4RTYA

Crystal structure of the c-src-sh3 domain in complex with the high affinity peptide app12
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
58
structure length
58
Chain Sequence
MTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the c-Src-SH3 domain in complex with the high affinity peptide APP12
rcsb
source organism Gallus gallus
molecule tags Protein binding
molecule keywords Proto-oncogene tyrosine-protein kinase Src
total genus 11
structure length 58
sequence length 58
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4rtyA00
1LCKA 4IIMA 1FMKA 3RBBB 1Y57A 1QCFA 1T3LA 2LJ3A 1U06A 4DEXA 1UUEA 1AWXA 2AKLA 1EFNA 2FPFA 2A08A 1E7OA 1UJ0A 2D1XA 4J9DA 2OI3A 2JTEA 1UDLA 3H41A 2LX7A 2DJQA 2C0IA 2D8HA 4JPBW 1ABQA 4CC2A 5IHNA 1KJWA 3EHQA 2GTOA 2GBQA 1RLPC 2RF0A 1HSQA 1PNJA 1NG2A 4LNPA 1K0SA 1TUDA 2B86A 3REAB 2DL3A 4F14A 1M3AA 2F2XA 4HVVA 1GFCA 1SPKA 4Y92A 2O9VA 1X2QA 4RUGA 2KRNA 5ECAA 2C0OA 1X69A 4J9CA 2JMCA 2JT4A 1AWJA 2F2VA 4OMMA 1M3BA 1IO6A 1M3CA 2W10A 1UE9A 2CDTA 2LQWA 2DBKA 2DM1A 1QLYA 1AD5A 2YDLA 3VS7A 3REBB 2NWMA 1T0JA 1K76A 2SRCA 4AFQC 1K9AA 1E6HA 3R6NA 5IH2A 1J3TA 2PNIA 3O5ZA 4F17A 1MUZA 2X3XD 1G83A 2RQWA 2AZVA 1UGVA 2PZ1A 1JQQA 3I35A 2EGAA 2KT8A 1KIKA 4AFUC 1WA7A 3M0PA 1MV0B 1SSHA 1ZBJA 4OMNA 1WFWA 1S1NA 4J9FA 2ECZA 2JW4A 4RTXA 1UTIA 3QWXX 2AZSA 1VA7A 2ED0A 4D8KA 1AWOA 2O88A 1A0NB 1GBRA 1M8MA 1RI9A 1WIEA 4DEYA 1WLPB 1B3QA 2L3PA 3KFVA 1SRMA 2EGEA 1BBZA 1GCQA 2EQIA 1CKAA 1OPLA 2DF6A 4Z8AA 2LP5A 2HDAA 3EG3A 2DL8A 4LN2A 3M0TA 3ULRB 1WI7A 2YUNA 2EGCA 2L2PA 2VKNA 1HJDA 1ZUYA 1M30A 1WXBA 3PVLA 1PRLC 2EVRA 2K9GA 2KR3A 1V1CA 5L23A 3UA6A 4J9BA 2K3BA 3C0CA 1K0XA 2MOXA 2FPDA 1ZUUA 2EYZA 2KYBA 4IIOA 3IQLA 4LUDA 2RNAA 1WXUA 1WYXA 1Z9ZA 2C0TA 2D0NA 2DBMA 2JS2A 2GTJA 3EG2A 3M0QA 2FG0A 1AOJA 4K11A 1RUWA 5GJVB 2DL4A 2ABLA 2DL7A 1W70A 3QWYA 4HVUA 1U5SA 2J6OA 4ESRA 2QDLA 2DX1A 3VS3A 2F2WA 2KRSA 3I9QA 1GBQA 3H0IA 1UJYA 3EG0A 1QWFA 2DA9A 3TSWA 4J9GA 4RTZA 4JJDA 4CC7A 2ROLA 2BZ8A 2ENMA 1YN8A 2KYMA 4CC3A 2CT4A 2FPEA 2CSQA 2K79A 3M0RA 2J06A 4JJBA 3UATA 1WX6A 2L3QA 2DILA 1Z9QA 5FWBA 1JO8A 1T0HA 1SHGA 1WDXA 4LE9A 2LJ1A 1BU1A 1SHFA 2VVKA 2JM8A 2EYYA 2KT1A 1YNZA 1X6GA 2P4RA 2A37A 2J05A 1W6XA 2O31A 4OMOA 1PRMC 2W0ZA 2VWFA 2A36A 3GBQA 5FWCA 4HVWA 3TSZA 3I5SA 1VYTA 4J9EA 2K6DA 1GCPA 4CC4B 2RQVA 1H92A 2CUBA 2LMJA 1JU5C 1UG1A 2D8JA 3ZL7C 1B07A 4EIKA 1GL5A 1Y0MA 4Z89A 2LNHB 2K2MA 1PWTA 1AZGB 3NMZC 1VYUA 3NPFA 1OPKA 2FEIA 4R0KA 2KE9A 2EYXA 1JXOA 2HCKA 4KRTA 5IXFA 1X6BA 5I22A 2YUOA 4JZ3A 2E5KA 4J9IA 1AWWA 4M4ZA 1AZEA 3LH5A 2LQNA 2FRWA 2ROTA 1BK2A 1MV3A 4AFSC 2J6FA 3NGPA 1NEBA 4OMQA 1YWPA 5I11A 1ZUKA 2EPDA 4LUEA 3SHWA 3I5RA 3H0HA 1HD3A 1ABOA 2DNUA 2JS0A 3VS0A 1W1FA 2IIMA 4X1VA 2KXCA 5GJWB 4AG1C 4OMLA 2DRMA 2YSQA 2J6KA 2L0AA 2CH4W 1TG0A 2LCSA 1U3OA 2V1RA 1RLQC 1AVZC 2O9SA 2DE0X 4RTWA 1QKXA 3A98A 2HSPA 4JJCA 5IHIA 2NUZA 4QT7A 3VS6A 2FO0A 1BB9A 2DYBA 5IHKA 4RTYA 1NLPC 1K4US 4J9HA 4A63B 2YUPA 3M0SA 2A28A 1UFFA 5HCKA 1I0CA 1FYNA 4ZNXA 2H8HA 3U23A 5IXBA 1T3SA 1NEGA 2RQTA 2KRMA 2ESWA 1NM7A 1VYVA 2CT3A 2KROA 2JMAA 4AG2C 2V1QA 1TUCA 1N5ZA 2G6FX 1UHFA 2DMOA 1YWOA 2KXDA 2CREA 4F16A 1PKTA 1WXTA 1UHCA 1G2BA 2RMOA 2ED1A 4JZ4A 2JXBA 3TVTA 2L3SA 2KBTA 1PHTA 3SEMA 4Z88A 3VRZA 1H3HA 2SEMA 2EKHA 3PVQA 2DRKA 2RQUA 1CKBA 2AKKA 4HXJA 2RPNA 4RTUA 1ZLMA 2RN8A 3UF4A 1JXMA 1OOTA 2GNCA 2KEAA 1GFDA 4E6RA 1E6GA 4ORZA 1M27C 1I07A 2M51A 2HEQA 2DL5A 2EBPA 2KNBB 4WCIA 3VS2A 2KGTA 2EYWA 2AK5A 3THKA 1CSKA 1NYFA 1X27A 1PKSA 2CH4A 2YT6A 2GQIA 2OAWA 2XMFA 4RTVA 1XOVA 1ZX6A 4GLMA 3EG1A 2M0YA 2X3WD 2HBWA 2RQRA 2J7IA 1NLOC 2PTKA 3H0FA 1KFZA 3M0UA 2BZXA 4FSSA 2BZYA 1OEBA 1JEGA 1GCQC 4OMPA 4D8DA 1ARKA 1I1JA 1QKWA 3UA7A 1AEYA 2O2OA 3VS5A 3VS1A 1KSWA 1H8KA 3FJ5A 1YCSB 2MIOA 4HCKA 1ZSGA 5FW9A 2EW3A 2YUQA 1NYGA 3EHRA 4RTTA 2LJ0A 2JM9A 1SRLA 3RNJA 2I0NA 4AFZC 1X2KA 2DVJA 3VRYA 1SEMA 3VS4A 2K7AA 3NHNA 1GRIA 4GBQA 1OV3A 1QWEA 2FRYA 3PE0A 1YP5A 1K1ZA 1X43A 3CQTA 2GGRA 2OJ2A 2CUDA 3JV3A 2BTTA 1UECA 2MCNA 3EGUA 5EC7A 2LZ6B 2CSIA 2DLPA
chains in the Genus database with same CATH superfamily
4FIBA 1Q86R 5LJ5h 4FW2A 1VQ7A 1Y57A 2MMPA 2Y4XA 1WJSA 2XHCA 4X34A 5FRMA 2FPFA 3DLLA 2L8DA 4J9DA 1RAIB 4XU3A 1D0YA 2LDMA 1M1GA 2C0IA 2D8HA 4CC2A 1ABQA 4E7HA 5IHNA 1VQ9A 1RLPC 2RHYA 4KH0B 1TUDA 2PVOB 1KD1R 2ZPFB 1M3AA 2K5IA 2VV5A 4JLIA 2WACA 1WGSA 3A5ZB 2O9VA 4RUGA 3V7CA 4Y91A 5LJ3e 2KRNA 3G71Q 3CMEA 3GPLA 2DO3A 2C0OA 3L42A 3CBPA 3CC2T 1MMDA 3VV0A 1PSFA 2W10A 3OS1A 2CDTA 3D7SB 3VUZA 1Y96A 1QLYA 3NTHA 2YDLA 1T0JA 1K76A 1M1KU 1K73C 1K9AA 4DQ2A 1ZSZB 2RHIA 3R6NA 4AT1B 3O5ZA 3PTAA 2X3XD 3FIFA 2EAYA 3META 2AZVA 2NUTA 3QHSA 1Q7YR 1KIKA 3QIIA 1WA7A 2MYSA 4F7UF 1WFWA 5KYUB 4OP0A 2IPOB 1UTIA 4J83A 1VQ8A 4UC4A 9ATCB 3J7AF 2QEXQ 4KGZB 2O88A 4ANJA 3RUXA 1WJRA 2A0FB 4XTYA 2DTHA 1FMWA 2MI6A 2GQVA 3VU3C 2BE9B 3MP6A 2F5TX 2LP5A 2HDAA 3OB9A 2DL8A 3CCJQ 4PJLA 2YUNA 4J6YA 3BDUA 2D0QB 1N9RA 5CO7A 2VKNA 1ZUYA 1WXBA 1BCOA 4X9DA 3JB9F 2X4YA 2K9GA 2KR3A 4LXCA 3OYGA 4BI4A 2ZCFB 1G3YA 1QMCA 2K3BA 2MOXA 3C4SA 1AT1B 4FYVB 3CC4Q 2DETA 1WXUA 1Z9ZA 3OW2P 2V26A 4MZMA 3CMAT 4KGVB 2FG0A 2K3XA 4K11A 1RUWA 2M1HA 3CCUT 5DY9A 2ABLA 3VKIA 1XQHA 1TS9A 2MK5A 2RHXA 2QDLA 3V8KA 4PKCC 3I9QA 1Q7YU 4P5NA 4C8QC 3CCUQ 1VQOQ 2DA9A 1NJIU 1G8XA 3INZA 4J9GA 4RTZA 1W4SA 2XDPA 4A4EA 4BUGA 2X9HA 2KYMA 3EFOA 1VUBA 1OU9A 4M7DF 3I55T 1YI2A 2DTIA 1T0HA 3OYJA 1WDXA 2LJ1A 4M7DG 1Q81C 3EFRA 1SHFA 1QP3A 3M59A 4PJMA 3LWHA 2COWA 1KQSP 1YNZA 3SFMA 1X6GA 1R77A 1Q81R 1S72T 2A37A 4QW2A 1W6XA 4M78G 1U1TA 2KY9A 5GAOq 2DERA 4N4IA 5GANe 5LJ3f 5GMKm 3DKMA 3I5SA 3WXMB 2CZ7B 5M9OA 1VYTA 4BI3A 4V2SA 3R6OA 4NOYA 1M2VA 2MPXC 4M7AE 4BY6C 3CC7T 1N8RU 4C0DB 1Q86C 2E65A 1Q86U 2ZPGB 1H641 3FC3A 3OYNA 1XNIA 3FB9A 3NPFA 1OPKA 3RKXA 4R0KA 2DYIA 2KE9A 1X01A 1JJ2P 3HSBA 3HFOA 2YUOA 2K57A 3FJPA 1TH7A 3G71T 1YJNQ 1Y71A 4BE1A 4M4ZA 2LQNA 2HQEA 3OS2A 5D6WA 1N6AA 5CKDA 1VQMT 1NEBA 4OMQA 1LOJA 2CP5A 2EPDA 1TUGB 2H3JA 2JS0A 1ABOA 3VS0A 1W2BP 1NE8A 2CZ6B 2QQSA 2DVEA 4X1VA 5FU6B 4VUBA 4DOWA 2KXCA 5HY6A 2DRMA 1JRIA 1MGQA 3PIOA 4L59A 3OMCA 1TG0A 3SDZA 1RLQC 1QVGP 4X9CA 3LW5E 3A98A 3CCRT 2HSPA 