1E6GA

A-spectrin sh3 domain a11v, v23l, m25i, v53i, v58l mutant
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
59
structure length
59
Chain Sequence
TGKELVLVLYDYQEKSPRELTIKKGDILTLLNSTNKDWWKVEVNDRQGFIPAAYLKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sh3-domain
molecule keywords SPECTRIN ALPHA CHAIN
publication title Conformational Strain in the Hydrophobic Core and its Implications for Protein Folding and Design
pubmed doi rcsb
source organism Gallus gallus
total genus 10
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2000-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1e6gA00
2VKNA 3QWXX 4J9FA 1Z9QA 1W1FA 5GJVB 1PKSA 2RQRA 2CT3A 2FPDA 2L0AA 1Y57A 1H92A 1QLYA 2C0TA 1WA7A 2CUDA 3NGPA 1T0HA 1X6GA 2AK5A 1S1NA 2H8HA 4F14A 1KJWA 5FWBA 2K3BA 4WCIA 1QWFA 1UG1A 2A36A 2EW3A 4RTWA 2NWMA 2VWFA 4RTYA 3UATA 1VYVA 1G83A 2G6FX 2F2XA 1N5ZA 2EKHA 1W70A 2L3QA 2DE0X 4OMMA 1GFCA 1WFWA 2EYYA 3VS5A 2K6DA 1PRMC 2D8JA 2PNIA 3LH5A 1SSHA 2KT8A 4OMOA 3RNJA 1KSWA 2EBPA 2EQIA 2LQWA 2K9GA 4RTVA 2LJ0A 1M27C 3UA6A 1JXOA 1I0CA 2CREA 4KRTA 3VS1A 1AD5A 1YWPA 2GQIA 4RTZA 2O9VA 4IIMA 2DL7A 2GTOA 2HEQA 2EPDA 4ESRA 1NLOC 1SHFA 4ORZA 4Z88A 1PKTA 3EG2A 3H0IA 3REAB 4QT7A 5I22A 1ZSGA 3SHWA 4AG1C 4J9BA 3EG3A 3M0UA 3PE0A 1BU1A 2FPFA 1B07A 2KGTA 1RLQC 1M3BA 1MV3A 2DBMA 2B86A 2QDLA 1OEBA 1YP5A 1NM7A 1CKBA 2BZ8A 2DRKA 4M4ZA 2M51A 3TSWA 4GLMA 1X2KA 4HCKA 2X3XD 2ENMA 1PHTA 1X27A 1UUEA 4D8KA 3UF4A 1K9AA 1FMKA 1Z9ZA 1AEYA 3I5SA 4J9EA 1AOJA 2DA9A 1UE9A 1VA7A 1UGVA 2J6KA 1WXUA 1WDXA 5IXBA 2C0IA 3A98A 2LJ1A 4OMNA 1G2BA 1U06A 1YCSB 2JW4A 4RTTA 1AZGB 2XMFA 2KE9A 2EYXA 1U5SA 1WYXA 3I35A 3M0RA 3UA7A 4CC2A 4GBQA 1AWXA 1UTIA 2RQVA 4DEXA 4Z89A 2A08A 2VVKA 5L23A 1BB9A 2MOXA 2YUOA 3PVQA 2AZSA 1GCQA 5GJWB 1AWWA 2RF0A 2LMJA 2A28A 3R6NA 5IH2A 3H41A 4HVVA 1AWJA 2JM8A 2KROA 2W0ZA 1H3HA 2KBTA 2FG0A 1AVZC 2JM9A 1GFDA 2PZ1A 1SRMA 1OOTA 3M0TA 2F2VA 2K2MA 1BBZA 3EGUA 3NPFA 2RQWA 4D8DA 2KRMA 2DILA 2LQNA 4X1VA 5IHKA 2ESWA 1KFZA 1WLPB 4ZNXA 1OPKA 1ARKA 2BTTA 2V1QA 1T3LA 2GGRA 2CH4A 1ZLMA 4R0KA 4LUDA 1LCKA 4HXJA 2RPNA 1QKWA 1K1ZA 3EHQA 2RQUA 1SHGA 3IQLA 3ULRB 3QWYA 2LZ6B 2SRCA 1GCQC 2JTEA 2YUPA 2C0OA 1RLPC 3M0QA 3NHNA 1X2QA 1M30A 3REBB 2RN8A 1E6HA 4JZ4A 2EGEA 4AFQC 2JS0A 2K7AA 2DVJA 1JU5C 3VS6A 2KXCA 2BZXA 3TSZA 1NYFA 1RUWA 5EC7A 1YN8A 3VS7A 4OMLA 3THKA 2KRNA 2RMOA 4CC7A 3ZL7C 1J3TA 1A0NB 1HSQA 2O88A 3EG0A 2YUQA 3TVTA 2ED1A 2SEMA 1TUDA 4CC4B 1BK2A 1ZX6A 3C0CA 3RBBB 1ABOA 3JV3A 4E6RA 1V1CA 1JQQA 2DNUA 4HVWA 4JJCA 4RTXA 2DBKA 4DEYA 2AKLA 1ZUYA 2HCKA 1NG2A 3M0PA 1B3QA 2JMAA 4OMPA 2HBWA 1AWOA 2MIOA 1FYNA 2HSPA 1ZUUA 1K4US 2K79A 2J6OA 4FSSA 3VS4A 2DYBA 1HD3A 1YWOA 2AKKA 4J9DA 1GCPA 2KR3A 2KYBA 2DMOA 1MV0B 2E5KA 2L3PA 1TG0A 2EYZA 3GBQA 1U3OA 2PTKA 2D8HA 2EVRA 1MUZA 3NMZC 2NUZA 5FWCA 3EHRA 2L3SA 2MCNA 4AFZC 1VYUA 3H0HA 2D1XA 4LE9A 2GBQA 2DL4A 2OJ2A 1UJ0A 2ED0A 2J06A 2F2WA 1T0JA 1WXBA 1AZEA 2J05A 1GBRA 2KRSA 1GBQA 1QWEA 4F16A 2LP5A 2KNBB 3PVLA 1PNJA 2A37A 1QCFA 4AG2C 1I1JA 1KIKA 4IIOA 1SPKA 1WI7A 1ZUKA 2X3WD 2J6FA 3H0FA 4JZ3A 1OV3A 1OPLA 1ABQA 2JT4A 1X6BA 4HVUA 3FJ5A 4RTUA 2EGAA 1SEMA 1M8MA 2KXDA 2ROLA 3I5RA 2DF6A 1VYTA 2DL8A 2L2PA 1WXTA 2M0YA 1PRLC 1W6XA 2ROTA 1UHCA 2O31A 2KYMA 4LNPA 3VRZA 2LNHB 2KT1A 1JO8A 1H8KA 4A63B 4Y92A 2YT6A 1E7OA 1JEGA 1IO6A 2DM1A 2W10A 3VS0A 3I9QA 2OI3A 1X69A 1HJDA 1K0SA 2FPEA 2CT4A 2EGCA 1UFFA 1JXMA 1TUCA 2YDLA 1E6GA 2GNCA 2P4RA 2ABLA 2DJQA 2RNAA 2FRYA 2AZVA 2EYWA 1YNZA 2CSIA 5ECAA 2CSQA 5HCKA 4CC3A 3EG1A 1EFNA 2FEIA 2LJ3A 2YSQA 1K0XA 3KFVA 4OMQA 4Z8AA 1NYGA 4F17A 3M0SA 2JMCA 2O9SA 5IHNA 3U23A 5I11A 2LX7A 2RQTA 1GRIA 2DRMA 2DL5A 3VS3A 5IXFA 1CSKA 4J9GA 2DLPA 2IIMA 1NLPC 2YUNA 2FO0A 4JJBA 2CH4W 1I07A 2DL3A 1WIEA 1K76A 2GTJA 2DX1A 2V1RA 1CKAA 1Y0MA 4J9CA 2CUBA 2CDTA 4EIKA 1GL5A 2OAWA 3CQTA 3O5ZA 1X43A 5FW9A 4AFSC 2I0NA 2ECZA 1SRLA 5IHIA 4JJDA 4LN2A 2LCSA 3VRYA 1XOVA 2FRWA 1PWTA 2HDAA 2J7IA 4JPBW 1UHFA 1UDLA 3VS2A 4J9IA 1UJYA 2JS2A 4J9HA 4RUGA 4LUEA 1UECA 1RI9A 2KEAA 1WX6A 1QKXA 1T3SA 1ZBJA 2JXBA 1NEGA 2D0NA 2BZYA 3SEMA 1NEBA 2O2OA 1M3AA 4AFUC 4K11A 1M3CA
chains in the Genus database with same CATH superfamily
5HY6A 2VKNA 1Z9QA 4PKCC 4M7AF 3OYKA 2FPDA 4ME7A 4M75E 1H92A 3OS5A 2BUDA 5L8RE 3NGPA 4A53A 4C0DB 2ZCFB 4PFZA 3RERA 2JZ2A 5FWBA 2K3BA 5HK3A 1VQKA 4WCIA 2A36A 4ZN1A 2NWMA 3PTAA 4C8QG 5IT9E 3URGA 1YHQT 4QQ6A 1VYVA 3CCUA 2G6FX 3OBWA 4IUPA 2QEXT 3CC7T 2QQRA 4OMMA 5KYYB 3QDFA 1WFWA 3VS5A 3L1AA 1PRMC 1TWBA 3LH5A 4OMOA 2EBPA 5J26A 2LQWA 3CXCP 1RABB 5J3BA 4RTVA 2LJ0A 3UA6A 2E3IA 3OSVA 1I0CA 4KRTA 1AD5A 2O9VA 4QVZA 2DL7A 4ESRA 1SHFA 2CS7A 2QA4T 4QT7A 3JB9D 4AG1C 4J9BA 4II1A 3PE0A 1I81A 2X35A 4M7DD 2FPFA 4C5HA 1B07A 2KGTA 1FMWA 1RLQC 1N9SA 2DBMA 4M77E 2DRKA 3JCMJ 4PLLA 4GLKA 1MMGA 2QQAA 2EWNA 1X2KA 4J6WA 4LDUA 2DXBA 3BE3A 5LJ3d 5KCHA 3EAEA 1K9AA 3CBMA 1VA7A 4J6XA 5KYNA 3FJPA 4KH0B 3A98A 2RA2A 4AMCA 3J81E 1NZ9A 1UGPB 3L2VA 1YJ9Q 1YCSB 5CK9A 3GOXA 4OB1B 1U5SA 3M0RA 2RJDA 3UA7A 2H3JA 1WQ7A 2DKGA 2A08A 1TTHB 5LJ3f 2BIVA 5L23A 2Y4YA 4ZTFA 1BB9A 3L2ZA 1BI1A 4BI8B 4ELZC 4OMFB 1VQMT 1H641 3CCSA 1AWWA 2NUPB 3G4ST 4M7AE 4HVVA 1QP3A 3EGDB 3CCQQ 1AVZC 5KYWA 2CKKA 2PZ1A 2OTLQ 1IREB 4C8QA 2AIRB 1LJOA 3M0TA 1C1AA 2JTMA 3EGUA 2K3YA 2RQWA 4D8DA 3G6EA 2C06A 3VKIA 3CC4T 2LQNA 4C92G 3PIPA 2FZGB 1KFZA 2L5QA 3E19A 2DYIA 4ZNXA 2MI6A 2BTTA 2V1QA 1VQ5Q 1OU8A 4N4GA 1Q95G 3CMAA 2RPNA 3MEAA 2IVWA 3IQLA 2LZ6B 1VIEA 2MAMA 2SRCA 1RLPC 2E12A 3NHNA 2DZCA 3GPLA 5KYXA 3REBB 2EGEA 4QQGA 2JS0A 3M58A 2DVJA 1JU5C 3H9NA 1BCOA 4FT4A 5D6XA 3E2UA 1RUWA 4FYVB 1XJWB 3VS7A 2CP2A 4OMLA 3LWIA 4BE2A 3M4GA 2QDYB 2KRNA 2ZPGB 4FL6A 2RMOA 1BCMA 1J3TA 1A0NB 1G3YA 3RKXA 2O88A 1M90R 2SEMA 1TUDA 1BK2A 1ZX6A 4JJCA 5GANe 2FHDA 2AKLA 3HP9A 1VQKT 2HCKA 3TEEA 4ZGJB 4OMPA 2HBWA 3EG9B 2M9UA 4RG2A 2KDSA 5CKBA 1SF9A 1JJ2A 1YWOA 1R0BG 1IB8A 1Q82C 2E70A 2DMOA 4Z02A 2E5KA 2L3PA 3LX7A 3QPHA 4QW2A 2QQ9A 3META 4A4KA 1U3OA 2GFAA 3NMZC 3OYGA 2MCNA 4E7SA 4RKUE 4HCCA 3DKMA 4MZTA 5M9OA 3OYLA 4LE9A 2DL4A 1QVFP 3EFOB 5I2MA 4BACA 1WHKA 4J83A 4EMKA 2OTJA 4F16A 2F69A 1VQKQ 3MO8A 3GLXA 3JCMP 4OVAA 3FB9A 4IIOA 3JB9G 1SPKA 1AHJB 4Q5WA 1WNLA 