2D9TA

Solution structure of the tudor domain of tudor domain containing protein 3 from mouse
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
78
structure length
78
Chain Sequence
GSSGSSGKVWKPGDECFALYWEDNKFYRAEVEALHSSGMTAVVKFTDYGNYEEVLLSNIKPVQTEAWVRDPNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tudor domain-containing protein 3
publication title Solution structure of the Tudor domain of Tudor domain containing protein 3 from mouse
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 5
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2005-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2d9tA01
2LRQA 3BDLA 4B9WA 5IAYA 4C5EA 3OYHA 3CEYA 2RI3A 4E7JA 2DIGA 3S3MA 4FL6A 1MHNA 2HQEA 3KUFA 5KCHA 2LDMA 4PLLA 3OYBA 3FEOA 3DB4A 4BD3A 3QJ6A 2X4XA 5FROA 3NTKA 3OYMA 1WJSA 4BE0A 2D9TA 3LLRA 2PQWA 3ME9A 4HCZA 2MWOA 4QQDA 1G5VA 2RJFA 3OA6A 3LH0A 2EQUA 2R58A 3NTHA 4CRIA 4A4HA 4BE1A 2LVMA 1WGSA 3LGFA 3UWNA 5FRMA 3MP1A 2X4WA 3MP8A 4Z02A 5C6SA 2RHXA 3OYLA 2LCCA 3F70A 3OYAA 3OYJA 2FHDA 3L42A 3UT1A 2RO0A 4C5GA 5KCOA 3QKJA 3ZEHA 2EQMA 2GFUA 2G3RA 3MEAA 3C4SA 3M9QA 4C5IA 2YRVA 3DB3A 3ASKA 2R5AA 5IN1A 4E7HA 2XK0A 3P8DA 3OMGA 4A4EA 2HQXA 2XDPA 2K3YA 3PMIA 3S3NA 2RHUA 4IUQA 2RHZA 3MEVA 2M1HA 2X4YA 2L89A 4Q5WA 2MWPA 3QIIA 3L2UA 3H8ZA 2M0OA 3H6ZA 3EAEA 3OYKA 3OYGA 3L2RA 4BACA 4N4GA 2B8AA 2IG0A 2L8DA 3OYCA 2CKKA 4BDZA 2E5QA 4FU6A 2JZ2A 1OI1A 3QBYA 2R57A 1SSFA 3LYIA 3Q1JA 3LX7A 3PFSA 4RG2A 4A4GA 2BIVA 3OYIA 2VYTA 3E9GA 2LTOA 3LGLA 4ZTJA 2F5KA 2EFIA 4N4IA 2RJCA 1KHCA 2O4XA 3OB9A 4QQGA 3OYDA 4QW2A 1OZ3A 3OS2A 5D6XA 3MP6A 2RHYA 3SD4A 3OYNA 2QQRA 2RJDA 3OY9A 3MO8A 2GF7A 2DAQA 5KE2A 4A4FA 2K3XA 1XNIA 3P8HA 2E6NA 4QVZA 4LD6A 4IURA 4BE2A 4X34A 3FDRA 5M9OA 4BDYA 3META 3PNWC 4IKFA 2X35A 4E7KA 1WJQA 5D6WA 3L2VA 1OZ2A 2EQJA 4E7IA 2O4XB 2QQSA 2DIQA 4IUVA 1RI0A 2BUDA 5J39A 3DLMA 5CIUA 3O8VA 5J26A 2L3RA 3OYFA 3FC3A 3OQ5A 4PLIA 3E9FA 1N27A 2EQKA 3FLGA 4EDUA 3NTIA 4L59A 5KH6A 4NS5A 3L2QA 4OVAA 2BKDN 3OMCA 3PMTA 2RI2A 4IUUA 4IUPA 2JTFA 4QQ6A 2RI5A 4N4HA 2NLUA 5C0MA 3GOXA 2P0KA 4C5HA 3OYEA 5FRNA 1H3ZA 2R5MA 4IUTA 3MEWA 3S6WA 5D6YA 2RHIA 2RJEA 3L2WA 4E7LA 4GY5A 2WACA 2EKOA 3OS0A 4PL6A 3OS1A 4B9XA 4UC4A 1WJRA 2GFAA 5KE3A 3S3OA 2M16A 4ZTFA 1OYXA 3MEUA 4II1A
chains in the Genus database with same CATH superfamily
2LRQA 2D0NA 2DKGA 3FB9A 2K4YA 5DLQE 4JDSA 3CCMT 3RKYA 3DKMA 1RUWA 1WLPB 2EJ9A 1FMKA 4PLLA 3VV0A 1IHVA 2OTLA 2YLBA 1KQSA 4J9HA 3ZFJA 1WX6A 1WJSA 2RQTA 1G3SA 1LOJA 3CCLQ 2YUPA 4CRIA 5IXFA 2LVMA 4PJNA 1VIEA 2H3JA 4Z02A 2E64A 4AFQC 2LT4A 4OMMA 4NL2A 2FHDA 3TREA 4M78G 3CCVT 1NJIR 2DA9A 1SHGA 1VQ8Q 2OX7A 4JUVA 3C4SA 1VQ4Q 3DB3A 2ROLA 1OPKA 1VQPT 4IUQA 5GJVB 1PM3A 1VIFA 2KRMA 3QHSA 1YIJA 2FZKB 2EYQA 2OAWA 1SSFA 2CUDA 4Y91A 4KRTA 1ZA1B 5CQXA 5KYWA 4FSSA 1PKTA 3CCQT 1NLPC 1YJ9T 5KYYA 4QW2A 2Z0WA 1ZBXA 2G6FX 3SD4A 4JPBW 1NYGA 1JXMA 1IO6A 4MMLA 2KYBA 1KD1C 4QVZA 5CVIA 3WXMB 5KYWB 3PNWC 3MHXA 2OTJT 2FG0A 2K6DA 1HXDA 4M75A 5KYYB 3E2UA 1YCSB 3I35A 1IRXA 1V76A 2LT1A 5GAOr 4HCBA 1QVFP 2WSEE 3DLLA 3OMCA 2DVJA 3M58A 3CCVQ 1TTHB 4IUTA 1W2BP 1AOJA 4M75B 5IXBA 2CZ0B 4B9XA 4JJCA 2RHIA 1KC8R 3BDLA 1WXBA 5GAOl 4E7JA 3RBBB 2DYIA 2HQEA 1KSWA 1ZX6A 1VQ7T 4FM4B 2ZGWA 1JB0E 1I5OB 4FYVB 2FL7A 4AG2C 1Z9ZA 1UGQB 2MYSA 3WVEB 3CCQQ 1MUZA 2W0ZA 3RMQA 3CCET 3HRTA 1M1KU 1IXDA 3QKJA 4M7AC 2KNBB 3ZEHA 1R0CB 3FRNA 2JJ9A 4C5IA 1TOVA 4KH0B 3TSZA 4Z89A 3C0CA 4PJOF 2OTJQ 2EBPA 1YI2T 4N0AA 4RTWA 3JCMJ 2L8DA 4MZTA 2NUZA 5LJ5f 1YCYA 3QBYA 4RG2A 2DNUA 3OYIA 4RTXA 4F7UE 3M57A 1SG5A 4Z88A 2DPPB 2X4JA 1SHFA 3TU4K 2O88A 2XU8A 2QQRA 1GRIA 1K4US 2CH4W 1NG2A 2KI7A 3M5AA 2A0FB 1VQ5A 1OZ2A 2RK2A 5GANd 1D1CA 4BY6B 2D8JA 5KYNA 1BK2A 2QQSA 2M9UA 1R8OB 3DLMA 3FC3A 4ANJA 5I2MA 4M78A 1Q7YC 4EMHA 5KH6A 5I11A 3CCEQ 3GOXA 4M7DE 2YLCA 5GANg 1NBEB 1HSQA 4C92G 4E7LA 4C8QE 1XQHA 2K2VA 1YWPA 3M54A 2PUOB 5LL6S 1WJRA 3EH1A 4HVUA 1YJWA 4II1A 1H3HA 3SEMA 3OYYA 4M78B 2RMOA 4XTWA 3CCSQ 2EGCA 4KGVB 2GTOA 3OYBA 1Q86R 1WHHA 2I2LA 3RKWA 3NTKA 4DOVA 2VKNA 5CKBA 1ZUKA 5GANh 1UUEA 1YP5A 1CKBA 4M7AF 2JM9A 4BI4A 2K7AA 3MP1A 1NJIC 2ZPHB 3CCLA 2EYXA 4M75C 3OYJA 3H0IA 5GMKh 2JTEA 3EHRA 2JW4A 5AT1B 4AMCA 2DTOA 2RF0A 6AT1B 4CI0C 2DX1A 4XAXB 1VQ8A 2KT8A 1VQ4A 1GCPA 5GAOq 3CQTA 4KT0E 4LUEA 1WHJA 1UHCA 4N4GA 1OEBA 4FU6A 2X9HA 3M0RA 4RTVA 3LYIA 2MI6A 1E7OA 2JM8A 5GAN6 3SWNA 2VYTA 3X26B 2QGGA 4F17A 2HKNA 5GAOn 2DYBA 1LCKA 2LCLA 5D6XA 3A98A 2MIOA 1RABB 1I07A 1PWTA 4EMKB 4PJOG 4C0DC 1QCFA 1HJDA 2PUKB 2ZPBB 1GFCA 3SWNB 3CCMA 2X35A 1BI3A 4QKUA 1SEMA 2M51A 2AKKA 2DBMA 3MCAB 5CAIA 3O8VA 5CO7A 2L3RA 3EG9B 1X43A 2A08A 2E12A 2HCKA 2QXFA 1N27A 3KBGA 1WZOA 2KEAA 3P8BB 2P0KA 1VQ9Q 4JZ3A 1KK7A 2K79A 1KC8C 3S6WA 1O9SA 2RB6A 3CXCS 3C12A 1Q81R 3URGA 3RR6A 3U23A 1Y07A 4BY6C 1VQPA 3FEOA 3CCUA 4M77F 3DB4A 4BD3A 1G3YA 3GP8A 1M8VA 2QDLA 4A54A 3PIOA 3CMAA 4JLIA 2LX9A 2XMFA 1BBZA 3V8LA 1QVPA 5GMKe 5ECAA 1R77A 1BU1A 1NM7A 2K57A 3OA6A 4DEYA 3EFOA 4PK4A 4D8KA 3CCQA 4HVVA 3O5ZA 4KBMB 1YJ9A 1M90U 2OTLQ 1WHGA 2CT4A 4OB2B 1I4K1 2EPDA 4OB0B 4M78C 2EGEA 3EFOB 2K3YA 1UE9A 3VS4A 1CSKA 3L2RA 3RIRA 2JZ2A 2VGNA 4A53A 2COZA 2Y90A 4MDWA 3QWYA 2Y4YA 3M56A 4C92A 2CZ1B 1VQKT 4OB3B 1PNJA 1U8RA 2DEUA 4AFZC 4XTVA 2DM1A 4Y92A 4QVDA 1YIJQ 2GF7A 4A4FA 2K3XA 1XNIA 4C92B 2ZCFB 3CC7T 2VC8A 4LN2A 3QG1A 3JCMX 2NUPB 1WJQA 4YTLA 1U06A 1VQ7A 2VB6A 1RI0A 3CCRT 2LMJA 5LJ3d 1M8MA 2DL3A 1SSHA 1UGPB 4J83A 3FLGA 5GAMd 4QT7A 1AVZC 5HCKA 3REAB 3HHTB 2CS7A 4LDXA 2R5MA 4FW1A 3REBB 2DERA 2GCXA 1QVFA 1M90C 4EMKC 5LJ3g 1JJ2S 2CSIA 1Y96B 2QG9B 5GAMg 3CEYA 1XOVA 3SWNC 1Q86C 3S3MA 4J9BA 1PKSA 1W2BA 3JCMQ 1YI2A 4XQ3A 2KRSA 1MMDA 3QJ6A 1D1BA 1PD0A 2L2PA 3BE3A 1IHWA 5CKFA 4CC3A 4QVCA 1YHQT 1G3TA 2X4WA 1PRLC 4OGEA 5LJ3h 1QCNA 4X9CA 5GAMh 1B3QA 2ZPEB 2VXFA 4E6RA 2EW3A 4JRPA 1VQ5T 1K8AR 4X9DA 1M2OA 3VYHB 4J7IA 2XDDA 2CDTA 4DOWA 3GF5A 5GAN3 2RHUA 2C0IA 3L2UA 4KUDK 4M77G 1I5LA 1J3TA 4PJOB 2KY9A 4OMNA 4F16A 1Y71A 2A28A 2GBQA 2KDSA 1OI1A 4BI3A 2ED0A 3LX7A 2EYWA 1TWBA 3ER0A 4ZTJA 2AZVA 2F5KA 2GQVA 1RI9A 2E65A 2ROTA 4OMPA 4LE9A 4BB7A 2CP2A 3OS2A 4ESRA 2FPEA 4E7ZA 3HL8A 2DAQA 2L3QA 2L3SA 2DO3A 3VS7A 2CP6A 1QP3A 2KVQG 4LDUA 4E47A 5HK0A 1WA7A 4F04B 4FT4A 1QW1A 1LJOA 4ME7A 3UATA 2AKLA 1AWWA 3OS5A 4J9DA 3I9QA 4N4HA 4C0GA 4J7FA 4OB1B 2DJQA 3FIFA 3BW1A 2HD0A 1Q81C 2YDLA 1VQ5Q 4FYXB 2YXYA 2HSEB 2KYMA 1VA7A 1M1GA 1YJNA 1QVGS 4C92C 4XU3A 2AT1B 2QEXT 5I21A 2CP5A 2DIGA 2W10A 2J6FA 1MHNA 3RESA 2RN8A 1HD3A 5FROA 1Y0MA 5LJ3e 3UDCA 3CBPA 3CPFA 8AT1B 1EX4A 5FRMA 1JO8A 4WTOB 2K9GA 1M1KR 1TG0A 2EJFA 4E7HA 4A4EA 3LW5E 3H0HA 1KQSS 3JB9D 3M55A 1TU0B 4J9IA 1U1SA 3EAEA 2F69A 1K9MU 1MV3A 5LJ5j 2L0AA 5IHNA 1S72T 2JN0A 