1E6GA

A-spectrin sh3 domain a11v, v23l, m25i, v53i, v58l mutant
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
59
structure length
59
Chain Sequence
TGKELVLVLYDYQEKSPRELTIKKGDILTLLNSTNKDWWKVEVNDRQGFIPAAYLKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPECTRIN ALPHA CHAIN
publication title Conformational Strain in the Hydrophobic Core and its Implications for Protein Folding and Design
pubmed doi rcsb
source organism Gallus gallus
molecule tags Sh3-domain
total genus 10
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2000-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1e6gA00
4LUDA 2CSIA 2YUPA 1RUWA 3M0PA 2ECZA 1HD3A 5I11A 3M0TA 2DL8A 3U23A 2BZXA 2JS2A 4AFSC 4GBQA 1GBQA 2O88A 2H8HA 2O9SA 2YUNA 4J9HA 4AFQC 2HCKA 2SRCA 2RF0A 1M3BA 1K0XA 2W0ZA 5IHKA 3VS4A 1M27C 2DRMA 4A63B 2CREA 1UTIA 5EC7A 2KT8A 1YNZA 4OMLA 3EHRA 2CH4A 1UFFA 2L3SA 2CDTA 3VS6A 2OI3A 1MV3A 1A0NB 1AZGB 2LQNA 1V1CA 1X6BA 4LNPA 3REAB 2W10A 2X3XD 4LE9A 1W6XA 2KRMA 4RTTA 2EYZA 2F2WA 1FMKA 3NHNA 2L3QA 2I0NA 1WI7A 2KE9A 2O31A 2ENMA 1W1FA 5IXFA 3M0UA 2DL3A 2DL5A 3EG3A 2AKKA 2EYXA 1T0HA 1ABQA 3NPFA 2M0YA 2LX7A 2C0IA 3CQTA 4AG1C 2DBKA 1T3SA 1YCSB 2CT3A 1CSKA 2DE0X 2HSPA 2J7IA 1E6HA 2LZ6B 2YSQA 5GJVB 3A98A 3PVLA 4CC4B 2F2XA 1RLQC 1UE9A 2G6FX 1AWJA 1I0CA 5GJWB 2JMAA 2KYBA 3M0RA 1S1NA 2EGAA 5ECAA 2JXBA 3H0HA 1GCQA 1YN8A 2FO0A 1RLPC 2RMOA 2EPDA 4HCKA 2V1RA 1X27A 2A08A 4M4ZA 5HCKA 1AZEA 1WFWA 3SEMA 2DA9A 4HXJA 3VS5A 2J6OA 3UF4A 4AFZC 1NEGA 1NLPC 2V1QA 2C0OA 5FWBA 1HJDA 1JXMA 2K3BA 2CH4W 3QWXX 2FPEA 3UA7A 1JQQA 2DL7A 4JZ4A 3RNJA 4JJBA 3ZL7C 1UDLA 2GBQA 2RQUA 2D1XA 2O9VA 1WDXA 4J9BA 2EYYA 4OMMA 2RQVA 1KSWA 2CUDA 1OPLA 2KGTA 1GCQC 3H0FA 2K9GA 4J9DA 1BU1A 2DNUA 2FEIA 4DEYA 1SHFA 3RBBB 2K6DA 3TSZA 2DX1A 4GLMA 4CC2A 1LCKA 3M0QA 3H0IA 1VYTA 1SRMA 1UJ0A 3EG1A 4AG2C 2ROTA 4RTZA 2HBWA 1M8MA 1W70A 2FG0A 1PKSA 2AK5A 2F2VA 4HVVA 1WXTA 2KBTA 4IIMA 3O5ZA 1NG2A 1YP5A 1JO8A 1NLOC 3NGPA 2LP5A 1OEBA 3IQLA 4J9IA 1NEBA 2FRYA 2ED1A 3M0SA 1N5ZA 4OMPA 5I22A 2L0AA 1T3LA 2FPFA 1K4US 1MV0B 1T0JA 3TVTA 1KFZA 2LNHB 1B07A 2JS0A 3VS3A 2HDAA 1PKTA 5IHIA 2VVKA 3KFVA 2DL4A 1NYGA 2IIMA 3VS1A 2RPNA 4JPBW 1H8KA 1SEMA 1U06A 3EG0A 1GCPA 2JT4A 2J05A 2VKNA 1BBZA 2AZSA 1CKBA 2J6FA 2XMFA 4X1VA 1U5SA 2CUBA 1AWOA 2EBPA 2HEQA 1VYVA 1G2BA 2JM8A 2PZ1A 2RN8A 2MOXA 5IHNA 3UATA 4RUGA 2EKHA 3VS2A 2ED0A 1UHCA 4ZNXA 3EGUA 1WYXA 2J06A 2JMCA 2PTKA 1TUCA 4F17A 4R0KA 2DYBA 2P4RA 4OMOA 4RTUA 1VYUA 1U3OA 4D8KA 2FRWA 1MUZA 2DILA 1SPKA 2GTOA 5L23A 2KR3A 2L3PA 1X2QA 1J3TA 2EGCA 4QT7A 2AZVA 4E6RA 1YWPA 2SEMA 1IO6A 2RQTA 1GBRA 4LUEA 2AKLA 1UUEA 4WCIA 3ULRB 1M3CA 1JEGA 3FJ5A 4RTXA 3LH5A 1ZX6A 3VRYA 1G83A 1Z9QA 2DBMA 2RNAA 2RQWA 1K9AA 2RQRA 2NWMA 1HSQA 1PHTA 1ZLMA 2GGRA 1JXOA 1WX6A 1SHGA 2EQIA 2ROLA 4Y92A 2GNCA 2LJ0A 4CC3A 2MCNA 2YUOA 1ZUKA 2EVRA 1ZUUA 4DEXA 2EW3A 4KRTA 3R6NA 2DM1A 2A37A 3JV3A 1X69A 1OPKA 1RI9A 1I1JA 1M30A 4K11A 1NM7A 3TSWA 2KNBB 2DLPA 1E6GA 2YT6A 3EHQA 1PWTA 3THKA 1UGVA 2DVJA 4EIKA 2OJ2A 1QKWA 2LJ3A 5IH2A 2B86A 2DMOA 1TUDA 2E5KA 1WXBA 1FYNA 4Z88A 2D0NA 3QWYA 1ABOA 3I5SA 4OMQA 4ORZA 3PVQA 2D8HA 1Y57A 2K79A 1AWXA 2YDLA 2D8JA 3I5RA 1I07A 1WXUA 2BZ8A 1H3HA 3UA6A 4F14A 2LJ1A 1OV3A 2A36A 2VWFA 4J9CA 2LQWA 2K2MA 3SHWA 2J6KA 2ESWA 2ABLA 4J9EA 1JU5C 1ZSGA 1AVZC 1VA7A 2X3WD 1WA7A 1XOVA 1WIEA 4JJCA 3PE0A 1QLYA 2K7AA 4RTWA 1PRMC 4OMNA 1BK2A 2KT1A 5FWCA 2YUQA 2DF6A 2JM9A 4AFUC 2KRSA 1QWEA 2M51A 5IXBA 4IIOA 4CC7A 1QWFA 1UG1A 1KIKA 2O2OA 1PRLC 1E7OA 3H41A 4Z89A 2CSQA 1X2KA 2CT4A 1AEYA 4J9GA 1AD5A 1GFCA 1YWOA 2BTTA 1UECA 1UHFA 1Y0MA 4JJDA 1X43A 1AOJA 4RTVA 4LN2A 2PNIA 1X6GA 2EYWA 2KXCA 4FSSA 4HVUA 2GTJA 2LCSA 2EGEA 1BB9A 4D8DA 2NUZA 1K0SA 3I35A 3VRZA 1GFDA 1B3QA 1H92A 3I9QA 4F16A 2GQIA 3NMZC 1OOTA 4ESRA 1ZBJA 1QCFA 1ARKA 4HVWA 1SRLA 3C0CA 2JTEA 1K76A 1SSHA 2LMJA 3GBQA 2KYMA 4JZ3A 1Z9ZA 3REBB 1GL5A 1AWWA 2KEAA 1KJWA 1QKXA 2DJQA 4Z8AA 1CKAA 2FPDA 4J9FA 3VS0A 1NYFA 1EFNA 2DRKA 2KROA 3VS7A 5FW9A 2L2PA 2KRNA 1M3AA 2OAWA 1PNJA 2KXDA 2BZYA 2QDLA 1ZUYA 4RTYA 1UJYA 2C0TA 2A28A 2MIOA 1WLPB 1K1ZA 3EG2A 2JW4A 1GRIA 1TG0A
chains in the Genus database with same CATH superfamily
1VQ8T 1QW1A 2EJFA 5CKBA 3PFSA 3M0PA 3JCMV 2ECZA 2RHZA 1EIFA 4DQ2A 1KC8R 1YITQ 4XTUA 2XHCA 1YITA 1YJ9Q 2ZAEA 2QQBA 1YJ9A 3CMAA 2RF0A 2X51A 1WHJA 1K0XA 1M27C 1UTIA 4J7FA 3EHRA 2CP6A 2CH4A 1K73R 2XDPA 4BE2A 2LQNA 5KYYA 4KBMB 1OZ3A 1WHGA 3A8LB 3D7SB 4LNPA 4M75A 1M1KR 3ME9A 2X3XD 2X35A 5GAMf 2F2WA 5FROA 2WACA 3CEYA 3RMQA 1K9MU 2VV5A 2KE9A 1SKUB 2QQSA 2LQKA 2AKKA 1T0HA 2X4JA 1ABQA 3UPUA 2AHJB 3CQTA 4A4KA 3CBPA 3KXTA 1YCSB 2XIDA 3CXCS 3CCQQ 2XICA 2CT3A 2RJFA 2HSPA 3CCQA 2J7IA 1E6HA 5GJVB 3CC4Q 2D6FA 3JB9F 4B9XA 3CC4A 2G6FX 1AWJA 4Z02A 2EQMA 2KYBA 5GANd 2EGAA 5ECAA 4IUPA 1TUGB 3MP8A 1PSFA 4C0ZA 4RG2A 1YN8A 5KYNA 1RLPC 2RMOA 4XAXB 1YITT 2LNVA 4HCKA 3HRUA 5GAMh 2NUTB 1YJ9T 5FU7C 1WFWA 4KH1B 3UF4A 1KD1C 1NLPC 1GXIE 2RI5A 1M2VA 2K3BA 2CH4W 4M7DG 2DL7A 4FYYB 1Q86U 1UDLA 4II1A 2CP5A 1G3YA 1WDXA 4BACA 1OPLA 1TU0B 1RAHB 3CCUA 1ZQ1A 3H0FA 1VQPQ 2K9GA 1MNEA 2DNUA 1VQPA 4FW1A 4BI3A 1C0MA 3OBYA 3CPWA 3GNFB 1SHFA 4L6V5 2K6DA 4Y91A 4GLMA 4CC2A 1LCKA 1SRMA 1UJ0A 3EG1A 4XTWA 4RTZA 1TH7A 1M8MA 3EG9B 4HVVA 2YWWA 1D1CA 4IIMA 3O5ZA 2EQJA 4C8QC 2RO0A 3CCQT 2DEUA 4XTYA 2D9TA 3JB9G 4C0FA 3M0SA 1N5ZA 3PNWC 4KGZB 5CKFA 3CC4T 5GAOr 3JAME 1T3LA 2DTHA 5GANe 3TVTA 1AHJB 4ZGJB 9ATCB 2DD4A 2DPPB 3CCJQ 2DL4A 3VUZA 1H8KA 1SEMA 3GNGA 4L5GA 1SG5A 3CCJA 3SFMA 2J6FA 4X1VA 2JOYA 2EBPA 2ZPEB 1BI1A 2HEQA 5GMKm 3HFOA 4XQ3A 1QCNA 2JM8A 2RN8A 3PTAA 1VQNQ 5GAN5 5DY9A 3RKWA 2VXFA 3M9QA 1X01A 3G71A 4HKEA 4CRIA 3AT1B 2JMCA 2KAFA 3E9GA 3M4GA 5J26A 4RTUA 5KYWB 1U3OA 2R58A 2BIVA 3J81E 1VQPT 3A8GB 3CD6Q 2GTOA 3EFSA 1VQ9Q 3OB9A 1X2QA 3OYHA 4XTVA 3CD6A 2SEMA 2AKLA 2LT4A 2M16A 1ZSZB 2YRVA 3OS5A 2COYA 3QJ6A 3FJ5A 2CP2A 3VRYA 1G83A 4J83A 4C92B 3CC2Q 2E3HA 3OW2S 1WHLA 1PCXA 1ZLMA 1JXOA 1SHGA 2GNCA 2VUBA 2MCNA 5GAOl 1ZUKA 3HRSA 1G8XA 4PJOB 2EVRA 3FIFA 4D6WA 3FC3A 3MEUA 4PJJA 3JCMQ 3RMSA 1R77A 3EAEA 3JCMf 3DKMA 5GAOq 3M53A 3JV3A 1VOMA 1KQ2A 4C92F 2KNBB 2A7YA 3JCMg 2HQHA 2YT6A 1KD1R 1PWTA 4EIKA 2KDSA 1QKWA 4WF2A 5IH2A 