1QVPA

C terminal sh3-like domain from diphtheria toxin repressor residues 144-226.
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
87
structure length
87
Chain Sequence
GSHMDAAAPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRDGHITLSHNGKDVELLDDLAHTIRIEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Diphtheria toxin repressor
publication title Prolylpeptide binding by the prokaryotic SH3-like domain of the diphtheria toxin repressor: a regulatory switch.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
total genus 4
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2003-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1qvpA00
1BI2A 3HRUA 3HRSA 1QVPA 1G3WA 1BYMA 1QW1A 2K5FA 4O5VA 2K5IA 1FX7A 1FWZA 4O6JA 1P92A 3E19A 2H3JA 1G3YA 2QQAA 3HRTA 1BI3A 2K5LA 2LX9A 2QQ9A 1G3SA 2GCXA 1G3TA 2QQBA 1BI1A 1U8RA 3GLXA 1BI0A 3MHXA 2K4YA 5CVIA
chains in the Genus database with same CATH superfamily
2D8HA 2NUPA 3NPFA 1MHNA 3F70A 2RJEA 3CCEQ 3CC7A 2Y90A 1KSWA 3LH5A 2FYKA 2XMFA 4C8QF 2DK3A 1HK9A 3HL8A 2JM8A 5GAOm 2ROTA 1S72T 2GCXA 1AVZC 1KC8R 1KD1R 4EMKA 4M7DF 1MGQA 4M78D 2DLPA 3HTRA 1K8AR 4RTVA 5HK0A 3MEAA 1KHIA 1VQKQ 1RLPC 2IVWA 2DTHA 2J6KA 1M8VA 3QO3A 3BE3A 2JZ2A 1PCXA 3OMCA 2D1XA 3EHQA 3RMQA 2B86A 3UT1A 2JW4A 1LPLA 4XTWA 5IT9E 2PTKA 1IZ6A 2BE7D 5DLOA 1VQ6T 4ANJA 1UGSB 1JRIA 2QDYB 4M77D 2RHZA 1Y96A 1RABB 3EG0A 3VS3A 3RDVA 4BI8B 1BIBA 4D8KA 1K9MR 2YRVA 1VIFA 3RESA 3VS6A 2DYIA 2PNIA 5GAOr 1KHCA 2DL4A 3MJXA 2PVOB 4C5EA 4Z88A 4LDXA 3PMTA 3GNFB 4AG2C 2FG0A 3OW2A 2IG0A 2V1RA 4YTLA 1Q86U 4JRPA 3NHNA 5FU6C 2E10A 2P0KA 2FO0A 5J39A 2EQMA 1EX4A 4FSXA 1VQOT 1K73U 3UPUA 2V8JA 3VKIA 2YLCA 1ZSGA 3CCJQ 2CP2A 1D3BA 3OB9A 3VV0A 2DX1A 2E64A 2EPDA 1GRIA 2J06A 4LUDA 4IKFA 4ORZA 2RD1A 4N4IA 1SF9A 1TH7A 2JMCA 3G1JA 1HSQA 3OYYA 2X4XA 2L2PA 2MK5A 3MKDA 3BDUA 1E7OA 1VIEA 1K0SA 5LJ3f 2LDMA 1VQNT 1TXQA 3OYGA 2L89A 3GBQA 4F14A 4KGVB 1QP3A 2VUBA 5KYWA 4ZTFA 1N8RU 2DL3A 2QGGA 2RNAA 5GAMd 2ZPIB 4QKUA 4C5GA 1XJWB 3L2VA 2DETA 3QWXX 2BTTA 1XNIA 4J9GA 1HJDA 2GFAA 2EBPA 4J8OA 3OS0A 1I07A 1PSFA 4JJCA 3D7SB 1NPRA 1YI2T 2RHUA 4OGCA 3VRYA 2KVQG 2OX7A 4M75B 5GAOn 2X4JA 6AT1B 3LX7A 4E47A 2XI9A 4J9IA 4BDZA 1ZUYA 3O8VA 1EFNA 2DPPB 4D6WA 2COYA 4M7AD 2XG8D 3FLGA 3G71Q 2HEQA 2Z0WA 3FRNA 4HVUA 2GTOA 5GMKh 3PGGA 3DB3A 4JZ3A 5LJ5d 3NMZC 3SWNC 5IHIA 5IAYA 5GAN5 2LTOA 2YUPA 1UEBA 1M1GA 2XDDA 1NBEB 1PKTA 3CCUT 1I4K1 2FRYA 1QCNA 1PWTA 2RN8A 3PNWC 2J05A 2CP6A 2RHYA 4BE1A 2LZ6B 2RJCA 3M59A 2QG9B 2YDLA 1FWZA 3RUXA 5D6YA 1D1AA 3CC4A 1WZOA 2CSIA 3BFMA 1OI1A 2E3IA 2IPOB 3HKSA 1S72A 2LVMA 1Z9QA 4QQ6A 2L8DA 4NS5A 2ZPHB 1BCMA 3V7SA 3E2UA 3CPFA 3VYHB 5KYYA 1QVGS 4PFPA 2VGMA 1NM7A 3VJPA 4KGZB 1GFDA 3L2ZA 3REAB 4D8DA 1G3TA 4M78G 1VQ6A 3LWIA 3QBYA 1BI0A 1YIJQ 4KRTA 1M8MA 4BI3A 1W2BS 1W6XA 2A37A 1W2BP 5GANj 1T3SA 5GJWB 2V26A 1VOMA 2EFIA 3TQ7P 1BI1A 4M77G 1QKWA 2FB7A 1KQ1A 3UA6A 1YITT 2L3SA 1FYNA 4QVZA 1VQOA 4JS4A 3QDFA 2KDSA 3M55A 3NTIA 4GLKA 1AZEA 2ZPFB 1QVFA 3RIRA 4C8QA 3JB9J 3E19A 3HRTA 1V1CA 3TREA 2XDPA 4IIMA 2M0OA 5GAOp 2KEAA 4M7DA 1BK2A 4ZGJB 3CPWP 3QWYA 4AFZC 4DOWA 3PFSA 3CMAQ 4E7ZA 4HA8A 4PKCC 4MZTA 3ZL7C 2X9HA 3OYIA 1VQNA 1U3OA 4DBFA 3OYNA 2RA2A 1M2OA 2DXBA 2DM1A 4Z02A 2WSFE 3RKYA 4C8QC 4DOVA 1V76A 4BY6C 2XU8A 3SWNB 3X25B 2CS7A 3EGUA 2QA4T 4KUDK 1Y07A 3OYKA 2DD4A 4FT2A 4DBHA 4EMHA 4PJNA 1PSEA 5CKBA 1KJWA 3M58A 4IUPA 4F7UE 2NYSA 3MCAB 1F1BB 3LWHA 3M0UA 2YWWA 4LD9K 1JJ2P 2LX7A 4HKEA 5D6XA 1YI2A 2P0PA 5L23A 5IHNA 1OOTA 2A7YA 2WACA 3RBBB 3HP9A 2YLBA 2KQWA 2KGTA 5A0GA 2JN0A 1QQJA 3EGXA 3BY7A 4LXCA 7AT1B 1MV0B 4M78F 2YSQA 2EYXA 3EGDA 4EIKA 4OMLA 4IUVA 3JCMe 1X01A 2K5LA 1YCYA 1KQSP 1NZ9A 4OMNA 2A36A 2VGNA 3OS5A 4M7AG 2RQVA 4C8QE 4FYWB 3A8HB 4FL6A 2EKHA 2EQJA 3JSCA 1ZUKA 2MYSA 3CC7T 3I5SA 3P8DA 4M7DE 5KYUB 2K3YA 1N9RA 3H41A 2LNVA 1X6GA 3KBGA 5GAOq 2ZGWA 2RQRA 5CR2A 2MMPA 2C0OA 1UG1A 3AT1B 3CBMA 1UGPB 1RACB 3FB9A 1YCSB 4BUGA 3G4SQ 1R0BG 3CCQT 1UJYA 4LN2A 2ZPBB 2RHXA 3OYJA 1K8AC 1YJ9T 1ZA1B 2DE0X 1B3QA 1VQ5Q 8AT1B 4E6RA 2MF2A 5FRNA 1WI7A 4OMMA 1XOVA 1R0CB 5GAMg 1Q81U 3RMSA 4ZN3A 1OQKA 1D1BA 4PFZA 2KXDA 1Q7YC 3JB9G 3JCMP 5C0MA 4QVDA 2DYBA 2G6FX 4RMOA 2J7IA 2JTMA 2K3BA 4KBMB 4JLGA 4MZPA 1TSFA 2E5QA 4II1A 4A53A 2E65A 1SG5A 5GANe 3X24B 1D0ZA 3CCUQ 2RI3A 4RKUE 3MHXA 3RR6A 1QCOA 3M0RA 1W4SA 4RG8A 1YITA 4RTUA 4ME7A 1WX6A 1ZQ1A 1BU1A 1WFWA 4XTUA 2JTFA 4UC4A 2XDBA 3NTHA 2HNIA 1LCKA 3M57A 1M9SA 5LJ3j 2KT1A 5D6WA 2QQSA 2NLUA 1NJIC 3ASKA 1YJWQ 3VS4A 1MMGA 5GAMf 4A63B 3OW2P 2FRWA 3MP8A 5FLXE 1QCFA 4LDYA 4E7JA 3M4YA 4BE0A 1VYUA 3JV3A 3VUZA 2GF7A 1BB9A 5GAN4 4M7AF 1B07A 4OB1B 4XK8E 2HQEA 2NUTA 5CAIA 4JLIA 4RUGA 3M56A 3L42A 2QA4A 1AWJA 2RI5A 3I56Q 3T9NA 3OYDA 3BDLA 2EIFA 2AHJB 2BZXA 2BIVA 3CQTA 4C5HA 2IIMA 5CCAA 3CCST 2RHIA 1K1ZA 2VASA 1VQ4T 1ABOA 3EFRA 1NPPA 2OAWA 5EG2A 2SEMA 2DZ9A 2A0FB 1HYOA 1D0YA 4M75D 1YJNQ 4PJOB 1VQ8Q 1UB4A 1G8XA 2ZCFB 3IQLA 2O31A 5GAN7 2KE9A 2GGRA 1JQQA 4C92G 2DZCA 2XHCA 1OULA 3QXEB 1SHFA 1RI0A 2DXCA 2EVRA 3HHTB 4JS5A 2EQUA 4FYYB 1BCOA 2LJ0A 1GL5A 1Z9ZA 4PJOG 1VQPT 5IXBA 2DL7A 2KRSA 2SRCA 4A4GA 4PJLA 3J80E 1RAHB 3LGFA 3CMEQ 2ZPEB 3FEOA 1WJSA 4C0GA 3SD4A 1PC0A 3CC4T 1IGUA 4RTYA 3OYEA 4BB7A 5EC7A 3KFVA 2QA4Q 2HQHA 2E5KA 1X27A 4L59A 1HD3A 2AT1B 1SSFA 2DL8A 3CCQA 4IUQA 3UF4A 4MMLA 2K7AA 5KE3A 1H92A 1YJ9A 2K6DA 3JCMd 5IH2A 1Q7YR 1G5VA 2ENMA 2QEXT 1K9AA 3ULRB 4OVAA 4DEYA 2DVJA 1I81A 1M4ZA 4XQ3A 1IGQA 2WSCE 1IREB 4EMKC 3CCVT 1M3AA 3KXTA 1YN8A 1WQ7A 2YUNA 1U1SA 2J6FA 4IUTA 1VQMT 4M78A 3MP6A 2OJ2A 4MDWA 2E3HA 3S6WA 1TG0A 2RK1A 3JCMJ 1N6AA 3QYGB 4OMOA 2CREA 3NFCA 3TU4K 3MP1A 3CC2Q 3QSUA 1H3ZA 3S3MA 4JRIA 2DMOA 2BE9B 4OGEA 1VQ9T 2KR3A 3I55T 2NUZA 2VXEA 3CC7Q 2MWPA 2O9SA 2AK5A 4M77A 4O6JA 1NJIR 4M78C 4HCBA 4PK4A 4FYXB 3A8LB 1WPYA 3C95A 3JCMQ 2M51A 1AWXA 5LJ3e 4E7LA 4XAXB 2NWMA 3J81E 2P84A 4LDWA 2YT6A 3HRSA 2BZYA 4XU0A 1QMCA 1CKAA 1XTDA 1JXOA 4IURA 2KSSA 1I5OB 3VU3C 1QVFP 3PIOA 3OYLA 2CP3A 3LW5E 3PVLA 5GANd 1T0HA 2FPDA 5CKDA 4FIBA 3GOXA 1GFCA 1TWBA 1PM3A 1M90U 5IHKA 3MEWA 1M1KC 1B34A 3CCSA 5FRMA 3CCLT 1RLQC 4JJDA 3TCJA 2O4XB 1VQ4A 4ZTJA 1KFZA 4J5YA 2OI3A 4M78E 2EGCA 2KNBB 4IIOA 2EQKA 3INZA 5CVIA 4DQ2A 2M9UA 2PZ1A 5FU7C 2XD0A 1QWFA 1Q95G 2FPEA 2K5IA 2L5QA 