2D9TA

Solution structure of the tudor domain of tudor domain containing protein 3 from mouse
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
78
structure length
78
Chain Sequence
GSSGSSGKVWKPGDECFALYWEDNKFYRAEVEALHSSGMTAVVKFTDYGNYEEVLLSNIKPVQTEAWVRDPNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the Tudor domain of Tudor domain containing protein 3 from mouse
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
molecule keywords Tudor domain-containing protein 3
total genus 5
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2005-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2d9tA01
3NTHA 1G5VA 3L2RA 3MEAA 5D6WA 3FC3A 5KCOA 2VYTA 1RI0A 4N4GA 4FU6A 4BD3A 3E9FA 4C5IA 2EKOA 2R57A 3SD4A 2X35A 4NS5A 3PMTA 2GFUA 1OZ2A 2RHZA 3MO8A 1MHNA 3MEUA 4PLIA 2JTFA 2O4XB 2K3YA 2G3RA 3L2VA 1KHCA 3LYIA 4E7JA 4HCZA 3S3NA 2R5AA 3H6ZA 2XK0A 3DB4A 4IUQA 2HQEA 3OYNA 3OYEA 4IKFA 1H3ZA 2DAQA 4OVAA 4C5EA 5FROA 4N4IA 4RG2A 3QJ6A 4E7LA 3MEVA 3OY9A 3QIIA 4A4GA 3OYLA 4E7HA 4BDZA 2RJDA 3P8DA 4QQ6A 2MWOA 5KH6A 5J39A 3OYKA 2JZ2A 4FL6A 2DIQA 3L42A 2P0KA 2K3XA 3S6WA 5FRMA 4C5GA 3M9QA 3DLMA 2RO0A 1XNIA 3OYIA 2EQMA 1N27A 4BE0A 2BUDA 2HQXA 3P8HA 4QW2A 3LGLA 2R58A 4B9WA 2RJFA 3BDLA 2RHYA 4IUVA 1WJRA 3MP1A 5CIUA 3OYJA 1OYXA 3L2QA 2EQUA 3META 3LLRA 4II1A 4BACA 3QBYA 1WJQA 4ZTJA 3OS0A 3OYFA 3KUFA 4A4EA 1OI1A 5KE2A 5D6XA 3S3MA 2B8AA 2BIVA 2O4XA 2X4XA 4IURA 2RHIA 3C4SA 5FRNA 2EFIA 3OYGA 2CKKA 3LX7A 2E6NA 3PFSA 3CEYA 3L2UA 4BE2A 2YRVA 4IUTA 2F5KA 2RJEA 4B9XA 4BDYA 4ZTFA 2L3RA 2XDPA 4QVZA 3NTIA 3PNWC 2L8DA 2NLUA 4IUPA 2GF7A 3OYMA 2E5QA 2BKDN 2GFAA 4EDUA 2RI2A 4UC4A 2RHXA 3OYBA 4X34A 2RHUA 3QKJA 4BE1A 3OS1A 4PLLA 3OMCA 4L59A 2WACA 2RI5A 4LD6A 5KCHA 4Z02A 2D9TA 3S3OA 3ME9A 1WJSA 3OS2A 2LVMA 2EQJA 3F70A 3PMIA 4N4HA 2RI3A 2X4WA 4IUUA 4QQDA 4C5HA 3OYDA 3L2WA 4A4FA 4E7IA 2QQRA 2EQKA 1WGSA 2IG0A 3NTKA 4PL6A 3E9GA 2LTOA 2M1HA 3EAEA 3Q1JA 5D6YA 3FDRA 5C0MA 2LCCA 2R5MA 3FEOA 4GY5A 3OQ5A 3MP8A 3DB3A 2L89A 4QQGA 3OMGA 3ZEHA 2LDMA 3LH0A 3FLGA 3GOXA 2LRQA 5IN1A 5IAYA 2MWPA 3OYHA 2QQSA 4CRIA 1OZ3A 3LGFA 1SSFA 2PQWA 2M16A 3UWNA 3OA6A 2M0OA 2RJCA 3OYAA 2FHDA 5KE3A 4Q5WA 3ASKA 4E7KA 3OB9A 5M9OA 5J26A 3H8ZA 3MEWA 3O8VA 5C6SA 4A4HA 2DIGA 3MP6A 3OYCA 2X4YA 3UT1A
chains in the Genus database with same CATH superfamily
1KD1U 2DO3A 5GAMh 1G5VA 1AWXA 1PRLC 2EYYA 2LNVA 2E1HA 1JQQA 1N6AA 2EKOA 3I55T 3I55A 1P92A 4PLIA 5GANj 4DBQA 3PIPA 2PVGB 2QEXQ 2D1XA 1NG2A 2XK0A 2CT4A 1KD1R 1WXBA 4WCIA 4M77F 3A1PA 2PUKB 2KYBA 4KUIA 2VXEA 3JCMd 1KQSA 4PNOA 4BDZA 1Q82R 1R77A 4P5NA 2K79A 1XQHA 3CCMA 3HL8A 2YWWA 3DLMA 5DY9A 3JB9I 4R55A 2A36A 2YRCA 4PJOD 2M51A 3KFVA 1GBQA 1NPRA 1YHQQ 3OSVA 3CCLA 1BI3A 1NJIC 3R6NA 2VUBA 2K5LA 2CKKA 1SPKA 2E6NA 3G6ET 2E65A 2MI6A 3M53A 1KK7A 1Q86C 2QA4A 2KMTA 1ACMB 1M2VB 3JCMP 4PJOG 2HBWA 4BE1A 1IO6A 2MCNA 2CP6A 2P0QA 4LD6A 3JCMQ 1TOVA 1W2BS 3EHQA 4RTYA 1EFNA 3SFMA 1AHJB 3M54A 1CKAA 2VXFA 2VASA 3INZA 4CI0C 2RMOA 3UATA 2K2VA 5FW9A 2DZ9A 2LQNA 3MP8A 5LJ3f 2RPNA 2X3XD 2ZPEB 2NUTA 3GOXA 2K7AA 2ED1A 1X2KA 4RUGA 1T3LA 2KSSA 2QQSA 4CRIA 1G83A 1S72T 1N8RU 4XTXA 1X27A 1UGRB 2FG0A 1K73R 1LJOA 1YP5A 4Q5WA 3MEWA 2PVOB 1M1KC 3I35A 3PTAA 1YJ9Q 3VS6A 1VQNA 1PWTA 4M78A 2DXUA 1VQLT 2O4XB 3CPFA 1QVFS 9ATCB 3BFMA 2SRCA 3CD6T 1H3ZA 4M77A 1CSKA 4A4GA 2DTHA 2QQAA 1RAHB 1OU8A 2RJDA 1RAAB 3L42A 4M7DE 3CCEA 2KEAA 2JM9A 1VYVA 3R6OA 2BUDA 2FVUA 1YITT 2RHYA 1VQKA 2DLPA 3I5RA 2CUDA 4JJNK 4M75A 3RDVA 2BIVA 3H41A 1VIEA 2X51A 3C4SA 3VUZA 4XQ3A 3PFSA 3CCUA 2HL3A 4AG2C 5L23A 4OB0B 1LVKA 3C0CA 4CC4B 2GF7A 2DF6A 4M4ZA 1I81A 4FSXA 4A63B 4HVVA 1VQPQ 3UDCA 1Y96B 1JXMA 5CQYA 4BUGA 4M78D 4A53A 2B86A 3M0TA 4FCYA 3JB9G 3OMCA 1YWPA 4C8QD 2NUPA 3AHUA 3MCAB 3OYDA 4C5HA 2VKNA 2DD4A 1QWFA 4J8OA 4NOYA 2O9VA 2QTVA 4RTUA 3Q1JA 3EAEA 1K1ZA 1BIAA 4LN2A 3CC2Q 2E64A 3OQ5A 4X1VA 1UUEA 1VQ6Q 2LDMA 2F69A 3VS1A 3CMAQ 2MOXA 1NPPA 3JCMW 1IXDA 2FHDA 1AZEA 2CH4A 2O9SA 1QVGS 1FYNA 4OMLA 1JEGA 1FWZA 3M5AA 2QGFB 3UT1A 3H0IA 8ATCB 3JAME 2VYTA 2JUFA 4BD3A 3E9FA 4HCBA 1YI2A 1MHNA 3MEUA 2DMOA 2RQRA 3U23A 2X4JA 4F14A 2DL3A 2G3RA 5GMKj 5LJ5e 2CP2A 3UA7A 4BB7A 1AT1B 1Q82U 3VUBA 2RA2A 3OYLA 1H8KA 1K4US 3M4GA 3RKYA 2RQUA 5LJ5d 3HFNA 1XNIA 4J9FA 3I9QA 3RESA 5GAN3 1VQ7T 4N0AA 2RJFA 1YWOA 1WQ7A 4AFQC 3EFOB 5AYFA 1YCSB 1UGSB 3M0RA 4A4EA 2XICA 1W70A 2O4XA 2X4XA 5GAN2 3MKDA 1K0SA 2CZ6B 2EFIA 1F1BB 2QYZA 1VQ8Q 3RNJA 1NYGA 3CC7Q 2A37A 2EGAA 4ZN1A 4C92E 1MMNA 2L8DA 1D09B 2NLUA 1M90C 1YHQT 1M90U 4RTXA 5A0GA 2A0FB 2RQTA 5GAOl 3OYBA 2XMFA 2DFUA 3QKJA 3KBGA 4AFUC 2KT8A 2ROLA 4L59A 4ZGJB 1ZQ1A 1HYOA 2H8HA 2DYIA 2VWFA 3MJXA 4IUUA 2AIRB 2WSCE 1JB0E 4A4FA 3ZBDA 1MNEA 3E9GA 3G4SQ 2F5TX 1GCPA 4X9DA 1VQMT 2LZ6B 2YDLA 2XIDA 5LJ5j 3JCMJ 1K8AR 5GMKe 3GPLA 4M7DF 1VQ5Q 3LH5A 3MHXA 3FIFA 4XU3A 4FYYB 1QMCA 4XTZA 2JS2A 2X4YA 1MGQA 1PD0A 3NTHA 3TQ7P 5L8RE 2ECZA 1IHWA 2JS0A 4E7SA 1VQ9Q 3JV3A 2OI3A 2OTLT 4M7AA 3JSCA 2ZPIB 3CC2T 4E7JA 4FW1A 4MDXA 1JJ2A 4KUDK 3CBPA 3PVQA 3TSWA 1H641 4ORZA 5GAOn 4GLMA 1QP2A 3P8DA 4QQ6A 3BE3A 1BI1A 2DIQA 1MUZA 1AWJA 1GBRA 3OYIA 1BCOA 2ZZDA 2DVEA 3I5SA 1AZGB 1VQ4Q 4O6JA 1VQKQ 5EG2A 4FT2A 4C92F 4IURA 4M78G 1FMVA 1KC8C 1KC8U 4AMCA 1DJ7B 2BE7D 1PG5B 1TUDA 3TEEA 1QVFA 2HSPA 1VQOQ 2O2OA 2RHXA 2ESWA 1ABQA 1Q86R 3NHNA 2KAFA 2RF0A 2D9TA 1X43A 2DNUA 3EGDA 2DTOA 2OTJQ 4EIKA 2F2XA 2H3EB 2IIMA 1M1FA 3SWNC 3EGUA 1R0CB 1NEBA 2DEQA 2KROA 2I2LA 2HAXA 4F7UE 1PD1A 2COWA 1JBMA 3CC2A 4CC3A 2CUBA 1NJIU 1U06A 1D0YA 3CCVT 1PCXA 2XI9A 2FPEA 5CO7A 3CC4A 2DPPB 4HVUA 2HEQA 2DIGA 1C1AA 2A28A 5KYUA 2DE0X 4IIOA 5KCOA 2AHJB 1HSQA 2LJ0A 4Z8AA 2EGEA 3MO8A 4KULA 3LYIA 1MV0B 2CYZB 3QSUA 2JXBA 2LNHB 4GBQA 3JRZA 3EG9B 5KH6A 5CKDA 5GANh 2DX1A 1WDXA 1N27A 4AT1B 3RUXA 2HQHA 2DKGA 1E6HA 5ECAA 3TREA 1PKTA 1FMWA 2COZA 3OYFA 3JCMh 4FYWB 4A54A 4M7DG 5CKFA 3URGA 5KE2A 5CQXA 2GCXA 2GQVA 2NUTB 3RR6A 1YJNA 4XK8E 1YIJQ 2P0PA 4DBFA 4IUTA 2F5KA 4B9XA 4BDYA 5IHNA 1IHVA 3HRUA 2V8JA 1AWOA 2HBPA 3QG1A 1HK9A 4LUDA 5IXBA 1BK2A 1JXOA 3CCVQ 4DBHA 1Y96A 5KYWA 1ZUUA 1YFNA 2QA4T 5GAMe 5KCHA 3OS2A 3JB9F 1WXTA 3CPWP 3DLLA 2AK5A 2Y4XA 1SF9A 2EVRA 3HRSA 2V26A 2DXBA 5CCAA 4EMHA 1ZSGA 4RTVA 3QWYA 2R5MA 3P8BB 4D8KA 1K8AU 2DETA 1NLPC 3I55Q 4ELZC 4ATOA 5IAYA 2NUPB 3H0HA 4VUBA 2QASA 5GANe 3OA6A 3E19A 4C0GA 4B6MA 5GAMf 5LJ3g 5J26A 5FU7C 3O8VA 2Y4YA 3S3NA 2LT4A 3CCMQ 3TU4K 5HK3A 4DEXA 1UHFA 4AFZC 4JRKA 2V1RA 1O9SA 3SD4A 2X35A 4M78E 4XTWA 3CMEA 4M77D 2JJ9A 2K3YA 3PVLA 1TTHB 1SG5A 4IUQA 1JRIA 1M3BA 2V8IA 3THKA 3JCMX 1QWEA 4N4IA 1OPLA 3OY9A 2ZGWA 3L1AA 1K76A 1X6OA 4JJDA 3REBB 2DJQA 5KYXB 1RACB 1QVGP 1WQWA 1Q95G 5GANf 3OBYA 4M75D 1TUGB 1SKUB 1VQLA 1AD5A 1K9AA 1VQ9T 3EGDB 1KSWA 5I2SA 1RAIB 