  2ED0 A;  4J9D A;  2YT6 A;  2KT8 A;  1E7O A;  2HBW A;  2KBT A;  2L3Q A;  1BU1 A;  3PVL A;  1GRI A;  1MV0 B;  1QLY A;  1VYT A;  2GBQ A;  1U5S A;  4R0K A;  1GBQ A;  2O9V A;  2YDL A;  4J9C A;  1AWO A;  1WI7 A;  1AWJ A;  4OMM A;  4CC3 A;  2D1X A;  1AWW A;  2LQN A;  2YUN A;  1FMK A;  1WDX A;  2KXD A;  4JZ4 A;  4OML A;  3ULR B;  2FRY A;  1K0X A;  3A98 A;  2V1R A;  2D8H A;  1RLP C;  1HJD A;  2KR3 A;  2CUD A;  2XMF A;  2GTO A;  1YP5 A;  2DL8 A;  2AZV A;  2GTJ A;  1ABO A;  1U3O A;  2DL4 A;  3O5Z A;  3JV3 A;  1M8M A;  1RLQ C;  1WXB A;  4OMO A;  1UHC A;  1UTI A;  1CKB A;  2RQR A;  2HCK A;  2DBM A;  2K6D A;  2K7A A;  3M0U A;  5IHI A;  3SEM A;  2KRS A;  2DRK A;  2RPN A;  3UF4 A;  3U23 A;  5IXB A;  2EQI A;  1OPK A;  2RQW A;  2L3P A;  1K0S A;  1TUC A;  1I1J A;  5FW9 A;  2KYM A;  1UE9 A;  1YN8 A;  5I11 A;  2RN8 A;  1UDL A;  1WYX A;  2ESW A;  1UJ0 A;  1GFD A;  3C0C A;  4J9B A;  1QWF A;  2EGC A;  1YWO A;  1SSH A;  1WFW A;  2JMC A;  3NPF A;  1JO8 A;  2PTK A;  2KRN A;  1B07 A;  2LJ0 A;  4J9F A;  1SPK A;  4HVW A;  1PKS A;  1W70 A;  2NUZ A;  5FWB A;  2EYZ A;  1KSW A;  1ZLM A;  2CUB A;  2FG0 A;  4OMN A;  2BZX A;  4IIO A;  4AFQ C;  3M0T A;  3CQT A;  2MOX A;  2DE0 X;  2C0O A;  2C0T A;  4F16 A;  4ZNX A;  3VS2 A;  3I35 A;  1JQQ A;  1X27 A;  3VS6 A;  1NG2 A;  2G6F X;  2JMA A;  2YUP A;  3EG3 A;  2EW3 A;  2D0N A;  2ENM A;  1K76 A;  2E5K A;  2FPD A;  2C0I A;  2AZS A;  4Z88 A;  1UUE A;  2K79 A;  2EGE A;  2HEQ A;  1EFN A;  4RTV A;  2DX1 A;  1PRM C;  2LJ1 A;  4J9E A;  3M0R A;  4WCI A;  3QWX X;  2J7I A;  4M4Z A;  3VS4 A;  1PKT A;  1WLP B;  4JZ3 A;  3UAT A;  4LNP A;  1WIE A;  2ROL A;  4J9I A;  4JJB A;  2JTE A;  1BB9 A;  3THK A;  2EPD A;  4F14 A;  1E6H A;  3EGU A;  2AKK A;  5EC7 A;  2EVR A;  3M0S A;  5IHN A;  1SRL A;  3UA7 A;  2ABL A;  1SEM A;  1TG0 A;  2X3X D;  1B3Q A;  4ORZ A;  3VS3 A;  4KRT A;  2CH4 W;  5L23 A;  2DLP A;  3LH5 A;  4RTU A;  3PVQ A;  1QCF A;  1V1C A;  1UEC A;  1KFZ A;  1G2B A;  1Z9Z A;  2D8J A;  1NM7 A;  3H0H A;  2DBK A;  1OEB A;  1UHF A;  2RF0 A;  5IXF A;  4AFZ C;  3ZL7 C;  1VYV A;  1WXU A;  4RTX A;  1IO6 A;  1ZX6 A;  2EBP A;  3EHR A;  2LJ3 A;  4RTW A;  2PZ1 A;  1H3H A;  1PNJ A;  2VWF A;  2CRE A;  1MUZ A;  1ARK A;  2BZ8 A;  1N5Z A;  4CC2 A;  1W6X A;  1UFF A;  1SRM A;  2OI3 A;  4AG1 C;  2H8H A;  3H0F A;  1HSQ A;  1Z9Q A;  2FPF A;  1JEG A;  2A08 A;  2K9G A;  1I0C A;  2FO0 A;  2EKH A;  2KT1 A;  4HXJ A;  4RTT A;  2LCS A;  2EYW A;  1W1F A;  1ZUY A;  1PHT A;  1X2Q A;  1UGV A;  2L0A A;  2CT3 A;  1AZE A;  4LUD A;  1JXM A;  2JM8 A;  1M3C A;  4Y92 A;  2A37 A;  2FEI A;  1NYF A;  1Y0M A;  2JT4 A;  1WA7 A;  2M0Y A;  2PNI A;  2KNB B;  2VKN A;  4J9G A;  1E6G A;  4ESR A;  2P4R A;  2DL7 A;  4J9H A;  3VS5 A;  4D8K A;  2KXC A;  2DA9 A;  1JXO A;  2RQT A;  2KRO A;  2ROT A;  5ECA A;  1QKX A;  2RQU A;  3TSW A;  4K11 A;  2KGT A;  2FRW A;  2JM9 A;  3NGP A;  1YNZ A;  2O2O A;  2O88 A;  4X1V A;  2YUO A;  4FSS A;  2ED1 A;  2J6O A;  1WX6 A;  2LMJ A;  4GBQ A;  1HD3 A;  4QT7 A;  1QWE A;  2F2W A;  2KE9 A;  3EHQ A;  2LQW A;  2LP5 A;  2I0N A;  3M0Q A;  2BZY A;  1AZG B;  2HSP A;  4OMP A;  2K2M A;  2DM1 A;  1A0N B;  2IIM A;  2LNH B;  2O9S A;  2SRC A;  4HVV A;  2ECZ A;  2OAW A;  5GJV B;  2HDA A;  1QKW A;  5HCK A;  3EG2 A;  1OOT A;  1GBR A;  2X3W D;  1K9A A;  1AVZ C;  1ABQ A;  2YSQ A;  2J06 A;  1NYG A;  3VS7 A;  3H41 A;  2DF6 A;  4OMQ A;  3VRZ A;  2SEM A;  4LN2 A;  4AFS C;  4IIM A;  1K4U S;  2AKL A;  1ZSG A;  2V1Q A;  4HCK A;  1M30 A;  3I5R A;  2J6K A;  2FPE A;  4Z89 A;  1CKA A;  4DEY A;  2KEA A;  3UA6 A;  2DL5 A;  3M0P A;  5I22 A;  1AEY A;  5IH2 A;  3EG0 A;  2DRM A;  1NEB A;  2MIO A;  2GNC A;  2DVJ A;  1JU5 C;  1SHG A;  1H92 A;  3VS0 A;  3R6N A;  3KFV A;  5FWC A;  2RNA A;  1TUD A; 
