2ESWA

Atomic structure of the n-terminal sh3 domain of mouse beta pix,p21-activated kinase (pak)-interacting exchange factor
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
60
structure length
60
Chain Sequence
PLGSQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTHNGRTGWFPSNYVREI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho guanine nucleotide exchange factor 7
publication title Crystal structure of the N-terminal SH3 domain of mouse betaPIX, p21-activated kinase-interacting exchange factor
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 10
structure length 60
sequence length 60
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2eswA00
2O31A 1UFFA 2DL4A 1UHFA 3EG1A 2DF6A 1TUDA 1YN8A 2C0TA 4E6RA 2D8HA 2X3WD 2KT1A 1K9AA 1UHCA 3TSZA 2I0NA 1HSQA 4QT7A 2A08A 3QWYA 1NM7A 2EQIA 2FPEA 2JMAA 1WX6A 1YCSB 1NLPC 4LE9A 4AFZC 1KFZA 3VRZA 2EYZA 4M4ZA 2LZ6B 1VYUA 3REAB 2ED1A 2KRSA 1I1JA 1OV3A 2AK5A 3VRYA 2FO0A 1M3CA 2M51A 3M0PA 4GBQA 1QWFA 2LJ0A 2ED0A 2GNCA 4RTZA 2HCKA 2OI3A 2SEMA 2K9GA 1JEGA 2EYYA 2YDLA 2FEIA 2D0NA 3ULRB 3A98A 2JM9A 2JT4A 2KR3A 1NEBA 3UF4A 5FW9A 5GJVB 2C0IA 1IO6A 1GBQA 1YP5A 2EVRA 4HCKA 2ECZA 1ZBJA 4Y92A 2XMFA 1MV3A 1XOVA 2L3PA 2LNHB 2KBTA 1HD3A 1JQQA 2RN8A 4J9IA 3M0UA 2KXDA 4RTWA 4AFUC 1LCKA 2IIMA 2GTJA 4KRTA 4ORZA 2V1RA 1PWTA 2PZ1A 2O9VA 1NG2A 1YWPA 1BU1A 1SSHA 1W1FA 4HVWA 2BZXA 2DBMA 2HBWA 1NLOC 2KNBB 2RF0A 1Z9QA 1X6GA 2PTKA 2DMOA 2CSQA 2ESWA 2KEAA 1B07A 3QWXX 2KT8A 1AWJA 2BZ8A 2GTOA 4X1VA 1ARKA 1GL5A 2DX1A 2EGEA 3EHQA 1U06A 1GCQC 2LQNA 4CC4B 3RNJA 2EGCA 3I9QA 1QWEA 2GGRA 2MIOA 3VS4A 1I0CA 1SHFA 1J3TA 1MUZA 1M8MA 1OPKA 1AZEA 1AWWA 4CC3A 2CUDA 1G83A 3H0HA 3EG3A 2E5KA 3U23A 4D8KA 1GBRA 4AG1C 1EFNA 1SRLA 4LN2A 2KROA 2FRWA 3PVLA 2EYWA 2CT4A 1S1NA 3VS1A 5IHNA 2P4RA 2A28A 4OMPA 3VS2A 2A37A 3NHNA 1PHTA 2DVJA 2CSIA 2J6FA 2RNAA 1WA7A 3C0CA 2YUPA 2NUZA 3PE0A 1UTIA 1OEBA 1JO8A 1A0NB 4F17A 2L0AA 4RTVA 3THKA 1ZX6A 2DA9A 2JTEA 2RPNA 1ZUKA 4Z88A 4K11A 1Y57A 4Z8AA 2DL7A 1QKWA 1N5ZA 2C0OA 4J9DA 1M3AA 1BK2A 1E7OA 2GQIA 2GBQA 1UUEA 2X3XD 1SHGA 3RBBB 5EC7A 1QLYA 1K1ZA 2K2MA 4ZNXA 2EPDA 2AKKA 1OOTA 1PKTA 2RMOA 2ABLA 3NGPA 1W6XA 2HDAA 4OMLA 1M3BA 1W70A 2KE9A 2RQVA 4LUEA 4AFSC 1PRMC 2AKLA 2DL5A 5IH2A 1KIKA 1B3QA 4OMOA 1YNZA 1CSKA 1AZGB 1MV0B 2F2XA 1T3LA 2VKNA 1VYVA 3FJ5A 1GCQA 2RQWA 3I5RA 2ROTA 3NMZC 2F2WA 2EKHA 2CUBA 1SRMA 2KRMA 1ZSGA 2K79A 1JU5C 2K6DA 2FPFA 5IXFA 4R0KA 1AWXA 1X69A 2DILA 4J9HA 1K0SA 4AFQC 2CDTA 3NPFA 2KGTA 2RQTA 2RQUA 5IHKA 1QCFA 3H0FA 3UA6A 3H41A 1GCPA 1KSWA 2VWFA 1WYXA 1NYGA 3M0TA 4J9BA 1X27A 1CKBA 2HSPA 1RUWA 3JV3A 4RTTA 2NWMA 1X6BA 1AWOA 2W10A 2EYXA 1K4US 4ESRA 2A36A 2ENMA 1WDXA 4LUDA 1OPLA 1U5SA 2KRNA 2YSQA 2MOXA 5FWCA 1JXOA 2AZSA 3ZL7C 3R6NA 4J9GA 2JW4A 3UA7A 3EHRA 1ZUUA 1ABOA 3KFVA 2FRYA 1X2KA 2D8JA 2LMJA 2YUOA 4RTUA 4HVUA 1QKXA 1K76A 2DL8A 3M0QA 2FPDA 4FSSA 2BTTA 5HCKA 1UG1A 1UECA 2L3SA 2L2PA 3EG2A 2O9SA 3CQTA 1YWOA 1GFDA 1WLPB 4JPBW 3SHWA 1RI9A 1T3SA 2V1QA 2KXCA 4F14A 1FMKA 2CH4W 1FYNA 1WXTA 1KJWA 2LJ1A 2DBKA 2LX7A 3I5SA 1AEYA 1RLQC 1UDLA 2LJ3A 1PNJA 5GJWB 1T0HA 2DJQA 2HEQA 5I22A 2K7AA 2D1XA 2B86A 2JXBA 4A63B 1V1CA 4JJDA 2CT3A 1H92A 2LQWA 1SEMA 5IXBA 4GLMA 2EBPA 3VS5A 3M0SA 1WIEA 1ZLMA 4AG2C 4RTYA 1NEGA 1Y0MA 2MCNA 1TUCA 4HXJA 2YUQA 2ROLA 2J06A 1T0JA 5IHIA 2H8HA 1UJYA 4RUGA 1G2BA 2J6KA 2KYBA 2QDLA 3H0IA 3REBB 2AZVA 2JS0A 3EGUA 1TG0A 1UJ0A 4CC7A 1BB9A 2YT6A 1BBZA 1CKAA 1UE9A 4HVVA 1E6GA 1AVZC 4JZ4A 2O88A 1WXBA 4JJBA 1VYTA 2F2VA 2G6FX 3VS3A 4EIKA 3LH5A 3VS7A 2J7IA 3EG0A 2DL3A 2CH4A 1NYFA 1SPKA 1E6HA 2VVKA 4IIMA 5ECAA 2EW3A 1WXUA 2YUNA 1UGVA 1JXMA 2KYMA 4D8DA 3IQLA 3PVQA 1AOJA 4RTXA 3VS6A 4DEYA 2O2OA 2DM1A 1ABQA 1PKSA 1H8KA 4OMNA 4OMQA 3TVTA 2FG0A 1ZUYA 2CREA 2DRKA 2LCSA 3SEMA 1GRIA 2W0ZA 3O5ZA 4IIOA 2J6OA 3UATA 3GBQA 2DLPA 2RQRA 1H3HA 1X43A 2JM8A 5FWBA 1K0XA 2DNUA 2DRMA 1GFCA 1U3OA 1I07A 2DE0X 4J9FA 1VA7A 1Z9ZA 4LNPA 2K3BA 4JJCA 4OMMA 4WCIA 1WI7A 4Z89A 1PRLC 2M0YA 4CC2A 2LP5A 1AD5A 2DYBA 1M27C 4DEXA 4J9CA 2OJ2A 1X2QA 3TSWA 3M0RA 4JZ3A 3I35A 2J05A 4F16A 1HJDA 2OAWA 2JMCA 2BZYA 1M30A 2JS2A 5L23A 1RLPC 2EGAA 2PNIA 4J9EA 5I11A 2L3QA 1WFWA 3VS0A 2SRCA
chains in the Genus database with same CATH superfamily
1Y7XA 2K5FA 1UFFA 3V7RA 2P4TA 2DF6A 4XU1A 1TUDA 2D8HA 4EPCA 1K9AA 1UHCA 1ZA1B 4PJOD 2I0NA 1HSQA 1IGUA 2ZZDA 3RR6A 2F5TX 3C12A 4FW1A 2P84A 4LE9A 2MWOA 2ZPBB 4RMOA 1VQ7A 2LZ6B 4M78C 2ED1A 5J39A 3LH0A 2I2LA 1VQ8T 1M3CA 2M51A 5DY9A 2OAUA 2LVMA 4PJOA 2GNCA 2OI3A 1VQ4Q 2SEMA 3CMET 2K9GA 5L8RE 3JCMh 2EYYA 2FEIA 2XKOC 3A98A 3M9QA 2JT4A 4XU2A 1YHQT 5GJVB 1QVGS 4XU0A 1Q82C 1NPPA 1YJNA 1K9MC 2RO0A 2L8DA 2ECZA 2EAYA 5LJ5g 4FYWB 3G6ET 1PCXA 2RN8A 5LJ5e 1FMVA 2KXDA 1IGQA 2DEUA 4ORZA 2V1RA 2EJGA 2O9VA 3FRNA 5AT1B 1W1FA 1M1FA 2BZXA 2DBMA 1RAHB 1NLOC 2RF0A 4DBQA 3CC4A 2P0KA 1SF9A 3VUBA 3QWXX 2E3IA 1KHCA 2BZ8A 2GTOA 4Y28E 3CCJA 2E3HA 3QYHB 3EHQA 1GCQC 1LPLA 2OX7A 2VGNA 3PGGA 5LJ3f 1J3TA 1MUZA 5KYYB 1OPKA 1AZEA 1AWWA 3CPWP 1G83A 3OBYA 2KROA 2HBPA 1R8OB 3DB4A 1S1NA 5IHNA 1YJ9T 1Q81C 2P4RA 3VS2A 2P0QA 3NHNA 2DVJA 2CSIA 3CCST 3PE0A 5GAMj 3A5ZB 1VQLT 1S72A 1WNLA 1YJNQ 4E47A 1VQPA 1RABB 3THKA 5KCOA 5CQXA 4M7AC 2OTJT 4XU3A 3DLMA 1X6OA 3EGXB 2CGHA 4EMKB 1Q7YU 4C8QD 4M75E 2D6FA 4J9DA 2GBQA 1UUEA 5GANj 2X3XD 2DKGA 1R77A 5EC7A 1QLYA 3M4GA 4BI4A 1VQ8A 3C94A 2EPDA 2JN0A 2E65A 3JB9D 1RAGB 4PJOG 4M77A 5FRMA 1W6XA 4C8QA 4E7LA 4J7IA 3CC4Q 2GCXA 3GIBA 1M3BA 1YIJQ 2RJDA 3P8DA 3CMEA 3M5AA 1PRMC 1UGRB 2QA4Q 3A8OB 1YNZA 5D6WA 5GAOm 3CCJQ 1YHQA 4A53A 4J8OA 2D9TA 4P5NA 1GCQA 2RQWA 2ROTA 4PJOF 2F2WA 4BUGA 3L2ZA 2KRMA 2QQBA 2K79A 4OGEA 4FL6A 3PTAA 5IXFA 1QVGA 2NUPB 2DILA 5CK9A 3KUFA 3WXMB 3G4SQ 1OULA 1W2BS 2MAMA 5IHKA 2RHYA 2A7YA 3H0FA 5J26A 3H9NA 1VQ9Q 1GCPA 2YXYA 1DJ7B 3MJXA 4PFOA 2QAZA 3L2VA 1VQPQ 3QZ5B 2RI3A 3JV3A 2NWMA 5LL6S 4J5YA 4JRKA 1VIEA 1WQWA 1PSFA 4ESRA 1WDXA 5LJ3d 2MOXA 4M7AB 1D3BB 1TTHB 4J9GA 3UA7A 3EHRA 2JNGA 1ABOA 2RM4A 3MEUA 1KD1U 3KFVA 2AHJB 5KE2A 2D8JA 2LMJA 3EFRA 4RTUA 2DL8A 3VU3C 5GAMg 3MEWA 1M1KR 1I4K1 5CIUA 1UECA 1TOVA 2O9SA 1M2VB 3CQTA 1SG5A 1GFDA 3H8ZA 3CCSA 1WLPB 1RI9A 1T3SA 1M90R 2KXCA 4F14A 1WXTA 4XQ3A 2EFIA 