1VIEA

Structure of dihydrofolate reductase
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
60
structure length
60
Chain Sequence
b'PSNATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHYDROFOLATE REDUCTASE
molecule tags Oxidoreductase
source organism Escherichia coli
publication title A plasmid-encoded dihydrofolate reductase from trimethoprim-resistant bacteria has a novel D2-symmetric active site.
pubmed doi rcsb
total genus 12
structure length 60
sequence length 60
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 1996-10-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.60 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1vieA00
2P4TA 2VV5A 2RH2A 3UDCA 1VIEA 3SFMA 1VIFA 2RK2A 3T9NA 2RK1A 2GQVA 2OAUA
chains in the Genus database with same CATH superfamily
4M75B 2HQHA 1IREB 1ZSZA 1M2VB 1HSQA 2AZVA 3JCMc 1K76A 1KK7A 1ZQ1A 4LD6A 3O5ZA 4CRIA 2J6OA 5GMKl 5GAN6 1NPRA 4EMKC 5KYXA 2QEXA 2DTHA 3CCEA 2RK1A 3META 4XQ3A 5CKBA 1M3AA 3EHQA 2P0KA 2LCLA 1D0XA 3EGXA 4XU0A 4C92F 2F5KA 4OB1B 1RADB 3CPWP 1ZBJA 4R55A 2FB7A 2E6ZA 3LWIA 3C4SA 3TSWA 3AT1B 1GCQC 4FW1A 5AT1B 3JCMh 1M90R 1W2BP 3PVQA 4NL3A 1M8MA 3OYMA 2RN8A 2DL5A 4PKCC 2L2PA 1IHWA 3VS0A 2RHYA 1YI2Q 2YWWA 3JB9D 2PZ1A 1KQSP 5GMKi 4OGCA 2WACA 1YN8A 3SFMA 4M77F 1BIBA 1TXQA 2AKLA 3GF5A 2JM8A 3HL8A 1JO8A 1ZLMA 3EG9A 3VS4A 1MHNA 1RAAB 1SPKA 1AT1B 2JOYA 2I0NA 1M27C 4B6MA 1LVKA 4ATOA 4OMOA 2HL3A 4C0DC 4AFUC 4F7UF 4E7SA 4JDSA 3CQTA 1ZBXA 1H641 4CC4B 5D6WA 3ZEHA 4MDWA 3GNGA 4BI3A 3OSVA 1KFZA 4M77A 2ZPEB 1YHQQ 2OX7A 1YHQT 5GMKm 1Y96B 3TU4K 4PJOA 2KK4A 5D6YA 1MGQA 1QVFS 4CC3A 1YWOA 3O8VA 3JCMg 2JM9A 2C0OA 2F69A 4M7AC 2DAQA 4EPCA 1QP2A 3GP8A 3M57A 1N8RC 4BDZA 2RM4A 3VYHB 4M78G 4LDVA 4M77B 1KSWA 5AYFA 3RMQA 3I5SA 4LDXA 1M5Q1 2YDLA 2XU8A 4HKEA 3DLMA 1K73U 2X4WA 1OV3A 3CC7A 1NLOC 4M7DA 1YITQ 4E7ZA 1NPPA 2ATCB 5GAMj 1D0ZA 2F5TX 1YI2T 1H8KA 4IUVA 2QI2A 4JRQA 3UDCA 4QW2A 1I07A 2M9UA 1TSFA 3ZFJA 3U23A 1B07A 4Z02A 3HHTB 4KH0B 3L2WA 2DXTA 3BE3A 2Y4YA 3VS2A 3RERA 1UDLA 1G8XA 3CC7Q 1BCOA 2DMOA 3CCMT 1UTIA 2CZ0B 4TVRA 4AFZC 4AG2C 4CC7A 2HKQB 4CI0C 1U8RA 5LL6S 3HTRA 2AHJB 2YLBA 4RCCA 4OB0B 3V8LA 4DEXA 3NPFA 1TWBA 4XTZA 3PMIA 3ZBDA 1VUBA 3CCUT 3HSBA 4F7UE 2O9VA 4MZTA 2D0QB 4A53A 4ZN3A 1M3CA 1JJ2P 5A0LA 2MK5A 5IH2A 3RKWA 4M75G 3X24B 3LLRA 3V7SA 2BZXA 2DIGA 1F1BB 2RB6A 4A63B 4M77E 4EMHA 1AD5A 3QWXX 1FXXA 2EKHA 2DXUA 1UFFA 2O88A 5KE3A 1S72A 1WIEA 2OTLA 3OB9A 2R58A 2YUNA 4DBQA 2NUPA 4M78F 1R0CB 2PUKB 3LGLA 1VQNT 2QYZA 3CBMA 2EYWA 4FYVB 2ZCFB 3CCVQ 3FRNA 1W4SA 1MMGA 4OGEA 4BACA 5GAOn 3QJ6A 1SF9A 2P0PA 1M1GA 1WHHA 3I56T 1IGUA 3E19A 1I8FA 4J9BA 2EYZA 2FHDA 3M54A 5FU6C 2DZ9A 4ZNXA 2LQWA 1JQQA 5DLOA 2E10A 2E5QA 3FJPA 2CGHA 2F2WA 4FW2A 1XOVA 1VQ4T 3NTIA 3CCLA 2EYYA 3M5AA 3PIPA 1YITT 1WXBA 2D6FA 2YUOA 2LP5A 1WGSA 2RA2A 1RAGB 4J9DA 3CCRT 1VQLQ 2JN0A 3C95A 1UG1A 1I1JA 1OI1A 2MIOA 3EG0A 1Y96A 4LNPA 3SB2A 1S72T 2QQAA 1OOTA 2EKOA 2FVUA 1KD1R 1P92A 1Y0MA 2EGEA 4XK8E 3KXTA 2EFIA 2KRMA 5GAMd 2K5FA 2E4HA 2ZPGB 1X6BA 2EQJA 4N4GA 2V8JA 3NMZC 5GAN3 3FC3A 3AHUA 3RBBB 2CH4W 6AT1B 2A28A 4A4HA 4E7LA 1K4US 2X4XA 1R0BG 2XHCA 4XU3A 2PVDB 1Q81R 4EIKA 2QEXQ 3A8MB 5GAN2 3CCET 4PK4A 3OYAA 2JS2A 3I55Q 1MNDA 3V8KA 4F7UA 3IQLA 1Q81C 1X43A 2DILA 4FU6A 3RDVA 3CMEQ 1PWTA 3BFMA 4NOYA 1KIKA 2HQXA 1MMNA 1H3ZA 3M58A 1OX9A 2CP7A 5LJ3e 2ESWA 3PVLA 1OZ3A 5CIUA 3EGUA 1YJ9T 2LCCA 3OS2A 4PFPA 3CCQQ 4IURA 4FYWB 3JV3A 3QJYA 4EMGA 1ZSZC 3INZA 1D1BA 2DYBA 1YI2A 1N9SA 3TSZA 2EYQA 2MOXA 1K0SA 3QSUA 1IZ6A 3CCLQ 3CC7T 1OX8A 5DM7R 4HVWA 3JCMV 4L6V5 4M77D 3FB9A 3E2UA 1QVGP 4PJOG 1VIEA 4PJJA 1Z9ZA 4J9CA 4PJOD 2DEUA 1K8AR 2RJDA 4FL6A 4JZ4A 1Q82C 1LNXA 2MCNA 3G71T 1W2BS 3TREA 3ULRB 5LJ5g 2ZPFB 4KBMB 2L89A 3NFCA 1K9AA 3JCMb 2DJQA 4J7FA 1QW1A 5J39A 2A0FB 2RD1A 1VQPQ 3G6EQ 4IUUA 2CP3A 1PNJA 1FMWA 3RUXA 4A4EA 1VQ6T 1M30A 1BBZA 1MMAA 1SRMA 2FZGB 2GFAA 1M1KC 3OYLA 4RTZA 4Y92A 3RKYA 4DA4A 4Y28E 3CPWA 1WZOA 5IAYA 4KGZB 1CSKA 4Z89A 4M78C 4HT9A 2BE9B 4ESRA 4MZMA 3P8HA 2HSPA 3L2QA 2K57A 5KYWB 7AT1B 2XI9A 5GJWB 2FO0A 2X3XD 3M53A 2KBTA 2X4YA 2RH2A 2YRCA 5GAMh 1VIFA 4ME7A 1GBQA 2LJ1A 1YNZA 3M0TA 1RL2A 4IUQA 2ABLA 2DM1A 1M90C 1Y71A 2A7YA 5GAOp 1K73R 5LJ3d 2DTOA 4FCYA 2RO0A 1YJNQ 1NEGA 4X1VA 5GANe 1X6GA 2MAMA 3A8GB 1YITA 3CCLT 2EGAA 4E47A 3HRSA 1M8VA 4MZPA 1MUZA 2QG9B 3A5ZB 2DNUA 5CR2A 4JRPA 1FX7A 4RTVA 2DA9A 2W0ZA 1SEMA 5LJ5d 4C92D 4OMMA 2E64A 4GY5A 4JZ3A 2KMTA 2IPOB 1AOJA 1FMKA 2DTIA 2DRKA 3M4YA 3QPHA 1X2KA 2CDTA 4R56A 2KRNA 4HT8A 2GFUA 5GAN7 4C0DB 4RTTA 3EG1A 3CCSA 1D1CA 1FYNA 3RR6A 1PKSA 2CUDA 4M7AE 2MPXC 1YJNA 4RG2A 2DX1A 4M7AD 4YTLA 5GAN5 2I2LA 2KE9A 4M75E 4KRTA 4OB3B 4J6YA 5GANg 1T0HA 1VQMQ 3SWNB 2DKGA 2DD5A 2FPDA 2BZYA 1VQLT 2QQBA 1QLYA 3FDRA 1KG1A 3PMTA 4JJCA 4NS5A 4M78E 2AKKA 3QYGB 3CC4T 2XDBA 4JLGA 4D8DA 2HD0A 1VQKT 4OMQA 1GFCA 2XG8D 2GQIA 4ZTFA 2SEMA 5CVIA 1H3HA 1QVPA 1SRLA 2JT4A 3MEUA 1UUEA 1ABOA 2PNIA 1YIJA 1NG2A 4KGXB 4C5IA 4F04B 1HD3A 3MEAA 1WYXA 2WSFE 2QK0A 1O75A 3BDUA 3CCVT 1YJ9Q 4BB7A 1VQ8T 3OS5A 1PHTA 2LJ3A 1G83A 1D3BB 2KGTA 3JB9F 1BK2A 4FM4B 1IRXA 2DBMA 5GAOr 1RAHB 4KULA 1K9MR 3M9QA 2JTMA 1LCKA 1NJIU 1RLPC 2RQWA 1KQ2A 4M77C 1RUWA 1WHMA 1T0JA 4M7DC 2KI7A 1KQSA 1X01A 2QAZA 4KH1B 2E3HA 4JS5A 2LNVA 3E9GA 5FU7B 2VXFA 2XDDA 4BDYA 2DIQA 1EFNA 1QCOA 4JJBA 3EFRA 1VQ7T 1VYTA 2ZPHB 1SKUB 2KQWA 3WXMB 3R6NA 4QVDA 1WQWA 3M0RA 1VYUA 5A0DA 1PD1A 3CMET 1WLPB 3SD4A 4C8QG 4ZGJB 3E1SA 2K7AA 4EMKB 2PU9B 9ATCB 1Z9QA 4XTUA 2VASA 4F16A 2DEQA 5LJ3h 3LYIA 2LQKA 2CZ6B 2X9HA 2DO3A 1K1ZA 1VQ4Q 2DERA 1TS9A 4M77G 4M78B 3VRZA 1MV3A 1BI1A 5I2MA 3SDZA 3VV0A 3CCRQ 4PJOB 3A8OB 5FLXE 3CC2A 1Q7YU 2Y90A 3OY9A 2MMPA 2R5MA 3GNFB 3OW2S 4E7HA 5EC7A 5KYYA 3VS6A 3JB9J 4J5YA 2LNHB 4KT0E 3OYNA 1ZSGA 2FPEA 3N5BB 2ROLA 1WJQA 3JCMW 3JCMP 3UATA 1B7TA 2XIDA 1Q7YC 4RTWA 2K3BA 2EAYA 4N4IA 2RPNA 3DKMA 2FPFA 2M0OA 4RUGA 1UJYA 5KYXB 1WFWA 1SSHA 3ER0A 3OA6A 1N8RR 2NUTA 3CCQT 4JPBW 2H3JA 2CSQA 4JLIA 1VQ9A 2J6KA 4QVZA 1I4K1 2IIMA 4XTYA 1D3BA 1TH7A 1YCYA 3OYYA 1M1KR 2RNAA 2JZ2A 2E5KA 2HMAA 5GAMf 3PTAA 2GNCA 1W70A 2QTXA 4II1A 2V8KA 2D8HA 3QIIA 4BE0A 1YJWT 3V8JA 4BY6B 4J6WA 2VWFA 2QASA 2QDYB 1ARKA 1VQ8A 2QTVA 4M75A 1Q82R 2GGRA 3MPUB 