#chains in the Genus database with same CATH topology
 5HK3 A;  4LXC A;  1NEG A;  1KQ1 A;  2DET A;  4PLL A;  3G71 T;  4ATO A;  1LOJ A;  5LJ3 f;  3OW2 S;  3UWN A;  2D9T A;  1G83 A;  1GFC A;  3TSZ A;  1YJN Q;  2E6N A;  2W10 A;  4BDY A;  4XTV A;  4ZGE B;  3OY9 A;  2MI6 A;  1RI0 A;  4CC7 A;  3X26 B;  2XG8 D;  1GCQ C;  3JSC A;  1YCS B;  1J3T A;  2E41 A;  2QI2 A;  2MK5 A;  1CSK A;  1GCP A;  4CC4 B;  4X34 A;  4DQ2 A;  4QVZ A;  2GFA A;  3KXT A;  1XQH A;  4PJO B;  2JXB A;  3UDC A;  1GL5 A;  5C6S A;  1AWX A;  1BK2 A;  2DJQ A;  4JJD A;  3I55 T;  1W2B S;  4RTY A;  3RKY A;  1OPL A;  4PLI A;  2NUP A;  1XNI A;  3KBG A;  5LJ3 g;  2D6F A;  5KYW B;  2X4Y A;  1Y07 A;  3JB9 H;  3CD6 A;  1VA7 A;  4XU1 A;  2A28 A;  1AD5 A;  3BY7 A;  2E3H A;  3H8Z A;  2M51 A;  2FZK B;  4RTZ A;  3FJ5 A;  4XU0 A;  3J80 E;  1VQ4 Q;  1IRX A;  1BBZ A;  1PC0 A;  1FMW A;  2GGR A;  1U1T A;  3A8H B;  2EYX A;  3ER0 A;  4IUT A;  2ZPF B;  5GAN j;  3JRZ A;  1X2K A;  2VVK A;  2HAX A;  4LUE A;  1M5Q 1;  4PJO E;  1JBM A;  1GCQ A;  1TXQ A;  1OV3 A;  3RMQ A;  3IQL A;  3GIB A;  5GAO q;  1PD0 A;  1VIF A;  2YWW A;  1JB0 E;  3HSB A;  3RNJ A;  4J6X A;  2LQ8 A;  4E6R A;  1V29 B;  1YIJ A;  4F17 A;  3CCR T;  2CYZ B;  2W0Z A;  1RAC B;  3E9F A;  2YLB A;  1VOM A;  4L5G A;  4JS5 A;  4PJO C;  3P8B B;  4RCC A;  3CD6 T;  3DB4 A;  4B9W A;  1VQ5 T;  2ED0 A;  3OQ5 A;  1N9S A;  2HBW A;  3FIF A;  2L3Q A;  3MO8 A;  4PFZ A;  3RES A;  4M7A G;  5GAO r;  5FU7 B;  3EH1 A;  1MV0 B;  1IB8 A;  4N4H A;  1QLY A;  1VYT A;  2VXE A;  3L1A A;  3CCV A;  4PK4 A;  2KI7 A;  2I2L A;  3CCJ Q;  4M75 G;  3M57 A;  5KE3 A;  1NPR A;  1WDX A;  5GMK l;  4B9X A;  4OML A;  2FZG B;  1K0X A;  3A98 A;  1C1A A;  1RLP C;  2DXB A;  4YTL A;  2KR3 A;  2CUD A;  2XMF A;  4EMK B;  1U3O A;  1RAF B;  4M7A F;  3JV3 A;  2DTH A;  2LCC A;  5LJ5 j;  1RLQ C;  2YLC A;  4JLI A;  2PU9 B;  1H3Z A;  9ATC B;  2HCK A;  3MP1 A;  3LWI A;  2K5L A;  1SF9 A;  2JNG A;  3M0U A;  4A53 A;  3OYD A;  4C8Q D;  2IVW A;  3U23 A;  2KAF A;  3QZ9 B;  5IXB A;  1OPK A;  3BDU A;  5CKD A;  1I1J A;  5DY9 A;  2VXF A;  3P8D A;  4BI8 B;  4LD9 K;  3QUI A;  5I11 A;  1YHQ T;  2K3X A;  3JB9 F;  1UJ0 A;  2E5Q A;  1QWF A;  2RJC A;  2IG0 A;  1R0B G;  2K57 A;  4L6V 5;  1W4S A;  1SPK A;  3JCM h;  1ZLM A;  2RHY A;  3M4Y A;  2PQW A;  3N5B B;  2A3L A;  5LJ5 e;  2RK1 A;  2M16 A;  2DE0 X;  2C0T A;  1WJQ A;  4F16 A;  1VQO Q;  2BKD N;  3OW2 P;  1VQN A;  3VS2 A;  3EFO B;  1WQW A;  3VV0 A;  3VS6 A;  2VYT A;  1NG2 A;  2CP7 A;  4WF2 A;  1VQM Q;  5GAM h;  1Q82 U;  2MWO A;  4M77 D;  4J5Y A;  4RMO A;  1UUE A;  2QA4 A;  3L2Z A;  2EGE A;  3TCJ A;  4HCZ A;  4RTV A;  4J9E A;  1MGQ A;  3M0R A;  1YJ9 A;  1LNX A;  4C8Q C;  4Y28 E;  2MMP A;  3S6W A;  2J7I A;  4M4Z A;  2QG9 B;  2DEQ A;  3LH0 A;  1QVG P;  2EPD A;  3JAM E;  3ASK A;  3M5A A;  5IHN A;  3UA7 A;  1YJN A;  2ABL A;  1K73 U;  3CMA T;  5GAN f;  1SEM A;  2CP3 A;  4DBQ A;  2CH4 W;  3WVE B;  1RAA B;  5D7U A;  1BCO A;  3LH5 A;  2XID A;  1QCF A;  1VQ5 A;  1V1C A;  5GAN h;  1G2B A;  4GY5 A;  3LGL A;  2EIF A;  2RF0 A;  3ZL7 C;  1TTH B;  5IAY A;  1D0Y