2ESWA

Atomic structure of the n-terminal sh3 domain of mouse beta pix,p21-activated kinase (pak)-interacting exchange factor
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
60
structure length
60
Chain Sequence
PLGSQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTHNGRTGWFPSNYVREI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho guanine nucleotide exchange factor 7
publication title Crystal structure of the N-terminal SH3 domain of mouse betaPIX, p21-activated kinase-interacting exchange factor
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 10
structure length 60
sequence length 60
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2eswA00
1MUZA 1I1JA 1JQQA 2EGAA 4RTXA 1J3TA 2G6FX 3EG0A 3I9QA 2RQTA 4JZ4A 2EYWA 4Y92A 4CC3A 2D8HA 2HCKA 2X3WD 2DBKA 2KT1A 2VWFA 4JPBW 2EQIA 2E5KA 2O88A 2YSQA 1UGVA 2KXCA 1TUCA 2QDLA 2L3PA 1B3QA 2EYYA 4Z89A 1X2QA 4R0KA 1OOTA 2DX1A 2KR3A 2LJ3A 1Y0MA 4GLMA 2O9VA 4F14A 2FO0A 5FWCA 2EBPA 1N5ZA 3FJ5A 3TVTA 2LQNA 1WXTA 1AWWA 1WX6A 1YWPA 2J6FA 2PZ1A 4AFQC 2A28A 1I0CA 2DILA 1GCQC 2J6KA 2C0IA 1AVZC 2C0OA 2CUDA 2IIMA 3VS0A 1HJDA 1GBQA 2RMOA 1SEMA 2KRNA 1K76A 3TSZA 2KXDA 2EW3A 1SRLA 2VKNA 3EGUA 2FPFA 2JXBA 1JU5C 2ECZA 1ABQA 2C0TA 2W10A 1AZEA 4AFUC 2EVRA 1WLPB 2GTOA 1K0XA 3UA7A 1RLPC 3M0RA 2EGCA 4IIOA 1AWJA 2RF0A 4J9IA 1OPLA 3VS7A 2FG0A 4JJDA 3NMZC 5GJWB 2K9GA 1PHTA 1WYXA 1YCSB 1LCKA 2DLPA 3NGPA 1OV3A 4OMLA 1UJ0A 2F2WA 1QKWA 1T0JA 4HVWA 1H92A 4E6RA 1K4US 2DJQA 3VRZA 2JW4A 1NG2A 2DL5A 2FRYA 2FRWA 2GGRA 2YUOA 3I5RA 1EFNA 1GRIA 1SHFA 2PTKA 1WXBA 5IXBA 2L2PA 1GCPA 1ZSGA 5IHKA 3I35A 3M0PA 1M3CA 2DRMA 2RQVA 1UHFA 1KJWA 4EIKA 4D8DA 1GBRA 1NM7A 2BZ8A 1E6GA 3RNJA 2M51A 2MCNA 2CSQA 1I07A 2HDAA 2RQUA 4CC2A 3R6NA 2GTJA 4RTWA 1T3SA 2RN8A 3M0QA 3I5SA 3U23A 1Y57A 1ZLMA 2D0NA 1CKBA 3CQTA 3KFVA 3NPFA 2JM9A 2V1QA 3EG3A 2FPDA 3VS1A 1K9AA 3O5ZA 3TSWA 2A36A 4D8KA 3M0UA 1GCQA 2OAWA 4AG1C 2KEAA 2RQRA 3EHQA 1XOVA 1JEGA 2JM8A 3VS6A 2PNIA 1HSQA 2JT4A 4HCKA 1QKXA 2I0NA 2MOXA 1IO6A 2CDTA 3ZL7C 2BZYA 1PKSA 1A0NB 1NLPC 2JMCA 1NLOC 4HXJA 1X6GA 1UDLA 4J9CA 2JS2A 4HVVA 2NWMA 2GNCA 1ARKA 2DRKA 2AKLA 2LQWA 4RTZA 1G83A 1JXOA 4ESRA 2LMJA 2DL8A 2SRCA 2AZVA 1UECA 2J06A 2X3XD 2DA9A 2DVJA 5IHNA 2KRMA 4J9FA 4ORZA 3THKA 1W1FA 2XMFA 1W6XA 2YT6A 4Z8AA 2F2VA 1AEYA 2V1RA 2LCSA 3UF4A 4WCIA 4RTUA 5ECAA 4FSSA 4KRTA 2O2OA 1NEGA 1NYGA 1PWTA 2SEMA 1UUEA 2KYBA 1E6HA 1AWOA 2F2XA 2EKHA 3EG2A 4AG2C 2FEIA 1AZGB 1TG0A 1ZUKA 2KT8A 1FYNA 1WIEA 1U06A 2KNBB 2YDLA 4OMQA 2KYMA 3H0HA 3LH5A 3H0FA 4X1VA 3VS5A 4QT7A 1UFFA 3H0IA 1SHGA 3IQLA 4OMNA 1X27A 2GBQA 1X43A 5GJVB 4AFZC 2ABLA 1T0HA 2HBWA 1AOJA 1YNZA 5IH2A 2O31A 1M3BA 1FMKA 4JZ3A 2DYBA 4DEXA 4DEYA 1MV3A 1PNJA 1QWEA 2CREA 2LP5A 1VA7A 2A08A 2M0YA 1K0SA 3EHRA 2O9SA 4J9HA 2LNHB 2RPNA 2ENMA 1WI7A 2A37A 1YP5A 1ABOA 1CSKA 1GFCA 1CKAA 2KRSA 2DNUA 2LZ6B 2ROLA 1X2KA 2JTEA 2L3QA 2B86A 2K79A 1KFZA 2ESWA 1NYFA 1BK2A 1ZUUA 1QWFA 4J9GA 2DL7A 2RNAA 2YUPA 1M30A 1RLQC 2W0ZA 4HVUA 4OMPA 2GQIA 1T3LA 3PE0A 3REBB 1H3HA 2KBTA 1AD5A 1X69A 2LJ0A 1U3OA 4LE9A 5I11A 2BZXA 2DL4A 3PVLA 2OI3A 2YUNA 1GL5A 2L0AA 1AWXA 1K1ZA 4K11A 4RUGA 1WXUA 1S1NA 4CC4B 1PKTA 1SRMA 3VRYA 1M8MA 1WDXA 2DMOA 4RTTA 4LNPA 4M4ZA 1OEBA 5I22A 4LUDA 1UTIA 2J7IA 4RTYA 4Z88A 3ULRB 3GBQA 4F16A 3NHNA 2K6DA 1VYTA 2ED0A 1BBZA 1UE9A 2CT3A 1YWOA 5FWBA 1U5SA 1ZBJA 3EG1A 1X6BA 2D8JA 3M0SA 2K2MA 1UHCA 3A98A 2AKKA 2EYXA 1UJYA 1H8KA 1BB9A 4IIMA 3VS3A 1ZX6A 1YN8A 2L3SA 2CH4A 1V1CA 2K7AA 2KGTA 1SPKA 2LJ1A 2LX7A 3H41A 1OPKA 1GFDA 4OMMA 2H8HA 1WFWA 4LN2A 1MV0B 1ZUYA 1G2BA 1PRMC 1Z9ZA 1QCFA 1B07A 2RQWA 2EGEA 2YUQA 1BU1A 3JV3A 3REAB 3C0CA 2P4RA 2ED1A 4GBQA 1NEBA 1RUWA 4OMOA 3SEMA 2JS0A 1KIKA 1PRLC 4J9DA 1SSHA 5IHIA 2DM1A 2HSPA 1JXMA 4J9EA 2OJ2A 4AFSC 2BTTA 2FPEA 2CH4W 3UA6A 1TUDA 2DL3A 3UATA 2DF6A 2J6OA 3M0TA 2AZSA 4RTVA 4CC7A 2KE9A 3SHWA 1Z9QA 3RBBB 2CSIA 3QWYA 4JJBA 2JMAA 1VYVA 4ZNXA 1M27C 3VS4A 2J05A 2VVKA 1UG1A 1M3AA 1QLYA 1HD3A 1VYUA 1W70A 1WA7A 1KSWA 2NUZA 2HEQA 5L23A 3PVQA 1RI9A 5HCKA 4JJCA 1JO8A 2CUBA 2K3BA 2AK5A 2D1XA 2EYZA 4A63B 5FW9A 5EC7A 3QWXX 4J9BA 4F17A 2CT4A 2MIOA 2KROA 2ROTA 3VS2A 2EPDA 4LUEA 5IXFA 2DE0X 2DBMA 1E7OA
chains in the Genus database with same CATH superfamily
1MUZA 2P0KA 4JDSA 2EGAA 1J3TA 2G6FX 5GMKl 2VXFA 4JZ4A 3PIPA 4CC3A 1MGQA 3QDRB 4QVDA 4MZMA 1VQLA 2JNGA 2RHUA 5J3BA 4JUVA 1B7TA 1B3QA 2EYYA 4Z89A 4PNOA 3OYBA 2DX1A 2KR3A 2COYA 3PNWC 5M9OA 3AT1B 2YXYA 2O9VA 2FO0A 3EAEA 3CCRT 4PLLA 4CRIA 4OMFB 1N5ZA 2M02A 2D6FA 5LJ5j 4AFQC 1I0CA 3OB9A 1GCQC 2J6KA 3QBYA 5D6WA 2C0OA 4ZGJB 3FRNA 2LDMA 4BE1A 4ZTFA 3QO3A 2RMOA 4Y91A 1SEMA 2AIRB 1K76A 2CP7A 3TSZA 4A4HA 5LJ5d 3CCSA 5FRNA 1KD1R 1SRLA 1QVGP 2K2VA 1M90U 1AZEA 3LLRA 3FEOA 4FT4A 1WLPB 4ZGEB 1K0XA 3M0RA 4J9IA 5FRMA 1OPLA 1UEBA 3VS7A 3CCMQ 5HK0A 1K8AC 4J7IA 2K9GA 1OU8A 4FYWB 3S3NA 2HKNA 1YCSB 4M7DG 3NGPA 1ZSZC 4YTLA 1PSEA 3EFRA 1OV3A 2LX9A 3Q1JA 6AT1B 4GY5A 1K9MU 1H92A 4EMKA 4E6RA 2HL3A 4M75F 2RK2A 2JW4A 2FRYA 2DL5A 4M7DD 2YUOA 2IPOB 3OYEA 1YJNQ 1GRIA 4LDYA 3OYCA 1N6AA 1WXBA 3TU4K 1VQ9Q 3C4SA 3I35A 3OS5A 1M3CA 3BE3A 2DRMA 2RQVA 2KAFA 2HKQB 3BDUA 3MO8A 1E6GA 2YLBA 3A8HB 3ZEHA 3RUXA 2QYZA 4PJOB 2HQEA 4FT2A 3NTIA 1TUGB 4M77G 3U23A 1Q81C 3PIOA 3C12A 3CMET 4BY6C 2PVDB 2OTLQ 2WACA 3NPFA 1FMWA 3VS1A 1D09B 2V8KA 3O5ZA 3TSWA 2A36A 4M77D 1H641 2OAWA 4AG1C 4FU6A 2EWNA 3CXCS 1YI2T 5GAOm 1G3WA 1JEGA 4L59A 2JM8A 3CC2A 2HQXA 1KHCA 2RJFA 1Q7YR 4HCKA 2FVUA 2F5KA 2WSFE 3MEVA 1Y07A 2CDTA 1D3BB 1JJ2P 4V2SA 1PKSA 2FL7A 2Z0WA 2F5TX 2JMCA 4M75A 4HXJA 1IXDA 3V7RA 4II1A 1VQ8T 2NWMA 2DXTA 2DRKA 1XJWB 3HFOA 1KC8R 3OY9A 1JXOA 1KD1C 2J06A 1AHJB 5CKEA 4NS5A 1YITA 3G6EA 1W1FA 2XMFA 3OS2A 4Z8AA 2E70A 2HL5C 3G71T 4M75C 4BI3A 2FZCB 4DQ2A 5GMKj 4N4GA 1F1BB 2CZ1B 4E7SA 3OYHA 4KRTA 2O2OA 3HP9A 5CCAA 1PWTA 3G7ZA 2KYBA 4RMOA 2DXBA 4PJMA 1QW1A 2FEIA 1AT1B 3KUFA 1FYNA 1U06A 1Q82U 2LCLA 1VQ5Q 5GANj 3LH5A 3OYGA 3H0FA 4J5YA 4AMCA 4QT7A 1YITQ 3I55T 4M7AF 1G3TA 4FW2A 4DBHA 3HSBA 1QCOA 3CCUT 5GANd 2RK1A 4AFZC 4DBQA 3P8DA 5IH2A 2VV5A 4DEXA 1PCXA 2KI7A 2CREA 2LP5A 2LTOA 2DTHA 3EHRA 4BDYA 1UGPB 3HHTB 4F7UE 2A0FB 1YCYA 2ENMA 1YP5A 4E7KA 2E3IA 1ABOA 2RM4A 2EQJA 