1I5LA 4QT7A 3VS6A 2RJFA 1NLPC 1RI0A 1M2VB 4XQ3A 4A63B 2A28A 2EFIA 1MMGA 3RESA 4RKUE 3U23A 1T3SA 5DLOA 3LYIA 1VYVA 1VQ4T 2I2LA 3CCEA 1KG1A 2CGHA 4C5GA 1R8OB 3RR6A 4M7DD 2V8IA 1YWOA 2KXDA 4XU2A 4A53A 2RK2A 2E41A 4C92A 2FL7A 1VQLA 2JTMA 3QJYA 2ED1A 4E47A 2X4XA 4CI0C 3GLXA 1BI1A 2E1HA 2KBTA 4C8QG 4E7ZA 4ZN1A 3PGGA 2QXFA 1SKUB 2EKHA 2DRKA 3M55A 4RTUA 4OB1B 4C0GA 1VQ4A 2IG0A 4BDYA 3PMIA 4E6RA 1I07A 3CMEQ 1VQ5Q 2HEQA 2M0OA 1X27A 2QQBA 2EQKA 4FM4B 3G4SA 3QYHB 1YJNT 3EG1A 2M0YA 2YLBA 2X3WD 4PK4A 3M54A 5LJ5d 3CXCP 2RQRA 1NLOC 2O4XA 2QAZA 3M0UA 4XU1A 4FSSA 1OEBA 3VUBA 3L2ZA 3ZFJA 2E3IA 4FYYB 3QYGB 2JN0A 1BI3A 4C0FA 2E5QA 1VQ9T 3H8ZA 4GY5A 3CPFA 4HCKA 1ACMB 3BDLA 5FW9A 4EMKC 2LNVA 4L5GA 4M78E 5GANj 1SRLA 3M9QA 2I0NA 3HKSA 3FDRA 4XAXB 4ZTFA 2DVJA 1N9SA 5L8RE 1SEMA 2QA4A 1M2OA 3CC2A 2M16A 2K7AA 4PJNA 2RJDA 5J39A 1VQKQ 5GAOn 3EH1A 3PE0A 3CCSA 3PIPA 4JRQA 3LGFA 4QQGA 1G5VA 4M75F 3CQTA 2VUBA 2CUDA 3JV3A 1PSEA 4C5EA 5EC7A 2LZ6B 2HMAA 1WHHA 1FMKA 3RBBB 1M90R 4NL3A 2XU8A 3BY7A 3EG9A 4DEXA 1UEBA 1SSFA 2OX7A 4LDYA 1OZ3A 1C6VX 1LPLA 1M90C 2D1XA 2OI3A 1UGRB 2DZCA 3H41A 6AT1B 1K73R 2DJQA 1OX8A 1OZ2A 3EHQA 2GTOA 2RF0A 1HSQA 1PNJA 1NG2A 2F1LA 2K2VA 1K9MC 2DL3A 4OB0B 4F14A 2E3HA 2QDYB 2JUFA 1SF9A 1SPKA 3RMSA 1IXDA 2JOYA 5ECAA 2M9UA 2VXFA 3CPWP 1X69A 2JZ2A 1AWJA 2KDSA 1EIFA 1ZA2B 1BKBA 2LQWA 2DBKA 4M7AD 1AD5A 3ER0A 5LJ3d 2SRCA 4LDUA 5IAYA 4E7KA 2FZGB 2P0KA 1E6HA 5IH2A 4QQ6A 4WTOB 1G83A 2RI5A 2PZ1A 1VQNQ 2CP6A 2EGAA 3CC2Q 3KUFA 1TXQA 2KMTA 2RA2A 2RH2A 1MV0B 1SSHA 2CP0A 4XU0A 2GFUA 2JW4A 2NYSA 4J7FA 4KUIA 2AZSA 3EH2A 5A0LA 1UB4A 3MEVA 2HBPA 2EQJA 2R57A 1QVPA 3CCSQ 1GXIE 3CC7A 1I5OB 2YXYA 1M8MA 1FX7A 4E7SA 1RI9A 5GAOl 2OTLT 2E6NA 4C92B 4A4HA 1VQKA 3CBOA 4M78F 1SRMA 3JCMd 5GMKh 4BI8B 2PQWA 3X20B 3HHTB 1I81A 2D9TA 2QQAA 1N8RR 3EG3A 3A8HB 1VQLT 1K8AR 4M77A 3OYAA 3I55A 1YI2T 4A4FA 2OAUA 3TQ7P 3OSSC 4PJOC 1HJDA 3CD6A 1PM3A 2EVRA 1V1CA 3UA6A 1D1AA 2PVDB 3PNWC 4J9BA 4M75C 2DKGA 3EFOB 3JCMc 2OTJA 1K0XA 1VOMA 4C8QB 1ZUUA 4IIOA 4PFPA 1M5Q1 2QQRA 2C0TA 2D0NA 4QVCA 2JS2A 1B34A 1B34B 3M0QA 2AHJB 1BIBA 2NUPA 5FU7B 3S6WA 3UDCA 4BDZA 1WHKA 4M7DE 1Q82C 2VC8A 4ESRA 5KE2A 2DX1A 3T9NA 2KRSA 3MJXA 4BB7A 4PLIA 5I21A 3EG0A 1FXXA 1QVFP 2E10A 3TEEA 4JJDA 2ZPHB 4IUTA 3A8LB 1H3ZA 1YN8A 3E1SA 2CSQA 2R5AA 3UATA 4KUDK 1WX6A 4E2FB 3RKWA 1IZ6A 2L3QA 1QCNA 5I2MA 1KC8R 3CCET 4PJOA 5LJ5f 3JCMP 3C95A 5FWBA 1SG5A 2KAFA 3CPWA 3CCJA 4LE9A 3OSVA 2VVKA 4IUVA 5FLXE 3JB9G 1D0XA 1YITQ 1MNDA 2EYYA 2KT1A 1QVFA 3OBYA 4PFZA 2P4RA 4FCYA 2J05A 1ZA1B 4OMOA 3JRZA 4F7UE 3SB2A 2W0ZA 4XTUA 4DBFA 5CQYA 4OGCA 5FWCA 4HVWA 2QYZA 3P8DA 3JCMQ 3RIRA 3WVEB 2YWWA 4RG2A 1GCPA 1M4ZA 2HD0A 5A0GA 2L89A 2EWNA 1YCYA 2D8JA 3X25B 3C12A 3ZL7C 3CXCS 1VQ8T 2LVMA 1B07A 3HPWA 4EIKA 1YJWA 4Z89A 1GL5A 5KYYB 1U1SA 1PWTA 1EZZB 3NMZC 1KHCA 2FEIA 2DXTA 2OTJQ 1JXOA 1JJ2S 2VGMA 1X6BA 3G4SQ 3RMQA 3L1AA 5CVIA 3EFSA 3QZ5B 5LJ5g 5KCOA 4OGEA 4PNOA 3LH5A 3GOXA 2DTOA 2ROTA 1MV3A 1ZQ1A 4AFSC 3G6EQ 2X51A 3CCQA 2QK0A 2LT4A 3JCMX 2JVVA 4LUEA 1KD1C 4M78A 4B9XA 1RAEB 2DNUA 3M53A 4M78B 2MWPA 2IIMA 2FZKB 5GJWB 4MZTA 4OMLA 1IGQA 3ZBDA 5LJ3g 1UGQB 1HXDA 5I2SA 5IN1A 4M7DB 2O9SA 5GAN6 4RTWA 4A4KA 1QKXA 1YIJQ 2AT1B 1KQSS 5GANh 1WHMA 2EKOA 2FO0A 2HQHA 1O75A 4HT9A 1XJWB 1WJQA 4M75E 3WVDB 4J9HA 3OS0A 2YUPA 5HCKA 1I0CA 1BI2A 4M77E 2H8HA 4M7AC 1NEGA 2EJGA 2COZA 3N5BB 4OMFB 4N4GA 1UGPB 2FHDA 2KROA 3FRNA 4LDVA 5AYFA 1RAHB 2K5LA 1QW1A 1UHFA 2XI9A 2CREA 1HK9A 4F16A 3OYFA 3OYIA 3JB9H 1WXTA 1D1CA 1V76A 3L2RA 1YITT 4N4HA 4QQDA 4YTLA 1JB0E 4Z88A 4EMHA 3VRZA 3PVQA 1K9MR 2Z0WA 2AKKA 4HXJA 1ZLMA 1NJIC 3UF4A 1TOVA 2GNCA 1TSFA 3EGDA 5KYXA 5GAMh 5DLQE 5KYXB 4ORZA 2KNBB 3EAEA 1CSKA 1NYFA 1PKSA 2CH4A 2YT6A 3A1PA 4MMKA 2GQIA 4RTVA 2RHZA 4JDSA 1VIFA 1ZX6A 4GLMA 3S3OA 1TU0B 3GNFB 4EMKB 3G7ZA 2J7IA 4ME7A 2ZPBB 3CCVA 2HAXA 2VASA 4MDXA 2COYA 8ATCB 3G71A 3JCMW 1NJIR 1U8RA 1IB8A 5CQXA 4DBRA 2XG8D 3VS1A 1H8KA 1YCSB 1S72A 1ZSGA 1FWZA 2EQUA 1NYGA 5FROA 3EHRA 2QQ9A 3GP8A 4RTTA 4D6WA 4B9WA 1RL2A 2EQMA 1D3BB 4PLLA 4ZN3A 3L2VA 4LD9K 3NHNA 1Q81U 1RADB 4GBQA 3CCRA 1QWEA 1M1FA 2QEXA 1JJ2A 2ZPEB 1NPRA 1X43A 5GAMj 2GGRA 2CP7A 3MCAB 1UECA 4M75D 3L2WA 2DD5A 2CSIA 3JCMe 4A4GA 2JNGA 1LCKA 4IIMA 4M77D 2ZAEA 1U06A 5FRNA 2HL5C 2RI3A 2AKLA 1EFNA 5D6YA 2A08A 3BW1A 1UGSB 1UJ0A 4R55A 1VQMA 5GMKl 2JTEA 2E70A 2EIFA 2QGGA 1UDLA 2D6FA 1WHGA 2YRVA 3A8OB 2L3RA 3QG1A 5GAN8 4KT0E 3L2QA 2OTLA 4A54A 3OYDA 2GBQA 1K0SA 2DPPB 2YRDA 4C92G 2DFUA 1VQ7T 2DIQA 1KQSA 1GFCA 3V8LA 1X2QA 1NBEB 4E7LA 4J6XA 2CS7A 5J26A 4JS5A 3F70A 2JMCA 2JT4A 4DA4A 4F7UB 4OMMA 1M3BA 3CD6T 1BIAA 1UE9A 3SWNB 2DM1A 4FL6A 3SWNA 1IGUA 1PC0A 4Q5WA 4J8OA 3REBB 1N27A 2B8AA 2RJEA 1J3TA 4TVRA 3Q1JA 4F17A 1MUZA 1UGVA 4C5HA 1JQQA 2VXEA 3I35A 4HKEA 2KT8A 5CKHA 3V7RA 1R0CB 3M0PA 4OMNA 2ZZDA 2NLUA 2P84A 4RTXA 3ME9A 3TCJA 4FT2A 1VA7A 4EDUA 4JLGA 5GMKj 4HCZA 2CKKA 2WSEE 1M9SA 1AWOA 4FU6A 1GBRA 1WIEA 3UT1A 2FYKA 4DEYA 2A3LA 1F1BB 1B3QA 4F04B 3KFVA 3OY9A 4O6JA 1BI0A 2EGEA 5C0MA 2NUPB 2R58A 1VQ6T 2DF6A 4Z8AA 1KHIA 3G6EA 3CCQQ 2QTVA 4LN2A 3MHXA 3M0TA 4BE2A 3ULRB 2E64A 3NTIA 2LQ8A 4C8QE 3AHUA 2EGCA 2L2PA 1M30A 3PVLA 1PRLC 1AHJB 5L23A 5A0DA 2M02A 1R0BG 3C0CA 3JCMJ 2FPDA 1ZSZC 2EYZA 3IQLA 3GF5A 5KYWB 5GANg 1WYXA 2VYTA 2YHTA 1D1BA 3M56A 2QTXA 4M7AA 4L6V5 1AOJA 1W70A 3QWYA 4HVUA 1U5SA 1XTDA 3VS3A 4B6MA 2F2WA 4E7IA 1GBQA 3H0IA 1QWFA 3I55Q 3E19A 4PL6A 3ASKA 3M0RA 2J06A 4C92E 1WQ7A 2DILA 4Y28E 2ZPIB 5KYYA 2Y4YA 4ZGJB 1Z9QA 3X28B 1SHGA 1Y96B 1VQPA 3CCMQ 1BU1A 1VQ5A 5GAMe 4E7JA 3JSCA 3PT9A 3CEYA 4C8QD 1PRMC 2BIVA 1WZOA 3QDFA 1VQ6A 1PD0A 2A36A 4OB3B 3TSZA 4J9EA 2K5FA 2DAQA 3I56T 2K6DA 4CC4B 3O8VA 2RQVA 2QEXT 1H92A 1D09B 3E2UA 1JU5C 1IHWA 1UG1A 4M77C 2MWOA 1YFNA 5CKEA 3OW2A 1WQWA 3P8HA 2LNHB 4ELZC 2K2MA 1AZGB 5GAOm 2CYZB 3CC4A 7AT1B 4C92D 4M7AG 4CRIA 3CC7Q 4RCBA 4HT8A 2RHUA 5GANf 4M7DA 4J7IA 5I22A 3MP1A 1O9SA 2ZGWA 3CBMA 3CCVT 3JCMf 1VQ8Q 3OYMA 2J6FA 3NGPA 3M57A 1YWPA 4IUUA 5I11A 5GAMg 4C92F 4OVAA 3OA6A 3A8MB 4ATOA 2DEUA 4MDWA 5GAN3 2MAMA 3CC4T 2YSQA 2VGNA 4M77G 3J81E 2LCSA 2E6ZA 5CKFA 1QVGS 2V1RA 1AVZC 2HNIA 3JCMV 1M1KR 2PUKB 5IHIA 4IKFA 2NUZA 1P92A 1D0ZA 4O5VA 2XD0A 