2L3RA 2LJ3A 3M0TA 2NUPB 2HBPA 2QQAA 4FU6A 2HKQB 2CUBA 4KUIA 4M75G 2DIQA 2LC4A 3EG2A 4J9HA 1UE9A 1M1FA 1M3CA 1VQPA 4M77E 1VQLT 1K73R 2Y4YA 1D0XA 1T0JA 3EFOA 4HVWA 4EMKB 1T3LA 4M7AA 3THKA 3L2WA 1VQ7A 4C0DC 5GMKj 2OTJT 1X43A 3A5ZB 2KRNA 2KRMA 2DERA 4J83A 2D6FA 3EG9A 5ECAA 2O9VA 4JZ4A 2CKKA 5FU6B 1YBYA 2GQIA 2ZAEA 5DY9A 3JB9D 3MEVA 2K79A 1WDXA 1AZGB 1Y96B 4BDYA 4Y28E 1OPLA 2QQRA 2A3LA 1M2VA 4M7AC 4C0ZA 1IHWA 1BBZA 2JXBA 3GF5A 2QEXA 2JMAA 3QUIA 1NEBA 3SB2A 2AKKA 2FEIA 4B9XA 1ZUUA 3NGPA 3OY9A 3H6ZA 5GAMh 3CCVA 4BI4A 3QJYA 2DBKA 4RTTA 4OMFB 1ZLMA 1VQMA 4LDVA 3L1AA 3OSVA 2E70A 4OB2B 3UDCA 1PNJA 3JCMV 1ZSZA 1G2BA 3E9GA 2DJZA 3ZFJA 3CCRT 1UTIA 3GLXA 2HZYA 3SDZA 4XTYA 4PNOA 2DIGA 1VQ9A 3I55A 2OTLT 2RJFA 4J6WA 2YRDA 4CRIA 1WLPB 3CC4Q 3CPWS 1RADB 1D09B 3C12A 5GJVB 2QTXA 4LNPA 1S72Q 1Y57A 4KULA 4WCIA 5KYWB 3P8BB 4HCZA 4M7AE 1Q82U 2RQWA 2P4RA 4A4HA 5KYXA 4FM4B 1UHFA 1RUWA 1NLPC 4DA4A 2COWA 2JTEA 1JXMA 2CSQA 1QP2A 4M75F 5FU7B 5FROA 2CZ0B 2I2LA 2L3PA 2MCNA 3JB9H 2O2OA 1BI3A 1WHLA 2L0AA 1Y0MA 3OS1A 1VQ6Q 2O01E 3QJ6A 2EQIA 1M1KR 3HSBA 4DEXA 4ELZC 4M7DC 1BI2A 1O75A 3WXMB 1JJ2S 3CCET 1MMAA 3LLRA 1WHMA 4X9CA 5KH6A 4C92D 4WTOB 3JAME 1WJQA 3CCLA 1AHJB 1G3YA 2DEUA 9ATCB 1SSHA 1TU0B 3JCMg 4C0DB 2V8IA 3I35A 5L8RE 5LJ3d 4PJOD 1LVKA 4RCCA 3ZBDA 1VQKT 2HKNA 3O5ZA 3CEYA 1VQOQ 3I55Q 4EMGA 1RAAB 1Q81C 4O5VA 2QASA 1KQSS 5LL6S 2KT8A 2DBMA 3VYGA 2XICA 1ACMB 2QGFB 2C06A 3CCMT 1NG2A 2CUDA 3U23A 4C92A 1NLOC 2CDTA 1OYXA 1IO6A 2ABLA 2DVEA 1X75C 1TTHB 4BE2A 1VQLA 2MIOA 3E1SA 3FJ5A 1QVPA 1ZBXA 5KYNA 1QW1A 2QYZA 1UJ0A 5A0DA 1VQNQ 4BACA 3JB9I 4HVVA 4M4ZA 4AFSC 5HK3A 4M77F 1TUDA 3EH1A 2KXCA 4EDUA 3RERA 1I1JA 5KYYB 5CQXA 1JU5C 1RAIB 5J3BA 2OTJA 5DLQE 3SFMA 2JJ9A 4C0FA 5GMKe 5HY6A 2QK0A 4F7UB 2LQWA 2DL5A 1WQWA 3OYAA 2E41A 1QVGA 4GBQA 2F2XA 3M9QA 1UGVA 3CCLQ 3M53A 2RQUA 3DB4A 3JCMX 3MO8A 2O88A 1YI2Q 3CD6T 4EPCA 1S1NA 3OYBA 1PKSA 4OB3B 1AWOA 3OMGA 2HL3A 4F7UG 5GANg 2AZSA 5J26A 4QQGA 1W2BA 1H641 2RMOA 1YHQA 2HBWA 2BZ8A 3PTAA 5FWBA 3TSWA 2EYYA 1OPKA 2E4HA 4C8QB 4BY6B 3S3OA 1OEBA 2KYBA 5A2QE 3CCRA 2DRMA 2X3XD 4Z89A 4M7DB 2F2VA 4KT0E 1BIAA 2HL5C 2OTLA 3A8OB 3I5RA 2I0NA 4FSSA 3M0PA 5LJ5g 3OW2S 4XTZA 4CI0C 3L2RA 1TS9A 2FPFA 2LP5A 4DBQA 3G71T 4ELYC 2Y4XA 2ZZDA 1OU8A 4N4HA 2RPNA 1VUBA 3DKMA 2ROLA 2MI6A 4N0AA 1I8FA 2QAZA 2VKNA 3CXCA 3HFNA 1OZ3A 1GCQA 4KGXB 4L5GA 2CGHA 1ZA2B 4X9DA 1JEGA 3X26B 1IRXA 1AEYA 1GBQA 2EYWA 1KC8U 1KD1U 2RF0A 2CH4W 1SHGA 1K8AU 4PFOA 5HKCA 2LNHB 2DNUA 1YWOA 5CIUA 5CQYA 3RKXA 1W1FA 2AKLA 5CKFA 3CCEA 4LE9A 3RNJA 3JCMc 3URGA 2PVDB 1ARKA 1UFFA 3EGXB 1SEMA 1C1AA 4C5IA 3PVQA 5LJ5f 3L2UA 1PHTA 1GCPA 4J9CA 1GCQC 1Q81R 1R8OB 4J6XA 3CCRQ 3EGDB 3J7AF 1WJRA 2V8KA 1VQKA 1YITQ 1K9MU 1MV3A 2PVGB 4V2SA 1SRMA 2P0QA 5FW9A 2FL7A 5GAN8 1UHCA 1K76A 3G6ET 2DXUA 3G7ZA 2YXYA 1YWPA 3QZ5B 4P5NA 3ER0A 3V8LA 3CCMA 3E9FA 4RTXA 3JB9F 4AFUC 5I2SA 1Y71A 2CH4A 3FJPA 1YIJT 3JCMb 1AT1B 1WHJA 4PLIA 2MAMA 2O4XA 3M5AA 1Q86C 1WYXA 2DTOA 1GXIE 4M75A 2DO3A 4J9DA 3LYIA 4F17A 3V8JA 1K73C 2XK0A 3EG3A 5AYFA 4QVCA 2PUKB 1VQ7T 3CBOA 3OYMA 4LUEA 1I5LA 1Y7XA 2E1HA 1H8KA 1OX8A 2L3QA 2VWFA 4A4EA 2YHTA 2AZVA 4PL6A 3AHUA 1OU9A 1MNEA 2DF6A 3GNGA 2DJQA 3CCJA 1N5ZA 1FX7A 1LJOA 3H0HA 4M75C 2XIDA 2BKDN 2QQ9A 3CD6A 1N9SA 3CMAT 1YFNA 4XU3A 1N8RC 2VC8A 3PE0A 3V7RA 1PG5B 2KAFA 2DTIA 1X6OA 4B9WA 3PIPA 4Q5WA 2QTVA 3QG1A 1X69A 4HXJA 2QI2A 1QWEA 1M90C 2EJ9A 5KE2A 3CCMQ 1WHKA 2ECZA 1WIEA 4XU1A 5GAN6 3QHSA 2PU9B 2QQBA 2KROA 1FMKA 3FIFA 2K4YA 3DLMA 3PMIA 3QDRB 2EW3A 5LJ3g 4ZNXA 4ZGDB 5I2MA 1X2QA 1VYVA 2M1HA 1DJ7B 1RI9A 2EWNA 2H3EB 4M75E 4R56A 2F69A 4JDSA 1IXDA 4C92F 3WVDB 3H9NA 4FW1A 4MDXA 2CYZB 3HRUA 2NUTB 1XQHA 3G71A 2E12A 3CCQQ 1G83A 3R6NA 3VS1A 2DKGA 4IUUA 4PJOF 1QVFS 3SEMA 4J9FA 1YJ9Q 2LCCA 3L2QA 4M77C 3CD6Q 2DAQA 3LGLA 3A98A 1PD1A 2FVUA 2P4TA 1YNZA 2RJDA 1ABQA 1CSKA 2JNGA 2B8AA 4RG2A 2CZ6B 4RTWA 4CC3A 1V29B 3P8HA 2KYMA 4GY5A 1NEGA 1WA7A 2H8HA 5FWCA 2JUFA 2LT4A 2D8JA 2DA9A 3JCMh 2YUQA 1M27C 3G4ST 2D0QB 1G3WA 3ME9A 3SWNA 2C0TA 1JBMA 3G6EA 1OV3A 1VQ5T 1BKBA 3OYCA 4PJMA 4J9EA 3TVTA 1Q86R 1M5Q1 4E7KA 3OSSC 2K57A 4K11A 3DLLA 4ZN1A 1U8RA 2ESWA 2ED0A 3OA6A 2RO0A 3QIIA 4NL2A 1YIJA 2KI7A 4E7SA 5GMKm 1OX9A 2K5FA 1UGQB 1K4US 2JOYA 3EFSA 2LQ8A 1P92A 3C0CA 4A4FA 2FZCB 4OMPA 4A54A 4R55A 4JUVA 2CT4A 3C94A 1ZHIA 4AFQC 2KBTA 2K9GA 2X3WD 3ZEHA 1LNXA 1BYMA 2EGAA 4CC2A 3WVEB 3M54A 3A8GB 3CCSQ 1Q82C 2GNCA 4GLMA 3RKWA 4FCYA 2JT4A 2EJFA 2GQVA 1N8RR 1VQ4Q 4JPBW 5A0LA 4ATOA 3OQ5A 4M78B 2F2WA 1YJWT 2R5AA 1M1KU 2M0YA 3CMAA 2CZ7B 3M4GA 5D7UA 5KYUA 2HAXA 2ED1A 4VUBA 1M90R 1ZX6A 2RB6A 4AMCA 8ATCB 5GANh 1YHQT 1PRLC 2DD5A 3G6EQ 1HXDA 5HCKA 1KIKA 1RL2A 4CC4B 2VV5A 2GFUA 4F7UA 3QKJA 1NE8A 2EJGA 1QVGP 4QQDA 1D3BB 1WHGA 4M77B 3C4SA 3I56T 1RAEB 3A8MB 1VQPQ 2X51A 5CKEA 4C8QD 3N5BB 2DXTA 2R57A 1QKXA 4Z8AA 2A28A 2GBQA 4OP0A 4F04B 5I22A 2G3RA 2LQKA 3I9QA 3GIBA 4M7DD 2R58A 2FZGB 2ATCB 4J6YA 5CK9A 3UA7A 5GAMj 1VQ7Q 2F1LA 1YJNT 3TSZA 4Y91A 1VQ8T 1EIFA 1UGRB 2LMJA 2RH2A 1N27A 1MMDA 1ZSZC 5LJ5h 1M3BA 2W0ZA 3FDRA 1AWWA 5GAN2 2LT1A 2M02A 1SKUB 1IB8A 3VUBA 5IXFA 2LJ1A 1W70A 4PJJA 1D1CA 2YRCA 4HT8A 1WXBA 3H8ZA 1B34B 4JRQA 2QEXQ 4NL3A 1VYTA 2OAUA 4ZGEB 1WNLA 1A0NB 3EAEA 4OF1A 3CCVQ 3CMET 2QXFA 5LJ5j 2F5TX 2X4YA 4OMQA 1QLYA 2W10A 3GP8A 1VQMQ 2X4WA 4MMKA 3CXCS 1JO8A 3S3NA 4JJBA 1SPKA 3NTKA 3CXCP 2CP5A 2V1QA 1JB0E 1X6BA 3EG1A 2RI2A 1X2KA 4J7FA 3VRZA 3G4SA 1VA7A 1CKBA 4CC7A 3GPLA 1VQ9Q 1RAGB 3UATA 2RK2A 2XKOC 2LQNA 3MPUB 1SRLA 3OBYA 5CKHA 3EFOB 1VQ5A 1NYFA 4HT9A 4KH0B 2KMTA 1U5SA 2CZ1B 4M7AB 3OS2A 2D0NA 1E6HA 2MPXC 1PRMC 2K2VA 2MOXA 3BW1A 4FT4A 1O9SA 1IHVA 4FW2A 3SHWA 4L6V5 4PJOA 3EG9B 1C0MA 4RCBA 4X1VA 2QDLA 1FXXA 1MUZA 5GAOl 2E6ZA 1YP5A 3V7CA 3CC2T 2C0IA 1UDLA 2MWOA 2R5MA 2EYQA 3JCMf 5GMKi 1Q82R 3CCUA 1M2VB 2HDAA 4C92C 1E6GA 3META 4QT7A 4AG1C 1R77A 1AD5A 3CCJT 3R6OA 1WXUA 3OYHA 5I11A 1NYGA 1RAFB 2H3JA 4AT1B 3REBB 2ZPGB 4PJOC 5C6SA 5GAN3 2LX9A 2FHDA 3VS0A 1ZBJA 1FMVA 1YJWA 1B7TA 1FMWA 2BUDA 3MEUA 5CO7A 4MZMA 4OB0B 1ZSZB 3OBWA 2JM9A 1MNDA 1KC8C 2CP0A 1KD1C 4LDUA 1GBRA 4QW2A 3H0IA 1UECA 2HQXA 1K0XA 3EH2A 2CT3A 5DM7R 3QPHA 3UWNA 2WSEE 1UUEA 3OYFA 3A1PA 3LH0A 5M9OA 2VXFA 3I56A 2RQTA 1VQLQ 4F16A 2FZKB 2CP7A 2EKOA 2EYZA 4C92E 1KK7A 1EZZB 5LJ3h 2LRQA 2RM4A 1WHHA 3H0FA 3CPWA 3VS7A 4KH1B 4NOYA 4WF2A 3JRZA 5KYXB 1K9MC 4PLLA 1PD0A 5KCOA 1TOVA 2A08A 5GAMe 2COZA 2OTJQ 1YJNA 2F5KA 2J6OA 4LD6A 1VQ8A 2VB6A 4PJOE 2LCLA 4C8QG 4JJNK 2DRKA 4ESRA 5GANf 2DEQA 1M30A 3VS2A 4M7DG 4XTVA 2HSPA 2AIRB 1H3HA 3EHRA 4E7HA 3HFOA 2VVKA 5AT1B 2D9TA 1KG1A 3KUFA 4J7IA 4BD3A 2HCKA 3X28B 4J9BA 1I0CA 4XTXA 1JJ2A 2HMAA 3QYHB 2K3XA 5IN1A 1WXTA 3CMEA 1YHQQ 1MMNA 2DFUA 2X35A 5LJ5e 4N0AC 4DBRA 1WGSA 4E7IA 4Y92A 1G3SA 1Q7YU 2PUOB 1KQ2A 1J3TA 1U06A 2DILA 4B6MA 1OZ2A 1U1TA 2JS0A 5GMKl 4C92B 1AOJA 2VYTA 3VS5A 3FC3A 2HD0A 1KQSA 4HCCA 3M0QA 2OTLQ 2EGEA 3V8KA 3TEEA 4F7UF 3PT9A 2EAYA 2LCSA 3JCMW 4JRKA 2GTJA 4XU2A 4HCKA 4X34A 2KY9A 4A4KA 2PQWA 3M0SA 1TUGB 4E2FB 4RTZA 1LOJA 3X20B 1C6VX 4TVRA 2M16A 3Q1JA 1NJIU 2HSEB 3HPWA 5KCHA 4FYVB 4R0KA 5I21A 2JVVA 1TUCA 2KK4A 2E6NA 2JS2A 2YUOA 3CBPA 3QZ9B 3CC2A 2K2MA 4N4GA
