1VIEA

Structure of dihydrofolate reductase
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
60
structure length
60
Chain Sequence
PSNATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords DIHYDROFOLATE REDUCTASE
publication title A plasmid-encoded dihydrofolate reductase from trimethoprim-resistant bacteria has a novel D2-symmetric active site.
pubmed doi rcsb
source organism Escherichia coli
total genus 12
structure length 60
sequence length 60
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 1996-10-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.60 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1vieA00
3T9NA 2VV5A 2GQVA 3SFMA 3UDCA 2RK1A 1VIFA 2P4TA 1VIEA 2RK2A 2RH2A 2OAUA
chains in the Genus database with same CATH superfamily
2RB6A 3X24B 3OW2S 4J6WA 1YP5A 4RCCA 1X2QA 1QW1A 2NWMA 1HJDA 3VS5A 3TSWA 1QVPA 1QVGP 1KD1U 2JW4A 2LX7A 1Q82U 1K9MU 1T0HA 1H641 4B9XA 2XMFA 1KD1R 3SWNC 2MCNA 1RLQC 4WF2A 1N9SA 4CI0C 1U06A 2ZAEA 2CS7A 1ZLMA 3J80E 4M75A 4MDXA 1ARKA 2O2OA 3CC2A 1GRIA 4EPCA 3NTHA 2A7YA 2E3HA 1AOJA 3CCLA 1AHJB 1NPPA 1Y7XA 2CZ1B 2LCCA 2DXBA 4KUDK 4E7HA 2QEXT 4O6JA 5I2MA 3CCEQ 1ZHIA 4FYVB 4J9EA 3UATA 1WXUA 1VQ4Q 1WHLA 4E7SA 2KYMA 5GAN6 1G2BA 1HXDA 4J9IA 4XQ3A 1VQ5T 4MZPA 2PNIA 5DLQE 4AG2C 2DRKA 3SDZA 3EFSA 4QQ6A 4OMNA 3BE3A 3FDRA 3GNGA 1Q7YC 5FW9A 4LUEA 5IXFA 1B07A 2BZYA 2EGCA 2YLCA 3OYFA 1VA7A 2NUTA 3LGFA 1KQSA 2RM4A 4V2SA 1QWEA 2M0OA 1QCFA 3EGUA 4EMHA 2QEXA 3EG9A 1T3SA 3CCVQ 1YFNA 2AZVA 3OYJA 1O75A 3EGXB 2AKLA 1KG1A 4RTVA 3ZFJA 1KD1C 4CC4B 4EMKC 1LOJA 3GP8A 2K4YA 3JCMP 5D7UA 4M75D 2LT1A 2R57A 3CBPA 2GQIA 3WXMB 2FL7A 1I5LA 2CZ6B 2RQWA 2HBWA 4HKEA 2BKDN 1D09B 4FSSA 1YBYA 2HQXA 4HCCA 1BI3A 1RADB 3CC4Q 3NMZC 2LNVA 4A4HA 3EFOA 3OA6A 3M0TA 1OEBA 1NEGA 2DJZA 3M4GA 3OW2A 3CC2Q 1VQOA 1JEGA 3QXEB 3P8DA 5GMKi 2H3JA 2RJEA 3CCLQ 5GAOr 1EX4A 2ROLA 4JRPA 2RN8A 1PKTA 4A4GA 3BFMA 2JS2A 2D0NA 3VKIA 3GLXA 2HSEB 2XI9A 1M8VA 1NG2A 1DJ7B 2FZCB 3H0IA 3H8ZA 3V7SA 4IUQA 3MHXA 4ZTFA 1FMWA 3F70A 1WIEA 4E6RA 4FU6A 3M53A 4Y91A 4DOVA 2ZPBB 4J7FA 4M77C 2COZA 1OU8A 2BZXA 1KHIA 3FJ5A 3PVQA 2X9HA 1KFZA 1K1ZA 3NPFA 4GLKA 4OP0A 3LWHA 2E65A 3H9NA 2EFIA 4OF1A 1VQOT 2JM9A 2KGTA 3G7ZA 1SRLA 2DA9A 4F7UE 2RA2A 4FT2A 1AD5A 2EKHA 2VGNA 2DF6A 2DEUA 4M78E 3HPWA 4ZGJB 2ZZDA 2GTJA 1BKBA 1W1FA 4M77D 2NUPB 1X43A 5GAMe 5C6SA 2G6FX 1E6HA 4RTUA 3KBGA 5IHIA 3OYHA 3AT1B 1NPRA 4EIKA 2LQNA 4VUBA 5IAYA 4CC2A 3HKSA 2KQWA 2EQJA 2E5KA 2DIQA 1HD3A 4JS4A 1JJ2P 1QCNA 4C0ZA 3FC3A 4ELZC 2MAMA 2E12A 3CBOA 3QPHA 2CT3A 2CSIA 2ZPFB 3EAEA 5J26A 1Z9QA 1KQSP 5FRMA 3O5ZA 3HRTA 2J7IA 4E7LA 2KMTA 1M1GA 4DEYA 1BI2A 3EG1A 1VQOQ 2QAZA 3UA7A 2RMOA 3X20B 4J6XA 2FYKA 1Q95G 1GFCA 1GXIE 2HD0A 2F5KA 5GJVB 2CUBA 4AG1C 3LX7A 2VB6A 1PSEA 3EGXA 2WSFE 2QGFB 2GF7A 4OB0B 2OTLA 2LJ0A 2I2LA 1ZSZB 2LDMA 1VQ9A 1UEBA 4KRTA 2DL5A 3E9GA 3G1JA 3X26B 3RERA 1Z9ZA 1H3HA 1JRIA 2CGHA 2QA4A 2JZ2A 3OW2P 1Q81R 2DPPB 2VXEA 3P8HA 3CMAA 2KDSA 5C0MA 2PQWA 2HKNA 2CH4W 3I55A 1VQMA 1GFDA 2XG8D 5GAMh 2ED1A 2J05A 4LDUA 2GFUA 1QWFA 1PM3A 4JJCA 3JCMX 1UGPB 5KCOA 2RD1A 3JAME 2CYZB 4C92E 3RKXA 2FZGB 1UJ0A 2JJ9A 1D0ZA 2AHJB 3QYHB 1ZA1B 1X01A 2OTLT 2MMPA 2MWOA 5CQXA 2LQWA 4XU0A 5LL6S 1MHNA 4KGXB 2FG0A 1G3WA 4LD9K 3REBB 1JQQA 1VQ9T 1OYXA 3IQLA 2QG9B 4JJDA 2DD4A 1R77A 1A0NB 2DZ9A 2V1QA 4B9WA 3QDFA 1M2VB 2EGAA 3MCAB 5CR2A 4BE0A 1JO8A 5GAN5 3PTAA 5M9OA 2QA4T 2DXUA 4UC4A 4ORZA 3OYLA 4MZTA 3NTIA 3M0PA 3CMAT 1D3BB 5FRNA 2M02A 3I55T 1X75C 2HL5C 1VQMT 3O8VA 3I5SA 3META 4E47A 3L42A 5FLXE 2CT4A 4X9DA 3C12A 4C92B 3CPWS 3CCMA 1N9RA 5LJ3e 8ATCB 2W0ZA 2ZPHB 1MUZA 4NL3A 1I5OB 2NUPA 2K2VA 3VS6A 4XK8E 2OI3A 4LE9A 2OTLQ 3A8HB 2KNBB 2P0KA 2RH2A 5CQYA 4NOYA 4JZ4A 1XNIA 1HSQA 4M7DE 4WCIA 4F7UG 5FU7B 2DAQA 2DL7A 1VQ9Q 2EIFA 4JS5A 3JCMg 1V1CA 2LP5A 4M78G 5GMKm 1BIAA 2EVRA 2KSSA 3I5RA 4GLMA 2RHIA 2C0TA 2QA4Q 1UECA 2QTVA 4O5VA 4PLIA 3CMAQ 3CCSA 2XDBA 4A4KA 3M4YA 3CCJA 3WVEB 5GAOp 2D6FA 3LH0A 3MKDA 4R56A 3I55Q 4M4ZA 4Z89A 4EDUA 1FMKA 1IRXA 3CC7T 2KRMA 3EG0A 1Y96B 4PJOE 1Y0MA 4JRKA 2CZ0B 2LQ8A 7AT1B 2X4JA 3CMEA 4Q5WA 4BI8B 4C8QE 5AYFA 1GL5A 1O9SA 4M7DB 2YWWA 3QYGB 1YN8A 3H6ZA 3R6NA 4C0FA 2FRWA 1GCQC 2EPDA 2GFAA 2IIMA 1QKWA 3X28B 2YRCA 1NLOC 2I0NA 1NE8A 1WQWA 2JTFA 1ZSZA 4BE1A 1NBEB 4BE2A 1CKBA 4N4GA 2EYZA 2K2MA 1ABQA 1TTHB 3PT9A 3SFMA 1FYNA 2WSEE 2DETA 2DJQA 3G71Q 3CCEA 3CCST 4KGZB 4J9BA 1KK7A 5LJ3d 1M3CA 2KE9A 2YUNA 3OBYA 3VV0A 3RUXA 1G5VA 1VOMA 3CXCS 3E19A 2HZYA 4E2FB 1QKXA 5A0GA 4PJOB 2X51A 3CCMQ 2OAUA 5GANd 1UDLA 2ESWA 1WHMA 2JXBA 2V1RA 3EHRA 3QBYA 5IH2A 1K73R 3JCMV 2QQBA 4C8QB 3CMET 1ZBXA 1YI2A 5IHKA 3SB2A 3ZEHA 1QP2A 1M2OA 4ME7A 1VQNA 3RNJA 3OYNA 3MEVA 1Q86U 1ZUKA 3DB4A 3VJPA 2FPEA 3UA6A 5GAN2 2GQVA 1MMGA 5GJWB 3G6EA 2M51A 3CPWA 1SF9A 2B8AA 2KVQG 5EC7A 1Q7YR 3FIFA 1YWPA 4C92G 2FPFA 3CCET 4KUIA 1LPLA 4PJLA 1ZUUA 5D6YA 1VQ4T 2L5QA 2A37A 1X69A 3A98A 2KR3A 3CCSQ 4RG8A 3REAB 3CCJQ 2XICA 1YCYA 1X6OA 4FIBA 1D3BA 2ECZA 4DBQA 3TVTA 2RQRA 4F04B 2V8IA 1G83A 3KUFA 4C92A 3L2ZA 2GGRA 3CC4A 1KIKA 2E64A 1Q82R 1K9MR 3GF5A 3CMEQ 2LT4A 2KT1A 4N0AA 5AT1B 4FYXB 3MP8A 3HHTB 1KC8U 2MK5A 3FB9A 5IN1A 1U1SA 1ZBJA 3CCVT 1S1NA 2P4RA 4Z88A 4PL6A 5LJ5e 1V76A 2X4XA 4D6WA 1VQ7A 4M7AE 1KQ2A 2VV5A 4ZGEB 3J81E 3HFOA 4LDVA 4ATOA 1K73C 2LC4A 4RCBA 2KRSA 4XU2A 4BB7A 3R6OA 2MIOA 4QW2A 5KYYB 4PJJA 3QWXX 1BYMA 3EFRA 2E6ZA 4M7DG 4HVVA 2P84A 4JRQA 4HXJA 1X2KA 4A4FA 4ZGDB 3CC4T 2JTMA 1V29B 1IHVA 