3CCMT 2ATCB 5GANg 3VJPA 1RLQC 1PNJA 1T0HA 3CD6Q 2O4XB 1N8RU 4GY5A 5I22A 1YITA 2D1XA 4A63B 1QQJA 5DLOA 2RHZA 5FU6B 1H92A 2LQWA 1BI1A 2KK4A 1YI2Q 3M0SA 1OX8A 1WPYA 4AG2C 5KYXA 5GAN3 4EMGA 3X28B 3CEYA 1K8AR 1N9SA 3OYLA 2F1LA 3JCMc 5LJ5h 4C8QG 1VQMT 1G2BA 3REBB 3V8JA 2C06A 2AZVA 4A4HA 4CC7A 1N27A 4JDSA 3TEEA 1BBZA 3J7AF 4YTLA 4HVVA 2LX9A 3JB9G 2O88A 1VYTA 3SFMA 1QW1A 2G6FX 1VQOQ 3JCMg 2HL5C 3LH5A 2CH4A 3OW2S 3EFOA 4IIMA 2IG0A 2LDMA 4J7FA 4F7UG 3QIIA 1ZSZB 2EW3A 1UGVA 3VV0A 2RI5A 3JB9F 3HHTB 1NJIU 1AOJA 4RTXA 3FEOA 1OZ3A 4ANJA 1VQNT 3MEAA 3NTKA 4O6JA 2D0QB 1PKSA 4KULA 4FSXA 2QQAA 2E64A 4A4FA 3TVTA 4F7UF 4HKEA 3LYIA 2CREA 2EKOA 3SEMA 1GRIA 3E1SA 3O5ZA 4IIOA 1SKUB 3GBQA 2OTLT 2RQRA 4XTUA 4TVRA 4CRIA 1YITQ 1X43A 2KMTA 1JRIA 2DYIA 2DRMA 4NL3A 4FT2A 2IVWA 2DE0X 4J9FA 5D6XA 3CXCS 3CC7T 2QG9B 4EMHA 4JS4A 4OMMA 2VGMA 1WI7A 1PRLC 1OX9A 5CKEA 1AD5A 2DYBA 2DO3A 4BD3A 2OJ2A 1X2QA 1OU8A 2J05A 4FYXB 1HJDA 3EG9B 2KY9A 5GAN4 4KH0B 2BZYA 1BIBA 4N4HA 2PUOB 3CCUT 2KSSA 2GFUA 1TWBA 3CCMA 3EG1A 5CKHA 5I21A 2C0TA 7AT1B 3JB9J 4E6RA 2X3WD 5CKFA 2KT1A 1I5OB 2A08A 2G3RA 3QWYA 1WX6A 3TREA 4M75F 4FCYA 4AFZC 2QI2A 3HRUA 2EYZA 4R55A 3JCMX 1VYUA 5FU7C 2ZCFB 3UWNA 1UB4A 1I1JA 1OV3A 4C92D 4ME7A 3CCRT 2XG8D 1V29B 2LCLA 2LJ0A 2ED0A 4RTZA 2HCKA 3VYHB 2LC4A 3FDRA 2EWNA 2E70A 4ZGJB 1WQ7A 3LLRA 2VB6A 4KGVB 4IUPA 3A8LB 4FYYB 3RERA 2RHIA 3LGLA 5AYFA 4C92A 3L2UA 2LT1A 1NEBA 3UF4A 2X4XA 1Q86C 3E2UA 4RG2A 3CCLT 4HT8A 3S3OA 1LNXA 5CAIA 2XMFA 4HCCA 1XOVA 5IT9E 2LNHB 4HA8A 2X51A 5LJ5j 4FT4A 4XTZA 3X25B 4E7IA 4ZTJA 1LCKA 1WHMA 1OYXA 4QVDA 1JBMA 2XHCA 2IPOB 3CMAT 3EAEA 4PJOC 4IUVA 3OW2A 1VQNA 1BU1A 1SSHA 1QVGP 3M58A 2P0PA 3EH1A 2HBWA 3AT1B 5GAMf 2KNBB 4C0ZA 2DXCA 2QQRA 2CSQA 3OQ5A 3KXTA 3CC2T 1BI3A 3OYYA 2DETA 3JB9H 1QVFS 2YRDA 2FZKB 2OTLA 1ARKA 3DKMA 3P8HA 2DX1A 1U06A 2LQNA 3DB3A 3RNJA 2EGCA 2QGGA 4PFPA 5GANf 1B34B 3CC7A 1QWEA 2GGRA 3S6WA 3OS5A 3AHUA 2K3YA 4M7DE 3HRSA 2CUDA 1VQ6A 3H0HA 3EG3A 2QEXT 4D8KA 2VXFA 2KQWA 3J80E 2DXUA 2CYZB 4OB1B 3META 3E9FA 2DIQA 3PVLA 2E12A 3QDRB 2EYWA 2Z0WA 4J6XA 5HY6A 2A37A 2CKKA 1M9SA 1FX7A 3M57A 1JO8A 1RAFB 3CCUA 1A0NB 1RI0A 2L0AA 3INZA 4M78E 1ZX6A 2JTEA 5GAN8 3OYNA 1VQ5T 1ZUKA 4Z88A 1Y96B 3JCMV 1C0MA 4Z8AA 3CCQQ 1VQKT 2X35A 1KC8R 5A0DA 1QKWA 2C0OA 2MF2A 3G71Q 1K73C 1M3AA 1BK2A 1E7OA 3JCMf 1SHGA 3RBBB 3L42A 3I56A 3CCRA 1K1ZA 1WJQA 1RAAB 2AKKA 3HTRA 4QVCA 1QP3A 1WJSA 2PU9B 2V8JA 2HDAA 5KYUA 1IB8A 1IXDA 1W70A 2KE9A 2RQVA 4PLLA 1UGSB 3RKWA 4AFSC 3NTHA 2DL5A 1KIKA 4OMOA 1N9RA 4C92G 3G7ZA 1CSKA 2F2XA 4KT0E 6AT1B 1D0XA 4XTYA 1VYVA 3FJ5A 2ZAEA 4BDZA 3I5RA 3CCLA 3S3NA 3OYIA 1MMNA 1SRMA 3L2RA 1NPRA 1BYMA 2K6DA 1VQ6Q 1O75A 3OYHA 4R0KA 4C92F 1AWXA 2XI9A 1X69A 2B8AA 4AFQC 3I55T 1ZA2B 3NPFA 3JSCA 4OB2B 1WHGA 3CMAA 4M77C 4C8QC 1U1SA 3H41A 5GAMd 2RH2A 1PM3A 1KSWA 2X4JA 1U1TA 4DA4A 2NLUA 1V76A 1NYGA 3M0TA 4HCBA 4M7DB 1X27A 1CKBA 1M2OA 1M1KU 5CR2A 3VKIA 2YLBA 1LJOA 3EGDB 1X6BA 1AWOA 1VQ7Q 3UPUA 2CP5A 5KCHA 1M90U 5GANd 2A36A 1W2BP 2ENMA 3QDFA 2KRNA 1U5SA 2DTHA 3JB9I 4PJLA 5FWCA 2COWA 2HQXA 4O5VA 2JW4A 3I56Q 2GFAA 1QVFA 2XD0A 4M78B 4JRPA 2FRYA 4KUIA 4V2SA 3LX7A 3JCMJ 3MPUB 1K76A 1K9MR 2X4WA 2M0OA 2BTTA 4M7AE 1UG1A 5A0LA 2A3LA 1RL2A 1K8AU 3SHWA 2V1QA 3GOXA 1FMKA 2CH4W 4ZN3A 2DTOA 5EG2A 1KJWA 1FWZA 4FW2A 3V7CA 3OYEA 1C1AA 1YFNA 2HQEA 2KI7A 2DBKA 1VQ5A 1UDLA 1TS9A 2WSCE 1ZQ1A 2HSEB 3GPLA 1D0ZA 1VQKA 4EMKA 2EJFA 4IUQA 2K7AA 2JXBA 2CT3A 2GF7A 1MNDA 4GLMA 3C4SA 4IUTA 4MDWA 1JB0E 2L5QA 4RTYA 4PLIA 2A0FB 4DBFA 2YUQA 2ROLA 1T0JA 1VOMA 2DD4A 2YRVA 2M1HA 4M77B 3JCMP 3CCET 4C8QB 1WJRA 3EGUA 1KQSA 4GLKA 2YT6A 4BY6C 1UE9A 3ZFJA 1E6GA 4DQ2A 4JJBA 3JCMb 3G6EA 4PJJA 5GMKi 5CVIA 3VS3A 1Q81R 4F7UA 4JRIA 2J7IA 1G3WA 2YUNA 4ZN1A 5GAN2 3E9GA 3I55A 2HZYA 1QP2A 1AT1B 3A8GB 2EQUA 3PVQA 2JTMA 3VS6A 4JJNK 1S72Q 2Y90A 2NUTA 4E2FB 4OMNA 5KE3A 3FB9A 1ZUYA 1HK9A 2F69A 2VASA 3SB2A 3OW2P 3E19A 3MHXA 3X26B 4NOYA 3CCVT 8AT1B 3RIRA 4N4IA 2J6OA 3UATA 2CP2A 1Y71A 1BIAA 1W4SA 2DLPA 1H3HA 5FWBA 4L59A 2VYTA 4FYVB 4M75D 1VQ8Q 1I07A 3KBGA 1VA7A 1Z9ZA 2VXEA 2EJ9A 4FM4B 1D3BA 1TXQA 1G3TA 2RJEA 4WCIA 3OB9A 4CC2A 2RI2A 3CMEQ 1Q7YC 1YJ9A 1U8RA 2HKNA 1XTDA 3M0RA 4JZ3A 5IAYA 5GMKe 2K3XA 4M75A 1YHQQ 4F16A 2EIFA 1VUBA 2OAWA 2JMCA 4C5IA 2HKQB 5GAN7 1VQLA 1M2VA 1RLPC 2KVQG 5I11A 2BUDA 3RMQA 2OTJA 2L3QA 1WFWA 3VS0A 5A0GA 2R5AA 2O31A 3G6EQ 3CXCP 3QUIA 4E7ZA 4KUDK 4BY6B 2CP0A 4IKFA 3OSVA 4QT7A 5LJ5f 5I2SA 4JLIA 2FPEA 2E41A 3GNFB 1NLPC 4M4ZA 5I2MA 3CBMA 1X75C 2JUFA 4AT1B 1I5LA 3VRYA 1YJWT 4GBQA 1F1BB 1QWFA 3PIOA 3LWHA 4QW2A 3A1PA 5KYXB 4BI8B 3CCEA 1JEGA 3ULRB 1S72T 2JM9A 2KR3A 5FW9A 2O01E 2QTVA 3OYDA 1GBQA 3MP1A 4HCKA 1ZBJA 4Y92A 2V8IA 2DVEA 2PVDB 2K5LA 2L3PA 1NZ9A 2KBTA 1JQQA 1BI0A 3QJ6A 3M0UA 4RTWA 1YJ9Q 3EFOB 1R0BG 4AFUC 4XTWA 2IIMA 4KRTA 3X24B 4BE0A 3CCSQ 4PNOA 2AIRB 3OYGA 3PIPA 2JZ2A 2VC8A 1VQLQ 5HKCA 1RADB 1NG2A 1KD1C 4HVWA 3GF5A 1VIFA 2OTJQ 1M4ZA 2EQKA 3BFMA 1X6GA 4C92C 2DMOA 4ELZC 2ESWA 2KEAA 4C0DC 2RJFA 1IREB 2BE7D 5DLQE 1VQ4T 1AWJA 2MI6A 2LT4A 3QXEB 2EGEA 2X4YA 4CC4B 1I8FA 1X01A 3D7SB 4DOVA 2HQHA 4B6MA 2PVGB 3CPWA 4MZMA 2FYKA 5CO7A 2MIOA 1JJ2S 3SD4A 1I0CA 2DXBA 3HSBA 2QK0A 4A4GA 4CC3A 1KC8U 3BY7A 1N8RC 1HYOA 1SRLA 5CQYA 4M75G 2CT4A 3VS1A 2HAXA 1QVFP 4M7AF 1I81A 1PHTA 2J6FA 5KYWB 2RNAA 4RG8A 3C0CA 2YUPA 3S3MA 3L2WA 4A4EA 1EZZB 3EFSA 2E1HA 4E7KA 4EDUA 5LJ5d 2DIGA 2HL3A 2XDPA 2RPNA 4K11A 1PD0A 1EIFA 3C95A 4KBMB 1N5ZA 5CKDA 5FRNA 3MKDA 2GQIA 4KH1B 2QGFB 1Y07A 2MWPA 1D1BA 5KH6A 3JAME 5LJ3e 5GAN5 1VQMA 4ZNXA 2E6ZA 3CPFA 1MNEA 2RMOA 2ABLA 2CZ6B 1G3SA 4BB7A 4X34A 4C5HA 2QTXA 3O8VA 4J6YA 1QCOA 1HXDA 1NJIC 2AKLA 4XTXA 1PSEA 2MMPA 3X20B 2RD1A 2VKNA 2DERA 1RAEB 4C92B 2F5KA 5CCAA 2CUBA 4MMKA 4C0DB 4UC4A 1ZSGA 4PJOE 1JU5C 1YJNT 2R57A 4L5GA 2WSFE 2FPFA 3OS2A 2XK0A 4J9HA 2JVVA 3SWNA 2KGTA 2RQUA 4QKUA 3RKXA 3UA6A 4MZPA 2XDDA 3G1JA 3CCMQ 1PC0A 1Q82U 2VWFA 1N6AA 2HD0A 2GQVA 1K9MU 4LD6A 2LQ8A 1BKBA 1RUWA 4RTTA 5GMKh 5CKBA 3CC4T 1VQ4A 1YIJT 2YLCA 2EYXA 1D0YA 1Q95G 2RA2A 3JCMQ 2QA4T 3QG1A 2PVOB 1OPLA 4DBHA 2YSQA 3CCJT 1B34A 2AZSA 2DAQA 3R6NA 3HP9A 1VQMQ 4ZGDB 5FU7B 3LGFA 2RK2A 4LDVA 2FVUA 1Q86R 2YUOA 3GLXA 1QKXA 3RKYA 1MMAA 2FPDA 