4RTYA

Crystal structure of the c-src-sh3 domain in complex with the high affinity peptide app12
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
58
structure length
58
Chain Sequence
b'MTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene tyrosine-protein kinase Src
publication title Crystal structure of the c-Src-SH3 domain in complex with the high affinity peptide APP12
rcsb
source organism Gallus gallus
molecule tags Protein binding
total genus 11
structure length 58
sequence length 58
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4rtyA00
1E7OA 2ED1A 4J9DA 4ZNXA 4Z88A 1X6BA 4AG2C 1U06A 2VVKA 1KJWA 2GTOA 2FPDA 4QT7A 3RBBB 2ED0A 2DF6A 1IO6A 1TUCA 2AZVA 2EW3A 4J9EA 1GBRA 5IHIA 1SHFA 2RQUA 4F14A 4OMPA 2A37A 5FWCA 1T3LA 1FMKA 1TUDA 3VRYA 1UG1A 4JPBW 1WXTA 2CH4W 1ZBJA 1AZEA 2KYBA 1UHCA 1Y0MA 2KRNA 2AKKA 1W6XA 1G2BA 1K76A 3SHWA 1UGVA 3A98A 4LN2A 1JXOA 1OPKA 2V1QA 1BB9A 2HCKA 2O9VA 4RTXA 1NM7A 2EYXA 3IQLA 1CKAA 2J05A 1VYVA 1UJYA 3REAB 2JM8A 1NEGA 1ZUKA 2ROLA 2JTEA 1GCPA 3TSWA 1AVZC 3GBQA 3JV3A 1QKWA 1X2KA 4J9HA 1SRLA 4IIMA 4ESRA 4RTZA 1VYUA 1JXMA 2EKHA 2ENMA 1WI7A 4RTTA 2YUOA 2KRSA 2FEIA 2GGRA 1W1FA 3EG3A 3R6NA 2BZ8A 2KT1A 4AG1C 2C0TA 2BZXA 1ABQA 3I35A 2PZ1A 2MOXA 2M51A 1ABOA 4A63B 1X2QA 4JZ3A 1SRMA 2H8HA 2JT4A 2VWFA 1H3HA 2YT6A 1NG2A 4JZ4A 3VS2A 2CUDA 2V1RA 1UDLA 1GFCA 3VS5A 4OMMA 4M4ZA 1XOVA 2LCSA 2DL5A 3NMZC 1UTIA 2AK5A 2DL4A 1M30A 1OEBA 2X3XD 2DBMA 2A08A 4JJCA 1KFZA 1ZUYA 2JS2A 2LZ6B 1H92A 1UFFA 2A28A 2EYWA 3VS3A 1ZSGA 3O5ZA 1A0NB 1AWOA 2LQNA 1M3BA 2RN8A 2DRKA 5IHKA 2EGCA 5I22A 4OMLA 1Z9QA 1GCQC 1Z9ZA 3NGPA 1JO8A 4FSSA 2HSPA 2LX7A 2KXCA 2LP5A 1WYXA 2SEMA 5FW9A 2DMOA 1HD3A 1WXBA 1YP5A 1CKBA 3M0RA 2EBPA 2MIOA 2RQVA 3PVQA 1FYNA 3M0QA 2J6FA 4LE9A 1S1NA 1UE9A 2DILA 4CC2A 1K9AA 4HVUA 1NLPC 3EGUA 2FG0A 4HCKA 4LNPA 4LUDA 1AWXA 4J9GA 1QLYA 2DNUA 4ORZA 4DEYA 5IXFA 3VS0A 1PRMC 1H8KA 1PWTA 2J7IA 2RNAA 1NYFA 1UHFA 2EQIA 4WCIA 1QKXA 4EIKA 2JW4A 4OMNA 2RQTA 1LCKA 1SEMA 3ULRB 4AFQC 5FWBA 2CUBA 1M27C 1KIKA 1J3TA 2KXDA 2K6DA 1RI9A 4AFZC 1I1JA 1AD5A 3UA6A 3VRZA 2PNIA 2O88A 3UF4A 4OMOA 2YDLA 1E6HA 2CH4A 4J9BA 2D8JA 1JU5C 2C0OA 2DYBA 1MV0B 2ESWA 2LJ3A 3U23A 2DX1A 5L23A 1ZX6A 2JMCA 1RLQC 1AWJA 4J9CA 1K1ZA 2EYYA 4D8DA 2M0YA 2DE0X 3CQTA 2RQWA 2L3SA 2LMJA 2EPDA 2DRMA 1QCFA 2FRWA 3EG0A 4OMQA 2O31A 3VS7A 4E6RA 2CT3A 1WLPB 5GJVB 4J9IA 2GBQA 1EFNA 1AZGB 1SSHA 4R0KA 1CSKA 2EGEA 2CT4A 2OI3A 2I0NA 3REBB 4GBQA 1Y57A 1BU1A 3LH5A 1BBZA 1OV3A 1X6GA 2F2VA 1K0SA 2C0IA 1WA7A 2KR3A 1UUEA 2LJ0A 1GBQA 3THKA 1AWWA 2RPNA 2X3WD 2BTTA 2DA9A 2CDTA 4GLMA 1BK2A 3RNJA 1KSWA 1ARKA 2JXBA 1NEBA 2RF0A 1VA7A 2E5KA 2L3PA 1WIEA 4Z89A 3EG2A 4F16A 2EYZA 3I9QA 2CSIA 2ROTA 2KROA 2ECZA 1W70A 2L3QA 1V1CA 2J6KA 3EHQA 1SHGA 1YWPA 1X69A 3EG1A 3I5RA 2W0ZA 5GJWB 2FO0A 2DLPA 3PVLA 1MUZA 1E6GA 3PE0A 1I07A 1YCSB 4CC3A 2A36A 1T0JA 2RMOA 2YSQA 2KT8A 1VYTA 1WDXA 1G83A 1OPLA 3VS1A 1ZUUA 3M0SA 3EHRA 2RQRA 5IXBA 1YWOA 3KFVA 1GFDA 2DL8A 4LUEA 2D8HA 2KBTA 2KEAA 2JM9A 1U5SA 2AKLA 2GNCA 1ZLMA 1PKSA 3UATA 2CSQA 2L0AA 2MCNA 4RUGA 2K3BA 3M0TA 2DBKA 2O2OA 1OOTA 3QWXX 2D0NA 2B86A 1GCQA 2LNHB 4AFSC 2YUPA 2QDLA 2DL3A 3UA7A 4F17A 3H0IA 1M3CA 2KE9A 3NHNA 1YNZA 2NWMA 1JQQA 2J06A 1WX6A 5IH2A 2YUQA 2K9GA 1NYGA 1AOJA 1T0HA 4JJDA 2KGTA 4J9FA 2KYMA 3FJ5A 1K0XA 1X43A 2JS0A 2F2WA 3ZL7C 4K11A 2VKNA 1UECA 2HBWA 1TG0A 2KRMA 2G6FX 2IIMA 4JJBA 2DJQA 1WFWA 3H0HA 4RTWA 3VS6A 2GTJA 1AEYA 2OJ2A 2HEQA 4HVWA 1K4US 1JEGA 1UJ0A 1SPKA 1QWFA 2FPEA 2OAWA 1RLPC 2DVJA 2SRCA 2F2XA 1RUWA 4IIOA 1PNJA 4HVVA 3QWYA 2L2PA 2AZSA 3SEMA 4AFUC 1X27A 1MV3A 4X1VA 2J6OA 2PTKA 3NPFA 4D8KA 2YUNA 2ABLA 1NLOC 4KRTA 1I0CA 2XMFA 4RTUA 2K7AA 3TSZA 1GRIA 1WXUA 3M0PA 1PHTA 2O9SA 5I11A 1N5ZA 2LJ1A 1M8MA 2BZYA 3TVTA 1YN8A 5HCKA 2NUZA 2DM1A 2KNBB 2FPFA 2CREA 2D1XA 2W10A 1HSQA 1GL5A 1HJDA 1M3AA 1T3SA 3VS4A 4HXJA 2EVRA 5IHNA 4DEXA 3H0FA 1QWEA 1U3OA 2GQIA 3I5SA 4RTYA 4Y92A 4CC4B 4CC7A 2EGAA 3C0CA 5EC7A 1PRLC 5ECAA 2JMAA 1B07A 2DL7A 2FRYA 1B3QA 2HDAA 2P4RA 2K2MA 2K79A 3M0UA 4Z8AA 2LQWA 1PKTA 3H41A 4RTVA
chains in the Genus database with same CATH superfamily
2LNVA 2EFIA 2PVDB 1X6BA 4AG2C 4RCCA 1U06A 2VVKA 1M1KR 3RMSA 2FPDA 3OYEA 1R77A 2ED0A 1VIFA 2DF6A 5CQXA 1XQHA 4OMPA 4XU1A 5FWCA 1T3LA 3P8BB 2JN0A 3S3NA 3X24B 2CH4W 3CCJT 4ZGEB 5FU6B 5CO7A 4C0DB 2KRNA 2PQWA 2AKKA 4PJOA 3SHWA 6AT1B 4M7AD 3MEUA 1VQ7Q 2LC4A 5GANe 4HT9A 1F1BB 2HCKA 2O9VA 5GAMd 4RTXA 1NM7A 2ZPGB 4C8QD 2J05A 3CXCS 1VQLQ 2BKDN 1NEGA 1ZUKA 2VC8A 4FSXA 2BE9B 1Q82U 2DIGA 4UC4A 2XIDA 2PUOB 4ESRA 1VQMT 4FT2A 3X25B 1VYUA 1JXMA 5A0DA 4QVCA 3P8DA 1WI7A 4C5EA 3CC7T 3AT1B 3A8MB 3TEEA 2DZ9A 3EG3A 5GANh 3R6NA 2BZ8A 3OYIA 2KT1A 2BZXA 2K5FA 4II1A 3CCET 4FT4A 3JCMX 2BE7D 3PNWC 1UGRB 5KYXA 1QVPA 4M78A 5FRMA 2CP2A 1M90C 1M2OA 2RJDA 1Q81R 2EJGA 2VXFA 3E2UA 1KQSA 1XOVA 2LCSA 2RI3A 3NMZC 1M30A 2COYA 1KC8U 2DK3A 2DBMA 2DETA 4JJCA 2OTJA 1ZUYA 2LZ6B 1KHCA 2A28A 4KUDK 2BIVA 1M3BA 3EFOB 3C12A 3R6OA 1ZBXA 5IHKA 2GF7A 5I22A 4OMLA 1Z9QA 2EYQA 1GCQC 3QXEB 1JO8A 1ZSZC 4E7KA 5CR2A 3JB9I 4R55A 1D3BA 3LH0A 3CMAT 1K8AU 1WYXA 1OU8A 2KDSA 1HD3A 3FJPA 2MMPA 4HCBA 1NPPA 3JCMh 2MIOA 3PVQA 4M7DA 1M1FA 4LE9A 4NS5A 2DILA 1K9AA 4HVUA 4PLLA 1YITA 2X51A 2LQ8A 2QEXA 2ZPHB 3NTHA 2HZYA 3OYNA 2OTJQ 5IXFA 1PRMC 2R5AA 1FWZA 1WPYA 4JDSA 3LGFA 1BI1A 3CCRT 2JW4A 2B8AA 1Q86U 1KQ1A 1LCKA 4ELYC 1IGQA 5FWBA 2OTLQ 1J3TA 5GMKi 1VQ6A 1OZ2A 2K5LA 4E47A 3LWHA 3UA6A 3VRZA 2AT1B 2PNIA 3JCMc 4OMOA 2LT1A 2CP3A 4J9BA 2KVQG 4M77E 1YITQ 2LJ3A 2QI2A 3GNFB 3G71A 2O4XA 3H6ZA 2YLCA 2HSEB 1AWJA 4J9CA 2M0YA 3SB2A 4M77B 1MMGA 4D6WA 2RHXA 1KQSP 5KYUA 3JB9G 1VQ6Q 5GAMh 4OMQA 2O31A 5HY6A 1OX8A 4QQGA 2QG9B 4M75D 1VQ9T 2EGEA 3L2RA 1VQNA 2I0NA 1Y57A 1R8OB 2P84A 4C0GA 2RD1A 2RM4A 3CXCA 1SKUB 1BBZA 1X6GA 2NYSA 2DAQA 3CPWA 4QKUA 4XTWA 5GAN4 2M02A 1AWWA 2RPNA 2DA9A 1OU9A 2QAZA 2JXBA 2KAFA 5CKHA 2L3PA 4OGCA 1YJWQ 2K3YA 2X4XA 3OYMA 3EG2A 4F16A 3I9QA 1YI2A 2KROA 1V1CA 3DLMA 2J6KA 4PL6A 5GAOl 4BE0A 1YWPA 1X69A 3EG1A 3CCLA 3QKJA 2LRQA 1WHJA 5GMKh 2QGGA 1I07A 1YCSB 2M9UA 2QTXA 3JRZA 1IREB 3CCQT 4C92E 2YSQA 2E6NA 1VYTA 4J6YA 4ELZC 3VS1A 2X4JA 5C0MA 2QQ9A 2RQRA 1YWOA 3QYGB 