3MEAA 1YI2Q 2E6NA 1WHGA 3QO3A 1JXOA 2EQIA 3CPFA 1Y96A 4E7JA 1VQNQ 4BI3A 3CC2T 5CVIA 2E4HA 2DTIA 1ZUYA 4N0AC 5FU6B 4ELYC 4M7AB 4M75C 2K5IA 2PZ1A 3QZ9B 3CCLT 3MP1A 4M7DA 2CP5A 2J06A 5DM7R 3SHWA 3CCUQ 4LDXA 4FT4A 2CSQA 2A08A 1VYUA 3G6EQ 2DX1A 3JCMc 4PJOG 2DEQA 1IB8A 4XU3A 1Q82C 4QVZA 1K9MC 4RUGA 4L5GA 1K0XA 2DL4A 4C8QG 2V8JA 5FROA 3OYBA 4PJNA 2BTTA 1M1KU 3JCMf 5I2SA 4HT8A 1RAEB 5GAOq 2DK3A 3A8GB 3LLRA 2MYSA 4P5NA 2X35A 4PJOA 2R5AA 1Y07A 2QI2A 2MI6A 2DL3A 3VYHB 2L3QA 5LJ5h 4C8QA 1XQHA 5HY6A 2YHTA 2DRMA 3RESA 3BDLA 2XDDA 1BIBA 4QT7A 2KRNA 4C0DB 5DY9A 1S72A 2HKQB 3CPWP 1VQ7Q 5KE3A 1NM7A 4F7UF 2RJCA 4J83A 8AT1B 4AFUC 1UGRB 3C4SA 1K8AU 4M78F 2KI7A 2XU8A 1PRLC 1H8KA 4IURA 1JXMA 1X6GA 1UFFA 1MV3A 3M0SA 3N5BB 3QKJA 2M16A 1W2BS 1AT1B 3QJ6A 1K8AR 1UUEA 2BUDA 1QCOA 2H3EB 2QDLA 4KT0E 1W70A 1VIEA 3V7RA 4OMPA 4ESRA 1D1BA 2Z0WA 1JB0E 2HAXA 4NL2A 1TUCA 3VS3A 4C5IA 1YJWQ 4LUDA 3L2RA 3JB9J 3L1AA 5KYWB 5GAMj 2QTXA 5HKCA 2DYBA 2WSCE 2RK2A 1GCPA 3ASKA 1VYVA 1P92A 4C5EA 4ZN1A 1LJOA 3ULRB 3C0CA 1KJWA 2JTEA 2J6FA 1AEYA 1X6BA 1OULA 2XHCA 1BCOA 3UPUA 1D1AA 5CKBA 1G8XA 1OV3A 1AWJA 1LNXA 4BY6B 1I4K1 2EQKA 3OYIA 3JCMW 3TU4K 3A1PA 2YT6A 5KYYA 4DA4A 3ZL7C 1TXQA 3QZ5B 4J9HA 4E7IA 4XAXB 2QASA 1QVFS 3EG3A 1K76A 4M7AG 1NLPC 5KYXB 3DLLA 3UDCA 2FRYA 3RMSA 2F2WA 3RKWA 3G4SQ 4JZ3A 2R5MA 5GAMg 4F7UB 2BE9B 2VASA 5KYNA 3H0HA 1K8AC 3CBMA 4QKUA 3PIPA 4M78B 2M9UA 2XD0A 2ZPEB 2VWFA 1S72Q 1SKUB 1MMAA 2GBQA 4OVAA 4M7AA 1EIFA 2F2XA 1BCMA 2L3RA 2RJFA 3NHNA 4RTTA 4J7IA 1RAFB 2C0IA 1VQLA 1LVKA 1TSFA 2D9TA 2DMOA 1JU5C 2QQ9A 3BY7A 1NJIU 3J7AF 1YNZA 4XTUA 2K9GA 4R55A 4C92F 2LRQA 2P4TA 4PLLA 5HCKA 4LNPA 2JS0A 1GBQA 3BDUA 4KH1B 1SSHA 4PFOA 2DO3A 3JCMb 2E41A 3GOXA 5GAOm 4PJMA 4J9FA 3JB9I 2DIGA 2LZ6B 2CP0A 4HCZA 2Y4XA 1TUGB 3Q1JA 1I1JA 2JMAA 1PWTA 1W2BA 3M9QA 2GCXA 1C0MA 5GAMd 2X3XD 5GAN4 4J5YA 2QQSA 4RTWA 3CCQQ 3GIBA 1OPLA 4LD6A 1OQKA 2GNCA 4JUVA 2DD5A 4J8OA 4HA8A 1N27A 1IHWA 3CD6A 3OYCA 4F17A 4CC7A 2J6KA 2HSPA 1FMVA 2D1XA 1YIJA 1B3QA 3GNFB 2FO0A 3M0UA 2QGGA 1RLPC 3SWNB 2CZ7B 4OMFB 3TQ7P 2KK4A 4OGEA 3L2VA 1OZ3A 4J9CA 2ATCB 4C5HA 1U8RA 1W4SA 1I0CA 3VRYA 1PNJA 1WDXA 4M7DF 1VQKA 1M30A 4ZNXA 4M75E 5LJ3j 1HYOA 5CKDA 3G71A 4FSXA 3H0FA 3QHSA 1M3BA 1M9SA 3OMGA 5KYWA 2M1HA 2F69A 1NJIC 2DKGA 1YITA 5GANj 4N4IA 4RTXA 2A36A 1QVFA 2KXCA 3EH2A 2A0FB 3VS1A 4CC3A 5CKEA 1MV0B 1VQLQ 5GMKe 3S3NA 1ZX6A 4Z8AA 2KEAA 3MEWA 5HK0A 4PJOF 3SD4A 2YRDA 1WXTA 1D1CA 3PNWC 1PD1A 3M55A 2DE0X 1WGSA 2QQRA 3P8BB 4ANJA 4C8QF 5CCAA 4PNOA 2G3RA 1VQKT 2NUZA 1UTIA 5ECAA 2O9VA 1AWWA 3OS1A 3HTRA 2DILA 3OYGA 2L2PA 3LW5E 3G71T 5IHNA 1VQ6Q 2EYQA 5LJ3g 3VUBA 1PG5B 2HDAA 4R0KA 3JB9H 3V8JA 4PK4A 1SPKA 4EMKB 4F7UA 1YJ9A 1VUBA 2AK5A 2HL3A 5GANg 3CCMT 5KYUB 2E10A 2NYSA 4M78A 3CD6Q 1M90U 4A63B 4AFSC 4D8DA 2PTKA 4C5GA 4AFQC 1YIJQ 3M54A 3JSCA 3OBWA 4OB1B 2VC8A 3EH1A 2E1HA 3OS5A 1M27C 2RQTA 5IXBA 5CO7A 3JB9F 4M77E 5CKHA 2YLBA 5FWBA 3GBQA 1QMCA 4MMLA 4QQGA 3AHUA 5EG2A 1VQKQ 3MJXA 1SHFA 2EKOA 4IUVA 4J9DA 1F1BB 3TSZA 2OTJA 2D8HA 2XK0A 1U1TA 3CCJT 1YJ9T 2RJDA 1YITQ 1N8RU 1JJ2S 2VYTA 5GMKh 3VRZA 2JM8A 2X4YA 4EMGA 4KH0B 2K3YA 1J3TA 1N8RR 1RUWA 3VS4A 2DERA 3JCMh 5I11A 1KQSS 4JJBA 2WACA 5GAMf 1PSFA 3RR6A 4BD3A 2COWA 3JCMJ 4M77B 1N5ZA 4FYWB 5J3BA 2LCSA 1TS9A 1WJRA 3M5AA 2OX7A 2RHXA 5CK9A 2O9SA 4JPBW 3EG2A 3SWNA 2DZCA 3CCUA 1Q86R 2ROTA 3E2UA 2F2VA 2K3BA 1LCKA 3OYAA 1ZSZC 4M78D 4N4HA 4D8KA 1Y71A 4M7AF 3NFCA 4XU1A 1M2VA 2OTJT 2OAWA 1KHCA 5CKFA 1MNDA 1M90C 3JRZA 4E7ZA 3HSBA 2ABLA 1YWOA 4HCBA 2V26A 2HBPA 2DLPA 2K7AA 1YJ9Q 4XTYA 2RQVA 2RQUA 1K9AA 2JT4A 4HVUA 3OB9A 1D0XA 2LQKA 4JJNK 1ZQ1A 2PVDB 5LJ5j 2FB7A 4IUUA 1NYGA 1YI2T 4IIMA 2A3LA 1TH7A 2FEIA 1VQNT 2YUOA 4M75G 2Y90A 2JNGA 2PUOB 2B86A 2IVWA 2RF0A 3V8LA 1VQ5A 3CCUT 1M1FA 1RAHB 3HP9A 4JLIA 4X1VA 3G6ET 1KC8R 3ME9A 1BBZA 1TUDA 4L59A 1N8RC 5DLOA 5L8RE 2JUFA 2QDYB 3M0RA 2FPDA 2OTJQ 2HQHA 1IZ6A 4OB3B 4QVDA 3OYMA 5A0DA 3QSUA 2CP2A 2CH4A 2DTHA 2W10A 3OQ5A 3DB3A 1K0SA 1T0JA 3M56A 1X27A 4RMOA 2RI2A 4EMKA 4OMMA 1TU0B 1Q86C 5LJ5g 1WNLA 3A8OB 1PRMC 5KYUA 1YJWA 2CREA 4MZMA 3M58A 3KXTA 1AWXA 3FRNA 4C92C 3OYKA 1QLYA 3DLMA 4LDYA 3CCRA 4X9CA 3JCMQ 3INZA 4HCKA 1YJNA 1WJQA 3LH5A 6AT1B 1OX8A 3HL8A 3CQTA 1OOTA 1H92A 1UJYA 1VQ7T 3OYYA 3DKMA 1JJ2A 1WHHA 1K4US 1AZEA 3CXCA 2JVVA 4F14A 1KQ1A 5CIUA 2YDLA 1RAAB 5GAN3 1XOVA 4J6YA 4BUGA 5FU7C 4C92D 2RHZA 4OB2B 1VQPA 2DNUA 2CP7A 4RG2A 1RAGB 1B7TA 1GBRA 1SHGA 4XTXA 2P0QA 4M77G 4QVCA 1E7OA 1WYXA 1UG1A 2JOYA 2DM1A 1KC8C 2RI3A 4AT1B 2Y4YA 1WZOA 1YJWT 2QEXQ 1M1KR 5LJ3f 1UGSB 3A5ZB 5HK3A 2YUPA 1NZ9A 4JDSA 5LJ5d 2ENMA 1IREB 3CCRT 3G4SA 2O88A 1YJNT 3MPUB 5GAOn 1FX7A 1HK9A 2K79A 1IXDA 3S6WA 5GANf 1WFWA 1T3LA 4M77A 1VQ5Q 2PUKB 3OS0A 2YSQA 1RACB 2KROA 2MPXC 2RHYA 2ZCFB 4XTZA 2DBKA 2DBMA 2F1LA 4M7DC 3RMQA 2IPOB 5FWCA 2DVEA 1U3OA 1C1AA 3MP6A 1OU9A 1VQPT 3HRSA 5D6XA 2LMJA 5GAN7 3JB9G 2YXYA 1EFNA 1VYTA 2K6DA 1WA7A 3VUZA 2FVUA 2LJ1A 3UWNA 5GAOl 4A4EA 1WHKA 3HRUA 4L6V5 2EJGA 4BI4A 1BU1A 4M7DD 2BZ8A 3QDRB 3QG1A 2D0QB 3EHQA 3S3MA 2EYWA 3G4ST 2LX9A 4AFZC 4PJOC 2KY9A 3QWYA 3A8MB 1N6AA 1UHFA 3CCRQ 4J9GA 2XDPA 1YJNQ 4ZTJA 2KXDA 1S72T 4X34A 4C8QC 4HVWA 1NEBA 3CCQA 1I8FA 2EAYA 3QIIA 4RKUE 4XTWA 2XIDA 1YHQA 1KSWA 1M1KC 3RIRA 1W6XA 2ZGWA 1UHCA 4PJOD 2COYA 2KYBA 2P0PA 1VQPQ 2ZPGB 3M59A 5KCHA 3C94A 2X3WD 1B34B 4HT9A 1XTDA 4FYYB 1TG0A 3CEYA 2CKKA 5D6WA 2O31A 2CP3A 4LN2A 4C8QD 3OYDA 4LXCA 4Z02A 1BI0A 3M57A 3TCJA 4IUTA 4AMCA 1QQJA 