1VIEA

Structure of dihydrofolate reductase
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
60
structure length
60
Chain Sequence
PSNATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHYDROFOLATE REDUCTASE
publication title A plasmid-encoded dihydrofolate reductase from trimethoprim-resistant bacteria has a novel D2-symmetric active site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 12
structure length 60
sequence length 60
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 1996-10-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.60 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1vieA00
2RK1A 2OAUA 2RK2A 3UDCA 1VIFA 2VV5A 3SFMA 3T9NA 2GQVA 2RH2A 1VIEA 2P4TA
chains in the Genus database with same CATH superfamily
2O2OA 1YJNT 2JVVA 1XNIA 1QCFA 4FYXB 2YUOA 2LMJA 5IN1A 3L2UA 2DEQA 3MEUA 4D8KA 1VQ5A 2NWMA 2DF6A 4JLGA 1TS9A 2YUPA 1I8FA 2JXBA 1GCQC 2NUPA 3EG0A 3JCMf 1ABQA 4C0ZA 1M1KU 2RI3A 4J9EA 3CBPA 3GLXA 1KD1U 3CCJQ 3GPLA 1EFNA 1B34A 1YJWA 1VQ4Q 2LVMA 1WA7A 1N5ZA 1ZBJA 5LJ5d 1X6GA 4KULA 3OA6A 3OYEA 2YDLA 2LQNA 1W6XA 1KHCA 3VRZA 2ECZA 2M0OA 3QZ9B 2NYSA 3V8JA 3I56Q 3NGPA 2YHTA 2YRVA 4XU3A 3HPWA 1JU5C 2CYZB 1WI7A 1MMGA 2ATCB 4N0AA 2DILA 3BDLA 4PLIA 5IXBA 3P8HA 3OYFA 3NPFA 1PRLC 5FLXE 2P0KA 3N5BB 2PUOB 3CCLT 2EQUA 1YWPA 3QZ5B 4E47A 1MHNA 2VKNA 1LJOA 3EG1A 4OMLA 5D6YA 1M27C 4OMPA 3OYJA 2E6NA 2YUNA 4J7FA 3OYYA 2RO0A 2JS0A 2AZVA 4A54A 2KXCA 5I22A 1VQOT 4M7DA 3QXEB 2QTVA 1IO6A 1T3LA 3DKMA 5HK3A 2DNUA 2DL3A 2FO0A 4HT9A 4BE2A 1NYFA 2D8HA 2RHXA 3VUBA 2WSEE 1JBMA 3OYAA 2AT1B 4Z02A 3VS7A 2K3BA 4QVCA 4KBMB 2JS2A 1E6GA 4FCYA 2KE9A 3MHXA 2PNIA 1T0HA 1PKSA 2LX7A 3CCMT 2HQHA 4F7UG 1M90U 4BACA 3LH0A 1SG5A 5FU6B 4BI8B 3CCUT 4ATOA 5A2QE 3CCLQ 3CC4T 2HKQB 3I5SA 4RG2A 1BKBA 3EHQA 2B8AA 4GLMA 4XAXB 2EQJA 1VQLA 1EZZB 2HZYA 3VUZA 4IUUA 3E1SA 1I5OB 2V26A 4OB1B 4A63B 1K9AA 1UGSB 3NTKA 3UATA 1Q82U 1X2KA 2GBQA 1AD5A 1GCQA 1EX4A 2E12A 2YLCA 1ZUUA 2CH4W 2F5TX 3QYHB 1D1AA 5GAMe 3CCSA 2F1LA 3TQ7P 4FT4A 3V7SA 1KFZA 2X9HA 3HRTA 3QJYA 1YHQT 4M7AC 3OMCA 2EYYA 3H0IA 5GMKe 1XOVA 1YI2A 4HVUA 2SRCA 2A28A 3J80E 1K0XA 4PJOC 4DQ2A 4J5YA 4D6WA 2K3YA 4VUBA 4M78B 3CC4A 3CCMQ 2KRMA 1Z9QA 4PLLA 2P4RA 3DLLA 2M51A 1SEMA 4QQ6A 4Y92A 2EVRA 1MUZA 6AT1B 1I0CA 4C0FA 3CCUQ 1Z9ZA 2CP5A 3RNJA 1F1BB 2D1XA 2IIMA 1MNEA 1ABOA 2C0TA 4A53A 2QQRA 2CP0A 3JB9H 5GAN5 5HY6A 2WSCE 2BTTA 1BYMA 2KY9A 2RPNA 1VQ7T 5C0MA 1HYOA 2K2MA 5LJ5j 3EGXB 3X24B 4R56A 5GAN3 2AKKA 1S72A 3I55T 3M55A 1D3BA 5L23A 3C95A 2VUBA 1YHQQ 4ORZA 3A1PA 2PQWA 2LJ3A 4QT7A 3CXCP 1WIEA 1SSHA 2O88A 2XG8D 1ZSZC 5GJWB 1K73U 1M9SA 1O75A 3NTHA 4FT2A 3OBYA 4C8QC 1X27A 4KT0E 1OU8A 2FPDA 3QWXX 5GMKm 3LWIA 4JZ3A 1IGQA 1UUEA 2G3RA 2HDAA 5KYWB 5GAOp 5LJ5g 4C8QG 1NZ9A 1NLPC 1E7OA 1VQ8T 3HRUA 2ED0A 1VQKA 1Y07A 1YIJT 1G8XA 4OGEA 4NOYA 4A4GA 5DY9A 2DM1A 1VQ7Q 4KGVB 2K7AA 2AHJB 1HD3A 4RTWA 4PK4A 3A5ZB 4M75B 5GAMh 3CC2Q 3PT9A 4M77C 1M2OA 3HP9A 1GCPA 3OYLA 1NPRA 1IB8A 1H3HA 5GMKh 3G6EA 2PVOB 1OYXA 4E7ZA 3PVLA 4M7AA 1X75C 4CRIA 1T0JA 3H9NA 1WGSA 4PJOA 2KRSA 3TEEA 4M78E 3RBBB 4E7JA 1KQSS 3VS2A 3JCMb 3PNWC 1M1KR 4LD9K 5KYXB 3D7SB 1W2BS 1JRIA 1PHTA 1KD1R 5LJ5f 2CP6A 3DB3A 5CK9A 1Y57A 2PVGB 4WCIA 2A0FB 2D8JA 3L2QA 3CCEA 3G71A 4BB7A 2LJ1A 1QWFA 2FRYA 1I81A 1D0ZA 5GAN6 1YIJQ 1GL5A 2D0NA 4C0GA 2EJ9A 4Q5WA 2GTJA 4F7UB 2X4JA 1WHKA 2EYXA 4FL6A 2DETA 2EJGA 2BZXA 2EBPA 1TUCA 3MP1A 5I2MA 1R8OB 8ATCB 2V8JA 2M1HA 1C6VX 2KROA 2COZA 2QYZA 5LJ3d 1SRLA 2AIRB 4XQ3A 2QA4A 4F04B 2RJDA 2DEUA 1QCNA 4QVDA 4DEYA 3E2UA 2K2VA 1JEGA 2H8HA 4AG2C 4N4GA 4JLIA 3OS0A 5DM7R 4CI0C 5GANe 1JXMA 1ZSZA 3VV0A 4MZMA 1WXBA 1ACMB 2DA9A 3M0QA 3PIOA 4C8QA 3CC7T 2PZ1A 2DK3A 2LRQA 1YCYA 3RKYA 4BY6C 4LE9A 4AFSC 2CZ1B 1T3SA 3E9GA 4TVRA 1ZUYA 1BK2A 4HKEA 2KRNA 3SFMA 1AZGB 3E19A 4C8QD 1HXDA 3JB9G 3OS1A 2NLUA 1TH7A 3CCQT 4OF1A 1TG0A 3QDFA 1N6AA 2K5LA 4RKUE 4LDUA 2LNHB 1M90R 4KUDK 1EIFA 1XJWB 4F7UF 2Y4YA 3V8KA 1RADB 1YITT 1CKBA 4M75E 2LZ6B 4M77A 3UF4A 1NE8A 2ESWA 1ZLMA 5KE2A 1RABB 3OW2A 1U8RA 4HT8A 4O6JA 2KYBA 2RQWA 1YCSB 2ZPFB 5I11A 3I9QA 1FX7A 1YJ9Q 1ARKA 1C1AA 4M77D 1AOJA 1RAGB 4AMCA 4XTZA 3LLRA 1M1KC 4LXCA 4JJDA 3S3MA 1KD1C 1Q82R 1IRXA 4E7HA 3AHUA 1UTIA 3FJPA 1K1ZA 5IAYA 4J8OA 1VQNT 2HEQA 1Y7XA 1M5Q1 1FYNA 3CCVA 4PNOA 3X20B 2RK2A 2DZCA 1UGVA 3P8BB 1X6BA 5EG2A 1GFCA 1V29B 5CKEA 3CCQQ 3C94A 4AT1B 2DJQA 2O9VA 4MDXA 3VS1A 4N4HA 2HQXA 3CMET 1M1FA 1NEGA 1U06A 4PFOA 4RMOA 4MZPA 2JT4A 4F14A 2COWA 4LNPA 2HSPA 1VQPA 3QO3A 2KBTA 1RLPC 2DL8A 4OVAA 4LDXA 2DTIA 2DBKA 2OTJA 2K57A 2BIVA 1G3SA 3FC3A 1JO8A 4C92E 2XIDA 1QKWA 2FEIA 4CC4B 5GANh 1NBEB 1QCOA 2K6DA 3CCRA 5FRNA 2FB7A 3CCJT 1KG1A 4M7DG 1PC0A 1PNJA 1VQ4T 3REAB 4A4FA 2IPOB 2L8DA 1VQNQ 2J06A 1BU1A 4IURA 5D6XA 1C0MA 2X51A 1G5VA 2MWPA 4XTUA 2LCSA 2QGGA 2BZ8A 1BI2A 2H3JA 2QQBA 2HMAA 3JB9D 1M90C 1DJ7B 2XHCA 3CMEQ 5LJ3j 2QAZA 4AG1C 1G3TA 3RKWA 1K73R 3EG9B 3A8MB 5GAMj 1RLQC 3OS5A 2LCCA 2VGMA 3CCJA 4QQGA 2MOXA 4X9DA 1KQSA 3A8HB 4C8QF 5CAIA 4IUPA 2L2PA 5A0LA 4DOVA 5HKCA 1Q82C 2O9SA 2DLPA 4XK8E 5GAOm 2KMTA 2GF7A 2EYQA 3L42A 1WDXA 1BI1A 1AZEA 3EG3A 1RAAB 1NLOC 4QKUA 3VYHB 3X28B 3I56A 2YRCA 3EGDA 1VYUA 4E7KA 2X4XA 5LJ3g 1LVKA 4XU1A 2V8IA 1YJNA 5GAMg 1VIFA 4PJMA 4M77F 3C12A 2FVUA 4BDYA 3INZA 1FMWA 1UFFA 2FZKB 4BI4A 2DVJA 3OS2A 2QGFB 2FG0A 1R0BG 2ZGWA 1TOVA 1KK7A 1K9MC 2HSEB 4NS5A 5CKFA 4M75C 2ZPHB 3PMIA 1Q86U 3RIRA 2RA2A 2EWNA 1P92A 5IHNA 3LGFA 1V76A 3CXCS 1I5LA 3JCMW 2BE7D 5FROA 3H6ZA 5FRMA 1BI3A 2GTOA 2V1QA 4HVWA 1WHJA 2YWWA 1Y0MA 3VS6A 1UDLA 1H641 2DXCA 3JCMe 3CD6Q 4M7DD 3ULRB 3VKIA 3VS5A 5LJ3f 2RQUA 2LC4A 2ZPEB 2JNGA 3SWNC 1KSWA 4DBFA 1IHVA 5GAMf 3EH2A 3EH1A 2A08A 1QVFP 3CCLA 2FYKA 4JRIA 4WTOB 2OJ2A 4C0DB 3FIFA 1QP2A 2I0NA 3GBQA 1NPPA 1K73C 2Y4XA 1MGQA 1AWOA 1ZBXA 4KGXB 2L89A 4EPCA 1BIBA 3QBYA 2RI5A 1QP3A 3G4ST 2XI9A 2NUPB 1W70A 3OYIA 1VQOA 3JSCA 3MKDA 3PVQA 2I2LA 1H8KA 1B34B 4KH1B 2AZSA 1I4K1 4KGZB 5C6SA 2DYBA 5FU7C 4C92C 4Z88A 2J05A 3BW1A 1NG2A 3JB9F 4E7LA 2VVKA 4ZGEB 4WF2A 1IGUA 1ZSGA 4B6MA 4FYWB 2F5KA 4RTVA 3HHTB 3HSBA 3QG1A 5I2SA 1UJYA 2O4XA 2OTLT 1YWOA 2QTXA 3CCMA 1QW1A 3Q1JA 1N8RU 3UWNA 4ZGJB 4FYVB 3QDRB 1VQLQ 3R6NA 2SEMA 2L3QA 4E7IA 2VWFA 4LUDA 4PFPA 2EGEA 