4ME7A 3RMSA 2G6FX 2X3WD 4PFPA 5DLQE 2FL7A 1TXQA 2YHTA 5HK0A 2FZKB 2YRVA 3BDUA 3EH1A 2Y90A 1FX7A 1TS9A 2RK1A 5FU7B 1YI2T 1VQPA 3QHSA 1PSEA 3M0PA 2HKQB 1BBZA 4JJBA 3RBBB 2PUOB 2LVMA 2KRNA 3KXTA 1K0XA 1G3TA 3VS3A 4PL6A 2LQ8A 1GFCA 4BI4A 1VQNQ 1NBEB 3OMGA 1M3AA 2D0QB 3GIBA 5HKCA 3GLXA 1I4K1 2GGRA 2H3JA 4M7AF 3DKMA 1ZA2B 2O88A 4HVWA 1QP3A 4GLKA 3A8GB 4MMLA 2RJCA 1M1KR 3H0FA 2P4TA 1WX6A 3CC7T 3OB9A 1YIJT 4J9BA 3OW2A 4M78F 3H9NA 3OYCA 1OX9A 1U8RA 5IHIA 1MMDA 1S72A 2DL8A 4KGVB 3M0SA 4NS5A 3VS5A 4C8QB 1RAGB 3SWNA 3L2VA 4J9IA 2HKNA 3EFSA 5FROA 3CCUT 3HSBA 1PNJA 4PJOE 3QIIA 1JJ2P 1D1AA 2ZAEA 2YRDA 3QYGB 3V7CA 5GJWB 3S6WA 4LDVA 1C0MA 1AOJA 4FIBA 1ZBXA 2RM4A 1AWWA 4Y91A 3C94A 1WHJA 2DBKA 4FYXB 3RKWA 4ZTJA 1BKBA 2K2MA 1MV3A 2GTOA 2B8AA 4JLIA 3JCMf 3M56A 3M0UA 4O5VA 4ESRA 2MF2A 3CBOA 2P4RA 3NTIA 1WA7A 2D8JA 5D7UA 4KBMB 1V76A 4C92G 3D7SB 2CZ1B 2QTXA 4QVDA 3EGXA 2RI5A 1EIFA 5KYYA 2KI7A 1Z9ZA 1BU1A 1QCFA 2QQRA 4OP0A 4EMGA 3JCMe 4D6WA 1Y71A 4M7DA 2YUNA 4EMKC 5KYNA 1WI7A 2MPXC 3A5ZB 2EGCA 2ZPFB 4KH1B 1UB4A 2MWPA 1H92A 1WHKA 4C92C 2JM8A 4C92B 3UWNA 4F7UG 1QQJA 1ABOA 1T0HA 2ENMA 1I5OB 1Y0MA 3H8ZA 4QKUA 5I2MA 5M9OA 1RABB 4XU0A 2FZGB 4XTUA 3VS4A 1N9RA 2XU8A 3QZ5B 1RI0A 4E2FB 2JVVA 2KK4A 2COYA 1OZ2A 4RCBA 2LCLA 1N8RC 5GAN5 3DB4A 3HFOA 4KGXB 2DAQA 4M75F 4C5EA 2K4YA 3G71A 1JU5C 3MEVA 1VIFA 1X6GA 2J6FA 1OULA 4DEYA 4PJOB 2K3XA 1WHGA 4X9CA 1WLPB 2DK3A 2OJ2A 2YUOA 3CCLT 4LDYA 4OB3B 4BE0A 4WF2A 1X75C 4WTOB 5I22A 1VQOT 5CK9A 2PNIA 5CIUA 1OYXA 2HSEB 1VQLQ 4NL3A 2XD0A 3KUFA 1B34A 5D6XA 5GAN6 2BZYA 3EG0A 4PFZA 4J9GA 2OAWA 5FLXE 4MZPA 1OOTA 4OMFB 2EQIA 2RQVA 2QQBA 5CVIA 4BE2A 1ZA1B 2KR3A 4RCCA 3EHRA 4C0DC 4ANJA 3C95A 1K9MC 2MK5A 2M0YA 3L2ZA 5LJ3j 1KQ1A 2YUQA 3CCSA 5A0LA 2JTEA 5DLOA 2EYQA 3RMQA 4HCCA 3QYHB 4LDUA 2FRYA 5CR2A 4CC7A 3CC7A 1SHGA 1Q81U 2HNIA 1YNZA 4M75G 1ZUYA 2LCCA 4FM4B 3DB3A 4PJOC 2DILA 2DRMA 2L2PA 3LH0A 4KGZB 1Q81R 3EFRA 2M0OA 2V8KA 3BY7A 5KE3A 1Q81C 1IGUA 1T0JA 3G4SA 3E2UA 3T9NA 4C5IA 2R57A 3SEMA 1YCYA 3PMTA 3CBMA 2RN8A 4AFSC 4JRIA 1B07A 4BI8B 2KRMA 2E4HA 1VQMQ 1VQ4A 1G3WA 3E1SA 2DRKA 5GAN4 1HJDA 1MNDA 5GJVB 2M9UA 4E7HA 1GL5A 2QI2A 2GTJA 2DXCA 2DM1A 4MZTA 1VQ9A 2HQXA 2YT6A 3M0QA 3O5ZA 3VS0A 2QEXT 1WJRA 1QKXA 4J83A 1V1CA 1OI1A 2XDBA 4HXJA 3NFCA 2CH4W 4JRPA 2RHIA 3OYGA 1KQSS 2OTJA 2A3LA 1YIJA 1T3SA 2EYWA 1IREB 1KC8R 3WXMB 1QVPA 1BB9A 4UC4A 4NL2A 3CMET 5GMKm 1I0CA 2ZPBB 3OS1A 4OB1B 5GAOm 1VUBA 2EPDA 4M77C 2JMCA 4M77B 3CC4Q 3S3OA 2ZPGB 4C8QF 4J9HA 2QQ9A 3LW5E 2RQWA 2V1QA 2VB6A 5LJ3h 5D6YA 1Q7YU 4E47A 1J3TA 3J81E 1I07A 1I5LA 2LRQA 7AT1B 1VYTA 4M75C 5EC7A 2L5QA 2IPOB 4DOVA 3LWHA 1NE8A 2C0OA 1ZUKA 3G71T 2QGGA 2HCKA 4C92A 2JT4A 1K73C 4ZNXA 2KT1A 1XOVA 3MPUB 3QUIA 1WHHA 4HT9A 4D8DA 1KG1A 4HCZA 2R5AA 5CKEA 3V8LA 2BZXA 2ZCFB 4M7AC 1D3BA 1OV3A 4EMKA 1YJNQ 1RI9A 2L0AA 2SEMA 5J39A 3JCMc 2JZ2A 1YJNT 4ZN3A 2F1LA 1MMGA 3J7AF 4PJLA 2DL5A 4F7UA 4M7DD 1YN8A 3GBQA 2C0TA 3CCVA 3A8LB 3QBYA 4RKUE 2OTLA 1YJWT 4KRTA 3VRYA 4E6RA 4M7AG 2EJFA 4YTLA 2W10A 2CS7A 3OYYA 3CCJT 3CCQT 1B34B 3L2UA 3VKIA 1PSFA 5GMKi 2XDPA 1UG1A 1BI2A 1U5SA 4EDUA 1WFWA 1YITQ 4C8QE 1BYMA 1IB8A 1LCKA 1K9MR 3CCSQ 3QDFA 2DTIA 1M4ZA 3PMIA 1GFDA 1Y7XA 4JJCA 2EJ9A 5GAMj 3QJYA 5GAMd 5CKBA 2M1HA 3FDRA 4QT7A 3CC4T 1WXUA 1BCMA 5GAN7 4DA4A 1KHIA 3CQTA 1D1CA 4RTTA 1SSFA 3CPWA 2M16A 1M9SA 5GAOq 2FO0A 1ZLMA 4N0AC 2HDAA 2YSQA 2K9GA 2LX9A 2EKHA 3VRZA 2AZSA 1S72Q 3PIOA 2RB6A 3CPWS 4FU6A 3CCRT 1RADB 2DD5A 1K73U 5A0DA 3ULRB 4JS5A 4C8QC 1U1TA 2GNCA 3PGGA 3TVTA 4RTWA 2P84A 1XTDA 2E3HA 4C5GA 1H3HA 1R8OB 2J05A 4F16A 1M1GA 2HD0A 3MP1A 3I56A 2D6FA 2NUZA 1S1NA 5FU6C 1D1BA 3S3MA 2KQWA 1RAEB 2AZVA 1VQ8T 3UA6A 5FRNA 1O75A 5FWCA 5GANg 2K57A 3G7ZA 3WVDB 2MAMA 3PE0A 3OW2P 3VU3C 3HP9A 5IHKA 2VGNA 3VS2A 1ARKA 2GFAA 4X34A 1UGQB 3FJ5A 3JCMg 1UTIA 2KGTA 2CZ7B 4Z02A 1M30A 3CXCS 2E12A 3F70A 2CSIA 2LQWA 4BY6B 1QW1A 3JB9H 4PJOF 4BY6C 1X2QA 1QVGA 4QVCA 3SHWA 5LJ3d 2ROTA 4J9CA 1MMAA 2C06A 2HZYA 1K8AC 2RD1A 5IT9E 4C0ZA 1NEGA 2FYKA 4XTYA 2DYBA 3TSZA 1UECA 3NGPA 4RMOA 5LL6S 1QLYA 3MP6A 4TVRA 2D8HA 2CT3A 3UPUA 2MIOA 1TUCA 4MZMA 1VQ6T 2GFUA 1KD1C 1SRMA 3V7SA 1EZZB 2RH2A 4OGEA 2FPDA 1KHCA 3H6ZA 4MDWA 3WVEB 3HPWA 1QCOA 1YBYA 4HKEA 6AT1B 3EG1A 4E7LA 4LNPA 4FL6A 2P0KA 4L5GA 1W2BA 1D3BB 3P8HA 1VQPT 5A2QE 2XKOC 3EFOA 1OX8A 3OS0A 2K5IA 3CCJQ 3CCQQ 2OAUA 4DBRA 2L3QA 3ER0A 1TH7A 2CGHA 3HRTA 3M4YA 4F7UF 2HMAA 2BZ8A 2CZ0B 1YJWQ 1UGPB 5AT1B 4L6V5 1JJ2S 1W1FA 4LE9A 2E5QA 3AT1B 4OMMA 3A8MB 2DJZA 1M90R 3CCLQ 2YUPA 4M77E 2JW4A 2WACA 2XG8D 2C0IA 2X4WA 4JRQA 1Q7YR 2ED0A 3L2WA 2K3BA 4E7IA 4OGCA 2IG0A 1HD3A 2LTOA 5FWBA 2LQKA 2LCSA 3CD6Q 2E41A 2JMAA 1Q82C 4FT4A 2QA4Q 4GY5A 4OMQA 1U3OA 2BE9B 4QQGA 1N5ZA 3ZEHA 3JB9J 1GXIE 1V29B 1AVZC 1E7OA 1C6VX 4M75E 3OYHA 1YJ9T 1M1KU 3VYGA 1AEYA 4E7ZA 3REAB 3SDZA 5KYUB 2RK2A 2LX7A 1Y57A 3NMZC 3G71Q 4LDXA 2QXFA 2AT1B 3J80E 2Z0WA 4J9DA 4A4HA 1QVFP 3CXCA 4EMKB 4HT8A 3QXEB 1X6BA 3JB9D 2RHZA 4J7IA 1VQ7A 3A8HB 2L3SA 4JZ3A 2KVQG 3GF5A 3G1JA 1D0XA 2MWOA 3OYKA 3VJPA 1YJ9A 2RO0A 4DQ2A 1W4SA 2EQMA 1KIKA 4OMNA 4ELYC 2JOYA 1B7TA 2KE9A 3BW1A 3OYJA 1YHQA 1JO8A 3META 4J6XA 4II1A 2EYZA 1WYXA 3CCRA 1WIEA 2F2VA 5LJ3e 4JDSA 1M8VA 4A4KA 2NWMA 5GMKl 4FSSA 2XHCA 3IQLA 3M59A 2AKLA 4ZGDB 2FPFA 1ZBJA 4F7UB 2F2WA 4QVZA 2JN0A 1UEBA 1VA7A 1NM7A 3I56T 3C12A 5FU6B 5LJ5h 2DZCA 1TU0B 2DERA 3GNGA 1VQNT 4PLLA 2J06A 4BI3A 2VV5A 1OEBA 4OMOA 1PHTA 3FRNA 2EQJA 4QQDA 2FEIA 3CCUQ 1G2BA 4C8QG 1UJ0A 1GCQA 2EQKA 2CP5A 2OTJT 2EJGA 4R0KA 3OSSC 4EPCA 3FEOA 2E70A 4LDWA 3UF4A 2DVJA 3X25B 2QAZA 1VQMA 3M57A 4M7DC 2RNAA 1A0NB 3RKXA 2DL4A 2FB7A 3M58A 4KH0B 2FRWA 3V8KA 4JPBW 3RERA 5C6SA 1NJIR 1Z9QA 2EWNA 3MEAA 2LT1A 1OPKA 1FXXA 1N8RR 2DXTA 2WSFE 1VQ6A 1KQ2A 4PK4A 1VQKT 8AT1B 2YXYA 3GP8A 3JCMb 1KQSP 2HQEA 3NPFA 1GRIA 2EW3A 3JCMV 4OVAA 3CCET 4RG2A 2DEUA 3OW2S 3VV0A 4Z89A 2OX7A 1M2OA 3EG9A 1VQ8A 2QDYB 4MMKA 1G3YA 5LJ5g 1WHMA 2EYXA 3QDRB 3CCEQ 2CREA 5DM7R 4HA8A 1WHLA 4XTVA 1YI2Q 5GMKh 3VYHB 4PJNA 1SEMA 2FZCB 2KXCA 2OTLQ 3QZ9B 3N5BB 1IZ6A 4J6WA 1M8MA 1SHFA 4DOWA 2M02A 3CCMT 2E3IA 4F17A 4M78B 2EAYA 2KRSA 1YJWA 2IVWA 1PM3A 2QK0A 1I8FA 2D0NA 3TCJA 1VQ5T 2ATCB 3CXCP 4M7AE 2BKDN 1HXDA 2ZPHB 1M3CA 2CP7A 1PKSA 4PKCC 2RHUA 1LNXA 2E6ZA 4M7AD 2I0NA 5LJ5f 3EGXB 1Q7YC 2HL5C 5HY6A 3ME9A 3HTRA 3G4ST 4J5YA 2RI3A 2CP3A 1KFZA 1RL2A 1IRXA 1GCQC 3FB9A 4AG1C 3CD6A 2CP0A 1K9MU 3EH2A 1QKWA 3V8JA 5J3BA 2LP5A 1UFFA 4LXCA 1UDLA 4Y28E 4LUEA 4PJJA 4RTZA 5IN1A 2JNGA 3X26B 2W0ZA 5GAOr 1LOJA 3CMAA 1WPYA 2PQWA 4JS4A 3OYAA 1CKBA 3SB2A 1RLPC 3G6EA 1TSFA 1ZSZA 3A8OB 1Y07A 1RAFB 4CC2A 2ABLA 5D6WA 3FC3A 2AKKA 4OMPA 4M78C 2YLCA 2QDLA 1WZOA 2QEXA 4C0FA 5I21A 1VQ7Q 2DBMA 4XU2A 3OYNA 4J6YA 2E5KA 3QWXX 