1G2BA 5A0LA 1WQWA 1M27C 5GAN5 2DXBA 1RL2A 3M4GA 1G83A 1HK9A 3ZL7C 1K8AU 4DBHA 3G6EA 4LUDA 2A3LA 2KBTA 1JXOA 1OZ3A 2QI2A 2NUTA 4NOYA 1FMVA 3OYNA 3EFSA 3CCUT 1BIAA 2QEXQ 2DTIA 2P0QA 2RK1A 3CMAT 3CC2T 1TH7A 3EGXA 3V7RA 4PJOC 1ZSZC 4M7DA 2EQJA 1HYOA 4E7IA 4IIOA 2RNAA 2DETA 4IUVA 4C8QA 5FWBA 2NUTB 3FJ5A 2LX7A 4PNOA 2XICA 3J80E 4PJOD 3OQ5A 4KULA 1GCQA 3SHWA 2BKDN 1QP2A 5GAN7 4C92F 2JTFA 2ED1A 1UGVA 4KGZB 4MZPA 3EGXB 1H3ZA 2JT4A 3CCMQ 4M7DB 1YBYA 1B07A 4E7SA 3OS1A 1EIFA 4M77A 2COWA 2LJ1A 5FU6B 3PT9A 1UJYA 5DY9A 3I56A 2DBKA 3KUFA 1AD5A 2JVVA 1AZGB 2KR3A 2KSSA 1S72Q 4HT8A 1QKXA 2QQ9A 5GJWB 4MZMA 5D7UA 2DXCA 5A2QE 2D9TA 3VS0A 3M0QA 1I0CA 2MWOA 3X28B 4M77B 1OPLA 4JRKA 2HEQA 1JQQA 4HA8A 3UWNA 4RTUA 2CP0A 5L23A 1RACB 1VQKA 2E4HA 1RAAB 2F2VA 1OX8A 1K8AC 1JU5C 1VQPQ 5CKEA 3CCUQ 2YWWA 2X51A 1SPKA 1I81A 2LQ8A 3ASKA 4XTXA 3CMAQ 1OOTA 2CREA 2R5AA 2XK0A 2HKQB 3CC7A 3KFVA 3H6ZA 1FWZA 2BZYA 2PZ1A 2QAZA 5IHIA 2WSFE 1YJ9Q 1TXQA 4XU0A 1ZQ1A 5GMKm 3CCRA 2BIVA 1TUCA 1UGSB 1AWJA 3V8JA 1D0ZA 2EFIA 3L1AA 2V26A 4QQGA 1SRMA 1RAGB 2CT3A 1ZUYA 3CPWS 4V2SA 2C06A 3VU3C 1M3CA 1X2QA 2DRMA 4M7AD 3EG0A 1UHFA 3QYHB 2PVGB 4M7AE 2E6NA 2DXUA 1OU8A 2HBPA 1H8KA 2VASA 4L6V5 2P84A 5CCAA 3EHQA 4ELYC 4RCCA 2DLPA 2A7YA 3A8GB 3UA7A 1UB4A 1ARKA 1X6BA 4D8DA 4J9EA 3OYFA 3LH5A 3NGPA 1YHQA 2RI2A 4IUPA 4AFUC 3QDRB 4C5HA 2HBWA 4MMKA 2V1RA 1JBMA 4LDYA 2HDAA 5CQYA 3QZ5B 4PL6A 1RAEB 1VQ7Q 2GFAA 2CYZB 2GGRA 2MK5A 3VKIA 1KG1A 2GTJA 4GBQA 2PTKA 1JRIA 2KRNA 5CR2A 1OX9A 3JAME 4ZGEB 4XTUA 2RJFA 2XHCA 1WHMA 1WXUA 5C6SA 3CMEA 1K73R 1M1KC 2CH4A 2M0YA 4XTYA 1UEBA 3HRSA 1YI2Q 1M90R 5FU6C 1X6OA 3I55A 2YRVA 2ZPFB 3M0UA 3P8DA 4PJLA 2RHZA 2L89A 2XG8D 2M0OA 3OYKA 2YRDA 2E3IA 1M2VA 1D1AA 4M77C 2FRWA 2LQNA 2IVWA 1BI0A 2C0TA 1E6HA 3NPFA 1QLYA 4WF2A 1YJNT 1KQ1A 2O4XA 3OB9A 5J3BA 2YUNA 4M75D 1SF9A 1O75A 1YN8A 3M0PA 1ZUUA 1M2VB 1PHTA 4M75E 4DEXA 4FYYB 4C0ZA 1WYXA 3KXTA 4X34A 2QEXA 2LCSA 4PJJA 2HZYA 3L2VA 1WIEA 2O4XB 4F7UF 3SB2A 2DIQA 1AEYA 1VQOT 2QDYB 3I5RA 3CD6T 1XTDA 1WHKA 1A0NB 4D6WA 5CK9A 1AWXA 1F1BB 4R0KA 2V8IA 3HRUA 1FMWA 3OYHA 2DRKA 3RMSA 2NYSA 3A1PA 3THKA 1K9AA 4M7DF 3E19A 2ATCB 4QQDA 3G6ET 1S72A 2DEQA 4N0AC 4JZ4A 3LH0A 2DVEA 4C8QF 1YJNQ 2MPXC 3OYLA 3MP8A 3OW2S 3L2ZA 2VUBA 4PJMA 5KYXA 5GANe 2G3RA 2EAYA 1VQLT 1W1FA 1AWOA 2E6ZA 3CC2A 1IB8A 1LNXA 1M3BA 2HAXA 3ULRB 3VUZA 5IH2A 3INZA 4FW2A 2JMAA 2AIRB 2RQWA 1K73U 3HTRA 2EIFA 3JV3A 4ZNXA 1W4SA 2F5TX 3PFSA 1VQ6A 3OYDA 3VRYA 3I56T 4VUBA 2FEIA 2XIDA 1X2KA 4M78D 4IURA 5LJ3f 2BE9B 2ABLA 4IKFA 4M78E 2AK5A 4O5VA 5GMKi 3HKSA 2DD5A 3G6EQ 2KGTA 5FWCA 3RNJA 5J26A 5I22A 2OAUA 2EQKA 3NTIA 3JCMd 1K76A 1Z9QA 3PMTA 2YSQA 4DBRA 3CPWP 2RJEA 5GAN8 1VQLQ 4XTZA 4ZTFA 3JB9I 4A63B 1KIKA 3JCMg 3R6OA 1WI7A 3HP9A 4F7UG 2L3PA 4GLMA 2KAFA 3CBOA 1I8FA 4BE0A 3LLRA 1E6GA 2HQHA 1C0MA 3G1JA 1BKBA 1K0XA 1K73C 2FVUA 1VUBA 3QO3A 4PFPA 5HKCA 1MMGA 3M0SA 1QVFS 2J05A 3G7ZA 3I56Q 3M59A 5GAOp 3JCMh 1T0JA 3M9QA 3VYGA 2F2XA 1AZEA 3M4YA 4RG8A 2DL8A 3QIIA 4KH1B 4BACA 1VQKQ 4M7DG 2P4TA 3QSUA 1K9MR 1UG1A 5DLOA 2P4RA 2E10A 5I2SA 4ZGJB 1M3AA 1S1NA 4C8QG 1UFFA 2GQIA 2LQWA 4OP0A 2RQUA 3AT1B 5A0DA 1VQNA 1TS9A 2DL5A 1IGQA 3QWXX 3CC7Q 3EH2A 3SDZA 2MMPA 3GNFB 3H0FA 5KE2A 1T3LA 1N5ZA 1PCXA 3FDRA 3TEEA 3CCRQ 5EC7A 4HCCA 1M4ZA 3VS5A 2HL5C 5DM7R 1OQKA 5FU7B 3CMET 1X75C 5CIUA 3PE0A 4PLIA 3JB9H 3L2QA 3I55T 1H92A 2NLUA 3OYEA 5FRNA 2K3BA 3UPUA 2SRCA 2L5QA 3OS0A 1YNZA 2J7IA 4JS4A 2BE7D 4B9WA 1NEBA 3A8OB 1C6VX 1X69A 1YHQQ 4MDXA 1ZA2B 2V8JA 2CGHA 3JCMe 2SEMA 1U5SA 2R58A 2VVKA 4BE1A 2E5KA 1B7TA 2DFUA 4RMOA 2KK4A 3PVLA 1VQMT 1ZSGA 4J9FA 1UDLA 2RO0A 4C5GA 3VJPA 4JLGA 2F2WA 3RUXA 4C92D 3V7CA 2XDPA 3C94A 3S3NA 1ZBJA 4C92E 4TVRA 5GAMe 3M0TA 4R55A 3T9NA 3CMEQ 1QVGA 2CKKA 2R57A 4JJNK 1VQOA 3A8HB 3I55Q 1IREB 1X01A 3CD6A 2FPFA 3CXCP 3OW2P 1KHCA 5GANj 2MAMA 2FZGB 1X6GA 4OMOA 5HY6A 3NFCA 4F7UA 3GIBA 4OMLA 4PFOA 3JCMb 3M53A 3EFRA 3EG3A 1M9SA 5GMKj 4LXCA 1KD1U 5CKHA 3EGDA 3UF4A 2D6FA 5GAOm 4JJDA 1PRMC 2DL7A 4F7UB 3G4SA 2VGMA 4DBFA 3RKXA 1IGUA 1VQMQ 1JEGA 1Q82U 1GBRA 4J9CA 2EQIA 2PVDB 1YFNA 3EGDB 4UC4A 5KE3A 3S3OA 3BY7A 1OYXA 3MEUA 2KROA 1VQLA 3TCJA 5KCHA 2HSPA 4AFSC 2FYKA 1PG5B 1R0BG 2X4XA 5FU7C 5CKDA 3OYMA 4PJOE 4F14A 1YITT 1LVKA 3J7AF 1VQ6T 1D3BA 4A4HA 1QKWA 2DK3A 3LGFA 4HVWA 2K2MA 2PU9B 3A8LB 5IHKA 4JJBA 4C8QB 1V29B 2K5FA 1M30A 3MEAA 1NZ9A 1G3WA 4BUGA 3JCMW 2JS2A 3I5SA 4HCKA 4HXJA 5IN1A 1D3BB 3OMGA 2HQXA 5EG2A 1K9MC 2X4YA 2YUOA 2DXTA 1X27A 2B8AA 1PD1A 2IPOB 2DZ9A 2E5QA 4BDZA 3RDVA 2DTHA 2FRYA 5KYUA 4P5NA 1C1AA 1QMCA 2QA4A 4DBQA 1D0YA 2PVOB 3AHUA 4L5GA 2HNIA 3WVDB 1WQ7A 1JJ2P 4FSXA 4M4ZA 1UECA 3CC2Q 2E1HA 1Q82C 5AYFA 1TSFA 1YWOA 3EG1A 3JB9F 2LC4A 1PC0A 5KYUB 4PFZA 4LDVA 1NE8A 3CC4T 4J5YA 1GL5A 4CC7A 2AHJB 1YITQ 1VQ6Q 4X1VA 2E41A 2BUDA 2KXCA 3QZ9B 2YUQA 2QGFB 1RAHB 2CZ6B 1W6XA 1N8RR 2JUFA 4FT2A 5GANf 4IUUA 1Q7YU 3J81E 1OV3A 2MF2A 2RM4A 3MEWA 2DF6A 5D6YA 4GY5A 2WACA 4RTTA 4ELZC 2V8KA 2RI3A 3GNGA 4ZN3A 5GAN2 3CPWA 2MCNA 2LDMA 4RCBA 4C0DB 3CCJT 2LNHB 1VQNT 4XU1A 2V1QA 4LNPA 1G5VA 3CCST 3PIPA 3E1SA 3NTHA 4RUGA 4BI8B 2RH2A 1LPLA 3F70A 1KJWA 2YRCA 3OYAA 1Y7XA 1NJIU 2LNVA 2CSQA 1I1JA 2GFUA 2D1XA 3IQLA 3H41A 1QWFA 2BZXA 2JMCA 3G71T 3CC4Q 2DZCA 2O31A 4ATOA 3A5ZB 2FPDA 2XDBA 2D8HA 3OYCA 2WSCE 1ACMB 3TVTA 4M7DC 2ZZDA 1BCMA 1FXXA 1T0HA 3E9GA 1N9RA 4C8QC 4N4IA 1QVGP 1D0XA 4M7DD 5LJ5d 4R56A 1KHIA 1GCQC 3MP6A 1GFDA 2RHYA 3OY9A 4C8QD 4C0FA 3MO8A 2O9VA 5LJ3j 2KQWA 5GAMj 3NMZC 5GMKl 1NLOC 2QQBA 4OMFB 3CCJQ 5LJ5g 4FCYA 1VQNQ 1EZZB 4RTZA 2KMTA 4J6XA 2DILA 4K11A 4M77D 5GAN4 2QTXA 1BI1A 3VS2A 4M77E 4EDUA 1MMAA 2DL4A 2H3EB 4QQ6A 2KXDA 3JCMc 2A36A 1UJ0A 3QXEB 1VQMA 1MV0B 2EWNA 1ZLMA 2RA2A 3L2WA 1RAFB 1KQSP 2BTTA 1KC8U 1AHJB 3G71Q 3JB9G 1BCOA 4C5EA 5LJ5h 1VQ9T 1VYTA 2EGAA 2GNCA 5FLXE 1BIBA 2XKOC 3GLXA 3QUIA 2OJ2A 2K5LA 1M1FA 4E2FB 1WPYA 3OBYA 3H9NA 1N8RU 2LQKA 4RKUE 2EKHA 2F1LA 2FO0A 2EQUA 1G8XA 1UTIA 1WGSA 2ZPIB 4EMKA 2RHXA 2O9SA 2LCCA 1TUDA 2DMOA 1NPRA 1Q95G 1CKAA 3HPWA 4DA4A 2EQMA 2ZAEA 1VOMA 1M5Q1 3MPUB 2QTVA 1WHLA 3QJYA 3PMIA 3EG9A 2OTLT 2M1HA 4Q5WA 3X24B 3G4ST 2X3WD 2RPNA 4HKEA 2IG0A 2LJ3A 1PSEA 3Q1JA 3QDFA 2P0PA 2X3XD 2D0QB 4LDWA 3HFNA 1OU9A 2RJCA 2JS0A 2JOYA 2QQAA 3JSCA 3GBQA 2QK0A 1BB9A 1Y57A 3VS1A 3CXCA 3LWHA 4HT9A 3OW2A 2LZ6B 2YHTA 1VQOQ 3CCVA 3META 3JCMf 5KYXB 2CP7A 3JCMP 3CD6Q 7AT1B 1YIJT 2YT6A 1RADB 4O6JA 9ATCB 1ABQA 4J9GA 3CBMA 1MNEA 2RD1A 3X20B 2H8HA 5J39A 1N8RC 1YITA 2J6KA 1ABOA 4JRQA 1GXIE 4L59A 3QPHA 4NS5A 4M75F 4EMGA 1FYNA 4AT1B 2I0NA 5LJ5e 3OSVA 1WNLA 2AZSA 4EIKA 1SRLA 2EVRA 2M16A 1U3OA 5GAMf 5IAYA 2A37A 1P92A 1OULA 3G4SQ 4AG1C 4FL6A 3LWIA 1SKUB 2K5IA 4Y28E 3RERA 3OSSC 1U1TA 1Q86U 1V1CA 1PSFA 1N9SA 2QA4T 1WXTA 