2X3WD 3CCUQ 1RAIB 2R57A 5D6YA 1YI2A 1OV3A 2LCCA 2HAXA 2JJ9A 4C92A 3FJ5A 2COYA 2DIGA 3KUFA 3JB9J 2DF6A 5CR2A 1WXTA 4F7UG 4M75B 3RUXA 4OB2B 2M0YA 2QASA 1I5OB 1EX4A 2XK0A 1UHCA 2O31A 2KYMA 4LNPA 2EJ9A 5IN1A 3BDLA 4PJJA 1WGSA 3CBOA 2HBPA 3CPFA 3RESA 2W10A 3VS0A 1QCNA 2FVUA 1N27A 3V8JA 4J5YA 3QJYA 1X69A 1JJ2P 1Y96A 2CT4A 4MMLA 4HCBA 2EGCA 1R77A 5LL6S 2QXFA 5GAN5 2DFUA 3MPUB 1E6GA 2ABLA 2RNAA 5GANd 3V8LA 3JCMg 1YNZA 3OYFA 5C0MA 1KQSA 1OX9A 3L2QA 2LJ3A 2E4HA 3KFVA 4OMQA 1Q7YU 4JLIA 2JVVA 1KG1A 2O9SA 5C6SA 4N0AA 1EIFA 4J7FA 3G6ET 2IIMA 1B34A 1ZA2B 3QKJA 4FT2A 3ASKA 3DLLA 1YHQA 2RK1A 5GAMf 2QEXA 4JS5A 4XTVA 2V1RA 1CKAA 2YLCA 4J9CA 3QXEB 3CC7A 5CKFA 3O5ZA 3OYCA 4C0DC 2I0NA 5DLOA 4L59A 4A54A 3CCSQ 5IHIA 4JJDA 1RAEB 3VRYA 1XOVA 2FRWA 2J7IA 5FROA 1W4SA 3G71A 3A1PA 1UHFA 3QO3A 1UECA 2FZCB 3OY9A 3INZA 2V8KA 3JAME 1T3SA 1ZBJA 4FW1A 2E41A 3SEMA 5GMKi 4E7HA 3SWNC 1IHVA 3PMTA 1V76A 5GAMh 3PGGA 3LWHA 2WSEE 4FCYA 1VQLT 3AHUA 2NYSA 1UGQB 1VQ8T 5DM7R 1AT1B 4X34A 4M75F 3CMAQ 4F7UA 1RAAB 1Y57A 1RAFB 1PD1A 1WA7A 2GFUA 1T0HA 1GXIE 1KQSP 3QBYA 5KYUB 2H8HA 2QG9B 4M7AB 4F14A 1KJWA 4LDWA 1WHMA 1FX7A 7AT1B 1BI0A 1QWFA 1YITT 1QVPA 3CCMT 5GMKh 3UATA 1KQ2A 1Q7YC 1U1SA 1RADB 2EKHA 2XG8D 3FDRA 4RCCA 2CGHA 2L3QA 2RI2A 5GAOn 2VGMA 2K6DA 2HL3A 3Q1JA 2D8JA 1SSHA 2KT8A 2K57A 3RNJA 1ZSZB 2EQIA 2GF7A 5GAN8 1W2BP 2K9GA 3EGXA 2QAZA 4LXCA 1M27C 3OYAA 2CREA 3VS1A 3KBGA 1YWPA 1M1GA 2GTOA 2E1HA 3JCMX 1NLOC 4B9XA 4ORZA 1PM3A 1VQMA 4Z88A 1PKTA 2VV5A 1D1BA 3EG2A 1ZBXA 4M78F 3G4SA 1JBMA 1ZSGA 3SHWA 2KSSA 3M0UA 1BU1A 1YI2T 4XU1A 4M7DE 1M3BA 2QDLA 1OEBA 3OA6A 2EQUA 3MEUA 2HNIA 3FEOA 1VQ9T 3GIBA 3M4YA 4JRPA 1PSFA 3CC4A 4OB3B 1PHTA 3X25B 4BY6B 1X27A 4BE0A 1Q86U 1K73R 4IURA 3CXCA 3TREA 1AEYA 2RJFA 3QJ6A 4P5NA 1UGVA 2R58A 1KHIA 3ER0A 3A8GB 2J6KA 3TQ7P 1WXUA 2OTJQ 3ME9A 1Y71A 8AT1B 3CMET 1X01A 4OMNA 1G2BA 4C8QB 4MDWA 2JW4A 3CCRA 3A5ZB 3CEYA 1YI2Q 2KVQG 3D7SB 3RR6A 4ANJA 2VASA 4RCBA 3QUIA 2HMAA 1WJRA 1AWXA 3EH2A 4Z89A 1VQ7A 4L5GA 3CCVQ 4PJOC 1OZ3A 2FYKA 3OSSC 1QW1A 2MOXA 3PVQA 2AZSA 1TXQA 2EFIA 4FYXB 3R6NA 2DK3A 3S3OA 1AWJA 4N4HA 2KROA 1WJQA 1H3HA 2JM9A 2KI7A 1SRMA 5LJ5j 1KC8C 1OOTA 1HXDA 3E9GA 3V7SA 1M1FA 3OYDA 1BBZA 5HK0A 5IHKA 3V7CA 5GAN4 4PJOD 1OPKA 1Q82R 2RJEA 1T3LA 1D1CA 2FB7A 2EAYA 2NUTB 2ZPHB 2CH4A 1OULA 2QTVA 4R0KA 4LUDA 3RMSA 1XNIA 2JN0A 1UEBA 2O4XA 1QKWA 3EHQA 1SHGA 1H3ZA 2XKOC 4C5EA 3G71T 2XI9A 4JDSA 1MNDA 5A0GA 2C0OA 3M55A 1PG5B 4B9WA 1X2QA 1M30A 1Q86C 2E64A 2KY9A 2RN8A 3QYGB 3OW2A 2EJGA 3FLGA 3P8BB 4PFOA 2MYSA 2KXCA 2BZXA 1QVGP 2HKQB 2DXTA 4J7IA 4BDYA 4M78E 2PVDB 4Y91A 1YN8A 4DOWA 1K73U 3THKA 4A4HA 1YHQQ 2QTXA 2QEXQ 3ZL7C 3CC2T 1UGSB 3CC7Q 3RBBB 1V1CA 4XTWA 4PJLA 2DNUA 3LGFA 3S6WA 3I55A 2E5QA 1ZUYA 3M0PA 2JMAA 3G71Q 1YIJA 2RHUA 1FYNA 2RHIA 1IXDA 4DA4A 2K79A 3LYIA 4C8QF 4FSSA 3VS4A 1HD3A 2AKKA 3VU3C 3JRZA 1GCPA 3CPWP 2KYBA 2CP5A 1VOMA 3JCMe 4E47A 2QA4Q 2QQBA 2EYZA 2A7YA 4R55A 4C92B 1MUZA 2LRQA 3M56A 4JS4A 4XTYA 2AT1B 3EHRA 2X4JA 2L3SA 4M75C 2AHJB 4C0ZA 3HFNA 1EZZB 2D1XA 2YRDA 2GQVA 2GBQA 3RDVA 1UJ0A 2ED0A 2J06A 1Y7XA 1GBRA 2J05A 2HQXA 2KRSA 4FU6A 1KQSS 3PVLA 2KNBB 4AG2C 3UT1A 3OW2P 1SSFA 1OI1A 1WI7A 1ZUKA 1Q82U 1MHNA 2J6FA 3HRSA 1BKBA 3H0FA 2YRVA 5DLQE 2HSEB 1VQ4T 1X6BA 1Y96B 4HVUA 3MP8A 4KGXB 4MZMA 2DEUA 1IZ6A 3WVEB 1M8MA 2KXDA 4XAXB 4BB7A 2ROLA 3I5RA 4JRQA 1VYTA 1K73C 1YFNA 2ROTA 4PJMA 1QVFA 5CCAA 2KT1A 2D0QB 2LT4A 8ATCB 3BY7A 1VQMQ 4PL6A 1VQOT 2EYQA 2QQSA 3G4SQ 3NTIA 1IO6A 3CCRT 2DTIA 3I9QA 4M77C 2ZPBB 3CD6T 1M2VB 2DTOA 1VQ7T 2XDDA 1JXMA 1TUCA 2P4RA 3JSCA 3WVDB 1YCYA 1FMVA 3V7RA 2X51A 3CC4Q 1RI0A 3JCMc 4E2FB 2CSIA 2F5KA 2Y4XA 5ECAA 1VQLA 3RKWA 2HZYA 5HCKA 3UPUA 1VQ8A 2YSQA 1K0XA 2BE7D 3C12A 1NYGA 3QG1A 1YJWA 3M0SA 5GAMe 3HRTA 3OYJA 2JMCA 3U23A 5I11A 3JCMd 2X9HA 2RQTA 2ZGWA 1GRIA 4M77D 1LPLA 3UWNA 2DRMA 3SWNA 2EQMA 4DBHA 4N4IA 2ATCB 5FU7B 2VC8A 5IXFA 4J9GA 2DLPA 2D6FA 1OYXA 4M7DB 3GNGA 4ZN3A 2FO0A 4JJBA 2YRCA 2CH4W 1YITA 1Q7YR 4C8QE 1I07A 3CCMA 1WIEA 4C92F 2KAFA 4PJOG 3CCET 2DAQA 4HKEA 1Y0MA 1VQ7Q 4EIKA 5FU6C 1GL5A 4FIBA 1X43A 3QDRB 2CP0A 1SRLA 5GMKe 4M7AC 2DVEA 3NTHA 1JB0E 5KE3A 1PWTA 3CCLT 2L8DA 3JCMf 4XTXA 1K8AC 2L89A 1S72T 1UJYA 1U8RA 3QZ9B 2OAUA 3OYEA 4LUEA 1OX8A 3OS0A 4R56A 4XU2A 1WX6A 1QKXA 1P92A 2RH2A 1NEBA 3RKYA 1TUGB 4RMOA 1ZSZC 4J9FA 1W1FA 2EIFA 3LLRA 2CP3A 1PKSA 2RQRA 4M7AD 1WJSA 5LJ3j 2L0AA 4DBRA 3OYBA 1QLYA 2C0TA 3I55T 1VQ9A 5AT1B 2RO0A 4KULA 1X6GA 1S1NA 3EGXB 1YIJT 3JCMh 3HTRA 2DETA 2R5AA 5DY9A 3CXCS 1UG1A 2CZ1B 1NPPA 2EW3A 1YJNA 1MMAA 4RTWA 2VWFA 2LT1A 1BI3A 2F2XA 2E3HA 2H3EB 2XD0A 1W70A 1WHGA 1D3BA 2DE0X 3CMEA 1GFCA 4FSXA 2F5TX 1D09B 4X9DA 4A4FA 1KSWA 2DIQA 5GAMd 2LQ8A 1BIBA 3I55Q 2GQIA 1K9MU 2HEQA 2Z0WA 1YIJQ 1LNXA 3H0IA 5CQYA 5I22A 4PFPA 3EG3A 3A8OB 4M7DF 1KC8R 2PU9B 4M78B 2B86A 1YP5A 4HT8A 1NM7A 5D7UA 1I8FA 4PJOA 4M4ZA 3QYHB 4PNOA 3TSWA 4GLMA 4HCKA 2I2LA 2ENMA 5GAN6 4C92E 4D8KA 2RI5A 3UF4A 4OGCA 4NOYA 4L6V5 1FMKA 1W2BA 1AOJA 2M16A 2MPXC 2DA9A 2A3LA 2CP6A 3JCMW 4KT0E 2X4YA 2F1LA 2P84A 2Y90A 5GMKl 2C0IA 1M8VA 3C95A 3SD4A 2LJ1A 1Q86R 1U06A 3E9FA 2NLUA 2P4TA 4RTTA 2XMFA 2ZPFB 4UC4A 1VQ6T 3I35A 3PT9A 2LDMA 4CC2A 4GBQA 3G6EQ 1UTIA 4QKUA 3PFSA 2VVKA 4JRKA 4IUQA 2VXEA 2CZ0B 3DLMA 1N9RA 2COZA 5GJWB 3ZEHA 3G1JA 2RF0A 1VQPT 1VIFA 2O4XB 3CC2A 5IH2A 1YJWT 3H41A 4C0GA 5GMKm 3OYYA 2PVGB 1R8OB 3CCJT 1YJ9A 2COWA 1GFDA 1UB4A 3JCMQ 2JOYA 4M77G 3OYMA 5KH6A 1K9MC 2F2VA 2K2MA 3O8VA 1RAHB 2FZKB 2DILA 3HFOA 4KUIA 4B6MA 1WZOA 5I21A 2GGRA 4C0FA 3MEVA 1ZLMA 1LCKA 4HXJA 1RACB 3VYGA 3WXMB 1VQLQ 1BIAA 1GCQC 5LJ5h 1VQ8Q 4WF2A 2OTLA 3M0QA 2VXFA 3OMGA 2R5MA 4IUVA 5GANg 1KC8U 2E6ZA 2VB6A 2HD0A 4JZ4A 3MP1A 4AFQC 3N5BB 5GAOr 2K7AA 3VS6A 2RHYA 3TSZA 5EC7A 1YITQ 3V8KA 4KGVB 3CCMQ 4JUVA 4CC7A 2LNVA 1HSQA 3EG0A 2YUQA 4M7AG 1VQ4A 3TVTA 2ED1A 4CC4B 2K4YA 3C0CA 5FRMA 1ABOA 1TS9A 3JV3A 1G3SA 5LJ5g 1JQQA 4ZGDB 3M54A 2HKNA 1Y07A 1NG2A 4NL2A 4LDXA 4F7UE 3HPWA 1YJNT 2MIOA 2HSPA 1QVFS 3HHTB 3QHSA 1ZUUA 5CQXA 1K4US 2K5IA 4C5IA 1VQNT 3PIOA 2KR3A 1QVGA 5KYWB 1VQOA 1PD0A 1TG0A 3GBQA 5GANj 2D8HA 2EVRA 4ZGEB 1Q81R 4DOVA 2CZ7B 3CD6A 3P8HA 4AFZC 1VYUA 3H0HA 4PK4A 3OB9A 1VQ9Q 1BI2A 4QVDA 1OZ2A 1T0JA 