2DYBA 4BY6B 5IHKA 2GCXA 2X4WA 1TWBA 3M0SA 3X24B 2P0QA 3UPUA 4NS5A 1FYNA 5HK3A 4ZNXA 2HQXA 2X4JA 1VQPQ 4M7AF 2RQTA 2KRMA 2ESWA 2CT3A 2JTFA 3P8BB 1MMNA 3RERA 1YIJT 4AG2C 2V1QA 5KH6A 4MZPA 2LCLA 3J80E 1PCXA 2QA4Q 2KQWA 4IUPA 5LJ3j 3CCMT 1Q82U 3CCLQ 2IVWA 1S72Q 1UHCA 3JB9I 1Y07A 1DJ7B 2RMOA 2JXBA 3TVTA 1KC8C 2XK0A 3A8GB 2L3SA 1PHTA 4LD6A 3SEMA 2SEMA 3LH0A 2HL3A 3G6ET 3CMET 3I56Q 1YJNA 2RQUA 4M77F 2DXCA 5GAN7 5GAOp 1OULA 1N8RC 1OOTA 2RJCA 2FB7A 2HSEB 1I4K1 5KCHA 3S3MA 3CPWS 2M51A 3QKJA 2DL5A 4WCIA 2EBPA 1QCOA 2LC4A 3HL8A 2BUDA 2KGTA 2EYWA 1VQOT 2AK5A 3BFMA 2C06A 3QO3A 2OAWA 2XMFA 5LJ5e 2X35A 1XOVA 3G1JA 2EJ9A 4M75A 4FYWB 3OYHA 2PTKA 3H0FA 5GAN5 1D3BA 1KFZA 4XTZA 1G3TA 1QP2A 4J6WA 2BZYA 4PFOA 3E9GA 4OMPA 4D8DA 1ARKA 3OYBA 1I1JA 3EGXA 3MEAA 1JBMA 1QKWA 1VQ7Q 4BACA 3VS5A 1I8FA 2XIDA 4XK8E 3FJ5A 2AIRB 2GF7A 4DBQA 4II1A 4LDXA 2YUQA 4ZTJA 1YJ9A 2O01E 2LJ0A 3GNGA 1OX9A 2JM9A 3OS5A 3RNJA 1FMVA 1OQKA 2KI7A 3OYCA 4NL2A 3HRTA 3M5AA 3OW2S 4AMCA 4PJOG 5CCAA 3JAME 2HKQB 1KQ1A 1RACB 1NZ9A 2FRYA 1YP5A 1VQLQ 3CCLA 1OYXA 4JRIA 2ATCB 2EJFA 2OJ2A 2XDBA 2BTTA 1Q82R 3EGUA 4XTVA 2DLPA 3MP8A 3OYYA 3EGDB 4C8QA 2KK4A 2LTOA 1QCFA 3QXEB 1T3LA 2QA4T 2LJ3A 4DOVA 1UUEA 1AWXA 2DZ9A 4GLKA 1G3SA 2PUOB 5HKCA 1E7OA 3OBWA 1MNEA 3CCQT 2H3EB 4JS4A 3X26B 1VQOA 1YHQQ 2RI2A 2LX7A 1M1KC 3TREA 4JPBW 4EMKA 1ZSZA 4M78D 2MF2A 1KJWA 2E4HA 4C92C 2YRCA 5CKBA 4LNPA 3OYLA 2B86A 1X6OA 3REAB 2F2XA 3AT1B 2Y90A 4HVVA 4Y92A 3CCRQ 5D7UA 2RD1A 4IUQA 5KYUA 2DIGA 2FVUA 2DXBA 4J9CA 4HCBA 4PJOB 2P0PA 2F2VA 3DLMA 1IO6A 1M3CA 1KD1U 4EPCA 1VQPT 2DEQA 3VS7A 2NWMA 5GMKi 4RG8A 1YJWQ 4AFQC 2XDDA 1Q7YC 3HRUA 2FZCB 1MHNA 2PNIA 3VYHB 3VJPA 2BE7D 2RQWA 5KYNA 4ELYC 4ZGEB 5CR2A 4PJJA 1QVFS 4R56A 3DB4A 4AFUC 3JCMh 1IREB 1ZBJA 3EGXB 2OTLQ 1S1NA 4J9FA 2ECZA 1RAGB 2CP2A 3QWXX 3HFNA 4F7UA 2ED0A 3NFCA 3CCLT 3H6ZA 1K8AU 4D8KA 1YITA 5GANd 4RCCA 5A2QE 1KQ2A 1A0NB 1K8AC 1WLPB 3VYGA 1YBYA 2L3PA 3V8JA 5CAIA 1BBZA 1X75C 1GCQA 4PJOD 2EQIA 1CKAA 1OPLA 3CCMA 1WI7A 1ZHIA 2NUTB 1VQ5T 3MO8A 5LJ5j 2KYBA 4WF2A 4LUDA 3FEOA 1LNXA 1M8VA 2RNAA 3OMGA 2DBMA 2WSFE 2GTJA 1NPPA 3EG2A 4KULA 4KH1B 3JCMg 5GJVB 3SD4A 2DL4A 2DL7A 3FLGA 2O4XB 3PFSA 3MKDA 2P4TA 1WNLA 4C5IA 2G3RA 2RO0A 2KSSA 2J6OA 2QI2A 5GAMf 2V8KA 8AT1B 4PJOE 4C8QF 4QVDA 1UJYA 3CCEQ 3M4YA 3TSWA 1LVKA 1Y7XA 4CC7A 2QASA 2LCCA 2LRQA 2BZ8A 2ROLA 2ENMA 4RMOA 4CC3A 3KXTA 2CT4A 3C94A 4QVZA 2FPEA 2K79A 4KGXB 4JJBA 1OU8A 1YIJA 3ZEHA 1JO8A 1V29B 5IT9E 2JM8A 4M77B 1YJ9T 1YJWT 3JCMb 4JRKA 4M75B 1RAAB 5LJ3h 3HTRA 2O31A 4N0AA 3OYEA 3S3NA 4FW1A 3QDRB 2DXUA 2VWFA 1VQNT 3GBQA 2RM4A 2DK3A 1WHLA 5CK9A 4IURA 4HCCA 1YHQT 1WHJA 4QKUA 3CCUA 4BD3A 2CUBA 5FU7C 2LMJA 4FYXB 5GAN4 1Y0MA 3CCST 5HK0A 5KYWA 2WSCE 1VYUA 4M7AB 1G3WA 3CMAQ 2EYXA 2LX9A 2HCKA 4PJOF 5GAMd 4KRTA 5IXFA 1K73U 3E9FA 3LX7A 4JZ3A 1MMAA 2F5KA 2E5KA 4J9IA 2XICA 2XKOC 1EX4A 4JUVA 5GMKe 1AWWA 1WPYA 4DBHA 1AZEA 5LL6S 4C0DC 2FRWA 1PD1A 1BK2A 2RK1A 1HYOA 2BKDN 1ZUKA 2E12A 4JRPA 3SHWA 3I5RA 3H0HA 3QZ9B 1HD3A 3QJ6A 1W1FA 4FSXA 3MEWA 1QQJA 2DD4A 4AG1C 3LLRA 4XTXA 2R5MA 3OYKA 2PVGB 2HKNA 5AT1B 1IRXA 2J6KA 2L0AA 2CH4W 3CCVQ 4N0AC 1U3OA 5CIUA 2DE0X 4JJCA 3V7SA 3H9NA 3CD6Q 1BB9A 2EYQA 3TU4K 3JB9J 1C0MA 4RTYA 1KC8U 3UWNA 1IHVA 1K4US 2CP3A 3DB3A 5FU6C 4XTWA 1UFFA 1BYMA 2F69A 3LWIA 5IXBA 4OF1A 5D6XA 1NM7A 4HA8A 2VB6A 1YI2Q 1TTHB 5EG2A 3L2UA 1VIEA 2JMAA 1LJOA 1PG5B 1TUCA 1N5ZA 2G6FX 1YHQA 1RABB 2DMOA 3NTKA 1PKTA 1G2BA 2LT1A 3MPUB 5DM7R 5C6SA 3JB9D 4JZ4A 1YJ9Q 2K3YA 4M78C 1H3HA 1VQKT 5GAOr 1VQMQ 1C1AA 2QGFB 1CKBA 3QPHA 1Q95G 2RPNA 2RN8A 1BCMA 3M4GA 1JXMA 3BE3A 4C0ZA 4M7DC 2KEAA 3CMAA 4OB2B 1GFDA 1VQ6Q 1E6GA 2PU9B 1M27C 4EMGA 3MEUA 1M90U 2DJZA 3VS2A 2GFAA 2YLCA 3THKA 4JJNK 3HRSA 4M75G 1VQ9Q 4MMLA 3KBGA 2OTJT 1KK7A 3QSUA 1OI1A 3LGLA 2K4YA 2HBWA 2BZXA 3RKYA 3GIBA 3URGA 1JEGA 1GCQC 5GAN2 3UA7A 2KVQG 1AEYA 2O2OA 1QVGA 1ZBXA 3QBYA 1KSWA 2L5QA 2MIOA 2A7YA 3M58A 2QG9B 2EW3A 3EG9B 1VQ4Q 3RDVA 1W2BA 4LDWA 2HZYA 2JJ9A 4AFZC 2CZ0B 3HP9A 4FT4A 1X2KA 1W2BS 4ZGDB 3VRYA 3I56A 5J3BA 3VS4A 2RB6A 4Z02A 4BE0A 2LQKA 4F7UG 1GRIA 3OQ5A 5KE3A 3SWNC 1B7TA 1OV3A 3CCJT 1K9MU 2CZ1B 3PMTA 2V8JA 3QUIA 1K1ZA 3CXCA 2MCNA 1VQNA 3G4ST 1RAFB 4J5YA 4KBMB
chains in the Genus database with same CATH topology
1LCKA 4IIMA 1FMKA 3RBBB 1Y57A 1QCFA 1T3LA 2LJ3A 1U06A 4DEXA 1UUEA 1AWXA 2AKLA 1EFNA 2FPFA 2A08A 1E7OA 1UJ0A 2D1XA 4J9DA 2OI3A 2JTEA 1UDLA 3H41A 2LX7A 2DJQA 2C0IA 2D8HA 4JPBW 1ABQA 4CC2A 5IHNA 1KJWA 3EHQA 2GTOA 2GBQA 1RLPC 2RF0A 1HSQA 1PNJA 1NG2A 4LNPA 1K0SA 1TUDA 2B86A 3REAB 2DL3A 4F14A 1M3AA 2F2XA 4HVVA 1GFCA 1SPKA 4Y92A 2O9VA 1X2QA 4RUGA 2KRNA 5ECAA 2C0OA 1X69A 4J9CA 2JMCA 2JT4A 1AWJA 2F2VA 4OMMA 1M3BA 1IO6A 1M3CA 2W10A 1UE9A 2CDTA 2LQWA 2DBKA 2DM1A 1QLYA 1AD5A 2YDLA 3VS7A 3REBB 2NWMA 1T0JA 1K76A 2SRCA 4AFQC 1K9AA 1E6HA 3R6NA 5IH2A 1J3TA 2PNIA 3O5ZA 4F17A 1MUZA 2X3XD 1G83A 2RQWA 2AZVA 1UGVA 2PZ1A 1JQQA 3I35A 2EGAA 2KT8A 1KIKA 4AFUC 1WA7A 3M0PA 1MV0B 1SSHA 1ZBJA 4OMNA 1WFWA 1S1NA 4J9FA 2ECZA 2JW4A 4RTXA 1UTIA 3QWXX 2AZSA 1VA7A 2ED0A 4D8KA 1AWOA 2O88A 1A0NB 1GBRA 1M8MA 1RI9A 1WIEA 4DEYA 1WLPB 1B3QA 2L3PA 3KFVA 1SRMA 2EGEA 1BBZA 1GCQA 2EQIA 1CKAA 1OPLA 2DF6A 4Z8AA 2LP5A 2HDAA 3EG3A 2DL8A 4LN2A 3M0TA 3ULRB 1WI7A 2YUNA 2EGCA 2L2PA 2VKNA 1HJDA 1ZUYA 1M30A 1WXBA 3PVLA 1PRLC 2EVRA 2K9GA 2KR3A 1V1CA 5L23A 3UA6A 4J9BA 2K3BA 3C0CA 1K0XA 2MOXA 2FPDA 1ZUUA 2EYZA 2KYBA 4IIOA 3IQLA 4LUDA 2RNAA 1WXUA 1WYXA 1Z9ZA 2C0TA 2D0NA 2DBMA 2JS2A 2GTJA 3EG2A 3M0QA 2FG0A 1AOJA 4K11A 1RUWA 5GJVB 2DL4A 2ABLA 2DL7A 1W70A 3QWYA 4HVUA 1U5SA 2J6OA 4ESRA 2QDLA 2DX1A 3VS3A 2F2WA 2KRSA 3I9QA 1GBQA 3H0IA 1UJYA 3EG0A 1QWFA 2DA9A 3TSWA 4J9GA 4RTZA 4JJDA 4CC7A 2ROLA 2BZ8A 2ENMA 1YN8A 2KYMA 4CC3A 2CT4A 2FPEA 2CSQA 2K79A 3M0RA 2J06A 4JJBA 3UATA 1WX6A 2L3QA 2DILA 1Z9QA 5FWBA 1JO8A 1T0HA 1SHGA 1WDXA 4LE9A 2LJ1A 1BU1A 1SHFA 2VVKA 2JM8A 2EYYA 2KT1A 1YNZA 1X6GA 2P4RA 2A37A 2J05A 1W6XA 2O31A 4OMOA 1PRMC 2W0ZA 2VWFA 2A36A 3GBQA 5FWCA 4HVWA 3TSZA 3I5SA 1VYTA 4J9EA 2K6DA 1GCPA 4CC4B 2RQVA 1H92A 2CUBA 2LMJA 1JU5C 1UG1A 2D8JA 3ZL7C 1B07A 4EIKA 1GL5A 1Y0MA 4Z89A 2LNHB 2K2MA 1PWTA 1AZGB 3NMZC 1VYUA 3NPFA 1OPKA 2FEIA 4R0KA 2KE9A 2EYXA 1JXOA 2HCKA 4KRTA 5IXFA 1X6BA 5I22A 2YUOA 4JZ3A 2E5KA 4J9IA 1AWWA 4M4ZA 1AZEA 3LH5A 2LQNA 2FRWA 2ROTA 1BK2A 1MV3A 4AFSC 2J6FA 3NGPA 1NEBA 4OMQA 1YWPA 5I11A 1ZUKA 2EPDA 4LUEA 3SHWA 3I5RA 3H0HA 1HD3A 1ABOA 2DNUA 2JS0A 3VS0A 1W1FA 2IIMA 4X1VA 2KXCA 5GJWB 4AG1C 4OMLA 2DRMA 2YSQA 2J6KA 2L0AA 2CH4W 1TG0A 2LCSA 1U3OA 2V1RA 1RLQC 1AVZC 2O9SA 2DE0X 4RTWA 1QKXA 3A98A 2HSPA 4JJCA 5IHIA 2NUZA 4QT7A 3VS6A 2FO0A 1BB9A 2DYBA 5IHKA 4RTYA 1NLPC 1K4US 4J9HA 4A63B 2YUPA 3M0SA 2A28A 1UFFA 5HCKA 1I0CA 1FYNA 4ZNXA 2H8HA 3U23A 5IXBA 1T3SA 1NEGA 2RQTA 2KRMA 2ESWA 1NM7A 1VYVA 2CT3A 2KROA 2JMAA 4AG2C 2V1QA 1TUCA 1N5ZA 2G6FX 1UHFA 2DMOA 1YWOA 2KXDA 2CREA 4F16A 1PKTA 1WXTA 1UHCA 1G2BA 2RMOA 2ED1A 4JZ4A 2JXBA 3TVTA 2L3SA 2KBTA 1PHTA 3SEMA 4Z88A 3VRZA 1H3HA 2SEMA 2EKHA 3PVQA 2DRKA 2RQUA 1CKBA 2AKKA 4HXJA 2RPNA 4RTUA 1ZLMA 2RN8A 3UF4A 1JXMA 1OOTA 2GNCA 2KEAA 1GFDA 4E6RA 1E6GA 4ORZA 1M27C 1I07A 2M51A 2HEQA 2DL5A 2EBPA 2KNBB 4WCIA 3VS2A 2KGTA 2EYWA 2AK5A 3THKA 1CSKA 1NYFA 1X27A 1PKSA 2CH4A 2YT6A 2GQIA 2OAWA 2XMFA 4RTVA 1XOVA 1ZX6A 4GLMA 3EG1A 2M0YA 2X3WD 2HBWA 2RQRA 2J7IA 1NLOC 2PTKA 3H0FA 1KFZA 3M0UA 2BZXA 4FSSA 2BZYA 1OEBA 1JEGA 1GCQC 4OMPA 4D8DA 1ARKA 1I1JA 1QKWA 3UA7A 1AEYA 2O2OA 3VS5A 3VS1A 1KSWA 1H8KA 3FJ5A 1YCSB 2MIOA 4HCKA 1ZSGA 5FW9A 2EW3A 2YUQA 1NYGA 3EHRA 4RTTA 2LJ0A 2JM9A 1SRLA 3RNJA 2I0NA 4AFZC 1X2KA 2DVJA 3VRYA 1SEMA 3VS4A 2K7AA 3NHNA 1GRIA 4GBQA 1OV3A 1QWEA 2FRYA 3PE0A 1YP5A 1K1ZA 1X43A 3CQTA 2GGRA 2OJ2A 2CUDA 3JV3A 2BTTA 1UECA 2MCNA 3EGUA 5EC7A 2LZ6B 2CSIA 2DLPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LCK A;  4IIM A;  1FMK A;  3RBB B;  1Y57 A;  1QCF A;  1T3L A;  2LJ3 A;  1U06 A;  4DEX A;  1UUE A;  1AWX A;  2AKL A;  1EFN A;  2FPF A;  2A08 A;  1E7O A;  1UJ0 A;  2D1X A;  4J9D A;  2OI3 A;  2JTE A;  1UDL A;  3H41 A;  2LX7 A;  2DJQ A;  2C0I A;  2D8H A;  4JPB W;  1ABQ A;  4CC2 A;  5IHN A;  1KJW A;  3EHQ A;  2GTO A;  2GBQ A;  1RLP C;  2RF0 A;  1HSQ A;  1PNJ A;  1NG2 A;  4LNP A;  1K0S A;  1TUD A;  2B86 A;  3REA B;  2DL3 A;  4F14 A;  1M3A A;  2F2X A;  4HVV A;  1GFC A;  1SPK A;  4Y92 A;  2O9V A;  1X2Q A;  4RUG A;  2KRN A;  5ECA A;  2C0O A;  1X69 A;  4J9C A;  2JMC A;  2JT4 A;  1AWJ A;  2F2V A;  4OMM A;  1M3B A;  1IO6 A;  1M3C A;  2W10 A;  1UE9 A;  2CDT A;  2LQW A;  2DBK A;  2DM1 A;  1QLY A;  1AD5 A;  2YDL A;  3VS7 A;  3REB B;  2NWM A;  1T0J A;  1K76 A;  2SRC A;  4AFQ C;  1K9A A;  1E6H A;  3R6N A;  5IH2 A;  1J3T A;  2PNI A;  3O5Z A;  4F17 A;  1MUZ A;  2X3X D;  1G83 A;  2RQW A;  2AZV A;  1UGV A;  2PZ1 A;  1JQQ A;  3I35 A;  2EGA A;  2KT8 A;  1KIK A;  4AFU C;  1WA7 A;  3M0P A;  1MV0 B;  1SSH A;  1ZBJ A;  4OMN A;  1WFW A;  1S1N A;  4J9F A;  2ECZ A;  2JW4 A;  4RTX A;  1UTI A;  3QWX X;  2AZS A;  1VA7 A;  2ED0 A;  4D8K A;  1AWO A;  2O88 A;  1A0N B;  1GBR A;  1M8M A;  1RI9 A;  1WIE A;  4DEY A;  1WLP B;  1B3Q A;  2L3P A;  3KFV A;  1SRM A;  2EGE A;  1BBZ A;  1GCQ A;  2EQI A;  1CKA A;  1OPL A;  2DF6 A;  4Z8A A;  2LP5 A;  2HDA A;  3EG3 A;  2DL8 A;  4LN2 A;  3M0T A;  3ULR B;  1WI7 A;  2YUN A;  2EGC A;  2L2P A;  2VKN A;  1HJD A;  1ZUY A;  1M30 A;  1WXB A;  3PVL A;  1PRL C;  2EVR A;  2K9G A;  2KR3 A;  1V1C A;  5L23 A;  3UA6 A;  4J9B A;  2K3B A;  3C0C A;  1K0X A;  2MOX A;  2FPD A;  1ZUU A;  2EYZ A;  2KYB A;  4IIO A;  3IQL A;  4LUD A;  2RNA A;  1WXU A;  1WYX A;  1Z9Z A;  2C0T A;  2D0N A;  2DBM A;  2JS2 A;  2GTJ A;  3EG2 A;  3M0Q A;  2FG0 A;  1AOJ A;  4K11 A;  1RUW A;  5GJV B;  2DL4 A;  2ABL A;  2DL7 A;  1W70 A;  3QWY A;  4HVU A;  1U5S A;  2J6O A;  4ESR A;  2QDL A;  2DX1 A;  3VS3 A;  2F2W A;  2KRS A;  3I9Q A;  1GBQ A;  3H0I A;  1UJY A;  3EG0 A;  1QWF A;  2DA9 A;  3TSW A;  4J9G A;  4RTZ A;  4JJD A;  4CC7 A;  2ROL A;  2BZ8 A;  2ENM A;  1YN8 A;  2KYM A;  4CC3 A;  2CT4 A;  2FPE A;  2CSQ A;  2K79 A;  3M0R A;  2J06 A;  4JJB A;  3UAT A;  1WX6 A;  2L3Q A;  2DIL A;  1Z9Q A;  5FWB A;  1JO8 A;  1T0H A;  1SHG A;  1WDX A;  4LE9 A;  2LJ1 A;  1BU1 A;  1SHF A;  2VVK A;  2JM8 A;  2EYY A;  2KT1 A;  1YNZ A;  1X6G A;  2P4R A;  2A37 A;  2J05 A;  1W6X A;  2O31 A;  4OMO A;  1PRM C;  2W0Z A;  2VWF A;  2A36 A;  3GBQ A;  5FWC A;  4HVW A;  3TSZ A;  3I5S A;  1VYT A;  4J9E A;  2K6D A;  1GCP A;  4CC4 B;  2RQV A;  1H92 A;  2CUB A;  2LMJ A;  1JU5 C;  1UG1 A;  2D8J A;  3ZL7 C;  1B07 A;  4EIK A;  1GL5 A;  1Y0M A;  4Z89 A;  2LNH B;  2K2M A;  1PWT A;  1AZG B;  3NMZ C;  1VYU A;  3NPF A;  1OPK A;  2FEI A;  4R0K A;  2KE9 A;  2EYX A;  1JXO A;  2HCK A;  4KRT A;  5IXF A;  1X6B A;  5I22 A;  2YUO A;  4JZ3 A;  2E5K A;  4J9I A;  1AWW A;  4M4Z A;  1AZE A;  3LH5 A;  2LQN A;  2FRW A;  2ROT A;  1BK2 A;  1MV3 A;  4AFS C;  2J6F A;  3NGP A;  1NEB A;  4OMQ A;  1YWP A;  5I11 A;  1ZUK A;  2EPD A;  4LUE A;  3SHW A;  3I5R A;  3H0H A;  1HD3 A;  1ABO A;  2DNU A;  2JS0 A;  3VS0 A;  1W1F A;  2IIM A;  4X1V A;  2KXC A;  5GJW B;  4AG1 C;  4OML A;  2DRM A;  2YSQ A;  2J6K A;  2L0A A;  2CH4 W;  1TG0 A;  2LCS A;  1U3O A;  2V1R A;  1RLQ C;  1AVZ C;  2O9S A;  2DE0 X;  4RTW A;  1QKX A;  3A98 A;  2HSP A;  4JJC A;  5IHI A;  2NUZ A;  4QT7 A;  3VS6 A;  2FO0 A;  1BB9 A;  2DYB A;  5IHK A;  4RTY A;  1NLP C;  1K4U S;  4J9H A;  4A63 B;  2YUP A;  3M0S A;  2A28 A;  1UFF A;  5HCK A;  1I0C A;  1FYN A;  4ZNX A;  2H8H A;  3U23 A;  5IXB A;  1T3S A;  1NEG A;  2RQT A;  2KRM A;  2ESW A;  1NM7 A;  1VYV A;  2CT3 A;  2KRO A;  2JMA A;  4AG2 C;  2V1Q A;  1TUC A;  1N5Z A;  2G6F X;  1UHF A;  2DMO A;  1YWO A;  2KXD A;  2CRE A;  4F16 A;  1PKT A;  1WXT A;  1UHC A;  1G2B A;  2RMO A;  2ED1 A;  4JZ4 A;  2JXB A;  3TVT A;  2L3S A;  2KBT A;  1PHT A;  3SEM A;  4Z88 A;  3VRZ A;  1H3H A;  2SEM A;  2EKH A;  3PVQ A;  2DRK A;  2RQU A;  1CKB A;  2AKK A;  4HXJ A;  2RPN A;  4RTU A;  1ZLM A;  2RN8 A;  3UF4 A;  1JXM A;  1OOT A;  2GNC A;  2KEA A;  1GFD A;  4E6R A;  1E6G A;  4ORZ A;  1M27 C;  1I07 A;  2M51 A;  2HEQ A;  2DL5 A;  2EBP A;  2KNB B;  4WCI A;  3VS2 A;  2KGT A;  2EYW A;  2AK5 A;  3THK A;  1CSK A;  1NYF A;  1X27 A;  1PKS A;  2CH4 A;  2YT6 A;  2GQI A;  2OAW A;  2XMF A;  4RTV A;  1XOV A;  1ZX6 A;  4GLM A;  3EG1 A;  2M0Y A;  2X3W D;  2HBW A;  2RQR A;  2J7I A;  1NLO C;  2PTK A;  3H0F A;  1KFZ A;  3M0U A;  2BZX A;  4FSS A;  2BZY A;  1OEB A;  1JEG A;  1GCQ C;  4OMP A;  4D8D A;  1ARK A;  1I1J A;  1QKW A;  3UA7 A;  1AEY A;  2O2O A;  3VS5 A;  3VS1 A;  1KSW A;  1H8K A;  3FJ5 A;  1YCS B;  2MIO A;  4HCK A;  1ZSG A;  5FW9 A;  2EW3 A;  2YUQ A;  1NYG A;  3EHR A;  4RTT A;  2LJ0 A;  2JM9 A;  1SRL A;  3RNJ A;  2I0N A;  4AFZ C;  1X2K A;  2DVJ A;  3VRY A;  1SEM A;  3VS4 A;  2K7A A;  3NHN A;  1GRI A;  4GBQ A;  1OV3 A;  1QWE A;  2FRY A;  3PE0 A;  1YP5 A;  1K1Z A;  1X43 A;  3CQT A;  2GGR A;  2OJ2 A;  2CUD A;  3JV3 A;  2BTT A;  1UEC A;  2MCN A;  3EGU A;  5EC7 A;  2LZ6 B;  2CSI A;  2DLP A; 