chains in the Genus database with same CATH topology
4A4HA 3G4ST 1Q7YC 3JB9G 4FM4B 2D0QB 1MHNA 1G3WA 3F70A 3JCMP 3ME9A 5C0MA 4DA4A 4QVDA 1QP2A 2RJEA 4M75F 5FU7B 3SWNA 4PJOD 3CC7A 2Y90A 2CZ0B 5FROA 4RMOA 1JBMA 3G6EA 1VQ5T 2FYKA 1BKBA 4C8QF 2I2LA 2DK3A 2JTMA 3OYCA 1HK9A 3HL8A 4KBMB 4JLGA 3JB9H 5GAOm 1BI3A 4MZPA 1M5Q1 3OS1A 4E7KA 1S72T 3OSSC 2GCXA 2E5QA 4II1A 2K57A 4A53A 2E65A 4EMKA 1MGQA 2O01E 3QJ6A 4M78D 5GANe 3X24B 4ZN1A 3DLLA 4M7DF 3HSBA 2RI3A 4RKUE 5HK0A 3MHXA 1U8RA 3MEAA 4ELZC 3OA6A 1KHIA 4M7DC 2RO0A 3QIIA 1BI2A 4NL2A 2IVWA 1W4SA 1YIJA 1O75A 2DTHA 4RG8A 1YITA 5GMKm 3QO3A 3WXMB 1M8VA 1JJ2S 2JZ2A 3CCET 3LLRA 2K5FA 1UGQB 3OMCA 4X9CA 4ME7A 5KH6A 2JOYA 4C92D 1ZQ1A 3EFSA 2LQ8A 3RMQA 1P92A 4XTUA 3JAME 2JTFA 1WJQA 3UT1A 3CCLA 4A4FA 1AHJB 1G3YA 4UC4A 4XTWA 5IT9E 2XDBA 3NTHA 1IZ6A 2HNIA 3M57A 1M9SA 4A54A 1NJIC 5DLOA 5LJ3j 1VQ6T 4R55A 3JCMg 4JUVA 5D6WA 2QQSA 4C0DB 3C94A 2NLUA 1UGSB 2V8IA 1ZHIA 3ASKA 5L8RE 5LJ3d 1JRIA 2QDYB 4M77D 4RCCA 2RHZA 1Y96A 3ZBDA 5GAMf 1VQKT 3CEYA 3MP8A 4BI8B 1BIBA 5FLXE 3ZEHA 1LNXA 2YRVA 4LDYA 1VIFA 3M4YA 4E7JA 3RESA 4BE0A 1BYMA 4EMGA 1Q81C 3VUZA 3WVEB 3M54A 3A8GB 4O5VA 1Q82C 1VQLT 2GF7A 3RKWA 1KHCA 5GAOr 1KQSS 5LL6S 2PVOB 5GAN4 4M7AF 4C5EA 2EJFA 2GQVA 3VYGA 2XICA 4LDXA 3PMTA 3GNFB 4OB1B 4XK8E 5A0LA 3CCMT 2C06A 4ATOA 3OQ5A 2IG0A 3OW2A 2HQEA 4YTLA 1Q86U 4JRPA 5CAIA 4M78B 4C92A 4JLIA 3M56A 3L42A 2QA4A 5FU6C 1OYXA 1YJWT 2E10A 2P0KA 2RI5A 2R5AA 5J39A 1M1KU 2DVEA 2EQMA 3T9NA 3BDLA 3OYDA 1X75C 2EIFA 3CMAA 4FSXA 2AHJB 2CZ7B 3M4GA 4BE2A 1VQOT 3E1SA 1K73U 1VQLA 2HAXA 3UPUA 2V8JA 2BIVA 4VUBA 3VKIA 4C5HA 1QVPA 1ZBXA 2YLCA 5CCAA 1QW1A 2RHIA 3CCST 2RB6A 5A0DA 5GANh 4BACA 1D3BA 1YHQT 3OB9A 3VV0A 2DD5A 2E64A 1HXDA 3JB9I 1VQ4T 5HK3A 1RL2A 2VV5A 4M77F 2GFUA 4F7UA 3QKJA 3EFRA 1NPPA 5EG2A 4EDUA 1NE8A 2DZ9A 2EJGA 3RERA 4IKFA 4QQDA 5CQXA 4M75D 2RD1A 4N4IA 5DLQE 5J3BA 1D3BB 4M77B 3SFMA 3C4SA 1TH7A 4C0FA 5GMKe 3I56T 5HY6A 3A8MB 1UB4A 2X4XA 3OYYA 2ZCFB 5CKEA 4C8QD 4F7UB 3BDUA 1VIEA 5GAN7 3N5BB 2DXTA 2R57A 5LJ3f 1WQWA 2LDMA 4OP0A 1VQNT 3OYAA 2G3RA 2LQKA 4C92G 2E41A 1QVGA 3OYGA 3GIBA 2DZCA 4M7DD 2XHCA 3M9QA 2L89A 2R58A 3M53A 3QXEB 1QP3A 2VUBA 4J6YA 5CK9A 4ZTFA 1N8RU 3DB4A 3JCMX 3MO8A 5GAMj 1RI0A 2DXCA 3CD6T 3HHTB 1YJNT 4JS5A 2EQUA 4EPCA 5GAMd 3OYBA 4OB3B 2ZPIB 4Y91A 1VQ8T 4C5GA 1EIFA 1UGRB 2RH2A 4PJOG 3L2VA 1VQPT 3OMGA 1N27A 5LJ5h 4A4GA 1XNIA 3FDRA 5GANg 4F7UG 5GAN2 2GFAA 3J80E 3LGFA 4J8OA 5J26A 2LT1A 4QQGA 3OS0A 1W2BA 4PJOB 1H641 1PSFA 2ZPEB 3FEOA 1YHQA 1WJSA 4C0GA 3SD4A 3PTAA 3VUBA 3CC4T 1NPRA 1YI2T 2RHUA 4OGCA 3OYEA 4BB7A 2KVQG 4M75B 4HT8A 5GAOn 2X4JA 3H8ZA 1B34B 3LX7A 4E47A 4JRQA 2XI9A 4BDZA 4C8QB 4NL3A 3O8VA 4BY6B 2DPPB 4D6WA 3S3OA 4L59A 2OAUA 4ZGEB 4M7AD 5A2QE 3CCRA 2XG8D 1WNLA 3FLGA 3EAEA 4OF1A 3FRNA 4M7DB 3CMET 1SSFA 5GMKh 3CCQA 2QXFA 4IUQA 4KT0E 3PGGA 5LJ5j 4MMLA 2F5TX 2X4YA 3DB3A 1BIAA 3GP8A 2OTLA 2X4WA 4MMKA 5LJ5d 3A8OB 5KE3A 3CXCS 3SWNC 3S3NA 1YJ9A 3JCMd 5IAYA 5GAN5 4KUDK 1G5VA 2LTOA 5LJ5g 1UEBA 1M1GA 2XDDA 2QEXT 3OW2S 3NTKA 4OVAA 4XTZA 4CI0C 1I81A 3CCUT 1M4ZA 4XQ3A 2WSCE 3L2RA 1I4K1 1JB0E 2RI2A 1IREB 3G71T 4ELYC 4EMKC 3PNWC 3CCVT 2Y4XA 2ZZDA 4J7FA 3KXTA 1WQ7A 3G4SA 4N4HA 1VUBA 3DKMA 2RHYA 3GPLA 1U1SA 2MI6A 4BE1A 4IUTA 4N0AA 2RK2A 4M78A 3M59A 2RJCA 2XKOC 1I8FA 3MP6A 1VQMT 3RUXA 1FWZA 3CXCA 4MDWA 3OBYA 5CKHA 3HFNA 5D6YA 3S6WA 3CC4A 2RK1A 3JCMJ 1N6AA 1OZ3A 1VQ5A 3BFMA 4HT9A 3QYGB 2KMTA 3NFCA 4L5GA 2CGHA 4X9DA 1OI1A 2CZ1B 3X26B 3TU4K 3HKSA 3MP1A 1S72A 4M7AB 2LVMA 3QSUA 1KC8U 1H3ZA 1KD1U 3OS2A 3S3MA 1K8AU 4JRIA 4QQ6A 5HKCA 5CIUA 2K2VA 2L8DA 4NS5A 2ZPHB 5CQYA 4OGEA 3RKXA 1VQ9T 3V7SA 3CPFA 3VYHB 3BW1A 3I55T 2VXEA 4FT4A 1O9SA 5CKFA 3CCEA 4L6V5 2MWPA 3JCMc 4PJOA 4RCBA 3URGA 2PVDB 4M77A 4O6JA 1QVGS 1FXXA 2VGMA 4M78C 4HCBA 5GAOl 3A8LB 1WPYA 2E6ZA 3VJPA 3V7CA 4C5IA 3C95A 3L2ZA 3CC2T 5LJ5f 3JCMQ 3L2UA 1G3TA 2MWOA 4M78G 1VQ6A 2R5MA 2EYQA 3JCMf 3LWIA 1R8OB 4J6XA 3QBYA 5GMKi 5LJ3e 3CCUA 4E7LA 1BI0A 4C92C 3J7AF 1WJRA 4XAXB 2V8KA 3META 3J81E 1VQKA 4LDWA 3HRSA 1K9MU 2PVGB 3CCJT 4V2SA 3R6OA 4XU0A 3OYHA 2P0QA 2FL7A 4BI3A 5GAN8 3G6ET 1W2BS 2DXUA 3G7ZA 1XTDA 2H3JA 2ZPGB 4PJOC 4IURA 5C6SA 2KSSA 5GAN3 3QZ5B 4P5NA 3ER0A 2LX9A 3V8LA 3CCMA 3E9FA 3VU3C 5GANj 2FHDA 3PIOA 3OYLA 3JB9F 5I2SA 1Y71A 3LW5E 5GANd 2EFIA 3FJPA 5CKDA 1BI1A 4M77G 1YJWA 2FB7A 1YIJT 4FIBA 3JCMb 1KQ1A 2BUDA 3M5AA 4PLIA 2MAMA 2O4XA 3MEUA 3GOXA 1YITT 5CO7A 4MZMA 4QVZA 1VQOA 1Q86C 4OB0B 2DTOA 4JS4A 3OBWA 1GXIE 1M90U 2KDSA 3M55A 3NTIA 4M75A 4GLKA 1KC8C 1KD1C 2DO3A 3MEWA 4LDUA 3LYIA 2ZPFB 1M1KC 1B34A 4QW2A 3CCSA 5FRMA 1QVFA 3V8JA 3RIRA 3CCLT 2HQXA 4C8QA 3JB9J 1K73C 2XK0A 3E19A 3TCJA 5AYFA 2O4XB 4QVCA 1VQ4A 3HRTA 2PUKB 1VQ7T 4ZTJA 3TREA 3CBOA 3OYMA 2XDPA 2M0OA 5GAOp 5DM7R 3QPHA 3UWNA 1I5LA 2WSEE 1Y7XA 4ZGJB 4J5YA 4M7DA 2E1HA 3OYFA 4M78E 4DOWA 3LH0A 3PFSA 2VXFA 5M9OA 3I56A 4A4EA 2EQKA 2YHTA 4PL6A 3AHUA 3INZA 4HA8A 4PKCC 5CVIA 4DQ2A 2M9UA 5FU7C 4MZTA 3GNGA 2XD0A 3OYIA 3CCJA 2EKOA 2K5IA 1VQNA 4C92E 5LJ3h 1FX7A 1LJOA 2L5QA 2LRQA 2RM4A 4M75C 3CPWA 2XIDA 2L3RA 2RA2A 2DXBA 4NOYA 3OYNA 4WF2A 3JRZA 2WSFE 4Z02A 1K9MC 2HBPA 2QQAA 2BKDN 3RKYA 4C8QC 4PLLA 4DOVA 4FU6A 4BY6C 5KCOA 2QQ9A 2XU8A 3SWNB 3X25B 2CS7A 2QA4T 5GAMe 4KUIA 4M75G 1Y07A 2DIQA 2LC4A 1YJNA 1N9SA 2F5KA 3CD6A 3OYKA 4LD6A 1M1FA 3CMAT 2DD4A 4FT2A 4EMHA 1VQ8A 4PJOE 2LCLA 4XU3A 4M77E 1VQPA 2VC8A 