4HCZA 1TUGB 3MKDA 2OI3A 4NL3A 4XK8E 2OTJA 2JNGA 2JXBA 4J6WA 4KGXB 3EG2A 1MGQA 1GBQA 4M7AG 3NHNA 4OGCA 1NEGA 4JS5A 2KE9A 3L42A 1MNDA 3UT1A 1KQ2A 2NUPA 5KCOA 3R6NA 3C95A 3JCMV 4FIBA 2KT1A 2J06A 2ZPGB 1H641 2IIMA 2J6OA 2QASA 2O01E 5IT9E 4OF1A 3CC4A 3H8ZA 2CZ7B 2CUBA 1QQJA 3VRZA 1UGRB 1Y96A 3VS6A 2ENMA 1VYVA 3VUBA 1EFNA 1W2BS 3UA6A 1RLQC 1QCOA 2RJDA 3CCEA 3P8HA 4BE2A 5M9OA 4BDYA 1JJ2A 3VS3A 2QA4Q 4E7KA 4WCIA 4A4KA 1T3SA 1NYFA 1KD1R 2RQRA 4OMQA 1KFZA 3CCJA 5HK3A 2E70A 1ZHIA 3CCSA 3E9FA 1RLPC 4PKCC 3GPLA 2RI5A 4GLKA 2FB7A 2VXEA 3PTAA 3ZBDA 1Q82R 2EKOA 4M78F 2E3HA 4PJOA 1ZSZA 1D09B 4ZN1A 1Q81U 2HL3A 4ZGDB 1IZ6A 3G71A 1QWEA 2XD0A 2DE0X 5FW9A 2VV5A 1WDXA 4LD9K 4JRIA 3TSWA 3SFMA 2NWMA 3V7SA 3JB9J 3ME9A 2PQWA 1VYUA 1BI2A 2COYA 1B34A 2Y4XA 3A8MB 2BZ8A 1ZSZB 4B6MA 2B86A 4M75G 1AT1B 2CP3A 1K1ZA 3OBWA 2VWFA 3V8KA 4J8OA 2DD4A 2EYYA 3D7SB 3HFOA 3HSBA 3FJPA 1YJWT 1DJ7B 1B34B 1BYMA 4CC2A 4KUIA 4FYWB 3TQ7P 2LP5A 4J6YA 3MEVA 3EGUA 2EJGA 1NPPA 1WFWA 2MWPA 2JTMA 3OYGA 2XI9A 4IIMA 2ESWA 3MJXA 2M02A 2PNIA 4A4GA 4RTYA 2C0OA 3CCLT 2LTOA 3LGLA 1FX7A 2QYZA 2MOXA 4CC4B 3QYGB 1W70A 4Z8AA 3BFMA 1VQ8T 1VQ4T 4LD6A 8ATCB 1VQ9A 5D6WA 5A0GA 3JRZA 1XJWB 1K0SA 1N6AA 1RAIB 3X25B 4M7AA 1MMNA 2ECZA 2O2OA 2HMAA 3BDUA 4OVAA 4XU2A 2RQVA 5C0MA 4ORZA 1Q7YR 3N5BB 2DJZA 3PGGA 1YJWQ 2LJ0A 2FZCB 2EYZA 4EPCA 4DQ2A 3PVQA 5L8RE 4M7AB
chains in the Genus database with same CATH topology
2LRQA 2V8KA 2DKGA 3FB9A 2K4YA 5GAMg 3OYHA 3CEYA 1XOVA 2RI3A 4JDSA 5DLQE 3RKYA 3SWNC 3DKMA 3GNGA 4ZN3A 5GAN2 3CCMT 3S3MA 3CPWA 3RMSA 1W2BA 2EJ9A 2LDMA 4PLLA 3VV0A 4RCBA 2OTLA 3JCMQ 2YLBA 1YI2A 4XQ3A 1KQSA 4C0DB 3QJ6A 3ZFJA 1WJSA 3CCJT 1VQNT 4M7DF 1G3SA 3E19A 4XU1A 4QQDA 3G6ET 1G5VA 1S72A 2DEQA 4N0AC 3CCST 5CKFA 3PIPA 1LOJA 3LH0A 3E1SA 3NTHA 2DVEA 4CRIA 4QVCA 4C8QF 1YHQT 4BI8B 2LVMA 1G3TA 1GXIE 1VIEA 2H3JA 2X4WA 2RH2A 3MP8A 4Z02A 3OYLA 3OW2S 4OGEA 3F70A 5LJ3h 2E64A 3OYAA 1Y7XA 3L2ZA 2LT4A 4NL2A 1NJIU 2FHDA 2LNVA 4X9CA 3TREA 5GAMh 2VUBA 2ZPEB 4M78G 2VXFA 3CCVT 5GANe 2GFUA 2G3RA 4JUVA 3C4SA 4JRPA 2EAYA 4X9DA 1VQ5T 1VQLT 3DB3A 3VYHB 4J7IA 2XDDA 3G71T 4DOWA 2DZCA 3GF5A 5GAN3 2E6ZA 1VQPT 2RHUA 4IUQA 3OYMA 4ATOA 3L2UA 4KUDK 3A5ZB 4M77G 3CC2A 2XDBA 1I5LA 1LNXA 2HAXA 4PJOB 2KY9A 3VUZA 1Y71A 3OYCA 1VIFA 3QHSA 3INZA 1YIJA 2EYQA 2KDSA 2WSCE 1K73U 1OI1A 4BI3A 1SSFA 2EIFA 4Y91A 1W4SA 2F5TX 3LX7A 3PFSA 4M7DC 2ZZDA 1FXXA 5CQXA 3E9GA 3CCQT 3ER0A 4ZTJA 2F5KA 1N9RA 2GQVA 4C8QC 3JB9J 4N4IA 1YJ9T 1VQ6A 2E65A 3OYDA 4BB7A 4M7DD 5LJ5d 4R56A 4QW2A 1KHIA 3OS2A 1ZBXA 3MP6A 3I56T 2RHYA 3SD4A 4VUBA 3OY9A 4C8QD 4C0FA 3MO8A 3HL8A 2DAQA 5LJ3j 4MMLA 2XIDA 2KQWA 2DO3A 1KD1C 4QVZA 5CVIA 4M78D 4IURA 5LJ3f 3WXMB 5GAMj 1QP3A 3PNWC 2KVQG 3MHXA 4IKFA 2OTJT 4M78E 4LDUA 4O5VA 4E47A 5HK0A 5GMKl 3JAME 5GMKi 1HXDA 2QQBA 4M75A 4OMFB 5LJ5g 3HKSA 2DD5A 4FT4A 2KMTA 1QW1A 1LJOA 4J6XA 4ME7A 4M77D 5J26A 2LT1A 5GAN4 5GAOr 4HCBA 2OAUA 2QTXA 1BI1A 2EQKA 3OS5A 4M77E 3NTIA 4EDUA 3JCMd 2WSEE 3DLLA 3OMCA 3PMTA 4QQ6A 4N4HA 3M58A 3JCMc 4C0GA 4J7FA 4OB1B 3QXEB 1VQMA 4IUTA 2EWNA 3FIFA 3BW1A 2HD0A 4M75B 1Q81C 2RJEA 2RA2A 3L2WA 2CZ0B 5GAN8 4B9XA 4XTZA 1KC8U 2RHIA 1AHJB 1M1GA 3JB9I 3JB9G 4ZTFA 1YJNA 1QVGS 4C92C 3BDLA 4XU3A 4C5EA 5LJ5h 1VQ9T 2QEXT 5GAOl 3JCMg 5FLXE 3R6OA 5I21A 4E7JA 2DIGA 1BIBA 3HP9A 1MHNA 2HQEA 3RESA 2XKOC 3GLXA 3QUIA 1VQ7T 2K5LA 1M1FA 4FM4B 4F7UG 1WPYA 3OBYA 2ZGWA 2KAFA 3CBOA 5FROA 1JB0E 1I8FA 5LJ3e 3UDCA 2FL7A 3LLRA 2LQKA 4RKUE 4BE0A 1N8RU 1BKBA 1UGQB 1K73C 2FVUA 1VUBA 2EQUA 3CBPA 3CPFA 3QO3A 3WVEB 5HKCA 1WGSA 2ZPIB 5FRMA 4EMKA 2RHXA 2LCCA 3RMQA 1QVFS 3CCET 3G7ZA 1NPRA 3HRTA 3M59A 5GAOp 3JCMh 1M1KU 3QKJA 4M7AC 3HPWA 3ZEHA 2EQMA 4DA4A 1M5Q1 3FRNA 3M9QA 4C5IA 2EJFA 3VYGA 4PJOF 4E7HA 3M4YA 4RG8A 4A4EA 3LW5E 3QJYA 3PMIA 1KQSS 2OTLT 1YI2T 2M1HA 4N0AA 4Q5WA 3X24B 3JB9D 3M55A 3QIIA 3G4ST 1U1SA 3EAEA 4BACA 2F69A 1K9MU 3JCMJ 4HKEA 2IG0A 2L8DA 2P4TA 4MZTA 5LJ5j 3QSUA 5DLOA 1S72T 4M7DG 2JN0A 5A0LA 2E10A 5LJ5f 1YCYA 3QBYA 1WQWA 5I2SA 4RG2A 1PSEA 3Q1JA 4ZGJB 5GAN5 2P0PA 4C8QG 2DXBA 1JJ2A 1RL2A 3M4GA 3OYIA 4OP0A 4F7UE 3M57A 2D0QB 5A0DA 1HK9A 1VQNA 4LDWA 1K8AU 3HFNA 2DPPB 2RJCA 3G6EA 2X4JA 2JOYA 2A3LA 3TU4K 2QQAA 1OZ3A 2QI2A 3JSCA 3SDZA 2XU8A 2MMPA 4NOYA 3GNFB 3OYNA 2QQRA 3EFSA 3CCUT 1BIAA 5KE2A 3CXCA 2DTIA 3LWHA 3OW2A 4HT9A 2YHTA 2P0QA 2RK1A 3FDRA 3CMAT 3TEEA 3CCVA 1TH7A 3META 3CC2T 3V7RA 3M5AA 4PJOC 3JCMf 1VQ5A 1OZ2A 2RK2A 5GANd 3JCMP 2EQJA 1YIJT 4HCCA 4BY6B 4E7IA 4M7DA 4O6JA 2QQSA 1M4ZA 3CBMA 5DM7R 2RD1A 4IUVA 2M9UA 5FU7B 3X20B 4C8QA 5J39A 3CMET 1N8RC 1R8OB 4PNOA 1X75C 3DLMA 2XICA 5CIUA 3J80E 3FC3A 1YITA 3OQ5A 4PLIA 3JB9H 5I2MA 4M78A 4KULA 1Q7YC 4EMHA 4JRQA 4MDXA 4L59A 3QPHA 5KH6A 4NS5A 3L2QA 4M75F 4EMGA 2BKDN 1QP2A 5GAN7 4C92F 2JTFA 5LJ5e 3I55T 3GOXA 2NLUA 4MZPA 3OSVA 4M7DE 1WNLA 2YLCA 5GANg 3OYEA 5FRNA 1H3ZA 3UPUA 4M7DB 1YBYA 4C92G 4E7LA 2L5QA 4C8QE 1XQHA 2K2VA 3OS0A 3OS1A 1EIFA 4M77A 3M54A 2PUOB 5LL6S 2M16A 1WJRA 5GAMf 5FU6B 1YJWA 4II1A 3PT9A 5DY9A 4B9WA 5IAYA 4JS4A 1P92A 3OYYA 4M78B 4FL6A 4XTWA 3I56A 3LWIA 3KUFA 3A8OB 2K5IA 4Y28E 3RERA 3OSSC 1U1TA 3OYBA 1Q86U 1PSFA 1N9SA 2JVVA 2QA4T 2KSSA 2I2LA 4HT8A 2QQ9A 3NTKA 4MZMA 3RKWA 2DXCA 2V8JA 2D9TA 4HCZA 4DOVA 5A2QE 2CGHA 5CKBA 2MWOA 4NL3A 3X28B 4XK8E 2OTJA 3JCMe 4M77B 2JNGA 4JRKA 5GANh 4J6WA 2R58A 4M7AF 4BE1A 4HA8A 3UWNA 4BI4A 1MGQA 3MP1A 4RMOA 1NJIC 1VQKA 2KK4A 4M7AG 2ZPHB 3CCLA 1VQMT 4OGCA 4M75C 4JS5A 1K8AC 3OYJA 3L42A 3UT1A 2RO0A 4C5GA 5KCOA 3VJPA 4JLGA 3C95A 5CKEA 5GMKh 1Q86C 1KQ2A 3JCMV 1I81A 2DTOA 4FIBA 2LQ8A 2ZPGB 3ASKA 1H641 4XTXA 2R5AA 4CI0C 3RUXA 4C92D 2XK0A 4XAXB 3V7CA 1VQ8A 2XDPA 3C94A 1VQ4A 3S3NA 5GAOq 4C92E 3CC7A 5IT9E 2O01E 4TVRA 4KT0E 4OF1A 3CC4A 3H8ZA 5GAMe 3H6ZA 4R55A 4N4GA 2CZ7B 3T9NA 4PJOE 1FWZA 1QVGA 2CKKA 4FU6A 2WSFE 2R57A 3LYIA 4JJNK 2MI6A 4XU0A 1ZQ1A 1VQOA 3A8HB 5GMKm 3CCRA 2BIVA 1UGRB 1IREB 1UGSB 2VYTA 1X01A 3SWNA 3V8JA 3X26B 5GAN6 3CD6A 1Y96A 2EFIA 3L1AA 1KHCA 4QQGA 5GAOn 5GANj 3CPWS 2MAMA 3VUBA 4V2SA 2C06A 1W2BS 2LCLA 3VU3C 5D6XA 5HY6A 3NFCA 4M7AD 2RJDA 3QYHB 4F7UA 3GIBA 2PVGB 4EMKB 4PJOG 4C0DC 3CCEA 4M7AE 3P8HA 2E6NA 3JCMb 2DXUA 2PUKB 3M53A 4BE2A 2HBPA 3EFRA 5M9OA 2ZPBB 4L6V5 5CCAA 1M9SA 3SWNB 5GMKj 4BDYA 4ELYC 2X35A 3CCMA 4RCCA 4A4KA 4E7KA 1KD1U 1BI3A 2A7YA 3A8GB 5CKHA 1UB4A 2D6FA 5GAOm 3MCAB 3CCJA 5CAIA 5HK3A 2E70A 1ZHIA 3O8VA 2L3RA 5CO7A 3OYFA 4F7UB 3G4SA 2E12A 2QXFA 3CCSA 2VGMA 1N27A 3E9FA 3RKXA 1YHQA 3KBGA 4PKCC 2RI2A 4IUPA 3QDRB 2RI5A 3GPLA 4GLKA 3P8BB 2P0KA 4C5HA 4MMKA 2FB7A 2VXEA 1JBMA 3PTAA 1KC8C 3S6WA 4LDYA 1Q82U 1O9SA 2RB6A 3ZBDA 3CXCS 2EKOA 5CQYA 2PVDB 3QZ5B 4M78F 4PL6A 4PJOA 4UC4A 2GFAA 5KE3A 3S3OA 2CYZB 3BY7A 4ZN1A 1Q81U 1OYXA 3C12A 3MEUA 4ZGDB 1IZ6A 1VQLA 3VKIA 3URGA 1KG1A 3G71A 3TCJA 2XD0A 5KCHA 1Y07A 4BY6C 2VV5A 1VQPA 3FEOA 3CCUA 4M77F 3DB4A 4BD3A 2FYKA 1JRIA 4LD9K 4JRIA 5CKDA 1G3YA 2X4XA 5FU7C 4ZGEB 3SFMA 3V7SA 4XTUA 5CR2A 3ME9A 2PQWA 2Y4XA 1BI2A 3GP8A 1B34A 4A54A 3A8MB 3PIOA 3CMAA 4JLIA 1YITT 1VQ6T 3J7AF 2LX9A 3V8LA 2RJFA 1QVPA 5GMKe 3OA6A 2K57A 1D3BA 4M75G 4A4HA 2XHCA 2DK3A 3LGFA 5C6SA 3CMEA 2PU9B 3OBWA 3CCQA 3A8LB 1M1KC 1M8VA 3V8KA 4XTYA 4C8QB 4J8OA 4KBMB 2DD4A 1YJ9A 4PJOD 1UEBA 3HFOA 3HSBA 1M90U 1V29B 3HRSA 2K5FA 3FJPA 5FU6C 1X6OA 1YJWT 3MEAA 1NZ9A 1DJ7B 4OB2B 1I4K1 1B34B 1G3WA 4BUGA 3I55A 3JCMW 1BYMA 4OB0B 2YRVA 4KUIA 2ZPFB 4M78C 5IN1A 3P8DA 1D3BB 3OMGA 2HQXA 2K3YA 4J6YA 5EG2A 2RHZA 3MEVA 1K9MC 2EJGA 2X4YA 1NPPA 2L89A 2MWPA 2XG8D 2DXTA 2JTMA 2M0OA 3OYKA 3OYGA 3L2RA 2XI9A 2B8AA 3RIRA 4BDZA 2DZ9A 2E5QA 4M77C 2JZ2A 2VGNA 4A53A 2IVWA 2Y90A 4MDWA 1BI0A 2DTHA 4A4GA 2Y4YA 3M56A 4P5NA 4C92A 2QA4A 2CZ1B 1VQKT 4OB3B 2PVOB 3CCLT 3AHUA 2LTOA 3LGLA 4WF2A 1FX7A 1U8RA 1YJNT 1KQ1A 4L5GA 2HNIA 3WVDB 2O4XA 3OB9A 5J3BA 1WQ7A 4FSXA 4M75D 3QYGB 1O75A 2E1HA 4XTVA 1Q82C 5AYFA 4M75E 4QVDA 3BFMA 2GF7A 1VQ8T 3JB9F 2LC4A 4A4FA 4C0ZA 1VQ4T 2K3XA 1XNIA 3KXTA 4C92B 4LD6A 2ZCFB 3CC7T 4X34A 2VC8A 4LDVA 1NE8A 1VQ9A 3QG1A 3JCMX 2QEXA 3CC4T 4J5YA 4YTLA 1WJQA 5D6WA 5A0GA 3JRZA 3L2VA 2AHJB 2O4XB 4F7UF 1VQ7A 1N6AA 3SB2A 2DIQA 3X25B 4M7AA 1VQOT 1RI0A 2BUDA 2E41A 2QDYB 3CCRT 5LJ3d 3QZ9B 1UGPB 3CD6T 4J83A 3BDUA 3FLGA 2CZ6B 5GAMd 1XTDA 4OVAA 2JUFA 4FT2A 4XU2A 4IUUA 4D6WA 5C0MA 5GANf 1Q7YU 3J81E 3HHTB 2CS7A 4LDXA 5CK9A 2R5MA 2DJZA 3N5BB 2MF2A 2RM4A 3MEWA 3PGGA 5D6YA 2V8IA 2GCXA 1QVFA 4GY5A 2WACA 1M90C 4EPCA 3HRUA 4DQ2A 4ELZC 4EMKC 5L8RE 4M7AB 5LJ3g 1JJ2S 1Y96B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LRQ A;  3BDL A;  4B9W A;  5IAY A;  4C5E A;  3OYH A;  3CEY A;  2RI3 A;  4E7J A;  2DIG A;  3S3M A;  4FL6 A;  1MHN A;  2HQE A;  3KUF A;  5KCH A;  2LDM A;  4PLL A;  3OYB A;  3FEO A;  3DB4 A;  4BD3 A;  3QJ6 A;  2X4X A;  5FRO A;  3NTK A;  3OYM A;  1WJS A;  4BE0 A;  2D9T A;  3LLR A;  2PQW A;  3ME9 A;  4HCZ A;  2MWO A;  4QQD A;  1G5V A;  2RJF A;  3OA6 A;  3LH0 A;  2EQU A;  2R58 A;  3NTH A;  4CRI A;  4A4H A;  4BE1 A;  2LVM A;  1WGS A;  3LGF A;  3UWN A;  5FRM A;  3MP1 A;  2X4W A;  3MP8 A;  4Z02 A;  5C6S A;  2RHX A;  3OYL A;  2LCC A;  3F70 A;  3OYA A;  3OYJ A;  2FHD A;  3L42 A;  3UT1 A;  2RO0 A;  4C5G A;  5KCO A;  3QKJ A;  3ZEH A;  2EQM A;  2GFU A;  2G3R A;  3MEA A;  3C4S A;  3M9Q A;  4C5I A;  2YRV A;  3DB3 A;  3ASK A;  2R5A A;  5IN1 A;  4E7H A;  2XK0 A;  3P8D A;  3OMG A;  4A4E A;  2HQX A;  2XDP A;  2K3Y A;  3PMI A;  3S3N A;  2RHU A;  4IUQ A;  2RHZ A;  3MEV A;  2M1H A;  2X4Y A;  2L89 A;  4Q5W A;  2MWP A;  3QII A;  3L2U A;  3H8Z A;  2M0O A;  3H6Z A;  3EAE A;  3OYK A;  3OYG A;  3L2R A;  4BAC A;  4N4G A;  2B8A A;  2IG0 A;  2L8D A;  3OYC A;  2CKK A;  4BDZ A;  2E5Q A;  4FU6 A;  2JZ2 A;  1OI1 A;  3QBY A;  2R57 A;  1SSF A;  3LYI A;  3Q1J A;  3LX7 A;  3PFS A;  4RG2 A;  4A4G A;  2BIV A;  3OYI A;  2VYT A;  3E9G A;  2LTO A;  3LGL A;  4ZTJ A;  2F5K A;  2EFI A;  4N4I A;  2RJC A;  1KHC A;  2O4X A;  3OB9 A;  4QQG A;  3OYD A;  4QW2 A;  1OZ3 A;  3OS2 A;  5D6X A;  3MP6 A;  2RHY A;  3SD4 A;  3OYN A;  2QQR A;  2RJD A;  3OY9 A;  3MO8 A;  2GF7 A;  2DAQ A;  5KE2 A;  4A4F A;  2K3X A;  1XNI A;  3P8H A;  2E6N A;  4QVZ A;  4LD6 A;  4IUR A;  4BE2 A;  4X34 A;  3FDR A;  5M9O A;  4BDY A;  3MET A;  3PNW C;  4IKF A;  2X35 A;  4E7K A;  1WJQ A;  5D6W A;  3L2V A;  1OZ2 A;  2EQJ A;  4E7I A;  2O4X B;  2QQS A;  2DIQ A;  4IUV A;  1RI0 A;  2BUD A;  5J39 A;  3DLM A;  5CIU A;  3O8V A;  5J26 A;  2L3R A;  3OYF A;  3FC3 A;  3OQ5 A;  4PLI A;  3E9F A;  1N27 A;  2EQK A;  3FLG A;  4EDU A;  3NTI A;  4L59 A;  5KH6 A;  4NS5 A;  3L2Q A;  4OVA A;  2BKD N;  3OMC A;  3PMT A;  2RI2 A;  4IUU A;  4IUP A;  2JTF A;  4QQ6 A;  2RI5 A;  4N4H A;  2NLU A;  5C0M A;  3GOX A;  2P0K A;  4C5H A;  3OYE A;  5FRN A;  1H3Z A;  2R5M A;  4IUT A;  3MEW A;  3S6W A;  5D6Y A;  2RHI A;  2RJE A;  3L2W A;  4E7L A;  4GY5 A;  2WAC A;  2EKO A;  3OS0 A;  4PL6 A;  3OS1 A;  4B9X A;  4UC4 A;  1WJR A;  2GFA A;  5KE3 A;  3S3O A;  2M16 A;  4ZTF A;  1OYX A;  3MEU A;  4II1 A; 
#chains in the Genus database with same CATH topology
 2LRQ A;  2D0N A;  2DKG A;  3FB9 A;  2K4Y A;  5DLQ E;  4JDS A;  3CCM T;  3RKY A;  3DKM A;  1RUW A;  1WLP B;  2EJ9 A;  1FMK A;  4PLL A;  3VV0 A;  1IHV A;  2OTL A;  2YLB A;  1KQS A;  4J9H A;  3ZFJ A;  1WX6 A;  1WJS A;  2RQT A;  1G3S A;  1LOJ A;  3CCL Q;  2YUP A;  4CRI A;  5IXF A;  2LVM A;  4PJN A;  1VIE A;  2H3J A;  4Z02 A;  2E64 A;  4AFQ C;  2LT4 A;  4OMM A;  4NL2 A;  2FHD A;  3TRE A;  4M78 G;  3CCV T;  1NJI R;  2DA9 A;  1SHG A;  1VQ8 Q;  2OX7 A;  4JUV A;  3C4S A;  1VQ4 Q;  3DB3 A;  2ROL A;  1OPK A;  1VQP T;  4IUQ A;  5GJV B;  1PM3 A;  1VIF A;  2KRM A;  3QHS A;  1YIJ A;  2FZK B;  2EYQ A;  2OAW A;  1SSF A;  2CUD A;  4Y91 A;  4KRT A;  1ZA1 B;  5CQX A;  5KYW A;  4FSS A;  1PKT A;  3CCQ T;  1NLP C;  1YJ9 T;  5KYY A;  4QW2 A;  2Z0W A;  1ZBX A;  2G6F X;  3SD4 A;  4JPB W;  1NYG A;  1JXM A;  1IO6 A;  4MML A;  2KYB A;  1KD1 C;  4QVZ A;  5CVI A;  3WXM B;  5KYW B;  3PNW C;  3MHX A;  2OTJ T;  2FG0 A;  2K6D A;  1HXD A;  4M75 A;  5KYY B;  3E2U A;  1YCS B;  3I35 A;  1IRX A;  1V76 A;  2LT1 A;  5GAO r;  4HCB A;  1QVF P;  2WSE E;  3DLL A;  3OMC A;  2DVJ A;  3M58 A;  3CCV Q;  1TTH B;  4IUT A;  1W2B P;  1AOJ A;  4M75 B;  5IXB A;  2CZ0 B;  4B9X A;  4JJC A;  2RHI A;  1KC8 R;  3BDL A;  1WXB A;  5GAO l;  4E7J A;  3RBB B;  2DYI A;  2HQE A;  1KSW A;  1ZX6 A;  1VQ7 T;  4FM4 B;  2ZGW A;  1JB0 E;  1I5O B;  4FYV B;  2FL7 A;  4AG2 C;  1Z9Z A;  1UGQ B;  2MYS A;  3WVE B;  3CCQ Q;  1MUZ A;  2W0Z A;  3RMQ A;  3CCE T;  3HRT A;  1M1K U;  1IXD A;  3QKJ A;  4M7A C;  2KNB B;  3ZEH A;  1R0C B;  3FRN A;  2JJ9 A;  4C5I A;  1TOV A;  4KH0 B;  3TSZ A;  4Z89 A;  3C0C A;  4PJO F;  2OTJ Q;  2EBP A;  1YI2 T;  4N0A A;  4RTW A;  3JCM J;  2L8D A;  4MZT A;  2NUZ A;  5LJ5 f;  1YCY A;  3QBY A;  4RG2 A;  2DNU A;  3OYI A;  4RTX A;  4F7U E;  3M57 A;  1SG5 A;  4Z88 A;  2DPP B;  2X4J A;  1SHF A;  3TU4 K;  2O88 A;  2XU8 A;  2QQR A;  1GRI A;  1K4U S;  2CH4 W;  1NG2 A;  2KI7 A;  3M5A A;  2A0F B;  1VQ5 A;  1OZ2 A;  2RK2 A;  5GAN d;  1D1C A;  4BY6 B;  2D8J A;  5KYN A;  1BK2 A;  2QQS A;  2M9U A;  1R8O B;  3DLM A;  3FC3 A;  4ANJ A;  5I2M A;  4M78 A;  1Q7Y C;  4EMH A;  5KH6 A;  5I11 A;  3CCE Q;  3GOX A;  4M7D E;  2YLC A;  5GAN g;  1NBE B;  1HSQ A;  4C92 G;  4E7L A;  4C8Q E;  1XQH A;  2K2V A;  1YWP A;  3M54 A;  2PUO B;  5LL6 S;  1WJR A;  3EH1 A;  4HVU A;  1YJW A;  4II1 A;  1H3H A;  3SEM A;  3OYY A;  4M78 B;  