1TUDA 4PJOF 1WXBA 2D0NA 5C6SA 4JDSA 2MPXC 1NZ9A 2PVGB 3PVQA 2K79A 1AWXA 5I21A 1I07A 1NJIC 2K5FA 5A0GA 4J9CA 1NE8A 4JJNK 2J6KA 1VQNT 2LX9A 2HAXA 3WVDB 3EGDA 2DTOA 2X3WD 3MP6A 4M7AD 1XOVA 1QQJA 4JJCA 3M58A 4ELYC 1QLYA 1YJWQ 4BUGA 3QXEB 4GLKA 2JUFA 1YJWA 5GAN2 4C92D 1D0XA 2BKDN 4EMKC 3JCMc 2RK2A 1M4ZA 3CD6T 2JM9A 1VQ9T 2P0PA 4N0AA 2WSFE 4CC7A 4PJOD 2O2OA 1PRLC 1KIKA 1JJ2S 1BIBA 1V76A 3OA6A 4Z89A 2FHDA 2ZPGB 1X2KA 1AEYA 3PMIA 4J9GA 2BTTA 4KH0B 2RI2A 2RA2A 5GANj 4DBRA 3CMEQ 5D6WA 3CC2T 2PNIA 2HBPA 3L2ZA 2GTJA 4JRKA 3MJXA 1BB9A 1MNDA 2HZYA 3CCSQ 2NUZA 3JCMW 3VRZA 4C92G 3CCSA 1N8RR 2E6NA 1R0BG 4DBQA 3I9QA 4PJOG 5GAN8 3UT1A 5A0DA 4JS4A 3META 3OYYA 1SRLA 4BI8B 3MO8A 2JTEA 4BB7A 1Z9ZA 2QTVA 3BDUA 2E4HA 1KJWA 1N27A 4JUVA 3R6OA 1CKAA 3BY7A 3SDZA 3CBMA 3VS0A 5FU6C 4HA8A 2A0FB 5FW9A 2KRNA 2X9HA 4PKCC 4A4EA 3OW2P 1YJWT 2MIOA 4RCCA 3OSSC 2GFAA 3OS1A 5J39A 4DBFA 4XK8E 2JW4A 1TTHB 2L5QA 1YJNQ 4P5NA 4LUDA 3VYHB 4LD6A 5HK0A 1YJNA 3L2WA 3CPFA 4F04B 2YUPA 3TCJA 5KCOA 1VIFA 1HD3A 4PLIA 5I11A 3M0TA 4LDUA 1YI2Q 1K8AC 2RJDA 1V29B 3CMET 2B8AA 4GBQA 3CBOA 1GBQA 3LGLA 3X25B 3EFOB 5IHKA 3VS4A 2CREA 2V26A 5EC7A 1YNZA 5LJ5f 2IG0A 2LCLA 2L3SA 1Q82C 4O6JA 5FU7B 4MDXA 3VS6A 2OI3A 2X4WA 1AZGB 1NJIR 1RAAB 2I2LA 1XTDA 4MMKA 4LE9A 2LC4A 4F7UB 3A1PA 2L89A 2VGMA 2NUPA 3V7CA 5GAOm 1PG5B 2L3QA 2LT1A 1BIAA 4M77C 3V8LA 2O31A 3EG9A 5KH6A 3CCMQ 2ENMA 1W1FA 2YLBA 3CCMA 2DL5A 3WVEB 4NL2A 1WNLA 3HRTA 1H3ZA 1M2OA 2M0YA 2C0IA 4AG1C 1T3SA 3RDVA 4F7UF 2DE0X 2PUOB 2YSQA 3A98A 7AT1B 4CC4B 1HYOA 1RLQC 3DLLA 1UE9A 5LJ5h 2QDYB 3QJYA 1YJNT 5LJ3h 4OGEA 4IUVA 4C8QB 2QTXA 2P0KA 1OU8A 4MZPA 2Z0WA 2E41A 2CP0A 1SF9A 1IB8A 4QQ6A 3NTHA 3X28B 4HT9A 1YI2T 4PJLA 2EPDA 3M59A 5HCKA 3SEMA 1FWZA 4C8QF 4HXJA 4BDYA 1HJDA 1EX4A 2DZ9A 2LQ8A 2O9VA 2EYYA 2RQVA 3CCEQ 2CUDA 2KGTA 4M7AE 2JZ2A 3CCEA 1BU1A 2OTJT 5GAMd 1WGSA 3RBBB 4M7DB 4M7AA 3M0QA 4NOYA 5FRNA 4AG2C 4B6MA 3CCMT 1YCYA 2HBWA 4PJOE 3ASKA 2F2VA 2AK5A 4C92A 3HFNA 5GAOp 3EH1A 1VQ6Q 2LCCA 4F7UG 1RABB 4C0DC 4DOWA 1VQ6A 4M75E 2LP5A 1OEBA 3IQLA 3QDFA 4J9IA 2VXEA 3P8HA 4PJOA 5CQXA 4M7DF 2ED1A 2YRDA 4J6YA 1M90U 5I22A 2QXFA 3HSBA 2RK1A 1T0JA 1MMNA 4HCZA 4LD9K 1KQSS 1D0ZA 1I8FA 2GQVA 1D3BA 4TVRA 1YIJQ 3OYAA 1U5SA 5DLOA 4M78C 1AWOA 4C8QG 1Q82R 1VYVA 2PZ1A 3UWNA 2DIQA 2FZCB 1Q81U 2MF2A 1QVGS 1Q7YC 4ATOA 2FVUA 4M7DD 3ZFJA 4QKUA 3EGUA 3L2VA 2EIFA 1FMVA 1PM3A 4B9WA 2EWNA 1TUCA 4E7IA 4FCYA 2PVDB 1W2BA 2P4RA 3BDLA 1VYUA 4FYXB 2KMTA 4PJMA 3CCET 1ACMB 1MUZA 1SPKA 3C12A 1QVFA 2KR3A 3OYFA 4Q5WA 1J3TA 2EGCA 3CC7Q 4A4FA 2RQTA 1N6AA 1GBRA 3CC7A 1IZ6A 3JSCA 4BD3A 3ULRB 1Y07A 1JEGA 4RTXA 4EMKB 3LH5A 1ZX6A 1Z9QA 2KK4A 1VQ6T 1HSQA 3JB9D 3OSVA 2EQIA 2ROLA 4Y92A 2R5AA 4CC3A 2FYKA 3OYEA 1N8RU 1ZUUA 2EW3A 5AYFA 2X4XA 2DM1A 2WSCE 1OPKA 1K9MC 2OTLQ 4LDYA 3TSWA 3UDCA 1E6GA 2AT1B 2OTLA 1UGVA 4E7HA 1IHVA 3H8ZA 1YIJT 2JVVA 5D7UA 2PQWA 2LJ3A 3J80E 1XJWB 2EQKA 2B86A 2DMOA 2M1HA 1FYNA 4Z88A 3RR6A 5GANf 2E6ZA 3I5SA 4NL3A 4ORZA 1IRXA 3TREA 3S6WA 2VC8A 3LWIA 4BE1A 2BZ8A 4QQGA 3PIOA 4F14A 1OV3A 1JRIA 2VWFA 2FZKB 2DTIA 5GANg 3SHWA 6AT1B 1N9RA 2JTMA 2ABLA 1JU5C 2E65A 3GLXA 3FEOA 4PK4A 2O4XB 5CKDA 2R57A 1WA7A 1WJSA 3GPLA 4RTWA 1D1BA 3M5AA 5GAN7 3M57A 4IUUA 3L2RA 3C4SA 2HNIA 2FL7A 3QHSA 5HKCA 5FWCA 2YUQA 4KGVB 3QZ9B 4AFUC 4V2SA 4XU0A 2M51A 5IXBA 1Q95G 3CC7T 4IIOA 2WSEE 1UG1A 1YFNA 2F1LA 4JRPA 4CI0C 3L2QA 1VQOT 3H41A 1G3WA 2X4YA 1KQSP 4J8OA 2CT4A 4PFPA 2CKKA 2K57A 1GFCA 3Q1JA 1UB4A 2E1HA 1VQNA 4RTVA 4LN2A 4HCCA 1X6GA 1VQ7Q 3LX7A 1NPPA 1Q86C 2MYSA 1VQ7A 3EFOA 5KE3A 2ZPIB 2QQAA 2RHIA 2R5MA 2QAZA 4X34A 4R55A 3PIPA 1QVGP 4N0AC 3OMGA 2QA4T 1B3QA 2OTLT 1VQ9A 2KI7A 4FYWB 1H92A 2LDMA 1OOTA 4FW2A 5GAN3 1Q7YR 3MKDA 4RCBA 5AT1B 1M8VA 3GBQA 1RI0A 4JZ3A 3REBB 2DJQA 4QQDA 3TU4K 3CC2A 2EJ9A 5GMKh 2Y4YA 2P0QA 2KROA 5GAMj 3MEWA 2DKGA 4E7KA 3URGA 5DLQE 1O9SA 2AIRB 2COWA 2BZYA 3SWNA 2C0TA 3H9NA 5I2SA 2A28A 4M77B 1WLPB 1K1ZA 2RB6A 1KHCA 3J7AF 4E7JA 3VJPA 4ZN1A 1RAEB 1IREB 2EKOA 1TS9A 3M55A 4J7IA 2CZ7B 2L8DA 5KYYB 1OU9A 1B34B 1M5Q1 2DL8A 4M77F 3OYKA 4ZN3A 1BYMA 2JS2A 5GAN6 1TSFA 4AFSC 4JLIA 1WQ7A 3CCVQ 2DEQA 2O9SA 4J9HA 2HCKA 1VQ7T 3ZBDA 2SRCA 1K9MR 3CCVA 3C94A 5CQYA 4A63B 2JNGA 4OMLA 3CCLQ 4JLGA 1UFFA 2PVOB 2CDTA 3CCLA 3JCMh 4M7DE 1A0NB 1KC8U 2F5KA 2M02A 3BW1A 1X6BA 4IUTA 3X26B 2W10A 3CXCA 2KRMA 4M7DA 4M77D 2EYZA 2BE9B 3DLMA 2BE7D 2I0NA 3CMEA 3M0UA 3FB9A 3JCMb 3EG3A 2EYXA 1K73U 3NPFA 4A4GA 2LX7A 3P8DA 2DBKA 1MMDA 2QASA 1VQMQ 2EJGA 2XKOC 4FU6A 2LZ6B 1M1KU 4R56A 3PVLA 1VQMA 2DZCA 3LWHA 4HCBA 1NPRA 1FX7A 5KYXB 2H3EB 1I0CA 4EPCA 2JMAA 3M0RA 1S1NA 2JXBA 1EZZB 5HK3A 2ZPFB 4N4GA 2HL5C 4M77G 1Q86R 4C5IA 1GCQA 4L59A 2FO0A 3OMCA 1PD0A 4E7SA 1W4SA 1X27A 2A08A 3OBWA 2XD0A 1AZEA 1D0YA 1HXDA 3CCVT 3TEEA 4N4IA 3VS5A 2J6OA 2FZGB 4AFZC 1C6VX 2V1QA 1Y96B 1JXMA 5LJ5d 4IUQA 5LJ3d 4M78B 3UA7A 3CCLT 1JQQA 3JCMX 1I5OB 1VUBA 1TWBA 3RNJA 4JJBA 3ZL7C 2GBQA 2RHXA 4OMMA 1KSWA 2HL3A 5CCAA 4J9DA 4FIBA 3INZA 2V8JA 2K5IA 2FEIA 3A5ZB 1UGQB 2KSSA 5KCHA 2DXBA 2E12A 4DEYA 5IAYA 3G7ZA 1YI2A 2NUTA 2XDBA 4M78F 5KYUB 2XU8A 4JS5A 3QIIA 2RHUA 1W70A 2FG0A 1PKSA 1O75A 1LJOA 3HP9A 1QP3A 4LDXA 5HY6A 1WXTA 2KBTA 4FT2A 1ZA1B 4QVZA 1NG2A 1NLOC 3CPWS 3PGGA 1NEBA 1VQMT 4ME7A 2O01E 4X9CA 3MPUB 1K4US 1KFZA 1I81A 2LNHB 2OTJQ 4IURA 2HDAA 1PKTA 5IHIA 4PNOA 4M7AC 4Y28E 1BI3A 2OTJA 1NYGA 3M4YA 3VS1A 1VQLT 3EG0A 1GCPA 4M78D 2J05A 2AZSA 1KK7A 5IT9E 4O5VA 1JB0E 1LVKA 1M1GA 4E7LA 4C5GA 1G2BA 1S72Q 2K3YA 4RG8A 2CS7A 1X6OA 2MOXA 2P4TA 5IHNA 3UATA 4RUGA 5LJ5e 1S72A 2MWOA 4C0GA 5LJ3e 1D1AA 5CK9A 2ED0A 2M0OA 5DM7R 3QBYA 5M9OA 1M1FA 3MEVA 4ZNXA 4PJNA 4M75C 4FSXA 1KQ1A 1ZBXA 2ZGWA 2PUKB 3H6ZA 1Y7XA 4F17A 4R0KA 3PMTA 2DYBA 2KY9A 4OMOA 2DD5A 1NBEB 4OB1B 4D8KA 3OW2A 3A8OB 4M78G 1RL2A 4QT7A 2AZVA 4E6RA 3FRNA 1YWPA 1N9SA 4LUEA 2XK0A 1BCMA 3LH0A 3AHUA 4RKUE 3RKXA 4GY5A 3GIBA 1MMGA 2DBMA 2XI9A 4BE0A 1D09B 2H3JA 2RNAA 2RQWA 4FYVB 2F69A 2KVQG 3QSUA 2RQRA 3E1SA 2JN0A 2GGRA 2LJ0A 3MP1A 2D0QB 2YUOA 4X9DA 5KYWA 4LXCA 3BE3A 2DETA 3V7RA 3OQ5A 1RAFB 4LDVA 4OMFB 2FB7A 1DJ7B 2A37A 4IKFA 1X69A 1M30A 3HL8A 3OYLA 2VGNA 3RUXA 4XU1A 3ZEHA 4C92E 2V8IA 2MK5A 1ZSZA 1I5LA 1OX8A 2DLPA 3P8BB 2DVJA 3GOXA 