A;  1WXU A;  4RTX A;  2RK2 A;  3EHR A;  2LJ3 A;  1WHG A;  4M78 G;  2XK0 A;  1SG5 A;  4C8Q F;  3FRN A;  1ARK A;  4BUG A;  1KQS A;  2OI3 A;  4AG1 C;  3H0F A;  3CME Q;  5CK9 A;  2A08 A;  4M7D B;  4QQ6 A;  4C0F A;  3I55 Q;  4M7A D;  2K5I A;  4M78 B;  4RTT A;  5KYN A;  1W1F A;  1X2Q A;  3JCM Q;  1D1B A;  4LUD A;  2OAU A;  4XAX B;  1JXM A;  2QQS A;  3PT9 A;  1WJS A;  4ZN3 A;  2HNI A;  3OYH A;  5LJ5 h;  2COY A;  4HA8 A;  3CC7 Q;  2M0Y A;  2PNI A;  1TS9 A;  2KNB B;  2VKN A;  4J9G A;  2Y4Y A;  4PJO F;  2DZ9 A;  1NBE B;  1ZHI A;  5LJ3 h;  5D6Y A;  5HK0 A;  1YIT Q;  2DA9 A;  2MYS A;  4A54 A;  5ECA A;  1VQ8 Q;  2KGT A;  5CKH A;  2FRW A;  3QBY A;  4V2S A;  4JUV A;  1VQP Q;  3OYF A;  3CXC P;  3CPW S;  2YUO A;  4QKU A;  4PJN A;  3BFM A;  3CCS T;  4AT1 B;  3ZEH A;  3V7R A;  2KE9 A;  2LQW A;  4C0G A;  4MZM A;  2E1H A;  1BI2 A;  2HSP A;  3RUX A;  1K9M C;  2EFI A;  2GF7 A;  1A0N B;  1Q7Y U;  4HVV A;  2QDY B;  6AT1 B;  3CCR Q;  2HDA A;  5HCK A;  2HKQ B;  2F1L A;  1AVZ C;  4RCB A;  4M7D A;  2RHZ A;  5AT1 B;  5C0M A;  1Q86 U;  2YSQ A;  4M7A C;  2GFU A;  2OTJ A;  1QMC A;  2DF6 A;  5CKE A;  4OMQ A;  2NUT A;  2EJG A;  3CC2 Q;  1ZSG A;  2EQJ A;  1K8A C;  2JJ9 A;  2R5M A;  5GAN d;  1CKA A;  2M1H A;  3M54 A;  4DEY A;  2KEA A;  3OMC A;  5I22 A;  3CBP A;  3EG0 A;  1VQ6 T;  3PMI A;  2DRM A;  3EGX A;  1NEB A;  2RHU A;  1KHC A;  2EJ9 A;  1S72 A;  2H3J A;  3FDR A;  3FEO A;  1MMA A;  3P8H A;  2COW A;  1G5V A;  1O9S A;  3CCL T;  3OYK A;  2AT1 B;  2VAS A;  5GMK j;  4LD6 A;  4O6J A;  3TVT A;  3QYG B;  2MCN A;  5LL6 S;  3PMT A;  1PWT A;  2AK5 A;  4MML A;  3E9G A;  2QXF A;  1VQO A;  4EPC A;  1M90 C;  3INZ A;  5IHK A;  1LCK A;  4LE9 A;  1I81 A;  3E2U A;  4KGZ B;  4A4H A;  1KQ2 A;  2J05 A;  3SDZ A;  2GQI A;  5LJ5 d;  1VUB A;  2P0P A;  1QVF P;  1I07 A;  3NHN A;  2HSE B;  2PVD B;  1M1K R;  2CT4 A;  1EIF A;  1U06 A;  1AOJ A;  3FLG A;  1TUG B;  2AIR B;  2L3S A;  1RI9 A;  1X6B A;  3CPW P;  1SSF A;  1VQL T;  2QDL A;  2X4X A;  3MJX A;  3REB B;  2QEX T;  3RIR A;  2OJ2 A;  1MV3 A;  1PRL C;  3DKM A;  2P84 A;  4KUI A;  4J6W A;  2DXT A;  3A1P A;  3I56 Q;  1Q81 R;  3DB3 A;  4E7J A;  1M90 R;  3QKJ A;  4BY6 B;  1M3A A;  1NLP C;  4HKE A;  3G71 Q;  2L2P A;  3MEA A;  5FU6 C;  1UG1 A;  1TSF A;  3OS1 A;  1H8K A;  4ME7 A;  4DOW A;  1W2B A;  3A8L B;  2EGA A;  1RUW A;  1Q86 R;  1YIJ Q;  1YWP A;  1D0X A;  4CI0 C;  1XOV A;  2M0O A;  1Q95 G;  3UPU A;  1X69 A;  5D6W A;  4QW2 A;  1WGS A;  1PD1 A;  2VUB A;  1UGS B;  3G7Z A;  3CCS Q;  5KE2 A;  2F2X A;  2ATC B;  1WQ7 A;  1K73 C;  1ZUU A;  2ZPB B;  3OSS C;  3CCR A;  3HKS A;  5LJ3 e;  1RAD B;  1KJW A;  3RKW A;  2LT4 A;  1RAI B;  2OTJ T;  4HCC A;  2CDT A;  1Y96 A;  4F7U E;  3OYG A;  5KCH A;  2XDB A;  4J9D A;  1E7O A;  5KYX B;  2KBT A;  1BI3 A;  1GRI A;  3OA6 A;  1YJ9 Q;  1EZZ B;  1U5S A;  4R56 A;  2QK0 A;  3PIO A;  4DBF A;  1VQ7 Q;  4MDW A;  2YDL A;  5GMK h;  3E19 A;  5EG2 A;  1YJW T;  5CCA A;  4J9C A;  2RHI A;  1AWJ A;  4C92 D;  1AWW A;  1KD1 C;  2V8K A;  8AT1 B;  1KK7 A;  3VUZ A;  1FMK A;  2P4T A;  2KQW A;  4JZ4 A;  2DPP B;  3DLM A;  3H6Z A;  2XHC A;  2P0Q A;  1YP5 A;  2RM4 A;  1KC8 C;  2QQ9 A;  5LJ3 j;  1VIE A;  2DL4 A;  1BIB A;  1Q82 C;  1IHV A;  2K2V A;  2XU8 A;  4F7U B;  3CCJ T;  1M8M A;  1M2V A;  2HQH A;  2CZ6 B;  4OMO A;  3CC7 T;  1UTI A;  1CKB A;  3GP8 A;  3V7C A;  1OX9 A;  1PM3 A;  2DBM A;  2K6D A;  2K7A A;  1QVG S;  4OB1 B;  1B34 A;  