2D9TA

Solution structure of the tudor domain of tudor domain containing protein 3 from mouse
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
78
structure length
78
Chain Sequence
GSSGSSGKVWKPGDECFALYWEDNKFYRAEVEALHSSGMTAVVKFTDYGNYEEVLLSNIKPVQTEAWVRDPNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the Tudor domain of Tudor domain containing protein 3 from mouse
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
molecule keywords Tudor domain-containing protein 3
total genus 5
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2005-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2d9tA01
3L2RA 3OYLA 4QVZA 5D6WA 4EDUA 3S3NA 4UC4A 2B8AA 3O8VA 3DB4A 5D6XA 3L42A 3OS2A 2RJDA 3FEOA 3L2QA 3QIIA 2WACA 3PMIA 2FHDA 2G3RA 3P8HA 1G5VA 1OI1A 2D9TA 2DIQA 2L3RA 3PNWC 4A4EA 4BD3A 5M9OA 4QQ6A 1WJRA 2R58A 3E9GA 2IG0A 3LGLA 2VYTA 2E5QA 3PMTA 4C5IA 3BDLA 5J39A 3OMCA 2RHYA 4NS5A 2EFIA 2LVMA 1WJSA 1KHCA 2RI2A 4E7LA 2HQEA 2GFUA 5D6YA 4IUVA 3CEYA 3MEWA 3OYBA 4E7HA 2R57A 2EKOA 4C5HA 3LYIA 2E6NA 2HQXA 3OYAA 4FU6A 3OYHA 2GFAA 2K3YA 4FL6A 4B9WA 3OA6A 2DAQA 3L2UA 4BDZA 4BE1A 4C5EA 1MHNA 2LCCA 3C4SA 2RJCA 3OYIA 2RO0A 2QQSA 1WJQA 3QKJA 2RJFA 2RHUA 3H8ZA 2RJEA 4QQDA 4PL6A 3OS1A 3OYFA 2MWOA 2DIGA 2LDMA 2BKDN 3QJ6A 4Z02A 4N4HA 3MEAA 4E7JA 3S3OA 3S3MA 4QQGA 2RHIA 3FC3A 2M1HA 3MEUA 2X4XA 1OZ2A 3OB9A 3MP1A 3QBYA 4BDYA 1SSFA 2EQJA 3MO8A 2YRVA 4PLLA 2L8DA 3MEVA 1N27A 3NTKA 3MP8A 3OYGA 4IKFA 4BACA 2MWPA 3ASKA 5KCOA 4N4GA 3META 4II1A 2O4XA 1WGSA 3DLMA 3M9QA 4PLIA 5KCHA 3P8DA 2LRQA 2R5MA 2RHXA 4BE2A 3F70A 4A4GA 2R5AA 3OYKA 3GOXA 4ZTFA 2K3XA 4RG2A 4CRIA 5J26A 4N4IA 2PQWA 4B9XA 3OS0A 4LD6A 3LLRA 4OVAA 2RHZA 4X34A 2NLUA 2RI5A 4IUUA 4IUPA 5IAYA 2M0OA 2GF7A 2P0KA 2BUDA 3ME9A 3OYMA 5C6SA 5FROA 3UWNA 3OYEA 5FRMA 5C0MA 3NTHA 2X4YA 3SD4A 4E7KA 1XNIA 3OYDA 3OYCA 3LH0A 3UT1A 4IUQA 4QW2A 3OY9A 2X4WA 5CIUA 2RI3A 5KH6A 4BE0A 3OQ5A 4E7IA 2LTOA 3S6WA 3DB3A 4L59A 4IURA 3EAEA 5KE2A 5KE3A 1H3ZA 5FRNA 4ZTJA 3KUFA 3LGFA 2XDPA 3ZEHA 3LX7A 2F5KA 3H6ZA 3E9FA 1OZ3A 3FLGA 3OYNA 3Q1JA 5IN1A 4A4FA 2BIVA 3L2WA 2X35A 2L89A 3MP6A 2XK0A 2JTFA 4GY5A 4Q5WA 3PFSA 4A4HA 2CKKA 4C5GA 1RI0A 2EQMA 3OYJA 2EQKA 2EQUA 2QQRA 2O4XB 3NTIA 3OMGA 2JZ2A 4IUTA 2M16A 4HCZA 3FDRA 1OYXA 3L2VA
chains in the Genus database with same CATH superfamily
3P8BB 2DNUA 2RA2A 1W2BS 3N5BB 2HNIA 4ZGEB 2VKNA 2ZGWA 1KQSP 2H3EB 1D1BA 3SWNA 5LJ3h 2G3RA 5DM7R 5GAOq 4M77C 2K5LA 2KT1A 1NM7A 1AWJA 1YBYA 5J39A 1BKBA 3OMCA 1K8AR 1ZLMA 1RAFB 2Y4XA 4LNPA 1VQNT 3CMET 2LNHB 1BIBA 1Y0MA 4JRKA 2RPNA 3HRTA 2RJFA 1EIFA 3G4SA 3LWIA 2MWOA 3M0QA 2LDMA 1X6BA 2BKDN 4BY6B 4HT8A 4DBQA 4HCBA 1UE9A 1JEGA 1KHIA 1SRLA 3M5AA 1ZSGA 2KROA 1UHFA 1NPRA 2GCXA 3CPWS 1T0HA 2EJFA 1VQPQ 2XDDA 2O4XA 2HCKA 2LRQA 1QP3A 4Z88A 2DD5A 1VQ4Q 2PZ1A 3M4GA 4AT1B 4CC3A 3CCET 1C0MA 3L2ZA 1YJWQ 1LPLA 2KBTA 1U1SA 4JRPA 5FRMA 4B6MA 1WHKA 2GQVA 2RF0A 2KSSA 1GFCA 2RI3A 1VQPA 1RL2A 3PE0A 4E7IA 2XG8D 3EAEA 5KE2A 2HSPA 2YLBA 4DA4A 2XDPA 4C0DB 1NJIR 2ZPBB 2FVUA 4EIKA 2LCSA 1VQLQ 4Q5WA 2BZ8A 2X9HA 4M77A 4C5GA 1G8XA 2KY9A 1LVKA 4M7AF 1N6AA 1XQHA 1ZA2B 5I22A 1U1TA 3ULRB 1QVGS 4XTZA 3M54A 1VQ8A 4M77G 3C94A 3OS2A 2QQBA 4D6WA 5GAN6 4DBRA 3O5ZA 2EBPA 1WJRA 3CPFA 4RTUA 3BDLA 4PJJA 4JDSA 4RKUE 2LVMA 3JB9H 4KULA 2KNBB 2CH4W 4HVUA 2DX1A 4OGEA 2A28A 1GL5A 4C5HA 2VXEA 4OB2B 2W10A 2CP0A 3L2UA 2DL3A 1TG0A 1BK2A 1AT1B 1WHGA 1JQQA 1Q7YU 2L3QA 2EW3A 7AT1B 1VQ5A 2RQWA 4C92D 2QGGA 2CZ1B 2DL8A 1VQKQ 1VOMA 4YTLA 1VQ8T 5FWBA 1X6OA 3JCMb 3ZFJA 4J9BA 3F70A 5IT9E 5DLOA 1VQ9A 1G83A 3CCQQ 1MMGA 3QUIA 1UDLA 3FJ5A 1IGUA 2HL3A 4M75B 5IH2A 5CKDA 4JZ3A 2E5KA 3G4ST 4C8QD 5EC7A 1I5LA 1ZUYA 3JCMX 1M8MA 4J9HA 4MMLA 1MMDA 4C0FA 2KRSA 1VQOQ 1PKSA 3FLGA 5GAN5 3Q1JA 3WVEB 1IREB 5AT1B 2COZA 2XK0A 4C92C 2DM1A 1WLPB 1RAAB 4MZPA 2OTJQ 2P4TA 1CKBA 2O88A 2M51A 2M02A 2KQWA 2HMAA 1LCKA 3JB9J 3DB4A 2DF6A 2L3SA 2YT6A 2DZCA 4FCYA 1MV0B 1G5VA 1AHJB 2E5QA 1Z9ZA 2QTXA 1ABOA 3CBPA 4E47A 3GNFB 4XQ3A 2GFUA 5GAOp 1OEBA 2O2OA 3CBOA 3MEWA 4M77D 3LYIA 1AWOA 4D8KA 5GMKe 1NEGA 3U23A 4J9EA 3RDVA 3H8ZA 1TWBA 5KYXB 4PL6A 4J6YA 4M7DC 5GJVB 2X4JA 4Z02A 2FRWA 4FSXA 4M7AE 2LT4A 1NEBA 2J6KA 1KQSA 3HFOA 3HKSA 2PNIA 1UGVA 3EG0A 4II1A 3EH2A 4R0KA 2YHTA 2EWNA 1KC8U 2VB6A 2PQWA 2EIFA 3GP8A 3VRZA 2M9UA 1PNJA 2LMJA 4PNOA 3UWNA 1GCQC 3BDUA 5CKEA 3VUZA 4XU1A 5I21A 1K76A 4EMHA 2QEXQ 2V8JA 1K73R 1Q82R 1QWFA 2WSEE 2EGCA 4C8QA 5FLXE 4ZTJA 2XMFA 2ZCFB 2KAFA 4M7AA 2A08A 2C0TA 3BW1A 3E9FA 3PT9A 5GAN7 2CGHA 3H0HA 4RG8A 4EMKB 2JS0A 1YWOA 3PFSA 2K9GA 1ZBXA 4C8QG 3RMSA 2FZCB 2QQRA 2O4XB 3M0SA 4GLKA 2PTKA 4Y92A 1KFZA 4BI4A 6AT1B 4HCZA 2OX7A 1BCMA 4QVZA 2DD4A 1G3WA 3VS4A 3VS3A 2D6FA 1G3YA 4HXJA 1QVPA 4M75G 4ZGDB 2JM8A 2SEMA 2L3RA 1YIJA 3QZ5B 5GAN8 2AHJB 2HQEA 4AMCA 1M3CA 4IUVA 5J3BA 4RTWA 3EGDB 2E4HA 2QASA 3GIBA 2KE9A 1MMAA 1TH7A 3CCVT 3CCRQ 3PVLA 2F5TX 3D7SB 4LXCA 2VV5A 4OF1A 3CCMA 2K57A 3A5ZB 4L6V5 1FYNA 3NTKA 3CC4A 1D0YA 3EFSA 4K11A 2RQVA 3A8GB 2QEXA 2FG0A 2NUTB 1GBRA 2FZGB 1JRIA 4RG2A 2NUTA 4OMOA 2EVRA 4N0AA 5KYYA 3HRUA 3JAME 4ORZA 5FU7C 4OVAA 2RHZA 2YUPA 1D1CA 4PJOE 4HA8A 4RCBA 3BY7A 2M0OA 5CCAA 3OYMA 1QLYA 3FB9A 1YCYA 1FWZA 2AK5A 2O9SA 2FPFA 1FX7A 3I5SA 1YJNQ 3G71A 4L59A 1X01A 3RMQA 3URGA 3J81E 1G2BA 5KYNA 3NFCA 2RK1A 2PUOB 1D09B 3CCRA 1KSWA 4VUBA 2DEUA 3CD6T 1VQ5T 1TSFA 2GTJA 2JTFA 2LCLA 8ATCB 4ME7A 5D7UA 5GAMj 3M0TA 2QAZA 1VA7A 3S3NA 1Q82C 3FEOA 2LNVA 4BB7A 1SHFA 1T3SA 1X69A 3GBQA 1UB4A 5M9OA 2DK3A 1QW1A 2CZ0B 5ECAA 1V29B 1WFWA 1QVFP 2ZPFB 3NGPA 4KGZB 3CXCP 2YUQA 1K4US 2HQXA 3VJPA 2AZVA 1AWXA 3CCRT 2GQIA 3EFRA 3CCUA 4EPCA 2HKNA 2J6FA 3MCAB 5LJ3d 3G71T 2OTLQ 3T9NA 3MEAA 2YUOA 2D0NA 2FEIA 4DBFA 2L8DA 4FYWB 5LJ5e 2JVVA 5GJWB 3MP8A 3CC7Q 2CS7A 5FW9A 2CREA 1KQ1A 5KCHA 3SFMA 1ZSZA 2LT1A 5GAOl 4A54A 2DYIA 2NUPA 4B9XA 4KGXB 3RKWA 2E10A 2QYZA 2RI5A 1VQLT 4IUPA 5IAYA 4ELYC 3V7RA 3AHUA 5CKFA 1KIKA 3G6EQ 3VS5A 4DBHA 5IXFA 1YHQT 1W2BA 2AKLA 2B86A 2DE0X 1I81A 2AZSA 5LL6S 2EYQA 1YITT 2MOXA 1PG5B 3JCMf 1AWWA 3VKIA 2BIVA 3BE3A 2HSEB 2MIOA 4RUGA 4JRIA 3H0IA 1LJOA 1Q81U 1SF9A 1TU0B 1GCQA 3MHXA 4EMKA 1IRXA 3CMEA 1K73C 4M78C 3CBMA 2KVQG 4JJCA 3CMAT 4C92E 1YJ9T 2D9TA 4LN2A 4QQ6A 3M55A 1VQMQ 3E9GA 5I2MA 1KD1R 3KXTA 1S72Q 4E7SA 2NYSA 2L5QA 3UPUA 5A0DA 1R77A 1P92A 5GAMg 1VQPT 3CPWA 1SSHA 2MYSA 4M7DE 4HVWA 4BUGA 1OX9A 2JMCA 2VWFA 4XTUA 1HSQA 3VS1A 2RB6A 2LJ1A 8AT1B 1ZUKA 1QWEA 1VQ6T 4ZN1A 2KT8A 1ARKA 4OMMA 5KCOA 4N4GA 3META 4F7UG 3RIRA 1JU5C 2RM4A 3EGXB 4FT4A 5GANe 1WQ7A 2V1QA 1OPKA 4LD6A 1X75C 2PU9B 2I0NA 4HT9A 2NLUA 2XIDA 3VRYA 2GF7A 4F7UA 1YJWA 1ABQA 2OTJT 2FZKB 3J80E 3OYCA 1V76A 4RTZA 1H8KA 1M1KU 2FPDA 3QYGB 4HVVA 1VQ5Q 3JSCA 4MZMA 1AZGB 1TS9A 1AVZC 