2PQWA 1AZEA 5AYFA 1D0XA 5KCOA 1GBQA 1QWEA 2LP5A 1RAGB 2RM4A 2MWOA 3H6ZA 2IG0A 2A37A 1KIKA 1I1JA 6AT1B 4D6WA 1OQKA 4M77A 1YJNQ 5A0DA 3I56A 1N8RC 2K2VA 5KYXB 2RHXA 4JZ3A 1G5VA 4FYYB 3P8DA 3CPWA 1OPLA 5GAN2 5EG2A 2JT4A 3CMEQ 3BDUA 5GAOl 2MK5A 1KK7A 4NS5A 1SEMA 1ZHIA 1JJ2S 3X24B 2DL8A 2L2PA 3QIIA 4GY5A 1NBEB 2XIDA 3CCEA 1PRLC 4J8OA 2KK4A 2VGNA 1FXXA 2XDBA 3S3MA 1G3TA 3VRZA 2LNHB 1F1BB 2QI2A 3GNFB 4A63B 1NJIR 3JB9H 1E7OA 1HK9A 4PLIA 2VUBA 1JEGA 5FU7C 1K8AR 2RHZA 3UDCA 3CCLA 3ZBDA 4M7DC 2DPPB 2YLBA 1BYMA 1WHJA 2PUKB 1S72A 3SWNB 3MEWA 5GAOm 1K0SA 2FPEA 2YXYA 1UFFA 5A0LA 2LQKA 2YDLA 2M1HA 2GNCA 2DJQA 5KYUA 5GAOq 2FRYA 3X26B 4M7AA 2AZVA 2EYWA 2EQJA 1WHLA 5IAYA 2E65A 4CC3A 2CP7A 2DXCA 1EFNA 2FEIA 1TU0B 1YJ9T 4DQ2A 2PVOB 5IHNA 2LX7A 3FRNA 1QQJA 1D0ZA 2DL5A 4EMKB 1CSKA 1Q81U 2EJFA 1WHHA 4BUGA 2YUNA 2YHTA 3C94A 4CRIA 2M02A 4EPCA 1ZSZA 3KXTA 4ZTJA 3M9QA 4E7JA 4E7LA 2DEQA 2V8IA 2GTJA 4FM4B 3OYNA 5FLXE 2JNGA 4F04B 5FW9A 3CCQT 2ECZA 4IUUA 2OTLT 4LN2A 1QCOA 3CC2Q 2O01E 2RJCA 2HDAA 4E7KA 2ZPEB 2YWWA 1UDLA 4J9IA 4J9HA 4RUGA 1OU9A 4HCZA 2KEAA 1M2OA 2RK2A 1VQ5T 2D0NA 1LVKA 1RL2A 2BZYA 3NTKA 3M59A 1M3AA 4AFUC 1X6OA 1D3BB 4K11A 4BDZA 3VYHB 3HSBA 4KBMB 3QWXX 5GAOp 3VV0A 5GJVB 4BI3A 4IUTA 4M75D 2CT3A 4QVCA 1HYOA 1SG5A 1NJIU 2CUDA 2QK0A 1K8AU 2AK5A 5CO7A 3F70A 3VUZA 2P0PA 1C0MA 4JJNK 3TCJA 1W2BS 3MCAB 3EFSA 2XICA 4RTYA 1G83A 4M78C 1N5ZA 4BI4A 4O5VA 4ELYC 4IKFA 2EQKA 5LJ3h 2EYYA 1IHWA 2PNIA 1NPRA 1Q81C 5FRNA 4PJOB 1B34B 4HA8A 1VQ6A 1VQ4Q 2RI3A 3MP6A 4WTOB 3HRUA 2JUFA 1JXOA 3OS2A 4O6JA 4RTZA 1M9SA 4IIMA 2EPDA 2RB6A 2OX7A 3I56T 1VQPA 3REAB 4M78D 4JLGA 4OF1A 2BKDN 2K5FA 3NFCA 3RIRA 1D0YA 5I2SA 5KYYA 3CCJA 4C5GA 2NUTA 3L2WA 5LJ3g 2MWPA 1MV3A 1R0CB 1WQWA 3EH1A 3C4SA 2ZAEA 1K9MR 1VQOQ 1CKBA 2BZ8A 2M51A 3CCRQ 4EDUA 3OS1A 2X3XD 3CD6Q 1UUEA 1MGQA 1Z9ZA 3I5SA 4J9EA 4OP0A 3J80E 4LDVA 1UE9A 1O75A 1TSFA 1YBYA 3CCUT 2G3RA 2CZ6B 4F7UB 2DJZA 3H8ZA 3OYIA 4V2SA 1WDXA 5IXBA 1B7TA 1O9SA 3OYHA 1NJIC 2DZ9A 2ZZDA 4KGZB 2VYTA 1IGQA 3I56Q 3J7AF 4X9CA 2MF2A 3M57A 1AZGB 2JTFA 3ZFJA 4AT1B 2KE9A 2EYXA 1WYXA 5LJ5e 2RQVA 4DEXA 5GAN7 4LD6A 3HKSA 2YUOA 1GCQA 3CCEQ 2LMJA 2A28A 1M1KR 2JM8A 2W0ZA 3OQ5A 2KBTA 2FG0A 4M7DG 2P0QA 3CCLQ 3NPFA 1MNEA 4EMHA 2X4XA 1S72Q 2KRMA 4X1VA 2FL7A 3CCVA 2ESWA 1VQNA 3BFMA 1KQ1A 1WLPB 4PJOF 1ARKA 4XTZA 1QVGS 5J39A 3L42A 3VUBA 4BY6C 2NUPA 1PCXA 1K1ZA 5CKEA 2RQUA 1TH7A 3ULRB 3QWYA 2X4WA 1D1AA 3EGDA 2JTEA 2YUPA 1KD1R 3MJXA 1M5Q1 3VJPA 3DB3A 4VUBA 1ZA1B 1E6HA 2V8JA 3A8HB 2XU8A 3QSUA 3X20B 4ATOA 1M90U 2QGFB 3SFMA 4A4GA 1KHCA 4C8QC 2RD1A 3JB9F 1FWZA 2DXUA 1N8RR 1NYFA 2L3RA 1MMDA 3CCST 4KH1B 3CPWS 3GF5A 4M75G 3L2UA 5GAN3 3SB2A 4XTUA 5A2QE 4E6RA 3JCMb 4HVWA 4RTXA 2DBKA 4DEYA 4F7UF 4DBFA 1B3QA 2E6NA 4PJNA 5CAIA 1AWOA 4XQ3A 1PSEA 3FC3A 4E7IA 1M2VA 2HQHA 5CKHA 2J6OA 4C8QD 5LJ5d 2DYBA 3QZ5B 3MHXA 4M77B 4J9DA 3DB4A 5GANf 2D9TA 1TOVA 2WACA 1MV0B 3CMAT 2V26A 4MMKA 3OW2S 5CVIA 2PTKA 3TU4K 2NUZA 5FWCA 2PUOB 3L2RA 1M1KU 4RG8A 2XDPA 4KUDK 2OJ2A 2LVMA 1G3WA 2F2WA 2CYZB 1WXBA 3A8LB 3EG9A 2XHCA 2EKOA 3LGLA 4M7DA 1PNJA 4J6YA 5CKDA 5LJ5f 1QCFA 1VUBA 2E10A 4M78G 3FIFA 9ATCB 1QP2A 1IRXA 2QA4A 4LD9K 1JRIA 5GANh 2KQWA 3M53A 5CIUA 1XTDA 2BE9B 1ABQA 3CBPA 1M90C 3S3NA 2A0FB 2WSCE 4XU0A 4RTUA 2EGAA 2MMPA 5FU6B 3OBYA 4MDXA 1KD1U 1V29B 3GP8A 1VQ6Q 3EFOA 4PJOE 4Y28E 2DO3A 1W6XA 5D6WA 2LCLA 1JO8A 3CCQA 1H8KA 4QQDA 4Y92A 1N8RU 2YT6A 1VQPQ 3A8MB 2DD5A 4EMKC 4CI0C 1NE8A 4A4EA 4EMGA 1YJWQ 1I4K1 5GAMg 4HT9A 2DM1A 2LTOA 3CCJQ 2OI3A 1PC0A 1HJDA 1WPYA 2K3XA 1UGRB 2HL5C 3X28B 5KE2A 2LC4A 1VQ5A 4C92C 3LW5E 2DERA 1DJ7B 4TVRA 4M75A 1XQHA 3HL8A 4OB0B 2OTJT 1MMNA 2CSQA 4DBQA 4YTLA 4MZPA 3EG1A 3AT1B 1X75C 1M1KC 3PNWC 4Z8AA 4F17A 4XU3A 4LDYA 2DTHA 3LH0A 4M77F 2HQEA 4FW2A 3VS3A 3EFRA 3OMCA 3CCVT 1NLPC 4BD3A 3R6OA 2P0KA 2DL3A 3RMQA 4C92D 3JB9I 1K76A 1N6AA 3MKDA 3E1SA 1G8XA 2DX1A 5HKCA 4BE1A 3SDZA 2CUBA 4FYWB 2CDTA 2OAWA 4JRIA 3CQTA 2WSFE 4XK8E 5GAMj 4AFSC 1ZQ1A 3G7ZA 4E7ZA 3M5AA 3BW1A 2IPOB 4NL3A 2GCXA 2LCSA 4OGEA 2QGGA 2KMTA 1KD1C 4JPBW 2ZPIB 3VS2A 5LJ3e 1ACMB 2JS2A 4M78A 1RI9A 3PMIA 1M4ZA 2B8AA 1C6VX 2JXBA 1NEGA 1LOJA 3T9NA 2LX9A 2QYZA 2M0OA 4N0AC 1IGUA 1SKUB 3JCMV 2K5LA 2DD4A 1U1TA 2O2OA 5GMKj 1I5LA 1VQNQ 1QMCA 1M3CA
chains in the Genus database with same CATH topology
2VKNA 3QWXX 4J9FA 1Z9QA 1W1FA 5GJVB 1PKSA 2RQRA 2CT3A 2FPDA 2L0AA 1Y57A 1H92A 1QLYA 2C0TA 1WA7A 2CUDA 3NGPA 1T0HA 1X6GA 2AK5A 1S1NA 2H8HA 4F14A 1KJWA 5FWBA 2K3BA 4WCIA 1QWFA 1UG1A 2A36A 2EW3A 4RTWA 2NWMA 2VWFA 4RTYA 3UATA 1VYVA 1G83A 2G6FX 2F2XA 1N5ZA 2EKHA 1W70A 2L3QA 2DE0X 4OMMA 1GFCA 1WFWA 2EYYA 3VS5A 2K6DA 1PRMC 2D8JA 2PNIA 3LH5A 1SSHA 2KT8A 4OMOA 3RNJA 1KSWA 2EBPA 2EQIA 2LQWA 2K9GA 4RTVA 2LJ0A 1M27C 3UA6A 1JXOA 1I0CA 2CREA 4KRTA 3VS1A 1AD5A 1YWPA 2GQIA 4RTZA 2O9VA 4IIMA 2DL7A 2GTOA 2HEQA 2EPDA 4ESRA 1NLOC 1SHFA 4ORZA 4Z88A 1PKTA 3EG2A 3H0IA 3REAB 4QT7A 5I22A 1ZSGA 3SHWA 4AG1C 4J9BA 3EG3A 3M0UA 3PE0A 1BU1A 2FPFA 1B07A 2KGTA 1RLQC 1M3BA 1MV3A 2DBMA 2B86A 2QDLA 1OEBA 1YP5A 1NM7A 1CKBA 2BZ8A 2DRKA 4M4ZA 2M51A 3TSWA 4GLMA 1X2KA 4HCKA 2X3XD 2ENMA 1PHTA 1X27A 1UUEA 4D8KA 3UF4A 1K9AA 1FMKA 1Z9ZA 1AEYA 3I5SA 4J9EA 1AOJA 2DA9A 1UE9A 1VA7A 1UGVA 2J6KA 1WXUA 1WDXA 5IXBA 2C0IA 3A98A 2LJ1A 4OMNA 1G2BA 1U06A 1YCSB 2JW4A 4RTTA 1AZGB 2XMFA 2KE9A 2EYXA 1U5SA 1WYXA 3I35A 3M0RA 3UA7A 4CC2A 4GBQA 1AWXA 1UTIA 2RQVA 4DEXA 4Z89A 2A08A 2VVKA 5L23A 1BB9A 2MOXA 2YUOA 3PVQA 2AZSA 1GCQA 5GJWB 1AWWA 2RF0A 2LMJA 2A28A 3R6NA 5IH2A 3H41A 4HVVA 1AWJA 2JM8A 2KROA 2W0ZA 1H3HA 2KBTA 2FG0A 1AVZC 2JM9A 1GFDA 2PZ1A 1SRMA 1OOTA 3M0TA 2F2VA 2K2MA 1BBZA 3EGUA 3NPFA 2RQWA 4D8DA 2KRMA 2DILA 2LQNA 4X1VA 5IHKA 2ESWA 1KFZA 1WLPB 4ZNXA 1OPKA 1ARKA 2BTTA 2V1QA 1T3LA 2GGRA 2CH4A 1ZLMA 4R0KA 4LUDA 1LCKA 4HXJA 2RPNA 1QKWA 1K1ZA 3EHQA 2RQUA 1SHGA 3IQLA 3ULRB 3QWYA 2LZ6B 2SRCA 1GCQC 2JTEA 2YUPA 2C0OA 1RLPC 3M0QA 3NHNA 1X2QA 1M30A 3REBB 2RN8A 1E6HA 4JZ4A 2EGEA 4AFQC 2JS0A 2K7AA 2DVJA 1JU5C 3VS6A 2KXCA 2BZXA 3TSZA 1NYFA 1RUWA 5EC7A 1YN8A 3VS7A 4OMLA 3THKA 2KRNA 2RMOA 4CC7A 3ZL7C 1J3TA 1A0NB 1HSQA 2O88A 3EG0A 2YUQA 3TVTA 2ED1A 2SEMA 1TUDA 4CC4B 1BK2A 1ZX6A 3C0CA 3RBBB 1ABOA 3JV3A 4E6RA 1V1CA 