2NLUA 2MWOA 4M7DE 2VGMA 3R6OA 1H92A 1N5ZA 4BI8B 1UJ0A 1VA7A 3C0CA 1GRIA 4B9WA 1VQOA 1R77A 2KROA 2L5QA 1OYXA 1VQPA 4D6WA 1FMVA 5GANh 1V76A 3RESA 2F2VA 5D7UA 2X3WD 4LXCA 2EBPA 5CKEA 3A1PA 3G4ST 5C0MA 3H41A 4ELZC 1Q86R 3CD6Q 1WHJA 2FEIA 2IG0A 1U5SA 2RF0A 5FRNA 5KYUA 3X25B 1QMCA 1T3LA 2EJFA 2COZA 2RI2A 1UGRB 1VQ5A 5KCHA 2COYA 1KQ1A 3I9QA 3MP1A 1VOMA 1QKWA 1B3QA 3CCMQ 1FWZA 1UGVA 5EG2A 3LWHA 2KYBA 2P84A 3CD6A 4V2SA 3CXCS 3EH1A 5GAOl 3I56Q 4K11A 1YJNT 2EPDA 4JJNK 2KRSA 4RCBA 3OQ5A 1QKXA 1RACB 3TVTA 5GMKe 1SHGA 4J83A 1YBYA 2XK0A 1IXDA 1AHJB 2NYSA 1HK9A 2HBWA 3JB9G 2FL7A 2A36A 1VQMT 1K9MU 3MKDA 3M0UA 1WDXA 3MEWA 3CCUA 1X69A 2E6NA 2K3XA 1T3SA 4XU1A 5FU6B 2M16A 4Z88A 1PSEA 1EZZB 2HL5C 1RI0A 2GF7A 5IN1A 3C94A 1XJWB 2K3YA 4PLLA 2NUPB 2VKNA 3UWNA 4C8QF 2QA4T 1I5OB 2JVVA 1K0XA 2V1RA 1K8AC 3MJXA 2OJ2A 5LJ3f 2DFUA 4PJOF 3L2UA 1VQ6Q 2QQSA 2ED0A 2QQRA 2LT4A 1RLQC 3EG9B 1CKAA 1X75C 1YJWA 3GBQA 2BIVA 1K73C 1PSFA 2L3QA 2RK2A 1BI2A 2LDMA 4PJOC 2BTTA 4O6JA 4AFSC 2KDSA 4F17A 2NWMA 2GQVA 2DRMA 2E65A 2YUQA 3OYFA 2QA4Q 1M4ZA 2V26A 2OTJA 2DVEA 5GAOm 2H3EB 2LMJA 3QDFA 2RQTA 5IXFA 2DL4A 2M02A 2JTEA 2VVKA 1VQ5Q 4HA8A 4A4GA 3L2RA 2WSCE 2R5AA 2L3SA 4E6RA 3DLLA 2JUFA 3OYEA 4PFOA 5IHNA 4AMCA 3OYHA 3GIBA 1UECA 2JMAA 1UHFA 3MEVA 2EQKA 2X35A 2XICA 4BI4A 2M0YA 3ME9A 4J9GA 1KC8U 2YLCA 3G71A 1YHQA 1HXDA 2X51A 3VKIA 3J7AF 1PRMC 3D7SB 1KQSS 3CCJQ 4UC4A 3M59A 4X9DA 3PE0A 3TEEA 2OI3A 3CEYA 2DLPA 1YP5A 4O5VA 4FYYB 2ZAEA 1ZA2B 1BB9A 3MO8A 1VYVA 3QKJA 1NLPC 5GMKh 2O4XA 2HZYA 3L42A 3DB4A 4DEYA 4M75C 1VQ7Q 3VYGA 2DXBA 5LJ3j 1BIAA 4D8KA 2KSSA 3H8ZA 1YFNA 3RNJA 1BI3A 1W2BA 2ENMA 1D0YA 1RI9A 3VUBA 4BE1A 2CZ1B 1A0NB 1UE9A 1WXUA 4EMKA 3G4SQ 3EGDB 2GTJA 3OMCA 1Q86U 1QWFA 4X34A 3CCSQ 1ZX6A 3C12A 1QWEA 3EG2A 4RTUA 4R0KA 2KVQG 2JS0A 1AZGB 2O31A 4ZGDB 2CSIA 5HK0A 4J9HA 3HRTA 1I0CA 3S6WA 2KR3A 1VQ8Q 1N9RA 2DVJA 2WSEE 5FU7C 1GCQA 4AT1B 2P0QA 4F14A 2YHTA 1TUGB 4HCBA 3CCJT 1ZA1B 3REBB 2EQUA 2H8HA 4C5EA 3G71Q 1ZUKA 2KXCA 1NYGA 5DY9A 2LCSA 4GLKA 4PJNA 1TTHB 2KT8A 3S3MA 1ZUUA 5GANf 1VQMA 2KEAA 2LZ6B 2CZ7B 8ATCB 4C0ZA 2IVWA 3M0SA 2DYIA 4M7DD 2VC8A 4OP0A 4LN2A 3CMAA 4M75F 1IB8A 4OMFB 3M0PA 3MHXA 1VQKA 1NM7A 3JCMQ 1Y57A 2K9GA 4RG8A 3CBOA 1JRIA 2X4JA 2YRVA 1NEBA 1VQLA 4PFZA 3M4GA 3OYGA 3FIFA 4GLMA 2COWA 2AIRB 3QUIA 4E7IA 1VQ4A 1V1CA 4MDXA 1D1AA 1RAIB 4M7AB 3JCMe 2F2XA 3J80E 1BKBA 1G5VA 3PT9A 2A3LA 3CC2Q 3A8LB 5LJ5h 3LX7A 1AZEA 1PM3A 3I56A 1YJWQ 5KYUB 3VS1A 1IGQA 3UA6A 2BKDN 2AK5A 2E1HA 5CQYA 2A37A 3SWNA 3QWYA 4QKUA 4OMPA 1LPLA 1VQPT 3V7RA 3M55A 2RQUA 1X2QA 2DF6A 4MMLA 2DE0X 3G7ZA 1C0MA 4BUGA 2L8DA 2OTLT 1WNLA 3HRUA 4XTWA 5I2SA 3CCJA 5FRMA 4BY6C 2YT6A 4Z8AA 2ROTA 3UF4A 1M1FA 1NJIC 3X20B 1M3BA 1XQHA 2DD4A 3NGPA 3VRYA 1PG5B 4QQDA 2EVRA 3TCJA 2DL7A 2FRWA 4PJLA 4J9IA 4NL2A 1PCXA 1WJSA 4M7AG 3QDRB 3QO3A 1AVZC 3HPWA 3OYJA 3CCQA 2E3IA 1XTDA 2O2OA 5CAIA 2MF2A 3PFSA 5LJ5j 4JRKA 1MMDA 1QVFP 3CCMA 3P8DA 3CMAQ 2RHXA 3Q1JA 1JEGA 5CQXA 2J05A 1JBMA 3CBPA 3P8BB 1OZ2A 3LW5E 4IIOA 4M78A 3CC4Q 1LOJA 5IT9E 3JCMJ 4EDUA 1MV0B 2JXBA 1JXOA 4QT7A 1GCPA 2SRCA 3V7CA 1BCMA 1PRLC 5GAMe 2KY9A 4J9FA 3CC2T 2MI6A 5HKCA 5FWCA 1VQ6A 2L3PA 4RTXA 4DOVA 2EJGA 2L3RA 4RTYA 3KFVA 3OW2P 3S3NA 1GL5A 3CPFA 4DBHA 3QHSA 4WTOB 5FROA 3WVEB 4JUVA 4C92A 3OYBA 5A0GA 3X26B 3CMEA 2VUBA 2O01E 3QG1A 1EX4A 3EAEA 5GAN4 5L8RE 3S3OA 1RABB 2DBKA 2J7IA 5DLQE 4C8QB 1WHGA 2NUZA 3MP8A 1Q81U 3QBYA 2RJEA 2D8JA 4QQGA 2DL8A 1AWJA 2AT1B 2EWNA 1LJOA 3J81E 2NUTB 1RAFB 5D6XA 1VQKQ 4LUDA 1J3TA 3BW1A 1NBEB 2DJZA 1K9MC 2LC4A 2A08A 5CO7A 3G4SA 2JNGA 3X28B 3CCVA 2ED1A 3CMAT 3RIRA 5HK3A 1X27A 1YWPA 4KGVB 3HFNA 1U1SA 5LJ3g 2G3RA 2C0IA 2C0TA 1RAEB 3EH2A 3OMGA 1M2VA 2RJCA 5KCOA 2GBQA 2JJ9A 2RI3A 3CC4A 1WA7A 1PD0A 1DJ7B 1V29B 4IIMA 4LDYA 1WJRA 5GANj 2CUBA 4J8OA 4J7IA 2KYMA 2VGNA 4E7KA 2HCKA 3NTKA 1YIJQ 4HCCA 1QVGA 3OSSC 1O9SA 3H9NA 1Q95G 1KD1C 4C0FA 4C5HA 1KC8C 4DBRA 1R8OB 1KD1U 2YRDA 5CKDA 4PLIA 3H0IA 2QXFA 3CD6T 2HQEA 2QEXT 4ZN1A 1QCFA 2CS7A 1NE8A 4FYXB 4FSSA 5KYNA 3TQ7P 1AWOA 4C8QD 3L1AA 4E2FB 3CCST 4BD3A 1KHIA 1OEBA 4Q5WA 3OYIA 1G3TA 2CH4A 3MCAB 4J9EA 2CYZB 1WHKA 1OULA 5GANd 2QGGA 1I5LA 1TOVA 5IXBA 4HCKA 2KNBB 4QQ6A 3URGA 5I22A 1E7OA 1QVGS 1ACMB 4M7DG 1UHCA 1WXTA 3I5RA 2HDAA 1WI7A 1VQOT 3JSCA 2D1XA 3EFOB 2M1HA 4M7DF 4FT4A 4M75D 2PQWA 2LT1A 3QXEB 5M9OA 4PJMA 4F7UG 2ECZA 2V8IA 2JMCA 1KJWA 4C8QC 1ZUYA 3VS7A 3FJ5A 2XMFA 1TUCA 4C92C 5FWBA 4OMLA 2J6FA 4JRIA 4HXJA 2FYKA 4N0AA 3I55T 3L2ZA 1ZSZB 2FG0A 2OAUA 2K5LA 2DPPB 4ELYC 4L5GA 4OF1A 2E70A 4L59A 3OYKA 4DQ2A 5KYWA 4XAXB 1JU5C 1NYFA 2LJ0A 2CP6A 3JB9I 1PKTA 1E6GA 4M7AA 3OBWA 2RI5A 8AT1B 1Q7YR 2VXEA 1SG5A 3VUZA 3EHRA 3HP9A 4N4HA 1WQ7A 2RMOA 4E7JA 1YCSB 2XKOC 4C92G 2L0AA 4X9CA 1IO6A 2YSQA 3PNWC 1C6VX 2HEQA 3H6ZA 2K4YA 4JJDA 3EG3A 4A4FA 2CP2A 4F7UB 2XDPA 2FRYA 3JAME 3CXCP 2P4RA 4VUBA 2LX9A 2EJ9A 3LGFA 1JB0E 3LH5A 1AEYA 3ASKA 4C5GA 3M0QA 1UGSB 5CK9A 1QQJA 4M7DB 3FLGA 4LE9A 1S72Q 2LRQA 4LD9K 5L23A 2DL3A 1GFDA 2GCXA 1OU9A 2JW4A 1ABQA 1G3YA 2QDLA 5KYYB 4IUTA 1TUDA 1M1KU 3OS1A 2EW3A 2HNIA 2Z0WA 2RJFA 1UGQB 2DZCA 3JCMX 4WCIA 2V1QA 3PIOA 3CCEQ 5GMKj 1VQ7A 2CP5A 1OU8A 2MYSA 3H0FA 3G6EA 3L2VA 2BUDA 5FW9A 5KH6A 2LX7A 3VJPA 1QCNA 1NZ9A 3VS5A 5J26A 2G6FX 5IHKA 1Q82U 1WHLA 5ECAA 1VQ5T 2PVOB 2BZ8A 3OYDA 3UA7A 1WPYA 4PNOA 1BU1A 4C0GA 2DXCA 1W1FA 4OMNA 1N6AA 2RHIA 2AZSA 3GLXA 4ORZA 4A4KA 2C06A 2BE7D 2XD0A 4ANJA 3ZL7C 3KBGA 2HBPA 1D09B 4WF2A 4OVAA 2O4XB 3A98A 2LVMA 4DOWA 1YIJT 2GTOA 5A2QE 5GJVB 3FEOA 5IHIA 4M78D 1OPLA 4J6XA 2M51A 1HYOA 4RKUE 3MP6A 5GAN8 4Y91A 1MNEA 1K8AU 2LQ8A 3VU3C 2RQRA 3PGGA 4HVVA 1N27A 2B8AA 1QVFA 2FZCB 3EGDA 4XTVA 3LH0A 5LJ5f 1GBRA 3UPUA 2HAXA 2EQMA 2P4TA 4CC2A 1G3WA 1VQNQ 2CKKA 2PTKA 2ZZDA 3E9FA 3F70A 1VQ9T 2HKNA 2PVGB 4IKFA 2PUOB 3G1JA 4OB2B 2LQNA 4AG1C 3NHNA 4FT2A 1M90U 5KE2A 1N8RU 1HJDA 2B86A 4DBFA 3DB3A 1JXMA 1VQNA 3OBYA 5HCKA 2KXDA 2R57A 4FIBA 4XTXA 3HFOA 4C8QA 3H0HA 2K5IA 4QVCA 3RKXA 1ZHIA 5GAMg 3G6ET 1C1AA 2ZGWA 1QP3A 1CKBA 1XNIA 4A54A 3KUFA 3EGXB 2CREA 2FZKB 4KUIA 3GPLA 1TU0B 2F1LA 1X6OA 2K6DA 5CKFA 2RHZA 1Q86C 2Y4XA 2W10A 3HKSA 2K79A 1SSFA 1EIFA 1BI0A 1WX6A 3JCMd 4IUPA 4N0AC 4ZGEB 2D0NA 2OTJT 4HCZA 4B9XA 3CPWS 2K2MA 2OTLQ 1Y07A 1PC0A 4XU2A 1SHFA 4RMOA 1AWXA 3BY7A 4C92B 3OYCA 4GBQA 4ZTJA 5CKHA 1B34A 2K2VA 4LDWA 5LJ5e 3RMSA 4AFQC 2YXYA 4LDUA 1KHCA 3EFOA 3UT1A 2CP0A 2DK3A 2EGCA 1YJ9A 1GXIE 2VB6A 2DETA 1U3OA 2O9SA 4JS4A 4BE2A 1OPKA 2QA4A 2E12A 3SEMA 4FSXA 1E6HA 2MWPA 1UEBA 4M4ZA 1U06A 1AWWA 4KUDK 4LUEA 2QQ9A 1KC8R 2EIFA 2JTFA 1G2BA 1M9SA 1VQOQ 5I11A 3I35A 1Y7XA 2RQVA 1M2OA 2OAWA 3EFSA 3M56A 3OS0A 5C6SA 1JJ2S 3THKA 3BDLA 2ZPBB 3I55A 1VQ9Q 1W6XA 1TG0A 2CT4A 1OQKA 3OW2A 2EYXA 5J3BA 2J06A 3JRZA 1IHVA 4PJOE 3QZ9B 2KAFA 4MMKA 3T9NA 2EQIA 2KT1A 5I21A 3CCRA 2ZPIB 3NTHA 3QYHB 3VS3A 2HSEB 1UB4A 1U1TA 3SWNC 2OTJQ 3CXCA 3REAB 3WVDB 3GOXA 4P5NA 3A8HB 2E41A 3JCMf 3JB9H 4C92E 1I81A 5HY6A 4M7AF 2D9TA 4PL6A 4C8QE 1BYMA 2LTOA 1JJ2A 2RHUA 3SHWA 5CCAA 2YUPA 3CCUQ 1G3SA 1S1NA 2VYTA 1B34B 2VV5A 4HVUA 5GAOq 1NJIR 2QGFB 3QZ5B 2CT3A 1UGPB