3OYEA 3QJ6A 3OBWA 5KYWB 5CAIA 4IIMA 4PJOA 2EBPA 2GQIA 1IGQA 2MMPA 3HHTB 3M9QA 5KYXA 2A7YA 1PC0A 2NYSA 2BTTA 2KXDA 3FJPA 1X69A 4QW2A 4V2SA 3LGLA 4B9WA 3BDLA 4FW2A 3PT9A 4C0DB 5IXFA 3I56Q 4XU1A 3L2QA 2EQUA 4BACA 1WJQA 4M7AB 3CCRQ 1VYUA 1RLQC 1WNLA 1OQKA 2GBQA 4C92D 1X01A 3LX7A 2J6KA 4Z88A 1UGVA 1M27C 2E10A 2XDDA 4XAXB 3V7RA 4ZTFA 4IUPA 1R0BG 2MYSA 3OYMA 3QO3A 1B3QA 2DA9A 3CMAT 5KYYB 4KT0E 4F04B 3OS5A 1I1JA 5CKHA 3X24B 3LWIA 1WJSA 4Y92A 2LC4A 1D0ZA 2PZ1A 3X28B 1SRLA 1WGSA 4HCKA 4RG8A 1N9SA 4M77G 4J7FA 3QPHA 1G8XA 1YITA 3CCST 2L89A 2YLBA 1M5Q1 4JZ4A 5I11A 3FLGA 1UE9A 1UHCA 1OZ3A 3LGFA 2VVKA 2LJ1A 1TWBA 1VQ5A 4K11A 2PTKA 3ASKA 2KDSA 3RIRA 3EG3A 3L2RA 2EIFA 2WSEE 2KBTA 4N4GA 4M7DB 1M2VA 4LD9K 2JTFA 4C8QA 2VC8A 1NZ9A 3ZL7C 1LPLA 1SSHA 2KYMA 1XJWB 5GAOp 4IKFA 2LJ3A 4FYVB 3M55A 5GAN8 1E6GA 1BIBA 1NYFA 5FRMA 3X20B 1BI0A 2J6OA 1U1SA 1RUWA 2R58A 5HCKA 1TG0A 4IUVA 5GAMg 2KY9A 1NLOC 3LLRA 4JLGA 3CCJA 3CCQA 3VS7A 4JUVA 2L3PA 1VOMA 1ZSZC 1Q86U 1ZSZB 1KJWA 4OF1A 3CEYA 5GANd 5IH2A 2JTMA 2RJEA 2L3RA 2X9HA 3PNWC 1VQ4T 2DL7A 2RI2A 2O31A 1VQOA 1FMKA 4PJMA 4ZGEB 2VGMA 1OU9A 1PRMC 3HKSA 3A98A 3GNFB 4M75B 4J9EA 2O01E 4PFOA 2CDTA 1ZHIA 2K6DA 4N4HA 1UJYA 3SWNB 2CSQA 3NTKA 1ZX6A 5C0MA 2J7IA 1W2BP 1G3SA 3ZFJA 2A08A 4OB2B 2KNBB 1W6XA 1EX4A 2K5FA 3CMEQ 2QG9B 2PVDB 1QCNA 3EG2A 2PU9B 4R56A 4E7KA 2LMJA 3G6EQ
chains in the Genus database with same CATH topology
1KD1U 3CXCA 4EMKB 2DO3A 5GAMh 1G5VA 4HT8A 5KCOA 2AHJB 3QXEB 2LNVA 2E1HA 1N6AA 3T9NA 4C5IA 2EKOA 2R57A 3I55T 3JB9D 3I55A 1YCYA 1P92A 2RHZA 3CBMA 3MO8A 3PMTA 4JRIA 4BI8B 4PLIA 5GANj 3PIPA 2PVGB 4J7IA 4KULA 1VQ7A 1VQ4A 1G3WA 3A8HB 3LYIA 2XK0A 3E1SA 4M77F 5GAN4 2CYZB 3QSUA 2KVQG 3GF5A 2PUKB 2M9UA 4KUIA 2VXEA 3JCMd 4E7HA 1KQSA 4PNOA 4BDZA 3JRZA 4P5NA 5KH6A 2MWOA 2QI2A 3OYKA 3VJPA 1XQHA 2DXCA 3CCMA 3HL8A 5CKDA 5DY9A 3DLMA 5GANh 2RO0A 3JB9I 4R55A 4MZTA 1YJ9A 4DQ2A 1W4SA 2EQMA 4PJOD 1N27A 1VQ9A 2HQXA 3RUXA 4ELYC 2DKGA 2JOYA 2QEXT 1NPRA 1WJRA 3TREA 4J83A 3BW1A 3OSVA 3OYJA 1YHQA 3META 4J6XA 4II1A 3CCRA 3CCLA 3OYFA 3JCMh 4A54A 5LJ3e 1OI1A 1BI3A 5CKFA 3URGA 5KE2A 4JDSA 5CQXA 1NJIC 3NFCA 2XDBA 2GCXA 4A4KA 5GMKl 2VUBA 2GQVA 1M8VA 1YJNA 4JRPA 2RHIA 2K5LA 4XK8E 3OYGA 2CKKA 2XHCA 1KQSS 2OTJA 2A3LA 2E6NA 3M59A 4ZGDB 3G6ET 1YIJA 2E65A 2MI6A 2P0PA 4BDYA 4IUTA 2F5KA 4B9XA 4F7UB 1IREB 4QVZA 3M53A 2JN0A 3WXMB 3HRUA 1QVPA 2V8JA 1UEBA 2HBPA 1Q86C 3QG1A 3I56T 2QA4A 3C12A 4UC4A 1HK9A 2KMTA 5FU6B 5LJ5h 2DZCA 4NL2A 3CMET 3JCMP 5GMKm 4PJOG 1Y96A 2ZPBB 4BE1A 3OS1A 3GNGA 4OB1B 5GAOm 1VQNT 2P0QA 4PLLA 1VUBA 4M77C 5GAMe 2QA4T 4BI3A 2VV5A 4LD6A 4M77B 5KCHA 3JCMQ 1W2BS 3S3OA 2ZPGB 3OS2A 3FRNA 4C8QF 3JB9F 2EQJA 2QQ9A 4QQDA 3LW5E 3SFMA 1AHJB 3M54A 3DLLA 4C8QG 2Y4XA 3HRSA 2VXFA 2EQKA 3INZA 5D6YA 5LJ3h 4CI0C 1Q7YU 2EJGA 2OTJT 2DXBA 5CCAA 2K2VA 4EMHA 3OSSC 2R5MA 2DZ9A 4EPCA 4E47A 3FEOA 3P8BB 2E70A 3MP8A 4LDWA 3J81E 5LJ3f 1K8AU 2ZPEB 4ELZC 1I5LA 3GOXA 4ATOA 2LRQA 3X25B 5IAYA 4VUBA 1VQMA 2KSSA 2QQSA 3M57A 4CRIA 4M75C 4M7DC 2L5QA 1S72T 5GANe 3RKXA 4DOVA 3E19A 4XTXA 2FB7A 3M58A 3OA6A 3LWHA 1N8RU 1NE8A 4C0GA 1UGRB 5GAMf 4M7AA 1LJOA 4Q5WA 3V8KA 3G71T 5LJ3g 3RERA 5J26A 5FU7C 3MEWA 2PVOB 3O8VA 5C6SA 1M1KC 2Y4YA 4C92A 3S3NA 2LT4A 2EWNA 1K73C 3TU4K 3PTAA 5HK3A 3MEAA 2LT1A 4JRKA 1FXXA 1O9SA 2DXTA 1VQNA 2WSFE 4M78A 1VQ6A 2DXUA 1XOVA 2X35A 3QUIA 3SD4A 1KQ2A 1VQKT 4M78E 1VQLT 4HT9A 4XTWA 3GP8A 3CMEA 4M77D 2O4XB 2K3YA 3CPFA 1KG1A 1QVFS 4HCZA 3BFMA 2R5AA 4IUQA 1JRIA 5CKEA 3JCMb 2HQEA 3CD6T 3V8LA 1H3ZA 2V8IA 4M77A 3JCMX 2ZCFB 4OVAA 3JCMV 4M7AC 3CCET 4N4IA 4RG2A 1D3BA 3OW2S 4EMKA 3VV0A 3OY9A 2ZGWA 4A4GA 2DTHA 2QQAA 3L1AA 2RJDA 5J39A 3JCMc 1VQ8A 2QDYB 1X6OA 2JZ2A 1G3YA 4MMKA 3L42A 5LJ5g 4M7DE 1YJNT 3QDRB 3CCEA 4ZN3A 1WQWA 5DM7R 3R6OA 4HA8A 4XTVA 2BUDA 3J7AF 5GANf 3OBYA 2FVUA 4F7UA 1YITT 5GMKh 4M7DD 3VYHB 4M75D 2RHYA 1VQLA 1VQKA 3CCVA 3A8LB 3QBYA 3QZ9B 4RKUE 4JJNK 1VQ9T 2OTLA 3N5BB 4M75A 1IZ6A 4J6WA 2BIVA 1YJWT 5I2SA 4DOWA 1VIEA 4ME7A 3C4SA 3RMSA 3CCMT 4M7AG 2EJFA 3VUZA 4YTLA 4XQ3A 2CS7A 5DLQE 2FL7A 4M78B 2EAYA 2YHTA 3PFSA 3CCUA 3OYYA 3CCJT 5HK0A 1B34B 3L2UA 3CCQT 1YJWA 2YRVA 2IVWA 3VKIA 1PSFA 3BDUA 5GMKi 4OB0B 2XDPA 1I8FA 3TCJA 2Y90A 1VQ5T 1BI2A 2GF7A 4M7AE 1FX7A 2BKDN 2RK1A 1I81A 4FSXA 1HXDA 2ZPHB 5FU7B 4EDUA 1YI2T 4C8QE 1VQPA 1BYMA 3QHSA 1PSEA 4PKCC 3UDCA 1Y96B 1LNXA 2E6ZA 2RHUA 5CQYA 4BUGA 4M78D 4A53A 4M7AD 5LJ5f 3JB9G 4M7DG 3OMCA 1Q7YC 2PUOB 5HY6A 4C8QD 3ME9A 2DTIA 2LVMA 3MCAB 3AHUA 3G4ST 4J5YA 3OYDA 1M4ZA 3PMIA 2RI3A 1Y7XA 4C5HA 3KXTA 1G3TA 2DD4A 2EJ9A 5GAMj 3QJYA 1RL2A 4J8OA 4NOYA 4PL6A 5GAMd 3FB9A 3Q1JA 3EAEA 2M1HA 5CKBA 3CD6A 1BIAA 1K9MU 3FDRA 3V8JA 2LQ8A 3CC4T 5J3BA 4BI4A 2E64A 3OQ5A 4Y28E 3OMGA 5GAN7 2LDMA 2D0QB 4DA4A 3GIBA 2F69A 5HKCA 1KHIA 3GLXA 5IN1A 2JNGA 3X26B 1I4K1 5GAOr 1LOJA 1NPPA 2H3JA 3CMAA 4M7AF 3DKMA 1WPYA 1SSFA 2PQWA 2M16A 3CPWA 1M9SA 1QP3A 4GLKA 4JS4A 3A8GB 4MMLA 5GAOq 3JCMW 2RJCA 3OYAA 4N0AC 2FHDA 2P4TA 3SB2A 1QVGS 3CC7T 3OB9A 2LX9A 3G6EA 1FWZA 3M5AA 3OW2A 1YIJT 4M78F 3A8OB 3OYCA 1Y07A 3UT1A 1U8RA 3PIOA 1S72A 5D6WA 3FC3A 3JAME 2RB6A 2VYTA 3CPWS 2JUFA 4FU6A 4BD3A 3CCRT 3E9FA 4HCBA 2DD5A 4M78C 2YLCA 4NS5A 1K73U 5A0DA 1YI2A 1MHNA 3MEUA 4JS5A 4C8QB 2QEXA 2X4JA 4C0FA 4C8QC 2G3RA 3SWNA 5GMKj 3L2VA 5I21A 5LJ5e 1U1TA 4XU2A 3OYNA 4J6YA 3OYEA 3EFSA 4BB7A 1Q82U 5FROA 3PGGA 3QJ6A 3CCUT 3HSBA 3OBWA 3VUBA 4PJOE 2RA2A 3QIIA 3OYLA 5CAIA 4PJOA 3QYGB 3V7CA 1XTDA 3M4GA 3RKYA 2MMPA 3HHTB 4LDVA 3S6WA 4C5GA 3M9QA 5LJ5d 2A7YA 3HFNA 1R8OB 1XNIA 4FIBA 3FJPA 1M1GA 4QW2A 3RESA 4V2SA 5GAN3 1ZBXA 2HD0A 2RM4A 3LGLA 4N0AA 2RJFA 3BDLA 4B9WA 1VQ7T 1WQ7A 3C94A 3PT9A 4Y91A 4C0DB 3MP1A 4XU1A 3I56A 3L2QA 2EQUA 4BACA 2D6FA 1WJQA 3RKWA 1BKBA 5AYFA 4ZTJA 4M7AB 1UGSB 5FU6C 4A4EA 3S3MA 2B8AA 2XICA 1WNLA 2KQWA 2O4XA 4JLIA 2X4XA 5GAN2 1VQ8T 4C92D 5FRNA 1X01A 1O75A 2CZ6B 2EFIA 3LX7A 3JCMf 2E10A 5GANg 3M56A 2XDDA 2K57A 3G7ZA 4O5VA 4XAXB 3WVDB 2MF2A 2MAMA 3V7RA 3CBOA 4ZN1A 4C92E 4ZTFA 3VU3C 3NTIA 2L8DA 2NLUA 4IUPA 3HP9A 2VGNA 3OYMA 1M90C 3QO3A 1YHQT 1M90U 2GFAA 5A0GA 4KBMB 5GAOl 3OYBA 4X34A 3CMAT 1UGQB 3JCMg 3QKJA 4KT0E 3KBGA 4C92G 2CZ1B 3OS5A 2QTXA 4QVDA 2CZ7B 4L59A 4ZGJB 5CKHA 2RI5A 3X24B 1EIFA 1ZQ1A 4Z02A 3LWIA 1WJSA 3CXCS 2E12A 2LC4A 3F70A 4IUUA 3X28B 1QW1A 4BY6B 3JB9H 2WSCE 4PJOF 1JB0E 4BY6C 4A4FA 3ZBDA 1QVGA 2QQRA 1WGSA 4OP0A 4QVCA 5LJ3d 3E9GA 4D6WA 4EMGA 3JCMe 1Y71A 2F5TX 4RG8A 4M7DA 1N9SA 4M77G 4X9DA 4J7FA 2C06A 3QPHA 1VQMT 4EMKC 1K8AC 1YITA 3CCST 2L89A 2YLBA 3A5ZB 1M5Q1 2RD1A 3FLGA 2XIDA 2ZPFB 5IT9E 4C0ZA 1UB4A 2MWPA 5LJ5j 3JCMJ 2FYKA 5GMKe 1OZ3A 3LGFA 4C92C 4XTYA 3GPLA 4C92B 3UWNA 4M7DF 4RMOA 1VQ5A 4F7UG 3MHXA 3ASKA 3FIFA 4XU3A 5M9OA 2KDSA 3H8ZA 