4C8QG 4JJNK 1PSEA 1N8RC 3V7RA 5CKBA 2KAFA 2Y4YA 3M58A 2DTIA 4IUPA 1X6OA 5GANf 4F7UE 2DEQA 4B9WA 3MCAB 4EMKB 3LWHA 4M7DG 4XTVA 3PIPA 4LD9K 4M7AA 4Q5WA 3QG1A 2QI2A 1M90C 2EJ9A 4HKEA 3HFOA 5KE2A 5D6XA 3L2WA 4E7HA 1VQ7A 1YI2A 4C0DC 2P0PA 2D9TA 5GMKj 2OTJT 3KUFA 1KG1A 4J7IA 4XU1A 3A5ZB 4BD3A 5GAN6 3QHSA 2PU9B 3X28B 2QQBA 2A7YA 2WACA 4J83A 2D6FA 3HP9A 2YLBA 3FIFA 2KQWA 4XTXA 2CKKA 2K4YA 5FU6B 3DLMA 1YBYA 3PMIA 3QDRB 1JJ2A 5A0GA 5LJ3g 2JN0A 3QYHB 5DY9A 4ZGDB 3BY7A 3JB9D 2K3XA 3MEVA 5I2MA 5IN1A 3CMEA 1Y96B 4M78F 4BDYA 4Y28E 2X35A 2QQRA 5LJ5e 2A3LA 2M1HA 4N0AC 1WGSA 4IUVA 3JCMe 4M7AC 4C0ZA 1DJ7B 1X01A 2K5LA 4E7IA 1YCYA 1G3SA 1NZ9A 2EWNA 1Q7YU 4M75E 2PUOB 2F69A 4JDSA 4R56A 1KQ2A 2OTJA 3GF5A 2QEXA 3QUIA 4C92F 3WVDB 3SB2A 2VGNA 3OS5A 4B9XA 4M7AG 4C8QE 1OZ2A 3A8HB 4MDXA 4FL6A 1U1TA 2CYZB 2EQJA 3HRUA 3OY9A 1XQHA 3JSCA 5GMKl 4C92B 3H6ZA 3G71A 2VYTA 2E12A 5GAMh 4BI4A 3QJYA 3CCVA 3FC3A 2HD0A 3CC7T 1KQSA 4M7DE 3P8DA 4HCCA 4OMFB 2DKGA 4IUUA 1VQMA 4LDVA 4PJOF 3L1AA 1QVFS 2K3YA 3OSVA 1N9RA 2E70A 4OB2B 2LNVA 2LCCA 3UDCA 3L2QA 3KBGA 4M77C 3V8KA 3TEEA 4F7UF 3JCMV 5GAOq 2ZGWA 3PT9A 2EAYA 5CR2A 2MMPA 2DAQA 3CBMA 3E9GA 2DJZA 1UGPB 3ZFJA 3FB9A 3CCRT 3JCMW 3LGLA 3GLXA 4JRKA 2FVUA 2P4TA 4XU2A 4BUGA 3SDZA 4XTYA 4X34A 2KY9A 3CCQT 2RJDA 4PNOA 4A4KA 2DIGA 2PQWA 1VQ9A 2ZPBB 3I55A 2OTLT 1LOJA 2RHXA 2RJFA 4TVRA 3X20B 4J6WA 2M16A 3OYJA 3Q1JA 1K8AC 4CRIA 1YJ9T 2JNGA 1NJIU 3CPWS 2B8AA 3HPWA 4RG2A 5KCHA 5I21A 3C12A 2MF2A 2JVVA 2CZ6B 2KK4A 5FRNA 2E6NA 2QTXA 1V29B 3P8HA 1XOVA 3CBPA 3QZ9B 3CC2A 4GY5A 4KULA 5GAMg 3P8BB 4HCZA 1Q81U 3RMSA 4ZN3A 2JUFA 2LT4A 4N4GA 1Q82U 4M7AE 3JCMh
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BI2 A;  3HRU A;  3HRS A;  1QVP A;  1G3W A;  1BYM A;  1QW1 A;  2K5F A;  4O5V A;  2K5I A;  1FX7 A;  1FWZ A;  4O6J A;  1P92 A;  3E19 A;  2H3J A;  1G3Y A;  2QQA A;  3HRT A;  1BI3 A;  2K5L A;  2LX9 A;  2QQ9 A;  1G3S A;  2GCX A;  1G3T A;  2QQB A;  1BI1 A;  1U8R A;  3GLX A;  1BI0 A;  3MHX A;  2K4Y A;  5CVI A; 
#chains in the Genus database with same CATH topology
 2D8H A;  2NUP A;  3NPF A;  1MHN A;  3F70 A;  2RJE A;  3CCE Q;  3CC7 A;  2Y90 A;  1KSW A;  3LH5 A;  2FYK A;  2XMF A;  4C8Q F;  2DK3 A;  1HK9 A;  3HL8 A;  2JM8 A;  5GAO m;  2ROT A;  1S72 T;  2GCX A;  1AVZ C;  1KC8 R;  1KD1 R;  4EMK A;  4M7D F;  1MGQ A;  4M78 D;  2DLP A;  3HTR A;  1K8A R;  4RTV A;  5HK0 A;  3MEA A;  1KHI A;  1VQK Q;  1RLP C;  2IVW A;  2DTH A;  2J6K A;  1M8V A;  3QO3 A;  3BE3 A;  2JZ2 A;  1PCX A;  3OMC A;  2D1X A;  3EHQ A;  3RMQ A;  2B86 A;  3UT1 A;  2JW4 A;  1LPL A;  4XTW A;  5IT9 E;  2PTK A;  1IZ6 A;  2BE7 D;  5DLO A;  1VQ6 T;  4ANJ A;  1UGS B;  1JRI A;  2QDY B;  4M77 D;  2RHZ A;  1Y96 A;  1RAB B;  3EG0 A;  3VS3 A;  3RDV A;  4BI8 B;  1BIB A;  4D8K A;  1K9M R;  2YRV A;  1VIF A;  3RES A;  3VS6 A;  2DYI A;  2PNI A;  5GAO r;  1KHC A;  2DL4 A;  3MJX A;  2PVO B;  4C5E A;  4Z88 A;  4LDX A;  3PMT A;  3GNF B;  4AG2 C;  2FG0 A;  3OW2 A;  2IG0 A;  2V1R A;  4YTL A;  1Q86 U;  4JRP A;  3NHN A;  5FU6 C;  2E10 A;  2P0K A;  2FO0 A;  5J39 A;  2EQM A;  1EX4 A;  4FSX A;  1VQO T;  1K73 U;  3UPU A;  2V8J A;  3VKI A;  2YLC A;  1ZSG A;  3CCJ Q;  2CP2 A;  1D3B A;  3OB9 A;  3VV0 A;  2DX1 A;  2E64 A;  2EPD A;  1GRI A;  2J06 A;  4LUD A;  4IKF A;  4ORZ A;  2RD1 A;  4N4I A;  1SF9 A;  1TH7 A;  2JMC A;  3G1J A;  1HSQ A;  3OYY A;  2X4X A;  2L2P A;  2MK5 A;  3MKD A;  3BDU A;  1E7O A;  1VIE A;  1K0S A;  5LJ3 f;  2LDM A;  1VQN T;  1TXQ A;  3OYG A;  2L89 A;  3GBQ A;  4F14 A;  4KGV B;  1QP3 A;  2VUB A;  5KYW A;  4ZTF A;  1N8R U;  2DL3 A;  2QGG A;  2RNA A;  5GAM d;  2ZPI B;  4QKU A;  4C5G A;  1XJW B;  3L2V A;  2DET A;  3QWX X;  2BTT A;  1XNI A;  4J9G A;  1HJD A;  2GFA A;  2EBP A;  4J8O A;  3OS0 A;  1I07 A;  1PSF A;  4JJC A;  3D7S B;  1NPR A;  1YI2 T;  2RHU A;  4OGC A;  3VRY A;  2KVQ G;  2OX7 A;  4M75 B;  5GAO n;  2X4J A;  6AT1 B;  3LX7 A;  4E47 A;  2XI9 A;  4J9I A;  4BDZ A;  1ZUY A;  3O8V A;  1EFN A;  2DPP B;  4D6W A;  2COY A;  4M7A D;  2XG8 D;  3FLG A;  3G71 Q;  2HEQ A;  2Z0W A;  3FRN A;  4HVU A;  2GTO A;  5GMK h;  3PGG A;  3DB3 A;  4JZ3 A;  5LJ5 d;  3NMZ C;  3SWN C;  5IHI A;  5IAY A;  5GAN 5;  2LTO A;  2YUP A;  1UEB A;  1M1G A;  2XDD A;  1NBE B;  1PKT A;  3CCU T;  1I4K 1;  2FRY A;  1QCN A;  1PWT A;  2RN8 A;  3PNW C;  2J05 A;  2CP6 A;  2RHY A;  4BE1 A;  2LZ6 B;  2RJC A;  3M59 A;  2QG9 B;  2YDL A;  1FWZ A;  3RUX A;  5D6Y A;  1D1A A;  3CC4 A;  1WZO A;  2CSI A;  3BFM A;  1OI1 A;  2E3I A;  2IPO B;  3HKS A;  1S72 A;  2LVM A;  1Z9Q A;  4QQ6 A;  2L8D A;  4NS5 A;  2ZPH B;  1BCM A;  3V7S A;  3E2U A;  3CPF A;  3VYH B;  5KYY A;  1QVG S;  4PFP A;  2VGM A;  1NM7 A;  3VJP A;  4KGZ B;  1GFD A;  3L2Z A;  3REA B;  4D8D A;  1G3T A;  4M78 G;  1VQ6 A;  3LWI A;  3QBY A;  1BI0 A;  1YIJ Q;  4KRT A;  1M8M A;  4BI3 A;  1W2B S;  1W6X A;  2A37 A;  1W2B P;  5GAN j;  1T3S A;  5GJW B;  2V26 A;  1VOM A;  2EFI A;  3TQ7 P;  1BI1 A;  4M77 G;  1QKW A;  2FB7 A;  1KQ1 A;  3UA6 A;  1YIT T;  2L3S A;  1FYN A;  4QVZ A;  1VQO A;  4JS4 A;  3QDF A;  2KDS A;  3M55 A;  3NTI A;  4GLK A;  1AZE A;  2ZPF B;  1QVF A;  3RIR A;  4C8Q A;  3JB9 J;  3E19 A;  3HRT A;  1V1C A;  3TRE A;  2XDP A;  4IIM A;  2M0O A;  5GAO p;  2KEA A;  4M7D A;  1BK2 A;  4ZGJ B;  3CPW P;  3QWY A;  4AFZ C;  4DOW A;  3PFS A;  3CMA Q;  4E7Z A;  4HA8 A;  4PKC C;  4MZT A;  3ZL7 C;  2X9H A;  3OYI A;  1VQN A;  1U3O A;  4DBF A;  3OYN A;  2RA2 A;  1M2O A;  2DXB A;  2DM1 A;  4Z02 A;  2WSF E;  3RKY A;  4C8Q C;  4DOV A;  1V76 A;  4BY6 C;  2XU8 A;  3SWN B;  3X25 B;  2CS7 A;  3EGU A;  2QA4 T;  4KUD K;  1Y07 A;  3OYK A;  2DD4 A;  4FT2 A;  4DBH A;  4EMH A;  4PJN A;  1PSE A;  5CKB A;  1KJW A;  3M58 A;  4IUP A;  4F7U E;  2NYS A;  3MCA B;  1F1B B;  3LWH A;  3M0U A;  2YWW A;  4LD9 K;  1JJ2 P;  2LX7 A;  4HKE A;  5D6X A;  1YI2 A;  2P0P A;  5L23 A;  5IHN A;  1OOT A;  2A7Y A;  2WAC A;  3RBB B;  3HP9 A;  2YLB A;  2KQW A;  2KGT A;  5A0G A;  2JN0 A;  1QQJ A;  3EGX A;  3BY7 A;  4LXC A;  7AT1 B;  1MV0 B;  4M78 F;  2YSQ A;  2EYX A;  3EGD A;  4EIK A;  4OML A;  4IUV A;  3JCM e;  1X01 A;  2K5L A;  1YCY A;  1KQS P;  1NZ9 A;  4OMN A;  2A36 A;  2VGN A;  3OS5 A;  4M7A G;  2RQV A;  4C8Q E;  4FYW B;  