3CCUA 4M7AG 2E1HA 1S1NA 4ME7A 5CVIA 2CZ7B 3PE0A 1U3OA 3H41A 2DL4A 4PJOG 1VQMT 4A4HA 4ELZC 4XTYA 4M7DB 2CREA 1PD0A 3G4SQ 4OMMA 1OX9A 5L8RE 1UB4A 4M75A 1Y71A 1NEBA 2E3IA 5KCHA 2NUZA 5GAOr 4PFZA 3TVTA 5I21A 1YI2Q 1N27A 2KXDA 1PM3A 4EIKA 4ESRA 2X3WD 2K3XA 4J7IA 2X4YA 3PIPA 5GMKl 1YHQA 5D6WA 3JCMh 3CC2T 1U5SA 3TSWA 1M3BA 2EIFA 3PTAA 1WHGA 1JJ2S 5KYUB 3OSVA 2OTLQ 1GBRA 4HCZA 1OZ3A 2O31A 4X9CA 3V7RA 2KT1A 2F2XA 3SWNA 1WXTA 1KHIA 2LT1A 2M0YA 3QIIA 5CKBA 4BDZA 4X34A 2RMOA 1X69A 2CT4A 5DLQE 1ZA2B 3ME9A 3V8LA 4DBHA 1VQMQ 5KCOA 4CC3A 2OAWA 4M7DF 3A8OB 1BBZA 4PJNA 1VQ7A 2XICA 2LQ8A 4XTVA 3BDUA 2JN0A 2MK5A 5KE3A 3UA7A 3CC2A 3VRYA 2CSIA 4C92A 3I55A 5ECAA 2OX7A 3CPFA 4Y28E 8AT1B 3CEYA 3MEWA 1SHGA 1IXDA 2JJ9A 1M3AA 4EMKC 1Y96A 3VS3A 1SRMA 4DBRA 1PWTA 1WHHA 3CPWS 1RI0A 2CZ0B 4M77G 2DXBA 4OB2B 5CR2A 1J3TA 2DXUA 1VQKQ 3URGA 1OEBA 4AFZC 2DO3A 2E5QA 1WQ7A 2CGHA 4M7AD 1VQ8A 4XTXA 1TTHB 4PJOD 1VQ9T 1YIJA 2K5FA 1UHFA 3M59A 1BIAA 2CP3A 3GNGA 1WFWA 3G6EQ 1U1SA 2P0PA 2ZPIB 4IIMA 3LYIA 4OMOA 1D3BB 2YSQA 3LWHA 2PTKA 3M4GA 2CT3A 1UGQB 1VUBA 3OBWA 1WPYA 3C4SA 2DD5A 1UECA 4J9HA 1PCXA 2EYWA 4JRQA 1M30A 4BUGA 4RTZA 2KNBB 2X3XD 5IHIA 4BI3A 5GAMd 1K8AU 2CDTA 2KSSA 4MMLA 3CCEQ 1WQWA 2AK5A 1Q86R 2NUTB 4IUVA 1YJ9T 2DRKA 2EAYA 2RF0A 4J6WA 2DL7A 4MZTA 3UPUA 3THKA 3FDRA 1WJQA 1H3ZA 3HTRA 3OYNA 3M0SA 2B86A 2Y90A 2DJZA 1VQ9Q 1W1FA 3KXTA 1JJ2P 4LUEA 2E4HA 1RUWA 1WHMA 3P8DA 1M2VA 5LJ5e 2XK0A 2CSQA 3SB2A 2BKDN 3EFOB 1ZUKA 3GNFB 2P0QA 2W0ZA 1Q81U 1SKUB 4F16A 4M7AB 1OULA 3EGUA 2CZ6B 1H92A 4CC2A 3GOXA 3SDZA 2JM9A 2MCNA 3PFSA 4EMKA 2XDBA 2H3EB 4L59A 1RAFB 2XU8A 3MCAB 1VYVA 5DLOA 2YLBA 2GCXA 5GMKi 3M54A 4V2SA 5KYYA 2HBPA 2MWOA 3CC7A 3J81E 2LJ0A 1NJIU 2KDSA 4LDWA 2GNCA 3GIBA 3META 2GFUA 4R0KA 4C5GA 3TCJA 1M8MA 5FU6C 3A98A 5IHKA 4HCBA 4B9XA 5KYNA 2QQ9A 3CCQA 3L2RA 3PGGA 1BI0A 1VQ6T 1PRMC 2A7YA 4X1VA 3CBMA 1QWEA 2VYTA 3CPWP 3O8VA 3LW5E 1QVGP 4C5IA 1N8RR 4JJNK 5A0GA 4PJJA 4ZNXA 4IKFA 4J9BA 1K76A 1D0YA 2CH4A 4RUGA 3CMAT 1YITA 2QEXT 2RB6A 4OMFB 5FWBA 4FSSA 3SD4A 2EYZA 4M7AF 4F7UE 3M57A 3NHNA 2M9UA 4C5EA 2X35A 2QQSA 2D6FA 3KUFA 2KQWA 4PJOF 3EG2A 1ZSZB 1M8VA 1OOTA 5CKDA 3V7CA 3CCVQ 1ZA1B 2E41A 3VS0A 4HCKA 4C8QB 1QKXA 1QVFS 3OB9A 1M3CA 1TUDA 4HCCA 2EFIA 1OX8A 3JCMc 1OZ2A 2RHZA 2PVDB 1QQJA 1D1CA 4CC7A 1VQNA 4M78C 2C0OA 2KR3A 2Z0WA 3G7ZA 2CP7A 3ASKA 4OMNA 4XU0A 1X2QA 2RD1A 4M78G 4QW2A 3QJ6A 1AWXA 3JRZA 2YXYA 2P4TA 1VQ6Q 5LJ5h 2MF2A 1VQPQ 1RAHB 2KAFA 1QLYA 3CMEA 2RNAA 1FMKA 1HK9A 1VQ5T 2G6FX 4M77B 5GAOl 4GLKA 2YT6A 4LDVA 3CMAQ 4HA8A 1D1BA 5GAN8 2DKGA 1N9RA 2QEXQ 2QASA 3JB9J 5IXFA 3TSZA 2QG9B 3R6OA 2F2VA 3MEAA 4ZN1A 2QK0A 2JTMA 3EAEA 4Z8AA 3FRNA 2KT8A 2L0AA 3ZBDA 1OV3A 4OB0B 1JQQA 5A0DA 2EJFA 4J9IA 2W10A 3L2WA 1K4US 2JM8A 5GMKj 1GBQA 4DOWA 5CCAA 3QUIA 2HKNA 2C0IA 1VQ4A 3QYGB 5M9OA 2IG0A 2VXEA 1W2BA 2O01E 4KUIA 1IZ6A 3MEVA 2R5MA 1YBYA 1HSQA 3C0CA 3QHSA 3CD6T 3U23A 1ZQ1A 4D8DA 3CQTA 2K9GA 5GANd 3H0FA 4J9FA 4E7SA 4E6RA 1N8RC 2VC8A 2K5IA 2RJFA 2DFUA 2EGCA 1VQ5Q 1AHJB 1WYXA 2M02A 4JRPA 2JMAA 1Q7YU 4BD3A 2DE0X 3KFVA 3VJPA 4EMGA 1SHFA 4RTXA 3T9NA 1M1GA 5CKHA 2E64A 2HL3A 4LDYA 4JUVA 3DLMA 1YJWQ 4FIBA 2RK1A 2A37A 2KYMA 2XDDA 1K0SA 2EW3A 4BE0A 1OPLA 4M75G 3CD6A 2RM4A 4C8QE 3LX7A 1YJNQ 1ZHIA 4ZN3A 4BY6B 5IT9E 3OYBA 4M78A 2DD4A 1RI9A 2ZPGB 4GY5A 1D09B 5KH6A 3OYDA 3M0UA 1B3QA 1KC8U 3QPHA 4QVZA 3F70A 2R57A 2PU9B 4M78D 5IH2A 1VQLT 3RMQA 2DX1A 3WXMB 1K8AR 3H8ZA 3OYMA 4M77E 3L2ZA 4ZTJA 4J83A 4JJCA 3FLGA 4A4EA 3BFMA 3HL8A 2RJEA 4JPBW 4C5HA 2DYIA 2D0QB 2CUDA 3CCST 2GFAA 3EGXA 1VYTA 3M0TA 4ELYC 3BE3A 4O5VA 1FXXA 4IIOA 4HXJA 5KYUA 1YI2T 3EGDB 2BE9B 1LOJA 2MPXC 2WACA 3UDCA 3E9FA 1M4ZA 3TU4K 4KRTA 2WSFE 3JV3A 3OYHA 2CS7A 2RH2A 1Q81R 3AT1B 2FRWA 4C92G 2FL7A 2HD0A 1LPLA 4YTLA 4OMQA 3HFOA 3ER0A 2LX9A 1VQOQ 2IVWA 4LD6A 4II1A 5KYWA 2X4WA 5LJ3e 3RKXA 4OP0A 2DMOA 2J7IA 3G4SA 1WXUA 3WVEB 1KQ1A 3LH5A 1RAEB 2V1RA 2DIQA 2L3PA 1NJIR 2LQWA 2DAQA 2HCKA 3A8GB 4RCBA 1S72T 2ZZDA 1QVFA 3CCSQ 2ABLA 4DEXA 3OW2S 1RAIB 2JMCA 3M4YA 1UEBA 2XDPA 2FPFA 3JCMX 1NYGA 4J9DA 3VYGA 4J6YA 2ROTA 2AKLA 2DVEA 1K9MU 3WVDB 1PSFA 1UE9A 2V8KA 4M75D 3CC4Q 2GGRA 2OTLA 1JXOA 1JB0E 1WLPB 1ZX6A 1TXQA 2HL5C 2ZPBB 4RTTA 2VGNA 2E5KA 5GANj 2CP2A 4QQDA 1BB9A 4RG8A 3VU3C 1AWWA 3JAME 4FSXA 5KYXA 2RHYA 3H0HA 1CKAA 1WJRA 1SSFA 2MMPA 3I35A 5AYFA 1K8AC 1N9SA 5GAOn 1YFNA 2QXFA 3PMTA 1VQMA 2DXTA 1VQKT 2BUDA 2EQMA 1KQ2A 3FEOA 1GFDA 1PKTA 3M0PA 4R55A 5GAN7 2HBWA 2PUKB 5CQXA 4HVVA 2R58A 3ZFJA 2DTHA 1BCMA 1D0XA 3RERA 1WJSA 4OB3B 4F7UA 4J6XA 2KK4A 1S72Q 4BE1A 4FM4B 3S3OA 2EQKA 3G6ET 5GANg 3X26B 4M78F 1V1CA 3DB4A 1BCOA 4KH0B 2O4XB 1HJDA 4J9CA 4PJLA 1AVZC 1Q81C 2VASA 2LT4A 2RQTA 2NUTA 4NL2A 2QDLA 1B07A 5J3BA 1XQHA 2LNVA 2QQAA 4JZ4A 5GAN2 1OI1A 2QDYB 1WNLA 4C92D 3JCMd 2DRMA 2OI3A 2RJCA 1VIEA 5LJ3h 1OU9A 3OY9A 1QVGS 3CCET 5FW9A 3G71T 1XTDA 3RDVA 3FB9A 1WX6A 2E70A 1VOMA 4PKCC 2EQIA 3JCMP 4FW1A 3M58A 1NJIC 2M16A 3EFOA 3I55Q 2K4YA 4A4KA 4DA4A 1OPKA 1KJWA 2DERA 1KIKA 9ATCB 3O5ZA 5GAN4 3GF5A 2VB6A 4JJBA 3X25B 4PL6A 3FJ5A 3UA6A 3CXCA 1UJ0A 1SPKA 2DL5A 2EKOA 4M7DE 2JZ2A 5GANf 1I1JA 2QA4T 3RESA 3S3NA 5GJVB 2FPEA 2KEAA 4JDSA 1A0NB 1G3WA 2FHDA 2C06A 4FU6A 1YNZA 4XTWA 4LN2A 2XD0A 4XU2A 3OMGA 3SWNB 1MMNA 2KGTA 4JRKA 2JTEA 1Q7YR 2E3HA 3MO8A 3UT1A 1VQ8Q 1GRIA 1U1TA 1RACB 1LCKA 1TWBA 4Z89A 2J6OA 4J9GA 4EMHA 3OYKA 1FWZA 3OW2P 3QKJA 1AEYA 4P5NA 2J6KA 4Y91A 3G71Q 4IUTA 3M56A 2EGAA 4F17A 5D7UA 3OYGA 4IUQA 2HNIA 1RL2A 2CKKA 3M9QA 3S6WA 2D9TA 3I5RA 3RUXA 1MV3A 1NM7A 1X6OA 1UG1A 4AFUC 1VQ9A 4ANJA 4M75F 1G83A 1MNDA 2DBMA 2VV5A 3L2VA 5CQYA 5CO7A 1GXIE 3CBOA 1PSEA 3M5AA 3MP8A 3SHWA 3ZEHA 2MI6A 2RI2A 3BY7A 5FU7B 2LCLA 4C92B 4FW2A 3JCMJ 5EC7A 2A3LA 1VA7A 5FWCA 2LP5A 1LNXA 2QA4Q 2DIGA 2A36A 2DTOA 3OQ5A 2L3SA 2HAXA 2QI2A 1MMDA 1Y96B 1KC8R 1PG5B 3MPUB 4E2FB 2MAMA 3GP8A 1AWJA 2XMFA 1SF9A 3JCMQ 2JOYA 2KI7A 3HRSA 2L5QA 1PD1A 3REBB 2LQKA 1YN8A 2LDMA 1W4SA 3OYCA 1CSKA 4PJOB 2HQEA 1IREB 4RTYA 2RN8A 1YJ9A 2ENMA 2ZAEA 4RTUA 3RMSA 3CCVT 2LTOA 3OSSC 2VXFA 1AT1B 4L5GA 4M4ZA 1FMVA 3SEMA 2F2WA 3QWYA 3G1JA 5CIUA 1X43A 3HFNA 2FZCB 2KVQG 4C0DC 2COYA 1IHWA 2GQIA 4ZTFA 3JCMV 1R77A 2ZCFB 2GQVA 1G2BA 3KBGA 4C92F 4JS5A 3EG9A 3HKSA 2JW4A 2R5AA 2RQRA 1VQPT 1UGRB 5J39A 2JUFA 2E65A 1YP5A 2OTJT 3EFRA 3RR6A 1TUGB 1Q7YC 3MJXA 3CC7Q 4OGCA 3NTIA 1JJ2A 3CCRT 4ZGDB 2RQVA 4UC4A 2ROLA 3MP6A 2F69A 3J7AF 1QVPA 2DZ9A 3NFCA 3TREA 4N0AC 3EHRA 2P84A 1TU0B 1Q86C 2MIOA 2RHUA 4FYYB 2L3RA 2K79A 1I07A 2RHIA 4AFQC 1KQSP 4B9WA 4DBQA 1M2VB 4GBQA 1UHCA 1W2BP 1YITQ 2YUQA 3M53A 3A8LB 1K9MR 1O9SA 1VQ6A 1X01A 2FZGB 3VS4A 1B7TA 1G3YA 1TSFA 1E6HA 3IQLA 4NL3A 2BZYA 2ED1A 3JB9I 4JS4A 2E6ZA 4M7DC 4MDWA 2DPPB 5HK0A 1WHLA 2EPDA 1KC8C 3CMAA 4MMKA 2QEXA 2XKOC 5LL6S 3L1AA 1WZOA 3NMZC 3JCMg 2J6FA 2OAUA 5AT1B 4EMKB 1UGPB 3ZL7C 2OTJQ 4K11A 2JTFA 1Q95G 2YRDA 2E10A 2CUBA 1QMCA 5J26A 3EFSA 3QSUA 2MYSA 5HCKA 3CCRQ 2EKHA 1MV0B 5KYYB 4M7AE 3CPWA 3M0RA 4L6V5 7AT1B 1YJWT 3LGLA 3I56T 1QVGA 1OQKA 1R0CB 4PJOE 4RCCA 5GAOq 1MMAA 4N4IA 4EDUA