2E5KA 3QUIA 4C8QD 3EFRA 3QWYA 3QG1A 1WJRA 4OMQA 2D8JA 3JCMJ 3I5RA 1WXUA 1H3HA 1OX9A 5I2MA 3UA6A 2LJ1A 1S72T 2QGFB 2LQWA 3L42A 4M77E 4UC4A 2ESWA 3QZ5B 3CMAQ 1AVZC 1F1BB 1K8AR 1JJ2A 1ZA2B 1WIEA 1KHIA 3PE0A 3QPHA 3SB2A 5FRMA 2E3IA 3V8KA 2K7AA 4OGCA 4M77A 4BI4A 1KD1U 1PRMC 4OMNA 3CPWP 1BK2A 2PU9B 3GF5A 5D6XA 1MHNA 1Y71A 2KT1A 4VUBA 3HHTB 2DF6A 3OYIA 2CZ6B 1QWEA 1YIJA 4OB2B 3C95A 3HTRA 1B34A 3OYNA 1E7OA 4FM4B 4OB0B 2CSQA 4BDZA 4A4HA 4BY6C 3TQ7P 4OVAA 3HPWA 4PLLA 3CCRQ 1Y0MA 1IHWA 5CKEA 3I55Q 3LGFA 3CCRA 5FLXE 2EYWA 2KXCA 5GAMg 3I55A 4E2FB 2HKQB 4C5EA 3I56Q 3QYHB 2CZ1B 4HVUA 2LCSA 2HKNA 3I56A 1XQHA 2CP7A 4D8DA 4YTLA 1XNIA 1BI0A 5GAMe 4XTZA 4DOVA 1WHMA 2DK3A 2QQRA 5LJ5j 3NMZC 1VQOQ 5LJ3j 1RAGB 3G1JA 1ARKA 1VQOA 4J6XA 1SSHA 2JJ9A 2KYMA 1GL5A 4J5YA 1AWWA 1QKXA 3NTIA 4Z8AA 2DYIA 5CAIA 2FPDA 1G3TA 1NYFA 4QW2A 1WPYA 1M90C 3OY9A 2L2PA 3CMAT 3E19A 3OS0A 1IXDA 1U1SA 1M3AA 1PNJA 4KT0E 2Y4XA 1R0CB 2ATCB 2QDLA 1ZUYA 4E7ZA 1VQ4Q 2QA4Q 2ZCFB 3JB9J 1HK9A 3VKIA 3HKSA 1VQ4A 4ANJA 2QA4A 2IVWA 3VYGA 3NFCA 5IN1A 2QK0A 1EFNA 5GAOn 3V7SA 5KYXA 1TG0A 2F5TX 2RJEA 1RACB 4MZMA 2EQUA 2CSIA 2YHTA 3CCUQ 2XDDA 4DBHA 1RUWA 2EFIA 1RAIB 4N4HA 4MMLA 3U23A 1Q81C 2QEXQ 3FDRA 2EYQA 2BZXA 3CCRT 2QEXA 4M78E 2NUPB 2O88A 3I55T 2H8HA 2YUNA 4KUIA 5CVIA 3SWNC 4AFQC 1M3BA 3DB3A 4KULA 2DAQA 4MZTA 1Y96A 3I56T 4XTXA 2JTFA 3JCMP 2W0ZA 2DRMA 4M78A 2KT8A 5FU6B 2HD0A 2LRQA 3EGXB 3OYJA 1OI1A 2OAUA 1MV3A 3VV0A 5GMKi 1QVPA 1U1TA 1UGSB 1V1CA 4FL6A 3X20B 2G3RA 3REAB 3L2UA 2LTOA 3MEAA 2E5QA 1W6XA 5KYUA 2QG9B 4RTTA 2HSEB 1FMKA 3NHNA 1G3SA 5GANh 2K4YA 1WI7A 1YBYA 4AMCA 5IXFA 3N5BB 1B7TA 2DL3A 3QYGB 1N8RC 4PFOA 3LYIA 3QO3A 3JCMd 1OYXA 1NJIU 1CSKA 2LVMA 4F7UE 1VQ4T 3G71Q 1H641 3KBGA 3OYBA 2F2XA 4M7DC 5GJWB 8AT1B 2NYSA 4F7UA 3JB9H 3CCUT 3CXCP 5GMKe 2YXYA 3H0HA 3A8HB 1BI2A 2QEXT 2V1RA 4M4ZA 4M7AB 4FT4A 2DJZA 1LNXA 2DA9A 2OX7A 4C8QE 1NEGA 3F70A 3WXMB 2C0OA 5FWBA 2RM4A 1FMWA 2E10A 2E64A 3QWXX 2FPEA 1BKBA 4JZ4A 4C8QA 4ZTJA 2RQUA 4OF1A 2D1XA 4J9BA 4M7AF 1X75C 1GCQC 3M54A 5A2QE 2KQWA 1LOJA 1M90R 3RERA 4M75B 4PL6A 3CCJT 3TSZA 2DX1A 3G4SQ 3H0IA 1D3BB 1VYTA 4KGXB 4AT1B 3M56A 2DIGA 2ROTA 3G4SA 1I4K1 4JRQA 3JCMe 2P84A 5EG2A 1KQSA 1YP5A 1JO8A 3A8MB 1TXQA 4M75F 3NGPA 4A54A 2QQ9A 3T9NA 2FRYA 3VUBA 4ELZC 3G71T 1QCOA 4OMPA 1JBMA 2QYZA 2RJCA 2HQEA 2IPOB 1Q81R 2L0AA 2FPFA 1MV0B 1WJQA 1PC0A 5CKHA 2VASA 1YHQQ 1VQKQ 1B07A 2JS0A 3VS3A 4HT8A 2VVKA 1YHQA 1VQKA 3KFVA 1QVGA 2IIMA 2RPNA 4JPBW 3G6EQ 1U06A 3X24B 2JT4A 2VKNA 4OP0A 3G6EA 1BBZA 3RKYA 2CZ0B 2HQXA 1CKBA 2XMFA 3E9FA 1RADB 4XU2A 2CUBA 3LLRA 5GAN4 5CR2A 3OYMA 2MAMA 4M75D 2YRCA 2CYZB 2Y90A 4MDWA 1K8AU 2XG8D 2EKHA 2K2VA 3VS2A 3S3OA 1UHCA 3MCAB 1M2VB 3OYCA 2HMAA 1U8RA 1FXXA 1WYXA 2J06A 4M7AG 2PTKA 4ZTFA 1AT1B 4C0DB 1VIEA 4KUDK 1VQLQ 2FRWA 2DILA 1UGRB 5L23A 3VU3C 1VQLA 2L3PA 1Q82U 8ATCB 4ZGEB 1IO6A 4C5HA 4QVDA 3G4ST 1UUEA 4WCIA 1OZ2A 1M3CA 1UEBA 2COZA 4EDUA 4XU3A 1W2BS 1WHHA 2K3XA 4M75G 3KUFA 1QP2A 1K9AA 1UGPB 2MI6A 2DXUA 1QVFS 1OQKA 5GMKj 2NWMA 2VYTA 3OYGA 1PHTA 2QGGA 1WX6A 3QKJA 1KC8C 3O8VA 4BY6B 4WTOB 2GFUA 1WQWA 4DEXA 4KRTA 3R6NA 3E2UA 1MGQA 4PFZA 1IGUA 1YHQT 1VQKT 1RI9A 1I1JA 4K11A 1NM7A 2RD1A 3EHQA 3G6ET 3THKA 5D6YA 5LL6S 1P92A 1TOVA 3GP8A 2OJ2A 1PSEA 1R8OB 4EMKA 1BCOA 1ABOA 1K73C 2V8KA 2D8HA 1Y57A 2YDLA 2A36A 2A3LA 1VQ5Q 4OB3B 2K2MA 2RHYA 1ZHIA 3OS2A 1VQ5A 1M1KC 4J9EA 1ZSGA 1VA7A 2BUDA 1LPLA 4ZGDB 2CGHA 5L8RE 1KG1A 2RH2A 4RMOA 2DFUA 1ZSZC 1WZOA 2ZPBB 3CCST 3S3NA 1M9SA 2RI3A 3NTKA 2EAYA 5LJ3f 1QMCA 2DXCA 1VQ8Q 2L3RA 2KRSA 4C92C 5C0MA 1G5VA 1VQ8A 1QWFA 5LJ5g 5A0LA 5LJ3g 3RESA 2DXTA 2E70A 4E47A 3FJPA 1PD1A 4PJOC 1AD5A 3LW5E 1OULA 1YWOA 1UECA 3JRZA 1UHFA 3ER0A 4JJDA 1X43A 4EMGA 2O4XA 1AOJA 5CO7A 4NS5A 4QVCA 1JJ2P 4FSSA 2M9UA 3RIRA 2EGEA 2DO3A 3EGXA 1MMAA 1K0SA 3I35A 1WHKA 2ZPHB 1GFDA 2MMPA 3DB4A 3SWNB 1C1AA 3OYDA 2NLUA 3BFMA 3PT9A 4F16A 2GQIA 2DVEA 4ESRA 3V8JA 1SSFA 1ZBJA 1QCFA 4HVWA 2QI2A 3C0CA 1K76A 2LMJA 2C06A 2CP3A 3S3MA 2KEAA 5CIUA 2MWPA 4J6WA 4J9FA 1VQ5T 5J3BA 3QDRB 2DRKA 2YLCA 2VB6A 3FLGA 3VS7A 4LDWA 4A53A 2DERA 1W2BP 4DA4A 3EH2A 3EGDB 4JRIA 3MHXA 2OAWA 3JB9I 2KXDA 2GF7A 4RTYA 2GCXA 1UJYA 5GMKl 1QVFP 4EMHA 1IGQA 3EG2A 1Q7YU 2ZZDA 5KE2A 2K5LA 3L1AA 1GRIA 3SD4A
chains in the Genus database with same CATH topology
4LUDA 2CSIA 2YUPA 1RUWA 3M0PA 2ECZA 1HD3A 5I11A 3M0TA 2DL8A 3U23A 2BZXA 2JS2A 4AFSC 4GBQA 1GBQA 2O88A 2H8HA 2O9SA 2YUNA 4J9HA 4AFQC 2HCKA 2SRCA 2RF0A 1M3BA 1K0XA 2W0ZA 5IHKA 3VS4A 1M27C 2DRMA 4A63B 2CREA 1UTIA 5EC7A 2KT8A 1YNZA 4OMLA 3EHRA 2CH4A 1UFFA 2L3SA 2CDTA 3VS6A 2OI3A 1MV3A 1A0NB 1AZGB 2LQNA 1V1CA 1X6BA 4LNPA 3REAB 2W10A 2X3XD 4LE9A 1W6XA 2KRMA 4RTTA 2EYZA 2F2WA 1FMKA 3NHNA 2L3QA 2I0NA 1WI7A 2KE9A 2O31A 2ENMA 1W1FA 5IXFA 3M0UA 2DL3A 2DL5A 3EG3A 2AKKA 2EYXA 1T0HA 1ABQA 3NPFA 2M0YA 2LX7A 2C0IA 3CQTA 4AG1C 2DBKA 1T3SA 1YCSB 2CT3A 1CSKA 2DE0X 2HSPA 2J7IA 1E6HA 2LZ6B 2YSQA 5GJVB 3A98A 3PVLA 4CC4B 2F2XA 1RLQC 1UE9A 2G6FX 1AWJA 1I0CA 5GJWB 2JMAA 2KYBA 3M0RA 1S1NA 2EGAA 5ECAA 2JXBA 3H0HA 1GCQA 1YN8A 2FO0A 1RLPC 2RMOA 2EPDA 4HCKA 2V1RA 1X27A 2A08A 4M4ZA 5HCKA 1AZEA 1WFWA 3SEMA 2DA9A 4HXJA 3VS5A 2J6OA 3UF4A 4AFZC 1NEGA 1NLPC 2V1QA 2C0OA 5FWBA 1HJDA 1JXMA 2K3BA 2CH4W 3QWXX 2FPEA 3UA7A 1JQQA 2DL7A 4JZ4A 3RNJA 4JJBA 3ZL7C 1UDLA 2GBQA 2RQUA 2D1XA 2O9VA 1WDXA 4J9BA 2EYYA 4OMMA 2RQVA 1KSWA 2CUDA 1OPLA 2KGTA 1GCQC 3H0FA 2K9GA 4J9DA 1BU1A 2DNUA 2FEIA 4DEYA 1SHFA 3RBBB 2K6DA 3TSZA 2DX1A 4GLMA 4CC2A 1LCKA 3M0QA 3H0IA 1VYTA 1SRMA 1UJ0A 3EG1A 4AG2C 2ROTA 4RTZA 2HBWA 1M8MA 1W70A 2FG0A 1PKSA 2AK5A 2F2VA 4HVVA 1WXTA 2KBTA 4IIMA 3O5ZA 1NG2A 1YP5A 1JO8A 1NLOC 3NGPA 2LP5A 1OEBA 3IQLA 4J9IA 1NEBA 2FRYA 2ED1A 3M0SA 1N5ZA 4OMPA 5I22A 2L0AA 1T3LA 2FPFA 1K4US 1MV0B 1T0JA 3TVTA 1KFZA 2LNHB 1B07A 2JS0A 3VS3A 2HDAA 1PKTA 5IHIA 2VVKA 3KFVA 2DL4A 1NYGA 2IIMA 3VS1A 2RPNA 4JPBW 1H8KA 1SEMA 1U06A 3EG0A 1GCPA 2JT4A 2J05A 2VKNA 1BBZA 2AZSA 1CKBA 2J6FA 2XMFA 4X1VA 1U5SA 2CUBA 1AWOA 2EBPA 2HEQA 1VYVA 1G2BA 2JM8A 2PZ1A 2RN8A 2MOXA 5IHNA 3UATA 4RUGA 2EKHA 3VS2A 2ED0A 1UHCA 4ZNXA 3EGUA 1WYXA 2J06A 2JMCA 2PTKA 1TUCA 4F17A 4R0KA 2DYBA 2P4RA 4OMOA 4RTUA 1VYUA 1U3OA 4D8KA 2FRWA 1MUZA 