1CKAA 4EMKB 3OA6A 5GAMf 2ROLA 2VB6A 1X2KA 3CCJT 2B86A 1PM3A 4HCZA 2ESWA 3G4SQ 1NYFA 1ZUUA 2CZ7B 4J9GA 3RDVA 1KQSP 2DL7A 5GMKh 1OX8A 1RLQC 3I56A 3FIFA 3BDLA 1LNXA 1T3LA 2FYKA 1WHMA 3JB9H 3P8HA 2DEQA 1X69A 2LJ0A 1S72A 4LXCA 1MNDA 1YIJT 2DL4A 3JCMX 4M7AE 2YUNA 1GL5A 1Q7YC 2IG0A 3V8JA 4RUGA 3V7CA 3CC7A 1QQJA 1R77A 4PFPA 3R6OA 4BE2A 2DMOA 1VQ4T 4LNPA 3VKIA 1OEBA 2VGNA 1K73C 5KYNA 4M7AA 4RTYA 3ULRB 5HK3A 3I56Q 3NHNA 2K6DA 1VYTA 2EJ9A 1KC8C 4DOWA 1YWOA 3EG1A 2K2MA 2X4YA 2E6NA 2ZPBB 4HCCA 2E10A 5CQXA 3MCAB 3VS3A 1ZX6A 3FB9A 4C92C 3CD6Q 3PMTA 2CH4A 2ZPHB 2R57A 3L2WA 2OAUA 1SPKA 4M7AC 2HBPA 3V8KA 5CO7A 4M75B 4C5HA 3INZA 4OMMA 1WFWA 1MV0B 2M16A 1G2BA 1IB8A 1B07A 3EH2A 4MZPA 4C0GA 4C5GA 1BU1A 3REAB 3A5ZB 4GBQA 1NEBA 4EPCA 5GAOq 3RKXA 1SSHA 2DM1A 4J9EA 2OJ2A 4AFSC 4ELYC 2RHYA 2EJFA 3E9GA 5GAMe 1VQMT 2DF6A 3M0TA 4A4EA 4JRPA 3OSSC 3H6ZA 1W2BP 3RBBB 3OW2S 4FYVB 5LL6S 3L42A 4FYYB 3FJPA 1VYVA 3NTHA 1QVFP 4ZNXA 1M27C 2PVOB 3VS4A 2QDYB 4Z02A 1PC0A 2XDBA 1BI3A 1QLYA 1KSWA 2DEUA 3PFSA 4N4IA 1VQPQ 5LJ3g 2MK5A 3JRZA 1HK9A 1VQ7A 1M1KC 3GNGA 1BI2A 1VQKT 3F70A 2X4WA 5FW9A 2QASA 3QWXX 3T9NA 1LOJA 1YJ9T 2FZGB 2ROTA 3CCVT 3VS2A 2L8DA 2DBMA 3ZL7C 4BB7A 2LC4A 1I1JA 2EYQA 2VYTA 1Y71A 3MKDA 3I9QA 2QG9B 2RQTA 5C0MA 2JVVA 4FIBA 2HCKA 2E64A 2DBKA 2V8JA 4FSXA 4JS4A 2KXCA 4KT0E 1TUCA 4VUBA 3SDZA 1FXXA 1VQ7Q 2L3PA 5GAN6 3X20B 5IT9E 2K3XA 3WVDB 1N8RR 3MEWA 4R0KA 4HCBA 1G5VA 4PK4A 2LJ3A 4Y28E 5IN1A 4F7UB 4QW2A 3FJ5A 2LQNA 1YWPA 2J6FA 2A28A 2DILA 4J7FA 5A0GA 4RKUE 3JCMc 3SFMA 2WSCE 3CC4A 2CUDA 2LT4A 3E2UA 4ELZC 2KRNA 4XU2A 2EW3A 1N9RA 2VKNA 2FPFA 1VQNT 2JXBA 4D6WA 2EVRA 1IHWA 2QEXQ 1YHQT 3LWIA 2FG0A 4M7AB 2DXCA 3PT9A 2EKOA 1PHTA 1VQ6T 1LCKA 1WQ7A 1Q86U 4IURA 3V8LA 4OB2B 2DTOA 3LWHA 5HY6A 3CCQQ 1G3YA 2RD1A 2H3JA 4PFZA 4XTYA 2GGRA 4IUVA 1I8FA 4EMGA 3OYAA 4F04B 3MP8A 3CCLT 3JB9J 2BIVA 4D8DA 1HXDA 5DLQE 2Y4YA 1QVGS 3CCRA 2HDAA 3V7SA 2RQUA 2KVQG 2P0PA 1Q82R 2CKKA 2GTJA 4HA8A 4KGZB 1H3ZA 1T3SA 2RN8A 3X25B 1ZLMA 4O6JA 4ZN1A 3TEEA 2I2LA 1BKBA 1NJIC 3EG3A 2FPDA 2DIQA 5J26A 1K9AA 1WJQA 1PD1A 3JCMQ 3M0UA 1GCQA 1OULA 2OTJQ 2KEAA 2LNVA 1FWZA 1YBYA 1XOVA 2X35A 4XU0A 3JCMb 3JB9I 3VS6A 2PNIA 1HSQA 2HMAA 1N8RC 2EAYA 1W4SA 2MOXA 4MMLA 3HPWA 2X51A 2DD4A 1A0NB 1HYOA 1WHJA 4J83A 3CCET 4E47A 2DZ9A 1UDLA 2MAMA 1VQLQ 4E7ZA 3DKMA 1ZSZA 2CS7A 1BI0A 4RTZA 4ESRA 2LMJA 2SRCA 2M1HA 2BE9B 2DYIA 1TH7A 2DVJA 1W6XA 2F2VA 2DJZA 3S6WA 3EFSA 2XK0A 2YRCA 2JUFA 2BE7D 1WQWA 4WCIA 4LDWA 3GLXA 4C8QF 2CP0A 4E2FB 3G1JA 1DJ7B 2SEMA 1TSFA 3EG2A 3CMEA 2GFAA 4CI0C 4E7JA 1YJWA 3CCSQ 5KYWA 1JJ2S 3OYIA 2JN0A 3H0HA 3QKJA 1PD0A 5LJ3j 1NE8A 4X1VA 1ZA2B 3NFCA 1UFFA 3H0IA 5DY9A 1ZHIA 1YI2A 3CCMT 4OMNA 1X27A 2QA4A 1TOVA 4PLIA 3VUBA 5LJ5h 1T0HA 3L2VA 5DLOA 1YNZA 5LJ3d 4MMKA 2XU8A 2R5AA 1M3BA 4JZ3A 2DYBA 3DB3A 5FU6B 2E1HA 2H3EB 2LRQA 1MV3A 1PNJA 3CMEQ 1QWEA 1K0SA 2M0YA 2DKGA 2ZPIB 4PJOG 1YJWQ 1I4K1 2A37A 4FCYA 1VQ8A 3RESA 4HT9A 1D0YA 3OBWA 1YJNT 4QKUA 2KRSA 2DNUA 2LZ6B 2CP2A 3M4YA 2JTEA 5GAN8 4BDZA 1VQ9T 4PJOD 2HQHA 1QWFA 2RNAA 2K4YA 3MP6A 2DERA 2QA4Q 4IUUA 2W0ZA 3LX7A 2DVEA 4M75E 1PSFA 3PE0A 1U1SA 2DAQA 3REBB 3CPFA 1H3HA 2XHCA 1AD5A 4C8QA 1MMGA 2OI3A 2RI5A 1ZA1B 5CQYA 1M4ZA 4ZN3A 1K1ZA 1S1NA 1PKTA 2OTLT 2K57A 5KYYA 2GF7A 1E7OA 4LUDA 4PJNA 4MDXA 2JTFA 3GBQA 4XAXB 3LGFA 4C8QC 4F16A 3I55A 2PQWA 2CT3A 1ACMB 1U5SA 5CKFA 4XK8E 1X6BA 2L5QA 2LQ8A 1K8AU 3M0SA 3CCUA 3CC2Q 1UHCA 2VASA 3EH1A 2HZYA 3RMQA 1BB9A 3BFMA 3JCMf 1KQSS 4R55A 2F69A 1V1CA 2LCCA 4LDUA 2K7AA 2YRVA 4J8OA 1IRXA 3GNFB 2CZ6B 3H41A 1GFDA 3M57A 3OYMA 2NUTA 1ZUYA 1Z9ZA 3J7AF 1QCFA 2EGEA 2PVGB 3CCJA 2JTMA 3JV3A 3C0CA 2P4RA 4E7LA 4C92F 1ZSZB 2FHDA 1RUWA 4PKCC 2E3HA 3SEMA 3CCUQ 4J9DA 5IHIA 1OZ2A 2HSPA 2RJEA 3G6EQ 1I5LA 3UA6A 1JB0E 2QAZA 4BI8B 4OB0B 3A8LB 3SWNC 3UATA 2J6OA 2EQMA 3GPLA 4CC7A 1LJOA 1M2OA 3SHWA 2A7YA 3UDCA 1D1CA 4E7IA 3UPUA 2ZZDA 1TWBA 1OYXA 2VVKA 3M9QA 1UG1A 1M3AA 3CCJQ 1EZZB 1VQ4A 1VQ5T 1HD3A 1MMDA 1RL2A 2NUZA 1WZOA 4LDVA 3L2RA 5J39A 4PFOA 2CGHA 5KYWB 3MJXA 1YITT 2AK5A 1NBEB 2QXFA 1Q86R 3CXCA 4A63B 3MPUB 3QYGB 4M78F 4BY6B 4L6V5 4IUQA 5IXFA 4OMPA 4C92E 5GAN3 2HAXA 3PGGA 4RTXA 4BUGA 2XDPA 2HNIA 2EYWA 3JCMW 4Y92A 2ZPFB 2D8HA 4IUTA 5GMKi 4IUPA 4C5IA 3DB4A 3EGDA 2DTIA 3OYLA 5GANh 3HRSA 3JCMe 1W2BS 2O88A 4LDXA 2YSQA 1OU9A 2LT1A 4C92A 3NTKA 3OBYA 5GAMg 3G4ST 3VJPA 5IAYA 3CPWS 1P92A 4PL6A 3ZBDA 1QVFS 2RJDA 1X2QA 2V8IA 2JOYA 2L89A 4KUIA 3BY7A 4KBMB 5KCHA 4OB1B 4F14A 1VQMA 5FWCA 3OSVA 2FB7A 1S72Q 3TVTA 2XDDA 1AWWA 1WX6A 2QTVA 4ZTJA 4C8QB 1QMCA 4PJLA 1AVZC 1VUBA 4M78E 4KUDK 2YRDA 2IIMA 3CC7Q 3VS0A 1GBQA 1TXQA 3JCMJ 3JB9G 4OB3B 4KGVB 3QZ5B 1ABQA 2C0TA 2W10A 4OP0A 5KYYB 4AFUC 5GMKm 5A2QE 2GTOA 2VUBA 4IIOA 2RF0A 2DXUA 1YFNA 4M78A 2COWA 1QP2A 1VQKA 3JB9D 4X9CA 3CBPA 3NMZC 1YJ9A 3GF5A 4DOVA 2NUPA 4O5VA 1SF9A 2NLUA 3WXMB 3CCVA 1B34A 1WPYA 1SSFA 2DLPA 3CD6T 3HTRA 1SKUB 2LQKA 2Y90A 1QKWA 2RJCA 1T0JA 4AT1B 2XKOC 1M90R 3PMIA 4OVAA 1NG2A 1NZ9A 5GAOl 4M78C 3I5RA 1EFNA 1SHFA 2YWWA 2X9HA 5IXBA 5IHKA 1GCPA 2NUTB 3VYGA 1YJ9Q 1C1AA 1KJWA 1WHGA 4M7DF 1GBRA 5CAIA 4OGEA 4MDWA 5KYXA 4ME7A 2BZ8A 3L2QA 1Y7XA 2DZCA 2M51A 2MCNA 4C0DC 2CSQA 1I07A 5KH6A 1K9MR 3X26B 4C5EA 4CC2A 1D1AA 3QHSA 4RTWA 4XTZA 5GAOr 1BIAA 3I5SA 1Q7YU 2PUKB 1KK7A 2RI3A 2KK4A 3CQTA 3KFVA 2V1QA 1Y96A 4N0AC 5LJ5e 3A8OB 2JZ2A 4D8KA 1K73U 3BW1A 4XQ3A 3OYJA 2CP6A 1VQPT 2VXEA 5KCOA 5GAN4 2DETA 2MWPA 2Y4XA 1XTDA 2RQRA 3CMAT 3QJYA 2JT4A 4M77F 3M5AA 5CR2A 1QKXA 1IO6A 3OMGA 4KH0B 2DPPB 4F7UG 1NLPC 1IHVA 1RI0A 2XI9A 2VGMA 1UB4A 1RADB 1VOMA 4J9CA 4HVVA 2GNCA 3DLMA 1ARKA 4RCBA 1VQ7T 1G83A 3EGDB 1N9SA 2DL8A 1EIFA 4M7DA 2DA9A 3CCLA 4C92B 1R8OB 5IHNA 4FM4B 2YT6A 3RERA 2KSSA 3OYYA 2V1RA 5I2SA 3OYDA 5I2MA 4M7AG 2RHXA 5ECAA 4IKFA 4OF1A 4FSSA 3OW2A 1NEGA 1NYGA 1TTHB 4L5GA 1WHLA 8AT1B 1UUEA 2RB6A 2F2XA 1N27A 2EKHA 2COZA 3JCMP 1IGUA 3CC4Q 4AG2C 3MP1A 4M7AD 2DD5A 1AZGB 3OYKA 4M7DC 1TG0A 2E6ZA 1ZUKA 2KT8A 2KY9A 1WIEA 5GANf 1M90C 5C6SA 2KNBB 2YDLA 4DBFA 2QEXT 3VS5A 3JSCA 3ASKA 3OQ5A 2E65A 3TREA 1SHGA 1M1KU 1WJSA 4M77A 2M0OA 4A4FA 3SD4A 1X43A 1KHIA 2KMTA 1FX7A 4M78B 1RAEB 2P84A 1AOJA 2O31A 2NUPB 2D9TA 1VQOT 5KE2A 1B34B 1X75C 4PJJA 2A08A 1K9MC 2O9SA 