chains in the Genus database with same CATH topology
3UDCA 4C92A 3E9FA 3I55A 1YJNT 2JVVA 1N6AA 1M4ZA 2K5LA 3CPFA 4RKUE 4Y28E 1XNIA 4LDUA 3TU4K 4KUDK 1EIFA 3CEYA 3MEWA 2WSFE 4F7UF 3OYHA 2CS7A 2Y4YA 3V8KA 4EMKC 2RH2A 1YITT 5IN1A 4M75E 1Y96A 4C92G 3L2UA 4M77A 2DEQA 2FL7A 1NE8A 3MEUA 5KE2A 3OW2A 2HD0A 1U8RA 4HT8A 4YTLA 1VQ5A 4O6JA 3HFOA 3CPWS 2ZPFB 1RI0A 3ER0A 2CZ0B 2LX9A 2IVWA 4JLGA 4LD6A 1FX7A 4M77G 1I8FA 4II1A 2DXBA 2X4WA 4OB2B 3JCMf 5CR2A 5LJ3e 4M77D 2DXUA 4C0ZA 1M1KU 3URGA 3RKXA 4OP0A 2RI3A 4XTZA 3CBPA 3LLRA 3GLXA 1M1KC 1KD1U 2DO3A 3G4SA 2E5QA 3GPLA 1WQ7A 1B34A 3WVEB 3S3MA 1YJWA 1KD1C 4E7HA 3AHUA 2CGHA 2LVMA 4M7AD 5LJ5d 1KQ1A 4KULA 1VQ8A 3FJPA 3OA6A 5IAYA 3OYEA 2DIQA 4J8OA 2DAQA 4XTXA 1VQNT 1KHCA 1Y7XA 1M5Q1 3A8GB 1VQ9T 4PJOD 2M0OA 4RCBA 1YIJA 3CCVA 2K5FA 3QZ9B 4PNOA 3V8JA 1S72T 2ZZDA 3M59A 1QVFA 1BIAA 3X20B 3GNGA 2RK2A 2YHTA 2YRVA 3OW2S 1U1SA 2DZCA 4XU3A 3HPWA 2CYZB 3P8BB 2P0PA 2ZPIB 5EG2A 3M4YA 3LYIA 1UEBA 1V29B 2XDPA 4N0AA 3JCMX 5CKEA 1D3BB 3VYGA 3C94A 3LWHA 3BDLA 4PLIA 4J6YA 4MDXA 3P8HA 3OYFA 1NJIU 2DVEA 4N4HA 1K9MU 2HQXA 3WVDB 1PSFA 3CMET 5FLXE 2P0KA 3N5BB 2PUOB 2V8KA 4M75D 3M4GA 1M1FA 3CCLT 1UGQB 2EQUA 1VUBA 2OTLA 3OBWA 1WPYA 3QZ5B 3C4SA 4E47A 1JB0E 2DD5A 2ZPBB 4RMOA 1MHNA 2VGNA 4MZPA 1LJOA 5GANj 5D6YA 4QQDA 4RG8A 4JRQA 4BUGA 3VU3C 3OYJA 3JAME 2E6NA 4FSXA 1VQPA 3QO3A 4J7FA 3OYYA 4OVAA 4LDXA 2DTIA 4BI3A 2RHYA 2RO0A 5GAMd 2OTJA 4A54A 2K57A 1WJRA 1K8AU 1VQOT 2BIVA 1SSFA 2MMPA 1G3SA 3QXEB 2KSSA 4MMLA 4M7DA 1WQWA 5AYFA 3FC3A 1K8AC 1YJ9T 1N9SA 4IUVA 4C92E 3DKMA 5HK3A 5GAOn 2QXFA 2XIDA 3PMTA 1VQMA 2DXTA 2EAYA 1VQKT 2BUDA 4J6WA 2EQMA 5GANh 1KQ2A 3FEOA 3CCRA 4MZTA 3UPUA 4HT9A 5FRNA 2FB7A 4R55A 5GAN7 3CCJT 4M7DG 4BE2A 1KG1A 3FDRA 1WJQA 1VQ4T 2PUKB 2RHXA 3VUBA 5CQXA 4A4FA 1H3ZA 2L8DA 2WSEE 2R58A 3OYNA 1JBMA 3ZFJA 2DTHA 3OYAA 2Y90A 2DJZA 3RERA 1WJSA 4OB3B 4IURA 4Z02A 3KXTA 4F7UA 4J6XA 4QVCA 2KK4A 4KBMB 5D6XA 4BE1A 4FM4B 3S3OA 3P8DA 1G5VA 2EQKA 2MWPA 3MHXA 4XTUA 5LJ5e 3G6ET 2XK0A 5GANg 3SB2A 2BKDN 3CCMT 1BI2A 4F7UG 3X26B 4M78F 1M90U 4BACA 3DB4A 2H3JA 2QQBA 3GNFB 3LH0A 3JB9D 2P0QA 2O4XB 1M90C 1DJ7B 1Q81U 2XHCA 5FU6B 4M7AB 1Q81C 5LJ3j 4BI8B 2LT4A 3CCUT 5A2QE 4ATOA 3CC4T 1G3TA 2CZ6B 4NL2A 4RG2A 3RKWA 1BKBA 3GOXA 3A8MB 3SDZA 2B8AA 5J3BA 5GAMj 3PFSA 4XAXB 2EQJA 1XQHA 2LNVA 2QQAA 4EMKA 2XDBA 4L59A 3OS5A 5GAN2 1VQLA 1OI1A 3VUZA 2QDYB 2LCCA 1WNLA 2VGMA 3E1SA 4IUUA 4C92D 3JCMd 4OB1B 3CCJA 2XU8A 4QQGA 3MCAB 4X9DA 1UGSB 5DLOA 1KQSA 2RJCA 1VIEA 2YLBA 2GCXA 3A8HB 3M54A 3NTKA 5LJ3h 4C8QF 5GMKi 5CAIA 4IUPA 3OY9A 2HBPA 1Q82U 3G71T 1QVGS 5A0LA 2MWOA 4DOVA 1XTDA 5HKCA 1Q82C 2YLCA 2E12A 3FB9A 3CC7A 4XK8E 2E70A 2F5TX 4PKCC 5GAOm 3J81E 2KMTA 3JCMP 2GF7A 2EYQA 3L42A 2KDSA 3QYHB 4LDWA 3M58A 3GIBA 1BI1A 3META 2M16A 1NJIC 2GFUA 5GAMe 3I56A 2K4YA 3CCSA 3VYHB 3X28B 4A4KA 4C5GA 4DA4A 4FT4A 3V7SA 3HRTA 3TCJA 5FU6C 3QJYA 1YHQT 4M7AC 4E7KA 5GAN4 3OMCA 3GF5A 5GMKe 1XOVA 4HCBA 3X25B 4B9XA 4PL6A 2QQ9A 3CXCA 3CCQA 3L2RA 1YI2A 3PGGA 1BI0A 2X4XA 5LJ3g 2EKOA 4M7DE 1VQ6T 2JZ2A 5GANf 3J80E 2QA4T 2A7YA 4DQ2A 4J5YA 3CBMA 4PJOC 4D6WA 4XU1A 2V8IA 2K3YA 2VYTA 3RESA 1YJNA 4VUBA 3O8VA 3S3NA 4M78B 3LW5E 3CC4A 5GAMg 4C5IA 4JJNK 5A0GA 4PLLA 1VIFA 4IKFA 3DLLA 4JDSA 4M77F 4QQ6A 3C12A 2FVUA 1G3WA 4BDYA 2FHDA 3CMAT 3INZA 3OS2A 1YITA 4BI4A 2C06A 2QEXT 2RB6A 2ZGWA 4FU6A 4OMFB 4C0FA 4XTWA 1K9MC 2XD0A 3CCET 3SD4A 4XU2A 4M7AF 4NS5A 3OMGA 5CKFA 3SWNB 4M75C 2ZPHB 4JRKA 3M57A 4F7UE 2M9UA 3MO8A 3PMIA 3UT1A 4C5EA 2X35A 2QQSA 2D6FA 4A53A 3KUFA 1U1TA 2KQWA 4PJOF 3RIRA 1Q86U 2RA2A 2QQRA 2EWNA 1P92A 1M8VA 5CKDA 3V7CA 3LGFA 3CXCS 1I5LA 3JCMW 4EMHA 3OYKA 1FWZA 2E41A 3JB9H 4C8QB 5GAN5 5HY6A 3QKJA 4P5NA 1QVFS 2WSCE 3OB9A 5FROA 3H6ZA 4Y91A 2EFIA 2KY9A 1VQ7T 4HCCA 3JCMc 1BI3A 4IUTA 3M56A 5FRMA 1OZ2A 2RHZA 5C0MA 2PVDB 3OYGA 5LJ5j 4IUQA 2HNIA 1RL2A 2CKKA 3M9QA 3S6WA 1VQNA 2D9TA 3RUXA 4M78C 1H641 3X24B 1X6OA 1VQ9A 4R56A 5GAN3 2DXCA 4M75F 3JCMe 1S72A 3I55T 3G7ZA 3ASKA 1D3BA 3M55A 4XU0A 4M7DD 3C95A 2VUBA 2VV5A 3VKIA 5CQYA 3L2VA 5CO7A 1GXIE 3CBOA 1PSEA 3M5AA 3MP8A 5LJ3f 3ZEHA 2MI6A 2RD1A 2RI2A 4M78G 3BY7A 4QW2A 5FU7B 2LCLA 2PQWA 2LC4A 3QJ6A 4C92B 2A3LA 3JCMJ 2ZPEB 2JNGA 3JRZA 3SWNC 2P4TA 5LJ5h 1LNXA 2MF2A 5GAMf 2DIGA 2DTOA 2KAFA 3CMEA 3OQ5A 2HAXA 1HK9A 1VQ5T 2XG8D 3CCLA 2FYKA 2QI2A 4JRIA 1Y96B 4C0DB 4M77B 3FIFA 5GAOl 1QP2A 4GLKA 1K73U 1M9SA 2MAMA 3GP8A 1O75A 4LDVA 3NTHA 1NPPA 4FT2A 3OBYA 1K73C 2Y4XA 4C8QC 1MGQA 3JCMQ 2JOYA 3HRSA 4HA8A 1ZBXA 5GAN8 2L5QA 2L89A 2DKGA 4KT0E 1N9RA 4EPCA 3JB9J 2LQKA 5GMKm 1BIBA 3QBYA 3LWIA 2RI5A 2G3RA 1QP3A 3R6OA 3MEAA 3G4ST 2XI9A 2LDMA 1W4SA 5GAOp 3OYIA 5LJ5g 4ZN1A 3OYCA 1VQOA 4C8QG 1NZ9A 2HQEA 1IREB 3JSCA 2JTMA 4PJOB 3EAEA 1VQ8T 1YJ9A 3FRNA 3HRUA 2I2LA 3ZBDA 1B34B 4OB0B 1VQKA 5A0DA 1I4K1 1Y07A 2EJFA 3RMSA 3L2WA 1YIJT 3CCVT 2LTOA 4OGEA 5GMKj 3OSSC 2VXFA 4DOWA 5C6SA 5CCAA 5FU7C 3QUIA 4NOYA 4C92C 4A4GA 4L5GA 5DY9A 1VQ4A 3QYGB 5M9OA 2IG0A 3BW1A 2AHJB 2VXEA 1W2BA 5CIUA 3JB9F 2O01E 4KUIA 4E7LA 1IZ6A 3A5ZB 3HFNA 3MEVA 4M75B 2KVQG 2R5MA 3PT9A 4WF2A 4C0DC 4ZGEB 4M77C 1YBYA 3HP9A 3QHSA 3CD6T 3OYLA 2F5KA 1NPRA 3HHTB 1ZQ1A 3QG1A 3HSBA 5I2SA 5GMKh 2O4XA 3G6EA 2OTLT 2PVOB 5GANd 2QTXA 1OYXA 4ZTFA 3JCMV 1QW1A 2ZCFB 3Q1JA 3CCMA 1N8RU 4M7AA 1X75C 3UWNA 2GQVA 4ZGJB 4CRIA 1N8RC 2VC8A 3KBGA 2K5IA 4C92F 4JS5A 2RJFA 3QDRB 3HKSA 2R5AA 1WGSA 1VQPT 4PJOA 1UGRB 4E7IA 5J39A 3CCUA 1AHJB 2JUFA 