2DILA 1SPKA 2GTOA 5L23A 2KR3A 2L3PA 1X2QA 1J3TA 2EGCA 4QT7A 2AZVA 4E6RA 1YWPA 2SEMA 1IO6A 2RQTA 1GBRA 4LUEA 2AKLA 1UUEA 4WCIA 3ULRB 1M3CA 1JEGA 3FJ5A 4RTXA 3LH5A 1ZX6A 3VRYA 1G83A 1Z9QA 2DBMA 2RNAA 2RQWA 1K9AA 2RQRA 2NWMA 1HSQA 1PHTA 1ZLMA 2GGRA 1JXOA 1WX6A 1SHGA 2EQIA 2ROLA 4Y92A 2GNCA 2LJ0A 4CC3A 2MCNA 2YUOA 1ZUKA 2EVRA 1ZUUA 4DEXA 2EW3A 4KRTA 3R6NA 2DM1A 2A37A 3JV3A 1X69A 1OPKA 1RI9A 1I1JA 1M30A 4K11A 1NM7A 3TSWA 2KNBB 2DLPA 1E6GA 2YT6A 3EHQA 1PWTA 3THKA 1UGVA 2DVJA 4EIKA 2OJ2A 1QKWA 2LJ3A 5IH2A 2B86A 2DMOA 1TUDA 2E5KA 1WXBA 1FYNA 4Z88A 2D0NA 3QWYA 1ABOA 3I5SA 4OMQA 4ORZA 3PVQA 2D8HA 1Y57A 2K79A 1AWXA 2YDLA 2D8JA 3I5RA 1I07A 1WXUA 2BZ8A 1H3HA 3UA6A 4F14A 2LJ1A 1OV3A 2A36A 2VWFA 4J9CA 2LQWA 2K2MA 3SHWA 2J6KA 2ESWA 2ABLA 4J9EA 1JU5C 1ZSGA 1AVZC 1VA7A 2X3WD 1WA7A 1XOVA 1WIEA 4JJCA 3PE0A 1QLYA 2K7AA 4RTWA 1PRMC 4OMNA 1BK2A 2KT1A 5FWCA 2YUQA 2DF6A 2JM9A 4AFUC 2KRSA 1QWEA 2M51A 5IXBA 4IIOA 4CC7A 1QWFA 1UG1A 1KIKA 2O2OA 1PRLC 1E7OA 3H41A 4Z89A 2CSQA 1X2KA 2CT4A 1AEYA 4J9GA 1AD5A 1GFCA 1YWOA 2BTTA 1UECA 1UHFA 1Y0MA 4JJDA 1X43A 1AOJA 4RTVA 4LN2A 2PNIA 1X6GA 2EYWA 2KXCA 4FSSA 4HVUA 2GTJA 2LCSA 2EGEA 1BB9A 4D8DA 2NUZA 1K0SA 3I35A 3VRZA 1GFDA 1B3QA 1H92A 3I9QA 4F16A 2GQIA 3NMZC 1OOTA 4ESRA 1ZBJA 1QCFA 1ARKA 4HVWA 1SRLA 3C0CA 2JTEA 1K76A 1SSHA 2LMJA 3GBQA 2KYMA 4JZ3A 1Z9ZA 3REBB 1GL5A 1AWWA 2KEAA 1KJWA 1QKXA 2DJQA 4Z8AA 1CKAA 2FPDA 4J9FA 3VS0A 1NYFA 1EFNA 2DRKA 2KROA 3VS7A 5FW9A 2L2PA 2KRNA 1M3AA 2OAWA 1PNJA 2KXDA 2BZYA 2QDLA 1ZUYA 4RTYA 1UJYA 2C0TA 2A28A 2MIOA 1WLPB 1K1ZA 3EG2A 2JW4A 1GRIA 1TG0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LUD A;  2CSI A;  2YUP A;  1RUW A;  3M0P A;  2ECZ A;  1HD3 A;  5I11 A;  3M0T A;  2DL8 A;  3U23 A;  2BZX A;  2JS2 A;  4AFS C;  4GBQ A;  1GBQ A;  2O88 A;  2H8H A;  2O9S A;  2YUN A;  4J9H A;  4AFQ C;  2HCK A;  2SRC A;  2RF0 A;  1M3B A;  1K0X A;  2W0Z A;  5IHK A;  3VS4 A;  1M27 C;  2DRM A;  4A63 B;  2CRE A;  1UTI A;  5EC7 A;  2KT8 A;  1YNZ A;  4OML A;  3EHR A;  2CH4 A;  1UFF A;  2L3S A;  2CDT A;  3VS6 A;  2OI3 A;  1MV3 A;  1A0N B;  1AZG B;  2LQN A;  1V1C A;  1X6B A;  4LNP A;  3REA B;  2W10 A;  2X3X D;  4LE9 A;  1W6X A;  2KRM A;  4RTT A;  2EYZ A;  2F2W A;  1FMK A;  3NHN A;  2L3Q A;  2I0N A;  1WI7 A;  2KE9 A;  2O31 A;  2ENM A;  1W1F A;  5IXF A;  3M0U A;  2DL3 A;  2DL5 A;  3EG3 A;  2AKK A;  2EYX A;  1T0H A;  1ABQ A;  3NPF A;  2M0Y A;  2LX7 A;  2C0I A;  3CQT A;  4AG1 C;  2DBK A;  1T3S A;  1YCS B;  2CT3 A;  1CSK A;  2DE0 X;  2HSP A;  2J7I A;  1E6H A;  2LZ6 B;  2YSQ A;  5GJV B;  3A98 A;  3PVL A;  4CC4 B;  2F2X A;  1RLQ C;  1UE9 A;  2G6F X;  1AWJ A;  1I0C A;  5GJW B;  2JMA A;  2KYB A;  3M0R A;  1S1N A;  2EGA A;  5ECA A;  2JXB A;  3H0H A;  1GCQ A;  1YN8 A;  2FO0 A;  1RLP C;  2RMO A;  2EPD A;  4HCK A;  2V1R A;  1X27 A;  2A08 A;  4M4Z A;  5HCK A;  1AZE A;  1WFW A;  3SEM A;  2DA9 A;  4HXJ A;  3VS5 A;  2J6O A;  3UF4 A;  4AFZ C;  1NEG A;  1NLP C;  2V1Q A;  2C0O A;  5FWB A;  1HJD A;  1JXM A;  2K3B A;  2CH4 W;  3QWX X;  2FPE A;  3UA7 A;  1JQQ A;  2DL7 A;  4JZ4 A;  3RNJ A;  4JJB A;  3ZL7 C;  1UDL A;  2GBQ A;  2RQU A;  2D1X A;  2O9V A;  1WDX A;  4J9B A;  2EYY A;  4OMM A;  2RQV A;  1KSW A;  2CUD A;  1OPL A;  2KGT A;  1GCQ C;  3H0F A;  2K9G A;  4J9D A;  1BU1 A;  2DNU A;  2FEI A;  4DEY A;  1SHF A;  3RBB B;  2K6D A;  3TSZ A;  2DX1 A;  4GLM A;  4CC2 A;  1LCK A;  3M0Q A;  3H0I A;  1VYT A;  1SRM A;  1UJ0 A;  3EG1 A;  4AG2 C;  2ROT A;  4RTZ A;  2HBW A;  1M8M A;  1W70 A;  2FG0 A;  1PKS A;  2AK5 A;  2F2V A;  4HVV A;  1WXT A;  2KBT A;  4IIM A;  3O5Z A;  1NG2 A;  1YP5 A;  1JO8 A;  1NLO C;  3NGP A;  2LP5 A;  1OEB A;  3IQL A;  4J9I A;  1NEB A;  2FRY A;  2ED1 A;  3M0S A;  1N5Z A;  4OMP A;  5I22 A;  2L0A A;  1T3L A;  2FPF A;  1K4U S;  1MV0 B;  1T0J A;  3TVT A;  1KFZ A;  2LNH B;  1B07 A;  2JS0 A;  3VS3 A;  2HDA A;  1PKT A;  5IHI A;  2VVK A;  3KFV A;  2DL4 A;  1NYG A;  2IIM A;  3VS1 A;  2RPN A;  4JPB W;  1H8K A;  1SEM A;  1U06 A;  3EG0 A;  1GCP A;  2JT4 A;  2J05 A;  2VKN A;  1BBZ A;  2AZS A;  1CKB A;  2J6F A;  2XMF A;  4X1V A;  1U5S A;  2CUB A;  1AWO A;  2EBP A;  2HEQ A;  1VYV A;  1G2B A;  2JM8 A;  2PZ1 A;  2RN8 A;  2MOX A;  5IHN A;  3UAT A;  4RUG A;  2EKH A;  3VS2 A;  2ED0 A;  1UHC A;  4ZNX A;  3EGU A;  1WYX A;  2J06 A;  2JMC A;  2PTK A;  1TUC A;  4F17 A;  4R0K A;  2DYB A;  2P4R A;  4OMO A;  4RTU A;  1VYU A;  1U3O A;  4D8K A;  2FRW A;  1MUZ A;  2DIL A;  1SPK A;  2GTO A;  5L23 A;  2KR3 A;  2L3P A;  1X2Q A;  1J3T A;  2EGC A;  4QT7 A;  2AZV A;  4E6R A;  1YWP A;  2SEM A;  1IO6 A;  2RQT A;  1GBR A;  4LUE A;  2AKL A;  1UUE A;  4WCI A;  3ULR B;  1M3C A;  1JEG A;  3FJ5 A;  4RTX A;  3LH5 A;  1ZX6 A;  3VRY A;  1G83 A;  1Z9Q A;  2DBM A;  2RNA A;  2RQW A;  1K9A A;  2RQR A;  2NWM A;  1HSQ A;  1PHT A;  1ZLM A;  2GGR A;  1JXO A;  1WX6 A;  1SHG A;  2EQI A;  2ROL A;  4Y92 A;  2GNC A;  2LJ0 A;  4CC3 A;  2MCN A;  2YUO A;  1ZUK A;  2EVR A;  1ZUU A;  4DEX A;  2EW3 A;  4KRT A;  3R6N A;  2DM1 A;  2A37 A;  3JV3 A;  1X69 A;  1OPK A;  1RI9 A;  1I1J A;  1M30 A;  4K11 A;  1NM7 A;  3TSW A;  2KNB B;  2DLP A;  1E6G A;  2YT6 A;  3EHQ A;  1PWT A;  3THK A;  1UGV A;  2DVJ A;  4EIK A;  2OJ2 A;  1QKW A;  2LJ3 A;  5IH2 A;  2B86 A;  2DMO A;  1TUD A;  2E5K A;  1WXB A;  1FYN A;  4Z88 A;  2D0N A;  3QWY A;  1ABO A;  3I5S A;  4OMQ A;  4ORZ A;  3PVQ A;  2D8H A;  1Y57 A;  2K79 A;  1AWX A;  2YDL A;  2D8J A;  3I5R A;  1I07 A;  1WXU A;  2BZ8 A;  1H3H A;  3UA6 A;  4F14 A;  2LJ1 A;  1OV3 A;  2A36 A;  2VWF A;  4J9C A;  2LQW A;  2K2M A;  3SHW A;  2J6K A;  2ESW A;  2ABL A;  4J9E A;  1JU5 C;  1ZSG A;  1AVZ C;  1VA7 A;  2X3W D;  1WA7 A;  1XOV A;  1WIE A;  4JJC A;  3PE0 A;  1QLY A;  2K7A A;  4RTW A;  1PRM C;  4OMN A;  1BK2 A;  2KT1 A;  5FWC A;  2YUQ A;  2DF6 A;  2JM9 A;  4AFU C;  2KRS A;  1QWE A;  2M51 A;  5IXB A;  4IIO A;  4CC7 A;  1QWF A;  1UG1 A;  1KIK A;  2O2O A;  1PRL C;  1E7O A;  3H41 A;  4Z89 A;  2CSQ A;  1X2K A;  2CT4 A;  1AEY A;  4J9G A;  1AD5 A;  1GFC A;  1YWO A;  2BTT A;  1UEC A;  1UHF A;  1Y0M A;  4JJD A;  1X43 A;  1AOJ A;  4RTV A;  4LN2 A;  2PNI A;  1X6G A;  2EYW A;  2KXC A;  4FSS A;  4HVU A;  2GTJ A;  2LCS A;  2EGE A;  1BB9 A;  4D8D A;  2NUZ A;  1K0S A;  3I35 A;  3VRZ A;  1GFD A;  1B3Q A;  1H92 A;  3I9Q A;  4F16 A;  2GQI A;  3NMZ C;  1OOT A;  4ESR A;  1ZBJ A;  1QCF A;  1ARK A;  4HVW A;  1SRL A;  3C0C A;  2JTE A;  1K76 A;  1SSH A;  2LMJ A;  3GBQ A;  2KYM A;  4JZ3 A;  1Z9Z A;  3REB B;  1GL5 A;  1AWW A;  2KEA A;  1KJW A;  1QKX A;  2DJQ A;  4Z8A A;  1CKA A;  2FPD A;  4J9F A;  3VS0 A;  1NYF A;  1EFN A;  2DRK A;  2KRO A;  3VS7 A;  5FW9 A;  2L2P A;  2KRN A;  1M3A A;  2OAW A;  1PNJ A;  2KXD A;  2BZY A;  2QDL A;  1ZUY A;  4RTY A;  1UJY A;  2C0T A;  2A28 A;  2MIO A;  1WLP B;  1K1Z A;  3EG2 A;  2JW4 A;  1GRI A;  1TG0 A; 