1BI3A 5DLQE 3C4SA 2KEAA 2DD4A 1RAFB 1BCOA 1N8RR 3DB4A 2AKLA 1LOJA 1VQPT 4ZTJA 1Q81C 3OA6A 1YI2Q 2HBPA 3UATA 4AT1B 4C92B 4LDVA 2DXUA 3GF5A 2K3BA 2O2OA 4JJNK 1LNXA 4AFSC 3MPUB 2DL3A 4JRQA 5LJ5g 1TXQA 1YNZA 4A4GA 1NJIC 4N4GA 3L2ZA 4KGZB 4IKFA 4FL6A 2DD5A 1ZA1B 2Z0WA 1YFNA 5IH2A 3VU3C 1VQ5A 2I2LA 3MP1A 2XDBA 5GAMf 1FXXA 4XK8E 1VQOQ 5GAOp 2Y90A 5D6WA 5GAN8 3JCMW 4E7JA 3QUIA 4RTWA 3VS6A 3CPWP 1S72T 1N27A 4HVWA 4M7AE 1JEGA 1UJ0A 4FYVB 2CP7A 4C8QE 2FZKB 4IIOA 4YTLA 1D3BB 3CD6A 3DB3A 3OSSC 2QA4T 4IUVA 3CCJQ 3FDRA 1IGUA 2DO3A 4M7AB 4BDZA 3NPFA 2ABLA 2D6FA 1C1AA 3OYLA 2WSFE 3LYIA 2EWNA 3FB9A 2YHTA 1MHNA 1JRIA 3PGGA 4IUPA 1PHTA 1SF9A 2BZYA 2R58A 2NUZA 4DOVA 2KNBB 1G5VA 2HL3A 2W10A 2COZA 1HJDA 3HFOA 3H8ZA 3VS4A 4OVAA 2QYZA 5IHNA 3H0FA 3I55T 2GQIA 3SWNC 3C0CA 2QEXT 1VQMQ 3QSUA 2YRDA 1NE8A 4A4HA 2FRYA 2HDAA 3CC7Q 3MCAB 2K79A 4Z8AA 5C6SA 2LQWA 2O4XB 1TOVA 2Y4XA 4R56A 4XAXB 1E7OA 2ED1A 1Q82R 3MP6A 5A0LA 4J9DA 4ZNXA 3CCEQ 1KJWA 4M77G 3RBBB 1PC0A 2FVUA 2RJCA 3CMAA 1TUCA 2AZVA 3L2UA 2E65A 1SHFA 2X4YA 4X9DA 4J6XA 1UG1A 1QVFS 2MI6A 5DLOA 1D1BA 3HPWA 1WXTA 4PFOA 3HHTB 1ZBJA 3G71T 2P0PA 3CCST 3A98A 3ZEHA 3RKYA 5KH6A 1JXOA 2V1QA 1BB9A 1V76A 1BI2A 1M5Q1 3E19A 2CZ1B 3CCRA 4JS4A 8AT1B 4ZN3A 1QW1A 3CMAQ 2JM8A 4OP0A 5KYWB 1TTHB 4L6V5 5KCOA 1H641 2E70A 2K2VA 1GCPA 1VQNT 2HKQB 3OSVA 4OB3B 3S3OA 1TH7A 2FYKA 4NL3A 1RACB 4J9HA 4LDXA 1SRLA 2VV5A 4IIMA 1K8AR 2ATCB 3OQ5A 1K9MU 5CIUA 3C94A 1N6AA 3URGA 2EKHA 2HKNA 3MEWA 3X20B 4RTTA 3QDRB 3QG1A 2KRSA 1QP2A 1W1FA 4F7UF 3CCRQ 4Z02A 2JTFA 2GQVA 3OBWA 3VYHB 3L1AA 2C0TA 3A8HB 3L2WA 1ABQA 2PZ1A 2MOXA 3EH2A 3PFSA 1SRMA 4MDXA 3CCLT 1H3HA 3VS2A 2ZCFB 3E9FA 3LLRA 3RDVA 5GAMj 2V1RA 3GP8A 1UDLA 2DTIA 3S6WA 1VQ9A 4N0AC 2XICA 3VS5A 2A3LA 1Q86R 4RCBA 4M4ZA 3MEVA 4EMKC 3OS1A 4M75E 4JUVA 5CKDA 1OEBA 4E7HA 3EAEA 2X3XD 3LX7A 3QIIA 2COWA 4O6JA 4M77A 3M57A 1H92A 1A0NB 4C5IA 1AWOA 4FYYB 2RN8A 4B6MA 2DRKA 4CI0C 4LD9K 1LVKA 3FRNA 4MMLA 4FM4B 4EMGA 2HSPA 4M75B 1BIBA 4PJLA 4XU2A 1VQ9Q 5FU7B 5GAOn 2XK0A 4KUIA 3V7SA 1WXBA 5LJ5d 4M78D 1YP5A 1CKBA 2EBPA 5I2MA 4JRKA 4PJOF 1Q7YU 3CCQA 5GMKj 4CC2A 4BE2A 5I2SA 3DLLA 2FG0A 4HCKA 4LNPA 1WQ7A 1AWXA 1VQ5T 4ORZA 3CC4T 4PLIA 2IPOB 2RNAA 3WVDB 5IT9E 1UHFA 3PTAA 2DXTA 4WCIA 4EIKA 3CCUT 2VGNA 1VQPA 4OMNA 3RKWA 4M7DG 1M2VB 1SEMA 1K73C 4AFQC 3EG9B 2Y4YA 1KIKA 3CMEA 1UGSB 2O88A 5FLXE 3F70A 3RUXA 1E6HA 4LDWA 3VUZA 3CCQQ 1JU5C 4EMHA 3PMTA 1QCOA 2LVMA 2WACA 1PM3A 2A0FB 3FC3A 1QQJA 3V8LA 3CD6T 2OX7A 2CP6A 1ZX6A 2ZPIB 3LGLA 1RLQC 2E1HA 5EG2A 4BI4A 3GLXA 4D8DA 3RIRA 4LD6A 4C92A 1VQPQ 3HRTA 2E3HA 4M78F 2EPDA 3NTKA 3OW2A 2FRWA 3BFMA 2LQKA 1S72A 4C0ZA 1WLPB 3META 3G4ST 4C0FA 4E7SA 8ATCB 5GAN7 1VQKT 2QQBA 1BU1A 3JCMe 1IB8A 2KSSA 4MMKA 1WJSA 2QA4A 2QGFB 3RNJA 1C6VX 1I4K1 1U8RA 1B34B 2BUDA 5I21A 4OF1A 1SSFA 4QQDA 2QTVA 2E5KA 4Z89A 4DOWA 2EYZA 2CSIA 2ROTA 1LJOA 4M7DF 3EHQA 3MP8A 2YRCA 4FW1A 1MNDA 2KMTA 2W0ZA 2FO0A 1YCYA 1M90U 3PVLA 1MUZA 2JUFA 2CZ6B 7AT1B 1T0JA 1I5OB 2NLUA 1D0ZA 1OPLA 3OS2A 1ZUUA 3M0SA 2DEQA 4M7AA 1ZA2B 5IXBA 3KFVA 3I55A 4PJOC 1IZ6A 4LUEA 2L89A 2JM9A 2EJ9A 2HQXA 1U5SA 2F5KA 2LDMA 2XDPA 4C8QA 1ZLMA 1P92A 2WSEE 2CSQA 2MCNA 1B7TA 5DM7R 1OOTA 3QWXX 1X01A 2D0NA 2E12A 2B86A 1YIJA 1RAHB 5GAMe 5GAN2 2QDLA 3JCMJ 3DKMA 5LJ5h 1YJNT 2YUQA 3FLGA 5LJ3d 3OW2P 2M16A 3I55Q 1AOJA 2DZCA 2KGTA 3MJXA 4EPCA 2JS0A 2QEXQ 2VKNA 1M1KC 2HBWA 3CCSA 1TG0A 2E5QA 2G6FX 1IHVA 2DJQA 1WFWA 4N4IA 2MF2A 2V8KA 2OJ2A 4M78C 2HEQA 1KQ2A 1JB0E 1M8VA 4OB1B 1SPKA 1WHHA 1VOMA 5IN1A 1RLPC 2SRCA 5GMKe 4M75G 2RJFA 2F2XA 1G3TA 5LL6S 3V8JA 3M9QA 3EGDB 1O75A 3QWYA 2QQAA 2L2PA 2AZSA 1DJ7B 3G71Q 1KD1U 3CCSQ 1MV3A 3V7RA 3J80E 3JB9D 5CQYA 2C06A 2DERA 5GMKl 1M9SA 2YUNA 4BI3A 1NLOC 4KRTA 3TSZA 2RH2A 1GRIA 1I8FA 3OS0A 3JB9H 5KYWA 4Y91A 1OYXA 5I11A 1N5ZA 2LJ1A 3PT9A 3TVTA 2LCCA 4M7DC 2JVVA 3VYGA 1MGQA 1ZSZB 1HSQA 5M9OA 1M3AA 3OYKA 2NUPB 2ZZDA 1VQNQ 3M54A 3OYJA 3INZA 1M4ZA 2V26A 4HXJA 2EVRA 2G3RA 2MPXC 2RO0A 1AHJB 1U3OA 4CC4B 5ECAA 3EH1A 2EQMA 1B07A 3CC2T 2E41A 3PIPA 2KQWA 1FX7A 5D6XA 4RTVA 2E64A 3OBYA 3OYFA 4O5VA 1D09B 1VQLT 1K9MR 4J5YA 5LJ5f 2XD0A 2GTOA 4DBFA 5GMKm 5A0GA 3JCMV 3CMET 4N4HA 3CCLQ 4BD3A 2EJFA 3NTIA 4J9EA 4BY6C 5IHIA 2RQUA 4F14A 1GBRA 2JTMA 3JB9F 4KH1B 1TUDA 3L2VA 3VRYA 2F1LA 4JPBW 5J3BA 1N9SA 5GAOm 1AZEA 1Y07A 2KYBA 1UHCA 1RAGB 5GAOr 1W6XA 3V7CA 5KE3A 1Q81U 4VUBA 3CC4A 2RI5A 2KY9A 3AHUA 4E7ZA 2PU9B 5AYFA 3SD4A 3CCUA 2JOYA 4M75A 2EYXA 3BE3A 3OYBA 3M4YA 1CKAA 2M1HA 1VYVA 1UJYA 3CXCP 1NJIU 1VIEA 4J6WA 2JTEA 1OULA 3TSWA 1AVZC 3L2QA 3JV3A 4E7LA 1VQ5Q 4C5GA 3CC4Q 1M1GA 3HSBA 2MAMA 2ENMA 1M2VA 2YUOA 4HKEA 2DTHA 2GGRA 1Q7YR 4V2SA 3EG9A 3A8GB 1MMAA 2FL7A 2KI7A 1MMDA 4IURA 4AG1C 1EX4A 3V8KA 5KYNA 3I35A 4PFPA 3X26B 4C8QB 3CCMT 4A63B 1X2QA 4JZ3A 1PD1A 2JT4A 2VWFA 2DKGA 4OB2B 3G4SA 1NG2A 1D0YA 2CKKA 1GFCA 4WF2A 4FW2A 5GAOq 1N9RA 4J7FA 1VQKA 2ZPBB 3CD6Q 2DL5A 2DL4A 3EGXB 3CEYA 2A08A 2CZ7B 2JNGA 1KFZA 1VQ4T 1UFFA 1PG5B 1ZSGA 3O5ZA 4EDUA 2LQNA 2O01E 1XNIA 3NGPA 2D0QB 2FB7A 3LW5E 3TU4K 4FSSA 3M58A 3A1PA 3S3MA 5A2QE 2LP5A 3J81E 3G4SQ 2SEMA 1YIJT 2DMOA 3CBPA 4BUGA 4XTUA 4PKCC 1VQKQ 2RQVA 1FYNA 2DIQA 4KGXB 1WHGA 3L42A 2YWWA 2CP5A 1NLPC 1B34A 4LUDA 2DNUA 3VS0A 2K57A 4PNOA 2J7IA 2EQJA 4RMOA 4KULA 4L59A 1NYFA 2EQIA 4M77D 3CBOA 4Y28E 1FMVA 3ULRB 4BE1A 2CUBA 2RI2A 4QW2A 4Q5WA 2KXDA 2K6DA 2FZCB 5FROA 4BACA 1I1JA 3RR6A 2L5QA 1KC8R 3UF4A 2YDLA 5LJ3f 2CH4A 5FU6C 4C0DC 1U1TA 1N8RC 2YXYA 2ESWA 3MHXA 1RL2A 1TU0B 2A7YA 3QO3A 1YJNA 2DX1A 1K9MC 5L23A 4XTXA 2JMCA 5LJ3g 1Y71A 5LJ5j 5GANd 1M90R 2DTOA 3WVEB 1YHQT 1K1ZA 2EYYA 1X75C 4KH0B 3CQTA 4ZN1A 1ACMB 2RQWA 5HK0A 3I56T 2XDDA 3UDCA 2DRMA 2CGHA 1QCFA 4PJOD 3EG0A 3VJPA 1KQSS 2CT3A 5GJVB 1AZGB 1SSHA 3HRSA 3M55A 1CSKA 4R0KA 4ZGJB 2OI3A 4C92G 3REBB 4GBQA 4HCCA 2XG8D 4M77F 2F2VA 2C0IA 1WA7A 2KR3A 1YJNQ 1UUEA 2GFAA 1GBQA 2LJ0A 1WHMA 3THKA 4GLMA 2CDTA 1FMWA 4GLKA 3OMCA 1NEBA 4GY5A 2RF0A 1VA7A 2AIRB 1UGQB 1BKBA 2XI9A 1WIEA 3SWNB 1BYMA 3OS5A 3HKSA 1UGPB 1YJ9T 1W70A 3JCMd 4P5NA 1KHIA 3Q1JA 3RERA 2K4YA 2ZGWA 3KXTA 5GJWB 4HT8A 1ZHIA 2DLPA 1E6GA 3QYHB 3G6ET 2FHDA 1NZ9A 3A5ZB 4ATOA 1RI0A 1NBEB 4E2FB 2RMOA 3EGDA 2EQKA 1ZQ1A 4J8OA 2ZAEA 