3VYGA 1G3YA 1KQ2A 5HCKA 1JJ2A 2L2PA 3G4ST 2QASA 8ATCB 3MCAB 5HK3A 1OZ2A 3LWIA 1WGSA 2EQMA 1FYNA 3OY9A 1YCYA 4QQDA 4LDYA 1VQ9T 2LJ1A 1BCOA 1WHHA 1AEYA 5GJWB 1VQPT 1Y96A 2M16A 1TH7A 3TU4K 2HEQA 1IZ6A 1KQSS 1VQNQ 5M9OA 1Q81U 1C6VX 4RCBA 4Z02A 2M9UA 4J83A 4A54A 5FROA 3M59A 2K57A 4HCZA 4PJOB 3PMTA 4XTVA 4B9XA 5IHIA 3BDUA 3OA6A 2DFUA 2ZPHB 2OTLQ 5KYUB 5D7UA 2JS0A 1TG0A 1XQHA 5A2QE 3A8MB 1OI1A 1CKAA 3CC7Q 2DEQA 4JZ4A 2WSEE 2F2VA 4N0AA 4EMKC 4M77E 3EG0A 2DL3A 1NYFA 4C8QE 3H6ZA 1G8XA 2ZGWA 3LW5E 4M7DD 1MHNA 2VV5A 1WXUA 4IURA 4BE2A 2L89A 3M54A 3VUZA 3CD6T 4JS5A 2M02A 3QKJA 4DEYA 3CCUQ 2O2OA 2DM1A 3FIFA 1H8KA 2KDSA 3V8KA 1K73R 2QQSA 1YI2T 3CC2A 3RDVA 4M7DA 2FG0A 2PUKB 1D09B 3QZ9B 2DRKA 4ATOA 4F7UE 3EGDA 2LCSA 3URGA 1KG1A 2H3EB 4M78D 2W0ZA 2CP3A 1YIJA 2BKDN 3FC3A 1M5Q1 2QA4A 1K0XA 3CCRQ 2DNUA 5KYYA 4MZTA 2LNVA 2FZCB 2X9HA 4OF1A 4JJCA 2QEXA 1Q82R 4Z89A 1XNIA 2MPXC 2ZPIB 1VQOT 1R0CB 4M78A 4OMFB 3HL8A 4C0FA 4DEXA 5C6SA 5GMKj 3N5BB 3I35A 2MK5A 3G4SA 3V8LA 3CCLQ 3BE3A 5LJ3h 1M30A 4CI0C 1BI2A 4LDWA 2EGAA 2PNIA 3OYKA 4OP0A 5GMKl 3MP6A 2LRQA 1WHJA 4KGXB 2SRCA 3JRZA 2DL4A 1VQ9A 3EGXA 1UHFA 4DOWA 4WF2A 3JCMd 1YN8A 2LTOA 4N4GA 3TSZA 2JOYA 1NM7A 2EQIA 2JMAA 3CMAQ 1YCSB 2VUBA 2Y4YA 1KFZA 4M77D 3VRZA 4Y91A 3M56A 3REAB 2KRSA 4XK8E 1YITT 2AK5A 4PL6A 4F04B 2FO0A 3M0PA 4M75C 2FL7A 3CC2Q 3OBWA 3QHSA 3QSUA 2K5IA 2YDLA 3CBOA 2D0NA 2KAFA 4C0GA 4L6V5 3HKSA 2C0IA 1IO6A 1TU0B 4NL2A 2ZPFB 1BCMA 3MEVA 1YP5A 1RACB 2EVRA 3OS0A 2FZGB 1M1KC 3QPHA 2QEXQ 1NBEB 1MV3A 3L1AA 3QO3A 3WVEB 2NUPA 1HD3A 1TSFA 4F7UB 4J9IA 4PKCC 1IRXA 5FU6C 1M90C 2GTJA 3CD6A 1PWTA 2RHUA 2PZ1A 3M53A 1KHIA 1YWPA 4M7AD 3GP8A 1MMGA 3CPWS 2XICA 5GAOp 1VQ5Q 2NUTB 1YI2A 4M7DG 1Z9QA 1MGQA 2PTKA 1VQKQ 1WHKA 2FHDA 1B07A 3JCMW 2KT8A 1P92A 3RMSA 3ZBDA 5GAOn 1K8AC 4M7AA 1GL5A 2CS7A 3ZEHA 3I9QA 2CZ7B 4VUBA 4M7DF 1G5VA 1ZSZC 3VS4A 1SHFA 1M8MA 4M78G 1VQOA 4C5GA 4OB3B 4IUUA 2E5KA 3U23A 1GBRA 4AG1C 1EFNA 4LN2A 2XDBA 4LDUA 2FRWA 2K2VA 1MMDA 4QQGA 4JRQA 2A28A 2H3JA 4OMPA 2RB6A 4M75B 3P8BB 1WA7A 3ME9A 2CZ1B 2NUZA 4M78F 1UTIA 1OEBA 5GAMe 3QJYA 4F17A 4RTVA 2DXTA 1TUGB 1JJ2P 4J6WA 2DA9A 2O4XA 3HFOA 2COZA 1Y57A 2EQJA 4ZGEB 3I55Q 4X9DA 4LXCA 2DL7A 1KQ1A 4BI3A 2LQKA 3PT9A 5GANe 3OMCA 3PMIA 5LJ3j 2DPPB 3T9NA 4QVZA 2K2MA 1OOTA 1PKTA 3NGPA 5HK0A 1M8VA 3OS1A 1ZBXA 4OMLA 3OYFA 5FLXE 1LOJA 4M77G 2AT1B 4LUEA 2E5QA 1PD1A 5IH2A 1B3QA 1M1GA 2XIDA 3CBPA 1Q7YR 1AZGB 1MV0B 1T3LA 4KGZB 4E7HA 3OYJA 3NMZC 2EKHA 2ZPEB 3FLGA 3TQ7P 2XU8A 2V8KA 1WZOA 2DZ9A 3WVDB 2DTIA 1ZSZA 1IHVA 4M77F 4BACA 2RHXA 4C8QF 2QDYB 4A4KA 1K0SA 2R5MA 3JCMe 2E6NA 1NE8A 2CDTA 3CCQT 2RQTA 4C92E 1O9SA 3G71T 1QCFA 1AHJB 3M4YA 2YHTA 3PNWC 2NYSA 1Q86U 2DK3A 3QYGB 1WYXA 1PG5B 2LCCA 4J9BA 4PJMA 9ATCB 3CCVA 4FIBA 2DJZA 1RAIB 2HSPA 1EX4A 1OU9A 1W2BA 2BIVA 2W10A 1K4US 4M7AG 2YWWA 1UGQB 4LUDA 4LD9K 2EYQA 2FB7A 1JXOA 4PFZA 1QVPA 3ZL7C 1GXIE 1ZUUA 4OB0B 4DBRA 3UDCA 2K4YA 4ZTFA 3F70A 5GMKm 3SWNC 4QQ6A 3MP8A 1UGPB 1X2KA 3CCEQ 4HVUA 3EG9A 3SDZA 1VQ6T 3M0QA 4FSSA 1ACMB 2L3SA 2RK1A 3EG2A 1YWOA 2Y4XA 4BE1A 5KYWA 4JPBW 1XJWB 4NS5A 3OYBA 3Q1JA 2CP6A 5D6YA 2MYSA 3HRTA 1KK7A 3DLLA 2LX7A 3I5SA 3QBYA 2LJ3A 4E7JA 5LJ3g 3R6OA 4BDYA 3TCJA 1KD1R 4OVAA 2QQ9A 2DJQA 2B86A 3OYCA 4C5EA 1V1CA 4JJDA 1VQ7T 5J3BA 1OQKA 1SEMA 1YJWA 5IXBA 2EBPA 3VS5A 4OGCA 5DM7R 1WIEA 1ZLMA 4RCCA 1NEGA 1Y0MA 2JTFA 2RJCA 3I56T 2MCNA 1FXXA 3OYMA 1TUCA 2COYA 4HXJA 2J06A 3CCVQ 2H8HA 1UJYA 1B7TA 4RUGA 2YRCA 2J6KA 2KYBA 2QDLA 3H0IA 3J81E 1UJ0A 1BB9A 5GAN6 4XAXB 1N8RR 4R56A 1K73U 4WTOB 1KQSP 1AVZC 1WXBA 2V26A 2DZCA 4II1A 2ZPGB 5C0MA 2DD5A 4RKUE 2JJ9A 4JUVA 4EIKA 2CZ0B 2QYZA 1YBYA 3VS7A 1SPKA 1E6HA 4X9CA 2VVKA 3BDLA 5KYNA 2QXFA 1WHLA 1LVKA 1UEBA 1D1CA 5ECAA 3M55A 1JXMA 1SSFA 5GAOl 2KYMA 5IN1A 4D8DA 3CCQA 2WACA 3V7SA 1IHWA 1D1AA 3IQLA 5GAOq 3G71A 2L3RA 3SWNB 1QCNA 1ABQA 4OMQA 3BW1A 1KC8C 1QMCA 4PJNA 3OYAA 4E7SA 3FJPA 1FMWA 3MO8A 4PK4A 4B9WA 4LDXA 2HNIA 4JLGA 2E4HA 2PQWA 4N0AC 2HMAA 2JM8A 4ELYC 3L2QA 2E10A 3HFNA 3EH2A 4MDXA 1GFCA 1U3OA 5GAMh 1YJWQ 4LNPA 1H641 2K3BA 3RESA 1NJIR 3A8HB 3ASKA 3PFSA 2M0YA 2LP5A 4Q5WA 1M27C 1ZHIA 4J9CA 2R58A 4HT9A 3NFCA 3TSWA 3NTIA 3GNGA 3OMGA 5GANh 5GAOr 3ER0A 4M7DC 4FU6A 4MMLA 2JS2A 5L23A 3CXCA 2BE9B 3HPWA 4AMCA 4J9EA 3UT1A 1H3ZA 2CP7A 4D6WA 3RUXA 4X1VA 3OSSC
chains in the Genus database with same CATH topology
2O31A 1UFFA 2DL4A 1UHFA 3EG1A 2DF6A 1TUDA 1YN8A 2C0TA 4E6RA 2D8HA 2X3WD 2KT1A 1K9AA 1UHCA 3TSZA 2I0NA 1HSQA 4QT7A 2A08A 3QWYA 1NM7A 2EQIA 2FPEA 2JMAA 1WX6A 1YCSB 1NLPC 4LE9A 4AFZC 1KFZA 3VRZA 2EYZA 4M4ZA 2LZ6B 1VYUA 3REAB 2ED1A 2KRSA 1I1JA 1OV3A 2AK5A 3VRYA 2FO0A 1M3CA 2M51A 3M0PA 4GBQA 1QWFA 2LJ0A 2ED0A 2GNCA 4RTZA 2HCKA 2OI3A 2SEMA 2K9GA 1JEGA 2EYYA 2YDLA 2FEIA 2D0NA 3ULRB 3A98A 2JM9A 2JT4A 2KR3A 1NEBA 3UF4A 5FW9A 5GJVB 2C0IA 1IO6A 1GBQA 1YP5A 2EVRA 4HCKA 2ECZA 1ZBJA 4Y92A 2XMFA 1MV3A 1XOVA 2L3PA 2LNHB 2KBTA 1HD3A 1JQQA 2RN8A 4J9IA 3M0UA 2KXDA 4RTWA 4AFUC 1LCKA 2IIMA 2GTJA 4KRTA 4ORZA 2V1RA 1PWTA 2PZ1A 2O9VA 1NG2A 1YWPA 1BU1A 1SSHA 1W1FA 4HVWA 2BZXA 2DBMA 2HBWA 1NLOC 2KNBB 2RF0A 1Z9QA 1X6GA 2PTKA 2DMOA 2CSQA 2ESWA 2KEAA 1B07A 3QWXX 2KT8A 1AWJA 2BZ8A 2GTOA 4X1VA 1ARKA 1GL5A 2DX1A 2EGEA 3EHQA 1U06A 1GCQC 2LQNA 4CC4B 3RNJA 2EGCA 3I9QA 1QWEA 2GGRA 2MIOA 3VS4A 1I0CA 1SHFA 1J3TA 1MUZA 1M8MA 1OPKA 1AZEA 1AWWA 4CC3A 2CUDA 1G83A 3H0HA 3EG3A 2E5KA 3U23A 4D8KA 1GBRA 4AG1C 1EFNA 1SRLA 4LN2A 2KROA 2FRWA 3PVLA 2EYWA 2CT4A 1S1NA 3VS1A 5IHNA 2P4RA 2A28A 4OMPA 3VS2A 2A37A 3NHNA 1PHTA 2DVJA 2CSIA 2J6FA 2RNAA 1WA7A 3C0CA 2YUPA 2NUZA 3PE0A 1UTIA 1OEBA 1JO8A 1A0NB 4F17A 2L0AA 4RTVA 3THKA 1ZX6A 2DA9A 2JTEA 2RPNA 1ZUKA 4Z88A 4K11A 1Y57A 4Z8AA 2DL7A 1QKWA 1N5ZA 2C0OA 4J9DA 1M3AA 1BK2A 1E7OA 2GQIA 2GBQA 1UUEA 2X3XD 1SHGA 3RBBB 5EC7A 1QLYA 1K1ZA 2K2MA 4ZNXA 2EPDA 2AKKA 1OOTA 1PKTA 2RMOA 2ABLA 3NGPA 1W6XA 2HDAA 4OMLA 1M3BA 1W70A 2KE9A 2RQVA 4LUEA 4AFSC 1PRMC 2AKLA 2DL5A 5IH2A 1KIKA 1B3QA 4OMOA 1YNZA 1CSKA 1AZGB 1MV0B 2F2XA 1T3LA 2VKNA 1VYVA 3FJ5A 1GCQA 2RQWA 3I5RA 2ROTA 3NMZC 2F2WA 2EKHA 2CUBA 1SRMA 2KRMA 1ZSGA 2K79A 1JU5C 2K6DA 2FPFA 5IXFA 4R0KA 1AWXA 1X69A 2DILA 4J9HA 1K0SA 4AFQC 2CDTA 3NPFA 2KGTA 2RQTA 2RQUA 5IHKA 1QCFA 