1JQQA 2DNUA 4HVWA 4JJCA 4RTXA 2DBKA 4DEYA 2AKLA 1ZUYA 2HCKA 1NG2A 3M0PA 1B3QA 2JMAA 4OMPA 2HBWA 1AWOA 2MIOA 1FYNA 2HSPA 1ZUUA 1K4US 2K79A 2J6OA 4FSSA 3VS4A 2DYBA 1HD3A 1YWOA 2AKKA 4J9DA 1GCPA 2KR3A 2KYBA 2DMOA 1MV0B 2E5KA 2L3PA 1TG0A 2EYZA 3GBQA 1U3OA 2PTKA 2D8HA 2EVRA 1MUZA 3NMZC 2NUZA 5FWCA 3EHRA 2L3SA 2MCNA 4AFZC 1VYUA 3H0HA 2D1XA 4LE9A 2GBQA 2DL4A 2OJ2A 1UJ0A 2ED0A 2J06A 2F2WA 1T0JA 1WXBA 1AZEA 2J05A 1GBRA 2KRSA 1GBQA 1QWEA 4F16A 2LP5A 2KNBB 3PVLA 1PNJA 2A37A 1QCFA 4AG2C 1I1JA 1KIKA 4IIOA 1SPKA 1WI7A 1ZUKA 2X3WD 2J6FA 3H0FA 4JZ3A 1OV3A 1OPLA 1ABQA 2JT4A 1X6BA 4HVUA 3FJ5A 4RTUA 2EGAA 1SEMA 1M8MA 2KXDA 2ROLA 3I5RA 2DF6A 1VYTA 2DL8A 2L2PA 1WXTA 2M0YA 1PRLC 1W6XA 2ROTA 1UHCA 2O31A 2KYMA 4LNPA 3VRZA 2LNHB 2KT1A 1JO8A 1H8KA 4A63B 4Y92A 2YT6A 1E7OA 1JEGA 1IO6A 2DM1A 2W10A 3VS0A 3I9QA 2OI3A 1X69A 1HJDA 1K0SA 2FPEA 2CT4A 2EGCA 1UFFA 1JXMA 1TUCA 2YDLA 1E6GA 2GNCA 2P4RA 2ABLA 2DJQA 2RNAA 2FRYA 2AZVA 2EYWA 1YNZA 2CSIA 5ECAA 2CSQA 5HCKA 4CC3A 3EG1A 1EFNA 2FEIA 2LJ3A 2YSQA 1K0XA 3KFVA 4OMQA 4Z8AA 1NYGA 4F17A 3M0SA 2JMCA 2O9SA 5IHNA 3U23A 5I11A 2LX7A 2RQTA 1GRIA 2DRMA 2DL5A 3VS3A 5IXFA 1CSKA 4J9GA 2DLPA 2IIMA 1NLPC 2YUNA 2FO0A 4JJBA 2CH4W 1I07A 2DL3A 1WIEA 1K76A 2GTJA 2DX1A 2V1RA 1CKAA 1Y0MA 4J9CA 2CUBA 2CDTA 4EIKA 1GL5A 2OAWA 3CQTA 3O5ZA 1X43A 5FW9A 4AFSC 2I0NA 2ECZA 1SRLA 5IHIA 4JJDA 4LN2A 2LCSA 3VRYA 1XOVA 2FRWA 1PWTA 2HDAA 2J7IA 4JPBW 1UHFA 1UDLA 3VS2A 4J9IA 1UJYA 2JS2A 4J9HA 4RUGA 4LUEA 1UECA 1RI9A 2KEAA 1WX6A 1QKXA 1T3SA 1ZBJA 2JXBA 1NEGA 2D0NA 2BZYA 3SEMA 1NEBA 2O2OA 1M3AA 4AFUC 4K11A 1M3CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VKN A;  3QWX X;  4J9F A;  1Z9Q A;  1W1F A;  5GJV B;  1PKS A;  2RQR A;  2CT3 A;  2FPD A;  2L0A A;  1Y57 A;  1H92 A;  1QLY A;  2C0T A;  1WA7 A;  2CUD A;  3NGP A;  1T0H A;  1X6G A;  2AK5 A;  1S1N A;  2H8H A;  4F14 A;  1KJW A;  5FWB A;  2K3B A;  4WCI A;  1QWF A;  1UG1 A;  2A36 A;  2EW3 A;  4RTW A;  2NWM A;  2VWF A;  4RTY A;  3UAT A;  1VYV A;  1G83 A;  2G6F X;  2F2X A;  1N5Z A;  2EKH A;  1W70 A;  2L3Q A;  2DE0 X;  4OMM A;  1GFC A;  1WFW A;  2EYY A;  3VS5 A;  2K6D A;  1PRM C;  2D8J A;  2PNI A;  3LH5 A;  1SSH A;  2KT8 A;  4OMO A;  3RNJ A;  1KSW A;  2EBP A;  2EQI A;  2LQW A;  2K9G A;  4RTV A;  2LJ0 A;  1M27 C;  3UA6 A;  1JXO A;  1I0C A;  2CRE A;  4KRT A;  3VS1 A;  1AD5 A;  1YWP A;  2GQI A;  4RTZ A;  2O9V A;  4IIM A;  2DL7 A;  2GTO A;  2HEQ A;  2EPD A;  4ESR A;  1NLO C;  1SHF A;  4ORZ A;  4Z88 A;  1PKT A;  3EG2 A;  3H0I A;  3REA B;  4QT7 A;  5I22 A;  1ZSG A;  3SHW A;  4AG1 C;  4J9B A;  3EG3 A;  3M0U A;  3PE0 A;  1BU1 A;  2FPF A;  1B07 A;  2KGT A;  1RLQ C;  1M3B A;  1MV3 A;  2DBM A;  2B86 A;  2QDL A;  1OEB A;  1YP5 A;  1NM7 A;  1CKB A;  2BZ8 A;  2DRK A;  4M4Z A;  2M51 A;  3TSW A;  4GLM A;  1X2K A;  4HCK A;  2X3X D;  2ENM A;  1PHT A;  1X27 A;  1UUE A;  4D8K A;  3UF4 A;  1K9A A;  1FMK A;  1Z9Z A;  1AEY A;  3I5S A;  4J9E A;  1AOJ A;  2DA9 A;  1UE9 A;  1VA7 A;  1UGV A;  2J6K A;  1WXU A;  1WDX A;  5IXB A;  2C0I A;  3A98 A;  2LJ1 A;  4OMN A;  1G2B A;  1U06 A;  1YCS B;  2JW4 A;  4RTT A;  1AZG B;  2XMF A;  2KE9 A;  2EYX A;  1U5S A;  1WYX A;  3I35 A;  3M0R A;  3UA7 A;  4CC2 A;  4GBQ A;  1AWX A;  1UTI A;  2RQV A;  4DEX A;  4Z89 A;  2A08 A;  2VVK A;  5L23 A;  1BB9 A;  2MOX A;  2YUO A;  3PVQ A;  2AZS A;  1GCQ A;  5GJW B;  1AWW A;  2RF0 A;  2LMJ A;  2A28 A;  3R6N A;  5IH2 A;  3H41 A;  4HVV A;  1AWJ A;  2JM8 A;  2KRO A;  2W0Z A;  1H3H A;  2KBT A;  2FG0 A;  1AVZ C;  2JM9 A;  1GFD A;  2PZ1 A;  1SRM A;  1OOT A;  3M0T A;  2F2V A;  2K2M A;  1BBZ A;  3EGU A;  3NPF A;  2RQW A;  4D8D A;  2KRM A;  2DIL A;  2LQN A;  4X1V A;  5IHK A;  2ESW A;  1KFZ A;  1WLP B;  4ZNX A;  1OPK A;  1ARK A;  2BTT A;  2V1Q A;  1T3L A;  2GGR A;  2CH4 A;  1ZLM A;  4R0K A;  4LUD A;  1LCK A;  4HXJ A;  2RPN A;  1QKW A;  1K1Z A;  3EHQ A;  2RQU A;  1SHG A;  3IQL A;  3ULR B;  3QWY A;  2LZ6 B;  2SRC A;  1GCQ C;  2JTE A;  2YUP A;  2C0O A;  1RLP C;  3M0Q A;  3NHN A;  1X2Q A;  1M30 A;  3REB B;  2RN8 A;  1E6H A;  4JZ4 A;  2EGE A;  4AFQ C;  2JS0 A;  2K7A A;  2DVJ A;  1JU5 C;  3VS6 A;  2KXC A;  2BZX A;  3TSZ A;  1NYF A;  1RUW A;  5EC7 A;  1YN8 A;  3VS7 A;  4OML A;  3THK A;  2KRN A;  2RMO A;  4CC7 A;  3ZL7 C;  1J3T A;  1A0N B;  1HSQ A;  2O88 A;  3EG0 A;  2YUQ A;  3TVT A;  2ED1 A;  2SEM A;  1TUD A;  4CC4 B;  1BK2 A;  1ZX6 A;  3C0C A;  3RBB B;  1ABO A;  3JV3 A;  4E6R A;  1V1C A;  1JQQ A;  2DNU A;  4HVW A;  4JJC A;  4RTX A;  2DBK A;  4DEY A;  2AKL A;  1ZUY A;  2HCK A;  1NG2 A;  3M0P A;  1B3Q A;  2JMA A;  4OMP A;  2HBW A;  1AWO A;  2MIO A;  1FYN A;  2HSP A;  1ZUU A;  1K4U S;  2K79 A;  2J6O A;  4FSS A;  3VS4 A;  2DYB A;  1HD3 A;  1YWO A;  2AKK A;  4J9D A;  1GCP A;  2KR3 A;  2KYB A;  2DMO A;  1MV0 B;  2E5K A;  2L3P A;  1TG0 A;  2EYZ A;  3GBQ A;  1U3O A;  2PTK A;  2D8H A;  2EVR A;  1MUZ A;  3NMZ C;  2NUZ A;  5FWC A;  3EHR A;  2L3S A;  2MCN A;  4AFZ C;  1VYU A;  3H0H A;  2D1X A;  4LE9 A;  2GBQ A;  2DL4 A;  2OJ2 A;  1UJ0 A;  2ED0 A;  2J06 A;  2F2W A;  1T0J A;  1WXB A;  1AZE A;  2J05 A;  1GBR A;  2KRS A;  1GBQ A;  1QWE A;  4F16 A;  2LP5 A;  2KNB B;  3PVL A;  1PNJ A;  2A37 A;  1QCF A;  4AG2 C;  1I1J A;  1KIK A;  4IIO A;  1SPK A;  1WI7 A;  1ZUK A;  2X3W D;  2J6F A;  3H0F A;  4JZ3 A;  1OV3 A;  1OPL A;  1ABQ A;  2JT4 A;  1X6B A;  4HVU A;  3FJ5 A;  4RTU A;  2EGA A;  1SEM A;  1M8M A;  2KXD A;  2ROL A;  3I5R A;  2DF6 A;  1VYT A;  2DL8 A;  2L2P A;  1WXT A;  2M0Y A;  1PRL C;  1W6X A;  2ROT A;  1UHC A;  2O31 A;  2KYM A;  4LNP A;  3VRZ A;  2LNH B;  2KT1 A;  1JO8 A;  1H8K A;  4A63 B;  4Y92 A;  2YT6 A;  1E7O A;  1JEG A;  1IO6 A;  2DM1 A;  2W10 A;  3VS0 A;  3I9Q A;  2OI3 A;  1X69 A;  1HJD A;  1K0S A;  2FPE A;  2CT4 A;  2EGC A;  1UFF A;  1JXM A;  1TUC A;  2YDL A;  1E6G A;  2GNC A;  2P4R A;  2ABL A;  2DJQ A;  2RNA A;  2FRY A;  2AZV A;  2EYW A;  1YNZ A;  2CSI A;  5ECA A;  2CSQ A;  5HCK A;  4CC3 A;  3EG1 A;  1EFN A;  2FEI A;  2LJ3 A;  2YSQ A;  1K0X A;  3KFV A;  4OMQ A;  4Z8A A;  1NYG A;  4F17 A;  3M0S A;  2JMC A;  2O9S A;  5IHN A;  3U23 A;  5I11 A;  2LX7 A;  2RQT A;  1GRI A;  2DRM A;  2DL5 A;  3VS3 A;  5IXF A;  1CSK A;  4J9G A;  2DLP A;  2IIM A;  1NLP C;  2YUN A;  2FO0 A;  4JJB A;  2CH4 W;  1I07 A;  2DL3 A;  1WIE A;  1K76 A;  2GTJ A;  2DX1 A;  2V1R A;  1CKA A;  1Y0M A;  4J9C A;  2CUB A;  2CDT A;  4EIK A;  1GL5 A;  2OAW A;  3CQT A;  3O5Z A;  1X43 A;  5FW9 A;  4AFS C;  2I0N A;  2ECZ A;  1SRL A;  5IHI A;  4JJD A;  4LN2 A;  2LCS A;  3VRY A;  1XOV A;  2FRW A;  1PWT A;  2HDA A;  2J7I A;  4JPB W;  1UHF A;  1UDL A;  3VS2 A;  4J9I A;  1UJY A;  2JS2 A;  4J9H A;  4RUG A;  4LUE A;  1UEC A;  1RI9 A;  2KEA A;  1WX6 A;  1QKX A;  1T3S A;  1ZBJ A;  2JXB A;  1NEG A;  2D0N A;  2BZY A;  3SEM A;  1NEB A;  2O2O A;  1M3A A;  4AFU C;  4K11 A;  1M3C A; 
