1VIEA

Structure of dihydrofolate reductase
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
60
structure length
60
Chain Sequence
b'PSNATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHYDROFOLATE REDUCTASE
publication title A plasmid-encoded dihydrofolate reductase from trimethoprim-resistant bacteria has a novel D2-symmetric active site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 12
structure length 60
sequence length 60
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 1996-10-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.60 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1vieA00
2P4TA 2RK1A 2VV5A 2OAUA 2GQVA 3T9NA 2RK2A 1VIFA 1VIEA 3UDCA 2RH2A 3SFMA
chains in the Genus database with same CATH superfamily
4RG2A 2JNGA 2BE7D 5FRMA 1M9SA 2RQWA 5A0GA 1ABQA 4L59A 1YBYA 1U06A 2KBTA 5GAN5 2KXCA 3LWIA 4HT8A 1Y57A 3OMGA 1NJIR 1JBMA 1OYXA 1VQ4Q 4C92B 2DTOA 5LJ5d 2DL3A 3L2QA 3S3MA 2VXFA 2ATCB 2GQIA 2VB6A 4E7KA 2PVDB 4M7DD 2VYTA 2QXFA 3EG9A 2MWOA 4PLIA 3GPLA 4ELYC 2CP3A 2FYKA 2X4XA 2HCKA 2NUTB 1UB4A 2Z0WA 1HJDA 4RTVA 1S72Q 1D1AA 1SF9A 1P92A 5CKDA 1FX7A 4ELZC 2K4YA 2XICA 2YRVA 1K9AA 4PJOG 4XK8E 4OMOA 5EC7A 3OYHA 4ZTJA 4PJOE 1I8FA 5ECAA 2F2VA 3G1JA 2A36A 3MP6A 5LJ5f 4F7UB 2RHIA 2LCLA 1KHCA 2AKLA 2ZPHB 1VQKQ 2K5FA 3M58A 5KYYB 1WXBA 2ECZA 5LJ3j 1Z9QA 3URGA 3PFSA 1YHQA 2J05A 1Y7XA 2JN0A 1YJWQ 5J3BA 2M02A 4EMKC 4FM4B 3VS2A 5IXFA 1JJ2S 2Y90A 2ZCFB 4M7AG 4J9CA 4AG2C 2YLBA 4BE2A 2FO0A 1AD5A 4M7AE 1WQ7A 1YHQT 3C94A 3CMEA 4DEXA 3I5RA 1QVFS 5GAN7 1VQ5A 1D1CA 3RIRA 5GAN2 5FLXE 2JS0A 2V8IA 5FU7B 2GTOA 3MEUA 1UTIA 2H8HA 3C4SA 1NG2A 2M1HA 3CCJA 4MZMA 1SRLA 3FEOA 2IIMA 3CMET 3ZL7C 1W2BS 1VQ5T 5EG2A 4BY6C 5GAMj 1Q81U 3RKXA 4C8QD 1V29B 1AZGB 4AG1C 2L2PA 3CCSA 1DJ7B 3P8HA 1WIEA 1WZOA 3OY9A 3CPWS 1QVFA 3CCJT 1SSFA 1WHJA 1YP5A 1NYFA 1JXMA 4M75F 1YCYA 2K3BA 3OYGA 1YJNT 1VIEA 2D8HA 4XU0A 1XJWB 2FG0A 1M2VB 3OYAA 2K57A 4EIKA 4A4HA 1YJNQ 4OP0A 1K73C 1KD1C 3CCST 2RJFA 3A8MB 3FDRA 3C95A 4HCKA 1W2BA 3PGGA 4KBMB 3QG1A 4FYYB 3BE3A 3RDVA 4M4ZA 4NL2A 1KSWA 4ZNXA 3CD6Q 2JTMA 2CT4A 2DXBA 2P0KA 1QCNA 1SEMA 4RTYA 2LNHB 3QJ6A 1OI1A 3SEMA 5KYUA 3EG3A 2ZPIB 3JB9G 4FSXA 2J06A 2KVQG 3SFMA 2DD4A 1ZQ1A 1D1BA 4CC2A 1VQPA 3KFVA 2JOYA 2DVEA 1M5Q1 5I11A 3JCMb 1B7TA 1EZZB 3WXMB 4E7HA 1YIJQ 3H8ZA 5GAMd 3EFRA 2V1QA 5KH6A 4JRKA 1WJQA 2NUPB 4D6WA 2K3YA 2FRYA 1VQPT 3PMTA 2RMOA 4RTUA 1UFFA 4A4FA 4JRQA 3NGPA 2KK4A 2FZKB 3EFOA 1KC8U 1AWOA 2WSFE 2CZ7B 5LL6S 1WHHA 4V2SA 4M78F 3NTHA 1K9MR 2CREA 4O6JA 3ZBDA 4PJOA 2DAQA 1WJSA 3X20B 2P4TA 1JRIA 4C5EA 5IN1A 1M8VA 1GFCA 2VWFA 3N5BB 4HCBA 2DF6A 1OPLA 4LUEA 1WPYA 2Y4YA 5KCOA 3HRUA 5GAMf 4RTZA 3CCQA 2KDSA 3OW2P 1UJYA 5AT1B 5KYWB 2KRMA 5IH2A 3OYLA 3DKMA 4C0DC 1OX9A 4J9DA 2O01E 1KFZA 2E65A 2RF0A 4M77C 1E6GA 3BFMA 2KAFA 4DOWA 2BIVA 1KQSS 2E3IA 3FJPA 3ZFJA 4X9CA 1M1KU 3CC7Q 2LQWA 5GAOm 4M7AA 5J39A 2XDPA 3R6NA 1E6HA 4NL3A 2F5TX 4ZN3A 3CCVA 1SSHA 2O9SA 3CXCP 3CC2T 1Q82U 3QKJA 2EBPA 2X3XD 1LJOA 5A0LA 4OMNA 1U1SA 2NWMA 3MO8A 3CC2Q 5DM7R 4UC4A 2L5QA 3CCVT 5KCHA 2RK2A 4E7JA 2F69A 2JM9A 3REAB 4DBRA 4HVVA 3CBMA 3M57A 5CIUA 3CCMQ 2E4HA 1VQ9A 3L2ZA 4F17A 1KJWA 2OI3A 2QA4Q 1RLQC 1OU8A 1PCXA 1IXDA 1IGUA 2LDMA 3GF5A 2OTLA 2CP5A 4M78B 2D0NA 2EGAA 4TVRA 4YTLA 1MMNA 1I81A 3V8KA 3A1PA 3BDLA 2JTFA 1VQ7A 1M90C 3RESA 3JCMV 3OW2A 4A4GA 4B6MA 2FPFA 1VQ9T 9ATCB 2JMAA 1JO8A 3RKYA 2X35A 2OTLT 2JUFA 1WNLA 1N27A 3RKWA 5IHKA 5DY9A 3JCMh 1K8AC 2CYZB 3QIIA 1VQ7T 1BI1A 4AFSC 3VS1A 3U23A 1MGQA 1MHNA 4J7IA 3CC4A 4KULA 1NE8A 5I22A 5D7UA 4XQ3A 1BU1A 2XHCA 1T0JA 1QKXA 1X43A 1RAEB 2RO0A 3DLMA 5CK9A 1YN8A 4QVCA 1QVGP 2EFIA 4N0AC 4J9FA 4FCYA 3CC4T 2XG8D 1QWFA 3CCLQ 3GOXA 4FW2A 1S1NA 4M7DG 2HD0A 4ZN1A 4ZGEB 1AWJA 4EMHA 4Z8AA 3EGDB 3FIFA 4FYWB 1Y0MA 1X6BA 5HY6A 4M7DE 1KIKA 5CKFA 2H3EB 2K9GA 4C0GA 3UDCA 3GIBA 3OMCA 3NPFA 3OYBA 2QQBA 1B34B 1BI0A 1R77A 4HXJA 2KYBA 1Q81R 2ZZDA 3A98A 3NTKA 2EYXA 1UHCA 3KBGA 2PU9B 4QQGA 1TXQA 2K2MA 3X26B 3QZ5B 5KYNA 3EAEA 1UGQB 3JCMc 1YCSB 5HK0A 3VS4A 1K0SA 5FU6B 5GAN8 4OB2B 2D9TA 1TSFA 1BCOA 4XTXA 4E6RA 3KXTA 4D8KA 1M4ZA 4JUVA 2EGCA 1Y96A 1A0NB 4BUGA 3DLLA 4MDWA 4C92C 1VYTA 1GCQC 4BD3A 3FLGA 2PNIA 4QT7A 1ARKA 4B9XA 1QW1A 5CKEA 3TSZA 3FB9A 2FEIA 1K73U 4OMFB 1ZSZB 4F7UG 2VVKA 1KD1U 5GAOp 2ENMA 3UF4A 2XKOC 2DMOA 2K79A 3MP8A 2P0PA 3JB9H 1VQOA 1NLPC 4L6V5 1KG1A 5GJVB 2DL8A 4FYXB 3G6ET 4X9DA 2EGEA 3FC3A 5D6WA 3G6EQ 5CQXA 1VIFA 5CR2A 4FYVB 2KYMA 3RMQA 4MDXA 1N9RA 1WFWA 3EG0A 1UG1A 2AHJB 2LX7A 3JCMd 1VQOT 4Y28E 3REBB 1OULA 4FW1A 2E6NA 1BK2A 1W4SA 2RJEA 1KC8R 1YI2A 1M30A 2DXUA 2EIFA 1VQ8Q 1YWOA 2EYQA 1AZEA 1TOVA 2MYSA 3LLRA 3H0IA 1XQHA 3I35A 3MEWA 1T3SA 1KQ1A 4Z88A 2CP0A 2RA2A 3TCJA 3H6ZA 3HKSA 2BZ8A 4RMOA 1IZ6A 4BI8B 4AMCA 5J26A 1MNEA 2QGGA 4NOYA 1VOMA 1H92A 1YI2T 2DLPA 2JT4A 3G7ZA 2QG9B 3JCMf 1Q95G 4N4HA 5FU7C 1NEBA 4OGCA 1MMDA 5A0DA 3SDZA 1LOJA 5CO7A 4PJJA 3RBBB 3CCEA 2GFAA 3OBYA 1N8RU 1HXDA 2DNUA 4BI4A 2PZ1A 3JCMQ 3ASKA 3EG9B 1M1KR 2EWNA 3DB3A 2RQTA 3ME9A 3JSCA 1GBQA 2PTKA 3M4GA 4E47A 2GNCA 4IUUA 1U8RA 1RAIB 2LT4A 4OB1B 2DVJA 3CCET 1BB9A 1X69A 1T3LA 1SRMA 1WQWA 3CBOA 3VYGA 1Q82R 2HL5C 4M7DA 1D0YA 2HEQA 2F2XA 1UDLA 4Z89A 2XIDA 2LX9A 3HL8A 2FZGB 3OB9A 4DA4A 1IB8A 5HKCA 3OYEA 2CSQA 2DPPB 3I55A 2DFUA 2XDBA 4C92D 3QHSA 1N9SA 3SWNA 3CCUA 2B8AA 1IGQA 2HQEA 4X34A 3G4SA 2PUOB 2K5LA 1WI7A 2FPDA 4IUQA 4WTOB 5GAMh 1QVPA 4LDVA 2CP7A 2DJZA 3M0UA 2DBKA 4C0ZA 3CQTA 2BTTA 2EYWA 3OSVA 5GANe 2X51A 2DO3A 3M9QA 1QKWA 2MF2A 3G4ST 2YLCA 4OF1A 2COWA 5GAOn 4XTUA 3TU4K 1TS9A 2L3RA 3NMZC 4II1A 2OTJA 2VGMA 1VYVA 1YNZA 3J81E 3V7CA 1Q7YC 1U1TA 2CUDA 2KT8A 4J8OA 1M90U 1JXOA 4M75G 2LZ6B 4JZ3A 4KUDK 1YHQQ 4M75E 4EPCA 2YUQA 4OMQA 4JJBA 6AT1B 2OTJT 1FXXA 4PJOF 1HSQA 1LPLA 4OMPA 3UA7A 3HFNA 1I0CA 1K8AU 2OAUA 3X24B 2J6FA 3L2RA 2DL7A 2LRQA 1ZUKA 2KGTA 3HTRA 3J7AF 3GLXA 2R57A 3CMEQ 1ZHIA 4M75C 3MJXA 2HBWA 5GAN6 2D6FA 1VQ5Q 3VS7A 1TG0A 2VASA 4C8QA 5IHNA 1B07A 1RAHB 4PJMA 2M0YA 1B3QA 5GMKh 1VQ6A 3CMAA 3CCJQ 2GGRA 3OYYA 1AWXA 2X9HA 5LJ3d 1MV0B 1VYUA 2HQXA 4M7AF 2QAZA 3CEYA 5KYUB 3CCSQ 3TSWA 2JMCA 1VQ6T 1GRIA 3CMAT 2ABLA 5LJ5e 1XTDA 3QZ9B 2PUKB 3V8LA 4J9BA 1ABOA 3VRYA 4A4EA 4BI3A 2OAWA 4PJLA 2AIRB 