3H0FA 3UA6A 3H41A 1GCPA 1KSWA 2VWFA 1WYXA 1NYGA 3M0TA 4J9BA 1X27A 1CKBA 2HSPA 1RUWA 3JV3A 4RTTA 2NWMA 1X6BA 1AWOA 2W10A 2EYXA 1K4US 4ESRA 2A36A 2ENMA 1WDXA 4LUDA 1OPLA 1U5SA 2KRNA 2YSQA 2MOXA 5FWCA 1JXOA 2AZSA 3ZL7C 3R6NA 4J9GA 2JW4A 3UA7A 3EHRA 1ZUUA 1ABOA 3KFVA 2FRYA 1X2KA 2D8JA 2LMJA 2YUOA 4RTUA 4HVUA 1QKXA 1K76A 2DL8A 3M0QA 2FPDA 4FSSA 2BTTA 5HCKA 1UG1A 1UECA 2L3SA 2L2PA 3EG2A 2O9SA 3CQTA 1YWOA 1GFDA 1WLPB 4JPBW 3SHWA 1RI9A 1T3SA 2V1QA 2KXCA 4F14A 1FMKA 2CH4W 1FYNA 1WXTA 1KJWA 2LJ1A 2DBKA 2LX7A 3I5SA 1AEYA 1RLQC 1UDLA 2LJ3A 1PNJA 5GJWB 1T0HA 2DJQA 2HEQA 5I22A 2K7AA 2D1XA 2B86A 2JXBA 4A63B 1V1CA 4JJDA 2CT3A 1H92A 2LQWA 1SEMA 5IXBA 4GLMA 2EBPA 3VS5A 3M0SA 1WIEA 1ZLMA 4AG2C 4RTYA 1NEGA 1Y0MA 2MCNA 1TUCA 4HXJA 2YUQA 2ROLA 2J06A 1T0JA 5IHIA 2H8HA 1UJYA 4RUGA 1G2BA 2J6KA 2KYBA 2QDLA 3H0IA 3REBB 2AZVA 2JS0A 3EGUA 1TG0A 1UJ0A 4CC7A 1BB9A 2YT6A 1BBZA 1CKAA 1UE9A 4HVVA 1E6GA 1AVZC 4JZ4A 2O88A 1WXBA 4JJBA 1VYTA 2F2VA 2G6FX 3VS3A 4EIKA 3LH5A 3VS7A 2J7IA 3EG0A 2DL3A 2CH4A 1NYFA 1SPKA 1E6HA 2VVKA 4IIMA 5ECAA 2EW3A 1WXUA 2YUNA 1UGVA 1JXMA 2KYMA 4D8DA 3IQLA 3PVQA 1AOJA 4RTXA 3VS6A 4DEYA 2O2OA 2DM1A 1ABQA 1PKSA 1H8KA 4OMNA 4OMQA 3TVTA 2FG0A 1ZUYA 2CREA 2DRKA 2LCSA 3SEMA 1GRIA 2W0ZA 3O5ZA 4IIOA 2J6OA 3UATA 3GBQA 2DLPA 2RQRA 1H3HA 1X43A 2JM8A 5FWBA 1K0XA 2DNUA 2DRMA 1GFCA 1U3OA 1I07A 2DE0X 4J9FA 1VA7A 1Z9ZA 4LNPA 2K3BA 4JJCA 4OMMA 4WCIA 1WI7A 4Z89A 1PRLC 2M0YA 4CC2A 2LP5A 1AD5A 2DYBA 1M27C 4DEXA 4J9CA 2OJ2A 1X2QA 3TSWA 3M0RA 4JZ3A 3I35A 2J05A 4F16A 1HJDA 2OAWA 2JMCA 2BZYA 1M30A 2JS2A 5L23A 1RLPC 2EGAA 2PNIA 4J9EA 5I11A 2L3QA 1WFWA 3VS0A 2SRCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O31 A;  1UFF A;  2DL4 A;  1UHF A;  3EG1 A;  2DF6 A;  1TUD A;  1YN8 A;  2C0T A;  4E6R A;  2D8H A;  2X3W D;  2KT1 A;  1K9A A;  1UHC A;  3TSZ A;  2I0N A;  1HSQ A;  4QT7 A;  2A08 A;  3QWY A;  1NM7 A;  2EQI A;  2FPE A;  2JMA A;  1WX6 A;  1YCS B;  1NLP C;  4LE9 A;  4AFZ C;  1KFZ A;  3VRZ A;  2EYZ A;  4M4Z A;  2LZ6 B;  1VYU A;  3REA B;  2ED1 A;  2KRS A;  1I1J A;  1OV3 A;  2AK5 A;  3VRY A;  2FO0 A;  1M3C A;  2M51 A;  3M0P A;  4GBQ A;  1QWF A;  2LJ0 A;  2ED0 A;  2GNC A;  4RTZ A;  2HCK A;  2OI3 A;  2SEM A;  2K9G A;  1JEG A;  2EYY A;  2YDL A;  2FEI A;  2D0N A;  3ULR B;  3A98 A;  2JM9 A;  2JT4 A;  2KR3 A;  1NEB A;  3UF4 A;  5FW9 A;  5GJV B;  2C0I A;  1IO6 A;  1GBQ A;  1YP5 A;  2EVR A;  4HCK A;  2ECZ A;  1ZBJ A;  4Y92 A;  2XMF A;  1MV3 A;  1XOV A;  2L3P A;  2LNH B;  2KBT A;  1HD3 A;  1JQQ A;  2RN8 A;  4J9I A;  3M0U A;  2KXD A;  4RTW A;  4AFU C;  1LCK A;  2IIM A;  2GTJ A;  4KRT A;  4ORZ A;  2V1R A;  1PWT A;  2PZ1 A;  2O9V A;  1NG2 A;  1YWP A;  1BU1 A;  1SSH A;  1W1F A;  4HVW A;  2BZX A;  2DBM A;  2HBW A;  1NLO C;  2KNB B;  2RF0 A;  1Z9Q A;  1X6G A;  2PTK A;  2DMO A;  2CSQ A;  2ESW A;  2KEA A;  1B07 A;  3QWX X;  2KT8 A;  1AWJ A;  2BZ8 A;  2GTO A;  4X1V A;  1ARK A;  1GL5 A;  2DX1 A;  2EGE A;  3EHQ A;  1U06 A;  1GCQ C;  2LQN A;  4CC4 B;  3RNJ A;  2EGC A;  3I9Q A;  1QWE A;  2GGR A;  2MIO A;  3VS4 A;  1I0C A;  1SHF A;  1J3T A;  1MUZ A;  1M8M A;  1OPK A;  1AZE A;  1AWW A;  4CC3 A;  2CUD A;  1G83 A;  3H0H A;  3EG3 A;  2E5K A;  3U23 A;  4D8K A;  1GBR A;  4AG1 C;  1EFN A;  1SRL A;  4LN2 A;  2KRO A;  2FRW A;  3PVL A;  2EYW A;  2CT4 A;  1S1N A;  3VS1 A;  5IHN A;  2P4R A;  2A28 A;  4OMP A;  3VS2 A;  2A37 A;  3NHN A;  1PHT A;  2DVJ A;  2CSI A;  2J6F A;  2RNA A;  1WA7 A;  3C0C A;  2YUP A;  2NUZ A;  3PE0 A;  1UTI A;  1OEB A;  1JO8 A;  1A0N B;  4F17 A;  2L0A A;  4RTV A;  3THK A;  1ZX6 A;  2DA9 A;  2JTE A;  2RPN A;  1ZUK A;  4Z88 A;  4K11 A;  1Y57 A;  4Z8A A;  2DL7 A;  1QKW A;  1N5Z A;  2C0O A;  4J9D A;  1M3A A;  1BK2 A;  1E7O A;  2GQI A;  2GBQ A;  1UUE A;  2X3X D;  1SHG A;  3RBB B;  5EC7 A;  1QLY A;  1K1Z A;  2K2M A;  4ZNX A;  2EPD A;  2AKK A;  1OOT A;  1PKT A;  2RMO A;  2ABL A;  3NGP A;  1W6X A;  2HDA A;  4OML A;  1M3B A;  1W70 A;  2KE9 A;  2RQV A;  4LUE A;  4AFS C;  1PRM C;  2AKL A;  2DL5 A;  5IH2 A;  1KIK A;  1B3Q A;  4OMO A;  1YNZ A;  1CSK A;  1AZG B;  1MV0 B;  2F2X A;  1T3L A;  2VKN A;  1VYV A;  3FJ5 A;  1GCQ A;  2RQW A;  3I5R A;  2ROT A;  3NMZ C;  2F2W A;  2EKH A;  2CUB A;  1SRM A;  2KRM A;  1ZSG A;  2K79 A;  1JU5 C;  2K6D A;  2FPF A;  5IXF A;  4R0K A;  1AWX A;  1X69 A;  2DIL A;  4J9H A;  1K0S A;  4AFQ C;  2CDT A;  3NPF A;  2KGT A;  2RQT A;  2RQU A;  5IHK A;  1QCF A;  3H0F A;  3UA6 A;  3H41 A;  1GCP A;  1KSW A;  2VWF A;  1WYX A;  1NYG A;  3M0T A;  4J9B A;  1X27 A;  1CKB A;  2HSP A;  1RUW A;  3JV3 A;  4RTT A;  2NWM A;  1X6B A;  1AWO A;  2W10 A;  2EYX A;  1K4U S;  4ESR A;  2A36 A;  2ENM A;  1WDX A;  4LUD A;  1OPL A;  1U5S A;  2KRN A;  2YSQ A;  2MOX A;  5FWC A;  1JXO A;  2AZS A;  3ZL7 C;  3R6N A;  4J9G A;  2JW4 A;  3UA7 A;  3EHR A;  1ZUU A;  1ABO A;  3KFV A;  2FRY A;  1X2K A;  2D8J A;  2LMJ A;  2YUO A;  4RTU A;  4HVU A;  1QKX A;  1K76 A;  2DL8 A;  3M0Q A;  2FPD A;  4FSS A;  2BTT A;  5HCK A;  1UG1 A;  1UEC A;  2L3S A;  2L2P A;  3EG2 A;  2O9S A;  3CQT A;  1YWO A;  1GFD A;  1WLP B;  4JPB W;  3SHW A;  1RI9 A;  1T3S A;  2V1Q A;  2KXC A;  4F14 A;  1FMK A;  2CH4 W;  1FYN A;  1WXT A;  1KJW A;  2LJ1 A;  2DBK A;  2LX7 A;  3I5S A;  1AEY A;  1RLQ C;  1UDL A;  2LJ3 A;  1PNJ A;  5GJW B;  1T0H A;  2DJQ A;  2HEQ A;  5I22 A;  2K7A A;  2D1X A;  2B86 A;  2JXB A;  4A63 B;  1V1C A;  4JJD A;  2CT3 A;  1H92 A;  2LQW A;  1SEM A;  5IXB A;  4GLM A;  2EBP A;  3VS5 A;  3M0S A;  1WIE A;  1ZLM A;  4AG2 C;  4RTY A;  1NEG A;  1Y0M A;  2MCN A;  1TUC A;  4HXJ A;  2YUQ A;  2ROL A;  2J06 A;  1T0J A;  5IHI A;  2H8H A;  1UJY A;  4RUG A;  1G2B A;  2J6K A;  2KYB A;  2QDL A;  3H0I A;  3REB B;  2AZV A;  2JS0 A;  3EGU A;  1TG0 A;  1UJ0 A;  4CC7 A;  1BB9 A;  2YT6 A;  1BBZ A;  1CKA A;  1UE9 A;  4HVV A;  1E6G A;  1AVZ C;  4JZ4 A;  2O88 A;  1WXB A;  4JJB A;  1VYT A;  2F2V A;  2G6F X;  3VS3 A;  4EIK A;  3LH5 A;  3VS7 A;  2J7I A;  3EG0 A;  2DL3 A;  2CH4 A;  1NYF A;  1SPK A;  1E6H A;  2VVK A;  4IIM A;  5ECA A;  2EW3 A;  1WXU A;  2YUN A;  1UGV A;  1JXM A;  2KYM A;  4D8D A;  3IQL A;  3PVQ A;  1AOJ A;  4RTX A;  3VS6 A;  4DEY A;  2O2O A;  2DM1 A;  1ABQ A;  1PKS A;  1H8K A;  4OMN A;  4OMQ A;  3TVT A;  2FG0 A;  1ZUY A;  2CRE A;  2DRK A;  2LCS A;  3SEM A;  1GRI A;  2W0Z A;  3O5Z A;  4IIO A;  2J6O A;  3UAT A;  3GBQ A;  2DLP A;  2RQR A;  1H3H A;  1X43 A;  2JM8 A;  5FWB A;  1K0X A;  2DNU A;  2DRM A;  1GFC A;  1U3O A;  1I07 A;  2DE0 X;  4J9F A;  1VA7 A;  1Z9Z A;  4LNP A;  2K3B A;  4JJC A;  4OMM A;  4WCI A;  1WI7 A;  4Z89 A;  1PRL C;  2M0Y A;  4CC2 A;  2LP5 A;  1AD5 A;  2DYB A;  1M27 C;  4DEX A;  4J9C A;  2OJ2 A;  1X2Q A;  3TSW A;  3M0R A;  4JZ3 A;  3I35 A;  2J05 A;  4F16 A;  1HJD A;  2OAW A;  2JMC A;  2BZY A;  1M30 A;  2JS2 A;  5L23 A;  1RLP C;  2EGA A;  2PNI A;  4J9E A;  5I11 A;  2L3Q A;  1WFW A;  3VS0 A;  2SRC A; 