chains in the Genus database with same CATH topology
4M75B 3OYIA 1IREB 4MZMA 1G3TA 3P8HA 2E65A 3OYFA 3L2QA 2K57A 1M4ZA 2XI9A 3MCAB 2OTJA 2CYZB 5GANd 3JCMc 2DVEA 1ZQ1A 5GAOm 4LD6A 5GMKl 4CRIA 5GAN6 1I5LA 1NPRA 3M53A 4EMKC 2X4YA 2RH2A 5GAMh 1VIFA 4ME7A 4QQ6A 2QEXA 2DTHA 3CCEA 2RK1A 3URGA 4HA8A 4A4GA 3META 4XQ3A 5CKBA 1RL2A 3L2RA 4IUQA 2WSCE 2R5AA 1QVGS 2P0KA 1M90C 3DLLA 1Y71A 2A7YA 2LCLA 2JUFA 5GAOp 4M7DG 3OYEA 4XU0A 5LJ3d 2F5KA 4C92F 2DTOA 2RO0A 4OB1B 3OYHA 1VQOT 3JSCA 3GIBA 4R55A 2FB7A 2E6ZA 2M1HA 3C4SA 3MEVA 3LWIA 4M7DF 5GANe 2EQKA 4FT4A 2MAMA 3A8GB 3JCMh 4M75D 2X35A 2PQWA 2LT1A 3QXEB 1YITA 5M9OA 4NL3A 2XICA 4BI4A 3OYMA 3CCLT 3ME9A 4PKCC 4E47A 4F7UG 2V8IA 1KC8U 2YLCA 3HRSA 1M8VA 2RHYA 4MZPA 3A5ZB 3G71A 3JB9D 1YHQA 1HXDA 5GMKi 3VKIA 5CR2A 3J7AF 4JRPA 4OGCA 1FX7A 4C8QC 2WACA 3SFMA 1KQSS 4M77F 4UC4A 5LJ5d 3M59A 4X9DA 1BIBA 4C92C 3GF5A 4C92D 3TEEA 3HL8A 3CEYA 2E64A 4JRIA 2FYKA 4N0AA 4O5VA 4GY5A 3I55T 2KMTA 3L2ZA 1MHNA 3MO8A 2DTIA 3QKJA 2OAUA 5GMKh 2K5LA 2O4XA 3M4YA 2DPPB 3QPHA 4ELYC 3L42A 4L5GA 4R56A 3DB4A 4HT8A 4M75C 4OF1A 2E70A 4L59A 3VYGA 2GFUA 3OYKA 2DXBA 2JOYA 5GAN7 5LJ3j 4C0DB 1BIAA 4DQ2A 3CCSA 2KSSA 4XAXB 3H8ZA 4ATOA 1BI3A 4M7AE 4C0DC 1W2BA 1YJNA 4F7UF 3VUBA 4BE1A 4JDSA 3JB9I 1ZBXA 4RG2A 1H641 1KHIA 2CZ1B 5D6WA 3ZEHA 3OBWA 4M7AA 4M7AD 4MDWA 2RI5A 3GNGA 4BI3A 4EMKA 2VXEA 3OSVA 4YTLA 3VUZA 3OMCA 1Q86U 5GAN5 4X34A 2I2LA 4M77A 2ZPEB 3HP9A 4N4HA 3C12A 4M75E 4OB3B 1WQ7A 4J6YA 4E7JA 1YHQT 5GANg 2XKOC 2KVQG 4C92G 5GMKm 1Y96B 4X9CA 4ZGDB 3TU4K 4PJOA 2KK4A 5D6YA 1MGQA 3SWNB 5HK0A 1QVFS 3PNWC 2DKGA 2DD5A 3HRTA 3H6ZA 2K4YA 3S6WA 4A4FA 3O8VA 4F7UB 1VQLT 2QQBA 3JCMg 1N9RA 2XDPA 3FDRA 1KG1A 3PMTA 2F69A 2WSEE 3JAME 4NS5A 4M78E 5FU7C 4VUBA 3QYGB 2P0QA 2DAQA 2LX9A 4M7AC 2EJ9A 3LGFA 3CC4T 2YHTA 4EPCA 1JB0E 3JCMJ 2XDBA 1QP2A 3GP8A 4JLGA 4HCBA 2HD0A 3CCJT 3ASKA 4C5GA 3M57A 1N8RC 4BDZA 1VQKT 1UGSB 2RM4A 5CK9A 3VYHB 4M78G 3FLGA 4LDVA 2XG8D 4M77B 4M7DB 4ZTFA 5AYFA 2EQUA 5CVIA 4C5EA 2LRQA 4LD9K 3RMQA 5DY9A 1QVPA 2GCXA 4GLKA 3S3MA 3MEUA 4LDXA 1G3YA 5GANf 1M5Q1 2XU8A 4HKEA 1VQMA 3DLMA 2CZ7B 4C5IA 2X4WA 1YIJA 1K73U 4C0ZA 4IUTA 3CC7A 2IVWA 1M1KU 3MEAA 3OS1A 4M7DA 2WSFE 4M7DD 1O75A 2VC8A 1NPPA 4OP0A 2HNIA 2RJFA 3BDUA 1UGQB 2DZCA 5GAMj 4M75F 3CMAA 3CCVT 2F5TX 4BB7A 3JCMX 1YI2T 1VQ8T 4OMFB 3OS5A 4IUVA 2QI2A 1D3BB 3MHXA 1VQKA 4JRQA 3PIOA 3UDCA 4QW2A 3JCMQ 2M9UA 3JB9F 4RG8A 3CBOA 4FM4B 1JRIA 5GMKj 1VQ7A 3G6EA 3ZFJA 2X4JA 2YRVA 5GAOr 3L2VA 2BUDA 4KULA 3M9QA 2JTMA 4Z02A 5KH6A 3HHTB 3M4GA 3VJPA 1NJIU 3OYGA 1VQLA 3FIFA 3L2WA 1KQ2A 4M77C 1NZ9A 2DXTA 5J26A 4M7DC 1Q82U 2Y4YA 3QUIA 4E7IA 1KQSA 1X01A 1VQ4A 3RERA 4MDXA 4JS5A 1VQ5T 2LNVA 3E9GA 5FU7B 4M7AB 2PVOB 3JCMe 3J80E 2VXFA 2XDDA 1BKBA 3CCMT 4BDYA 1G5VA 2DIQA 3PT9A 3OYDA 2CZ0B 2A3LA 1WPYA 4PNOA 4TVRA 4C0GA 2DXCA 3EFRA 1VQ7T 3A8LB 1N6AA 2ZPHB 2RHIA 5LJ5h 3LX7A 3WXMB 2KQWA 4QVDA 3I56A 3GLXA 1WQWA 4A4KA 5A0DA 2C06A 4CI0C 1U8RA 2XD0A 3CMET 5LL6S 3SD4A 2BKDN 4C8QG 4ZGJB 3KBGA 2HBPA 3E1SA 2E1HA 5CQYA 2AHJB 2YLBA 2PU9B 4RCCA 4WF2A 3SWNA 4OVAA 4EMKB 2O4XB 4OB0B 3V8LA 4XTUA 4XTZA 3PMIA 1VQPT 3ZBDA 2LVMA 1VUBA 4DOWA 3CCUT 3V7RA 3M55A 3HSBA 2DEQA 1YIJT 3LYIA 5LJ3h 4F7UE 2LQKA 4MMLA 2CZ6B 4MZTA 5A2QE 2DO3A 3G7ZA 3FEOA 2D0QB 4A53A 4ZN3A 4M78D 4J6XA 4M77G 4M78B 5A0LA 4BUGA 4RKUE 3MP6A 1BI1A 5GAN8 2L8DA 2OTLT 5I2MA 4Y91A 3RKWA 4M75G 3X24B 3LLRA 3V7SA 1WNLA 3SDZA 3HRUA 3VV0A 2DIGA 4XTWA 4PJOB 3A8OB 5I2SA 5FLXE 3CCJA 2RB6A 3CC2A 1Q7YU 5FRMA 1K8AU 4M77E 2LQ8A 2Y90A 3PGGA 3VU3C 4BY6C 4EMHA 1N27A 3OY9A 2MMPA 2R5MA 3GNFB 1FXXA 1M1FA 2B8AA 2DXUA 3OW2S 1QVFA 4E7HA 4XTVA 5LJ5f 3LH0A 1NJIC 5KE3A 1S72A 3X20B 3JB9J 1XQHA 2DD4A 2OTLA 3UPUA 3OB9A 4J5YA 2HAXA 4KT0E 3OYNA 4QQDA 2R58A 3N5BB 2EQMA 2P4TA 4M78F 2PUKB 3LGLA 1WJQA 3CBMA 3JCMW 1VQNT 3JCMP 1G3WA 3TCJA 2XIDA 1Q7YC 4NL2A 2EAYA 4N4IA 1WJSA 2ZCFB 4M7AG 2CKKA 3QDRB 3DKMA 2M0OA 2ZZDA 3QO3A 3FRNA 1W4SA 3E9FA 3F70A 4OGEA 4BACA 5GAOn 1VQ9T 2PVGB 3HPWA 4IKFA 2PUOB 3QJ6A 3OYJA 3CCQA 2P0PA 1M1GA 4OB2B 3ER0A 3OA6A 3I56T 1XTDA 3CCQT 3CCRT 2H3JA 3E19A 5CAIA 1I8FA 2FHDA 3M54A 2MF2A 4JLIA 5FU6C 2DZ9A 3PFSA 5LJ5j 1VQ9A 4JRKA 4QVZA 3CCMA 5DLOA 1I4K1 2E10A 2E5QA 3FJPA 3P8DA 2CGHA 4FT2A 5KE2A 1M90U 2RHXA 4XTYA 1N8RU 1D3BA 1TH7A 1XOVA 1YCYA 3OYYA 3Q1JA 1VQ4T 3NTIA 2JZ2A 3CCLA 5CQXA 3M5AA 3PIPA 1YITT 3DB3A 1JBMA 3CBPA 1VQNA 3P8BB 2D6FA 1OZ2A 3LW5E 3OBYA 4M78A 2R57A 1WGSA 1LOJA 4FIBA 2RA2A 4XTXA 3HFOA 4C8QA 5GAMf 2K5IA 4EDUA 3RKXA 4QVCA 1ZHIA 3PTAA 2QTXA 2JN0A 4II1A 5GAMg 2V8KA 3C95A 3QIIA 3G6ET 3SB2A 4BE0A 1OI1A 1S72T 1Y96A 3V7CA 1YJWT 2ZGWA 2QQAA 1QP3A 2EKOA 2FVUA 3V8JA 4BY6B 5GAMe 1XNIA 2KY9A 4J6WA 4A54A 3KUFA 3CC2T 1P92A 2MI6A 5HKCA 4KUIA 3GPLA 1VQ6A 2QDYB 4XK8E 1VQ8A 1X6OA 5CKFA 3KXTA 2RHZA 1Q86C 2Y4XA 3HKSA 2EFIA 4M75A 1SSFA 1EIFA 1BI0A 2NLUA 3JCMd 5GAMd 4DOVA 2EJGA 2K5FA 2ZPGB 2MWOA 4IUPA 2L3RA 4M7DE 2EQJA 3S3NA 2VGMA 3R6OA 4N0AC 4ZGEB 4N4GA 4HCZA 4BI8B 2V8JA 2OTJT 5GAN3 3CPFA 3FC3A 3AHUA 4B9WA 4B9XA 1VQOA 3QHSA 2L5QA 3CPWS 1OYXA 4A4HA 1VQPA 4D6WA 5GANh 4E7LA 5FROA 3RESA 3WVEB 4JUVA 2X4XA 4C92A 2XHCA 1Y07A 3OYBA 4XU3A 4XU2A 3X26B 5A0GA 3CMEA 5CKEA 4RMOA 2PVDB 3G4ST 2VUBA 4ELZC 5C0MA 3BY7A 4C92B 2O01E 3A8MB 3QG1A 5GAN2 3OYCA 3CCET 3EAEA 5GAN4 2IG0A 5L8RE 5CKHA 3S3OA 4ZTJA 5DLQE 1B34A 4C8QB 2K2VA 4LDWA 5LJ5e 3OYAA 5FRNA 3RMSA 3MP8A 1KHCA 4LDUA 3V8KA 3X25B 4F7UA 