2ESWA

Atomic structure of the n-terminal sh3 domain of mouse beta pix,p21-activated kinase (pak)-interacting exchange factor
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
60
structure length
60
Chain Sequence
PLGSQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTHNGRTGWFPSNYVREI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Rho guanine nucleotide exchange factor 7
publication title Crystal structure of the N-terminal SH3 domain of mouse betaPIX, p21-activated kinase-interacting exchange factor
pubmed doi rcsb
source organism Mus musculus
total genus 10
structure length 60
sequence length 60
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2eswA00
2C0OA 1BU1A 2GGRA 2DF6A 1GRIA 1UHFA 2GTJA 2L2PA 3NPFA 2KGTA 1IO6A 2J05A 1XOVA 3NGPA 2D8JA 5I22A 3M0SA 2RQTA 2HSPA 2G6FX 1ABQA 1BB9A 2DE0X 2DRKA 1NYGA 4IIOA 2ESWA 2HBWA 2X3XD 1U3OA 2EGAA 2K3BA 2J7IA 1M27C 1FMKA 2J6OA 3EG0A 3VS6A 1JQQA 2CH4W 3EG2A 2O9SA 2J6KA 2CT4A 2GBQA 1M8MA 4HCKA 4JPBW 2RQWA 4DEYA 3UATA 1X43A 1ZUYA 3SEMA 2JW4A 2DL7A 2LZ6B 2O88A 2O2OA 1B3QA 2A08A 2RPNA 4JZ4A 4E6RA 1T0JA 2CDTA 2L0AA 3VS0A 1KJWA 1GFDA 2LQWA 1PKSA 4AG2C 2J6FA 2JM9A 2NWMA 2BZXA 4RTYA 5IHNA 1QLYA 3SHWA 1WI7A 4Z88A 2VKNA 1NM7A 3RNJA 1AVZC 2L3PA 2F2VA 1KSWA 1ZBJA 3VS7A 4JZ3A 1BBZA 3VS1A 2FRYA 1RI9A 1KFZA 3CQTA 2ECZA 2RF0A 2K6DA 1RLQC 3RBBB 2K9GA 1YWOA 2SRCA 2W10A 1OPLA 4OMOA 1WXUA 3FJ5A 2C0TA 2D1XA 1U06A 1ZX6A 3LH5A 4LN2A 2EYWA 3IQLA 1PWTA 2K2MA 2DL5A 1H92A 3EHRA 2YUOA 4F17A 3THKA 2PZ1A 2DJQA 1K0XA 1UE9A 1OOTA 3ZL7C 4RTUA 1VYTA 1A0NB 2W0ZA 2YT6A 1SRMA 2M0YA 3PVLA 4OMQA 1E6HA 1MV0B 1CKBA 1M3CA 3UF4A 1HJDA 1WIEA 2AZSA 1X6GA 2KXDA 2RMOA 3VRYA 1SHGA 3M0PA 4LUEA 4RTZA 2BTTA 4JJCA 2EGCA 2CUBA 4JJDA 4CC7A 1SSHA 2O9VA 1GCQC 2LP5A 2L3SA 2HCKA 3GBQA 1GFCA 2EW3A 2JT4A 3M0RA 1TUCA 1WXTA 1AZEA 2D8HA 3TSZA 2DBMA 2F2WA 1QWEA 3TSWA 1ZSGA 1K9AA 1EFNA 2CH4A 2LJ0A 2LX7A 2EPDA 1JXMA 2FO0A 2JM8A 4CC3A 1ZLMA 2YUPA 4RTTA 2F2XA 1CSKA 2ROTA 4J9BA 2KRSA 3PVQA 1UDLA 4LE9A 5IHIA 1AWOA 1PNJA 1RLPC 2EYXA 1FYNA 4DEXA 4RUGA 5IXBA 2MOXA 2HDAA 2KXCA 3VS5A 2RQRA 2FG0A 5L23A 1SEMA 2DNUA 2ABLA 3I5SA 2P4RA 1G83A 1U5SA 1K76A 4R0KA 1K0SA 1X69A 2K79A 2EGEA 2A28A 3H0FA 4WCIA 4AG1C 4HXJA 1I1JA 1JU5C 1UECA 2DM1A 3ULRB 4JJBA 4CC2A 1T0HA 1MV3A 1W70A 1PKTA 3VS2A 2FPDA 2JMAA 2DVJA 2V1QA 1K4US 1UJYA 4HVWA 1QWFA 1VYVA 2ROLA 1PRLC 1B07A 4FSSA 1OPKA 2YUNA 3EGUA 2PNIA 2DBKA 4HVUA 2VWFA 2CREA 2JMCA 1LCKA 3M0UA 3EHQA 2CT3A 3A98A 2KROA 2AK5A 1VYUA 1Z9QA 1HSQA 5IXFA 1W6XA 2OJ2A 2AKKA 4EIKA 1X2QA 2EKHA 2LJ3A 2V1RA 1NYFA 2I0NA 2DA9A 2KNBB 4J9GA 3R6NA 1X2KA 4Y92A 2M51A 4AFSC 1JO8A 4X1VA 2ED0A 3QWYA 2EBPA 3U23A 1JEGA 1QKXA 1SHFA 1WXBA 1G2BA 2EYZA 3JV3A 2CUDA 1GCQA 4GBQA 4OMNA 1HD3A 2DMOA 2GTOA 1GL5A 2DL3A 4ORZA 3REBB 2K7AA 2RN8A 1I0CA 2O31A 2B86A 2KBTA 1QCFA 3PE0A 4LUDA 4F14A 4OMLA 1GBQA 1AWJA 2LCSA 5IH2A 5ECAA 2FEIA 1NLPC 2GNCA 1WDXA 1RUWA 2KRMA 1AWWA 4LNPA 3REAB 2EYYA 1NEGA 4D8DA 1X27A 2YDLA 2BZ8A 2JS0A 2ED1A 1E7OA 3I9QA 2LQNA 2YUQA 5EC7A 1Y0MA 1S1NA 2KEAA 2H8HA 3KFVA 2DILA 3NMZC 1WYXA 2KR3A 2PTKA 1ZUUA 1UUEA 4QT7A 2JXBA 5IHKA 2IIMA 2J06A 1M3AA 1AWXA 1NLOC 1V1CA 3QWXX 4RTXA 3EG1A 3NHNA 4IIMA 2KE9A 5HCKA 1H3HA 2XMFA 2RQUA 1JXOA 2DL8A 2MCNA 4OMMA 2KYMA 4J9IA 2JTEA 4K11A 3VS3A 1TUDA 1Z9ZA 1AOJA 2VVKA 2E5KA 4Z8AA 4HVVA 3C0CA 1MUZA 4CC4B 2DLPA 2AKLA 1BK2A 1UGVA 2JS2A 4KRTA 4OMPA 3H0HA 1OEBA 2L3QA 1TG0A 2LMJA 1J3TA 2DL4A 4D8KA 1X6BA 4J9DA 2QDLA 3I5RA 1K1ZA 3O5ZA 2DX1A 2KRNA 1WLPB 2ENMA 1T3SA 1T3LA 3TVTA 4GLMA 1SPKA 2EQIA 4ZNXA 1WX6A 1YN8A 2FPEA 2HEQA 5FWBA 1WA7A 2BZYA 3M0QA 1W1FA 4J9CA 2YSQA 1UJ0A 2C0IA 4M4ZA 2A36A 4AFZC 2NUZA 3I35A 4RTVA 5GJVB 2DYBA 4J9EA 1CKAA 2GQIA 1GCPA 3EG3A 5FWCA 4J9FA 1N5ZA 1PHTA 1I07A 1GBRA 2X3WD 2KYBA 4A63B 4ESRA 1E6GA 2CSIA 2AZVA 1H8KA 2FRWA 5I11A 1SRLA 2CSQA 1AEYA 3M0TA 1Y57A 4Z89A 1YCSB 3VS4A 4AFUC 1PRMC 2LJ1A 5FW9A 1WFWA 1AD5A 1UG1A 2KT1A 1QKWA 2OI3A 1YNZA 5GJWB 1M3BA 1OV3A 2D0NA 1KIKA 1UFFA 1VA7A 2DRMA 1NG2A 2RNAA 1M30A 1ZUKA 3H41A 1NEBA 2SEMA 2KT8A 2OAWA 3UA7A 1AZGB 2A37A 2EVRA 4RTWA 2FPFA 3UA6A 1UTIA 3H0IA 1ABOA 1UHCA 1ARKA 2RQVA 4AFQC 4F16A 2MIOA 4J9HA 1YP5A 1YWPA 2LNHB 3VRZA
chains in the Genus database with same CATH superfamily
2C0OA 1BU1A 1PSEA 2GGRA 5GAN8 2GTJA 1MHNA 3C4SA 2L2PA 4M7AD 1IO6A 4A4GA 1FWZA 3H9NA 1OX8A 4JDSA 2COYA 3JCMX 2DYIA 1ZQ1A 3RERA 3OS5A 2IG0A 1FMKA 4C8QE 2ZPBB 3VS6A 3EG2A 1B7TA 2EIFA 4HCBA 4DBQA 4JPBW 4J6YA 4XU3A 1X43A 1ZUYA 4M7DC 4C92C 2XDBA 2LZ6B 4R56A 2CDTA 3VS0A 5CVIA 1FXXA 4IUPA 1D1BA 2LQWA 3JCMJ 5A2QE 1AVZC 4E47A 1KSWA 4LD9K 2BIVA 4JZ3A 1Q81U 3ME9A 1B34A 1RI9A 3J80E 2DD4A 3M59A 2ZAEA 1RAIB 2K6DA 4PJMA 4MDXA 1VIFA 1W2BS 5GAOm 3RKXA 5KE3A 4BI8B 2HMAA 1U06A 1KQSS 1W2BA 2E1HA 2EYWA 2DXTA 3IQLA 1WQWA 1WHGA 3PIPA 4XU2A 4B6MA 4ANJA 1X6OA 2GF7A 3M58A 1RL2A 3ZL7C 4RTUA 1D0YA 1VYTA 2RHUA 1A0NB 2K57A 1SRMA 2L5QA 4BE2A 3CCQT 2M1HA 2L3RA 3CC2T 3EAEA 3HFNA 3UF4A 2EYQA 1HJDA 2RMOA 3VRYA 3M0PA 1RABB 4LUEA 2YRDA 1KD1R 4OF1A 2JTMA 3A1PA 3JCMe 4JJCA 2EGCA 1SKUB 2CUBA 4DBRA 2L3SA 3JCMW 2HCKA 4F7UE 4ELYC 2R58A 1TUCA 2RA2A 2CP6A 1IHWA 1ZSZC 2ZPEB 3TSZA 3G71T 3BE3A 2DBMA 3FEOA 1YIJA 1M90C 3CCMA 4P5NA 2NLUA 4TVRA 5HKCA 1IB8A 1JXMA 2FO0A 1WJRA 4DA4A 3D7SB 2YUPA 4L5GA 4XTUA 5C0MA 3OYFA 4M78D 3CCMQ 2KRSA 3PVQA 5CIUA 1AWOA 1VQPT 3CPFA 2LTOA 2M9UA 2MOXA 5LJ5g 4FL6A 1TU0B 2RQRA 5GAMf 3GP8A 1Q86C 1KK7A 3C94A 3LWHA 3I5SA 4J8OA 1NE8A 2A3LA 2NUTB 3FJPA 2BE7D 2HAXA 4IKFA 1QP3A 2K79A 2RK1A 3H0FA 2JUFA 1YITQ 2DO3A 1UECA 3CCVT 3ULRB 4FT4A 1RACB 3OYIA 1PKTA 2KK4A 3UPUA 5KCOA 2WSFE 3JB9D 4PJOB 2V26A 3J7AF 2VB6A 4OB2B 2OTLT 3RKYA 3CMEA 1G3YA 2CZ7B 2WSCE 4AMCA 1K73U 2PNIA 1WPYA 4HVUA 2MI6A 3CMEQ 1BCOA 1LCKA 4MMLA 2RK2A 2CT3A 3OYMA 2AK5A 3CCJA 1Z9QA 1RAFB 3OBYA 3HL8A 2X4JA 5IXFA 2AKKA 4EIKA 2DJZA 3OS1A 3CCJQ 5FU6C 1YBYA 1X2KA 4Y92A 2RJEA 2LCLA 2O4XB 3CPWA 2XIDA 2NUTA 4FW1A 1SHFA 1RI0A 2ZCFB 1BYMA 2EYZA 5GAOp 2K5FA 3BW1A 3P8HA 4M7AF 1H3ZA 3I55A 3BFMA 1GL5A 1S72T 4DBFA 3DLMA 2DEQA 4C5IA 1MMAA 4ORZA 4PJOA 1PCXA 3I55Q 4M7DE 2RN8A 2Y4YA 4OB1B 5AT1B 4M77D 3PE0A 2M02A 4C92E 3OYAA 3GOXA 4ZTFA 1Q81C 1K9MU 1NLPC 3CCST 4PJLA 3VUZA 3FDRA 