4Y28E 3PE0A 3RDVA 2LNHB 3PVLA 3X25B 4FCYA 5A0LA 3L2QA 1YCSB 2QK0A 3UT1A 1G3TA 4IKFA 1ZA2B 4XTVA 2E70A 1Y57A 4RTZA 2RK1A 1XJWB 4DBRA 3THKA 2DFUA 1RI0A 1CKAA 1M3AA 3CXCP 2DYIA 3CCQT 1QVGS 1PC0A 4FL6A 4PKCC 3UF4A 3S3OA 1YHQT 2A28A 1UGVA 2VGMA 1PHTA 2L8DA 1WQ7A 4BDZA 1OI1A 3FEOA 3I56A 4KBMB 5L23A 2JN0A 1G3YA 3EGDB 3JB9D 4FW2A 1PD0A 1NJIR 1NYFA 5I22A 2HMAA 5GMKl 2CP6A 4DQ2A 1UB4A 2LJ3A 3VS0A 4DEXA 5IT9E 4A53A 4JLGA 3KFVA 1MMDA 4BDYA 2MWPA 4YTLA 3ER0A 3RBBB 4DBFA 3NGPA 3D7SB 4OMLA 1VQ6A 3FLGA 4B6MA 2EBPA 4LDWA 1MNEA 2RHUA 4OMOA 4PFPA 2V8KA 3HFNA 2CUDA 3FJPA 4M75F 3QJYA 1H3ZA 1WHJA 2VXFA 2L3PA 3URGA 2PU9B 4GBQA 1D0YA 1Q81U 2K5LA 5LJ5f 1VQLT 1IGQA 1SG5A 3NTKA 1YHQQ 5FU6C 4WTOB 1AWOA 4M7AC 3I9QA 3I56T 3QUIA 2GTOA 3VS2A 2HQEA 2HEQA 3PMIA 1RL2A 2RO0A 2L3SA 2H8HA 2HCKA 3L2WA 2VUBA 2C0OA 2DXCA 5I21A 1BI1A 1I81A 3OY9A 2K5FA 2NLUA 1WI7A 2DL8A 4C0GA 2F5TX 1IGUA 2M0YA 3LWIA 1VQ6T 4M7AD 2QYZA 2K57A 5GMKj 1VQ8A 2O4XB 2CDTA 4IIOA 1OZ2A 2AT1B 2FZKB 4TVRA 4MMKA 2QXFA 2EGEA 4K11A 3RKYA 1ABOA 2DXTA 1FWZA 2KT8A 4FW1A 2BE7D 2DVJA 2KAFA 3SEMA 3M0QA 2BIVA 3CD6T 1M8MA 3PIOA 3ZBDA 1OX9A 1QP3A 1R8OB 2C06A 2AKKA 3C95A 1YIJT 1PKSA 2EYYA 4C0DC 3I56Q 4GY5A 1EZZB 2RPNA 2VKNA 3JCMe 5J39A 2ED0A 2E5QA 1WX6A 2FHDA 3PFSA 2K3XA 1QVGA 1B34A 2EQUA 1AVZC 2R58A 4M77F 3CC7A 4M75B 1ACMB 3OS2A 1MMNA 3LGLA 3VS7A 5A2QE 1AZGB 2YUQA 1RAIB 2SEMA 1VQ8T 1GCQA 3JV3A 1G3SA 1Q81C 5GANe 5KYXA 1IO6A 1U5SA 3BW1A 3MO8A 2PVGB 4Y92A 4KULA 1YITT 3TREA 3LYIA 3I35A 1R0BG 3OSVA 1UE9A 4OMQA 3V8KA 9ATCB 4KGVB 2IG0A 1SEMA 3GPLA 2KBTA 4F16A 1JBMA 2EQMA 4QQDA 1R0CB 2LVMA 3PGGA 4DBHA 2OJ2A 2L0AA 4RTYA 2RI5A 2E3IA 2EYXA 4NS5A 2DTOA 2HNIA 1M90R 1OPKA 3OYEA 3VYGA 1BK2A 2SRCA 1VQMQ 2AIRB 1ZSGA 3V7CA 2RNAA 4DOWA 3PMTA 1C6VX 3EGDA 4BY6C 4IUPA 2NUTB 2YRVA 1FXXA 2JMCA 1RI9A 1UGQB 3EG9B 1MGQA 3E9FA 1CSKA 4OGCA 1VQ8Q 1SSFA 1W2BP 3OSSC 1PCXA 2AZSA 4ZN3A 2MF2A 1WXBA 2LCLA 5KE2A 2XKOC 2O01E 3U23A 5GAN8 3JCMd 1RABB 4E7KA 4M78C 4JRIA 1VQ4A 2X4WA 3MEUA 2D8JA 1I07A 2QQAA 5LJ3h 1K73U 1BB9A 2LTOA 4MDWA 1VIFA 2ZPIB 2EJFA 3A8LB 1WPYA 4A54A 2EJ9A 2MOXA 3EFOB 1TWBA 5GANh 3CC7Q 3L2UA 1TOVA 1SRMA 3WVDB 1WJSA 3TEEA 1WLPB 1M5Q1 4PFZA 5KH6A 4CRIA 3T9NA 1Q7YU 1M4ZA 2EW3A 1E6GA 2O4XA 3OMCA 3CCVA 3H41A 4II1A 1QVFP 3E1SA 4BACA 4FM4B 2J6OA 5CAIA 2L89A 2EWNA 3VU3C 2VVKA 2PVOB
chains in the Genus database with same CATH topology
3OS0A 2RB6A 3X24B 2EIFA 4R55A 4JS5A 4C92F 3JCMg 3OW2S 2RHYA 4J6WA 4M78G 2ZCFB 1BIAA 5GMKm 4RCCA 4XTZA 1QW1A 2KSSA 2LRQA 4M7DC 3RMQA 2RHIA 2P4TA 2DVEA 4PLLA 1QVPA 1KD1U 3MP6A 1VQPT 1Q82U 3HRSA 1K9MU 3BDUA 5D6XA 4O5VA 1H641 4PLIA 5GAN7 2DO3A 3JCMb 2E41A 3GOXA 3CCSA 4B9XA 5GAOm 3JB9G 2XDBA 4A4KA 3M4YA 3JB9I 3CCJA 3WVEB 5GAOp 2D6FA 2DIGA 3SWNC 3LH0A 3VUZA 4WF2A 2FVUA 1N9SA 4R56A 3UWNA 5GAOl 4A4EA 4CI0C 4EDUA 4HCZA 2CS7A 2Y4XA 3HRUA 3J80E 4L6V5 3Q1JA 4M75A 4MDXA 2EJGA 3CC7T 4BI4A 3CC2A 1Y96B 4M7DD 1W2BA 4PJOE 3M9QA 2GCXA 3QG1A 3QDRB 4EPCA 3NTHA 5GAMd 2D0QB 2A7YA 5GAN4 4JRKA 4J5YA 2CZ0B 2LQ8A 3S3MA 3CCLA 2QQSA 2X4JA 3G4ST 3CMEA 2LX9A 4Q5WA 3GIBA 4BI8B 4LD6A 4C8QE 5AYFA 4PJOC 2KY9A 1AHJB 1NPPA 1N6AA 1O9SA 2DD5A 3A8MB 4HA8A 4J8OA 1Y7XA 1N27A 2CZ1B 2DXBA 2LCCA 3QYGB 3H6ZA 4KUDK 3CD6A 3OYCA 2XDPA 4C0FA 4E7HA 2QEXT 4O6JA 5I2MA 4ZTJA 2GFAA 3X28B 1S72T 5FU7B 4X34A 4C8QC 1NE8A 1ZHIA 1YIJA 1WQWA 3GNFB 2JTFA 4BE1A 4BE2A 3CCQA 1I8FA 2EAYA 3QIIA 4N4GA 4RKUE 5GAN6 3SWNB 4XTWA 2CZ7B 1HXDA 4OMFB 3PT9A 3SFMA 2XIDA 2WSEE 4XQ3A 2KK4A 1YHQA 1VQ5T 4MZPA 4OGEA 1M1KC 3L2VA 3RIRA 5DLQE 1OZ3A 2ZGWA 3SDZA 3CCEA 3CCST 3EFSA 4PJOD 4C5HA 1U8RA 2P0PA 1W4SA 4XTUA 4QQ6A 5LJ3d 2ZPGB 3M59A 3FDRA 3GNGA 5KCHA 3C94A 1Q7YC 4M7DF 1B34B 1VQKA 3OBYA 1XTDA 4HT9A 3VV0A 3RUXA 4M77A 1G5VA 3CEYA 2CKKA 5D6WA 3CXCS 3E19A 4M75E 4C8QD 3OYDA 5LJ3j 4Z02A 5A0GA 4PJOB 1BI0A 2YLCA 3M57A 3TCJA 3OYFA 5CKDA 4IUTA 3G71A 3LGFA 4FSXA 2RM4A 1KQSA 2OAUA 5GANd 4V2SA 3QBYA 3QHSA 4Y28E 1M9SA 2M0OA 3OMGA 3X25B 4EMHA 2M1HA 2QEXA 2F69A 2QQBA 3JCMV 1NJIC 4C8QB 2DKGA 1YITA 3CMET 5A0LA 3L2QA 1ZBXA 1YI2A 5GANj 4N4IA 3UT1A 1G3TA 4IKFA 3OYJA 3SB2A 3ZEHA 1QP2A 4XTVA 2E70A 4ME7A 1VQNA 1QVFA 1O75A 3OYNA 2RK1A 1KG1A 3MEVA 1Q86U 5CKEA 3DB4A 3VJPA 5GMKe 1RI0A 3ZFJA 3S3NA 1KD1C 3CCQT 1QVGS 3MEWA 4EMKC 5HK0A 4FL6A 4PJOF 1LOJA 5GAN2 2GQVA 2K4YA 3SD4A 3GP8A 3G6EA 4PKCC 3CPWA 3JCMP 3S3OA 1YHQT 2B8AA 2KVQG 2VGMA 3PNWC 2L8DA 3FIFA 4M75D 3M55A 1WGSA 2LT1A 4C92G 2R57A 2QQRA 3CBPA 3P8BB 4KUIA 3CCET 4C8QF 1WQ7A 3WXMB 4BDZA 5D6YA 2FL7A 5CCAA 1I5LA 1VQ4T 2CZ6B 1OI1A 2L5QA 3FEOA 4HKEA 4PNOA 2BKDN 4KBMB 2G3RA 3I56A 1VQKT 4RG8A 2JN0A 1YBYA 1G3YA 2HQXA 4HCCA 3JB9D 1BI3A 2XICA 3OS1A 3OYGA 1YCYA 2LNVA 3LW5E 1X6OA 4FIBA 3G71T 5GMKl 1D3BA 2EYQA 4A4HA 4DQ2A 5LJ3g 1UB4A 3VUBA 2V8IA 3OA6A 3JB9H 2DJZA 3M4GA 3V8JA 3OW2A 5IT9E 1VQOA 4A53A 4JLGA 3KUFA 4C92A 3L2ZA 4BDYA 3QXEB 2MWPA 3P8DA 4YTLA 5GMKi 2H3JA 2RJEA 3ER0A 4EMKB 3CC4A 4F7UA 1YJ9A 1VUBA 2E64A 5GAOr 3GF5A 5GANg 2LT4A 1VQ6A 3FLGA 4N0AA 3CCMT 4JRPA 4LDWA 2RHUA 3MP8A 3HHTB 2E10A 4A4GA 2V8KA 4M78A 1KC8U 3HFNA 3BFMA 1M90U 3FJPA 3FB9A 4M75F 5IN1A 3QJYA 1U1SA 3VKIA 1H3ZA 3GLXA 4C5GA 2XI9A 3CCVT 1M8VA 2VXFA 4PL6A 3URGA 5LJ5e 2PU9B 2X4XA 3M54A 4D6WA 1DJ7B 3JSCA 1VQ7A 3OBWA 4M7AE 4OB1B 2VC8A 1KQ2A 1Q81U 2VV5A 3H8ZA 2K5LA 5LJ5f 2E1HA 3OS5A 4ZGEB 3J81E 3HFOA 1VQLT 4LDVA 3V7SA 4ATOA 5CO7A 1K73C 3JB9F 4M77E 2LC4A 4IUQA 3NTKA 3MHXA 4ZTFA 4RCBA 3F70A 5CKHA 5FU6C 2YLBA 4M7AC 3I56T 4FU6A 3QUIA 