1Q81U 3UT1A 1Q81C 2DK3A 3QBYA 4FU6A 2RJEA 1YJ9A 1GXIE 2EJFA 2RI2A 1UGRB 5IT9E 1VQ5A 3BFMA 4NOYA 4JS4A 4QQGA 2HQXA 5KCHA 4BE2A 2EWNA 1KQ1A 3M58A 2E12A 2QA4A 1H3ZA 1LJOA 3J81E 4FSXA 5LJ3e 3MP1A 1OZ3A 2MWPA 5CIUA 1FWZA 1UEBA 1YJ9T 5EG2A 2LCCA 5D6XA 3OS2A 4KUDK 3LWHA 2QQ9A 2EIFA 3CD6A 2JTFA 3CXCS 4V2SA 4IURA 5GAOl 3BW1A 1M9SA 2DJZA 1YJNT 1K9MC 3QJYA 4JJNK 1Y7XA 4RCBA 2LC4A 4EMGA 5CO7A 3G4SA 3OQ5A 2JNGA 3X28B 3CCVA 3INZA 5GMKe 1YI2A 3EFSA 3M56A 1N9SA 4J83A 3CMAT 1YBYA 2EYQA 2XK0A 3OS0A 3RIRA 5C6SA 5HK3A 1JJ2S 1AHJB 1HK9A 3QSUA 3JB9G 2FL7A 1IZ6A 1VQMT 1K9MU 3CC7T 3HFNA 5DM7R 1U1SA 5LJ3g 3BDLA 2ZPBB 2G3RA 3MEWA 3JCMV 3CCUA 4L6V5 3I55A 2E6NA 4M77D 3FB9A 3OMGA 2K3XA 2RJCA 4PJOG 1VIEA 4XU1A 5FU6B 2M16A 4PJOD 5KCOA 3OW2A 2RI3A 2RJDA 4FL6A 5J3BA 1PSEA 3CC4A 1DJ7B 1V29B 3JRZA 1Q82C 4PJOE 3QZ9B 1LNXA 4LDYA 1RI0A 1WJRA 2GF7A 2KAFA 3TREA 5IN1A 3G71T 5LJ5g 3C94A 5GANj 4J8OA 1W2BS 2ZPFB 4MMKA 4KBMB 2L89A 3NFCA 4J7IA 3T9NA 2K3YA 5I21A 4PLLA 3CCRA 2VGNA 2ZPIB 3NTHA 3UWNA 4C8QF 4E7KA 3JCMb 3QYHB 1QW1A 4J7FA 3NTKA 1UB4A 1U1TA 3SWNC 5J39A 2QA4T 1QVGA 2RD1A 4HCCA 2JVVA 3OSSC 4IUUA 1O9SA 3CXCA 1KD1C 1K8AC 4C0FA 4C5HA 4PJOF 5LJ3f 3WVDB 3L2UA 3GOXA 1KC8C 3RUXA 4P5NA 3A8HB 2E41A 3JCMf 4A4EA 3JB9H 4C92E 1VQ6T 1R8OB 1KD1U 2QQSA 1I81A 2QQRA 5CKDA 5HY6A 2LT4A 4M7AF 2D9TA 4PLIA 4PL6A 4C8QE 1BYMA 2LTOA 2QXFA 2GFAA 3CD6T 1X75C 1YJWA 2HQEA 1JJ2A 2QEXT 1M1KC 2BIVA 3OYLA 2RHUA 4ZN1A 1K73C 1PSFA 2CS7A 5CCAA 1NE8A 2RK2A 1BI2A 2LDMA 1G3SA 2VYTA 3RKYA 4PJOC 4DA4A 4C8QD 3L1AA 4Y28E 1B34B 2VV5A 5GAOq 3CPWA 3CCST 5IAYA 3QZ5B 4O6JA 2KDSA 4BD3A 2GQVA 4HT9A 4M78C 4Q5WA 1UGPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P4T A;  2VV5 A;  2RH2 A;  3UDC A;  1VIE A;  3SFM A;  1VIF A;  2RK2 A;  3T9N A;  2RK1 A;  2GQV A;  2OAU A; 
#chains in the Genus database with same CATH topology
 4M75 B;  2HQH A;  1IRE B;  1ZSZ A;  1M2V B;  1HSQ A;  2AZV A;  3JCM c;  1K76 A;  1KK7 A;  1ZQ1 A;  4LD6 A;  3O5Z A;  4CRI A;  2J6O A;  5GMK l;  5GAN 6;  1NPR A;  4EMK C;  5KYX A;  2QEX A;  2DTH A;  3CCE A;  2RK1 A;  3MET A;  4XQ3 A;  5CKB A;  1M3A A;  3EHQ A;  2P0K A;  2LCL A;  1D0X A;  3EGX A;  4XU0 A;  4C92 F;  2F5K A;  4OB1 B;  1RAD B;  3CPW P;  1ZBJ A;  4R55 A;  2FB7 A;  2E6Z A;  3LWI A;  3C4S A;  3TSW A;  3AT1 B;  1GCQ C;  4FW1 A;  5AT1 B;  3JCM h;  1M90 R;  1W2B P;  3PVQ A;  4NL3 A;  1M8M A;  3OYM A;  2RN8 A;  2DL5 A;  4PKC C;  2L2P A;  1IHW A;  3VS0 A;  2RHY A;  1YI2 Q;  2YWW A;  3JB9 D;  2PZ1 A;  1KQS P;  5GMK i;  4OGC A;  2WAC A;  1YN8 A;  3SFM A;  4M77 F;  1BIB A;  1TXQ A;  2AKL A;  3GF5 A;  2JM8 A;  3HL8 A;  1JO8 A;  1ZLM A;  3EG9 A;  3VS4 A;  1MHN A;  1RAA B;  1SPK A;  1AT1 B;  2JOY A;  2I0N A;  1M27 C;  4B6M A;  1LVK A;  4ATO A;  4OMO A;  2HL3 A;  4C0D C;  4AFU C;  4F7U F;  4E7S A;  4JDS A;  3CQT A;  1ZBX A;  1H64 1;  4CC4 B;  5D6W A;  3ZEH A;  4MDW A;  3GNG A;  4BI3 A;  3OSV A;  1KFZ A;  4M77 A;  2ZPE B;  1YHQ Q;  2OX7 A;  1YHQ T;  5GMK m;  1Y96 B;  3TU4 K;  4PJO A;  2KK4 A;  5D6Y A;  1MGQ A;  1QVF S;  4CC3 A;  1YWO A;  3O8V A;  3JCM g;  2JM9 A;  2C0O A;  2F69 A;  4M7A C;  2DAQ A;  4EPC A;  1QP2 A;  3GP8 A;  3M57 A;  1N8R C;  4BDZ A;  2RM4 A;  3VYH B;  4M78 G;  4LDV A;  4M77 B;  1KSW A;  5AYF A;  3RMQ A;  3I5S A;  4LDX A;  1M5Q 1;  2YDL A;  2XU8 A;  4HKE A;  3DLM A;  1K73 U;  2X4W A;  1OV3 A;  3CC7 A;  1NLO C;  4M7D A;  1YIT Q;  4E7Z A;  1NPP A;  2ATC B;  5GAM j;  1D0Z A;  2F5T X;  1YI2 T;  1H8K A;  4IUV A;  2QI2 A;  4JRQ A;  3UDC A;  4QW2 A;  1I07 A;  2M9U A;  1TSF A;  3ZFJ A;  3U23 A;  1B07 A;  4Z02 A;  3HHT B;  4KH0 B;  3L2W A;  2DXT A;  3BE3 A;  2Y4Y A;  3VS2 A;  3RER A;  1UDL A;  1G8X A;  3CC7 Q;  1BCO A;  2DMO A;  3CCM T;  1UTI A;  2CZ0 B;  4TVR A;  4AFZ C;  4AG2 C;  4CC7 A;  2HKQ B;  4CI0 C;  1U8R A;  5LL6 S;  3HTR A;  2AHJ B;  2YLB A;  4RCC A;  4OB0 B;  3V8L A;  4DEX A;  3NPF A;  1TWB A;  4XTZ A;  3PMI A;  3ZBD A;  1VUB A;  3CCU T;  3HSB A;  4F7U E;  2O9V A;  4MZT A;  2D0Q B;  4A53 A;  4ZN3 A;  1M3C A;  1JJ2 P;  5A0L A;  2MK5 A;  5IH2 A;  3RKW A;  4M75 G;  3X24 B;  3LLR A;  3V7S A;  2BZX A;  2DIG A;  1F1B B;  2RB6 A;  4A63 B;  4M77 E;  4EMH A;  1AD5 A;  3QWX X;  1FXX A;  2EKH A;  2DXU A;  1UFF A;  2O88 A;  5KE3 A;  1S72 A;  1WIE A;  2OTL A;  3OB9 A;  2R58 A;  2YUN A;  4DBQ A;  2NUP A;  4M78 F;  1R0C B;  2PUK B;  3LGL A;  1VQN T;  2QYZ A;  3CBM A;  2EYW A;  4FYV B;  2ZCF B;  3CCV Q;  3FRN A;  1W4S A;  1MMG A;  4OGE A;  4BAC A;  5GAO n;  3QJ6 A;  1SF9 A;  2P0P A;  1M1G A;  1WHH A;  3I56 T;  1IGU A;  3E19 A;  1I8F A;  4J9B A;  2EYZ A;  2FHD A;  3M54 A;  5FU6 C;  2DZ9 A;  4ZNX A;  2LQW A;  1JQQ A;  5DLO A;  2E10 A;  2E5Q A;  3FJP A;  2CGH A;  2F2W A;  4FW2 A;  1XOV A;  1VQ4 T;  3NTI A;  3CCL A;  2EYY A;  3M5A A;  3PIP A;  1YIT T;  1WXB A;  2D6F A;  2YUO A;  2LP5 A;  1WGS A;  2RA2 A;  1RAG B;  4J9D A;  3CCR T;  1VQL Q;  2JN0 A;  3C95 A;  1UG1 A;  1I1J A;  1OI1 A;  2MIO A;  3EG0 A;  1Y96 A;  4LNP A;  3SB2 A;  1S72 T;  2QQA A;  1OOT A;  2EKO A;  2FVU A;  1KD1 R;  1P92 A;  1Y0M A;  2EGE A;  4XK8 E;  3KXT A;  2EFI A;  2KRM A;  5GAM d;  2K5F A;  2E4H A;  2ZPG B;  1X6B A;  2EQJ A;  4N4G A;  2V8J A;  3NMZ C;  5GAN 3;  3FC3 A;  3AHU A;  3RBB B;  2CH4 W;  6AT1 B;  2A28 A;  4A4H A;  4E7L A;  1K4U S;  2X4X A;  1R0B G;  2XHC A;  4XU3 A;  2PVD B;  1Q81 R;  4EIK A;  2QEX Q;  3A8M B;  5GAN 2;  3CCE T;  4PK4 A;  3OYA A;  2JS2 A;  3I55 Q;  1MND A;  3V8K A;  4F7U A;  3IQL A;  1Q81 C;  1X43 A;  2DIL A;  4FU6 A;  3RDV A;  3CME Q;  1PWT A;  3BFM A;  4NOY A;  1KIK A;  2HQX A;  1MMN A;  1H3Z A;  3M58 A;  1OX9 A;  2CP7 A;  5LJ3 e;  2ESW A;  3PVL A;  1OZ3 A;  5CIU A;  3EGU A;  1YJ9 T;  2LCC A;  3OS2 A;  4PFP A;  3CCQ Q;  4IUR A;  4FYW B;  3JV3 A;  3QJY A;  4EMG A;  1ZSZ C;  3INZ A;  1D1B A;  2DYB A;  1YI2 A;  1N9S A;  3TSZ A;  2EYQ A;  2MOX A;  1K0S A;  3QSU A;  1IZ6 A;  3CCL Q;  3CC7 T;  1OX8 A;  5DM7 R;  4HVW A;  3JCM V;  4L6V 5;  4M77 D;  3FB9 A;  3E2U A;  1QVG P;  4PJO G;  1VIE A;  4PJJ A;  1Z9Z A;  4J9C A;  4PJO D;  2DEU A;  1K8A R;  2RJD A;  4FL6 A;  4JZ4 A;  1Q82 C;  1LNX A;  2MCN A;  3G71 T;  1W2B S;  3TRE A;  3ULR B;  