3DB3A 5FRNA 3EGUA 4C8QB 2MMPA 3OYNA 2X3XD 4GY5A 1ACMB 1B07A 1QKWA 2YSQA 1UJYA 3HP9A 3PIPA 2OI3A 1VIFA 1SKUB 3HPWA 1M2VA 4IUTA 1X2KA 3L2RA 3QO3A 1H3HA 1D1AA 5LJ5g 3PMIA 4AFQC 2EYXA 2EGAA 2YUNA 4BD3A 4J83A 3I55A 3EGXA 5GAN3 2DTOA 2E65A 4Z89A 2IVWA 3GPLA 2L3PA 1RAEB 2HEQA 1XOVA 1Q7YC 3JB9G 3LH5A 2RJCA 2RO0A 2QQSA 2DBKA 3CXCS 3VUBA 2JT4A 1M3BA 1Y71A 4JUVA 3H41A 3HSBA 3S3OA 1UUEA 3A8HB 1ZX6A 1QCNA 1KD1U 1YNZA 3E2UA 2CSQA 4PLLA 5GMKl 4FYXB 4LDYA 1RI9A 4PFZA 2DRMA 5L8RE 1AOJA 1M2VB 2QA4T 3HFNA 5GMKm 2F69A 4A4GA 1PWTA 1I4K1 1U06A 2LQNA 2L2PA 2QXFA 2CP2A 2DEQA 3V8KA 3CMAQ 3JRZA 2JOYA 5FROA 1YN8A 1AEYA 2EYYA 1NBEB 5LJ3f 4J9IA 2CUBA 3OW2P 4RTYA 1MNEA 1W6XA 1GXIE 5FU6C 3CCVA 2VGMA 2XD0A 4BE0A 3RKXA 2ZPIB 1PHTA 1MNDA 5A2QE 3VS2A 4XTWA 3EFOB 3OBYA 2IPOB 4JJDA 1K0XA 1WXBA 4MZTA 3SHWA 3IQLA 4TVRA 4A4FA 1M27C 4J6WA 3MP6A 5LJ5f 2DZ9A 2A7YA 3CCJQ 2CKKA 3I35A 3M58A 2W0ZA 2M16A 2GBQA 4C8QF 4JRQA 4Z8AA 3CCLT 1H641 4ESRA 1NYFA 5HY6A 2B8AA 4KH1B 1LNXA 1YIJT 1SHGA 2RJDA 2FHDA 4E2FB 1WI7A 5KYWA 4CI0C 3CCQA 3M53A 2DKGA 1KQSS 1BI3A 3C95A 4J6XA 2DXCA 2RMOA 2GFAA 2K3YA 2KEAA 4M77F 2FYKA 3CD6Q 4PK4A 1VQKA 1HYOA 1WA7A 4QQDA 4XU0A 4O5VA 2OTLA 3AT1B 2RHIA 3FC3A 1SSFA 1FMKA 2EQJA 4IIMA 1BI0A 4A53A 1M90C 2ZPEB 3I9QA 2ZZDA 3EGDA 2DETA 2RHXA 4XU2A 4XTXA 1VQMA 4RTXA 3V7CA 5GMKj 3V8JA 4HCKA 4C8QC 1OU9A 3CC7A 3G7ZA 3CPWP 2Y90A 3OYEA 1K8AC 1BCOA 1TXQA 1UG1A 2X4YA 2RN8A 3SD4A 3SEMA 4M7DB 1UEBA 3EFOA 5KYWB 4PJOD 3LH0A 1S1NA 1Q86C 4QVCA 5CIUA 3OQ5A 3E19A 1MUZA 1WHHA 2A0FB 4XTVA 3LGFA 3LX7A 5LJ5j 1KJWA 2ED0A 5GMKi 1OZ3A 1BI2A 3H0FA 2XHCA 1HXDA 2G6FX 2QK0A 4FSSA 4BI8B 3G6EA 2RH2A 1CSKA 2EQUA 4AG1C 2GGRA 5CQXA 2JJ9A 2KK4A 1PD1A 4P5NA 4PJOA 3OA6A 3LGLA 2J6OA 3I55Q 1JO8A 1VQ4A 1TTHB 2GTOA 2EYZA 4FYVB 4PJOF 4A4KA 3OYAA 4V2SA 3CC4Q 1MHNA 2V8IA 2HBWA 1MGQA 2K79A 1NLPC 1RUWA 5GAMe 3CC2Q 2CH4A 3M57A 1Y07A 4F17A 1N8RR 3REBB 4OP0A 4QQGA 1K9MU 2M1HA 1NYGA 3MEUA 2YDLA 1NLOC 1Y96A 2LP5A 4AFSC 1BI1A 4OMLA 2FL7A 1YJ9Q 2E41A 4BACA 4M7AD 3TSZA 3ASKA 4J9CA 1RADB 4XU3A 3RESA 1YP5A 2C06A 3M56A 3QZ9B 2R5MA 5HKCA 2L0AA 2YXYA 1VYTA 4C92F 3JCMe 2JMAA 4N4IA 1C1AA 2LQ8A 2LQWA 1YIJQ 4J9GA 1EFNA 5CK9A 2P0KA 2K2MA 2PVDB 4LDUA 2NWMA 2DJQA 1YITQ 1I0CA 3UT1A 4IUQA 2VVKA 1SPKA 1WHJA 2X4WA 4OB1B 3QG1A 3E1SA 2QQAA 3EHQA 1H3ZA 1WHMA 1SEMA 2CT3A 1K1ZA 3H6ZA 2JXBA 4F14A 1YWPA 5IN1A 3CCSQ 1Z9QA 1SG5A 1ZHIA 4LDXA 2D0QB 5I11A 2EQKA 3RNJA 2EAYA 3RR6A 3L2VA 5D6WA 3OS5A 4JZ4A 3R6NA 1B34A 2DRKA 3OW2A 5DLQE 1QMCA 3UDCA 1RLQC 1VQ4T 5CKBA 3PMTA 1VIEA 4M7DF 5KYXA 1VYVA 4FYYB 4M7AG 1QKXA 2PVGB 3MPUB 2JW4A 2EKOA 4L5GA 1N8RC 2J7IA 4OMQA 2DAQA 4MMKA 1M1FA 3CCMQ 5GAOm 4J7IA 2P0PA 3HRSA 1UGPB 1Y96B 1T0JA 4DQ2A 1UGQB 1E6GA 2F2XA 4M78E 1DJ7B 2V26A 4AG2C 4E7JA 2LJ3A 3VYGA 3MEVA 1EZZB 4M78D 1K9MR 5FWCA 3JB9F 4Y28E 1WIEA 3PGGA 5EG2A 4ZN3A 4PLIA 4F7UE 4N0AC 1N8RU 4ZTFA 2MPXC 3HTRA 4F7UF 2VUBA 5GAMh 1PCXA 1G3SA 1PSEA 4PJOB 2E70A 2VASA 2EJ9A 4PKCC 4M7AB 3SWNB 1VQ9T 1RLPC 2QGFB 2BZXA 3JV3A 2D1XA 4M7DG 1TUCA 2J05A 3OY9A 4QW2A 4XAXB 1JXOA 2AKKA 5A0LA 2CZ6B 1I07A 4D8DA 3CCJA 3VS0A 3DKMA 2SRCA 4M75E 2P84A 5CO7A 1QVGP 3V7SA 3G1JA 4XK8E 3JCMQ 3ER0A 2BE7D 1XTDA 4HKEA 3VYHB 3TQ7P 3QDRB 2LJ0A 3OYLA 2PUKB 5D6XA 3L42A 4LUDA 3QIIA 3PNWC 3KBGA 2AT1B 3X25B 1IXDA 5GAN2 3I56T 1YFNA 3UF4A 1WJSA 4E7LA 1HD3A 1TUGB 3CCUT 2JUFA 2RNAA 3EHRA 4AFUC 1OV3A 2J06A 2KR3A 3NPFA 4J5YA 4B9WA 4FIBA 4M77E 3QKJA 1I8FA 3TCJA 1IO6A 1JJ2P 5LJ3g 4OB0B 4ELZC 3QDFA 3OS1A 1K9MC 4RTVA 1IHVA 1Y57A 1R8OB 3X20B 3JCMP 2X4XA 4M78B 1D0XA 1UECA 2KXDA 1YI2A 1RAHB 5LJ3e 2HZYA 3UATA 1K0SA 2F2VA 3OYGA 1JJ2S 2MWPA 3A8OB 3JB9D 1VQ7T 2YLCA 2EYWA 2O01E 4FW2A 3TVTA 1VQ9Q 1FMWA 4KT0E 2JS2A 1W70A 5IHNA 2ROLA 4BY6C 1XJWB 3ME9A 5KYUA 3FJPA 2CUDA 1LOJA 3OYDA 1O9SA 4M77B 3EG1A 1OOTA 1X6GA 1VQ7A 2Z0WA 4M78F 5KH6A 3CCMT 3RBBB 1M30A 2ZPHB 2VC8A 2KYBA 5L23A 4X9DA 2EGEA 3CCSA 2F5KA 1NJIU 2DXBA 3CC7T 2K6DA 3EG2A 2L89A 1Q86U 1V1CA 2EQMA 1VQNQ 5KYYB 4QKUA 4J7FA 2QEXT 2EPDA 3REAB 3NHNA 3PIOA 1BBZA 1H92A 4UC4A 1GBQA 2D8HA 3EG9B 3WXMB 3CXCA 1TUDA 1R0CB 2ABLA 2MCNA 4OMPA 2R58A 4C0DC 4C5IA 2AIRB 1WDXA 2ROTA 1D3BA 5LJ5d 3CCST 1KHCA 2X3WD 4R56A 4NL3A 3QSUA 5CAIA 3OYBA 3TEEA 3JCMW 2OAWA 3GLXA 1ZA1B 2OAUA 2P0QA 2ZPGB 1K73U 2K5IA 1N5ZA 3C4SA 4C92B 2O31A 2EJGA 1KC8C 2DTHA 1OPLA 1YJNA 4PJOC 4JJNK 4F16A 4M7AC 3UA7A 2HQHA 1RAGB 5CR2A 1B34B 1UJ0A 1ZQ1A 3HHTB 4J8OA 1KC8R 4CC2A 3PVQA 1VQ7Q 4M7DD 2V1RA 3H9NA 4J9DA 4CRIA 1OU8A 2NUZA 1WYXA 4M75D 5J26A 3OS0A 4OMFB 5IHKA 1YJWT 4GBQA 1QVFA 2XDBA 2DO3A 3ZBDA 1YCSB 4IUUA 2FPEA 1WX6A 1BIAA 5C0MA 2KGTA 2JTEA 2DVJA 2COWA 2MF2A 2P4RA 1IB8A 4JPBW 2XI9A 3X26B 4M78G 1B7TA 1ZBJA 2QQ9A 1PRLC 3A8LB 1J3TA 4QT7A 1WXTA 2E64A 2JNGA 2E3IA 1VQ6A 3I55T 2KRMA 2LC4A 2HD0A 4M75C 3ZL7C 4A4HA 2ZAEA 1AZEA 4M78A 3J7AF 2DL5A 1Y7XA 2WSFE 1ZUUA 1VQOT 1RACB 2CZ7B 5GAMf 2K4YA 3L2QA 1X2QA 2HL5C 4PJLA 3P8HA 1OI1A 1VQKT 1WNLA 2CYZB 1S72A 4PJMA 2F2WA 4JLGA 4MDWA 4NS5A 3DLLA 1NE8A 5HK0A 5HCKA 2D8JA 5KYUB 1G3TA 1FMVA 3OYHA 1JXMA 5IHIA 4R55A 2E6ZA 1JBMA 2QTVA 1Q82U 1QVGA 2IIMA 1QQJA 2OTJA 1M8VA 5GANh 3OW2S 1M90R 3G4SQ 2DIGA 3GF5A 4M4ZA 2BE9B 2DXUA 1B3QA 2QA4A 1OZ2A 3OB9A 3MP1A 4QVDA 1WQWA 1UFFA 3QHSA 4NOYA 2DMOA 3M0UA 4IKFA 5FU6B 3NMZC 1YI2T 1M3AA 4BE2A 3M9QA 2DERA 2I2LA 3QWYA 2KDSA 4PFOA 1KQ2A 3NTHA 1NJIC 4BI3A 1K9AA 3CQTA 4FM4B 3R6OA 2PVOB 2COYA 2C0OA 3JCMc 4CC7A 1KK7A 2GNCA 2DLPA 3A1PA 4RTTA 1WPYA 4FW1A 3S6WA 2ATCB 4IURA 1FXXA 4O6JA 4IIOA 1VQ6Q 3MKDA 4OB3B 2X35A 1Q81R 1M1KC 5GANf 1IZ6A 1RI0A 3CCEQ 5FU7B 3VS7A 1KG1A 2CSIA 1TOVA 4E6RA 2CDTA 2XICA 4EDUA 3LW5E 3O8VA 2BZYA 2XU8A 1WZOA 3CMAA 2JTMA 1NPPA 2DIQA 4A4EA 1M1GA 3CCJT 4J9FA 3A8MB 2VYTA 5GMKh 2EFIA 2DXTA 2HAXA 2R57A 4LUEA 3CCLQ 3L1AA 2YWWA 1UGSB 1IHWA 4BE1A 4BDZA 1BB9A 4C5EA 1Q95G 2RHUA 2KXCA 1UTIA 1MMNA 3CCUQ 1VQLA 2QDYB 1M2OA 1ZSZB 4BDYA 2RK2A 1X43A 3MO8A 2YRVA 1QCOA 3RERA 3M0RA 1GCPA 3FRNA 2C0IA 1N9SA 3DLMA 3I56Q 2DTIA 2DL4A 3GOXA 4EMKC 1Q7YR 4M7DA 3LWHA 3VV0A 1CKAA 3M4YA 3INZA 9ATCB 1M90U 3I5RA 2VXFA 3V8LA 4JS4A 1M1KR 3JCMg 1Q81C 1YHQA 4Y91A 4KRTA 4GLMA 1JJ2A 2MI6A 2QG9B 3M59A 1QP2A 1SRMA 4C0GA 3CC4T 1VQNA 3X28B 1MV3A 1YJ9A 1T3LA 1E7OA 2JM9A 3EG9A 1N9RA 3G71Q 2OTLT 4M75F 3JCMJ 1YJNT 2WSCE 3CCVQ 4DOVA 1UGRB 5GAOn 3JCMh 2V8KA 3OYJA 1U3OA 3OMGA 3NTIA 1PC0A 2RQTA 3QJ6A 3S3MA 3TU4K 3OYYA 1PRMC 2HDAA 5A0GA 3QXEB 4DEXA 5GANg 1VQ8Q 4X1VA 2ECZA 3CCQT 4ZGJB 2LX9A 5AYFA 3A98A 2IG0A 2A3LA 1IGQA 1EX4A 4EMGA 2O9VA 1HJDA 3FIFA 3KFVA 4LDVA 2CP5A 3CEYA 4E7HA 5IXBA 1VUBA 5CKHA 1UHCA 2E6NA 4FU6A 2RQUA 1W4SA 1NZ9A 4KBMB 2LCCA 3OYIA 5DY9A 2YRDA 1WJQA 2DBMA 1OULA 4KUIA 4ATOA 1GFDA 2A37A 2KYMA 3QPHA 2RJEA 2OJ2A 4E7ZA 4LE9A 4C0ZA 4RMOA 2QI2A 1JB0E 