4XU2A 4BB7A 3R6OA 3M53A 4Y91A 4DOVA 4QW2A 4MMLA 2ZPBB 4QQGA 4J7FA 4M77C 3AHUA 5EG2A 1BYMA 2HQEA 2EKOA 1KHIA 4IUVA 3EFRA 3PMIA 1RL2A 2E6ZA 2RO0A 4GLKA 4OP0A 3L2WA 2VUBA 2DXCA 5I21A 3LWHA 2E65A 4M7DG 1BI1A 1I81A 2EFIA 2K5FA 4OF1A 3OY9A 1VQOT 2NLUA 3G7ZA 4JRQA 2OTJA 2XK0A 4A4FA 1U1TA 4C0GA 4ZGDB 3CCJT 2F5TX 4F7UE 3LWIA 3CC4T 2RA2A 1YJ9T 2JTMA 2RJDA 1V29B 4FT2A 1VQ6T 3MEAA 1N8RU 4M7AD 2E6NA 2VGNA 2VYTA 5GMKh 3QO3A 1JJ2S 4M78E 2X4YA 3CPFA 2ZZDA 1Y96A 3HPWA 4ZGJB 4E7JA 2K57A 4BI3A 5GMKj 4EMGA 1BKBA 1VQ8A 2O4XB 3CC2T 2K3YA 1OZ2A 4M77D 5CVIA 2DTIA 4N0AC 4TVRA 4MMKA 5FU6B 2QXFA 5GAMe 4ELYC 4M7AB 3JCMh 5C6SA 4M75C 2K5IA 3QZ9B 3RKYA 3CCLT 2DXTA 1KQSS 3KBGA 3MP1A 1FWZA 2WACA 5GAMf 4M7DA 1PSFA 5DM7R 3OYHA 4LDXA 4FT4A 2KAFA 4BD3A 1NPRA 3JCMJ 4M77B 2BIVA 3CD6T 4VUBA 5J3BA 5IAYA 3PIOA 3HKSA 2KQWA 3JCMc 3ZBDA 1R8OB 1QP3A 4PJOG 2C06A 1WJRA 2EQJA 3M5AA 2DEQA 2DIQA 3C95A 1YIJT 2RHXA 4JS4A 5CK9A 4XU3A 4C0ZA 3FC3A 3SWNA 4QVZA 2DZCA 2MAMA 2E12A 4C0DC 4L5GA 4ELZC 4GY5A 3CCUA 1K9MC 3CBOA 3QPHA 4C8QG 2V8JA 5FROA 3JCMe 2ZPFB 3OYAA 3EAEA 5J39A 5J26A 3OYBA 2E5QA 4M78D 4N4HA 1M1KU 1Y71A 4M7AF 3JCMf 2FHDA 3NFCA 5I2SA 5FRMA 4HT8A 4XU1A 3PFSA 2K3XA 2OTJT 3HRTA 5GAOq 1QVGA 2DK3A 1B34A 2EQUA 2KMTA 4JUVA 3A8GB 4E7LA 1KHCA 1M1GA 2R58A 5CKFA 1BI2A 4M77F 1M90C 3LLRA 3JRZA 3CC7A 4P5NA 4M75B 2X35A 3HSBA 3OS2A 4PJOA 3X20B 3LGLA 2R5AA 4J6XA 1Y07A 5A2QE 4HCBA 2HBPA 2QI2A 2FYKA 1VQ8T 4XTYA 1G3SA 2MI6A 1Q81C 1GXIE 3VYHB 5GANe 2HD0A 5LJ5h 3OB9A 4C8QA 3BW1A 1XQHA 5HY6A 2LQKA 4JJNK 1ZQ1A 2PVDB 2F5KA 2YHTA 3MO8A 3BDLA 3RESA 2FB7A 2PVGB 4IUUA 5LJ5j 2XDDA 4KULA 1YITT 3TREA 1BIBA 3LYIA 1YI2T 3LX7A 1PSEA 2A3LA 3OSVA 4C0DB 5DY9A 1S72A 1TH7A 3V8KA 2WSFE 1VQNT 4M75G 2Y90A 5KE3A 2GF7A 4F7UF 2RJCA 2IG0A 4OB0B 2OTLA 4J83A 2I2LA 2JNGA 3GPLA 1UGRB 3C4SA 1K8AU 1JBMA 2PUOB 4M78F 2EQMA 2IVWA 2XU8A 3V8LA 1VQ5A 4QQDA 2LDMA 2LVMA 3PGGA 4IURA 3CCUT 1VQ9A 1M1FA 1UEBA 2RI5A 3HP9A 4JLIA 4NS5A 3G6ET 3N5BB 2DTOA 2HNIA 2M16A 3QKJA 1W2BS 3E9GA 3QJ6A 3X26B 3OYEA 3VYGA 3ME9A 2BUDA 3RERA 1JRIA 4L59A 1N8RC 4KT0E 5DLOA 5L8RE 3V7CA 4DOWA 1Q82C 2CGHA 2JUFA 1VIEA 3V7RA 3PMTA 2QA4A 2JZ2A 2QDYB 2DPPB 2VXEA 3P8HA 1JB0E 2KDSA 4IUPA 4BY6C 3CMAA 4OB3B 1IZ6A 2HAXA 2YRVA 4NL2A 4QVDA 3OYMA 5A0DA 2PQWA 4C5IA 5C0MA 3QSUA 3L2RA 3JB9J 1FXXA 3L1AA 3I55A 1VQMA 2XG8D 5GAMh 1UGQB 2DTHA 4LDUA 1MGQA 2GFUA 3JCMX 1UGPB 3DB3A 3E9FA 3OQ5A 2QTXA 4OGCA 5KCOA 5GAMj 2RD1A 5HKCA 1SSFA 2WSCE 3M56A 3JAME 2CYZB 2RK2A 4C92E 4RMOA 2RI2A 4EMKA 3OSSC 1Q86C 3ASKA 3RKXA 1WNLA 1P92A 3A8OB 5LJ5g 4C5EA 4ZN1A 1LJOA 1YJWA 4ZN3A 4MZMA 2AHJB 3QYHB 2MF2A 3M58A 3KXTA 1X01A 2OTLT 2LCLA 2MMPA 2MWOA 5CQXA 5KE2A 3FRNA 4C92C 4XU0A 2XKOC 5LL6S 2O01E 1MHNA 4LDYA 2XHCA 3DLMA 3OYKA 1G3WA 5GAN8 4X9CA 3CCRA 3JCMd 3INZA 3JCMQ 3UPUA 4LD9K 1YJNA 5CKBA 1WJQA 3HL8A 1VQ9T 1OYXA 4E7KA 4M78C 2DD4A 1VQ7T 3OYYA 3DKMA 1JJ2A 4JRIA 1LNXA 2DZ9A 4BY6B 3CXCA 2X4WA 3MEUA 4B9WA 1VQ4A 2JVVA 1I4K1 3MCAB 2QQAA 1KQ1A 5CR2A 2EQKA 4BE0A 5CIUA 5LJ3h 3OYIA 1K73U 5GAN5 3JCMW 3PTAA 3TU4K 5GAN3 5M9OA 2QA4T 1XOVA 2DXUA 4J6YA 4UC4A 2LTOA 4DA4A 3QZ5B 4MZTA 3NTIA 4MDWA 3OYLA 4E7IA 1VIFA 4XAXB 5FU7C 4BUGA 2ZPIB 3CMAT 1QVFS 2EJFA 4C92D 2RHZA 4OB2B 3A8LB 1D3BB 1WPYA 1VQPA 5FRNA 4M7AG 4A54A 2EJ9A 4RG2A 3DLLA 5GANh 3I55T 1X75C 3L2UA 1VQMT 3O8VA 3META 4E47A 3UDCA 3L42A 4XTXA 3WVDB 5FLXE 2P0QA 4X9DA 4M77G 4QVCA 3C12A 4C92B 1WJSA 3RMSA 3RKWA 2JOYA 3TEEA 2R5MA 5GAMg 4F7UB 3CPWS 3CCMA 1N9RA 5LJ3e 1M5Q1 1KC8C 2RI3A 5KH6A 2Y4YA 2ZPHB 4CRIA 3T9NA 1YJWT 1Q7YU 1K8AC 1M4ZA 3CBMA 3PIPA 5LJ3f 1UGSB 4M78B 2M9UA 2XD0A 2ZPEB 4NL3A 3A5ZB 2O4XA 3OMCA 5HK3A 3CCVA 1NZ9A 4II1A 4JDSA 2K2VA 4XK8E 3E1SA 5LJ5d 1IREB 3CCRT 4BACA 3G4SA 4OVAA 4FM4B 1YJNT 4M7AA 3A8HB 5CAIA 1EIFA 2L3RA 2P0KA 2RH2A 2RJFA 2L89A 1FX7A 1HK9A 2EWNA 5CQYA 4J7IA 5GAOn 4NOYA 3VU3C 3S6WA 1VQLA 5GANf 1XNIA 4M7DB 2D9TA 4M7DE 4F7UG 2QQ9A 3BY7A 1NJIU 2PVOB 3J7AF 2DAQA 2PUKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T9N A;  2VV5 A;  2GQV A;  3SFM A;  3UDC A;  2RK1 A;  1VIF A;  2P4T A;  1VIE A;  2RK2 A;  2RH2 A;  2OAU A; 
#chains in the Genus database with same CATH topology
 2RB6 A;  3X24 B;  3OW2 S;  4J6W A;  1YP5 A;  4RCC A;  1X2Q A;  1QW1 A;  2NWM A;  1HJD A;  3VS5 A;  3TSW A;  1QVP A;  1QVG P;  1KD1 U;  2JW4 A;  2LX7 A;  1Q82 U;  1K9M U;  1T0H A;  1H64 1;  4B9X A;  2XMF A;  1KD1 R;  3SWN C;  2MCN A;  1RLQ C;  4WF2 A;  1N9S A;  4CI0 C;  1U06 A;  2ZAE A;  2CS7 A;  1ZLM A;  3J80 E;  4M75 A;  4MDX A;  1ARK A;  2O2O A;  3CC2 A;  1GRI A;  4EPC A;  3NTH A;  2A7Y A;  2E3H A;  1AOJ A;  3CCL A;  1AHJ B;  1NPP A;  1Y7X A;  2CZ1 B;  2LCC A;  2DXB A;  4KUD K;  4E7H A;  2QEX T;  4O6J A;  5I2M A;  3CCE Q;  1ZHI A;  4FYV B;  4J9E A;  3UAT A;  1WXU A;  1VQ4 Q;  1WHL A;  4E7S A;  2KYM A;  5GAN 6;  1G2B A;  1HXD A;  4J9I A;  4XQ3 A;  1VQ5 T;  4MZP A;  2PNI A;  5DLQ E;  4AG2 C;  2DRK A;  3SDZ A;  3EFS A;  4QQ6 A;  4OMN A;  3BE3 A;  3FDR A;  3GNG A;  1Q7Y C;  5FW9 A;  4LUE A;  5IXF A;  1B07 A;  2BZY A;  2EGC A;  2YLC A;  3OYF A;  1VA7 A;  2NUT A;  3LGF A;  1KQS A;  2RM4 A;  4V2S A;  1QWE A;  2M0O A;  1QCF A;  3EGU A;  4EMH A;  2QEX A;  3EG9 A;  1T3S A;  3CCV Q;  1YFN A;  2AZV A;  3OYJ A;  1O75 A;  3EGX B;  2AKL A;  1KG1 A;  4RTV A;  3ZFJ A;  1KD1 C;  4CC4 B;  4EMK C;  1LOJ A;  3GP8 A;  2K4Y A;  3JCM P;  5D7U A;  4M75 D;  2LT1 A;  2R57 A;  3CBP A;  2GQI A;  3WXM B;  2FL7 A;  1I5L A;  