5LJ5 g;  2ZPF B;  4KBM B;  2L89 A;  3NFC A;  1K9A A;  3JCM b;  2DJQ A;  4J7F A;  1QW1 A;  5J39 A;  2A0F B;  2RD1 A;  1VQP Q;  3G6E Q;  4IUU A;  2CP3 A;  1PNJ A;  1FMW A;  3RUX A;  4A4E A;  1VQ6 T;  1M30 A;  1BBZ A;  1MMA A;  1SRM A;  2FZG B;  2GFA A;  1M1K C;  3OYL A;  4RTZ A;  4Y92 A;  3RKY A;  4DA4 A;  4Y28 E;  3CPW A;  1WZO A;  5IAY A;  4KGZ B;  1CSK A;  4Z89 A;  4M78 C;  4HT9 A;  2BE9 B;  4ESR A;  4MZM A;  3P8H A;  2HSP A;  3L2Q A;  2K57 A;  5KYW B;  7AT1 B;  2XI9 A;  5GJW B;  2FO0 A;  2X3X D;  3M53 A;  2KBT A;  2X4Y A;  2RH2 A;  2YRC A;  5GAM h;  1VIF A;  4ME7 A;  1GBQ A;  2LJ1 A;  1YNZ A;  3M0T A;  1RL2 A;  4IUQ A;  2ABL A;  2DM1 A;  1M90 C;  1Y71 A;  2A7Y A;  5GAO p;  1K73 R;  5LJ3 d;  2DTO A;  4FCY A;  2RO0 A;  1YJN Q;  1NEG A;  4X1V A;  5GAN e;  1X6G A;  2MAM A;  3A8G B;  1YIT A;  3CCL T;  2EGA A;  4E47 A;  3HRS A;  1M8V A;  4MZP A;  1MUZ A;  2QG9 B;  3A5Z B;  2DNU A;  5CR2 A;  4JRP A;  1FX7 A;  4RTV A;  2DA9 A;  2W0Z A;  1SEM A;  5LJ5 d;  4C92 D;  4OMM A;  2E64 A;  4GY5 A;  4JZ3 A;  2KMT A;  2IPO B;  1AOJ A;  1FMK A;  2DTI A;  2DRK A;  3M4Y A;  3QPH A;  1X2K A;  2CDT A;  4R56 A;  2KRN A;  4HT8 A;  2GFU A;  5GAN 7;  4C0D B;  4RTT A;  3EG1 A;  3CCS A;  1D1C A;  1FYN A;  3RR6 A;  1PKS A;  2CUD A;  4M7A E;  2MPX C;  1YJN A;  4RG2 A;  2DX1 A;  4M7A D;  4YTL A;  5GAN 5;  2I2L A;  2KE9 A;  4M75 E;  4KRT A;  4OB3 B;  4J6Y A;  5GAN g;  1T0H A;  1VQM Q;  3SWN B;  2DKG A;  2DD5 A;  2FPD A;  2BZY A;  1VQL T;  2QQB A;  1QLY A;  3FDR A;  1KG1 A;  3PMT A;  4JJC A;  4NS5 A;  4M78 E;  2AKK A;  3QYG B;  3CC4 T;  2XDB A;  4JLG A;  4D8D A;  2HD0 A;  1VQK T;  4OMQ A;  1GFC A;  2XG8 D;  2GQI A;  4ZTF A;  2SEM A;  5CVI A;  1H3H A;  1QVP A;  1SRL A;  2JT4 A;  3MEU A;  1UUE A;  1ABO A;  2PNI A;  1YIJ A;  1NG2 A;  4KGX B;  4C5I A;  4F04 B;  1HD3 A;  3MEA A;  1WYX A;  2WSF E;  2QK0 A;  1O75 A;  3BDU A;  3CCV T;  1YJ9 Q;  4BB7 A;  1VQ8 T;  3OS5 A;  1PHT A;  2LJ3 A;  1G83 A;  1D3B B;  2KGT A;  3JB9 F;  1BK2 A;  4FM4 B;  1IRX A;  2DBM A;  5GAO r;  1RAH B;  4KUL A;  1K9M R;  3M9Q A;  2JTM A;  1LCK A;  1NJI U;  1RLP C;  2RQW A;  1KQ2 A;  4M77 C;  1RUW A;  1WHM A;  1T0J A;  4M7D C;  2KI7 A;  1KQS A;  1X01 A;  2QAZ A;  4KH1 B;  2E3H A;  4JS5 A;  2LNV A;  3E9G A;  5FU7 B;  2VXF A;  2XDD A;  4BDY A;  2DIQ A;  1EFN A;  1QCO A;  4JJB A;  3EFR A;  1VQ7 T;  1VYT A;  2ZPH B;  1SKU B;  2KQW A;  3WXM B;  3R6N A;  4QVD A;  1WQW A;  3M0R A;  1VYU A;  5A0D A;  1PD1 A;  3CME T;  1WLP B;  3SD4 A;  4C8Q G;  4ZGJ B;  3E1S A;  2K7A A;  4EMK B;  2PU9 B;  9ATC B;  1Z9Q A;  4XTU A;  2VAS A;  4F16 A;  2DEQ A;  5LJ3 h;  3LYI A;  2LQK A;  2CZ6 B;  2X9H A;  2DO3 A;  1K1Z A;  1VQ4 Q;  2DER A;  1TS9 A;  4M77 G;  4M78 B;  3VRZ A;  1MV3 A;  1BI1 A;  5I2M A;  3SDZ A;  3VV0 A;  3CCR Q;  4PJO B;  3A8O B;  5FLX E;  3CC2 A;  1Q7Y U;  2Y90 A;  3OY9 A;  2MMP A;  2R5M A;  3GNF B;  3OW2 S;  4E7H A;  5EC7 A;  5KYY A;  3VS6 A;  3JB9 J;  4J5Y A;  2LNH B;  4KT0 E;  3OYN A;  1ZSG A;  2FPE A;  3N5B B;  2ROL A;  1WJQ A;  3JCM W;  3JCM P;  3UAT A;  1B7T A;  2XID A;  1Q7Y C;  4RTW A;  2K3B A;  2EAY A;  4N4I A;  2RPN A;  3DKM A;  2FPF A;  2M0O A;  4RUG A;  1UJY A;  5KYX B;  1WFW A;  1SSH A;  3ER0 A;  3OA6 A;  1N8R R;  2NUT A;  3CCQ T;  4JPB W;  2H3J A;  2CSQ A;  4JLI A;  1VQ9 A;  2J6K A;  4QVZ A;  1I4K 1;  2IIM A;  4XTY A;  1D3B A;  1TH7 A;  1YCY A;  3OYY A;  1M1K R;  2RNA A;  2JZ2 A;  2E5K A;  2HMA A;  5GAM f;  3PTA A;  2GNC A;  1W70 A;  2QTX A;  4II1 A;  2V8K A;  2D8H A;  3QII A;  4BE0 A;  1YJW T;  3V8J A;  4BY6 B;  4J6W A;  2VWF A;  2QAS A;  2QDY B;  1ARK A;  1VQ8 A;  2QTV A;  4M75 A;  1Q82 R;  2GGR A;  3MPU B;  2NLU A;  2MWO A;  4M7D E;  2VGM A;  3R6O A;  1H92 A;  1N5Z A;  4BI8 B;  1UJ0 A;  1VA7 A;  3C0C A;  1GRI A;  4B9W A;  1VQO A;  1R77 A;  2KRO A;  2L5Q A;  1OYX A;  1VQP A;  4D6W A;  1FMV A;  5GAN h;  1V76 A;  3RES A;  2F2V A;  5D7U A;  2X3W D;  4LXC A;  2EBP A;  5CKE A;  3A1P A;  3G4S T;  5C0M A;  3H41 A;  4ELZ C;  1Q86 R;  3CD6 Q;  1WHJ A;  2FEI A;  2IG0 A;  1U5S A;  2RF0 A;  5FRN A;  5KYU A;  3X25 B;  1QMC A;  1T3L A;  2EJF A;  2COZ A;  2RI2 A;  1UGR B;  1VQ5 A;  5KCH A;  2COY A;  1KQ1 A;  3I9Q A;  3MP1 A;  1VOM A;  1QKW A;  1B3Q A;  3CCM Q;  1FWZ A;  1UGV A;  5EG2 A;  3LWH A;  2KYB A;  2P84 A;  3CD6 A;  4V2S A;  3CXC S;  3EH1 A;  5GAO l;  3I56 Q;  4K11 A;  1YJN T;  2EPD A;  4JJN K;  2KRS A;  4RCB A;  3OQ5 A;  1QKX A;  1RAC B;  3TVT A;  5GMK e;  1SHG A;  4J83 A;  1YBY A;  2XK0 A;  1IXD A;  1AHJ B;  2NYS A;  1HK9 A;  2HBW A;  3JB9 G;  2FL7 A;  2A36 A;  1VQM T;  1K9M U;  3MKD A;  3M0U A;  1WDX A;  3MEW A;  3CCU A;  1X69 A;  2E6N A;  2K3X A;  1T3S A;  4XU1 A;  5FU6 B;  2M16 A;  4Z88 A;  1PSE A;  1EZZ B;  2HL5 C;  1RI0 A;  2GF7 A;  5IN1 A;  3C94 A;  1XJW B;  2K3Y A;  4PLL A;  2NUP B;  2VKN A;  3UWN A;  4C8Q F;  2QA4 T;  1I5O B;  2JVV A;  1K0X A;  2V1R A;  1K8A C;  3MJX A;  2OJ2 A;  5LJ3 f;  2DFU A;  4PJO F;  3L2U A;  1VQ6 Q;  2QQS A;  2ED0 A;  2QQR A;  2LT4 A;  1RLQ C;  3EG9 B;  1CKA A;  1X75 C;  1YJW A;  3GBQ A;  2BIV A;  1K73 C;  1PSF A;  2L3Q A;  2RK2 A;  1BI2 A;  2LDM A;  4PJO C;  2BTT A;  4O6J A;  4AFS C;  2KDS A;  4F17 A;  2NWM A;  2GQV A;  2DRM A;  2E65 A;  2YUQ A;  3OYF A;  2QA4 Q;  1M4Z A;  2V26 A;  2OTJ A;  2DVE A;  5GAO m;  2H3E B;  2LMJ A;  3QDF A;  2RQT A;  5IXF A;  2DL4 A;  2M02 A;  2JTE A;  2VVK A;  1VQ5 Q;  4HA8 A;  4A4G A;  3L2R A;  2WSC E;  2R5A A;  2L3S A;  4E6R A;  3DLL A;  2JUF A;  3OYE A;  4PFO A;  5IHN A;  4AMC A;  3OYH A;  3GIB A;  1UEC A;  2JMA A;  1UHF A;  3MEV A;  2EQK A;  2X35 A;  2XIC A;  4BI4 A;  2M0Y A;  3ME9 A;  4J9G A;  1KC8 U;  2YLC A;  3G71 A;  1YHQ A;  1HXD A;  2X51 A;  3VKI A;  3J7A F;  1PRM C;  3D7S B;  1KQS S;  3CCJ Q;  4UC4 A;  3M59 A;  4X9D A;  3PE0 A;  3TEE A;  2OI3 A;  3CEY A;  2DLP A;  1YP5 A;  4O5V A;  4FYY B;  2ZAE A;  1ZA2 B;  1BB9 A;  3MO8 A;  1VYV A;  3QKJ A;  1NLP C;  5GMK h;  2O4X A;  2HZY A;  3L42 A;  3DB4 A;  4DEY A;  4M75 C;  1VQ7 Q;  3VYG A;  2DXB A;  5LJ3 j;  1BIA A;  4D8K A;  2KSS A;  3H8Z A;  1YFN A;  3RNJ A;  1BI3 A;  1W2B A;  2ENM A;  1D0Y A;  1RI9 A;  3VUB