4M7AG 2E1HA 3TEEA 2E65A 2OTJT 4ME7A 4M78E 5CVIA 4JRPA 3EFRA 2CZ7B 1Q7YU 4BD3A 4E7JA 1KQSS 3VJPA 3JCMb 4EMGA 1Q7YC 4PJOG 3PNWC 4LD9K 4OGCA 1VQMT 4A4HA 3NTIA 4ELZC 1JJ2A 3T9NA 1W2BS 1M1GA 5CKHA 2E64A 4LDYA 1JRIA 4JUVA 4XTYA 4ZGDB 4UC4A 3CCRT 4M7DB 5LJ5f 3DB3A 3DLMA 5CK9A 5L8RE 1BYMA 2PVGB 1UB4A 4V2SA 4FIBA 3MP6A 4M75A 2F69A 3J7AF 1QVPA 2RK1A 2DZ9A 3NFCA 1Y71A 3L2QA 3CCEA 3TREA 4N0AC 4BB7A 5KCHA 3G71A 2XDDA 5GAOr 1Q86C 5I21A 4BE0A 1I81A 5GAN6 1N27A 2RHUA 4M75G 2L3RA 3CD6A 2RM4A 4C8QE 3LX7A 4C0GA 1ZHIA 2EJ9A 4Q5WA 2RHIA 2X4JA 4F7UB 2K3XA 4J7IA 2X4YA 4B9WA 4BY6B 4ZN3A 5GMKl 4EDUA 3PIPA 5IT9E 4FL6A 1YHQA 5D6WA 3JCMh 2EJGA 3MP1A 5I2MA 1R8OB 3CC2T 3OYBA 4M78A 2V8JA 2M1HA 3A8LB 3M53A 5LJ3d 1O9SA 2DD4A 1VQ6A 1X01A 2EIFA 2ZPGB 4XQ3A 3PTAA 2QA4A 1JJ2S 4GY5A 5KH6A 1G3YA 3OSVA 3OYDA 4NL3A 2RJDA 3JB9I 4JS4A 2E6ZA 1KC8U 4M7DC 4HCZA 4MDWA 4QVDA 3QPHA 2DPPB 1OZ3A 4QVZA 5HK0A 3F70A 2R57A 1KC8C 4X9CA 2K2VA 3V7RA 2PU9B 4M78D 3CMAA 4MMKA 3SWNA 1VQLT 2QEXA 2XKOC 1KHIA 2LT1A 4N4GA 5LL6S 3RMQA 3L1AA 4JLIA 3QIIA 3JCMg 5CKBA 3OS0A 2OAUA 4EMKB 5DM7R 4X34A 4BDZA 1UGPB 3WXMB 5GANe 4CI0C 3H8ZA 5DLQE 3VV0A 5GAMh 3OYMA 4MZMA 3L2ZA 4M77E 4ZTJA 2JTFA 3ME9A 4J83A 2E10A 3V8LA 3PIOA 3FLGA 4C8QA 5J26A 3CC7T 3EFSA 3QSUA 4A4EA 3BFMA 2DK3A 3HL8A 5KCOA 2LRQA 1YCYA 2RJEA 3RKYA 4BY6C 4C5HA 4M7AE 2CZ1B 3CPWA 4L6V5 4M7DF 3A8OB 2D0QB 1YJWT 3LGLA 3E9GA 3I56T 4TVRA 2GFAA 3CCST 1QVGA 4HKEA 1VQ7A 3SFMA 4ELYC 2XICA 4PJOE 3E19A 2LQ8A 4C8QD 1HXDA 4XTVA 3JB9G 3BDUA 2JN0A 3OS1A 4O5VA 5KE3A 2NLUA 1FXXA 1TH7A 4RCCA 3CCQT 5GAOq 1YI2T 4OF1A 3CC2A 4N4IA 1LOJA 2WACA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RK1 A;  2OAU A;  2RK2 A;  3UDC A;  1VIF A;  2VV5 A;  3SFM A;  3T9N A;  2GQV A;  2RH2 A;  1VIE A;  2P4T A; 
#chains in the Genus database with same CATH topology
 2O2O A;  1YJN T;  2JVV A;  1XNI A;  1QCF A;  4FYX B;  2YUO A;  2LMJ A;  5IN1 A;  3L2U A;  2DEQ A;  3MEU A;  4D8K A;  1VQ5 A;  2NWM A;  2DF6 A;  4JLG A;  1TS9 A;  2YUP A;  1I8F A;  2JXB A;  1GCQ C;  2NUP A;  3EG0 A;  3JCM f;  1ABQ A;  4C0Z A;  1M1K U;  2RI3 A;  4J9E A;  3CBP A;  3GLX A;  1KD1 U;  3CCJ Q;  3GPL A;  1EFN A;  1B34 A;  1YJW A;  1VQ4 Q;  2LVM A;  1WA7 A;  1N5Z A;  1ZBJ A;  5LJ5 d;  1X6G A;  4KUL A;  3OA6 A;  3OYE A;  2YDL A;  2LQN A;  1W6X A;  1KHC A;  3VRZ A;  2ECZ A;  2M0O A;  3QZ9 B;  2NYS A;  3V8J A;  3I56 Q;  3NGP A;  2YHT A;  2YRV A;  4XU3 A;  3HPW A;  1JU5 C;  2CYZ B;  1WI7 A;  1MMG A;  2ATC B;  4N0A A;  2DIL A;  3BDL A;  4PLI A;  5IXB A;  3P8H A;  3OYF A;  3NPF A;  1PRL C;  5FLX E;  2P0K A;  3N5B B;  2PUO B;  3CCL T;  2EQU A;  1YWP A;  3QZ5 B;  4E47 A;  1MHN A;  2VKN A;  1LJO A;  3EG1 A;  4OML A;  5D6Y A;  1M27 C;  4OMP A;  3OYJ A;  2E6N A;  2YUN A;  4J7F A;  3OYY A;  2RO0 A;  2JS0 A;  2AZV A;  4A54 A;  2KXC A;  5I22 A;  1VQO T;  4M7D A;  3QXE B;  2QTV A;  1IO6 A;  1T3L A;  3DKM A;  5HK3 A;  2DNU A;  2DL3 A;  2FO0 A;  4HT9 A;  4BE2 A;  1NYF A;  2D8H A;  2RHX A;  3VUB A;  2WSE E;  1JBM A;  3OYA A;  2AT1 B;  4Z02 A;  3VS7 A;  2K3B A;  4QVC A;  4KBM B;  2JS2 A;  1E6G A;  4FCY A;  2KE9 A;  3MHX A;  2PNI A;  1T0H A;  1PKS A;  2LX7 A;  3CCM T;  2HQH A;  4F7U G;  1M90 U;  4BAC A;  3LH0 A;  1SG5 A;  5FU6 B;  4BI8 B;  3CCU T;  4ATO A;  5A2Q E;  3CCL Q;  3CC4 T;  2HKQ B;  3I5S A;  4RG2 A;  1BKB A;  3EHQ A;  2B8A A;  4GLM A;  4XAX B;  2EQJ A;  1VQL A;  1EZZ B;  2HZY A;  3VUZ A;  4IUU A;  3E1S A;  1I5O B;  2V26 A;  4OB1 B;  4A63 B;  1K9A A;  1UGS B;  3NTK A;  3UAT A;  1Q82 U;  1X2K A;  2GBQ A;  1AD5 A;  1GCQ A;  1EX4 A;  2E12 A;  2YLC A;  1ZUU A;  2CH4 W;  2F5T X;  3QYH B;  1D1A A;  5GAM e;  3CCS A;  2F1L A;  3TQ7 P;  4FT4 A;  3V7S A;  1KFZ A;  2X9H A;  3HRT A;  3QJY A;  1YHQ T;  4M7A C;  3OMC A;  2EYY A;  3H0I A;  5GMK e;  1XOV A;  1YI2 A;  4HVU A;  2SRC A;  2A28 A;  3J80 E;  1K0X A;  4PJO C;  4DQ2 A;  4J5Y A;  4D6W A;  2K3Y A;  4VUB A;  4M78 B;  3CC4 A;  3CCM Q;  2KRM A;  1Z9Q A;  4PLL A;  2P4R A;  3DLL A;  2M51 A;  1SEM A;  4QQ6 A;  4Y92 A;  2EVR A;  1MUZ A;  6AT1 B;  1I0C A;  4C0F A;  3CCU Q;  1Z9Z A;  2CP5 A;  3RNJ A;  1F1B B;  2D1X A;  2IIM A;  1MNE A;  1ABO A;  2C0T A;  4A53 A;  2QQR A;  2CP0 A;  3JB9 H;  5GAN 5;  5HY6 A;  2WSC E;  2BTT A;  1BYM A;  2KY9 A;  2RPN A;  1VQ7 T;  5C0M A;  1HYO A;  2K2M A;  5LJ5 j;  3EGX B;  3X24 B;  4R56 A;  5GAN 3;  2AKK A;  1S72 A;  3I55 T;  3M55 A;  1D3B A;  5L23 A;  3C95 A;  2VUB A;  1YHQ Q;  4ORZ A;  3A1P A;  2PQW A;  2LJ3 A;  4QT7 A;  3CXC P;  1WIE A;  1SSH A;  2O88 A;  2XG8 D;  1ZSZ C;  5GJW B;  1K73 U;  1M9S A;  1O75 A;  3NTH A;  4FT2 A;  3OBY A;  4C8Q C;  1X27 A;  4KT0 E;  1OU8 A;  2FPD A;  3QWX X;  5GMK m;  3LWI A;  4JZ3 A;  1IGQ A;  1UUE A;  2G3R A;  2HDA A;  5KYW B;  5GAO p;  5LJ5 g;  4C8Q G;  1NZ9 A;  1NLP C;  1E7O A;  1VQ8 T;  3HRU A;  2ED0 A;  1VQK A;  1Y07 A;  1YIJ T;  1G8X A;  4OGE A;  4NOY A;  4A4G A;  5DY9 A;  2DM1 A;  1VQ7 Q;  4KGV B;  2K7A A;  2AHJ B;  1HD3 A;  4RTW A;  4PK4 A;  3A5Z B;  4M75 B;  5GAM h;  3CC2 Q;  3PT9 A;  4M77 C;  1M2O A;  3HP9 A;  1GCP A;  3OYL A;  1NPR A;  1IB8 A;  1H3H A;  5GMK h;  3G6E A;  2PVO B;  1OYX A;  4E7Z A;  3PVL A;  4M7A A;  1X75 C;  4CRI A;  1T0J A;  3H9N A;  1WGS A;  4PJO A;  2KRS A;  3TEE A;  4M78 E;  3RBB B;  4E7J A;  1KQS S;  3VS2 A;  3JCM b;  3PNW C;  1M1K R;  4LD9 K;  5KYX B;  3D7S B;  1W2B S;  1JRI A;  1PHT A;  1KD1 R;  5LJ5 f;  2CP6 A;  3DB3 A;  5CK9 A;  1Y57 A;  2PVG B;  4WCI A;  2A0F B;  2D8J A;  3L2Q A;  3CCE A;  3G71 A;  4BB7 A;  2LJ1 A;  1QWF A;  2FRY A;  1I81 A;  1D0Z A;  5GAN 6;  1YIJ Q;  1GL5 A;  2D0N A;  4C0G A;  2EJ9 A;  4Q5W A;  2GTJ A;  4F7U B;  2X4J A;  1WHK A;  2EYX A;  4FL6 A;  2DET A;  2EJG A;  2BZX A;  2EBP A;  1TUC A;  3MP1 A;  5I2M A;  1R8O B;  8ATC B;  2V8J A;  2M1H A;  1C6V X;  2KRO A;  2COZ A;  2QYZ A;  5LJ3 d;  1SRL A;  2AIR B;  4XQ3 A;  2QA4 A;  4F04 B;  2RJD A;  2DEU A;  1QCN A;  4QVD A;  4DEY A;  3E2U A;  2K2V A;  1JEG A;  2H8H A;  4AG2 C;  4N4G A;  4JLI A;  3OS0 A;  5DM7 R;  4CI0 C;  5GAN e;  1JXM A;  1ZSZ A;  3VV0 A;  4MZM A;  1WXB A;  1ACM B;  2DA9 A;  3M0Q A;  3PIO A;  4C8Q A;  3CC7 T;  2PZ1 A;  2DK3 A;  2LRQ A;  1YCY A;  3RKY A;  4BY6 C;  4LE9 A;  4AFS C;  2CZ1 B;  1T3S A;  3E9G A;  4TVR A;  1ZUY A;  1BK2 A;  4HKE A;  2KRN A;  3SFM A;  1AZG B;  3E19 A;  4C8Q D;  1HXD A;  3JB9 G;  3OS1 A;  2NLU A;  1TH7 A;  3CCQ T;  4OF1 A;  1TG0 A;  3QDF A;  1N6A A;  2K5L A;  4RKU E;  4LDU A;  2LNH B;  1M90 R;  4KUD K;  1EIF A;  1XJW B;  4F7U F;  2Y4Y A;  3V8K A;  1RAD B;  1YIT T;  1CKB A;  4M75 E;  2LZ6 B;  4M77 A;  3UF4 A;  1NE8 A;  2ESW A;  1ZLM A;  5KE2 A;  1RAB B;  3OW2 A;  1U8R A;  4HT8 A;  4O6J A;  2KYB A;  2RQW A;  1YCS B;  2ZPF B;  5I11 A;  3I9Q A;  1FX7 A;  1YJ9 Q;  1ARK A;  1C1A A;  4M77 D;  1AOJ A;  1RAG B;  4AMC A;  4XTZ A;  3LLR A;  1M1K C;  4LXC A;  4JJD A;  3S3M A;  1KD1 C;  1Q82 R;  1IRX A;  4E7H A;  3AHU A;  1UTI A;  3FJP A;  1K1Z A;  5IAY A;  4J8O A;  1VQN T;  2HEQ A;  1Y7X A;  1M5Q 1;  1FYN A;  3CCV A;  4PNO A;  3X20 B;  2RK2 A;  2DZC A;  1UGV A;  3P8B B;  1X6B A;  5EG2 A;  1GFC A;  1V29 B;  5CKE A;  3CCQ Q;  3C94 A;  4AT1 B;  2DJQ A;  2O9V A;  4MDX A;  3VS1 A;  4N4H A;  2HQX A;  3CME T;  1M1F A;  1NEG A;  1U06 A;  4PFO A;  4RMO A;  4MZP A;  2JT4 A;  4F14 A;  2COW A;  4LNP A;  2HSP A;  1VQP A;  3QO3 A;  2KBT A;  1RLP C;  2DL8 A;  4OVA A;  4LDX A;  2DTI A;  2DBK A;  2OTJ A;  2K57 A;  2BIV A;  1G3S A;  3FC3 A;  1JO8 A;  4C92 E;  2XID A;  1QKW A;  2FEI A;  4CC4 B;  5GAN h;  1NBE B;  1QCO A;  2K6D A;  3CCR A;  5FRN A;  2FB7 A;  3CCJ T;  1KG1 A;  4M7D G;  1PC0 A;  1PNJ A;  1VQ4 T;  3REA B;  4A4F A;  2IPO B;  2L8D A;  1VQN Q;  2J06 A;  1BU1 A;  4IUR A;  5D6X A;  1C0M A;  2X51 A;  1G5V A;  2MWP A;  4XTU A;  2LCS A;  2QGG A;  2BZ8 A;  1BI2 A;  2H3J A;  2QQB A;  2HMA A;  3JB9 D;  1M90 C;  1DJ7 B;  2XHC A;  3CME Q;  5LJ3 j;  2QAZ A;  4AG1 C;  1G3T A;  3RKW A;  1K73 R;  3EG9 B;  3A8M B;  5GAM j;  1RLQ C;  3OS5 A;  2LCC A;  2VGM A;  3CCJ A;  4QQG A;  2MOX A;  4X9D A;  1KQS A;  3A8H B;  4C8Q F;  5CAI A;  4IUP A;  2L2P A;  5A0L A;  4DOV A;  5HKC A;  1Q82 C;  2O9S A;  2DLP A;  4XK8 E;  5GAO m;  2KMT A;  2GF7 A;  2EYQ A;  3L42 A;  1WDX A;  1BI1 A;  1AZE A;  3EG3 A;  1RAA B;  1NLO C;  4QKU A;  3VYH B;  3X28 B;  3I56 A;  2YRC A;  3EGD A;  1VYU A;  4E7K A;  2X4X A;  5LJ3 g;  1LVK A;  4XU1 A;  2V8I A;  1YJN A;  5GAM g;  1VIF A;  4PJM A;  4M77 F;  3C12 A;  2FVU A;  4BDY A;  3INZ A;  1FMW A;  1UFF A;  2FZK B;  4BI4 A;  2DVJ A;  3OS2 A;  2QGF B;  2FG0 A;  1R0B G;  2ZGW A;  1TOV A;  1KK7 A;  1K9M C;  2HSE B;  4NS5 A;  5CKF A;  4M75 C;  2ZPH B;  3PMI A;  1Q86 U;  3RIR A;  2RA2 A;  2EWN A;  1P92 A;  5IHN A;  3LGF A;  1V76 A;  3CXC S;  1I5L A;  3JCM W;  2BE7 D;  5FRO A;  3H6Z A;  5FRM A;  1BI3 A;  2GTO A;  2V1Q A;  4HVW A;  1WHJ A;  2YWW A;  1Y0M A;  3VS6 A;  1UDL A;  1H64 1;  2DXC A;  3JCM e;  3CD6 Q;  4M7D D;  3ULR B;  3VKI A;  3VS5 A;  5LJ3 f;  2RQU A;  2LC4 A;  2ZPE B;  2JNG A;  3SWN C;  1KSW A;  4DBF A;  1IHV A;  5GAM f;  3EH2 A;  3EH1 A;  2A08 A;  1QVF P;  3CCL A;  2FYK A;  4JRI A;  4WTO B;  2OJ2 A;  4C0D B;  3FIF A;  1QP2 A;  2I0N A;  3GBQ A;  1NPP A;  1K73 C;  2Y4X A;  1MGQ A;  1AWO A;  1ZBX A;  4KGX B;  2L89 A;  4EPC A;  1BIB A;  3QBY A;  2RI5 A;  1QP3 A;  3G4S T;  2XI9 A;  2NUP B;  1W70 A;  3OYI A;  1VQO A;  3JSC A;  3MKD A;  3PVQ A;  2I2L A;  1H8K A;  1B34 B;  4KH1 B;  2AZS A;  1I4K 1;  4KGZ B;  5C6S A;  2DYB A;  5FU7 C;  4C92 C;  4Z88 A;  2J05 A;  3BW1 A;  1NG2 A;  3JB9 F;  4E7L A;  2VVK A;  4ZGE B;  4WF2 A;  1IGU A;  1ZSG A;  4B6M A;  4FYW B;  2F5K A;  4RTV A;  3HHT B;  3HSB A;  3QG1 A;  5I2S A;  1UJY A;  2O4X A;  2OTL T;  1YWO A;  2QTX A;  3CCM A;  1QW1 A;  3Q1J A;  1N8R U;  3UWN A;  4ZGJ B;  4FYV B;  3QDR B;  1VQL Q;  3R6N A;  2SEM A;  2L3Q A;  4E7I A;  2VWF A;  4LUD A;  4PFP A;  2EGE A;  3CCU A;  4M7A G;  2E1H A;  1S1N A;  4ME7 A;  5CVI A;  2CZ7 B;  3PE0 A;  1U3O A;  3H41 A;  2DL4 A;  4PJO G;  1VQM T;  4A4H A;  4ELZ C;  4XTY A;  4M7D B;  2CRE A;  1PD0 A;  3G4S Q;  4OMM A;  1OX9 A;  5L8R E;  1UB4 A;  4M75 A;  1Y71 A;  1NEB A;  2E3I A;  5KCH A;  2NUZ A;  5GAO r;  4PFZ A;  3TVT A;  5I21 A;  1YI2 Q;  1N27 A;  2KXD A;  1PM3 A;  4EIK A;  4ESR A;  2X3W D;  2K3X A;  4J7I A;  2X4Y A;  3PIP A;  5GMK l;  1YHQ A;  5D6W A;  3JCM h;  3CC2 T;  1U5S A;  3TSW A;  1M3B A;  2EIF A;  3PTA A;  1WHG A;  1JJ2 S;  5KYU B;  3OSV A;  2OTL Q;  1GBR A;  4HCZ A;  1OZ3 A;  2O31 A;  4X9C A;  3V7R A;  2KT1 A;  2F2X A;  3SWN A;  1WXT A;  1KHI A;  2LT1 A;  2M0Y A;  3QII A;  5CKB A;  4BDZ A;  4X34 A;  2RMO A;  1X69 A;  2CT4 A;  5DLQ E;  1ZA2 B;  3ME9 A;  3V8L A;  4DBH A;  1VQM Q;  5KCO A;  4CC3 A;  2OAW A;  4M7D F;  3A8O B;  1BBZ A;  4PJN A;  1VQ7 A;  2XIC A;  2LQ8 A;  4XTV A;  3BDU A;  2JN0 A;  2MK5 A;  5KE3 A;  3UA7 A;  3CC2 A;  3VRY A;  2CSI A;  4C92 A;  3I55 A;  5ECA A;  2OX7 A;  3CPF A;  4Y28 E;  8AT1 B;  3CEY A;  3MEW A;  1SHG A;  1IXD A;  2JJ9 A;  1M3A A;  4EMK C;  1Y96 A;  3VS3 A;  1SRM A;  4DBR A;  1PWT A;  1WHH A;  3CPW S;  1RI0 A;  2CZ0 B;  4M77 G;  2DXB A;  4OB2 B;  5CR2 A;  1J3T A;  2DXU A;  1VQK Q;  3URG A;  1OEB A;  4AFZ C;  2DO3 A;  2E5Q A;  1WQ7 A;  2CGH A;  4M7A D;  1VQ8 A;  4XTX A;  1TTH B;  4PJO D;  1VQ9 T;  1YIJ A;  2K5F A;  1UHF A;  3M59 A;  1BIA A;  2CP3 A;  3GNG A;  1WFW A;  3G6E Q;  1U1S A;  2P0P A;  2ZPI B;  4IIM A;  3LYI A;  4OMO A;  1D3B B;  2YSQ A;  3LWH A;  2PTK A;  3M4G A;  2CT3 A;  1UGQ B;  1VUB A;  3OBW A;  1WPY A;  3C4S A;  2DD5 A;  1UEC A;  4J9H A;  1PCX A;  2EYW A;  4JRQ A;  1M30 A;  4BUG A;  4RTZ A;  2KNB B;  2X3X D;  5IHI A;  4BI3 A;  5GAM d;  1K8A U;  2CDT A;  2KSS A;  4MML A;  3CCE Q;  1WQW A;  2AK5 A;  1Q86 R;  2NUT B;  4IUV A;  1YJ9 T;  2DRK A;  2EAY A;  2RF0 A;  4J6W A;  2DL7 A;  4MZT A;  3UPU A;  3THK A;  3FDR A;  1WJQ A;  1H3Z A;  3HTR A;  3OYN A;  3M0S A;  2B86 A;  2Y90 A;  2DJZ A;  1VQ9 Q;  1W1F A;  3KXT A;  1JJ2 P;  4LUE A;  2E4H A;  1RUW A;  1WHM A;  3P8D A;  1M2V A;  5LJ5 e;  2XK0 A;  2CSQ A;  3SB2 A;  2BKD N;  3EFO B;  1ZUK A;  3GNF B;  2P0Q A;  2W0Z A;  1Q81 U;  1SKU B;  4F16 A;  4M7A B;  1OUL A;  3EGU A;  2CZ6 B;  1H92 A;  4CC2 A;  3GOX A;  3SDZ A;  2JM9 A;  2MCN A;  3PFS A;  4EMK A;  2XDB A;  2H3E B;  4L59 A;  1RAF B;  2XU8 A;  3MCA B;  