2CZ6 B;  2RQW A;  2HBW A;  4HKE A;  2BKD N;  1D09 B;  4FSS A;  1YBY A;  2HQX A;  4HCC A;  1BI3 A;  1RAD B;  3CC4 Q;  3NMZ C;  2LNV A;  4A4H A;  3EFO A;  3OA6 A;  3M0T A;  1OEB A;  1NEG A;  2DJZ A;  3M4G A;  3OW2 A;  3CC2 Q;  1VQO A;  1JEG A;  3QXE B;  3P8D A;  5GMK i;  2H3J A;  2RJE A;  3CCL Q;  5GAO r;  1EX4 A;  2ROL A;  4JRP A;  2RN8 A;  1PKT A;  4A4G A;  3BFM A;  2JS2 A;  2D0N A;  3VKI A;  3GLX A;  2HSE B;  2XI9 A;  1M8V A;  1NG2 A;  1DJ7 B;  2FZC B;  3H0I A;  3H8Z A;  3V7S A;  4IUQ A;  3MHX A;  4ZTF A;  1FMW A;  3F70 A;  1WIE A;  4E6R A;  4FU6 A;  3M53 A;  4Y91 A;  4DOV A;  2ZPB B;  4J7F A;  4M77 C;  2COZ A;  1OU8 A;  2BZX A;  1KHI A;  3FJ5 A;  3PVQ A;  2X9H A;  1KFZ A;  1K1Z A;  3NPF A;  4GLK A;  4OP0 A;  3LWH A;  2E65 A;  3H9N A;  2EFI A;  4OF1 A;  1VQO T;  2JM9 A;  2KGT A;  3G7Z A;  1SRL A;  2DA9 A;  4F7U E;  2RA2 A;  4FT2 A;  1AD5 A;  2EKH A;  2VGN A;  2DF6 A;  2DEU A;  4M78 E;  3HPW A;  4ZGJ B;  2ZZD A;  2GTJ A;  1BKB A;  1W1F A;  4M77 D;  2NUP B;  1X43 A;  5GAM e;  5C6S A;  2G6F X;  1E6H A;  4RTU A;  3KBG A;  5IHI A;  3OYH A;  3AT1 B;  1NPR A;  4EIK A;  2LQN A;  4VUB A;  5IAY A;  4CC2 A;  3HKS A;  2KQW A;  2EQJ A;  2E5K A;  2DIQ A;  1HD3 A;  4JS4 A;  1JJ2 P;  1QCN A;  4C0Z A;  3FC3 A;  4ELZ C;  2MAM A;  2E12 A;  3CBO A;  3QPH A;  2CT3 A;  2CSI A;  2ZPF B;  3EAE A;  5J26 A;  1Z9Q A;  1KQS P;  5FRM A;  3O5Z A;  3HRT A;  2J7I A;  4E7L A;  2KMT A;  1M1G A;  4DEY A;  1BI2 A;  3EG1 A;  1VQO Q;  2QAZ A;  3UA7 A;  2RMO A;  3X20 B;  4J6X A;  2FYK A;  1Q95 G;  1GFC A;  1GXI E;  2HD0 A;  2F5K A;  5GJV B;  2CUB A;  4AG1 C;  3LX7 A;  2VB6 A;  1PSE A;  3EGX A;  2WSF E;  2QGF B;  2GF7 A;  4OB0 B;  2OTL A;  2LJ0 A;  2I2L A;  1ZSZ B;  2LDM A;  1VQ9 A;  1UEB A;  4KRT A;  2DL5 A;  3E9G A;  3G1J A;  3X26 B;  3RER A;  1Z9Z A;  1H3H A;  1JRI A;  2CGH A;  2QA4 A;  2JZ2 A;  3OW2 P;  1Q81 R;  2DPP B;  2VXE A;  3P8H A;  3CMA A;  2KDS A;  5C0M A;  2PQW A;  2HKN A;  2CH4 W;  3I55 A;  1VQM A;  1GFD A;  2XG8 D;  5GAM h;  2ED1 A;  2J05 A;  4LDU A;  2GFU A;  1QWF A;  1PM3 A;  4JJC A;  3JCM X;  1UGP B;  5KCO A;  2RD1 A;  3JAM E;  2CYZ B;  4C92 E;  3RKX A;  2FZG B;  1UJ0 A;  2JJ9 A;  1D0Z A;  2AHJ B;  3QYH B;  1ZA1 B;  1X01 A;  2OTL T;  2MMP A;  2MWO A;  5CQX A;  2LQW A;  4XU0 A;  5LL6 S;  1MHN A;  4KGX B;  2FG0 A;  1G3W A;  4LD9 K;  3REB B;  1JQQ A;  1VQ9 T;  1OYX A;  3IQL A;  2QG9 B;  4JJD A;  2DD4 A;  1R77 A;  1A0N B;  2DZ9 A;  2V1Q A;  4B9W A;  3QDF A;  1M2V B;  2EGA A;  3MCA B;  5CR2 A;  4BE0 A;  1JO8 A;  5GAN 5;  3PTA A;  5M9O A;  2QA4 T;  2DXU A;  4UC4 A;  4ORZ A;  3OYL A;  4MZT A;  3NTI A;  3M0P A;  3CMA T;  1D3B B;  5FRN A;  2M02 A;  3I55 T;  1X75 C;  2HL5 C;  1VQM T;  3O8V A;  3I5S A;  3MET A;  4E47 A;  3L42 A;  5FLX E;  2CT4 A;  4X9D A;  3C12 A;  4C92 B;  3CPW S;  3CCM A;  1N9R A;  5LJ3 e;  8ATC B;  2W0Z A;  2ZPH B;  1MUZ A;  4NL3 A;  1I5O B;  2NUP A;  2K2V A;  3VS6 A;  4XK8 E;  2OI3 A;  4LE9 A;  2OTL Q;  3A8H B;  2KNB B;  2P0K A;  2RH2 A;  5CQY A;  4NOY A;  4JZ4 A;  1XNI A;  1HSQ A;  4M7D E;  4WCI A;  4F7U G;  5FU7 B;  2DAQ A;  2DL7 A;  1VQ9 Q;  2EIF A;  4JS5 A;  3JCM g;  1V1C A;  2LP5 A;  4M78 G;  5GMK m;  1BIA A;  2EVR A;  2KSS A;  3I5R A;  4GLM A;  2RHI A;  2C0T A;  2QA4 Q;  1UEC A;  2QTV A;  4O5V A;  4PLI A;  3CMA Q;  3CCS A;  2XDB A;  4A4K A;  3M4Y A;  3CCJ A;  3WVE B;  5GAO p;  2D6F A;  3LH0 A;  3MKD A;  4R56 A;  3I55 Q;  4M4Z A;  4Z89 A;  4EDU A;  1FMK A;  1IRX A;  3CC7 T;  2KRM A;  3EG0 A;  1Y96 B;  4PJO E;  1Y0M A;  4JRK A;  2CZ0 B;  2LQ8 A;  7AT1 B;  2X4J A;  3CME A;  4Q5W A;  4BI8 B;  4C8Q E;  5AYF A;  1GL5 A;  1O9S A;  4M7D B;  2YWW A;  3QYG B;  1YN8 A;  3H6Z A;  3R6N A;  4C0F A;  2FRW A;  1GCQ C;  2EPD A;  2GFA A;  2IIM A;  1QKW A;  3X28 B;  2YRC A;  1NLO C;  2I0N A;  1NE8 A;  1WQW A;  2JTF A;  1ZSZ A;  4BE1 A;  1NBE B;  4BE2 A;  1CKB A;  4N4G A;  2EYZ A;  2K2M A;  1ABQ A;  1TTH B;  3PT9 A;  3SFM A;  1FYN A;  2WSE E;  2DET A;  2DJQ A;  3G71 Q;  3CCE A;  3CCS T;  4KGZ B;  4J9B A;  1KK7 A;  5LJ3 d;  1M3C A;  2KE9 A;  2YUN A;  3OBY A;  3VV0 A;  3RUX A;  1G5V A;  1VOM A;  3CXC S;  3E19 A;  2HZY A;  4E2F B;  1QKX A;  5A0G A;  4PJO B;  2X51 A;  3CCM Q;  2OAU A;  5GAN d;  1UDL A;  2ESW A;  1WHM A;  2JXB A;  2V1R A;  3EHR A;  3QBY A;  5IH2 A;  1K73 R;  3JCM V;  2QQB A;  4C8Q B;  3CME T;  1ZBX A;  1YI2 A;  5IHK A;  3SB2 A;  3ZEH A;  1QP2 A;  1M2O A;  4ME7 A;  1VQN A;  3RNJ A;  3OYN A;  3MEV A;  1Q86 U;  1ZUK A;  3DB4 A;  3VJP A;  2FPE A;  3UA6 A;  5GAN 2;  2GQV A;  1MMG A;  5GJW B;  3G6E A;  2M51 A;  3CPW A;  1SF9 A;  2B8A A;  2KVQ G;  5EC7 A;  1Q7Y R;  3FIF A;  1YWP A;  4C92 G;  2FPF A;  3CCE T;  4KUI A;  1LPL A;  4PJL A;  1ZUU A;  5D6Y A;  1VQ4 T;  2L5Q A;  2A37 A;  1X69 A;  3A98 A;  2KR3 A;  3CCS Q;  4RG8 A;  3REA B;  3CCJ Q;  2XIC A;  1YCY A;  1X6O A;  4FIB A;  1D3B A;  2ECZ A;  4DBQ A;  3TVT A;  2RQR A;  4F04 B;  2V8I A;  1G83 A;  3KUF A;  4C92 A;  3L2Z A;  2GGR A;  3CC4 A;  1KIK A;  2E64 A;  1Q82 R;  1K9M R;  3GF5 A;  3CME Q;  2LT4 A;  2KT1 A;  4N0A A;  5AT1 B;  4FYX B;  3MP8 A;  3HHT B;  1KC8 U;  2MK5 A;  3FB9 A;  5IN1 A;  1U1S A;  1ZBJ A;  3CCV T;  1S1N A;  2P4R A;  4Z88 A;  4PL6 A;  5LJ5 e;  1V76 A;  2X4X A;  4D6W A;  1VQ7 A;  4M7A E;  1KQ2 A;  2VV5 A;  4ZGE B;  3J81 E;  3HFO A;  4LDV A;  4ATO A;  1K73 C;  2LC4 A;  4RCB A;  2KRS A;  4XU2 