#chains in the Genus database with same CATH topology
 5HY6 A;  2VKN A;  1Z9Q A;  4PKC C;  4M7A F;  3OYK A;  2FPD A;  4ME7 A;  4M75 E;  1H92 A;  3OS5 A;  2BUD A;  5L8R E;  3NGP A;  4A53 A;  4C0D B;  2ZCF B;  4PFZ A;  3RER A;  2JZ2 A;  5FWB A;  2K3B A;  5HK3 A;  1VQK A;  4WCI A;  2A36 A;  4ZN1 A;  2NWM A;  3PTA A;  4C8Q G;  5IT9 E;  3URG A;  1YHQ T;  4QQ6 A;  1VYV A;  3CCU A;  2G6F X;  3OBW A;  4IUP A;  2QEX T;  3CC7 T;  2QQR A;  4OMM A;  5KYY B;  3QDF A;  1WFW A;  3VS5 A;  3L1A A;  1PRM C;  1TWB A;  3LH5 A;  4OMO A;  2EBP A;  5J26 A;  2LQW A;  3CXC P;  1RAB B;  5J3B A;  4RTV A;  2LJ0 A;  3UA6 A;  2E3I A;  3OSV A;  1I0C A;  4KRT A;  1AD5 A;  2O9V A;  4QVZ A;  2DL7 A;  4ESR A;  1SHF A;  2CS7 A;  2QA4 T;  4QT7 A;  3JB9 D;  4AG1 C;  4J9B A;  4II1 A;  3PE0 A;  1I81 A;  2X35 A;  4M7D D;  2FPF A;  4C5H A;  1B07 A;  2KGT A;  1FMW A;  1RLQ C;  1N9S A;  2DBM A;  4M77 E;  2DRK A;  3JCM J;  4PLL A;  4GLK A;  1MMG A;  2QQA A;  2EWN A;  1X2K A;  4J6W A;  4LDU A;  2DXB A;  3BE3 A;  5LJ3 d;  5KCH A;  3EAE A;  1K9A A;  3CBM A;  1VA7 A;  4J6X A;  5KYN A;  3FJP A;  4KH0 B;  3A98 A;  2RA2 A;  4AMC A;  3J81 E;  1NZ9 A;  1UGP B;  3L2V A;  1YJ9 Q;  1YCS B;  5CK9 A;  3GOX A;  4OB1 B;  1U5S A;  3M0R A;  2RJD A;  3UA7 A;  2H3J A;  1WQ7 A;  2DKG A;  2A08 A;  1TTH B;  5LJ3 f;  2BIV A;  5L23 A;  2Y4Y A;  4ZTF A;  1BB9 A;  3L2Z A;  1BI1 A;  4BI8 B;  4ELZ C;  4OMF B;  1VQM T;  1H64 1;  3CCS A;  1AWW A;  2NUP B;  3G4S T;  4M7A E;  4HVV A;  1QP3 A;  3EGD B;  3CCQ Q;  1AVZ C;  5KYW A;  2CKK A;  2PZ1 A;  2OTL Q;  1IRE B;  4C8Q A;  2AIR B;  1LJO A;  3M0T A;  1C1A A;  2JTM A;  3EGU A;  2K3Y A;  2RQW A;  4D8D A;  3G6E A;  2C06 A;  3VKI A;  3CC4 T;  2LQN A;  4C92 G;  3PIP A;  2FZG B;  1KFZ A;  2L5Q A;  3E19 A;  2DYI A;  4ZNX A;  2MI6 A;  2BTT A;  2V1Q A;  1VQ5 Q;  1OU8 A;  4N4G A;  1Q95 G;  3CMA A;  2RPN A;  3MEA A;  2IVW A;  3IQL A;  2LZ6 B;  1VIE A;  2MAM A;  2SRC A;  1RLP C;  2E12 A;  3NHN A;  2DZC A;  3GPL A;  5KYX A;  3REB B;  2EGE A;  4QQG A;  2JS0 A;  3M58 A;  2DVJ A;  1JU5 C;  3H9N A;  1BCO A;  4FT4 A;  5D6X A;  3E2U A;  1RUW A;  4FYV B;  1XJW B;  3VS7 A;  2CP2 A;  4OML A;  3LWI A;  4BE2 A;  3M4G A;  2QDY B;  2KRN A;  2ZPG B;  4FL6 A;  2RMO A;  1BCM A;  1J3T A;  1A0N B;  1G3Y A;  3RKX A;  2O88 A;  1M90 R;  2SEM A;  1TUD A;  1BK2 A;  1ZX6 A;  4JJC A;  5GAN e;  2FHD A;  2AKL A;  3HP9 A;  1VQK T;  2HCK A;  3TEE A;  4ZGJ B;  4OMP A;  2HBW A;  3EG9 B;  2M9U A;  4RG2 A;  2KDS A;  5CKB A;  1SF9 A;  1JJ2 A;  1YWO A;  1R0B G;  1IB8 A;  1Q82 C;  2E70 A;  2DMO A;  4Z02 A;  2E5K A;  2L3P A;  3LX7 A;  3QPH A;  4QW2 A;  2QQ9 A;  3MET A;  4A4K A;  1U3O A;  2GFA A;  3NMZ C;  3OYG A;  2MCN A;  4E7S A;  4RKU E;  4HCC A;  3DKM A;  4MZT A;  5M9O A;  3OYL A;  4LE9 A;  2DL4 A;  1QVF P;  3EFO B;  5I2M A;  4BAC A;  1WHK A;  4J83 A;  4EMK A;  2OTJ A;  4F16 A;  2F69 A;  1VQK Q;  3MO8 A;  3GLX A;  3JCM P;  4OVA A;  3FB9 A;  4IIO A;  3JB9 G;  1SPK A;  1AHJ B;  4Q5W A;  1WNL A;  2X3W D;  3CCU Q;  1RAI B;  2R57 A;  5D6Y A;  1YI2 A;  1OV3 A;  2LCC A;  2HAX A;  2JJ9 A;  4C92 A;  3FJ5 A;  2COY A;  2DIG A;  3KUF A;  3JB9 J;  2DF6 A;  5CR2 A;  1WXT A;  4F7U G;  4M75 B;  3RUX A;  4OB2 B;  2M0Y A;  2QAS A;  1I5O B;  1EX4 A;  2XK0 A;  1UHC A;  2O31 A;  2KYM A;  4LNP A;  2EJ9 A;  5IN1 A;  3BDL A;  4PJJ A;  1WGS A;  3CBO A;  2HBP A;  3CPF A;  3RES A;  2W10 A;  3VS0 A;  1QCN A;  2FVU A;  1N27 A;  3V8J A;  4J5Y A;  3QJY A;  1X69 A;  1JJ2 P;  1Y96 A;  2CT4 A;  4MML A;  4HCB A;  2EGC A;  1R77 A;  5LL6 S;  2QXF A;  5GAN 5;  2DFU A;  3MPU B;  1E6G A;  2ABL A;  2RNA A;  5GAN d;  3V8L A;  3JCM g;  1YNZ A;  3OYF A;  5C0M A;  1KQS A;  1OX9 A;  3L2Q A;  2LJ3 A;  2E4H A;  3KFV A;  4OMQ A;  1Q7Y U;  4JLI A;  2JVV A;  1KG1 A;  2O9S A;  5C6S A;  4N0A A;  1EIF A;  4J7F A;  3G6E T;  2IIM A;  1B34 A;  1ZA2 B;  3QKJ A;  4FT2 A;  3ASK A;  3DLL A;  1YHQ A;  2RK1 A;  5GAM f;  2QEX A;  4JS5 A;  4XTV A;  2V1R A;  1CKA A;  2YLC A;  4J9C A;  3QXE B;  3CC7 A;  5CKF A;  3O5Z A;  3OYC A;  4C0D C;  2I0N A;  5DLO A;  4L59 A;  4A54 A;  3CCS Q;  5IHI A;  4JJD A;  1RAE B;  3VRY A;  1XOV A;  2FRW A;  2J7I A;  5FRO A;  1W4S A;  3G71 A;  3A1P A;  1UHF A;  3QO3 A;  1UEC A;  2FZC B;  3OY9 A;  3INZ A;  2V8K A;  3JAM E;  1T3S A;  1ZBJ A;  4FW1 A;  2E41 A;  3SEM A;  5GMK i;  4E7H A;  3SWN C;  1IHV A;  3PMT A;  1V76 A;  5GAM h;  3PGG A;  3LWH A;  2WSE E;  4FCY A;  1VQL T;  3AHU A;  2NYS A;  1UGQ B;  1VQ8 T;  5DM7 R;  1AT1 B;  4X34 A;  4M75 F;  3CMA Q;  4F7U A;  1RAA B;  1Y57 A;  1RAF B;  1PD1 A;  1WA7 A;  2GFU A;  1T0H A;  1GXI E;  1KQS P;  3QBY A;  5KYU B;  2H8H A;  2QG9 B;  4M7A B;  4F14 A;  1KJW A;  4LDW A;  1WHM A;  1FX7 A;  7AT1 B;  1BI0 A;  1QWF A;  1YIT T;  1QVP A;  3CCM T;  5GMK h;  3UAT A;  1KQ2 A;  1Q7Y C;  1U1S A;  1RAD B;  2EKH A;  2XG8 D;  3FDR A;  4RCC A;  2CGH A;  2L3Q A;  2RI2 A;  5GAO n;  2VGM A;  2K6D A;  2HL3 A;  3Q1J A;  2D8J A;  1SSH A;  2KT8 A;  2K57 A;  3RNJ A;  1ZSZ B;  2EQI A;  2GF7 A;  5GAN 8;  1W2B P;  2K9G A;  3EGX A;  2QAZ A;  4LXC A;  1M27 C;  3OYA A;  2CRE A;  3VS1 A;  3KBG A;  1YWP A;  1M1G A;  2GTO A;  2E1H A;  3JCM X;  1NLO C;  4B9X A;  4ORZ A;  1PM3 A;  1VQM A;  4Z88 A;  1PKT A;  2VV5 A;  1D1B A;  3EG2 A;  1ZBX A;  4M78 F;  3G4S A;  1JBM A;  1ZSG A;  3SHW A;  2KSS A;  3M0U A;  1BU1 A;  1YI2 T;  4XU1 A;  4M7D E;  1M3B A;  2QDL A;  1OEB A;  3OA6 A;  