#chains in the Genus database with same CATH topology
 1Y7X A;  2K5F A;  1UFF A;  3V7R A;  2P4T A;  2DF6 A;  4XU1 A;  1TUD A;  2D8H A;  4EPC A;  1K9A A;  1UHC A;  1ZA1 B;  4PJO D;  2I0N A;  1HSQ A;  1IGU A;  2ZZD A;  3RR6 A;  2F5T X;  3C12 A;  4FW1 A;  2P84 A;  4LE9 A;  2MWO A;  2ZPB B;  4RMO A;  1VQ7 A;  2LZ6 B;  4M78 C;  2ED1 A;  5J39 A;  3LH0 A;  2I2L A;  1VQ8 T;  1M3C A;  2M51 A;  5DY9 A;  2OAU A;  2LVM A;  4PJO A;  2GNC A;  2OI3 A;  1VQ4 Q;  2SEM A;  3CME T;  2K9G A;  5L8R E;  3JCM h;  2EYY A;  2FEI A;  2XKO C;  3A98 A;  3M9Q A;  2JT4 A;  4XU2 A;  1YHQ T;  5GJV B;  1QVG S;  4XU0 A;  1Q82 C;  1NPP A;  1YJN A;  1K9M C;  2RO0 A;  2L8D A;  2ECZ A;  2EAY A;  5LJ5 g;  4FYW B;  3G6E T;  1PCX A;  2RN8 A;  5LJ5 e;  1FMV A;  2KXD A;  1IGQ A;  2DEU A;  4ORZ A;  2V1R A;  2EJG A;  2O9V A;  3FRN A;  5AT1 B;  1W1F A;  1M1F A;  2BZX A;  2DBM A;  1RAH B;  1NLO C;  2RF0 A;  4DBQ A;  3CC4 A;  2P0K A;  1SF9 A;  3VUB A;  3QWX X;  2E3I A;  1KHC A;  2BZ8 A;  2GTO A;  4Y28 E;  3CCJ A;  2E3H A;  3QYH B;  3EHQ A;  1GCQ C;  1LPL A;  2OX7 A;  2VGN A;  3PGG A;  5LJ3 f;  1J3T A;  1MUZ A;  5KYY B;  1OPK A;  1AZE A;  1AWW A;  3CPW P;  1G83 A;  3OBY A;  2KRO A;  2HBP A;  1R8O B;  3DB4 A;  1S1N A;  5IHN A;  1YJ9 T;  1Q81 C;  2P4R A;  3VS2 A;  2P0Q A;  3NHN A;  2DVJ A;  2CSI A;  3CCS T;  3PE0 A;  5GAM j;  3A5Z B;  1VQL T;  1S72 A;  1WNL A;  1YJN Q;  4E47 A;  1VQP A;  1RAB B;  3THK A;  5KCO A;  5CQX A;  4M7A C;  2OTJ T;  4XU3 A;  3DLM A;  1X6O A;  3EGX B;  2CGH A;  4EMK B;  1Q7Y U;  4C8Q D;  4M75 E;  2D6F A;  4J9D A;  2GBQ A;  1UUE A;  5GAN j;  2X3X D;  2DKG A;  1R77 A;  5EC7 A;  1QLY A;  3M4G A;  4BI4 A;  1VQ8 A;  3C94 A;  2EPD A;  2JN0 A;  2E65 A;  3JB9 D;  1RAG B;  4PJO G;  4M77 A;  5FRM A;  1W6X A;  4C8Q A;  4E7L A;  4J7I A;  3CC4 Q;  2GCX A;  3GIB A;  1M3B A;  1YIJ Q;  2RJD A;  3P8D A;  3CME A;  3M5A A;  1PRM C;  1UGR B;  2QA4 Q;  3A8O B;  1YNZ A;  5D6W A;  5GAO m;  3CCJ Q;  1YHQ A;  4A53 A;  4J8O A;  2D9T A;  4P5N A;  1GCQ A;  2RQW A;  2ROT A;  4PJO F;  2F2W A;  4BUG A;  3L2Z A;  2KRM A;  2QQB A;  2K79 A;  4OGE A;  4FL6 A;  3PTA A;  5IXF A;  1QVG A;  2NUP B;  2DIL A;  5CK9 A;  3KUF A;  3WXM B;  3G4S Q;  1OUL A;  1W2B S;  2MAM A;  5IHK A;  2RHY A;  2A7Y A;  3H0F A;  5J26 A;  3H9N A;  1VQ9 Q;  1GCP A;  2YXY A;  1DJ7 B;  3MJX A;  4PFO A;  2QAZ A;  3L2V A;  1VQP Q;  3QZ5 B;  2RI3 A;  3JV3 A;  2NWM A;  5LL6 S;  4J5Y A;  4JRK A;  1VIE A;  1WQW A;  1PSF A;  4ESR A;  1WDX A;  5LJ3 d;  2MOX A;  4M7A B;  1D3B B;  1TTH B;  4J9G A;  3UA7 A;  3EHR A;  2JNG A;  1ABO A;  2RM4 A;  3MEU A;  1KD1 U;  3KFV A;  2AHJ B;  5KE2 A;  2D8J A;  2LMJ A;  3EFR A;  4RTU A;  2DL8 A;  3VU3 C;  5GAM g;  3MEW A;  1M1K R;  1I4K 1;  5CIU A;  1UEC A;  1TOV A;  2O9S A;  1M2V B;  3CQT A;  1SG5 A;  1GFD A;  3H8Z A;  3CCS A;  1WLP B;  1RI9 A;  1T3S A;  1M90 R;  2KXC A;  4F14 A;  1WXT A;  4XQ3 A;  2EFI A;  3CCM T;  2ATC B;  5GAN g;  3VJP A;  1RLQ C;  1PNJ A;  1T0H A;  3CD6 Q;  2O4X B;  1N8R U;  4GY5 A;  5I22 A;  1YIT A;  2D1X A;  4A63 B;  1QQJ A;  5DLO A;  2RHZ A;  5FU6 B;  1H92 A;  2LQW A;  1BI1 A;  2KK4 A;  1YI2 Q;  3M0S A;  1OX8 A;  1WPY A;  4AG2 C;  5KYX A;  5GAN 3;  4EMG A;  3X28 B;  3CEY A;  1K8A R;  1N9S A;  3OYL A;  2F1L A;  3JCM c;  5LJ5 h;  4C8Q G;  1VQM T;  1G2B A;  3REB B;  3V8J A;  2C06 A;  2AZV A;  4A4H A;  4CC7 A;  1N27 A;  4JDS A;  3TEE A;  1BBZ A;  3J7A F;  4YTL A;  4HVV A;  2LX9 A;  3JB9 G;  2O88 A;  1VYT A;  3SFM A;  1QW1 A;  2G6F X;  1VQO Q;  3JCM g;  2HL5 C;  3LH5 A;  2CH4 A;  3OW2 S;  3EFO A;  4IIM A;  2IG0 A;  2LDM A;  4J7F A;  4F7U G;  3QII A;  1ZSZ B;  2EW3 A;  1UGV A;  3VV0 A;  2RI5 A;  3JB9 F;  3HHT B;  1NJI U;  1AOJ A;  4RTX A;  3FEO A;  1OZ3 A;  4ANJ A;  1VQN T;  3MEA A;  3NTK A;  4O6J A;  2D0Q B;  1PKS A;  4KUL A;  4FSX A;  2QQA A;  2E64 A;  4A4F A;  3TVT A;  4F7U F;  4HKE A;  3LYI A;  2CRE A;  2EKO A;  3SEM A;  1GRI A;  3E1S A;  3O5Z A;  4IIO A;  1SKU B;  3GBQ A;  2OTL T;  2RQR A;  4XTU A;  4TVR A;  4CRI A;  1YIT Q;  1X43 A;  2KMT A;  1JRI A;  2DYI A;  2DRM A;  4NL3 A;  4FT2 A;  2IVW A;  2DE0 X;  4J9F A;  5D6X A;  3CXC S;  3CC7 T;  2QG9 B;  4EMH A;  4JS4 A;  4OMM A;  2VGM A;  1WI7 A;  1PRL C;  1OX9 A;  5CKE A;  1AD5 A;  2DYB A;  2DO3 A;  4BD3 A;  2OJ2 A;  1X2Q A;  1OU8 A;  2J05 A;  4FYX B;  1HJD A;  3EG9 B;  2KY9 A;  5GAN 4;  4KH0 B;  2BZY A;  1BIB A;  4N4H A;  2PUO B;  3CCU T;  2KSS A;  2GFU A;  1TWB A;  3CCM A;  3EG1 A;  5CKH A;  5I21 A;  2C0T A;  7AT1 B;  3JB9 J;  4E6R A;  2X3W D;  5CKF A;  2KT1 A;  1I5O B;  2A08 A;  2G3R A;  3QWY A;  1WX6 A;  3TRE A;  4M75 F;  4FCY A;  4AFZ C;  2QI2 A;  3HRU A;  2EYZ A;  4R55 A;  3JCM X;  1VYU A;  5FU7 C;  2ZCF B;  3UWN A;  1UB4 A;  1I1J A;  1OV3 A;  4C92 D;  4ME7 A;  3CCR T;  2XG8 D;  1V29 B;  2LCL A;  2LJ0 A;  2ED0 A;  4RTZ A;  2HCK A;  3VYH B;  2LC4 A;  3FDR A;  2EWN A;  2E70 A;  4ZGJ B;  1WQ7 A;  3LLR A;  2VB6 A;  4KGV B;  4IUP A;  3A8L B;  4FYY B;  3RER A;  2RHI A;  3LGL A;  5AYF A;  4C92 A;  3L2U A;  2LT1 A;  1NEB A;  3UF4 A;  2X4X A;  1Q86 C;  3E2U A;  4RG2 A;  3CCL T;  4HT8 A;  3S3O A;  1LNX A;  5CAI A;  2XMF A;  4HCC A;  1XOV A;  5IT9 E;  2LNH B;  4HA8 A;  2X51 A;  5LJ5 j;  4FT4 A;  4XTZ A;  3X25 B;  4E7I A;  4ZTJ A;  1LCK A;  1WHM A;  1OYX A;  4QVD A;  1JBM A;  2XHC A;  2IPO B;  3CMA T;  3EAE A;  4PJO C;  4IUV A;  3OW2 A;  1VQN A;  1BU1 