A;  4BE1 A;  2CZ1 B;  1A0N B;  1UE9 A;  1WXU A;  4EMK A;  3G4S Q;  3EGD B;  2GTJ A;  3OMC A;  1Q86 U;  1QWF A;  4X34 A;  3CCS Q;  1ZX6 A;  3C12 A;  1QWE A;  3EG2 A;  4RTU A;  4R0K A;  2KVQ G;  2JS0 A;  1AZG B;  2O31 A;  4ZGD B;  2CSI A;  5HK0 A;  4J9H A;  3HRT A;  1I0C A;  3S6W A;  2KR3 A;  1VQ8 Q;  1N9R A;  2DVJ A;  2WSE E;  5FU7 C;  1GCQ A;  4AT1 B;  2P0Q A;  4F14 A;  2YHT A;  1TUG B;  4HCB A;  3CCJ T;  1ZA1 B;  3REB B;  2EQU A;  2H8H A;  4C5E A;  3G71 Q;  1ZUK A;  2KXC A;  1NYG A;  5DY9 A;  2LCS A;  4GLK A;  4PJN A;  1TTH B;  2KT8 A;  3S3M A;  1ZUU A;  5GAN f;  1VQM A;  2KEA A;  2LZ6 B;  2CZ7 B;  8ATC B;  4C0Z A;  2IVW A;  3M0S A;  2DYI A;  4M7D D;  2VC8 A;  4OP0 A;  4LN2 A;  3CMA A;  4M75 F;  1IB8 A;  4OMF B;  3M0P A;  3MHX A;  1VQK A;  1NM7 A;  3JCM Q;  1Y57 A;  2K9G A;  4RG8 A;  3CBO A;  1JRI A;  2X4J A;  2YRV A;  1NEB A;  1VQL A;  4PFZ A;  3M4G A;  3OYG A;  3FIF A;  4GLM A;  2COW A;  2AIR B;  3QUI A;  4E7I A;  1VQ4 A;  1V1C A;  4MDX A;  1D1A A;  1RAI B;  4M7A B;  3JCM e;  2F2X A;  3J80 E;  1BKB A;  1G5V A;  3PT9 A;  2A3L A;  3CC2 Q;  3A8L B;  5LJ5 h;  3LX7 A;  1AZE A;  1PM3 A;  3I56 A;  1YJW Q;  5KYU B;  3VS1 A;  1IGQ A;  3UA6 A;  2BKD N;  2AK5 A;  2E1H A;  5CQY A;  2A37 A;  3SWN A;  3QWY A;  4QKU A;  4OMP A;  1LPL A;  1VQP T;  3V7R A;  3M55 A;  2RQU A;  1X2Q A;  2DF6 A;  4MML A;  2DE0 X;  3G7Z A;  1C0M A;  4BUG A;  2L8D A;  2OTL T;  1WNL A;  3HRU A;  4XTW A;  5I2S A;  3CCJ A;  5FRM A;  4BY6 C;  2YT6 A;  4Z8A A;  2ROT A;  3UF4 A;  1M1F A;  1NJI C;  3X20 B;  1M3B A;  1XQH A;  2DD4 A;  3NGP A;  3VRY A;  1PG5 B;  4QQD A;  2EVR A;  3TCJ A;  2DL7 A;  2FRW A;  4PJL A;  4J9I A;  4NL2 A;  1PCX A;  1WJS A;  4M7A G;  3QDR B;  3QO3 A;  1AVZ C;  3HPW A;  3OYJ A;  3CCQ A;  2E3I A;  1XTD A;  2O2O A;  5CAI A;  2MF2 A;  3PFS A;  5LJ5 j;  4JRK A;  1MMD A;  1QVF P;  3CCM A;  3P8D A;  3CMA Q;  2RHX A;  3Q1J A;  1JEG A;  5CQX A;  2J05 A;  1JBM A;  3CBP A;  3P8B B;  1OZ2 A;  3LW5 E;  4IIO A;  4M78 A;  3CC4 Q;  1LOJ A;  5IT9 E;  3JCM J;  4EDU A;  1MV0 B;  2JXB A;  1JXO A;  4QT7 A;  1GCP A;  2SRC A;  3V7C A;  1BCM A;  1PRL C;  5GAM e;  2KY9 A;  4J9F A;  3CC2 T;  2MI6 A;  5HKC A;  5FWC A;  1VQ6 A;  2L3P A;  4RTX A;  4DOV A;  2EJG A;  2L3R A;  4RTY A;  3KFV A;  3OW2 P;  3S3N A;  1GL5 A;  3CPF A;  4DBH A;  3QHS A;  4WTO B;  5FRO A;  3WVE B;  4JUV A;  4C92 A;  3OYB A;  5A0G A;  3X26 B;  3CME A;  2VUB A;  2O01 E;  3QG1 A;  1EX4 A;  3EAE A;  5GAN 4;  5L8R E;  3S3O A;  1RAB B;  2DBK A;  2J7I A;  5DLQ E;  4C8Q B;  1WHG A;  2NUZ A;  3MP8 A;  1Q81 U;  3QBY A;  2RJE A;  2D8J A;  4QQG A;  2DL8 A;  1AWJ A;  2AT1 B;  2EWN A;  1LJO A;  3J81 E;  2NUT B;  1RAF B;  5D6X A;  1VQK Q;  4LUD A;  1J3T A;  3BW1 A;  1NBE B;  2DJZ A;  1K9M C;  2LC4 A;  2A08 A;  5CO7 A;  3G4S A;  2JNG A;  3X28 B;  3CCV A;  2ED1 A;  3CMA T;  3RIR A;  5HK3 A;  1X27 A;  1YWP A;  4KGV B;  3HFN A;  1U1S A;  5LJ3 g;  2G3R A;  2C0I A;  2C0T A;  1RAE B;  3EH2 A;  3OMG A;  1M2V A;  2RJC A;  5KCO A;  2GBQ A;  2JJ9 A;  2RI3 A;  3CC4 A;  1WA7 A;  1PD0 A;  1DJ7 B;  1V29 B;  4IIM A;  4LDY A;  1WJR A;  5GAN j;  2CUB A;  4J8O A;  4J7I A;  2KYM A;  2VGN A;  4E7K A;  2HCK A;  3NTK A;  1YIJ Q;  4HCC A;  1QVG A;  3OSS C;  1O9S A;  3H9N A;  1Q95 G;  1KD1 C;  4C0F A;  4C5H A;  1KC8 C;  4DBR A;  1R8O B;  1KD1 U;  2YRD A;  5CKD A;  4PLI A;  3H0I A;  2QXF A;  3CD6 T;  2HQE A;  2QEX T;  4ZN1 A;  1QCF A;  2CS7 A;  1NE8 A;  4FYX B;  4FSS A;  5KYN A;  3TQ7 P;  1AWO A;  4C8Q D;  3L1A A;  4E2F B;  3CCS T;  4BD3 A;  1KHI A;  1OEB A;  4Q5W A;  3OYI A;  1G3T A;  2CH4 A;  3MCA B;  4J9E A;  2CYZ B;  1WHK A;  1OUL A;  5GAN d;  2QGG A;  1I5L A;  1TOV A;  5IXB A;  4HCK A;  2KNB B;  4QQ6 A;  3URG A;  5I22 A;  1E7O A;  1QVG S;  1ACM B;  4M7D G;  1UHC A;  1WXT A;  3I5R A;  2HDA A;  1WI7 A;  1VQO T;  3JSC A;  2D1X A;  3EFO B;  2M1H A;  4M7D F;  4FT4 A;  4M75 D;  2PQW A;  2LT1 A;  3QXE B;  5M9O A;  4PJM A;  4F7U G;  2ECZ A;  2V8I A;  2JMC A;  1KJW A;  4C8Q C;  1ZUY A;  3VS7 A;  3FJ5 A;  2XMF A;  1TUC A;  4C92 C;  5FWB A;  4OML A;  2J6F A;  4JRI A;  4HXJ A;  2FYK A;  4N0A A;  3I55 T;  3L2Z A;  1ZSZ B;  2FG0 A;  2OAU A;  2K5L A;  2DPP B;  4ELY C;  4L5G A;  4OF1 A;  2E70 A;  4L59 A;  3OYK A;  4DQ2 A;  5KYW A;  4XAX B;  1JU5 C;  1NYF A;  2LJ0 A;  2CP6 A;  3JB9 I;  1PKT A;  1E6G A;  4M7A A;  3OBW A;  2RI5 A;  8AT1 B;  1Q7Y R;  2VXE A;  1SG5 A;  3VUZ A;  3EHR A;  3HP9 A;  4N4H A;  1WQ7 A;  2RMO A;  4E7J A;  1YCS B;  2XKO C;  4C92 G;  2L0A A;  4X9C A;  1IO6 A;  2YSQ A;  3PNW C;  1C6V X;  2HEQ A;  3H6Z A;  2K4Y A;  4JJD A;  3EG3 A;  4A4F A;  2CP2 A;  4F7U B;  2XDP A;  2FRY A;  3JAM E;  3CXC P;  2P4R A;  4VUB A;  2LX9 A;  2EJ9 A;  3LGF A;  1JB0 E;  3LH5 A;  1AEY A;  3ASK A;  4C5G A;  3M0Q A;  1UGS B;  5CK9 A;  1QQJ A;  4M7D B;  3FLG A;  4LE9 A;  1S72 Q;  2LRQ A;  4LD9 K;  5L23 A;  2DL3 A;  1GFD A;  2GCX A;  1OU9 A;  2JW4 A;  1ABQ A;  1G3Y A;  2QDL A;  5KYY B;  4IUT A;  1TUD A;  1M1K U;  3OS1 A;  2EW3 A;  2HNI A;  2Z0W A;  2RJF A;  1UGQ B;  2DZC A;  3JCM X;  4WCI A;  2V1Q A;  3PIO A;  3CCE Q;  5GMK j;  1VQ7 A;  2CP5 A;  1OU8 A;  2MYS A;  3H0F A;  3G6E A;  3L2V A;  2BUD A;  5FW9 A;  5KH6 A;  2LX7 A;  3VJP A;  1QCN A;  1NZ9 A;  3VS5 A;  5J26 A;  2G6F X;  5IHK A;  1Q82 U;  1WHL A;  5ECA A;  1VQ5 T;  2PVO B;  2BZ8 A;  3OYD A;  3UA7 A;  1WPY A;  4PNO A;  1BU1 A;  4C0G A;  2DXC A;  1W1F A;  4OMN A;  1N6A A;  2RHI A;  2AZS A;  3GLX A;  4ORZ A;  4A4K A;  2C06 A;  2BE7 D;  2XD0 A;  4ANJ A;  3ZL7 C;  3KBG A;  2HBP A;  1D09 B;  4WF2 A;  4OVA A;  2O4X B;  3A98 A;  2LVM A;  4DOW A;  1YIJ T;  2GTO A;  5A2Q E;  5GJV B;  3FEO A;  5IHI A;  4M78 D;  1OPL A;  4J6X A;  2M51 A;  1HYO A;  4RKU E;  3MP6 A;  5GAN 8;  4Y91 A;  1MNE A;  1K8A U;  2LQ8 A;  3VU3 C;  2RQR A;  3PGG A;  4HVV A;  1N27 A;  2B8A A;  1QVF A;  2FZC B;  3EGD A;  4XTV A;  3LH0 A;  5LJ5 f;  1GBR A;  3UPU A;  2HAX A;  2EQM A;  2P4T A;  4CC2 A;  1G3W A;  1VQN Q;  2CKK A;  2PTK A;  2ZZD A;  3E9F A;  3F70 A;  1VQ9 T;  2HKN A;  2PVG B;  4IKF A;  2PUO B;  3G1J A;  4OB2 B;  2LQN A;  4AG1 C;  3NHN A;  4FT2 A;  1M90 U;  5KE2 A;  