4CC7A 1AWWA 1VUBA 4M78G 4KT0E 3CCRA 1G2BA 2NUZA 1M27C 2CZ1B 2XK0A 1YJ9A 5LJ3f 2MI6A 1EIFA 2ED1A 3TREA 1KD1R 1Y07A 4ZTFA 4Y91A 2X4WA 5I2MA 1OPKA 2CKKA 4OB0B 3LYIA 3EFOB 3J80E 3VU3C 5GJWB 2VUBA 3CCRT 2DILA 2ZPBB 2OJ2A 4QW2A 4PJOB 4M78C 2QTXA 1X2KA 1YJ9T 3JV3A 2WSEE 4RG8A 2C0OA 4PKCC 1SHFA 3HSBA 4PFZA 1TTHB 5KYXA 2MMPA 1LNXA 2ZGWA 3KUFA 4KRTA 3L2VA 1D09B 4OGEA 1VQPQ 2E64A 1SHGA 2WACA 2IG0A 2W10A 1VQNA 3OSSC 1FMVA 1I07A 2EJGA 3LX7A 4M77G 4JS5A 2DE0X 1GCPA 2E6ZA 4EMKA 1N8RC 3INZA 4M77E 3I9QA 4F14A 1YWPA 3PMIA 3OYNA 2M16A 3MP1A 4FSSA 3JB9F 4GY5A 4LD9K 4QVDA 3MKDA 4M7AB 3MPUB 1I5OB 1XOVA 1VQNT 2E41A 3GNGA 4LDWA 2DK3A 3M56A 1JEGA 1MMGA 2YXYA 5L8RE 1D0ZA 3S6WA 1CKBA 3CCQT 5D6YA 1T0HA 3AT1B 3CCQQ 5KE3A 1PG5B 4M75D 5GANg 2RD1A 5CKBA 2ROTA 2ED0A 2QEXA 4CI0C 3EGXA 3LGFA 1TUGB 4M75A 2J6KA 2XDDA 1AVZC 1M3BA 2DBMA 2R5MA 3OYIA 4IUVA 1N5ZA 1W70A 1H3ZA 1G83A 4HVUA 2W0ZA 4XU1A 5FW9A 2KNBB 3OW2S 2MCNA 3VJPA 1ZBXA 4GLMA 4J7FA 1PWTA 1MV3A 2QEXT 4KH0B 5IHIA 2FHDA 1PSEA 4LNPA 5FWCA 3QUIA 5FU6C 3CCVQ 2B86A 1UHFA 1VQLA 3PIPA 1NM7A 4ZGDB 3G71A 2DL5A 1NYGA 1OU9A 3L2UA 4MZPA 1C1AA 3H0HA 2K3XA 4Y92A 4XTVA 8AT1B 2MIOA 3MEVA 3H9NA 5KE2A 3R6OA 3M53A 2K6DA 3V7SA 4DBQA 1M3CA 1D3BA 2ESWA 2RK1A 1VQLT 1NPPA 3UATA 3G71T 3AHUA 3CXCS 2RI2A 1UUEA 3RERA 1OX8A 1VQ9Q 1ZSZC 2KSSA 1F1BB 4RTTA 4BDYA 3E9GA 2HSEB 3PIOA 2OTLQ 3LW5E 4IUTA 5GAMe 2KT1A 1UGPB 2IPOB 2DEQA 3NFCA 3HP9A 1VQ7Q 4FU6A 4M78D 4ME7A 2CUBA 1C0MA 5GMKi 3EG2A 3QWYA 2L3QA 2RPNA 3E2UA 4KGZB 5LJ5g 2AZVA 1M90R 2RI5A 3CXCA 3L1AA 1OZ2A 3I56A 2RM4A 4IIOA 3L2WA 3QDRB 2LJ3A 4LUDA 3FJ5A 3P8BB 5HK3A 1WHLA 5GMKl 1ZA2B 2E10A 3EHQA 4IUPA 1GFDA 1X6OA 3CC4Q 1K8AR 1BIBA 2R58A 4J9EA 1Q86C 1K76A 1WLPB 1Q7YU 1UGVA 3HRSA 3OYCA 1TUDA 1RAAB 3I56T 2GF7A 3O8VA 2YT6A 1X27A 1WHMA 1C6VX 2SEMA 2DERA 1UJ0A 2EQIA 2LQKA 2KRNA 4RUGA 2FL7A 4C5GA 2XD0A 4ANJA 4C92G 4JDSA 5GANj 2A37A 4M77D 1Y96B 2J7IA 2HL3A 4M77A 2MOXA 2C0TA 2ZPFB 4C92E 1PKTA 3M5AA 1BI2A 2QDYB 2GFUA 1I1JA 3WVEB 5GMKe 2O9VA 2KQWA 2D1XA 4PFOA 1I5LA 4DBFA 2QQSA 3QBYA 4JRPA 1QVGS 3VUZA 2CSIA 3BY7A 1QQJA 1O9SA 2EW3A 4FT2A 1ZA1B 2YSQA 4GLKA 2DZCA 1SKUB 4ESRA 3MHXA 4CC4B 2V1RA 1YITA 3VS6A 5D6XA 1TU0B 2E12A 3EH2A 1FYNA 2LT1A 3JCMP 2JXBA 5DLQE 4E7LA 4M7DF 3LH5A 1X01A 3P8DA 2BZXA 3LWHA 2XU8A 3V7RA 4Z02A 1NZ9A 1D0XA 3WVDB 1YITT 1QVGA 4F7UE 3QYGB 3D7SB 4CRIA 1M8MA 1PNJA 2RI3A 1ACMB 3UA6A 1RI0A 2X4JA 2JW4A 3OYJA 2A3LA 2L89A 1R0CB 1VQMA 4RCCA 3E1SA 3T9NA 2LCSA 2L0AA 1KK7A 3MEAA 1HD3A 1IHWA 2NYSA 1VQOQ 2COYA 2QQAA 5CAIA 5FWBA 1QP2A 1Z9ZA 5LJ5j 1V76A 4RCBA 1TWBA 4JLGA 1UGRB 1GBRA 5FROA 2LQNA 1U3OA 2O4XB 4B9WA 1E7OA 2EQKA 2DJQA 2F1LA 2RHYA 3RR6A 5C6SA 1LVKA 2K2VA 2L8DA 2P0QA 1CSKA 2HSPA 8ATCB 2DETA 1YI2Q 3OS0A 2EQJA 3EGUA 4KGXB 1NJIC 1PSFA 5I2SA 3ER0A 4N0AA 3S3NA 4HCZA 3E9FA 2CDTA 3EH1A 1R8OB 3SHWA 3QO3A 1PD1A 1VQ4A 4OMLA 4E7IA 3ZEHA 5C0MA 4IIMA 2RN8A 4M7DB 2RQVA 1H641 5LJ3h 3L42A 1JU5C 4XTWA 5GAMg 1M3AA 4C8QF 1K1ZA 3UPUA 2AT1B 3GNFB 2OX7A 1JB0E 4HVWA 4WF2A 4MZTA 4LDUA 5I21A 1VQ4T 1M2OA 3CCEQ 1S72A 2LQ8A 3X25B 3BDUA 1UECA 5IT9E 3SWNB 4DOVA 4A63B 3I5SA 2Y4XA 2DIGA 2E3HA 5HCKA 3RUXA 2YDLA 2VKNA 2X3WD 2YUNA 3JRZA 2F2WA 1PD0A 1S72T 4QVZA 1JJ2P 2DL4A 2GTJA 1NEGA 3M59A 3PT9A 4C92A 1AEYA 1GCQA 2QQRA 1VQKA 1TUCA 3O5ZA 2J6OA 4XU3A 1Y71A 2FZCB 3I55T 1QVFP 2GQVA 3GBQA 1YJWA 2MK5A 3JCMJ 4R0KA 4EDUA 3I55Q 3OYKA 3EG1A 4A54A 4DQ2A 2NUTA 3CCUT 2QI2A 2C0IA 4D8DA 1VQKT 2G6FX 2RQUA 4JZ4A 1WA7A 1PKSA 2BUDA 2XMFA 3QDFA 3QWXX 3CCUQ 2P84A 3F70A 3G4SQ 3TQ7P 1W2BP 2CH4W 1I4K1 2CP6A 3SD4A 1G3YA 1RL2A 4PJOC 1YJWT 3E19A 3JCMe 4F04B 3PTAA 3IQLA 4F7UA 4ZGJB 1G3TA 2CT3A 3CPWP 2DYIA 2LJ0A 3VKIA 3OA6A 2AKKA 4LN2A 4BACA 2EKOA 5KYYA 3OS1A 2CGHA 2CZ6B 4C8QB 2RJCA 3VS5A 1MMAA 1R0BG 4LXCA 2OTJQ 1WDXA 1GL5A 2KROA 1AT1B 4J6XA 3JAME 2V8KA 5GAOr 3H0FA 1G3SA 2RHXA 2MPXC 1QWEA 2L3SA 4PK4A 1N6AA 1Q7YR 1KHIA 3M0QA 3M0PA 1IO6A 1ZBJA 2RHZA 1WX6A 4M7AC 2DRMA 1EFNA 2DA9A 2HBPA 2LVMA 1JJ2A 3JCMX 1YJNA 1QLYA 2VV5A 4E2FB 3C0CA 3HPWA 4RTXA 5CKHA 4QKUA 2PQWA 3RNJA 1O75A 4J83A 2EQUA 1Q86U 4Q5WA 2SRCA 3CD6A 1NPRA 4HT9A 2LC4A 4OVAA 2XI9A 2ZAEA 3CBPA 1VQ6Q 4JJNK 2RQRA 3CMAQ 2E5QA 5CCAA 2O2OA 4XTZA 2A28A 4L5GA 1SPKA 2AZSA 2DM1A 1K0XA 2DX1A 3PVQA 3CD6T 2LMJA 3OYFA 2QASA 2DTIA 2JTEA 1TH7A 3PE0A 1VA7A 1IRXA 4M78E 4PFPA 1QCOA 1CKAA 3OS2A 1M2VA 3CPWA 5KYXB 1YIJA 1K73R 4JJDA 2HQHA 4AFZC 1OQKA 3NHNA 3OYMA 4BE0A 3JB9I 4QQDA 2GBQA 1RI9A 2KY9A 2EQMA 2O31A 1K9MC 3FRNA 2VC8A 4A4KA 1X2QA 3CCRQ 4BB7A 3M55A 3GP8A 1G3WA 1PRMC 3TVTA 1YIJT 4EMKB 2YUOA 1YJ9Q 2DTHA 2V8JA 2YWWA 5GMKj 2JZ2A 4KUIA 4PL6A 2CH4A 1ZX6A 4OB3B 1W6XA 1KQSP 1JQQA 2DEUA 5A2QE 1IREB 2QDLA 3X28B 4IKFA 1QCFA 5GMKm 4C5HA 3VS3A 1M1FA 2EVRA 4PJOD 4HKEA 2H3JA 5L23A 2I0NA 4N4IA 4DBHA 2NUPA 1WHKA 3Q1JA 2F5KA 3UT1A 2BE9B 1G5VA 1VQNQ 4BY6B 5IAYA 3EGXB 4M75B 3CC7A 2FPEA 2KE9A 1ZUUA 1RACB 4LE9A 2KEAA 4R55A 1U5SA 2HKQB 1BI3A 2ZPGB 4GBQA 4C0FA 1FMKA 2DXTA 2PVGB 1N8RR 2DRKA 3VV0A 1UEBA 4N4GA 1FWZA 1OEBA 1BKBA 1RADB 3CC7T 3QPHA 3OQ5A 2RJDA 4XAXB 3CC2A 4M7AD 1ZSGA 4IURA 5KYWA 4XU2A 4LDXA 2EJ9A 1NJIU 4OMMA 2V26A 2D0QB 5LJ3e 2KRSA 3JCMg 2RB6A 4M77F 1RABB 1RLPC 3THKA 2GCXA 4CC3A 2JVVA 5IXBA 4C5IA 2NLUA 4LDYA 3CCMA 2EKHA 4R56A 2PVOB 2QA4A 2QEXQ 4FIBA 1D3BB 1MUZA 4MMKA 1PRLC 2VXEA 4JPBW 2M0OA 4JLIA 2I2LA 2A08A 2D8JA 2KXDA 1X75C 1KQSA 2DD5A 2BKDN 2K7AA 1H8KA 2EPDA 2DZ9A 3CCMT 2HKNA 3H41A 2QYZA 1PC0A 2RNAA 2QA4T 2JS2A 1NBEB 3QYHB 2HZYA 1VQLQ 3TEEA 3G71Q 3BW1A 2FB7A 1BIAA 1UGSB 3A5ZB 2LCCA 5GANh 2KR3A 1X6GA 5CVIA 3VUBA 2KMTA 4JS4A 2HAXA 2YRDA 3M0RA 1AHJB 2A7YA 4F16A 4M78A 3A8OB 4A53A 1K4US 4J9GA 3ULRB 4KH1B 2HNIA 4BDZA 2DXCA 1WXTA 1RAFB 3CCLA 2JJ9A 5DLOA 2FRWA 1W1FA 4J9HA 1WYXA 3JB9D 2R5AA 1IHVA 4C0DB 1Q81C 2COZA 2C06A 2M51A 1WXUA 4J6YA 4E7ZA 4FT4A 2E70A 2QK0A 1BYMA 4M77B 3CCLT 1QP3A 2HDAA 3M0TA 4EMGA 3JCMW 4JJCA 3QJYA 2EJFA 4X1VA 3I56Q 3MCAB 3HFOA 3HRTA 2DIQA 4HA8A 1BBZA 1BCMA 3DB4A 2EYYA 1RUWA 1KQ2A 1V1CA 3A8HB 4XTYA 2ZPEB 1G8XA 2X4YA 3OYDA 2E5KA 2QQ9A 2EAYA 4NS5A 4J9IA 1ZUYA 2HMAA 1M1GA 3EGDA 4J6WA 2O88A 5CQYA 1Q86R 4O5VA 2P4RA 4M7DC 1OZ3A 5GAOl 4RKUE 1MNDA 2WSCE 3RMSA 3LH0A 5LJ5h 1HK9A 1B34A 4ATOA 2YRCA 4FL6A 1HYOA 1OV3A 2RHUA 4AFUC 1ZLMA 3PVLA 2EYZA 2CP2A 4MMLA 2IVWA 4HCCA 3A8GB 3SWNC 3JB9J 5GAOq 1PHTA 1PM3A 3M0SA 1FMWA 4JRIA 2QTVA 3QXEB 1GXIE 1H3HA 2L3PA 1J3TA 5GAN4 1YITQ 4AFQC 3G6EA 2JM8A 3A8LB 2K5IA 2QGFB 1WJRA 3M54A 2CS7A 3C12A 4C92F 2MWPA 1KC8C 2AK5A 2LP5A 1UE9A 3S3OA 3QSUA 2KI7A 3VYHB 1SG5A 3HHTB 4AT1B 5GANd 4ORZA 2RH2A 5GAN3 5M9OA 1VQ8A 4LD6A 1RAGB 2DKGA 1ZSZA 1EX4A 4E7SA 2DYBA 5LJ3g 2LTOA 7AT1B 2ROLA 1VQMT 2YUPA 4C8QG 5FRNA 1K9MU 4KGVB 3PNWC 4P5NA 1VQMQ 1VQ8T 4C8QE 4PNOA 1OOTA 1LCKA 1YFNA 4PLLA 4F7UF 1M1KC 4VUBA 3M4YA 4PJNA 2E1HA 2MAMA 5GANf 3NTIA 2A0FB 1WGSA 2YHTA 3SB2A 4C8QC 2CZ0B 3OS5A 4RTWA 3VRZA 1WHGA 2LNVA 1AOJA 2M9UA 3V8JA 3UWNA 4QQ6A 1Q82C 1NLOC 3EHRA 2LJ1A 4BE1A 4K11A 5AYFA 1XNIA 4J5YA 2O4XA 4DEYA 3CPFA 2BZYA 3META 3LGLA 3EFSA 4WCIA 2VGNA 3OBWA 1QMCA 2G3RA 2FVUA 3VS0A