A;  1SSH A;  1QVG P;  3M58 A;  2P0P A;  3EH1 A;  2HBW A;  3AT1 B;  5GAM f;  2KNB B;  4C0Z A;  2DXC A;  2QQR A;  2CSQ A;  3OQ5 A;  3KXT A;  3CC2 T;  1BI3 A;  3OYY A;  2DET A;  3JB9 H;  1QVF S;  2YRD A;  2FZK B;  2OTL A;  1ARK A;  3DKM A;  3P8H A;  2DX1 A;  1U06 A;  2LQN A;  3DB3 A;  3RNJ A;  2EGC A;  2QGG A;  4PFP A;  5GAN f;  1B34 B;  3CC7 A;  1QWE A;  2GGR A;  3S6W A;  3OS5 A;  3AHU A;  2K3Y A;  4M7D E;  3HRS A;  2CUD A;  1VQ6 A;  3H0H A;  3EG3 A;  2QEX T;  4D8K A;  2VXF A;  2KQW A;  3J80 E;  2DXU A;  2CYZ B;  4OB1 B;  3MET A;  3E9F A;  2DIQ A;  3PVL A;  2E12 A;  3QDR B;  2EYW A;  2Z0W A;  4J6X A;  5HY6 A;  2A37 A;  2CKK A;  1M9S A;  1FX7 A;  3M57 A;  1JO8 A;  1RAF B;  3CCU A;  1A0N B;  1RI0 A;  2L0A A;  3INZ A;  4M78 E;  1ZX6 A;  2JTE A;  5GAN 8;  3OYN A;  1VQ5 T;  1ZUK A;  4Z88 A;  1Y96 B;  3JCM V;  1C0M A;  4Z8A A;  3CCQ Q;  1VQK T;  2X35 A;  1KC8 R;  5A0D A;  1QKW A;  2C0O A;  2MF2 A;  3G71 Q;  1K73 C;  1M3A A;  1BK2 A;  1E7O A;  3JCM f;  1SHG A;  3RBB B;  3L42 A;  3I56 A;  3CCR A;  1K1Z A;  1WJQ A;  1RAA B;  2AKK A;  3HTR A;  4QVC A;  1QP3 A;  1WJS A;  2PU9 B;  2V8J A;  2HDA A;  5KYU A;  1IB8 A;  1IXD A;  1W70 A;  2KE9 A;  2RQV A;  4PLL A;  1UGS B;  3RKW A;  4AFS C;  3NTH A;  2DL5 A;  1KIK A;  4OMO A;  1N9R A;  4C92 G;  3G7Z A;  1CSK A;  2F2X A;  4KT0 E;  6AT1 B;  1D0X A;  4XTY A;  1VYV A;  3FJ5 A;  2ZAE A;  4BDZ A;  3I5R A;  3CCL A;  3S3N A;  3OYI A;  1MMN A;  1SRM A;  3L2R A;  1NPR A;  1BYM A;  2K6D A;  1VQ6 Q;  1O75 A;  3OYH A;  4R0K A;  4C92 F;  1AWX A;  2XI9 A;  1X69 A;  2B8A A;  4AFQ C;  3I55 T;  1ZA2 B;  3NPF A;  3JSC A;  4OB2 B;  1WHG A;  3CMA A;  4M77 C;  4C8Q C;  1U1S A;  3H41 A;  5GAM d;  2RH2 A;  1PM3 A;  1KSW A;  2X4J A;  1U1T A;  4DA4 A;  2NLU A;  1V76 A;  1NYG A;  3M0T A;  4HCB A;  4M7D B;  1X27 A;  1CKB A;  1M2O A;  1M1K U;  5CR2 A;  3VKI A;  2YLB A;  1LJO A;  3EGD B;  1X6B A;  1AWO A;  1VQ7 Q;  3UPU A;  2CP5 A;  5KCH A;  1M90 U;  5GAN d;  2A36 A;  1W2B P;  2ENM A;  3QDF A;  2KRN A;  1U5S A;  2DTH A;  3JB9 I;  4PJL A;  5FWC A;  2COW A;  2HQX A;  4O5V A;  2JW4 A;  3I56 Q;  2GFA A;  1QVF A;  2XD0 A;  4M78 B;  4JRP A;  2FRY A;  4KUI A;  4V2S A;  3LX7 A;  3JCM J;  3MPU B;  1K76 A;  1K9M R;  2X4W A;  2M0O A;  2BTT A;  4M7A E;  1UG1 A;  5A0L A;  2A3L A;  1RL2 A;  1K8A U;  3SHW A;  2V1Q A;  3GOX A;  1FMK A;  2CH4 W;  4ZN3 A;  2DTO A;  5EG2 A;  1KJW A;  1FWZ A;  4FW2 A;  3V7C A;  3OYE A;  1C1A A;  1YFN A;  2HQE A;  2KI7 A;  2DBK A;  1VQ5 A;  1UDL A;  1TS9 A;  2WSC E;  1ZQ1 A;  2HSE B;  3GPL A;  1D0Z A;  1VQK A;  4EMK A;  2EJF A;  4IUQ A;  2K7A A;  2JXB A;  2CT3 A;  2GF7 A;  1MND A;  4GLM A;  3C4S A;  4IUT A;  4MDW A;  1JB0 E;  2L5Q A;  4RTY A;  4PLI A;  2A0F B;  4DBF A;  2YUQ A;  2ROL A;  1T0J A;  1VOM A;  2DD4 A;  2YRV A;  2M1H A;  4M77 B;  3JCM P;  3CCE T;  4C8Q B;  1WJR A;  3EGU A;  1KQS A;  4GLK A;  2YT6 A;  4BY6 C;  1UE9 A;  3ZFJ A;  1E6G A;  4DQ2 A;  4JJB A;  3JCM b;  3G6E A;  4PJJ A;  5GMK i;  5CVI A;  3VS3 A;  1Q81 R;  4F7U A;  4JRI A;  2J7I A;  1G3W A;  2YUN A;  4ZN1 A;  5GAN 2;  3E9G A;  3I55 A;  2HZY A;  1QP2 A;  1AT1 B;  3A8G B;  2EQU A;  3PVQ A;  2JTM A;  3VS6 A;  4JJN K;  1S72 Q;  2Y90 A;  2NUT A;  4E2F B;  4OMN A;  5KE3 A;  3FB9 A;  1ZUY A;  1HK9 A;  2F69 A;  2VAS A;  3SB2 A;  3OW2 P;  3E19 A;  3MHX A;  3X26 B;  4NOY A;  3CCV T;  8AT1 B;  3RIR A;  4N4I A;  2J6O A;  3UAT A;  2CP2 A;  1Y71 A;  1BIA A;  1W4S A;  2DLP A;  1H3H A;  5FWB A;  4L59 A;  2VYT A;  4FYV B;  4M75 D;  1VQ8 Q;  1I07 A;  3KBG A;  1VA7 A;  1Z9Z A;  2VXE A;  2EJ9 A;  4FM4 B;  1D3B A;  1TXQ A;  1G3T A;  2RJE A;  4WCI A;  3OB9 A;  4CC2 A;  2RI2 A;  3CME Q;  1Q7Y C;  1YJ9 A;  1U8R A;  2HKN A;  1XTD A;  3M0R A;  4JZ3 A;  5IAY A;  5GMK e;  2K3X A;  4M75 A;  1YHQ Q;  4F16 A;  2EIF A;  1VUB A;  2OAW A;  2JMC A;  4C5I A;  2HKQ B;  5GAN 7;  1VQL A;  1M2V A;  1RLP C;  2KVQ G;  5I11 A;  2BUD A;  3RMQ A;  2OTJ A;  2L3Q A;  1WFW A;  3VS0 A;  5A0G A;  2R5A A;  2O31 A;  3G6E Q;  3CXC P;  3QUI A;  4E7Z A;  4KUD K;  4BY6 B;  2CP0 A;  4IKF A;  3OSV A;  4QT7 A;  5LJ5 f;  5I2S A;  4JLI A;  2FPE A;  2E41 A;  3GNF B;  1NLP C;  4M4Z A;  5I2M A;  3CBM A;  1X75 C;  2JUF A;  4AT1 B;  1I5L A;  3VRY A;  1YJW T;  4GBQ A;  1F1B B;  1QWF A;  3PIO A;  3LWH A;  4QW2 A;  3A1P A;  5KYX B;  4BI8 B;  3CCE A;  1JEG A;  3ULR B;  1S72 T;  2JM9 A;  2KR3 A;  5FW9 A;  2O01 E;  2QTV A;  3OYD A;  1GBQ A;  3MP1 A;  4HCK A;  1ZBJ A;  4Y92 A;  2V8I A;  2DVE A;  2PVD B;  2K5L A;  2L3P A;  1NZ9 A;  2KBT A;  1JQQ A;  1BI0 A;  3QJ6 A;  3M0U A;  4RTW A;  1YJ9 Q;  3EFO B;  1R0B G;  4AFU C;  4XTW A;  2IIM A;  4KRT A;  3X24 B;  4BE0 A;  3CCS Q;  4PNO A;  2AIR B;  3OYG A;  3PIP A;  2JZ2 A;  2VC8 A;  1VQL Q;  5HKC A;  1RAD B;  1NG2 A;  1KD1 C;  4HVW A;  3GF5 A;  1VIF A;  2OTJ Q;  1M4Z A;  2EQK A;  3BFM A;  1X6G A;  4C92 C;  2DMO A;  4ELZ C;  2ESW A;  2KEA A;  4C0D C;  2RJF A;  1IRE B;  2BE7 D;  5DLQ E;  1VQ4 T;  1AWJ A;  2MI6 A;  2LT4 A;  3QXE B;  2EGE A;  2X4Y A;  4CC4 B;  1I8F A;  1X01 A;  3D7S B;  4DOV A;  2HQH A;  4B6M A;  2PVG B;  3CPW A;  4MZM A;  2FYK A;  5CO7 A;  2MIO A;  1JJ2 S;  3SD4 A;  1I0C A;  2DXB A;  3HSB A;  2QK0 A;  4A4G A;  4CC3 A;  1KC8 U;  3BY7 A;  1N8R C;  1HYO A;  1SRL A;  5CQY A;  4M75 G;  2CT4 A;  3VS1 A;  2HAX A;  1QVF P;  4M7A F;  1I81 A;  1PHT A;  2J6F A;  5KYW B;  2RNA A;  4RG8 A;  3C0C A;  2YUP A;  3S3M A;  3L2W A;  4A4E A;  1EZZ B;  3EFS A;  2E1H A;  4E7K A;  4EDU A;  5LJ5 d;  2DIG A;  2HL3 A;  2XDP A;  2RPN A;  4K11 A;  1PD0 A;  1EIF A;  3C95 A;  4KBM B;  1N5Z A;  5CKD A;  5FRN A;  3MKD A;  2GQI A;  4KH1 B;  2QGF B;  1Y07 A;  2MWP A;  1D1B A;  5KH6 A;  3JAM E;  5LJ3 e;  5GAN 5;  1VQM A;  4ZNX A;  2E6Z A;  3CPF A;  1MNE A;  2RMO A;  2ABL A;  2CZ6 B;  1G3S A;  4BB7 A;  4X34 A;  4C5H A;  2QTX A;  3O8V A;  4J6Y A;  1QCO A;  1HXD A;  1NJI C;  2AKL A;  4XTX A;  1PSE A;  2MMP A;  3X20 B;  2RD1 A;  2VKN A;  2DER A;  1RAE B;  4C92 B;  2F5K A;  5CCA A;  2CUB A;  4MMK A;  4C0D B;  4UC4 A;  1ZSG A;  4PJO E;  1JU5 C;  1YJN T;  2R57 A;  4L5G A;  2WSF E;  2FPF A;  3OS2 A;  