2RPNA 3CCEA 3CCQT 1WI7A 1VIFA 4C0DB 4M77C 1PG5B 1ZQ1A 1WHHA 5GAMj 2K5FA 2K79A 2DK3A 3OS1A 3E1SA 1R0CB 2YUPA 1M30A 1BCOA 4HVUA 1TU0B 5GAMd 2KBTA 3RKWA 1BCMA 2RO0A 3CCRQ 1U3OA 4LE9A 5KYXB 3PVLA 3CCEQ 1WXUA 1SRMA 3VRYA 5GMKe 4E7HA 3VYHB 1M8MA 4J6XA 3J81E 5KYUA 4M4ZA 5I22A 2D0QB 1UTIA 1Y96B 2BKDN 2J7IA 1LPLA 4DA4A 2OTJT 8ATCB 2DFUA 4JJNK 4B6MA 3E19A 3CCMA 2ED0A 4A53A 1M2VA 2D8JA 5GANe 1UGSB 3A98A 2AKKA 3D7SB 4UC4A 1UJYA 1H8KA 1I5OB 1V76A 2MMPA 4JLGA 1YN8A 2L3SA 4KGXB 3RMSA 2ZCFB 4XU1A 2V26A 3VV0A 2RHZA 1MMAA 3META 5GAMh 2LJ1A 2LX7A 4ANJA 1VQLT 1OPKA 1GXIE 2JJ9A 1YJNA 4N4HA 2RQWA 2YUQA 1RAAB 3LW5E 2K5IA 3C95A 5CKBA 3GOXA 1VQ9A 2ED1A 2L3RA 5GAOn 3VUZA 5A0LA 5L8RE 3WVEB 2JS0A 4RG8A 3LGLA 3KBGA 1R0BG 4J6YA 1QVGA 2FPEA 4M7DB 2CH4W 3RKYA 2DL3A 2AZSA 4RTVA 3A8GB 3JB9F 2XG8D 1KQ2A 1D1BA 2CSIA 1RAIB 2NYSA 4LD6A 2RA2A 2XICA 3VU3C 2OTLA 1WHKA 5GAN5 3CCST 1NJIU 1Q82C 1VYUA 1W70A 1WA7A 2ZPEB 1D0XA 2GFUA 4C8QE 4JJCA 1XNIA 2CP3A 2A3LA 4QQ6A 3OYNA 2D1XA 2MYSA 2EYZA 1YI2Q 5EC7A 7AT1B 4EMKC 2CT4A 2KROA 1OQKA 5D6XA 1N8RU 2EPDA 4M77B 2DE0X 5FU7C 3G71A 4NOYA 1UGRB 2QGGA 1JQQA 4FL6A 3EG0A 3KXTA 4NL3A 2ZPGB 1YJWT 4KULA 1WJRA 2X3WD 1VQ8Q 2KT1A 1M1FA 2VWFA 4JPBW 3MEAA 2EQIA 2K5LA 2E5KA 1JBMA 4FYXB 5LJ3h 1UGVA 4BE0A 2QQSA 2QDLA 1IGQA 2OX7A 2PUOB 3M4GA 3HRTA 4QQDA 3GP8A 1QCNA 2QA4T 1OOTA 4MZTA 4RCCA 3TCJA 2E4HA 1Y0MA 2QQ9A 4GLMA 2O4XA 5D7UA 3M54A 3G71Q 2EBPA 3C94A 5GAN7 4LD9K 4J6WA 2MI6A 1WXTA 1C0MA 2PZ1A 3J80E 1K73R 2C0IA 3OYFA 1C6VX 5AT1B 3QG1A 1ZBXA 5CVIA 1HJDA 5GAOp 3SWNA 4NL2A 1M1GA 2KXDA 2B8AA 4A4GA 1JJ2A 1VQ5A 1WGSA 3EGUA 4XU3A 2XD0A 1JU5C 2ECZA 4JRQA 2RI2A 1G8XA 3P8BB 3UA7A 5KYUB 1RLPC 2EGCA 1AWJA 2CP5A 4F7UF 2MPXC 2GCXA 2QQBA 5HKCA 3EG9A 3I55Q 4JJDA 4JS5A 3GIBA 3CC2T 4Q5WA 5GJWB 1JRIA 1RAGB 1WYXA 4BI4A 1M2VB 2QTXA 2F1LA 2ATCB 4OMLA 3JCMg 1UJ0A 2F2WA 1O75A 3QIIA 2EQKA 1YIJA 4HVWA 1MMNA 1K4US 1UGQB 4A4KA 3UWNA 3CXCP 2DJQA 1X6OA 3VRZA 3QYHB 1Q81U 2FRWA 2LVMA 2PTKA 3JCMV 4QVZA 5CKDA 2R5MA 3G4SA 2L2PA 1ZSGA 3M0PA 2R58A 3RR6A 2DIGA 3EFOA 1UHFA 4EIKA 3G6ET 3A1PA 2ZAEA 1NM7A 5CKHA 3RNJA 1D0ZA 3R6NA 1YIJQ 3URGA 3M0QA 3L2ZA 1Y57A 3CBOA 2EQUA 2D0NA 1CKBA 2X4XA 3EGXA 1M1KR 2JM9A 1V29B 2KDSA 2P4TA 3CEYA 1RACB 4R56A 1VQ4Q 3CBMA 5FU7B 4BD3A 4F7UA 2E41A 4XTUA 1BIBA 2YHTA 1G3SA 3L1AA 4WF2A 3EHQA 4X34A 2WSEE 2QGFB 4KH1B 1KD1U 3DLLA 4DBRA 2HD0A 3PTAA 3HFNA 2I0NA 3QUIA 1KQSA 3CD6A 2BZYA 2CYZB 2QI2A 3H9NA 5LJ5f 3ZFJA 1NLOC 1IREB 4EMHA 1M5Q1 2DO3A 1X6GA 4C8QG 3QJ6A 2G3RA 1FMVA 2JS2A 2AKLA 4OGCA 2LQWA 1U8RA 2AZVA 1UECA 2X3XD 4C8QD 4WTOB 4M75G 4C0ZA 2O01E 3M55A 5I21A 1KG1A 2KRMA 2E12A 4J9FA 4ORZA 3THKA 3I56T 1AEYA 2ZGWA 4GLKA 1NPPA 2AHJB 3LYIA 1VQMQ 1S72T 2LCSA 3UT1A 3UF4A 4B9XA 4RTUA 3FC3A 2QQAA 2O4XB 5LJ5g 4M75D 5CK9A 3SB2A 1RAHB 2KQWA 1E6HA 1AWOA 2E5QA 3CC7T 4JRIA 3S3OA 3HKSA 2FZKB 3M53A 1TS9A 2C06A 3ME9A 3SWNB 4OMQA 4ZGDB 2KYMA 2VC8A 5LJ3f 1VQPA 1X01A 3CMAA 3IQLA 1OI1A 1VQKQ 2GBQA 3ER0A 3FLGA 4N0AA 4EDUA 5GJVB 3QPHA 1M8VA 5FROA 1BI1A 2ABLA 2HBWA 2MF2A 3EG9B 3CCVQ 3O8VA 1FMKA 1QVPA 4FW1A 4DEYA 3CPWP 3TQ7P 1Q86C 2MWOA 1VA7A 4J9HA 2LNHB 2M9UA 1M9SA 3H8ZA 4XTWA 1NPRA 1WNLA 1CSKA 1GFCA 4X9DA 1W2BA 3AHUA 2EIFA 2IVWA 3LH0A 2L3QA 1Q95G 1KFZA 3CMAQ 3M59A 3CPWA 5A0DA 1QP3A 1QVFA 1BK2A 1VQNA 1LVKA 2P0QA 1MHNA 3QZ9B 1YHQA 2GQIA 3JAME 4HKEA 4C0FA 3X24B 1XQHA 3EFOB 4BACA 1KC8U 1NJIR 4QQGA 3RIRA 4PJOF 5I11A 2BZXA 5EG2A 1BYMA 2L0AA 1AWXA 1VQ6A 4B9WA 4K11A 3QSUA 4CC4B 9ATCB 4M7DE 1WDXA 1EX4A 2X4JA 4RTTA 3EGXB 2EFIA 1VQNQ 2QEXA 4Z88A 5CIUA 3L2UA 1OZ3A 4TVRA 1YHQQ 3OW2P 1SG5A 3N5BB 3HRUA 1BBZA 1UE9A 5FWBA 1IZ6A 1ZBJA 4C92G 2EYXA 5LJ3e 4RG2A 2RH2A 1VQ6Q 2QK0A 4IIMA 5DM7R 1VQOA 3OMCA 3OS0A 2KGTA 3S3MA 5FLXE 2YLCA 4C92D 4XTVA 3CCQA 4PJOE 5D6YA 3QDFA 2H8HA 4M77E 4LN2A 3JCMd 5KE3A 1PRMC 1K8AR 3MEUA 4HT8A 4OMOA 3CCLQ 4ATOA 1KIKA 1PRLC 2PU9B 1JXMA 5GAN2 3M56A 2BTTA 4A54A 1RAFB 1TUDA 4PJOA 3E9FA 1MNEA 1VQOQ 2KE9A 1Z9QA 1KQ1A 4JLIA 4M78G 1VIEA 2HSEB 3QWYA 2XIDA 1OX9A 1RABB 4QVCA 4XTXA 2AT1B 2QQRA 4JJBA 2JMAA 3M58A 3CC4T 2J05A 3MHXA 5FU6C 1I81A 4M78D 2HEQA 5L23A 5GANg 2BUDA 3PVQA 2EJGA 1RI9A 5HCKA 3X28B 4PJOC 2RHIA 1JO8A 2CUBA 2OTJA 2K3BA 1O9SA 2K3YA 3A8MB 2CZ0B 4J9BA 4F17A 3JCMh 3QXEB 1D3BA 2MIOA 4JRKA 5AYFA 4LUEA 1Q81R 4P5NA 3FDRA 3HL8A 1U1TA 2GQVA
chains in the Genus database with same CATH topology
1MUZA 1I1JA 1JQQA 2EGAA 4RTXA 1J3TA 2G6FX 3EG0A 3I9QA 2RQTA 4JZ4A 2EYWA 4Y92A 4CC3A 2D8HA 2HCKA 2X3WD 2DBKA 2KT1A 2VWFA 4JPBW 2EQIA 2E5KA 2O88A 2YSQA 1UGVA 2KXCA 1TUCA 2QDLA 2L3PA 1B3QA 2EYYA 4Z89A 1X2QA 4R0KA 1OOTA 2DX1A 2KR3A 2LJ3A 1Y0MA 4GLMA 2O9VA 4F14A 2FO0A 5FWCA 2EBPA 1N5ZA 3FJ5A 3TVTA 2LQNA 1WXTA 1AWWA 1WX6A 1YWPA 2J6FA 2PZ1A 4AFQC 2A28A 1I0CA 2DILA 1GCQC 2J6KA 2C0IA 1AVZC 2C0OA 2CUDA 2IIMA 3VS0A 1HJDA 1GBQA 2RMOA 1SEMA 2KRNA 1K76A 3TSZA 2KXDA 2EW3A 1SRLA 2VKNA 3EGUA 2FPFA 2JXBA 1JU5C 2ECZA 1ABQA 2C0TA 2W10A 1AZEA 4AFUC 2EVRA 1WLPB 2GTOA 1K0XA 3UA7A 1RLPC 3M0RA 2EGCA 4IIOA 1AWJA 2RF0A 4J9IA 1OPLA 3VS7A 2FG0A 4JJDA 3NMZC 5GJWB 2K9GA 1PHTA 1WYXA 1YCSB 1LCKA 2DLPA 3NGPA 1OV3A 4OMLA 1UJ0A 2F2WA 1QKWA 1T0JA 4HVWA 1H92A 4E6RA 1K4US 2DJQA 3VRZA 2JW4A 1NG2A 2DL5A 2FRYA 2FRWA 2GGRA 2YUOA 3I5RA 1EFNA 1GRIA 1SHFA 2PTKA 1WXBA 5IXBA 2L2PA 1GCPA 1ZSGA 5IHKA 3I35A 3M0PA 1M3CA 2DRMA 2RQVA 1UHFA 1KJWA 4EIKA 4D8DA 1GBRA 1NM7A 2BZ8A 1E6GA 3RNJA 2M51A 2MCNA 2CSQA 1I07A 2HDAA 2RQUA 4CC2A 3R6NA 2GTJA 4RTWA 1T3SA 2RN8A 3M0QA 3I5SA 3U23A 1Y57A 1ZLMA 2D0NA 1CKBA 3CQTA 3KFVA 3NPFA 2JM9A 2V1QA 3EG3A 2FPDA 3VS1A 1K9AA 3O5ZA 3TSWA 2A36A 4D8KA 3M0UA 1GCQA 2OAWA 4AG1C 2KEAA 2RQRA 3EHQA 1XOVA 1JEGA 2JM8A 3VS6A 2PNIA 1HSQA 2JT4A 4HCKA 1QKXA 2I0NA 2MOXA 1IO6A 2CDTA 3ZL7C 2BZYA 1PKSA 1A0NB 1NLPC 2JMCA 1NLOC 4HXJA 1X6GA 1UDLA 4J9CA 2JS2A 4HVVA 2NWMA 2GNCA 1ARKA 2DRKA 2AKLA 2LQWA 4RTZA 1G83A 1JXOA 4ESRA 2LMJA 2DL8A 2SRCA 2AZVA 1UECA 2J06A 2X3XD 2DA9A 2DVJA 5IHNA 2KRMA 4J9FA 4ORZA 3THKA 1W1FA 2XMFA 1W6XA 2YT6A 4Z8AA 2F2VA 1AEYA 2V1RA 2LCSA 3UF4A 4WCIA 4RTUA 5ECAA 4FSSA 4KRTA 2O2OA 1NEGA 1NYGA 1PWTA 2SEMA 1UUEA 2KYBA 1E6HA 1AWOA 2F2XA 2EKHA 3EG2A 4AG2C 2FEIA 1AZGB 1TG0A 1ZUKA 2KT8A 1FYNA 1WIEA 1U06A 2KNBB 2YDLA 4OMQA 2KYMA 3H0HA 