2E10A 3REAB 2VGMA 4B9XA 1NEGA 4N0AA 4L59A 4BD3A 2ZPGB 4PKCC 1TSFA 2O4XA 3MP6A 4J7IA 3KFVA 3VUBA 4XK8E 4QT7A 1RAGB 1VQ8A 2RHIA 2IIMA 2J06A 2JJ9A 1EX4A 2QA4A 5CKBA 3HTRA 3OYHA 1Y7XA 5KYYB 1V1CA 5LJ5d 3QWXX 1VQ8Q 4RTXA 2LQ8A 1K8AR 3NHNA 1G3TA 2QA4Q 2RQUA 2DL8A 4E2FB 2EQMA 4M75B 4K11A 2XD0A 1AOJA 2M16A 4Z8AA 4PJJA 4HVVA 2DLPA 2OTJA 4OMPA 2ZPHB 3H0HA 1YJNT 1J3TA 2DL4A 3CCMT 2EAYA 1OZ2A 2OTJQ 1M1KR 2QDLA 1BI2A 3I5RA 4OGEA 4BDYA 3O5ZA 4A53A 5I21A 2DX1A 2KRNA 3VKIA 3JCMf 5HK3A 3OYDA 4C8QD 2EQIA 4ZNXA 3NTKA 1UGSB 5LJ5h 1WA7A 4YTLA 1YITT 2A36A 4AFZC 4RTVA 6AT1B 3QUIA 4MZTA 2DYBA 1TS9A 3M57A 1GCPA 4IUVA 1WZOA 1N5ZA 4LD6A 2X3WD 3HPWA 5CCAA 1Q7YC 4M78E 1QCNA 3GNFB 4FYXB 2CSQA 2OX7A 1Y57A 3VS4A 1EZZB 1WFWA 4M75A 4OGCA 1YNZA 3PFSA 3CMET 4KGZB 4FU6A 2K3YA 5GMKm 1K73C 2X35A 4EMKB 1RAHB 2VXEA 2NUPB 1JJ2P 5FU7B 3M53A 2DAQA 1QVFA 2HD0A 3H41A 2OAWA 2HKQB 3OMGA 4XU0A 1AZGB 2A37A 1R77A 2FPFA 3SWNC 4F04B 5GAOn 1ABOA 2DK3A 1UHCA 1ZBXA 2RQVA 1N27A 1RAEB 2LQKA 2MIOA 2QGGA 4F16A 3P8BB 4QQDA 2MAMA 3VRZA 1VQOT 1UHFA 4B9WA 3QDRB 3OBWA 3NPFA 4J6XA 2E4HA 2J05A 1XOVA 1R8OB 2X4XA 1RADB 3M0SA 1KHIA 1ABQA 3I55T 3MJXA 4J7FA 4E7JA 2DRKA 1NYGA 1XQHA 2K2VA 3HRTA 5CO7A 5GAOl 2K3BA 3TU4K 4IUTA 2CH4W 2X4WA 1UGQB 2J6KA 4LDUA 4HCKA 3MP8A 4NL2A 5CKHA 3N5BB 2QQAA 3G1JA 4EMKA 2JW4A 1M2VB 1I5LA 1K9MC 4Z02A 2O88A 1B3QA 2IVWA 1N8RR 5FRMA 2NUPA 2L0AA 1KJWA 1OULA 4LXCA 2H3JA 1FMVA 1PKSA 2QI2A 1HXDA 2KMTA 1WI7A 4Z88A 1OU9A 4UC4A 3RNJA 3MPUB 2F2VA 4C0FA 1ZBJA 3VS7A 1BBZA 3VS1A 3OSSC 4M77F 5KH6A 2RF0A 1RLQC 3RBBB 2SRCA 2W10A 1WXUA 2HKNA 4E7LA 1VQ8T 4LN2A 1F1BB 2QA4T 2CS7A 5GAN3 1VQPA 5GAMj 4A4KA 2RM4A 3THKA 1QVGS 1C6VX 2DJQA 2E41A 5GMKe 4LDWA 1VQPQ 2Y4XA 2YT6A 3Q1JA 3PVLA 1HYOA 2QTXA 1M2VA 2F1LA 1WHKA 1O75A 3ZFJA 3ZEHA 2OTJT 4F7UG 3MEUA 1CKBA 1M3CA 4Q5WA 3CCVA 4V2SA 2KXDA 4X9CA 3JRZA 3OYBA 2VGNA 2GFAA 3PGGA 4RTZA 5CAIA 1KC8U 4CC7A 1IGUA 4JJDA 1SSHA 2O9VA 1TXQA 3GBQA 3CC4T 3EGXB 1GFCA 1KD1U 2JT4A 5IT9E 3M0RA 4HCZA 4PJOC 3JB9H 5GAN7 2D8HA 2EFIA 1EFNA 3BY7A 1DJ7B 2LJ0A 2EPDA 1JRIA 3CEYA 4CC3A 1BI1A 5CKEA 2KSSA 3EFOB 1G3SA 1MGQA 3HRSA 4FYWB 1WGSA 1RLPC 4N0AC 4DEXA 5IXBA 4BACA 5FRNA 4M7DD 3VS5A 5M9OA 4MZMA 4C92D 4C8QF 2KY9A 2DNUA 3INZA 3BDLA 1NJIU 2RI2A 3L2QA 4C0GA 1K0SA 2A28A 4AG1C 4WCIA 3OYEA 1JU5C 2R57A 3EGDA 2DM1A 2X4YA 3SWNB 1W70A 3BDUA 1S72A 3JCMP 4FYVB 4LDVA 1HK9A 4KGVB 3EFRA 1UJYA 4HCCA 1QWFA 4ZN3A 3EGXA 4WF2A 1W4SA 1S72Q 4KGXB 1PRLC 2DBKA 2E3HA 1QVGP 3DB4A 3MEWA 3X20B 3CCSA 1KG1A 1PM3A 3V7RA 3EFOA 8ATCB 3CCSQ 2OJ2A 2MWOA 1LVKA 3MKDA 2QQSA 1U1SA 4M7AG 2I0NA 4LDXA 4J9GA 4O6JA 3EG9B 1D0XA 2P4TA 2CYZB 2K3XA 2ED0A 1PSFA 1I8FA 4ZGDB 1JEGA 1FMWA 4PJNA 3JCMc 4M7DG 1WXBA 2P0QA 1G2BA 2RHXA 1OX9A 5GAMd 2CUDA 1GCQA 3MP1A 3SWNA 4OMNA 1HD3A 2ZPIB 3OSVA 2EJ9A 3FC3A 2DL3A 2C06A 1IREB 3JAME 3REBB 4WTOB 2K7AA 1I0CA 2B86A 4O5VA 4LUDA 4F14A 3L1AA 2CZ6B 5DLOA 4BY6B 2G3RA 3M4YA 4F7UF 1AT1B 4PFZA 1PC0A 5KE2A 4M75C 5GANf 5IH2A 5ECAA 2CP0A 2X9HA 1YJNA 3QKJA 2GNCA 2P0KA 1WDXA 2KRMA 1SG5A 2FHDA 5GAOr 1YJNQ 4D8DA 3CD6T 1X27A 2YDLA 4MDWA 3PMIA 2JS0A 4EMHA 2K4YA 5GAMh 2P84A 4IUQA 1SF9A 5EC7A 1Y0MA 4FIBA 5HK0A 2KDSA 3EG9A 5LJ5e 1SSFA 2H8HA 1I81A 2RJDA 1V29B 1YITA 2PTKA 3UT1A 4HT9A 2CP2A 4DOVA 2JXBA 1WNLA 5LJ3f 4HA8A 1Q7YU 3WXMB 1X75C 2RI5A 1VOMA 3CCLA 4E7IA 4IIMA 4QKUA 1W2BP 4BDZA 1KC8C 4OMMA 3LH0A 5CR2A 4N4GA 2JTEA 1KQSP 3CCLQ 2V8IA 1TUDA 1C1AA 1KHCA 2VVKA 3VYGA 1KD1C 3C0CA 3E19A 1UGVA 2JS2A 2QEXA 4OVAA 1YFNA 3G6ET 2LMJA 3X26B 4QVZA 4EMKC 1Q81R 5GMKl 2BE9B 2WSEE 2QEXQ 1IRXA 3JB9I 1OZ3A 2E6NA 4GLKA 4NS5A 5FU7C 3RIRA 9ATCB 4PJOE 4RG2A 3MCAB 1T3LA 3NTHA 1NZ9A 3TVTA 3L2WA 1QW1A 4M78G 1TTHB 2HEQA 2XICA 3CPWS 2BZYA 3S3NA 1W1FA 1N9SA 1UJ0A 1VQOA 2XU8A 3RMSA 2NUZA 4KH1B 1TOVA 2OAUA 1NJIC 4J9EA 2GQIA 4M7AB 3EG3A 1OI1A 1PHTA 2VXFA 2KYBA 5EG2A 1VQOQ 2AZVA 2DERA 1H8KA 2E70A 2FRWA 1SRLA 3A8GB 3C95A 1BIAA 3TQ7P 3OW2A 3KBGA 1YCSB 4VUBA 4XTWA 3SDZA 2LJ1A 3FLGA 2KT1A 5KYWB 1R0CB 4PFPA 1UEBA 2Y90A 2LX9A 4M7DF 3G7ZA 2DD5A 4C92F 2RJFA 3JB9G 2D0NA 1YJ9A 3PIOA 2DTOA 3E2UA 2QAZA 4J83A 3SFMA 2RB6A 2RNAA 1M30A 1ZUKA 3CXCA 1YJ9Q 2SEMA 2KT8A 2FZGB 3UA7A 4A4FA 2GQVA 3UA6A 1UTIA 4FCYA 5KYXB 4KUDK 3EFSA 2FYKA 3L2RA 1GXIE 3LGLA 1XNIA 2QQRA 2LC4A 2RI3A 5CKFA 2DF6A 1GRIA 3QBYA 3ZBDA 3JCMd 4M7AA 2KAFA 2XK0A 2G6FX 4IUUA 5D6XA 3V8KA 1VQMA 2ZGWA 1LJOA 3ASKA 2HBWA 2FZKB 1U3OA 2RH2A 4JLIA 5KYWA 2J6OA 2O9SA 1VQMQ 1JJ2A 2CT4A 2GBQA 1M8MA 3E9GA 4DEYA 3UATA 2JNGA 3M4GA 2NYSA 3SEMA 4RMOA 1C0MA 3H6ZA 2LT1A 3TCJA 4ZN1A 3CPWP 4M77G 2DIQA 1ZA2B 1WHLA 2EWNA 1N9RA 4J5YA 4C0ZA 2JZ2A 3CMAA 4AG2C 1VQ5A 2JM9A 1IGQA 1K73R 3JCMh 2NWMA 2BZXA 4RTYA 1QLYA 2YLBA 5KYXA 2YHTA 2L3PA 3CMAQ 3CC4A 1VQ5Q 4M75E 3QIIA 2FRYA 2ECZA 3CCRT 1QVPA 2RHZA 3CC4Q 2K9GA 3UWNA 1YWOA 1OPLA 2QDYB 2VV5A 3FJ5A 2WACA 4BB7A 4KULA 2C0TA 3OYKA 1ZHIA 1VQ7T 2D1XA 4QQGA 1ZX6A 2HL3A 3I56A 3HHTB 2DL5A 2QK0A 5KCHA 3ER0A 4M78F 1PD1A 1TH7A 3CCLT 2YUOA 4F17A 3I56Q 2PZ1A 5DY9A 1M9SA 1RAAB 3LGFA 1UE9A 2ZPFB 5LJ5f 4OMQA 1FX7A 3CC7T 2VASA 3M55A 2BUDA 4A54A 1YJWA 1I5OB 3OQ5A 1IZ6A 2QEXT 1WIEA 2AZSA 5I2SA 1QVFS 1X6GA 5DLQE 4E7SA 1Q82U 1SHGA 1YJWQ 5IN1A 2JTFA 2AIRB 1K9MR 3MEVA 2E6ZA 1M1GA 2BTTA 3VU3C 1GCQC 2LP5A 3RR6A 2I2LA 3WVEB 3P8DA 2EW3A 2HBPA 3JB9F 4QW2A 2XKOC 1WXTA 4JS5A 3OS2A 5CK9A 3PT9A 1QWEA 3TSWA 4ZGEB 1ZSGA 5CQYA 2HQHA 4C8QG 3PTAA 3OYJA 2QASA 1ZLMA 3M56A 2QXFA 2F2XA 2ROTA 4J9BA 3TREA 3H8ZA 3SD4A 2EYXA 1WHJA 1FYNA 2YXYA 2DVEA 2HDAA 1YCYA 2DXBA 2FG0A 1SEMA 1G83A 1U5SA 3QJYA 2KI7A 2K5LA 1QMCA 4R0KA 1X69A 2Z0WA 3PMTA 2COZA 1YJ9T 4HXJA 4E7ZA 1I1JA 1VQ4T 4BI3A 2M0OA 2FL7A 1VIEA 4CC2A 1T0HA 3RUXA 4XQ3A 2FPDA 2EKOA 1MMGA 4Y28E 3LYIA 1BIBA 4BE1A 2E12A 2V1QA 1K4US 4KH0B 4ZGJB 5GAN4 5L8RE 1VYVA 1BI3A 4N4HA 5GANj 1OPKA 2YUNA 2ZZDA 3EGUA 2P0PA 1Y71A 2FZCB 2VWFA 2CREA 3UDCA 4BY6C 2DTHA 2EQKA 3GNGA 2DETA 5J39A 4RCCA 4OB3B 2QG9B 1HSQA 3CD6A 1NPPA 4C5EA 1X2QA 2EKHA 5GAMe 2LJ3A 2V1RA 1VQMT 1WJQA 1QVFP 5GAMg 1G5VA 3CD6Q 3R6NA 1M8VA 2M51A 3DKMA 3LW5E 2DIGA 3FB9A 2MWPA 3U23A 5LJ3j 2XG8D 1XJWB 2R5AA 1X01A 3META 5FROA 4GBQA 3EGDB 3JCMQ 3CMAT 2E64A 1VQ5T 4PJOD 1PD0A 3DLLA 4PNOA 1U8RA 4M77A 5GMKj 2O31A 4FYYB 4OMLA 3WVDB 3PNWC 