2RMO A;  4XTW A;  3CCS Q;  2EGC A;  4KGV B;  2GTO A;  3OYB A;  1Q86 R;  1WHH A;  2I2L A;  3RKW A;  3NTK A;  4DOV A;  2VKN A;  5CKB A;  1ZUK A;  5GAN h;  1UUE A;  1YP5 A;  1CKB A;  4M7A F;  2JM9 A;  4BI4 A;  2K7A A;  3MP1 A;  1NJI C;  2ZPH B;  3CCL A;  2EYX A;  4M75 C;  3OYJ A;  3H0I A;  5GMK h;  2JTE A;  3EHR A;  2JW4 A;  5AT1 B;  4AMC A;  2DTO A;  2RF0 A;  6AT1 B;  4CI0 C;  2DX1 A;  4XAX B;  1VQ8 A;  2KT8 A;  1VQ4 A;  1GCP A;  5GAO q;  3CQT A;  4KT0 E;  4LUE A;  1WHJ A;  1UHC A;  4N4G A;  1OEB A;  4FU6 A;  2X9H A;  3M0R A;  4RTV A;  3LYI A;  2MI6 A;  1E7O A;  2JM8 A;  5GAN 6;  3SWN A;  2VYT A;  3X26 B;  2QGG A;  4F17 A;  2HKN A;  5GAO n;  2DYB A;  1LCK A;  2LCL A;  5D6X A;  3A98 A;  2MIO A;  1RAB B;  1I07 A;  1PWT A;  4EMK B;  4PJO G;  4C0D C;  1QCF A;  1HJD A;  2PUK B;  2ZPB B;  1GFC A;  3SWN B;  3CCM A;  2X35 A;  1BI3 A;  4QKU A;  1SEM A;  2M51 A;  2AKK A;  2DBM A;  3MCA B;  5CAI A;  3O8V A;  5CO7 A;  2L3R A;  3EG9 B;  1X43 A;  2A08 A;  2E12 A;  2HCK A;  2QXF A;  1N27 A;  3KBG A;  1WZO A;  2KEA A;  3P8B B;  2P0K A;  1VQ9 Q;  4JZ3 A;  1KK7 A;  2K79 A;  1KC8 C;  3S6W A;  1O9S A;  2RB6 A;  3CXC S;  3C12 A;  1Q81 R;  3URG A;  3RR6 A;  3U23 A;  1Y07 A;  4BY6 C;  1VQP A;  3FEO A;  3CCU A;  4M77 F;  3DB4 A;  4BD3 A;  1G3Y A;  3GP8 A;  1M8V A;  2QDL A;  4A54 A;  3PIO A;  3CMA A;  4JLI A;  2LX9 A;  2XMF A;  1BBZ A;  3V8L A;  1QVP A;  5GMK e;  5ECA A;  1R77 A;  1BU1 A;  1NM7 A;  2K57 A;  3OA6 A;  4DEY A;  3EFO A;  4PK4 A;  4D8K A;  3CCQ A;  4HVV A;  3O5Z A;  4KBM B;  1YJ9 A;  1M90 U;  2OTL Q;  1WHG A;  2CT4 A;  4OB2 B;  1I4K 1;  2EPD A;  4OB0 B;  4M78 C;  2EGE A;  3EFO B;  2K3Y A;  1UE9 A;  3VS4 A;  1CSK A;  3L2R A;  3RIR A;  2JZ2 A;  2VGN A;  4A53 A;  2COZ A;  2Y90 A;  4MDW A;  3QWY A;  2Y4Y A;  3M56 A;  4C92 A;  2CZ1 B;  1VQK T;  4OB3 B;  1PNJ A;  1U8R A;  2DEU A;  4AFZ C;  4XTV A;  2DM1 A;  4Y92 A;  4QVD A;  1YIJ Q;  2GF7 A;  4A4F A;  2K3X A;  1XNI A;  4C92 B;  2ZCF B;  3CC7 T;  2VC8 A;  4LN2 A;  3QG1 A;  3JCM X;  2NUP B;  1WJQ A;  4YTL A;  1U06 A;  1VQ7 A;  2VB6 A;  1RI0 A;  3CCR T;  2LMJ A;  5LJ3 d;  1M8M A;  2DL3 A;  1SSH A;  1UGP B;  4J83 A;  3FLG A;  5GAM d;  4QT7 A;  1AVZ C;  5HCK A;  3REA B;  3HHT B;  2CS7 A;  4LDX A;  2R5M A;  4FW1 A;  3REB B;  2DER A;  2GCX A;  1QVF A;  1M90 C;  4EMK C;  5LJ3 g;  1JJ2 S;  2CSI A;  1Y96 B;  2QG9 B;  5GAM g;  3CEY A;  1XOV A;  3SWN C;  1Q86 C;  3S3M A;  4J9B A;  1PKS A;  1W2B A;  3JCM Q;  1YI2 A;  4XQ3 A;  2KRS A;  1MMD A;  3QJ6 A;  1D1B A;  1PD0 A;  2L2P A;  3BE3 A;  1IHW A;  5CKF A;  4CC3 A;  4QVC A;  1YHQ T;  1G3T A;  2X4W A;  1PRL C;  4OGE A;  5LJ3 h;  1QCN A;  4X9C A;  5GAM h;  1B3Q A;  2ZPE B;  2VXF A;  4E6R A;  2EW3 A;  4JRP A;  1VQ5 T;  1K8A R;  4X9D A;  1M2O A;  3VYH B;  4J7I A;  2XDD A;  2CDT A;  4DOW A;  3GF5 A;  5GAN 3;  2RHU A;  2C0I A;  3L2U A;  4KUD K;  4M77 G;  1I5L A;  1J3T A;  4PJO B;  2KY9 A;  4OMN A;  4F16 A;  1Y71 A;  2A28 A;  2GBQ A;  2KDS A;  1OI1 A;  4BI3 A;  2ED0 A;  3LX7 A;  2EYW A;  1TWB A;  3ER0 A;  4ZTJ A;  2AZV A;  2F5K A;  2GQV A;  1RI9 A;  2E65 A;  2ROT A;  4OMP A;  4LE9 A;  4BB7 A;  2CP2 A;  3OS2 A;  4ESR A;  2FPE A;  4E7Z A;  3HL8 A;  2DAQ A;  2L3Q A;  2L3S A;  2DO3 A;  3VS7 A;  2CP6 A;  1QP3 A;  2KVQ G;  4LDU A;  4E47 A;  5HK0 A;  1WA7 A;  4F04 B;  4FT4 A;  1QW1 A;  1LJO A;  4ME7 A;  3UAT A;  2AKL A;  1AWW A;  3OS5 A;  4J9D A;  3I9Q A;  4N4H A;  4C0G A;  4J7F A;  4OB1 B;  2DJQ A;  3FIF A;  3BW1 A;  2HD0 A;  1Q81 C;  2YDL A;  1VQ5 Q;  4FYX B;  2YXY A;  2HSE B;  2KYM A;  1VA7 A;  1M1G A;  1YJN A;  1QVG S;  4C92 C;  4XU3 A;  2AT1 B;  2QEX T;  5I21 A;  2CP5 A;  2DIG A;  2W10 A;  2J6F A;  1MHN A;  3RES A;  2RN8 A;  1HD3 A;  5FRO A;  1Y0M A;  5LJ3 e;  3UDC A;  3CBP A;  3CPF A;  8AT1 B;  1EX4 A;  5FRM A;  1JO8 A;  4WTO B;  2K9G A;  1M1K R;  1TG0 A;  2EJF A;  4E7H A;  4A4E A;  3LW5 E;  3H0H A;  1KQS S;  3JB9 D;  3M55 A;  1TU0 B;  4J9I A;  1U1S A;  3EAE A;  2F69 A;  1K9M U;  1MV3 A;  5LJ5 j;  2L0A A;  5IHN A;  1S72 T;  2JN0 A;  1G2B A;  5A0L A;  1WQW A;  1M27 C;  5GAN 5;  2DXB A;  1RL2 A;  3M4G A;  1G83 A;  1HK9 A;  3ZL7 C;  1K8A U;  4DBH A;  3G6E A;  4LUD A;  2A3L A;  2KBT A;  1JXO A;  1OZ3 A;  2QI2 A;  2NUT A;  4NOY A;  1FMV A;  3OYN A;  3EFS A;  3CCU T;  1BIA A;  2QEX Q;  2DTI A;  2P0Q A;  2RK1 A;  3CMA T;  3CC2 T;  1TH7 A;  3EGX A;  3V7R A;  4PJO C;  1ZSZ C;  4M7D A;  2EQJ A;  1HYO A;  4E7I A;  4IIO A;  2RNA A;  2DET A;  4IUV A;  4C8Q A;  5FWB A;  2NUT B;  3FJ5 A;  2LX7 A;  4PNO A;  2XIC A;  3J80 E;  4PJO D;  3OQ5 A;  4KUL A;  1GCQ A;  3SHW A;  2BKD N;  1QP2 A;  5GAN 7;  4C92 F;  2JTF A;  2ED1 A;  1UGV A;  4KGZ B;  4MZP A;  3EGX B;  1H3Z A;  2JT4 A;  3CCM Q;  4M7D B;  1YBY A;  1B07 A;  4E7S A;  3OS1 A;  1EIF A;  4M77 A;  2COW A;  2LJ1 A;  5FU6 B;  3PT9 A;  1UJY A;  5DY9 A;  3I56 A;  2DBK A;  3KUF A;  1AD5 A;  2JVV A;  1AZG B;  2KR3 A;  2KSS A;  1S72 Q;  4HT8 A;  1QKX A;  2QQ9 A;  5GJW B;  4MZM A;  5D7U A;  2DXC A;  5A2Q E;  2D9T A;  3VS0 A;  3M0Q A;  1I0C A;  2MWO A;  3X28 B;  4M77 B;  1OPL A;  4JRK A;  2HEQ A;  1JQQ A;  4HA8 A;  3UWN A;  4RTU A;  2CP0 A;  5L23 A;  1RAC B;  1VQK A;  2E4H A;  1RAA B;  2F2V A;  1OX8 A;  1K8A C;  1JU5 C;  1VQP Q;  5CKE A;  3CCU Q;  2YWW A;  2X51 A;  1SPK A;  1I81 A;  2LQ8 A;  3ASK A;  4XTX A;  3CMA Q;  1OOT A;  2CRE A;  2R5A A;  2XK0 A;  2HKQ B;  3CC7 A;  3KFV A;  3H6Z A;  1FWZ A;  2BZY A;  2PZ1 A;  2QAZ A;  5IHI A;  2WSF E;  1YJ9 Q;  1TXQ A;  4XU0 A;  1ZQ1 A;  5GMK m;  3CCR A;  2BIV A;  1TUC A;  1UGS B;  1AWJ A;  3V8J A;  1D0Z A;  2EFI A;  3L1A A;  2V26 A;  4QQG A;  1SRM A;  1RAG B;  2CT3 A;  1ZUY A;  3CPW S;  4V2S A;  2C06 A;  3VU3 C;  1M3C A;  1X2Q A;  2DRM A;  4M7A D;  3EG0 A;  1UHF A;  3QYH B;  2PVG B;  4M7A E;  2E6N A;  2DXU A;  1OU8 A;  2HBP A;  1H8K A;  2VAS A;  4L6V 5;  2P84 A;  5CCA A;  3EHQ A;  4ELY C;  4RCC A;  2DLP A;  2A7Y A;  3A8G B;  3UA7 A;  1UB4 A;  1ARK A;  1X6B A;  4D8D A;  4J9E A;  3OYF A;  3LH5 A;  3NGP A;  1YHQ A;  2RI2 A;  4IUP A;  4AFU C;  3QDR B;  4C5H A;  2HBW A;  4MMK A;  2V1R A;  1JBM A;  4LDY A;  2HDA A;  5CQY A;  3QZ5 B;  4PL6 A;  1RAE B;  1VQ7 Q;  2GFA A;  2CYZ B;  2GGR A;  2MK5 A;  3VKI A;  1KG1 A;  2GTJ A;  4GBQ A;  2PTK A;  1JRI A;  2KRN A;  5CR2 A;  1OX9 A;  3JAM E;  4ZGE B;  4XTU A;  2RJF A;  2XHC A;  1WHM A;  1WXU A;  5C6S A;  3CME A;  1K73 R;  1M1K C;  2CH4 A;  2M0Y A;  4XTY A;  1UEB A;  3HRS A;  1YI2 Q;  1M90 R;  5FU6 C;  1X6O A;  3I55 A;  2YRV A;  2ZPF B;  3M0U A;  3P8D A;  4PJL A;  2RHZ A;  2L89 A;  2XG8 D;  2M0O A;  3OYK A;  2YRD A;  2E3I A;  1M2V A;  1D1A A;  