chains in the Genus database with same CATH topology
4CI0C 3LGFA 4M75A 4RG2A 2XDDA 2PQWA 2JNGA 3KBGA 5FRMA 2PU9B 1M9SA 1O75A 4J83A 2EQUA 4QQGA 2R5MA 3X26B 3QZ5B 4IUVA 3EAEA 4L59A 1YBYA 1UGQB 4Q5WA 3OYIA 3JCMc 5GAN5 1NPRA 3CD6A 1H3ZA 5HK0A 3LWIA 4HT8A 3OMGA 5FU6B 1JBMA 5GAN8 1OYXA 4HT9A 2LC4A 4C92B 4OVAA 4XU1A 2XI9A 2DTOA 4OB2B 2D9TA 5LJ5d 3CBPA 5CKBA 3L2QA 3OW2S 3S3MA 3VJPA 1ZBXA 4XTXA 3KXTA 4JJNK 4J7FA 1M4ZA 4JUVA 2E5QA 2VXFA 5CCAA 2QEXT 4E7KA 4XTZA 2PVDB 2FHDA 1PSEA 1Y96A 4L5GA 2VYTA 3QUIA 4M7DD 2QXFA 5FU6C 4BUGA 3DLLA 4MDWA 2MWOA 4PLIA 4C92C 3CD6T 3GPLA 4BD3A 3FLGA 3PIPA 1VQLA 3OYFA 4ELYC 2FYKA 2X4XA 4ZGDB 2DTIA 1TH7A 3G71A 1UB4A 4M78E 3L2UA 4MZPA 1P92A 2K3XA 4B9XA 3OS2A 5CKDA 1FX7A 1QW1A 4XTVA 3CPWA 5CKEA 1YIJA 4ELZC 3MEVA 2K4YA 2XICA 2YRVA 3FB9A 1I5LA 5KE2A 3R6OA 4PJOG 4XK8E 3M53A 4OMFB 3V7SA 4F7UG 3OYMA 1K73U 1KD1U 5GAOp 4BE0A 2XKOC 3JB9I 3MP8A 3OYHA 1D3BA 4QQDA 2P0PA 4ZTJA 3JB9H 4PJOE 2RK1A 1VQOA 1I8FA 2EQMA 2KY9A 4L6V5 1VQLT 1KG1A 1NPPA 1K9MC 3FRNA 3G71T 2VC8A 3AHUA 4A4KA 3MP6A 5LJ5f 3CXCS 4F7UB 2RI2A 2RHIA 2LCLA 4BB7A 3M55A 3G6ET 3RERA 4X9DA 3GP8A 1G3WA 1KHCA 1YIJT 2KSSA 2ZPHB 4EMKB 3FC3A 2DTHA 2V8JA 2K5FA 3M58A 5D6WA 3E9GA 1VIFA 5CQXA 5GMKj 5CR2A 4BDYA 3PIOA 3RMQA 3LW5E 4MDXA 2JZ2A 4IUTA 1N9RA 5GAMe 5LJ3j 4KUIA 3URGA 3PFSA 4PL6A 1YHQA 1UGPB 2AHJB 2DEQA 3JCMd 1VQOT 3NFCA 4OB3B 1Y7XA 4Y28E 2JN0A 3HP9A 4FU6A 4M78D 4ME7A 5J3BA 4EMKC 5GMKi 2E6NA 1W4SA 5A2QE 4FM4B 1IREB 1JJ2S 3X28B 2Y90A 2ZCFB 4IKFA 4M7AG 2RJEA 5LJ5g 1YI2A 5GMKm 2DXUA 2EIFA 4C5HA 2RI5A 2EYQA 2YLBA 1M1FA 3CXCA 3L1AA 1OZ2A 3LLRA 3I56A 4BE2A 1XQHA 2RM4A 4M7AE 4PJOD 3L2WA 1WQ7A 1YHQT 3C94A 3MEWA 3QDRB 4HKEA 3CMEA 1KQ1A 2H3JA 4N4IA 3P8BB 1QVFS 2RA2A 3TCJA 5GAN7 5HK3A 3H6ZA 1VQ5A 3RIRA 3Q1JA 2F5KA 5GAN2 3UT1A 3HKSA 2V8IA 5FLXE 5GMKl 2E10A 5FU7B 1G5VA 4IUPA 1X6OA 4RMOA 3MEUA 1IZ6A 4BI8B 4BY6B 5IAYA 5J26A 4M75B 4NOYA 1BIBA 3CC7A 1YI2T 2R58A 1Q86C 3C4SA 2M1HA 3CCJA 4MZMA 1Q7YU 3G7ZA 3HRSA 3OYCA 3FEOA 3I56T 3JCMf 2GF7A 4R55A 3O8VA 3CMET 4N4HA 1W2BS 5FU7C 1BI3A 4OGCA 1VQ5T 5EG2A 4BY6C 2ZPGB 5A0DA 5GAMj 2LQKA 3SDZA 1LOJA 1Q81U 3RKXA 5CO7A 4C0FA 2FL7A 2DXTA 2PVGB 4C8QD 4C5GA 3CCEA 1V29B 2XD0A 2GFAA 3OBYA 3CCSA 4C92G 1DJ7B 4JDSA 5GANj 3VV0A 3P8HA 1N8RU 1HXDA 1UEBA 1FWZA 4M77D 1BKBA 1Y96B 4N4GA 4BI4A 3OY9A 3CC7T 3QPHA 3JCMQ 3CPWS 1QVFA 3ASKA 3OQ5A 1SSFA 2RJDA 4M77A 2EWNA 4XAXB 2ZPFB 4IURA 3CCJT 3DB3A 4C92E 4M7AD 3M5AA 1BI2A 2QDYB 2GFUA 4XU2A 3WVEB 4LDXA 2EJ9A 4M75F 3ME9A 1YCYA 3JSCA 5GMKe 2KQWA 1NJIU 3M4GA 4E47A 3OYGA 1YJNT 1VIEA 2D0QB 5LJ3e 4XU0A 4JRPA 2QQSA 3QBYA 3JCMg 2RB6A 4M77F 4IUUA 1QVGS 3VUZA 1U8RA 3BY7A 3OYAA 1O9SA 2K57A 2GCXA 2LT4A 4OB1B 4A4HA 2JVVA 4OP0A 4C5IA 1K73C 3CCET 1KD1C 3CCST 2RJFA 2NLUA 3A8MB 4FT2A 4LDYA 3CCMA 4GLKA 1WQWA 2DZCA 3CBOA 3FDRA 3C95A 3MHXA 3VYGA 4R56A 1W2BA 3PGGA 2PVOB 4KBMB 2QA4A 3QG1A 1YITA 4FIBA 1D3BB 4M7DA 4MMKA 5D6XA 2E12A 2VXEA 4NL2A 2M0OA 2LT1A 4JLIA 2XIDA 2I2LA 2LX9A 3HL8A 1X75C 2JTMA 2DXBA 2P0KA 3JCMP 1KQSA 5DLQE 4E7LA 1Q86U 4M7DF 2DD5A 2BKDN 3QJ6A 1X01A 3OB9A 3P8DA 4DA4A 5HKCA 3OYEA 3LWHA 1OI1A 2XU8A 2DZ9A 2DPPB 3I55A 3CCMT 2ZPIB 3V7RA 3JB9G 4FSXA 5A0GA 4Z02A 1NZ9A 2QA4T 3WVDB 4C92D 1YITT 3QHSA 2XDBA 1QVGA 1N9SA 3SWNA 4F7UE 3CCUA 3QYGB 2KVQG 3SFMA 2DD4A 1ZQ1A 4CRIA 2B8AA 2HQEA 4X34A 3QYHB 3G4SA 1VQPA 2JOYA 2PUOB 2K5LA 2RI3A 3TEEA 2DVEA 3BW1A 4IUQA 1M5Q1 5GAMh 3JCMb 1QVPA 1RI0A 2X4JA 4LDVA 2DJZA 2FB7A 3WXMB 1BIAA 1UGSB 3A5ZB 4C0ZA 4E7HA 3OYJA 2LCCA 3H8ZA 5GANh 5GAMd 2A3LA 3OSVA 5CVIA 3EFRA 2L89A 5KH6A 1VQMA 4JRKA 3VUBA 4RCCA 1WJQA 2KMTA 3E1SA 5GANe 4JS4A 4D6WA 3T9NA 2DO3A 2K3YA 3M9QA 2HAXA 2MF2A 1AHJB 2A7YA 3MEAA 3G4ST 1VQPT 2YLCA 3PMTA 4OF1A 2QQAA 4M78A 5GAOn 3A8OB 4A53A 5CAIA 4XTUA 3TU4K 2L3RA 4II1A 2OTJA 2VGMA 4A4FA 4JRQA 2HNIA 1QP2A 4BDZA 2KK4A 2DXCA 5LJ5j 3J81E 3V7CA 1KC8U 1Q7YC 1U1TA 2WSFE 2CZ7B 5LL6S 4RCBA 3CCLA 4J8OA 1M90U 4V2SA 4JLGA 4M78F 5DLOA 3NTHA 1UGRB 4M75G 4O6JA 5FROA 3ZBDA 4PJOA 3JB9D 2R5AA 2DAQA 1WJSA 3X20B 2O4XB 4B9WA 2P4TA 4KUDK 1JRIA 4C0DB 5IN1A 4C5EA 1Q81C 1M8VA 2C06A 4M75E 4EPCA 2EQKA 2RHYA 4J6YA 3N5BB 1FXXA 4PJOF 5C6SA 4FT4A 4HCBA 2E70A 2L8DA 2K2VA 1WPYA 2P0QA 2Y4YA 5KCOA 3HRUA 5GAMf 3HFNA 3CCQA 1K8AU 1BYMA 2KDSA 4M77B 2OAUA 3X24B 3CCLT 1QP3A 3L2RA 4EMGA 3DKMA 3OS0A 4C0DC 3OYLA 2LRQA 2EQJA 3JCMW 1NJIC 3QJYA 1PSFA 2EJFA 5I2SA 3ER0A 4N0AA 3S3NA 4HCZA 2O01E 3MCAB 3GLXA 2R57A 3HFOA 3J7AF 2E65A 1ZHIA 4M75C 3HRTA 3E9FA 2DIQA 4HA8A 1R8OB 5GAN6 3QO3A 2D6FA 3DB4A 1KQ2A 4M77C 4C8QA 3BFMA 2KAFA 4DOWA 2BIVA 1KQSS 1VQ4A 3FJPA 4E7IA 3ZEHA 3A8HB 3ZFJA 5C0MA 5GMKh 4XTYA 4M7DB 2ZPEB 4X9CA 1M1KU 1VQ6A 1H641 5LJ3h 3CMAA 2X4YA 3L42A 5GAOm 3OYDA 5J39A 4M7AA 4XTWA 2QQ9A 5GAMg 2XDPA 2EAYA 4NS5A 4C8QF 3OYYA 3UPUA 4NL3A 5LJ3d 3GNFB 2F5TX 4ZN3A 3CCVA 1M1GA 1JB0E 2HQXA 4J6WA 4WF2A 4MZTA 3CEYA 4LDUA 4O5VA 5CQYA 4M7DC 4M7AF 5I21A 1OZ3A 5GAOl 4RKUE 1VQ4T 2WSCE 3RMSA 1S72A 2LQ8A 3LH0A 1Q82U 3CC2T 5LJ5h 1HK9A 1B34A 3BDUA 3QKJA 3X25B 3SWNB 5IT9E 4ATOA 1LJOA 4DOVA 5A0LA 1VQ6T 4FL6A 3CMAT 1U1SA 3MO8A 5LJ5e 2RHUA 1XTDA 2Y4XA 3QZ9B 5DM7R 2DIGA 4UC4A 2PUKB 3V8LA 2L5QA 4MMLA 2IVWA 3RUXA 4A4EA 4BI3A 3CCVT 5KCHA 2RK2A 3JRZA 4E7JA 2F69A 4HCCA 1VUBA 3A8GB 3SWNC 4M78G 4KT0E 3CCRA 3JB9J 3CBMA 5GAOq 3M57A 1S72T 4QVZA 5CIUA 1VQ9A 2CZ1B 3L2ZA 3M59A 4JRIA 3QXEB 3PT9A 3CC2A 2XK0A 4C92A 1GXIE 1YJ9A 2QQRA 1VQKA 5GAN4 5LJ3f 3G6EA 2MI6A 1EIFA 