1YIT T;  4M7D F;  2DRK A;  2DD5 A;  2RPN A;  2L3P A;  1K0S A;  1TUC A;  4F7U G;  2V26 A;  1K9M U;  2KMT A;  2KYM A;  1VQP T;  1VQL Q;  2QYZ A;  1UE9 A;  1M1K U;  1YN8 A;  2QAS A;  1WYX A;  2XIC A;  4E7H A;  2RH2 A;  1Q81 U;  3V8J A;  4ELY C;  3G4S T;  1NJI C;  3CCV T;  3VUB A;  4FIB A;  1SSH A;  4QVC A;  1WFW A;  2JMC A;  1JO8 A;  5KYW A;  2KRN A;  1N9R A;  2E3I A;  4J83 A;  3PGG A;  5CR2 A;  4J9F A;  4JRI A;  3V8L A;  3G6E T;  1PKS A;  2CUB A;  2FG0 A;  2CZ1 B;  4M7D C;  1M90 U;  4IIO A;  2JVV A;  3M0T A;  3CQT A;  5D6X A;  3V7S A;  4ZNX A;  1BIA A;  1X27 A;  1YIJ T;  1TWB A;  1OU8 A;  2NLU A;  3SWN C;  4OGC A;  2G6F X;  2DER A;  2DAQ A;  2YUP A;  2EW3 A;  2ENM A;  2F69 A;  1K76 A;  1RAG B;  2FPD A;  2AZS A;  3CCU T;  2K79 A;  4C5H A;  3JCM J;  1M4Z A;  3CCU A;  2DK3 A;  3JCM X;  2ZPI B;  2ZAE A;  1I8F A;  4PJM A;  2QEX A;  1VQO T;  3EH2 A;  1QQJ A;  4M78 D;  3VS4 A;  1PKT A;  1WLP B;  4JZ3 A;  1QVF A;  1WIE A;  2ROL A;  4J9I A;  4JJB A;  4BI4 A;  3L2W A;  4C92 G;  2CZ7 B;  1OUL A;  5KYU A;  4VUB A;  1ZBX A;  4OB2 B;  2X3X D;  1B3Q A;  4ORZ A;  3VS3 A;  3VU3 C;  1MMN A;  4KRT A;  2EQM A;  1YCY A;  2LDM A;  2DLP A;  5I21 A;  4RTU A;  4E2F B;  4KT0 E;  5IT9 E;  2RO0 A;  2YRD A;  1NM7 A;  1OEB A;  1U1S A;  2HKN A;  3QJ6 A;  5IXF A;  4Z02 A;  3VYG A;  4ZTJ A;  1VQ7 T;  2EBP A;  4ZGD B;  3EFS A;  4N4G A;  1H3H A;  3HFO A;  4OP0 A;  3CMA Q;  5GAM g;  4FT2 A;  4IUP A;  5IN1 A;  1X6O A;  2G3R A;  4MDX A;  4PFO A;  1VQN T;  2B8A A;  4XTY A;  3SD4 A;  3CCM A;  3G1J A;  3MCA B;  2KT1 A;  1PSF A;  3CXC S;  1PHT A;  5M9O A;  5LJ5 f;  1MNE A;  3I55 A;  2L0A A;  2KY9 A;  2JZ2 A;  4R55 A;  1M3C A;  1D0Z A;  1EX4 A;  4M77 G;  2LC4 A;  4Y92 A;  3CC7 A;  4KGX B;  2FEI A;  1VQM A;  3OBY A;  4NL2 A;  1OU9 A;  1E6G A;  3S3M A;  2P4R A;  2RHX A;  2KXC A;  1K9M R;  1JXO A;  3ME9 A;  4ZN1 A;  4QQD A;  3TSW A;  2ZCF B;  2IPO B;  2ZPE B;  4C5E A;  3NGP A;  5I2S A;  2JTF A;  4FSS A;  1VQN Q;  3M53 A;  1YJW A;  2LQK A;  2F2W A;  3OBW A;  2I0N A;  3HRU A;  5CAI A;  2K2M A;  4EMH A;  2DM1 A;  1ZSZ B;  2IIM A;  2LNH B;  2SRC A;  2D0Q B;  2CP0 A;  1BCM A;  2CP2 A;  2OAW A;  1KC8 U;  2A7Y A;  1QKW A;  3L2V A;  4PJO G;  1YI2 A;  1OYX A;  3A8O B;  2OTJ Q;  1NJI U;  2DEU A;  1ABQ A;  2DD4 A;  3RER A;  3VS7 A;  2VGN A;  2V8J A;  2DO3 A;  3FB9 A;  3VRZ A;  5KYY A;  3GNG A;  1I5O B;  3TU4 K;  3OYM A;  2V1Q A;  4E7I A;  3I5R A;  1M2O A;  2M02 A;  5KH6 A;  3CCU Q;  1MHN A;  3JB9 I;  2HL3 A;  1D09 B;  3HRS A;  1QP2 A;  5GAN 4;  4BI3 A;  1WHK A;  3F70 A;  4EDU A;  4M7A E;  1TH7 A;  3EAE A;  5CKB A;  4BD3 A;  1PSE A;  3MEW A;  4M7D G;  3RDV A;  1OI1 A;  3NFC A;  4P5N A;  4J7F A;  1YI2 T;  2JOY A;  3OB9 A;  3R6N A;  5FWC A;  2FYK A;  1TUD A;  4M75 D;  2GCX A;  1IZ6 A;  2J6F A;  1SKU B;  3LYI A;  2LTO A;  3OS5 A;  3G4S A;  1U8R A;  1I5L A;  1M3B A;  1KIK A;  2DL3 A;  3LW5 E;  2WSC E;  3VRY A;  4EMG A;  4BDZ A;  2KVQ G;  2ZGW A;  4MMK A;  3VS1 A;  2JW4 A;  2KRM A;  1K1Z A;  3GPL A;  1ZBJ A;  2K5F A;  1O75 A;  2QA4 T;  4MZP A;  1LJO A;  2JS2 A;  2QQA A;  3EG9 B;  1VQK A;  1Q81 C;  4M78 C;  3CMA A;  1T0H A;  2R58 A;  3L2U A;  4AG2 C;  3Q1J A;  5DLO A;  2BE7 D;  4N0A A;  5GJW B;  2BTT A;  4JPB W;  4M7A B;  1SHF A;  2RI3 A;  1WXT A;  2DMO A;  2RJF A;  5GAN g;  2B86 A;  3L42 A;  3PIP A;  2A36 A;  3GBQ A;  4Z8A A;  1AHJ B;  5GAM d;  4A4K A;  3NTK A;  3FC3 A;  3CC2 T;  1QVF