3LH5A 3H0FA 4X1VA 3VS5A 4QT7A 1UFFA 3H0IA 1SHGA 3IQLA 4OMNA 1X27A 2GBQA 1X43A 5GJVB 4AFZC 2ABLA 1T0HA 2HBWA 1AOJA 1YNZA 5IH2A 2O31A 1M3BA 1FMKA 4JZ3A 2DYBA 4DEXA 4DEYA 1MV3A 1PNJA 1QWEA 2CREA 2LP5A 1VA7A 2A08A 2M0YA 1K0SA 3EHRA 2O9SA 4J9HA 2LNHB 2RPNA 2ENMA 1WI7A 2A37A 1YP5A 1ABOA 1CSKA 1GFCA 1CKAA 2KRSA 2DNUA 2LZ6B 2ROLA 1X2KA 2JTEA 2L3QA 2B86A 2K79A 1KFZA 2ESWA 1NYFA 1BK2A 1ZUUA 1QWFA 4J9GA 2DL7A 2RNAA 2YUPA 1M30A 1RLQC 2W0ZA 4HVUA 4OMPA 2GQIA 1T3LA 3PE0A 3REBB 1H3HA 2KBTA 1AD5A 1X69A 2LJ0A 1U3OA 4LE9A 5I11A 2BZXA 2DL4A 3PVLA 2OI3A 2YUNA 1GL5A 2L0AA 1AWXA 1K1ZA 4K11A 4RUGA 1WXUA 1S1NA 4CC4B 1PKTA 1SRMA 3VRYA 1M8MA 1WDXA 2DMOA 4RTTA 4LNPA 4M4ZA 1OEBA 5I22A 4LUDA 1UTIA 2J7IA 4RTYA 4Z88A 3ULRB 3GBQA 4F16A 3NHNA 2K6DA 1VYTA 2ED0A 1BBZA 1UE9A 2CT3A 1YWOA 5FWBA 1U5SA 1ZBJA 3EG1A 1X6BA 2D8JA 3M0SA 2K2MA 1UHCA 3A98A 2AKKA 2EYXA 1UJYA 1H8KA 1BB9A 4IIMA 3VS3A 1ZX6A 1YN8A 2L3SA 2CH4A 1V1CA 2K7AA 2KGTA 1SPKA 2LJ1A 2LX7A 3H41A 1OPKA 1GFDA 4OMMA 2H8HA 1WFWA 4LN2A 1MV0B 1ZUYA 1G2BA 1PRMC 1Z9ZA 1QCFA 1B07A 2RQWA 2EGEA 2YUQA 1BU1A 3JV3A 3REAB 3C0CA 2P4RA 2ED1A 4GBQA 1NEBA 1RUWA 4OMOA 3SEMA 2JS0A 1KIKA 1PRLC 4J9DA 1SSHA 5IHIA 2DM1A 2HSPA 1JXMA 4J9EA 2OJ2A 4AFSC 2BTTA 2FPEA 2CH4W 3UA6A 1TUDA 2DL3A 3UATA 2DF6A 2J6OA 3M0TA 2AZSA 4RTVA 4CC7A 2KE9A 3SHWA 1Z9QA 3RBBB 2CSIA 3QWYA 4JJBA 2JMAA 1VYVA 4ZNXA 1M27C 3VS4A 2J05A 2VVKA 1UG1A 1M3AA 1QLYA 1HD3A 1VYUA 1W70A 1WA7A 1KSWA 2NUZA 2HEQA 5L23A 3PVQA 1RI9A 5HCKA 4JJCA 1JO8A 2CUBA 2K3BA 2AK5A 2D1XA 2EYZA 4A63B 5FW9A 5EC7A 3QWXX 4J9BA 4F17A 2CT4A 2MIOA 2KROA 2ROTA 3VS2A 2EPDA 4LUEA 5IXFA 2DE0X 2DBMA 1E7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MUZ A;  1I1J A;  1JQQ A;  2EGA A;  4RTX A;  1J3T A;  2G6F X;  3EG0 A;  3I9Q A;  2RQT A;  4JZ4 A;  2EYW A;  4Y92 A;  4CC3 A;  2D8H A;  2HCK A;  2X3W D;  2DBK A;  2KT1 A;  2VWF A;  4JPB W;  2EQI A;  2E5K A;  2O88 A;  2YSQ A;  1UGV A;  2KXC A;  1TUC A;  2QDL A;  2L3P A;  1B3Q A;  2EYY A;  4Z89 A;  1X2Q A;  4R0K A;  1OOT A;  2DX1 A;  2KR3 A;  2LJ3 A;  1Y0M A;  4GLM A;  2O9V A;  4F14 A;  2FO0 A;  5FWC A;  2EBP A;  1N5Z A;  3FJ5 A;  3TVT A;  2LQN A;  1WXT A;  1AWW A;  1WX6 A;  1YWP A;  2J6F A;  2PZ1 A;  4AFQ C;  2A28 A;  1I0C A;  2DIL A;  1GCQ C;  2J6K A;  2C0I A;  1AVZ C;  2C0O A;  2CUD A;  2IIM A;  3VS0 A;  1HJD A;  1GBQ A;  2RMO A;  1SEM A;  2KRN A;  1K76 A;  3TSZ A;  2KXD A;  2EW3 A;  1SRL A;  2VKN A;  3EGU A;  2FPF A;  2JXB A;  1JU5 C;  2ECZ A;  1ABQ A;  2C0T A;  2W10 A;  1AZE A;  4AFU C;  2EVR A;  1WLP B;  2GTO A;  1K0X A;  3UA7 A;  1RLP C;  3M0R A;  2EGC A;  4IIO A;  1AWJ A;  2RF0 A;  4J9I A;  1OPL A;  3VS7 A;  2FG0 A;  4JJD A;  3NMZ C;  5GJW B;  2K9G A;  1PHT A;  1WYX A;  1YCS B;  1LCK A;  2DLP A;  3NGP A;  1OV3 A;  4OML A;  1UJ0 A;  2F2W A;  1QKW A;  1T0J A;  4HVW A;  1H92 A;  4E6R A;  1K4U S;  2DJQ A;  3VRZ A;  2JW4 A;  1NG2 A;  2DL5 A;  2FRY A;  2FRW A;  2GGR A;  2YUO A;  3I5R A;  1EFN A;  1GRI A;  1SHF A;  2PTK A;  1WXB A;  5IXB A;  2L2P A;  1GCP A;  1ZSG A;  5IHK A;  3I35 A;  3M0P A;  1M3C A;  2DRM A;  2RQV A;  1UHF A;  1KJW A;  4EIK A;  4D8D A;  1GBR A;  1NM7 A;  2BZ8 A;  1E6G A;  3RNJ A;  2M51 A;  2MCN A;  2CSQ A;  1I07 A;  2HDA A;  2RQU A;  4CC2 A;  3R6N A;  2GTJ A;  4RTW A;  1T3S A;  2RN8 A;  3M0Q A;  3I5S A;  3U23 A;  1Y57 A;  1ZLM A;  2D0N A;  1CKB A;  3CQT A;  3KFV A;  3NPF A;  2JM9 A;  2V1Q A;  3EG3 A;  2FPD A;  3VS1 A;  1K9A A;  3O5Z A;  3TSW A;  2A36 A;  4D8K A;  3M0U A;  1GCQ A;  2OAW A;  4AG1 C;  2KEA A;  2RQR A;  3EHQ A;  1XOV A;  1JEG A;  2JM8 A;  3VS6 A;  2PNI A;  1HSQ A;  2JT4 A;  4HCK A;  1QKX A;  2I0N A;  2MOX A;  1IO6 A;  2CDT A;  3ZL7 C;  2BZY A;  1PKS A;  1A0N B;  1NLP C;  2JMC A;  1NLO C;  4HXJ A;  1X6G A;  1UDL A;  4J9C A;  2JS2 A;  4HVV A;  2NWM A;  2GNC A;  1ARK A;  2DRK A;  2AKL A;  2LQW A;  4RTZ A;  1G83 A;  1JXO A;  4ESR A;  2LMJ A;  2DL8 A;  2SRC A;  2AZV A;  1UEC A;  2J06 A;  2X3X D;  2DA9 A;  2DVJ A;  5IHN A;  2KRM A;  4J9F A;  4ORZ A;  3THK A;  1W1F A;  2XMF A;  1W6X A;  2YT6 A;  4Z8A A;  2F2V A;  1AEY A;  2V1R A;  2LCS A;  3UF4 A;  4WCI A;  4RTU A;  5ECA A;  4FSS A;  4KRT A;  2O2O A;  1NEG A;  1NYG A;  1PWT A;  2SEM A;  1UUE A;  2KYB A;  1E6H A;  1AWO A;  2F2X A;  2EKH A;  3EG2 A;  4AG2 C;  2FEI A;  1AZG B;  1TG0 A;  1ZUK A;  2KT8 A;  1FYN A;  1WIE A;  1U06 A;  2KNB B;  2YDL A;  4OMQ A;  2KYM A;  3H0H A;  3LH5 A;  3H0F A;  4X1V A;  3VS5 A;  4QT7 A;  1UFF A;  3H0I A;  1SHG A;  3IQL A;  4OMN A;  1X27 A;  2GBQ A;  1X43 A;  5GJV B;  4AFZ C;  2ABL A;  1T0H A;  2HBW A;  1AOJ A;  1YNZ A;  5IH2 A;  2O31 A;  1M3B A;  1FMK A;  4JZ3 A;  2DYB A;  4DEX A;  4DEY A;  1MV3 A;  1PNJ A;  1QWE A;  2CRE A;  2LP5 A;  1VA7 A;  2A08 A;  2M0Y A;  1K0S A;  3EHR A;  2O9S A;  4J9H A;  2LNH B;  2RPN A;  2ENM A;  1WI7 A;  2A37 A;  1YP5 A;  1ABO A;  1CSK A;  1GFC A;  1CKA A;  2KRS A;  2DNU A;  2LZ6 B;  2ROL A;  1X2K A;  2JTE A;  2L3Q A;  2B86 A;  2K79 A;  1KFZ A;  2ESW A;  1NYF A;  1BK2 A;  1ZUU A;  1QWF A;  4J9G A;  2DL7 A;  2RNA A;  2YUP A;  1M30 A;  1RLQ C;  2W0Z A;  4HVU A;  4OMP A;  2GQI A;  1T3L A;  3PE0 A;  3REB B;  1H3H A;  2KBT A;  1AD5 A;  1X69 A;  2LJ0 A;  1U3O A;  4LE9 A;  5I11 A;  2BZX A;  2DL4 A;  3PVL A;  2OI3 A;  2YUN A;  1GL5 A;  2L0A A;  1AWX A;  1K1Z A;  4K11 A;  4RUG A;  1WXU A;  1S1N A;  4CC4 B;  1PKT A;  1SRM A;  3VRY A;  1M8M A;  1WDX A;  2DMO A;  4RTT A;  4LNP A;  4M4Z A;  1OEB A;  5I22 A;  4LUD A;  1UTI A;  2J7I A;  4RTY A;  4Z88 A;  3ULR B;  3GBQ A;  4F16 A;  3NHN A;  2K6D A;  1VYT A;  2ED0 A;  1BBZ A;  1UE9 A;  2CT3 A;  1YWO A;  5FWB A;  1U5S A;  1ZBJ A;  3EG1 A;  1X6B A;  2D8J A;  3M0S A;  2K2M A;  1UHC A;  3A98 A;  2AKK A;  2EYX A;  1UJY A;  1H8K A;  1BB9 A;  4IIM A;  3VS3 A;  1ZX6 A;  1YN8 A;  2L3S A;  2CH4 A;  1V1C A;  2K7A A;  2KGT A;  1SPK A;  2LJ1 A;  2LX7 A;  3H41 A;  1OPK A;  1GFD A;  4OMM A;  2H8H A;  1WFW A;  4LN2 A;  1MV0 B;  1ZUY A;  1G2B A;  1PRM C;  1Z9Z A;  1QCF A;  1B07 A;  2RQW A;  2EGE A;  2YUQ A;  1BU1 A;  3JV3 A;  3REA B;  3C0C A;  2P4R A;  2ED1 A;  4GBQ A;  1NEB A;  1RUW A;  4OMO A;  3SEM A;  2JS0 A;  1KIK A;  1PRL C;  4J9D A;  1SSH A;  5IHI A;  2DM1 A;  2HSP A;  1JXM A;  4J9E A;  2OJ2 A;  4AFS C;  2BTT A;  2FPE A;  2CH4 W;  3UA6 A;  1TUD A;  2DL3 A;  3UAT A;  2DF6 A;  2J6O A;  3M0T A;  2AZS A;  4RTV A;  4CC7 A;  2KE9 A;  3SHW A;  1Z9Q A;  3RBB B;  2CSI A;  3QWY A;  4JJB A;  2JMA A;  1VYV A;  4ZNX A;  1M27 C;  3VS4 A;  2J05 A;  2VVK A;  1UG1 A;  1M3A A;  1QLY A;  1HD3 A;  1VYU A;  1W70 A;  1WA7 A;  1KSW A;  2NUZ A;  2HEQ A;  5L23 A;  3PVQ A;  1RI9 A;  5HCK A;  4JJC A;  1JO8 A;  2CUB A;  2K3B A;  2AK5 A;  2D1X A;  2EYZ A;  4A63 B;  5FW9 A;  5EC7 A;  3QWX X;  4J9B A;  4F17 A;  2CT4 A;  2MIO A;  2KRO A;  2ROT A;  3VS2 A;  2EPD A;  4LUE A;  5IXF A;  2DE0 X;  2DBM A;  1E7O A; 