A;  4BB7 A;  3R6O A;  2MIO A;  4QW2 A;  5KYY B;  4PJJ A;  3QWX X;  1BYM A;  3EFR A;  2E6Z A;  4M7D G;  4HVV A;  2P84 A;  4JRQ A;  4HXJ A;  1X2K A;  4A4F A;  4ZGD B;  3CC4 T;  2JTM A;  1V29 B;  1IHV A;  3MEA A;  1YI2 Q;  2E6N A;  1WHG A;  3QO3 A;  1JXO A;  2EQI A;  3CPF A;  1Y96 A;  4E7J A;  1VQN Q;  4BI3 A;  3CC2 T;  5CVI A;  2E4H A;  2DTI A;  1ZUY A;  4N0A C;  5FU6 B;  4ELY C;  4M7A B;  4M75 C;  2K5I A;  2PZ1 A;  3QZ9 B;  3CCL T;  3MP1 A;  4M7D A;  2CP5 A;  2J06 A;  5DM7 R;  3SHW A;  3CCU Q;  4LDX A;  4FT4 A;  2CSQ A;  2A08 A;  1VYU A;  3G6E Q;  2DX1 A;  3JCM c;  4PJO G;  2DEQ A;  1IB8 A;  4XU3 A;  1Q82 C;  4QVZ A;  1K9M C;  4RUG A;  4L5G A;  1K0X A;  2DL4 A;  4C8Q G;  2V8J A;  5FRO A;  3OYB A;  4PJN A;  2BTT A;  1M1K U;  3JCM f;  5I2S A;  4HT8 A;  1RAE B;  5GAO q;  2DK3 A;  3A8G B;  3LLR A;  2MYS A;  4P5N A;  2X35 A;  4PJO A;  2R5A A;  1Y07 A;  2QI2 A;  2MI6 A;  2DL3 A;  3VYH B;  2L3Q A;  5LJ5 h;  4C8Q A;  1XQH A;  5HY6 A;  2YHT A;  2DRM A;  3RES A;  3BDL A;  2XDD A;  1BIB A;  4QT7 A;  2KRN A;  4C0D B;  5DY9 A;  1S72 A;  2HKQ B;  3CPW P;  1VQ7 Q;  5KE3 A;  1NM7 A;  4F7U F;  2RJC A;  4J83 A;  8AT1 B;  4AFU C;  1UGR B;  3C4S A;  1K8A U;  4M78 F;  2KI7 A;  2XU8 A;  1PRL C;  1H8K A;  4IUR A;  1JXM A;  1X6G A;  1UFF A;  1MV3 A;  3M0S A;  3N5B B;  3QKJ A;  2M16 A;  1W2B S;  1AT1 B;  3QJ6 A;  1K8A R;  1UUE A;  2BUD A;  1QCO A;  2H3E B;  2QDL A;  4KT0 E;  1W70 A;  1VIE A;  3V7R A;  4OMP A;  4ESR A;  1D1B A;  2Z0W A;  1JB0 E;  2HAX A;  4NL2 A;  1TUC A;  3VS3 A;  4C5I A;  1YJW Q;  4LUD A;  3L2R A;  3JB9 J;  3L1A A;  5KYW B;  5GAM j;  2QTX A;  5HKC A;  2DYB A;  2WSC E;  2RK2 A;  1GCP A;  3ASK A;  1VYV A;  1P92 A;  4C5E A;  4ZN1 A;  1LJO A;  3ULR B;  3C0C A;  1KJW A;  2JTE A;  2J6F A;  1AEY A;  1X6B A;  1OUL A;  2XHC A;  1BCO A;  3UPU A;  1D1A A;  5CKB A;  1G8X A;  1OV3 A;  1AWJ A;  1LNX A;  4BY6 B;  1I4K 1;  2EQK A;  3OYI A;  3JCM W;  3TU4 K;  3A1P A;  2YT6 A;  5KYY A;  4DA4 A;  3ZL7 C;  1TXQ A;  3QZ5 B;  4J9H A;  4E7I A;  4XAX B;  2QAS A;  1QVF S;  3EG3 A;  1K76 A;  4M7A G;  1NLP C;  5KYX B;  3DLL A;  3UDC A;  2FRY A;  3RMS A;  2F2W A;  3RKW A;  3G4S Q;  4JZ3 A;  2R5M A;  5GAM g;  4F7U B;  2BE9 B;  2VAS A;  5KYN A;  3H0H A;  1K8A C;  3CBM A;  4QKU A;  3PIP A;  4M78 B;  2M9U A;  2XD0 A;  2ZPE B;  2VWF A;  1S72 Q;  1SKU B;  1MMA A;  2GBQ A;  4OVA A;  4M7A A;  1EIF A;  2F2X A;  1BCM A;  2L3R A;  2RJF A;  3NHN A;  4RTT A;  4J7I A;  1RAF B;  2C0I A;  1VQL A;  1LVK A;  1TSF A;  2D9T A;  2DMO A;  1JU5 C;  2QQ9 A;  3BY7 A;  1NJI U;  3J7A F;  1YNZ A;  4XTU A;  2K9G A;  4R55 A;  4C92 F;  2LRQ A;  2P4T A;  4PLL A;  5HCK A;  4LNP A;  2JS0 A;  1GBQ A;  3BDU A;  4KH1 B;  1SSH A;  4PFO A;  2DO3 A;  3JCM b;  2E41 A;  3GOX A;  5GAO m;  4PJM A;  4J9F A;  3JB9 I;  2DIG A;  2LZ6 B;  2CP0 A;  4HCZ A;  2Y4X A;  1TUG B;  3Q1J A;  1I1J A;  2JMA A;  1PWT A;  1W2B A;  3M9Q A;  2GCX A;  1C0M A;  5GAM d;  2X3X D;  5GAN 4;  4J5Y A;  2QQS A;  4RTW A;  3CCQ Q;  3GIB A;  1OPL A;  4LD6 A;  1OQK A;  2GNC A;  4JUV A;  2DD5 A;  4J8O A;  4HA8 A;  1N27 A;  1IHW A;  3CD6 A;  3OYC A;  4F17 A;  4CC7 A;  2J6K A;  2HSP A;  1FMV A;  2D1X A;  1YIJ A;  1B3Q A;  3GNF B;  2FO0 A;  3M0U A;  2QGG A;  1RLP C;  3SWN B;  2CZ7 B;  4OMF B;  3TQ7 P;  2KK4 A;  4OGE A;  3L2V A;  1OZ3 A;  4J9C A;  2ATC B;  4C5H A;  1U8R A;  1W4S A;  1I0C A;  3VRY A;  1PNJ A;  1WDX A;  4M7D F;  1VQK A;  1M30 A;  4ZNX A;  4M75 E;  5LJ3 j;  1HYO A;  5CKD A;  3G71 A;  4FSX A;  3H0F A;  3QHS A;  1M3B A;  1M9S A;  3OMG A;  5KYW A;  2M1H A;  2F69 A;  1NJI C;  2DKG A;  1YIT A;  5GAN j;  4N4I A;  4RTX A;  2A36 A;  1QVF A;  2KXC A;  3EH2 A;  2A0F B;  3VS1 A;  4CC3 A;  5CKE A;  1MV0 B;  1VQL Q;  5GMK e;  3S3N A;  1ZX6 A;  4Z8A A;  2KEA A;  3MEW A;  5HK0 A;  4PJO F;  3SD4 A;  2YRD A;  1WXT A;  1D1C A;  3PNW C;  1PD1 A;  3M55 A;  2DE0 X;  1WGS A;  2QQR A;  3P8B B;  4ANJ A;  4C8Q F;  5CCA A;  4PNO A;  2G3R A;  1VQK T;  2NUZ A;  1UTI A;  5ECA A;  2O9V A;  1AWW A;  3OS1 A;  3HTR A;  2DIL A;  3OYG A;  2L2P A;  3LW5 E;  3G71 T;  5IHN A;  1VQ6 Q;  2EYQ A;  5LJ3 g;  3VUB A;  1PG5 B;  2HDA A;  4R0K A;  3JB9 H;  3V8J A;  4PK4 A;  1SPK A;  4EMK B;  4F7U A;  1YJ9 A;  1VUB A;  2AK5 A;  2HL3 A;  5GAN g;  3CCM T;  5KYU B;  2E10 A;  2NYS A;  4M78 A;  3CD6 Q;  1M90 U;  4A63 B;  4AFS C;  4D8D A;  2PTK A;  4C5G A;  4AFQ C;  1YIJ Q;  3M54 A;  3JSC A;  3OBW A;  4OB1 B;  2VC8 A;  3EH1 A;  2E1H A;  3OS5 A;  1M27 C;  2RQT A;  5IXB A;  5CO7 A;  3JB9 F;  4M77 E;  5CKH A;  2YLB A;  5FWB A;  3GBQ A;  1QMC A;  4MML A;  4QQG A;  3AHU A;  5EG2 A;  1VQK Q;  3MJX A;  1SHF A;  2EKO A;  4IUV A;  4J9D A;  1F1B B;  3TSZ A;  2OTJ A;  2D8H A;  2XK0 A;  1U1T A;  3CCJ T;  1YJ9 T;  2RJD A;  1YIT Q;  1N8R U;  1JJ2 S;  2VYT A;  5GMK h;  3VRZ A;  2JM8 A;  2X4Y A;  4EMG A;  4KH0 B;  2K3Y A;  1J3T A;  1N8R R;  1RUW A;  3VS4 A;  2DER A;  3JCM h;  5I11 A;  1KQS S;  4JJB A;  2WAC A;  5GAM f;  1PSF A;  3RR6 A;  4BD3 A;  2COW A;  3JCM J;  4M77 B;  1N5Z A;  4FYW B;  5J3B A;  2LCS A;  1TS9 A;  1WJR A;  3M5A A;  2OX7 A;  2RHX A;  5CK9 A;  2O9S A;  4JPB W;  3EG2 A;  3SWN A;  2DZC A;  3CCU A;  1Q86 R;  2ROT A;  3E2U A;  2F2V A;  2K3B A;  1LCK A;  3OYA A;  1ZSZ C;  4M78 D;  4N4H A;  4D8K A;  1Y71 A;  4M7A F;  3NFC A;  4XU1 A;  1M2V A;  2OTJ T;  2OAW A;  1KHC A;  5CKF A;  1MND A;  1M90 C;  