3A8H B;  4FL6 A;  2EKH A;  2EQJ A;  3JSC A;  1ZUK A;  2MYS A;  3CC7 T;  3I5S A;  3P8D A;  4M7D E;  5KYU B;  2K3Y A;  1N9R A;  3H41 A;  2LNV A;  1X6G A;  3KBG A;  5GAO q;  2ZGW A;  2RQR A;  5CR2 A;  2MMP A;  2C0O A;  1UG1 A;  3AT1 B;  3CBM A;  1UGP B;  1RAC B;  3FB9 A;  1YCS B;  4BUG A;  3G4S Q;  1R0B G;  3CCQ T;  1UJY A;  4LN2 A;  2ZPB B;  2RHX A;  3OYJ A;  1K8A C;  1YJ9 T;  1ZA1 B;  2DE0 X;  1B3Q A;  1VQ5 Q;  8AT1 B;  4E6R A;  2MF2 A;  5FRN A;  1WI7 A;  4OMM A;  1XOV A;  1R0C B;  5GAM g;  1Q81 U;  3RMS A;  4ZN3 A;  1OQK A;  1D1B A;  4PFZ A;  2KXD A;  1Q7Y C;  3JB9 G;  3JCM P;  5C0M A;  4QVD A;  2DYB A;  2G6F X;  4RMO A;  2J7I A;  2JTM A;  2K3B A;  4KBM B;  4JLG A;  4MZP A;  1TSF A;  2E5Q A;  4II1 A;  4A53 A;  2E65 A;  1SG5 A;  5GAN e;  3X24 B;  1D0Z A;  3CCU Q;  2RI3 A;  4RKU E;  3MHX A;  3RR6 A;  1QCO A;  3M0R A;  1W4S A;  4RG8 A;  1YIT A;  4RTU A;  4ME7 A;  1WX6 A;  1ZQ1 A;  1BU1 A;  1WFW A;  4XTU A;  2JTF A;  4UC4 A;  2XDB A;  3NTH A;  2HNI A;  1LCK A;  3M57 A;  1M9S A;  5LJ3 j;  2KT1 A;  5D6W A;  2QQS A;  2NLU A;  1NJI C;  3ASK A;  1YJW Q;  3VS4 A;  1MMG A;  5GAM f;  4A63 B;  3OW2 P;  2FRW A;  3MP8 A;  5FLX E;  1QCF A;  4LDY A;  4E7J A;  3M4Y A;  4BE0 A;  1VYU A;  3JV3 A;  3VUZ A;  2GF7 A;  1BB9 A;  5GAN 4;  4M7A F;  1B07 A;  4OB1 B;  4XK8 E;  2HQE A;  2NUT A;  5CAI A;  4JLI A;  4RUG A;  3M56 A;  3L42 A;  2QA4 A;  1AWJ A;  2RI5 A;  3I56 Q;  3T9N A;  3OYD A;  3BDL A;  2EIF A;  2AHJ B;  2BZX A;  2BIV A;  3CQT A;  4C5H A;  2IIM A;  5CCA A;  3CCS T;  2RHI A;  1K1Z A;  2VAS A;  1VQ4 T;  1ABO A;  3EFR A;  1NPP A;  2OAW A;  5EG2 A;  2SEM A;  2DZ9 A;  2A0F B;  1HYO A;  1D0Y A;  4M75 D;  1YJN Q;  4PJO B;  1VQ8 Q;  1UB4 A;  1G8X A;  2ZCF B;  3IQL A;  2O31 A;  5GAN 7;  2KE9 A;  2GGR A;  1JQQ A;  4C92 G;  2DZC A;  2XHC A;  1OUL A;  3QXE B;  1SHF A;  1RI0 A;  2DXC A;  2EVR A;  3HHT B;  4JS5 A;  2EQU A;  4FYY B;  1BCO A;  2LJ0 A;  1GL5 A;  1Z9Z A;  4PJO G;  1VQP T;  5IXB A;  2DL7 A;  2KRS A;  2SRC A;  4A4G A;  4PJL A;  3J80 E;  1RAH B;  3LGF A;  3CME Q;  2ZPE B;  3FEO A;  1WJS A;  4C0G A;  3SD4 A;  1PC0 A;  3CC4 T;  1IGU A;  4RTY A;  3OYE A;  4BB7 A;  5EC7 A;  3KFV A;  2QA4 Q;  2HQH A;  2E5K A;  1X27 A;  4L59 A;  1HD3 A;  2AT1 B;  1SSF A;  2DL8 A;  3CCQ A;  4IUQ A;  3UF4 A;  4MML A;  2K7A A;  5KE3 A;  1H92 A;  1YJ9 A;  2K6D A;  3JCM d;  5IH2 A;  1Q7Y R;  1G5V A;  2ENM A;  2QEX T;  1K9A A;  3ULR B;  4OVA A;  4DEY A;  2DVJ A;  1I81 A;  1M4Z A;  4XQ3 A;  1IGQ A;  2WSC E;  1IRE B;  4EMK C;  3CCV T;  1M3A A;  3KXT A;  1YN8 A;  1WQ7 A;  2YUN A;  1U1S A;  2J6F A;  4IUT A;  1VQM T;  4M78 A;  3MP6 A;  2OJ2 A;  4MDW A;  2E3H A;  3S6W A;  1TG0 A;  2RK1 A;  3JCM J;  1N6A A;  3QYG B;  4OMO A;  2CRE A;  3NFC A;  3TU4 K;  3MP1 A;  3CC2 Q;  3QSU A;  1H3Z A;  3S3M A;  4JRI A;  2DMO A;  2BE9 B;  4OGE A;  1VQ9 T;  2KR3 A;  3I55 T;  2NUZ A;  2VXE A;  3CC7 Q;  2MWP A;  2O9S A;  2AK5 A;  4M77 A;  4O6J A;  1NJI R;  4M78 C;  4HCB A;  4PK4 A;  4FYX B;  3A8L B;  1WPY A;  3C95 A;  3JCM Q;  2M51 A;  1AWX A;  5LJ3 e;  4E7L A;  4XAX B;  2NWM A;  3J81 E;  2P84 A;  4LDW A;  2YT6 A;  3HRS A;  2BZY A;  4XU0 A;  1QMC A;  1CKA A;  1XTD A;  1JXO A;  4IUR A;  2KSS A;  1I5O B;  3VU3 C;  1QVF P;  3PIO A;  3OYL A;  2CP3 A;  3LW5 E;  3PVL A;  5GAN d;  1T0H A;  2FPD A;  5CKD A;  4FIB A;  3GOX A;  1GFC A;  1TWB A;  1PM3 A;  1M90 U;  5IHK A;  3MEW A;  1M1K C;  1B34 A;  3CCS A;  5FRM A;  3CCL T;  1RLQ C;  4JJD A;  3TCJ A;  2O4X B;  1VQ4 A;  4ZTJ A;  1KFZ A;  4J5Y A;  2OI3 A;  4M78 E;  2EGC A;  2KNB B;  4IIO A;  2EQK A;  3INZ A;  5CVI A;  4DQ2 A;  2M9U A;  2PZ1 A;  5FU7 C;  2XD0 A;  1QWF A;  1Q95 G;  2FPE A;  2K5I A;  2L5Q A;  2L3R A;  2LJ3 A;  3M0T A;  2NUP B;  2HBP A;  2QQA A;  4FU6 A;  2HKQ B;  2CUB A;  4KUI A;  4M75 G;  2DIQ A;  2LC4 A;  3EG2 A;  4J9H A;  1UE9 A;  1M1F A;  1M3C A;  1VQP A;  4M77 E;  1VQL T;  1K73 R;  2Y4Y A;  1D0X A;  1T0J A;  3EFO A;  4HVW A;  4EMK B;  1T3L A;  4M7A A;  3THK A;  3L2W A;  1VQ7 A;  4C0D C;  5GMK j;  2OTJ T;  1X43 A;  3A5Z B;  2KRN A;  2KRM A;  2DER A;  4J83 A;  2D6F A;  3EG9 A;  5ECA A;  2O9V A;  4JZ4 A;  2CKK A;  5FU6 B;  1YBY A;  2GQI A;  2ZAE A;  5DY9 A;  3JB9 D;  3MEV A;  2K79 A;  1WDX A;  1AZG B;  1Y96 B;  4BDY A;  4Y28 E;  1OPL A;  2QQR A;  2A3L A;  1M2V A;  4M7A C;  4C0Z A;  1IHW A;  1BBZ A;  2JXB A;  3GF5 A;  2QEX A;  2JMA A;  3QUI A;  1NEB A;  3SB2 A;  2AKK A;  2FEI A;  4B9X A;  1ZUU A;  3NGP A;  3OY9 A;  3H6Z A;  5GAM h;  3CCV A;  4BI4 A;  3QJY A;  2DBK A;  4RTT A;  4OMF B;  1ZLM A;  1VQM A;  4LDV A;  3L1A A;  3OSV A;  2E70 A;  4OB2 B;  3UDC A;  1PNJ A;  3JCM V;  1ZSZ A;  1G2B A;  3E9G A;  2DJZ A;  3ZFJ A;  3CCR T;  1UTI A;  3GLX A;  2HZY A;  3SDZ A;  4XTY A;  4PNO A;  2DIG A;  1VQ9 A;  3I55 A;  2OTL T;  2RJF A;  4J6W A;  2YRD A;  4CRI A;  1WLP B;  3CC4 Q;  3CPW S;  1RAD B;  1D09 B;  3C12 A;  5GJV B;  2QTX A;  4LNP A;  1S72 Q;  1Y57 A;  4KUL A;  4WCI A;  5KYW B;  3P8B B;  4HCZ A;  4M7A E;  1Q82 U;  2RQW A;  2P4R A;  4A4H A;  5KYX A;  4FM4 B;  1UHF A;  1RUW A;  1NLP C;  4DA4 A;  2COW A;  2JTE A;  1JXM A;  2CSQ A;  1QP2 A;  4M75 F;  5FU7 B;  5FRO A;  2CZ0 B;  2I2L A;  2L3P A;  2MCN A;  3JB9 H;  2O2O A;  1BI3 A;  1WHL A;  2L0A A;  1Y0M A;  3OS1 A;  1VQ6 Q;  2O01 E;  3QJ6 A;  2EQI A;  1M1K R;  3HSB A;  4DEX A;  4ELZ C;  4M7D C;  1BI2 A;  1O75 A;  3WXM B;  1JJ2 S;  3CCE T;  1MMA A;  3LLR A;  1WHM A;  4X9C A;  5KH6 A;  4C92 D;  4WTO B;  3JAM E;  1WJQ A;  3CCL A;  1AHJ B;  1G3Y A;  2DEU A;  9ATC B;  1SSH A;  1TU0 B;  3JCM g;  4C0D B;  2V8I A;  3I35 A;  5L8R E;  5LJ3 d;  4PJO D;  1LVK A;  4RCC A;  3ZBD A;  1VQK T;  2HKN A;  3O5Z A;  3CEY A;  1VQO Q;  3I55 Q;  4EMG A;  1RAA B;  1Q81 C;  4O5V A;  2QAS A;  1KQS S;  5LL6 S;  2KT8 A;  2DBM A;  3VYG A;  2XIC A;  1ACM B;  2QGF B;  2C06 A;  3CCM T;  1NG2 A;  2CUD A;  3U23 A;  4C92 A;  1NLO C;  2CDT A;  1OYX A;  1IO6 A;  2ABL A;  2DVE A;  1X75 C;  1TTH B;  4BE2 A;  1VQL A;  2MIO A;  3E1S A;  3FJ5 A;  1QVP A;  1ZBX A;  5KYN A;  1QW1 A;  2QYZ A;  1UJ0 A;  5A0D A;  1VQN Q;  4BAC A;  3JB9 I;  4HVV A;  4M4Z A;  4AFS C;  5HK3 A;  4M77 F;  1TUD A;  3EH1 A;  2KXC A;  4EDU A;  