4WF2A 1U5SA 5GAOr 1YHQQ 1YITA 1W2BP 4PJOG 3MJXA 2K5FA 3SDZA 1N27A 3JB9I 1PD0A 1RABB 3JCMd 4CC4B 1QCFA 1D3BB 1WGSA 4MDXA 2E3HA 4OGCA 1M5Q1 1D0ZA 2H3JA 2JN0A 2K3XA 1E6HA 1GRIA 3LLRA 4X34A 4C92A 5LJ3j 2FB7A 1KD1C 1PSFA 2Y4YA 1XNIA 2E1HA 4JLIA 5GANj 2K7AA 4PJNA 2DILA 3RKYA 4C92G 2LTOA 3CCEA 3CC2A 3THKA 4RCCA 5KE3A 1BU1A 1NG2A 1OX8A 3JCMV 2X51A 3GNGA 3ZEHA 5CQYA 4F7UB 1QVFS 4ZNXA 3L2WA 2LZ6B 1VQOA 2H8HA 1X27A 1VQMT 2RQRA 3EH1A 3RUXA 1O75A 2YRCA 5I2SA 2JZ2A 3QYHB 1WHLA 2RD1A 1C6VX 3CD6A 5GAMd 4LDWA 2VGNA 4WTOB 4AFZC 1Q86R 3QWXX 2WACA 4X9CA 1S72T 3VU3C 2CP7A 1BYMA 1WXUA 1ZSZC 3I56A 3TSWA 2E12A 2RHYA 4FT2A 2HBPA 3QJYA 2RI2A 2FRYA 2CP3A 5D6YA 4M75A 1M4ZA 4WCIA 3OBWA 1PM3A 3CC2T 2MAMA 1YI2Q 4FL6A 4PFPA 4F04B 2KRNA 5GAN4 2KMTA 3UA6A 5LJ5h 2QA4Q 2ENMA 4OMNA 3OYFA 3C12A 1I1JA 1RAIB 1M9SA 4N4HA 4HCCA 3SWNC 1R0BG 3QBYA 3M0PA 4C8QE 2K2VA 1U8RA 1I5OB 3CCLA 3HL8A 3G6ET 4NL2A 2M0YA 2FO0A 2HKQB 4XTYA 3P8DA 3C0CA 3SB2A 1HK9A 2CP6A 2R5AA 3OYKA 2DJZA 2DVEA 1AD5A 1A0NB 3CMEQ 2BTTA 5GANd 2BUDA 2EKHA 5C6SA 2ED1A 3BFMA 4A63B 2XKOC 2EQIA 2DYBA 4E7KA 1F1BB 2MK5A 2ESWA 4DOWA 4LD9K 3PTAA 3EG3A 3VS6A 4JJBA 1W1FA 1PKTA 1VYUA 4ANJA 2QDLA 3TREA 3X24B 2A36A 3KUFA 2LQKA 4KUDK 4DEYA 2DPPB 2LX7A 4KGVB 3WVDB 1OQKA 1K8AU 4JS5A 3OSVA 2NUPB 2KI7A 5HK3A 2DA9A 4KH0B 2K3BA 5CVIA 3OSSC 2CT4A 2F1LA 2DFUA 2DL7A 3FDRA 1OYXA
chains in the Genus database with same CATH topology
3P8BB 2RA2A 1VQOT 1W2BS 3N5BB 3S3NA 1Q82C 2HNIA 4ZGEB 2CZ7B 5GAMf 4M7DD 2K4YA 2ZGWA 3L2QA 4P5NA 3FEOA 2LNVA 3SWNA 5LJ3h 4BB7A 2G3RA 3P8HA 1G5VA 5DM7R 1OI1A 5GAOq 4PJOA 4M77C 1VQKT 2K5LA 1UB4A 5M9OA 2DK3A 1QW1A 1WNLA 1YBYA 2CZ0B 3LGLA 5J39A 3OA6A 2CYZB 1BKBA 1S72A 4MDWA 3OMCA 4JLGA 4NS5A 1VQ4A 1V29B 1NE8A 5HK0A 3DLLA 2ZPFB 2Y4XA 1G3TA 4PJOF 1VQNT 3CMET 4A4KA 2HQXA 3OYAA 4V2SA 3VJPA 3OYHA 1BIBA 4R55A 2E6ZA 1JBMA 1QVGA 1Q82U 1MHNA 4JRKA 2V8IA 3CCRT 1MGQA 3HRTA 3EFRA 3CCUA 4EPCA 2OTJA 2RJFA 5GAMe 1EIFA 3G4SA 1M8VA 5GANh 3OW2S 3LWIA 3MCAB 3M57A 2MWOA 5LJ3d 2DIGA 1Y07A 3GF5A 3G71T 2LDMA 4BY6B 2BKDN 3T9NA 4HT8A 3MEAA 4OP0A 4QQGA 4HCBA 2QA4A 2DXUA 2M1HA 3MEUA 1K9MU 1OZ2A 3OB9A 3MP1A 1Y96A 1KHIA 4QVDA 1BI1A 2L8DA 1WQWA 3M5AA 2FL7A 5LJ5e 2JVVA 3QHSA 4NOYA 1NPRA 2E41A 3MP8A 5FU6B 4IKFA 4BACA 2GCXA 1YI2T 3ASKA 4M7AD 2CS7A 4XU3A 2EJFA 3RESA 2XDDA 3CPWS 2O4XA 2C06A 3M56A 3QZ9B 1KQ1A 4BE2A 3M9QA 5KCHA 3SFMA 2LRQA 2LT1A 2R5MA 5GAOl 4A54A 5HKCA 1QP3A 2DD5A 4C92F 3M4GA 3JCMe 2I2LA 4N4IA 4B9XA 2LQ8A 3CCET 3L2ZA 2KDSA 3RKWA 2E10A 2RI5A 1VQLT 4IUPA 5IAYA 5CK9A 4ELYC 1U1SA 2P0KA 3V7RA 4JRPA 5FRMA 1KQ2A 2PVDB 4LDUA 3NTHA 3AHUA 1NJIC 4BI3A 2GQVA 5CKFA 4FM4B 3R6OA 3UT1A 2PVOB 4IUQA 2KSSA 2X4WA 3JCMc 1YHQT 1W2BA 2RI3A 1VQPA 1RL2A 1WPYA 4OB1B 4E7IA 3S6WA 1I81A 3QG1A 4IURA 2XG8D 5LL6S 3E1SA 2QQAA 3EAEA 5KE2A 1FXXA 4O6JA 1H3ZA 2YLBA 4DA4A 2EYQA 1YITT 2XDPA 3JCMf 3H6ZA 4C0DB 5IN1A 3VKIA 4OB3B 2BIVA 2X35A 2ZPBB 2FVUA 1M1KC 1ZHIA 4Q5WA 5GANf 4LDXA 4JRIA 4M77A 2D0QB 1IZ6A 4C5GA 1RI0A 2KY9A 1LJOA 2EQKA 2EAYA 1Q81U 5FU7B 1KG1A 4M7AF 1N6AA 1XQHA 1U1TA 1OYXA 3MHXA 4EMKA 2XICA 3L2VA 1QVGS 4XTZA 3M54A 5D6WA 4EDUA 1VQ8A 3OS5A 3CMEA 1K73C 3LW5E 3O8VA 4M78C 3CBMA 4M77G 2KVQG 1B34A 3C94A 2XU8A 2QQBA 3OS2A 4D6WA 3OW2A 5DLQE 3CMAA 3UDCA 2JTMA 1NPPA 2D9TA 2DIQA 4C92E 5GAN6 1VQ4T 4A4EA 5CKBA 1YJ9T 1M1GA 1WJRA 3M55A 3E9GA 3A8MB 3PMTA 2VYTA 1VIEA 3CPFA 4QQ6A 3BDLA 5I2MA 3KXTA 4JDSA 4M7DF 4RKUE 5GMKh 2EFIA 2LVMA 3JB9H 4M7AG 2L5QA 2PVGB 3UPUA 4KULA 2DXTA 5A0DA 2HAXA 2R57A 2EKOA 4OGEA 1P92A 4L5GA 5GAMg 1N8RC 4C5HA 3L1AA 2VXEA 4OB2B 1UGSB 1VQPT 3CPWA 4BE1A 3L2UA 4BDZA 2DAQA 4MMKA 4C5EA 4M7DE 1M1FA 5GAOm 4BUGA 4J7IA 2P0PA 1Q7YU 3HRSA 1UGPB 2RHUA 4XTUA 1Y96B 4DQ2A 1UGQB 4M78E 1VQ5A 2RB6A 1DJ7B 4C92D 1VQLA 1VQ6T 4E7JA 2QDYB 3VYGA 4ZN1A 4BDYA 2RK2A 3MO8A 2YRVA 2CZ1B 3MEVA 4M78D 3RERA 4YTLA 1VQ8T 3JB9F 1X6OA 3FRNA 4Y28E 5KCOA 3JCMb 1N9SA 3META 3PGGA 4N4GA 5EG2A 4ZN3A 3ZFJA 3CMAT 3DLMA 4F7UG 4PLIA 3RIRA 4F7UE 2RM4A 4FT4A 3F70A 4N0AC 2DTIA 1N8RU 4ZTFA 3GOXA 5GANe 1WQ7A 4EMKC 5DLOA 4F7UF 5IT9E 2VUBA 5GAMh 1VQ9A 4M7DA 3LWHA 3VV0A 1G3SA 3M4YA 3INZA 4LD6A 1X75C 2PU9B 1PSEA 3QUIA 4HT9A 1M90U 2NLUA 2XIDA 4PJOB 2GF7A 2E70A 4PKCC 2EJ9A 4M7AB 4M75B 4F7UA 3SWNB 1YJWA 2VXFA 3V8LA 5CKDA 1VQ9T 4JS4A 3JCMg 1Q81C 3G4ST 4C8QD 2OTJT 3J80E 4M7DG 3OYCA 1YHQA 4Y91A 3OY9A 4QW2A 1I5LA 1M1KU 1JJ2A 2MI6A 4XAXB 3M59A 3QYGB 1QP2A 3JCMX 3JSCA 5A0LA 4MMLA 4MZMA 4C0GA 2CZ6B 3CC4T 1VQNA 3X28B 3DB3A 4C0FA 3CCJA 5FRNA 1YJ9A 3DKMA 4M75E 4C8QB 2MMPA 3FLGA 1N9RA 5CO7A 5GAN5 3Q1JA 3WVEB 3V7SA 3OYNA 2OTLT 4XK8E 1IREB 4M75F 3JCMQ 3ER0A 3JCMJ 1YJNT 2WSCE 2XK0A 4GY5A 4C92C 1UGRB 4DOVA 3HP9A 3PIPA 5GAOn 1XTDA 4HKEA 2V8KA 1VIFA 3JCMh 3VYHB 3OYJA 3HPWA 3OMGA 3NTIA 4MZPA 2P4TA 4IUTA 3QDRB 3QJ6A 3S3MA 3L2RA 3TU4K 3OYLA 3QO3A 3OYYA 2KQWA 2PUKB 5A0GA 3DB4A 3QXEB 5D6XA 3JB9J 3L42A 5LJ5g 3QIIA 5GANg 3PMIA 2DZCA 3PNWC 3CCQT 3KBGA 4BD3A 2LX9A 5AYFA 3X25B 4ZGJB 1AHJB 2A3LA 2IG0A 2E5QA 4J83A 5GAN2 3I55A 2QTXA 4EMGA 5GAN3 3I56T 3FIFA 3CBPA 4E47A 1WJSA 4E7LA 3GNFB 2DTOA 4XQ3A 2E65A 4LDVA 2GFUA 5GAOp 3CCUT 3CBOA 2JUFA 3CEYA 3MEWA 4E7HA 2IVWA 3GPLA 4M77D 1VUBA 3LYIA 5CKHA 2E6NA 4J5YA 1XOVA 4FU6A 1Q7YC 4B9WA 1W4SA 3JB9G 1NZ9A 4KBMB 2LCCA 5GMKe 2RJCA 3OYIA 2RO0A 4FIBA 5DY9A 2QQSA 4M77E 1WJQA 3QKJA 3VUBA 4KUIA 1I8FA 3TCJA 3CXCS 4ATOA 1Y71A 3H8ZA 5LJ3g 3QPHA 4JUVA 2RJEA 4OB0B 4ELZC 4PL6A 4J6YA 3OS1A 4M7DC 4C0ZA 1K9MC 2X4JA 4RMOA 3HSBA 4Z02A 3S3OA 2QI2A 1JB0E 3A8HB 1R8OB 4FSXA 4WF2A 3X20B 5GAOr 4M7AE 3JCMP 2X4XA 4M78B 2LT4A 1YITA 4PJOG 1KD1U 1YI2A 4PLLA 5GMKl 2K5FA 5LJ3e 3SDZA 1N27A 1KQSA 3JB9I 3HFOA 3HKSA 3OYGA 4LDYA 1JJ2S 2MWPA 3JCMd 3A8OB 3JB9D 4II1A 5L8RE 1D3BB 1VQ7T 2YLCA 1WGSA 2YHTA 2QA4T 2EWNA 4MDXA 3HFNA 1M5Q1 4OGCA 2F69A 2O01E 4A4GA 5GMKm 1KC8U 2H3JA 2JN0A 1I4K1 2K3XA 4KT0E 2PQWA 2QXFA 3LLRA 4X34A 2EIFA 4BY6C 3GP8A 2DEQA 2M9UA 3V8KA 4C92A 5LJ3j 3JRZA 2FB7A 3ME9A 2JOYA 4PNOA 5FROA 3FJPA 3UWNA 3BDUA 5CKEA 1KD1C 1PSFA 3VUZA 2Y4YA 4XU1A 1LOJA 1XNIA 5LJ3f 5I21A 3OYDA 1O9SA 2E1HA 1GXIE 4M77B 4JLIA 5FU6C 5GANj 1VQ7A 3CCVA 2VGMA 4EMHA 2XD0A 4M78F 5KH6A 3RKYA 2V8JA 3RKXA 2ZPIB 4C92G 3CCMT 4BE0A 2LTOA 3CCEA 5A2QE 3CC2A 4RCCA 2WSEE 2ZPHB 4XTWA 2VC8A 3OBYA 4C8QA 5KE3A 4X9DA 5FLXE 4ZTJA 2ZCFB 3GNGA 2KAFA 3JCMV 3ZEHA 4F7UB 5CQYA 4M7AA 3CCSA 2F5KA 3BW1A 3E9FA 4MZTA 2DXBA 3PT9A 2CGHA 5GAN7 4TVRA 1NJIU 3CC7T 1QVFS 4A4FA 3L2WA 1VQOA 4J6WA 2L89A 3MP6A 1Q86U 4RG8A 5LJ5f 2DZ9A 4EMKB 3CCJT 2A7YA 3PFSA 1VQMT 2CKKA 2EQMA 3RUXA 1ZBXA 1O75A 3M58A 4C8QG 3RMSA 4J7FA 2QQRA 2O4XB 4GLKA 5I2SA 2QEXT 2JZ2A 3QYHB 2M16A 4BI4A 4C8QF 4HCZA 3PIOA 4JRQA 2RD1A 3CD6A 5GAMd 4QVZA 2DD4A 1H641 1G3WA 3CCLT 4UC4A 5HY6A 2B8AA 1LNXA 