2EQU A;  3MEU A;  2HNI A;  3FEO A;  1VQ9 T;  3GIB A;  3M4Y A;  4JRP A;  1PSF A;  3CC4 A;  4OB3 B;  1PHT A;  3X25 B;  4BY6 B;  1X27 A;  4BE0 A;  1Q86 U;  1K73 R;  4IUR A;  3CXC A;  3TRE A;  1AEY A;  2RJF A;  3QJ6 A;  4P5N A;  1UGV A;  2R58 A;  1KHI A;  3ER0 A;  3A8G B;  2J6K A;  3TQ7 P;  1WXU A;  2OTJ Q;  3ME9 A;  1Y71 A;  8AT1 B;  3CME T;  1X01 A;  4OMN A;  1G2B A;  4C8Q B;  4MDW A;  2JW4 A;  3CCR A;  3A5Z B;  3CEY A;  1YI2 Q;  2KVQ G;  3D7S B;  3RR6 A;  4ANJ A;  2VAS A;  4RCB A;  3QUI A;  2HMA A;  1WJR A;  1AWX A;  3EH2 A;  4Z89 A;  1VQ7 A;  4L5G A;  3CCV Q;  4PJO C;  1OZ3 A;  2FYK A;  3OSS C;  1QW1 A;  2MOX A;  3PVQ A;  2AZS A;  1TXQ A;  2EFI A;  4FYX B;  3R6N A;  2DK3 A;  3S3O A;  1AWJ A;  4N4H A;  2KRO A;  1WJQ A;  1H3H A;  2JM9 A;  2KI7 A;  1SRM A;  5LJ5 j;  1KC8 C;  1OOT A;  1HXD A;  3E9G A;  3V7S A;  1M1F A;  3OYD A;  1BBZ A;  5HK0 A;  5IHK A;  3V7C A;  5GAN 4;  4PJO D;  1OPK A;  1Q82 R;  2RJE A;  1T3L A;  1D1C A;  2FB7 A;  2EAY A;  2NUT B;  2ZPH B;  2CH4 A;  1OUL A;  2QTV A;  4R0K A;  4LUD A;  3RMS A;  1XNI A;  2JN0 A;  1UEB A;  2O4X A;  1QKW A;  3EHQ A;  1SHG A;  1H3Z A;  2XKO C;  4C5E A;  3G71 T;  2XI9 A;  4JDS A;  1MND A;  5A0G A;  2C0O A;  3M55 A;  1PG5 B;  4B9W A;  1X2Q A;  1M30 A;  1Q86 C;  2E64 A;  2KY9 A;  2RN8 A;  3QYG B;  3OW2 A;  2EJG A;  3FLG A;  3P8B B;  4PFO A;  2MYS A;  2KXC A;  2BZX A;  1QVG P;  2HKQ B;  2DXT A;  4J7I A;  4BDY A;  4M78 E;  2PVD B;  4Y91 A;  1YN8 A;  4DOW A;  1K73 U;  3THK A;  4A4H A;  1YHQ Q;  2QTX A;  2QEX Q;  3ZL7 C;  3CC2 T;  1UGS B;  3CC7 Q;  3RBB B;  1V1C A;  4XTW A;  4PJL A;  2DNU A;  3LGF A;  3S6W A;  3I55 A;  2E5Q A;  1ZUY A;  3M0P A;  2JMA A;  3G71 Q;  1YIJ A;  2RHU A;  1FYN A;  2RHI A;  1IXD A;  4DA4 A;  2K79 A;  3LYI A;  4C8Q F;  4FSS A;  3VS4 A;  1HD3 A;  2AKK A;  3VU3 C;  3JRZ A;  1GCP A;  3CPW P;  2KYB A;  2CP5 A;  1VOM A;  3JCM e;  4E47 A;  2QA4 Q;  2QQB A;  2EYZ A;  2A7Y A;  4R55 A;  4C92 B;  1MUZ A;  2LRQ A;  3M56 A;  4JS4 A;  4XTY A;  2AT1 B;  3EHR A;  2X4J A;  2L3S A;  4M75 C;  2AHJ B;  4C0Z A;  3HFN A;  1EZZ B;  2D1X A;  2YRD A;  2GQV A;  2GBQ A;  3RDV A;  1UJ0 A;  2ED0 A;  2J06 A;  1Y7X A;  1GBR A;  2J05 A;  2HQX A;  2KRS A;  4FU6 A;  1KQS S;  3PVL A;  2KNB B;  4AG2 C;  3UT1 A;  3OW2 P;  1SSF A;  1OI1 A;  1WI7 A;  1ZUK A;  1Q82 U;  1MHN A;  2J6F A;  3HRS A;  1BKB A;  3H0F A;  2YRV A;  5DLQ E;  2HSE B;  1VQ4 T;  1X6B A;  1Y96 B;  4HVU A;  3MP8 A;  4KGX B;  4MZM A;  2DEU A;  1IZ6 A;  3WVE B;  1M8M A;  2KXD A;  4XAX B;  4BB7 A;  2ROL A;  3I5R A;  4JRQ A;  1VYT A;  1K73 C;  1YFN A;  2ROT A;  4PJM A;  1QVF A;  5CCA A;  2KT1 A;  2D0Q B;  2LT4 A;  8ATC B;  3BY7 A;  1VQM Q;  4PL6 A;  1VQO T;  2EYQ A;  2QQS A;  3G4S Q;  3NTI A;  1IO6 A;  3CCR T;  2DTI A;  3I9Q A;  4M77 C;  2ZPB B;  3CD6 T;  1M2V B;  2DTO A;  1VQ7 T;  2XDD A;  1JXM A;  1TUC A;  2P4R A;  3JSC A;  3WVD B;  1YCY A;  1FMV A;  3V7R A;  2X51 A;  3CC4 Q;  1RI0 A;  3JCM c;  4E2F B;  2CSI A;  2F5K A;  2Y4X A;  5ECA A;  1VQL A;  3RKW A;  2HZY A;  5HCK A;  3UPU A;  1VQ8 A;  2YSQ A;  1K0X A;  2BE7 D;  3C12 A;  1NYG A;  3QG1 A;  1YJW A;  3M0S A;  5GAM e;  3HRT A;  3OYJ A;  2JMC A;  3U23 A;  5I11 A;  3JCM d;  2X9H A;  2RQT A;  2ZGW A;  1GRI A;  4M77 D;  1LPL A;  3UWN A;  2DRM A;  3SWN A;  2EQM A;  4DBH A;  4N4I A;  2ATC B;  5FU7 B;  2VC8 A;  5IXF A;  4J9G A;  2DLP A;  2D6F A;  1OYX A;  4M7D B;  3GNG A;  4ZN3 A;  2FO0 A;  4JJB A;  2YRC A;  2CH4 W;  1YIT A;  1Q7Y R;  4C8Q E;  1I07 A;  3CCM A;  1WIE A;  4C92 F;  2KAF A;  4PJO G;  3CCE T;  2DAQ A;  4HKE A;  1Y0M A;  1VQ7 Q;  4EIK A;  5FU6 C;  1GL5 A;  4FIB A;  1X43 A;  3QDR B;  2CP0 A;  1SRL A;  5GMK e;  4M7A C;  2DVE A;  3NTH A;  1JB0 E;  5KE3 A;  1PWT A;  3CCL T;  2L8D A;  3JCM f;  4XTX A;  1K8A C;  2L89 A;  1S72 T;  1UJY A;  1U8R A;  3QZ9 B;  2OAU A;  3OYE A;  4LUE A;  1OX8 A;  3OS0 A;  4R56 A;  4XU2 A;  1WX6 A;  1QKX A;  1P92 A;  2RH2 A;  1NEB A;  3RKY A;  1TUG B;  4RMO A;  1ZSZ C;  4J9F A;  1W1F A;  2EIF A;  3LLR A;  2CP3 A;  1PKS A;  2RQR A;  4M7A D;  1WJS A;  5LJ3 j;  2L0A A;  4DBR A;  3OYB A;  1QLY A;  2C0T A;  3I55 T;  1VQ9 A;  5AT1 B;  2RO0 A;  4KUL A;  1X6G A;  1S1N A;  3EGX B;  1YIJ T;  3JCM h;  3HTR A;  2DET A;  2R5A A;  5DY9 A;  3CXC S;  1UG1 A;  2CZ1 B;  1NPP A;  2EW3 A;  1YJN A;  1MMA A;  4RTW A;  2VWF A;  2LT1 A;  1BI3 A;  2F2X A;  2E3H A;  2H3E B;  2XD0 A;  1W70 A;  1WHG A;  1D3B A;  2DE0 X;  3CME A;  1GFC A;  4FSX A;  2F5T X;  1D09 B;  4X9D A;  4A4F A;  1KSW A;  2DIQ A;  5GAM d;  2LQ8 A;  1BIB A;  3I55 Q;  2GQI A;  1K9M U;  2HEQ A;  2Z0W A;  1YIJ Q;  1LNX A;  3H0I A;  5CQY A;  5I22 A;  4PFP A;  3EG3 A;  3A8O B;  4M7D F;  1KC8 R;  2PU9 B;  4M78 B;  2B86 A;  1YP5 A;  4HT8 A;  1NM7 A;  5D7U A;  1I8F A;  4PJO A;  4M4Z A;  3QYH B;  4PNO A;  3TSW A;  4GLM A;  4HCK A;  2I2L A;  2ENM A;  5GAN 6;  4C92 E;  4D8K A;  2RI5 A;  3UF4 A;  4OGC A;  4NOY A;  4L6V 5;  1FMK A;  1W2B A;  1AOJ A;  2M16 A;  2MPX C;  2DA9 A;  2A3L A;  2CP6 A;  3JCM W;  4KT0 E;  2X4Y A;  2F1L A;  2P84 A;  2Y90 A;  5GMK l;  2C0I A;  1M8V A;  3C95 A;  3SD4 A;  2LJ1 A;  1Q86 R;  1U06 A;  3E9F A;  2NLU A;  2P4T A;  4RTT A;  2XMF A;  2ZPF B;  4UC4 A;  1VQ6 T;  3I35 A;  3PT9 A;  2LDM A;  4CC2 A;  4GBQ A;  3G6E Q;  1UTI A;  4QKU A;  3PFS A;  2VVK A;  4JRK A;  4IUQ A;  2VXE A;  2CZ0 B;  3DLM A;  1N9R A;  2COZ A;  5GJW B;  3ZEH A;  3G1J A;  2RF0 A;  1VQP T;  1VIF A;  2O4X B;  3CC2 A;  5IH2 A;  1YJW T;  3H41 A;  4C0G A;  5GMK m;  3OYY A;  2PVG B;  1R8O B;  3CCJ T;  1YJ9 A;  2COW A;  1GFD A;  1UB4 A;  3JCM Q;  2JOY A;  4M77 G;  3OYM A;  5KH6 A;  1K9M C;  2F2V A;  2K2M A;  3O8V A;  1RAH B;  2FZK B;  2DIL A;  3HFO A;  4KUI A;  4B6M A;  1WZO A;  5I21 A;  2GGR A;  4C0F A;  3MEV A;  1ZLM A;  1LCK A;  4HXJ A;  1RAC B;  3VYG A;  3WXM B;  1VQL Q;  1BIA A;  1GCQ C;  5LJ5 h;  1VQ8 Q;  4WF2 A;  2OTL A;  3M0Q A;  2VXF A;  3OMG A;  2R5M A;  4IUV A;  5GAN g;  1KC8 U;  2E6Z A;  2VB6 A;  2HD0 A;  4JZ4 A;  3MP1 A;  4AFQ C;  3N5B B;  5GAO r;  2K7A A;  3VS6 A;  2RHY A;  3TSZ A;  5EC7 A;  1YIT Q;  3V8K A;  4KGV B;  3CCM