2XK0 A;  4J9H A;  2JVV A;  3SWN A;  2KGT A;  2RQU A;  4QKU A;  3RKX A;  3UA6 A;  4MZP A;  2XDD A;  3G1J A;  3CCM Q;  1PC0 A;  1Q82 U;  2VWF A;  1N6A A;  2HD0 A;  2GQV A;  1K9M U;  4LD6 A;  2LQ8 A;  1BKB A;  1RUW A;  4RTT A;  5GMK h;  5CKB A;  3CC4 T;  1VQ4 A;  1YIJ T;  2YLC A;  2EYX A;  1D0Y A;  1Q95 G;  2RA2 A;  3JCM Q;  2QA4 T;  3QG1 A;  2PVO B;  1OPL A;  4DBH A;  2YSQ A;  3CCJ T;  1B34 A;  2AZS A;  2DAQ A;  3R6N A;  3HP9 A;  1VQM Q;  4ZGD B;  5FU7 B;  3LGF A;  2RK2 A;  4LDV A;  2FVU A;  1Q86 R;  2YUO A;  3GLX A;  1QKX A;  3RKY A;  1MMA A;  2FPD A;  3VYG A;  1G3Y A;  1KQ2 A;  5HCK A;  1JJ2 A;  2L2P A;  3G4S T;  2QAS A;  8ATC B;  3MCA B;  5HK3 A;  1OZ2 A;  3LWI A;  1WGS A;  2EQM A;  1FYN A;  3OY9 A;  1YCY A;  4QQD A;  4LDY A;  1VQ9 T;  2LJ1 A;  1BCO A;  1WHH A;  1AEY A;  5GJW B;  1VQP T;  1Y96 A;  2M16 A;  1TH7 A;  3TU4 K;  2HEQ A;  1IZ6 A;  1KQS S;  1VQN Q;  5M9O A;  1Q81 U;  1C6V X;  4RCB A;  4Z02 A;  2M9U A;  4J83 A;  4A54 A;  5FRO A;  3M59 A;  2K57 A;  4HCZ A;  4PJO B;  3PMT A;  4XTV A;  4B9X A;  5IHI A;  3BDU A;  3OA6 A;  2DFU A;  2ZPH B;  2OTL Q;  5KYU B;  5D7U A;  2JS0 A;  1TG0 A;  1XQH A;  5A2Q E;  3A8M B;  1OI1 A;  1CKA A;  3CC7 Q;  2DEQ A;  4JZ4 A;  2WSE E;  2F2V A;  4N0A A;  4EMK C;  4M77 E;  3EG0 A;  2DL3 A;  1NYF A;  4C8Q E;  3H6Z A;  1G8X A;  2ZGW A;  3LW5 E;  4M7D D;  1MHN A;  2VV5 A;  1WXU A;  4IUR A;  4BE2 A;  2L89 A;  3M54 A;  3VUZ A;  3CD6 T;  4JS5 A;  2M02 A;  3QKJ A;  4DEY A;  3CCU Q;  2O2O A;  2DM1 A;  3FIF A;  1H8K A;  2KDS A;  3V8K A;  1K73 R;  2QQS A;  1YI2 T;  3CC2 A;  3RDV A;  4M7D A;  2FG0 A;  2PUK B;  1D09 B;  3QZ9 B;  2DRK A;  4ATO A;  4F7U E;  3EGD A;  2LCS A;  3URG A;  1KG1 A;  2H3E B;  4M78 D;  2W0Z A;  2CP3 A;  1YIJ A;  2BKD N;  3FC3 A;  1M5Q 1;  2QA4 A;  1K0X A;  3CCR Q;  2DNU A;  5KYY A;  4MZT A;  2LNV A;  2FZC B;  2X9H A;  4OF1 A;  4JJC A;  2QEX A;  1Q82 R;  4Z89 A;  1XNI A;  2MPX C;  2ZPI B;  1VQO T;  1R0C B;  4M78 A;  4OMF B;  3HL8 A;  4C0F A;  4DEX A;  5C6S A;  5GMK j;  3N5B B;  3I35 A;  2MK5 A;  3G4S A;  3V8L A;  3CCL Q;  3BE3 A;  5LJ3 h;  1M30 A;  4CI0 C;  1BI2 A;  4LDW A;  2EGA A;  2PNI A;  3OYK A;  4OP0 A;  5GMK l;  3MP6 A;  2LRQ A;  1WHJ A;  4KGX B;  2SRC A;  3JRZ A;  2DL4 A;  1VQ9 A;  3EGX A;  1UHF A;  4DOW A;  4WF2 A;  3JCM d;  1YN8 A;  2LTO A;  4N4G A;  3TSZ A;  2JOY A;  1NM7 A;  2EQI A;  2JMA A;  3CMA Q;  1YCS B;  2VUB A;  2Y4Y A;  1KFZ A;  4M77 D;  3VRZ A;  4Y91 A;  3M56 A;  3REA B;  2KRS A;  4XK8 E;  1YIT T;  2AK5 A;  4PL6 A;  4F04 B;  2FO0 A;  3M0P A;  4M75 C;  2FL7 A;  3CC2 Q;  3OBW A;  3QHS A;  3QSU A;  2K5I A;  2YDL A;  3CBO A;  2D0N A;  2KAF A;  4C0G A;  4L6V 5;  3HKS A;  2C0I A;  1IO6 A;  1TU0 B;  4NL2 A;  2ZPF B;  1BCM A;  3MEV A;  1YP5 A;  1RAC B;  2EVR A;  3OS0 A;  2FZG B;  1M1K C;  3QPH A;  2QEX Q;  1NBE B;  1MV3 A;  3L1A A;  3QO3 A;  3WVE B;  2NUP A;  1HD3 A;  1TSF A;  4F7U B;  4J9I A;  4PKC C;  1IRX A;  5FU6 C;  1M90 C;  2GTJ A;  3CD6 A;  1PWT A;  2RHU A;  2PZ1 A;  3M53 A;  1KHI A;  1YWP A;  4M7A D;  3GP8 A;  1MMG A;  3CPW S;  2XIC A;  5GAO p;  1VQ5 Q;  2NUT B;  1YI2 A;  4M7D G;  1Z9Q A;  1MGQ A;  2PTK A;  1VQK Q;  1WHK A;  2FHD A;  1B07 A;  3JCM W;  2KT8 A;  1P92 A;  3RMS A;  3ZBD A;  5GAO n;  1K8A C;  4M7A A;  1GL5 A;  2CS7 A;  3ZEH A;  3I9Q A;  2CZ7 B;  4VUB A;  4M7D F;  1G5V A;  1ZSZ C;  3VS4 A;  1SHF A;  1M8M A;  4M78 G;  1VQO A;  4C5G A;  4OB3 B;  4IUU A;  2E5K A;  3U23 A;  1GBR A;  4AG1 C;  1EFN A;  4LN2 A;  2XDB A;  4LDU A;  2FRW A;  2K2V A;  1MMD A;  4QQG A;  4JRQ A;  2A28 A;  2H3J A;  4OMP A;  2RB6 A;  4M75 B;  3P8B B;  1WA7 A;  3ME9 A;  2CZ1 B;  2NUZ A;  4M78 F;  1UTI A;  1OEB A;  5GAM e;  3QJY A;  4F17 A;  4RTV A;  2DXT A;  1TUG B;  1JJ2 P;  4J6W A;  2DA9 A;  2O4X A;  3HFO A;  2COZ A;  1Y57 A;  2EQJ A;  4ZGE B;  3I55 Q;  4X9D A;  4LXC A;  2DL7 A;  1KQ1 A;  4BI3 A;  2LQK A;  3PT9 A;  5GAN e;  3OMC A;  3PMI A;  5LJ3 j;  2DPP B;  3T9N A;  4QVZ A;  2K2M A;  1OOT A;  1PKT A;  3NGP A;  5HK0 A;  1M8V A;  3OS1 A;  1ZBX A;  4OML A;  3OYF A;  5FLX E;  1LOJ A;  4M77 G;  2AT1 B;  4LUE A;  2E5Q A;  1PD1 A;  5IH2 A;  1B3Q A;  1M1G A;  2XID A;  3CBP A;  1Q7Y R;  1AZG B;  1MV0 B;  1T3L A;  4KGZ B;  4E7H A;  3OYJ A;  3NMZ C;  2EKH A;  2ZPE B;  3FLG A;  3TQ7 P;  2XU8 A;  2V8K A;  1WZO A;  2DZ9 A;  3WVD B;  2DTI A;  1ZSZ A;  1IHV A;  4M77 F;  4BAC A;  2RHX A;  4C8Q F;  2QDY B;  4A4K A;  1K0S A;  2R5M A;  3JCM e;  2E6N A;  1NE8 A;  2CDT A;  3CCQ T;  2RQT A;  4C92 E;  1O9S A;  3G71 T;  1QCF A;  1AHJ B;  3M4Y A;  2YHT A;  3PNW C;  2NYS A;  1Q86 U;  2DK3 A;  3QYG B;  1WYX A;  1PG5 B;  2LCC A;  4J9B A;  4PJM A;  9ATC B;  3CCV A;  4FIB A;  2DJZ A;  1RAI B;  2HSP A;  1EX4 A;  1OU9 A;  1W2B A;  2BIV A;  2W10 A;  1K4U S;  4M7A G;  2YWW A;  1UGQ B;  4LUD A;  4LD9 K;  2EYQ A;  2FB7 A;  1JXO A;  4PFZ A;  1QVP A;  3ZL7 C;  1GXI E;  1ZUU A;  4OB0 B;  4DBR A;  3UDC A;  2K4Y A;  4ZTF A;  3F70 A;  5GMK m;  3SWN C;  4QQ6 A;  3MP8 A;  1UGP B;  1X2K A;  3CCE Q;  4HVU A;  3EG9 A;  3SDZ A;  1VQ6 T;  3M0Q A;  4FSS A;  1ACM B;  2L3S A;  2RK1 A;  3EG2 A;  1YWO A;  2Y4X A;  4BE1 A;  5KYW A;  4JPB W;  1XJW B;  4NS5 A;  3OYB A;  3Q1J A;  2CP6 A;  5D6Y A;  2MYS A;  3HRT A;  1KK7 A;  3DLL A;  2LX7 A;  3I5S A;  3QBY A;  2LJ3 A;  4E7J A;  5LJ3 g;  3R6O A;  4BDY A;  3TCJ A;  1KD1 R;  4OVA A;  2QQ9 A;  2DJQ A;  2B86 A;  3OYC A;  4C5E A;  1V1C A;  4JJD A;  1VQ7 T;  5J3B A;  1OQK A;  1SEM A;  1YJW A;  5IXB A;  2EBP A;  3VS5 A;  4OGC A;  5DM7 R;  1WIE A;  1ZLM A;  4RCC A;  1NEG A;  1Y0M A;  2JTF A;  2RJC A;  3I56 T;  2MCN A;  1FXX A;  3OYM A;  1TUC A;  2COY A;  4HXJ A;  2J06 A;  3CCV Q;  2H8H A;  1UJY A;  1B7T A;  4RUG A;  2YRC A;  2J6K A;  2KYB A;  2QDL A;  3H0I A;  3J81 E;  1UJ0 A;  1BB9 A;  5GAN 6;  4XAX B;  1N8R R;  4R56 A;  1K73 U;  4WTO B;  1KQS P;  1AVZ C;  1WXB A;  2V26 A;  2DZC A;  4II1 A;  2ZPG B;  5C0M A;  2DD5 A;  4RKU E;  2JJ9 A;  4JUV A;  4EIK A;  2CZ0 B;  2QYZ A;  1YBY A;  3VS7 A;  1SPK A;  1E6H A;  4X9C A;  2VVK A;  3BDL A;  5KYN A;  2QXF A;  1WHL A;  1LVK A;  1UEB A;  1D1C A;  5ECA A;  3M55 A;  1JXM A;  1SSF A;  5GAO l;  2KYM A;  5IN1 A;  4D8D A;  3CCQ A;  2WAC A;  3V7S A;  1IHW A;  1D1A A;  3IQL A;  5GAO q;  3G71 A;  2L3R A;  3SWN B;  1QCN A;  1ABQ A;  4OMQ A;  3BW1 A;  1KC8 C;  1QMC A;  4PJN A;  3OYA A;  4E7S A;  3FJP A;  1FMW A;  3MO8 A;  4PK4 A;  4B9W A;  4LDX A;  2HNI A;  4JLG A;  2E4H A;  2PQW A;  4N0A C;  2HMA A;  2JM8 A;  4ELY C;  3L2Q A;  2E10 A;  3HFN A;  3EH2 A;  4MDX A;  1GFC A;  1U3O A;  5GAM h;  1YJW Q;  4LNP A;  1H64 1;  2K3B A;  3RES A;  1NJI R;  3A8H B;  3ASK A;  3PFS A;  2M0Y A;  2LP5 A;  4Q5W A;  1M27 C;  1ZHI A;  4J9C A;  2R58 A;  4HT9 A;  3NFC A;  3TSW A;  3NTI A;  3GNG A;  3OMG A;  5GAN h;  5GAO r;  3ER0 A;  4M7D C;  4FU6 A;  4MML A;  2JS2 A;  5L23 A;  3CXC A;  2BE9 B;  3HPW A;  4AMC A;  4J9E A;  3UT1 A;  1H3Z A;  2CP7 A;  4D6W A;  3RUX A;  4X1V A;  3OSS C; 