3RER A;  1I1J A;  5KYY B;  5CQX A;  1JU5 C;  1RAI B;  5J3B A;  2OTJ A;  5DLQ E;  3SFM A;  2JJ9 A;  4C0F A;  5GMK e;  5HY6 A;  2QK0 A;  4F7U B;  2LQW A;  2DL5 A;  1WQW A;  3OYA A;  2E41 A;  1QVG A;  4GBQ A;  2F2X A;  3M9Q A;  1UGV A;  3CCL Q;  3M53 A;  2RQU A;  3DB4 A;  3JCM X;  3MO8 A;  2O88 A;  1YI2 Q;  3CD6 T;  4EPC A;  1S1N A;  3OYB A;  1PKS A;  4OB3 B;  1AWO A;  3OMG A;  2HL3 A;  4F7U G;  5GAN g;  2AZS A;  5J26 A;  4QQG A;  1W2B A;  1H64 1;  2RMO A;  1YHQ A;  2HBW A;  2BZ8 A;  3PTA A;  5FWB A;  3TSW A;  2EYY A;  1OPK A;  2E4H A;  4C8Q B;  4BY6 B;  3S3O A;  1OEB A;  2KYB A;  5A2Q E;  3CCR A;  2DRM A;  2X3X D;  4Z89 A;  4M7D B;  2F2V A;  4KT0 E;  1BIA A;  2HL5 C;  2OTL A;  3A8O B;  3I5R A;  2I0N A;  4FSS A;  3M0P A;  5LJ5 g;  3OW2 S;  4XTZ A;  4CI0 C;  3L2R A;  1TS9 A;  2FPF A;  2LP5 A;  4DBQ A;  3G71 T;  4ELY C;  2Y4X A;  2ZZD A;  1OU8 A;  4N4H A;  2RPN A;  1VUB A;  3DKM A;  2ROL A;  2MI6 A;  4N0A A;  1I8F A;  2QAZ A;  2VKN A;  3CXC A;  3HFN A;  1OZ3 A;  1GCQ A;  4KGX B;  4L5G A;  2CGH A;  1ZA2 B;  4X9D A;  1JEG A;  3X26 B;  1IRX A;  1AEY A;  1GBQ A;  2EYW A;  1KC8 U;  1KD1 U;  2RF0 A;  2CH4 W;  1SHG A;  1K8A U;  4PFO A;  5HKC A;  2LNH B;  2DNU A;  1YWO A;  5CIU A;  5CQY A;  3RKX A;  1W1F A;  2AKL A;  5CKF A;  3CCE A;  4LE9 A;  3RNJ A;  3JCM c;  3URG A;  2PVD B;  1ARK A;  1UFF A;  3EGX B;  1SEM A;  1C1A A;  4C5I A;  3PVQ A;  5LJ5 f;  3L2U A;  1PHT A;  1GCP A;  4J9C A;  1GCQ C;  1Q81 R;  1R8O B;  4J6X A;  3CCR Q;  3EGD B;  3J7A F;  1WJR A;  2V8K A;  1VQK A;  1YIT Q;  1K9M U;  1MV3 A;  2PVG B;  4V2S A;  1SRM A;  2P0Q A;  5FW9 A;  2FL7 A;  5GAN 8;  1UHC A;  1K76 A;  3G6E T;  2DXU A;  3G7Z A;  2YXY A;  1YWP A;  3QZ5 B;  4P5N A;  3ER0 A;  3V8L A;  3CCM A;  3E9F A;  4RTX A;  3JB9 F;  4AFU C;  5I2S A;  1Y71 A;  2CH4 A;  3FJP A;  1YIJ T;  3JCM b;  1AT1 B;  1WHJ A;  4PLI A;  2MAM A;  2O4X A;  3M5A A;  1Q86 C;  1WYX A;  2DTO A;  1GXI E;  4M75 A;  2DO3 A;  4J9D A;  3LYI A;  4F17 A;  3V8J A;  1K73 C;  2XK0 A;  3EG3 A;  5AYF A;  4QVC A;  2PUK B;  1VQ7 T;  3CBO A;  3OYM A;  4LUE A;  1I5L A;  1Y7X A;  2E1H A;  1H8K A;  1OX8 A;  2L3Q A;  2VWF A;  4A4E A;  2YHT A;  2AZV A;  4PL6 A;  3AHU A;  1OU9 A;  1MNE A;  2DF6 A;  3GNG A;  2DJQ A;  3CCJ A;  1N5Z A;  1FX7 A;  1LJO A;  3H0H A;  4M75 C;  2XID A;  2BKD N;  2QQ9 A;  3CD6 A;  1N9S A;  3CMA T;  1YFN A;  4XU3 A;  1N8R C;  2VC8 A;  3PE0 A;  3V7R A;  1PG5 B;  2KAF A;  2DTI A;  1X6O A;  4B9W A;  3PIP A;  4Q5W A;  2QTV A;  3QG1 A;  1X69 A;  4HXJ A;  2QI2 A;  1QWE A;  1M90 C;  2EJ9 A;  5KE2 A;  3CCM Q;  1WHK A;  2ECZ A;  1WIE A;  4XU1 A;  5GAN 6;  3QHS A;  2PU9 B;  2QQB A;  2KRO A;  1FMK A;  3FIF A;  2K4Y A;  3DLM A;  3PMI A;  3QDR B;  2EW3 A;  5LJ3 g;  4ZNX A;  4ZGD B;  5I2M A;  1X2Q A;  1VYV A;  2M1H A;  1DJ7 B;  1RI9 A;  2EWN A;  2H3E B;  4M75 E;  4R56 A;  2F69 A;  4JDS A;  1IXD A;  4C92 F;  3WVD B;  3H9N A;  4FW1 A;  4MDX A;  2CYZ B;  3HRU A;  2NUT B;  1XQH A;  3G71 A;  2E12 A;  3CCQ Q;  1G83 A;  3R6N A;  3VS1 A;  2DKG A;  4IUU A;  4PJO F;  1QVF S;  3SEM A;  4J9F A;  1YJ9 Q;  2LCC A;  3L2Q A;  4M77 C;  3CD6 Q;  2DAQ A;  3LGL A;  3A98 A;  1PD1 A;  2FVU A;  2P4T A;  1YNZ A;  2RJD A;  1ABQ A;  1CSK A;  2JNG A;  2B8A A;  4RG2 A;  2CZ6 B;  4RTW A;  4CC3 A;  1V29 B;  3P8H A;  2KYM A;  4GY5 A;  1NEG A;  1WA7 A;  2H8H A;  5FWC A;  2JUF A;  2LT4 A;  2D8J A;  2DA9 A;  3JCM h;  2YUQ A;  1M27 C;  3G4S T;  2D0Q B;  1G3W A;  3ME9 A;  3SWN A;  2C0T A;  1JBM A;  3G6E A;  1OV3 A;  1VQ5 T;  1BKB A;  3OYC A;  4PJM A;  4J9E A;  3TVT A;  1Q86 R;  1M5Q 1;  4E7K A;  3OSS C;  2K57 A;  4K11 A;  3DLL A;  4ZN1 A;  1U8R A;  2ESW A;  2ED0 A;  3OA6 A;  2RO0 A;  3QII A;  4NL2 A;  1YIJ A;  2KI7 A;  4E7S A;  5GMK m;  1OX9 A;  2K5F A;  1UGQ B;  1K4U S;  2JOY A;  3EFS A;  2LQ8 A;  1P92 A;  3C0C A;  4A4F A;  2FZC B;  4OMP A;  4A54 A;  4R55 A;  4JUV A;  2CT4 A;  3C94 A;  1ZHI A;  4AFQ C;  2KBT A;  2K9G A;  2X3W D;  3ZEH A;  1LNX A;  1BYM A;  2EGA A;  4CC2 A;  3WVE B;  3M54 A;  3A8G B;  3CCS Q;  1Q82 C;  2GNC A;  4GLM A;  3RKW A;  4FCY A;  2JT4 A;  2EJF A;  2GQV A;  1N8R R;  1VQ4 Q;  4JPB W;  5A0L A;  4ATO A;  3OQ5 A;  4M78 B;  2F2W A;  1YJW T;  2R5A A;  1M1K U;  2M0Y A;  3CMA A;  2CZ7 B;  3M4G A;  5D7U A;  5KYU A;  2HAX A;  2ED1 A;  4VUB A;  1M90 R;  1ZX6 A;  2RB6 A;  4AMC A;  8ATC B;  5GAN h;  1YHQ T;  1PRL C;  2DD5 A;  3G6E Q;  1HXD A;  5HCK A;  1KIK A;  1RL2 A;  4CC4 B;  2VV5 A;  2GFU A;  4F7U A;  3QKJ A;  1NE8 A;  2EJG A;  1QVG P;  4QQD A;  1D3B B;  1WHG A;  4M77 B;  3C4S A;  3I56 T;  1RAE B;  3A8M B;  1VQP Q;  2X51 A;  5CKE A;  4C8Q D;  3N5B B;  2DXT A;  2R57 A;  1QKX A;  4Z8A A;  2A28 A;  2GBQ A;  4OP0 A;  4F04 B;  5I22 A;  2G3R A;  2LQK A;  3I9Q A;  3GIB A;  4M7D D;  2R58 A;  2FZG B;  2ATC B;  4J6Y A;  5CK9 A;  3UA7 A;  5GAM j;  1VQ7 Q;  2F1L A;  1YJN T;  3TSZ A;  4Y91 A;  1VQ8 T;  1EIF A;  1UGR B;  2LMJ A;  2RH2 A;  1N27 A;  1MMD A;  1ZSZ C;  5LJ5 h;  1M3B A;  2W0Z A;  3FDR A;  1AWW A;  5GAN 2;  2LT1 A;  2M02 A;  1SKU B;  1IB8 A;  3VUB A;  5IXF A;  2LJ1 A;  1W70 A;  4PJJ A;  1D1C A;  2YRC A;  4HT8 A;  1WXB A;  3H8Z A;  1B34 B;  4JRQ A;  2QEX Q;  4NL3 A;  1VYT A;  2OAU A;  4ZGE B;  1WNL A;  1A0N B;  3EAE A;  4OF1 A;  3CCV Q;  3CME T;  2QXF A;  5LJ5 j;  2F5T X;  2X4Y A;  4OMQ A;  1QLY A;  2W10 A;  3GP8 A;  1VQM Q;  2X4W A;  4MMK A;  3CXC S;  1JO8 A;  3S3N A;  4JJB A;  1SPK A;  3NTK A;  3CXC P;  2CP5 A;  2V1Q A;  1JB0 E;  1X6B A;  3EG1 A;  2RI2 A;  1X2K A;  4J7F A;  3VRZ A;  3G4S A;  1VA7 A;  1CKB A;  4CC7 A;  3GPL A;  1VQ9 Q;  1RAG B;  3UAT A;  2RK2 A;  2XKO C;  2LQN A;  3MPU B;  1SRL A;  3OBY A;  5CKH A;  3EFO B;  1VQ5 A;  1NYF A;  4HT9 A;  4KH0 B;  2KMT A;  1U5S A;  2CZ1 B;  4M7A B;  3OS2 A;  2D0N A;  1E6H A;  2MPX C;  1PRM C;  2K2V A;  2MOX A;  3BW1 A;  4FT4 A;  1O9S A;  1IHV A;  4FW2 A;  3SHW A;  4L6V 5;  4PJO A;  3EG9 B;  1C0M A;  4RCB A;  4X1V A;  2QDL A;  1FXX A;  1MUZ A;  5GAO l;  2E6Z A;  1YP5 A;  3V7C A;  3CC2 T;  2C0I A;  1UDL A;  2MWO A;  2R5M A;  2EYQ A;  3JCM f;  5GMK i;  1Q82 R;  3CCU A;  1M2V B;  2HDA A;  4C92 C;  1E6G A;  3MET A;  4QT7 A;  4AG1 C;  1R77 A;  1AD5 A;  3CCJ T;  