3GOXA 1JJ2S 1GFDA 2HL5C 2DL8A 1OX9A 4LDUA 5CAIA 2KBTA 4FCYA 3BDLA 4A4EA 2GNCA 3CC2A 4XU0A 2XU8A 1TWBA 2L0AA 2P0KA 4DQ2A 2YLBA 3M0TA 2DBKA 4M7AG 1GCQA 2LNHB 4RKUE 1KD1R 2YUPA 1VQLA 1ZSZA 3J7AF 3H0IA 1M3CA 2KE9A 2NUPA 4C8QG 2NWMA 1RABB 3C95A 4C92F 3JAME 2K9GA 4M7DD 2P0QA 2QK0A 3FJ5A 1Q82C 1K0XA 2F2WA 2QXFA 1W4SA 3CC2Q 4A4FA 2DJZA 2KRMA 5CKFA 1QVFA 2IIMA 1K73U 2R57A 3HL8A 4B9WA 2GTJA 1AEYA 2L3RA 4L5GA 3CPWS 3CCVT 4X9CA 3CMEQ 2VASA 1QWFA 1XJWB 4ZTFA 1NPRA 3NFCA 2MWPA 2K3XA 1OQKA 4M77C 3SEMA 3QDFA 4AFUC 1KC8C 1W2BS 4EMKB 2PTKA 4XTYA 5LJ3j 2HAXA 5CVIA 1WNLA 3MEAA 2X9HA 2K7AA 2WSCE 1HYOA 1WXUA 1RAIB 4MDWA 3H9NA 3VV0A 3CCMA 1M8MA 1S72Q 4M7AF 4TVRA 1YN8A 1K8AC 2DM1A 4NOYA 1XTDA 2FPFA 2CREA 2D1XA 2DYIA 1GL5A 2IG0A 4C8QF 1KK7A 2L8DA 5LJ5e 4DEXA 1QWEA 2V8JA 1PRLC 5L8RE 3ZFJA 4DBHA 1MMNA 1NJIR 2JMAA 2QA4Q 3SDZA 2DL7A 4JLGA 4KBMB 1D1CA 2K2MA 2P4RA 1VQ4A 1V29B 4WTOB 2LTOA 2YRVA 1PKTA 1HXDA 2OTLA 3E9GA 2RJEA 1Q86C 4Z88A 3CCMQ 3MO8A 2CYZB 4QT7A 2ZPFB 3ZBDA 1IO6A 2VGMA 5AT1B 2EW3A 1Y96B 2LX9A 4C5HA 3N5BB 2A37A 2NUTB 2PVGB 3BW1A 2K5IA 1QVFP 1FMKA 4KT0E 4JS5A 3EGXA 3M4GA 1X6OA 1G3YA 2E6ZA 2XHCA 4OMFB 1Y0MA 4C92C 4BB7A 5KYYB 2QASA 1G2BA 1K76A 1VQ4Q 1UGVA 2X35A 4F7UE 1JJ2A 1BIAA 4LN2A 1OPKA 4OB0B 5D6YA 3TREA 3LWIA 1I81A 2QQRA 1OI1A 1RADB 3IQLA 4XU3A 4J7IA 2E4HA 1WJRA 2DXBA 3ASKA 3REAB 5CCAA 3T9NA 1YIJQ 2CZ0B 1KG1A 5DY9A 2ROLA 3TQ7P 3JSCA 4FYWB 1QVGS 4FIBA 1VQ8T 2DEUA 4F7UB 5J39A 5GANf 3GBQA 1QKWA 2HNIA 2V8IA 1X2KA 3HP9A 1KD1C 1M1KU 4RTZA 3VUBA 2MWOA 5GANg 4HCZA 3UWNA 1YJWA 1EZZB 1YHQA 2LCLA 2FEIA 4XTVA 2QQSA 3M59A 3I56A 3OYAA 2M51A 1ABOA 1WHLA 1Y7XA 2H8HA 3QBYA 3GIBA 3A8LB 2YT6A 4JZ4A 2CUDA 1WZOA 4PJOE 1BCMA 3OYDA 2LT4A 4OMMA 4M7AC 2PVOB 3HTRA 1UTIA 2HD0A 2AK5A 4RG8A 5IAYA 4C8QC 3FEOA 3JCMQ 4JRPA 1MNEA 3KUFA 2JS2A 2FZGB 1YHQQ 2EYWA 3VS3A 1O9SA 1VQ7T 3JCMf 2EGCA 3I56Q 4PJOB 1W2BA 1Z9ZA 3QJYA 2M0OA 4PK4A 1YJ9A 3JCMg 2LX7A 2CS7A 2DXCA 2KXCA 3JB9J 3PMIA 4X34A 5FW9A 2DVEA 3OYGA 2F69A 2GCXA 3M0RA 2EKOA 3G6EA 3M0QA 1UB4A 1JJ2P 4IUQA 2EIFA 2J6FA 1S1NA 1UE9A 2VXEA 3OYHA 3EGUA 1VUBA 4J9GA 1QLYA 4M75F 4E7IA 2RA2A 4DEYA 1H8KA 3A8OB 1PWTA 3SWNA 5LJ3e 1VQOA 2XKOC 2JZ2A 4M78E 1QKXA 2KK4A 4KGVB 4AMCA 2RQTA 3CPFA 1YJ9Q 3EFRA 3GPLA 2HQEA 3RKXA 1M27C 1G3SA 3G1JA 4A54A 4JRIA 1RI9A 4AFZC 1AD5A 4DA4A 3CBMA 3TCJA 4RG2A 3G6EQ 2QDYB 3JCMP 3PIOA 5KYXB 2D8JA 4M78B 2C0OA 2DYBA 3M5AA 1MV0B 4IUUA 3CCJA 3G7ZA 3U23A 4BDYA 1EIFA 2GFUA 2RK1A 4DBQA 4DBRA 5CKBA 4IUTA 5LJ3h 2DE0X 4MZPA 2VUBA 5GAMg 1LPLA 2L3SA 2LMJA 4HA8A 5CK9A 4FYXB 4J83A 4OGEA 4M7DE 3ER0A 2D9TA 3CCUQ 3VS7A 4E6RA 4J9IA 2GBQA 1EFNA 3CCVA 1JBMA 2CT4A 3RMQA 1D0XA 3ME9A 5CKEA 3LH5A 3BDUA 5FRNA 2VYTA 1OV3A 1AT1B 3HFNA 1K0SA 5HK3A 2RK2A 2EQUA 1W2BP 4M7DB 1QVGA 1BI0A 1VQMA 3OYCA 2X3WD 2OTJT 2BTTA 1BK2A 1OZ3A 1KSWA 2X4WA 4ZGDB 2ZPEB 3OB9A 1ARKA 1G3WA 3CC7A 2IVWA 2PUKB 3BY7A 1WJQA 3QZ5B 2EAYA 3UT1A 1HK9A 4MZTA 2HMAA 1WGSA 3D7SB 4B9XA 5GAN3 5GANj 3CCEA 2H3JA 2ECZA 1RAEB 2L3QA 3OYYA 1GXIE 2OAUA 2OTLT 1QMCA 1SHGA 1YBYA 2HQHA 3I5RA 3CCVQ 3GNGA 3PE0A 1SG5A 3O8VA 2DPPB 4CC3A 2A36A 1K73R 2KT8A 4XQ3A 1YITT 4N0AA 1PCXA 1WDXA 1G83A 3X28B 3EHRA 5KE2A 4F7UG 4BY6B 5GAN6 4EMKA 2AHJB 4QVDA 2D8HA 3VKIA 3WXMB 3OY9A 2RHYA 1PKSA 4M75C 1RAAB 5FU7C 3UPUA 4RUGA 1PSEA 2RHUA 1VQ6T 3FIFA 1G8XA 3UA7A 3SFMA 5KYUB 4F17A 3OMGA 3NHNA 1JQQA 2RHIA 1QCNA 4NL2A 4BI8B 2J06A 1WX6A 3HRUA 4QQ6A 3KBGA 5D7UA 4XTZA 3EFOA 1NYGA 1T0HA 4JJDA 3OW2S 3M56A 4J9FA 1IXDA 1QP3A 3QJ6A 1C0MA 2KYMA 1R0BG 1X43A 5KCHA 3ZL7C 4FU6A 4K11A 1U1SA 1UECA 2MYSA 5J26A 3JCMb 3M53A 2MK5A 1YJWT 1D1AA 4JJBA 3E1SA 4ME7A 4CRIA 3H0HA 4F04B 4PJOG 1QVGP 1K4US 1Y96A 3EFSA 3QPHA 1TUGB 2NUTA 2FPEA 2H3EB 3RESA 2OAWA 1IHWA 1PD0A 2DVJA 1N8RU 4A53A 3MKDA 1RUWA 4QVZA 3P8HA 1VQ8A 1PNJA 4HVVA 5GAN5 1TSFA 1Q95G 4LDYA 1WQWA 5KYYA 4PFZA 1X27A 4PJMA 1WHKA 4X1VA 2J6OA 4D8KA 1H3ZA 4ANJA 4LXCA 1TS9A 1YI2T 1I0CA 2RHZA 2XMFA 4JLIA 4RTUA 4C92D 2P4TA 9ATCB 2VB6A 2JJ9A 4A4KA 1R0CB 3M0PA 1UEBA 2O9SA 2E3IA 4MZMA 4F7UA 5HCKA 4PJJA 1VQ8Q 1T3SA 1PSFA 2CP0A 2F5TX 3QHSA 1Q7YC 2DFUA 3I5SA 4RTYA 4Y92A 4CC7A 2EGAA 2R5MA 4M78G 5EC7A 1IRXA 1I5LA 5HKCA 1B3QA 1VQOT 3M0UA 3QZ9B 4PJNA 2E10A 1VQ7A 2RB6A 3H41A
chains in the Genus database with same CATH topology
1E7OA 2ED1A 4J9DA 4ZNXA 4Z88A 1X6BA 4AG2C 1U06A 2VVKA 1KJWA 2GTOA 2FPDA 4QT7A 3RBBB 2ED0A 2DF6A 1IO6A 1TUCA 2AZVA 2EW3A 4J9EA 1GBRA 5IHIA 1SHFA 2RQUA 4F14A 4OMPA 2A37A 5FWCA 1T3LA 1FMKA 1TUDA 3VRYA 1UG1A 4JPBW 1WXTA 2CH4W 1ZBJA 1AZEA 2KYBA 1UHCA 1Y0MA 2KRNA 2AKKA 1W6XA 1G2BA 1K76A 3SHWA 1UGVA 3A98A 4LN2A 1JXOA 1OPKA 2V1QA 1BB9A 2HCKA 2O9VA 4RTXA 1NM7A 2EYXA 3IQLA 1CKAA 2J05A 1VYVA 1UJYA 3REAB 2JM8A 1NEGA 1ZUKA 2ROLA 2JTEA 1GCPA 3TSWA 1AVZC 3GBQA 3JV3A 1QKWA 1X2KA 4J9HA 1SRLA 4IIMA 4ESRA 4RTZA 1VYUA 1JXMA 2EKHA 2ENMA 1WI7A 4RTTA 2YUOA 2KRSA 2FEIA 2GGRA 1W1FA 3EG3A 3R6NA 2BZ8A 2KT1A 4AG1C 2C0TA 2BZXA 1ABQA 3I35A 2PZ1A 2MOXA 2M51A 1ABOA 4A63B 1X2QA 4JZ3A 1SRMA 2H8HA 2JT4A 2VWFA 1H3HA 2YT6A 1NG2A 4JZ4A 3VS2A 2CUDA 2V1RA 1UDLA 1GFCA 3VS5A 4OMMA 4M4ZA 1XOVA 2LCSA 2DL5A 3NMZC 1UTIA 2AK5A 2DL4A 1M30A 1OEBA 2X3XD 2DBMA 2A08A 4JJCA 1KFZA 1ZUYA 2JS2A 2LZ6B 1H92A 1UFFA 2A28A 2EYWA 3VS3A 1ZSGA 3O5ZA 1A0NB 1AWOA 2LQNA 1M3BA 2RN8A 2DRKA 5IHKA 2EGCA 5I22A 4OMLA 1Z9QA 1GCQC 1Z9ZA 3NGPA 1JO8A 4FSSA 2HSPA 2LX7A 2KXCA 2LP5A 1WYXA 2SEMA 5FW9A 2DMOA 1HD3A 1WXBA 1YP5A 1CKBA 3M0RA 2EBPA 2MIOA 2RQVA 3PVQA 1FYNA 3M0QA 2J6FA 4LE9A 1S1NA 1UE9A 2DILA 4CC2A 1K9AA 4HVUA 1NLPC 3EGUA 2FG0A 4HCKA 4LNPA 4LUDA 1AWXA 4J9GA 1QLYA 2DNUA 4ORZA 4DEYA 5IXFA 3VS0A 1PRMC 1H8KA 1PWTA 2J7IA 2RNAA 1NYFA 1UHFA 2EQIA 4WCIA 1QKXA 4EIKA 2JW4A 4OMNA 2RQTA 1LCKA 1SEMA 3ULRB 4AFQC 5FWBA 2CUBA 1M27C 1KIKA 1J3TA 2KXDA 2K6DA 1RI9A 4AFZC 1I1JA 1AD5A 3UA6A 3VRZA 2PNIA 2O88A 3UF4A 4OMOA 2YDLA 1E6HA 2CH4A 4J9BA 2D8JA 1JU5C 2C0OA 2DYBA 1MV0B 2ESWA 2LJ3A 3U23A 2DX1A 5L23A 1ZX6A 2JMCA 1RLQC 1AWJA 4J9CA 1K1ZA 2EYYA 4D8DA 2M0YA 2DE0X 3CQTA 2RQWA 2L3SA 2LMJA 2EPDA 2DRMA 1QCFA 2FRWA 3EG0A 4OMQA 2O31A 3VS7A 4E6RA 2CT3A 1WLPB 5GJVB 4J9IA 2GBQA 1EFNA 1AZGB 1SSHA 4R0KA 1CSKA 2EGEA 2CT4A 2OI3A 2I0NA 3REBB 4GBQA 1Y57A 1BU1A 3LH5A 1BBZA 