4M77 C;  2FRW A;  2LQN A;  2IVW A;  1BI0 A;  2C0T A;  1E6H A;  3NPF A;  1QLY A;  4WF2 A;  1YJN T;  1KQ1 A;  2O4X A;  3OB9 A;  5J3B A;  2YUN A;  4M75 D;  1SF9 A;  1O75 A;  1YN8 A;  3M0P A;  1ZUU A;  1M2V B;  1PHT A;  4M75 E;  4DEX A;  4FYY B;  4C0Z A;  1WYX A;  3KXT A;  4X34 A;  2QEX A;  2LCS A;  4PJJ A;  2HZY A;  3L2V A;  1WIE A;  2O4X B;  4F7U F;  3SB2 A;  2DIQ A;  1AEY A;  1VQO T;  2QDY B;  3I5R A;  3CD6 T;  1XTD A;  1WHK A;  1A0N B;  4D6W A;  5CK9 A;  1AWX A;  1F1B B;  4R0K A;  2V8I A;  3HRU A;  1FMW A;  3OYH A;  2DRK A;  3RMS A;  2NYS A;  3A1P A;  3THK A;  1K9A A;  4M7D F;  3E19 A;  2ATC B;  4QQD A;  3G6E T;  1S72 A;  2DEQ A;  4N0A C;  4JZ4 A;  3LH0 A;  2DVE A;  4C8Q F;  1YJN Q;  2MPX C;  3OYL A;  3MP8 A;  3OW2 S;  3L2Z A;  2VUB A;  4PJM A;  5KYX A;  5GAN e;  2G3R A;  2EAY A;  1VQL T;  1W1F A;  1AWO A;  2E6Z A;  3CC2 A;  1IB8 A;  1LNX A;  1M3B A;  2HAX A;  3ULR B;  3VUZ A;  5IH2 A;  3INZ A;  4FW2 A;  2JMA A;  2AIR B;  2RQW A;  1K73 U;  3HTR A;  2EIF A;  3JV3 A;  4ZNX A;  1W4S A;  2F5T X;  3PFS A;  1VQ6 A;  3OYD A;  3VRY A;  3I56 T;  4VUB A;  2FEI A;  2XID A;  1X2K A;  4M78 D;  4IUR A;  5LJ3 f;  2BE9 B;  2ABL A;  4IKF A;  4M78 E;  2AK5 A;  4O5V A;  5GMK i;  3HKS A;  2DD5 A;  3G6E Q;  2KGT A;  5FWC A;  3RNJ A;  5J26 A;  5I22 A;  2OAU A;  2EQK A;  3NTI A;  3JCM d;  1K76 A;  1Z9Q A;  3PMT A;  2YSQ A;  4DBR A;  3CPW P;  2RJE A;  5GAN 8;  1VQL Q;  4XTZ A;  4ZTF A;  3JB9 I;  4A63 B;  1KIK A;  3JCM g;  3R6O A;  1WI7 A;  3HP9 A;  4F7U G;  2L3P A;  4GLM A;  2KAF A;  3CBO A;  1I8F A;  4BE0 A;  3LLR A;  1E6G A;  2HQH A;  1C0M A;  3G1J A;  1BKB A;  1K0X A;  1K73 C;  2FVU A;  1VUB A;  3QO3 A;  4PFP A;  5HKC A;  1MMG A;  3M0S A;  1QVF S;  2J05 A;  3G7Z A;  3I56 Q;  3M59 A;  5GAO p;  3JCM h;  1T0J A;  3M9Q A;  3VYG A;  2F2X A;  1AZE A;  3M4Y A;  4RG8 A;  2DL8 A;  3QII A;  4KH1 B;  4BAC A;  1VQK Q;  4M7D G;  2P4T A;  3QSU A;  1K9M R;  1UG1 A;  5DLO A;  2P4R A;  2E10 A;  5I2S A;  4ZGJ B;  1M3A A;  1S1N A;  4C8Q G;  1UFF A;  2GQI A;  2LQW A;  4OP0 A;  2RQU A;  3AT1 B;  5A0D A;  1VQN A;  1TS9 A;  2DL5 A;  1IGQ A;  3QWX X;  3CC7 Q;  3EH2 A;  3SDZ A;  2MMP A;  3GNF B;  3H0F A;  5KE2 A;  1T3L A;  1N5Z A;  1PCX A;  3FDR A;  3TEE A;  3CCR Q;  5EC7 A;  4HCC A;  1M4Z A;  3VS5 A;  2HL5 C;  5DM7 R;  1OQK A;  5FU7 B;  3CME T;  1X75 C;  5CIU A;  3PE0 A;  4PLI A;  3JB9 H;  3L2Q A;  3I55 T;  1H92 A;  2NLU A;  3OYE A;  5FRN A;  2K3B A;  3UPU A;  2SRC A;  2L5Q A;  3OS0 A;  1YNZ A;  2J7I A;  4JS4 A;  2BE7 D;  4B9W A;  1NEB A;  3A8O B;  1C6V X;  1X69 A;  1YHQ Q;  4MDX A;  1ZA2 B;  2V8J A;  2CGH A;  3JCM e;  2SEM A;  1U5S A;  2R58 A;  2VVK A;  4BE1 A;  2E5K A;  1B7T A;  2DFU A;  4RMO A;  2KK4 A;  3PVL A;  1VQM T;  1ZSG A;  4J9F A;  1UDL A;  2RO0 A;  4C5G A;  3VJP A;  4JLG A;  2F2W A;  3RUX A;  4C92 D;  3V7C A;  2XDP A;  3C94 A;  3S3N A;  1ZBJ A;  4C92 E;  4TVR A;  5GAM e;  3M0T A;  4R55 A;  3T9N A;  3CME Q;  1QVG A;  2CKK A;  2R57 A;  4JJN K;  1VQO A;  3A8H B;  3I55 Q;  1IRE B;  1X01 A;  3CD6 A;  2FPF A;  3CXC P;  3OW2 P;  1KHC A;  5GAN j;  2MAM A;  2FZG B;  1X6G A;  4OMO A;  5HY6 A;  3NFC A;  4F7U A;  3GIB A;  4OML A;  4PFO A;  3JCM b;  3M53 A;  3EFR A;  3EG3 A;  1M9S A;  5GMK j;  4LXC A;  1KD1 U;  5CKH A;  3EGD A;  3UF4 A;  2D6F A;  5GAO m;  4JJD A;  1PRM C;  2DL7 A;  4F7U B;  3G4S A;  2VGM A;  4DBF A;  3RKX A;  1IGU A;  1VQM Q;  1JEG A;  1Q82 U;  1GBR A;  4J9C A;  2EQI A;  2PVD B;  1YFN A;  3EGD B;  4UC4 A;  5KE3 A;  3S3O A;  3BY7 A;  1OYX A;  3MEU A;  2KRO A;  1VQL A;  3TCJ A;  5KCH A;  2HSP A;  4AFS C;  2FYK A;  1PG5 B;  1R0B G;  2X4X A;  5FU7 C;  5CKD A;  3OYM A;  4PJO E;  4F14 A;  1YIT T;  1LVK A;  3J7A F;  1VQ6 T;  1D3B A;  4A4H A;  1QKW A;  2DK3 A;  3LGF A;  4HVW A;  2K2M A;  2PU9 B;  3A8L B;  5IHK A;  4JJB A;  4C8Q B;  1V29 B;  2K5F A;  1M30 A;  3MEA A;  1NZ9 A;  1G3W A;  4BUG A;  3JCM W;  2JS2 A;  3I5S A;  4HCK A;  4HXJ A;  5IN1 A;  1D3B B;  3OMG A;  2HQX A;  5EG2 A;  1K9M C;  2X4Y A;  2YUO A;  2DXT A;  1X27 A;  2B8A A;  1PD1 A;  2IPO B;  2DZ9 A;  2E5Q A;  4BDZ A;  3RDV A;  2DTH A;  2FRY A;  5KYU A;  4P5N A;  1C1A A;  1QMC A;  2QA4 A;  4DBQ A;  1D0Y A;  2PVO B;  3AHU A;  4L5G A;  2HNI A;  3WVD B;  1WQ7 A;  1JJ2 P;  4FSX A;  4M4Z A;  1UEC A;  3CC2 Q;  2E1H A;  1Q82 C;  5AYF A;  1TSF A;  1YWO A;  3EG1 A;  3JB9 F;  2LC4 A;  1PC0 A;  5KYU B;  4PFZ A;  4LDV A;  1NE8 A;  3CC4 T;  4J5Y A;  1GL5 A;  4CC7 A;  2AHJ B;  1YIT Q;  1VQ6 Q;  4X1V A;  2E41 A;  2BUD A;  2KXC A;  3QZ9 B;  2YUQ A;  2QGF B;  1RAH B;  2CZ6 B;  1W6X A;  1N8R R;  2JUF A;  4FT2 A;  5GAN f;  4IUU A;  1Q7Y U;  3J81 E;  1OV3 A;  2MF2 A;  2RM4 A;  3MEW A;  2DF6 A;  5D6Y A;  4GY5 A;  2WAC A;  4RTT A;  4ELZ C;  2V8K A;  2RI3 A;  3GNG A;  4ZN3 A;  5GAN 2;  3CPW A;  2MCN A;  2LDM A;  4RCB A;  4C0D B;  3CCJ T;  2LNH B;  1VQN T;  4XU1 A;  2V1Q A;  4LNP A;  1G5V A;  3CCS T;  3PIP A;  3E1S A;  3NTH A;  4RUG A;  4BI8 B;  2RH2 A;  1LPL A;  3F70 A;  1KJW A;  2YRC A;  3OYA A;  1Y7X A;  1NJI U;  2LNV A;  2CSQ A;  1I1J A;  2GFU A;  2D1X A;  3IQL A;  3H41 A;  1QWF A;  2BZX A;  2JMC A;  3G71 T;  3CC4 Q;  2DZC A;  2O31 A;  4ATO A;  3A5Z B;  2FPD A;  2XDB A;  2D8H A;  3OYC A;  2WSC E;  1ACM B;  3TVT A;  4M7D C;  2ZZD A;  1BCM A;  1FXX A;  1T0H A;  3E9G A;  1N9R A;  4C8Q C;  4N4I A;  1QVG P;  1D0X A;  4M7D D;  5LJ5 d;  4R56 A;  1KHI A;  1GCQ C;  3MP6 A;  1GFD A;  2RHY A;  3OY9 A;  4C8Q D;  4C0F A;  3MO8 A;  2O9V A;  5LJ3 j;  2KQW A;  5GAM j;  3NMZ C;  5GMK l;  1NLO C;  2QQB A;  4OMF B;  3CCJ Q;  5LJ5 g;  4FCY A;  1VQN Q;  1EZZ B;  4RTZ A;  2KMT A;  4J6X A;  2DIL A;  4K11 A;  4M77 D;  5GAN 4;  2QTX A;  1BI1 A;  3VS2 A;  4M77 E;  4EDU A;  1MMA A;  2DL4 A;  2H3E B;  4QQ6 A;  2KXD A;  3JCM c;  2A36 A;  1UJ0 A;  3QXE B;  1VQM A;  1MV0 B;  2EWN A;  1ZLM A;  2RA2 A;  3L2W A;  1RAF B;  1KQS P;  2BTT A;  1KC8 U;  1AHJ B;  3G71 Q;  3JB9 G;  1BCO A;  4C5E A;  5LJ5 h;  1VQ9 T;  1VYT A;  2EGA A;  2GNC A;  5FLX E;  1BIB A;  2XKO C;  3GLX A;  3QUI A;  2OJ2 A;  2K5L A;  1M1F A;  4E2F B;  1WPY A;  3OBY A;  3H9N A;  1N8R U;  2LQK A;  4RKU E;  2EKH A;  2F1L A;  2FO0 A;  2EQU A;  1G8X A;  1UTI A;  1WGS A;  2ZPI B;  4EMK A;  2RHX A;  2O9S A;  2LCC A;  1TUD A;  2DMO A;  1NPR A;  1Q95 G;  1CKA A;  3HPW A;  4DA4 A;  2EQM A;  2ZAE A;  1VOM A;  1M5Q 1;  3MPU B;  2QTV A;  1WHL A;  3QJY A;  3PMI A;  3EG9 A;  2OTL T;  2M1H A;  4Q5W A;  3X24 B;  3G4S T;  2X3W D;  2RPN A;  4HKE A;  2IG0 A;  2LJ3 A;  1PSE A;  3Q1J A;  3QDF A;  2P0P A;  2X3X D;  2D0Q B;  4LDW A;  3HFN A;  1OU9 A;  2RJC A;  2JS0 A;  2JOY A;  2QQA A;  