1Y07A 2LCSA 2CGHA 2DPPB 3V8JA 2FEIA 4OB0B 1MMDA 3G6EA 2VC8A 2RJCA 1RUWA 2KVQG 2JN0A 3NTIA 1D09B 3I56T 3G6EQ 2CP5A 2MPXC 8AT1B 2BZ8A 2EJGA 1YI2A 3M5AA 4CI0C 4LDYA 2LQNA 2YUQA 4C8QB 5GAN2 2E3IA 3LLRA 2KEAA 1OYXA 1YI2Q 4DBHA 1WHHA 4JRPA 3L2ZA 4GY5A 1WYXA 2KR3A 3OA6A 3QHSA 2PUOB 3VV0A 4FSXA 3M9QA 5IHKA 3QJ6A 1YJWT 2DEUA 1M3AA 2L89A 2F5KA 1AWXA 3A8MB 5GMKi 4M7AC 5LL6S 3X25B 1Q82C 3EG1A 5HCKA 4EDUA 2KYMA 4J9IA 4A4EA 1PG5B 3VS3A 1Z9ZA 2COWA 2E5KA 4PJOG 1BK2A 4KRTA 1JB0E 1OEBA 1MNDA 2XHCA 1XTDA 2QQBA 3OMCA 2XDPA 4R55A 1X6BA 4XAXB 4JRQA 2CP7A 4J9DA 1K1ZA 5GANd 2DZCA 2HZYA 1WLPB 1T3SA 1M90R 1ACMB 3SB2A 4C8QA 4GLMA 1WX6A 2FPEA 3M0QA 4J9CA 5AYFA 2YSQA 2C0IA 3NFCA 3A5ZB 4M4ZA 2YLCA 1Q95G 3GIBA 3F70A 1CKAA 4C5GA 2CZ1B 5FWCA 3OYLA 3OYYA 3CCET 4FM4B 1GBRA 2DTIA 2QYZA 3V7CA 4C92G 1E6GA 2CSIA 5I2MA 1LNXA 1KQSA 4D6WA 5I11A 1Q86R 4C0DB 1AEYA 2B8AA 4Z89A 3CBMA 1UGPB 4NOYA 5LJ3d 1AD5A 3RESA 1UG1A 1UB4A 4F7UB 1QKWA 4M75D 1M2OA 2OI3A 3CBPA 5GANh 3EH1A 2KQWA 1UFFA 2LRQA 1KC8R 4KT0E 1IXDA 2A0FB 2DXUA 2QGFB 1NG2A 2D0QB 2BKDN 2LNVA 3JCMb 1NEBA 3G4SA 3S6WA 3JCMg 4RTWA 2DZ9A 3MO8A 2DXCA 5A0DA 3H0IA 3G4SQ 4A4HA 4AFQC 2EQJA 4J9HA 1YP5A 5J3BA 1YWPA 3CCRA 1I4K1 5D7UA 1P92A 2XI9A 2AT1B 5LJ3h 1M1FA 2HL5C 3OYGA 3JCMV 4BI4A 3QDFA 1D1AA 2E65A 2KGTA 3V8LA 2PQWA 3CCRQ 4XTVA 1D0ZA 1VQ7A 1MMNA 3NGPA 2MK5A 1YIJQ 2D8JA 5I22A 2HSEB 2RQTA 5CQXA 1VQKA 2HSPA 1BB9A 2DE0X 1VQ7Q 2RHYA 3L42A 4IIOA 2ESWA 1NJIR 4QVCA 4M78C 2X3XD 2EGAA 5LJ5j 2J7IA 1M27C 1VQKQ 3EG0A 4F7UA 5GMKh 1JQQA 2AHJB 1D3BB 1G8XA 2RQWA 3QG1A 4ELZC 1TUGB 3FIFA 3M54A 3CC7A 1K8AU 2DL7A 4X9DA 3A8LB 4PLLA 4QVDA 2ATCB 1KQ1A 2A08A 2O2OA 2RPNA 4M75G 4JZ4A 5DM7R 4E6RA 1T0JA 3CC7Q 2V8JA 1GFDA 2J6FA 4N4IA 4MZPA 5IHNA 3SHWA 2VKNA 1NM7A 2LT4A 3E1SA 1VUBA 3RKWA 2MYSA 5FLXE 1YI2T 4PJOF 1M1KU 3HP9A 7AT1B 3CQTA 1KFZA 3GPLA 4EPCA 4ME7A 2V8KA 1BKBA 1BCMA 4OMOA 2RO0A 2LDMA 2CP3A 4OP0A 2DFUA 3S3OA 1M5Q1 3LH5A 3A8OB 3OW2S 1PWTA 2K2MA 4RKUE 1H92A 2CKKA 3OY9A 3EHRA 1AHJB 4JS4A 4Y91A 4RCBA 4M7DB 1K0XA 4C92B 1D3BA 1OOTA 2W0ZA 2X51A 2M0YA 4XTZA 4JRIA 1JBMA 4M7AE 1E6HA 3O8VA 3GF5A 1MV0B 2H3EB 3JSCA 1VQ4A 1H641 3CXCS 1VQ9A 3MEAA 4BUGA 2QTVA 2DKGA 1TWBA 2JVVA 1R0BG 2GCXA 4NL3A 1VQ4Q 4RG8A 1VQ9Q 4FW2A 5J26A 2RD1A 2FB7A 1WQ7A 4L6V5 1AZEA 4M77C 2PU9B 2F2WA 3QZ9B 4E7HA 1K9AA 3RMQA 2CH4A 2LX7A 4BE0A 2JM8A 5IAYA 4RTTA 4PLIA 1CSKA 1UDLA 4LE9A 5IHIA 2VYTA 4KBMB 1PNJA 1OQKA 3EH2A 3E9FA 4RUGA 4C5HA 4M7DA 5A0LA 2KXCA 1JJ2S 4PK4A 4C92A 5L23A 3VJPA 1Q7YR 2ABLA 2P4RA 5D6WA 1YHQA 3C12A 1VQNA 1K76A 2EGEA 2IPOB 1YHQQ 1VQNQ 3TEEA 4JJBA 1MV3A 3VS2A 3G4ST 2JMAA 3OS0A 3A8HB 5GAOq 2DVJA 3LX7A 4XU1A 4AT1B 1N8RU 1ZSZB 4HVWA 3S3MA 3HKSA 1MNEA 3FRNA 3OW2P 2ROLA 1VQLA 3QO3A 1B07A 4FSSA 4M75F 4XTYA 3CCUA 2YWWA 1LPLA 1LOJA 1YIJT 3LWIA 2JMCA 3M0UA 1VQLQ 3EHQA 3A98A 2EQUA 2KROA 1VQ6A 3CCUQ 1VYUA 4M78B 1W6XA 1WHMA 1VQKT 5KYNA 1VQ6Q 2L8DA 5CKDA 4JLGA 4JJNK 3CXCP 1NYFA 2DA9A 2KNBB 3DB3A 3MHXA 4HT8A 4AFSC 2MMPA 2HQXA 1JO8A 4FT2A 2JOYA 3VYHB 4X1VA 3QPHA 3QWYA 2EBPA 3QYHB 4C8QC 1QKXA 4EMGA 2HQEA 1K8AC 3X24B 3L2UA 3JV3A 4JRKA 1NBEB 2XDDA 5KYYA 2DMOA 2GTOA 1N6AA 1IHVA 2R5MA 1NPRA 2K5IA 2YRVA 5KYUB 1ZSZA 4E7KA 1Y96B 2KBTA 2YRCA 5D6YA 1QCFA 1GBQA 3OYCA 1M1KC 4QQ6A 4PFOA 1AWJA 5GAN6 2EJFA 2D9TA 2CZ0B 4XTXA 2LVMA 3J81E 1AWWA 3CCJT 4LNPA 2EYYA 2MF2A 5FU6B 4M78A 1QCOA 1BI0A 1UGRB 2ED1A 1KQ2A 1E7OA 3I9QA 1S1NA 1ZA1B 4HKEA 5HY6A 2DILA 3NMZC 3HFOA 1ZUUA 3T9NA 3L2VA 4X34A 1UUEA 4OMFB 2F69A 3CCEA 3QYGB 2GFUA 1NLOC 1VQ9T 1V76A 3OB9A 3CCEQ 4ATOA 3CBOA 2VUBA 5GAN5 1QQJA 2KE9A 1H3HA 2XMFA 3QXEB 3KUFA 5KYUA 1JXOA 2MCNA 1Y96A 4C0DC 2HNIA 2PVGB 4M77B 5GANe 5GANg 3R6OA 1MUZA 3CCQA 4CC4B 3CC2A 2AKLA 2PVDB 2L3QA 1TG0A 4D8KA 3CCQQ 3OYNA 3CC2Q 4J6WA 3KXTA 3X28B 3QZ5B 1O9SA 2ENMA 4PL6A 4M77E 1M4ZA 5C6SA 2PUKB 1SPKA 2F5TX 4KUIA 3HSBA 3GLXA 1YN8A 5FWBA 3HRUA 3G71A 1M90U 3I35A 3QSUA 5LJ3e 5GJVB 1YHQT 5LJ3g 1VQNT 2LCCA 4J9FA 3G71Q 1I07A 2E5QA 4A63B 4ESRA 4JUVA 2O01E 2D6FA 2QQ9A 4ZTJA 1EIFA 3M0TA 4CRIA 4MMKA 4AFUC 1PRMC 5FW9A 1N8RC 1QVGA 3RDVA 4DQ2A 1Q86U 1QP2A 5GJWB 1M3BA 1Q82R 5A0GA 4DOWA 3URGA 1VQLT 1OV3A 1KIKA 3CCUT 3AT1B 1VA7A 1WJSA 1D1CA 2DRMA 3V7SA 1OU8A 1VQ6T 2FVUA 3CCVQ 2EVRA 2PVOB 2OTLA 4IURA 2A7YA 1ARKA 1U1TA 4II1A 3AHUA 1B34B 3JB9J 2LNHB 1G3WA 2OTLQ
chains in the Genus database with same CATH topology
2C0OA 1BU1A 2GGRA 2DF6A 1GRIA 1UHFA 2GTJA 2L2PA 3NPFA 2KGTA 1IO6A 2J05A 1XOVA 3NGPA 2D8JA 5I22A 3M0SA 2RQTA 2HSPA 2G6FX 1ABQA 1BB9A 2DE0X 2DRKA 1NYGA 4IIOA 2ESWA 2HBWA 2X3XD 1U3OA 2EGAA 2K3BA 2J7IA 1M27C 1FMKA 2J6OA 3EG0A 3VS6A 1JQQA 2CH4W 3EG2A 2O9SA 2J6KA 2CT4A 2GBQA 1M8MA 4HCKA 4JPBW 2RQWA 4DEYA 3UATA 1X43A 1ZUYA 3SEMA 2JW4A 2DL7A 2LZ6B 2O88A 2O2OA 1B3QA 2A08A 2RPNA 4JZ4A 4E6RA 1T0JA 2CDTA 2L0AA 3VS0A 1KJWA 1GFDA 2LQWA 1PKSA 4AG2C 2J6FA 2JM9A 2NWMA 2BZXA 4RTYA 5IHNA 1QLYA 3SHWA 1WI7A 4Z88A 2VKNA 1NM7A 3RNJA 1AVZC 2L3PA 2F2VA 1KSWA 1ZBJA 3VS7A 4JZ3A 1BBZA 3VS1A 2FRYA 1RI9A 1KFZA 3CQTA 2ECZA 2RF0A 2K6DA 1RLQC 3RBBB 2K9GA 1YWOA 2SRCA 2W10A 1OPLA 4OMOA 1WXUA 3FJ5A 2C0TA 2D1XA 1U06A 1ZX6A 3LH5A 4LN2A 2EYWA 3IQLA 1PWTA 2K2MA 2DL5A 1H92A 3EHRA 2YUOA 4F17A 3THKA 2PZ1A 2DJQA 1K0XA 1UE9A 1OOTA 3ZL7C 4RTUA 1VYTA 1A0NB 2W0ZA 2YT6A 1SRMA 2M0YA 3PVLA 4OMQA 1E6HA 1MV0B 1CKBA 1M3CA 3UF4A 1HJDA 1WIEA 2AZSA 1X6GA 2KXDA 2RMOA 3VRYA 1SHGA 3M0PA 4LUEA 4RTZA 2BTTA 4JJCA 2EGCA 2CUBA 4JJDA 4CC7A 1SSHA 2O9VA 1GCQC 2LP5A 2L3SA 2HCKA 3GBQA 1GFCA 2EW3A 2JT4A 3M0RA 1TUCA 1WXTA 1AZEA 2D8HA 3TSZA 2DBMA 2F2WA 1QWEA 3TSWA 1ZSGA 1K9AA 1EFNA 2CH4A 2LJ0A 2LX7A 2EPDA 1JXMA 2FO0A 2JM8A 4CC3A 1ZLMA 2YUPA 4RTTA 2F2XA 1CSKA 2ROTA 4J9BA 2KRSA 3PVQA 1UDLA 4LE9A 5IHIA 1AWOA 1PNJA 1RLPC 2EYXA 1FYNA 4DEXA 4RUGA 5IXBA 2MOXA 2HDAA 2KXCA 3VS5A 2RQRA 2FG0A 5L23A 1SEMA 2DNUA 2ABLA 3I5SA 2P4RA 1G83A 1U5SA 1K76A 4R0KA 1K0SA 1X69A 2K79A 2EGEA 2A28A 3H0FA 4WCIA 4AG1C 4HXJA 1I1JA 1JU5C 1UECA 2DM1A 3ULRB 4JJBA 4CC2A 1T0HA 1MV3A 1W70A 1PKTA 3VS2A 2FPDA 2JMAA 2DVJA 2V1QA 1K4US 1UJYA 4HVWA 1QWFA 1VYVA 2ROLA 1PRLC 1B07A 4FSSA 1OPKA 2YUNA 3EGUA 2PNIA 2DBKA 4HVUA 2VWFA 2CREA 2JMCA 1LCKA 3M0UA 3EHQA 2CT3A 3A98A 2KROA 2AK5A 1VYUA 1Z9QA 1HSQA 5IXFA 1W6XA 2OJ2A 