4XTZA 5I2MA 5LL6S 3RIRA 3MP6A 4TVRA 2X4YA 1MGQA 3NTHA 4XTUA 4XU0A 1N9RA 3L2RA 2EIFA 2XU8A 5L8RE 2WSEE 3QZ5B 3UPUA 1RI0A 4N4GA 4M7DB 2JVVA 2KK4A 4MZMA 2OTLT 1VQ6T 2GFUA 1OZ2A 1KD1C 3JSCA 2ZPIB 4LD9K 2JTFA 3V7SA 4RCBA 2LCLA 4C8QA 2VC8A 3CC2T 2RH2A 4OGEA 1NZ9A 1N8RC 1KHCA 4E7JA 5GAN5 4MDXA 3H6ZA 1JJ2A 4KUDK 3DB4A 3CBPA 3HFOA 4MDWA 3WVEB 5GAOp 4IKFA 3HPWA 1YBYA 2DAQA 4M75F 4C5EA 2K4YA 1H641 4HKEA 3G71A 5GAOn 4E7LA 3MEVA 1VIFA 3M55A 5GAN8 1QP2A 3P8DA 4QQ6A 4PJOB 1BI1A 4FL6A 1BIBA 2DIQA 2P0KA 2K3XA 4L5GA 1W2BA 3X20B 4X9CA 5FRMA 2DK3A 1D3BB 1BI0A 3OYIA 3CCLT 4LDYA 1U1SA 4OB3B 4BE0A 3P8HA 2ZZDA 1VQPT 4WF2A 5A2QE 2DVEA 2R58A 1X75C 4IUVA 2XKOC 5CIUA 2KY9A 5CK9A 5GAMg 1VQOT 1OYXA 4O6JA 3LLRA 4JLGA 4NL3A 3OS0A 2XD0A 3KUFA 5EG2A 4FT2A 1B34A 5D6XA 2K5IA 3CCJA 4C92F 3CCQA 4JUVA 2OAUA 4IURA 3ER0A 5GAN6 4M78G 1TH7A 2CGHA 3HRTA 3M4YA 5FLXE 4F7UF 1Q86U 4MZPA 1KC8C 4OMFB 4OF1A 1KC8U 2CZ0B 3CEYA 5CVIA 5GANd 2QQBA 4BE2A 1UGPB 2JTMA 2RJEA 2L3RA 1DJ7B 4RCCA 3PNWC 4L6V5 1JJ2S 3TEEA 1QVFA 1VQ4T 4C0DC 2E5QA 3C95A 1K9MC 2RI2A 1VQOA 2RHXA 3L2ZA 4ZGEB 5LJ3j 2VGMA 1KQ1A 3A8MB 2DJZA 3CCSA 3HKSA 2KAFA 4M77E 5A0LA 5DLOA 2EYQA 2WACA 3RMQA 2XG8D 3GNFB 2D9TA 4M75B 4HCCA 2DTOA 2O01E 3QYHB 4LDUA 1ZHIA 4N4HA 2X4WA 4JRQA 3SWNB 5CR2A 1M1FA 3L2WA 3SWNC 3CC7A 4E7IA 4OGCA 2IG0A 1Q81U 3NTKA 2HNIA 2LTOA 2LQKA 4M75G 2DEQA 2E41A 2LCCA 5C0MA 4FT4A 4FM4B 2I2LA 1Q82C 2HAXA 4F7UE 4GY5A 1JBMA 3CC2A 1G3SA 3DB3A 4QQGA 3ZFJA 3ZEHA 3JB9J 1NJIU 4PJOC 3LH0A 4OB2B 1GXIE 3CCVT 1V29B 2K5FA 4M75E 2XI9A 5CO7A 3OYHA 1YJ9T 3VYGA 1M1KU 3EFRA 3SDZA 3CC4A 2DPPB 2PVDB 2RK2A 2M0OA 2V8KA 3BY7A 2PU9B 5KE3A 4R56A 1Q81C 4LDXA 4E7KA 2QXFA 3J80E 4A4HA 2DIGA 3G4SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NTH A;  1G5V A;  3L2R A;  3MEA A;  5D6W A;  3FC3 A;  5KCO A;  2VYT A;  1RI0 A;  4N4G A;  4FU6 A;  4BD3 A;  3E9F A;  4C5I A;  2EKO A;  2R57 A;  3SD4 A;  2X35 A;  4NS5 A;  3PMT A;  2GFU A;  1OZ2 A;  2RHZ A;  3MO8 A;  1MHN A;  3MEU A;  4PLI A;  2JTF A;  2O4X B;  2K3Y A;  2G3R A;  3L2V A;  1KHC A;  3LYI A;  4E7J A;  4HCZ A;  3S3N A;  2R5A A;  3H6Z A;  2XK0 A;  3DB4 A;  4IUQ A;  2HQE A;  3OYN A;  3OYE A;  4IKF A;  1H3Z A;  2DAQ A;  4OVA A;  4C5E A;  5FRO A;  4N4I A;  4RG2 A;  3QJ6 A;  4E7L A;  3MEV A;  3OY9 A;  3QII A;  4A4G A;  3OYL A;  4E7H A;  4BDZ A;  2RJD A;  3P8D A;  4QQ6 A;  2MWO A;  5KH6 A;  5J39 A;  3OYK A;  2JZ2 A;  4FL6 A;  2DIQ A;  3L42 A;  2P0K A;  2K3X A;  3S6W A;  5FRM A;  4C5G A;  3M9Q A;  3DLM A;  2RO0 A;  1XNI A;  3OYI A;  2EQM A;  1N27 A;  4BE0 A;  2BUD A;  2HQX A;  3P8H A;  4QW2 A;  3LGL A;  2R58 A;  4B9W A;  2RJF A;  3BDL A;  2RHY A;  4IUV A;  1WJR A;  3MP1 A;  5CIU A;  3OYJ A;  1OYX A;  3L2Q A;  2EQU A;  3MET A;  3LLR A;  4II1 A;  4BAC A;  3QBY A;  1WJQ A;  4ZTJ A;  3OS0 A;  3OYF A;  3KUF A;  4A4E A;  1OI1 A;  5KE2 A;  5D6X A;  3S3M A;  2B8A A;  2BIV A;  2O4X A;  2X4X A;  4IUR A;  2RHI A;  3C4S A;  5FRN A;  2EFI A;  3OYG A;  2CKK A;  3LX7 A;  2E6N A;  3PFS A;  3CEY A;  3L2U A;  4BE2 A;  2YRV A;  4IUT A;  2F5K A;  2RJE A;  4B9X A;  4BDY A;  4ZTF A;  2L3R A;  2XDP A;  4QVZ A;  3NTI A;  3PNW C;  2L8D A;  2NLU A;  4IUP A;  2GF7 A;  3OYM A;  2E5Q A;  2BKD N;  2GFA A;  4EDU A;  2RI2 A;  4UC4 A;  2RHX A;  3OYB A;  4X34 A;  2RHU A;  3QKJ A;  4BE1 A;  3OS1 A;  4PLL A;  3OMC A;  4L59 A;  2WAC A;  2RI5 A;  4LD6 A;  5KCH A;  4Z02 A;  2D9T A;  3S3O A;  3ME9 A;  1WJS A;  3OS2 A;  2LVM A;  2EQJ A;  3F70 A;  3PMI A;  4N4H A;  2RI3 A;  2X4W A;  4IUU A;  4QQD A;  4C5H A;  3OYD A;  3L2W A;  4A4F A;  4E7I A;  2QQR A;  2EQK A;  1WGS A;  2IG0 A;  3NTK A;  4PL6 A;  3E9G A;  2LTO A;  2M1H A;  3EAE A;  3Q1J A;  5D6Y A;  3FDR A;  5C0M A;  2LCC A;  2R5M A;  3FEO A;  4GY5 A;  3OQ5 A;  3MP8 A;  3DB3 A;  2L89 A;  4QQG A;  3OMG A;  3ZEH A;  2LDM A;  3LH0 A;  3FLG A;  3GOX A;  2LRQ A;  5IN1 A;  5IAY A;  2MWP A;  3OYH A;  2QQS A;  4CRI A;  1OZ3 A;  3LGF A;  1SSF A;  2PQW A;  2M16 A;  3UWN A;  3OA6 A;  2M0O A;  2RJC A;  3OYA A;  2FHD A;  5KE3 A;  4Q5W A;  3ASK A;  4E7K A;  3OB9 A;  5M9O A;  5J26 A;  3H8Z A;  3MEW A;  3O8V A;  5C6S A;  4A4H A;  2DIG A;  3MP6 A;  3OYC A;  2X4Y A;  3UT1 A; 
#chains in the Genus database with same CATH topology
 1KD1 U;  2DO3 A;  5GAM h;  1G5V A;  1AWX A;  1PRL C;  2EYY A;  2LNV A;  2E1H A;  1JQQ A;  1N6A A;  2EKO A;  3I55 T;  3I55 A;  1P92 A;  4PLI A;  5GAN j;  4DBQ A;  3PIP A;  2PVG B;  2QEX Q;  2D1X A;  1NG2 A;  2XK0 A;  2CT4 A;  1KD1 R;  1WXB A;  4WCI A;  4M77 F;  3A1P A;  2PUK B;  2KYB A;  4KUI A;  2VXE A;  3JCM d;  1KQS A;  4PNO A;  4BDZ A;  1Q82 R;  1R77 A;  4P5N A;  2K79 A;  1XQH A;  3CCM A;  3HL8 A;  2YWW A;  3DLM A;  5DY9 A;  3JB9 I;  4R55 A;  2A36 A;  2YRC A;  4PJO D;  2M51 A;  3KFV A;  1GBQ A;  1NPR A;  1YHQ Q;  3OSV A;  3CCL A;  1BI3 A;  1NJI C;  3R6N A;  2VUB A;  2K5L A;  2CKK A;  1SPK A;  2E6N A;  3G6E T;  2E65 A;  2MI6 A;  3M53 A;  1KK7 A;  1Q86 C;  2QA4 A;  2KMT A;  1ACM B;  1M2V B;  3JCM P;  4PJO G;  2HBW A;  4BE1 A;  1IO6 A;  2MCN A;  2CP6 A;  2P0Q A;  4LD6 A;  3JCM Q;  1TOV A;  1W2B S;  3EHQ A;  4RTY A;  1EFN A;  3SFM A;  1AHJ B;  3M54 A;  1CKA A;  2VXF A;  2VAS A;  3INZ A;  4CI0 C;  2RMO A;  3UAT A;  2K2V A;  5FW9 A;  2DZ9 A;  2LQN A;  3MP8 A;  5LJ3 f;  2RPN A;  2X3X D;  2ZPE B;  2NUT A;  3GOX A;  2K7A A;  2ED1 A;  1X2K A;  4RUG A;  1T3L A;  2KSS A;  2QQS A;  4CRI A;  1G83 A;  1S72 T;  1N8R U;  4XTX A;  1X27 A;  1UGR B;  2FG0 A;  1K73 R;  1LJO A;  1YP5 A;  4Q5W A;  3MEW A;  2PVO B;  1M1K C;  3I35 A;  3PTA A;  1YJ9 Q;  3VS6 A;  1VQN A;  1PWT A;  4M78 A;  2DXU A;  1VQL T;  2O4X B;  3CPF A;  1QVF S;  9ATC B;  3BFM A;  2SRC A;  3CD6 T;  1H3Z A;  4M77 A;  1CSK A;  4A4G A;  2DTH A;  2QQA A;  1RAH B;  1OU8 A;  2RJD A;  1RAA B;  3L42 A;  4M7D E;  3CCE A;  2KEA A;  2JM9 A;  1VYV A;  3R6O A;  2BUD A;  2FVU A;  1YIT T;  2RHY A;  1VQK A;  2DLP A;  3I5R A;  2CUD A;  4JJN K;  4M75 A;  3RDV A;  2BIV A;  3H41 A;  1VIE A;  2X51 A;  3C4S A;  3VUZ A;  4XQ3 A;  3PFS A;  3CCU A;  2HL3 A;  4AG2 C;  5L23 A;  4OB0 B;  1LVK A;  3C0C A;  4CC4 B;  2GF7 A;  2DF6 A;  4M4Z A;  1I81 A;  4FSX A;  4A63 B;  4HVV A;  1VQP Q;  3UDC A;  1Y96 B;  1JXM A;  5CQY A;  4BUG A;  4M78 D;  4A53 A;  2B86 A;  3M0T A;  4FCY A;  3JB9 G;  3OMC A;  1YWP A;  4C8Q D;  2NUP A;  3AHU A;  3MCA B;  3OYD A;  4C5H A;  2VKN A;  2DD4 A;  1QWF A;  4J8O A;  4NOY A;  2O9V A;  2QTV A;  4RTU A;  3Q1J A;  3EAE A;  1K1Z A;  1BIA A;  4LN2 A;  3CC2 Q;  2E64 A;  3OQ5 A;  4X1V A;  1UUE A;  1VQ6 Q;  2LDM A;  2F69 A;  3VS1 A;  3CMA Q;  2MOX A;  1NPP A;  3JCM W;  1IXD A;  2FHD A;  1AZE A;  2CH4 A;  2O9S A;  