4LDWA 3WXMB 2VGNA 3CXCA 1YIJT 2D6FA 1G3YA 2RJDA 4M75G 1QVPA 2WACA 4ZGDB 2FHDA 4X9CA 1S72T 2L3RA 3VU3C 1BYMA 1YIJA 2R58A 4C0DC 3I56A 4C5IA 2E12A 3QZ5B 1D3BA 2RHYA 4FT2A 2HBPA 3QJYA 4CI0C 1KHCA 2RI2A 2AHJB 5LJ5d 5GAN8 2HQEA 3M53A 4R56A 4NL3A 3CCQA 5CAIA 5D6YA 4IUVA 3QSUA 5J3BA 3OYBA 3TEEA 2DKGA 4M75A 3JCMW 1BI3A 1KQSS 1M4ZA 3C95A 3GLXA 3OBWA 3CC2T 4J6XA 2DXCA 2MAMA 3GIBA 2OAUA 2GFAA 2K3YA 4FL6A 3CCVT 1TH7A 2P0QA 2ZPGB 4M77F 1K73U 2FYKA 2K5IA 3C4SA 4C92B 5GAN4 1VQKA 2F5TX 2EJGA 1KC8C 2KMTA 2DTHA 4QQDA 5LJ5h 2VV5A 4XU0A 3OYFA 3C12A 1YJNA 4PJOC 1M9SA 4N4HA 4O5VA 4JJNK 2OTLA 4M7AC 2RHIA 4HCCA 4OF1A 3FC3A 3SWNC 3CCMA 3QBYA 4C8QE 1SSFA 2K2VA 2K57A 3A5ZB 2EQJA 1U8RA 4L6V5 1BI0A 4A53A 3CCLA 1M90C 5CR2A 3NTKA 1B34B 3HL8A 3G6ET 3CC4A 4NL2A 2ZPEB 3EFSA 1ZQ1A 3HHTB 4J8OA 2ZZDA 3A8GB 2QEXA 4XTYA 3P8DA 2RHXA 4XU2A 1HK9A 2R5AA 4XTXA 3SB2A 3OYKA 1JRIA 1VQMA 4RG2A 4CRIA 3V7CA 4M75D 5GMKj 3V8JA 2DJZA 5J26A 3JAME 4N0AA 3OS0A 3HRUA 4C8QC 4OMFB 3CCST 5FU7C 2DVEA 1YJWT 4OVAA 1QVFA 2RHZA 2DO3A 2XDBA 3ZBDA 3CC7A 3G7ZA 4IUUA 4HA8A 4RCBA 3BY7A 4PJOE 2M0OA 5GANd 2Y90A 5CCAA 2BUDA 3OYEA 1BIAA 5C6SA 3OYMA 1K8AC 5C0MA 3BFMA 3FB9A 2XKOC 2X4YA 3SD4A 4E7KA 1YCYA 4M7DB 1UEBA 4PJOD 1FWZA 3LH0A 4DOWA 4LD9K 3PTAA 1Q86C 1FX7A 4QVCA 2MF2A 5CIUA 3OQ5A 3G71A 4L59A 1X01A 2XI9A 3RMQA 3URGA 3X26B 3E19A 4M78G 2QQ9A 3TREA 3X24B 3J81E 3NFCA 2RK1A 3A8LB 4XTVA 3KUFA 2PUOB 3LGFA 2LQKA 3LX7A 5LJ5j 4KUDK 3CCRA 5GMKi 1OZ3A 2E64A 1BI2A 2DPPB 2JNGA 2XHCA 1HXDA 4VUBA 3WVDB 1VQ6A 3I55T 1K8AU 4JS5A 3OSVA 3CD6T 1VQ5T 4BI8B 3G6EA 2JTFA 2LC4A 2RH2A 2HD0A 5HK3A 4M75C 4A4HA 4M78A 3J7AF 2LCLA 5CVIA 2EQUA 1Y7XA 2WSFE 3OSSC 4ME7A 5GAMj 3FDRA 5CQXA 2KK4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L2R A;  3OYL A;  4QVZ A;  5D6W A;  4EDU A;  3S3N A;  4UC4 A;  2B8A A;  3O8V A;  3DB4 A;  5D6X A;  3L42 A;  3OS2 A;  2RJD A;  3FEO A;  3L2Q A;  3QII A;  2WAC A;  3PMI A;  2FHD A;  2G3R A;  3P8H A;  1G5V A;  1OI1 A;  2D9T A;  2DIQ A;  2L3R A;  3PNW C;  4A4E A;  4BD3 A;  5M9O A;  4QQ6 A;  1WJR A;  2R58 A;  3E9G A;  2IG0 A;  3LGL A;  2VYT A;  2E5Q A;  3PMT A;  4C5I A;  3BDL A;  5J39 A;  3OMC A;  2RHY A;  4NS5 A;  2EFI A;  2LVM A;  1WJS A;  1KHC A;  2RI2 A;  4E7L A;  2HQE A;  2GFU A;  5D6Y A;  4IUV A;  3CEY A;  3MEW A;  3OYB A;  4E7H A;  2R57 A;  2EKO A;  4C5H A;  3LYI A;  2E6N A;  2HQX A;  3OYA A;  4FU6 A;  3OYH A;  2GFA A;  2K3Y A;  4FL6 A;  4B9W A;  3OA6 A;  2DAQ A;  3L2U A;  4BDZ A;  4BE1 A;  4C5E A;  1MHN A;  2LCC A;  3C4S A;  2RJC A;  3OYI A;  2RO0 A;  2QQS A;  1WJQ A;  3QKJ A;  2RJF A;  2RHU A;  3H8Z A;  2RJE A;  4QQD A;  4PL6 A;  3OS1 A;  3OYF A;  2MWO A;  2DIG A;  2LDM A;  2BKD N;  3QJ6 A;  4Z02 A;  4N4H A;  3MEA A;  4E7J A;  3S3O A;  3S3M A;  4QQG A;  2RHI A;  3FC3 A;  2M1H A;  3MEU A;  2X4X A;  1OZ2 A;  3OB9 A;  3MP1 A;  3QBY A;  4BDY A;  1SSF A;  2EQJ A;  3MO8 A;  2YRV A;  4PLL A;  2L8D A;  3MEV A;  1N27 A;  3NTK A;  3MP8 A;  3OYG A;  4IKF A;  4BAC A;  2MWP A;  3ASK A;  5KCO A;  4N4G A;  3MET A;  4II1 A;  2O4X A;  1WGS A;  3DLM A;  3M9Q A;  4PLI A;  5KCH A;  3P8D A;  2LRQ A;  2R5M A;  2RHX A;  4BE2 A;  3F70 A;  4A4G A;  2R5A A;  3OYK A;  3GOX A;  4ZTF A;  2K3X A;  4RG2 A;  4CRI A;  5J26 A;  4N4I A;  2PQW A;  4B9X A;  3OS0 A;  4LD6 A;  3LLR A;  4OVA A;  2RHZ A;  4X34 A;  2NLU A;  2RI5 A;  4IUU A;  4IUP A;  5IAY A;  2M0O A;  2GF7 A;  2P0K A;  2BUD A;  3ME9 A;  3OYM A;  5C6S A;  5FRO A;  3UWN A;  3OYE A;  5FRM A;  5C0M A;  3NTH A;  2X4Y A;  3SD4 A;  4E7K A;  1XNI A;  3OYD A;  3OYC A;  3LH0 A;  3UT1 A;  4IUQ A;  4QW2 A;  3OY9 A;  2X4W A;  5CIU A;  2RI3 A;  5KH6 A;  4BE0 A;  3OQ5 A;  4E7I A;  2LTO A;  3S6W A;  3DB3 A;  4L59 A;  4IUR A;  3EAE A;  5KE2 A;  5KE3 A;  1H3Z A;  5FRN A;  4ZTJ A;  3KUF A;  3LGF A;  2XDP A;  3ZEH A;  3LX7 A;  2F5K A;  3H6Z A;  3E9F A;  1OZ3 A;  3FLG A;  3OYN A;  3Q1J A;  5IN1 A;  4A4F A;  2BIV A;  3L2W A;  2X35 A;  2L89 A;  3MP6 A;  2XK0 A;  2JTF A;  4GY5 A;  4Q5W A;  3PFS A;  4A4H A;  2CKK A;  4C5G A;  1RI0 A;  2EQM A;  3OYJ A;  2EQK A;  2EQU A;  2QQR A;  2O4X B;  3NTI A;  3OMG A;  2JZ2 A;  4IUT A;  2M16 A;  4HCZ A;  3FDR A;  1OYX A;  3L2V A; 
#chains in the Genus database with same CATH topology
 3P8B B;  2DNU A;  2RA2 A;  1W2B S;  3N5B B;  2HNI A;  4ZGE B;  2VKN A;  2ZGW A;  1KQS P;  2H3E B;  1D1B A;  3SWN A;  5LJ3 h;  2G3R A;  5DM7 R;  5GAO q;  4M77 C;  2K5L A;  2KT1 A;  1NM7 A;  1AWJ A;  1YBY A;  5J39 A;  1BKB A;  3OMC A;  1K8A R;  1ZLM A;  1RAF B;  2Y4X A;  4LNP A;  1VQN T;  3CME T;  2LNH B;  1BIB A;  1Y0M A;  4JRK A;  2RPN A;  3HRT A;  2RJF A;  1EIF A;  3G4S A;  3LWI A;  2MWO A;  3M0Q A;  2LDM A;  1X6B A;  2BKD N;  4BY6 B;  4HT8 A;  4DBQ A;  4HCB A;  1UE9 A;  1JEG A;  1KHI A;  1SRL A;  3M5A A;  1ZSG A;  2KRO A;  1UHF A;  1NPR A;  2GCX A;  3CPW S;  1T0H A;  2EJF A;  1VQP Q;  2XDD A;  2O4X A;  2HCK A;  2LRQ A;  1QP3 A;  4Z88 A;  2DD5 A;  1VQ4 Q;  2PZ1 A;  3M4G A;  4AT1 B;  4CC3 A;  3CCE T;  1C0M A;  3L2Z A;  1YJW Q;  1LPL A;  2KBT A;  1U1S A;  4JRP A;  5FRM A;  4B6M A;  1WHK A;  2GQV A;  2RF0 A;  2KSS A;  1GFC A;  2RI3 A;  1VQP A;  1RL2 A;  3PE0 A;  4E7I A;  2XG8 D;  3EAE A;  5KE2 A;  2HSP A;  2YLB A;  4DA4 A;  2XDP A;  4C0D B;  1NJI R;  2ZPB B;  2FVU A;  4EIK A;  2LCS A;  1VQL Q;  4Q5W A;  2BZ8 A;  2X9H A;  4M77 A;  4C5G A;  1G8X A;  2KY9 A;  1LVK A;  4M7A F;  1N6A A;  1XQH A;  1ZA2 B;  5I22 A;  1U1T A;  3ULR B;  1QVG S;  4XTZ A;  3M54 A;  1VQ8 A;  4M77 G;  3C94 A;  3OS2 A;  2QQB A;  4D6W A;  5GAN 6;  4DBR A;  3O5Z A;  2EBP A;  1WJR A;  3CPF A;  4RTU A;  3BDL A;  4PJJ A;  4JDS A;  4RKU E;  2LVM A;  3JB9 H;  4KUL A;  2KNB B;  2CH4 W;  4HVU A;  2DX1 A;  4OGE A;  2A28 A;  1GL5 A;  4C5H A;  2VXE A;  4OB2 B;  2W10 A;  2CP0 A;  3L2U A;  2DL3 A;  1TG0 A;  1BK2 A;  1AT1 B;  1WHG A;  1JQQ A;  1Q7Y U;  2L3Q A;  2EW3 A;  7AT1 B;  1VQ5 A;  2RQW A;  4C92 D;  2QGG A;  2CZ1 B;  2DL8 A;  1VQK Q;  1VOM A;  4YTL A;  1VQ8 T;  5FWB A;  1X6O A;  3JCM b;  3ZFJ A;  4J9B A;  3F70 A;  5IT9 E;  5DLO A;  1VQ9 A;  1G83 A;  3CCQ Q;  1MMG A;  3QUI A;  1UDL A;  3FJ5 A;  1IGU A;  2HL3 A;  4M75 B;  5IH2 A;  5CKD A;  4JZ3 A;  2E5K A;  3G4S T;  4C8Q D;  5EC7 A;  1I5L A;  1ZUY A;  3JCM X;  1M8M A;  4J9H A;  4MML A;  1MMD A;  4C0F A;  2KRS A;  1VQO Q;  1PKS A;  3FLG A;  5GAN 5;  3Q1J A;  3WVE B;  1IRE B;  5AT1 B;  2COZ A;  2XK0 A;  4C92 C;  2DM1 A;  1WLP B;  1RAA B;  4MZP A;  2OTJ Q;  2P4T A;  1CKB A;  2O88 A;  2M51 A;  2M02 A;  2KQW A;  2HMA A;  1LCK A;  3JB9 J;  3DB4 A;  2DF6 A;  2L3S A;  2YT6 A;  2DZC A;  4FCY A;  1MV0 B;  1G5V A;  1AHJ B;  2E5Q A;  1Z9Z A;  2QTX A;  