2AKKA 4EIKA 1X2QA 2EKHA 2LJ3A 2V1RA 1NYFA 2I0NA 2DA9A 2KNBB 4J9GA 3R6NA 1X2KA 4Y92A 2M51A 4AFSC 1JO8A 4X1VA 2ED0A 3QWYA 2EBPA 3U23A 1JEGA 1QKXA 1SHFA 1WXBA 1G2BA 2EYZA 3JV3A 2CUDA 1GCQA 4GBQA 4OMNA 1HD3A 2DMOA 2GTOA 1GL5A 2DL3A 4ORZA 3REBB 2K7AA 2RN8A 1I0CA 2O31A 2B86A 2KBTA 1QCFA 3PE0A 4LUDA 4F14A 4OMLA 1GBQA 1AWJA 2LCSA 5IH2A 5ECAA 2FEIA 1NLPC 2GNCA 1WDXA 1RUWA 2KRMA 1AWWA 4LNPA 3REAB 2EYYA 1NEGA 4D8DA 1X27A 2YDLA 2BZ8A 2JS0A 2ED1A 1E7OA 3I9QA 2LQNA 2YUQA 5EC7A 1Y0MA 1S1NA 2KEAA 2H8HA 3KFVA 2DILA 3NMZC 1WYXA 2KR3A 2PTKA 1ZUUA 1UUEA 4QT7A 2JXBA 5IHKA 2IIMA 2J06A 1M3AA 1AWXA 1NLOC 1V1CA 3QWXX 4RTXA 3EG1A 3NHNA 4IIMA 2KE9A 5HCKA 1H3HA 2XMFA 2RQUA 1JXOA 2DL8A 2MCNA 4OMMA 2KYMA 4J9IA 2JTEA 4K11A 3VS3A 1TUDA 1Z9ZA 1AOJA 2VVKA 2E5KA 4Z8AA 4HVVA 3C0CA 1MUZA 4CC4B 2DLPA 2AKLA 1BK2A 1UGVA 2JS2A 4KRTA 4OMPA 3H0HA 1OEBA 2L3QA 1TG0A 2LMJA 1J3TA 2DL4A 4D8KA 1X6BA 4J9DA 2QDLA 3I5RA 1K1ZA 3O5ZA 2DX1A 2KRNA 1WLPB 2ENMA 1T3SA 1T3LA 3TVTA 4GLMA 1SPKA 2EQIA 4ZNXA 1WX6A 1YN8A 2FPEA 2HEQA 5FWBA 1WA7A 2BZYA 3M0QA 1W1FA 4J9CA 2YSQA 1UJ0A 2C0IA 4M4ZA 2A36A 4AFZC 2NUZA 3I35A 4RTVA 5GJVB 2DYBA 4J9EA 1CKAA 2GQIA 1GCPA 3EG3A 5FWCA 4J9FA 1N5ZA 1PHTA 1I07A 1GBRA 2X3WD 2KYBA 4A63B 4ESRA 1E6GA 2CSIA 2AZVA 1H8KA 2FRWA 5I11A 1SRLA 2CSQA 1AEYA 3M0TA 1Y57A 4Z89A 1YCSB 3VS4A 4AFUC 1PRMC 2LJ1A 5FW9A 1WFWA 1AD5A 1UG1A 2KT1A 1QKWA 2OI3A 1YNZA 5GJWB 1M3BA 1OV3A 2D0NA 1KIKA 1UFFA 1VA7A 2DRMA 1NG2A 2RNAA 1M30A 1ZUKA 3H41A 1NEBA 2SEMA 2KT8A 2OAWA 3UA7A 1AZGB 2A37A 2EVRA 4RTWA 2FPFA 3UA6A 1UTIA 3H0IA 1ABOA 1UHCA 1ARKA 2RQVA 4AFQC 4F16A 2MIOA 4J9HA 1YP5A 1YWPA 2LNHB 3VRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C0O A;  1BU1 A;  2GGR A;  2DF6 A;  1GRI A;  1UHF A;  2GTJ A;  2L2P A;  3NPF A;  2KGT A;  1IO6 A;  2J05 A;  1XOV A;  3NGP A;  2D8J A;  5I22 A;  3M0S A;  2RQT A;  2HSP A;  2G6F X;  1ABQ A;  1BB9 A;  2DE0 X;  2DRK A;  1NYG A;  4IIO A;  2ESW A;  2HBW A;  2X3X D;  1U3O A;  2EGA A;  2K3B A;  2J7I A;  1M27 C;  1FMK A;  2J6O A;  3EG0 A;  3VS6 A;  1JQQ A;  2CH4 W;  3EG2 A;  2O9S A;  2J6K A;  2CT4 A;  2GBQ A;  1M8M A;  4HCK A;  4JPB W;  2RQW A;  4DEY A;  3UAT A;  1X43 A;  1ZUY A;  3SEM A;  2JW4 A;  2DL7 A;  2LZ6 B;  2O88 A;  2O2O A;  1B3Q A;  2A08 A;  2RPN A;  4JZ4 A;  4E6R A;  1T0J A;  2CDT A;  2L0A A;  3VS0 A;  1KJW A;  1GFD A;  2LQW A;  1PKS A;  4AG2 C;  2J6F A;  2JM9 A;  2NWM A;  2BZX A;  4RTY A;  5IHN A;  1QLY A;  3SHW A;  1WI7 A;  4Z88 A;  2VKN A;  1NM7 A;  3RNJ A;  1AVZ C;  2L3P A;  2F2V A;  1KSW A;  1ZBJ A;  3VS7 A;  4JZ3 A;  1BBZ A;  3VS1 A;  2FRY A;  1RI9 A;  1KFZ A;  3CQT A;  2ECZ A;  2RF0 A;  2K6D A;  1RLQ C;  3RBB B;  2K9G A;  1YWO A;  2SRC A;  2W10 A;  1OPL A;  4OMO A;  1WXU A;  3FJ5 A;  2C0T A;  2D1X A;  1U06 A;  1ZX6 A;  3LH5 A;  4LN2 A;  2EYW A;  3IQL A;  1PWT A;  2K2M A;  2DL5 A;  1H92 A;  3EHR A;  2YUO A;  4F17 A;  3THK A;  2PZ1 A;  2DJQ A;  1K0X A;  1UE9 A;  1OOT A;  3ZL7 C;  4RTU A;  1VYT A;  1A0N B;  2W0Z A;  2YT6 A;  1SRM A;  2M0Y A;  3PVL A;  4OMQ A;  1E6H A;  1MV0 B;  1CKB A;  1M3C A;  3UF4 A;  1HJD A;  1WIE A;  2AZS A;  1X6G A;  2KXD A;  2RMO A;  3VRY A;  1SHG A;  3M0P A;  4LUE A;  4RTZ A;  2BTT A;  4JJC A;  2EGC A;  2CUB A;  4JJD A;  4CC7 A;  1SSH A;  2O9V A;  1GCQ C;  2LP5 A;  2L3S A;  2HCK A;  3GBQ A;  1GFC A;  2EW3 A;  2JT4 A;  3M0R A;  1TUC A;  1WXT A;  1AZE A;  2D8H A;  3TSZ A;  2DBM A;  2F2W A;  1QWE A;  3TSW A;  1ZSG A;  1K9A A;  1EFN A;  2CH4 A;  2LJ0 A;  2LX7 A;  2EPD A;  1JXM A;  2FO0 A;  2JM8 A;  4CC3 A;  1ZLM A;  2YUP A;  4RTT A;  2F2X A;  1CSK A;  2ROT A;  4J9B A;  2KRS A;  3PVQ A;  1UDL A;  4LE9 A;  5IHI A;  1AWO A;  1PNJ A;  1RLP C;  2EYX A;  1FYN A;  4DEX A;  4RUG A;  5IXB A;  2MOX A;  2HDA A;  2KXC A;  3VS5 A;  2RQR A;  2FG0 A;  5L23 A;  1SEM A;  2DNU A;  2ABL A;  3I5S A;  2P4R A;  1G83 A;  1U5S A;  1K76 A;  4R0K A;  1K0S A;  1X69 A;  2K79 A;  2EGE A;  2A28 A;  3H0F A;  4WCI A;  4AG1 C;  4HXJ A;  1I1J A;  1JU5 C;  1UEC A;  2DM1 A;  3ULR B;  4JJB A;  4CC2 A;  1T0H A;  1MV3 A;  1W70 A;  1PKT A;  3VS2 A;  2FPD A;  2JMA A;  2DVJ A;  2V1Q A;  1K4U S;  1UJY A;  4HVW A;  1QWF A;  1VYV A;  2ROL A;  1PRL C;  1B07 A;  4FSS A;  1OPK A;  2YUN A;  3EGU A;  2PNI A;  2DBK A;  4HVU A;  2VWF A;  2CRE A;  2JMC A;  1LCK A;  3M0U A;  3EHQ A;  2CT3 A;  3A98 A;  2KRO A;  2AK5 A;  1VYU A;  1Z9Q A;  1HSQ A;  5IXF A;  1W6X A;  2OJ2 A;  2AKK A;  4EIK A;  1X2Q A;  2EKH A;  2LJ3 A;  2V1R A;  1NYF A;  2I0N A;  2DA9 A;  2KNB B;  4J9G A;  3R6N A;  1X2K A;  4Y92 A;  2M51 A;  4AFS C;  1JO8 A;  4X1V A;  2ED0 A;  3QWY A;  2EBP A;  3U23 A;  1JEG A;  1QKX A;  1SHF A;  1WXB A;  1G2B A;  2EYZ A;  3JV3 A;  2CUD A;  1GCQ A;  4GBQ A;  4OMN A;  1HD3 A;  2DMO A;  2GTO A;  1GL5 A;  2DL3 A;  4ORZ A;  3REB B;  2K7A A;  2RN8 A;  1I0C A;  2O31 A;  2B86 A;  2KBT A;  1QCF A;  3PE0 A;  4LUD A;  4F14 A;  4OML A;  1GBQ A;  1AWJ A;  2LCS A;  5IH2 A;  5ECA A;  2FEI A;  1NLP C;  2GNC A;  1WDX A;  1RUW A;  2KRM A;  1AWW A;  4LNP A;  3REA B;  2EYY A;  1NEG A;  4D8D A;  1X27 A;  2YDL A;  2BZ8 A;  2JS0 A;  2ED1 A;  1E7O A;  3I9Q A;  2LQN A;  2YUQ A;  5EC7 A;  1Y0M A;  1S1N A;  2KEA A;  2H8H A;  3KFV A;  2DIL A;  3NMZ C;  1WYX A;  2KR3 A;  2PTK A;  1ZUU A;  1UUE A;  4QT7 A;  2JXB A;  5IHK A;  2IIM A;  2J06 A;  1M3A A;  1AWX A;  1NLO C;  1V1C A;  3QWX X;  4RTX A;  3EG1 A;  3NHN A;  4IIM A;  2KE9 A;  5HCK A;  1H3H A;  2XMF A;  2RQU A;  1JXO A;  2DL8 A;  2MCN A;  4OMM A;  2KYM A;  4J9I A;  2JTE A;  4K11 A;  3VS3 A;  1TUD A;  1Z9Z A;  1AOJ A;  2VVK A;  2E5K A;  4Z8A A;  4HVV A;  3C0C A;  1MUZ A;  4CC4 B;  2DLP A;  2AKL A;  1BK2 A;  1UGV A;  2JS2 A;  4KRT A;  4OMP A;  3H0H A;  1OEB A;  2L3Q A;  1TG0 A;  2LMJ A;  1J3T A;  2DL4 A;  4D8K A;  1X6B A;  4J9D A;  2QDL A;  3I5R A;  1K1Z A;  3O5Z A;  2DX1 A;  2KRN A;  1WLP B;  2ENM A;  1T3S A;  1T3L A;  3TVT A;  4GLM A;  1SPK A;  2EQI A;  4ZNX A;  1WX6 A;  1YN8 A;  2FPE A;  2HEQ A;  5FWB A;  1WA7 A;  2BZY A;  3M0Q A;  1W1F A;  4J9C A;  2YSQ A;  1UJ0 A;  2C0I A;  4M4Z A;  2A36 A;  4AFZ C;  2NUZ A;  3I35 A;  4RTV A;  5GJV B;  2DYB A;  4J9E A;  1CKA A;  2GQI A;  1GCP A;  3EG3 A;  5FWC A;  4J9F A;  1N5Z A;  1PHT A;  1I07 A;  1GBR A;  2X3W D;  2KYB A;  4A63 B;  4ESR A;  1E6G A;  2CSI A;  2AZV A;  1H8K A;  2FRW A;  5I11 A;  1SRL A;  2CSQ A;  1AEY A;  3M0T A;  1Y57 A;  4Z89 A;  1YCS B;  3VS4 A;  4AFU C;  1PRM C;  2LJ1 A;  5FW9 A;  1WFW A;  1AD5 A;  1UG1 A;  2KT1 A;  1QKW A;  2OI3 A;  1YNZ A;  5GJW B;  1M3B A;  1OV3 A;  2D0N A;  1KIK A;  1UFF A;  1VA7 A;  2DRM A;  1NG2 A;  2RNA A;  1M30 A;  1ZUK A;  3H41 A;  1NEB A;  2SEM A;  2KT8 A;  2OAW A;  3UA7 A;  1AZG B;  2A37 A;  2EVR A;  4RTW A;  2FPF A;  3UA6 A;  1UTI A;  3H0I A;  1ABO A;  1UHC A;  1ARK A;  2RQV A;  4AFQ C;  4F16 A;  2MIO A;  4J9H A;  1YP5 A;  1YWP A;  2LNH B;  3VRZ A; 