1QVG S;  1FYN A;  4OML A;  1JEG A;  1FWZ A;  3M5A A;  2QGF B;  3UT1 A;  3H0I A;  8ATC B;  3JAM E;  2VYT A;  2JUF A;  4BD3 A;  3E9F A;  4HCB A;  1YI2 A;  1MHN A;  3MEU A;  2DMO A;  2RQR A;  3U23 A;  2X4J A;  4F14 A;  2DL3 A;  2G3R A;  5GMK j;  5LJ5 e;  2CP2 A;  3UA7 A;  4BB7 A;  1AT1 B;  1Q82 U;  3VUB A;  2RA2 A;  3OYL A;  1H8K A;  1K4U S;  3M4G A;  3RKY A;  2RQU A;  5LJ5 d;  3HFN A;  1XNI A;  4J9F A;  3I9Q A;  3RES A;  5GAN 3;  1VQ7 T;  4N0A A;  2RJF A;  1YWO A;  1WQ7 A;  4AFQ C;  3EFO B;  5AYF A;  1YCS B;  1UGS B;  3M0R A;  4A4E A;  2XIC A;  1W70 A;  2O4X A;  2X4X A;  5GAN 2;  3MKD A;  1K0S A;  2CZ6 B;  2EFI A;  1F1B B;  2QYZ A;  1VQ8 Q;  3RNJ A;  1NYG A;  3CC7 Q;  2A37 A;  2EGA A;  4ZN1 A;  4C92 E;  1MMN A;  2L8D A;  1D09 B;  2NLU A;  1M90 C;  1YHQ T;  1M90 U;  4RTX A;  5A0G A;  2A0F B;  2RQT A;  5GAO l;  3OYB A;  2XMF A;  2DFU A;  3QKJ A;  3KBG A;  4AFU C;  2KT8 A;  2ROL A;  4L59 A;  4ZGJ B;  1ZQ1 A;  1HYO A;  2H8H A;  2DYI A;  2VWF A;  3MJX A;  4IUU A;  2AIR B;  2WSC E;  1JB0 E;  4A4F A;  3ZBD A;  1MNE A;  3E9G A;  3G4S Q;  2F5T X;  1GCP A;  4X9D A;  1VQM T;  2LZ6 B;  2YDL A;  2XID A;  5LJ5 j;  3JCM J;  1K8A R;  5GMK e;  3GPL A;  4M7D F;  1VQ5 Q;  3LH5 A;  3MHX A;  3FIF A;  4XU3 A;  4FYY B;  1QMC A;  4XTZ A;  2JS2 A;  2X4Y A;  1MGQ A;  1PD0 A;  3NTH A;  3TQ7 P;  5L8R E;  2ECZ A;  1IHW A;  2JS0 A;  4E7S A;  1VQ9 Q;  3JV3 A;  2OI3 A;  2OTL T;  4M7A A;  3JSC A;  2ZPI B;  3CC2 T;  4E7J A;  4FW1 A;  4MDX A;  1JJ2 A;  4KUD K;  3CBP A;  3PVQ A;  3TSW A;  1H64 1;  4ORZ A;  5GAO n;  4GLM A;  1QP2 A;  3P8D A;  4QQ6 A;  3BE3 A;  1BI1 A;  2DIQ A;  1MUZ A;  1AWJ A;  1GBR A;  3OYI A;  1BCO A;  2ZZD A;  2DVE A;  3I5S A;  1AZG B;  1VQ4 Q;  4O6J A;  1VQK Q;  5EG2 A;  4FT2 A;  4C92 F;  4IUR A;  4M78 G;  1FMV A;  1KC8 C;  1KC8 U;  4AMC A;  1DJ7 B;  2BE7 D;  1PG5 B;  1TUD A;  3TEE A;  1QVF A;  2HSP A;  1VQO Q;  2O2O A;  2RHX A;  2ESW A;  1ABQ A;  1Q86 R;  3NHN A;  2KAF A;  2RF0 A;  2D9T A;  1X43 A;  2DNU A;  3EGD A;  2DTO A;  2OTJ Q;  4EIK A;  2F2X A;  2H3E B;  2IIM A;  1M1F A;  3SWN C;  3EGU A;  1R0C B;  1NEB A;  2DEQ A;  2KRO A;  2I2L A;  2HAX A;  4F7U E;  1PD1 A;  2COW A;  1JBM A;  3CC2 A;  4CC3 A;  2CUB A;  1NJI U;  1U06 A;  1D0Y A;  3CCV T;  1PCX A;  2XI9 A;  2FPE A;  5CO7 A;  3CC4 A;  2DPP B;  4HVU A;  2HEQ A;  2DIG A;  1C1A A;  2A28 A;  5KYU A;  2DE0 X;  4IIO A;  5KCO A;  2AHJ B;  1HSQ A;  2LJ0 A;  4Z8A A;  2EGE A;  3MO8 A;  4KUL A;  3LYI A;  1MV0 B;  2CYZ B;  3QSU A;  2JXB A;  2LNH B;  4GBQ A;  3JRZ A;  3EG9 B;  5KH6 A;  5CKD A;  5GAN h;  2DX1 A;  1WDX A;  1N27 A;  4AT1 B;  3RUX A;  2HQH A;  2DKG A;  1E6H A;  5ECA A;  3TRE A;  1PKT A;  1FMW A;  2COZ A;  3OYF A;  3JCM h;  4FYW B;  4A54 A;  4M7D G;  5CKF A;  3URG A;  5KE2 A;  5CQX A;  2GCX A;  2GQV A;  2NUT B;  3RR6 A;  1YJN A;  4XK8 E;  1YIJ Q;  2P0P A;  4DBF A;  4IUT A;  2F5K A;  4B9X A;  4BDY A;  5IHN A;  1IHV A;  3HRU A;  2V8J A;  1AWO A;  2HBP A;  3QG1 A;  1HK9 A;  4LUD A;  5IXB A;  1BK2 A;  1JXO A;  3CCV Q;  4DBH A;  1Y96 A;  5KYW A;  1ZUU A;  1YFN A;  2QA4 T;  5GAM e;  5KCH A;  3OS2 A;  3JB9 F;  1WXT A;  3CPW P;  3DLL A;  2AK5 A;  2Y4X A;  1SF9 A;  2EVR A;  3HRS A;  2V26 A;  2DXB A;  5CCA A;  4EMH A;  1ZSG A;  4RTV A;  3QWY A;  2R5M A;  3P8B B;  4D8K A;  1K8A U;  2DET A;  1NLP C;  3I55 Q;  4ELZ C;  4ATO A;  5IAY A;  2NUP B;  3H0H A;  4VUB A;  2QAS A;  5GAN e;  3OA6 A;  3E19 A;  4C0G A;  4B6M A;  5GAM f;  5LJ3 g;  5J26 A;  5FU7 C;  3O8V A;  2Y4Y A;  3S3N A;  2LT4 A;  3CCM Q;  3TU4 K;  5HK3 A;  4DEX A;  1UHF A;  4AFZ C;  4JRK A;  2V1R A;  1O9S A;  3SD4 A;  2X35 A;  4M78 E;  4XTW A;  3CME A;  4M77 D;  2JJ9 A;  2K3Y A;  3PVL A;  1TTH B;  1SG5 A;  4IUQ A;  1JRI A;  1M3B A;  2V8I A;  3THK A;  3JCM X;  1QWE A;  4N4I A;  1OPL A;  3OY9 A;  2ZGW A;  3L1A A;  1K76 A;  1X6O A;  4JJD A;  3REB B;  2DJQ A;  5KYX B;  1RAC B;  1QVG P;  1WQW A;  1Q95 G;  5GAN f;  3OBY A;  4M75 D;  1TUG B;  1SKU B;  1VQL A;  1AD5 A;  1K9A A;  1VQ9 T;  3EGD B;  1KSW A;  5I2S A;  1RAI B;  4ME7 A;  3RMS A;  2G6F X;  2X3W D;  4PFP A;  5DLQ E;  2FL7 A;  1TXQ A;  2YHT A;  5HK0 A;  2FZK B;  2YRV A;  3BDU A;  3EH1 A;  2Y90 A;  1FX7 A;  1TS9 A;  2RK1 A;  5FU7 B;  1YI2 T;  1VQP A;  3QHS A;  1PSE A;  3M0P A;  2HKQ B;  1BBZ A;  4JJB A;  3RBB B;  2PUO B;  2LVM A;  2KRN A;  3KXT A;  1K0X A;  1G3T A;  3VS3 A;  4PL6 A;  2LQ8 A;  1GFC A;  4BI4 A;  1VQN Q;  1NBE B;  3OMG A;  1M3A A;  2D0Q B;  3GIB A;  5HKC A;  3GLX A;  1I4K 1;  2GGR A;  2H3J A;  4M7A F;  3DKM A;  1ZA2 B;  2O88 A;  4HVW A;  1QP3 A;  4GLK A;  3A8G B;  4MML A;  2RJC A;  1M1K R;  3H0F A;  2P4T A;  1WX6 A;  3CC7 T;  3OB9 A;  1YIJ T;  4J9B A;  3OW2 A;  4M78 F;  3H9N A;  3OYC A;  1OX9 A;  1U8R A;  5IHI A;  1MMD A;  1S72 A;  2DL8 A;  4KGV B;  3M0S A;  4NS5 A;  3VS5 A;  4C8Q B;  1RAG B;  3SWN A;  3L2V A;  4J9I A;  2HKN A;  3EFS A;  5FRO A;  3CCU T;  3HSB A;  1PNJ A;  4PJO E;  3QII A;  1JJ2 P;  1D1A A;  2ZAE A;  2YRD A;  3QYG B;  3V7C A;  5GJW B;  3S6W A;  4LDV A;  1C0M A;  1AOJ A;  4FIB A;  1ZBX A;  2RM4 A;  1AWW A;  4Y91 A;  3C94 A;  1WHJ A;  2DBK A;  4FYX B;  3RKW A;  4ZTJ A;  1BKB A;  2K2M A;  1MV3 A;  2GTO A;  2B8A A;  4JLI A;  3JCM f;  3M56 A;  3M0U A;  4O5V A;  4ESR A;  2MF2 A;  3CBO A;  2P4R A;  3NTI A;  1WA7 A;  2D8J A;  5D7U A;  4KBM B;  1V76 A;  4C92 G;  3D7S B;  2CZ1 B;  2QTX A;  4QVD A;  3EGX A;  2RI5 A;  1EIF A;  5KYY A;  2KI7 A;  1Z9Z A;  1BU1 A;  1QCF A;  2QQR A;  4OP0 A;  4EMG A;  3JCM e;  4D6W A;  1Y71 A;  4M7D A;  2YUN A;  4EMK C;  5KYN A;  1WI7 A;  2MPX C;  3A5Z B;  2EGC A;  2ZPF B;  4KH1 B;  1UB4 A;  2MWP A;  1H92 A;  1WHK A;  4C92 C;  2JM8 A;  4C92 B;  3UWN A;  4F7U G;  1QQJ A;  1ABO A;  1T0H A;  2ENM A;  1I5O B;  1Y0M A;  3H8Z A;  4QKU A;  5I2M A;  5M9O A;  1RAB B;  4XU0 A;  2FZG B;  4XTU A;  3VS4 A;  1N9R A;  2XU8 A;  3QZ5 B;  1RI0 A;  4E2F B;  2JVV A;  2KK4 A;  2COY A;  1OZ2 A;  4RCB A;  2LCL A;  1N8R C;  5GAN 5;  3DB4 A;  3HFO A;  4KGX B;  2DAQ A;  4M75 F;  4C5E A;  2K4Y A;  3G71 A;  1JU5 C;  3MEV A;  1VIF A;  1X6G A;  2J6F A;  1OUL A;  4DEY A;  4PJO B;  2K3X A;  1WHG A;  4X9C A;  1WLP B;  2DK3 A;  2OJ2 A;  2YUO A;  3CCL T;  4LDY A;  4OB3 B;  4BE0 A;  4WF2 A;  1X75 C;  4WTO B;  5I22 A;  1VQO T;  5CK9 A;  2PNI A;  5CIU A;  1OYX A;  2HSE B;  1VQL Q;  4NL3 A;  2XD0 A;  3KUF A;  1B34 A;  5D6X A;  5GAN 6;  2BZY A;  3EG0 A;  4PFZ A;  4J9G A;  2OAW A;  5FLX E;  4MZP A;  1OOT A;  4OMF B;  2EQI A;  2RQV A;  2QQB A;  5CVI A;  4BE2 A;  1ZA1 B;  2KR3 A;  4RCC A;  3EHR A;  4C0D C;  4ANJ A;  3C95 A;  1K9M C;  2MK5 A;  2M0Y A;  3L2Z