#chains in the Genus database with same CATH topology
 1MUZ A;  2P0K A;  4JDS A;  2EGA A;  1J3T A;  2G6F X;  5GMK l;  2VXF A;  4JZ4 A;  3PIP A;  4CC3 A;  1MGQ A;  3QDR B;  4QVD A;  4MZM A;  1VQL A;  2JNG A;  2RHU A;  5J3B A;  4JUV A;  1B7T A;  1B3Q A;  2EYY A;  4Z89 A;  4PNO A;  3OYB A;  2DX1 A;  2KR3 A;  2COY A;  3PNW C;  5M9O A;  3AT1 B;  2YXY A;  2O9V A;  2FO0 A;  3EAE A;  3CCR T;  4PLL A;  4CRI A;  4OMF B;  1N5Z A;  2M02 A;  2D6F A;  5LJ5 j;  4AFQ C;  1I0C A;  3OB9 A;  1GCQ C;  2J6K A;  3QBY A;  5D6W A;  2C0O A;  4ZGJ B;  3FRN A;  2LDM A;  4BE1 A;  4ZTF A;  3QO3 A;  2RMO A;  4Y91 A;  1SEM A;  2AIR B;  1K76 A;  2CP7 A;  3TSZ A;  4A4H A;  5LJ5 d;  3CCS A;  5FRN A;  1KD1 R;  1SRL A;  1QVG P;  2K2V A;  1M90 U;  1AZE A;  3LLR A;  3FEO A;  4FT4 A;  1WLP B;  4ZGE B;  1K0X A;  3M0R A;  4J9I A;  5FRM A;  1OPL A;  1UEB A;  3VS7 A;  3CCM Q;  5HK0 A;  1K8A C;  4J7I A;  2K9G A;  1OU8 A;  4FYW B;  3S3N A;  2HKN A;  1YCS B;  4M7D G;  3NGP A;  1ZSZ C;  4YTL A;  1PSE A;  3EFR A;  1OV3 A;  2LX9 A;  3Q1J A;  6AT1 B;  4GY5 A;  1K9M U;  1H92 A;  4EMK A;  4E6R A;  2HL3 A;  4M75 F;  2RK2 A;  2JW4 A;  2FRY A;  2DL5 A;  4M7D D;  2YUO A;  2IPO B;  3OYE A;  1YJN Q;  1GRI A;  4LDY A;  3OYC A;  1N6A A;  1WXB A;  3TU4 K;  1VQ9 Q;  3C4S A;  3I35 A;  3OS5 A;  1M3C A;  3BE3 A;  2DRM A;  2RQV A;  2KAF A;  2HKQ B;  3BDU A;  3MO8 A;  1E6G A;  2YLB A;  3A8H B;  3ZEH A;  3RUX A;  2QYZ A;  4PJO B;  2HQE A;  4FT2 A;  3NTI A;  1TUG B;  4M77 G;  3U23 A;  1Q81 C;  3PIO A;  3C12 A;  3CME T;  4BY6 C;  2PVD B;  2OTL Q;  2WAC A;  3NPF A;  1FMW A;  3VS1 A;  1D09 B;  2V8K A;  3O5Z A;  3TSW A;  2A36 A;  4M77 D;  1H64 1;  2OAW A;  4AG1 C;  4FU6 A;  2EWN A;  3CXC S;  1YI2 T;  5GAO m;  1G3W A;  1JEG A;  4L59 A;  2JM8 A;  3CC2 A;  2HQX A;  1KHC A;  2RJF A;  1Q7Y R;  4HCK A;  2FVU A;  2F5K A;  2WSF E;  3MEV A;  1Y07 A;  2CDT A;  1D3B B;  1JJ2 P;  4V2S A;  1PKS A;  2FL7 A;  2Z0W A;  2F5T X;  2JMC A;  4M75 A;  4HXJ A;  1IXD A;  3V7R A;  4II1 A;  1VQ8 T;  2NWM A;  2DXT A;  2DRK A;  1XJW B;  3HFO A;  1KC8 R;  3OY9 A;  1JXO A;  1KD1 C;  2J06 A;  1AHJ B;  5CKE A;  4NS5 A;  1YIT A;  3G6E A;  1W1F A;  2XMF A;  3OS2 A;  4Z8A A;  2E70 A;  2HL5 C;  3G71 T;  4M75 C;  4BI3 A;  2FZC B;  4DQ2 A;  5GMK j;  4N4G A;  1F1B B;  2CZ1 B;  4E7S A;  3OYH A;  4KRT A;  2O2O A;  3HP9 A;  5CCA A;  1PWT A;  3G7Z A;  2KYB A;  4RMO A;  2DXB A;  4PJM A;  1QW1 A;  2FEI A;  1AT1 B;  3KUF A;  1FYN A;  1U06 A;  1Q82 U;  2LCL A;  1VQ5 Q;  5GAN j;  3LH5 A;  3OYG A;  3H0F A;  4J5Y A;  4AMC A;  4QT7 A;  1YIT Q;  3I55 T;  4M7A F;  1G3T A;  4FW2 A;  4DBH A;  3HSB A;  1QCO A;  3CCU T;  5GAN d;  2RK1 A;  4AFZ C;  4DBQ A;  3P8D A;  5IH2 A;  2VV5 A;  4DEX A;  1PCX A;  2KI7 A;  2CRE A;  2LP5 A;  2LTO A;  2DTH A;  3EHR A;  4BDY A;  1UGP B;  3HHT B;  4F7U E;  2A0F B;  1YCY A;  2ENM A;  1YP5 A;  4E7K A;  2E3I A;  1ABO A;  2RM4 A;  2EQJ A;  1CKA A;  4EMK B;  3OA6 A;  5GAM f;  2ROL A;  2VB6 A;  1X2K A;  3CCJ T;  2B86 A;  1PM3 A;  4HCZ A;  2ESW A;  3G4S Q;  1NYF A;  1ZUU A;  2CZ7 B;  4J9G A;  3RDV A;  1KQS P;  2DL7 A;  5GMK h;  1OX8 A;  1RLQ C;  3I56 A;  3FIF A;  3BDL A;  1LNX A;  1T3L A;  2FYK A;  1WHM A;  3JB9 H;  3P8H A;  2DEQ A;  1X69 A;  2LJ0 A;  1S72 A;  4LXC A;  1MND A;  1YIJ T;  2DL4 A;  3JCM X;  4M7A E;  2YUN A;  1GL5 A;  1Q7Y C;  2IG0 A;  3V8J A;  4RUG A;  3V7C A;  3CC7 A;  1QQJ A;  1R77 A;  4PFP A;  3R6O A;  4BE2 A;  2DMO A;  1VQ4 T;  4LNP A;  3VKI A;  1OEB A;  2VGN A;  1K73 C;  5KYN A;  4M7A A;  4RTY A;  3ULR B;  5HK3 A;  3I56 Q;  3NHN A;  2K6D A;  1VYT A;  2EJ9 A;  1KC8 C;  4DOW A;  1YWO A;  3EG1 A;  2K2M A;  2X4Y A;  2E6N A;  2ZPB B;  4HCC A;  2E10 A;  5CQX A;  3MCA B;  3VS3 A;  1ZX6 A;  3FB9 A;  4C92 C;  3CD6 Q;  3PMT A;  2CH4 A;  2ZPH B;  2R57 A;  3L2W A;  2OAU A;  1SPK A;  4M7A C;  2HBP A;  3V8K A;  5CO7 A;  4M75 B;  4C5H A;  3INZ A;  4OMM A;  1WFW A;  1MV0 B;  2M16 A;  1G2B A;  1IB8 A;  1B07 A;  3EH2 A;  4MZP A;  4C0G A;  4C5G A;  1BU1 A;  3REA B;  3A5Z B;  4GBQ A;  1NEB A;  4EPC A;  5GAO q;  3RKX A;  1SSH A;  2DM1 A;  4J9E A;  2OJ2 A;  4AFS C;  4ELY C;  2RHY A;  2EJF A;  3E9G A;  5GAM e;  1VQM T;  2DF6 A;  3M0T A;  4A4E A;  4JRP A;  3OSS C;  3H6Z A;  1W2B P;  3RBB B;  3OW2 S;  4FYV B;  5LL6 S;  3L42 A;  4FYY B;  3FJP A;  1VYV A;  3NTH A;  1QVF P;  4ZNX A;  1M27 C;  2PVO B;  3VS4 A;  2QDY B;  4Z02 A;  1PC0 A;  2XDB A;  1BI3 A;  1QLY A;  1KSW A;  2DEU A;  3PFS A;  4N4I A;  1VQP Q;  5LJ3 g;  2MK5 A;  3JRZ A;  1HK9 A;  1VQ7 A;  1M1K C;  3GNG A;  1BI2 A;  1VQK T;  3F70 A;  2X4W A;  5FW9 A;  2QAS A;  3QWX X;  3T9N A;  1LOJ A;  1YJ9 T;  2FZG B;  2ROT A;  3CCV T;  3VS2 A;  2L8D A;  2DBM A;  3ZL7 C;  4BB7 A;  2LC4 A;  1I1J A;  2EYQ A;  2VYT A;  1Y71 A;  3MKD A;  3I9Q A;  2QG9 B;  2RQT A;  5C0M A;  2JVV A;  4FIB A;  2HCK A;  2E64 A;  2DBK A;  2V8J A;  4FSX A;  4JS4 A;  2KXC A;  4KT0 E;  1TUC A;  4VUB A;  3SDZ A;  1FXX A;  1VQ7 Q;  2L3P A;  5GAN 6;  3X20 B;  5IT9 E;  2K3X A;  3WVD B;  1N8R R;  3MEW A;  4R0K A;  4HCB A;  1G5V A;  4PK4 A;  2LJ3 A;  4Y28 E;  5IN1 A;  4F7U B;  4QW2 A;  3FJ5 A;  2LQN A;  1YWP A;  2J6F A;  2A28 A;  2DIL A;  4J7F A;  5A0G A;  4RKU E;  3JCM c;  3SFM A;  2WSC E;  3CC4 A;  2CUD A;  2LT4 A;  3E2U A;  4ELZ C;  2KRN A;  4XU2 A;  2EW3 A;  1N9R A;  2VKN A;  2FPF A;  1VQN T;  2JXB A;  4D6W A;  2EVR A;  1IHW A;  2QEX Q;  1YHQ T;  3LWI A;  2FG0 A;  4M7A B;  2DXC A;  3PT9 A;  2EKO A;  1PHT A;  1VQ6 T;  1LCK A;  1WQ7 A;  1Q86 U;  4IUR A;  3V8L A;  4OB2 B;  2DTO A;  3LWH A;  5HY6 A;  3CCQ Q;  1G3Y A;  2RD1 A;  2H3J A;  4PFZ A;  4XTY A;  2GGR A;  4IUV A;  1I8F A;  4EMG A;  3OYA A;  4F04 B;  3MP8 A;  3CCL T;  3JB9 J;  2BIV A;  4D8D A;  1HXD A;  5DLQ E;  2Y4Y A;  1QVG S;  3CCR A;  2HDA A;  3V7S A;  2RQU A;  2KVQ G;  2P0P A;  1Q82 R;  2CKK A;  2GTJ A;  4HA8 A;  4KGZ B;  1H3Z A;  1T3S A;  2RN8 A;  3X25 B;  1ZLM A;  4O6J A;  4ZN1 A;  3TEE A;  2I2L A;  1BKB A;  1NJI C;  3EG3 A;  2FPD A;  2DIQ A;  5J26 A;  1K9A A;  1WJQ A;  1PD1 A;  3JCM Q;  3M0U A;  1GCQ A;  1OUL A;  2OTJ Q;  2KEA A;  2LNV A;  1FWZ A;  1YBY A;  1XOV A;  2X35 A;  4XU0 A;  3JCM b;  3JB9 I;  3VS6 A;  2PNI A;  1HSQ A;  2HMA A;  1N8R C;  2EAY A;  1W4S A;  2MOX A;  4MML A;  3HPW A;  2X51 A;  2DD4 A;  1A0N B;  1HYO A;  1WHJ A;  4J83 A;  3CCE T;  4E47 A;  2DZ9 A;  1UDL A;  2MAM A;  1VQL Q;  4E7Z A;  3DKM A;  1ZSZ A;  2CS7 A;  1BI0 A;  4RTZ A;  4ESR A;  2LMJ A;  2SRC A;  2M1H A;  2BE9 B;  2DYI A;  1TH7 A;  2DVJ A;  1W6X A;  2F2V A;  2DJZ A;  3S6W A;  3EFS A;  2XK0 A;  2YRC A;  2JUF A;  2BE7 D;  1WQW A;  4WCI A;  4LDW A;  3GLX A;  4C8Q F;  2CP0 A;  4E2F B;  3G1J A;  1DJ7 B;  2SEM A;  1TSF A;  3EG2 A;  3CME A;  2GFA A;  4CI0 C;  4E7J A;  1YJW A;  3CCS Q;  5KYW A;  1JJ2 S;  3OYI A;  2JN0 A;  3H0H A;  3QKJ A;  1PD0 A;  5LJ3 j;  1NE8 A;  4X1V A;  1ZA2 B;  3NFC A;  1UFF A;  3H0I A;  5DY9 A;  1ZHI A;  1YI2 A;  3CCM T;  4OMN A;  1X27 A;  2QA4 A;  1TOV A;  4PLI A;  3VUB A;  5LJ5 h;  1T0H A;  3L2V A;  5DLO A;  1YNZ A;  5LJ3 d;  4MMK A;  2XU8 A;  2R5A A;  1M3B A;  4JZ3 A;  2DYB A;  3DB3 A;  5FU6 B;  2E1H A;  2H3E B;  2LRQ A;  1MV3 A;  1PNJ A;  3CME Q;  1QWE A;  1K0S A;  2M0Y A;  2DKG A;  2ZPI B;  4PJO G;  1YJW Q;  1I4K 1;  2A37 A;  4FCY A;  1VQ8 A;  3RES A;  4HT9 A;  1D0Y A;  3OBW A;  1YJN T;  4QKU A;  2KRS A;  2DNU A;  2LZ6 B;  2CP2 A;  3M4Y A;  2JTE A;  5GAN 8;  4BDZ A;  1VQ9 T;  4PJO D;  2HQH A;  1QWF A;  2RNA A;  2K4Y A;  3MP6 A;  2DER A;  2QA4 Q;  4IUU A;  2W0Z A;  3LX7 A;  2DVE A;  4M75 E;  1PSF A;  3PE0 A;  1U1S A;  2DAQ A;  3REB B;  3CPF A;  1H3H A;  2XHC A;  1AD5 A;  4C8Q A;  1MMG A;  2OI3 A;  2RI5 A;  1ZA1 B;  5CQY A;  1M4Z A;  4ZN3 A;  1K1Z A;  1S1N A;  1PKT A;  2OTL T;  2K57 A;  5KYY A;  2GF7 A;  1E7O A;  4LUD A;  4PJN A;  4MDX A;  2JTF A;  3GBQ A;  4XAX B;  3LGF A;  4C8Q C;  4F16 A;  3I55 A;  2PQW A;  2CT3 A;  1ACM B;  1U5S A;  5CKF A;  4XK8 E;  1X6B A;  2L5Q A;  2LQ8 A;  1K8A U;  3M0S A;  3CCU A;  3CC2 Q;  1UHC A;  2VAS A;  3EH1 A;  2HZY A;  3RMQ A;  1BB9 A;  3BFM A;  3JCM f;  1KQS S;  4R55 A;  2F69 A;  1V1C A;  2LCC A;  4LDU A;  2K7A A;  2YRV A;  4J8O A;  1IRX A;  3GNF B;  2CZ6 B;  3H41 A;  1GFD A;  3M57 A;  3OYM A;  2NUT A;  1ZUY A;  1Z9Z A;  3J7A F;  1QCF A;  2EGE A;  2PVG B;  3CCJ A;  2JTM A;  3JV3 A;  3C0C A;  2P4R A;  4E7L A;  4C92 F;  1ZSZ B;  2FHD A;  1RUW A;  4PKC C;  2E3H A;  3SEM A;  3CCU Q;  4J9D A;  5IHI A;  1OZ2 A;  2HSP A;  2RJE A;  3G6E Q;  1I5L A;  3UA6 A;  1JB0 E;  2QAZ A;  4BI8 B;  4OB0 B;  3A8L B;  3SWN C;  3UAT A;  2J6O A;  2EQM A;  3GPL A;  4CC7 A;  1LJO A;  1M2O A;  3SHW A;  2A7Y A;  3UDC A;  1D1C A;  4E7I A;  3UPU A;  2ZZD A;  1TWB A;  1OYX A;  2VVK A;  3M9Q A;  1UG1 A;  1M3A A;  3CCJ Q;  1EZZ B;  1VQ4 A;  1VQ5 T;  1HD3 A;  1MMD A;  1RL2 A;  2NUZ A;  1WZO A;  4LDV A;  3L2R A;  5J39 A;  4PFO A;  2CGH A;  5KYW B;  3MJX A;  1YIT T;  2AK5 A;  1NBE B;  2QXF A;  1Q86 R;  3CXC A;  4A63 B;  3MPU B;  3QYG B;  4M78 F;  4BY6 B;  4L6V 5;  4IUQ A;  5IXF A;  4OMP A;  4C92 E;  5GAN 3;  2HAX A;  3PGG A;  4RTX A;  4BUG A;  2XDP A;  2HNI A;  2EYW A;  3JCM W;  4Y92 A;  2ZPF B;  2D8H A;  4IUT A;  5GMK i;  4IUP A;  4C5I A;  3DB4 A;  3EGD A;  2DTI A;  3OYL A;  5GAN h;  3HRS A;  3JCM e;  1W2B S;  2O88 A;  4LDX A;  2YSQ A;  1OU9 A;  2LT1 A;  4C92 A;  3NTK A;  3OBY A;  5GAM g;  3G4S T;  3VJP A;  5IAY A;  3CPW S;  1P92 A;  4PL6 A;  3ZBD A;  1QVF S;  2RJD A;  1X2Q A;  2V8I A;  2JOY A;  2L89 A;  4KUI A;  3BY7 A;  4KBM B;  5KCH A;  4OB1 B;  4F14 A;  1VQM A;  5FWC A;  3OSV A;  2FB7 A;  1S72 Q;  3TVT A;  2XDD A;  1AWW A;  1WX6 A;  2QTV A;  4ZTJ A;  4C8Q B;  1QMC A;  4PJL A;  1AVZ C;  1VUB A;  4M78 E;  4KUD K;  2YRD A;  2IIM A;  3CC7 Q;  3VS0 A;  1GBQ A;  1TXQ A;  3JCM J;  3JB9 G;  4OB3 B;  4KGV B;  3QZ5 B;  1ABQ A;  2C0T A;  2W10 A;  4OP0 A;  5KYY B;  4AFU C;  5GMK m;  5A2Q E;  2GTO A;  2VUB A;  4IIO A;  2RF0 A;  2DXU A;  1YFN A;  4M78 A;  2COW A;  1QP2 A;  1VQK A;  3JB9 D;  4X9C A;  3CBP A;  3NMZ C;  1YJ9 A;  3GF5 A;  4DOV A;  2NUP A;  4O5V A;  1SF9 A;  2NLU A;  3WXM B;  3CCV A;  1B34 A;  1WPY A;  1SSF A;  2DLP A;  3CD6 T;  3HTR A;  1SKU B;  2LQK A;  2Y90 A;  1QKW A;  2RJC A;  1T0J A;  4AT1 B;  2XKO C;  1M90 R;  3PMI A;  4OVA A;  1NG2 A;  1NZ9 A;  5GAO l;  4M78 C;  3I5R A;  1EFN A;  1SHF A;  2YWW A;  2X9H A;  5IXB A;  5IHK A;  1GCP A;  2NUT B;  3VYG A;  1YJ9 Q;  1C1A A;  1KJW A;  1WHG A;  4M7D F;  1GBR A;  5CAI A;  4OGE A;  4MDW A;  5KYX A;  4ME7 A;  2BZ8 A;  3L2Q A;  1Y7X A;  2DZC A;  2M51 A;  2MCN A;  4C0D C;  2CSQ A;  1I07 A;  5KH6 A;  1K9M R;  3X26 B;  4C5E A;  4CC2 A;  1D1A A;  3QHS A;  4RTW A;  4XTZ A;  5GAO r;  1BIA A;  3I5S A;  1Q7Y U;  2PUK B;  1KK7 A;  2RI3 A;  2KK4 A;  3CQT A;  3KFV A;  2V1Q A;  1Y96 A;  4N0A C;  5LJ5 e;  3A8O B;  2JZ2 A;  4D8K A;  1K73 U;  3BW1 A;  4XQ3 A;  3OYJ A;  2CP6 A;  1VQP T;  2VXE A;  5KCO A;  5GAN 4;  2DET A;  2MWP A;  2Y4X A;  1XTD A;  2RQR A;  3CMA T;  3QJY A;  2JT4 A;  4M77 F;  3M5A A;  5CR2 A;  1QKX A;  1IO6 A;  3OMG A;  4KH0 B;  2DPP B;  4F7U G;  1NLP C;  1IHV A;  1RI0 A;  2XI9 A;  2VGM A;  1UB4 A;  1RAD B;  1VOM A;  4J9C A;  4HVV A;  2GNC A;  3DLM A;  1ARK A;  4RCB A;  1VQ7 T;  1G83 A;  3EGD B;  1N9S A;  2DL8 A;  1EIF A;  4M7D A;  2DA9 A;  3CCL A;  4C92 B;  1R8O B;  5IHN A;  4FM4 B;  2YT6 A;  3RER A;  2KSS A;  3OYY A;  2V1R A;  5I2S A;  3OYD A;  5I2M A;  4M7A G;  2RHX A;  5ECA A;  4IKF A;  4OF1 A;  4FSS A;  3OW2 A;  1NEG A;  1NYG A;  1TTH B;  4L5G A;  1WHL A;  