#chains in the Genus database with same CATH topology
 4FIB A;  1Q86 R;  5LJ5 h;  4FW2 A;  1VQ7 A;  1Y57 A;  2MMP A;  2Y4X A;  1WJS A;  2XHC A;  4X34 A;  5FRM A;  2FPF A;  3DLL A;  2L8D A;  4J9D A;  1RAI B;  4XU3 A;  1D0Y A;  2LDM A;  1M1G A;  2C0I A;  2D8H A;  4CC2 A;  1ABQ A;  4E7H A;  5IHN A;  1VQ9 A;  1RLP C;  2RHY A;  4KH0 B;  1TUD A;  2PVO B;  1KD1 R;  2ZPF B;  1M3A A;  2K5I A;  2VV5 A;  4JLI A;  2WAC A;  1WGS A;  3A5Z B;  2O9V A;  4RUG A;  3V7C A;  4Y91 A;  5LJ3 e;  2KRN A;  3G71 Q;  3CME A;  3GPL A;  2DO3 A;  2C0O A;  3L42 A;  3CBP A;  3CC2 T;  1MMD A;  3VV0 A;  1PSF A;  2W10 A;  3OS1 A;  2CDT A;  3D7S B;  3VUZ A;  1Y96 A;  1QLY A;  3NTH A;  2YDL A;  1T0J A;  1K76 A;  1M1K U;  1K73 C;  1K9A A;  4DQ2 A;  1ZSZ B;  2RHI A;  3R6N A;  4AT1 B;  3O5Z A;  3PTA A;  2X3X D;  3FIF A;  2EAY A;  3MET A;  2AZV A;  2NUT A;  3QHS A;  1Q7Y R;  1KIK A;  3QII A;  1WA7 A;  2MYS A;  4F7U F;  1WFW A;  5KYU B;  4OP0 A;  2IPO B;  1UTI A;  4J83 A;  1VQ8 A;  4UC4 A;  9ATC B;  3J7A F;  2QEX Q;  4KGZ B;  2O88 A;  4ANJ A;  3RUX A;  1WJR A;  2A0F B;  4XTY A;  2DTH A;  1FMW A;  2MI6 A;  2GQV A;  3VU3 C;  2BE9 B;  3MP6 A;  2F5T X;  2LP5 A;  2HDA A;  3OB9 A;  2DL8 A;  3CCJ Q;  4PJL A;  2YUN A;  4J6Y A;  3BDU A;  2D0Q B;  1N9R A;  5CO7 A;  2VKN A;  1ZUY A;  1WXB A;  1BCO A;  4X9D A;  3JB9 F;  2X4Y A;  2K9G A;  2KR3 A;  4LXC A;  3OYG A;  4BI4 A;  2ZCF B;  1G3Y A;  1QMC A;  2K3B A;  2MOX A;  3C4S A;  1AT1 B;  4FYV B;  3CC4 Q;  2DET A;  1WXU A;  1Z9Z A;  3OW2 P;  2V26 A;  4MZM A;  3CMA T;  4KGV B;  2FG0 A;  2K3X A;  4K11 A;  1RUW A;  2M1H A;  3CCU T;  5DY9 A;  2ABL A;  3VKI A;  1XQH A;  1TS9 A;  2MK5 A;  2RHX A;  2QDL A;  3V8K A;  4PKC C;  3I9Q A;  1Q7Y U;  4P5N A;  4C8Q C;  3CCU Q;  1VQO Q;  2DA9 A;  1NJI U;  1G8X A;  3INZ A;  4J9G A;  4RTZ A;  1W4S A;  2XDP A;  4A4E A;  4BUG A;  2X9H A;  2KYM A;  3EFO A;  1VUB A;  1OU9 A;  4M7D F;  3I55 T;  1YI2 A;  2DTI A;  1T0H A;  3OYJ A;  1WDX A;  2LJ1 A;  4M7D G;  1Q81 C;  3EFR A;  1SHF A;  1QP3 A;  3M59 A;  4PJM A;  3LWH A;  2COW A;  1KQS P;  1YNZ A;  3SFM A;  1X6G A;  1R77 A;  1Q81 R;  1S72 T;  2A37 A;  4QW2 A;  1W6X A;  4M78 G;  1U1T A;  2KY9 A;  5GAO q;  2DER A;  4N4I A;  5GAN e;  5LJ3 f;  5GMK m;  3DKM A;  3I5S A;  3WXM B;  2CZ7 B;  5M9O A;  1VYT A;  4BI3 A;  4V2S A;  3R6O A;  4NOY A;  1M2V A;  2MPX C;  4M7A E;  4BY6 C;  3CC7 T;  1N8R U;  4C0D B;  1Q86 C;  2E65 A;  1Q86 U;  2ZPG B;  1H64 1;  3FC3 A;  3OYN A;  1XNI A;  3FB9 A;  3NPF A;  1OPK A;  3RKX A;  4R0K A;  2DYI A;  2KE9 A;  1X01 A;  1JJ2 P;  3HSB A;  3HFO A;  2YUO A;  2K57 A;  3FJP A;  1TH7 A;  3G71 T;  1YJN Q;  1Y71 A;  4BE1 A;  4M4Z A;  2LQN A;  2HQE A;  3OS2 A;  5D6W A;  1N6A A;  5CKD A;  1VQM T;  1NEB A;  4OMQ A;  1LOJ A;  2CP5 A;  2EPD A;  1TUG B;  2H3J A;  2JS0 A;  1ABO A;  3VS0 A;  1W2B P;  1NE8 A;  2CZ6 B;  2QQS A;  2DVE A;  4X1V A;  5FU6 B;  4VUB A;  4DOW A;  2KXC A;  5HY6 A;  2DRM A;  1JRI A;  1MGQ A;  3PIO A;  4L59 A;  3OMC A;  1TG0 A;  3SDZ A;  1RLQ C;  1QVG P;  4X9C A;  3LW5 E;  3A98 A;  3CCR T;  2HSP A;  1I5L A;  4QT7 A;  3VS6 A;  2RJF A;  1NLP C;  1RI0 A;  1M2V B;  4XQ3 A;  4A63 B;  2A28 A;  2EFI A;  1MMG A;  3RES A;  4RKU E;  3U23 A;  1T3S A;  5DLO A;  3LYI A;  1VYV A;  1VQ4 T;  2I2L A;  3CCE A;  1KG1 A;  2CGH A;  4C5G A;  1R8O B;  3RR6 A;  4M7D D;  2V8I A;  1YWO A;  2KXD A;  4XU2 A;  4A53 A;  2RK2 A;  2E41 A;  4C92 A;  2FL7 A;  1VQL A;  2JTM A;  3QJY A;  2ED1 A;  4E47 A;  2X4X A;  4CI0 C;  3GLX A;  1BI1 A;  2E1H A;  2KBT A;  4C8Q G;  4E7Z A;  4ZN1 A;  3PGG A;  2QXF A;  1SKU B;  2EKH A;  2DRK A;  3M55 A;  4RTU A;  4OB1 B;  4C0G A;  1VQ4 A;  2IG0 A;  4BDY A;  3PMI A;  4E6R A;  1I07 A;  3CME Q;  1VQ5 Q;  2HEQ A;  2M0O A;  1X27 A;  2QQB A;  2EQK A;  4FM4 B;  3G4S A;  3QYH B;  1YJN T;  3EG1 A;  2M0Y A;  2YLB A;  2X3W D;  4PK4 A;  3M54 A;  5LJ5 d;  3CXC P;  2RQR A;  1NLO C;  2O4X A;  2QAZ A;  3M0U A;  4XU1 A;  4FSS A;  1OEB A;  3VUB A;  3L2Z A;  3ZFJ A;  2E3I A;  4FYY B;  3QYG B;  2JN0 A;  1BI3 A;  4C0F A;  2E5Q A;  1VQ9 T;  3H8Z A;  4GY5 A;  3CPF A;  4HCK A;  1ACM B;  3BDL A;  5FW9 A;  4EMK C;  2LNV A;  4L5G A;  4M78 E;  5GAN j;  1SRL A;  3M9Q A;  2I0N A;  3HKS A;  3FDR A;  4XAX B;  4ZTF A;  2DVJ A;  1N9S A;  5L8R E;  1SEM A;  2QA4 A;  1M2O A;  3CC2 A;  2M16 A;  2K7A A;  4PJN A;  2RJD A;  5J39 A;  1VQK Q;  5GAO n;  3EH1 A;  3PE0 A;  3CCS A;  3PIP A;  4JRQ A;  3LGF A;  4QQG A;  1G5V A;  4M75 F;  3CQT A;  2VUB A;  2CUD A;  3JV3 A;  1PSE A;  4C5E A;  5EC7 A;  2LZ6 B;  2HMA A;  1WHH A;  1FMK A;  3RBB B;  1M90 R;  4NL3 A;  2XU8 A;  3BY7 A;  3EG9 A;  4DEX A;  1UEB A;  1SSF A;  2OX7 A;  4LDY A;  1OZ3 A;  1C6V X;  1LPL A;  1M90 C;  2D1X A;  2OI3 A;  1UGR B;  2DZC A;  3H41 A;  6AT1 B;  1K73 R;  2DJQ A;  1OX8 A;  1OZ2 A;  3EHQ A;  2GTO A;  2RF0 A;  1HSQ A;  1PNJ A;  1NG2 A;  2F1L A;  2K2V A;  1K9M C;  2DL3 A;  4OB0 B;  4F14 A;  2E3H A;  2QDY B;  2JUF A;  1SF9 A;  1SPK A;  3RMS A;  1IXD A;  2JOY A;  5ECA A;  2M9U A;  2VXF A;  3CPW P;  1X69 A;  2JZ2 A;  1AWJ A;  2KDS A;  1EIF A;  1ZA2 B;  1BKB A;  2LQW A;  2DBK A;  4M7A D;  1AD5 A;  3ER0 A;  5LJ3 d;  2SRC A;  4LDU A;  5IAY A;  4E7K A;  2FZG B;  2P0K A;  1E6H A;  5IH2 A;  4QQ6 A;  4WTO B;  1G83 A;  2RI5 A;  2PZ1 A;  1VQN Q;  2CP6 A;  2EGA A;  3CC2 Q;  3KUF A;  1TXQ A;  2KMT A;  2RA2 A;  2RH2 A;  1MV0 B;  1SSH A;  2CP0 A;  4XU0 A;  2GFU A;  2JW4 A;  2NYS A;  4J7F A;  4KUI