1OV3A 1X6GA 2F2VA 1K0SA 2C0IA 1WA7A 2KR3A 1UUEA 2LJ0A 1GBQA 3THKA 1AWWA 2RPNA 2X3WD 2BTTA 2DA9A 2CDTA 4GLMA 1BK2A 3RNJA 1KSWA 1ARKA 2JXBA 1NEBA 2RF0A 1VA7A 2E5KA 2L3PA 1WIEA 4Z89A 3EG2A 4F16A 2EYZA 3I9QA 2CSIA 2ROTA 2KROA 2ECZA 1W70A 2L3QA 1V1CA 2J6KA 3EHQA 1SHGA 1YWPA 1X69A 3EG1A 3I5RA 2W0ZA 5GJWB 2FO0A 2DLPA 3PVLA 1MUZA 1E6GA 3PE0A 1I07A 1YCSB 4CC3A 2A36A 1T0JA 2RMOA 2YSQA 2KT8A 1VYTA 1WDXA 1G83A 1OPLA 3VS1A 1ZUUA 3M0SA 3EHRA 2RQRA 5IXBA 1YWOA 3KFVA 1GFDA 2DL8A 4LUEA 2D8HA 2KBTA 2KEAA 2JM9A 1U5SA 2AKLA 2GNCA 1ZLMA 1PKSA 3UATA 2CSQA 2L0AA 2MCNA 4RUGA 2K3BA 3M0TA 2DBKA 2O2OA 1OOTA 3QWXX 2D0NA 2B86A 1GCQA 2LNHB 4AFSC 2YUPA 2QDLA 2DL3A 3UA7A 4F17A 3H0IA 1M3CA 2KE9A 3NHNA 1YNZA 2NWMA 1JQQA 2J06A 1WX6A 5IH2A 2YUQA 2K9GA 1NYGA 1AOJA 1T0HA 4JJDA 2KGTA 4J9FA 2KYMA 3FJ5A 1K0XA 1X43A 2JS0A 2F2WA 3ZL7C 4K11A 2VKNA 1UECA 2HBWA 1TG0A 2KRMA 2G6FX 2IIMA 4JJBA 2DJQA 1WFWA 3H0HA 4RTWA 3VS6A 2GTJA 1AEYA 2OJ2A 2HEQA 4HVWA 1K4US 1JEGA 1UJ0A 1SPKA 1QWFA 2FPEA 2OAWA 1RLPC 2DVJA 2SRCA 2F2XA 1RUWA 4IIOA 1PNJA 4HVVA 3QWYA 2L2PA 2AZSA 3SEMA 4AFUC 1X27A 1MV3A 4X1VA 2J6OA 2PTKA 3NPFA 4D8KA 2YUNA 2ABLA 1NLOC 4KRTA 1I0CA 2XMFA 4RTUA 2K7AA 3TSZA 1GRIA 1WXUA 3M0PA 1PHTA 2O9SA 5I11A 1N5ZA 2LJ1A 1M8MA 2BZYA 3TVTA 1YN8A 5HCKA 2NUZA 2DM1A 2KNBB 2FPFA 2CREA 2D1XA 2W10A 1HSQA 1GL5A 1HJDA 1M3AA 1T3SA 3VS4A 4HXJA 2EVRA 5IHNA 4DEXA 3H0FA 1QWEA 1U3OA 2GQIA 3I5SA 4RTYA 4Y92A 4CC4B 4CC7A 2EGAA 3C0CA 5EC7A 1PRLC 5ECAA 2JMAA 1B07A 2DL7A 2FRYA 1B3QA 2HDAA 2P4RA 2K2MA 2K79A 3M0UA 4Z8AA 2LQWA 1PKTA 3H41A 4RTVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E7O A;  2ED1 A;  4J9D A;  4ZNX A;  4Z88 A;  1X6B A;  4AG2 C;  1U06 A;  2VVK A;  1KJW A;  2GTO A;  2FPD A;  4QT7 A;  3RBB B;  2ED0 A;  2DF6 A;  1IO6 A;  1TUC A;  2AZV A;  2EW3 A;  4J9E A;  1GBR A;  5IHI A;  1SHF A;  2RQU A;  4F14 A;  4OMP A;  2A37 A;  5FWC A;  1T3L A;  1FMK A;  1TUD A;  3VRY A;  1UG1 A;  4JPB W;  1WXT A;  2CH4 W;  1ZBJ A;  1AZE A;  2KYB A;  1UHC A;  1Y0M A;  2KRN A;  2AKK A;  1W6X A;  1G2B A;  1K76 A;  3SHW A;  1UGV A;  3A98 A;  4LN2 A;  1JXO A;  1OPK A;  2V1Q A;  1BB9 A;  2HCK A;  2O9V A;  4RTX A;  1NM7 A;  2EYX A;  3IQL A;  1CKA A;  2J05 A;  1VYV A;  1UJY A;  3REA B;  2JM8 A;  1NEG A;  1ZUK A;  2ROL A;  2JTE A;  1GCP A;  3TSW A;  1AVZ C;  3GBQ A;  3JV3 A;  1QKW A;  1X2K A;  4J9H A;  1SRL A;  4IIM A;  4ESR A;  4RTZ A;  1VYU A;  1JXM A;  2EKH A;  2ENM A;  1WI7 A;  4RTT A;  2YUO A;  2KRS A;  2FEI A;  2GGR A;  1W1F A;  3EG3 A;  3R6N A;  2BZ8 A;  2KT1 A;  4AG1 C;  2C0T A;  2BZX A;  1ABQ A;  3I35 A;  2PZ1 A;  2MOX A;  2M51 A;  1ABO A;  4A63 B;  1X2Q A;  4JZ3 A;  1SRM A;  2H8H A;  2JT4 A;  2VWF A;  1H3H A;  2YT6 A;  1NG2 A;  4JZ4 A;  3VS2 A;  2CUD A;  2V1R A;  1UDL A;  1GFC A;  3VS5 A;  4OMM A;  4M4Z A;  1XOV A;  2LCS A;  2DL5 A;  3NMZ C;  1UTI A;  2AK5 A;  2DL4 A;  1M30 A;  1OEB A;  2X3X D;  2DBM A;  2A08 A;  4JJC A;  1KFZ A;  1ZUY A;  2JS2 A;  2LZ6 B;  1H92 A;  1UFF A;  2A28 A;  2EYW A;  3VS3 A;  1ZSG A;  3O5Z A;  1A0N B;  1AWO A;  2LQN A;  1M3B A;  2RN8 A;  2DRK A;  5IHK A;  2EGC A;  5I22 A;  4OML A;  1Z9Q A;  1GCQ C;  1Z9Z A;  3NGP A;  1JO8 A;  4FSS A;  2HSP A;  2LX7 A;  2KXC A;  2LP5 A;  1WYX A;  2SEM A;  5FW9 A;  2DMO A;  1HD3 A;  1WXB A;  1YP5 A;  1CKB A;  3M0R A;  2EBP A;  2MIO A;  2RQV A;  3PVQ A;  1FYN A;  3M0Q A;  2J6F A;  4LE9 A;  1S1N A;  1UE9 A;  2DIL A;  4CC2 A;  1K9A A;  4HVU A;  1NLP C;  3EGU A;  2FG0 A;  4HCK A;  4LNP A;  4LUD A;  1AWX A;  4J9G A;  1QLY A;  2DNU A;  4ORZ A;  4DEY A;  5IXF A;  3VS0 A;  1PRM C;  1H8K A;  1PWT A;  2J7I A;  2RNA A;  1NYF A;  1UHF A;  2EQI A;  4WCI A;  1QKX A;  4EIK A;  2JW4 A;  4OMN A;  2RQT A;  1LCK A;  1SEM A;  3ULR B;  4AFQ C;  5FWB A;  2CUB A;  1M27 C;  1KIK A;  1J3T A;  2KXD A;  2K6D A;  1RI9 A;  4AFZ C;  1I1J A;  1AD5 A;  3UA6 A;  3VRZ A;  2PNI A;  2O88 A;  3UF4 A;  4OMO A;  2YDL A;  1E6H A;  2CH4 A;  4J9B A;  2D8J A;  1JU5 C;  2C0O A;  2DYB A;  1MV0 B;  2ESW A;  2LJ3 A;  3U23 A;  2DX1 A;  5L23 A;  1ZX6 A;  2JMC A;  1RLQ C;  1AWJ A;  4J9C A;  1K1Z A;  2EYY A;  4D8D A;  2M0Y A;  2DE0 X;  3CQT A;  2RQW A;  2L3S A;  2LMJ A;  2EPD A;  2DRM A;  1QCF A;  2FRW A;  3EG0 A;  4OMQ A;  2O31 A;  3VS7 A;  4E6R A;  2CT3 A;  1WLP B;  5GJV B;  4J9I A;  2GBQ A;  1EFN A;  1AZG B;  1SSH A;  4R0K A;  1CSK A;  2EGE A;  2CT4 A;  2OI3 A;  2I0N A;  3REB B;  4GBQ A;  1Y57 A;  1BU1 A;  3LH5 A;  1BBZ A;  1OV3 A;  1X6G A;  2F2V A;  1K0S A;  2C0I A;  1WA7 A;  2KR3 A;  1UUE A;  2LJ0 A;  1GBQ A;  3THK A;  1AWW A;  2RPN A;  2X3W D;  2BTT A;  2DA9 A;  2CDT A;  4GLM A;  1BK2 A;  3RNJ A;  1KSW A;  1ARK A;  2JXB A;  1NEB A;  2RF0 A;  1VA7 A;  2E5K A;  2L3P A;  1WIE A;  4Z89 A;  3EG2 A;  4F16 A;  2EYZ A;  3I9Q A;  2CSI A;  2ROT A;  2KRO A;  2ECZ A;  1W70 A;  2L3Q A;  1V1C A;  2J6K A;  3EHQ A;  1SHG A;  1YWP A;  1X69 A;  3EG1 A;  3I5R A;  2W0Z A;  5GJW B;  2FO0 A;  2DLP A;  3PVL A;  1MUZ A;  1E6G A;  3PE0 A;  1I07 A;  1YCS B;  4CC3 A;  2A36 A;  1T0J A;  2RMO A;  2YSQ A;  2KT8 A;  1VYT A;  1WDX A;  1G83 A;  1OPL A;  3VS1 A;  1ZUU A;  3M0S A;  3EHR A;  2RQR A;  5IXB A;  1YWO A;  3KFV A;  1GFD A;  2DL8 A;  4LUE A;  2D8H A;  2KBT A;  2KEA A;  2JM9 A;  1U5S A;  2AKL A;  2GNC A;  1ZLM A;  1PKS A;  3UAT A;  2CSQ A;  2L0A A;  2MCN A;  4RUG A;  2K3B A;  3M0T A;  2DBK A;  2O2O A;  1OOT A;  3QWX X;  2D0N A;  2B86 A;  1GCQ A;  2LNH B;  4AFS C;  2YUP A;  2QDL A;  2DL3 A;  3UA7 A;  4F17 A;  3H0I A;  1M3C A;  2KE9 A;  3NHN A;  1YNZ A;  2NWM A;  1JQQ A;  2J06 A;  1WX6 A;  5IH2 A;  2YUQ A;  2K9G A;  1NYG A;  1AOJ A;  1T0H A;  4JJD A;  2KGT A;  4J9F A;  2KYM A;  3FJ5 A;  1K0X A;  1X43 A;  2JS0 A;  2F2W A;  3ZL7 C;  4K11 A;  2VKN A;  1UEC A;  2HBW A;  1TG0 A;  2KRM A;  2G6F X;  2IIM A;  4JJB A;  2DJQ A;  1WFW A;  3H0H A;  4RTW A;  3VS6 A;  2GTJ A;  1AEY A;  2OJ2 A;  2HEQ A;  4HVW A;  1K4U S;  1JEG A;  1UJ0 A;  1SPK A;  1QWF A;  2FPE A;  2OAW A;  1RLP C;  2DVJ A;  2SRC A;  2F2X A;  1RUW A;  4IIO A;  1PNJ A;  4HVV A;  3QWY A;  2L2P A;  2AZS A;  3SEM A;  4AFU C;  1X27 A;  1MV3 A;  4X1V A;  2J6O A;  2PTK A;  3NPF A;  4D8K A;  2YUN A;  2ABL A;  1NLO C;  4KRT A;  1I0C A;  2XMF A;  4RTU A;  2K7A A;  3TSZ A;  1GRI A;  1WXU A;  3M0P A;  1PHT A;  2O9S A;  5I11 A;  1N5Z A;  2LJ1 A;  1M8M A;  2BZY A;  3TVT A;  1YN8 A;  5HCK A;  2NUZ A;  2DM1 A;  2KNB B;  2FPF A;  2CRE A;  2D1X A;  2W10 A;  1HSQ A;  1GL5 A;  1HJD A;  1M3A A;  1T3S A;  3VS4 A;  4HXJ A;  2EVR A;  5IHN A;  4DEX A;  3H0F A;  1QWE A;  1U3O A;  2GQI A;  3I5S A;  4RTY A;  4Y92 A;  4CC4 B;  4CC7 A;  2EGA A;  3C0C A;  5EC7 A;  1PRL C;  5ECA A;  2JMA A;  1B07 A;  2DL7 A;  2FRY A;  1B3Q A;  2HDA A;  2P4R A;  2K2M A;  2K79 A;  3M0U A;  4Z8A A;  2LQW A;  1PKT A;  3H41 A;  4RTV A; 