Q;  4JUV A;  4CC7 A;  2LNV A;  1HSQ A;  3EG0 A;  2YUQ A;  4M7A G;  1VQ4 A;  3TVT A;  2ED1 A;  4CC4 B;  2K4Y A;  3C0C A;  5FRM A;  1ABO A;  1TS9 A;  3JV3 A;  1G3S A;  5LJ5 g;  1JQQ A;  4ZGD B;  3M54 A;  2HKN A;  1Y07 A;  1NG2 A;  4NL2 A;  4LDX A;  4F7U E;  3HPW A;  1YJN T;  2MIO A;  2HSP A;  1QVF S;  3HHT B;  3QHS A;  1ZUU A;  5CQX A;  1K4U S;  2K5I A;  4C5I A;  1VQN T;  3PIO A;  2KR3 A;  1QVG A;  5KYW B;  1VQO A;  1PD0 A;  1TG0 A;  3GBQ A;  5GAN j;  2D8H A;  2EVR A;  4ZGE B;  1Q81 R;  4DOV A;  2CZ7 B;  3CD6 A;  3P8H A;  4AFZ C;  1VYU A;  3H0H A;  4PK4 A;  3OB9 A;  1VQ9 Q;  1BI2 A;  4QVD A;  1OZ2 A;  1T0J A;  2PQW A;  1AZE A;  5AYF A;  1D0X A;  5KCO A;  1GBQ A;  1QWE A;  2LP5 A;  1RAG B;  2RM4 A;  2MWO A;  3H6Z A;  2IG0 A;  2A37 A;  1KIK A;  1I1J A;  6AT1 B;  4D6W A;  1OQK A;  4M77 A;  1YJN Q;  5A0D A;  3I56 A;  1N8R C;  2K2V A;  5KYX B;  2RHX A;  4JZ3 A;  1G5V A;  4FYY B;  3P8D A;  3CPW A;  1OPL A;  5GAN 2;  5EG2 A;  2JT4 A;  3CME Q;  3BDU A;  5GAO l;  2MK5 A;  1KK7 A;  4NS5 A;  1SEM A;  1ZHI A;  1JJ2 S;  3X24 B;  2DL8 A;  2L2P A;  3QII A;  4GY5 A;  1NBE B;  2XID A;  3CCE A;  1PRL C;  4J8O A;  2KK4 A;  2VGN A;  1FXX A;  2XDB A;  3S3M A;  1G3T A;  3VRZ A;  2LNH B;  1F1B B;  2QI2 A;  3GNF B;  4A63 B;  1NJI R;  3JB9 H;  1E7O A;  1HK9 A;  4PLI A;  2VUB A;  1JEG A;  5FU7 C;  1K8A R;  2RHZ A;  3UDC A;  3CCL A;  3ZBD A;  4M7D C;  2DPP B;  2YLB A;  1BYM A;  1WHJ A;  2PUK B;  1S72 A;  3SWN B;  3MEW A;  5GAO m;  1K0S A;  2FPE A;  2YXY A;  1UFF A;  5A0L A;  2LQK A;  2YDL A;  2M1H A;  2GNC A;  2DJQ A;  5KYU A;  5GAO q;  2FRY A;  3X26 B;  4M7A A;  2AZV A;  2EYW A;  2EQJ A;  1WHL A;  5IAY A;  2E65 A;  4CC3 A;  2CP7 A;  2DXC A;  1EFN A;  2FEI A;  1TU0 B;  1YJ9 T;  4DQ2 A;  2PVO B;  5IHN A;  2LX7 A;  3FRN A;  1QQJ A;  1D0Z A;  2DL5 A;  4EMK B;  1CSK A;  1Q81 U;  2EJF A;  1WHH A;  4BUG A;  2YUN A;  2YHT A;  3C94 A;  4CRI A;  2M02 A;  4EPC A;  1ZSZ A;  3KXT A;  4ZTJ A;  3M9Q A;  4E7J A;  4E7L A;  2DEQ A;  2V8I A;  2GTJ A;  4FM4 B;  3OYN A;  5FLX E;  2JNG A;  4F04 B;  5FW9 A;  3CCQ T;  2ECZ A;  4IUU A;  2OTL T;  4LN2 A;  1QCO A;  3CC2 Q;  2O01 E;  2RJC A;  2HDA A;  4E7K A;  2ZPE B;  2YWW A;  1UDL A;  4J9I A;  4J9H A;  4RUG A;  1OU9 A;  4HCZ A;  2KEA A;  1M2O A;  2RK2 A;  1VQ5 T;  2D0N A;  1LVK A;  1RL2 A;  2BZY A;  3NTK A;  3M59 A;  1M3A A;  4AFU C;  1X6O A;  1D3B B;  4K11 A;  4BDZ A;  3VYH B;  3HSB A;  4KBM B;  3QWX X;  5GAO p;  3VV0 A;  5GJV B;  4BI3 A;  4IUT A;  4M75 D;  2CT3 A;  4QVC A;  1HYO A;  1SG5 A;  1NJI U;  2CUD A;  2QK0 A;  1K8A U;  2AK5 A;  5CO7 A;  3F70 A;  3VUZ A;  2P0P A;  1C0M A;  4JJN K;  3TCJ A;  1W2B S;  3MCA B;  3EFS A;  2XIC A;  4RTY A;  1G83 A;  4M78 C;  1N5Z A;  4BI4 A;  4O5V A;  4ELY C;  4IKF A;  2EQK A;  5LJ3 h;  2EYY A;  1IHW A;  2PNI A;  1NPR A;  1Q81 C;  5FRN A;  4PJO B;  1B34 B;  4HA8 A;  1VQ6 A;  1VQ4 Q;  2RI3 A;  3MP6 A;  4WTO B;  3HRU A;  2JUF A;  1JXO A;  3OS2 A;  4O6J A;  4RTZ A;  1M9S A;  4IIM A;  2EPD A;  2RB6 A;  2OX7 A;  3I56 T;  1VQP A;  3REA B;  4M78 D;  4JLG A;  4OF1 A;  2BKD N;  2K5F A;  3NFC A;  3RIR A;  1D0Y A;  5I2S A;  5KYY A;  3CCJ A;  4C5G A;  2NUT A;  3L2W A;  5LJ3 g;  2MWP A;  1MV3 A;  1R0C B;  1WQW A;  3EH1 A;  3C4S A;  2ZAE A;  1K9M R;  1VQO Q;  1CKB A;  2BZ8 A;  2M51 A;  3CCR Q;  4EDU A;  3OS1 A;  2X3X D;  3CD6 Q;  1UUE A;  1MGQ A;  1Z9Z A;  3I5S A;  4J9E A;  4OP0 A;  3J80 E;  4LDV A;  1UE9 A;  1O75 A;  1TSF A;  1YBY A;  3CCU T;  2G3R A;  2CZ6 B;  4F7U B;  2DJZ A;  3H8Z A;  3OYI A;  4V2S A;  1WDX A;  5IXB A;  1B7T A;  1O9S A;  3OYH A;  1NJI C;  2DZ9 A;  2ZZD A;  4KGZ B;  2VYT A;  1IGQ A;  3I56 Q;  3J7A F;  4X9C A;  2MF2 A;  3M57 A;  1AZG B;  2JTF A;  3ZFJ A;  4AT1 B;  2KE9 A;  2EYX A;  1WYX A;  5LJ5 e;  2RQV A;  4DEX A;  5GAN 7;  4LD6 A;  3HKS A;  2YUO A;  1GCQ A;  3CCE Q;  2LMJ A;  2A28 A;  1M1K R;  2JM8 A;  2W0Z A;  3OQ5 A;  2KBT A;  2FG0 A;  4M7D G;  2P0Q A;  3CCL Q;  3NPF A;  1MNE A;  4EMH A;  2X4X A;  1S72 Q;  2KRM A;  4X1V A;  2FL7 A;  3CCV A;  2ESW A;  1VQN A;  3BFM A;  1KQ1 A;  1WLP B;  4PJO F;  1ARK A;  4XTZ A;  1QVG S;  5J39 A;  3L42 A;  3VUB A;  4BY6 C;  2NUP A;  1PCX A;  1K1Z A;  5CKE A;  2RQU A;  1TH7 A;  3ULR B;  3QWY A;  2X4W A;  1D1A A;  3EGD A;  2JTE A;  2YUP A;  1KD1 R;  3MJX A;  1M5Q 1;  3VJP A;  3DB3 A;  4VUB A;  1ZA1 B;  1E6H A;  2V8J A;  3A8H B;  2XU8 A;  3QSU A;  3X20 B;  4ATO A;  1M90 U;  2QGF B;  3SFM A;  4A4G A;  1KHC A;  4C8Q C;  2RD1 A;  3JB9 F;  1FWZ A;  2DXU A;  1N8R R;  1NYF A;  2L3R A;  1MMD A;  3CCS T;  4KH1 B;  3CPW S;  3GF5 A;  4M75 G;  3L2U A;  5GAN 3;  3SB2 A;  4XTU A;  5A2Q E;  4E6R A;  3JCM b;  4HVW A;  4RTX A;  2DBK A;  4DEY A;  4F7U F;  4DBF A;  1B3Q A;  2E6N A;  4PJN A;  5CAI A;  1AWO A;  4XQ3 A;  1PSE A;  3FC3 A;  4E7I A;  1M2V A;  2HQH A;  5CKH A;  2J6O A;  4C8Q D;  5LJ5 d;  2DYB A;  3QZ5 B;  3MHX A;  4M77 B;  4J9D A;  3DB4 A;  5GAN f;  2D9T A;  1TOV A;  2WAC A;  1MV0 B;  3CMA T;  2V26 A;  4MMK A;  3OW2 S;  5CVI A;  2PTK A;  3TU4 K;  2NUZ A;  5FWC A;  2PUO B;  3L2R A;  1M1K U;  4RG8 A;  2XDP A;  4KUD K;  2OJ2 A;  2LVM A;  1G3W A;  2F2W A;  2CYZ B;  1WXB A;  3A8L B;  3EG9 A;  2XHC A;  2EKO A;  3LGL A;  4M7D A;  1PNJ A;  4J6Y A;  5CKD A;  5LJ5 f;  1QCF A;  1VUB A;  2E10 A;  4M78 G;  3FIF A;  9ATC B;  1QP2 A;  1IRX A;  2QA4 A;  4LD9 K;  1JRI A;  5GAN h;  2KQW A;  3M53 A;  5CIU A;  1XTD A;  2BE9 B;  1ABQ A;  3CBP A;  1M90 C;  3S3N A;  2A0F B;  2WSC E;  4XU0 A;  4RTU A;  2EGA A;  2MMP A;  5FU6 B;  3OBY A;  4MDX A;  1KD1 U;  1V29 B;  3GP8 A;  1VQ6 Q;  3EFO A;  4PJO E;  4Y28 E;  2DO3 A;  1W6X A;  5D6W A;  2LCL A;  1JO8 A;  3CCQ A;  1H8K A;  4QQD A;  4Y92 A;  1N8R U;  2YT6 A;  1VQP Q;  3A8M B;  2DD5 A;  4EMK C;  4CI0 C;  1NE8 A;  4A4E A;  4EMG A;  1YJW Q;  1I4K 1;  5GAM g;  4HT9 A;  2DM1 A;  2LTO A;  3CCJ Q;  2OI3 A;  1PC0 A;  1HJD A;  1WPY A;  2K3X A;  1UGR B;  2HL5 C;  3X28 B;  5KE2 A;  2LC4 A;  1VQ5 A;  4C92 C;  3LW5 E;  2DER A;  1DJ7 B;  4TVR A;  4M75 A;  1XQH A;  3HL8 A;  4OB0 B;  2OTJ T;  1MMN A;  2CSQ A;  4DBQ A;  4YTL A;  4MZP A;  3EG1 A;  3AT1 B;  1X75 C;  1M1K C;  3PNW C;  4Z8A A;  4F17 A;  4XU3 A;  4LDY A;  2DTH A;  3LH0 A;  4M77 F;  2HQE A;  4FW2 A;  3VS3 A;  3EFR A;  3OMC A;  3CCV T;  1NLP C;  4BD3 A;  3R6O A;  2P0K A;  2DL3 A;  3RMQ A;  4C92 D;  3JB9 I;  1K76 A;  1N6A A;  3MKD A;  3E1S A;  1G8X A;  2DX1 A;  5HKC A;  4BE1 A;  3SDZ A;  2CUB A;  4FYW B;  2CDT A;  2OAW A;  4JRI A;  3CQT A;  2WSF E;  4XK8 E;  5GAM j;  4AFS C;  1ZQ1 A;  3G7Z A;  4E7Z A;  3M5A A;  3BW1 A;  2IPO B;  4NL3 A;  2GCX A;  2LCS A;  4OGE A;  2QGG A;  2KMT A;  1KD1 C;  4JPB W;  2ZPI B;  3VS2 A;  5LJ3 e;  1ACM B;  2JS2 A;  4M78 A;  1RI9 A;  3PMI A;  1M4Z A;  2B8A A;  1C6V X;  2JXB A;  1NEG A;  1LOJ A;  3T9N A;  2LX9 A;  2QYZ A;  2M0O A;  4N0A C;  1IGU A;  1SKU B;  3JCM V;  2K5L A;  2DD4 A;  1U1T A;  2O2O A;  5GMK j;  1I5L A;  1VQN Q;  1QMC A;  1M3C A; 