S;  2O4X A;  2E70 A;  2CSI A;  5CQX A;  1Y71 A;  3CCL Q;  4OMF B;  1S1N A;  2RQV A;  4J7I A;  4BAC A;  4CRI A;  1M27 C;  3LGF A;  3G6E Q;  5J39 A;  4PL6 A;  3CCQ Q;  1ZQ1 A;  2DIQ A;  4RUG A;  1Q7Y C;  3SWN A;  1ACM B;  1VQ6 Q;  3VYH B;  2RI5 A;  5GAO n;  1N27 A;  3CCL A;  4KBM B;  3PNW C;  1IRE B;  3RBB B;  1WZO A;  4AFU C;  4A4E A;  3JCM P;  4C92 B;  2XDP A;  1BI1 A;  2RA2 A;  4BE0 A;  1Q82 R;  5L8R E;  5LJ5 g;  3DLL A;  2EJF A;  2FB7 A;  4C5G A;  1RL2 A;  1G3Y A;  3PFS A;  3H9N A;  2CP5 A;  4N0A C;  1C0M A;  4A63 B;  1IGQ A;  5GAN 5;  3C95 A;  4J8O A;  4DEX A;  5HKC A;  1NLO C;  4HVU A;  1FWZ A;  3G71 A;  2LCL A;  3TEE A;  3ZFJ A;  3M4G A;  2NWM A;  2X4J A;  3SHW A;  4OVA A;  1X43 A;  2O01 E;  1ZUK A;  3CCE T;  2DZC A;  4D8D A;  1OZ2 A;  4M75 A;  4C8Q E;  2LX7 A;  1HK9 A;  2KT8 A;  1BU1 A;  1D3B B;  3PVL A;  3QZ5 B;  4UC4 A;  2DIG A;  1WNL A;  1GBQ A;  2O9V A;  1VQ9 A;  5FRO A;  4FYV B;  3X20 B;  1AWO A;  4M77 B;  3V8K A;  1WI7 A;  4OMM A;  3X24 B;  1VQK T;  2YRV A;  4FM4 B;  2ZPH B;  4J6Y A;  3JCM W;  3OYE A;  2RJE A;  2FRY A;  3SB2 A;  2CKK A;  1QVG A;  2V1R A;  3EGD A;  2D8H A;  1VQ9 Q;  1KG1 A;  4XTX A;  2GTO A;  3CEY A;  2DL8 A;  3CBM A;  1BKB A;  2GTJ A;  1ABO A;  1G8X A;  5CIU A;  4C8Q B;  1G3S A;  3M58 A;  1WXB A;  1XTD A;  2HL5 C;  1VQL A;  2MPX C;  1KHI A;  2RQR A;  3AT1 B;  3PTA A;  5J26 A;  2DYI A;  3QDR B;  4XTU A;  2KRS A;  3OYC A;  3LLR A;  3UF4 A;  2MWP A;  2QTX A;  1YIT A;  2RQW A;  3C4S A;  4OF1 A;  4F04 B;  4Q5W A;  1Y96 B;  2HD0 A;  1RAB B;  2XD0 A;  2HQE A;  1VQK Q;  1UDL A;  3CCJ A;  1K73 R;  3BW1 A;  2JN0 A;  1HYO A;  1B7T A;  1YJ9 T;  2R57 A;  1H64 1;  1YWO A;  2EGC A;  2QGG A;  4XQ3 A;  3NPF A;  5I2M A;  1QP3 A;  5GAN 2;  4HT9 A;  2PTK A;  4JLG A;  4RG8 A;  5FLX E;  2X4W A;  3EFR A;  1XJW B;  3EGD B;  4HVW A;  5FWB A;  2EYZ A;  2FVU A;  1TU0 B;  3GLX A;  2LRQ A;  2DTI A;  4FSX A;  2Y4X A;  2BZX A;  3OYB A;  4AFQ C;  3QYH B;  2KDS A;  3A8M B;  1MMG A;  2HMA A;  4BY6 C;  2CGH A;  1JQQ A;  3GOX A;  5GAM e;  1S72 T;  3S3O A;  1X75 C;  3EG3 A;  3CBO A;  3WVD B;  1D3B A;  4Z88 A;  1PCX A;  2HEQ A;  3JCM c;  4ANJ A;  2K4Y A;  2Y90 A;  4WCI A;  2DKG A;  3QWX X;  3TRE A;  1R8O B;  2VC8 A;  3UAT A;  5GAN 6;  4LNP A;  2LVM A;  3NTI A;  2PVO B;  2L89 A;  3HTR A;  4F14 A;  1E6H A;  2BUD A;  1VQM T;  1V76 A;  2YHT A;  5EC7 A;  2EVR A;  2ZPG B;  2EAY A;  1SRL A;  3GNF B;  1TG0 A;  1WJR A;  3CXC A;  4XTZ A;  4RKU E;  4DBR A;  3CCS A;  5L23 A;  3UT1 A;  3CME T;  1GXI E;  4QQG A;  2GQV A;  4OGE A;  2D8J A;  2DBK A;  4AFZ C;  3X28 B;  1RAH B;  1NPP A;  1VYV A;  1IO6 A;  2V8I A;  4RTW A;  2PZ1 A;  3OYN A;  4XU3 A;  1UGQ B;  2VWF A;  4ELZ C;  1N5Z A;  1YFN A;  4CC2 A;  1W6X A;  1UFF A;  5KCO A;  3QG1 A;  3J7A F;  3CCM Q;  1UEB A;  1TOV A;  1HSQ A;  4M77 E;  1Z9Q A;  4JRP A;  1M8V A;  2FPF A;  1JEG A;  2PUK B;  2FO0 A;  4HCB A;  3EGX B;  4HXJ A;  5J3B A;  5A0G A;  2LCS A;  2EYW A;  1ZUY A;  1UGV A;  4E47 A;  4PKC C;  4FCY A;  1NYF A;  2JT4 A;  1WA7 A;  3TQ7 P;  3HPW A;  3OYJ A;  2X35 A;  4M7D D;  1OZ3 A;  3JCM b;  4J9H A;  4D8K A;  2KRO A;  4JRQ A;  3OMG A;  2RQU A;  4KH0 B;  3HL8 A;  2HQX A;  3L2Q A;  1YNZ A;  2O2O A;  4LDV A;  2L8D A;  5KYU B;  3CC2 A;  4X1V A;  2ED1 A;  3CCM T;  2CS7 A;  4GBQ A;  1HD3 A;  2F5K A;  3VJP A;  4BE2 A;  4BE1 A;  1QCO A;  2LT1 A;  3EHQ A;  3M0Q A;  1PG5 B;  2LP5 A;  4L59 A;  1YJN T;  