2LDMA 3GF5A 2OTLA 4YTLA 4M78B 3A8LB 4TVRA 4XU3A 1Y71A 2K5IA 3TREA 1WJRA 1Y07A 4ZTFA 1I81A 3M54A 4Y91A 2CS7A 2X4WA 2CKKA 3C12A 2MWPA 4OB0B 5I2MA 3V8KA 3LYIA 4C92F 3I55T 3BDLA 2GQVA 3J80E 1KC8C 2JTFA 3VU3C 1VQ7A 2VUBA 1M90C 3S3OA 1YJWA 3QSUA 3RESA 3CCRT 3JCMJ 3JCMV 3VYHB 2ZPBB 4EDUA 3OW2A 4A4GA 4QW2A 3OYKA 3HHTB 4A54A 4DQ2A 3CCUT 1VQ9T 5GANd 4PJOB 4M78C 2QTXA 2RH2A 2QI2A 5GAN3 1YJ9T 1VQKT 5M9OA 2WSEE 4RG8A 4PKCC 3HSBA 1VQ8A 3RKYA 2BUDA 2X35A 2MMPA 1LNXA 4LD6A 2OTLT 2ZGWA 3KUFA 3L2VA 2OTJT 2JUFA 1WNLA 1N27A 2DKGA 3F70A 4OGEA 3RKWA 5DY9A 5LJ3g 2E64A 2LTOA 1I4K1 3JCMh 1K8AC 2WACA 3SD4A 1G3YA 1RL2A 2CYZB 2IG0A 3QIIA 1VQ7T 1BI1A 4PJOC 1YJWT 3E19A 1MGQA 3JCMe 1MHNA 4J7IA 1VQMT 4C8QG 3CC4A 5FRNA 3PTAA 4KULA 1VQNA 1K9MU 1NE8A 3OSSC 3PNWC 4P5NA 2EJGA 4F7UA 3LX7A 4ZGJB 4M77G 1G3TA 4XQ3A 2XHCA 4JS5A 3VKIA 2E6ZA 3OA6A 1VQ8T 4C8QE 4PNOA 4EMKA 1N8RC 4BACA 2EKOA 3INZA 3OS1A 2CGHA 2RO0A 2CZ6B 3DLMA 4M77E 4C8QB 4PLLA 5CK9A 4F7UF 3PMIA 3OYNA 2M16A 2RJCA 4QVCA 3MP1A 3JB9F 4GY5A 4LD9K 1M1KC 2EFIA 4N0AC 4VUBA 3M4YA 4QVDA 2E1HA 2MAMA 5GANf 4M7AB 1XOVA 3CC4T 4J6XA 2XG8D 1VQNT 3NTIA 3GOXA 2E41A 3JAME 2V8KA 4M7DG 2HD0A 5GAOr 1WGSA 2YHTA 3GNGA 4LDWA 3SB2A 4ZGEB 4ZN1A 4EMHA 4C8QC 1G3SA 2RHXA 2CZ0B 3OS5A 2DK3A 3M56A 3FIFA 2M9UA 1N6AA 2LNVA 3V8JA 1KHIA 4M7DE 5HY6A 5L8RE 5CKFA 3UWNA 2RHZA 3S6WA 4C0GA 4QQ6A 3UDCA 3CCQT 1Q82C 4M7AC 3GIBA 3OMCA 5D6YA 3OYBA 2QQBA 1B34B 1BI0A 4BE1A 2HBPA 2LVMA 1JJ2A 3JCMX 5AYFA 1XNIA 1YJNA 4J5YA 2O4XA 2ZZDA 3CPFA 3META 2VV5A 3LGLA 5KE3A 3EFSA 2VGNA 3HPWA 4M75D 3NTKA 3OBWA 2G3RA 2RD1A 5GANg 5CKHA 2QEXA 2FVUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P4T A;  2RK1 A;  2VV5 A;  2OAU A;  2GQV A;  3T9N A;  2RK2 A;  1VIF A;  1VIE A;  3UDC A;  2RH2 A;  3SFM A; 
#chains in the Genus database with same CATH topology
 4RG2 A;  2JNG A;  2BE7 D;  5FRM A;  1M9S A;  2RQW A;  5A0G A;  1ABQ A;  4L59 A;  1YBY A;  1U06 A;  2KBT A;  5GAN 5;  2KXC A;  3LWI A;  4HT8 A;  1Y57 A;  3OMG A;  1NJI R;  1JBM A;  1OYX A;  1VQ4 Q;  4C92 B;  2DTO A;  5LJ5 d;  2DL3 A;  3L2Q A;  3S3M A;  2VXF A;  2ATC B;  2GQI A;  2VB6 A;  4E7K A;  2PVD B;  4M7D D;  2VYT A;  2QXF A;  3EG9 A;  2MWO A;  4PLI A;  3GPL A;  4ELY C;  2CP3 A;  2FYK A;  2X4X A;  2HCK A;  2NUT B;  1UB4 A;  2Z0W A;  1HJD A;  4RTV A;  1S72 Q;  1D1A A;  1SF9 A;  1P92 A;  5CKD A;  1FX7 A;  4ELZ C;  2K4Y A;  2XIC A;  2YRV A;  1K9A A;  4PJO G;  4XK8 E;  4OMO A;  5EC7 A;  3OYH A;  4ZTJ A;  4PJO E;  1I8F A;  5ECA A;  2F2V A;  3G1J A;  2A36 A;  3MP6 A;  5LJ5 f;  4F7U B;  2RHI A;  2LCL A;  1KHC A;  2AKL A;  2ZPH B;  1VQK Q;  2K5F A;  3M58 A;  5KYY B;  1WXB A;  2ECZ A;  5LJ3 j;  1Z9Q A;  3URG A;  3PFS A;  1YHQ A;  2J05 A;  1Y7X A;  2JN0 A;  1YJW Q;  5J3B A;  2M02 A;  4EMK C;  4FM4 B;  3VS2 A;  5IXF A;  1JJ2 S;  2Y90 A;  2ZCF B;  4M7A G;  4J9C A;  4AG2 C;  2YLB A;  4BE2 A;  2FO0 A;  1AD5 A;  4M7A E;  1WQ7 A;  1YHQ T;  3C94 A;  3CME A;  4DEX A;  3I5R A;  1QVF S;  5GAN 7;  1VQ5 A;  1D1C A;  3RIR A;  5GAN 2;  5FLX E;  2JS0 A;  2V8I A;  5FU7 B;  2GTO A;  3MEU A;  1UTI A;  2H8H A;  3C4S A;  1NG2 A;  2M1H A;  3CCJ A;  4MZM A;  1SRL A;  3FEO A;  2IIM A;  3CME T;  3ZL7 C;  1W2B S;  1VQ5 T;  5EG2 A;  4BY6 C;  5GAM j;  1Q81 U;  3RKX A;  4C8Q D;  1V29 B;  1AZG B;  4AG1 C;  2L2P A;  3CCS A;  1DJ7 B;  3P8H A;  1WIE A;  1WZO A;  3OY9 A;  3CPW S;  1QVF A;  3CCJ T;  1SSF A;  1WHJ A;  1YP5 A;  1NYF A;  1JXM A;  4M75 F;  1YCY A;  2K3B A;  3OYG A;  1YJN T;  1VIE A;  2D8H A;  4XU0 A;  1XJW B;  2FG0 A;  1M2V B;  3OYA A;  2K57 A;  4EIK A;  4A4H A;  1YJN Q;  4OP0 A;  1K73 C;  1KD1 C;  3CCS T;  2RJF A;  3A8M B;  3FDR A;  3C95 A;  4HCK A;  1W2B A;  3PGG A;  4KBM B;  3QG1 A;  4FYY B;  3BE3 A;  3RDV A;  4M4Z A;  4NL2 A;  1KSW A;  4ZNX A;  3CD6 Q;  2JTM A;  2CT4 A;  2DXB A;  2P0K A;  1QCN A;  1SEM A;  4RTY A;  2LNH B;  3QJ6 A;  1OI1 A;  3SEM A;  5KYU A;  3EG3 A;  2ZPI B;  3JB9 G;  4FSX A;  2J06 A;  2KVQ G;  3SFM A;  2DD4 A;  1ZQ1 A;  1D1B A;  4CC2 A;  1VQP A;  3KFV A;  2JOY A;  2DVE A;  1M5Q 1;  5I11 A;  3JCM b;  1B7T A;  1EZZ B;  3WXM B;  4E7H A;  1YIJ Q;  3H8Z A;  5GAM d;  3EFR A;  2V1Q A;  5KH6 A;  4JRK A;  1WJQ A;  2NUP B;  4D6W A;  2K3Y A;  2FRY A;  1VQP T;  3PMT A;  2RMO A;  4RTU A;  1UFF A;  4A4F A;  4JRQ A;  3NGP A;  2KK4 A;  2FZK B;  3EFO A;  1KC8 U;  1AWO A;  2WSF E;  2CZ7 B;  5LL6 S;  1WHH A;  4V2S A;  4M78 F;  3NTH A;  1K9M R;  2CRE A;  4O6J A;  3ZBD A;  4PJO A;  2DAQ A;  1WJS A;  3X20 B;  2P4T A;  1JRI A;  4C5E A;  5IN1 A;  1M8V A;  1GFC A;  2VWF A;  3N5B B;  4HCB A;  2DF6 A;  1OPL A;  4LUE A;  1WPY A;  2Y4Y A;  5KCO A;  3HRU A;  5GAM f;  4RTZ A;  3CCQ A;  2KDS A;  3OW2 P;  1UJY A;  5AT1 B;  5KYW B;  2KRM A;  5IH2 A;  3OYL A;  3DKM A;  4C0D C;  1OX9 A;  4J9D A;  2O01 E;  1KFZ A;  2E65 A;  2RF0 A;  4M77 C;  1E6G A;  3BFM A;  2KAF A;  4DOW A;  2BIV A;  1KQS S;  2E3I A;  3FJP A;  3ZFJ A;  4X9C A;  1M1K U;  3CC7 Q;  2LQW A;  5GAO m;  4M7A A;  5J39 A;  2XDP A;  3R6N A;  1E6H A;  4NL3 A;  2F5T X;  4ZN3 A;  3CCV A;  1SSH A;  2O9S A;  3CXC P;  3CC2 T;  1Q82 U;  3QKJ A;  2EBP A;  2X3X D;  1LJO A;  5A0L A;  4OMN A;  1U1S A;  2NWM A;  3MO8 A;  3CC2 Q;  5DM7 R;  4UC4 A;  2L5Q A;  3CCV T;  5KCH A;  2RK2 A;  4E7J A;  2F69 A;  2JM9 A;  3REA B;  4DBR A;  4HVV A;  3CBM A;  3M57 A;  5CIU A;  3CCM Q;  2E4H A;  1VQ9 A;  3L2Z A;  4F17 A;  1KJW A;  2OI3 A;  2QA4 Q;  1RLQ C;  1OU8 A;  1PCX A;  1IXD A;  1IGU A;  2LDM A;  3GF5 A;  2OTL A;  2CP5 A;  4M78 B;  2D0N A;  2EGA A;  4TVR A;  4YTL A;  1MMN A;  1I81 A;  3V8K A;  3A1P A;  3BDL A;  2JTF A;  1VQ7 A;  1M90 C;  3RES A;  3JCM V;  3OW2 A;  4A4G A;  4B6M A;  2FPF A;  1VQ9 T;  9ATC B;  2JMA A;  1JO8 A;  3RKY A;  2X35 A;  2OTL T;  2JUF A;  1WNL A;  1N27 A;  3RKW A;  5IHK A;  5DY9 A;  3JCM h;  1K8A C;  2CYZ B;  3QII A;  1VQ7 T;  1BI1 A;  4AFS C;  3VS1 A;  3U23 A;  1MGQ A;  1MHN A;  4J7I A;  3CC4 A;  4KUL A;  1NE8 A;  5I22 A;  5D7U A;  4XQ3 A;  1BU1 A;  2XHC A;  1T0J A;  1QKX A;  1X43 A;  1RAE B;  2RO0 A;  3DLM A;  5CK9 A;  1YN8 A;  4QVC A;  1QVG P;  2EFI A;  4N0A C;  4J9F A;  4FCY A;  3CC4 T;  2XG8 D;  1QWF A;  3CCL Q;  3GOX