1ABO A;  3CBP A;  4E47 A;  3GNF B;  4XQ3 A;  2GFU A;  5GAO p;  1OEB A;  2O2O A;  3CBO A;  3MEW A;  4M77 D;  3LYI A;  1AWO A;  4D8K A;  5GMK e;  1NEG A;  3U23 A;  4J9E A;  3RDV A;  3H8Z A;  1TWB A;  5KYX B;  4PL6 A;  4J6Y A;  4M7D C;  5GJV B;  2X4J A;  4Z02 A;  2FRW A;  4FSX A;  4M7A E;  2LT4 A;  1NEB A;  2J6K A;  1KQS A;  3HFO A;  3HKS A;  2PNI A;  1UGV A;  3EG0 A;  4II1 A;  3EH2 A;  4R0K A;  2YHT A;  2EWN A;  1KC8 U;  2VB6 A;  2PQW A;  2EIF A;  3GP8 A;  3VRZ A;  2M9U A;  1PNJ A;  2LMJ A;  4PNO A;  3UWN A;  1GCQ C;  3BDU A;  5CKE A;  3VUZ A;  4XU1 A;  5I21 A;  1K76 A;  4EMH A;  2QEX Q;  2V8J A;  1K73 R;  1Q82 R;  1QWF A;  2WSE E;  2EGC A;  4C8Q A;  5FLX E;  4ZTJ A;  2XMF A;  2ZCF B;  2KAF A;  4M7A A;  2A08 A;  2C0T A;  3BW1 A;  3E9F A;  3PT9 A;  5GAN 7;  2CGH A;  3H0H A;  4RG8 A;  4EMK B;  2JS0 A;  1YWO A;  3PFS A;  2K9G A;  1ZBX A;  4C8Q G;  3RMS A;  2FZC B;  2QQR A;  2O4X B;  3M0S A;  4GLK A;  2PTK A;  4Y92 A;  1KFZ A;  4BI4 A;  6AT1 B;  4HCZ A;  2OX7 A;  1BCM A;  4QVZ A;  2DD4 A;  1G3W A;  3VS4 A;  3VS3 A;  2D6F A;  1G3Y A;  4HXJ A;  1QVP A;  4M75 G;  4ZGD B;  2JM8 A;  2SEM A;  2L3R A;  1YIJ A;  3QZ5 B;  5GAN 8;  2AHJ B;  2HQE A;  4AMC A;  1M3C A;  4IUV A;  5J3B A;  4RTW A;  3EGD B;  2E4H A;  2QAS A;  3GIB A;  2KE9 A;  1MMA A;  1TH7 A;  3CCV T;  3CCR Q;  3PVL A;  2F5T X;  3D7S B;  4LXC A;  2VV5 A;  4OF1 A;  3CCM A;  2K57 A;  3A5Z B;  4L6V 5;  1FYN A;  3NTK A;  3CC4 A;  1D0Y A;  3EFS A;  4K11 A;  2RQV A;  3A8G B;  2QEX A;  2FG0 A;  2NUT B;  1GBR A;  2FZG B;  1JRI A;  4RG2 A;  2NUT A;  4OMO A;  2EVR A;  4N0A A;  5KYY A;  3HRU A;  3JAM E;  4ORZ A;  5FU7 C;  4OVA A;  2RHZ A;  2YUP A;  1D1C A;  4PJO E;  4HA8 A;  4RCB A;  3BY7 A;  2M0O A;  5CCA A;  3OYM A;  1QLY A;  3FB9 A;  1YCY A;  1FWZ A;  2AK5 A;  2O9S A;  2FPF A;  1FX7 A;  3I5S A;  1YJN Q;  3G71 A;  4L59 A;  1X01 A;  3RMQ A;  3URG A;  3J81 E;  1G2B A;  5KYN A;  3NFC A;  2RK1 A;  2PUO B;  1D09 B;  3CCR A;  1KSW A;  4VUB A;  2DEU A;  3CD6 T;  1VQ5 T;  1TSF A;  2GTJ A;  2JTF A;  2LCL A;  8ATC B;  4ME7 A;  5D7U A;  5GAM j;  3M0T A;  2QAZ A;  1VA7 A;  3S3N A;  1Q82 C;  3FEO A;  2LNV A;  4BB7 A;  1SHF A;  1T3S A;  1X69 A;  3GBQ A;  1UB4 A;  5M9O A;  2DK3 A;  1QW1 A;  2CZ0 B;  5ECA A;  1V29 B;  1WFW A;  1QVF P;  2ZPF B;  3NGP A;  4KGZ B;  3CXC P;  2YUQ A;  1K4U S;  2HQX A;  3VJP A;  2AZV A;  1AWX A;  3CCR T;  2GQI A;  3EFR A;  3CCU A;  4EPC A;  2HKN A;  2J6F A;  3MCA B;  5LJ3 d;  3G71 T;  2OTL Q;  3T9N A;  3MEA A;  2YUO A;  2D0N A;  2FEI A;  4DBF A;  2L8D A;  4FYW B;  5LJ5 e;  2JVV A;  5GJW B;  3MP8 A;  3CC7 Q;  2CS7 A;  5FW9 A;  2CRE A;  1KQ1 A;  5KCH A;  3SFM A;  1ZSZ A;  2LT1 A;  5GAO l;  4A54 A;  2DYI A;  2NUP A;  4B9X A;  4KGX B;  3RKW A;  2E10 A;  2QYZ A;  2RI5 A;  1VQL T;  4IUP A;  5IAY A;  4ELY C;  3V7R A;  3AHU A;  5CKF A;  1KIK A;  3G6E Q;  3VS5 A;  4DBH A;  5IXF A;  1YHQ T;  1W2B A;  2AKL A;  2B86 A;  2DE0 X;  1I81 A;  2AZS A;  5LL6 S;  2EYQ A;  1YIT T;  2MOX A;  1PG5 B;  3JCM f;  1AWW A;  3VKI A;  2BIV A;  3BE3 A;  2HSE B;  2MIO A;  4RUG A;  4JRI A;  3H0I A;  1LJO A;  1Q81 U;  1SF9 A;  1TU0 B;  1GCQ A;  3MHX A;  4EMK A;  1IRX A;  3CME A;  1K73 C;  4M78 C;  3CBM A;  2KVQ G;  4JJC A;  3CMA T;  4C92 E;  1YJ9 T;  2D9T A;  4LN2 A;  4QQ6 A;  3M55 A;  1VQM Q;  3E9G A;  5I2M A;  1KD1 R;  3KXT A;  1S72 Q;  4E7S A;  2NYS A;  2L5Q A;  3UPU A;  5A0D A;  1R77 A;  1P92 A;  5GAM g;  1VQP T;  3CPW A;  1SSH A;  2MYS A;  4M7D E;  4HVW A;  4BUG A;  1OX9 A;  2JMC A;  2VWF A;  4XTU A;  1HSQ A;  3VS1 A;  2RB6 A;  2LJ1 A;  8AT1 B;  1ZUK A;  1QWE A;  1VQ6 T;  4ZN1 A;  2KT8 A;  1ARK A;  4OMM A;  5KCO A;  4N4G A;  3MET A;  4F7U G;  3RIR A;  1JU5 C;  2RM4 A;  3EGX B;  4FT4 A;  5GAN e;  1WQ7 A;  2V1Q A;  1OPK A;  4LD6 A;  1X75 C;  2PU9 B;  2I0N A;  4HT9 A;  2NLU A;  2XID A;  3VRY A;  2GF7 A;  4F7U A;  1YJW A;  1ABQ A;  2OTJ T;  2FZK B;  3J80 E;  3OYC A;  1V76 A;  4RTZ A;  1H8K A;  1M1K U;  2FPD A;  3QYG B;  4HVV A;  1VQ5 Q;  3JSC A;  4MZM A;  1AZG B;  1TS9 A;  1AVZ C;  3DB3 A;  5FRN A;  3EGU A;  4C8Q B;  2MMP A;  3OYN A;  2X3X D;  4GY5 A;  1ACM B;  1B07 A;  1QKW A;  2YSQ A;  1UJY A;  3HP9 A;  3PIP A;  2OI3 A;  1VIF A;  1SKU B;  3HPW A;  1M2V A;  4IUT A;  1X2K A;  3L2R A;  3QO3 A;  1H3H A;  1D1A A;  5LJ5 g;  3PMI A;  4AFQ C;  2EYX A;  2EGA A;  2YUN A;  4BD3 A;  4J83 A;  3I55 A;  3EGX A;  5GAN 3;  2DTO A;  2E65 A;  4Z89 A;  2IVW A;  3GPL A;  2L3P A;  1RAE B;  2HEQ A;  1XOV A;  1Q7Y C;  3JB9 G;  3LH5 A;  2RJC A;  2RO0 A;  2QQS A;  2DBK A;  3CXC S;  3VUB A;  2JT4 A;  1M3B A;  1Y71 A;  4JUV A;  3H41 A;  3HSB A;  3S3O A;  1UUE A;  3A8H B;  1ZX6 A;  1QCN A;  1KD1 U;  1YNZ A;  3E2U A;  2CSQ A;  4PLL A;  5GMK l;  4FYX B;  4LDY A;  1RI9 A;  4PFZ A;  2DRM A;  5L8R E;  1AOJ A;  1M2V B;  2QA4 T;  3HFN A;  5GMK m;  2F69 A;  4A4G A;  1PWT A;  1I4K 1;  1U06 A;  2LQN A;  2L2P A;  2QXF A;  2CP2 A;  2DEQ A;  3V8K A;  3CMA Q;  3JRZ A;  2JOY A;  5FRO A;  1YN8 A;  1AEY A;  2EYY A;  1NBE B;  5LJ3 f;  4J9I A;  2CUB A;  3OW2 P;  4RTY A;  1MNE A;  1W6X A;  1GXI E;  5FU6 C;  3CCV A;  2VGM A;  2XD0 A;  4BE0 A;  3RKX A;  2ZPI B;  1PHT A;  1MND A;  5A2Q E;  3VS2 A;  4XTW A;  3EFO B;  3OBY A;  2IPO B;  4JJD A;  1K0X A;  1WXB A;  4MZT A;  3SHW A;  3IQL A;  4TVR A;  4A4F A;  1M27 C;  4J6W A;  3MP6 A;  5LJ5 f;  2DZ9 A;  2A7Y A;  3CCJ Q;  2CKK A;  3I35 A;  3M58 A;  2W0Z A;  2M16 A;  2GBQ A;  4C8Q F;  4JRQ A;  4Z8A A;  3CCL T;  1H64 1;  4ESR A;  1NYF A;  5HY6 A;  2B8A A;  4KH1 B;  1LNX A;  1YIJ T;  1SHG A;  2RJD A;  2FHD A;  4E2F B;  1WI7 A;  5KYW A;  4CI0 C;  3CCQ A;  3M53 A;  2DKG A;  1KQS S;  1BI3 A;  3C95 A;  4J6X A;  2DXC A;  2RMO A;  2GFA A;  2K3Y A;  2KEA A;  4M77 F;  2FYK A;  3CD6 Q;  4PK4 A;  1VQK A;  1HYO A;  1WA7 A;  4QQD A;  4XU0 A;  4O5V A;  2OTL A;  3AT1 B;  2RHI A;  3FC3 A;  1SSF A;  1FMK A;  2EQJ A;  4IIM A;  1BI0 A;  4A53 A;  1M90 C;  2ZPE B;  3I9Q A;  2ZZD A;  3EGD A;  2DET A;  2RHX A;  4XU2 A;  4XTX A;  1VQM A;  4RTX A;  3V7C A;  5GMK j;  3V8J A;  4HCK A;  4C8Q C;  1OU9 A;  3CC7 A;  3G7Z A;  3CPW P;  2Y90 A;  3OYE A;  1K8A C;  1BCO A;  1TXQ A;  1UG1 A;  2X4Y A;  2RN8 A;  3SD4 A;  3SEM A;  4M7D B;  1UEB A;  3EFO A;  5KYW B;  4PJO D;  3LH0 A;  1S1N A;  1Q86 C;  4QVC A;  5CIU A;  3OQ5 A;  3E19 A;  1MUZ A;  1WHH A;  2A0F B;  4XTV A;  3LGF A;  3LX7 A;  5LJ5 j;  1KJW A;  2ED0 A;  5GMK i;  1OZ3 A;  1BI2 A;  3H0F A;  2XHC A;  1HXD A;  2G6F X;  2QK0 A;  4FSS A;  4BI8 B;  3G6E A;  2RH2 A;  1CSK A;  2EQU A;  4AG1 C;  2GGR A;  5CQX A;  2JJ9 A;  2KK4 A;  1PD1 A;  4P5N A;  4PJO A;  3OA6 A;  3LGL