#chains in the Genus database with same CATH topology
 1VQ8 T;  1QW1 A;  2EJF A;  5CKB A;  3PFS A;  3M0P A;  3JCM V;  2ECZ A;  2RHZ A;  1EIF A;  4DQ2 A;  1KC8 R;  1YIT Q;  4XTU A;  2XHC A;  1YIT A;  1YJ9 Q;  2ZAE A;  2QQB A;  1YJ9 A;  3CMA A;  2RF0 A;  2X51 A;  1WHJ A;  1K0X A;  1M27 C;  1UTI A;  4J7F A;  3EHR A;  2CP6 A;  2CH4 A;  1K73 R;  2XDP A;  4BE2 A;  2LQN A;  5KYY A;  4KBM B;  1OZ3 A;  1WHG A;  3A8L B;  3D7S B;  4LNP A;  4M75 A;  1M1K R;  3ME9 A;  2X3X D;  2X35 A;  5GAM f;  2F2W A;  5FRO A;  2WAC A;  3CEY A;  3RMQ A;  1K9M U;  2VV5 A;  2KE9 A;  1SKU B;  2QQS A;  2LQK A;  2AKK A;  1T0H A;  2X4J A;  1ABQ A;  3UPU A;  2AHJ B;  3CQT A;  4A4K A;  3CBP A;  3KXT A;  1YCS B;  2XID A;  3CXC S;  3CCQ Q;  2XIC A;  2CT3 A;  2RJF A;  2HSP A;  3CCQ A;  2J7I A;  1E6H A;  5GJV B;  3CC4 Q;  2D6F A;  3JB9 F;  4B9X A;  3CC4 A;  2G6F X;  1AWJ A;  4Z02 A;  2EQM A;  2KYB A;  5GAN d;  2EGA A;  5ECA A;  4IUP A;  1TUG B;  3MP8 A;  1PSF A;  4C0Z A;  4RG2 A;  1YN8 A;  5KYN A;  1RLP C;  2RMO A;  4XAX B;  1YIT T;  2LNV A;  4HCK A;  3HRU A;  5GAM h;  2NUT B;  1YJ9 T;  5FU7 C;  1WFW A;  4KH1 B;  3UF4 A;  1KD1 C;  1NLP C;  1GXI E;  2RI5 A;  1M2V A;  2K3B A;  2CH4 W;  4M7D G;  2DL7 A;  4FYY B;  1Q86 U;  1UDL A;  4II1 A;  2CP5 A;  1G3Y A;  1WDX A;  4BAC A;  1OPL A;  1TU0 B;  1RAH B;  3CCU A;  1ZQ1 A;  3H0F A;  1VQP Q;  2K9G A;  1MNE A;  2DNU A;  1VQP A;  4FW1 A;  4BI3 A;  1C0M A;  3OBY A;  3CPW A;  3GNF B;  1SHF A;  4L6V 5;  2K6D A;  4Y91 A;  4GLM A;  4CC2 A;  1LCK A;  1SRM A;  1UJ0 A;  3EG1 A;  4XTW A;  4RTZ A;  1TH7 A;  1M8M A;  3EG9 B;  4HVV A;  2YWW A;  1D1C A;  4IIM A;  3O5Z A;  2EQJ A;  4C8Q C;  2RO0 A;  3CCQ T;  2DEU A;  4XTY A;  2D9T A;  3JB9 G;  4C0F A;  3M0S A;  1N5Z A;  3PNW C;  4KGZ B;  5CKF A;  3CC4 T;  5GAO r;  3JAM E;  1T3L A;  2DTH A;  5GAN e;  3TVT A;  1AHJ B;  4ZGJ B;  9ATC B;  2DD4 A;  2DPP B;  3CCJ Q;  2DL4 A;  3VUZ A;  1H8K A;  1SEM A;  3GNG A;  4L5G A;  1SG5 A;  3CCJ A;  3SFM A;  2J6F A;  4X1V A;  2JOY A;  2EBP A;  2ZPE B;  1BI1 A;  2HEQ A;  5GMK m;  3HFO A;  4XQ3 A;  1QCN A;  2JM8 A;  2RN8 A;  3PTA A;  1VQN Q;  5GAN 5;  5DY9 A;  3RKW A;  2VXF A;  3M9Q A;  1X01 A;  3G71 A;  4HKE A;  4CRI A;  3AT1 B;  2JMC A;  2KAF A;  3E9G A;  3M4G A;  5J26 A;  4RTU A;  5KYW B;  1U3O A;  2R58 A;  2BIV A;  3J81 E;  1VQP T;  3A8G B;  3CD6 Q;  2GTO A;  3EFS A;  1VQ9 Q;  3OB9 A;  1X2Q A;  3OYH A;  4XTV A;  3CD6 A;  2SEM A;  2AKL A;  2LT4 A;  2M16 A;  1ZSZ B;  2YRV A;  3OS5 A;  2COY A;  3QJ6 A;  3FJ5 A;  2CP2 A;  3VRY A;  1G83 A;  4J83 A;  4C92 B;  3CC2 Q;  2E3H A;  3OW2 S;  1WHL A;  1PCX A;  1ZLM A;  1JXO A;  1SHG A;  2GNC A;  2VUB A;  2MCN A;  5GAO l;  1ZUK A;  3HRS A;  1G8X A;  4PJO B;  2EVR A;  3FIF A;  4D6W A;  3FC3 A;  3MEU A;  4PJJ A;  3JCM Q;  3RMS A;  1R77 A;  3EAE A;  3JCM f;  3DKM A;  5GAO q;  3M53 A;  3JV3 A;  1VOM A;  1KQ2 A;  4C92 F;  2KNB B;  2A7Y A;  3JCM g;  2HQH A;  2YT6 A;  1KD1 R;  1PWT A;  4EIK A;  2KDS A;  1QKW A;  4WF2 A;  5IH2 A;  1TUD A;  4PJO F;  1WXB A;  2D0N A;  5C6S A;  4JDS A;  2MPX C;  1NZ9 A;  2PVG B;  3PVQ A;  2K79 A;  1AWX A;  5I21 A;  1I07 A;  1NJI C;  2K5F A;  5A0G A;  4J9C A;  1NE8 A;  4JJN K;  2J6K A;  1VQN T;  2LX9 A;  2HAX A;  3WVD B;  3EGD A;  2DTO A;  2X3W D;  3MP6 A;  4M7A D;  1XOV A;  1QQJ A;  4JJC A;  3M58 A;  4ELY C;  1QLY A;  1YJW Q;  4BUG A;  3QXE B;  4GLK A;  2JUF A;  1YJW A;  5GAN 2;  4C92 D;  1D0X A;  2BKD N;  4EMK C;  3JCM c;  2RK2 A;  1M4Z A;  3CD6 T;  2JM9 A;  1VQ9 T;  2P0P A;  4N0A A;  2WSF E;  4CC7 A;  4PJO D;  2O2O A;  1PRL C;  1KIK A;  1JJ2 S;  1BIB A;  1V76 A;  3OA6 A;  4Z89 A;  2FHD A;  2ZPG B;  1X2K A;  1AEY A;  3PMI A;  4J9G A;  2BTT A;  4KH0 B;  2RI2 A;  2RA2 A;  5GAN j;  4DBR A;  3CME Q;  5D6W A;  3CC2 T;  2PNI A;  2HBP A;  3L2Z A;  2GTJ A;  4JRK A;  3MJX A;  1BB9 A;  1MND A;  2HZY A;  3CCS Q;  2NUZ A;  3JCM W;  3VRZ A;  4C92 G;  3CCS A;  1N8R R;  2E6N A;  1R0B G;  4DBQ A;  3I9Q A;  4PJO G;  5GAN 8;  3UT1 A;  5A0D A;  4JS4 A;  3MET A;  3OYY A;  1SRL A;  4BI8 B;  3MO8 A;  2JTE A;  4BB7 A;  1Z9Z A;  2QTV A;  3BDU A;  2E4H A;  1KJW A;  1N27 A;  4JUV A;  3R6O A;  1CKA A;  3BY7 A;  3SDZ A;  3CBM A;  3VS0 A;  5FU6 C;  4HA8 A;  2A0F B;  5FW9 A;  2KRN A;  2X9H A;  4PKC C;  4A4E A;  3OW2 P;  1YJW T;  2MIO A;  4RCC A;  3OSS C;  2GFA A;  3OS1 A;  5J39 A;  4DBF A;  4XK8 E;  2JW4 A;  1TTH B;  2L5Q A;  1YJN Q;  4P5N A;  4LUD A;  3VYH B;  4LD6 A;  5HK0 A;  1YJN A;  3L2W A;  3CPF A;  4F04 B;  2YUP A;  3TCJ A;  5KCO A;  1VIF A;  1HD3 A;  4PLI A;  5I11 A;  3M0T A;  4LDU A;  1YI2 Q;  1K8A C;  2RJD A;  1V29 B;  3CME T;  2B8A A;  4GBQ A;  3CBO A;  1GBQ A;  3LGL A;  3X25 B;  3EFO B;  5IHK A;  3VS4 A;  2CRE A;  2V26 A;  5EC7 A;  1YNZ A;  5LJ5 f;  2IG0 A;  2LCL A;  2L3S A;  1Q82 C;  4O6J A;  5FU7 B;  4MDX A;  3VS6 A;  2OI3 A;  2X4W A;  1AZG B;  1NJI R;  1RAA B;  2I2L A;  1XTD A;  4MMK A;  4LE9 A;  2LC4 A;  4F7U B;  3A1P A;  2L89 A;  2VGM A;  2NUP A;  3V7C A;  5GAO m;  1PG5 B;  2L3Q A;  2LT1 A;  1BIA A;  4M77 C;  3V8L A;  2O31 A;  3EG9 A;  5KH6 A;  3CCM Q;  2ENM A;  1W1F A;  2YLB A;  3CCM A;  2DL5 A;  3WVE B;  4NL2 A;  1WNL A;  3HRT A;  1H3Z A;  1M2O A;  2M0Y A;  2C0I A;  4AG1 C;  1T3S A;  3RDV A;  4F7U F;  2DE0 X;  2PUO B;  2YSQ A;  3A98 A;  7AT1 B;  4CC4 B;  1HYO A;  1RLQ C;  3DLL A;  1UE9 A;  5LJ5 h;  2QDY B;  3QJY A;  1YJN T;  5LJ3 h;  4OGE A;  4IUV A;  4C8Q