A;  4FW2 A;  1S1N A;  4M7D G;  2HD0 A;  4ZN1 A;  4ZGE B;  1AWJ A;  4EMH A;  4Z8A A;  3EGD B;  3FIF A;  4FYW B;  1Y0M A;  1X6B A;  5HY6 A;  4M7D E;  1KIK A;  5CKF A;  2H3E B;  2K9G A;  4C0G A;  3UDC A;  3GIB A;  3OMC A;  3NPF A;  3OYB A;  2QQB A;  1B34 B;  1BI0 A;  1R77 A;  4HXJ A;  2KYB A;  1Q81 R;  2ZZD A;  3A98 A;  3NTK A;  2EYX A;  1UHC A;  3KBG A;  2PU9 B;  4QQG A;  1TXQ A;  2K2M A;  3X26 B;  3QZ5 B;  5KYN A;  3EAE A;  1UGQ B;  3JCM c;  1YCS B;  5HK0 A;  3VS4 A;  1K0S A;  5FU6 B;  5GAN 8;  4OB2 B;  2D9T A;  1TSF A;  1BCO A;  4XTX A;  4E6R A;  3KXT A;  4D8K A;  1M4Z A;  4JUV A;  2EGC A;  1Y96 A;  1A0N B;  4BUG A;  3DLL A;  4MDW A;  4C92 C;  1VYT A;  1GCQ C;  4BD3 A;  3FLG A;  2PNI A;  4QT7 A;  1ARK A;  4B9X A;  1QW1 A;  5CKE A;  3TSZ A;  3FB9 A;  2FEI A;  1K73 U;  4OMF B;  1ZSZ B;  4F7U G;  2VVK A;  1KD1 U;  5GAO p;  2ENM A;  3UF4 A;  2XKO C;  2DMO A;  2K79 A;  3MP8 A;  2P0P A;  3JB9 H;  1VQO A;  1NLP C;  4L6V 5;  1KG1 A;  5GJV B;  2DL8 A;  4FYX B;  3G6E T;  4X9D A;  2EGE A;  3FC3 A;  5D6W A;  3G6E Q;  5CQX A;  1VIF A;  5CR2 A;  4FYV B;  2KYM A;  3RMQ A;  4MDX A;  1N9R A;  1WFW A;  3EG0 A;  1UG1 A;  2AHJ B;  2LX7 A;  3JCM d;  1VQO T;  4Y28 E;  3REB B;  1OUL A;  4FW1 A;  2E6N A;  1BK2 A;  1W4S A;  2RJE A;  1KC8 R;  1YI2 A;  1M30 A;  2DXU A;  2EIF A;  1VQ8 Q;  1YWO A;  2EYQ A;  1AZE A;  1TOV A;  2MYS A;  3LLR A;  3H0I A;  1XQH A;  3I35 A;  3MEW A;  1T3S A;  1KQ1 A;  4Z88 A;  2CP0 A;  2RA2 A;  3TCJ A;  3H6Z A;  3HKS A;  2BZ8 A;  4RMO A;  1IZ6 A;  4BI8 B;  4AMC A;  5J26 A;  1MNE A;  2QGG A;  4NOY A;  1VOM A;  1H92 A;  1YI2 T;  2DLP A;  2JT4 A;  3G7Z A;  2QG9 B;  3JCM f;  1Q95 G;  4N4H A;  5FU7 C;  1NEB A;  4OGC A;  1MMD A;  5A0D A;  3SDZ A;  1LOJ A;  5CO7 A;  4PJJ A;  3RBB B;  3CCE A;  2GFA A;  3OBY A;  1N8R U;  1HXD A;  2DNU A;  4BI4 A;  2PZ1 A;  3JCM Q;  3ASK A;  3EG9 B;  1M1K R;  2EWN A;  3DB3 A;  2RQT A;  3ME9 A;  3JSC A;  1GBQ A;  2PTK A;  3M4G A;  4E47 A;  2GNC A;  4IUU A;  1U8R A;  1RAI B;  2LT4 A;  4OB1 B;  2DVJ A;  3CCE T;  1BB9 A;  1X69 A;  1T3L A;  1SRM A;  1WQW A;  3CBO A;  3VYG A;  1Q82 R;  2HL5 C;  4M7D A;  1D0Y A;  2HEQ A;  2F2X A;  1UDL A;  4Z89 A;  2XID A;  2LX9 A;  3HL8 A;  2FZG B;  3OB9 A;  4DA4 A;  1IB8 A;  5HKC A;  3OYE A;  2CSQ A;  2DPP B;  3I55 A;  2DFU A;  2XDB A;  4C92 D;  3QHS A;  1N9S A;  3SWN A;  3CCU A;  2B8A A;  1IGQ A;  2HQE A;  4X34 A;  3G4S A;  2PUO B;  2K5L A;  1WI7 A;  2FPD A;  4IUQ A;  4WTO B;  5GAM h;  1QVP A;  4LDV A;  2CP7 A;  2DJZ A;  3M0U A;  2DBK A;  4C0Z A;  3CQT A;  2BTT A;  2EYW A;  3OSV A;  5GAN e;  2X51 A;  2DO3 A;  3M9Q A;  1QKW A;  2MF2 A;  3G4S T;  2YLC A;  4OF1 A;  2COW A;  5GAO n;  4XTU A;  3TU4 K;  1TS9 A;  2L3R A;  3NMZ C;  4II1 A;  2OTJ A;  2VGM A;  1VYV A;  1YNZ A;  3J81 E;  3V7C A;  1Q7Y C;  1U1T A;  2CUD A;  2KT8 A;  4J8O A;  1M90 U;  1JXO A;  4M75 G;  2LZ6 B;  4JZ3 A;  4KUD K;  1YHQ Q;  4M75 E;  4EPC A;  2YUQ A;  4OMQ A;  4JJB A;  6AT1 B;  2OTJ T;  1FXX A;  4PJO F;  1HSQ A;  1LPL A;  4OMP A;  3UA7 A;  3HFN A;  1I0C A;  1K8A U;  2OAU A;  3X24 B;  2J6F A;  3L2R A;  2DL7 A;  2LRQ A;  1ZUK A;  2KGT A;  3HTR A;  3J7A F;  3GLX A;  2R57 A;  3CME Q;  1ZHI A;  4M75 C;  3MJX A;  2HBW A;  5GAN 6;  2D6F A;  1VQ5 Q;  3VS7 A;  1TG0 A;  2VAS A;  4C8Q A;  5IHN A;  1B07 A;  1RAH B;  4PJM A;  2M0Y A;  1B3Q A;  5GMK h;  1VQ6 A;  3CMA A;  3CCJ Q;  2GGR A;  3OYY A;  1AWX A;  2X9H A;  5LJ3 d;  1MV0 B;  1VYU A;  2HQX A;  4M7A F;  2QAZ A;  3CEY A;  5KYU B;  3CCS Q;  3TSW A;  2JMC A;  1VQ6 T;  1GRI A;  3CMA T;  2ABL A;  5LJ5 e;  1XTD A;  3QZ9 B;  2PUK B;  3V8L A;  4J9B A;  1ABO A;  3VRY A;  4A4E A;  4BI3 A;  2OAW A;  4PJL A;  2AIR B;  4CC7 A;  1AWW A;  1VUB A;  4M78 G;  4KT0 E;  3CCR A;  1G2B A;  2NUZ A;  1M27 C;  2CZ1 B;  2XK0 A;  1YJ9 A;  5LJ3 f;  2MI6 A;  1EIF A;  2ED1 A;  3TRE A;  1KD1 R;  1Y07 A;  4ZTF A;  4Y91 A;  2X4W A;  5I2M A;  1OPK A;  2CKK A;  4OB0 B;  3LYI A;  3EFO B;  3J80 E;  3VU3 C;  5GJW B;  2VUB A;  3CCR T;  2DIL A;  2ZPB B;  2OJ2 A;  4QW2 A;  4PJO B;  4M78 C;  2QTX A;  1X2K A;  1YJ9 T;  3JV3 A;  2WSE E;  4RG8 A;  2C0O A;  4PKC C;  1SHF A;  3HSB A;  4PFZ A;  1TTH B;  5KYX A;  2MMP A;  1LNX A;  2ZGW A;  3KUF A;  4KRT A;  3L2V A;  1D09 B;  4OGE A;  1VQP Q;  2E64 A;  1SHG A;  2WAC A;  2IG0 A;  2W10 A;  1VQN A;  3OSS C;  1FMV A;  1I07 A;  2EJG A;  3LX7 A;  4M77 G;  4JS5 A;  2DE0 X;  1GCP A;  2E6Z A;  4EMK A;  1N8R C;  3INZ A;  4M77 E;  3I9Q A;  4F14 A;  1YWP A;  3PMI A;  3OYN A;  2M16 A;  3MP1 A;  4FSS A;  3JB9 F;  4GY5 A;  4LD9 K;  4QVD A;  3MKD A;  4M7A B;  3MPU B;  1I5O B;  1XOV A;  1VQN T;  2E41 A;  3GNG A;  4LDW A;  2DK3 A;  3M56 A;  1JEG A;  1MMG A;  2YXY A;  5L8R E;  1D0Z A;  3S6W A;  1CKB A;  3CCQ T;  5D6Y A;  1T0H A;  3AT1 B;  3CCQ Q;  5KE3 A;  1PG5 B;  4M75 D;  5GAN g;  2RD1 A;  5CKB A;  2ROT A;  2ED0 A;  2QEX A;  4CI0 C;  3EGX A;  3LGF A;  1TUG B;  4M75 A;  2J6K A;  2XDD A;  1AVZ C;  1M3B A;  2DBM A;  2R5M A;  3OYI A;  4IUV A;  1N5Z A;  1W70 A;  1H3Z A;  1G83 A;  4HVU A;  2W0Z A;  4XU1 A;  5FW9 A;  2KNB B;  3OW2 S;  2MCN A;  3VJP A;  1ZBX A;  4GLM A;  4J7F A;  1PWT A;  1MV3 A;  2QEX T;  4KH0 B;  5IHI A;  2FHD A;  1PSE A;  4LNP A;  5FWC A;  3QUI A;  5FU6 C;  3CCV Q;  2B86 A;  1UHF A;  1VQL A;  3PIP A;  1NM7 A;  4ZGD B;  3G71 A;  2DL5 A;  1NYG A;  1OU9 A;  3L2U A;  4MZP A;  1C1A A;  3H0H A;  2K3X A;  4Y92 A;  4XTV A;  8AT1 B;  2MIO A;  3MEV A;  3H9N A;  5KE2 A;  3R6O A;  3M53 A;  2K6D A;  3V7S A;  4DBQ A;  1M3C A;  1D3B A;  2ESW A;  2RK1 A;  1VQL T;  1NPP A;  3UAT A;  3G71 T;  3AHU A;  3CXC S;  2RI2 A;  1UUE A;  3RER A;  1OX8 A;  1VQ9 Q;  1ZSZ C;  2KSS A;  1F1B B;  4RTT A;  4BDY A;  3E9G A;  2HSE B;  3PIO A;  2OTL Q;  3LW5 E;  4IUT A;  5GAM e;  2KT1 A;  1UGP B;  2IPO B;  2DEQ A;  3NFC A;  3HP9 A;  1VQ7 Q;  4FU6 A;  4M78 D;  4ME7 A;  2CUB A;  1C0M A;  5GMK i;  3EG2 A;  3QWY A;  2L3Q A;  2RPN A;  3E2U A;  4KGZ B;  5LJ5 g;  2AZV A;  1M90 R;  2RI5 A;  3CXC A;  3L1A A;  1OZ2 A;  3I56 A;  2RM4 A;  4IIO A;  3L2W A;  3QDR B;  2LJ3 A;  4LUD A;  3FJ5 A;  3P8B B;  5HK3 A;  1WHL A;  5GMK l;  1ZA2 B;  