#chains in the Genus database with same CATH topology
 2LNV A;  2EFI A;  2PVD B;  1X6B A;  4AG2 C;  4RCC A;  1U06 A;  2VVK A;  1M1K R;  3RMS A;  2FPD A;  3OYE A;  1R77 A;  2ED0 A;  1VIF A;  2DF6 A;  5CQX A;  1XQH A;  4OMP A;  4XU1 A;  5FWC A;  1T3L A;  3P8B B;  2JN0 A;  3S3N A;  3X24 B;  2CH4 W;  3CCJ T;  4ZGE B;  5FU6 B;  5CO7 A;  4C0D B;  2KRN A;  2PQW A;  2AKK A;  4PJO A;  3SHW A;  6AT1 B;  4M7A D;  3MEU A;  1VQ7 Q;  2LC4 A;  5GAN e;  4HT9 A;  1F1B B;  2HCK A;  2O9V A;  5GAM d;  4RTX A;  1NM7 A;  2ZPG B;  4C8Q D;  2J05 A;  3CXC S;  1VQL Q;  2BKD N;  1NEG A;  1ZUK A;  2VC8 A;  4FSX A;  2BE9 B;  1Q82 U;  2DIG A;  4UC4 A;  2XID A;  2PUO B;  4ESR A;  1VQM T;  4FT2 A;  3X25 B;  1VYU A;  1JXM A;  5A0D A;  4QVC A;  3P8D A;  1WI7 A;  4C5E A;  3CC7 T;  3AT1 B;  3A8M B;  3TEE A;  2DZ9 A;  3EG3 A;  5GAN h;  3R6N A;  2BZ8 A;  3OYI A;  2KT1 A;  2BZX A;  2K5F A;  4II1 A;  3CCE T;  4FT4 A;  3JCM X;  2BE7 D;  3PNW C;  1UGR B;  5KYX A;  1QVP A;  4M78 A;  5FRM A;  2CP2 A;  1M90 C;  1M2O A;  2RJD A;  1Q81 R;  2EJG A;  2VXF A;  3E2U A;  1KQS A;  1XOV A;  2LCS A;  2RI3 A;  3NMZ C;  1M30 A;  2COY A;  1KC8 U;  2DK3 A;  2DBM A;  2DET A;  4JJC A;  2OTJ A;  1ZUY A;  2LZ6 B;  1KHC A;  2A28 A;  4KUD K;  2BIV A;  1M3B A;  3EFO B;  3C12 A;  3R6O A;  1ZBX A;  5IHK A;  2GF7 A;  5I22 A;  4OML A;  1Z9Q A;  2EYQ A;  1GCQ C;  3QXE B;  1JO8 A;  1ZSZ C;  4E7K A;  5CR2 A;  3JB9 I;  4R55 A;  1D3B A;  3LH0 A;  3CMA T;  1K8A U;  1WYX A;  1OU8 A;  2KDS A;  1HD3 A;  3FJP A;  2MMP A;  4HCB A;  1NPP A;  3JCM h;  2MIO A;  3PVQ A;  4M7D A;  1M1F A;  4LE9 A;  4NS5 A;  2DIL A;  1K9A A;  4HVU A;  4PLL A;  1YIT A;  2X51 A;  2LQ8 A;  2QEX A;  2ZPH B;  3NTH A;  2HZY A;  3OYN A;  2OTJ Q;  5IXF A;  1PRM C;  2R5A A;  1FWZ A;  1WPY A;  4JDS A;  3LGF A;  1BI1 A;  3CCR T;  2JW4 A;  2B8A A;  1Q86 U;  1KQ1 A;  1LCK A;  4ELY C;  1IGQ A;  5FWB A;  2OTL Q;  1J3T A;  5GMK i;  1VQ6 A;  1OZ2 A;  2K5L A;  4E47 A;  3LWH A;  3UA6 A;  3VRZ A;  2AT1 B;  2PNI A;  3JCM c;  4OMO A;  2LT1 A;  2CP3 A;  4J9B A;  2KVQ G;  4M77 E;  1YIT Q;  2LJ3 A;  2QI2 A;  3GNF B;  3G71 A;  2O4X A;  3H6Z A;  2YLC A;  2HSE B;  1AWJ A;  4J9C A;  2M0Y A;  3SB2 A;  4M77 B;  1MMG A;  4D6W A;  2RHX A;  1KQS P;  5KYU A;  3JB9 G;  1VQ6 Q;  5GAM h;  4OMQ A;  2O31 A;  5HY6 A;  1OX8 A;  4QQG A;  2QG9 B;  4M75 D;  1VQ9 T;  2EGE A;  3L2R A;  1VQN A;  2I0N A;  1Y57 A;  1R8O B;  2P84 A;  4C0G A;  2RD1 A;  2RM4 A;  3CXC A;  1SKU B;  1BBZ A;  1X6G A;  2NYS A;  2DAQ A;  3CPW A;  4QKU A;  4XTW A;  5GAN 4;  2M02 A;  1AWW A;  2RPN A;  2DA9 A;  1OU9 A;  2QAZ A;  2JXB A;  2KAF A;  5CKH A;  2L3P A;  4OGC A;  1YJW Q;  2K3Y A;  2X4X A;  3OYM A;  3EG2 A;  4F16 A;  3I9Q A;  1YI2 A;  2KRO A;  1V1C A;  3DLM A;  2J6K A;  4PL6 A;  5GAO l;  4BE0 A;  1YWP A;  1X69 A;  3EG1 A;  3CCL A;  3QKJ A;  2LRQ A;  1WHJ A;  5GMK h;  2QGG A;  1I07 A;  1YCS B;  2M9U A;  2QTX A;  3JRZ A;  1IRE B;  3CCQ T;  4C92 E;  2YSQ A;  2E6N A;  1VYT A;  4J6Y A;  4ELZ C;  3VS1 A;  2X4J A;  5C0M A;  2QQ9 A;  2RQR A;  1YWO A;  3QYG B;  1BI3 A;  5DLQ E;  3C4S A;  2KEA A;  2DD4 A;  1RAF B;  1BCO A;  1N8R R;  3DB4 A;  2AKL A;  1LOJ A;  1VQP T;  4ZTJ A;  1Q81 C;  3OA6 A;  1YI2 Q;  2HBP A;  3UAT A;  4AT1 B;  4C92 B;  4LDV A;  2DXU A;  3GF5 A;  2K3B A;  2O2O A;  4JJN K;  1LNX A;  4AFS C;  3MPU B;  2DL3 A;  4JRQ A;  5LJ5 g;  1TXQ A;  1YNZ A;  4A4G A;  1NJI C;  4N4G A;  3L2Z A;  4KGZ B;  4IKF A;  4FL6 A;  2DD5 A;  1ZA1 B;  2Z0W A;  1YFN A;  5IH2 A;  3VU3 C;  1VQ5 A;  2I2L A;  3MP1 A;  2XDB A;  5GAM f;  1FXX A;  4XK8 E;  1VQO Q;  5GAO p;  2Y90 A;  5D6W A;  5GAN 8;  3JCM W;  4E7J A;  3QUI A;  4RTW A;  3VS6 A;  3CPW P;  1S72 T;  1N27 A;  4HVW A;  4M7A E;  1JEG A;  1UJ0 A;  4FYV B;  2CP7 A;  4C8Q E;  2FZK B;  4IIO A;  4YTL A;  1D3B B;  3CD6 A;  3DB3 A;  3OSS C;  2QA4 T;  4IUV A;  3CCJ Q;  3FDR A;  1IGU A;  2DO3 A;  4M7A B;  4BDZ A;  3NPF A;  2ABL A;  2D6F A;  1C1A A;  3OYL A;  2WSF E;  3LYI A;  2EWN A;  3FB9 A;  2YHT A;  1MHN A;  1JRI A;  3PGG A;  4IUP A;  1PHT A;  1SF9 A;  2BZY A;  2R58 A;  2NUZ A;  4DOV A;  2KNB B;  1G5V A;  2HL3 A;  2W10 A;  2COZ A;  1HJD A;  3HFO A;  3H8Z A;  3VS4 A;  4OVA A;  2QYZ A;  5IHN A;  3H0F A;  3I55 T;  2GQI A;  3SWN C;  3C0C A;  2QEX T;  1VQM Q;  3QSU A;  2YRD A;  1NE8 A;  4A4H A;  2FRY A;  2HDA A;  3CC7 Q;  3MCA B;  2K79 A;  4Z8A A;  5C6S A;  2LQW A;  2O4X B;  1TOV A;  2Y4X A;  4R56 A;  4XAX B;  1E7O A;  2ED1 A;  1Q82 R;  3MP6 A;  5A0L A;  4J9D A;  4ZNX A;  3CCE Q;  1KJW A;  4M77 G;  3RBB B;  1PC0 A;  2FVU A;  2RJC A;  3CMA A;  1TUC A;  2AZV A;  3L2U A;  2E65 A;  1SHF A;  2X4Y A;  4X9D A;  4J6X A;  1UG1 A;  1QVF S;  2MI6 A;  5DLO A;  1D1B A;  3HPW A;  1WXT A;  4PFO A;  3HHT B;  1ZBJ A;  3G71 T;  2P0P A;  3CCS T;  3A98 A;  3ZEH A;  3RKY A;  5KH6 A;  1JXO A;  2V1Q A;  1BB9 A;  1V76 A;  1BI2 A;  1M5Q 1;  3E19 A;  2CZ1 B;  3CCR A;  4JS4 A;  8AT1 B;  4ZN3 A;  1QW1 A;  3CMA Q;  2JM8 A;  4OP0 A;  5KYW B;  1TTH B;  4L6V 5;  5KCO A;  1H64 1;  2E70 A;  2K2V A;  1GCP A;  1VQN T;  2HKQ B;  3OSV A;  4OB3 B;  3S3O A;  1TH7 A;  2FYK A;  4NL3 A;  1RAC B;  4J9H A;  4LDX A;  1SRL A;  2VV5 A;  4IIM A;  1K8A R;  2ATC B;  3OQ5 A;  1K9M U;  5CIU A;  3C94 A;  1N6A A;  3URG A;  2EKH A;  2HKN A;  3MEW A;  3X20 B;  4RTT A;  3QDR B;  3QG1 A;  2KRS A;  1QP2 A;  1W1F A;  4F7U F;  3CCR Q;  4Z02 A;  2JTF A;  2GQV A;  3OBW A;  3VYH B;  3L1A A;  2C0T A;  