A;  2J6O A;  3I55 Q;  1JO8 A;  1VQ4 A;  1TTH B;  2GTO A;  2EYZ A;  4FYV B;  4PJO F;  4A4K A;  3OYA A;  4V2S A;  3CC4 Q;  1MHN A;  2V8I A;  2HBW A;  1MGQ A;  2K79 A;  1NLP C;  1RUW A;  5GAM e;  3CC2 Q;  2CH4 A;  3M57 A;  1Y07 A;  4F17 A;  1N8R R;  3REB B;  4OP0 A;  4QQG A;  1K9M U;  2M1H A;  1NYG A;  3MEU A;  2YDL A;  1NLO C;  1Y96 A;  2LP5 A;  4AFS C;  1BI1 A;  4OML A;  2FL7 A;  1YJ9 Q;  2E41 A;  4BAC A;  4M7A D;  3TSZ A;  3ASK A;  4J9C A;  1RAD B;  4XU3 A;  3RES A;  1YP5 A;  2C06 A;  3M56 A;  3QZ9 B;  2R5M A;  5HKC A;  2L0A A;  2YXY A;  1VYT A;  4C92 F;  3JCM e;  2JMA A;  4N4I A;  1C1A A;  2LQ8 A;  2LQW A;  1YIJ Q;  4J9G A;  1EFN A;  5CK9 A;  2P0K A;  2K2M A;  2PVD B;  4LDU A;  2NWM A;  2DJQ A;  1YIT Q;  1I0C A;  3UT1 A;  4IUQ A;  2VVK A;  1SPK A;  1WHJ A;  2X4W A;  4OB1 B;  3QG1 A;  3E1S A;  2QQA A;  3EHQ A;  1H3Z A;  1WHM A;  1SEM A;  2CT3 A;  1K1Z A;  3H6Z A;  2JXB A;  4F14 A;  1YWP A;  5IN1 A;  3CCS Q;  1Z9Q A;  1SG5 A;  1ZHI A;  4LDX A;  2D0Q B;  5I11 A;  2EQK A;  3RNJ A;  2EAY A;  3RR6 A;  3L2V A;  5D6W A;  3OS5 A;  4JZ4 A;  3R6N A;  1B34 A;  2DRK A;  3OW2 A;  5DLQ E;  1QMC A;  3UDC A;  1RLQ C;  1VQ4 T;  5CKB A;  3PMT A;  1VIE A;  4M7D F;  5KYX A;  1VYV A;  4FYY B;  4M7A G;  1QKX A;  2PVG B;  3MPU B;  2JW4 A;  2EKO A;  4L5G A;  1N8R C;  2J7I A;  4OMQ A;  2DAQ A;  4MMK A;  1M1F A;  3CCM Q;  5GAO m;  4J7I A;  2P0P A;  3HRS A;  1UGP B;  1Y96 B;  1T0J A;  4DQ2 A;  1UGQ B;  1E6G A;  2F2X A;  4M78 E;  1DJ7 B;  2V26 A;  4AG2 C;  4E7J A;  2LJ3 A;  3VYG A;  3MEV A;  1EZZ B;  4M78 D;  1K9M R;  5FWC A;  3JB9 F;  4Y28 E;  1WIE A;  3PGG A;  5EG2 A;  4ZN3 A;  4PLI A;  4F7U E;  4N0A C;  1N8R U;  4ZTF A;  2MPX C;  3HTR A;  4F7U F;  2VUB A;  5GAM h;  1PCX A;  1G3S A;  1PSE A;  4PJO B;  2E70 A;  2VAS A;  2EJ9 A;  4PKC C;  4M7A B;  3SWN B;  1VQ9 T;  1RLP C;  2QGF B;  2BZX A;  3JV3 A;  2D1X A;  4M7D G;  1TUC A;  2J05 A;  3OY9 A;  4QW2 A;  4XAX B;  1JXO A;  2AKK A;  5A0L A;  2CZ6 B;  1I07 A;  4D8D A;  3CCJ A;  3VS0 A;  3DKM A;  2SRC A;  4M75 E;  2P84 A;  5CO7 A;  1QVG P;  3V7S A;  3G1J A;  4XK8 E;  3JCM Q;  3ER0 A;  2BE7 D;  1XTD A;  4HKE A;  3VYH B;  3TQ7 P;  3QDR B;  2LJ0 A;  3OYL A;  2PUK B;  5D6X A;  3L42 A;  4LUD A;  3QII A;  3PNW C;  3KBG A;  2AT1 B;  3X25 B;  1IXD A;  5GAN 2;  3I56 T;  1YFN A;  3UF4 A;  1WJS A;  4E7L A;  1HD3 A;  1TUG B;  3CCU T;  2JUF A;  2RNA A;  3EHR A;  4AFU C;  1OV3 A;  2J06 A;  2KR3 A;  3NPF A;  4J5Y A;  4B9W A;  4FIB A;  4M77 E;  3QKJ A;  1I8F A;  3TCJ A;  1IO6 A;  1JJ2 P;  5LJ3 g;  4OB0 B;  4ELZ C;  3QDF A;  3OS1 A;  1K9M C;  4RTV A;  1IHV A;  1Y57 A;  1R8O B;  3X20 B;  3JCM P;  2X4X A;  4M78 B;  1D0X A;  1UEC A;  2KXD A;  1YI2 A;  1RAH B;  5LJ3 e;  2HZY A;  3UAT A;  1K0S A;  2F2V A;  3OYG A;  1JJ2 S;  2MWP A;  3A8O B;  3JB9 D;  1VQ7 T;  2YLC A;  2EYW A;  2O01 E;  4FW2 A;  3TVT A;  1VQ9 Q;  1FMW A;  4KT0 E;  2JS2 A;  1W70 A;  5IHN A;  2ROL A;  4BY6 C;  1XJW B;  3ME9 A;  5KYU A;  3FJP A;  2CUD A;  1LOJ A;  3OYD A;  1O9S A;  4M77 B;  3EG1 A;  1OOT A;  1X6G A;  1VQ7 A;  2Z0W A;  4M78 F;  5KH6 A;  3CCM T;  3RBB B;  1M30 A;  2ZPH B;  2VC8 A;  2KYB A;  5L23 A;  4X9D A;  2EGE A;  3CCS A;  2F5K A;  1NJI U;  2DXB A;  3CC7 T;  2K6D A;  3EG2 A;  2L89 A;  1Q86 U;  1V1C A;  2EQM A;  1VQN Q;  5KYY B;  4QKU A;  4J7F A;  2QEX T;  2EPD A;  3REA B;  3NHN A;  3PIO A;  1BBZ A;  1H92 A;  4UC4 A;  1GBQ A;  2D8H A;  3EG9 B;  3WXM B;  3CXC A;  1TUD A;  1R0C B;  2ABL A;  2MCN A;  4OMP A;  2R58 A;  4C0D C;  4C5I A;  2AIR B;  1WDX A;  2ROT A;  1D3B A;  5LJ5 d;  3CCS T;  1KHC A;  2X3W D;  4R56 A;  4NL3 A;  3QSU A;  5CAI A;  3OYB A;  3TEE A;  3JCM W;  2OAW A;  3GLX A;  1ZA1 B;  2OAU A;  2P0Q A;  2ZPG B;  1K73 U;  2K5I A;  1N5Z A;  3C4S A;  4C92 B;  2O31 A;  2EJG A;  1KC8 C;  2DTH A;  1OPL A;  1YJN A;  4PJO C;  4JJN K;  4F16 A;  4M7A C;  3UA7 A;  2HQH A;  1RAG B;  5CR2 A;  1B34 B;  1UJ0 A;  1ZQ1 A;  3HHT B;  4J8O A;  1KC8 R;  4CC2 A;  3PVQ A;  1VQ7 Q;  4M7D D;  2V1R A;  3H9N A;  4J9D A;  4CRI A;  1OU8 A;  2NUZ A;  1WYX A;  4M75 D;  5J26 A;  3OS0 A;  4OMF B;  5IHK A;  1YJW T;  4GBQ A;  1QVF A;  2XDB A;  2DO3 A;  3ZBD A;  1YCS B;  4IUU A;  2FPE A;  1WX6 A;  1BIA A;  5C0M A;  2KGT A;  2JTE A;  2DVJ A;  2COW A;  2MF2 A;  2P4R A;  1IB8 A;  4JPB W;  2XI9 A;  3X26 B;  4M78 G;  1B7T A;  1ZBJ A;  2QQ9 A;  1PRL C;  3A8L B;  1J3T A;  4QT7 A;  1WXT A;  2E64 A;  2JNG A;  2E3I A;  1VQ6 A;  3I55 T;  2KRM A;  2LC4 A;  2HD0 A;  4M75 C;  3ZL7 C;  4A4H A;  2ZAE A;  1AZE A;  4M78 A;  3J7A F;  2DL5 A;  1Y7X A;  2WSF E;  1ZUU A;  1VQO T;  1RAC B;  2CZ7 B;  5GAM f;  2K4Y A;  3L2Q A;  1X2Q A;  2HL5 C;  4PJL A;  3P8H A;  1OI1 A;  1VQK T;  1WNL A;  2CYZ B;  1S72 A;  4PJM A;  2F2W A;  4JLG A;  4MDW A;  4NS5 A;  3DLL A;  1NE8 A;  5HK0 A;  5HCK A;  2D8J A;  5KYU B;  1G3T A;  1FMV A;  3OYH A;  1JXM A;  5IHI A;  4R55 A;  2E6Z A;  1JBM A;  2QTV A;  1Q82 U;  1QVG A;  2IIM A;  1QQJ A;  2OTJ A;  1M8V A;  5GAN h;  3OW2 S;  1M90 R;  3G4S Q;  2DIG A;  3GF5 A;  4M4Z A;  2BE9 B;  2DXU A;  1B3Q A;  2QA4 A;  1OZ2 A;  3OB9 A;  3MP1 A;  4QVD A;  1WQW A;  1UFF A;  3QHS A;  4NOY A;  2DMO A;  3M0U A;  4IKF A;  5FU6 B;  3NMZ C;  1YI2 T;  1M3A A;  4BE2 A;  3M9Q A;  2DER A;  2I2L A;  3QWY A;  2KDS A;  4PFO A;  1KQ2 A;  3NTH A;  1NJI C;  4BI3 A;  1K9A A;  3CQT A;  4FM4 B;  3R6O A;  2PVO B;  2COY A;  2C0O A;  3JCM c;  4CC7 A;  1KK7 A;  2GNC A;  2DLP A;  3A1P A;  4RTT A;  1WPY A;  4FW1 A;  3S6W A;  2ATC B;  4IUR A;  1FXX A;  4O6J A;  4IIO A;  1VQ6 Q;  3MKD A;  4OB3 B;  2X35 A;  1Q81 R;  1M1K C;  5GAN f;  1IZ6 A;  1RI0 A;  3CCE Q;  5FU7 B;  3VS7 A;  1KG1 A;  2CSI A;  1TOV A;  4E6R A;  2CDT A;  2XIC A;  4EDU A;  3LW5 E;  3O8V A;  2BZY A;  2XU8 A;  1WZO A;  3CMA A;  2JTM A;  1NPP A;  2DIQ A;  4A4E A;  1M1G A;  3CCJ T;  4J9F A;  3A8M B;  2VYT A;  5GMK h;  2EFI A;  2DXT A;  2HAX A;  2R57 A;  4LUE A;  3CCL Q;  3L1A A;  2YWW A;  1UGS B;  1IHW A;  4BE1 A;  4BDZ A;  1BB9 A;  4C5E A;  1Q95 G;  2RHU A;  2KXC A;  1UTI A;  1MMN A;  3CCU Q;  1VQL A;  2QDY B;  1M2O A;  1ZSZ B;  4BDY A;  2RK2 A;  1X43 A;  3MO8 A;  2YRV A;  1QCO A;  3RER A;  3M0R A;  1GCP A;  3FRN A;  2C0I A;  1N9S A;  3DLM A;  3I56 Q;  2DTI A;  2DL4 A;  3GOX A;  4EMK C;  1Q7Y R;  4M7D A;  3LWH A;  3VV0 A;  1CKA A;  3M4Y A;  3INZ A;  9ATC B;  1M90 U;  3I5R A;  2VXF A;  3V8L A;  4JS4 A;  1M1K R;  3JCM g;  1Q81 C;  1YHQ A;  4Y91 A;  4KRT A;  4GLM A;  1JJ2 A;  2MI6 A;  2QG9 B;  3M59 A;  1QP2 A;  1SRM A;  4C0G A;  3CC4 T;  1VQN A;  3X28 B;  1MV3 A;  1YJ9 A;  1T3L A;  1E7O A;  2JM9 A;  3EG9 A;  1N9R A;  3G71 Q;  2OTL