1VYV A;  5DLO A;  2YLB A;  2GCX A;  5GMK i;  3M54 A;  4V2S A;  5KYY A;  2HBP A;  2MWO A;  3CC7 A;  3J81 E;  2LJ0 A;  1NJI U;  2KDS A;  4LDW A;  2GNC A;  3GIB A;  3MET A;  2GFU A;  4R0K A;  4C5G A;  3TCJ A;  1M8M A;  5FU6 C;  3A98 A;  5IHK A;  4HCB A;  4B9X A;  5KYN A;  2QQ9 A;  3CCQ A;  3L2R A;  3PGG A;  1BI0 A;  1VQ6 T;  1PRM C;  2A7Y A;  4X1V A;  3CBM A;  1QWE A;  2VYT A;  3CPW P;  3O8V A;  3LW5 E;  1QVG P;  4C5I A;  1N8R R;  4JJN K;  5A0G A;  4PJJ A;  4ZNX A;  4IKF A;  4J9B A;  1K76 A;  1D0Y A;  2CH4 A;  4RUG A;  3CMA T;  1YIT A;  2QEX T;  2RB6 A;  4OMF B;  5FWB A;  4FSS A;  3SD4 A;  2EYZ A;  4M7A F;  4F7U E;  3M57 A;  3NHN A;  2M9U A;  4C5E A;  2X35 A;  2QQS A;  2D6F A;  3KUF A;  2KQW A;  4PJO F;  3EG2 A;  1ZSZ B;  1M8V A;  1OOT A;  5CKD A;  3V7C A;  3CCV Q;  1ZA1 B;  2E41 A;  3VS0 A;  4HCK A;  4C8Q B;  1QKX A;  1QVF S;  3OB9 A;  1M3C A;  1TUD A;  4HCC A;  2EFI A;  1OX8 A;  3JCM c;  1OZ2 A;  2RHZ A;  2PVD B;  1QQJ A;  1D1C A;  4CC7 A;  1VQN A;  4M78 C;  2C0O A;  2KR3 A;  2Z0W A;  3G7Z A;  2CP7 A;  3ASK A;  4OMN A;  4XU0 A;  1X2Q A;  2RD1 A;  4M78 G;  4QW2 A;  3QJ6 A;  1AWX A;  3JRZ A;  2YXY A;  2P4T A;  1VQ6 Q;  5LJ5 h;  2MF2 A;  1VQP Q;  1RAH B;  2KAF A;  1QLY A;  3CME A;  2RNA A;  1FMK A;  1HK9 A;  1VQ5 T;  2G6F X;  4M77 B;  5GAO l;  4GLK A;  2YT6 A;  4LDV A;  3CMA Q;  4HA8 A;  1D1B A;  5GAN 8;  2DKG A;  1N9R A;  2QEX Q;  2QAS A;  3JB9 J;  5IXF A;  3TSZ A;  2QG9 B;  3R6O A;  2F2V A;  3MEA A;  4ZN1 A;  2QK0 A;  2JTM A;  3EAE A;  4Z8A A;  3FRN A;  2KT8 A;  2L0A A;  3ZBD A;  1OV3 A;  4OB0 B;  1JQQ A;  5A0D A;  2EJF A;  4J9I A;  2W10 A;  3L2W A;  1K4U S;  2JM8 A;  5GMK j;  1GBQ A;  4DOW A;  5CCA A;  3QUI A;  2HKN A;  2C0I A;  1VQ4 A;  3QYG B;  5M9O A;  2IG0 A;  2VXE A;  1W2B A;  2O01 E;  4KUI A;  1IZ6 A;  3MEV A;  2R5M A;  1YBY A;  1HSQ A;  3C0C A;  3QHS A;  3CD6 T;  3U23 A;  1ZQ1 A;  4D8D A;  3CQT A;  2K9G A;  5GAN d;  3H0F A;  4J9F A;  4E7S A;  4E6R A;  1N8R C;  2VC8 A;  2K5I A;  2RJF A;  2DFU A;  2EGC A;  1VQ5 Q;  1AHJ B;  1WYX A;  2M02 A;  4JRP A;  2JMA A;  1Q7Y U;  4BD3 A;  2DE0 X;  3KFV A;  3VJP A;  4EMG A;  1SHF A;  4RTX A;  3T9N A;  1M1G A;  5CKH A;  2E64 A;  2HL3 A;  4LDY A;  4JUV A;  3DLM A;  1YJW Q;  4FIB A;  2RK1 A;  2A37 A;  2KYM A;  2XDD A;  1K0S A;  2EW3 A;  4BE0 A;  1OPL A;  4M75 G;  3CD6 A;  2RM4 A;  4C8Q E;  3LX7 A;  1YJN Q;  1ZHI A;  4ZN3 A;  4BY6 B;  5IT9 E;  3OYB A;  4M78 A;  2DD4 A;  1RI9 A;  2ZPG B;  4GY5 A;  1D09 B;  5KH6 A;  3OYD A;  3M0U A;  1B3Q A;  1KC8 U;  3QPH A;  4QVZ A;  3F70 A;  2R57 A;  2PU9 B;  4M78 D;  5IH2 A;  1VQL T;  3RMQ A;  2DX1 A;  3WXM B;  1K8A R;  3H8Z A;  3OYM A;  4M77 E;  3L2Z A;  4ZTJ A;  4J83 A;  4JJC A;  3FLG A;  4A4E A;  3BFM A;  3HL8 A;  2RJE A;  4JPB W;  4C5H A;  2DYI A;  2D0Q B;  2CUD A;  3CCS T;  2GFA A;  3EGX A;  1VYT A;  3M0T A;  4ELY C;  3BE3 A;  4O5V A;  1FXX A;  4IIO A;  4HXJ A;  5KYU A;  1YI2 T;  3EGD B;  2BE9 B;  1LOJ A;  2MPX C;  2WAC A;  3UDC A;  3E9F A;  1M4Z A;  3TU4 K;  4KRT A;  2WSF E;  3JV3 A;  3OYH A;  2CS7 A;  2RH2 A;  1Q81 R;  3AT1 B;  2FRW A;  4C92 G;  2FL7 A;  2HD0 A;  1LPL A;  4YTL A;  4OMQ A;  3HFO A;  3ER0 A;  2LX9 A;  1VQO Q;  2IVW A;  4LD6 A;  4II1 A;  5KYW A;  2X4W A;  5LJ3 e;  3RKX A;  4OP0 A;  2DMO A;  2J7I A;  3G4S A;  1WXU A;  3WVE B;  1KQ1 A;  3LH5 A;  1RAE B;  2V1R A;  2DIQ A;  2L3P A;  1NJI R;  2LQW A;  2DAQ A;  2HCK A;  3A8G B;  4RCB A;  1S72 T;  2ZZD A;  1QVF A;  3CCS Q;  2ABL A;  4DEX A;  3OW2 S;  1RAI B;  2JMC A;  3M4Y A;  1UEB A;  2XDP A;  2FPF A;  3JCM X;  1NYG A;  4J9D A;  3VYG A;  4J6Y A;  2ROT A;  2AKL A;  2DVE A;  1K9M U;  3WVD B;  1PSF A;  1UE9 A;  2V8K A;  4M75 D;  3CC4 Q;  2GGR A;  2OTL A;  1JXO A;  1JB0 E;  1WLP B;  1ZX6 A;  1TXQ A;  2HL5 C;  2ZPB B;  4RTT A;  2VGN A;  2E5K A;  5GAN j;  2CP2 A;  4QQD A;  1BB9 A;  4RG8 A;  3VU3 C;  1AWW A;  3JAM E;  4FSX A;  5KYX A;  2RHY A;  3H0H A;  1CKA A;  1WJR A;  1SSF A;  2MMP A;  3I35 A;  5AYF A;  1K8A C;  1N9S A;  5GAO n;  1YFN A;  2QXF A;  3PMT A;  1VQM A;  2DXT A;  1VQK T;  2BUD A;  2EQM A;  1KQ2 A;  3FEO A;  1GFD A;  1PKT A;  3M0P A;  4R55 A;  5GAN 7;  2HBW A;  2PUK B;  5CQX A;  4HVV A;  2R58 A;  3ZFJ A;  2DTH A;  1BCM A;  1D0X A;  3RER A;  1WJS A;  4OB3 B;  4F7U A;  4J6X A;  2KK4 A;  1S72 Q;  4BE1 A;  4FM4 B;  3S3O A;  2EQK A;  3G6E T;  5GAN g;  3X26 B;  4M78 F;  1V1C A;  3DB4 A;  1BCO A;  4KH0 B;  2O4X B;  1HJD A;  4J9C A;  4PJL A;  1AVZ C;  1Q81 C;  2VAS A;  2LT4 A;  2RQT A;  2NUT A;  4NL2 A;  2QDL A;  1B07 A;  5J3B A;  1XQH A;  2LNV A;  2QQA A;  4JZ4 A;  5GAN 2;  1OI1 A;  2QDY B;  1WNL A;  4C92 D;  3JCM d;  2DRM A;  2OI3 A;  2RJC A;  1VIE A;  5LJ3 h;  1OU9 A;  3OY9 A;  1QVG S;  3CCE T;  5FW9 A;  3G71 T;  1XTD A;  3RDV A;  3FB9 A;  1WX6 A;  2E70 A;  1VOM A;  4PKC C;  2EQI A;  3JCM P;  4FW1 A;  3M58 A;  1NJI C;  2M16 A;  3EFO A;  3I55 Q;  2K4Y A;  4A4K A;  4DA4 A;  1OPK A;  1KJW A;  2DER A;  1KIK A;  9ATC B;  3O5Z A;  5GAN 4;  3GF5 A;  2VB6 A;  4JJB A;  3X25 B;  4PL6 A;  3FJ5 A;  3UA6 A;  3CXC A;  1UJ0 A;  1SPK A;  2DL5 A;  2EKO A;  4M7D E;  2JZ2 A;  5GAN f;  1I1J A;  2QA4 T;  3RES A;  3S3N A;  5GJV B;  2FPE A;  2KEA A;  4JDS A;  1A0N B;  1G3W A;  2FHD A;  2C06 A;  4FU6 A;  1YNZ A;  4XTW A;  4LN2 A;  2XD0 A;  4XU2 A;  3OMG A;  3SWN B;  1MMN A;  2KGT A;  4JRK A;  2JTE A;  1Q7Y R;  2E3H A;  3MO8 A;  3UT1 A;  1VQ8 Q;  1GRI A;  1U1T A;  1RAC B;  1LCK A;  1TWB A;  4Z89 A;  2J6O A;  4J9G A;  4EMH A;  3OYK A;  1FWZ A;  3OW2 P;  3QKJ A;  1AEY A;  4P5N A;  2J6K A;  4Y91 A;  3G71 Q;  4IUT A;  3M56 A;  2EGA A;  4F17 A;  5D7U A;  3OYG A;  4IUQ A;  2HNI A;  1RL2 A;  2CKK A;  3M9Q A;  3S6W A;  2D9T A;  3I5R A;  3RUX A;  1MV3 A;  1NM7 A;  1X6O A;  1UG1 A;  4AFU C;  1VQ9 A;  4ANJ A;  4M75 F;  1G83 A;  1MND A;  2DBM A;  2VV5 A;  3L2V A;  5CQY A;  5CO7 A;  1GXI E;  3CBO A;  1PSE A;  3M5A A;  3MP8 A;  3SHW A;  3ZEH A;  2MI6 A;  2RI2 A;  3BY7 A;  5FU7 B;  2LCL A;  4C92 B;  4FW2 A;  3JCM J;  5EC7 A;  2A3L A;  1VA7 A;  5FWC A;  2LP5 A;  1LNX A;  2QA4 Q;  2DIG A;  2A36 A;  2DTO A;  3OQ5 A;  2L3S A;  2HAX A;  2QI2 A;  1MMD A;  