3A8H B;  3L2W A;  1ABQ A;  2PZ1 A;  2MOX A;  3EH2 A;  3PFS A;  1SRM A;  4MDX A;  3CCL T;  1H3H A;  3VS2 A;  2ZCF B;  3E9F A;  3LLR A;  3RDV A;  5GAM j;  2V1R A;  3GP8 A;  1UDL A;  2DTI A;  3S6W A;  1VQ9 A;  4N0A C;  2XIC A;  3VS5 A;  2A3L A;  1Q86 R;  4RCB A;  4M4Z A;  3MEV A;  4EMK C;  3OS1 A;  4M75 E;  4JUV A;  5CKD A;  1OEB A;  4E7H A;  3EAE A;  2X3X D;  3LX7 A;  3QII A;  2COW A;  4O6J A;  4M77 A;  3M57 A;  1H92 A;  1A0N B;  4C5I A;  1AWO A;  4FYY B;  2RN8 A;  4B6M A;  2DRK A;  4CI0 C;  4LD9 K;  1LVK A;  3FRN A;  4MML A;  4FM4 B;  4EMG A;  2HSP A;  4M75 B;  1BIB A;  4PJL A;  4XU2 A;  1VQ9 Q;  5FU7 B;  5GAO n;  2XK0 A;  4KUI A;  3V7S A;  1WXB A;  5LJ5 d;  4M78 D;  1YP5 A;  1CKB A;  2EBP A;  5I2M A;  4JRK A;  4PJO F;  1Q7Y U;  3CCQ A;  5GMK j;  4CC2 A;  4BE2 A;  5I2S A;  3DLL A;  2FG0 A;  4HCK A;  4LNP A;  1WQ7 A;  1AWX A;  1VQ5 T;  4ORZ A;  3CC4 T;  4PLI A;  2IPO B;  2RNA A;  3WVD B;  5IT9 E;  1UHF A;  3PTA A;  2DXT A;  4WCI A;  4EIK A;  3CCU T;  2VGN A;  1VQP A;  4OMN A;  3RKW A;  4M7D G;  1M2V B;  1SEM A;  1K73 C;  4AFQ C;  3EG9 B;  2Y4Y A;  1KIK A;  3CME A;  1UGS B;  2O88 A;  5FLX E;  3F70 A;  3RUX A;  1E6H A;  4LDW A;  3VUZ A;  3CCQ Q;  1JU5 C;  4EMH A;  3PMT A;  1QCO A;  2LVM A;  2WAC A;  1PM3 A;  2A0F B;  3FC3 A;  1QQJ A;  3V8L A;  3CD6 T;  2OX7 A;  2CP6 A;  1ZX6 A;  2ZPI B;  3LGL A;  1RLQ C;  2E1H A;  5EG2 A;  4BI4 A;  3GLX A;  4D8D A;  3RIR A;  4LD6 A;  4C92 A;  1VQP Q;  3HRT A;  2E3H A;  4M78 F;  2EPD A;  3NTK A;  3OW2 A;  2FRW A;  3BFM A;  2LQK A;  1S72 A;  4C0Z A;  1WLP B;  3MET A;  3G4S T;  4C0F A;  4E7S A;  8ATC B;  5GAN 7;  1VQK T;  2QQB A;  1BU1 A;  3JCM e;  1IB8 A;  2KSS A;  4MMK A;  1WJS A;  2QA4 A;  2QGF B;  3RNJ A;  1C6V X;  1I4K 1;  1U8R A;  1B34 B;  2BUD A;  5I21 A;  4OF1 A;  1SSF A;  4QQD A;  2QTV A;  2E5K A;  4Z89 A;  4DOW A;  2EYZ A;  2CSI A;  2ROT A;  1LJO A;  4M7D F;  3EHQ A;  3MP8 A;  2YRC A;  4FW1 A;  1MND A;  2KMT A;  2W0Z A;  2FO0 A;  1YCY A;  1M90 U;  3PVL A;  1MUZ A;  2JUF A;  2CZ6 B;  7AT1 B;  1T0J A;  1I5O B;  2NLU A;  1D0Z A;  1OPL A;  3OS2 A;  1ZUU A;  3M0S A;  2DEQ A;  4M7A A;  1ZA2 B;  5IXB A;  3KFV A;  3I55 A;  4PJO C;  1IZ6 A;  4LUE A;  2L89 A;  2JM9 A;  2EJ9 A;  2HQX A;  1U5S A;  2F5K A;  2LDM A;  2XDP A;  4C8Q A;  1ZLM A;  1P92 A;  2WSE E;  2CSQ A;  2MCN A;  1B7T A;  5DM7 R;  1OOT A;  3QWX X;  1X01 A;  2D0N A;  2E12 A;  2B86 A;  1YIJ A;  1RAH B;  5GAM e;  5GAN 2;  2QDL A;  3JCM J;  3DKM A;  5LJ5 h;  1YJN T;  2YUQ A;  3FLG A;  5LJ3 d;  3OW2 P;  2M16 A;  3I55 Q;  1AOJ A;  2DZC A;  2KGT A;  3MJX A;  4EPC A;  2JS0 A;  2QEX Q;  2VKN A;  1M1K C;  2HBW A;  3CCS A;  1TG0 A;  2E5Q A;  2G6F X;  1IHV A;  2DJQ A;  1WFW A;  4N4I A;  2MF2 A;  2V8K A;  2OJ2 A;  4M78 C;  2HEQ A;  1KQ2 A;  1JB0 E;  1M8V A;  4OB1 B;  1SPK A;  1WHH A;  1VOM A;  5IN1 A;  1RLP C;  2SRC A;  5GMK e;  4M75 G;  2RJF A;  2F2X A;  1G3T A;  5LL6 S;  3V8J A;  3M9Q A;  3EGD B;  1O75 A;  3QWY A;  2QQA A;  2L2P A;  2AZS A;  1DJ7 B;  3G71 Q;  1KD1 U;  3CCS Q;  1MV3 A;  3V7R A;  3J80 E;  3JB9 D;  5CQY A;  2C06 A;  2DER A;  5GMK l;  1M9S A;  2YUN A;  4BI3 A;  1NLO C;  4KRT A;  3TSZ A;  2RH2 A;  1GRI A;  1I8F A;  3OS0 A;  3JB9 H;  5KYW A;  4Y91 A;  1OYX A;  5I11 A;  1N5Z A;  2LJ1 A;  3PT9 A;  3TVT A;  2LCC A;  4M7D C;  2JVV A;  3VYG A;  1MGQ A;  1ZSZ B;  1HSQ A;  5M9O A;  1M3A A;  3OYK A;  2NUP B;  2ZZD A;  1VQN Q;  3M54 A;  3OYJ A;  3INZ A;  1M4Z A;  2V26 A;  4HXJ A;  2EVR A;  2G3R A;  2MPX C;  2RO0 A;  1AHJ B;  1U3O A;  4CC4 B;  5ECA A;  3EH1 A;  2EQM A;  1B07 A;  3CC2 T;  2E41 A;  3PIP A;  2KQW A;  1FX7 A;  5D6X A;  4RTV A;  2E64 A;  3OBY A;  3OYF A;  4O5V A;  1D09 B;  1VQL T;  1K9M R;  4J5Y A;  5LJ5 f;  2XD0 A;  2GTO A;  4DBF A;  5GMK m;  5A0G A;  3JCM V;  3CME T;  4N4H A;  3CCL Q;  4BD3 A;  2EJF A;  3NTI A;  4J9E A;  4BY6 C;  5IHI A;  2RQU A;  4F14 A;  1GBR A;  2JTM A;  3JB9 F;  4KH1 B;  1TUD A;  3L2V A;  3VRY A;  2F1L A;  4JPB W;  5J3B A;  1N9S A;  5GAO m;  1AZE A;  1Y07 A;  2KYB A;  1UHC A;  1RAG B;  5GAO r;  1W6X A;  3V7C A;  5KE3 A;  1Q81 U;  4VUB A;  3CC4 A;  2RI5 A;  2KY9 A;  3AHU A;  4E7Z A;  2PU9 B;  5AYF A;  3SD4 A;  3CCU A;  2JOY A;  4M75 A;  2EYX A;  3BE3 A;  3OYB A;  3M4Y A;  1CKA A;  2M1H A;  1VYV A;  1UJY A;  3CXC P;  1NJI U;  1VIE A;  4J6W A;  2JTE A;  1OUL A;  3TSW A;  1AVZ C;  3L2Q A;  3JV3 A;  4E7L A;  1VQ5 Q;  4C5G A;  3CC4 Q;  1M1G A;  3HSB A;  2MAM A;  2ENM A;  1M2V A;  2YUO A;  4HKE A;  2DTH A;  2GGR A;  1Q7Y R;  4V2S A;  3EG9 A;  3A8G B;  1MMA A;  2FL7 A;  2KI7 A;  1MMD A;  4IUR A;  4AG1 C;  1EX4 A;  3V8K A;  5KYN A;  3I35 A;  4PFP A;  3X26 B;  4C8Q B;  3CCM T;  4A63 B;  1X2Q A;  4JZ3 A;  1PD1 A;  2JT4 A;  2VWF A;  2DKG A;  4OB2 B;  3G4S A;  1NG2 A;  1D0Y A;  2CKK A;  1GFC A;  4WF2 A;  4FW2 A;  5GAO q;  1N9R A;  4J7F A;  1VQK A;  2ZPB B;  3CD6 Q;  2DL5 A;  2DL4 A;  3EGX B;  3CEY A;  2A08 A;  2CZ7 B;  2JNG A;  1KFZ A;  1VQ4 T;  1UFF A;  1PG5 B;  1ZSG A;  3O5Z A;  4EDU A;  2LQN A;  2O01 E;  1XNI A;  3NGP A;  2D0Q B;  2FB7 A;  3LW5 E;  3TU4 K;  4FSS A;  3M58 A;  3A1P A;  3S3M A;  5A2Q E;  2LP5 A;  3J81 E;  3G4S Q;  2SEM A;  1YIJ T;  2DMO A;  3CBP A;  4BUG A;  4XTU A;  4PKC C;  1VQK Q;  2RQV A;  1FYN A;  2DIQ A;  4KGX B;  1WHG A;  3L42 A;  2YWW A;  2CP5 A;  1NLP C;  1B34 A;  4LUD A;  2DNU A;  3VS0 A;  2K57 A;  4PNO A;  2J7I A;  2EQJ A;  4RMO A;  4KUL A;  4L59 A;  1NYF A;  2EQI A;  4M77 D;  3CBO A;  4Y28 E;  1FMV A;  3ULR B;  4BE1 A;  2CUB A;  2RI2 A;  4QW2 A;  4Q5W A;  2KXD A;  2K6D A;  2FZC B;  5FRO A;  4BAC A;  1I1J A;  3RR6 A;  2L5Q A;  1KC8 R;  3UF4 A;  2YDL A;  5LJ3 f;  2CH4 A;  5FU6 C;  4C0D C;  1U1T A;  1N8R C;  2YXY A;  2ESW A;  3MHX A;  1RL2 A;  1TU0 B;  2A7Y A;  3QO3 A;  1YJN A;  2DX1 A;  1K9M C;  5L23 A;  4XTX A;  2JMC A;  5LJ3 g;  1Y71 A;  5LJ5 j;  5GAN d;  1M90 R;  2DTO A;  3WVE B;  1YHQ T;  1K1Z A;  2EYY A;  1X75 C;  4KH0 B;  3CQT A;  4ZN1 A;  1ACM B;  2RQW A;  5HK0 A;  3I56 T;  2XDD A;  3UDC A;  2DRM A;  2CGH A;  1QCF A;  4PJO D;  3EG0 A;  3VJP A;  1KQS S;  2CT3 A;  5GJV B;  1AZG B;  