#chains in the Genus database with same CATH topology
 2C0O A;  1BU1 A;  1PSE A;  2GGR A;  5GAN 8;  2GTJ A;  1MHN A;  3C4S A;  2L2P A;  4M7A D;  1IO6 A;  4A4G A;  1FWZ A;  3H9N A;  1OX8 A;  4JDS A;  2COY A;  3JCM X;  2DYI A;  1ZQ1 A;  3RER A;  3OS5 A;  2IG0 A;  1FMK A;  4C8Q E;  2ZPB B;  3VS6 A;  3EG2 A;  1B7T A;  2EIF A;  4HCB A;  4DBQ A;  4JPB W;  4J6Y A;  4XU3 A;  1X43 A;  1ZUY A;  4M7D C;  4C92 C;  2XDB A;  2LZ6 B;  4R56 A;  2CDT A;  3VS0 A;  5CVI A;  1FXX A;  4IUP A;  1D1B A;  2LQW A;  3JCM J;  5A2Q E;  1AVZ C;  4E47 A;  1KSW A;  4LD9 K;  2BIV A;  4JZ3 A;  1Q81 U;  3ME9 A;  1B34 A;  1RI9 A;  3J80 E;  2DD4 A;  3M59 A;  2ZAE A;  1RAI B;  2K6D A;  4PJM A;  4MDX A;  1VIF A;  1W2B S;  5GAO m;  3RKX A;  5KE3 A;  4BI8 B;  2HMA A;  1U06 A;  1KQS S;  1W2B A;  2E1H A;  2EYW A;  2DXT A;  3IQL A;  1WQW A;  1WHG A;  3PIP A;  4XU2 A;  4B6M A;  4ANJ A;  1X6O A;  2GF7 A;  3M58 A;  1RL2 A;  3ZL7 C;  4RTU A;  1D0Y A;  1VYT A;  2RHU A;  1A0N B;  2K57 A;  1SRM A;  2L5Q A;  4BE2 A;  3CCQ T;  2M1H A;  2L3R A;  3CC2 T;  3EAE A;  3HFN A;  3UF4 A;  2EYQ A;  1HJD A;  2RMO A;  3VRY A;  3M0P A;  1RAB B;  4LUE A;  2YRD A;  1KD1 R;  4OF1 A;  2JTM A;  3A1P A;  3JCM e;  4JJC A;  2EGC A;  1SKU B;  2CUB A;  4DBR A;  2L3S A;  3JCM W;  2HCK A;  4F7U E;  4ELY C;  2R58 A;  1TUC A;  2RA2 A;  2CP6 A;  1IHW A;  1ZSZ C;  2ZPE B;  3TSZ A;  3G71 T;  3BE3 A;  2DBM A;  3FEO A;  1YIJ A;  1M90 C;  3CCM A;  4P5N A;  2NLU A;  4TVR A;  5HKC A;  1IB8 A;  1JXM A;  2FO0 A;  1WJR A;  4DA4 A;  3D7S B;  2YUP A;  4L5G A;  4XTU A;  5C0M A;  3OYF A;  4M78 D;  3CCM Q;  2KRS A;  3PVQ A;  5CIU A;  1AWO A;  1VQP T;  3CPF A;  2LTO A;  2M9U A;  2MOX A;  5LJ5 g;  4FL6 A;  1TU0 B;  2RQR A;  5GAM f;  3GP8 A;  1Q86 C;  1KK7 A;  3C94 A;  3LWH A;  3I5S A;  4J8O A;  1NE8 A;  2A3L A;  2NUT B;  3FJP A;  2BE7 D;  2HAX A;  4IKF A;  1QP3 A;  2K79 A;  2RK1 A;  3H0F A;  2JUF A;  1YIT Q;  2DO3 A;  1UEC A;  3CCV T;  3ULR B;  4FT4 A;  1RAC B;  3OYI A;  1PKT A;  2KK4 A;  3UPU A;  5KCO A;  2WSF E;  3JB9 D;  4PJO B;  2V26 A;  3J7A F;  2VB6 A;  4OB2 B;  2OTL T;  3RKY A;  3CME A;  1G3Y A;  2CZ7 B;  2WSC E;  4AMC A;  1K73 U;  2PNI A;  1WPY A;  4HVU A;  2MI6 A;  3CME Q;  1BCO A;  1LCK A;  4MML A;  2RK2 A;  2CT3 A;  3OYM A;  2AK5 A;  3CCJ A;  1Z9Q A;  1RAF B;  3OBY A;  3HL8 A;  2X4J A;  5IXF A;  2AKK A;  4EIK A;  2DJZ A;  3OS1 A;  3CCJ Q;  5FU6 C;  1YBY A;  1X2K A;  4Y92 A;  2RJE A;  2LCL A;  2O4X B;  3CPW A;  2XID A;  2NUT A;  4FW1 A;  1SHF A;  1RI0 A;  2ZCF B;  1BYM A;  2EYZ A;  5GAO p;  2K5F A;  3BW1 A;  3P8H A;  4M7A F;  1H3Z A;  3I55 A;  3BFM A;  1GL5 A;  1S72 T;  4DBF A;  3DLM A;  2DEQ A;  4C5I A;  1MMA A;  4ORZ A;  4PJO A;  1PCX A;  3I55 Q;  4M7D E;  2RN8 A;  2Y4Y A;  4OB1 B;  5AT1 B;  4M77 D;  3PE0 A;  2M02 A;  4C92 E;  3OYA A;  3GOX A;  4ZTF A;  1Q81 C;  1K9M U;  1NLP C;  3CCS T;  4PJL A;  3VUZ A;  3FDR A;  2E10 A;  3REA B;  2VGM A;  4B9X A;  1NEG A;  4N0A A;  4L59 A;  4BD3 A;  2ZPG B;  4PKC C;  1TSF A;  2O4X A;  3MP6 A;  4J7I A;  3KFV A;  3VUB A;  4XK8 E;  4QT7 A;  1RAG B;  1VQ8 A;  2RHI A;  2IIM A;  2J06 A;  2JJ9 A;  1EX4 A;  2QA4 A;  5CKB A;  3HTR A;  3OYH A;  1Y7X A;  5KYY B;  1V1C A;  5LJ5 d;  3QWX X;  1VQ8 Q;  4RTX A;  2LQ8 A;  1K8A R;  3NHN A;  1G3T A;  2QA4 Q;  2RQU A;  2DL8 A;  4E2F B;  2EQM A;  4M75 B;  4K11 A;  2XD0 A;  1AOJ A;  2M16 A;  4Z8A A;  4PJJ A;  4HVV A;  2DLP A;  2OTJ A;  4OMP A;  2ZPH B;  3H0H A;  1YJN T;  1J3T A;  2DL4 A;  3CCM T;  2EAY A;  1OZ2 A;  2OTJ Q;  1M1K R;  2QDL A;  1BI2 A;  3I5R A;  4OGE A;  4BDY A;  3O5Z A;  4A53 A;  5I21 A;  2DX1 A;  2KRN A;  3VKI A;  3JCM f;  5HK3 A;  3OYD A;  4C8Q D;  2EQI A;  4ZNX A;  3NTK A;  1UGS B;  5LJ5 h;  1WA7 A;  4YTL A;  1YIT T;  2A36 A;  4AFZ C;  4RTV A;  6AT1 B;  3QUI A;  4MZT A;  2DYB A;  1TS9 A;  3M57 A;  1GCP A;  4IUV A;  1WZO A;  1N5Z A;  4LD6 A;  2X3W D;  3HPW A;  5CCA A;  1Q7Y C;  4M78 E;  1QCN A;  3GNF B;  4FYX B;  2CSQ A;  2OX7 A;  1Y57 A;  3VS4 A;  1EZZ B;  1WFW A;  4M75 A;  4OGC A;  1YNZ A;  3PFS A;  3CME T;  4KGZ B;  4FU6 A;  2K3Y A;  5GMK m;  1K73 C;  2X35 A;  4EMK B;  1RAH B;  2VXE A;  2NUP B;  1JJ2 P;  5FU7 B;  3M53 A;  2DAQ A;  1QVF A;  2HD0 A;  3H41 A;  2OAW A;  2HKQ B;  3OMG A;  4XU0 A;  1AZG B;  2A37 A;  1R77 A;  2FPF A;  3SWN C;  4F04 B;  5GAO n;  1ABO A;  2DK3 A;  1UHC A;  1ZBX A;  2RQV A;  1N27 A;  1RAE B;  2LQK A;  2MIO A;  2QGG A;  4F16 A;  3P8B B;  4QQD A;  2MAM A;  3VRZ A;  1VQO T;  1UHF A;  4B9W A;  3QDR B;  3OBW A;  3NPF A;  4J6X A;  2E4H A;  2J05 A;  1XOV A;  1R8O B;  2X4X A;  1RAD B;  3M0S A;  1KHI A;  1ABQ A;  3I55 T;  3MJX A;  4J7F A;  4E7J A;  2DRK A;  1NYG A;  1XQH A;  2K2V A;  3HRT A;  5CO7 A;  5GAO l;  2K3B A;  3TU4 K;  4IUT A;  2CH4 W;  2X4W A;  1UGQ B;  2J6K A;  4LDU A;  4HCK A;  3MP8 A;  4NL2 A;  5CKH A;  3N5B B;  2QQA A;  3G1J A;  4EMK A;  2JW4 A;  1M2V B;  1I5L A;  1K9M C;  4Z02 A;  2O88 A;  1B3Q A;  2IVW A;  1N8R R;  5FRM A;  2NUP A;  2L0A A;  1KJW A;  1OUL A;  4LXC A;  2H3J A;  1FMV A;  1PKS A;  2QI2 A;  1HXD A;  2KMT A;  1WI7 A;  4Z88 A;  1OU9 A;  4UC4 A;  3RNJ A;  3MPU B;  2F2V A;  4C0F A;  1ZBJ A;  3VS7 A;  1BBZ A;  3VS1 A;  3OSS C;  4M77 F;  5KH6 A;  2RF0 A;  1RLQ C;  3RBB B;  2SRC A;  2W10 A;  1WXU A;  2HKN A;  4E7L A;  1VQ8 T;  4LN2 A;  1F1B B;  2QA4 T;  2CS7 A;  5GAN 3;  1VQP A;  5GAM j;  4A4K A;  2RM4 A;  3THK