3R6O A;  1WXU A;  3OYH A;  5I11 A;  1NYG A;  1RAF B;  2H3J A;  4AT1 B;  3REB B;  2ZPG B;  4PJO C;  5C6S A;  5GAN 3;  2LX9 A;  2FHD A;  3VS0 A;  1ZBJ A;  1FMV A;  1YJW A;  1B7T A;  1FMW A;  2BUD A;  3MEU A;  5CO7 A;  4MZM A;  4OB0 B;  1ZSZ B;  3OBW A;  2JM9 A;  1MND A;  1KC8 C;  2CP0 A;  1KD1 C;  4LDU A;  1GBR A;  4QW2 A;  3H0I A;  1UEC A;  2HQX A;  1K0X A;  3EH2 A;  2CT3 A;  5DM7 R;  3QPH A;  3UWN A;  2WSE E;  1UUE A;  3OYF A;  3A1P A;  3LH0 A;  5M9O A;  2VXF A;  3I56 A;  2RQT A;  1VQL Q;  4F16 A;  2FZK B;  2CP7 A;  2EKO A;  2EYZ A;  4C92 E;  1KK7 A;  1EZZ B;  5LJ3 h;  2LRQ A;  2RM4 A;  1WHH A;  3H0F A;  3CPW A;  3VS7 A;  4KH1 B;  4NOY A;  4WF2 A;  3JRZ A;  5KYX B;  1K9M C;  4PLL A;  1PD0 A;  5KCO A;  1TOV A;  2A08 A;  5GAM e;  2COZ A;  2OTJ Q;  1YJN A;  2F5K A;  2J6O A;  4LD6 A;  1VQ8 A;  2VB6 A;  4PJO E;  2LCL A;  4C8Q G;  4JJN K;  2DRK A;  4ESR A;  5GAN f;  2DEQ A;  1M30 A;  3VS2 A;  4M7D G;  4XTV A;  2HSP A;  2AIR B;  1H3H A;  3EHR A;  4E7H A;  3HFO A;  2VVK A;  5AT1 B;  2D9T A;  1KG1 A;  3KUF A;  4J7I A;  4BD3 A;  2HCK A;  3X28 B;  4J9B A;  1I0C A;  4XTX A;  1JJ2 A;  2HMA A;  3QYH B;  2K3X A;  5IN1 A;  1WXT A;  3CME A;  1YHQ Q;  1MMN A;  2DFU A;  2X35 A;  5LJ5 e;  4N0A C;  4DBR A;  1WGS A;  4E7I A;  4Y92 A;  1G3S A;  1Q7Y U;  2PUO B;  1KQ2 A;  1J3T A;  1U06 A;  2DIL A;  4B6M A;  1OZ2 A;  1U1T A;  2JS0 A;  5GMK l;  4C92 B;  1AOJ A;  2VYT A;  3VS5 A;  3FC3 A;  2HD0 A;  1KQS A;  4HCC A;  3M0Q A;  2OTL Q;  2EGE A;  3V8K A;  3TEE A;  4F7U F;  3PT9 A;  2EAY A;  2LCS A;  3JCM W;  4JRK A;  2GTJ A;  4XU2 A;  4HCK A;  4X34 A;  2KY9 A;  4A4K A;  2PQW A;  3M0S A;  1TUG B;  4E2F B;  4RTZ A;  1LOJ A;  3X20 B;  1C6V X;  4TVR A;  2M16 A;  3Q1J A;  1NJI U;  2HSE B;  3HPW A;  5KCH A;  4FYV B;  4R0K A;  5I21 A;  2JVV A;  1TUC A;  2KK4 A;  2E6N A;  2JS2 A;  2YUO A;  3CBP A;  3QZ9 B;  3CC2 A;  2K2M A;  4N4G A; 
#chains in the Genus database with same CATH homology
 4A4H A;  3G4S T;  1Q7Y C;  3JB9 G;  4FM4 B;  2D0Q B;  1MHN A;  1G3W A;  3F70 A;  3JCM P;  3ME9 A;  5C0M A;  4DA4 A;  4QVD A;  1QP2 A;  2RJE A;  4M75 F;  5FU7 B;  3SWN A;  4PJO D;  3CC7 A;  2Y90 A;  2CZ0 B;  5FRO A;  4RMO A;  1JBM A;  3G6E A;  1VQ5 T;  2FYK A;  1BKB A;  4C8Q F;  2I2L A;  2DK3 A;  2JTM A;  3OYC A;  1HK9 A;  3HL8 A;  4KBM B;  4JLG A;  3JB9 H;  5GAO m;  1BI3 A;  4MZP A;  1M5Q 1;  3OS1 A;  4E7K A;  1S72 T;  3OSS C;  2GCX A;  2E5Q A;  4II1 A;  2K57 A;  4A53 A;  2E65 A;  4EMK A;  1MGQ A;  2O01 E;  3QJ6 A;  4M78 D;  5GAN e;  3X24 B;  4ZN1 A;  3DLL A;  4M7D F;  3HSB A;  2RI3 A;  4RKU E;  5HK0 A;  3MHX A;  1U8R A;  3MEA A;  4ELZ C;  3OA6 A;  1KHI A;  4M7D C;  2RO0 A;  3QII A;  1BI2 A;  4NL2 A;  2IVW A;  1W4S A;  1YIJ A;  1O75 A;  2DTH A;  4RG8 A;  1YIT A;  5GMK m;  3QO3 A;  3WXM B;  1M8V A;  1JJ2 S;  2JZ2 A;  3CCE T;  3LLR A;  2K5F A;  1UGQ B;  3OMC A;  4X9C A;  4ME7 A;  5KH6 A;  2JOY A;  4C92 D;  1ZQ1 A;  3EFS A;  2LQ8 A;  3RMQ A;  1P92 A;  4XTU A;  3JAM E;  2JTF A;  1WJQ A;  3UT1 A;  3CCL A;  4A4F A;  1AHJ B;  1G3Y A;  4UC4 A;  4XTW A;  5IT9 E;  2XDB A;  3NTH A;  1IZ6 A;  2HNI A;  3M57 A;  1M9S A;  4A54 A;  1NJI C;  5DLO A;  5LJ3 j;  1VQ6 T;  4R55 A;  3JCM g;  4JUV A;  5D6W A;  2QQS A;  4C0D B;  3C94 A;  2NLU A;  1UGS B;  2V8I A;  1ZHI A;  3ASK A;  5L8R E;  5LJ3 d;  1JRI A;  2QDY B;  4M77 D;  4RCC A;  2RHZ A;  1Y96 A;  3ZBD A;  5GAM f;  1VQK T;  3CEY A;  3MP8 A;  4BI8 B;  1BIB A;  5FLX E;  3ZEH A;  1LNX A;  2YRV A;  4LDY A;  1VIF A;  3M4Y A;  4E7J A;  3RES A;  4BE0 A;  1BYM A;  4EMG A;  1Q81 C;  3VUZ A;  3WVE B;  3M54 A;  3A8G B;  4O5V A;  1Q82 C;  1VQL T;  2GF7 A;  3RKW A;  1KHC A;  5GAO r;  1KQS S;  5LL6 S;  2PVO B;  5GAN 4;  4M7A F;  4C5E A;  2EJF A;  2GQV A;  3VYG A;  2XIC A;  4LDX A;  3PMT A;  3GNF B;  4OB1 B;  4XK8 E;  5A0L A;  3CCM T;  2C06 A;  4ATO A;  3OQ5 A;  2IG0 A;  3OW2 A;  2HQE A;  4YTL A;  1Q86 U;  4JRP A;  5CAI A;  4M78 B;  4C92 A;  4JLI A;  3M56 A;  3L42 A;  2QA4 A;  5FU6 C;  1OYX A;  1YJW T;  2E10 A;  2P0K A;  2RI5 A;  2R5A A;  5J39 A;  1M1K U;  2DVE A;  2EQM A;  3T9N A;  3BDL A;  3OYD A;  1X75 C;  2EIF A;  3CMA A;  4FSX A;  2AHJ B;  2CZ7 B;  3M4G A;  4BE2 A;  1VQO T;  3E1S A;  1K73 U;  1VQL A;  2HAX A;  3UPU A;  2V8J A;  2BIV A;  4VUB A;  3VKI A;  4C5H A;  1QVP A;  1ZBX A;  2YLC A;  5CCA A;  1QW1 A;  2RHI A;  3CCS T;  2RB6 A;  5A0D A;  5GAN h;  4BAC A;  1D3B A;  1YHQ T;  3OB9 A;  3VV0 A;  2DD5 A;  2E64 A;  1HXD A;  3JB9 I;  1VQ4 T;  5HK3 A;  1RL2 A;  2VV5 A;  4M77 F;  2GFU A;  4F7U A;  3QKJ A;  3EFR A;  1NPP A;  5EG2 A;  4EDU A;  1NE8 A;  2DZ9 A;  2EJG A;  3RER A;  4IKF A;  4QQD A;  5CQX A;  4M75 D;  2RD1 A;  4N4I A;  5DLQ E;  5J3B A;  1D3B B;  4M77 B;  3SFM A;  3C4S A;  1TH7 A;  4C0F A;  5GMK e;  3I56 T;  5HY6 A;  3A8M B;  1UB4 A;  2X4X A;  3OYY A;  2ZCF B;  5CKE A;  4C8Q D;  4F7U B;  3BDU A;  1VIE A;  5GAN 7;  3N5B B;  2DXT A;  2R57 A;  5LJ3 f;  1WQW A;  2LDM A;  4OP0 A;  1VQN T;  3OYA A;  2G3R A;  2LQK A;  4C92 G;  2E41 A;  1QVG A;  3OYG A;  3GIB A;  2DZC A;  4M7D D;  2XHC A;  3M9Q A;  2L89 A;  2R58 A;  3M53 A;  3QXE B;  1QP3 A;  2VUB A;  4J6Y A;  5CK9 A;  4ZTF A;  1N8R U;  3DB4 A;  3JCM X;  3MO8 A;  5GAM j;  1RI0 A;  2DXC A;  3CD6 T;  3HHT B;  1YJN T;  4JS5 A;  2EQU A;  4EPC A;  5GAM d;  3OYB A;  4OB3 B;  2ZPI B;  4Y91 A;  1VQ8 T;  4C5G A;  1EIF A;  1UGR B;  2RH2 A;  4PJO G;  3L2V A;  1VQP T;  3OMG A;  1N27 A;  5LJ5 h;  4A4G A;  1XNI A;  3FDR A;  5GAN g;  4F7U G;  5GAN 2;  2GFA A;  3J80 E;  3LGF A;  4J8O A;  5J26 A;  2LT1 A;  4QQG A;  3OS0 A;  1W2B A;  4PJO B;  1H64 1;  1PSF A;  2ZPE B;  3FEO A;  1YHQ A;  1WJS A;  4C0G A;  3SD4 A;  3PTA A;  3VUB A;  3CC4 T;  1NPR A;  1YI2 T;  2RHU A;  4OGC A;  3OYE A;  4BB7 A;  2KVQ G;  4M75 B;  4HT8 A;  5GAO n;  2X4J A;  3H8Z A;  1B34 B;  3LX7 A;  4E47 A;  4JRQ A;  2XI9 A;  4BDZ A;  4C8Q B;  4NL3 A;  3O8V A;  4BY6 B;  2DPP B;  4D6W A;  3S3O A;  4L59 A;  2OAU A;  4ZGE B;  4M7A D;  5A2Q E;  3CCR A;  2XG8 D;  1WNL A;  3FLG A;  3EAE A;  4OF1 A;  3FRN A;  4M7D B;  3CME T;  1SSF A;  5GMK h;  3CCQ A;  2QXF A;  4IUQ A;  4KT0 E;  3PGG A;  5LJ5 j;  4MML A;  2F5T X;  2X4Y A;  3DB3 A;  1BIA A;  