2E10 A;  3EHQ A;  4IUP A;  1GFD A;  1X6O A;  3CC4 Q;  1K8A R;  1BIB A;  2R58 A;  4J9E A;  1Q86 C;  1K76 A;  1WLP B;  1Q7Y U;  1UGV A;  3HRS A;  3OYC A;  1TUD A;  1RAA B;  3I56 T;  2GF7 A;  3O8V A;  2YT6 A;  1X27 A;  1WHM A;  1C6V X;  2SEM A;  2DER A;  1UJ0 A;  2EQI A;  2LQK A;  2KRN A;  4RUG A;  2FL7 A;  4C5G A;  2XD0 A;  4ANJ A;  4C92 G;  4JDS A;  5GAN j;  2A37 A;  4M77 D;  1Y96 B;  2J7I A;  2HL3 A;  4M77 A;  2MOX A;  2C0T A;  2ZPF B;  4C92 E;  1PKT A;  3M5A A;  1BI2 A;  2QDY B;  2GFU A;  1I1J A;  3WVE B;  5GMK e;  2O9V A;  2KQW A;  2D1X A;  4PFO A;  1I5L A;  4DBF A;  2QQS A;  3QBY A;  4JRP A;  1QVG S;  3VUZ A;  2CSI A;  3BY7 A;  1QQJ A;  1O9S A;  2EW3 A;  4FT2 A;  1ZA1 B;  2YSQ A;  4GLK A;  2DZC A;  1SKU B;  4ESR A;  3MHX A;  4CC4 B;  2V1R A;  1YIT A;  3VS6 A;  5D6X A;  1TU0 B;  2E12 A;  3EH2 A;  1FYN A;  2LT1 A;  3JCM P;  2JXB A;  5DLQ E;  4E7L A;  4M7D F;  3LH5 A;  1X01 A;  3P8D A;  2BZX A;  3LWH A;  2XU8 A;  3V7R A;  4Z02 A;  1NZ9 A;  1D0X A;  3WVD B;  1YIT T;  1QVG A;  4F7U E;  3QYG B;  3D7S B;  4CRI A;  1M8M A;  1PNJ A;  2RI3 A;  1ACM B;  3UA6 A;  1RI0 A;  2X4J A;  2JW4 A;  3OYJ A;  2A3L A;  2L89 A;  1R0C B;  1VQM A;  4RCC A;  3E1S A;  3T9N A;  2LCS A;  2L0A A;  1KK7 A;  3MEA A;  1HD3 A;  1IHW A;  2NYS A;  1VQO Q;  2COY A;  2QQA A;  5CAI A;  5FWB A;  1QP2 A;  1Z9Z A;  5LJ5 j;  1V76 A;  4RCB A;  1TWB A;  4JLG A;  1UGR B;  1GBR A;  5FRO A;  2LQN A;  1U3O A;  2O4X B;  4B9W A;  1E7O A;  2EQK A;  2DJQ A;  2F1L A;  2RHY A;  3RR6 A;  5C6S A;  1LVK A;  2K2V A;  2L8D A;  2P0Q A;  1CSK A;  2HSP A;  8ATC B;  2DET A;  1YI2 Q;  3OS0 A;  2EQJ A;  3EGU A;  4KGX B;  1NJI C;  1PSF A;  5I2S A;  3ER0 A;  4N0A A;  3S3N A;  4HCZ A;  3E9F A;  2CDT A;  3EH1 A;  1R8O B;  3SHW A;  3QO3 A;  1PD1 A;  1VQ4 A;  4OML A;  4E7I A;  3ZEH A;  5C0M A;  4IIM A;  2RN8 A;  4M7D B;  2RQV A;  1H64 1;  5LJ3 h;  3L42 A;  1JU5 C;  4XTW A;  5GAM g;  1M3A A;  4C8Q F;  1K1Z A;  3UPU A;  2AT1 B;  3GNF B;  2OX7 A;  1JB0 E;  4HVW A;  4WF2 A;  4MZT A;  4LDU A;  5I21 A;  1VQ4 T;  1M2O A;  3CCE Q;  1S72 A;  2LQ8 A;  3X25 B;  3BDU A;  1UEC A;  5IT9 E;  3SWN B;  4DOV A;  4A63 B;  3I5S A;  2Y4X A;  2DIG A;  2E3H A;  5HCK A;  3RUX A;  2YDL A;  2VKN A;  2X3W D;  2YUN A;  3JRZ A;  2F2W A;  1PD0 A;  1S72 T;  4QVZ A;  1JJ2 P;  2DL4 A;  2GTJ A;  1NEG A;  3M59 A;  3PT9 A;  4C92 A;  1AEY A;  1GCQ A;  2QQR A;  1VQK A;  1TUC A;  3O5Z A;  2J6O A;  4XU3 A;  1Y71 A;  2FZC B;  3I55 T;  1QVF P;  2GQV A;  3GBQ A;  1YJW A;  2MK5 A;  3JCM J;  4R0K A;  4EDU A;  3I55 Q;  3OYK A;  3EG1 A;  4A54 A;  4DQ2 A;  2NUT A;  3CCU T;  2QI2 A;  2C0I A;  4D8D A;  1VQK T;  2G6F X;  2RQU A;  4JZ4 A;  1WA7 A;  1PKS A;  2BUD A;  2XMF A;  3QDF A;  3QWX X;  3CCU Q;  2P84 A;  3F70 A;  3G4S Q;  3TQ7 P;  1W2B P;  2CH4 W;  1I4K 1;  2CP6 A;  3SD4 A;  1G3Y A;  1RL2 A;  4PJO C;  1YJW T;  3E19 A;  3JCM e;  4F04 B;  3PTA A;  3IQL A;  4F7U A;  4ZGJ B;  1G3T A;  2CT3 A;  3CPW P;  2DYI A;  2LJ0 A;  3VKI A;  3OA6 A;  2AKK A;  4LN2 A;  4BAC A;  2EKO A;  5KYY A;  3OS1 A;  2CGH A;  2CZ6 B;  4C8Q B;  2RJC A;  3VS5 A;  1MMA A;  1R0B G;  4LXC A;  2OTJ Q;  1WDX A;  1GL5 A;  2KRO A;  1AT1 B;  4J6X A;  3JAM E;  2V8K A;  5GAO r;  3H0F A;  1G3S A;  2RHX A;  2MPX C;  1QWE A;  2L3S A;  4PK4 A;  1N6A A;  1Q7Y R;  1KHI A;  3M0Q A;  3M0P A;  1IO6 A;  1ZBJ A;  2RHZ A;  1WX6 A;  4M7A C;  2DRM A;  1EFN A;  2DA9 A;  2HBP A;  2LVM A;  1JJ2 A;  3JCM X;  1YJN A;  1QLY A;  2VV5 A;  4E2F B;  3C0C A;  3HPW A;  4RTX A;  5CKH A;  4QKU A;  2PQW A;  3RNJ A;  1O75 A;  4J83 A;  2EQU A;  1Q86 U;  4Q5W A;  2SRC A;  3CD6 A;  1NPR A;  4HT9 A;  2LC4 A;  4OVA A;  2XI9 A;  2ZAE A;  3CBP A;  1VQ6 Q;  4JJN K;  2RQR A;  3CMA Q;  2E5Q A;  5CCA A;  2O2O A;  4XTZ A;  2A28 A;  4L5G A;  1SPK A;  2AZS A;  2DM1 A;  1K0X A;  2DX1 A;  3PVQ A;  3CD6 T;  2LMJ A;  3OYF A;  2QAS A;  2DTI A;  2JTE A;  1TH7 A;  3PE0 A;  1VA7 A;  1IRX A;  4M78 E;  4PFP A;  1QCO A;  1CKA A;  3OS2 A;  1M2V A;  3CPW A;  5KYX B;  1YIJ A;  1K73 R;  4JJD A;  2HQH A;  4AFZ C;  1OQK A;  3NHN A;  3OYM A;  4BE0 A;  3JB9 I;  4QQD A;  2GBQ A;  1RI9 A;  2KY9 A;  2EQM A;  2O31 A;  1K9M C;  3FRN A;  2VC8 A;  4A4K A;  1X2Q A;  3CCR Q;  4BB7 A;  3M55 A;  3GP8 A;  1G3W A;  1PRM C;  3TVT A;  1YIJ T;  4EMK B;  2YUO A;  1YJ9 Q;  2DTH A;  2V8J A;  2YWW A;  5GMK j;  2JZ2 A;  4KUI A;  4PL6 A;  2CH4 A;  1ZX6 A;  4OB3 B;  1W6X A;  1KQS P;  1JQQ A;  2DEU A;  5A2Q E;  1IRE B;  2QDL A;  3X28 B;  4IKF A;  1QCF A;  5GMK m;  4C5H A;  3VS3 A;  1M1F A;  2EVR A;  4PJO D;  4HKE A;  2H3J A;  5L23 A;  2I0N A;  4N4I A;  4DBH A;  2NUP A;  1WHK A;  3Q1J A;  2F5K A;  3UT1 A;  2BE9 B;  1G5V A;  1VQN Q;  4BY6 B;  5IAY A;  3EGX B;  4M75 B;  3CC7 A;  2FPE A;  2KE9 A;  1ZUU A;  1RAC B;  4LE9 A;  2KEA A;  4R55 A;  1U5S A;  2HKQ B;  1BI3 A;  2ZPG B;  4GBQ A;  4C0F A;  1FMK A;  2DXT A;  2PVG B;  1N8R R;  2DRK A;  3VV0 A;  1UEB A;  4N4G A;  1FWZ A;  1OEB A;  1BKB A;  1RAD B;  3CC7 T;  3QPH A;  3OQ5 A;  2RJD A;  4XAX B;  3CC2 A;  4M7A D;  1ZSG A;  4IUR A;  5KYW A;  4XU2 A;  4LDX A;  2EJ9 A;  1NJI U;  4OMM A;  2V26 A;  2D0Q B;  5LJ3 e;  2KRS A;  3JCM g;  2RB6 A;  4M77 F;  1RAB B;  1RLP C;  3THK A;  2GCX A;  4CC3 A;  2JVV A;  5IXB A;  4C5I A;  2NLU A;  4LDY A;  3CCM A;  2EKH A;  4R56 A;  2PVO B;  2QA4 A;  2QEX Q;  4FIB A;  1D3B B;  1MUZ A;  4MMK A;  1PRL C;  2VXE A;  4JPB W;  2M0O A;  4JLI A;  2I2L A;  2A08 A;  2D8J A;  2KXD A;  1X75 C;  1KQS A;  2DD5 A;  2BKD N;  2K7A A;  1H8K A;  2EPD A;  2DZ9 A;  3CCM T;  2HKN A;  3H41 A;  2QYZ A;  1PC0 A;  2RNA A;  2QA4 T;  2JS2 A;  1NBE B;  3QYH B;  2HZY A;  1VQL Q;  3TEE A;  3G71 Q;  3BW1 A;  2FB7 A;  1BIA A;  1UGS B;  3A5Z B;  2LCC A;  5GAN h;  2KR3 A;  1X6G A;  5CVI A;  3VUB A;  2KMT A;  4JS4 A;  2HAX A;  2YRD A;  3M0R A;  1AHJ B;  2A7Y A;  4F16 A;  4M78 A;  3A8O B;  4A53 A;  1K4U S;  4J9G A;  3ULR B;  4KH1 B;  2HNI A;  4BDZ A;  2DXC A;  1WXT A;  1RAF B;  3CCL A;  2JJ9 A;  5DLO A;  2FRW A;  1W1F A;  4J9H A;  1WYX A;  3JB9 D;  2R5A A;  1IHV A;  4C0D B;  1Q81 C;  2COZ A;  2C06 A;  2M51 A;  1WXU A;  4J6Y A;  4E7Z A;  4FT4 A;  2E70 A;  