8AT1 B;  1UUE A;  2RB6 A;  2F2X A;  1N27 A;  2EKH A;  2COZ A;  3JCM P;  1IGU A;  3CC4 Q;  4AG2 C;  3MP1 A;  4M7A D;  2DD5 A;  1AZG B;  3OYK A;  4M7D C;  1TG0 A;  2E6Z A;  1ZUK A;  2KT8 A;  2KY9 A;  1WIE A;  5GAN f;  1M90 C;  5C6S A;  2KNB B;  2YDL A;  4DBF A;  2QEX T;  3VS5 A;  3JSC A;  3ASK A;  3OQ5 A;  2E65 A;  3TRE A;  1SHG A;  1M1K U;  1WJS A;  4M77 A;  2M0O A;  4A4F A;  3SD4 A;  1X43 A;  1KHI A;  2KMT A;  1FX7 A;  4M78 B;  1RAE B;  2P84 A;  1AOJ A;  2O31 A;  2NUP B;  2D9T A;  1VQO T;  5KE2 A;  1B34 B;  1X75 C;  4PJJ A;  2A08 A;  1K9M C;  2O9S A;  2RPN A;  3CCE A;  3CCQ T;  1WI7 A;  1VIF A;  4C0D B;  4M77 C;  1PG5 B;  1ZQ1 A;  1WHH A;  5GAM j;  2K5F A;  2K79 A;  2DK3 A;  3OS1 A;  3E1S A;  1R0C B;  2YUP A;  1M30 A;  1BCO A;  4HVU A;  1TU0 B;  5GAM d;  2KBT A;  3RKW A;  1BCM A;  2RO0 A;  3CCR Q;  1U3O A;  4LE9 A;  5KYX B;  3PVL A;  3CCE Q;  1WXU A;  1SRM A;  3VRY A;  5GMK e;  4E7H A;  3VYH B;  1M8M A;  4J6X A;  3J81 E;  5KYU A;  4M4Z A;  5I22 A;  2D0Q B;  1UTI A;  1Y96 B;  2BKD N;  2J7I A;  1LPL A;  4DA4 A;  2OTJ T;  8ATC B;  2DFU A;  4JJN K;  4B6M A;  3E19 A;  3CCM A;  2ED0 A;  4A53 A;  1M2V A;  2D8J A;  5GAN e;  1UGS B;  3A98 A;  2AKK A;  3D7S B;  4UC4 A;  1UJY A;  1H8K A;  1I5O B;  1V76 A;  2MMP A;  4JLG A;  1YN8 A;  2L3S A;  4KGX B;  3RMS A;  2ZCF B;  4XU1 A;  2V26 A;  3VV0 A;  2RHZ A;  1MMA A;  3MET A;  5GAM h;  2LJ1 A;  2LX7 A;  4ANJ A;  1VQL T;  1OPK A;  1GXI E;  2JJ9 A;  1YJN A;  4N4H A;  2RQW A;  2YUQ A;  1RAA B;  3LW5 E;  2K5I A;  3C95 A;  5CKB A;  3GOX A;  1VQ9 A;  2ED1 A;  2L3R A;  5GAO n;  3VUZ A;  5A0L A;  5L8R E;  3WVE B;  2JS0 A;  4RG8 A;  3LGL A;  3KBG A;  1R0B G;  4J6Y A;  1QVG A;  2FPE A;  4M7D B;  2CH4 W;  3RKY A;  2DL3 A;  2AZS A;  4RTV A;  3A8G B;  3JB9 F;  2XG8 D;  1KQ2 A;  1D1B A;  2CSI A;  1RAI B;  2NYS A;  4LD6 A;  2RA2 A;  2XIC A;  3VU3 C;  2OTL A;  1WHK A;  5GAN 5;  3CCS T;  1NJI U;  1Q82 C;  1VYU A;  1W70 A;  1WA7 A;  2ZPE B;  1D0X A;  2GFU A;  4C8Q E;  4JJC A;  1XNI A;  2CP3 A;  2A3L A;  4QQ6 A;  3OYN A;  2D1X A;  2MYS A;  2EYZ A;  1YI2 Q;  5EC7 A;  7AT1 B;  4EMK C;  2CT4 A;  2KRO A;  1OQK A;  5D6X A;  1N8R U;  2EPD A;  4M77 B;  2DE0 X;  5FU7 C;  3G71 A;  4NOY A;  1UGR B;  2QGG A;  1JQQ A;  4FL6 A;  3EG0 A;  3KXT A;  4NL3 A;  2ZPG B;  1YJW T;  4KUL A;  1WJR A;  2X3W D;  1VQ8 Q;  2KT1 A;  1M1F A;  2VWF A;  4JPB W;  3MEA A;  2EQI A;  2K5L A;  2E5K A;  1JBM A;  4FYX B;  5LJ3 h;  1UGV A;  4BE0 A;  2QQS A;  2QDL A;  1IGQ A;  2OX7 A;  2PUO B;  3M4G A;  3HRT A;  4QQD A;  3GP8 A;  1QCN A;  2QA4 T;  1OOT A;  4MZT A;  4RCC A;  3TCJ A;  2E4H A;  1Y0M A;  2QQ9 A;  4GLM A;  2O4X A;  5D7U A;  3M54 A;  3G71 Q;  2EBP A;  3C94 A;  5GAN 7;  4LD9 K;  4J6W A;  2MI6 A;  1WXT A;  1C0M A;  2PZ1 A;  3J80 E;  1K73 R;  2C0I A;  3OYF A;  1C6V X;  5AT1 B;  3QG1 A;  1ZBX A;  5CVI A;  1HJD A;  5GAO p;  3SWN A;  4NL2 A;  1M1G A;  2KXD A;  2B8A A;  4A4G A;  1JJ2 A;  1VQ5 A;  1WGS A;  3EGU A;  4XU3 A;  2XD0 A;  1JU5 C;  2ECZ A;  4JRQ A;  2RI2 A;  1G8X A;  3P8B B;  3UA7 A;  5KYU B;  1RLP C;  2EGC A;  1AWJ A;  2CP5 A;  4F7U F;  2MPX C;  2GCX A;  2QQB A;  5HKC A;  3EG9 A;  3I55 Q;  4JJD A;  4JS5 A;  3GIB A;  3CC2 T;  4Q5W A;  5GJW B;  1JRI A;  1RAG B;  1WYX A;  4BI4 A;  1M2V B;  2QTX A;  2F1L A;  2ATC B;  4OML A;  3JCM g;  1UJ0 A;  2F2W A;  1O75 A;  3QII A;  2EQK A;  1YIJ A;  4HVW A;  1MMN A;  1K4U S;  1UGQ B;  4A4K A;  3UWN A;  3CXC P;  2DJQ A;  1X6O A;  3VRZ A;  3QYH B;  1Q81 U;  2FRW A;  2LVM A;  2PTK A;  3JCM V;  4QVZ A;  5CKD A;  2R5M A;  3G4S A;  2L2P A;  1ZSG A;  3M0P A;  2R58 A;  3RR6 A;  2DIG A;  3EFO A;  1UHF A;  4EIK A;  3G6E T;  3A1P A;  2ZAE A;  1NM7 A;  5CKH A;  3RNJ A;  1D0Z A;  3R6N A;  1YIJ Q;  3URG A;  3M0Q A;  3L2Z A;  1Y57 A;  3CBO A;  2EQU A;  2D0N A;  1CKB A;  2X4X A;  3EGX A;  1M1K R;  2JM9 A;  1V29 B;  2KDS A;  2P4T A;  3CEY A;  1RAC B;  4R56 A;  1VQ4 Q;  3CBM A;  5FU7 B;  4BD3 A;  4F7U A;  2E41 A;  4XTU A;  1BIB A;  2YHT A;  1G3S A;  3L1A A;  4WF2 A;  3EHQ A;  4X34 A;  2WSE E;  2QGF B;  4KH1 B;  1KD1 U;  3DLL A;  4DBR A;  2HD0 A;  3PTA A;  3HFN A;  2I0N A;  3QUI A;  1KQS A;  3CD6 A;  2BZY A;  2CYZ B;  2QI2 A;  3H9N A;  5LJ5 f;  3ZFJ A;  1NLO C;  1IRE B;  4EMH A;  1M5Q 1;  2DO3 A;  1X6G A;  4C8Q G;  3QJ6 A;  2G3R A;  1FMV A;  2JS2 A;  2AKL A;  4OGC A;  2LQW A;  1U8R A;  2AZV A;  1UEC A;  2X3X D;  4C8Q D;  4WTO B;  4M75 G;  4C0Z A;  2O01 E;  3M55 A;  5I21 A;  1KG1 A;  2KRM A;  2E12 A;  4J9F A;  4ORZ A;  3THK A;  3I56 T;  1AEY A;  2ZGW A;  4GLK A;  1NPP A;  2AHJ B;  3LYI A;  1VQM Q;  1S72 T;  2LCS A;  3UT1 A;  3UF4 A;  4B9X A;  4RTU A;  3FC3 A;  2QQA A;  2O4X B;  5LJ5 g;  4M75 D;  5CK9 A;  3SB2 A;  1RAH B;  2KQW A;  1E6H A;  1AWO A;  2E5Q A;  3CC7 T;  4JRI A;  3S3O A;  3HKS A;  2FZK B;  3M53 A;  1TS9 A;  2C06 A;  3ME9 A;  3SWN B;  4OMQ A;  4ZGD B;  2KYM A;  2VC8 A;  5LJ3 f;  1VQP A;  1X01 A;  3CMA A;  3IQL A;  1OI1 A;  1VQK Q;  2GBQ A;  3ER0 A;  3FLG A;  4N0A A;  4EDU A;  5GJV B;  3QPH A;  1M8V A;  5FRO A;  1BI1 A;  2ABL A;  2HBW A;  2MF2 A;  3EG9 B;  3CCV Q;  3O8V A;  1FMK A;  1QVP A;  4FW1 A;  4DEY A;  3CPW P;  3TQ7 P;  1Q86 C;  2MWO A;  1VA7 A;  4J9H A;  2LNH B;  2M9U A;  1M9S A;  3H8Z A;  4XTW A;  1NPR A;  1WNL A;  1CSK A;  1GFC A;  4X9D A;  1W2B A;  3AHU A;  2EIF A;  2IVW A;  3LH0 A;  2L3Q A;  1Q95 G;  1KFZ A;  3CMA Q;  3M59 A;  3CPW A;  5A0D A;  1QP3 A;  1QVF A;  1BK2 A;  1VQN A;  1LVK A;  2P0Q A;  1MHN A;  3QZ9 B;  1YHQ A;  2GQI A;  3JAM E;  4HKE A;  4C0F A;  3X24 B;  1XQH A;  3EFO B;  4BAC A;  1KC8 U;  1NJI R;  4QQG A;  3RIR A;  4PJO F;  5I11 A;  2BZX A;  5EG2 A;  1BYM A;  2L0A A;  1AWX A;  1VQ6 A;  4B9W A;  4K11 A;  3QSU A;  4CC4 B;  9ATC B;  4M7D E;  1WDX A;  1EX4 A;  2X4J A;  4RTT A;  3EGX B;  2EFI A;  1VQN Q;  2QEX A;  4Z88 A;  5CIU A;  3L2U A;  1OZ3 A;  4TVR A;  1YHQ Q;  3OW2 P;  1SG5 A;  3N5B B;  3HRU A;  1BBZ A;  1UE9 A;  5FWB A;  1IZ6 A;  1ZBJ A;  4C92 G;  2EYX A;  5LJ3 e;  4RG2 A;  2RH2 A;  1VQ6 Q;  2QK0 A;  4IIM A;  5DM7 R;  1VQO A;  3OMC A;  3OS0 A;  2KGT A;  3S3M A;  5FLX E;  2YLC A;  4C92 D;  4XTV A;  3CCQ A;  4PJO E;  5D6Y A;  3QDF A;  2H8H A;  4M77 E;  4LN2 A;  3JCM d;  5KE3 A;  1PRM C;  1K8A R;  3MEU A;  4HT8 A;  4OMO A;  3CCL Q;  4ATO A;  1KIK A;  1PRL C;  2PU9 B;  1JXM A;  5GAN 2;  3M56 A;  2BTT A;  4A54 A;  1RAF B;  1TUD A;  4PJO A;  3E9F A;  1MNE A;  1VQO Q;  2KE9 A;  1Z9Q A;  1KQ1 A;  4JLI A;  4M78 G;  1VIE A;  2HSE B;  3QWY A;  2XID A;  1OX9 A;  1RAB B;  4QVC A;  4XTX A;  2AT1 B;  2QQR A;  4JJB A;  2JMA A;  3M58 A;  3CC4 T;  2J05 A;  3MHX A;  5FU6 C;  1I81 A;  4M78 D;  2HEQ A;  5L23 A;  5GAN g;  2BUD A;  3PVQ A;  2EJG A;  1RI9 A;  5HCK A;  3X28 B;  4PJO C;  2RHI A;  1JO8 A;  2CUB A;  2OTJ A;  2K3B A;  1O9S A;  2K3Y A;  3A8M B;  2CZ0 B;  4J9B A;  4F17 A;  3JCM h;  3QXE B;  1D3B A;  2MIO A;  4JRK A;  5AYF A;  4LUE A;  1Q81 R;  4P5N A;  3FDR A;  3HL8 A;  1U1T A;  2GQV A; 