#chains in the Genus database with same CATH homology
 2O31 A;  1UFF A;  2DL4 A;  1UHF A;  3EG1 A;  2DF6 A;  1TUD A;  1YN8 A;  2C0T A;  4E6R A;  2D8H A;  2X3W D;  2KT1 A;  1K9A A;  1UHC A;  3TSZ A;  2I0N A;  1HSQ A;  4QT7 A;  2A08 A;  3QWY A;  1NM7 A;  2EQI A;  2FPE A;  2JMA A;  1WX6 A;  1YCS B;  1NLP C;  4LE9 A;  4AFZ C;  1KFZ A;  3VRZ A;  2EYZ A;  4M4Z A;  2LZ6 B;  1VYU A;  3REA B;  2ED1 A;  2KRS A;  1I1J A;  1OV3 A;  2AK5 A;  3VRY A;  2FO0 A;  1M3C A;  2M51 A;  3M0P A;  4GBQ A;  1QWF A;  2LJ0 A;  2ED0 A;  2GNC A;  4RTZ A;  2HCK A;  2OI3 A;  2SEM A;  2K9G A;  1JEG A;  2EYY A;  2YDL A;  2FEI A;  2D0N A;  3ULR B;  3A98 A;  2JM9 A;  2JT4 A;  2KR3 A;  1NEB A;  3UF4 A;  5FW9 A;  5GJV B;  2C0I A;  1IO6 A;  1GBQ A;  1YP5 A;  2EVR A;  4HCK A;  2ECZ A;  1ZBJ A;  4Y92 A;  2XMF A;  1MV3 A;  1XOV A;  2L3P A;  2LNH B;  2KBT A;  1HD3 A;  1JQQ A;  2RN8 A;  4J9I A;  3M0U A;  2KXD A;  4RTW A;  4AFU C;  1LCK A;  2IIM A;  2GTJ A;  4KRT A;  4ORZ A;  2V1R A;  1PWT A;  2PZ1 A;  2O9V A;  1NG2 A;  1YWP A;  1BU1 A;  1SSH A;  1W1F A;  4HVW A;  2BZX A;  2DBM A;  2HBW A;  1NLO C;  2KNB B;  2RF0 A;  1Z9Q A;  1X6G A;  2PTK A;  2DMO A;  2CSQ A;  2ESW A;  2KEA A;  1B07 A;  3QWX X;  2KT8 A;  1AWJ A;  2BZ8 A;  2GTO A;  4X1V A;  1ARK A;  1GL5 A;  2DX1 A;  2EGE A;  3EHQ A;  1U06 A;  1GCQ C;  2LQN A;  4CC4 B;  3RNJ A;  2EGC A;  3I9Q A;  1QWE A;  2GGR A;  2MIO A;  3VS4 A;  1I0C A;  1SHF A;  1J3T A;  1MUZ A;  1M8M A;  1OPK A;  1AZE A;  1AWW A;  4CC3 A;  2CUD A;  1G83 A;  3H0H A;  3EG3 A;  2E5K A;  3U23 A;  4D8K A;  1GBR A;  4AG1 C;  1EFN A;  1SRL A;  4LN2 A;  2KRO A;  2FRW A;  3PVL A;  2EYW A;  2CT4 A;  1S1N A;  3VS1 A;  5IHN A;  2P4R A;  2A28 A;  4OMP A;  3VS2 A;  2A37 A;  3NHN A;  1PHT A;  2DVJ A;  2CSI A;  2J6F A;  2RNA A;  1WA7 A;  3C0C A;  2YUP A;  2NUZ A;  3PE0 A;  1UTI A;  1OEB A;  1JO8 A;  1A0N B;  4F17 A;  2L0A A;  4RTV A;  3THK A;  1ZX6 A;  2DA9 A;  2JTE A;  2RPN A;  1ZUK A;  4Z88 A;  4K11 A;  1Y57 A;  4Z8A A;  2DL7 A;  1QKW A;  1N5Z A;  2C0O A;  4J9D A;  1M3A A;  1BK2 A;  1E7O A;  2GQI A;  2GBQ A;  1UUE A;  2X3X D;  1SHG A;  3RBB B;  5EC7 A;  1QLY A;  1K1Z A;  2K2M A;  4ZNX A;  2EPD A;  2AKK A;  1OOT A;  1PKT A;  2RMO A;  2ABL A;  3NGP A;  1W6X A;  2HDA A;  4OML A;  1M3B A;  1W70 A;  2KE9 A;  2RQV A;  4LUE A;  4AFS C;  1PRM C;  2AKL A;  2DL5 A;  5IH2 A;  1KIK A;  1B3Q A;  4OMO A;  1YNZ A;  1CSK A;  1AZG B;  1MV0 B;  2F2X A;  1T3L A;  2VKN A;  1VYV A;  3FJ5 A;  1GCQ A;  2RQW A;  3I5R A;  2ROT A;  3NMZ C;  2F2W A;  2EKH A;  2CUB A;  1SRM A;  2KRM A;  1ZSG A;  2K79 A;  1JU5 C;  2K6D A;  2FPF A;  5IXF A;  4R0K A;  1AWX A;  1X69 A;  2DIL A;  4J9H A;  1K0S A;  4AFQ C;  2CDT A;  3NPF A;  2KGT A;  2RQT A;  2RQU A;  5IHK A;  1QCF A;  3H0F A;  3UA6 A;  3H41 A;  1GCP A;  1KSW A;  2VWF A;  1WYX A;  1NYG A;  3M0T A;  4J9B A;  1X27 A;  1CKB A;  2HSP A;  1RUW A;  3JV3 A;  4RTT A;  2NWM A;  1X6B A;  1AWO A;  2W10 A;  2EYX A;  1K4U S;  4ESR A;  2A36 A;  2ENM A;  1WDX A;  4LUD A;  1OPL A;  1U5S A;  2KRN A;  2YSQ A;  2MOX A;  5FWC A;  1JXO A;  2AZS A;  3ZL7 C;  3R6N A;  4J9G A;  2JW4 A;  3UA7 A;  3EHR A;  1ZUU A;  1ABO A;  3KFV A;  2FRY A;  1X2K A;  2D8J A;  2LMJ A;  2YUO A;  4RTU A;  4HVU A;  1QKX A;  1K76 A;  2DL8 A;  3M0Q A;  2FPD A;  4FSS A;  2BTT A;  5HCK A;  1UG1 A;  1UEC A;  2L3S A;  2L2P A;  3EG2 A;  2O9S A;  3CQT A;  1YWO A;  1GFD A;  1WLP B;  4JPB W;  3SHW A;  1RI9 A;  1T3S A;  2V1Q A;  2KXC A;  4F14 A;  1FMK A;  2CH4 W;  1FYN A;  1WXT A;  1KJW A;  2LJ1 A;  2DBK A;  2LX7 A;  3I5S A;  1AEY A;  1RLQ C;  1UDL A;  2LJ3 A;  1PNJ A;  5GJW B;  1T0H A;  2DJQ A;  2HEQ A;  5I22 A;  2K7A A;  2D1X A;  2B86 A;  2JXB A;  4A63 B;  1V1C A;  4JJD A;  2CT3 A;  1H92 A;  2LQW A;  1SEM A;  5IXB A;  4GLM A;  2EBP A;  3VS5 A;  3M0S A;  1WIE A;  1ZLM A;  4AG2 C;  4RTY A;  1NEG A;  1Y0M A;  2MCN A;  1TUC A;  4HXJ A;  2YUQ A;  2ROL A;  2J06 A;  1T0J A;  5IHI A;  2H8H A;  1UJY A;  4RUG A;  1G2B A;  2J6K A;  2KYB A;  2QDL A;  3H0I A;  3REB B;  2AZV A;  2JS0 A;  3EGU A;  1TG0 A;  1UJ0 A;  4CC7 A;  1BB9 A;  2YT6 A;  1BBZ A;  1CKA A;  1UE9 A;  4HVV A;  1E6G A;  1AVZ C;  4JZ4 A;  2O88 A;  1WXB A;  4JJB A;  1VYT A;  2F2V A;  2G6F X;  3VS3 A;  4EIK A;  3LH5 A;  3VS7 A;  2J7I A;  3EG0 A;  2DL3 A;  2CH4 A;  1NYF A;  1SPK A;  1E6H A;  2VVK A;  4IIM A;  5ECA A;  2EW3 A;  1WXU A;  2YUN A;  1UGV A;  1JXM A;  2KYM A;  4D8D A;  3IQL A;  3PVQ A;  1AOJ A;  4RTX A;  3VS6 A;  4DEY A;  2O2O A;  2DM1 A;  1ABQ A;  1PKS A;  1H8K A;  4OMN A;  4OMQ A;  3TVT A;  2FG0 A;  1ZUY A;  2CRE A;  2DRK A;  2LCS A;  3SEM A;  1GRI A;  2W0Z A;  3O5Z A;  4IIO A;  2J6O A;  3UAT A;  3GBQ A;  2DLP A;  2RQR A;  1H3H A;  1X43 A;  2JM8 A;  5FWB A;  1K0X A;  2DNU A;  2DRM A;  1GFC A;  1U3O A;  1I07 A;  2DE0 X;  4J9F A;  1VA7 A;  1Z9Z A;  4LNP A;  2K3B A;  4JJC A;  4OMM A;  4WCI A;  1WI7 A;  4Z89 A;  1PRL C;  2M0Y A;  4CC2 A;  2LP5 A;  1AD5 A;  2DYB A;  1M27 C;  4DEX A;  4J9C A;  2OJ2 A;  1X2Q A;  3TSW A;  3M0R A;  4JZ3 A;  3I35 A;  2J05 A;  4F16 A;  1HJD A;  2OAW A;  2JMC A;  2BZY A;  1M30 A;  2JS2 A;  5L23 A;  1RLP C;  2EGA A;  2PNI A;  4J9E A;  5I11 A;  2L3Q A;  1WFW A;  3VS0 A;  2SRC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...