2QK0 A;  1BYM A;  4M77 B;  3CCL T;  1QP3 A;  2HDA A;  3M0T A;  4EMG A;  3JCM W;  4JJC A;  3QJY A;  2EJF A;  4X1V A;  3I56 Q;  3MCA B;  3HFO A;  3HRT A;  2DIQ A;  4HA8 A;  1BBZ A;  1BCM A;  3DB4 A;  2EYY A;  1RUW A;  1KQ2 A;  1V1C A;  3A8H B;  4XTY A;  2ZPE B;  1G8X A;  2X4Y A;  3OYD A;  2E5K A;  2QQ9 A;  2EAY A;  4NS5 A;  4J9I A;  1ZUY A;  2HMA A;  1M1G A;  3EGD A;  4J6W A;  2O88 A;  5CQY A;  1Q86 R;  4O5V A;  2P4R A;  4M7D C;  1OZ3 A;  5GAO l;  4RKU E;  1MND A;  2WSC E;  3RMS A;  3LH0 A;  5LJ5 h;  1HK9 A;  1B34 A;  4ATO A;  2YRC A;  4FL6 A;  1HYO A;  1OV3 A;  2RHU A;  4AFU C;  1ZLM A;  3PVL A;  2EYZ A;  2CP2 A;  4MML A;  2IVW A;  4HCC A;  3A8G B;  3SWN C;  3JB9 J;  5GAO q;  1PHT A;  1PM3 A;  3M0S A;  1FMW A;  4JRI A;  2QTV A;  3QXE B;  1GXI E;  1H3H A;  2L3P A;  1J3T A;  5GAN 4;  1YIT Q;  4AFQ C;  3G6E A;  2JM8 A;  3A8L B;  2K5I A;  2QGF B;  1WJR A;  3M54 A;  2CS7 A;  3C12 A;  4C92 F;  2MWP A;  1KC8 C;  2AK5 A;  2LP5 A;  1UE9 A;  3S3O A;  3QSU A;  2KI7 A;  3VYH B;  1SG5 A;  3HHT B;  4AT1 B;  5GAN d;  4ORZ A;  2RH2 A;  5GAN 3;  5M9O A;  1VQ8 A;  4LD6 A;  1RAG B;  2DKG A;  1ZSZ A;  1EX4 A;  4E7S A;  2DYB A;  5LJ3 g;  2LTO A;  7AT1 B;  2ROL A;  1VQM T;  2YUP A;  4C8Q G;  5FRN A;  1K9M U;  4KGV B;  3PNW C;  4P5N A;  1VQM Q;  1VQ8 T;  4C8Q E;  4PNO A;  1OOT A;  1LCK A;  1YFN A;  4PLL A;  4F7U F;  1M1K C;  4VUB A;  3M4Y A;  4PJN A;  2E1H A;  2MAM A;  5GAN f;  3NTI A;  2A0F B;  1WGS A;  2YHT A;  3SB2 A;  4C8Q C;  2CZ0 B;  3OS5 A;  4RTW A;  3VRZ A;  1WHG A;  2LNV A;  1AOJ A;  2M9U A;  3V8J A;  3UWN A;  4QQ6 A;  1Q82 C;  1NLO C;  3EHR A;  2LJ1 A;  4BE1 A;  4K11 A;  5AYF A;  1XNI A;  4J5Y A;  2O4X A;  4DEY A;  3CPF A;  2BZY A;  3MET A;  3LGL A;  3EFS A;  4WCI A;  2VGN A;  3OBW A;  1QMC A;  2G3R A;  2FVU A;  3VS0 A; 
#chains in the Genus database with same CATH homology
 4CI0 C;  3LGF A;  4M75 A;  4RG2 A;  2XDD A;  2PQW A;  2JNG A;  3KBG A;  5FRM A;  2PU9 B;  1M9S A;  1O75 A;  4J83 A;  2EQU A;  4QQG A;  2R5M A;  3X26 B;  3QZ5 B;  4IUV A;  3EAE A;  4L59 A;  1YBY A;  1UGQ B;  4Q5W A;  3OYI A;  3JCM c;  5GAN 5;  1NPR A;  3CD6 A;  1H3Z A;  5HK0 A;  3LWI A;  4HT8 A;  3OMG A;  5FU6 B;  1JBM A;  5GAN 8;  1OYX A;  4HT9 A;  2LC4 A;  4C92 B;  4OVA A;  4XU1 A;  2XI9 A;  2DTO A;  4OB2 B;  2D9T A;  5LJ5 d;  3CBP A;  5CKB A;  3L2Q A;  3OW2 S;  3S3M A;  3VJP A;  1ZBX A;  4XTX A;  3KXT A;  4JJN K;  4J7F A;  1M4Z A;  4JUV A;  2E5Q A;  2VXF A;  5CCA A;  2QEX T;  4E7K A;  4XTZ A;  2PVD B;  2FHD A;  1PSE A;  1Y96 A;  4L5G A;  2VYT A;  3QUI A;  4M7D D;  2QXF A;  5FU6 C;  4BUG A;  3DLL A;  4MDW A;  2MWO A;  4PLI A;  4C92 C;  3CD6 T;  3GPL A;  4BD3 A;  3FLG A;  3PIP A;  1VQL A;  3OYF A;  4ELY C;  2FYK A;  2X4X A;  4ZGD B;  2DTI A;  1TH7 A;  3G71 A;  1UB4 A;  4M78 E;  3L2U A;  4MZP A;  1P92 A;  2K3X A;  4B9X A;  3OS2 A;  5CKD A;  1FX7 A;  1QW1 A;  4XTV A;  3CPW A;  5CKE A;  1YIJ A;  4ELZ C;  3MEV A;  2K4Y A;  2XIC A;  2YRV A;  3FB9 A;  1I5L A;  5KE2 A;  3R6O A;  4PJO G;  4XK8 E;  3M53 A;  4OMF B;  3V7S A;  4F7U G;  3OYM A;  1K73 U;  1KD1 U;  5GAO p;  4BE0 A;  2XKO C;  3JB9 I;  3MP8 A;  3OYH A;  1D3B A;  4QQD A;  2P0P A;  4ZTJ A;  3JB9 H;  4PJO E;  2RK1 A;  1VQO A;  1I8F A;  2EQM A;  2KY9 A;  4L6V 5;  1VQL T;  1KG1 A;  1NPP A;  1K9M C;  3FRN A;  3G71 T;  2VC8 A;  3AHU A;  4A4K A;  3MP6 A;  5LJ5 f;  3CXC S;  4F7U B;  2RI2 A;  2RHI A;  2LCL A;  4BB7 A;  3M55 A;  3G6E T;  3RER A;  4X9D A;  3GP8 A;  1G3W A;  1KHC A;  1YIJ T;  2KSS A;  2ZPH B;  4EMK B;  3FC3 A;  2DTH A;  2V8J A;  2K5F A;  3M58 A;  5D6W A;  3E9G A;  1VIF A;  5CQX A;  5GMK j;  5CR2 A;  4BDY A;  3PIO A;  3RMQ A;  3LW5 E;  4MDX A;  2JZ2 A;  4IUT A;  1N9R A;  5GAM e;  5LJ3 j;  4KUI A;  3URG A;  3PFS A;  4PL6 A;  1YHQ A;  1UGP B;  2AHJ B;  2DEQ A;  3JCM d;  1VQO T;  3NFC A;  4OB3 B;  1Y7X A;  4Y28 E;  2JN0 A;  3HP9 A;  4FU6 A;  4M78 D;  4ME7 A;  5J3B A;  4EMK C;  5GMK i;  2E6N A;  1W4S A;  5A2Q E;  4FM4 B;  1IRE B;  1JJ2 S;  3X28 B;  2Y90 A;  2ZCF B;  4IKF A;  4M7A G;  2RJE A;  5LJ5 g;  1YI2 A;  5GMK m;  2DXU A;  2EIF A;  4C5H A;  2RI5 A;  2EYQ A;  2YLB A;  1M1F A;  3CXC A;  3L1A A;  1OZ2 A;  3LLR A;  3I56 A;  4BE2 A;  1XQH A;  2RM4 A;  4M7A E;  4PJO D;  3L2W A;  1WQ7 A;  1YHQ T;  3C94 A;  3MEW A;  3QDR B;  4HKE A;  3CME A;  1KQ1 A;  2H3J A;  4N4I A;  3P8B B;  1QVF S;  2RA2 A;  3TCJ A;  5GAN 7;  5HK3 A;  3H6Z A;  1VQ5 A;  3RIR A;  3Q1J A;  2F5K A;  5GAN 2;  3UT1 A;  3HKS A;  2V8I A;  5FLX E;  5GMK l;  2E10 A;  5FU7 B;  1G5V A;  4IUP A;  1X6O A;  4RMO A;  3MEU A;  1IZ6 A;  4BI8 B;  4BY6 B;  5IAY A;  5J26 A;  4M75 B;  4NOY A;  1BIB A;  3CC7 A;  1YI2 T;  2R58 A;  1Q86 C;  3C4S A;  2M1H A;  3CCJ A;  4MZM A;  1Q7Y U;  3G7Z A;  3HRS A;  3OYC A;  3FEO A;  3I56 T;  3JCM f;  2GF7 A;  4R55 A;  3O8V A;  3CME T;  4N4H A;  1W2B S;  5FU7 C;  1BI3 A;  4OGC A;  1VQ5 T;  5EG2 A;  4BY6 C;  2ZPG B;  5A0D A;  5GAM j;  2LQK A;  3SDZ A;  1LOJ A;  1Q81 U;  3RKX A;  5CO7 A;  4C0F A;  2FL7 A;  2DXT A;  2PVG B;  4C8Q D;  4C5G A;  3CCE A;  1V29 B;  2XD0 A;  2GFA A;  3OBY A;  3CCS A;  4C92 G;  1DJ7 B;  4JDS A;  5GAN j;  3VV0 A;  3P8H A;  1N8R U;  1HXD A;  1UEB A;  1FWZ A;  4M77 D;  1BKB A;  1Y96 B;  4N4G A;  4BI4 A;  3OY9 A;  3CC7 T;  3QPH A;  3JCM Q;  3CPW S;  1QVF A;  3ASK A;  3OQ5 A;  1SSF A;  2RJD A;  4M77 A;  2EWN A;  4XAX B;  2ZPF B;  4IUR A;  3CCJ T;  3DB3 A;  4C92 E;  4M7A D;  3M5A A;  1BI2 A;  2QDY B;  2GFU A;  4XU2 A;  3WVE B;  4LDX A;  2EJ9 A;  4M75 F;  3ME9 A;  1YCY A;  3JSC A;  5GMK e;  2KQW A;  1NJI U;  3M4G A;  4E47 A;  3OYG A;  1YJN T;  1VIE A;  2D0Q B;  5LJ3 e;  4XU0 A;  4JRP A;  2QQS A;  3QBY A;  3JCM g;  2RB6 A;  4M77 F;  4IUU A;  1QVG S;  3VUZ A;  1U8R A;  3BY7 A;  3OYA A;  1O9S A;  2K57 A;  2GCX A;  2LT4 A;  4OB1 B;  4A4H A;  2JVV A;  4OP0 A;  4C5I A;  1K73 C;  3CCE T;  1KD1 C;  3CCS T;  2RJF A;  2NLU A;  3A8M B;  4FT2 A;  4LDY A;  3CCM A;  4GLK A;  1WQW A;  2DZC A;  3CBO A;  3FDR A;  3C95 A;  3MHX A;  3VYG A;  4R56 A;  1W2B A;  3PGG A;  2PVO B;  4KBM B;  2QA4 A;  3QG1 A;  1YIT A;  4FIB A;  1D3B B;  4M7D A;  4MMK A;  5D6X A;  2E12 A;  