A;  1QVG S;  1C6V X;  2DJQ A;  2E41 A;  5GMK e;  4LDW A;  1VQP Q;  2Y4X A;  2YT6 A;  3Q1J A;  3PVL A;  1HYO A;  2QTX A;  1M2V A;  2F1L A;  1WHK A;  1O75 A;  3ZFJ A;  3ZEH A;  2OTJ T;  4F7U G;  3MEU A;  1CKB A;  1M3C A;  4Q5W A;  3CCV A;  4V2S A;  2KXD A;  4X9C A;  3JRZ A;  3OYB A;  2VGN A;  2GFA A;  3PGG A;  4RTZ A;  5CAI A;  1KC8 U;  4CC7 A;  1IGU A;  4JJD A;  1SSH A;  2O9V A;  1TXQ A;  3GBQ A;  3CC4 T;  3EGX B;  1GFC A;  1KD1 U;  2JT4 A;  5IT9 E;  3M0R A;  4HCZ A;  4PJO C;  3JB9 H;  5GAN 7;  2D8H A;  2EFI A;  1EFN A;  3BY7 A;  1DJ7 B;  2LJ0 A;  2EPD A;  1JRI A;  3CEY A;  4CC3 A;  1BI1 A;  5CKE A;  2KSS A;  3EFO B;  1G3S A;  1MGQ A;  3HRS A;  4FYW B;  1WGS A;  1RLP C;  4N0A C;  4DEX A;  5IXB A;  4BAC A;  5FRN A;  4M7D D;  3VS5 A;  5M9O A;  4MZM A;  4C92 D;  4C8Q F;  2KY9 A;  2DNU A;  3INZ A;  3BDL A;  1NJI U;  2RI2 A;  3L2Q A;  4C0G A;  1K0S A;  2A28 A;  4AG1 C;  4WCI A;  3OYE A;  1JU5 C;  2R57 A;  3EGD A;  2DM1 A;  2X4Y A;  3SWN B;  1W70 A;  3BDU A;  1S72 A;  3JCM P;  4FYV B;  4LDV A;  1HK9 A;  4KGV B;  3EFR A;  1UJY A;  4HCC A;  1QWF A;  4ZN3 A;  3EGX A;  4WF2 A;  1W4S A;  1S72 Q;  4KGX B;  1PRL C;  2DBK A;  2E3H A;  1QVG P;  3DB4 A;  3MEW A;  3X20 B;  3CCS A;  1KG1 A;  1PM3 A;  3V7R A;  3EFO A;  8ATC B;  3CCS Q;  2OJ2 A;  2MWO A;  1LVK A;  3MKD A;  2QQS A;  1U1S A;  4M7A G;  2I0N A;  4LDX A;  4J9G A;  4O6J A;  3EG9 B;  1D0X A;  2P4T A;  2CYZ B;  2K3X A;  2ED0 A;  1PSF A;  1I8F A;  4ZGD B;  1JEG A;  1FMW A;  4PJN A;  3JCM c;  4M7D G;  1WXB A;  2P0Q A;  1G2B A;  2RHX A;  1OX9 A;  5GAM d;  2CUD A;  1GCQ A;  3MP1 A;  3SWN A;  4OMN A;  1HD3 A;  2ZPI B;  3OSV A;  2EJ9 A;  3FC3 A;  2DL3 A;  2C06 A;  1IRE B;  3JAM E;  3REB B;  4WTO B;  2K7A A;  1I0C A;  2B86 A;  4O5V A;  4LUD A;  4F14 A;  3L1A A;  2CZ6 B;  5DLO A;  4BY6 B;  2G3R A;  3M4Y A;  4F7U F;  1AT1 B;  4PFZ A;  1PC0 A;  5KE2 A;  4M75 C;  5GAN f;  5IH2 A;  5ECA A;  2CP0 A;  2X9H A;  1YJN A;  3QKJ A;  2GNC A;  2P0K A;  1WDX A;  2KRM A;  1SG5 A;  2FHD A;  5GAO r;  1YJN Q;  4D8D A;  3CD6 T;  1X27 A;  2YDL A;  4MDW A;  3PMI A;  2JS0 A;  4EMH A;  2K4Y A;  5GAM h;  2P84 A;  4IUQ A;  1SF9 A;  5EC7 A;  1Y0M A;  4FIB A;  5HK0 A;  2KDS A;  3EG9 A;  5LJ5 e;  1SSF A;  2H8H A;  1I81 A;  2RJD A;  1V29 B;  1YIT A;  2PTK A;  3UT1 A;  4HT9 A;  2CP2 A;  4DOV A;  2JXB A;  1WNL A;  5LJ3 f;  4HA8 A;  1Q7Y U;  3WXM B;  1X75 C;  2RI5 A;  1VOM A;  3CCL A;  4E7I A;  4IIM A;  4QKU A;  1W2B P;  4BDZ A;  1KC8 C;  4OMM A;  3LH0 A;  5CR2 A;  4N4G A;  2JTE A;  1KQS P;  3CCL Q;  2V8I A;  1TUD A;  1C1A A;  1KHC A;  2VVK A;  3VYG A;  1KD1 C;  3C0C A;  3E19 A;  1UGV A;  2JS2 A;  2QEX A;  4OVA A;  1YFN A;  3G6E T;  2LMJ A;  3X26 B;  4QVZ A;  4EMK C;  1Q81 R;  5GMK l;  2BE9 B;  2WSE E;  2QEX Q;  1IRX A;  3JB9 I;  1OZ3 A;  2E6N A;  4GLK A;  4NS5 A;  5FU7 C;  3RIR A;  9ATC B;  4PJO E;  4RG2 A;  3MCA B;  1T3L A;  3NTH A;  1NZ9 A;  3TVT A;  3L2W A;  1QW1 A;  4M78 G;  1TTH B;  2HEQ A;  2XIC A;  3CPW S;  2BZY A;  3S3N A;  1W1F A;  1N9S A;  1UJ0 A;  1VQO A;  2XU8 A;  3RMS A;  2NUZ A;  4KH1 B;  1TOV A;  2OAU A;  1NJI C;  4J9E A;  2GQI A;  4M7A B;  3EG3 A;  1OI1 A;  1PHT A;  2VXF A;  2KYB A;  5EG2 A;  1VQO Q;  2AZV A;  2DER A;  1H8K A;  2E70 A;  2FRW A;  1SRL A;  3A8G B;  3C95 A;  1BIA A;  3TQ7 P;  3OW2 A;  3KBG A;  1YCS B;  4VUB A;  4XTW A;  3SDZ A;  2LJ1 A;  3FLG A;  2KT1 A;  5KYW B;  1R0C B;  4PFP A;  1UEB A;  2Y90 A;  2LX9 A;  4M7D F;  3G7Z A;  2DD5 A;  4C92 F;  2RJF A;  3JB9 G;  2D0N A;  1YJ9 A;  3PIO A;  2DTO A;  3E2U A;  2QAZ A;  4J83 A;  3SFM A;  2RB6 A;  2RNA A;  1M30 A;  1ZUK A;  3CXC A;  1YJ9 Q;  2SEM A;  2KT8 A;  2FZG B;  3UA7 A;  4A4F A;  2GQV A;  3UA6 A;  1UTI A;  4FCY A;  5KYX B;  4KUD K;  3EFS A;  2FYK A;  3L2R A;  1GXI E;  3LGL A;  1XNI A;  2QQR A;  2LC4 A;  2RI3 A;  5CKF A;  2DF6 A;  1GRI A;  3QBY A;  3ZBD A;  3JCM d;  4M7A A;  2KAF A;  2XK0 A;  2G6F X;  4IUU A;  5D6X A;  3V8K A;  1VQM A;  2ZGW A;  1LJO A;  3ASK A;  2HBW A;  2FZK B;  1U3O A;  2RH2 A;  4JLI A;  5KYW A;  2J6O A;  2O9S A;  1VQM Q;  1JJ2 A;  2CT4 A;  2GBQ A;  1M8M A;  3E9G A;  4DEY A;  3UAT A;  2JNG A;  3M4G A;  2NYS A;  3SEM A;  4RMO A;  1C0M A;  3H6Z A;  2LT1 A;  3TCJ A;  4ZN1 A;  3CPW P;  4M77 G;  2DIQ A;  1ZA2 B;  1WHL A;  2EWN A;  1N9R A;  4J5Y A;  4C0Z A;  2JZ2 A;  3CMA A;  4AG2 C;  1VQ5 A;  2JM9 A;  1IGQ A;  1K73 R;  3JCM h;  2NWM A;  2BZX A;  4RTY A;  1QLY A;  2YLB A;  5KYX A;  2YHT A;  2L3P A;  3CMA Q;  3CC4 A;  1VQ5 Q;  4M75 E;  3QII A;  2FRY A;  2ECZ A;  3CCR T;  1QVP A;  2RHZ A;  3CC4 Q;  2K9G A;  3UWN A;  1YWO A;  1OPL A;  2QDY B;  2VV5 A;  3FJ5 A;  2WAC A;  4BB7 A;  4KUL A;  2C0T A;  3OYK A;  1ZHI A;  1VQ7 T;  2D1X A;  4QQG A;  1ZX6 A;  2HL3 A;  3I56 A;  3HHT B;  2DL5 A;  2QK0 A;  5KCH A;  3ER0 A;  4M78 F;  1PD1 A;  1TH7 A;  3CCL T;  2YUO A;  4F17 A;  3I56 Q;  2PZ1 A;  5DY9 A;  1M9S A;  1RAA B;  3LGF A;  1UE9 A;  2ZPF B;  5LJ5 f;  4OMQ A;  1FX7 A;  3CC7 T;  2VAS A;  3M55 A;  2BUD A;  4A54 A;  1YJW A;  1I5O B;  3OQ5 A;  1IZ6 A;  2QEX T;  1WIE A;  2AZS A;  5I2S A;  1QVF S;  1X6G A;  5DLQ E;  4E7S A;  1Q82 U;  1SHG A;  1YJW Q;  5IN1 A;  2JTF A;  2AIR B;  1K9M R;  3MEV A;  2E6Z A;  1M1G A;  2BTT A;  3VU3 C;  1GCQ C;  2LP5 A;  3RR6 A;  2I2L A;  3WVE B;  3P8D A;  2EW3 A;  2HBP A;  3JB9 F;  4QW2 A;  2XKO C;  1WXT A;  4JS5 A;  3OS2 A;  5CK9 A;  3PT9 A;  1QWE A;  3TSW A;  4ZGE B;  1ZSG A;  5CQY A;  2HQH A;  4C8Q G;  3PTA A;  3OYJ A;  2QAS A;  1ZLM A;  3M56 A;  2QXF A;  2F2X A;  2ROT A;  4J9B A;  3TRE A;  3H8Z A;  3SD4 A;  2EYX A;  1WHJ A;  1FYN A;  2YXY A;  2DVE A;  2HDA A;  1YCY A;  2DXB A;  2FG0 A;  1SEM A;  1G83 A;  1U5S A;  3QJY A;  2KI7 A;  2K5L A;  1QMC A;  4R0K A;  1X69 A;  2Z0W A;  3PMT A;  2COZ A;  1YJ9 T;  4HXJ A;  4E7Z A;  1I1J A;  1VQ4 T;  4BI3 A;  2M0O A;  2FL7 A;  1VIE A;  4CC2 A;  1T0H A;  3RUX A;  4XQ3 A;  2FPD A;  2EKO A;  1MMG A;  4Y28 E;  3LYI A;  1BIB A;  4BE1 A;  2E12 A;  2V1Q A;  1K4U S;  4KH0 B;  4ZGJ B;  5GAN 4;  5L8R E;  1VYV A;  1BI3 A;  4N4H A;  5GAN j;  1OPK A;  2YUN A;  2ZZD A;  3EGU A;  2P0P A;  1Y71 A;  