4OMP A;  5CKF A;  3I56 A;  1LVK A;  3AHU A;  2EKO A;  3RMS A;  1OOT A;  5FU7 C;  1GBR A;  1K9A A;  4DA4 A;  3CCE Q;  3CPW A;  4C5I A;  2J06 A;  3D7S B;  3WXM B;  3H41 A;  3HRT A;  5DM7 R;  4MZT A;  2LNV A;  4LN2 A;  1S72 Q;  4IIM A;  1K4U S;  2AKL A;  4HCK A;  2EQK A;  1M30 A;  2J6K A;  2FPE A;  4F7U F;  4Z89 A;  4M7D E;  1M1F A;  3JB9 J;  5KYY B;  3JCM V;  3QHS A;  1VQ8 A;  2EQU A;  1HXD A;  2E12 A;  3UA6 A;  4LDY A;  3M0P A;  1ZA1 B;  5IH2 A;  5LJ3 d;  4M78 A;  2RD1 A;  3RR6 A;  4DBH A;  2VGM A;  2GNC A;  3T9N A;  2DVJ A;  1JU5 C;  3RKX A;  3J81 E;  3HHT B;  3KFV A;  2X9H A;  3JCM d;  1UJY A;  2OTL T;  2CH4 A;  1QW1 A;  4X9C A;  3REA B;  4FT4 A;  2KYB A;  3A5Z B;  3NMZ C;  1KQS S;  1FMV A;  3MEU A;  2MF2 A;  2C06 A;  2DFU A;  4XTW A;  1D1A A;  2AHJ B;  1T3S A;  2K3B A;  3QXE B;  2JS0 A;  4Y91 A;  2EYY A;  1B34 B;  2DJZ A;  1MMD A;  1T0J A;  3M56 A;  3PE0 A;  2DYB A;  1X01 A;  1VYU A;  4JJC A;  2FZC B;  4LDX A;  1T3L A;  1JJ2 P;  1F1B B;  2RJD A;  1Q86 C;  1JRI A;  3I9Q A;  2K3Y A;  2XDD A;  4EIK A;  1FYN A;  4PJL A;  2BE9 B;  3H0I A;  2P0K A;  4C0D C;  4M75 F;  5CO7 A;  2YXY A;  1D1C A;  4IUQ A;  3QWY A;  2O31 A;  5AYF A;  5A2Q E;  4C0Z A;  2DTO A;  4JDS A;  1VQ5 Q;  2DIL A;  5GAM f;  2CSQ A;  2QEX Q;  2EYQ A;  3LX7 A;  4A4F A;  1WHH A;  1ZSZ C;  3EFO A;  1YI2 Q;  3M9Q A;  4M75 C;  2RMO A;  1UGP B;  4TVR A;  2DNU A;  1I4K 1;  3CPF A;  1OX8 A;  2F2V A;  4FL6 A;  3OYY A;  2DVE A;  4GLM A;  2FL7 A;  3SFM A;  2VB6 A;  2KK4 A;  3JCM e;  1WPY A;  2PUO B;  3I5S A;  4C8Q A;  1Q7Y R;  3QO3 A;  2YUQ A;  1X6G A;  3BDL A;  1YJW Q;  4WTO B;  2Z0W A;  4OB0 B;  2LZ6 B;  1VQ7 A;  1Y57 A;  1G3T A;  3QDF A;  2EWN A;  3OYA A;  3EG1 A;  5GAO p;  4KUL A;  4N4I A;  2YT6 A;  1KC8 R;  5GAO l;  4JS4 A;  4M77 A;  1R77 A;  3CCV Q;  5GMK i;  4LDW A;  1BI0 A;  3I56 T;  4KGV B;  2GBQ A;  4R0K A;  4M78 E;  1BYM A;  2HBP A;  1VQP A;  2QTV A;  4FU6 A;  1AT1 B;  1JJ2 S;  1NE8 A;  7AT1 B;  3OYI A;  3X25 B;  1QVP A;  1NJI R;  2WSE E;  2HZY A;  2QGF B;  4CC3 A;  2D1X A;  2LQN A;  4EMK A;  2YUN A;  3HFN A;  3MEV A;  4M75 B;  2KXD A;  4FYY B;  3ULR B;  5GAO m;  3BE3 A;  3OYL A;  3OS0 A;  1HJD A;  3MHX A;  2BIV A;  2L5Q A;  2AZV A;  2OTL Q;  4PJJ A;  3O5Z A;  4D6W A;  2JUF A;  1N8R C;  3JCM g;  1UHC A;  2A0F B;  2YRC A;  3G4S Q;  5GAN 3;  1FXX A;  5IHI A;  3SEM A;  5GAN e;  2JTM A;  3CC4 A;  2XI9 A;  3G6E A;  4PJO D;  4C92 A;  8ATC B;  2EQI A;  3MKD A;  4FW1 A;  1UGR B;  5FW9 A;  5FU6 B;  5FRN A;  2RN8 A;  3MP6 A;  1M2V B;  2ESW A;  3SWN B;  4F7U A;  4BB7 A;  4E7K A;  1GFD A;  3C0C A;  4J9B A;  1VQ9 T;  3OSV A;  4C92 E;  3M59 A;  4FW2 A;  3MP8 A;  1B07 A;  2O4X B;  2LJ0 A;  1W70 A;  2NUZ A;  4M78 F;  3CME A;  1KSW A;  2OX7 A;  4OMN A;  1G3W A;  3CC4 Q;  1R0C B;  1KD1 U;  2MOX A;  1WHL A;  4M7A A;  2C0O A;  1Y7X A;  2NUT B;  3R6O A;  3MPU B;  2DXC A;  3I35 A;  2COZ A;  2JMA A;  1M1G A;  3EG9 A;  2D0N A;  1WHM A;  2KSS A;  2E5K A;  2C0I A;  1ZA2 B;  4O5V A;  3CCQ A;  5KYX A;  1EFN A;  2X51 A;  1N8R R;  4LDU A;  2DX1 A;  1PRM C;  2LJ1 A;  1DJ7 B;  1IGU A;  3NTH A;  2NUP B;  5GAM j;  1OQK A;  2WSF E;  2JTE A;  1BB9 A;  3THK A;  3OS2 A;  3EGU A;  2AKK A;  3M0S A;  2OTL A;  4PJO A;  3A8G B;  1N6A A;  3L2R A;  4A4G A;  3CD6 Q;  2QQB A;  4M77 F;  3CC4 T;  2VV5 A;  5A0D A;  4XK8 E;  1K8A U;  1M9S A;  3QPH A;  3PVQ A;  4EMK C;  1UEC A;  1KFZ A;  2FHD A;  1Z9Z A;  2E4H