3JSC A;  3GBQ A;  2QK0 A;  1BB9 A;  1Y57 A;  3VS1 A;  3CXC A;  3LWH A;  4HT9 A;  3OW2 A;  2LZ6 B;  2YHT A;  1VQO Q;  3CCV A;  3MET A;  3JCM f;  5KYX B;  2CP7 A;  3JCM P;  3CD6 Q;  7AT1 B;  1YIJ T;  2YT6 A;  1RAD B;  4O6J A;  9ATC B;  1ABQ A;  4J9G A;  3CBM A;  1MNE A;  2RD1 A;  3X20 B;  2H8H A;  5J39 A;  1N8R C;  1YIT A;  2J6K A;  1ABO A;  4JRQ A;  1GXI E;  4L59 A;  3QPH A;  4NS5 A;  4M75 F;  4EMG A;  1FYN A;  4AT1 B;  2I0N A;  5LJ5 e;  3OSV A;  1WNL A;  2AZS A;  4EIK A;  1SRL A;  2EVR A;  2M16 A;  1U3O A;  5GAM f;  5IAY A;  2A37 A;  1P92 A;  1OUL A;  3G4S Q;  4AG1 C;  4FL6 A;  3LWI A;  1SKU B;  2K5I A;  4Y28 E;  3RER A;  3OSS C;  1U1T A;  1Q86 U;  1V1C A;  1PSF A;  1N9S A;  2QA4 T;  1WXT A;  4HCZ A;  1TUG B;  3MKD A;  2OI3 A;  4NL3 A;  4XK8 E;  2OTJ A;  2JNG A;  2JXB A;  4J6W A;  4KGX B;  3EG2 A;  1MGQ A;  1GBQ A;  4M7A G;  3NHN A;  4OGC A;  1NEG A;  4JS5 A;  2KE9 A;  3L42 A;  1MND A;  3UT1 A;  1KQ2 A;  2NUP A;  5KCO A;  3R6N A;  3C95 A;  3JCM V;  4FIB A;  2KT1 A;  2J06 A;  2ZPG B;  1H64 1;  2IIM A;  2J6O A;  2QAS A;  2O01 E;  5IT9 E;  4OF1 A;  3CC4 A;  3H8Z A;  2CZ7 B;  2CUB A;  1QQJ A;  3VRZ A;  1UGR B;  1Y96 A;  3VS6 A;  2ENM A;  1VYV A;  3VUB A;  1EFN A;  1W2B S;  3UA6 A;  1RLQ C;  1QCO A;  2RJD A;  3CCE A;  3P8H A;  4BE2 A;  5M9O A;  4BDY A;  1JJ2 A;  3VS3 A;  2QA4 Q;  4E7K A;  4WCI A;  4A4K A;  1T3S A;  1NYF A;  1KD1 R;  2RQR A;  4OMQ A;  1KFZ A;  3CCJ A;  5HK3 A;  2E70 A;  1ZHI A;  3CCS A;  3E9F A;  1RLP C;  4PKC C;  3GPL A;  2RI5 A;  4GLK A;  2FB7 A;  2VXE A;  3PTA A;  3ZBD A;  1Q82 R;  2EKO A;  4M78 F;  2E3H A;  4PJO A;  1ZSZ A;  1D09 B;  4ZN1 A;  1Q81 U;  2HL3 A;  4ZGD B;  1IZ6 A;  3G71 A;  1QWE A;  2XD0 A;  2DE0 X;  5FW9 A;  2VV5 A;  1WDX A;  4LD9 K;  4JRI A;  3TSW A;  3SFM A;  2NWM A;  3V7S A;  3JB9 J;  3ME9 A;  2PQW A;  1VYU A;  1BI2 A;  2COY A;  1B34 A;  2Y4X A;  3A8M B;  2BZ8 A;  1ZSZ B;  4B6M A;  2B86 A;  4M75 G;  1AT1 B;  2CP3 A;  1K1Z A;  3OBW A;  2VWF A;  3V8K A;  4J8O A;  2DD4 A;  2EYY A;  3D7S B;  3HFO A;  3HSB A;  3FJP A;  1YJW T;  1DJ7 B;  1B34 B;  1BYM A;  4CC2 A;  4KUI A;  4FYW B;  3TQ7 P;  2LP5 A;  4J6Y A;  3MEV A;  3EGU A;  2EJG A;  1NPP A;  1WFW A;  2MWP A;  2JTM A;  3OYG A;  2XI9 A;  4IIM A;  2ESW A;  3MJX A;  2M02 A;  2PNI A;  4A4G A;  4RTY A;  2C0O A;  3CCL T;  2LTO A;  3LGL A;  1FX7 A;  2QYZ A;  2MOX A;  4CC4 B;  3QYG B;  1W70 A;  4Z8A A;  3BFM A;  1VQ8 T;  1VQ4 T;  4LD6 A;  8ATC B;  1VQ9 A;  5D6W A;  5A0G A;  3JRZ A;  1XJW B;  1K0S A;  1N6A A;  1RAI B;  3X25 B;  4M7A A;  1MMN A;  2ECZ A;  2O2O A;  2HMA A;  3BDU A;  4OVA A;  4XU2 A;  2RQV A;  5C0M A;  4ORZ A;  1Q7Y R;  3N5B B;  2DJZ A;  3PGG A;  1YJW Q;  2LJ0 A;  2FZC B;  2EYZ A;  4EPC A;  4DQ2 A;  3PVQ A;  5L8R E;  4M7A B; 
#chains in the Genus database with same CATH homology
 2LRQ A;  2V8K A;  2DKG A;  3FB9 A;  2K4Y A;  5GAM g;  3OYH A;  3CEY A;  1XOV A;  2RI3 A;  4JDS A;  5DLQ E;  3RKY A;  3SWN C;  3DKM A;  3GNG A;  4ZN3 A;  5GAN 2;  3CCM T;  3S3M A;  3CPW A;  3RMS A;  1W2B A;  2EJ9 A;  2LDM A;  4PLL A;  3VV0 A;  4RCB A;  2OTL A;  3JCM Q;  2YLB A;  1YI2 A;  4XQ3 A;  1KQS A;  4C0D B;  3QJ6 A;  3ZFJ A;  1WJS A;  3CCJ T;  1VQN T;  4M7D F;  1G3S A;  3E19 A;  4XU1 A;  4QQD A;  3G6E T;  1G5V A;  1S72 A;  2DEQ A;  4N0A C;  3CCS T;  5CKF A;  3PIP A;  1LOJ A;  3LH0 A;  3E1S A;  3NTH A;  2DVE A;  4CRI A;  4QVC A;  4C8Q F;  1YHQ T;  4BI8 B;  2LVM A;  1G3T A;  1GXI E;  1VIE A;  2H3J A;  2X4W A;  2RH2 A;  3MP8 A;  4Z02 A;  3OYL A;  3OW2 S;  4OGE A;  3F70 A;  5LJ3 h;  2E64 A;  3OYA A;  1Y7X A;  3L2Z A;  2LT4 A;  4NL2 A;  1NJI U;  2FHD A;  2LNV A;  4X9C A;  3TRE A;  5GAM h;  2VUB A;  2ZPE B;  4M78 G;  2VXF A;  3CCV T;  5GAN e;  2GFU A;  2G3R A;  4JUV A;  3C4S A;  4JRP A;  2EAY A;  4X9D A;  1VQ5 T;  1VQL T;  3DB3 A;  3VYH B;  4J7I A;  2XDD A;  3G71 T;  4DOW A;  2DZC A;  3GF5 A;  5GAN 3;  2E6Z A;  1VQP T;  2RHU A;  4IUQ A;  3OYM A;  4ATO A;  3L2U A;  4KUD K;  3A5Z B;  4M77 G;  3CC2 A;  2XDB A;  1I5L A;  1LNX A;  2HAX A;  4PJO B;  2KY9 A;  3VUZ A;  1Y71 A;  3OYC A;  1VIF A;  3QHS A;  3INZ A;  1YIJ A;  2EYQ A;  2KDS A;  2WSC E;  1K73 U;  1OI1 A;  4BI3 A;  1SSF A;  2EIF A;  4Y91 A;  1W4S A;  2F5T X;  3LX7 A;  3PFS A;  4M7D C;  2ZZD A;  1FXX A;  5CQX A;  3E9G A;  3CCQ T;  3ER0 A;  4ZTJ A;  2F5K A;  1N9R A;  2GQV A;  4C8Q C;  3JB9 J;  4N4I A;  1YJ9 T;  1VQ6 A;  2E65 A;  3OYD A;  4BB7 A;  4M7D D;  5LJ5 d;  4R56 A;  4QW2 A;  1KHI A;  3OS2 A;  1ZBX A;  3MP6 A;  3I56 T;  2RHY A;  3SD4 A;  4VUB A;  3OY9 A;  4C8Q D;  4C0F A;  3MO8 A;  3HL8 A;  2DAQ A;  5LJ3 j;  4MML A;  2XID A;  2KQW A;  2DO3 A;  1KD1 C;  4QVZ A;  5CVI A;  4M78 D;  4IUR A;  5LJ3 f;  3WXM B;  5GAM j;  1QP3 A;  3PNW C;  2KVQ G;  3MHX A;  4IKF A;  2OTJ T;  4M78 E;  4LDU A;  4O5V A;  4E47 A;  5HK0 A;  5GMK l;  3JAM E;  5GMK i;  1HXD A;  2QQB A;  4M75 A;  4OMF B;  5LJ5 g;  3HKS A;  2DD5 A;  4FT4 A;  2KMT A;  1QW1 A;  1LJO A;  4J6X A;  4ME7 A;  4M77 D;  5J26 A;  2LT1 A;  5GAN 4;  5GAO r;  4HCB A;  2OAU A;  2QTX A;  1BI1 A;  2EQK A;  3OS5 A;  4M77 E;  3NTI A;  4EDU A;  3JCM d;  2WSE E;  3DLL A;  3OMC A;  3PMT A;  4QQ6 A;  4N4H A;  3M58 A;  3JCM c;  4C0G A;  4J7F A;  4OB1 B;  3QXE B;  1VQM A;  4IUT A;  2EWN A;  3FIF A;  3BW1 A;  2HD0 A;  4M75 B;  1Q81 C;  2RJE A;  2RA2 A;  3L2W A;  2CZ0 B;  5GAN 8;  4B9X A;  4XTZ A;  1KC8 U;  2RHI A;  1AHJ B;  1M1G A;  3JB9 I;  3JB9 G;  4ZTF A;  1YJN A;  1QVG S;  4C92 C;  3BDL A;  4XU3 A;  4C5E A;  5LJ5 h;  1VQ9 T;  2QEX T;  5GAO l;  3JCM g;  5FLX E;  3R6O A;  5I21 A;  4E7J A;  2DIG A;  1BIB A;  3HP9 A;  1MHN A;  2HQE A;  3RES A;  2XKO C;  3GLX A;  3QUI A;  1VQ7 T;  2K5L A;  1M1F A;  4FM4 B;  4F7U G;  1WPY A;  3OBY A;  2ZGW A;  2KAF A;  3CBO A;  5FRO A;  1JB0 E;  1I8F A;  5LJ3 e;  3UDC A;  2FL7 A;  3LLR A;  2LQK A;  4RKU E;  4BE0 A;  1N8R U;  1BKB A;  1UGQ B;  1K73 C;  2FVU A;  1VUB A;  2EQU A;  3CBP A;  3CPF A;  3QO3 A;  3WVE B;  5HKC A;  1WGS A;  2ZPI B;  5FRM A;  4EMK A;  2RHX A;  2LCC A;  3RMQ A;  1QVF S;  3CCE T;  3G7Z A;  1NPR A;  3HRT A;  3M59 A;  5GAO p;  3JCM h;  1M1K U;  3QKJ A;  4M7A C;  3HPW A;  3ZEH A;  2EQM A;  4DA4 A;  1M5Q 1;  3FRN A;  3M9Q A;  4C5I A;  2EJF A;  3VYG A;  4PJO F;  4E7H A;  3M4Y A;  4RG8 A;  4A4E A;  3LW5 E;  3QJY A;  3PMI A;  1KQS S;  2OTL T;  1YI2 T;  2M1H A;  4N0A A;  4Q5W A;  3X24 B;  3JB9 D;  3M55 A;  3QII A;  3G4S T;  1U1S A;  3EAE A;  4BAC A;  2F69 A;  1K9M U;  3JCM J;  4HKE A;  2IG0 A;  2L8D A;  2P4T A;  4MZT A;  5LJ5 j;  3QSU A;  5DLO A;  1S72 T;  4M7D G;  2JN0 A;  5A0L A;  2E10 A;  5LJ5 f;  1YCY A;  3QBY A;  