A;  5LJ3 j;  1KQ1 A;  2YUQ A;  3CCS A;  5A0L A;  2JTE A;  5DLO A;  2EYQ A;  3RMQ A;  4HCC A;  3QYH B;  4LDU A;  2FRY A;  5CR2 A;  4CC7 A;  3CC7 A;  1SHG A;  1Q81 U;  2HNI A;  1YNZ A;  4M75 G;  1ZUY A;  2LCC A;  4FM4 B;  3DB3 A;  4PJO C;  2DIL A;  2DRM A;  2L2P A;  3LH0 A;  4KGZ B;  1Q81 R;  3EFR A;  2M0O A;  2V8K A;  3BY7 A;  5KE3 A;  1Q81 C;  1IGU A;  1T0J A;  3G4S A;  3E2U A;  3T9N A;  4C5I A;  2R57 A;  3SEM A;  1YCY A;  3PMT A;  3CBM A;  2RN8 A;  4AFS C;  4JRI A;  1B07 A;  4BI8 B;  2KRM A;  2E4H A;  1VQM Q;  1VQ4 A;  1G3W A;  3E1S A;  2DRK A;  5GAN 4;  1HJD A;  1MND A;  5GJV B;  2M9U A;  4E7H A;  1GL5 A;  2QI2 A;  2GTJ A;  2DXC A;  2DM1 A;  4MZT A;  1VQ9 A;  2HQX A;  2YT6 A;  3M0Q A;  3O5Z A;  3VS0 A;  2QEX T;  1WJR A;  1QKX A;  4J83 A;  1V1C A;  1OI1 A;  2XDB A;  4HXJ A;  3NFC A;  2CH4 W;  4JRP A;  2RHI A;  3OYG A;  1KQS S;  2OTJ A;  2A3L A;  1YIJ A;  1T3S A;  2EYW A;  1IRE B;  1KC8 R;  3WXM B;  1QVP A;  1BB9 A;  4UC4 A;  4NL2 A;  3CME T;  5GMK m;  1I0C A;  2ZPB B;  3OS1 A;  4OB1 B;  5GAO m;  1VUB A;  2EPD A;  4M77 C;  2JMC A;  4M77 B;  3CC4 Q;  3S3O A;  2ZPG B;  4C8Q F;  4J9H A;  2QQ9 A;  3LW5 E;  2RQW A;  2V1Q A;  2VB6 A;  5LJ3 h;  5D6Y A;  1Q7Y U;  4E47 A;  1J3T A;  3J81 E;  1I07 A;  1I5L A;  2LRQ A;  7AT1 B;  1VYT A;  4M75 C;  5EC7 A;  2L5Q A;  2IPO B;  4DOV A;  3LWH A;  1NE8 A;  2C0O A;  1ZUK A;  3G71 T;  2QGG A;  2HCK A;  4C92 A;  2JT4 A;  1K73 C;  4ZNX A;  2KT1 A;  1XOV A;  3MPU B;  3QUI A;  1WHH A;  4HT9 A;  4D8D A;  1KG1 A;  4HCZ A;  2R5A A;  5CKE A;  3V8L A;  2BZX A;  2ZCF B;  4M7A C;  1D3B A;  1OV3 A;  4EMK A;  1YJN Q;  1RI9 A;  2L0A A;  2SEM A;  5J39 A;  3JCM c;  2JZ2 A;  1YJN T;  4ZN3 A;  2F1L A;  1MMG A;  3J7A F;  4PJL A;  2DL5 A;  4F7U A;  4M7D D;  1YN8 A;  3GBQ A;  2C0T A;  3CCV A;  3A8L B;  3QBY A;  4RKU E;  2OTL A;  1YJW T;  4KRT A;  3VRY A;  4E6R A;  4M7A G;  2EJF A;  4YTL A;  2W10 A;  2CS7 A;  3OYY A;  3CCJ T;  3CCQ T;  1B34 B;  3L2U A;  3VKI A;  1PSF A;  5GMK i;  2XDP A;  1UG1 A;  1BI2 A;  1U5S A;  4EDU A;  1WFW A;  1YIT Q;  4C8Q E;  1BYM A;  1IB8 A;  1LCK A;  1K9M R;  3CCS Q;  3QDF A;  2DTI A;  1M4Z A;  3PMI A;  1GFD A;  1Y7X A;  4JJC A;  2EJ9 A;  5GAM j;  3QJY A;  5GAM d;  5CKB A;  2M1H A;  3FDR A;  4QT7 A;  3CC4 T;  1WXU A;  1BCM A;  5GAN 7;  4DA4 A;  1KHI A;  3CQT A;  1D1C A;  4RTT A;  1SSF A;  3CPW A;  2M16 A;  1M9S A;  5GAO q;  2FO0 A;  1ZLM A;  4N0A C;  2HDA A;  2YSQ A;  2K9G A;  2LX9 A;  2EKH A;  3VRZ A;  2AZS A;  1S72 Q;  3PIO A;  2RB6 A;  3CPW S;  4FU6 A;  3CCR T;  1RAD B;  2DD5 A;  1K73 U;  5A0D A;  3ULR B;  4JS5 A;  4C8Q C;  1U1T A;  2GNC A;  3PGG A;  3TVT A;  4RTW A;  2P84 A;  1XTD A;  2E3H A;  4C5G A;  1H3H A;  1R8O B;  2J05 A;  4F16 A;  1M1G A;  2HD0 A;  3MP1 A;  3I56 A;  2D6F A;  2NUZ A;  1S1N A;  5FU6 C;  1D1B A;  3S3M A;  2KQW A;  1RAE B;  2AZV A;  1VQ8 T;  3UA6 A;  5FRN A;  1O75 A;  5FWC A;  5GAN g;  2K57 A;  3G7Z A;  3WVD B;  2MAM A;  3PE0 A;  3OW2 P;  3VU3 C;  3HP9 A;  5IHK A;  2VGN A;  3VS2 A;  1ARK A;  2GFA A;  4X34 A;  1UGQ B;  3FJ5 A;  3JCM g;  1UTI A;  2KGT A;  2CZ7 B;  4Z02 A;  1M30 A;  3CXC S;  2E12 A;  3F70 A;  2CSI A;  2LQW A;  4BY6 B;  1QW1 A;  3JB9 H;  4PJO F;  4BY6 C;  1X2Q A;  1QVG A;  4QVC A;  3SHW A;  5LJ3 d;  2ROT A;  4J9C A;  1MMA A;  2C06 A;  2HZY A;  1K8A C;  2RD1 A;  5IT9 E;  4C0Z A;  1NEG A;  2FYK A;  4XTY A;  2DYB A;  3TSZ A;  1UEC A;  3NGP A;  4RMO A;  5LL6 S;  1QLY A;  3MP6 A;  4TVR A;  2D8H A;  2CT3 A;  3UPU A;  2MIO A;  1TUC A;  4MZM A;  1VQ6 T;  2GFU A;  1KD1 C;  1SRM A;  3V7S A;  1EZZ B;  2RH2 A;  4OGE A;  2FPD A;  1KHC A;  3H6Z A;  4MDW A;  3WVE B;  3HPW A;  1QCO A;  1YBY A;  4HKE A;  6AT1 B;  3EG1 A;  4E7L A;  4LNP A;  4FL6 A;  2P0K A;  4L5G A;  1W2B A;  1D3B B;  3P8H A;  1VQP T;  5A2Q E;  2XKO C;  3EFO A;  1OX8 A;  3OS0 A;  2K5I A;  3CCJ Q;  3CCQ Q;  2OAU A;  4DBR A;  2L3Q A;  3ER0 A;  1TH7 A;  2CGH A;  3HRT A;  3M4Y A;  4F7U F;  2HMA A;  2BZ8 A;  2CZ0 B;  1YJW Q;  1UGP B;  5AT1 B;  4L6V 5;  1JJ2 S;  1W1F A;  4LE9 A;  2E5Q A;  3AT1 B;  4OMM A;  3A8M B;  2DJZ A;  1M90 R;  3CCL Q;  2YUP A;  4M77 E;  2JW4 A;  2WAC A;  2XG8 D;  2C0I A;  2X4W A;  4JRQ A;  1Q7Y R;  2ED0 A;  3L2W A;  2K3B A;  4E7I A;  4OGC A;  2IG0 A;  1HD3 A;  2LTO A;  5FWB A;  2LQK A;  2LCS A;  3CD6 Q;  2E41 A;  2JMA A;  1Q82 C;  4FT4 A;  2QA4 Q;  4GY5 A;  4OMQ A;  1U3O A;  2BE9 B;  4QQG A;  1N5Z A;  3ZEH A;  3JB9 J;  1GXI E;  1V29 B;  1AVZ C;  1E7O A;  1C6V X;  4M75 E;  3OYH A;  1YJ9 T;  1M1K U;  3VYG A;  1AEY A;  4E7Z A;  3REA B;  3SDZ A;  5KYU B;  2RK2 A;  2LX7 A;  1Y57 A;  3NMZ C;  3G71 Q;  4LDX A;  2QXF A;  2AT1 B;  3J80 E;  2Z0W A;  4J9D A;  4A4H A;  1QVF P;  3CXC A;  4EMK B;  4HT8 A;  3QXE B;  1X6B A;  3JB9 D;  2RHZ A;  4J7I A;  1VQ7 A;  3A8H B;  2L3S A;  4JZ3 A;  2KVQ G;  3GF5 A;  3G1J A;  1D0X A;  2MWO A;  3OYK A;  3VJP A;  1YJ9 A;  2RO0 A;  4DQ2 A;  1W4S A;  2EQM A;  1KIK A;  4OMN A;  4ELY C;  2JOY A;  1B7T A;  2KE9 A;  3BW1 A;  3OYJ A;  1YHQ A;  1JO8 A;  3MET A;  4J6X A;  4II1 A;  2EYZ A;  1WYX A;  3CCR A;  1WIE A;  2F2V A;  5LJ3 e;  4JDS A;  1M8V A;  4A4K A;  2NWM A;  5GMK l;  4FSS A;  2XHC A;  3IQL A;  3M59 A;  2AKL A;  4ZGD B;  2FPF A;  1ZBJ A;  4F7U B;  2F2W A;  4QVZ A;  2JN0 A;  1UEB A;  1VA7 A;  1NM7 A;  3I56 T;  3C12 A;  5FU6 B;  5LJ5 h;  2DZC A;  1TU0 B;  2DER A;  3GNG A;  1VQN T;  4PLL A;  2J06 A;  4BI3 A;  2VV5 A;  1OEB A;  4OMO A;  1PHT A;  3FRN A;  2EQJ A;  4QQD A;  2FEI A;  3CCU Q;  1G2B A;  4C8Q G;  1UJ0 A;  1GCQ A;  2EQK A;  2CP5 A;  2OTJ T;  2EJG A;  4R0K A;  3OSS C;  4EPC A;  3FEO A;  2E70 A;  4LDW A;  3UF4 A;  2DVJ A;  3X25 B;  2QAZ A;  1VQM A;  3M57 A;  4M7D C;  2RNA A;  1A0N B;  3RKX A;  2DL4 A;  2FB7 A;  3M58 A;  4KH0 B;  2FRW A;  3V8K A;  4JPB W;  3RER A;  5C6S A;  1NJI R;  1Z9Q A;  2EWN A;  3MEA A;  2LT1 A;  1OPK A;  1FXX A;  1N8R R;  2DXT A;  2WSF E;  1VQ6 A;  1KQ2 A;  4PK4 A;  1VQK T;  8AT1 B;  2YXY A;  3GP8 A;  3JCM b;  1KQS P;  2HQE A;  3NPF A;  1GRI A;  2EW3 A;  3JCM V;  4OVA A;  3CCE T;  4RG2 A;  2DEU A;  3OW2 S;  3VV0 A;  4Z89 A;  2OX7 A;  1M2O A;  3EG9 A;  1VQ8 A;  2QDY B;  4MMK A;  1G3Y A;  5LJ5 g;  1WHM A;  2EYX A;  3QDR B;  3CCE Q;  2CRE A;  5DM7 R;  4HA8 A;  1WHL A;  4XTV A;  1YI2 Q;  5GMK h;  3VYH B;  4PJN A;  1SEM A;  2FZC B;  2KXC A;  2OTL Q;  3QZ9 B;  3N5B B;  1IZ6 A;  4J6W A;  1M8M A;  1SHF A;  4DOW A;  2M02 A;  3CCM T;  2E3I A;  4F17 A;  4M78 B;  2EAY A;  2KRS A;  1YJW A;  2IVW A;  1PM3 A;  2QK0 A;  1I8F A;  2D0N A;  3TCJ A;  1VQ5 T;  2ATC B;  3CXC P;  4M7A E;  2BKD N;  1HXD A;  2ZPH B;  1M3C A;  2CP7 A;  1PKS