A;  3H0H A;  2L3R A;  2DXU A;  1UHF A;  3URG A;  3QSU A;  4IUV A;  5FRM A;  1ZX6 A;  1VQ8 T;  1QCN A;  1PNJ A;  4RG2 A;  5CVI A;  2CRE A;  1MUZ A;  5GMK m;  4PNO A;  2BZ8 A;  2ZZD A;  4FYX B;  4M75 E;  1RAE B;  1SRM A;  4ZGJ B;  2E64 A;  5A0L A;  2H8H A;  4DOV A;  3KUF A;  4JRK A;  2K9G A;  1I0C A;  2EKH A;  1LPL A;  4M77 C;  3JB9 D;  4OB3 B;  3OW2 A;  3LWH A;  2CT3 A;  1AZE A;  1NZ9 A;  3GF5 A;  1FX7 A;  1ZSZ A;  2JM8 A;  4E7Z A;  3HP9 A;  1VQ4 A;  2A37 A;  3C94 A;  1YBY A;  1KQS P;  1Y0M A;  4KH1 B;  4C92 F;  1VQ4 T;  4IUR A;  4ESR A;  1JJ2 A;  2DL7 A;  3VS5 A;  4QVD A;  1VQ6 A;  2RQT A;  2CP6 A;  4NS5 A;  2ROT A;  3VKI A;  3JCM f;  1QKX A;  1W2B P;  2H3E B;  4K11 A;  2RB6 A;  2CZ0 B;  2JM9 A;  2RI2 A;  1WHJ A;  4NL3 A;  4XU2 A;  4KUD K;  2O88 A;  3M55 A;  1YHQ Q;  2J6O A;  1WX6 A;  2LMJ A;  4QT7 A;  1QWE A;  2NYS A;  2BZY A;  2E65 A;  2MAM A;  1AZG B;  2O9S A;  3QII A;  2ECZ A;  5GJV B;  4JJN K;  2WAC A;  4X9D A;  2M9U A;  1IHW A;  4E7L A;  3EG2 A;  4AMC A;  5HY6 A;  2X3W D;  2F5T X;  4C92 C;  3E1S A;  2E10 A;  3O8V A;  3QJY A;  4II1 A;  4GLK A;  3CCE A;  1NYG A;  3MET A;  3JB9 G;  4E7S A;  4IUU A;  4C0D B;  5GAN 7;  3C12 A;  2SEM A;  5GMK e;  4AFS C;  2QQR A;  1YHQ A;  4PFP A;  1MND A;  1IXD A;  1K8A R;  2XKO C;  4ZTF A;  4HT8 A;  1P92 A;  4IKF A;  3ZBD A;  5DLQ E;  4FYW B;  3S3N A;  4NOY A;  2R5A A;  3CCQ T;  2PVG B;  2DL5 A;  2QAZ A;  2LX9 A;  1M1K C;  1AEY A;  2MIO A;  1UB4 A;  1C6V X;  1N8R U;  4C8Q G;  1SHG A;  2QA4 Q;  1H92 A;  3VS0 A;  3FJP A;  5CQY A;  2RNA A;  5GAN 8;  2E6Z A;  4B6M A;  1KD1 R; 
#chains in the Genus database with same CATH homology
 1UJY A;  2J6F A;  3TVT A;  1NEG A;  2CH4 A;  3REA B;  1M3B A;  2KYB A;  2MCN A;  3NMZ C;  1KIK A;  2DL3 A;  1PWT A;  2AK5 A;  3VRY A;  3VS1 A;  2JW4 A;  1G83 A;  1GFC A;  3TSZ A;  5IHK A;  1LCK A;  1T3S A;  2K3B A;  4LE9 A;  2W10 A;  2JS0 A;  2EYY A;  2KRM A;  1K1Z A;  1T0J A;  1ZBJ A;  2J05 A;  2GQI A;  4CC7 A;  2JS2 A;  1I07 A;  3NHN A;  3PE0 A;  2DYB A;  1VYU A;  1T0H A;  1GCQ C;  2CT4 A;  4JJC A;  1YCS B;  1T3L A;  4AG2 C;  1U06 A;  1J3T A;  1AOJ A;  1CSK A;  2BTT A;  4JPB W;  2L3S A;  1RI9 A;  5GJW B;  1GCP A;  1X6B A;  4CC4 B;  1SHF A;  1WXT A;  2DMO A;  3I9Q A;  2JXB A;  2QDL A;  2B86 A;  1GL5 A;  3REB B;  4EIK A;  2A36 A;  1AWX A;  3GBQ A;  2OJ2 A;  1FYN A;  1MV3 A;  1BK2 A;  4Z8A A;  2DJQ A;  4JJD A;  1PRL C;  4RTY A;  3H0I A;  1OPL A;  2CSI A;  1S1N A;  2RQV A;  1VA7 A;  2A28 A;  1AD5 A;  1M27 C;  1M3A A;  3QWY A;  1NLP C;  2L2P A;  2M51 A;  2O31 A;  4RUG A;  4RTZ A;  3FJ5 A;  1UG1 A;  2DIL A;  1H8K A;  2CSQ A;  1BBZ A;  2EGA A;  2RMO A;  2GGR A;  1RUW A;  3RBB B;  4AFU C;  2DNU A;  1YWP A;  1XOV A;  2EYX A;  1X69 A;  2F2V A;  1X2K A;  2VVK A;  4GLM A;  4LUE A;  1GCQ A;  2F2X A;  1OV3 A;  3IQL A;  4A63 B;  1ZUU A;  4DEX A;  3I5S A;  3RNJ A;  4E6R A;  1NLO C;  4HVU A;  4F17 A;  2YUQ A;  1KJW A;  1X6G A;  2NWM A;  2W0Z A;  3SHW A;  1X43 A;  2LZ6 B;  1Y57 A;  1ZUK A;  2CDT A;  4D8D A;  3EG1 A;  2LX7 A;  2ED0 A;  4J9D A;  2YT6 A;  2KT8 A;  1E7O A;  2HBW A;  2KBT A;  2L3Q A;  1BU1 A;  3PVL A;  1GRI A;  1MV0 B;  1QLY A;  1VYT A;  2GBQ A;  1U5S A;  4R0K A;  1GBQ A;  2O9V A;  2YDL A;  4J9C A;  1AWO A;  1WI7 A;  1AWJ A;  4OMM A;  4CC3 A;  2D1X A;  1AWW A;  2LQN A;  2YUN A;  1FMK A;  1WDX A;  2KXD A;  4JZ4 A;  4OML A;  3ULR B;  2FRY A;  1K0X A;  3A98 A;  2V1R A;  