1SSH A;  3HRS A;  3M55 A;  1CSK A;  4R0K A;  4ZGJ B;  2OI3 A;  4C92 G;  3REB B;  4GBQ A;  4HCC A;  2XG8 D;  4M77 F;  2F2V A;  2C0I A;  1WA7 A;  2KR3 A;  1YJN Q;  1UUE A;  2GFA A;  1GBQ A;  2LJ0 A;  1WHM A;  3THK A;  4GLM A;  2CDT A;  1FMW A;  4GLK A;  3OMC A;  1NEB A;  4GY5 A;  2RF0 A;  1VA7 A;  2AIR B;  1UGQ B;  1BKB A;  2XI9 A;  1WIE A;  3SWN B;  1BYM A;  3OS5 A;  3HKS A;  1UGP B;  1YJ9 T;  1W70 A;  3JCM d;  4P5N A;  1KHI A;  3Q1J A;  3RER A;  2K4Y A;  2ZGW A;  3KXT A;  5GJW B;  4HT8 A;  1ZHI A;  2DLP A;  1E6G A;  3QYH B;  3G6E T;  2FHD A;  1NZ9 A;  3A5Z B;  4ATO A;  1RI0 A;  1NBE B;  4E2F B;  2RMO A;  3EGD A;  2EQK A;  1ZQ1 A;  4J8O A;  2ZAE A;  3GOX A;  1JJ2 S;  1GFD A;  2HL5 C;  2DL8 A;  1OX9 A;  4LDU A;  5CAI A;  2KBT A;  4FCY A;  3BDL A;  4A4E A;  2GNC A;  3CC2 A;  4XU0 A;  2XU8 A;  1TWB A;  2L0A A;  2P0K A;  4DQ2 A;  2YLB A;  3M0T A;  2DBK A;  4M7A G;  1GCQ A;  2LNH B;  4RKU E;  1KD1 R;  2YUP A;  1VQL A;  1ZSZ A;  3J7A F;  3H0I A;  1M3C A;  2KE9 A;  2NUP A;  4C8Q G;  2NWM A;  1RAB B;  3C95 A;  4C92 F;  3JAM E;  2K9G A;  4M7D D;  2P0Q A;  2QK0 A;  3FJ5 A;  1Q82 C;  1K0X A;  2F2W A;  2QXF A;  1W4S A;  3CC2 Q;  4A4F A;  2DJZ A;  2KRM A;  5CKF A;  1QVF A;  2IIM A;  1K73 U;  2R57 A;  3HL8 A;  4B9W A;  2GTJ A;  1AEY A;  2L3R A;  4L5G A;  3CPW S;  3CCV T;  4X9C A;  3CME Q;  2VAS A;  1QWF A;  1XJW B;  4ZTF A;  1NPR A;  3NFC A;  2MWP A;  2K3X A;  1OQK A;  4M77 C;  3SEM A;  3QDF A;  4AFU C;  1KC8 C;  1W2B S;  4EMK B;  2PTK A;  4XTY A;  5LJ3 j;  2HAX A;  5CVI A;  1WNL A;  3MEA A;  2X9H A;  2K7A A;  2WSC E;  1HYO A;  1WXU A;  1RAI B;  4MDW A;  3H9N A;  3VV0 A;  3CCM A;  1M8M A;  1S72 Q;  4M7A F;  4TVR A;  1YN8 A;  1K8A C;  2DM1 A;  4NOY A;  1XTD A;  2FPF A;  2CRE A;  2D1X A;  2DYI A;  1GL5 A;  2IG0 A;  4C8Q F;  1KK7 A;  2L8D A;  5LJ5 e;  4DEX A;  1QWE A;  2V8J A;  1PRL C;  5L8R E;  3ZFJ A;  4DBH A;  1MMN A;  1NJI R;  2JMA A;  2QA4 Q;  3SDZ A;  2DL7 A;  4JLG A;  4KBM B;  1D1C A;  2K2M A;  2P4R A;  1VQ4 A;  1V29 B;  4WTO B;  2LTO A;  2YRV A;  1PKT A;  1HXD A;  2OTL A;  3E9G A;  2RJE A;  1Q86 C;  4Z88 A;  3CCM Q;  3MO8 A;  2CYZ B;  4QT7 A;  2ZPF B;  3ZBD A;  1IO6 A;  2VGM A;  5AT1 B;  2EW3 A;  1Y96 B;  2LX9 A;  4C5H A;  3N5B B;  2A37 A;  2NUT B;  2PVG B;  3BW1 A;  2K5I A;  1QVF P;  1FMK A;  4KT0 E;  4JS5 A;  3EGX A;  3M4G A;  1X6O A;  1G3Y A;  2E6Z A;  2XHC A;  4OMF B;  1Y0M A;  4C92 C;  4BB7 A;  5KYY B;  2QAS A;  1G2B A;  1K76 A;  1VQ4 Q;  1UGV A;  2X35 A;  4F7U E;  1JJ2 A;  1BIA A;  4LN2 A;  1OPK A;  4OB0 B;  5D6Y A;  3TRE A;  3LWI A;  1I81 A;  2QQR A;  1OI1 A;  1RAD B;  3IQL A;  4XU3 A;  4J7I A;  2E4H A;  1WJR A;  2DXB A;  3ASK A;  3REA B;  5CCA A;  3T9N A;  1YIJ Q;  2CZ0 B;  1KG1 A;  5DY9 A;  2ROL A;  3TQ7 P;  3JSC A;  4FYW B;  1QVG S;  4FIB A;  1VQ8 T;  2DEU A;  4F7U B;  5J39 A;  5GAN f;  3GBQ A;  1QKW A;  2HNI A;  2V8I A;  1X2K A;  3HP9 A;  1KD1 C;  1M1K U;  4RTZ A;  3VUB A;  2MWO A;  5GAN g;  4HCZ A;  3UWN A;  1YJW A;  1EZZ B;  1YHQ A;  2LCL A;  2FEI A;  4XTV A;  2QQS A;  3M59 A;  3I56 A;  3OYA A;  2M51 A;  1ABO A;  1WHL A;  1Y7X A;  2H8H A;  3QBY A;  3GIB A;  3A8L B;  2YT6 A;  4JZ4 A;  2CUD A;  1WZO A;  4PJO E;  1BCM A;  3OYD A;  2LT4 A;  4OMM A;  4M7A C;  2PVO B;  3HTR A;  1UTI A;  2HD0 A;  2AK5 A;  4RG8 A;  5IAY A;  4C8Q C;  3FEO A;  3JCM Q;  4JRP A;  1MNE A;  3KUF A;  2JS2 A;  2FZG B;  1YHQ Q;  2EYW A;  3VS3 A;  1O9S A;  1VQ7 T;  3JCM f;  2EGC A;  3I56 Q;  4PJO B;  1W2B A;  1Z9Z A;  3QJY A;  2M0O A;  4PK4 A;  1YJ9 A;  3JCM g;  2LX7 A;  2CS7 A;  2DXC A;  2KXC A;  3JB9 J;  3PMI A;  4X34 A;  5FW9 A;  2DVE A;  3OYG A;  2F69 A;  2GCX A;  3M0R A;  2EKO A;  3G6E A;  3M0Q A;  1UB4 A;  1JJ2 P;  4IUQ A;  2EIF A;  2J6F A;  1S1N A;  1UE9 A;  2VXE A;  3OYH A;  3EGU A;  1VUB A;  4J9G A;  1QLY A;  4M75 F;  4E7I A;  2RA2 A;  4DEY A;  1H8K A;  3A8O B;  1PWT A;  3SWN A;  5LJ3 e;  1VQO A;  2XKO C;  2JZ2 A;  4M78 E;  1QKX A;  2KK4 A;  4KGV B;  4AMC A;  2RQT A;  3CPF A;  1YJ9 Q;  3EFR A;  3GPL A;  2HQE A;  3RKX A;  1M27 C;  1G3S A;  3G1J A;  4A54 A;  4JRI A;  1RI9 A;  4AFZ C;  1AD5 A;  4DA4 A;  3CBM A;  3TCJ A;  4RG2 A;  3G6E Q;  2QDY B;  3JCM P;  3PIO A;  5KYX B;  2D8J A;  4M78 B;  2C0O A;  2DYB A;  3M5A A;  1MV0 B;  4IUU A;  3CCJ A;  3G7Z A;  3U23 A;  4BDY A;  1EIF A;  2GFU A;  2RK1 A;  4DBQ A;  4DBR A;  5CKB A;  4IUT A;  5LJ3 h;  2DE0 X;  4MZP A;  2VUB A;  5GAM g;  1LPL A;  2L3S A;  2LMJ A;  4HA8 A;  5CK9 A;  4FYX B;  4J83 A;  4OGE A;  4M7D E;  3ER0 A;  2D9T A;  3CCU Q;  3VS7 A;  4E6R A;  4J9I A;  2GBQ A;  1EFN A;  3CCV A;  1JBM A;  2CT4 A;  3RMQ A;  1D0X A;  3ME9 A;  5CKE A;  3LH5 A;  3BDU A;  5FRN A;  2VYT A;  1OV3 A;  1AT1 B;  3HFN A;  1K0S A;  5HK3 A;  2RK2 A;  2EQU A;  1W2B P;  4M7D B;  1QVG A;  1BI0 A;  1VQM A;  3OYC A;  2X3W D;  2OTJ T;  2BTT A;  1BK2 A;  1OZ3 A;  1KSW A;  2X4W A;  4ZGD B;  2ZPE B;  3OB9 A;  1ARK A;  1G3W A;  3CC7 A;  2IVW A;  2PUK B;  3BY7 A;  1WJQ A;  3QZ5 B;  2EAY A;  3UT1 A;  1HK9 A;  4MZT A;  2HMA A;  1WGS A;  3D7S B;  4B9X A;  5GAN 3;  5GAN j;  3CCE A;  2H3J A;  2ECZ A;  1RAE B;  2L3Q A;  3OYY A;  1GXI E;  2OAU A;  2OTL T;  1QMC A;  1SHG A;  1YBY A;  2HQH A;  3I5R A;  3CCV Q;  3GNG A;  3PE0 A;  1SG5 A;  3O8V A;  2DPP B;  4CC3 A;  2A36 A;  1K73 R;  2KT8 A;  4XQ3 A;  1YIT T;  4N0A A;  1PCX A;  1WDX A;  1G83 A;  3X28 B;  3EHR A;  5KE2 A;  4F7U G;  4BY6 B;  5GAN 6;  4EMK A;  2AHJ B;  4QVD A;  2D8H A;  3VKI A;  3WXM B;  3OY9 A;  2RHY A;  1PKS A;  4M75 C;  1RAA B;  5FU7 C;  3UPU A;  4RUG A;  1PSE A;  2RHU A;  1VQ6 T;  3FIF A;  1G8X A;  3UA7 A;  3SFM A;  5KYU B;  4F17 A;  3OMG A;  3NHN A;  1JQQ A;  2RHI A;  1QCN A;  4NL2 A;  4BI8 B;  2J06 A;  1WX6 A;  3HRU A;  4QQ6 A;  3KBG A;  5D7U A;  4XTZ A;  3EFO A;  1NYG A;  1T0H A;  4JJD A;  3OW2 S;  3M56 A;  4J9F A;  1IXD A;  1QP3 A;  3QJ6 A;  1C0M A;  2KYM A;  1R0B G;  1X43 A;  5KCH A;  3ZL7 C;  4FU6 A;  4K11 A;  1U1S A;  1UEC A;  2MYS A;  5J26 A;  3JCM b;  3M53 A;  2MK5 A;  1YJW T;  1D1A A;  4JJB A;  3E1S A;  4ME7 A;  4CRI A;  3H0H A;  4F04 B;  4PJO G;  1QVG P;  1K4U S;  1Y96 A;  3EFS A;  3QPH A;  1TUG B;  2NUT A;  2FPE A;  2H3E B;  3RES A;  2OAW A;  1IHW A;  1PD0 A;  2DVJ A;  1N8R U;  4A53 A;  3MKD A;  1RUW A;  4QVZ A;  3P8H A;  1VQ8 A;  1PNJ A;  4HVV A;  5GAN 5;  1TSF A;  1Q95 G;  4LDY A;  1WQW A;  5KYY A;  4PFZ A;  1X27 A;  4PJM A;  1WHK A;  4X1V A;  2J6O A;  4D8K A;  1H3Z A;  4ANJ A;  4LXC A;  1TS9 A;  1YI2 T;  1I0C A;  2RHZ A;  2XMF A;  4JLI A;  4RTU A;  4C92 D;  2P4T A;  9ATC B;  2VB6 A;  2JJ9 A;  4A4K A;  1R0C B;  3M0P A;  1UEB A;  2O9S A;  2E3I A;  4MZM A;  4F7U A;  5HCK A;  4PJJ A;  1VQ8 Q;  1T3S A;  1PSF A;  2CP0 A;  2F5T X;  3QHS A;  1Q7Y C;  2DFU A;  3I5S A;  4RTY A;  4Y92 A;  4CC7 A;  2EGA A;  2R5M A;  4M78 G;  5EC7 A;  1IRX A;  1I5L A;  5HKC A;  1B3Q A;  1VQO T;  3M0U A;  3QZ9 B;  4PJN A;  2E10 A;  1VQ7 A;  2RB6 A;  3H41 A; 