A;  2AZS A;  3EH2 A;  5A0L A;  1UB4 A;  3MEV A;  2HBP A;  2EQJ A;  2R57 A;  1QVP A;  3CCS Q;  1GXI E;  3CC7 A;  1I5O B;  2YXY A;  1M8M A;  1FX7 A;  4E7S A;  1RI9 A;  5GAO l;  2OTL T;  2E6N A;  4C92 B;  4A4H A;  1VQK A;  3CBO A;  4M78 F;  1SRM A;  3JCM d;  5GMK h;  4BI8 B;  2PQW A;  3X20 B;  3HHT B;  1I81 A;  2D9T A;  2QQA A;  1N8R R;  3EG3 A;  3A8H B;  1VQL T;  1K8A R;  4M77 A;  3OYA A;  3I55 A;  1YI2 T;  4A4F A;  2OAU A;  3TQ7 P;  3OSS C;  4PJO C;  1HJD A;  3CD6 A;  1PM3 A;  2EVR A;  1V1C A;  3UA6 A;  1D1A A;  2PVD B;  3PNW C;  4J9B A;  4M75 C;  2DKG A;  3EFO B;  3JCM c;  2OTJ A;  1K0X A;  1VOM A;  4C8Q B;  1ZUU A;  4IIO A;  4PFP A;  1M5Q 1;  2QQR A;  2C0T A;  2D0N A;  4QVC A;  2JS2 A;  1B34 A;  1B34 B;  3M0Q A;  2AHJ B;  1BIB A;  2NUP A;  5FU7 B;  3S6W A;  3UDC A;  4BDZ A;  1WHK A;  4M7D E;  1Q82 C;  2VC8 A;  4ESR A;  5KE2 A;  2DX1 A;  3T9N A;  2KRS A;  3MJX A;  4BB7 A;  4PLI A;  5I21 A;  3EG0 A;  1FXX A;  1QVF P;  2E10 A;  3TEE A;  4JJD A;  2ZPH B;  4IUT A;  3A8L B;  1H3Z A;  1YN8 A;  3E1S A;  2CSQ A;  2R5A A;  3UAT A;  4KUD K;  1WX6 A;  4E2F B;  3RKW A;  1IZ6 A;  2L3Q A;  1QCN A;  5I2M A;  1KC8 R;  3CCE T;  4PJO A;  5LJ5 f;  3JCM P;  3C95 A;  5FWB A;  1SG5 A;  2KAF A;  3CPW A;  3CCJ A;  4LE9 A;  3OSV A;  2VVK A;  4IUV A;  5FLX E;  3JB9 G;  1D0X A;  1YIT Q;  1MND A;  2EYY A;  2KT1 A;  1QVF A;  3OBY A;  4PFZ A;  2P4R A;  4FCY A;  2J05 A;  1ZA1 B;  4OMO A;  3JRZ A;  4F7U E;  3SB2 A;  2W0Z A;  4XTU A;  4DBF A;  5CQY A;  4OGC A;  5FWC A;  4HVW A;  2QYZ A;  3P8D A;  3JCM Q;  3RIR A;  3WVE B;  2YWW A;  4RG2 A;  1GCP A;  1M4Z A;  2HD0 A;  5A0G A;  2L89 A;  2EWN A;  1YCY A;  2D8J A;  3X25 B;  3C12 A;  3ZL7 C;  3CXC S;  1VQ8 T;  2LVM A;  1B07 A;  3HPW A;  4EIK A;  1YJW A;  4Z89 A;  1GL5 A;  5KYY B;  1U1S A;  1PWT A;  1EZZ B;  3NMZ C;  1KHC A;  2FEI A;  2DXT A;  2OTJ Q;  1JXO A;  1JJ2 S;  2VGM A;  1X6B A;  3G4S Q;  3RMQ A;  3L1A A;  5CVI A;  3EFS A;  3QZ5 B;  5LJ5 g;  5KCO A;  4OGE A;  4PNO A;  3LH5 A;  3GOX A;  2DTO A;  2ROT A;  1MV3 A;  1ZQ1 A;  4AFS C;  3G6E Q;  2X51 A;  3CCQ A;  2QK0 A;  2LT4 A;  3JCM X;  2JVV A;  4LUE A;  1KD1 C;  4M78 A;  4B9X A;  1RAE B;  2DNU A;  3M53 A;  4M78 B;  2MWP A;  2IIM A;  2FZK B;  5GJW B;  4MZT A;  4OML A;  1IGQ A;  3ZBD A;  5LJ3 g;  1UGQ B;  1HXD A;  5I2S A;  5IN1 A;  4M7D B;  2O9S A;  5GAN 6;  4RTW A;  4A4K A;  1QKX A;  1YIJ Q;  2AT1 B;  1KQS S;  5GAN h;  1WHM A;  2EKO A;  2FO0 A;  2HQH A;  1O75 A;  4HT9 A;  1XJW B;  1WJQ A;  4M75 E;  3WVD B;  4J9H A;  3OS0 A;  2YUP A;  5HCK A;  1I0C A;  1BI2 A;  4M77 E;  2H8H A;  4M7A C;  1NEG A;  2EJG A;  2COZ A;  3N5B B;  4OMF B;  4N4G A;  1UGP B;  2FHD A;  2KRO A;  3FRN A;  4LDV A;  5AYF A;  1RAH B;  2K5L A;  1QW1 A;  1UHF A;  2XI9 A;  2CRE A;  1HK9 A;  4F16 A;  3OYF A;  3OYI A;  3JB9 H;  1WXT A;  1D1C A;  1V76 A;  3L2R A;  1YIT T;  4N4H A;  4QQD A;  4YTL A;  1JB0 E;  4Z88 A;  4EMH A;  3VRZ A;  3PVQ A;  1K9M R;  2Z0W A;  2AKK A;  4HXJ A;  1ZLM A;  1NJI C;  3UF4 A;  1TOV A;  2GNC A;  1TSF A;  3EGD A;  5KYX A;  5GAM h;  5DLQ E;  5KYX B;  4ORZ A;  2KNB B;  3EAE A;  1CSK A;  1NYF A;  1PKS A;  2CH4 A;  2YT6 A;  3A1P A;  4MMK A;  2GQI A;  4RTV A;  2RHZ A;  4JDS A;  1VIF A;  1ZX6 A;  4GLM A;  3S3O A;  1TU0 B;  3GNF B;  4EMK B;  3G7Z A;  2J7I A;  4ME7 A;  2ZPB B;  3CCV A;  2HAX A;  2VAS A;  4MDX A;  2COY A;  8ATC B;  3G71 A;  3JCM W;  1NJI R;  1U8R A;  1IB8 A;  5CQX A;  4DBR A;  2XG8 D;  3VS1 A;  1H8K A;  1YCS B;  1S72 A;  1ZSG A;  1FWZ A;  2EQU A;  1NYG A;  5FRO A;  3EHR A;  2QQ9 A;  3GP8 A;  4RTT A;  4D6W A;  4B9W A;  1RL2 A;  2EQM A;  1D3B B;  4PLL A;  4ZN3 A;  3L2V A;  4LD9 K;  3NHN A;  1Q81 U;  1RAD B;  4GBQ A;  3CCR A;  1QWE A;  1M1F A;  2QEX A;  1JJ2 A;  2ZPE B;  1NPR A;  1X43 A;  5GAM j;  2GGR A;  2CP7 A;  3MCA B;  1UEC A;  4M75 D;  3L2W A;  2DD5 A;  2CSI A;  3JCM e;  4A4G A;  2JNG A;  1LCK A;  4IIM A;  4M77 D;  2ZAE A;  1U06 A;  5FRN A;  2HL5 C;  2RI3 A;  2AKL A;  1EFN A;  5D6Y A;  2A08 A;  3BW1 A;  1UGS B;  1UJ0 A;  4R55 A;  1VQM A;  5GMK l;  2JTE A;  2E70 A;  2EIF A;  2QGG A;  1UDL A;  2D6F A;  1WHG A;  2YRV A;  3A8O B;  2L3R A;  3QG1 A;  5GAN 8;  4KT0 E;  3L2Q A;  2OTL A;  4A54 A;  3OYD A;  2GBQ A;  1K0S A;  2DPP B;  2YRD A;  4C92 G;  2DFU A;  1VQ7 T;  2DIQ A;  1KQS A;  1GFC A;  3V8L A;  1X2Q A;  1NBE B;  4E7L A;  4J6X A;  2CS7 A;  5J26 A;  4JS5 A;  3F70 A;  2JMC A;  2JT4 A;  4DA4 A;  4F7U B;  4OMM A;  1M3B A;  3CD6 T;  1BIA A;  1UE9 A;  3SWN B;  2DM1 A;  4FL6 A;  3SWN A;  1IGU A;  1PC0 A;  4Q5W A;  4J8O A;  3REB B;  1N27 A;  2B8A A;  2RJE A;  1J3T A;  4TVR A;  3Q1J A;  4F17 A;  1MUZ A;  1UGV A;  4C5H A;  1JQQ A;  2VXE A;  3I35 A;  4HKE A;  2KT8 A;  5CKH A;  3V7R A;  1R0C B;  3M0P A;  4OMN A;  2ZZD A;  2NLU A;  2P84 A;  4RTX A;  3ME9 A;  3TCJ A;  4FT2 A;  1VA7 A;  4EDU A;  4JLG A;  5GMK j;  4HCZ A;  2CKK A;  2WSE E;  1M9S A;  1AWO A;  4FU6 A;  1GBR A;  1WIE A;  3UT1 A;  2FYK A;  4DEY A;  2A3L A;  1F1B B;  1B3Q A;  4F04 B;  3KFV A;  3OY9 A;  4O6J A;  1BI0 A;  2EGE A;  5C0M A;  2NUP B;  2R58 A;  1VQ6 T;  2DF6 A;  4Z8A A;  1KHI A;  3G6E A;  3CCQ Q;  2QTV A;  4LN2 A;  3MHX A;  3M0T A;  4BE2 A;  3ULR B;  2E64 A;  3NTI A;  2LQ8 A;  4C8Q E;  3AHU A;  2EGC A;  2L2P A;  1M30 A;  3PVL A;  1PRL C;  1AHJ B;  5L23 A;  5A0D A;  2M02 A;  1R0B G;  3C0C A;  3JCM J;  2FPD A;  1ZSZ C;  2EYZ A;  3IQL A;  3GF5 A;  5KYW B;  5GAN g;  1WYX A;  2VYT A;  2YHT A;  1D1B A;  3M56 A;  2QTX A;  4M7A A;  4L6V 5;  1AOJ A;  1W70 A;  3QWY A;  4HVU A;  1U5S A;  1XTD A;  3VS3 A;  4B6M A;  2F2W A;  4E7I A;  1GBQ A;  3H0I A;  1QWF A;  3I55 Q;  3E19 A;  4PL6 A;  3ASK A;  3M0R A;  2J06 A;  4C92 E;  1WQ7 A;  2DIL A;  4Y28 E;  2ZPI B;  5KYY A;  2Y4Y A;  4ZGJ B;  1Z9Q A;  3X28 B;  1SHG A;  1Y96 B;  1VQP A;  3CCM Q;  1BU1 A;  1VQ5 A;  5GAM e;  4E7J A;  3JSC A;  3PT9 A;  3CEY A;  4C8Q D;  1PRM C;  2BIV A;  1WZO A;  3QDF A;  1VQ6 A;  1PD0 A;  2A36 A;  4OB3 B;  3TSZ A;  4J9E A;  2K5F A;  2DAQ A;  3I56 T;  2K6D A;  4CC4 B;  3O8V A;  2RQV A;  2QEX T;  1H92 A;  1D09 B;  3E2U A;  1JU5 C;  1IHW