#chains in the Genus database with same CATH homology
 1MUZ A;  1I1J A;  1JQQ A;  2EGA A;  4RTX A;  1J3T A;  2G6F X;  3EG0 A;  3I9Q A;  2RQT A;  4JZ4 A;  2EYW A;  4Y92 A;  4CC3 A;  2D8H A;  2HCK A;  2X3W D;  2DBK A;  2KT1 A;  2VWF A;  4JPB W;  2EQI A;  2E5K A;  2O88 A;  2YSQ A;  1UGV A;  2KXC A;  1TUC A;  2QDL A;  2L3P A;  1B3Q A;  2EYY A;  4Z89 A;  1X2Q A;  4R0K A;  1OOT A;  2DX1 A;  2KR3 A;  2LJ3 A;  1Y0M A;  4GLM A;  2O9V A;  4F14 A;  2FO0 A;  5FWC A;  2EBP A;  1N5Z A;  3FJ5 A;  3TVT A;  2LQN A;  1WXT A;  1AWW A;  1WX6 A;  1YWP A;  2J6F A;  2PZ1 A;  4AFQ C;  2A28 A;  1I0C A;  2DIL A;  1GCQ C;  2J6K A;  2C0I A;  1AVZ C;  2C0O A;  2CUD A;  2IIM A;  3VS0 A;  1HJD A;  1GBQ A;  2RMO A;  1SEM A;  2KRN A;  1K76 A;  3TSZ A;  2KXD A;  2EW3 A;  1SRL A;  2VKN A;  3EGU A;  2FPF A;  2JXB A;  1JU5 C;  2ECZ A;  1ABQ A;  2C0T A;  2W10 A;  1AZE A;  4AFU C;  2EVR A;  1WLP B;  2GTO A;  1K0X A;  3UA7 A;  1RLP C;  3M0R A;  2EGC A;  4IIO A;  1AWJ A;  2RF0 A;  4J9I A;  1OPL A;  3VS7 A;  2FG0 A;  4JJD A;  3NMZ C;  5GJW B;  2K9G A;  1PHT A;  1WYX A;  1YCS B;  1LCK A;  2DLP A;  3NGP A;  1OV3 A;  4OML A;  1UJ0 A;  2F2W A;  1QKW A;  1T0J A;  4HVW A;  1H92 A;  4E6R A;  1K4U S;  2DJQ A;  3VRZ A;  2JW4 A;  1NG2 A;  2DL5 A;  2FRY A;  2FRW A;  2GGR A;  2YUO A;  3I5R A;  1EFN A;  1GRI A;  1SHF A;  2PTK A;  1WXB A;  5IXB A;  2L2P A;  1GCP A;  1ZSG A;  5IHK A;  3I35 A;  3M0P A;  1M3C A;  2DRM A;  2RQV A;  1UHF A;  1KJW A;  4EIK A;  4D8D A;  1GBR A;  1NM7 A;  2BZ8 A;  1E6G A;  3RNJ A;  2M51 A;  2MCN A;  2CSQ A;  1I07 A;  2HDA A;  2RQU A;  4CC2 A;  3R6N A;  2GTJ A;  4RTW A;  1T3S A;  2RN8 A;  3M0Q A;  3I5S A;  3U23 A;  1Y57 A;  1ZLM A;  2D0N A;  1CKB A;  3CQT A;  3KFV A;  3NPF A;  2JM9 A;  2V1Q A;  3EG3 A;  2FPD A;  3VS1 A;  1K9A A;  3O5Z A;  3TSW A;  2A36 A;  4D8K A;  3M0U A;  1GCQ A;  2OAW A;  4AG1 C;  2KEA A;  2RQR A;  3EHQ A;  1XOV A;  1JEG A;  2JM8 A;  3VS6 A;  2PNI A;  1HSQ A;  2JT4 A;  4HCK A;  1QKX A;  2I0N A;  2MOX A;  1IO6 A;  2CDT A;  3ZL7 C;  2BZY A;  1PKS A;  1A0N B;  1NLP C;  2JMC A;  1NLO C;  4HXJ A;  1X6G A;  1UDL A;  4J9C A;  2JS2 A;  4HVV A;  2NWM A;  2GNC A;  1ARK A;  2DRK A;  2AKL A;  2LQW A;  4RTZ A;  1G83 A;  1JXO A;  4ESR A;  2LMJ A;  2DL8 A;  2SRC A;  2AZV A;  1UEC A;  2J06 A;  2X3X D;  2DA9 A;  2DVJ A;  5IHN A;  2KRM A;  4J9F A;  4ORZ A;  3THK A;  1W1F A;  2XMF A;  1W6X A;  2YT6 A;  4Z8A A;  2F2V A;  1AEY A;  2V1R A;  2LCS A;  3UF4 A;  4WCI A;  4RTU A;  5ECA A;  4FSS A;  4KRT A;  2O2O A;  1NEG A;  1NYG A;  1PWT A;  2SEM A;  1UUE A;  2KYB A;  1E6H A;  1AWO A;  2F2X A;  2EKH A;  3EG2 A;  4AG2 C;  2FEI A;  1AZG B;  1TG0 A;  1ZUK A;  2KT8 A;  1FYN A;  1WIE A;  1U06 A;  2KNB B;  2YDL A;  4OMQ A;  2KYM A;  3H0H A;  3LH5 A;  3H0F A;  4X1V A;  3VS5 A;  4QT7 A;  1UFF A;  3H0I A;  1SHG A;  3IQL A;  4OMN A;  1X27 A;  2GBQ A;  1X43 A;  5GJV B;  4AFZ C;  2ABL A;  1T0H A;  2HBW A;  1AOJ A;  1YNZ A;  5IH2 A;  2O31 A;  1M3B A;  1FMK A;  4JZ3 A;  2DYB A;  4DEX A;  4DEY A;  1MV3 A;  1PNJ A;  1QWE A;  2CRE A;  2LP5 A;  1VA7 A;  2A08 A;  2M0Y A;  1K0S A;  3EHR A;  2O9S A;  4J9H A;  2LNH B;  2RPN A;  2ENM A;  1WI7 A;  2A37 A;  1YP5 A;  1ABO A;  1CSK A;  1GFC A;  1CKA A;  2KRS A;  2DNU A;  2LZ6 B;  2ROL A;  1X2K A;  2JTE A;  2L3Q A;  2B86 A;  2K79 A;  1KFZ A;  2ESW A;  1NYF A;  1BK2 A;  1ZUU A;  1QWF A;  4J9G A;  2DL7 A;  2RNA A;  2YUP A;  1M30 A;  1RLQ C;  2W0Z A;  4HVU A;  4OMP A;  2GQI A;  1T3L A;  3PE0 A;  3REB B;  1H3H A;  2KBT A;  1AD5 A;  1X69 A;  2LJ0 A;  1U3O A;  4LE9 A;  5I11 A;  2BZX A;  2DL4 A;  3PVL A;  2OI3 A;  2YUN A;  1GL5 A;  2L0A A;  1AWX A;  1K1Z A;  4K11 A;  4RUG A;  1WXU A;  1S1N A;  4CC4 B;  1PKT A;  1SRM A;  3VRY A;  1M8M A;  1WDX A;  2DMO A;  4RTT A;  4LNP A;  4M4Z A;  1OEB A;  5I22 A;  4LUD A;  1UTI A;  2J7I A;  4RTY A;  4Z88 A;  3ULR B;  3GBQ A;  4F16 A;  3NHN A;  2K6D A;  1VYT A;  2ED0 A;  1BBZ A;  1UE9 A;  2CT3 A;  1YWO A;  5FWB A;  1U5S A;  1ZBJ A;  3EG1 A;  1X6B A;  2D8J A;  3M0S A;  2K2M A;  1UHC A;  3A98 A;  2AKK A;  2EYX A;  1UJY A;  1H8K A;  1BB9 A;  4IIM A;  3VS3 A;  1ZX6 A;  1YN8 A;  2L3S A;  2CH4 A;  1V1C A;  2K7A A;  2KGT A;  1SPK A;  2LJ1 A;  2LX7 A;  3H41 A;  1OPK A;  1GFD A;  4OMM A;  2H8H A;  1WFW A;  4LN2 A;  1MV0 B;  1ZUY A;  1G2B A;  1PRM C;  1Z9Z A;  1QCF A;  1B07 A;  2RQW A;  2EGE A;  2YUQ A;  1BU1 A;  3JV3 A;  3REA B;  3C0C A;  2P4R A;  2ED1 A;  4GBQ A;  1NEB A;  1RUW A;  4OMO A;  3SEM A;  2JS0 A;  1KIK A;  1PRL C;  4J9D A;  1SSH A;  5IHI A;  2DM1 A;  2HSP A;  1JXM A;  4J9E A;  2OJ2 A;  4AFS C;  2BTT A;  2FPE A;  2CH4 W;  3UA6 A;  1TUD A;  2DL3 A;  3UAT A;  2DF6 A;  2J6O A;  3M0T A;  2AZS A;  4RTV A;  4CC7 A;  2KE9 A;  3SHW A;  1Z9Q A;  3RBB B;  2CSI A;  3QWY A;  4JJB A;  2JMA A;  1VYV A;  4ZNX A;  1M27 C;  3VS4 A;  2J05 A;  2VVK A;  1UG1 A;  1M3A A;  1QLY A;  1HD3 A;  1VYU A;  1W70 A;  1WA7 A;  1KSW A;  2NUZ A;  2HEQ A;  5L23 A;  3PVQ A;  1RI9 A;  5HCK A;  4JJC A;  1JO8 A;  2CUB A;  2K3B A;  2AK5 A;  2D1X A;  2EYZ A;  4A63 B;  5FW9 A;  5EC7 A;  3QWX X;  4J9B A;  4F17 A;  2CT4 A;  2MIO A;  2KRO A;  2ROT A;  3VS2 A;  2EPD A;  4LUE A;  5IXF A;  2DE0 X;  2DBM A;  1E7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...