3GP8 A;  2OTL A;  2X4W A;  4MMK A;  5LJ5 d;  3A8O B;  5KE3 A;  3CXC S;  3SWN C;  3S3N A;  1YJ9 A;  3JCM d;  5IAY A;  5GAN 5;  4KUD K;  1G5V A;  2LTO A;  5LJ5 g;  1UEB A;  1M1G A;  2XDD A;  2QEX T;  3OW2 S;  3NTK A;  4OVA A;  4XTZ A;  4CI0 C;  1I81 A;  3CCU T;  1M4Z A;  4XQ3 A;  2WSC E;  3L2R A;  1I4K 1;  1JB0 E;  2RI2 A;  1IRE B;  3G71 T;  4ELY C;  4EMK C;  3PNW C;  3CCV T;  2Y4X A;  2ZZD A;  4J7F A;  3KXT A;  1WQ7 A;  3G4S A;  4N4H A;  1VUB A;  3DKM A;  2RHY A;  3GPL A;  1U1S A;  2MI6 A;  4BE1 A;  4IUT A;  4N0A A;  2RK2 A;  4M78 A;  3M59 A;  2RJC A;  2XKO C;  1I8F A;  3MP6 A;  1VQM T;  3RUX A;  1FWZ A;  3CXC A;  4MDW A;  3OBY A;  5CKH A;  3HFN A;  5D6Y A;  3S6W A;  3CC4 A;  2RK1 A;  3JCM J;  1N6A A;  1OZ3 A;  1VQ5 A;  3BFM A;  4HT9 A;  3QYG B;  2KMT A;  3NFC A;  4L5G A;  2CGH A;  4X9D A;  1OI1 A;  2CZ1 B;  3X26 B;  3TU4 K;  3HKS A;  3MP1 A;  1S72 A;  4M7A B;  2LVM A;  3QSU A;  1KC8 U;  1H3Z A;  1KD1 U;  3OS2 A;  3S3M A;  1K8A U;  4JRI A;  4QQ6 A;  5HKC A;  5CIU A;  2K2V A;  2L8D A;  4NS5 A;  2ZPH B;  5CQY A;  4OGE A;  3RKX A;  1VQ9 T;  3V7S A;  3CPF A;  3VYH B;  3BW1 A;  3I55 T;  2VXE A;  4FT4 A;  1O9S A;  5CKF A;  3CCE A;  4L6V 5;  2MWP A;  3JCM c;  4PJO A;  4RCB A;  3URG A;  2PVD B;  4M77 A;  4O6J A;  1QVG S;  1FXX A;  2VGM A;  4M78 C;  4HCB A;  5GAO l;  3A8L B;  1WPY A;  2E6Z A;  3VJP A;  3V7C A;  4C5I A;  3C95 A;  3L2Z A;  3CC2 T;  5LJ5 f;  3JCM Q;  3L2U A;  1G3T A;  2MWO A;  4M78 G;  1VQ6 A;  2R5M A;  2EYQ A;  3JCM f;  3LWI A;  1R8O B;  4J6X A;  3QBY A;  5GMK i;  5LJ3 e;  3CCU A;  4E7L A;  1BI0 A;  4C92 C;  3J7A F;  1WJR A;  4XAX B;  2V8K A;  3MET A;  3J81 E;  1VQK A;  4LDW A;  3HRS A;  1K9M U;  2PVG B;  3CCJ T;  4V2S A;  3R6O A;  4XU0 A;  3OYH A;  2P0Q A;  2FL7 A;  4BI3 A;  5GAN 8;  3G6E T;  1W2B S;  2DXU A;  3G7Z A;  1XTD A;  2H3J A;  2ZPG B;  4PJO C;  4IUR A;  5C6S A;  2KSS A;  5GAN 3;  3QZ5 B;  4P5N A;  3ER0 A;  2LX9 A;  3V8L A;  3CCM A;  3E9F A;  3VU3 C;  5GAN j;  2FHD A;  3PIO A;  3OYL A;  3JB9 F;  5I2S A;  1Y71 A;  3LW5 E;  5GAN d;  2EFI A;  3FJP A;  5CKD A;  1BI1 A;  4M77 G;  1YJW A;  2FB7 A;  1YIJ T;  4FIB A;  3JCM b;  1KQ1 A;  2BUD A;  3M5A A;  4PLI A;  2MAM A;  2O4X A;  3MEU A;  3GOX A;  1YIT T;  5CO7 A;  4MZM A;  4QVZ A;  1VQO A;  1Q86 C;  4OB0 B;  2DTO A;  4JS4 A;  3OBW A;  1GXI E;  1M90 U;  2KDS A;  3M55 A;  3NTI A;  4M75 A;  4GLK A;  1KC8 C;  1KD1 C;  2DO3 A;  3MEW A;  4LDU A;  3LYI A;  2ZPF B;  1M1K C;  1B34 A;  4QW2 A;  3CCS A;  5FRM A;  1QVF A;  3V8J A;  3RIR A;  3CCL T;  2HQX A;  4C8Q A;  3JB9 J;  1K73 C;  2XK0 A;  3E19 A;  3TCJ A;  5AYF A;  2O4X B;  4QVC A;  1VQ4 A;  3HRT A;  2PUK B;  1VQ7 T;  4ZTJ A;  3TRE A;  3CBO A;  3OYM A;  2XDP A;  2M0O A;  5GAO p;  5DM7 R;  3QPH A;  3UWN A;  1I5L A;  2WSE E;  1Y7X A;  4ZGJ B;  4J5Y A;  4M7D A;  2E1H A;  3OYF A;  4M78 E;  4DOW A;  3LH0 A;  3PFS A;  2VXF A;  5M9O A;  3I56 A;  4A4E A;  2EQK A;  2YHT A;  4PL6 A;  3AHU A;  3INZ A;  4HA8 A;  4PKC C;  5CVI A;  4DQ2 A;  2M9U A;  5FU7 C;  4MZT A;  3GNG A;  2XD0 A;  3OYI A;  3CCJ A;  2EKO A;  2K5I A;  1VQN A;  4C92 E;  5LJ3 h;  1FX7 A;  1LJO A;  2L5Q A;  2LRQ A;  2RM4 A;  4M75 C;  3CPW A;  2XID A;  2L3R A;  2RA2 A;  2DXB A;  4NOY A;  3OYN A;  4WF2 A;  3JRZ A;  2WSF E;  4Z02 A;  1K9M C;  2HBP A;  2QQA A;  2BKD N;  3RKY A;  4C8Q C;  4PLL A;  4DOV A;  4FU6 A;  4BY6 C;  5KCO A;  2QQ9 A;  2XU8 A;  3SWN B;  3X25 B;  2CS7 A;  2QA4 T;  5GAM e;  4KUI A;  4M75 G;  1Y07 A;  2DIQ A;  2LC4 A;  1YJN A;  1N9S A;  2F5K A;  3CD6 A;  3OYK A;  4LD6 A;  1M1F A;  3CMA T;  2DD4 A;  4FT2 A;  4EMH A;  1VQ8 A;  4PJO E;  2LCL A;  4XU3 A;  4M77 E;  1VQP A;  2VC8 A;  4C8Q G;  4JJN K;  1PSE A;  1N8R C;  3V7R A;  5CKB A;  2KAF A;  2Y4Y A;  3M58 A;  2DTI A;  4IUP A;  1X6O A;  5GAN f;  4F7U E;  2DEQ A;  4B9W A;  3MCA B;  4EMK B;  3LWH A;  4M7D G;  4XTV A;  3PIP A;  4LD9 K;  4M7A A;  4Q5W A;  3QG1 A;  2QI2 A;  1M90 C;  2EJ9 A;  4HKE A;  3HFO A;  5KE2 A;  5D6X A;  3L2W A;  4E7H A;  1VQ7 A;  1YI2 A;  4C0D C;  2P0P A;  2D9T A;  5GMK j;  2OTJ T;  3KUF A;  1KG1 A;  4J7I A;  4XU1 A;  3A5Z B;  4BD3 A;  5GAN 6;  3QHS A;  2PU9 B;  3X28 B;  2QQB A;  2A7Y A;  2WAC A;  4J83 A;  2D6F A;  3HP9 A;  2YLB A;  3FIF A;  2KQW A;  4XTX A;  2CKK A;  2K4Y A;  5FU6 B;  3DLM A;  1YBY A;  3PMI A;  3QDR B;  1JJ2 A;  5A0G A;  5LJ3 g;  2JN0 A;  3QYH B;  5DY9 A;  4ZGD B;  3BY7 A;  3JB9 D;  2K3X A;  3MEV A;  5I2M A;  5IN1 A;  3CME A;  1Y96 B;  4M78 F;  4BDY A;  4Y28 E;  2X35 A;  2QQR A;  5LJ5 e;  2A3L A;  2M1H A;  4N0A C;  1WGS A;  4IUV A;  3JCM e;  4M7A C;  4C0Z A;  1DJ7 B;  1X01 A;  2K5L A;  4E7I A;  1YCY A;  1G3S A;  1NZ9 A;  2EWN A;  1Q7Y U;  4M75 E;  2PUO B;  2F69 A;  4JDS A;  4R56 A;  1KQ2 A;  2OTJ A;  3GF5 A;  2QEX A;  3QUI A;  4C92 F;  3WVD B;  3SB2 A;  2VGN A;  3OS5 A;  4B9X A;  4M7A G;  4C8Q E;  1OZ2 A;  3A8H B;  4MDX A;  4FL6 A;  1U1T A;  2CYZ B;  2EQJ A;  3HRU A;  3OY9 A;  1XQH A;  3JSC A;  5GMK l;  4C92 B;  3H6Z A;  3G71 A;  2VYT A;  2E12 A;  5GAM h;  4BI4 A;  3QJY A;  3CCV A;  3FC3 A;  2HD0 A;  3CC7 T;  1KQS A;  4M7D E;  3P8D A;  4HCC A;  4OMF B;  2DKG A;  4IUU A;  1VQM A;  4LDV A;  4PJO F;  3L1A A;  1QVF S;  2K3Y A;  3OSV A;  1N9R A;  2E70 A;  4OB2 B;  2LNV A;  2LCC A;  3UDC A;  3L2Q A;  3KBG A;  4M77 C;  3V8K A;  3TEE A;  4F7U F;  3JCM V;  5GAO q;  2ZGW A;  3PT9 A;  2EAY A;  5CR2 A;  2MMP A;  2DAQ A;  3CBM A;  3E9G A;  2DJZ A;  1UGP B;  3ZFJ A;  3FB9 A;  3CCR T;  3JCM W;  3LGL A;  3GLX A;  4JRK A;  2FVU A;  2P4T A;  4XU2 A;  4BUG A;  3SDZ A;  4XTY A;  4X34 A;  2KY9 A;  3CCQ T;  2RJD A;  4PNO A;  4A4K A;  2DIG A;  2PQW A;  1VQ9 A;  2ZPB B;  3I55 A;  2OTL T;  1LOJ A;  2RHX A;  2RJF A;  4TVR A;  3X20 B;  4J6W A;  2M16 A;  3OYJ A;  3Q1J A;  1K8A C;  4CRI A;  1YJ9 T;  2JNG A;  1NJI U;  3CPW S;  2B8A A;  3HPW A;  4RG2 A;  5KCH A;  5I21 A;  3C12 A;  2MF2 A;  2JVV A;  2CZ6 B;  2KK4 A;  5FRN A;  2E6N A;  2QTX A;  1V29 B;  3P8H A;  1XOV A;  3CBP A;  3QZ9 B;  3CC2 A;  4GY5 A;  4KUL A;  5GAM g;  3P8B B;  4HCZ A;  1Q81 U;  3RMS A;  4ZN3 A;  2JUF A;  2LT4 A;  4N4G A;  1Q82 U;  4M7A E;  3JCM h; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...