1N8R U;  1HJD A;  2B86 A;  4DBF A;  3DB3 A;  1JXM A;  1VQN A;  3OBY A;  5HCK A;  2KXD A;  2R57 A;  4FIB A;  4XTX A;  3HFO A;  4C8Q A;  3H0H A;  2K5I A;  4QVC A;  3RKX A;  1ZHI A;  5GAM g;  3G6E T;  1C1A A;  2ZGW A;  1QP3 A;  1CKB A;  1XNI A;  4A54 A;  3KUF A;  3EGX B;  2CRE A;  2FZK B;  4KUI A;  3GPL A;  1TU0 B;  2F1L A;  1X6O A;  2K6D A;  5CKF A;  2RHZ A;  1Q86 C;  2Y4X A;  2W10 A;  3HKS A;  2K79 A;  1SSF A;  1EIF A;  1BI0 A;  1WX6 A;  3JCM d;  4IUP A;  4N0A C;  4ZGE B;  2D0N A;  2OTJ T;  4HCZ A;  4B9X A;  3CPW S;  2K2M A;  2OTL Q;  1Y07 A;  1PC0 A;  4XU2 A;  1SHF A;  4RMO A;  1AWX A;  3BY7 A;  4C92 B;  3OYC A;  4GBQ A;  4ZTJ A;  5CKH A;  1B34 A;  2K2V A;  4LDW A;  5LJ5 e;  3RMS A;  4AFQ C;  2YXY A;  4LDU A;  1KHC A;  3EFO A;  3UT1 A;  2CP0 A;  2DK3 A;  2EGC A;  1YJ9 A;  1GXI E;  2VB6 A;  2DET A;  1U3O A;  2O9S A;  4JS4 A;  4BE2 A;  1OPK A;  2QA4 A;  2E12 A;  3SEM A;  4FSX A;  1E6H A;  2MWP A;  1UEB A;  4M4Z A;  1U06 A;  1AWW A;  4KUD K;  4LUE A;  2QQ9 A;  1KC8 R;  2EIF A;  2JTF A;  1G2B A;  1M9S A;  1VQO Q;  5I11 A;  3I35 A;  1Y7X A;  2RQV A;  1M2O A;  2OAW A;  3EFS A;  3M56 A;  3OS0 A;  5C6S A;  1JJ2 S;  3THK A;  3BDL A;  2ZPB B;  3I55 A;  1VQ9 Q;  1W6X A;  1TG0 A;  2CT4 A;  1OQK A;  3OW2 A;  2EYX A;  5J3B A;  2J06 A;  3JRZ A;  1IHV A;  4PJO E;  3QZ9 B;  2KAF A;  4MMK A;  3T9N A;  2EQI A;  2KT1 A;  5I21 A;  3CCR A;  2ZPI B;  3NTH A;  3QYH B;  3VS3 A;  2HSE B;  1UB4 A;  1U1T A;  3SWN C;  2OTJ Q;  3CXC A;  3REA B;  3WVD B;  3GOX A;  4P5N A;  3A8H B;  2E41 A;  3JCM f;  3JB9 H;  4C92 E;  1I81 A;  5HY6 A;  4M7A F;  2D9T A;  4PL6 A;  4C8Q E;  1BYM A;  2LTO A;  1JJ2 A;  2RHU A;  3SHW A;  5CCA A;  2YUP A;  3CCU Q;  1G3S A;  1S1N A;  2VYT A;  1B34 B;  2VV5 A;  4HVU A;  5GAO q;  1NJI R;  2QGF B;  3QZ5 B;  2CT3 A;  1UGP B; 
#chains in the Genus database with same CATH homology
 4M75 B;  3OYI A;  1IRE B;  4MZM A;  1G3T A;  3P8H A;  2E65 A;  3OYF A;  3L2Q A;  2K57 A;  1M4Z A;  2XI9 A;  3MCA B;  2OTJ A;  2CYZ B;  5GAN d;  3JCM c;  2DVE A;  1ZQ1 A;  5GAO m;  4LD6 A;  5GMK l;  4CRI A;  5GAN 6;  1I5L A;  1NPR A;  3M53 A;  4EMK C;  2X4Y A;  2RH2 A;  5GAM h;  1VIF A;  4ME7 A;  4QQ6 A;  2QEX A;  2DTH A;  3CCE A;  2RK1 A;  3URG A;  4HA8 A;  4A4G A;  3MET A;  4XQ3 A;  5CKB A;  1RL2 A;  3L2R A;  4IUQ A;  2WSC E;  2R5A A;  1QVG S;  2P0K A;  1M90 C;  3DLL A;  1Y71 A;  2A7Y A;  2LCL A;  2JUF A;  5GAO p;  4M7D G;  3OYE A;  4XU0 A;  5LJ3 d;  2F5K A;  4C92 F;  2DTO A;  2RO0 A;  4OB1 B;  3OYH A;  1VQO T;  3JSC A;  3GIB A;  4R55 A;  2FB7 A;  2E6Z A;  2M1H A;  3C4S A;  3MEV A;  3LWI A;  4M7D F;  5GAN e;  2EQK A;  4FT4 A;  2MAM A;  3A8G B;  3JCM h;  4M75 D;  2X35 A;  2PQW A;  2LT1 A;  3QXE B;  1YIT A;  5M9O A;  4NL3 A;  2XIC A;  4BI4 A;  3OYM A;  3CCL T;  3ME9 A;  4PKC C;  4E47 A;  4F7U G;  2V8I A;  1KC8 U;  2YLC A;  3HRS A;  1M8V A;  2RHY A;  4MZP A;  3A5Z B;  3G71 A;  3JB9 D;  1YHQ A;  1HXD A;  5GMK i;  3VKI A;  5CR2 A;  3J7A F;  4JRP A;  4OGC A;  1FX7 A;  4C8Q C;  2WAC A;  3SFM A;  1KQS S;  4M77 F;  4UC4 A;  5LJ5 d;  3M59 A;  4X9D A;  1BIB A;  4C92 C;  3GF5 A;  4C92 D;  3TEE A;  3HL8 A;  3CEY A;  2E64 A;  4JRI A;  2FYK A;  4N0A A;  4O5V A;  4GY5 A;  3I55 T;  2KMT A;  3L2Z A;  1MHN A;  3MO8 A;  2DTI A;  3QKJ A;  2OAU A;  5GMK h;  2K5L A;  2O4X A;  3M4Y A;  2DPP B;  3QPH A;  4ELY C;  3L42 A;  4L5G A;  4R56 A;  3DB4 A;  4HT8 A;  4M75 C;  4OF1 A;  2E70 A;  4L59 A;  3VYG A;  2GFU A;  3OYK A;  2DXB A;  2JOY A;  5GAN 7;  5LJ3 j;  4C0D B;  1BIA A;  4DQ2 A;  3CCS A;  2KSS A;  4XAX B;  3H8Z A;  4ATO A;  1BI3 A;  4M7A E;  4C0D C;  1W2B A;  1YJN A;  4F7U F;  3VUB A;  4BE1 A;  4JDS A;  3JB9 I;  1ZBX A;  4RG2 A;  1H64 1;  1KHI A;  2CZ1 B;  5D6W A;  3ZEH A;  3OBW A;  4M7A A;  4M7A D;  4MDW A;  2RI5 A;  3GNG A;  4BI3 A;  4EMK A;  2VXE A;  3OSV A;  4YTL A;  3VUZ A;  3OMC A;  1Q86 U;  5GAN 5;  4X34 A;  2I2L A;  4M77 A;  2ZPE B;  3HP9 A;  4N4H A;  3C12 A;  4M75 E;  4OB3 B;  1WQ7 A;  4J6Y A;  4E7J A;  1YHQ T;  5GAN g;  2XKO C;  2KVQ G;  4C92 G;  5GMK m;  1Y96 B;  4X9C A;  4ZGD B;  3TU4 K;  4PJO A;  2KK4 A;  5D6Y A;  1MGQ A;  3SWN B;  5HK0 A;  1QVF S;  3PNW C;  2DKG A;  2DD5 A;  3HRT A;  3H6Z A;  2K4Y A;  3S6W A;  4A4F A;  3O8V A;  4F7U B;  1VQL T;  2QQB A;  3JCM g;  1N9R A;  2XDP A;  3FDR A;  1KG1 A;  3PMT A;  2F69 A;  2WSE E;  3JAM E;  4NS5 A;  4M78 E;  5FU7 C;  4VUB A;  3QYG B;  2P0Q A;  2DAQ A;  2LX9 A;  4M7A C;  2EJ9 A;  3LGF A;  3CC4 T;  2YHT A;  4EPC A;  1JB0 E;  3JCM J;  2XDB A;  1QP2 A;  3GP8 A;  4JLG A;  4HCB A;  2HD0 A;  3CCJ T;  3ASK A;  4C5G A;  3M57 A;  1N8R C;  4BDZ A;  1VQK T;  1UGS B;  2RM4 A;  5CK9 A;  3VYH B;  4M78 G;  3FLG A;  4LDV A;  2XG8 D;  4M77 B;  4M7D B;  4ZTF A;  5AYF A;  2EQU A;  5CVI A;  4C5E A;  2LRQ A;  4LD9 K;  3RMQ A;  5DY9 A;  1QVP A;  2GCX A;  4GLK A;  3S3M A;  3MEU A;  4LDX A;  1G3Y A;  5GAN f;  1M5Q 1;  2XU8 A;  4HKE A;  1VQM A;  3DLM A;  2CZ7 B;  4C5I A;  2X4W A;  1YIJ A;  1K73 U;  4C0Z A;  4IUT A;  3CC7 A;  2IVW A;  1M1K U;  3MEA A;  3OS1 A;  4M7D A;  2WSF E;  4M7D D;  1O75 A;  2VC8 A;  1NPP A;  4OP0 A;  2HNI A;  2RJF A;  3BDU A;  1UGQ B;  2DZC A;  5GAM j;  4M75 F;  3CMA A;  3CCV T;  2F5T X;  4BB7 A;  3JCM X;  1YI2 T;  1VQ8 T;  4OMF B;  3OS5 A;  4IUV A;  2QI2 A;  1D3B B;  3MHX A;  1VQK A;  4JRQ A;  3PIO A;  3UDC A;  4QW2 A;  3JCM Q;  2M9U A;  3JB9 F;  4RG8 A;  3CBO A;  4FM4 B;  1JRI A;  5GMK j;  1VQ7 A;  3G6E A;  3ZFJ A;  2X4J A;  2YRV A;  5GAO r;  3L2V A;  2BUD A;  4KUL A;  3M9Q A;  2JTM A;  4Z02 A;  5KH6 A;  3HHT B;  3M4G A;  3VJP A;  1NJI U;  3OYG A;  1VQL A;  3FIF A;  3L2W A;  1KQ2 A;  4M77 C;  1NZ9 A;  2DXT A;  5J26 A;  4M7D C;  1Q82 U;  2Y4Y A;  3QUI A;  4E7I A;  1KQS A;  1X01 A;  1VQ4 A;  3RER A;  4MDX A;  4JS5 A;  1VQ5 T;  2LNV A;  3E9G A;  5FU7 B;  4M7A B;  2PVO B;  3JCM e;  3J80 E;  2VXF A;  2XDD A;  1BKB A;  3CCM T;  4BDY A;  1G5V A;  2DIQ A;  3PT9 A;  3OYD A;  2CZ0 B;  2A3L A;  1WPY A;  4PNO A;  4TVR A;  4C0G A;  2DXC A;  3EFR A;  1VQ7 T;  3A8L B;  1N6A A;  2ZPH B;  2RHI A;  5LJ5 h;  3LX7 A;  3WXM B;  2KQW A;  4QVD A;  3I56 A;  3GLX A;  1WQW A;  