B;  2QTX A;  2P0K A;  1OU8 A;  4MZP A;  2Z0W A;  2E41 A;  2CP0 A;  1SF9 A;  1IB8 A;  4QQ6 A;  3NTH A;  3X28 B;  4HT9 A;  1YI2 T;  4PJL A;  2EPD A;  3M59 A;  5HCK A;  3SEM A;  1FWZ A;  4C8Q F;  4HXJ A;  4BDY A;  1HJD A;  1EX4 A;  2DZ9 A;  2LQ8 A;  2O9V A;  2EYY A;  2RQV A;  3CCE Q;  2CUD A;  2KGT A;  4M7A E;  2JZ2 A;  3CCE A;  1BU1 A;  2OTJ T;  5GAM d;  1WGS A;  3RBB B;  4M7D B;  4M7A A;  3M0Q A;  4NOY A;  5FRN A;  4AG2 C;  4B6M A;  3CCM T;  1YCY A;  2HBW A;  4PJO E;  3ASK A;  2F2V A;  2AK5 A;  4C92 A;  3HFN A;  5GAO p;  3EH1 A;  1VQ6 Q;  2LCC A;  4F7U G;  1RAB B;  4C0D C;  4DOW A;  1VQ6 A;  4M75 E;  2LP5 A;  1OEB A;  3IQL A;  3QDF A;  4J9I A;  2VXE A;  3P8H A;  4PJO A;  5CQX A;  4M7D F;  2ED1 A;  2YRD A;  4J6Y A;  1M90 U;  5I22 A;  2QXF A;  3HSB A;  2RK1 A;  1T0J A;  1MMN A;  4HCZ A;  4LD9 K;  1KQS S;  1D0Z A;  1I8F A;  2GQV A;  1D3B A;  4TVR A;  1YIJ Q;  3OYA A;  1U5S A;  5DLO A;  4M78 C;  1AWO A;  4C8Q G;  1Q82 R;  1VYV A;  2PZ1 A;  3UWN A;  2DIQ A;  2FZC B;  1Q81 U;  2MF2 A;  1QVG S;  1Q7Y C;  4ATO A;  2FVU A;  4M7D D;  3ZFJ A;  4QKU A;  3EGU A;  3L2V A;  2EIF A;  1FMV A;  1PM3 A;  4B9W A;  2EWN A;  1TUC A;  4E7I A;  4FCY A;  2PVD B;  1W2B A;  2P4R A;  3BDL A;  1VYU A;  4FYX B;  2KMT A;  4PJM A;  3CCE T;  1ACM B;  1MUZ A;  1SPK A;  3C12 A;  1QVF A;  2KR3 A;  3OYF A;  4Q5W A;  1J3T A;  2EGC A;  3CC7 Q;  4A4F A;  2RQT A;  1N6A A;  1GBR A;  3CC7 A;  1IZ6 A;  3JSC A;  4BD3 A;  3ULR B;  1Y07 A;  1JEG A;  4RTX A;  4EMK B;  3LH5 A;  1ZX6 A;  1Z9Q A;  2KK4 A;  1VQ6 T;  1HSQ A;  3JB9 D;  3OSV A;  2EQI A;  2ROL A;  4Y92 A;  2R5A A;  4CC3 A;  2FYK A;  3OYE A;  1N8R U;  1ZUU A;  2EW3 A;  5AYF A;  2X4X A;  2DM1 A;  2WSC E;  1OPK A;  1K9M C;  2OTL Q;  4LDY A;  3TSW A;  3UDC A;  1E6G A;  2AT1 B;  2OTL A;  1UGV A;  4E7H A;  1IHV A;  3H8Z A;  1YIJ T;  2JVV A;  5D7U A;  2PQW A;  2LJ3 A;  3J80 E;  1XJW B;  2EQK A;  2B86 A;  2DMO A;  2M1H A;  1FYN A;  4Z88 A;  3RR6 A;  5GAN f;  2E6Z A;  3I5S A;  4NL3 A;  4ORZ A;  1IRX A;  3TRE A;  3S6W A;  2VC8 A;  3LWI A;  4BE1 A;  2BZ8 A;  4QQG A;  3PIO A;  4F14 A;  1OV3 A;  1JRI A;  2VWF A;  2FZK B;  2DTI A;  5GAN g;  3SHW A;  6AT1 B;  1N9R A;  2JTM A;  2ABL A;  1JU5 C;  2E65 A;  3GLX A;  3FEO A;  4PK4 A;  2O4X B;  5CKD A;  2R57 A;  1WA7 A;  1WJS A;  3GPL A;  4RTW A;  1D1B A;  3M5A A;  5GAN 7;  3M57 A;  4IUU A;  3L2R A;  3C4S A;  2HNI A;  2FL7 A;  3QHS A;  5HKC A;  5FWC A;  2YUQ A;  4KGV B;  3QZ9 B;  4AFU C;  4V2S A;  4XU0 A;  2M51 A;  5IXB A;  1Q95 G;  3CC7 T;  4IIO A;  2WSE E;  1UG1 A;  1YFN A;  2F1L A;  4JRP A;  4CI0 C;  3L2Q A;  1VQO T;  3H41 A;  1G3W A;  2X4Y A;  1KQS P;  4J8O A;  2CT4 A;  4PFP A;  2CKK A;  2K57 A;  1GFC A;  3Q1J A;  1UB4 A;  2E1H A;  1VQN A;  4RTV A;  4LN2 A;  4HCC A;  1X6G A;  1VQ7 Q;  3LX7 A;  1NPP A;  1Q86 C;  2MYS A;  1VQ7 A;  3EFO A;  5KE3 A;  2ZPI B;  2QQA A;  2RHI A;  2R5M A;  2QAZ A;  4X34 A;  4R55 A;  3PIP A;  1QVG P;  4N0A C;  3OMG A;  2QA4 T;  1B3Q A;  2OTL T;  1VQ9 A;  2KI7 A;  4FYW B;  1H92 A;  2LDM A;  1OOT A;  4FW2 A;  5GAN 3;  1Q7Y R;  3MKD A;  4RCB A;  5AT1 B;  1M8V A;  3GBQ A;  1RI0 A;  4JZ3 A;  3REB B;  2DJQ A;  4QQD A;  3TU4 K;  3CC2 A;  2EJ9 A;  5GMK h;  2Y4Y A;  2P0Q A;  2KRO A;  5GAM j;  3MEW A;  2DKG A;  4E7K A;  3URG A;  5DLQ E;  1O9S A;  2AIR B;  2COW A;  2BZY A;  3SWN A;  2C0T A;  3H9N A;  5I2S A;  2A28 A;  4M77 B;  1WLP B;  1K1Z A;  2RB6 A;  1KHC A;  3J7A F;  4E7J A;  3VJP A;  4ZN1 A;  1RAE B;  1IRE B;  2EKO A;  1TS9 A;  3M55 A;  4J7I A;  2CZ7 B;  2L8D A;  5KYY B;  1OU9 A;  1B34 B;  1M5Q 1;  2DL8 A;  4M77 F;  3OYK A;  4ZN3 A;  1BYM A;  2JS2 A;  5GAN 6;  1TSF A;  4AFS C;  4JLI A;  1WQ7 A;  3CCV Q;  2DEQ A;  2O9S A;  4J9H A;  2HCK A;  1VQ7 T;  3ZBD A;  2SRC A;  1K9M R;  3CCV A;  3C94 A;  5CQY A;  4A63 B;  2JNG A;  4OML A;  3CCL Q;  4JLG A;  1UFF A;  2PVO B;  2CDT A;  3CCL A;  3JCM h;  4M7D E;  1A0N B;  1KC8 U;  2F5K A;  2M02 A;  3BW1 A;  1X6B A;  4IUT A;  3X26 B;  2W10 A;  3CXC A;  2KRM A;  4M7D A;  4M77 D;  2EYZ A;  2BE9 B;  3DLM A;  2BE7 D;  2I0N A;  3CME A;  3M0U A;  3FB9 A;  3JCM b;  3EG3 A;  2EYX A;  1K73 U;  3NPF A;  4A4G A;  2LX7 A;  3P8D A;  2DBK A;  1MMD A;  2QAS A;  1VQM Q;  2EJG A;  2XKO C;  4FU6 A;  2LZ6 B;  1M1K U;  4R56 A;  3PVL A;  1VQM A;  2DZC A;  3LWH A;  4HCB A;  1NPR A;  1FX7 A;  5KYX B;  2H3E B;  1I0C A;  4EPC A;  2JMA A;  3M0R A;  1S1N A;  2JXB A;  1EZZ B;  5HK3 A;  2ZPF B;  4N4G A;  2HL5 C;  4M77 G;  1Q86 R;  4C5I A;  1GCQ A;  4L59 A;  2FO0 A;  3OMC A;  1PD0 A;  4E7S A;  1W4S A;  1X27 A;  2A08 A;  3OBW A;  2XD0 A;  1AZE A;  1D0Y A;  1HXD A;  3CCV T;  3TEE A;  4N4I A;  3VS5 A;  2J6O A;  2FZG B;  4AFZ C;  1C6V X;  2V1Q A;  1Y96 B;  1JXM A;  5LJ5 d;  4IUQ A;  5LJ3 d;  4M78 B;  3UA7 A;  3CCL T;  1JQQ A;  3JCM X;  1I5O B;  1VUB A;  1TWB A;  3RNJ A;  4JJB A;  3ZL7 C;  2GBQ A;  2RHX A;  4OMM A;  1KSW A;  2HL3 A;  5CCA A;  4J9D A;  4FIB A;  3INZ A;  2V8J A;  2K5I A;  2FEI A;  3A5Z B;  1UGQ B;  2KSS A;  5KCH A;  2DXB A;  2E12 A;  4DEY A;  5IAY A;  3G7Z A;  1YI2 A;  2NUT A;  2XDB A;  4M78 F;  5KYU B;  2XU8 A;  4JS5 A;  3QII A;  2RHU A;  1W70 A;  2FG0 A;  1PKS A;  1O75 A;  1LJO A;  3HP9 A;  1QP3 A;  4LDX A;  5HY6 A;  1WXT A;  2KBT A;  4FT2 A;  1ZA1 B;  4QVZ A;  1NG2 A;  1NLO C;  3CPW S;  3PGG A;  1NEB A;  1VQM T;  4ME7 A;  2O01 E;  4X9C A;  3MPU B;  1K4U S;  1KFZ A;  1I81 A;  2LNH B;  2OTJ Q;  4IUR A;  2HDA A;  1PKT A;  5IHI A;  4PNO A;  4M7A C;  4Y28 E;  1BI3 A;  2OTJ A;  1NYG A;  3M4Y A;  3VS1 A;  1VQL T;  3EG0 A;  1GCP A;  4M78 D;  2J05 A;  2AZS A;  1KK7 A;  5IT9 E;  4O5V A;  1JB0 E;  1LVK A;  1M1G A;  4E7L A;  4C5G A;  1G2B A;  1S72 Q;  2K3Y A;  4RG8 A;  2CS7 A;  1X6O A;  2MOX A;  2P4T A;  5IHN A;  3UAT A;  4RUG A;  5LJ5 e;  1S72 A;  2MWO A;  4C0G A;  5LJ3 e;  1D1A A;  5CK9 A;  2ED0 A;  2M0O A;  5DM7 R;  3QBY A;  5M9O A;  1M1F A;  3MEV A;  4ZNX A;  4PJN A;  4M75 C;  4FSX A;  1KQ1 A;  1ZBX A;  2ZGW A;  2PUK B;  3H6Z A;  1Y7X A;  4F17 A;  4R0K A;  3PMT A;  2DYB A;  2KY9 A;  4OMO A;  2DD5 A;  1NBE B;  4OB1 B;  4D8K A;  3OW2 A;  3A8O B;  