1WQW A;  5I2S A;  4RG2 A;  1PSE A;  3Q1J A;  4ZGJ B;  5GAN 5;  2P0P A;  4C8Q G;  2DXB A;  1JJ2 A;  1RL2 A;  3M4G A;  3OYI A;  4OP0 A;  4F7U E;  3M57 A;  2D0Q B;  5A0D A;  1HK9 A;  1VQN A;  4LDW A;  1K8A U;  3HFN A;  2DPP B;  2RJC A;  3G6E A;  2X4J A;  2JOY A;  2A3L A;  3TU4 K;  2QQA A;  1OZ3 A;  2QI2 A;  3JSC A;  3SDZ A;  2XU8 A;  2MMP A;  4NOY A;  3GNF B;  3OYN A;  2QQR A;  3EFS A;  3CCU T;  1BIA A;  5KE2 A;  3CXC A;  2DTI A;  3LWH A;  3OW2 A;  4HT9 A;  2YHT A;  2P0Q A;  2RK1 A;  3FDR A;  3CMA T;  3TEE A;  3CCV A;  1TH7 A;  3MET A;  3CC2 T;  3V7R A;  3M5A A;  4PJO C;  3JCM f;  1VQ5 A;  1OZ2 A;  2RK2 A;  5GAN d;  3JCM P;  2EQJ A;  1YIJ T;  4HCC A;  4BY6 B;  4E7I A;  4M7D A;  4O6J A;  2QQS A;  1M4Z A;  3CBM A;  5DM7 R;  2RD1 A;  4IUV A;  2M9U A;  5FU7 B;  3X20 B;  4C8Q A;  5J39 A;  3CME T;  1N8R C;  1R8O B;  4PNO A;  1X75 C;  3DLM A;  2XIC A;  5CIU A;  3J80 E;  3FC3 A;  1YIT A;  3OQ5 A;  4PLI A;  3JB9 H;  5I2M A;  4M78 A;  4KUL A;  1Q7Y C;  4EMH A;  4JRQ A;  4MDX A;  4L59 A;  3QPH A;  5KH6 A;  4NS5 A;  3L2Q A;  4M75 F;  4EMG A;  2BKD N;  1QP2 A;  5GAN 7;  4C92 F;  2JTF A;  5LJ5 e;  3I55 T;  3GOX A;  2NLU A;  4MZP A;  3OSV A;  4M7D E;  1WNL A;  2YLC A;  5GAN g;  3OYE A;  5FRN A;  1H3Z A;  3UPU A;  4M7D B;  1YBY A;  4C92 G;  4E7L A;  2L5Q A;  4C8Q E;  1XQH A;  2K2V A;  3OS0 A;  3OS1 A;  1EIF A;  4M77 A;  3M54 A;  2PUO B;  5LL6 S;  2M16 A;  1WJR A;  5GAM f;  5FU6 B;  1YJW A;  4II1 A;  3PT9 A;  5DY9 A;  4B9W A;  5IAY A;  4JS4 A;  1P92 A;  3OYY A;  4M78 B;  4FL6 A;  4XTW A;  3I56 A;  3LWI A;  3KUF A;  3A8O B;  2K5I A;  4Y28 E;  3RER A;  3OSS C;  1U1T A;  3OYB A;  1Q86 U;  1PSF A;  1N9S A;  2JVV A;  2QA4 T;  2KSS A;  2I2L A;  4HT8 A;  2QQ9 A;  3NTK A;  4MZM A;  3RKW A;  2DXC A;  2V8J A;  2D9T A;  4HCZ A;  4DOV A;  5A2Q E;  2CGH A;  5CKB A;  2MWO A;  4NL3 A;  3X28 B;  4XK8 E;  2OTJ A;  3JCM e;  4M77 B;  2JNG A;  4JRK A;  5GAN h;  4J6W A;  2R58 A;  4M7A F;  4BE1 A;  4HA8 A;  3UWN A;  4BI4 A;  1MGQ A;  3MP1 A;  4RMO A;  1NJI C;  1VQK A;  2KK4 A;  4M7A G;  2ZPH B;  3CCL A;  1VQM T;  4OGC A;  4M75 C;  4JS5 A;  1K8A C;  3OYJ A;  3L42 A;  3UT1 A;  2RO0 A;  4C5G A;  5KCO A;  3VJP A;  4JLG A;  3C95 A;  5CKE A;  5GMK h;  1Q86 C;  1KQ2 A;  3JCM V;  1I81 A;  2DTO A;  4FIB A;  2LQ8 A;  2ZPG B;  3ASK A;  1H64 1;  4XTX A;  2R5A A;  4CI0 C;  3RUX A;  4C92 D;  2XK0 A;  4XAX B;  3V7C A;  1VQ8 A;  2XDP A;  3C94 A;  1VQ4 A;  3S3N A;  5GAO q;  4C92 E;  3CC7 A;  5IT9 E;  2O01 E;  4TVR A;  4KT0 E;  4OF1 A;  3CC4 A;  3H8Z A;  5GAM e;  3H6Z A;  4R55 A;  4N4G A;  2CZ7 B;  3T9N A;  4PJO E;  1FWZ A;  1QVG A;  2CKK A;  4FU6 A;  2WSF E;  2R57 A;  3LYI A;  4JJN K;  2MI6 A;  4XU0 A;  1ZQ1 A;  1VQO A;  3A8H B;  5GMK m;  3CCR A;  2BIV A;  1UGR B;  1IRE B;  1UGS B;  2VYT A;  1X01 A;  3SWN A;  3V8J A;  3X26 B;  5GAN 6;  3CD6 A;  1Y96 A;  2EFI A;  3L1A A;  1KHC A;  4QQG A;  5GAO n;  5GAN j;  3CPW S;  2MAM A;  3VUB A;  4V2S A;  2C06 A;  1W2B S;  2LCL A;  3VU3 C;  5D6X A;  5HY6 A;  3NFC A;  4M7A D;  2RJD A;  3QYH B;  4F7U A;  3GIB A;  2PVG B;  4EMK B;  4PJO G;  4C0D C;  3CCE A;  4M7A E;  3P8H A;  2E6N A;  3JCM b;  2DXU A;  2PUK B;  3M53 A;  4BE2 A;  2HBP A;  3EFR A;  5M9O A;  2ZPB B;  4L6V 5;  5CCA A;  1M9S A;  3SWN B;  5GMK j;  4BDY A;  4ELY C;  2X35 A;  3CCM A;  4RCC A;  4A4K A;  4E7K A;  1KD1 U;  1BI3 A;  2A7Y A;  3A8G B;  5CKH A;  1UB4 A;  2D6F A;  5GAO m;  3MCA B;  3CCJ A;  5CAI A;  5HK3 A;  2E70 A;  1ZHI A;  3O8V A;  2L3R A;  5CO7 A;  3OYF A;  4F7U B;  3G4S A;  2E12 A;  2QXF A;  3CCS A;  2VGM A;  1N27 A;  3E9F A;  3RKX A;  1YHQ A;  3KBG A;  4PKC C;  2RI2 A;  4IUP A;  3QDR B;  2RI5 A;  3GPL A;  4GLK A;  3P8B B;  2P0K A;  4C5H A;  4MMK A;  2FB7 A;  2VXE A;  1JBM A;  3PTA A;  1KC8 C;  3S6W A;  4LDY A;  1Q82 U;  1O9S A;  2RB6 A;  3ZBD A;  3CXC S;  2EKO A;  5CQY A;  2PVD B;  3QZ5 B;  4M78 F;  4PL6 A;  4PJO A;  4UC4 A;  2GFA A;  5KE3 A;  3S3O A;  2CYZ B;  3BY7 A;  4ZN1 A;  1Q81 U;  1OYX A;  3C12 A;  3MEU A;  4ZGD B;  1IZ6 A;  1VQL A;  3VKI A;  3URG A;  1KG1 A;  3G71 A;  3TCJ A;  2XD0 A;  5KCH A;  1Y07 A;  4BY6 C;  2VV5 A;  1VQP A;  3FEO A;  3CCU A;  4M77 F;  3DB4 A;  4BD3 A;  2FYK A;  1JRI A;  4LD9 K;  4JRI A;  5CKD A;  1G3Y A;  2X4X A;  5FU7 C;  4ZGE B;  3SFM A;  3V7S A;  4XTU A;  5CR2 A;  3ME9 A;  2PQW A;  2Y4X A;  1BI2 A;  3GP8 A;  1B34 A;  4A54 A;  3A8M B;  3PIO A;  3CMA A;  4JLI A;  1YIT T;  1VQ6 T;  3J7A F;  2LX9 A;  3V8L A;  2RJF A;  1QVP A;  5GMK e;  3OA6 A;  2K57 A;  1D3B A;  4M75 G;  4A4H A;  2XHC A;  2DK3 A;  3LGF A;  5C6S A;  3CME A;  2PU9 B;  3OBW A;  3CCQ A;  3A8L B;  1M1K C;  1M8V A;  3V8K A;  4XTY A;  4C8Q B;  4J8O A;  4KBM B;  2DD4 A;  1YJ9 A;  4PJO D;  1UEB A;  3HFO A;  3HSB A;  1M90 U;  1V29 B;  3HRS A;  2K5F A;  3FJP A;  5FU6 C;  1X6O A;  1YJW T;  3MEA A;  1NZ9 A;  1DJ7 B;  4OB2 B;  1I4K 1;  1B34 B;  1G3W A;  4BUG A;  3I55 A;  3JCM W;  1BYM A;  4OB0 B;  2YRV A;  4KUI A;  2ZPF B;  4M78 C;  5IN1 A;  3P8D A;  1D3B B;  3OMG A;  2HQX A;  2K3Y A;  4J6Y A;  5EG2 A;  2RHZ A;  3MEV A;  1K9M C;  2EJG A;  2X4Y A;  1NPP A;  2L89 A;  2MWP A;  2XG8 D;  2DXT A;  2JTM A;  2M0O A;  3OYK A;  3OYG A;  3L2R A;  2XI9 A;  2B8A A;  3RIR A;  4BDZ A;  2DZ9 A;  2E5Q A;  4M77 C;  2JZ2 A;  2VGN A;  4A53 A;  2IVW A;  2Y90 A;  4MDW A;  1BI0 A;  2DTH A;  4A4G A;  2Y4Y A;  3M56 A;  4P5N A;  4C92 A;  2QA4 A;  2CZ1 B;  1VQK T;  4OB3 B;  2PVO B;  3CCL T;  3AHU A;  2LTO A;  3LGL A;  4WF2 A;  1FX7 A;  1U8R A;  1YJN T;  1KQ1 A;  4L5G A;  2HNI A;  3WVD B;  2O4X A;  3OB9 A;  5J3B A;  1WQ7 A;  4FSX A;  4M75 D;  3QYG B;  1O75 A;  2E1H A;  4XTV A;  1Q82 C;  5AYF A;  4M75 E;  4QVD A;  3BFM A;  2GF7 A;  1VQ8 T;  3JB9 F;  2LC4 A;  4A4F A;  4C0Z A;  1VQ4 T;  2K3X A;  1XNI A;  3KXT A;  4C92 B;  4LD6 A;  2ZCF B;  3CC7 T;  4X34 A;  2VC8 A;  4LDV A;  1NE8 A;  1VQ9 A;  3QG1 A;  3JCM X;  2QEX A;  3CC4 T;  4J5Y A;  4YTL A;  1WJQ A;  5D6W A;  5A0G A;  3JRZ A;  3L2V A;  2AHJ B;  2O4X B;  4F7U F;  1VQ7 A;  1N6A A;  3SB2 A;  2DIQ A;  3X25 B;  4M7A A;  1VQO T;  1RI0 A;  2BUD A;  2E41 A;  2QDY B;  3CCR T;  5LJ3 d;  3QZ9 B;  1UGP B;  3CD6 T;  4J83 A;  3BDU A;  3FLG A;  2CZ6 B;  5GAM d;  1XTD A;  4OVA A;  2JUF A;  4FT2 A;  4XU2 A;  4IUU A;  4D6W A;  5C0M A;  5GAN f;  1Q7Y U;  3J81 E;  3HHT B;  2CS7 A;  4LDX A;  5CK9 A;  2R5M A;  2DJZ A;  3N5B B;  2MF2 A;  2RM4 A;  3MEW A;  3PGG A;  5D6Y A;  2V8I A;  2GCX A;  1QVF A;  4GY5 A;  2WAC A;  1M90 C;  4EPC A;  3HRU A;  4DQ2 A;  4ELZ C;  4EMK C;  5L8R E;  4M7A B;  5LJ3 g;  1JJ2 S;  1Y96 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...