T;  4M75 F;  3JCM J;  1YJN T;  2WSC E;  3CCV Q;  4DOV A;  1UGR B;  5GAO n;  3JCM h;  2V8K A;  3OYJ A;  1U3O A;  3OMG A;  3NTI A;  1PC0 A;  2RQT A;  3QJ6 A;  3S3M A;  3TU4 K;  3OYY A;  1PRM C;  2HDA A;  5A0G A;  3QXE B;  4DEX A;  5GAN g;  1VQ8 Q;  4X1V A;  2ECZ A;  3CCQ T;  4ZGJ B;  2LX9 A;  5AYF A;  3A98 A;  2IG0 A;  2A3L A;  1IGQ A;  1EX4 A;  4EMG A;  2O9V A;  1HJD A;  3FIF A;  3KFV A;  4LDV A;  2CP5 A;  3CEY A;  4E7H A;  5IXB A;  1VUB A;  5CKH A;  1UHC A;  2E6N A;  4FU6 A;  2RQU A;  1W4S A;  1NZ9 A;  4KBM B;  2LCC A;  3OYI A;  5DY9 A;  2YRD A;  1WJQ A;  2DBM A;  1OUL A;  4KUI A;  4ATO A;  1GFD A;  2A37 A;  2KYM A;  3QPH A;  2RJE A;  2OJ2 A;  4E7Z A;  4LE9 A;  4C0Z A;  4RMO A;  2QI2 A;  1JB0 E;  4WF2 A;  1U5S A;  5GAO r;  1YHQ Q;  1YIT A;  1W2B P;  4PJO G;  3MJX A;  2K5F A;  3SDZ A;  1N27 A;  3JB9 I;  1PD0 A;  1RAB B;  3JCM d;  4CC4 B;  1QCF A;  1D3B B;  1WGS A;  4MDX A;  2E3H A;  4OGC A;  1M5Q 1;  1D0Z A;  2H3J A;  2JN0 A;  2K3X A;  1E6H A;  1GRI A;  3LLR A;  4X34 A;  4C92 A;  5LJ3 j;  2FB7 A;  1KD1 C;  1PSF A;  2Y4Y A;  1XNI A;  2E1H A;  4JLI A;  5GAN j;  2K7A A;  4PJN A;  2DIL A;  3RKY A;  4C92 G;  2LTO A;  3CCE A;  3CC2 A;  3THK A;  4RCC A;  5KE3 A;  1BU1 A;  1NG2 A;  1OX8 A;  3JCM V;  2X51 A;  3GNG A;  3ZEH A;  5CQY A;  4F7U B;  1QVF S;  4ZNX A;  3L2W A;  2LZ6 B;  1VQO A;  2H8H A;  1X27 A;  1VQM T;  2RQR A;  3EH1 A;  3RUX A;  1O75 A;  2YRC A;  5I2S A;  2JZ2 A;  3QYH B;  1WHL A;  2RD1 A;  1C6V X;  3CD6 A;  5GAM d;  4LDW A;  2VGN A;  4WTO B;  4AFZ C;  1Q86 R;  3QWX X;  2WAC A;  4X9C A;  1S72 T;  3VU3 C;  2CP7 A;  1BYM A;  1WXU A;  1ZSZ C;  3I56 A;  3TSW A;  2E12 A;  2RHY A;  4FT2 A;  2HBP A;  3QJY A;  2RI2 A;  2FRY A;  2CP3 A;  5D6Y A;  4M75 A;  1M4Z A;  4WCI A;  3OBW A;  1PM3 A;  3CC2 T;  2MAM A;  1YI2 Q;  4FL6 A;  4PFP A;  4F04 B;  2KRN A;  5GAN 4;  2KMT A;  3UA6 A;  5LJ5 h;  2QA4 Q;  2ENM A;  4OMN A;  3OYF A;  3C12 A;  1I1J A;  1RAI B;  1M9S A;  4N4H A;  4HCC A;  3SWN C;  1R0B G;  3QBY A;  3M0P A;  4C8Q E;  2K2V A;  1U8R A;  1I5O B;  3CCL A;  3HL8 A;  3G6E T;  4NL2 A;  2M0Y A;  2FO0 A;  2HKQ B;  4XTY A;  3P8D A;  3C0C A;  3SB2 A;  1HK9 A;  2CP6 A;  2R5A A;  3OYK A;  2DJZ A;  2DVE A;  1AD5 A;  1A0N B;  3CME Q;  2BTT A;  5GAN d;  2BUD A;  2EKH A;  5C6S A;  2ED1 A;  3BFM A;  4A63 B;  2XKO C;  2EQI A;  2DYB A;  4E7K A;  1F1B B;  2MK5 A;  2ESW A;  4DOW A;  4LD9 K;  3PTA A;  3EG3 A;  3VS6 A;  4JJB A;  1W1F A;  1PKT A;  1VYU A;  4ANJ A;  2QDL A;  3TRE A;  3X24 B;  2A36 A;  3KUF A;  2LQK A;  4KUD K;  4DEY A;  2DPP B;  2LX7 A;  4KGV B;  3WVD B;  1OQK A;  1K8A U;  4JS5 A;  3OSV A;  2NUP B;  2KI7 A;  5HK3 A;  2DA9 A;  4KH0 B;  2K3B A;  5CVI A;  3OSS C;  2CT4 A;  2F1L A;  2DFU A;  2DL7 A;  3FDR A;  1OYX A; 
#chains in the Genus database with same CATH homology
 3P8B B;  2RA2 A;  1VQO T;  1W2B S;  3N5B B;  3S3N A;  1Q82 C;  2HNI A;  4ZGE B;  2CZ7 B;  5GAM f;  4M7D D;  2K4Y A;  2ZGW A;  3L2Q A;  4P5N A;  3FEO A;  2LNV A;  3SWN A;  5LJ3 h;  4BB7 A;  2G3R A;  3P8H A;  1G5V A;  5DM7 R;  1OI1 A;  5GAO q;  4PJO A;  4M77 C;  1VQK T;  2K5L A;  1UB4 A;  5M9O A;  2DK3 A;  1QW1 A;  1WNL A;  1YBY A;  2CZ0 B;  3LGL A;  5J39 A;  3OA6 A;  2CYZ B;  1BKB A;  1S72 A;  4MDW A;  3OMC A;  4JLG A;  4NS5 A;  1VQ4 A;  1V29 B;  1NE8 A;  5HK0 A;  3DLL A;  2ZPF B;  2Y4X A;  1G3T A;  4PJO F;  1VQN T;  3CME T;  4A4K A;  2HQX A;  3OYA A;  4V2S A;  3VJP A;  3OYH A;  1BIB A;  4R55 A;  2E6Z A;  1JBM A;  1QVG A;  1Q82 U;  1MHN A;  4JRK A;  2V8I A;  3CCR T;  1MGQ A;  3HRT A;  3EFR A;  3CCU A;  4EPC A;  2OTJ A;  2RJF A;  5GAM e;  1EIF A;  3G4S A;  1M8V A;  5GAN h;  3OW2 S;  3LWI A;  3MCA B;  3M57 A;  2MWO A;  5LJ3 d;  2DIG A;  1Y07 A;  3GF5 A;  3G71 T;  2LDM A;  4BY6 B;  2BKD N;  3T9N A;  4HT8 A;  3MEA A;  4OP0 A;  4QQG A;  4HCB A;  2QA4 A;  2DXU A;  2M1H A;  3MEU A;  1K9M U;  1OZ2 A;  3OB9 A;  3MP1 A;  1Y96 A;  1KHI A;  4QVD A;  1BI1 A;  2L8D A;  1WQW A;  3M5A A;  2FL7 A;  5LJ5 e;  2JVV A;  3QHS A;  4NOY A;  1NPR A;  2E41 A;  3MP8 A;  5FU6 B;  4IKF A;  4BAC A;  2GCX A;  1YI2 T;  3ASK A;  4M7A D;  2CS7 A;  4XU3 A;  2EJF A;  3RES A;  2XDD A;  3CPW S;  2O4X A;  2C06 A;  3M56 A;  3QZ9 B;  1KQ1 A;  4BE2 A;  3M9Q A;  5KCH A;  3SFM A;  2LRQ A;  2LT1 A;  2R5M A;  5GAO l;  4A54 A;  5HKC A;  1QP3 A;  2DD5 A;  4C92 F;  3M4G A;  3JCM e;  2I2L A;  4N4I A;  4B9X A;  2LQ8 A;  3CCE T;  3L2Z A;  2KDS A;  3RKW A;  2E10 A;  2RI5 A;  1VQL T;  4IUP A;  5IAY A;  5CK9 A;  4ELY C;  1U1S A;  2P0K A;  3V7R A;  4JRP A;  5FRM A;  1KQ2 A;  2PVD B;  4LDU A;  3NTH A;  3AHU A;  1NJI C;  4BI3 A;  2GQV A;  5CKF A;  4FM4 B;  3R6O A;  3UT1 A;  2PVO B;  4IUQ A;  2KSS A;  2X4W A;  3JCM c;  1YHQ T;  1W2B A;  2RI3 A;  1VQP A;  1RL2 A;  1WPY A;  4OB1 B;  4E7I A;  3S6W A;  1I81 A;  3QG1 A;  4IUR A;  2XG8 D;  5LL6 S;  3E1S A;  2QQA A;  3EAE A;  5KE2 A;  1FXX A;  4O6J A;  1H3Z A;  2YLB A;  4DA4 A;  2EYQ A;  1YIT T;  2XDP A;  3JCM f;  3H6Z A;  4C0D B;  5IN1 A;  3VKI A;  4OB3 B;  2BIV A;  2X35 A;  2ZPB B;  2FVU A;  1M1K C;  1ZHI A;  4Q5W A;  5GAN f;  4LDX A;  4JRI A;  4M77 A;  2D0Q B;  1IZ6 A;  4C5G A;  1RI0 A;  2KY9 A;  1LJO A;  2EQK A;  2EAY A;  1Q81 U;  5FU7 B;  1KG1 A;  4M7A F;  1N6A A;  1XQH A;  1U1T A;  1OYX A;  3MHX A;  4EMK A;  2XIC A;  3L2V A;  1QVG S;  4XTZ A;  3M54 A;  5D6W A;  4EDU A;  1VQ8 A;  3OS5 A;  3CME A;  1K73 C;  3LW5 E;  3O8V A;  4M78 C;  3CBM A;  4M77 G;  2KVQ G;  1B34 A;  3C94 A;  2XU8 A;  2QQB A;  3OS2 A;  4D6W A;  3OW2 A;  5DLQ E;  3CMA A;  3UDC A;  2JTM A;  1NPP A;  2D9T A;  2DIQ A;  4C92 E;  5GAN 6;  1VQ4 T;  4A4E A;  5CKB A;  1YJ9 T;  1M1G A;  1WJR A;  3M55 A;  3E9G A;  3A8M B;  3PMT A;  2VYT A;  1VIE A;  3CPF A;  4QQ6 A;  3BDL A;  5I2M A;  3KXT A;  4JDS A;  4M7D F;  4RKU E;  5GMK h;  2EFI A;  2LVM A;  3JB9 H;  4M7A G;  2L5Q A;  2PVG B;  3UPU A;  4KUL A;  2DXT A;  5A0D A;  2HAX A;  2R57 A;  2EKO A;  4OGE A;  1P92 A;  4L5G A;  5GAM g;  1N8R C;  4C5H A;  3L1A A;  2VXE A;  4OB2 B;  1UGS B;  1VQP T;  3CPW A;  4BE1 A;  3L2U A;  4BDZ A;  2DAQ A;  4MMK A;  4C5E A;  4M7D E;  1M1F A;  5GAO m;  4BUG A;  4J7I A;  2P0P A;  1Q7Y U;  3HRS A;  1UGP B;  2RHU A;  4XTU A;  1Y96 B;  4DQ2 A;  1UGQ B;  4M78 E;  1VQ5 A;  2RB6 A;  1DJ7 B;  4C92 D;  1VQL A;  1VQ6 T;  4E7J A;  2QDY B;  3VYG A;  4ZN1 A;  4BDY A;  2RK2 A;  3MO8 A;  2YRV A;  2CZ1 B;  3MEV A;  4M78 D;  3RER A;  4YTL A;  1VQ8 T;  3JB9 F;  1X6O A;  3FRN A;  4Y28 E;  5KCO A;  3JCM b;  1N9S A;  3MET A;  3PGG A;  4N4G A;  5EG2 A;  4ZN3 A;  3ZFJ A;  3CMA T;  3DLM A;  4F7U G;  4PLI A;  3RIR A;  4F7U E;  2RM4 A;  4FT4 A;  