A;  4PKC C;  2RHU A;  1LNX A;  2E6Z A;  4M7A D;  2I0N A;  5LJ5 f;  3EGX B;  1Q7Y C;  2HL5 C;  5HY6 A;  3ME9 A;  3HTR A;  3G4S T;  4J5Y A;  2RI3 A;  2CP3 A;  1KFZ A;  1RL2 A;  1IRX A;  1GCQ C;  3FB9 A;  4AG1 C;  3CD6 A;  2CP0 A;  1K9M U;  3EH2 A;  1QKW A;  3V8J A;  5J3B A;  2LP5 A;  1UFF A;  4LXC A;  1UDL A;  4Y28 E;  4LUE A;  4PJJ A;  4RTZ A;  5IN1 A;  2JNG A;  3X26 B;  2W0Z A;  5GAO r;  1LOJ A;  3CMA A;  1WPY A;  2PQW A;  4JS4 A;  3OYA A;  1CKB A;  3SB2 A;  1RLP C;  3G6E A;  1TSF A;  1ZSZ A;  3A8O B;  1Y07 A;  1RAF B;  4CC2 A;  2ABL A;  5D6W A;  3FC3 A;  2AKK A;  4OMP A;  4M78 C;  2YLC A;  2QDL A;  1WZO A;  2QEX A;  4C0F A;  5I21 A;  1VQ7 Q;  2DBM A;  4XU2 A;  3OYN A;  4J6Y A;  2E5K A;  3QWX X;  3OYE A;  3QJ6 A;  3OBW A;  5KYW B;  5CAI A;  4IIM A;  4PJO A;  2EBP A;  2GQI A;  1IGQ A;  2MMP A;  3HHT B;  3M9Q A;  5KYX A;  2A7Y A;  1PC0 A;  2NYS A;  2BTT A;  2KXD A;  3FJP A;  1X69 A;  4QW2 A;  4V2S A;  3LGL A;  4B9W A;  3BDL A;  4FW2 A;  3PT9 A;  4C0D B;  5IXF A;  3I56 Q;  4XU1 A;  3L2Q A;  2EQU A;  4BAC A;  1WJQ A;  4M7A B;  3CCR Q;  1VYU A;  1RLQ C;  1WNL A;  1OQK A;  2GBQ A;  4C92 D;  1X01 A;  3LX7 A;  2J6K A;  4Z88 A;  1UGV A;  1M27 C;  2E10 A;  2XDD A;  4XAX B;  3V7R A;  4ZTF A;  4IUP A;  1R0B G;  2MYS A;  3OYM A;  3QO3 A;  1B3Q A;  2DA9 A;  3CMA T;  5KYY B;  4KT0 E;  4F04 B;  3OS5 A;  1I1J A;  5CKH A;  3X24 B;  3LWI A;  1WJS A;  4Y92 A;  2LC4 A;  1D0Z A;  2PZ1 A;  3X28 B;  1SRL A;  1WGS A;  4HCK A;  4RG8 A;  1N9S A;  4M77 G;  4J7F A;  3QPH A;  1G8X A;  1YIT A;  3CCS T;  2L89 A;  2YLB A;  1M5Q 1;  4JZ4 A;  5I11 A;  3FLG A;  1UE9 A;  1UHC A;  1OZ3 A;  3LGF A;  2VVK A;  2LJ1 A;  1TWB A;  1VQ5 A;  4K11 A;  2PTK A;  3ASK A;  2KDS A;  3RIR A;  3EG3 A;  3L2R A;  2EIF A;  2WSE E;  2KBT A;  4N4G A;  4M7D B;  1M2V A;  4LD9 K;  2JTF A;  4C8Q A;  2VC8 A;  1NZ9 A;  3ZL7 C;  1LPL A;  1SSH A;  2KYM A;  1XJW B;  5GAO p;  4IKF A;  2LJ3 A;  4FYV B;  3M55 A;  5GAN 8;  1E6G A;  1BIB A;  1NYF A;  5FRM A;  3X20 B;  1BI0 A;  2J6O A;  1U1S A;  1RUW A;  2R58 A;  5HCK A;  1TG0 A;  4IUV A;  5GAM g;  2KY9 A;  1NLO C;  3LLR A;  4JLG A;  3CCJ A;  3CCQ A;  3VS7 A;  4JUV A;  2L3P A;  1VOM A;  1ZSZ C;  1Q86 U;  1ZSZ B;  1KJW A;  4OF1 A;  3CEY A;  5GAN d;  5IH2 A;  2JTM A;  2RJE A;  2L3R A;  2X9H A;  3PNW C;  1VQ4 T;  2DL7 A;  2RI2 A;  2O31 A;  1VQO A;  1FMK A;  4PJM A;  4ZGE B;  2VGM A;  1OU9 A;  1PRM C;  3HKS A;  3A98 A;  3GNF B;  4M75 B;  4J9E A;  2O01 E;  4PFO A;  2CDT A;  1ZHI A;  2K6D A;  4N4H A;  1UJY A;  3SWN B;  2CSQ A;  3NTK A;  1ZX6 A;  5C0M A;  2J7I A;  1W2B P;  1G3S A;  3ZFJ A;  2A08 A;  4OB2 B;  2KNB B;  1W6X A;  1EX4 A;  2K5F A;  3CME Q;  2QG9 B;  2PVD B;  1QCN A;  3EG2 A;  2PU9 B;  4R56 A;  4E7K A;  2LMJ A;  3G6E Q; 
#chains in the Genus database with same CATH homology
 1KD1 U;  3CXC A;  4EMK B;  2DO3 A;  5GAM h;  1G5V A;  4HT8 A;  5KCO A;  2AHJ B;  3QXE B;  2LNV A;  2E1H A;  1N6A A;  3T9N A;  4C5I A;  2EKO A;  2R57 A;  3I55 T;  3JB9 D;  3I55 A;  1YCY A;  1P92 A;  2RHZ A;  3CBM A;  3MO8 A;  3PMT A;  4JRI A;  4BI8 B;  4PLI A;  5GAN j;  3PIP A;  2PVG B;  4J7I A;  4KUL A;  1VQ7 A;  1VQ4 A;  1G3W A;  3A8H B;  3LYI A;  2XK0 A;  3E1S A;  4M77 F;  5GAN 4;  2CYZ B;  3QSU A;  2KVQ G;  3GF5 A;  2PUK B;  2M9U A;  4KUI A;  2VXE A;  3JCM d;  4E7H A;  1KQS A;  4PNO A;  4BDZ A;  3JRZ A;  4P5N A;  5KH6 A;  2MWO A;  2QI2 A;  3OYK A;  3VJP A;  1XQH A;  2DXC A;  3CCM A;  3HL8 A;  5CKD A;  5DY9 A;  3DLM A;  5GAN h;  2RO0 A;  3JB9 I;  4R55 A;  4MZT A;  1YJ9 A;  4DQ2 A;  1W4S A;  2EQM A;  4PJO D;  1N27 A;  1VQ9 A;  2HQX A;  3RUX A;  4ELY C;  2DKG A;  2JOY A;  2QEX T;  1NPR A;  1WJR A;  3TRE A;  4J83 A;  3BW1 A;  3OSV A;  3OYJ A;  1YHQ A;  3MET A;  4J6X A;  4II1 A;  3CCR A;  3CCL A;  3OYF A;  3JCM h;  4A54 A;  5LJ3 e;  1OI1 A;  1BI3 A;  5CKF A;  3URG A;  5KE2 A;  4JDS A;  5CQX A;  1NJI C;  3NFC A;  2XDB A;  2GCX A;  4A4K A;  5GMK l;  2VUB A;  2GQV A;  1M8V A;  1YJN A;  4JRP A;  2RHI A;  2K5L A;  4XK8 E;  3OYG A;  2CKK A;  2XHC A;  1KQS S;  2OTJ A;  2A3L A;  2E6N A;  3M59 A;  4ZGD B;  3G6E T;  1YIJ A;  2E65 A;  2MI6 A;  2P0P A;  4BDY A;  4IUT A;  2F5K A;  4B9X A;  4F7U B;  1IRE B;  4QVZ A;  3M53 A;  2JN0 A;  3WXM B;  3HRU A;  1QVP A;  2V8J A;  1UEB A;  2HBP A;  1Q86 C;  3QG1 A;  3I56 T;  2QA4 A;  3C12 A;  4UC4 A;  1HK9 A;  2KMT A;  5FU6 B;  5LJ5 h;  2DZC A;  4NL2 A;  3CME T;  3JCM P;  5GMK m;  4PJO G;  1Y96 A;  2ZPB B;  4BE1 A;  3OS1 A;  3GNG A;  4OB1 B;  5GAO m;  1VQN T;  2P0Q A;  4PLL A;  1VUB A;  4M77 C;  5GAM e;  2QA4 T;  4BI3 A;  2VV5 A;  4LD6 A;  4M77 B;  5KCH A;  3JCM Q;  1W2B S;  3S3O A;  2ZPG B;  3OS2 A;  3FRN A;  4C8Q F;  3JB9 F;  2EQJ A;  2QQ9 A;  4QQD A;  3LW5 E;  3SFM A;  1AHJ B;  3M54 A;  3DLL A;  4C8Q G;  2Y4X A;  3HRS A;  2VXF A;  2EQK A;  3INZ A;  5D6Y A;  5LJ3 h;  4CI0 C;  1Q7Y U;  2EJG A;  2OTJ T;  2DXB A;  5CCA A;  2K2V A;  4EMH A;  3OSS C;  2R5M A;  2DZ9 A;  4EPC A;  4E47 A;  3FEO A;  3P8B B;  2E70 A;  3MP8 A;  4LDW A;  3J81 E;  5LJ3 f;  1K8A U;  2ZPE B;  4ELZ C;  1I5L A;  3GOX A;  4ATO A;  2LRQ A;  3X25 B;  5IAY A;  4VUB A;  1VQM A;  2KSS A;  2QQS A;  3M57 A;  4CRI A;  4M75 C;  4M7D C;  2L5Q A;  1S72 T;  5GAN e;  3RKX A;  4DOV A;  3E19 A;  4XTX A;  2FB7 A;  3M58 A;  3OA6 A;  3LWH A;  1N8R U;  1NE8 A;  4C0G A;  1UGR B;  5GAM f;  4M7A A;  1LJO A;  4Q5W A;  3V8K A;  3G71 T;  5LJ3 g;  3RER A;  5J26 A;  5FU7 C;  3MEW A;  2PVO B;  3O8V A;  5C6S A;  1M1K C;  2Y4Y A;  4C92 A;  3S3N A;  2LT4 A;  2EWN A;  1K73 C;  3TU4 K;  3PTA A;  5HK3 A;  3MEA A;  2LT1 A;  4JRK A;  1FXX A;  1O9S A;  2DXT A;  1VQN A;  2WSF E;  4M78 A;  1VQ6 A;  2DXU A;  1XOV A;  2X35 A;  3QUI A;  3SD4 A;  1KQ2 A;  1VQK T;  4M78 E;  1VQL T;  4HT9 A;  4XTW A;  3GP8 A;  3CME A;  4M77 D;  2O4X B;  2K3Y A;  3CPF A;  1KG1 A;  1QVF S;  4HCZ A;  3BFM A;  2R5A A;  4IUQ A;  1JRI A;  5CKE A;  3JCM b;  2HQE A;  3CD6 T;  3V8L A;  1H3Z A;  2V8I A;  4M77 A;  3JCM X;  2ZCF B;  4OVA A;  3JCM V;  4M7A C;  3CCE T;  4N4I A;  4RG2 A;  1D3B A;  3OW2 S;  4EMK A;  3VV0 A;  3OY9 A;  2ZGW A;  4A4G A;  2DTH A;  2QQA A;  3L1A A;  2RJD A;  5J39 A;  3JCM c;  1VQ8 A;  2QDY B;  1X6O A;  2JZ2 A;  1G3Y A;  4MMK A;  3L42 A;  5LJ5 g;  4M7D E;  1YJN T;  3QDR B;  3CCE A;  4ZN3 A;  1WQW A;  5DM7 R;  3R6O A;  4HA8 A;  4XTV A;  2BUD A;  3J7A F;  5GAN f;  3OBY A;  2FVU A;  4F7U A;  1YIT T;  5GMK h;  4M7D D;  3VYH B;  4M75 D;  2RHY A;  1VQL A;  1VQK A;  3CCV A;  3A8L B;  3QBY A;  3QZ9 B;  4RKU E;  4JJN K;  1VQ9 T;  2OTL A;  3N5B B;  4M75 A;  1IZ6 A;  4J6W A;  2BIV A;  1YJW T;  5I2S A;  4DOW A;  