3JRZ A;  4E7Z A;  3HSB A;  2ABL A;  1YWO A;  4HCB A;  2V26 A;  2HBP A;  2DLP A;  2K7A A;  1YJ9 Q;  4XTY A;  2RQV A;  2RQU A;  1K9A A;  2JT4 A;  4HVU A;  3OB9 A;  1D0X A;  2LQK A;  4JJN K;  1ZQ1 A;  2PVD B;  5LJ5 j;  2FB7 A;  4IUU A;  1NYG A;  1YI2 T;  4IIM A;  2A3L A;  1TH7 A;  2FEI A;  1VQN T;  2YUO A;  4M75 G;  2Y90 A;  2JNG A;  2PUO B;  2B86 A;  2IVW A;  2RF0 A;  3V8L A;  1VQ5 A;  3CCU T;  1M1F A;  1RAH B;  3HP9 A;  4JLI A;  4X1V A;  3G6E T;  1KC8 R;  3ME9 A;  1BBZ A;  1TUD A;  4L59 A;  1N8R C;  5DLO A;  5L8R E;  2JUF A;  2QDY B;  3M0R A;  2FPD A;  2OTJ Q;  2HQH A;  1IZ6 A;  4OB3 B;  4QVD A;  3OYM A;  5A0D A;  3QSU A;  2CP2 A;  2CH4 A;  2DTH A;  2W10 A;  3OQ5 A;  3DB3 A;  1K0S A;  1T0J A;  3M56 A;  1X27 A;  4RMO A;  2RI2 A;  4EMK A;  4OMM A;  1TU0 B;  1Q86 C;  5LJ5 g;  1WNL A;  3A8O B;  1PRM C;  5KYU A;  1YJW A;  2CRE A;  4MZM A;  3M58 A;  3KXT A;  1AWX A;  3FRN A;  4C92 C;  3OYK A;  1QLY A;  3DLM A;  4LDY A;  3CCR A;  4X9C A;  3JCM Q;  3INZ A;  4HCK A;  1YJN A;  1WJQ A;  3LH5 A;  6AT1 B;  1OX8 A;  3HL8 A;  3CQT A;  1OOT A;  1H92 A;  1UJY A;  1VQ7 T;  3OYY A;  3DKM A;  1JJ2 A;  1WHH A;  1K4U S;  1AZE A;  3CXC A;  2JVV A;  4F14 A;  1KQ1 A;  5CIU A;  2YDL A;  1RAA B;  5GAN 3;  1XOV A;  4J6Y A;  4BUG A;  5FU7 C;  4C92 D;  2RHZ A;  4OB2 B;  1VQP A;  2DNU A;  2CP7 A;  4RG2 A;  1RAG B;  1B7T A;  1GBR A;  1SHG A;  4XTX A;  2P0Q A;  4M77 G;  4QVC A;  1E7O A;  1WYX A;  1UG1 A;  2JOY A;  2DM1 A;  1KC8 C;  2RI3 A;  4AT1 B;  2Y4Y A;  1WZO A;  1YJW T;  2QEX Q;  1M1K R;  5LJ3 f;  1UGS B;  3A5Z B;  5HK3 A;  2YUP A;  1NZ9 A;  4JDS A;  5LJ5 d;  2ENM A;  1IRE B;  3CCR T;  3G4S A;  2O88 A;  1YJN T;  3MPU B;  5GAO n;  1FX7 A;  1HK9 A;  2K79 A;  1IXD A;  3S6W A;  5GAN f;  1WFW A;  1T3L A;  4M77 A;  1VQ5 Q;  2PUK B;  3OS0 A;  2YSQ A;  1RAC B;  2KRO A;  2MPX C;  2RHY A;  2ZCF B;  4XTZ A;  2DBK A;  2DBM A;  2F1L A;  4M7D C;  3RMQ A;  2IPO B;  5FWC A;  2DVE A;  1U3O A;  1C1A A;  3MP6 A;  1OU9 A;  1VQP T;  3HRS A;  5D6X A;  2LMJ A;  5GAN 7;  3JB9 G;  2YXY A;  1EFN A;  1VYT A;  2K6D A;  1WA7 A;  3VUZ A;  2FVU A;  2LJ1 A;  3UWN A;  5GAO l;  4A4E A;  1WHK A;  3HRU A;  4L6V 5;  2EJG A;  4BI4 A;  1BU1 A;  4M7D D;  2BZ8 A;  3QDR B;  3QG1 A;  2D0Q B;  3EHQ A;  3S3M A;  2EYW A;  3G4S T;  2LX9 A;  4AFZ C;  4PJO C;  2KY9 A;  3QWY A;  3A8M B;  1N6A A;  1UHF A;  3CCR Q;  4J9G A;  2XDP A;  1YJN Q;  4ZTJ A;  2KXD A;  1S72 T;  4X34 A;  4C8Q C;  4HVW A;  1NEB A;  3CCQ A;  1I8F A;  2EAY A;  3QII A;  4RKU E;  4XTW A;  2XID A;  1YHQ A;  1KSW A;  1M1K C;  3RIR A;  1W6X A;  2ZGW A;  1UHC A;  4PJO D;  2COY A;  2KYB A;  2P0P A;  1VQP Q;  2ZPG B;  3M59 A;  5KCH A;  3C94 A;  2X3W D;  1B34 B;  4HT9 A;  1XTD A;  4FYY B;  1TG0 A;  3CEY A;  2CKK A;  5D6W A;  2O31 A;  2CP3 A;  4LN2 A;  4C8Q D;  3OYD A;  4LXC A;  4Z02 A;  1BI0 A;  3M57 A;  3TCJ A;  4IUT A;  4AMC A;  1QQJ A;  4Y28 E;  3PE0 A;  3RDV A;  2LNH B;  3PVL A;  3X25 B;  4FCY A;  5A0L A;  3L2Q A;  1YCS B;  2QK0 A;  3UT1 A;  1G3T A;  4IKF A;  1ZA2 B;  4XTV A;  2E70 A;  1Y57 A;  4RTZ A;  2RK1 A;  1XJW B;  4DBR A;  3THK A;  2DFU A;  1RI0 A;  1CKA A;  1M3A A;  3CXC P;  2DYI A;  3CCQ T;  1QVG S;  1PC0 A;  4FL6 A;  4PKC C;  3UF4 A;  3S3O A;  1YHQ T;  2A28 A;  1UGV A;  2VGM A;  1PHT A;  2L8D A;  1WQ7 A;  4BDZ A;  1OI1 A;  3FEO A;  3I56 A;  4KBM B;  5L23 A;  2JN0 A;  1G3Y A;  3EGD B;  3JB9 D;  4FW2 A;  1PD0 A;  1NJI R;  1NYF A;  5I22 A;  2HMA A;  5GMK l;  2CP6 A;  4DQ2 A;  1UB4 A;  2LJ3 A;  3VS0 A;  4DEX A;  5IT9 E;  4A53 A;  4JLG A;  3KFV A;  1MMD A;  4BDY A;  2MWP A;  4YTL A;  3ER0 A;  3RBB B;  4DBF A;  3NGP A;  3D7S B;  4OML A;  1VQ6 A;  3FLG A;  4B6M A;  2EBP A;  4LDW A;  1MNE A;  2RHU A;  4OMO A;  4PFP A;  2V8K A;  3HFN A;  2CUD A;  3FJP A;  4M75 F;  3QJY A;  1H3Z A;  1WHJ A;  2VXF A;  2L3P A;  3URG A;  2PU9 B;  4GBQ A;  1D0Y A;  1Q81 U;  2K5L A;  5LJ5 f;  1VQL T;  1IGQ A;  1SG5 A;  3NTK A;  1YHQ Q;  5FU6 C;  4WTO B;  1AWO A;  4M7A C;  3I9Q A;  3I56 T;  3QUI A;  2GTO A;  3VS2 A;  2HQE A;  2HEQ A;  3PMI A;  1RL2 A;  2RO0 A;  2L3S A;  2H8H A;  2HCK A;  3L2W A;  2VUB A;  2C0O A;  2DXC A;  5I21 A;  1BI1 A;  1I81 A;  3OY9 A;  2K5F A;  2NLU A;  1WI7 A;  2DL8 A;  4C0G A;  2F5T X;  1IGU A;  2M0Y A;  3LWI A;  1VQ6 T;  4M7A D;  2QYZ A;  2K57 A;  5GMK j;  1VQ8 A;  2O4X B;  2CDT A;  4IIO A;  1OZ2 A;  2AT1 B;  2FZK B;  4TVR A;  4MMK A;  2QXF A;  2EGE A;  4K11 A;  3RKY A;  1ABO A;  2DXT A;  1FWZ A;  2KT8 A;  4FW1 A;  2BE7 D;  2DVJ A;  2KAF A;  3SEM A;  3M0Q A;  2BIV A;  3CD6 T;  1M8M A;  3PIO A;  3ZBD A;  1OX9 A;  1QP3 A;  1R8O B;  2C06 A;  2AKK A;  3C95 A;  1YIJ T;  1PKS A;  2EYY A;  4C0D C;  3I56 Q;  4GY5 A;  1EZZ B;  2RPN A;  2VKN A;  3JCM e;  5J39 A;  2ED0 A;  2E5Q A;  1WX6 A;  2FHD A;  3PFS A;  2K3X A;  1QVG A;  1B34 A;  2EQU A;  1AVZ C;  2R58 A;  4M77 F;  3CC7 A;  4M75 B;  1ACM B;  3OS2 A;  1MMN A;  3LGL A;  3VS7 A;  5A2Q E;  1AZG B;  2YUQ A;  1RAI B;  2SEM A;  1VQ8 T;  1GCQ A;  3JV3 A;  1G3S A;  1Q81 C;  5GAN e;  5KYX A;  1IO6 A;  1U5S A;  3BW1 A;  3MO8 A;  2PVG B;  4Y92 A;  4KUL A;  1YIT T;  3TRE A;  3LYI A;  3I35 A;  1R0B G;  3OSV A;  1UE9 A;  4OMQ A;  3V8K A;  9ATC B;  4KGV B;  2IG0 A;  1SEM A;  3GPL A;  2KBT A;  4F16 A;  1JBM A;  2EQM A;  4QQD A;  1R0C B;  2LVM A;  3PGG A;  4DBH A;  2OJ2 A;  2L0A A;  4RTY A;  2RI5 A;  2E3I A;  2EYX A;  4NS5 A;  