A;  1UG1 A;  4M77 C;  2MWO A;  1YFN A;  5CKE A;  3OW2 A;  1WQW A;  3P8H A;  2LNH B;  4ELZ C;  2K2M A;  1AZG B;  5GAO m;  2CYZ B;  3CC4 A;  7AT1 B;  4C92 D;  4M7A G;  4CRI A;  3CC7 Q;  4RCB A;  4HT8 A;  2RHU A;  5GAN f;  4M7D A;  4J7I A;  5I22 A;  3MP1 A;  1O9S A;  2ZGW A;  3CBM A;  3CCV T;  3JCM f;  1VQ8 Q;  3OYM A;  2J6F A;  3NGP A;  3M57 A;  1YWP A;  4IUU A;  5I11 A;  5GAM g;  4C92 F;  4OVA A;  3OA6 A;  3A8M B;  4ATO A;  2DEU A;  4MDW A;  5GAN 3;  2MAM A;  3CC4 T;  2YSQ A;  2VGN A;  4M77 G;  3J81 E;  2LCS A;  2E6Z A;  5CKF A;  1QVG S;  2V1R A;  1AVZ C;  2HNI A;  3JCM V;  1M1K R;  2PUK B;  5IHI A;  4IKF A;  2NUZ A;  1P92 A;  1D0Z A;  4O5V A;  2XD0 A;  2DYB A;  4BY6 B;  5IHK A;  2GCX A;  2X4W A;  1TWB A;  3M0S A;  3X24 B;  2P0Q A;  3UPU A;  4NS5 A;  1FYN A;  5HK3 A;  4ZNX A;  2HQX A;  2X4J A;  1VQP Q;  4M7A F;  2RQT A;  2KRM A;  2ESW A;  2CT3 A;  2JTF A;  3P8B B;  1MMN A;  3RER A;  1YIJ T;  4AG2 C;  2V1Q A;  5KH6 A;  4MZP A;  2LCL A;  3J80 E;  1PCX A;  2QA4 Q;  2KQW A;  4IUP A;  5LJ3 j;  3CCM T;  1Q82 U;  3CCL Q;  2IVW A;  1S72 Q;  1UHC A;  3JB9 I;  1Y07 A;  1DJ7 B;  2RMO A;  2JXB A;  3TVT A;  1KC8 C;  2XK0 A;  3A8G B;  2L3S A;  1PHT A;  4LD6 A;  3SEM A;  2SEM A;  3LH0 A;  2HL3 A;  3G6E T;  3CME T;  3I56 Q;  1YJN A;  2RQU A;  4M77 F;  2DXC A;  5GAN 7;  5GAO p;  1OUL A;  1N8R C;  1OOT A;  2RJC A;  2FB7 A;  2HSE B;  1I4K 1;  5KCH A;  3S3M A;  3CPW S;  2M51 A;  3QKJ A;  2DL5 A;  4WCI A;  2EBP A;  1QCO A;  2LC4 A;  3HL8 A;  2BUD A;  2KGT A;  2EYW A;  1VQO T;  2AK5 A;  3BFM A;  2C06 A;  3QO3 A;  2OAW A;  2XMF A;  5LJ5 e;  2X35 A;  1XOV A;  3G1J A;  2EJ9 A;  4M75 A;  4FYW B;  3OYH A;  2PTK A;  3H0F A;  5GAN 5;  1D3B A;  1KFZ A;  4XTZ A;  1G3T A;  1QP2 A;  4J6W A;  2BZY A;  4PFO A;  3E9G A;  4OMP A;  4D8D A;  1ARK A;  3OYB A;  1I1J A;  3EGX A;  3MEA A;  1JBM A;  1QKW A;  1VQ7 Q;  4BAC A;  3VS5 A;  1I8F A;  2XID A;  4XK8 E;  3FJ5 A;  2AIR B;  2GF7 A;  4DBQ A;  4II1 A;  4LDX A;  2YUQ A;  4ZTJ A;  1YJ9 A;  2O01 E;  2LJ0 A;  3GNG A;  1OX9 A;  2JM9 A;  3OS5 A;  3RNJ A;  1FMV A;  1OQK A;  2KI7 A;  3OYC A;  4NL2 A;  3HRT A;  3M5A A;  3OW2 S;  4AMC A;  4PJO G;  5CCA A;  3JAM E;  2HKQ B;  1KQ1 A;  1RAC B;  1NZ9 A;  2FRY A;  1YP5 A;  1VQL Q;  3CCL A;  1OYX A;  4JRI A;  2ATC B;  2EJF A;  2OJ2 A;  2XDB A;  2BTT A;  1Q82 R;  3EGU A;  4XTV A;  2DLP A;  3MP8 A;  3OYY A;  3EGD B;  4C8Q A;  2KK4 A;  2LTO A;  1QCF A;  3QXE B;  1T3L A;  2QA4 T;  2LJ3 A;  4DOV A;  1UUE A;  1AWX A;  2DZ9 A;  4GLK A;  1G3S A;  2PUO B;  5HKC A;  1E7O A;  3OBW A;  1MNE A;  3CCQ T;  2H3E B;  4JS4 A;  3X26 B;  1VQO A;  1YHQ Q;  2RI2 A;  2LX7 A;  1M1K C;  3TRE A;  4JPB W;  4EMK A;  1ZSZ A;  4M78 D;  2MF2 A;  1KJW A;  2E4H A;  4C92 C;  2YRC A;  5CKB A;  4LNP A;  3OYL A;  2B86 A;  1X6O A;  3REA B;  2F2X A;  3AT1 B;  2Y90 A;  4HVV A;  4Y92 A;  3CCR Q;  5D7U A;  2RD1 A;  4IUQ A;  5KYU A;  2DIG A;  2FVU A;  2DXB A;  4J9C A;  4HCB A;  4PJO B;  2P0P A;  2F2V A;  3DLM A;  1IO6 A;  1M3C A;  1KD1 U;  4EPC A;  1VQP T;  2DEQ A;  3VS7 A;  2NWM A;  5GMK i;  4RG8 A;  1YJW Q;  4AFQ C;  2XDD A;  1Q7Y C;  3HRU A;  2FZC B;  1MHN A;  2PNI A;  3VYH B;  3VJP A;  2BE7 D;  2RQW A;  5KYN A;  4ELY C;  4ZGE B;  5CR2 A;  4PJJ A;  1QVF S;  4R56 A;  3DB4 A;  4AFU C;  3JCM h;  1IRE B;  1ZBJ A;  3EGX B;  2OTL Q;  1S1N A;  4J9F A;  2ECZ A;  1RAG B;  2CP2 A;  3QWX X;  3HFN A;  4F7U A;  2ED0 A;  3NFC A;  3CCL T;  3H6Z A;  1K8A U;  4D8K A;  1YIT A;  5GAN d;  4RCC A;  5A2Q E;  1KQ2 A;  1A0N B;  1K8A C;  1WLP B;  3VYG A;  1YBY A;  2L3P A;  3V8J A;  5CAI A;  1BBZ A;  1X75 C;  1GCQ A;  4PJO D;  2EQI A;  1CKA A;  1OPL A;  3CCM A;  1WI7 A;  1ZHI A;  2NUT B;  1VQ5 T;  3MO8 A;  5LJ5 j;  2KYB A;  4WF2 A;  4LUD A;  3FEO A;  1LNX A;  1M8V A;  2RNA A;  3OMG A;  2DBM A;  2WSF E;  2GTJ A;  1NPP A;  3EG2 A;  4KUL A;  4KH1 B;  3JCM g;  5GJV B;  3SD4 A;  2DL4 A;  2DL7 A;  3FLG A;  2O4X B;  3PFS A;  3MKD A;  2P4T A;  1WNL A;  4C5I A;  2G3R A;  2RO0 A;  2KSS A;  2J6O A;  2QI2 A;  5GAM f;  2V8K A;  8AT1 B;  4PJO E;  4C8Q F;  4QVD A;  1UJY A;  3CCE Q;  3M4Y A;  3TSW A;  1LVK A;  1Y7X A;  4CC7 A;  2QAS A;  2LCC A;  2LRQ A;  2BZ8 A;  2ROL A;  2ENM A;  4RMO A;  4CC3 A;  3KXT A;  2CT4 A;  3C94 A;  4QVZ A;  2FPE A;  2K79 A;  4KGX B;  4JJB A;  1OU8 A;  1YIJ A;  3ZEH A;  1JO8 A;  1V29 B;  5IT9 E;  2JM8 A;  4M77 B;  1YJ9 T;  1YJW T;  3JCM b;  4JRK A;  4M75 B;  1RAA B;  5LJ3 h;  3HTR A;  2O31 A;  4N0A A;  3OYE A;  3S3N A;  4FW1 A;  3QDR B;  2DXU A;  2VWF A;  1VQN T;  3GBQ A;  2RM4 A;  2DK3 A;  1WHL A;  5CK9 A;  4IUR A;  4HCC A;  1YHQ T;  1WHJ A;  4QKU A;  3CCU A;  4BD3 A;  2CUB A;  5FU7 C;  2LMJ A;  4FYX B;  5GAN 4;  1Y0M A;  3CCS T;  5HK0 A;  5KYW A;  2WSC E;  1VYU A;  4M7A B;  1G3W A;  3CMA Q;  2EYX A;  2LX9 A;  2HCK A;  4PJO F;  5GAM d;  4KRT A;  5IXF A;  1K73 U;  3E9F A;  3LX7 A;  4JZ3 A;  1MMA A;  2F5K A;  2E5K A;  4J9I A;  2XIC A;  2XKO C;  1EX4 A;  4JUV A;  5GMK e;  1AWW A;  1WPY A;  4DBH A;  1AZE A;  5LL6 S;  4C0D C;  2FRW A;  1PD1 A;  1BK2 A;  2RK1 A;  1HYO A;  2BKD N;  1ZUK A;  2E12 A;  4JRP A;  3SHW A;  3I5R A;  3H0H A;  3QZ9 B;  1HD3 A;  3QJ6 A;  1W1F A;  4FSX A;  3MEW A;  1QQJ A;  2DD4 A;  4AG1 C;  3LLR A;  4XTX A;  2R5M A;  3OYK A;  2PVG B;  2HKN A;  5AT1 B;  1IRX A;  2J6K A;  2L0A A;  2CH4 W;  3CCV Q;  4N0A C;  1U3O A;  5CIU A;  2DE0 X;  4JJC A;  3V7S A;  3H9N A;  3CD6 Q;  1BB9 A;  2EYQ A;  3TU4 K;  3JB9 J;  1C0M A;  4RTY A;  1KC8 U;  3UWN A;  1IHV A;  1K4U S;  2CP3 A;  3DB3 A;  5FU6 C;  4XTW A;  1UFF A;  1BYM A;  2F69 A;  3LWI A;  5IXB A;  4OF1 A;  5D6X A;  1NM7 A;  4HA8 A;  2VB6 A;  1YI2 Q;  1TTH B;  5EG2 A;  3L2U A;  1VIE A;  2JMA A;  1LJO A;  1PG5 B;  1TUC A;  1N5Z A;  2G6F X;  1YHQ A;  1RAB B;  2DMO A;  3NTK A;  1PKT A;  1G2B A;  2LT1 A;  3MPU B;  5DM7 R;  5C6S A;  3JB9 D;  4JZ4 A;  1YJ9 Q;  2K3Y A;  4M78 C;  1H3H A;  1VQK T;  5GAO r;  1VQM Q;  1C1A A;  2QGF B;  1CKB A;  3QPH A;  1Q95 G;  2RPN A;  2RN8 A;  1BCM A;  3M4G A;  1JXM A;  3BE3 A;  4C0Z A;  4M7D C;  2KEA A;  3CMA A;  4OB2 B;  1GFD A;  1VQ6 Q;  1E6G A;  2PU9 B;  1M27 C;  4EMG A;  3MEU A;  1M90 U;  2DJZ A;  3VS2 A;  2GFA A;  2YLC A;  3THK A;  4JJN K;  3HRS A;  4M75 G;  1VQ9 Q;  4MML A;  3KBG A;  2OTJ T;  1KK7 A;  3QSU A;  1OI1 A;  3LGL A;  2K4Y A;  2HBW A;  2BZX A;  3RKY A;  3GIB A;  3URG A;  1JEG A;  1GCQ C;  5GAN 2;  3UA7 A;  2KVQ G;  1AEY A;  2O2O A;  1QVG A;  1ZBX A;  3QBY A;  1KSW A;  2L5Q A;  2MIO A;  2A7Y A;  3M58 A;  2QG9 B;  2EW3 A;  3EG9 B;  1VQ4 Q;  3RDV A;  1W2B A;  4LDW A;  2HZY A;  2JJ9 A;  4AFZ C;  2CZ0 B;  3HP9 A;  4FT4 A;  1X2K A;  1W2B S;  4ZGD B;  3VRY A;  3I56 A;  5J3B A;  3VS4 A;  2RB6 A;  4Z02 A;  4BE0 A;  2LQK A;  4F7U G;  1GRI A;  3OQ5 A;  5KE3 A;  3SWN C;  1B7T A;  1OV3 A;  3CCJ T;  1K9M U;  2CZ1 B;  3PMT A;  2V8J A;  3QUI A;  1K1Z A;  3CXC A;  2MCN A;  1VQN A;  3G4S T;  1RAF B;  4J5Y A;  4KBM B; 