2D8H A;  1RLP C;  1HJD A;  2KR3 A;  2CUD A;  2XMF A;  2GTO A;  1YP5 A;  2DL8 A;  2AZV A;  2GTJ A;  1ABO A;  1U3O A;  2DL4 A;  3O5Z A;  3JV3 A;  1M8M A;  1RLQ C;  1WXB A;  4OMO A;  1UHC A;  1UTI A;  1CKB A;  2RQR A;  2HCK A;  2DBM A;  2K6D A;  2K7A A;  3M0U A;  5IHI A;  3SEM A;  2KRS A;  2DRK A;  2RPN A;  3UF4 A;  3U23 A;  5IXB A;  2EQI A;  1OPK A;  2RQW A;  2L3P A;  1K0S A;  1TUC A;  1I1J A;  5FW9 A;  2KYM A;  1UE9 A;  1YN8 A;  5I11 A;  2RN8 A;  1UDL A;  1WYX A;  2ESW A;  1UJ0 A;  1GFD A;  3C0C A;  4J9B A;  1QWF A;  2EGC A;  1YWO A;  1SSH A;  1WFW A;  2JMC A;  3NPF A;  1JO8 A;  2PTK A;  2KRN A;  1B07 A;  2LJ0 A;  4J9F A;  1SPK A;  4HVW A;  1PKS A;  1W70 A;  2NUZ A;  5FWB A;  2EYZ A;  1KSW A;  1ZLM A;  2CUB A;  2FG0 A;  4OMN A;  2BZX A;  4IIO A;  4AFQ C;  3M0T A;  3CQT A;  2MOX A;  2DE0 X;  2C0O A;  2C0T A;  4F16 A;  4ZNX A;  3VS2 A;  3I35 A;  1JQQ A;  1X27 A;  3VS6 A;  1NG2 A;  2G6F X;  2JMA A;  2YUP A;  3EG3 A;  2EW3 A;  2D0N A;  2ENM A;  1K76 A;  2E5K A;  2FPD A;  2C0I A;  2AZS A;  4Z88 A;  1UUE A;  2K79 A;  2EGE A;  2HEQ A;  1EFN A;  4RTV A;  2DX1 A;  1PRM C;  2LJ1 A;  4J9E A;  3M0R A;  4WCI A;  3QWX X;  2J7I A;  4M4Z A;  3VS4 A;  1PKT A;  1WLP B;  4JZ3 A;  3UAT A;  4LNP A;  1WIE A;  2ROL A;  4J9I A;  4JJB A;  2JTE A;  1BB9 A;  3THK A;  2EPD A;  4F14 A;  1E6H A;  3EGU A;  2AKK A;  5EC7 A;  2EVR A;  3M0S A;  5IHN A;  1SRL A;  3UA7 A;  2ABL A;  1SEM A;  1TG0 A;  2X3X D;  1B3Q A;  4ORZ A;  3VS3 A;  4KRT A;  2CH4 W;  5L23 A;  2DLP A;  3LH5 A;  4RTU A;  3PVQ A;  1QCF A;  1V1C A;  1UEC A;  1KFZ A;  1G2B A;  1Z9Z A;  2D8J A;  1NM7 A;  3H0H A;  2DBK A;  1OEB A;  1UHF A;  2RF0 A;  5IXF A;  4AFZ C;  3ZL7 C;  1VYV A;  1WXU A;  4RTX A;  1IO6 A;  1ZX6 A;  2EBP A;  3EHR A;  2LJ3 A;  4RTW A;  2PZ1 A;  1H3H A;  1PNJ A;  2VWF A;  2CRE A;  1MUZ A;  1ARK A;  2BZ8 A;  1N5Z A;  4CC2 A;  1W6X A;  1UFF A;  1SRM A;  2OI3 A;  4AG1 C;  2H8H A;  3H0F A;  1HSQ A;  1Z9Q A;  2FPF A;  1JEG A;  2A08 A;  2K9G A;  1I0C A;  2FO0 A;  2EKH A;  2KT1 A;  4HXJ A;  4RTT A;  2LCS A;  2EYW A;  1W1F A;  1ZUY A;  1PHT A;  1X2Q A;  1UGV A;  2L0A A;  2CT3 A;  1AZE A;  4LUD A;  1JXM A;  2JM8 A;  1M3C A;  4Y92 A;  2A37 A;  2FEI A;  1NYF A;  1Y0M A;  2JT4 A;  1WA7 A;  2M0Y A;  2PNI A;  2KNB B;  2VKN A;  4J9G A;  1E6G A;  4ESR A;  2P4R A;  2DL7 A;  4J9H A;  3VS5 A;  4D8K A;  2KXC A;  2DA9 A;  1JXO A;  2RQT A;  2KRO A;  2ROT A;  5ECA A;  1QKX A;  2RQU A;  3TSW A;  4K11 A;  2KGT A;  2FRW A;  2JM9 A;  3NGP A;  1YNZ A;  2O2O A;  2O88 A;  4X1V A;  2YUO A;  4FSS A;  2ED1 A;  2J6O A;  1WX6 A;  2LMJ A;  4GBQ A;  1HD3 A;  4QT7 A;  1QWE A;  2F2W A;  2KE9 A;  3EHQ A;  2LQW A;  2LP5 A;  2I0N A;  3M0Q A;  2BZY A;  1AZG B;  2HSP A;  4OMP A;  2K2M A;  2DM1 A;  1A0N B;  2IIM A;  2LNH B;  2O9S A;  2SRC A;  4HVV A;  2ECZ A;  2OAW A;  5GJV B;  2HDA A;  1QKW A;  5HCK A;  3EG2 A;  1OOT A;  1GBR A;  2X3W D;  1K9A A;  1AVZ C;  1ABQ A;  2YSQ A;  2J06 A;  1NYG A;  3VS7 A;  3H41 A;  2DF6 A;  4OMQ A;  3VRZ A;  2SEM A;  4LN2 A;  4AFS C;  4IIM A;  1K4U S;  2AKL A;  1ZSG A;  2V1Q A;  4HCK A;  1M30 A;  3I5R A;  2J6K A;  2FPE A;  4Z89 A;  1CKA A;  4DEY A;  2KEA A;  3UA6 A;  2DL5 A;  3M0P A;  5I22 A;  1AEY A;  5IH2 A;  3EG0 A;  2DRM A;  1NEB A;  2MIO A;  2GNC A;  2DVJ A;  1JU5 C;  1SHG A;  1H92 A;  3VS0 A;  3R6N A;  3KFV A;  5FWC A;  2RNA A;  1TUD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...