1VIE A;  4ME7 A;  3C4S A;  3RMS A;  3CCM T;  4M7A G;  2EJF A;  3VUZ A;  4YTL A;  4XQ3 A;  2CS7 A;  5DLQ E;  2FL7 A;  4M78 B;  2EAY A;  2YHT A;  3PFS A;  3CCU A;  3OYY A;  3CCJ T;  5HK0 A;  1B34 B;  3L2U A;  3CCQ T;  1YJW A;  2YRV A;  2IVW A;  3VKI A;  1PSF A;  3BDU A;  5GMK i;  4OB0 B;  2XDP A;  1I8F A;  3TCJ A;  2Y90 A;  1VQ5 T;  1BI2 A;  2GF7 A;  4M7A E;  1FX7 A;  2BKD N;  2RK1 A;  1I81 A;  4FSX A;  1HXD A;  2ZPH B;  5FU7 B;  4EDU A;  1YI2 T;  4C8Q E;  1VQP A;  1BYM A;  3QHS A;  1PSE A;  4PKC C;  3UDC A;  1Y96 B;  1LNX A;  2E6Z A;  2RHU A;  5CQY A;  4BUG A;  4M78 D;  4A53 A;  4M7A D;  5LJ5 f;  3JB9 G;  4M7D G;  3OMC A;  1Q7Y C;  2PUO B;  5HY6 A;  4C8Q D;  3ME9 A;  2DTI A;  2LVM A;  3MCA B;  3AHU A;  3G4S T;  4J5Y A;  3OYD A;  1M4Z A;  3PMI A;  2RI3 A;  1Y7X A;  4C5H A;  3KXT A;  1G3T A;  2DD4 A;  2EJ9 A;  5GAM j;  3QJY A;  1RL2 A;  4J8O A;  4NOY A;  4PL6 A;  5GAM d;  3FB9 A;  3Q1J A;  3EAE A;  2M1H A;  5CKB A;  3CD6 A;  1BIA A;  1K9M U;  3FDR A;  3V8J A;  2LQ8 A;  3CC4 T;  5J3B A;  4BI4 A;  2E64 A;  3OQ5 A;  4Y28 E;  3OMG A;  5GAN 7;  2LDM A;  2D0Q B;  4DA4 A;  3GIB A;  2F69 A;  5HKC A;  1KHI A;  3GLX A;  5IN1 A;  2JNG A;  3X26 B;  1I4K 1;  5GAO r;  1LOJ A;  1NPP A;  2H3J A;  3CMA A;  4M7A F;  3DKM A;  1WPY A;  1SSF A;  2PQW A;  2M16 A;  3CPW A;  1M9S A;  1QP3 A;  4GLK A;  4JS4 A;  3A8G B;  4MML A;  5GAO q;  3JCM W;  2RJC A;  3OYA A;  4N0A C;  2FHD A;  2P4T A;  3SB2 A;  1QVG S;  3CC7 T;  3OB9 A;  2LX9 A;  3G6E A;  1FWZ A;  3M5A A;  3OW2 A;  1YIJ T;  4M78 F;  3A8O B;  3OYC A;  1Y07 A;  3UT1 A;  1U8R A;  3PIO A;  1S72 A;  5D6W A;  3FC3 A;  3JAM E;  2RB6 A;  2VYT A;  3CPW S;  2JUF A;  4FU6 A;  4BD3 A;  3CCR T;  3E9F A;  4HCB A;  2DD5 A;  4M78 C;  2YLC A;  4NS5 A;  1K73 U;  5A0D A;  1YI2 A;  1MHN A;  3MEU A;  4JS5 A;  4C8Q B;  2QEX A;  2X4J A;  4C0F A;  4C8Q C;  2G3R A;  3SWN A;  5GMK j;  3L2V A;  5I21 A;  5LJ5 e;  1U1T A;  4XU2 A;  3OYN A;  4J6Y A;  3OYE A;  3EFS A;  4BB7 A;  1Q82 U;  5FRO A;  3PGG A;  3QJ6 A;  3CCU T;  3HSB A;  3OBW A;  3VUB A;  4PJO E;  2RA2 A;  3QII A;  3OYL A;  5CAI A;  4PJO A;  3QYG B;  3V7C A;  1XTD A;  3M4G A;  3RKY A;  2MMP A;  3HHT B;  4LDV A;  3S6W A;  4C5G A;  3M9Q A;  5LJ5 d;  2A7Y A;  3HFN A;  1R8O B;  1XNI A;  4FIB A;  3FJP A;  1M1G A;  4QW2 A;  3RES A;  4V2S A;  5GAN 3;  1ZBX A;  2HD0 A;  2RM4 A;  3LGL A;  4N0A A;  2RJF A;  3BDL A;  4B9W A;  1VQ7 T;  1WQ7 A;  3C94 A;  3PT9 A;  4Y91 A;  4C0D B;  3MP1 A;  4XU1 A;  3I56 A;  3L2Q A;  2EQU A;  4BAC A;  2D6F A;  1WJQ A;  3RKW A;  1BKB A;  5AYF A;  4ZTJ A;  4M7A B;  1UGS B;  5FU6 C;  4A4E A;  3S3M A;  2B8A A;  2XIC A;  1WNL A;  2KQW A;  2O4X A;  4JLI A;  2X4X A;  5GAN 2;  1VQ8 T;  4C92 D;  5FRN A;  1X01 A;  1O75 A;  2CZ6 B;  2EFI A;  3LX7 A;  3JCM f;  2E10 A;  5GAN g;  3M56 A;  2XDD A;  2K57 A;  3G7Z A;  4O5V A;  4XAX B;  3WVD B;  2MF2 A;  2MAM A;  3V7R A;  3CBO A;  4ZN1 A;  4C92 E;  4ZTF A;  3VU3 C;  3NTI A;  2L8D A;  2NLU A;  4IUP A;  3HP9 A;  2VGN A;  3OYM A;  1M90 C;  3QO3 A;  1YHQ T;  1M90 U;  2GFA A;  5A0G A;  4KBM B;  5GAO l;  3OYB A;  4X34 A;  3CMA T;  1UGQ B;  3JCM g;  3QKJ A;  4KT0 E;  3KBG A;  4C92 G;  2CZ1 B;  3OS5 A;  2QTX A;  4QVD A;  2CZ7 B;  4L59 A;  4ZGJ B;  5CKH A;  2RI5 A;  3X24 B;  1EIF A;  1ZQ1 A;  4Z02 A;  3LWI A;  1WJS A;  3CXC S;  2E12 A;  2LC4 A;  3F70 A;  4IUU A;  3X28 B;  1QW1 A;  4BY6 B;  3JB9 H;  2WSC E;  4PJO F;  1JB0 E;  4BY6 C;  4A4F A;  3ZBD A;  1QVG A;  2QQR A;  1WGS A;  4OP0 A;  4QVC A;  5LJ3 d;  3E9G A;  4D6W A;  4EMG A;  3JCM e;  1Y71 A;  2F5T X;  4RG8 A;  4M7D A;  1N9S A;  4M77 G;  4X9D A;  4J7F A;  2C06 A;  3QPH A;  1VQM T;  4EMK C;  1K8A C;  1YIT A;  3CCS T;  2L89 A;  2YLB A;  3A5Z B;  1M5Q 1;  2RD1 A;  3FLG A;  2XID A;  2ZPF B;  5IT9 E;  4C0Z A;  1UB4 A;  2MWP A;  5LJ5 j;  3JCM J;  2FYK A;  5GMK e;  1OZ3 A;  3LGF A;  4C92 C;  4XTY A;  3GPL A;  4C92 B;  3UWN A;  4M7D F;  4RMO A;  1VQ5 A;  4F7U G;  3MHX A;  3ASK A;  3FIF A;  4XU3 A;  5M9O A;  2KDS A;  3H8Z A;  4XTZ A;  5I2M A;  5LL6 S;  3RIR A;  3MP6 A;  4TVR A;  2X4Y A;  1MGQ A;  3NTH A;  4XTU A;  4XU0 A;  1N9R A;  3L2R A;  2EIF A;  2XU8 A;  5L8R E;  2WSE E;  3QZ5 B;  3UPU A;  1RI0 A;  4N4G A;  4M7D B;  2JVV A;  2KK4 A;  4MZM A;  2OTL T;  1VQ6 T;  2GFU A;  1OZ2 A;  1KD1 C;  3JSC A;  2ZPI B;  4LD9 K;  2JTF A;  3V7S A;  4RCB A;  2LCL A;  4C8Q A;  2VC8 A;  3CC2 T;  2RH2 A;  4OGE A;  1NZ9 A;  1N8R C;  1KHC A;  4E7J A;  5GAN 5;  4MDX A;  3H6Z A;  1JJ2 A;  4KUD K;  3DB4 A;  3CBP A;  3HFO A;  4MDW A;  3WVE B;  5GAO p;  4IKF A;  3HPW A;  1YBY A;  2DAQ A;  4M75 F;  4C5E A;  2K4Y A;  1H64 1;  4HKE A;  3G71 A;  5GAO n;  4E7L A;  3MEV A;  1VIF A;  3M55 A;  5GAN 8;  1QP2 A;  3P8D A;  4QQ6 A;  4PJO B;  1BI1 A;  4FL6 A;  1BIB A;  2DIQ A;  2P0K A;  2K3X A;  4L5G A;  1W2B A;  3X20 B;  4X9C A;  5FRM A;  2DK3 A;  1D3B B;  1BI0 A;  3OYI A;  3CCL T;  4LDY A;  1U1S A;  4OB3 B;  4BE0 A;  3P8H A;  2ZZD A;  1VQP T;  4WF2 A;  5A2Q E;  2DVE A;  2R58 A;  1X75 C;  4IUV A;  2XKO C;  5CIU A;  2KY9 A;  5CK9 A;  5GAM g;  1VQO T;  1OYX A;  4O6J A;  3LLR A;  4JLG A;  4NL3 A;  3OS0 A;  2XD0 A;  3KUF A;  5EG2 A;  4FT2 A;  1B34 A;  5D6X A;  2K5I A;  3CCJ A;  4C92 F;  3CCQ A;  4JUV A;  2OAU A;  4IUR A;  3ER0 A;  5GAN 6;  4M78 G;  1TH7 A;  2CGH A;  3HRT A;  3M4Y A;  5FLX E;  4F7U F;  1Q86 U;  4MZP A;  1KC8 C;  4OMF B;  4OF1 A;  1KC8 U;  2CZ0 B;  3CEY A;  5CVI A;  5GAN d;  2QQB A;  4BE2 A;  1UGP B;  2JTM A;  2RJE A;  2L3R A;  1DJ7 B;  4RCC A;  3PNW C;  4L6V 5;  1JJ2 S;  3TEE A;  1QVF A;  1VQ4 T;  4C0D C;  2E5Q A;  3C95 A;  1K9M C;  2RI2 A;  1VQO A;  2RHX A;  3L2Z A;  4ZGE B;  5LJ3 j;  2VGM A;  1KQ1 A;  3A8M B;  2DJZ A;  3CCS A;  3HKS A;  2KAF A;  4M77 E;  5A0L A;  5DLO A;  2EYQ A;  2WAC A;  3RMQ A;  2XG8 D;  3GNF B;  2D9T A;  4M75 B;  4HCC A;  2DTO A;  2O01 E;  3QYH B;  4LDU A;  1ZHI A;  4N4H A;  2X4W A;  4JRQ A;  3SWN B;  5CR2 A;  1M1F A;  3L2W A;  3SWN C;  3CC7 A;  4E7I A;  4OGC A;  2IG0 A;  1Q81 U;  3NTK A;  2HNI A;  2LTO A;  2LQK A;  4M75 G;  2DEQ A;  2E41 A;  2LCC A;  5C0M A;  4FT4 A;  4FM4 B;  2I2L A;  1Q82 C;  2HAX A;  4F7U E;  4GY5 A;  1JBM A;  3CC2 A;  1G3S A;  3DB3 A;  4QQG A;  3ZFJ A;  3ZEH A;  3JB9 J;  1NJI U;  4PJO C;  3LH0 A;  4OB2 B;  1GXI E;  3CCV T;  1V29 B;  2K5F A;  4M75 E;  2XI9 A;  5CO7 A;  3OYH A;  1YJ9 T;  3VYG A;  1M1K U;  3EFR A;  3SDZ A;  3CC4 A;  2DPP B;  2PVD B;  2RK2 A;  2M0O A;  2V8K A;  3BY7 A;  2PU9 B;  5KE3 A;  4R56 A;  1Q81 C;  4LDX A;  4E7K A;  2QXF A;  3J80 E;  4A4H A;  2DIG A;  3G4S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...