#chains in the Genus database with same CATH homology
 2VKN A;  3QWX X;  4J9F A;  1Z9Q A;  1W1F A;  5GJV B;  1PKS A;  2RQR A;  2CT3 A;  2FPD A;  2L0A A;  1Y57 A;  1H92 A;  1QLY A;  2C0T A;  1WA7 A;  2CUD A;  3NGP A;  1T0H A;  1X6G A;  2AK5 A;  1S1N A;  2H8H A;  4F14 A;  1KJW A;  5FWB A;  2K3B A;  4WCI A;  1QWF A;  1UG1 A;  2A36 A;  2EW3 A;  4RTW A;  2NWM A;  2VWF A;  4RTY A;  3UAT A;  1VYV A;  1G83 A;  2G6F X;  2F2X A;  1N5Z A;  2EKH A;  1W70 A;  2L3Q A;  2DE0 X;  4OMM A;  1GFC A;  1WFW A;  2EYY A;  3VS5 A;  2K6D A;  1PRM C;  2D8J A;  2PNI A;  3LH5 A;  1SSH A;  2KT8 A;  4OMO A;  3RNJ A;  1KSW A;  2EBP A;  2EQI A;  2LQW A;  2K9G A;  4RTV A;  2LJ0 A;  1M27 C;  3UA6 A;  1JXO A;  1I0C A;  2CRE A;  4KRT A;  3VS1 A;  1AD5 A;  1YWP A;  2GQI A;  4RTZ A;  2O9V A;  4IIM A;  2DL7 A;  2GTO A;  2HEQ A;  2EPD A;  4ESR A;  1NLO C;  1SHF A;  4ORZ A;  4Z88 A;  1PKT A;  3EG2 A;  3H0I A;  3REA B;  4QT7 A;  5I22 A;  1ZSG A;  3SHW A;  4AG1 C;  4J9B A;  3EG3 A;  3M0U A;  3PE0 A;  1BU1 A;  2FPF A;  1B07 A;  2KGT A;  1RLQ C;  1M3B A;  1MV3 A;  2DBM A;  2B86 A;  2QDL A;  1OEB A;  1YP5 A;  1NM7 A;  1CKB A;  2BZ8 A;  2DRK A;  4M4Z A;  2M51 A;  3TSW A;  4GLM A;  1X2K A;  4HCK A;  2X3X D;  2ENM A;  1PHT A;  1X27 A;  1UUE A;  4D8K A;  3UF4 A;  1K9A A;  1FMK A;  1Z9Z A;  1AEY A;  3I5S A;  4J9E A;  1AOJ A;  2DA9 A;  1UE9 A;  1VA7 A;  1UGV A;  2J6K A;  1WXU A;  1WDX A;  5IXB A;  2C0I A;  3A98 A;  2LJ1 A;  4OMN A;  1G2B A;  1U06 A;  1YCS B;  2JW4 A;  4RTT A;  1AZG B;  2XMF A;  2KE9 A;  2EYX A;  1U5S A;  1WYX A;  3I35 A;  3M0R A;  3UA7 A;  4CC2 A;  4GBQ A;  1AWX A;  1UTI A;  2RQV A;  4DEX A;  4Z89 A;  2A08 A;  2VVK A;  5L23 A;  1BB9 A;  2MOX A;  2YUO A;  3PVQ A;  2AZS A;  1GCQ A;  5GJW B;  1AWW A;  2RF0 A;  2LMJ A;  2A28 A;  3R6N A;  5IH2 A;  3H41 A;  4HVV A;  1AWJ A;  2JM8 A;  2KRO A;  2W0Z A;  1H3H A;  2KBT A;  2FG0 A;  1AVZ C;  2JM9 A;  1GFD A;  2PZ1 A;  1SRM A;  1OOT A;  3M0T A;  2F2V A;  2K2M A;  1BBZ A;  3EGU A;  3NPF A;  2RQW A;  4D8D A;  2KRM A;  2DIL A;  2LQN A;  4X1V A;  5IHK A;  2ESW A;  1KFZ A;  1WLP B;  4ZNX A;  1OPK A;  1ARK A;  2BTT A;  2V1Q A;  1T3L A;  2GGR A;  2CH4 A;  1ZLM A;  4R0K A;  4LUD A;  1LCK A;  4HXJ A;  2RPN A;  1QKW A;  1K1Z A;  3EHQ A;  2RQU A;  1SHG A;  3IQL A;  3ULR B;  3QWY A;  2LZ6 B;  2SRC A;  1GCQ C;  2JTE A;  2YUP A;  2C0O A;  1RLP C;  3M0Q A;  3NHN A;  1X2Q A;  1M30 A;  3REB B;  2RN8 A;  1E6H A;  4JZ4 A;  2EGE A;  4AFQ C;  2JS0 A;  2K7A A;  2DVJ A;  1JU5 C;  3VS6 A;  2KXC A;  2BZX A;  3TSZ A;  1NYF A;  1RUW A;  5EC7 A;  1YN8 A;  3VS7 A;  4OML A;  3THK A;  2KRN A;  2RMO A;  4CC7 A;  3ZL7 C;  1J3T A;  1A0N B;  1HSQ A;  2O88 A;  3EG0 A;  2YUQ A;  3TVT A;  2ED1 A;  2SEM A;  1TUD A;  4CC4 B;  1BK2 A;  1ZX6 A;  3C0C A;  3RBB B;  1ABO A;  3JV3 A;  4E6R A;  1V1C A;  1JQQ A;  2DNU A;  4HVW A;  4JJC A;  4RTX A;  2DBK A;  4DEY A;  2AKL A;  1ZUY A;  2HCK A;  1NG2 A;  3M0P A;  1B3Q A;  2JMA A;  4OMP A;  2HBW A;  1AWO A;  2MIO A;  1FYN A;  2HSP A;  1ZUU A;  1K4U S;  2K79 A;  2J6O A;  4FSS A;  3VS4 A;  2DYB A;  1HD3 A;  1YWO A;  2AKK A;  4J9D A;  1GCP A;  2KR3 A;  2KYB A;  2DMO A;  1MV0 B;  2E5K A;  2L3P A;  1TG0 A;  2EYZ A;  3GBQ A;  1U3O A;  2PTK A;  2D8H A;  2EVR A;  1MUZ A;  3NMZ C;  2NUZ A;  5FWC A;  3EHR A;  2L3S A;  2MCN A;  4AFZ C;  1VYU A;  3H0H A;  2D1X A;  4LE9 A;  2GBQ A;  2DL4 A;  2OJ2 A;  1UJ0 A;  2ED0 A;  2J06 A;  2F2W A;  1T0J A;  1WXB A;  1AZE A;  2J05 A;  1GBR A;  2KRS A;  1GBQ A;  1QWE A;  4F16 A;  2LP5 A;  2KNB B;  3PVL A;  1PNJ A;  2A37 A;  1QCF A;  4AG2 C;  1I1J A;  1KIK A;  4IIO A;  1SPK A;  1WI7 A;  1ZUK A;  2X3W D;  2J6F A;  3H0F A;  4JZ3 A;  1OV3 A;  1OPL A;  1ABQ A;  2JT4 A;  1X6B A;  4HVU A;  3FJ5 A;  4RTU A;  2EGA A;  1SEM A;  1M8M A;  2KXD A;  2ROL A;  3I5R A;  2DF6 A;  1VYT A;  2DL8 A;  2L2P A;  1WXT A;  2M0Y A;  1PRL C;  1W6X A;  2ROT A;  1UHC A;  2O31 A;  2KYM A;  4LNP A;  3VRZ A;  2LNH B;  2KT1 A;  1JO8 A;  1H8K A;  4A63 B;  4Y92 A;  2YT6 A;  1E7O A;  1JEG A;  1IO6 A;  2DM1 A;  2W10 A;  3VS0 A;  3I9Q A;  2OI3 A;  1X69 A;  1HJD A;  1K0S A;  2FPE A;  2CT4 A;  2EGC A;  1UFF A;  1JXM A;  1TUC A;  2YDL A;  1E6G A;  2GNC A;  2P4R A;  2ABL A;  2DJQ A;  2RNA A;  2FRY A;  2AZV A;  2EYW A;  1YNZ A;  2CSI A;  5ECA A;  2CSQ A;  5HCK A;  4CC3 A;  3EG1 A;  1EFN A;  2FEI A;  2LJ3 A;  2YSQ A;  1K0X A;  3KFV A;  4OMQ A;  4Z8A A;  1NYG A;  4F17 A;  3M0S A;  2JMC A;  2O9S A;  5IHN A;  3U23 A;  5I11 A;  2LX7 A;  2RQT A;  1GRI A;  2DRM A;  2DL5 A;  3VS3 A;  5IXF A;  1CSK A;  4J9G A;  2DLP A;  2IIM A;  1NLP C;  2YUN A;  2FO0 A;  4JJB A;  2CH4 W;  1I07 A;  2DL3 A;  1WIE A;  1K76 A;  2GTJ A;  2DX1 A;  2V1R A;  1CKA A;  1Y0M A;  4J9C A;  2CUB A;  2CDT A;  4EIK A;  1GL5 A;  2OAW A;  3CQT A;  3O5Z A;  1X43 A;  5FW9 A;  4AFS C;  2I0N A;  2ECZ A;  1SRL A;  5IHI A;  4JJD A;  4LN2 A;  2LCS A;  3VRY A;  1XOV A;  2FRW A;  1PWT A;  2HDA A;  2J7I A;  4JPB W;  1UHF A;  1UDL A;  3VS2 A;  4J9I A;  1UJY A;  2JS2 A;  4J9H A;  4RUG A;  4LUE A;  1UEC A;  1RI9 A;  2KEA A;  1WX6 A;  1QKX A;  1T3S A;  1ZBJ A;  2JXB A;  1NEG A;  2D0N A;  2BZY A;  3SEM A;  1NEB A;  2O2O A;  1M3A A;  4AFU C;  4K11 A;  1M3C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...