4A4K A;  5A0D A;  2C06 A;  4CI0 C;  1U8R A;  2XD0 A;  3CME T;  5LL6 S;  3SD4 A;  2BKD N;  4C8Q G;  4ZGJ B;  3KBG A;  2HBP A;  3E1S A;  2E1H A;  5CQY A;  2AHJ B;  2YLB A;  2PU9 B;  4RCC A;  4WF2 A;  3SWN A;  4OVA A;  4EMK B;  2O4X B;  4OB0 B;  3V8L A;  4XTU A;  4XTZ A;  3PMI A;  1VQP T;  3ZBD A;  2LVM A;  1VUB A;  4DOW A;  3CCU T;  3V7R A;  3M55 A;  3HSB A;  2DEQ A;  1YIJ T;  3LYI A;  5LJ3 h;  4F7U E;  2LQK A;  4MML A;  2CZ6 B;  4MZT A;  5A2Q E;  2DO3 A;  3G7Z A;  3FEO A;  2D0Q B;  4A53 A;  4ZN3 A;  4M78 D;  4J6X A;  4M77 G;  4M78 B;  5A0L A;  4BUG A;  4RKU E;  3MP6 A;  1BI1 A;  5GAN 8;  2L8D A;  2OTL T;  5I2M A;  4Y91 A;  3RKW A;  4M75 G;  3X24 B;  3LLR A;  3V7S A;  1WNL A;  3SDZ A;  3HRU A;  3VV0 A;  2DIG A;  4XTW A;  4PJO B;  3A8O B;  5I2S A;  5FLX E;  3CCJ A;  2RB6 A;  3CC2 A;  1Q7Y U;  5FRM A;  1K8A U;  4M77 E;  2LQ8 A;  2Y90 A;  3PGG A;  3VU3 C;  4BY6 C;  4EMH A;  1N27 A;  3OY9 A;  2MMP A;  2R5M A;  3GNF B;  1FXX A;  1M1F A;  2B8A A;  2DXU A;  3OW2 S;  1QVF A;  4E7H A;  4XTV A;  5LJ5 f;  3LH0 A;  1NJI C;  5KE3 A;  1S72 A;  3X20 B;  3JB9 J;  1XQH A;  2DD4 A;  2OTL A;  3UPU A;  3OB9 A;  4J5Y A;  2HAX A;  4KT0 E;  3OYN A;  4QQD A;  2R58 A;  3N5B B;  2EQM A;  2P4T A;  4M78 F;  2PUK B;  3LGL A;  1WJQ A;  3CBM A;  3JCM W;  1VQN T;  3JCM P;  1G3W A;  3TCJ A;  2XID A;  1Q7Y C;  4NL2 A;  2EAY A;  4N4I A;  1WJS A;  2ZCF B;  4M7A G;  2CKK A;  3QDR B;  3DKM A;  2M0O A;  2ZZD A;  3QO3 A;  3FRN A;  1W4S A;  3E9F A;  3F70 A;  4OGE A;  4BAC A;  5GAO n;  1VQ9 T;  2PVG B;  3HPW A;  4IKF A;  2PUO B;  3QJ6 A;  3OYJ A;  3CCQ A;  2P0P A;  1M1G A;  4OB2 B;  3ER0 A;  3OA6 A;  3I56 T;  1XTD A;  3CCQ T;  3CCR T;  2H3J A;  3E19 A;  5CAI A;  1I8F A;  2FHD A;  3M54 A;  2MF2 A;  4JLI A;  5FU6 C;  2DZ9 A;  3PFS A;  5LJ5 j;  1VQ9 A;  4JRK A;  4QVZ A;  3CCM A;  5DLO A;  1I4K 1;  2E10 A;  2E5Q A;  3FJP A;  3P8D A;  2CGH A;  4FT2 A;  5KE2 A;  1M90 U;  2RHX A;  4XTY A;  1N8R U;  1D3B A;  1TH7 A;  1XOV A;  1YCY A;  3OYY A;  3Q1J A;  1VQ4 T;  3NTI A;  2JZ2 A;  3CCL A;  5CQX A;  3M5A A;  3PIP A;  1YIT T;  3DB3 A;  1JBM A;  3CBP A;  1VQN A;  3P8B B;  2D6F A;  1OZ2 A;  3LW5 E;  3OBY A;  4M78 A;  2R57 A;  1WGS A;  1LOJ A;  4FIB A;  2RA2 A;  4XTX A;  3HFO A;  4C8Q A;  5GAM f;  2K5I A;  4EDU A;  3RKX A;  4QVC A;  1ZHI A;  3PTA A;  2QTX A;  2JN0 A;  4II1 A;  5GAM g;  2V8K A;  3C95 A;  3QII A;  3G6E T;  3SB2 A;  4BE0 A;  1OI1 A;  1S72 T;  1Y96 A;  3V7C A;  1YJW T;  2ZGW A;  2QQA A;  1QP3 A;  2EKO A;  2FVU A;  3V8J A;  4BY6 B;  5GAM e;  1XNI A;  2KY9 A;  4J6W A;  4A54 A;  3KUF A;  3CC2 T;  1P92 A;  2MI6 A;  5HKC A;  4KUI A;  3GPL A;  1VQ6 A;  2QDY B;  4XK8 E;  1VQ8 A;  1X6O A;  5CKF A;  3KXT A;  2RHZ A;  1Q86 C;  2Y4X A;  3HKS A;  2EFI A;  4M75 A;  1SSF A;  1EIF A;  1BI0 A;  2NLU A;  3JCM d;  5GAM d;  4DOV A;  2EJG A;  2K5F A;  2ZPG B;  2MWO A;  4IUP A;  2L3R A;  4M7D E;  2EQJ A;  3S3N A;  2VGM A;  3R6O A;  4N0A C;  4ZGE B;  4N4G A;  4HCZ A;  4BI8 B;  2V8J A;  2OTJ T;  5GAN 3;  3CPF A;  3FC3 A;  3AHU A;  4B9W A;  4B9X A;  1VQO A;  3QHS A;  2L5Q A;  3CPW S;  1OYX A;  4A4H A;  1VQP A;  4D6W A;  5GAN h;  4E7L A;  5FRO A;  3RES A;  3WVE B;  4JUV A;  2X4X A;  4C92 A;  2XHC A;  1Y07 A;  3OYB A;  4XU3 A;  4XU2 A;  3X26 B;  5A0G A;  3CME A;  5CKE A;  4RMO A;  2PVD B;  3G4S T;  2VUB A;  4ELZ C;  5C0M A;  3BY7 A;  4C92 B;  2O01 E;  3A8M B;  3QG1 A;  5GAN 2;  3OYC A;  3CCE T;  3EAE A;  5GAN 4;  2IG0 A;  5L8R E;  5CKH A;  3S3O A;  4ZTJ A;  5DLQ E;  1B34 A;  4C8Q B;  2K2V A;  4LDW A;  5LJ5 e;  3OYA A;  5FRN A;  3RMS A;  3MP8 A;  1KHC A;  4LDU A;  3V8K A;  3X25 B;  4F7U A;  1Q81 U;  3UT1 A;  1Q81 C;  2DK3 A;  3QBY A;  4FU6 A;  2RJE A;  1YJ9 A;  1GXI E;  2EJF A;  2RI2 A;  1UGR B;  5IT9 E;  1VQ5 A;  3BFM A;  4NOY A;  4JS4 A;  4QQG A;  2HQX A;  5KCH A;  4BE2 A;  2EWN A;  1KQ1 A;  3M58 A;  2E12 A;  2QA4 A;  1H3Z A;  1LJO A;  3J81 E;  4FSX A;  5LJ3 e;  3MP1 A;  1OZ3 A;  2MWP A;  5CIU A;  1FWZ A;  1UEB A;  1YJ9 T;  5EG2 A;  2LCC A;  5D6X A;  3OS2 A;  4KUD K;  3LWH A;  2QQ9 A;  2EIF A;  3CD6 A;  2JTF A;  3CXC S;  4V2S A;  4IUR A;  5GAO l;  3BW1 A;  1M9S A;  2DJZ A;  1YJN T;  1K9M C;  3QJY A;  4JJN K;  1Y7X A;  4RCB A;  2LC4 A;  4EMG A;  5CO7 A;  3G4S A;  3OQ5 A;  2JNG A;  3X28 B;  3CCV A;  3INZ A;  5GMK e;  1YI2 A;  3EFS A;  3M56 A;  1N9S A;  4J83 A;  3CMA T;  1YBY A;  2EYQ A;  2XK0 A;  3OS0 A;  3RIR A;  5C6S A;  5HK3 A;  1JJ2 S;  1AHJ B;  1HK9 A;  3QSU A;  3JB9 G;  2FL7 A;  1IZ6 A;  1VQM T;  1K9M U;  3CC7 T;  3HFN A;  5DM7 R;  1U1S A;  5LJ3 g;  3BDL A;  2ZPB B;  2G3R A;  3MEW A;  3JCM V;  3CCU A;  4L6V 5;  3I55 A;  2E6N A;  4M77 D;  3FB9 A;  3OMG A;  2K3X A;  2RJC A;  4PJO G;  1VIE A;  4XU1 A;  5FU6 B;  2M16 A;  4PJO D;  5KCO A;  3OW2 A;  2RI3 A;  2RJD A;  4FL6 A;  5J3B A;  1PSE A;  3CC4 A;  1DJ7 B;  1V29 B;  3JRZ A;  1Q82 C;  4PJO E;  3QZ9 B;  1LNX A;  4LDY A;  1RI0 A;  1WJR A;  2GF7 A;  2KAF A;  3TRE A;  5IN1 A;  3G71 T;  5LJ5 g;  3C94 A;  5GAN j;  4J8O A;  1W2B S;  2ZPF B;  4MMK A;  4KBM B;  2L89 A;  3NFC A;  4J7I A;  3T9N A;  2K3Y A;  5I21 A;  4PLL A;  3CCR A;  2VGN A;  2ZPI B;  3NTH A;  3UWN A;  4C8Q F;  4E7K A;  3JCM b;  3QYH B;  1QW1 A;  4J7F A;  3NTK A;  1UB4 A;  1U1T A;  3SWN C;  5J39 A;  2QA4 T;  1QVG A;  2RD1 A;  4HCC A;  2JVV A;  3OSS C;  4IUU A;  1O9S A;  3CXC A;  1KD1 C;  1K8A C;  4C0F A;  4C5H A;  4PJO F;  5LJ3 f;  3WVD B;  3L2U A;  3GOX A;  1KC8 C;  3RUX A;  4P5N A;  3A8H B;  2E41 A;  3JCM f;  4A4E A;  3JB9 H;  4C92 E;  1VQ6 T;  1R8O B;  1KD1 U;  2QQS A;  1I81 A;  2QQR A;  5CKD A;  5HY6 A;  2LT4 A;  4M7A F;  2D9T A;  4PLI A;  4PL6 A;  4C8Q E;  1BYM A;  2LTO A;  2QXF A;  2GFA A;  3CD6 T;  1X75 C;  1YJW A;  2HQE A;  1JJ2 A;  2QEX T;  1M1K C;  2BIV A;  3OYL A;  2RHU A;  4ZN1 A;  1K73 C;  1PSF A;  2CS7 A;  5CCA A;  1NE8 A;  2RK2 A;  1BI2 A;  2LDM A;  1G3S A;  2VYT A;  3RKY A;  4PJO C;  4DA4 A;  4C8Q D;  3L1A A;  4Y28 E;  1B34 B;  2VV5 A;  5GAO q;  3CPW A;  3CCS T;  5IAY A;  3QZ5 B;  4O6J A;  2KDS A;  4BD3 A;  2GQV A;  4HT9 A;  4M78 C;  4Q5W A;  1UGP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...