1Y96 B;  1KC8 R;  1PG5 B;  3MPU B;  4E2F B;  2MAM A;  3GP8 A;  1AWJ A;  2XMF A;  1SF9 A;  3JCM Q;  2JOY A;  2KI7 A;  3HRS A;  2L5Q A;  1PD1 A;  3REB B;  2LQK A;  1YN8 A;  2LDM A;  1W4S A;  3OYC A;  1CSK A;  4PJO B;  2HQE A;  1IRE B;  4RTY A;  2RN8 A;  1YJ9 A;  2ENM A;  2ZAE A;  4RTU A;  3RMS A;  3CCV T;  2LTO A;  3OSS C;  2VXF A;  1AT1 B;  4L5G A;  4M4Z A;  1FMV A;  3SEM A;  2F2W A;  3QWY A;  3G1J A;  5CIU A;  1X43 A;  3HFN A;  2FZC B;  2KVQ G;  4C0D C;  2COY A;  1IHW A;  2GQI A;  4ZTF A;  3JCM V;  1R77 A;  2ZCF B;  2GQV A;  1G2B A;  3KBG A;  4C92 F;  4JS5 A;  3EG9 A;  3HKS A;  2JW4 A;  2R5A A;  2RQR A;  1VQP T;  1UGR B;  5J39 A;  2JUF A;  2E65 A;  1YP5 A;  2OTJ T;  3EFR A;  3RR6 A;  1TUG B;  1Q7Y C;  3MJX A;  3CC7 Q;  4OGC A;  3NTI A;  1JJ2 A;  3CCR T;  4ZGD B;  2RQV A;  4UC4 A;  2ROL A;  3MP6 A;  2F69 A;  3J7A F;  1QVP A;  2DZ9 A;  3NFC A;  3TRE A;  4N0A C;  3EHR A;  2P84 A;  1TU0 B;  1Q86 C;  2MIO A;  2RHU A;  4FYY B;  2L3R A;  2K79 A;  1I07 A;  2RHI A;  4AFQ C;  1KQS P;  4B9W A;  4DBQ A;  1M2V B;  4GBQ A;  1UHC A;  1W2B P;  1YIT Q;  2YUQ A;  3M53 A;  3A8L B;  1K9M R;  1O9S A;  1VQ6 A;  1X01 A;  2FZG B;  3VS4 A;  1B7T A;  1G3Y A;  1TSF A;  1E6H A;  3IQL A;  4NL3 A;  2BZY A;  2ED1 A;  3JB9 I;  4JS4 A;  2E6Z A;  4M7D C;  4MDW A;  2DPP B;  5HK0 A;  1WHL A;  2EPD A;  1KC8 C;  3CMA A;  4MMK A;  2QEX A;  2XKO C;  5LL6 S;  3L1A A;  1WZO A;  3NMZ C;  3JCM g;  2J6F A;  2OAU A;  5AT1 B;  4EMK B;  1UGP B;  3ZL7 C;  2OTJ Q;  4K11 A;  2JTF A;  1Q95 G;  2YRD A;  2E10 A;  2CUB A;  1QMC A;  5J26 A;  3EFS A;  3QSU A;  2MYS A;  5HCK A;  3CCR Q;  2EKH A;  1MV0 B;  5KYY B;  4M7A E;  3CPW A;  3M0R A;  4L6V 5;  7AT1 B;  1YJW T;  3LGL A;  3I56 T;  1QVG A;  1OQK A;  1R0C B;  4PJO E;  4RCC A;  5GAO q;  1MMA A;  4N4I A;  4EDU A; 
#chains in the Genus database with same CATH homology
 3UDC A;  4C92 A;  3E9F A;  3I55 A;  1YJN T;  2JVV A;  1N6A A;  1M4Z A;  2K5L A;  3CPF A;  4RKU E;  4Y28 E;  1XNI A;  4LDU A;  3TU4 K;  4KUD K;  1EIF A;  3CEY A;  3MEW A;  2WSF E;  4F7U F;  3OYH A;  2CS7 A;  2Y4Y A;  3V8K A;  4EMK C;  2RH2 A;  1YIT T;  5IN1 A;  4M75 E;  1Y96 A;  4C92 G;  3L2U A;  4M77 A;  2DEQ A;  2FL7 A;  1NE8 A;  3MEU A;  5KE2 A;  3OW2 A;  2HD0 A;  1U8R A;  4HT8 A;  4YTL A;  1VQ5 A;  4O6J A;  3HFO A;  3CPW S;  2ZPF B;  1RI0 A;  3ER0 A;  2CZ0 B;  2LX9 A;  2IVW A;  4JLG A;  4LD6 A;  1FX7 A;  4M77 G;  1I8F A;  4II1 A;  2DXB A;  2X4W A;  4OB2 B;  3JCM f;  5CR2 A;  5LJ3 e;  4M77 D;  2DXU A;  4C0Z A;  1M1K U;  3URG A;  3RKX A;  4OP0 A;  2RI3 A;  4XTZ A;  3CBP A;  3LLR A;  3GLX A;  1M1K C;  1KD1 U;  2DO3 A;  3G4S A;  2E5Q A;  3GPL A;  1WQ7 A;  1B34 A;  3WVE B;  3S3M A;  1YJW A;  1KD1 C;  4E7H A;  3AHU A;  2CGH A;  2LVM A;  4M7A D;  5LJ5 d;  1KQ1 A;  4KUL A;  1VQ8 A;  3FJP A;  3OA6 A;  5IAY A;  3OYE A;  2DIQ A;  4J8O A;  2DAQ A;  4XTX A;  1VQN T;  1KHC A;  1Y7X A;  1M5Q 1;  3A8G B;  1VQ9 T;  4PJO D;  2M0O A;  4RCB A;  1YIJ A;  3CCV A;  2K5F A;  3QZ9 B;  4PNO A;  3V8J A;  1S72 T;  2ZZD A;  3M59 A;  1QVF A;  1BIA A;  3X20 B;  3GNG A;  2RK2 A;  2YHT A;  2YRV A;  3OW2 S;  1U1S A;  2DZC A;  4XU3 A;  3HPW A;  2CYZ B;  3P8B B;  2P0P A;  2ZPI B;  5EG2 A;  3M4Y A;  3LYI A;  1UEB A;  1V29 B;  2XDP A;  4N0A A;  3JCM X;  5CKE A;  1D3B B;  3VYG A;  3C94 A;  3LWH A;  3BDL A;  4PLI A;  4J6Y A;  4MDX A;  3P8H A;  3OYF A;  1NJI U;  2DVE A;  4N4H A;  1K9M U;  2HQX A;  3WVD B;  1PSF A;  3CME T;  5FLX E;  2P0K A;  3N5B B;  2PUO B;  2V8K A;  4M75 D;  3M4G A;  1M1F A;  3CCL T;  1UGQ B;  2EQU A;  1VUB A;  2OTL A;  3OBW A;  1WPY A;  3QZ5 B;  3C4S A;  4E47 A;  1JB0 E;  2DD5 A;  2ZPB B;  4RMO A;  1MHN A;  2VGN A;  4MZP A;  1LJO A;  5GAN j;  5D6Y A;  4QQD A;  4RG8 A;  4JRQ A;  4BUG A;  3VU3 C;  3OYJ A;  3JAM E;  2E6N A;  4FSX A;  1VQP A;  3QO3 A;  4J7F A;  3OYY A;  4OVA A;  4LDX A;  2DTI A;  4BI3 A;  2RHY A;  2RO0 A;  5GAM d;  2OTJ A;  4A54 A;  2K57 A;  1WJR A;  1K8A U;  1VQO T;  2BIV A;  1SSF A;  2MMP A;  1G3S A;  3QXE B;  2KSS A;  4MML A;  4M7D A;  1WQW A;  5AYF A;  3FC3 A;  1K8A C;  1YJ9 T;  1N9S A;  4IUV A;  4C92 E;  3DKM A;  5HK3 A;  5GAO n;  2QXF A;  2XID A;  3PMT A;  1VQM A;  2DXT A;  2EAY A;  1VQK T;  2BUD A;  4J6W A;  2EQM A;  5GAN h;  1KQ2 A;  3FEO A;  3CCR A;  4MZT A;  3UPU A;  4HT9 A;  5FRN A;  2FB7 A;  4R55 A;  5GAN 7;  3CCJ T;  4M7D G;  4BE2 A;  1KG1 A;  3FDR A;  1WJQ A;  1VQ4 T;  2PUK B;  2RHX A;  3VUB A;  5CQX A;  4A4F A;  1H3Z A;  2L8D A;  2WSE E;  2R58 A;  3OYN A;  1JBM A;  3ZFJ A;  2DTH A;  3OYA A;  2Y90 A;  2DJZ A;  3RER A;  1WJS A;  4OB3 B;  4IUR A;  4Z02 A;  3KXT A;  4F7U A;  4J6X A;  4QVC A;  2KK4 A;  4KBM B;  5D6X A;  4BE1 A;  4FM4 B;  3S3O A;  3P8D A;  1G5V A;  2EQK A;  2MWP A;  3MHX A;  4XTU A;  5LJ5 e;  3G6E T;  2XK0 A;  5GAN g;  3SB2 A;  2BKD N;  3CCM T;  1BI2 A;  4F7U G;  3X26 B;  4M78 F;  1M90 U;  4BAC A;  3DB4 A;  2H3J A;  2QQB A;  3GNF B;  3LH0 A;  3JB9 D;  2P0Q A;  2O4X B;  1M90 C;  1DJ7 B;  1Q81 U;  2XHC A;  5FU6 B;  4M7A B;  1Q81 C;  5LJ3 j;  4BI8 B;  2LT4 A;  3CCU T;  5A2Q E;  4ATO A;  3CC4 T;  1G3T A;  2CZ6 B;  4NL2 A;  4RG2 A;  3RKW A;  1BKB A;  3GOX A;  3A8M B;  3SDZ A;  2B8A A;  5J3B A;  5GAM j;  3PFS A;  4XAX B;  2EQJ A;  1XQH A;  2LNV A;  2QQA A;  4EMK A;  2XDB A;  4L59 A;  3OS5 A;  5GAN 2;  1VQL A;  1OI1 A;  3VUZ A;  2QDY B;  2LCC A;  1WNL A;  2VGM A;  3E1S A;  4IUU A;  4C92 D;  3JCM d;  4OB1 B;  3CCJ A;  2XU8 A;  4QQG A;  3MCA B;  4X9D A;  1UGS B;  5DLO A;  1KQS A;  2RJC A;  1VIE A;  2YLB A;  2GCX A;  3A8H B;  3M54 A;  3NTK A;  5LJ3 h;  4C8Q F;  5GMK i;  5CAI A;  4IUP A;  3OY9 A;  2HBP A;  1Q82 U;  3G71 T;  1QVG S;  5A0L A;  2MWO A;  4DOV A;  1XTD A;  5HKC A;  1Q82 C;  2YLC A;  2E12 A;  3FB9 A;  3CC7 A;  4XK8 E;  2E70 A;  2F5T X;  4PKC C;  5GAO m;  3J81 E;  2KMT A;  3JCM P;  2GF7 A;  2EYQ A;  3L42 A;  2KDS A;  3QYH B;  4LDW A;  3M58 A;  3GIB A;  1BI1 A;  3MET A;  2M16 A;  1NJI C;  2GFU A;  5GAM e;  3I56 A;  2K4Y A;  3CCS A;  3VYH B;  3X28 B;  4A4K A;  4C5G A;  4DA4 A;  4FT4 A;  3V7S A;  3HRT A;  3TCJ A;  5FU6 C;  3QJY A;  1YHQ T;  4M7A C;  4E7K A;  5GAN 4;  3OMC A;  