2VXE A;  4NL2 A;  2M0O A;  2LT1 A;  4JLI A;  2XID A;  2I2L A;  2LX9 A;  3HL8 A;  1X75 C;  2JTM A;  2DXB A;  2P0K A;  3JCM P;  1KQS A;  5DLQ E;  4E7L A;  1Q86 U;  4M7D F;  2DD5 A;  2BKD N;  3QJ6 A;  1X01 A;  3OB9 A;  3P8D A;  4DA4 A;  5HKC A;  3OYE A;  3LWH A;  1OI1 A;  2XU8 A;  2DZ9 A;  2DPP B;  3I55 A;  3CCM T;  2ZPI B;  3V7R A;  3JB9 G;  4FSX A;  5A0G A;  4Z02 A;  1NZ9 A;  2QA4 T;  3WVD B;  4C92 D;  1YIT T;  3QHS A;  2XDB A;  1QVG A;  1N9S A;  3SWN A;  4F7U E;  3CCU A;  3QYG B;  2KVQ G;  3SFM A;  2DD4 A;  1ZQ1 A;  4CRI A;  2B8A A;  2HQE A;  4X34 A;  3QYH B;  3G4S A;  1VQP A;  2JOY A;  2PUO B;  2K5L A;  2RI3 A;  3TEE A;  2DVE A;  3BW1 A;  4IUQ A;  1M5Q 1;  5GAM h;  3JCM b;  1QVP A;  1RI0 A;  2X4J A;  4LDV A;  2DJZ A;  2FB7 A;  3WXM B;  1BIA A;  1UGS B;  3A5Z B;  4C0Z A;  4E7H A;  3OYJ A;  2LCC A;  3H8Z A;  5GAN h;  5GAM d;  2A3L A;  3OSV A;  5CVI A;  3EFR A;  2L89 A;  5KH6 A;  1VQM A;  4JRK A;  3VUB A;  4RCC A;  1WJQ A;  2KMT A;  3E1S A;  5GAN e;  4JS4 A;  4D6W A;  3T9N A;  2DO3 A;  2K3Y A;  3M9Q A;  2HAX A;  2MF2 A;  1AHJ B;  2A7Y A;  3MEA A;  3G4S T;  1VQP T;  2YLC A;  3PMT A;  4OF1 A;  2QQA A;  4M78 A;  5GAO n;  3A8O B;  4A53 A;  5CAI A;  4XTU A;  3TU4 K;  2L3R A;  4II1 A;  2OTJ A;  2VGM A;  4A4F A;  4JRQ A;  2HNI A;  1QP2 A;  4BDZ A;  2KK4 A;  2DXC A;  5LJ5 j;  3J81 E;  3V7C A;  1KC8 U;  1Q7Y C;  1U1T A;  2WSF E;  2CZ7 B;  5LL6 S;  4RCB A;  3CCL A;  4J8O A;  1M90 U;  4V2S A;  4JLG A;  4M78 F;  5DLO A;  3NTH A;  1UGR B;  4M75 G;  4O6J A;  5FRO A;  3ZBD A;  4PJO A;  3JB9 D;  2R5A A;  2DAQ A;  1WJS A;  3X20 B;  2O4X B;  4B9W A;  2P4T A;  4KUD K;  1JRI A;  4C0D B;  5IN1 A;  4C5E A;  1Q81 C;  1M8V A;  2C06 A;  4M75 E;  4EPC A;  2EQK A;  2RHY A;  4J6Y A;  3N5B B;  1FXX A;  4PJO F;  5C6S A;  4FT4 A;  4HCB A;  2E70 A;  2L8D A;  2K2V A;  1WPY A;  2P0Q A;  2Y4Y A;  5KCO A;  3HRU A;  5GAM f;  3HFN A;  3CCQ A;  1K8A U;  1BYM A;  2KDS A;  4M77 B;  2OAU A;  3X24 B;  3CCL T;  1QP3 A;  3L2R A;  4EMG A;  3DKM A;  3OS0 A;  4C0D C;  3OYL A;  2LRQ A;  2EQJ A;  3JCM W;  1NJI C;  3QJY A;  1PSF A;  2EJF A;  5I2S A;  3ER0 A;  4N0A A;  3S3N A;  4HCZ A;  2O01 E;  3MCA B;  3GLX A;  2R57 A;  3HFO A;  3J7A F;  2E65 A;  1ZHI A;  4M75 C;  3HRT A;  3E9F A;  2DIQ A;  4HA8 A;  1R8O B;  5GAN 6;  3QO3 A;  2D6F A;  3DB4 A;  1KQ2 A;  4M77 C;  4C8Q A;  3BFM A;  2KAF A;  4DOW A;  2BIV A;  1KQS S;  1VQ4 A;  3FJP A;  4E7I A;  3ZEH A;  3A8H B;  3ZFJ A;  5C0M A;  5GMK h;  4XTY A;  4M7D B;  2ZPE B;  4X9C A;  1M1K U;  1VQ6 A;  1H64 1;  5LJ3 h;  3CMA A;  2X4Y A;  3L42 A;  5GAO m;  3OYD A;  5J39 A;  4M7A A;  4XTW A;  2QQ9 A;  5GAM g;  2XDP A;  2EAY A;  4NS5 A;  4C8Q F;  3OYY A;  3UPU A;  4NL3 A;  5LJ3 d;  3GNF B;  2F5T X;  4ZN3 A;  3CCV A;  1M1G A;  1JB0 E;  2HQX A;  4J6W A;  4WF2 A;  4MZT A;  3CEY A;  4LDU A;  4O5V A;  5CQY A;  4M7D C;  4M7A F;  5I21 A;  1OZ3 A;  5GAO l;  4RKU E;  1VQ4 T;  2WSC E;  3RMS A;  1S72 A;  2LQ8 A;  3LH0 A;  1Q82 U;  3CC2 T;  5LJ5 h;  1HK9 A;  1B34 A;  3BDU A;  3QKJ A;  3X25 B;  3SWN B;  5IT9 E;  4ATO A;  1LJO A;  4DOV A;  5A0L A;  1VQ6 T;  4FL6 A;  3CMA T;  1U1S A;  3MO8 A;  5LJ5 e;  2RHU A;  1XTD A;  2Y4X A;  3QZ9 B;  5DM7 R;  2DIG A;  4UC4 A;  2PUK B;  3V8L A;  2L5Q A;  4MML A;  2IVW A;  3RUX A;  4A4E A;  4BI3 A;  3CCV T;  5KCH A;  2RK2 A;  3JRZ A;  4E7J A;  2F69 A;  4HCC A;  1VUB A;  3A8G B;  3SWN C;  4M78 G;  4KT0 E;  3CCR A;  3JB9 J;  3CBM A;  5GAO q;  3M57 A;  1S72 T;  4QVZ A;  5CIU A;  1VQ9 A;  2CZ1 B;  3L2Z A;  3M59 A;  4JRI A;  3QXE B;  3PT9 A;  3CC2 A;  2XK0 A;  4C92 A;  1GXI E;  1YJ9 A;  2QQR A;  1VQK A;  5GAN 4;  5LJ3 f;  3G6E A;  2MI6 A;  1EIF A;  2LDM A;  3GF5 A;  2OTL A;  4YTL A;  4M78 B;  3A8L B;  4TVR A;  4XU3 A;  1Y71 A;  2K5I A;  3TRE A;  1WJR A;  1Y07 A;  4ZTF A;  1I81 A;  3M54 A;  4Y91 A;  2CS7 A;  2X4W A;  2CKK A;  3C12 A;  2MWP A;  4OB0 B;  5I2M A;  3V8K A;  3LYI A;  4C92 F;  3I55 T;  3BDL A;  2GQV A;  3J80 E;  1KC8 C;  2JTF A;  3VU3 C;  1VQ7 A;  2VUB A;  1M90 C;  3S3O A;  1YJW A;  3QSU A;  3RES A;  3CCR T;  3JCM J;  3JCM V;  3VYH B;  2ZPB B;  4EDU A;  3OW2 A;  4A4G A;  4QW2 A;  3OYK A;  3HHT B;  4A54 A;  4DQ2 A;  3CCU T;  1VQ9 T;  5GAN d;  4PJO B;  4M78 C;  2QTX A;  2RH2 A;  2QI2 A;  5GAN 3;  1YJ9 T;  1VQK T;  5M9O A;  2WSE E;  4RG8 A;  4PKC C;  3HSB A;  1VQ8 A;  3RKY A;  2BUD A;  2X35 A;  2MMP A;  1LNX A;  4LD6 A;  2OTL T;  2ZGW A;  3KUF A;  3L2V A;  2OTJ T;  2JUF A;  1WNL A;  1N27 A;  2DKG A;  3F70 A;  4OGE A;  3RKW A;  5DY9 A;  5LJ3 g;  2E64 A;  2LTO A;  1I4K 1;  3JCM h;  1K8A C;  2WAC A;  3SD4 A;  1G3Y A;  1RL2 A;  2CYZ B;  2IG0 A;  3QII A;  1VQ7 T;  1BI1 A;  4PJO C;  1YJW T;  3E19 A;  1MGQ A;  3JCM e;  1MHN A;  4J7I A;  1VQM T;  4C8Q G;  3CC4 A;  5FRN A;  3PTA A;  4KUL A;  1VQN A;  1K9M U;  1NE8 A;  3OSS C;  3PNW C;  4P5N A;  2EJG A;  4F7U A;  3LX7 A;  4ZGJ B;  4M77 G;  1G3T A;  4XQ3 A;  2XHC A;  4JS5 A;  3VKI A;  2E6Z A;  3OA6 A;  1VQ8 T;  4C8Q E;  4PNO A;  4EMK A;  1N8R C;  4BAC A;  2EKO A;  3INZ A;  3OS1 A;  2CGH A;  2RO0 A;  2CZ6 B;  3DLM A;  4M77 E;  4C8Q B;  4PLL A;  5CK9 A;  4F7U F;  3PMI A;  3OYN A;  2M16 A;  2RJC A;  4QVC A;  3MP1 A;  3JB9 F;  4GY5 A;  4LD9 K;  1M1K C;  2EFI A;  4N0A C;  4VUB A;  3M4Y A;  4QVD A;  2E1H A;  2MAM A;  5GAN f;  4M7A B;  1XOV A;  3CC4 T;  4J6X A;  2XG8 D;  1VQN T;  3NTI A;  3GOX A;  2E41 A;  3JAM E;  2V8K A;  4M7D G;  2HD0 A;  5GAO r;  1WGS A;  2YHT A;  3GNG A;  4LDW A;  3SB2 A;  4ZGE B;  4ZN1 A;  4EMH A;  4C8Q C;  1G3S A;  2RHX A;  2CZ0 B;  3OS5 A;  2DK3 A;  3M56 A;  3FIF A;  2M9U A;  1N6A A;  2LNV A;  3V8J A;  1KHI A;  4M7D E;  5HY6 A;  5L8R E;  5CKF A;  3UWN A;  2RHZ A;  3S6W A;  4C0G A;  4QQ6 A;  3UDC A;  3CCQ T;  1Q82 C;  4M7A C;  3GIB A;  3OMC A;  5D6Y A;  3OYB A;  2QQB A;  1B34 B;  1BI0 A;  4BE1 A;  2HBP A;  2LVM A;  1JJ2 A;  3JCM X;  5AYF A;  1XNI A;  1YJN A;  4J5Y A;  2O4X A;  2ZZD A;  3CPF A;  3MET A;  2VV5 A;  3LGL A;  5KE3 A;  3EFS A;  2VGN A;  3HPW A;  4M75 D;  3NTK A;  3OBW A;  2G3R A;  2RD1 A;  5GAN g;  5CKH A;  2QEX A;  2FVU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...