4M78 G;  1RL2 A;  4QT7 A;  2AZV A;  4E6R A;  3FRN A;  1YWP A;  1N9S A;  4LUE A;  2XK0 A;  1BCM A;  3LH0 A;  3AHU A;  4RKU E;  3RKX A;  4GY5 A;  3GIB A;  1MMG A;  2DBM A;  2XI9 A;  4BE0 A;  1D09 B;  2H3J A;  2RNA A;  2RQW A;  4FYV B;  2F69 A;  2KVQ G;  3QSU A;  2RQR A;  3E1S A;  2JN0 A;  2GGR A;  2LJ0 A;  3MP1 A;  2D0Q B;  2YUO A;  4X9D A;  5KYW A;  4LXC A;  3BE3 A;  2DET A;  3V7R A;  3OQ5 A;  1RAF B;  4LDV A;  4OMF B;  2FB7 A;  1DJ7 B;  2A37 A;  4IKF A;  1X69 A;  1M30 A;  3HL8 A;  3OYL A;  2VGN A;  3RUX A;  4XU1 A;  3ZEH A;  4C92 E;  2V8I A;  2MK5 A;  1ZSZ A;  1I5L A;  1OX8 A;  2DLP A;  3P8B B;  2DVJ A;  3GOX A;  2E5K A;  3QUI A;  4C8Q D;  3EFR A;  3QWY A;  3QG1 A;  1WJR A;  4OMQ A;  2D8J A;  3JCM J;  3I5R A;  1WXU A;  1H3H A;  1OX9 A;  5I2M A;  3UA6 A;  2LJ1 A;  1S72 T;  2QGF B;  2LQW A;  3L42 A;  4M77 E;  4UC4 A;  2ESW A;  3QZ5 B;  3CMA Q;  1AVZ C;  1F1B B;  1K8A R;  1JJ2 A;  1ZA2 B;  1WIE A;  1KHI A;  3PE0 A;  3QPH A;  3SB2 A;  5FRM A;  2E3I A;  3V8K A;  2K7A A;  4OGC A;  4M77 A;  4BI4 A;  1KD1 U;  1PRM C;  4OMN A;  3CPW P;  1BK2 A;  2PU9 B;  3GF5 A;  5D6X A;  1MHN A;  1Y71 A;  2KT1 A;  4VUB A;  3HHT B;  2DF6 A;  3OYI A;  2CZ6 B;  1QWE A;  1YIJ A;  4OB2 B;  3C95 A;  3HTR A;  1B34 A;  3OYN A;  1E7O A;  4FM4 B;  4OB0 B;  2CSQ A;  4BDZ A;  4A4H A;  4BY6 C;  3TQ7 P;  4OVA A;  3HPW A;  4PLL A;  3CCR Q;  1Y0M A;  1IHW A;  5CKE A;  3I55 Q;  3LGF A;  3CCR A;  5FLX E;  2EYW A;  2KXC A;  5GAM g;  3I55 A;  4E2F B;  2HKQ B;  4C5E A;  3I56 Q;  3QYH B;  2CZ1 B;  4HVU A;  2LCS A;  2HKN A;  3I56 A;  1XQH A;  2CP7 A;  4D8D A;  4YTL A;  1XNI A;  1BI0 A;  5GAM e;  4XTZ A;  4DOV A;  1WHM A;  2DK3 A;  2QQR A;  5LJ5 j;  3NMZ C;  1VQO Q;  5LJ3 j;  1RAG B;  3G1J A;  1ARK A;  1VQO A;  4J6X A;  1SSH A;  2JJ9 A;  2KYM A;  1GL5 A;  4J5Y A;  1AWW A;  1QKX A;  3NTI A;  4Z8A A;  2DYI A;  5CAI A;  2FPD A;  1G3T A;  1NYF A;  4QW2 A;  1WPY A;  1M90 C;  3OY9 A;  2L2P A;  3CMA T;  3E19 A;  3OS0 A;  1IXD A;  1U1S A;  1M3A A;  1PNJ A;  4KT0 E;  2Y4X A;  1R0C B;  2ATC B;  2QDL A;  1ZUY A;  4E7Z A;  1VQ4 Q;  2QA4 Q;  2ZCF B;  3JB9 J;  1HK9 A;  3VKI A;  3HKS A;  1VQ4 A;  4ANJ A;  2QA4 A;  2IVW A;  3VYG A;  3NFC A;  5IN1 A;  2QK0 A;  1EFN A;  5GAO n;  3V7S A;  5KYX A;  1TG0 A;  2F5T X;  2RJE A;  1RAC B;  4MZM A;  2EQU A;  2CSI A;  2YHT A;  3CCU Q;  2XDD A;  4DBH A;  1RUW A;  2EFI A;  1RAI B;  4N4H A;  4MML A;  3U23 A;  1Q81 C;  2QEX Q;  3FDR A;  2EYQ A;  2BZX A;  3CCR T;  2QEX A;  4M78 E;  2NUP B;  2O88 A;  3I55 T;  2H8H A;  2YUN A;  4KUI A;  5CVI A;  3SWN C;  4AFQ C;  1M3B A;  3DB3 A;  4KUL A;  2DAQ A;  4MZT A;  1Y96 A;  3I56 T;  4XTX A;  2JTF A;  3JCM P;  2W0Z A;  2DRM A;  4M78 A;  2KT8 A;  5FU6 B;  2HD0 A;  2LRQ A;  3EGX B;  3OYJ A;  1OI1 A;  2OAU A;  1MV3 A;  3VV0 A;  5GMK i;  1QVP A;  1U1T A;  1UGS B;  1V1C A;  4FL6 A;  3X20 B;  2G3R A;  3REA B;  3L2U A;  2LTO A;  3MEA A;  2E5Q A;  1W6X A;  5KYU A;  2QG9 B;  4RTT A;  2HSE B;  1FMK A;  3NHN A;  1G3S A;  5GAN h;  2K4Y A;  1WI7 A;  1YBY A;  4AMC A;  5IXF A;  3N5B B;  1B7T A;  2DL3 A;  3QYG B;  1N8R C;  4PFO A;  3LYI A;  3QO3 A;  3JCM d;  1OYX A;  1NJI U;  1CSK A;  2LVM A;  4F7U E;  1VQ4 T;  3G71 Q;  1H64 1;  3KBG A;  3OYB A;  2F2X A;  4M7D C;  5GJW B;  8AT1 B;  2NYS A;  4F7U A;  3JB9 H;  3CCU T;  3CXC P;  5GMK e;  2YXY A;  3H0H A;  3A8H B;  1BI2 A;  2QEX T;  2V1R A;  4M4Z A;  4M7A B;  4FT4 A;  2DJZ A;  1LNX A;  2DA9 A;  2OX7 A;  4C8Q E;  1NEG A;  3F70 A;  3WXM B;  2C0O A;  5FWB A;  2RM4 A;  1FMW A;  2E10 A;  2E64 A;  3QWX X;  2FPE A;  1BKB A;  4JZ4 A;  4C8Q A;  4ZTJ A;  2RQU A;  4OF1 A;  2D1X A;  4J9B A;  4M7A F;  1X75 C;  1GCQ C;  3M54 A;  5A2Q E;  2KQW A;  1LOJ A;  1M90 R;  3RER A;  4M75 B;  4PL6 A;  3CCJ T;  3TSZ A;  2DX1 A;  3G4S Q;  3H0I A;  1D3B B;  1VYT A;  4KGX B;  4AT1 B;  3M56 A;  2DIG A;  2ROT A;  3G4S A;  1I4K 1;  4JRQ A;  3JCM e;  2P84 A;  5EG2 A;  1KQS A;  1YP5 A;  1JO8 A;  3A8M B;  1TXQ A;  4M75 F;  3NGP A;  4A54 A;  2QQ9 A;  3T9N A;  2FRY A;  3VUB A;  4ELZ C;  3G71 T;  1QCO A;  4OMP A;  1JBM A;  2QYZ A;  2RJC A;  2HQE A;  2IPO B;  1Q81 R;  2L0A A;  2FPF A;  1MV0 B;  1WJQ A;  1PC0 A;  5CKH A;  2VAS A;  1YHQ Q;  1VQK Q;  1B07 A;  2JS0 A;  3VS3 A;  4HT8 A;  2VVK A;  1YHQ A;  1VQK A;  3KFV A;  1QVG A;  2IIM A;  2RPN A;  4JPB W;  3G6E Q;  1U06 A;  3X24 B;  2JT4 A;  2VKN A;  4OP0 A;  3G6E A;  1BBZ A;  3RKY A;  2CZ0 B;  2HQX A;  1CKB A;  2XMF A;  3E9F A;  1RAD B;  4XU2 A;  2CUB A;  3LLR A;  5GAN 4;  5CR2 A;  3OYM A;  2MAM A;  4M75 D;  2YRC A;  2CYZ B;  2Y90 A;  4MDW A;  1K8A U;  2XG8 D;  2EKH A;  2K2V A;  3VS2 A;  3S3O A;  1UHC A;  3MCA B;  1M2V B;  3OYC A;  2HMA A;  1U8R A;  1FXX A;  1WYX A;  2J06 A;  4M7A G;  2PTK A;  4ZTF A;  1AT1 B;  4C0D B;  1VIE A;  4KUD K;  1VQL Q;  2FRW A;  2DIL A;  1UGR B;  5L23 A;  3VU3 C;  1VQL A;  2L3P A;  1Q82 U;  8ATC B;  4ZGE B;  1IO6 A;  4C5H A;  4QVD A;  3G4S T;  1UUE A;  4WCI A;  1OZ2 A;  1M3C A;  1UEB A;  2COZ A;  4EDU A;  4XU3 A;  1W2B S;  1WHH A;  2K3X A;  4M75 G;  3KUF A;  1QP2 A;  1K9A A;  1UGP B;  2MI6 A;  2DXU A;  1QVF S;  1OQK A;  5GMK j;  2NWM A;  2VYT A;  3OYG A;  1PHT A;  2QGG A;  1WX6 A;  3QKJ A;  1KC8 C;  3O8V A;  4BY6 B;  4WTO B;  2GFU A;  1WQW A;  4DEX A;  4KRT A;  3R6N A;  3E2U A;  1MGQ A;  4PFZ A;  1IGU A;  1YHQ T;  1VQK T;  1RI9 A;  1I1J A;  4K11 A;  1NM7 A;  2RD1 A;  3EHQ A;  3G6E T;  3THK A;  5D6Y A;  5LL6 S;  1P92 A;  1TOV A;  3GP8 A;  2OJ2 A;  1PSE A;  1R8O B;  4EMK A;  1BCO A;  1ABO A;  1K73 C;  2V8K A;  2D8H A;  1Y57 A;  2YDL A;  2A36 A;  2A3L A;  1VQ5 Q;  4OB3 B;  2K2M A;  2RHY A;  1ZHI A;  3OS2 A;  1VQ5 A;  1M1K C;  4J9E A;  1ZSG A;  1VA7 A;  2BUD A;  1LPL A;  4ZGD B;  2CGH A;  5L8R E;  1KG1 A;  2RH2 A;  4RMO A;  2DFU A;  1ZSZ C;  1WZO A;  2ZPB B;  3CCS T;  3S3N A;  1M9S A;  2RI3 A;  3NTK A;  2EAY A;  5LJ3 f;  1QMC A;  2DXC A;  1VQ8 Q;  2L3R A;  2KRS A;  4C92 C;  5C0M A;  1G5V A;  1VQ8 A;  1QWF A;  5LJ5 g;  5A0L A;  5LJ3 g;  3RES A;  2DXT A;  2E70 A;  4E47 A;  3FJP A;  1PD1 A;  4PJO C;  1AD5 A;  3LW5 E;  1OUL A;  1YWO A;  1UEC A;  3JRZ A;  1UHF A;  3ER0 A;  4JJD A;  1X43 A;  4EMG A;  2O4X A;  1AOJ A;  5CO7 A;  4NS5 A;  4QVC A;  1JJ2 P;  4FSS A;  2M9U A;  3RIR A;  2EGE A;  2DO3 A;  3EGX A;  1MMA A;  1K0S A;  3I35 A;  1WHK A;  2ZPH B;  1GFD A;  2MMP A;  3DB4 A;  3SWN B;  1C1A A;  3OYD A;  2NLU A;  3BFM A;  3PT9 A;  4F16 A;  2GQI A;  2DVE A;  4ESR A;  3V8J A;  1SSF A;  1ZBJ A;  1QCF A;  4HVW A;  2QI2 A;  3C0C A;  1K76 A;  2LMJ A;  2C06 A;  2CP3 A;  3S3M A;  2KEA A;  5CIU A;  2MWP A;  4J6W A;  4J9F A;  1VQ5 T;  5J3B A;  3QDR B;  2DRK A;  2YLC A;  2VB6 A;  3FLG A;  3VS7 A;  4LDW A;  4A53 A;  2DER A;  1W2B P;  4DA4 A;  3EH2 A;  3EGD B;  4JRI A;  3MHX A;  2OAW A;  3JB9 I;  2KXD A;  2GF7 A;  4RTY A;  2GCX A;  1UJY A;  5GMK l;  1QVF P;  4EMH A;  1IGQ A;  3EG2 A;  1Q7Y U;  2ZZD A;  5KE2 A;  2K5L A;  3L1A A;  1GRI A;  3SD4 A; 