3GF5 A;  5GMK e;  1XOV A;  4HCB A;  3X25 B;  4B9X A;  4PL6 A;  2QQ9 A;  3CXC A;  3CCQ A;  3L2R A;  1YI2 A;  3PGG A;  1BI0 A;  2X4X A;  5LJ3 g;  2EKO A;  4M7D E;  1VQ6 T;  2JZ2 A;  5GAN f;  3J80 E;  2QA4 T;  2A7Y A;  4DQ2 A;  4J5Y A;  3CBM A;  4PJO C;  4D6W A;  4XU1 A;  2V8I A;  2K3Y A;  2VYT A;  3RES A;  1YJN A;  4VUB A;  3O8V A;  3S3N A;  4M78 B;  3LW5 E;  3CC4 A;  5GAM g;  4C5I A;  4JJN K;  5A0G A;  4PLL A;  1VIF A;  4IKF A;  3DLL A;  4JDS A;  4M77 F;  4QQ6 A;  3C12 A;  2FVU A;  1G3W A;  4BDY A;  2FHD A;  3CMA T;  3INZ A;  3OS2 A;  1YIT A;  4BI4 A;  2C06 A;  2QEX T;  2RB6 A;  2ZGW A;  4FU6 A;  4OMF B;  4C0F A;  4XTW A;  1K9M C;  2XD0 A;  3CCE T;  3SD4 A;  4XU2 A;  4M7A F;  4NS5 A;  3OMG A;  5CKF A;  3SWN B;  4M75 C;  2ZPH B;  4JRK A;  3M57 A;  4F7U E;  2M9U A;  3MO8 A;  3PMI A;  3UT1 A;  4C5E A;  2X35 A;  2QQS A;  2D6F A;  4A53 A;  3KUF A;  1U1T A;  2KQW A;  4PJO F;  3RIR A;  1Q86 U;  2RA2 A;  2QQR A;  2EWN A;  1P92 A;  1M8V A;  5CKD A;  3V7C A;  3LGF A;  3CXC S;  1I5L A;  3JCM W;  4EMH A;  3OYK A;  1FWZ A;  2E41 A;  3JB9 H;  4C8Q B;  5GAN 5;  5HY6 A;  3QKJ A;  4P5N A;  1QVF S;  2WSC E;  3OB9 A;  5FRO A;  3H6Z A;  4Y91 A;  2EFI A;  2KY9 A;  1VQ7 T;  4HCC A;  3JCM c;  1BI3 A;  4IUT A;  3M56 A;  5FRM A;  1OZ2 A;  2RHZ A;  5C0M A;  2PVD B;  3OYG A;  5LJ5 j;  4IUQ A;  2HNI A;  1RL2 A;  2CKK A;  3M9Q A;  3S6W A;  1VQN A;  2D9T A;  3RUX A;  4M78 C;  1H64 1;  3X24 B;  1X6O A;  1VQ9 A;  4R56 A;  5GAN 3;  2DXC A;  4M75 F;  3JCM e;  1S72 A;  3I55 T;  3G7Z A;  3ASK A;  1D3B A;  3M55 A;  4XU0 A;  4M7D D;  3C95 A;  2VUB A;  2VV5 A;  3VKI A;  5CQY A;  3L2V A;  5CO7 A;  1GXI E;  3CBO A;  1PSE A;  3M5A A;  3MP8 A;  5LJ3 f;  3ZEH A;  2MI6 A;  2RD1 A;  2RI2 A;  4M78 G;  3BY7 A;  4QW2 A;  5FU7 B;  2LCL A;  2PQW A;  2LC4 A;  3QJ6 A;  4C92 B;  2A3L A;  3JCM J;  2ZPE B;  2JNG A;  3JRZ A;  3SWN C;  2P4T A;  5LJ5 h;  1LNX A;  2MF2 A;  5GAM f;  2DIG A;  2DTO A;  2KAF A;  3CME A;  3OQ5 A;  2HAX A;  1HK9 A;  1VQ5 T;  2XG8 D;  3CCL A;  2FYK A;  2QI2 A;  4JRI A;  1Y96 B;  4C0D B;  4M77 B;  3FIF A;  5GAO l;  1QP2 A;  4GLK A;  1K73 U;  1M9S A;  2MAM A;  3GP8 A;  1O75 A;  4LDV A;  3NTH A;  1NPP A;  4FT2 A;  3OBY A;  1K73 C;  2Y4X A;  4C8Q C;  1MGQ A;  3JCM Q;  2JOY A;  3HRS A;  4HA8 A;  1ZBX A;  5GAN 8;  2L5Q A;  2L89 A;  2DKG A;  4KT0 E;  1N9R A;  4EPC A;  3JB9 J;  2LQK A;  5GMK m;  1BIB A;  3QBY A;  3LWI A;  2RI5 A;  2G3R A;  1QP3 A;  3R6O A;  3MEA A;  3G4S T;  2XI9 A;  2LDM A;  1W4S A;  5GAO p;  3OYI A;  5LJ5 g;  4ZN1 A;  3OYC A;  1VQO A;  4C8Q G;  1NZ9 A;  2HQE A;  1IRE B;  3JSC A;  2JTM A;  4PJO B;  3EAE A;  1VQ8 T;  1YJ9 A;  3FRN A;  3HRU A;  2I2L A;  3ZBD A;  1B34 B;  4OB0 B;  1VQK A;  5A0D A;  1I4K 1;  1Y07 A;  2EJF A;  3RMS A;  3L2W A;  1YIJ T;  3CCV T;  2LTO A;  4OGE A;  5GMK j;  3OSS C;  2VXF A;  4DOW A;  5C6S A;  5CCA A;  5FU7 C;  3QUI A;  4NOY A;  4C92 C;  4A4G A;  4L5G A;  5DY9 A;  1VQ4 A;  3QYG B;  5M9O A;  2IG0 A;  3BW1 A;  2AHJ B;  2VXE A;  1W2B A;  5CIU A;  3JB9 F;  2O01 E;  4KUI A;  4E7L A;  1IZ6 A;  3A5Z B;  3HFN A;  3MEV A;  4M75 B;  2KVQ G;  2R5M A;  3PT9 A;  4WF2 A;  4C0D C;  4ZGE B;  4M77 C;  1YBY A;  3HP9 A;  3QHS A;  3CD6 T;  3OYL A;  2F5K A;  1NPR A;  3HHT B;  1ZQ1 A;  3QG1 A;  3HSB A;  5I2S A;  5GMK h;  2O4X A;  3G6E A;  2OTL T;  2PVO B;  5GAN d;  2QTX A;  1OYX A;  4ZTF A;  3JCM V;  1QW1 A;  2ZCF B;  3Q1J A;  3CCM A;  1N8R U;  4M7A A;  1X75 C;  3UWN A;  2GQV A;  4ZGJ B;  4CRI A;  1N8R C;  2VC8 A;  3KBG A;  2K5I A;  4C92 F;  4JS5 A;  2RJF A;  3QDR B;  3HKS A;  2R5A A;  1WGS A;  1VQP T;  4PJO A;  1UGR B;  4E7I A;  5J39 A;  3CCU A;  1AHJ B;  2JUF A;  4M7A G;  2E1H A;  3TEE A;  2E65 A;  2OTJ T;  4ME7 A;  4M78 E;  5CVI A;  4JRP A;  3EFR A;  2CZ7 B;  1Q7Y U;  4BD3 A;  4E7J A;  1KQS S;  3VJP A;  3JCM b;  4EMG A;  1Q7Y C;  4PJO G;  3PNW C;  4LD9 K;  4OGC A;  1VQM T;  4A4H A;  3NTI A;  4ELZ C;  1JJ2 A;  3T9N A;  1W2B S;  1M1G A;  5CKH A;  2E64 A;  4LDY A;  1JRI A;  4JUV A;  4XTY A;  4ZGD B;  4UC4 A;  3CCR T;  4M7D B;  5LJ5 f;  3DB3 A;  3DLM A;  5CK9 A;  5L8R E;  1BYM A;  2PVG B;  1UB4 A;  4V2S A;  4FIB A;  3MP6 A;  4M75 A;  2F69 A;  3J7A F;  1QVP A;  2RK1 A;  2DZ9 A;  3NFC A;  1Y71 A;  3L2Q A;  3CCE A;  3TRE A;  4N0A C;  4BB7 A;  5KCH A;  3G71 A;  2XDD A;  5GAO r;  1Q86 C;  5I21 A;  4BE0 A;  1I81 A;  5GAN 6;  1N27 A;  2RHU A;  4M75 G;  2L3R A;  3CD6 A;  2RM4 A;  4C8Q E;  3LX7 A;  4C0G A;  1ZHI A;  2EJ9 A;  4Q5W A;  2RHI A;  2X4J A;  4F7U B;  2K3X A;  4J7I A;  2X4Y A;  4B9W A;  4BY6 B;  4ZN3 A;  5GMK l;  4EDU A;  3PIP A;  5IT9 E;  4FL6 A;  1YHQ A;  5D6W A;  3JCM h;  2EJG A;  3MP1 A;  5I2M A;  1R8O B;  3CC2 T;  3OYB A;  4M78 A;  2V8J A;  2M1H A;  3A8L B;  3M53 A;  5LJ3 d;  1O9S A;  2DD4 A;  1VQ6 A;  1X01 A;  2EIF A;  2ZPG B;  4XQ3 A;  3PTA A;  2QA4 A;  1JJ2 S;  4GY5 A;  5KH6 A;  1G3Y A;  3OSV A;  3OYD A;  4NL3 A;  2RJD A;  3JB9 I;  4JS4 A;  2E6Z A;  1KC8 U;  4M7D C;  4HCZ A;  4MDW A;  4QVD A;  3QPH A;  2DPP B;  1OZ3 A;  4QVZ A;  5HK0 A;  3F70 A;  2R57 A;  1KC8 C;  4X9C A;  2K2V A;  3V7R A;  2PU9 B;  4M78 D;  3CMA A;  4MMK A;  3SWN A;  1VQL T;  2QEX A;  2XKO C;  1KHI A;  2LT1 A;  4N4G A;  5LL6 S;  3RMQ A;  3L1A A;  4JLI A;  3QII A;  3JCM g;  5CKB A;  3OS0 A;  2OAU A;  4EMK B;  5DM7 R;  4X34 A;  4BDZ A;  1UGP B;  3WXM B;  5GAN e;  4CI0 C;  3H8Z A;  5DLQ E;  3VV0 A;  5GAM h;  3OYM A;  4MZM A;  3L2Z A;  4M77 E;  4ZTJ A;  2JTF A;  3ME9 A;  4J83 A;  2E10 A;  3V8L A;  3PIO A;  3FLG A;  4C8Q A;  5J26 A;  3CC7 T;  3EFS A;  3QSU A;  4A4E A;  3BFM A;  2DK3 A;  3HL8 A;  5KCO A;  2LRQ A;  1YCY A;  2RJE A;  3RKY A;  4BY6 C;  4C5H A;  4M7A E;  2CZ1 B;  3CPW A;  4L6V 5;  4M7D F;  3A8O B;  2D0Q B;  1YJW T;  3LGL A;  3E9G A;  3I56 T;  4TVR A;  2GFA A;  3CCS T;  1QVG A;  4HKE A;  1VQ7 A;  3SFM A;  4ELY C;  2XIC A;  4PJO E;  3E19 A;  2LQ8 A;  4C8Q D;  1HXD A;  4XTV A;  3JB9 G;  3BDU A;  2JN0 A;  3OS1 A;  4O5V A;  5KE3 A;  2NLU A;  1FXX A;  1TH7 A;  4RCC A;  3CCQ T;  5GAO q;  1YI2 T;  4OF1 A;  3CC2 A;  4N4I A;  1LOJ A;  2WAC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...