#chains in the Genus database with same CATH homology
 1LCK A;  4IIM A;  1FMK A;  3RBB B;  1Y57 A;  1QCF A;  1T3L A;  2LJ3 A;  1U06 A;  4DEX A;  1UUE A;  1AWX A;  2AKL A;  1EFN A;  2FPF A;  2A08 A;  1E7O A;  1UJ0 A;  2D1X A;  4J9D A;  2OI3 A;  2JTE A;  1UDL A;  3H41 A;  2LX7 A;  2DJQ A;  2C0I A;  2D8H A;  4JPB W;  1ABQ A;  4CC2 A;  5IHN A;  1KJW A;  3EHQ A;  2GTO A;  2GBQ A;  1RLP C;  2RF0 A;  1HSQ A;  1PNJ A;  1NG2 A;  4LNP A;  1K0S A;  1TUD A;  2B86 A;  3REA B;  2DL3 A;  4F14 A;  1M3A A;  2F2X A;  4HVV A;  1GFC A;  1SPK A;  4Y92 A;  2O9V A;  1X2Q A;  4RUG A;  2KRN A;  5ECA A;  2C0O A;  1X69 A;  4J9C A;  2JMC A;  2JT4 A;  1AWJ A;  2F2V A;  4OMM A;  1M3B A;  1IO6 A;  1M3C A;  2W10 A;  1UE9 A;  2CDT A;  2LQW A;  2DBK A;  2DM1 A;  1QLY A;  1AD5 A;  2YDL A;  3VS7 A;  3REB B;  2NWM A;  1T0J A;  1K76 A;  2SRC A;  4AFQ C;  1K9A A;  1E6H A;  3R6N A;  5IH2 A;  1J3T A;  2PNI A;  3O5Z A;  4F17 A;  1MUZ A;  2X3X D;  1G83 A;  2RQW A;  2AZV A;  1UGV A;  2PZ1 A;  1JQQ A;  3I35 A;  2EGA A;  2KT8 A;  1KIK A;  4AFU C;  1WA7 A;  3M0P A;  1MV0 B;  1SSH A;  1ZBJ A;  4OMN A;  1WFW A;  1S1N A;  4J9F A;  2ECZ A;  2JW4 A;  4RTX A;  1UTI A;  3QWX X;  2AZS A;  1VA7 A;  2ED0 A;  4D8K A;  1AWO A;  2O88 A;  1A0N B;  1GBR A;  1M8M A;  1RI9 A;  1WIE A;  4DEY A;  1WLP B;  1B3Q A;  2L3P A;  3KFV A;  1SRM A;  2EGE A;  1BBZ A;  1GCQ A;  2EQI A;  1CKA A;  1OPL A;  2DF6 A;  4Z8A A;  2LP5 A;  2HDA A;  3EG3 A;  2DL8 A;  4LN2 A;  3M0T A;  3ULR B;  1WI7 A;  2YUN A;  2EGC A;  2L2P A;  2VKN A;  1HJD A;  1ZUY A;  1M30 A;  1WXB A;  3PVL A;  1PRL C;  2EVR A;  2K9G A;  2KR3 A;  1V1C A;  5L23 A;  3UA6 A;  4J9B A;  2K3B A;  3C0C A;  1K0X A;  2MOX A;  2FPD A;  1ZUU A;  2EYZ A;  2KYB A;  4IIO A;  3IQL A;  4LUD A;  2RNA A;  1WXU A;  1WYX A;  1Z9Z A;  2C0T A;  2D0N A;  2DBM A;  2JS2 A;  2GTJ A;  3EG2 A;  3M0Q A;  2FG0 A;  1AOJ A;  4K11 A;  1RUW A;  5GJV B;  2DL4 A;  2ABL A;  2DL7 A;  1W70 A;  3QWY A;  4HVU A;  1U5S A;  2J6O A;  4ESR A;  2QDL A;  2DX1 A;  3VS3 A;  2F2W A;  2KRS A;  3I9Q A;  1GBQ A;  3H0I A;  1UJY A;  3EG0 A;  1QWF A;  2DA9 A;  3TSW A;  4J9G A;  4RTZ A;  4JJD A;  4CC7 A;  2ROL A;  2BZ8 A;  2ENM A;  1YN8 A;  2KYM A;  4CC3 A;  2CT4 A;  2FPE A;  2CSQ A;  2K79 A;  3M0R A;  2J06 A;  4JJB A;  3UAT A;  1WX6 A;  2L3Q A;  2DIL A;  1Z9Q A;  5FWB A;  1JO8 A;  1T0H A;  1SHG A;  1WDX A;  4LE9 A;  2LJ1 A;  1BU1 A;  1SHF A;  2VVK A;  2JM8 A;  2EYY A;  2KT1 A;  1YNZ A;  1X6G A;  2P4R A;  2A37 A;  2J05 A;  1W6X A;  2O31 A;  4OMO A;  1PRM C;  2W0Z A;  2VWF A;  2A36 A;  3GBQ A;  5FWC A;  4HVW A;  3TSZ A;  3I5S A;  1VYT A;  4J9E A;  2K6D A;  1GCP A;  4CC4 B;  2RQV A;  1H92 A;  2CUB A;  2LMJ A;  1JU5 C;  1UG1 A;  2D8J A;  3ZL7 C;  1B07 A;  4EIK A;  1GL5 A;  1Y0M A;  4Z89 A;  2LNH B;  2K2M A;  1PWT A;  1AZG B;  3NMZ C;  1VYU A;  3NPF A;  1OPK A;  2FEI A;  4R0K A;  2KE9 A;  2EYX A;  1JXO A;  2HCK A;  4KRT A;  5IXF A;  1X6B A;  5I22 A;  2YUO A;  4JZ3 A;  2E5K A;  4J9I A;  1AWW A;  4M4Z A;  1AZE A;  3LH5 A;  2LQN A;  2FRW A;  2ROT A;  1BK2 A;  1MV3 A;  4AFS C;  2J6F A;  3NGP A;  1NEB A;  4OMQ A;  1YWP A;  5I11 A;  1ZUK A;  2EPD A;  4LUE A;  3SHW A;  3I5R A;  3H0H A;  1HD3 A;  1ABO A;  2DNU A;  2JS0 A;  3VS0 A;  1W1F A;  2IIM A;  4X1V A;  2KXC A;  5GJW B;  4AG1 C;  4OML A;  2DRM A;  2YSQ A;  2J6K A;  2L0A A;  2CH4 W;  1TG0 A;  2LCS A;  1U3O A;  2V1R A;  1RLQ C;  1AVZ C;  2O9S A;  2DE0 X;  4RTW A;  1QKX A;  3A98 A;  2HSP A;  4JJC A;  5IHI A;  2NUZ A;  4QT7 A;  3VS6 A;  2FO0 A;  1BB9 A;  2DYB A;  5IHK A;  4RTY A;  1NLP C;  1K4U S;  4J9H A;  4A63 B;  2YUP A;  3M0S A;  2A28 A;  1UFF A;  5HCK A;  1I0C A;  1FYN A;  4ZNX A;  2H8H A;  3U23 A;  5IXB A;  1T3S A;  1NEG A;  2RQT A;  2KRM A;  2ESW A;  1NM7 A;  1VYV A;  2CT3 A;  2KRO A;  2JMA A;  4AG2 C;  2V1Q A;  1TUC A;  1N5Z A;  2G6F X;  1UHF A;  2DMO A;  1YWO A;  2KXD A;  2CRE A;  4F16 A;  1PKT A;  1WXT A;  1UHC A;  1G2B A;  2RMO A;  2ED1 A;  4JZ4 A;  2JXB A;  3TVT A;  2L3S A;  2KBT A;  1PHT A;  3SEM A;  4Z88 A;  3VRZ A;  1H3H A;  2SEM A;  2EKH A;  3PVQ A;  2DRK A;  2RQU A;  1CKB A;  2AKK A;  4HXJ A;  2RPN A;  4RTU A;  1ZLM A;  2RN8 A;  3UF4 A;  1JXM A;  1OOT A;  2GNC A;  2KEA A;  1GFD A;  4E6R A;  1E6G A;  4ORZ A;  1M27 C;  1I07 A;  2M51 A;  2HEQ A;  2DL5 A;  2EBP A;  2KNB B;  4WCI A;  3VS2 A;  2KGT A;  2EYW A;  2AK5 A;  3THK A;  1CSK A;  1NYF A;  1X27 A;  1PKS A;  2CH4 A;  2YT6 A;  2GQI A;  2OAW A;  2XMF A;  4RTV A;  1XOV A;  1ZX6 A;  4GLM A;  3EG1 A;  2M0Y A;  2X3W D;  2HBW A;  2RQR A;  2J7I A;  1NLO C;  2PTK A;  3H0F A;  1KFZ A;  3M0U A;  2BZX A;  4FSS A;  2BZY A;  1OEB A;  1JEG A;  1GCQ C;  4OMP A;  4D8D A;  1ARK A;  1I1J A;  1QKW A;  3UA7 A;  1AEY A;  2O2O A;  3VS5 A;  3VS1 A;  1KSW A;  1H8K A;  3FJ5 A;  1YCS B;  2MIO A;  4HCK A;  1ZSG A;  5FW9 A;  2EW3 A;  2YUQ A;  1NYG A;  3EHR A;  4RTT A;  2LJ0 A;  2JM9 A;  1SRL A;  3RNJ A;  2I0N A;  4AFZ C;  1X2K A;  2DVJ A;  3VRY A;  1SEM A;  3VS4 A;  2K7A A;  3NHN A;  1GRI A;  4GBQ A;  1OV3 A;  1QWE A;  2FRY A;  3PE0 A;  1YP5 A;  1K1Z A;  1X43 A;  3CQT A;  2GGR A;  2OJ2 A;  2CUD A;  3JV3 A;  2BTT A;  1UEC A;  2MCN A;  3EGU A;  5EC7 A;  2LZ6 B;  2CSI A;  2DLP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...