#chains in the Genus database with same CATH homology
 4LUD A;  2CSI A;  2YUP A;  1RUW A;  3M0P A;  2ECZ A;  1HD3 A;  5I11 A;  3M0T A;  2DL8 A;  3U23 A;  2BZX A;  2JS2 A;  4AFS C;  4GBQ A;  1GBQ A;  2O88 A;  2H8H A;  2O9S A;  2YUN A;  4J9H A;  4AFQ C;  2HCK A;  2SRC A;  2RF0 A;  1M3B A;  1K0X A;  2W0Z A;  5IHK A;  3VS4 A;  1M27 C;  2DRM A;  4A63 B;  2CRE A;  1UTI A;  5EC7 A;  2KT8 A;  1YNZ A;  4OML A;  3EHR A;  2CH4 A;  1UFF A;  2L3S A;  2CDT A;  3VS6 A;  2OI3 A;  1MV3 A;  1A0N B;  1AZG B;  2LQN A;  1V1C A;  1X6B A;  4LNP A;  3REA B;  2W10 A;  2X3X D;  4LE9 A;  1W6X A;  2KRM A;  4RTT A;  2EYZ A;  2F2W A;  1FMK A;  3NHN A;  2L3Q A;  2I0N A;  1WI7 A;  2KE9 A;  2O31 A;  2ENM A;  1W1F A;  5IXF A;  3M0U A;  2DL3 A;  2DL5 A;  3EG3 A;  2AKK A;  2EYX A;  1T0H A;  1ABQ A;  3NPF A;  2M0Y A;  2LX7 A;  2C0I A;  3CQT A;  4AG1 C;  2DBK A;  1T3S A;  1YCS B;  2CT3 A;  1CSK A;  2DE0 X;  2HSP A;  2J7I A;  1E6H A;  2LZ6 B;  2YSQ A;  5GJV B;  3A98 A;  3PVL A;  4CC4 B;  2F2X A;  1RLQ C;  1UE9 A;  2G6F X;  1AWJ A;  1I0C A;  5GJW B;  2JMA A;  2KYB A;  3M0R A;  1S1N A;  2EGA A;  5ECA A;  2JXB A;  3H0H A;  1GCQ A;  1YN8 A;  2FO0 A;  1RLP C;  2RMO A;  2EPD A;  4HCK A;  2V1R A;  1X27 A;  2A08 A;  4M4Z A;  5HCK A;  1AZE A;  1WFW A;  3SEM A;  2DA9 A;  4HXJ A;  3VS5 A;  2J6O A;  3UF4 A;  4AFZ C;  1NEG A;  1NLP C;  2V1Q A;  2C0O A;  5FWB A;  1HJD A;  1JXM A;  2K3B A;  2CH4 W;  3QWX X;  2FPE A;  3UA7 A;  1JQQ A;  2DL7 A;  4JZ4 A;  3RNJ A;  4JJB A;  3ZL7 C;  1UDL A;  2GBQ A;  2RQU A;  2D1X A;  2O9V A;  1WDX A;  4J9B A;  2EYY A;  4OMM A;  2RQV A;  1KSW A;  2CUD A;  1OPL A;  2KGT A;  1GCQ C;  3H0F A;  2K9G A;  4J9D A;  1BU1 A;  2DNU A;  2FEI A;  4DEY A;  1SHF A;  3RBB B;  2K6D A;  3TSZ A;  2DX1 A;  4GLM A;  4CC2 A;  1LCK A;  3M0Q A;  3H0I A;  1VYT A;  1SRM A;  1UJ0 A;  3EG1 A;  4AG2 C;  2ROT A;  4RTZ A;  2HBW A;  1M8M A;  1W70 A;  2FG0 A;  1PKS A;  2AK5 A;  2F2V A;  4HVV A;  1WXT A;  2KBT A;  4IIM A;  3O5Z A;  1NG2 A;  1YP5 A;  1JO8 A;  1NLO C;  3NGP A;  2LP5 A;  1OEB A;  3IQL A;  4J9I A;  1NEB A;  2FRY A;  2ED1 A;  3M0S A;  1N5Z A;  4OMP A;  5I22 A;  2L0A A;  1T3L A;  2FPF A;  1K4U S;  1MV0 B;  1T0J A;  3TVT A;  1KFZ A;  2LNH B;  1B07 A;  2JS0 A;  3VS3 A;  2HDA A;  1PKT A;  5IHI A;  2VVK A;  3KFV A;  2DL4 A;  1NYG A;  2IIM A;  3VS1 A;  2RPN A;  4JPB W;  1H8K A;  1SEM A;  1U06 A;  3EG0 A;  1GCP A;  2JT4 A;  2J05 A;  2VKN A;  1BBZ A;  2AZS A;  1CKB A;  2J6F A;  2XMF A;  4X1V A;  1U5S A;  2CUB A;  1AWO A;  2EBP A;  2HEQ A;  1VYV A;  1G2B A;  2JM8 A;  2PZ1 A;  2RN8 A;  2MOX A;  5IHN A;  3UAT A;  4RUG A;  2EKH A;  3VS2 A;  2ED0 A;  1UHC A;  4ZNX A;  3EGU A;  1WYX A;  2J06 A;  2JMC A;  2PTK A;  1TUC A;  4F17 A;  4R0K A;  2DYB A;  2P4R A;  4OMO A;  4RTU A;  1VYU A;  1U3O A;  4D8K A;  2FRW A;  1MUZ A;  2DIL A;  1SPK A;  2GTO A;  5L23 A;  2KR3 A;  2L3P A;  1X2Q A;  1J3T A;  2EGC A;  4QT7 A;  2AZV A;  4E6R A;  1YWP A;  2SEM A;  1IO6 A;  2RQT A;  1GBR A;  4LUE A;  2AKL A;  1UUE A;  4WCI A;  3ULR B;  1M3C A;  1JEG A;  3FJ5 A;  4RTX A;  3LH5 A;  1ZX6 A;  3VRY A;  1G83 A;  1Z9Q A;  2DBM A;  2RNA A;  2RQW A;  1K9A A;  2RQR A;  2NWM A;  1HSQ A;  1PHT A;  1ZLM A;  2GGR A;  1JXO A;  1WX6 A;  1SHG A;  2EQI A;  2ROL A;  4Y92 A;  2GNC A;  2LJ0 A;  4CC3 A;  2MCN A;  2YUO A;  1ZUK A;  2EVR A;  1ZUU A;  4DEX A;  2EW3 A;  4KRT A;  3R6N A;  2DM1 A;  2A37 A;  3JV3 A;  1X69 A;  1OPK A;  1RI9 A;  1I1J A;  1M30 A;  4K11 A;  1NM7 A;  3TSW A;  2KNB B;  2DLP A;  1E6G A;  2YT6 A;  3EHQ A;  1PWT A;  3THK A;  1UGV A;  2DVJ A;  4EIK A;  2OJ2 A;  1QKW A;  2LJ3 A;  5IH2 A;  2B86 A;  2DMO A;  1TUD A;  2E5K A;  1WXB A;  1FYN A;  4Z88 A;  2D0N A;  3QWY A;  1ABO A;  3I5S A;  4OMQ A;  4ORZ A;  3PVQ A;  2D8H A;  1Y57 A;  2K79 A;  1AWX A;  2YDL A;  2D8J A;  3I5R A;  1I07 A;  1WXU A;  2BZ8 A;  1H3H A;  3UA6 A;  4F14 A;  2LJ1 A;  1OV3 A;  2A36 A;  2VWF A;  4J9C A;  2LQW A;  2K2M A;  3SHW A;  2J6K A;  2ESW A;  2ABL A;  4J9E A;  1JU5 C;  1ZSG A;  1AVZ C;  1VA7 A;  2X3W D;  1WA7 A;  1XOV A;  1WIE A;  4JJC A;  3PE0 A;  1QLY A;  2K7A A;  4RTW A;  1PRM C;  4OMN A;  1BK2 A;  2KT1 A;  5FWC A;  2YUQ A;  2DF6 A;  2JM9 A;  4AFU C;  2KRS A;  1QWE A;  2M51 A;  5IXB A;  4IIO A;  4CC7 A;  1QWF A;  1UG1 A;  1KIK A;  2O2O A;  1PRL C;  1E7O A;  3H41 A;  4Z89 A;  2CSQ A;  1X2K A;  2CT4 A;  1AEY A;  4J9G A;  1AD5 A;  1GFC A;  1YWO A;  2BTT A;  1UEC A;  1UHF A;  1Y0M A;  4JJD A;  1X43 A;  1AOJ A;  4RTV A;  4LN2 A;  2PNI A;  1X6G A;  2EYW A;  2KXC A;  4FSS A;  4HVU A;  2GTJ A;  2LCS A;  2EGE A;  1BB9 A;  4D8D A;  2NUZ A;  1K0S A;  3I35 A;  3VRZ A;  1GFD A;  1B3Q A;  1H92 A;  3I9Q A;  4F16 A;  2GQI A;  3NMZ C;  1OOT A;  4ESR A;  1ZBJ A;  1QCF A;  1ARK A;  4HVW A;  1SRL A;  3C0C A;  2JTE A;  1K76 A;  1SSH A;  2LMJ A;  3GBQ A;  2KYM A;  4JZ3 A;  1Z9Z A;  3REB B;  1GL5 A;  1AWW A;  2KEA A;  1KJW A;  1QKX A;  2DJQ A;  4Z8A A;  1CKA A;  2FPD A;  4J9F A;  3VS0 A;  1NYF A;  1EFN A;  2DRK A;  2KRO A;  3VS7 A;  5FW9 A;  2L2P A;  2KRN A;  1M3A A;  2OAW A;  1PNJ A;  2KXD A;  2BZY A;  2QDL A;  1ZUY A;  4RTY A;  1UJY A;  2C0T A;  2A28 A;  2MIO A;  1WLP B;  1K1Z A;  3EG2 A;  2JW4 A;  1GRI A;  1TG0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...