2FZC B;  2VWF A;  2CRE A;  3UDC A;  4BY6 C;  2DTH A;  2EQK A;  3GNG A;  2DET A;  5J39 A;  4RCC A;  4OB3 B;  2QG9 B;  1HSQ A;  3CD6 A;  1NPP A;  4C5E A;  1X2Q A;  2EKH A;  5GAM e;  2LJ3 A;  2V1R A;  1VQM T;  1WJQ A;  1QVF P;  5GAM g;  1G5V A;  3CD6 Q;  3R6N A;  1M8V A;  2M51 A;  3DKM A;  3LW5 E;  2DIG A;  3FB9 A;  2MWP A;  3U23 A;  5LJ3 j;  2XG8 D;  1XJW B;  2R5A A;  1X01 A;  3MET A;  5FRO A;  4GBQ A;  3EGD B;  3JCM Q;  3CMA T;  2E64 A;  1VQ5 T;  4PJO D;  1PD0 A;  3DLL A;  4PNO A;  1U8R A;  4M77 A;  5GMK j;  2O31 A;  4FYY B;  4OML A;  3WVD B;  3PNW C;  1Y07 A;  2LCS A;  2CGH A;  2DPP B;  3V8J A;  2FEI A;  4OB0 B;  1MMD A;  3G6E A;  2VC8 A;  2RJC A;  1RUW A;  2KVQ G;  2JN0 A;  3NTI A;  1D09 B;  3I56 T;  3G6E Q;  2CP5 A;  2MPX C;  8AT1 B;  2BZ8 A;  2EJG A;  1YI2 A;  3M5A A;  4CI0 C;  4LDY A;  2LQN A;  2YUQ A;  4C8Q B;  5GAN 2;  2E3I A;  3LLR A;  2KEA A;  1OYX A;  1YI2 Q;  4DBH A;  1WHH A;  4JRP A;  3L2Z A;  4GY5 A;  1WYX A;  2KR3 A;  3OA6 A;  3QHS A;  2PUO B;  3VV0 A;  4FSX A;  3M9Q A;  5IHK A;  3QJ6 A;  1YJW T;  2DEU A;  1M3A A;  2L89 A;  2F5K A;  1AWX A;  3A8M B;  5GMK i;  4M7A C;  5LL6 S;  3X25 B;  1Q82 C;  3EG1 A;  5HCK A;  4EDU A;  2KYM A;  4J9I A;  4A4E A;  1PG5 B;  3VS3 A;  1Z9Z A;  2COW A;  2E5K A;  4PJO G;  1BK2 A;  4KRT A;  1JB0 E;  1OEB A;  1MND A;  2XHC A;  1XTD A;  2QQB A;  3OMC A;  2XDP A;  4R55 A;  1X6B A;  4XAX B;  4JRQ A;  2CP7 A;  4J9D A;  1K1Z A;  5GAN d;  2DZC A;  2HZY A;  1WLP B;  1T3S A;  1M90 R;  1ACM B;  3SB2 A;  4C8Q A;  4GLM A;  1WX6 A;  2FPE A;  3M0Q A;  4J9C A;  5AYF A;  2YSQ A;  2C0I A;  3NFC A;  3A5Z B;  4M4Z A;  2YLC A;  1Q95 G;  3GIB A;  3F70 A;  1CKA A;  4C5G A;  2CZ1 B;  5FWC A;  3OYL A;  3OYY A;  3CCE T;  4FM4 B;  1GBR A;  2DTI A;  2QYZ A;  3V7C A;  4C92 G;  1E6G A;  2CSI A;  5I2M A;  1LNX A;  1KQS A;  4D6W A;  5I11 A;  1Q86 R;  4C0D B;  1AEY A;  2B8A A;  4Z89 A;  3CBM A;  1UGP B;  4NOY A;  5LJ3 d;  1AD5 A;  3RES A;  1UG1 A;  1UB4 A;  4F7U B;  1QKW A;  4M75 D;  1M2O A;  2OI3 A;  3CBP A;  5GAN h;  3EH1 A;  2KQW A;  1UFF A;  2LRQ A;  1KC8 R;  4KT0 E;  1IXD A;  2A0F B;  2DXU A;  2QGF B;  1NG2 A;  2D0Q B;  2BKD N;  2LNV A;  3JCM b;  1NEB A;  3G4S A;  3S6W A;  3JCM g;  4RTW A;  2DZ9 A;  3MO8 A;  2DXC A;  5A0D A;  3H0I A;  3G4S Q;  4A4H A;  4AFQ C;  2EQJ A;  4J9H A;  1YP5 A;  5J3B A;  1YWP A;  3CCR A;  1I4K 1;  5D7U A;  1P92 A;  2XI9 A;  2AT1 B;  5LJ3 h;  1M1F A;  2HL5 C;  3OYG A;  3JCM V;  4BI4 A;  3QDF A;  1D1A A;  2E65 A;  2KGT A;  3V8L A;  2PQW A;  3CCR Q;  4XTV A;  1D0Z A;  1VQ7 A;  1MMN A;  3NGP A;  2MK5 A;  1YIJ Q;  2D8J A;  5I22 A;  2HSE B;  2RQT A;  5CQX A;  1VQK A;  2HSP A;  1BB9 A;  2DE0 X;  1VQ7 Q;  2RHY A;  3L42 A;  4IIO A;  2ESW A;  1NJI R;  4QVC A;  4M78 C;  2X3X D;  2EGA A;  5LJ5 j;  2J7I A;  1M27 C;  1VQK Q;  3EG0 A;  4F7U A;  5GMK h;  1JQQ A;  2AHJ B;  1D3B B;  1G8X A;  2RQW A;  3QG1 A;  4ELZ C;  1TUG B;  3FIF A;  3M54 A;  3CC7 A;  1K8A U;  2DL7 A;  4X9D A;  3A8L B;  4PLL A;  4QVD A;  2ATC B;  1KQ1 A;  2A08 A;  2O2O A;  2RPN A;  4M75 G;  4JZ4 A;  5DM7 R;  4E6R A;  1T0J A;  3CC7 Q;  2V8J A;  1GFD A;  2J6F A;  4N4I A;  4MZP A;  5IHN A;  3SHW A;  2VKN A;  1NM7 A;  2LT4 A;  3E1S A;  1VUB A;  3RKW A;  2MYS A;  5FLX E;  1YI2 T;  4PJO F;  1M1K U;  3HP9 A;  7AT1 B;  3CQT A;  1KFZ A;  3GPL A;  4EPC A;  4ME7 A;  2V8K A;  1BKB A;  1BCM A;  4OMO A;  2RO0 A;  2LDM A;  2CP3 A;  4OP0 A;  2DFU A;  3S3O A;  1M5Q 1;  3LH5 A;  3A8O B;  3OW2 S;  1PWT A;  2K2M A;  4RKU E;  1H92 A;  2CKK A;  3OY9 A;  3EHR A;  1AHJ B;  4JS4 A;  4Y91 A;  4RCB A;  4M7D B;  1K0X A;  4C92 B;  1D3B A;  1OOT A;  2W0Z A;  2X51 A;  2M0Y A;  4XTZ A;  4JRI A;  1JBM A;  4M7A E;  1E6H A;  3O8V A;  3GF5 A;  1MV0 B;  2H3E B;  3JSC A;  1VQ4 A;  1H64 1;  3CXC S;  1VQ9 A;  3MEA A;  4BUG A;  2QTV A;  2DKG A;  1TWB A;  2JVV A;  1R0B G;  2GCX A;  4NL3 A;  1VQ4 Q;  4RG8 A;  1VQ9 Q;  4FW2 A;  5J26 A;  2RD1 A;  2FB7 A;  1WQ7 A;  4L6V 5;  1AZE A;  4M77 C;  2PU9 B;  2F2W A;  3QZ9 B;  4E7H A;  1K9A A;  3RMQ A;  2CH4 A;  2LX7 A;  4BE0 A;  2JM8 A;  5IAY A;  4RTT A;  4PLI A;  1CSK A;  1UDL A;  4LE9 A;  5IHI A;  2VYT A;  4KBM B;  1PNJ A;  1OQK A;  3EH2 A;  3E9F A;  4RUG A;  4C5H A;  4M7D A;  5A0L A;  2KXC A;  1JJ2 S;  4PK4 A;  4C92 A;  5L23 A;  3VJP A;  1Q7Y R;  2ABL A;  2P4R A;  5D6W A;  1YHQ A;  3C12 A;  1VQN A;  1K76 A;  2EGE A;  2IPO B;  1YHQ Q;  1VQN Q;  3TEE A;  4JJB A;  1MV3 A;  3VS2 A;  3G4S T;  2JMA A;  3OS0 A;  3A8H B;  5GAO q;  2DVJ A;  3LX7 A;  4XU1 A;  4AT1 B;  1N8R U;  1ZSZ B;  4HVW A;  3S3M A;  3HKS A;  1MNE A;  3FRN A;  3OW2 P;  2ROL A;  1VQL A;  3QO3 A;  1B07 A;  4FSS A;  4M75 F;  4XTY A;  3CCU A;  2YWW A;  1LPL A;  1LOJ A;  1YIJ T;  3LWI A;  2JMC A;  3M0U A;  1VQL Q;  3EHQ A;  3A98 A;  2EQU A;  2KRO A;  1VQ6 A;  3CCU Q;  1VYU A;  4M78 B;  1W6X A;  1WHM A;  1VQK T;  5KYN A;  1VQ6 Q;  2L8D A;  5CKD A;  4JLG A;  4JJN K;  3CXC P;  1NYF A;  2DA9 A;  2KNB B;  3DB3 A;  3MHX A;  4HT8 A;  4AFS C;  2MMP A;  2HQX A;  1JO8 A;  4FT2 A;  2JOY A;  3VYH B;  4X1V A;  3QPH A;  3QWY A;  2EBP A;  3QYH B;  4C8Q C;  1QKX A;  4EMG A;  2HQE A;  1K8A C;  3X24 B;  3L2U A;  3JV3 A;  4JRK A;  1NBE B;  2XDD A;  5KYY A;  2DMO A;  2GTO A;  1N6A A;  1IHV A;  2R5M A;  1NPR A;  2K5I A;  2YRV A;  5KYU B;  1ZSZ A;  4E7K A;  1Y96 B;  2KBT A;  2YRC A;  5D6Y A;  1QCF A;  1GBQ A;  3OYC A;  1M1K C;  4QQ6 A;  4PFO A;  1AWJ A;  5GAN 6;  2EJF A;  2D9T A;  2CZ0 B;  4XTX A;  2LVM A;  3J81 E;  1AWW A;  3CCJ T;  4LNP A;  2EYY A;  2MF2 A;  5FU6 B;  4M78 A;  1QCO A;  1BI0 A;  1UGR B;  2ED1 A;  1KQ2 A;  1E7O A;  3I9Q A;  1S1N A;  1ZA1 B;  4HKE A;  5HY6 A;  2DIL A;  3NMZ C;  3HFO A;  1ZUU A;  3T9N A;  3L2V A;  4X34 A;  1UUE A;  4OMF B;  2F69 A;  3CCE A;  3QYG B;  2GFU A;  1NLO C;  1VQ9 T;  1V76 A;  3OB9 A;  3CCE Q;  4ATO A;  3CBO A;  2VUB A;  5GAN 5;  1QQJ A;  2KE9 A;  1H3H A;  2XMF A;  3QXE B;  3KUF A;  5KYU A;  1JXO A;  2MCN A;  1Y96 A;  4C0D C;  2HNI A;  2PVG B;  4M77 B;  5GAN e;  5GAN g;  3R6O A;  1MUZ A;  3CCQ A;  4CC4 B;  3CC2 A;  2AKL A;  2PVD B;  2L3Q A;  1TG0 A;  4D8K A;  3CCQ Q;  3OYN A;  3CC2 Q;  4J6W A;  3KXT A;  3X28 B;  3QZ5 B;  1O9S A;  2ENM A;  4PL6 A;  4M77 E;  1M4Z A;  5C6S A;  2PUK B;  1SPK A;  2F5T X;  4KUI A;  3HSB A;  3GLX A;  1YN8 A;  5FWB A;  3HRU A;  3G71 A;  1M90 U;  3I35 A;  3QSU A;  5LJ3 e;  5GJV B;  1YHQ T;  5LJ3 g;  1VQN T;  2LCC A;  4J9F A;  3G71 Q;  1I07 A;  2E5Q A;  4A63 B;  4ESR A;  4JUV A;  2O01 E;  2D6F A;  2QQ9 A;  4ZTJ A;  1EIF A;  3M0T A;  4CRI A;  4MMK A;  4AFU C;  1PRM C;  5FW9 A;  1N8R C;  1QVG A;  3RDV A;  4DQ2 A;  1Q86 U;  1QP2 A;  5GJW B;  1M3B A;  1Q82 R;  5A0G A;  4DOW A;  3URG A;  1VQL T;  1OV3 A;  1KIK A;  3CCU T;  3AT1 B;  1VA7 A;  1WJS A;  1D1C A;  2DRM A;  3V7S A;  1OU8 A;  1VQ6 T;  2FVU A;  3CCV Q;  2EVR A;  2PVO B;  2OTL A;  4IUR A;  2A7Y A;  1ARK A;  1U1T A;  4II1 A;  3AHU A;  1B34 B;  3JB9 J;  2LNH B;  1G3W A;  2OTL Q; 