3F70 A;  4N0A C;  2DTI A;  1N8R U;  4ZTF A;  3GOX A;  5GAN e;  1WQ7 A;  4EMK C;  5DLO A;  4F7U F;  5IT9 E;  2VUB A;  5GAM h;  1VQ9 A;  4M7D A;  3LWH A;  3VV0 A;  1G3S A;  3M4Y A;  3INZ A;  4LD6 A;  1X75 C;  2PU9 B;  1PSE A;  3QUI A;  4HT9 A;  1M90 U;  2NLU A;  2XID A;  4PJO B;  2GF7 A;  2E70 A;  4PKC C;  2EJ9 A;  4M7A B;  4M75 B;  4F7U A;  3SWN B;  1YJW A;  2VXF A;  3V8L A;  5CKD A;  1VQ9 T;  4JS4 A;  3JCM g;  1Q81 C;  3G4S T;  4C8Q D;  2OTJ T;  3J80 E;  4M7D G;  3OYC A;  1YHQ A;  4Y91 A;  3OY9 A;  4QW2 A;  1I5L A;  1M1K U;  1JJ2 A;  2MI6 A;  4XAX B;  3M59 A;  3QYG B;  1QP2 A;  3JCM X;  3JSC A;  5A0L A;  4MML A;  4MZM A;  4C0G A;  2CZ6 B;  3CC4 T;  1VQN A;  3X28 B;  3DB3 A;  4C0F A;  3CCJ A;  5FRN A;  1YJ9 A;  3DKM A;  4M75 E;  4C8Q B;  2MMP A;  3FLG A;  1N9R A;  5CO7 A;  5GAN 5;  3Q1J A;  3WVE B;  3V7S A;  3OYN A;  2OTL T;  4XK8 E;  1IRE B;  4M75 F;  3JCM Q;  3ER0 A;  3JCM J;  1YJN T;  2WSC E;  2XK0 A;  4GY5 A;  4C92 C;  1UGR B;  4DOV A;  3HP9 A;  3PIP A;  5GAO n;  1XTD A;  4HKE A;  2V8K A;  1VIF A;  3JCM h;  3VYH B;  3OYJ A;  3HPW A;  3OMG A;  3NTI A;  4MZP A;  2P4T A;  4IUT A;  3QDR B;  3QJ6 A;  3S3M A;  3L2R A;  3TU4 K;  3OYL A;  3QO3 A;  3OYY A;  2KQW A;  2PUK B;  5A0G A;  3DB4 A;  3QXE B;  5D6X A;  3JB9 J;  3L42 A;  5LJ5 g;  3QII A;  5GAN g;  3PMI A;  2DZC A;  3PNW C;  3CCQ T;  3KBG A;  4BD3 A;  2LX9 A;  5AYF A;  3X25 B;  4ZGJ B;  1AHJ B;  2A3L A;  2IG0 A;  2E5Q A;  4J83 A;  5GAN 2;  3I55 A;  2QTX A;  4EMG A;  5GAN 3;  3I56 T;  3FIF A;  3CBP A;  4E47 A;  1WJS A;  4E7L A;  3GNF B;  2DTO A;  4XQ3 A;  2E65 A;  4LDV A;  2GFU A;  5GAO p;  3CCU T;  3CBO A;  2JUF A;  3CEY A;  3MEW A;  4E7H A;  2IVW A;  3GPL A;  4M77 D;  1VUB A;  3LYI A;  5CKH A;  2E6N A;  4J5Y A;  1XOV A;  4FU6 A;  1Q7Y C;  4B9W A;  1W4S A;  3JB9 G;  1NZ9 A;  4KBM B;  2LCC A;  5GMK e;  2RJC A;  3OYI A;  2RO0 A;  4FIB A;  5DY9 A;  2QQS A;  4M77 E;  1WJQ A;  3QKJ A;  3VUB A;  4KUI A;  1I8F A;  3TCJ A;  3CXC S;  4ATO A;  1Y71 A;  3H8Z A;  5LJ3 g;  3QPH A;  4JUV A;  2RJE A;  4OB0 B;  4ELZ C;  4PL6 A;  4J6Y A;  3OS1 A;  4M7D C;  4C0Z A;  1K9M C;  2X4J A;  4RMO A;  3HSB A;  4Z02 A;  3S3O A;  2QI2 A;  1JB0 E;  3A8H B;  1R8O B;  4FSX A;  4WF2 A;  3X20 B;  5GAO r;  4M7A E;  3JCM P;  2X4X A;  4M78 B;  2LT4 A;  1YIT A;  4PJO G;  1KD1 U;  1YI2 A;  4PLL A;  5GMK l;  2K5F A;  5LJ3 e;  3SDZ A;  1N27 A;  1KQS A;  3JB9 I;  3HFO A;  3HKS A;  3OYG A;  4LDY A;  1JJ2 S;  2MWP A;  3JCM d;  3A8O B;  3JB9 D;  4II1 A;  5L8R E;  1D3B B;  1VQ7 T;  2YLC A;  1WGS A;  2YHT A;  2QA4 T;  2EWN A;  4MDX A;  3HFN A;  1M5Q 1;  4OGC A;  2F69 A;  2O01 E;  4A4G A;  5GMK m;  1KC8 U;  2H3J A;  2JN0 A;  1I4K 1;  2K3X A;  4KT0 E;  2PQW A;  2QXF A;  3LLR A;  4X34 A;  2EIF A;  4BY6 C;  3GP8 A;  2DEQ A;  2M9U A;  3V8K A;  4C92 A;  5LJ3 j;  3JRZ A;  2FB7 A;  3ME9 A;  2JOY A;  4PNO A;  5FRO A;  3FJP A;  3UWN A;  3BDU A;  5CKE A;  1KD1 C;  1PSF A;  3VUZ A;  2Y4Y A;  4XU1 A;  1LOJ A;  1XNI A;  5LJ3 f;  5I21 A;  3OYD A;  1O9S A;  2E1H A;  1GXI E;  4M77 B;  4JLI A;  5FU6 C;  5GAN j;  1VQ7 A;  3CCV A;  2VGM A;  4EMH A;  2XD0 A;  4M78 F;  5KH6 A;  3RKY A;  2V8J A;  3RKX A;  2ZPI B;  4C92 G;  3CCM T;  4BE0 A;  2LTO A;  3CCE A;  5A2Q E;  3CC2 A;  4RCC A;  2WSE E;  2ZPH B;  4XTW A;  2VC8 A;  3OBY A;  4C8Q A;  5KE3 A;  4X9D A;  5FLX E;  4ZTJ A;  2ZCF B;  3GNG A;  2KAF A;  3JCM V;  3ZEH A;  4F7U B;  5CQY A;  4M7A A;  3CCS A;  2F5K A;  3BW1 A;  3E9F A;  4MZT A;  2DXB A;  3PT9 A;  2CGH A;  5GAN 7;  4TVR A;  1NJI U;  3CC7 T;  1QVF S;  4A4F A;  3L2W A;  1VQO A;  4J6W A;  2L89 A;  3MP6 A;  1Q86 U;  4RG8 A;  5LJ5 f;  2DZ9 A;  4EMK B;  3CCJ T;  2A7Y A;  3PFS A;  1VQM T;  2CKK A;  2EQM A;  3RUX A;  1ZBX A;  1O75 A;  3M58 A;  4C8Q G;  3RMS A;  4J7F A;  2QQR A;  2O4X B;  4GLK A;  5I2S A;  2QEX T;  2JZ2 A;  3QYH B;  2M16 A;  4BI4 A;  4C8Q F;  4HCZ A;  3PIO A;  4JRQ A;  2RD1 A;  3CD6 A;  5GAM d;  4QVZ A;  2DD4 A;  1H64 1;  1G3W A;  3CCL T;  4UC4 A;  5HY6 A;  2B8A A;  1LNX A;  4LDW A;  3WXM B;  2VGN A;  3CXC A;  1YIJ T;  2D6F A;  1G3Y A;  2RJD A;  4M75 G;  1QVP A;  2WAC A;  4ZGD B;  2FHD A;  4X9C A;  1S72 T;  2L3R A;  3VU3 C;  1BYM A;  1YIJ A;  2R58 A;  4C0D C;  3I56 A;  4C5I A;  2E12 A;  3QZ5 B;  1D3B A;  2RHY A;  4FT2 A;  2HBP A;  3QJY A;  4CI0 C;  1KHC A;  2RI2 A;  2AHJ B;  5LJ5 d;  5GAN 8;  2HQE A;  3M53 A;  4R56 A;  4NL3 A;  3CCQ A;  5CAI A;  5D6Y A;  4IUV A;  3QSU A;  5J3B A;  3OYB A;  3TEE A;  2DKG A;  4M75 A;  3JCM W;  1BI3 A;  1KQS S;  1M4Z A;  3C95 A;  3GLX A;  3OBW A;  3CC2 T;  4J6X A;  2DXC A;  2MAM A;  3GIB A;  2OAU A;  2GFA A;  2K3Y A;  4FL6 A;  3CCV T;  1TH7 A;  2P0Q A;  2ZPG B;  4M77 F;  1K73 U;  2FYK A;  2K5I A;  3C4S A;  4C92 B;  5GAN 4;  1VQK A;  2F5T X;  2EJG A;  1KC8 C;  2KMT A;  2DTH A;  4QQD A;  5LJ5 h;  2VV5 A;  4XU0 A;  3OYF A;  3C12 A;  1YJN A;  4PJO C;  1M9S A;  4N4H A;  4O5V A;  4JJN K;  2OTL A;  4M7A C;  2RHI A;  4HCC A;  4OF1 A;  3FC3 A;  3SWN C;  3CCM A;  3QBY A;  4C8Q E;  1SSF A;  2K2V A;  2K57 A;  3A5Z B;  2EQJ A;  1U8R A;  4L6V 5;  1BI0 A;  4A53 A;  3CCL A;  1M90 C;  5CR2 A;  3NTK A;  1B34 B;  3HL8 A;  3G6E T;  3CC4 A;  4NL2 A;  2ZPE B;  3EFS A;  1ZQ1 A;  3HHT B;  4J8O A;  2ZZD A;  3A8G B;  2QEX A;  4XTY A;  3P8D A;  2RHX A;  4XU2 A;  1HK9 A;  2R5A A;  4XTX A;  3SB2 A;  3OYK A;  1JRI A;  1VQM A;  4RG2 A;  4CRI A;  3V7C A;  4M75 D;  5GMK j;  3V8J A;  2DJZ A;  5J26 A;  3JAM E;  4N0A A;  3OS0 A;  3HRU A;  4C8Q C;  4OMF B;  3CCS T;  5FU7 C;  2DVE A;  1YJW T;  4OVA A;  1QVF A;  2RHZ A;  2DO3 A;  2XDB A;  3ZBD A;  3CC7 A;  3G7Z A;  4IUU A;  4HA8 A;  4RCB A;  3BY7 A;  4PJO E;  2M0O A;  5GAN d;  2Y90 A;  5CCA A;  2BUD A;  3OYE A;  1BIA A;  5C6S A;  3OYM A;  1K8A C;  5C0M A;  3BFM A;  3FB9 A;  2XKO C;  2X4Y A;  3SD4 A;  4E7K A;  1YCY A;  4M7D B;  1UEB A;  4PJO D;  1FWZ A;  3LH0 A;  4DOW A;  4LD9 K;  3PTA A;  1Q86 C;  1FX7 A;  4QVC A;  2MF2 A;  5CIU A;  3OQ5 A;  3G71 A;  4L59 A;  1X01 A;  2XI9 A;  3RMQ A;  3URG A;  3X26 B;  3E19 A;  4M78 G;  2QQ9 A;  3TRE A;  3X24 B;  3J81 E;  3NFC A;  2RK1 A;  3A8L B;  4XTV A;  3KUF A;  2PUO B;  3LGF A;  2LQK A;  3LX7 A;  5LJ5 j;  4KUD K;  3CCR A;  5GMK i;  1OZ3 A;  2E64 A;  1BI2 A;  2DPP B;  2JNG A;  2XHC A;  1HXD A;  4VUB A;  3WVD B;  1VQ6 A;  3I55 T;  1K8A U;  4JS5 A;  3OSV A;  3CD6 T;  1VQ5 T;  4BI8 B;  3G6E A;  2JTF A;  2LC4 A;  2RH2 A;  2HD0 A;  5HK3 A;  4M75 C;  4A4H A;  4M78 A;  3J7A F;  2LCL A;  5CVI A;  2EQU A;  1Y7X A;  2WSF E;  3OSS C;  4ME7 A;  5GAM j;  3FDR A;  5CQX A;  2KK4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...