#chains in the Genus database with same CATH homology
 1E7O A;  2ED1 A;  4J9D A;  4ZNX A;  4Z88 A;  1X6B A;  4AG2 C;  1U06 A;  2VVK A;  1KJW A;  2GTO A;  2FPD A;  4QT7 A;  3RBB B;  2ED0 A;  2DF6 A;  1IO6 A;  1TUC A;  2AZV A;  2EW3 A;  4J9E A;  1GBR A;  5IHI A;  1SHF A;  2RQU A;  4F14 A;  4OMP A;  2A37 A;  5FWC A;  1T3L A;  1FMK A;  1TUD A;  3VRY A;  1UG1 A;  4JPB W;  1WXT A;  2CH4 W;  1ZBJ A;  1AZE A;  2KYB A;  1UHC A;  1Y0M A;  2KRN A;  2AKK A;  1W6X A;  1G2B A;  1K76 A;  3SHW A;  1UGV A;  3A98 A;  4LN2 A;  1JXO A;  1OPK A;  2V1Q A;  1BB9 A;  2HCK A;  2O9V A;  4RTX A;  1NM7 A;  2EYX A;  3IQL A;  1CKA A;  2J05 A;  1VYV A;  1UJY A;  3REA B;  2JM8 A;  1NEG A;  1ZUK A;  2ROL A;  2JTE A;  1GCP A;  3TSW A;  1AVZ C;  3GBQ A;  3JV3 A;  1QKW A;  1X2K A;  4J9H A;  1SRL A;  4IIM A;  4ESR A;  4RTZ A;  1VYU A;  1JXM A;  2EKH A;  2ENM A;  1WI7 A;  4RTT A;  2YUO A;  2KRS A;  2FEI A;  2GGR A;  1W1F A;  3EG3 A;  3R6N A;  2BZ8 A;  2KT1 A;  4AG1 C;  2C0T A;  2BZX A;  1ABQ A;  3I35 A;  2PZ1 A;  2MOX A;  2M51 A;  1ABO A;  4A63 B;  1X2Q A;  4JZ3 A;  1SRM A;  2H8H A;  2JT4 A;  2VWF A;  1H3H A;  2YT6 A;  1NG2 A;  4JZ4 A;  3VS2 A;  2CUD A;  2V1R A;  1UDL A;  1GFC A;  3VS5 A;  4OMM A;  4M4Z A;  1XOV A;  2LCS A;  2DL5 A;  3NMZ C;  1UTI A;  2AK5 A;  2DL4 A;  1M30 A;  1OEB A;  2X3X D;  2DBM A;  2A08 A;  4JJC A;  1KFZ A;  1ZUY A;  2JS2 A;  2LZ6 B;  1H92 A;  1UFF A;  2A28 A;  2EYW A;  3VS3 A;  1ZSG A;  3O5Z A;  1A0N B;  1AWO A;  2LQN A;  1M3B A;  2RN8 A;  2DRK A;  5IHK A;  2EGC A;  5I22 A;  4OML A;  1Z9Q A;  1GCQ C;  1Z9Z A;  3NGP A;  1JO8 A;  4FSS A;  2HSP A;  2LX7 A;  2KXC A;  2LP5 A;  1WYX A;  2SEM A;  5FW9 A;  2DMO A;  1HD3 A;  1WXB A;  1YP5 A;  1CKB A;  3M0R A;  2EBP A;  2MIO A;  2RQV A;  3PVQ A;  1FYN A;  3M0Q A;  2J6F A;  4LE9 A;  1S1N A;  1UE9 A;  2DIL A;  4CC2 A;  1K9A A;  4HVU A;  1NLP C;  3EGU A;  2FG0 A;  4HCK A;  4LNP A;  4LUD A;  1AWX A;  4J9G A;  1QLY A;  2DNU A;  4ORZ A;  4DEY A;  5IXF A;  3VS0 A;  1PRM C;  1H8K A;  1PWT A;  2J7I A;  2RNA A;  1NYF A;  1UHF A;  2EQI A;  4WCI A;  1QKX A;  4EIK A;  2JW4 A;  4OMN A;  2RQT A;  1LCK A;  1SEM A;  3ULR B;  4AFQ C;  5FWB A;  2CUB A;  1M27 C;  1KIK A;  1J3T A;  2KXD A;  2K6D A;  1RI9 A;  4AFZ C;  1I1J A;  1AD5 A;  3UA6 A;  3VRZ A;  2PNI A;  2O88 A;  3UF4 A;  4OMO A;  2YDL A;  1E6H A;  2CH4 A;  4J9B A;  2D8J A;  1JU5 C;  2C0O A;  2DYB A;  1MV0 B;  2ESW A;  2LJ3 A;  3U23 A;  2DX1 A;  5L23 A;  1ZX6 A;  2JMC A;  1RLQ C;  1AWJ A;  4J9C A;  1K1Z A;  2EYY A;  4D8D A;  2M0Y A;  2DE0 X;  3CQT A;  2RQW A;  2L3S A;  2LMJ A;  2EPD A;  2DRM A;  1QCF A;  2FRW A;  3EG0 A;  4OMQ A;  2O31 A;  3VS7 A;  4E6R A;  2CT3 A;  1WLP B;  5GJV B;  4J9I A;  2GBQ A;  1EFN A;  1AZG B;  1SSH A;  4R0K A;  1CSK A;  2EGE A;  2CT4 A;  2OI3 A;  2I0N A;  3REB B;  4GBQ A;  1Y57 A;  1BU1 A;  3LH5 A;  1BBZ A;  1OV3 A;  1X6G A;  2F2V A;  1K0S A;  2C0I A;  1WA7 A;  2KR3 A;  1UUE A;  2LJ0 A;  1GBQ A;  3THK A;  1AWW A;  2RPN A;  2X3W D;  2BTT A;  2DA9 A;  2CDT A;  4GLM A;  1BK2 A;  3RNJ A;  1KSW A;  1ARK A;  2JXB A;  1NEB A;  2RF0 A;  1VA7 A;  2E5K A;  2L3P A;  1WIE A;  4Z89 A;  3EG2 A;  4F16 A;  2EYZ A;  3I9Q A;  2CSI A;  2ROT A;  2KRO A;  2ECZ A;  1W70 A;  2L3Q A;  1V1C A;  2J6K A;  3EHQ A;  1SHG A;  1YWP A;  1X69 A;  3EG1 A;  3I5R A;  2W0Z A;  5GJW B;  2FO0 A;  2DLP A;  3PVL A;  1MUZ A;  1E6G A;  3PE0 A;  1I07 A;  1YCS B;  4CC3 A;  2A36 A;  1T0J A;  2RMO A;  2YSQ A;  2KT8 A;  1VYT A;  1WDX A;  1G83 A;  1OPL A;  3VS1 A;  1ZUU A;  3M0S A;  3EHR A;  2RQR A;  5IXB A;  1YWO A;  3KFV A;  1GFD A;  2DL8 A;  4LUE A;  2D8H A;  2KBT A;  2KEA A;  2JM9 A;  1U5S A;  2AKL A;  2GNC A;  1ZLM A;  1PKS A;  3UAT A;  2CSQ A;  2L0A A;  2MCN A;  4RUG A;  2K3B A;  3M0T A;  2DBK A;  2O2O A;  1OOT A;  3QWX X;  2D0N A;  2B86 A;  1GCQ A;  2LNH B;  4AFS C;  2YUP A;  2QDL A;  2DL3 A;  3UA7 A;  4F17 A;  3H0I A;  1M3C A;  2KE9 A;  3NHN A;  1YNZ A;  2NWM A;  1JQQ A;  2J06 A;  1WX6 A;  5IH2 A;  2YUQ A;  2K9G A;  1NYG A;  1AOJ A;  1T0H A;  4JJD A;  2KGT A;  4J9F A;  2KYM A;  3FJ5 A;  1K0X A;  1X43 A;  2JS0 A;  2F2W A;  3ZL7 C;  4K11 A;  2VKN A;  1UEC A;  2HBW A;  1TG0 A;  2KRM A;  2G6F X;  2IIM A;  4JJB A;  2DJQ A;  1WFW A;  3H0H A;  4RTW A;  3VS6 A;  2GTJ A;  1AEY A;  2OJ2 A;  2HEQ A;  4HVW A;  1K4U S;  1JEG A;  1UJ0 A;  1SPK A;  1QWF A;  2FPE A;  2OAW A;  1RLP C;  2DVJ A;  2SRC A;  2F2X A;  1RUW A;  4IIO A;  1PNJ A;  4HVV A;  3QWY A;  2L2P A;  2AZS A;  3SEM A;  4AFU C;  1X27 A;  1MV3 A;  4X1V A;  2J6O A;  2PTK A;  3NPF A;  4D8K A;  2YUN A;  2ABL A;  1NLO C;  4KRT A;  1I0C A;  2XMF A;  4RTU A;  2K7A A;  3TSZ A;  1GRI A;  1WXU A;  3M0P A;  1PHT A;  2O9S A;  5I11 A;  1N5Z A;  2LJ1 A;  1M8M A;  2BZY A;  3TVT A;  1YN8 A;  5HCK A;  2NUZ A;  2DM1 A;  2KNB B;  2FPF A;  2CRE A;  2D1X A;  2W10 A;  1HSQ A;  1GL5 A;  1HJD A;  1M3A A;  1T3S A;  3VS4 A;  4HXJ A;  2EVR A;  5IHN A;  4DEX A;  3H0F A;  1QWE A;  1U3O A;  2GQI A;  3I5S A;  4RTY A;  4Y92 A;  4CC4 B;  4CC7 A;  2EGA A;  3C0C A;  5EC7 A;  1PRL C;  5ECA A;  2JMA A;  1B07 A;  2DL7 A;  2FRY A;  1B3Q A;  2HDA A;  2P4R A;  2K2M A;  2K79 A;  3M0U A;  4Z8A A;  2LQW A;  1PKT A;  3H41 A;  4RTV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...