#chains in the Genus database with same CATH homology
 2C0O A;  1BU1 A;  2GGR A;  2DF6 A;  1GRI A;  1UHF A;  2GTJ A;  2L2P A;  3NPF A;  2KGT A;  1IO6 A;  2J05 A;  1XOV A;  3NGP A;  2D8J A;  5I22 A;  3M0S A;  2RQT A;  2HSP A;  2G6F X;  1ABQ A;  1BB9 A;  2DE0 X;  2DRK A;  1NYG A;  4IIO A;  2ESW A;  2HBW A;  2X3X D;  1U3O A;  2EGA A;  2K3B A;  2J7I A;  1M27 C;  1FMK A;  2J6O A;  3EG0 A;  3VS6 A;  1JQQ A;  2CH4 W;  3EG2 A;  2O9S A;  2J6K A;  2CT4 A;  2GBQ A;  1M8M A;  4HCK A;  4JPB W;  2RQW A;  4DEY A;  3UAT A;  1X43 A;  1ZUY A;  3SEM A;  2JW4 A;  2DL7 A;  2LZ6 B;  2O88 A;  2O2O A;  1B3Q A;  2A08 A;  2RPN A;  4JZ4 A;  4E6R A;  1T0J A;  2CDT A;  2L0A A;  3VS0 A;  1KJW A;  1GFD A;  2LQW A;  1PKS A;  4AG2 C;  2J6F A;  2JM9 A;  2NWM A;  2BZX A;  4RTY A;  5IHN A;  1QLY A;  3SHW A;  1WI7 A;  4Z88 A;  2VKN A;  1NM7 A;  3RNJ A;  1AVZ C;  2L3P A;  2F2V A;  1KSW A;  1ZBJ A;  3VS7 A;  4JZ3 A;  1BBZ A;  3VS1 A;  2FRY A;  1RI9 A;  1KFZ A;  3CQT A;  2ECZ A;  2RF0 A;  2K6D A;  1RLQ C;  3RBB B;  2K9G A;  1YWO A;  2SRC A;  2W10 A;  1OPL A;  4OMO A;  1WXU A;  3FJ5 A;  2C0T A;  2D1X A;  1U06 A;  1ZX6 A;  3LH5 A;  4LN2 A;  2EYW A;  3IQL A;  1PWT A;  2K2M A;  2DL5 A;  1H92 A;  3EHR A;  2YUO A;  4F17 A;  3THK A;  2PZ1 A;  2DJQ A;  1K0X A;  1UE9 A;  1OOT A;  3ZL7 C;  4RTU A;  1VYT A;  1A0N B;  2W0Z A;  2YT6 A;  1SRM A;  2M0Y A;  3PVL A;  4OMQ A;  1E6H A;  1MV0 B;  1CKB A;  1M3C A;  3UF4 A;  1HJD A;  1WIE A;  2AZS A;  1X6G A;  2KXD A;  2RMO A;  3VRY A;  1SHG A;  3M0P A;  4LUE A;  4RTZ A;  2BTT A;  4JJC A;  2EGC A;  2CUB A;  4JJD A;  4CC7 A;  1SSH A;  2O9V A;  1GCQ C;  2LP5 A;  2L3S A;  2HCK A;  3GBQ A;  1GFC A;  2EW3 A;  2JT4 A;  3M0R A;  1TUC A;  1WXT A;  1AZE A;  2D8H A;  3TSZ A;  2DBM A;  2F2W A;  1QWE A;  3TSW A;  1ZSG A;  1K9A A;  1EFN A;  2CH4 A;  2LJ0 A;  2LX7 A;  2EPD A;  1JXM A;  2FO0 A;  2JM8 A;  4CC3 A;  1ZLM A;  2YUP A;  4RTT A;  2F2X A;  1CSK A;  2ROT A;  4J9B A;  2KRS A;  3PVQ A;  1UDL A;  4LE9 A;  5IHI A;  1AWO A;  1PNJ A;  1RLP C;  2EYX A;  1FYN A;  4DEX A;  4RUG A;  5IXB A;  2MOX A;  2HDA A;  2KXC A;  3VS5 A;  2RQR A;  2FG0 A;  5L23 A;  1SEM A;  2DNU A;  2ABL A;  3I5S A;  2P4R A;  1G83 A;  1U5S A;  1K76 A;  4R0K A;  1K0S A;  1X69 A;  2K79 A;  2EGE A;  2A28 A;  3H0F A;  4WCI A;  4AG1 C;  4HXJ A;  1I1J A;  1JU5 C;  1UEC A;  2DM1 A;  3ULR B;  4JJB A;  4CC2 A;  1T0H A;  1MV3 A;  1W70 A;  1PKT A;  3VS2 A;  2FPD A;  2JMA A;  2DVJ A;  2V1Q A;  1K4U S;  1UJY A;  4HVW A;  1QWF A;  1VYV A;  2ROL A;  1PRL C;  1B07 A;  4FSS A;  1OPK A;  2YUN A;  3EGU A;  2PNI A;  2DBK A;  4HVU A;  2VWF A;  2CRE A;  2JMC A;  1LCK A;  3M0U A;  3EHQ A;  2CT3 A;  3A98 A;  2KRO A;  2AK5 A;  1VYU A;  1Z9Q A;  1HSQ A;  5IXF A;  1W6X A;  2OJ2 A;  2AKK A;  4EIK A;  1X2Q A;  2EKH A;  2LJ3 A;  2V1R A;  1NYF A;  2I0N A;  2DA9 A;  2KNB B;  4J9G A;  3R6N A;  1X2K A;  4Y92 A;  2M51 A;  4AFS C;  1JO8 A;  4X1V A;  2ED0 A;  3QWY A;  2EBP A;  3U23 A;  1JEG A;  1QKX A;  1SHF A;  1WXB A;  1G2B A;  2EYZ A;  3JV3 A;  2CUD A;  1GCQ A;  4GBQ A;  4OMN A;  1HD3 A;  2DMO A;  2GTO A;  1GL5 A;  2DL3 A;  4ORZ A;  3REB B;  2K7A A;  2RN8 A;  1I0C A;  2O31 A;  2B86 A;  2KBT A;  1QCF A;  3PE0 A;  4LUD A;  4F14 A;  4OML A;  1GBQ A;  1AWJ A;  2LCS A;  5IH2 A;  5ECA A;  2FEI A;  1NLP C;  2GNC A;  1WDX A;  1RUW A;  2KRM A;  1AWW A;  4LNP A;  3REA B;  2EYY A;  1NEG A;  4D8D A;  1X27 A;  2YDL A;  2BZ8 A;  2JS0 A;  2ED1 A;  1E7O A;  3I9Q A;  2LQN A;  2YUQ A;  5EC7 A;  1Y0M A;  1S1N A;  2KEA A;  2H8H A;  3KFV A;  2DIL A;  3NMZ C;  1WYX A;  2KR3 A;  2PTK A;  1ZUU A;  1UUE A;  4QT7 A;  2JXB A;  5IHK A;  2IIM A;  2J06 A;  1M3A A;  1AWX A;  1NLO C;  1V1C A;  3QWX X;  4RTX A;  3EG1 A;  3NHN A;  4IIM A;  2KE9 A;  5HCK A;  1H3H A;  2XMF A;  2RQU A;  1JXO A;  2DL8 A;  2MCN A;  4OMM A;  2KYM A;  4J9I A;  2JTE A;  4K11 A;  3VS3 A;  1TUD A;  1Z9Z A;  1AOJ A;  2VVK A;  2E5K A;  4Z8A A;  4HVV A;  3C0C A;  1MUZ A;  4CC4 B;  2DLP A;  2AKL A;  1BK2 A;  1UGV A;  2JS2 A;  4KRT A;  4OMP A;  3H0H A;  1OEB A;  2L3Q A;  1TG0 A;  2LMJ A;  1J3T A;  2DL4 A;  4D8K A;  1X6B A;  4J9D A;  2QDL A;  3I5R A;  1K1Z A;  3O5Z A;  2DX1 A;  2KRN A;  1WLP B;  2ENM A;  1T3S A;  1T3L A;  3TVT A;  4GLM A;  1SPK A;  2EQI A;  4ZNX A;  1WX6 A;  1YN8 A;  2FPE A;  2HEQ A;  5FWB A;  1WA7 A;  2BZY A;  3M0Q A;  1W1F A;  4J9C A;  2YSQ A;  1UJ0 A;  2C0I A;  4M4Z A;  2A36 A;  4AFZ C;  2NUZ A;  3I35 A;  4RTV A;  5GJV B;  2DYB A;  4J9E A;  1CKA A;  2GQI A;  1GCP A;  3EG3 A;  5FWC A;  4J9F A;  1N5Z A;  1PHT A;  1I07 A;  1GBR A;  2X3W D;  2KYB A;  4A63 B;  4ESR A;  1E6G A;  2CSI A;  2AZV A;  1H8K A;  2FRW A;  5I11 A;  1SRL A;  2CSQ A;  1AEY A;  3M0T A;  1Y57 A;  4Z89 A;  1YCS B;  3VS4 A;  4AFU C;  1PRM C;  2LJ1 A;  5FW9 A;  1WFW A;  1AD5 A;  1UG1 A;  2KT1 A;  1QKW A;  2OI3 A;  1YNZ A;  5GJW B;  1M3B A;  1OV3 A;  2D0N A;  1KIK A;  1UFF A;  1VA7 A;  2DRM A;  1NG2 A;  2RNA A;  1M30 A;  1ZUK A;  3H41 A;  1NEB A;  2SEM A;  2KT8 A;  2OAW A;  3UA7 A;  1AZG B;  2A37 A;  2EVR A;  4RTW A;  2FPF A;  3UA6 A;  1UTI A;  3H0I A;  1ABO A;  1UHC A;  1ARK A;  2RQV A;  4AFQ C;  4F16 A;  2MIO A;  4J9H A;  1YP5 A;  1YWP A;  2LNH B;  3VRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...