2DTO A;  2HNI A;  1M90 R;  1OPK A;  3OYE A;  3VYG A;  1BK2 A;  2SRC A;  1VQM Q;  2AIR B;  1ZSG A;  3V7C A;  2RNA A;  4DOW A;  3PMT A;  1C6V X;  3EGD A;  4BY6 C;  4IUP A;  2NUT B;  2YRV A;  1FXX A;  2JMC A;  1RI9 A;  1UGQ B;  3EG9 B;  1MGQ A;  3E9F A;  1CSK A;  4OGC A;  1VQ8 Q;  1SSF A;  1W2B P;  3OSS C;  1PCX A;  2AZS A;  4ZN3 A;  2MF2 A;  1WXB A;  2LCL A;  5KE2 A;  2XKO C;  2O01 E;  3U23 A;  5GAN 8;  3JCM d;  1RAB B;  4E7K A;  4M78 C;  4JRI A;  1VQ4 A;  2X4W A;  3MEU A;  2D8J A;  1I07 A;  2QQA A;  5LJ3 h;  1K73 U;  1BB9 A;  2LTO A;  4MDW A;  1VIF A;  2ZPI B;  2EJF A;  3A8L B;  1WPY A;  4A54 A;  2EJ9 A;  2MOX A;  3EFO B;  1TWB A;  5GAN h;  3CC7 Q;  3L2U A;  1TOV A;  1SRM A;  3WVD B;  1WJS A;  3TEE A;  1WLP B;  1M5Q 1;  4PFZ A;  5KH6 A;  4CRI A;  3T9N A;  1Q7Y U;  1M4Z A;  2EW3 A;  1E6G A;  2O4X A;  3OMC A;  3CCV A;  3H41 A;  4II1 A;  1QVF P;  3E1S A;  4BAC A;  4FM4 B;  2J6O A;  5CAI A;  2L89 A;  2EWN A;  3VU3 C;  2VVK A;  2PVO B; 
#chains in the Genus database with same CATH homology
 3OS0 A;  2RB6 A;  3X24 B;  2EIF A;  4R55 A;  4JS5 A;  4C92 F;  3JCM g;  3OW2 S;  2RHY A;  4J6W A;  4M78 G;  2ZCF B;  1BIA A;  5GMK m;  4RCC A;  4XTZ A;  1QW1 A;  2KSS A;  2LRQ A;  4M7D C;  3RMQ A;  2RHI A;  2P4T A;  2DVE A;  4PLL A;  1QVP A;  1KD1 U;  3MP6 A;  1VQP T;  1Q82 U;  3HRS A;  1K9M U;  3BDU A;  5D6X A;  4O5V A;  1H64 1;  4PLI A;  5GAN 7;  2DO3 A;  3JCM b;  2E41 A;  3GOX A;  3CCS A;  4B9X A;  5GAO m;  3JB9 G;  2XDB A;  4A4K A;  3M4Y A;  3JB9 I;  3CCJ A;  3WVE B;  5GAO p;  2D6F A;  2DIG A;  3SWN C;  3LH0 A;  3VUZ A;  4WF2 A;  2FVU A;  1N9S A;  4R56 A;  3UWN A;  5GAO l;  4A4E A;  4CI0 C;  4EDU A;  4HCZ A;  2CS7 A;  2Y4X A;  3HRU A;  3J80 E;  4L6V 5;  3Q1J A;  4M75 A;  4MDX A;  2EJG A;  3CC7 T;  4BI4 A;  3CC2 A;  1Y96 B;  4M7D D;  1W2B A;  4PJO E;  3M9Q A;  2GCX A;  3QG1 A;  3QDR B;  4EPC A;  3NTH A;  5GAM d;  2D0Q B;  2A7Y A;  5GAN 4;  4JRK A;  4J5Y A;  2CZ0 B;  2LQ8 A;  3S3M A;  3CCL A;  2QQS A;  2X4J A;  3G4S T;  3CME A;  2LX9 A;  4Q5W A;  3GIB A;  4BI8 B;  4LD6 A;  4C8Q E;  5AYF A;  4PJO C;  2KY9 A;  1AHJ B;  1NPP A;  1N6A A;  1O9S A;  2DD5 A;  3A8M B;  4HA8 A;  4J8O A;  1Y7X A;  1N27 A;  2CZ1 B;  2DXB A;  2LCC A;  3QYG B;  3H6Z A;  4KUD K;  3CD6 A;  3OYC A;  2XDP A;  4C0F A;  4E7H A;  2QEX T;  4O6J A;  5I2M A;  4ZTJ A;  2GFA A;  3X28 B;  1S72 T;  5FU7 B;  4X34 A;  4C8Q C;  1NE8 A;  1ZHI A;  1YIJ A;  1WQW A;  3GNF B;  2JTF A;  4BE1 A;  4BE2 A;  3CCQ A;  1I8F A;  2EAY A;  3QII A;  4N4G A;  4RKU E;  5GAN 6;  3SWN B;  4XTW A;  2CZ7 B;  1HXD A;  4OMF B;  3PT9 A;  3SFM A;  2XID A;  2WSE E;  4XQ3 A;  2KK4 A;  1YHQ A;  1VQ5 T;  4MZP A;  4OGE A;  1M1K C;  3L2V A;  3RIR A;  5DLQ E;  1OZ3 A;  2ZGW A;  3SDZ A;  3CCE A;  3CCS T;  3EFS A;  4PJO D;  4C5H A;  1U8R A;  2P0P A;  1W4S A;  4XTU A;  4QQ6 A;  5LJ3 d;  2ZPG B;  3M59 A;  3FDR A;  3GNG A;  5KCH A;  3C94 A;  1Q7Y C;  4M7D F;  1B34 B;  1VQK A;  3OBY A;  1XTD A;  4HT9 A;  3VV0 A;  3RUX A;  4M77 A;  1G5V A;  3CEY A;  2CKK A;  5D6W A;  3CXC S;  3E19 A;  4M75 E;  4C8Q D;  3OYD A;  5LJ3 j;  4Z02 A;  5A0G A;  4PJO B;  1BI0 A;  2YLC A;  3M57 A;  3TCJ A;  3OYF A;  5CKD A;  4IUT A;  3G71 A;  3LGF A;  4FSX A;  2RM4 A;  1KQS A;  2OAU A;  5GAN d;  4V2S A;  3QBY A;  3QHS A;  4Y28 E;  1M9S A;  2M0O A;  3OMG A;  3X25 B;  4EMH A;  2M1H A;  2QEX A;  2F69 A;  2QQB A;  3JCM V;  1NJI C;  4C8Q B;  2DKG A;  1YIT A;  3CME T;  5A0L A;  3L2Q A;  1ZBX A;  1YI2 A;  5GAN j;  4N4I A;  3UT1 A;  1G3T A;  4IKF A;  3OYJ A;  3SB2 A;  3ZEH A;  1QP2 A;  4XTV A;  2E70 A;  4ME7 A;  1VQN A;  1QVF A;  1O75 A;  3OYN A;  2RK1 A;  1KG1 A;  3MEV A;  1Q86 U;  5CKE A;  3DB4 A;  3VJP A;  5GMK e;  1RI0 A;  3ZFJ A;  3S3N A;  1KD1 C;  3CCQ T;  1QVG S;  3MEW A;  4EMK C;  5HK0 A;  4FL6 A;  4PJO F;  1LOJ A;  5GAN 2;  2GQV A;  2K4Y A;  3SD4 A;  3GP8 A;  3G6E A;  4PKC C;  3CPW A;  3JCM P;  3S3O A;  1YHQ T;  2B8A A;  2KVQ G;  2VGM A;  3PNW C;  2L8D A;  3FIF A;  4M75 D;  3M55 A;  1WGS A;  2LT1 A;  4C92 G;  2R57 A;  2QQR A;  3CBP A;  3P8B B;  4KUI A;  3CCE T;  4C8Q F;  1WQ7 A;  3WXM B;  4BDZ A;  5D6Y A;  2FL7 A;  5CCA A;  1I5L A;  1VQ4 T;  2CZ6 B;  1OI1 A;  2L5Q A;  3FEO A;  4HKE A;  4PNO A;  2BKD N;  4KBM B;  2G3R A;  3I56 A;  1VQK T;  4RG8 A;  2JN0 A;  1YBY A;  1G3Y A;  2HQX A;  4HCC A;  3JB9 D;  1BI3 A;  2XIC A;  3OS1 A;  3OYG A;  1YCY A;  2LNV A;  3LW5 E;  1X6O A;  4FIB A;  3G71 T;  5GMK l;  1D3B A;  2EYQ A;  4A4H A;  4DQ2 A;  5LJ3 g;  1UB4 A;  3VUB A;  2V8I A;  3OA6 A;  3JB9 H;  2DJZ A;  3M4G A;  3V8J A;  3OW2 A;  5IT9 E;  1VQO A;  4A53 A;  4JLG A;  3KUF A;  4C92 A;  3L2Z A;  4BDY A;  3QXE B;  2MWP A;  3P8D A;  4YTL A;  5GMK i;  2H3J A;  2RJE A;  3ER0 A;  4EMK B;  3CC4 A;  4F7U A;  1YJ9 A;  1VUB A;  2E64 A;  5GAO r;  3GF5 A;  5GAN g;  2LT4 A;  1VQ6 A;  3FLG A;  4N0A A;  3CCM T;  4JRP A;  4LDW A;  2RHU A;  3MP8 A;  3HHT B;  2E10 A;  4A4G A;  2V8K A;  4M78 A;  1KC8 U;  3HFN A;  3BFM A;  1M90 U;  3FJP A;  3FB9 A;  4M75 F;  5IN1 A;  3QJY A;  1U1S A;  3VKI A;  1H3Z A;  3GLX A;  4C5G A;  2XI9 A;  3CCV T;  1M8V A;  2VXF A;  4PL6 A;  3URG A;  5LJ5 e;  2PU9 B;  2X4X A;  3M54 A;  4D6W A;  1DJ7 B;  3JSC A;  1VQ7 A;  3OBW A;  4M7A E;  4OB1 B;  2VC8 A;  1KQ2 A;  1Q81 U;  2VV5 A;  3H8Z A;  2K5L A;  5LJ5 f;  2E1H A;  3OS5 A;  4ZGE B;  3J81 E;  3HFO A;  1VQL T;  4LDV A;  3V7S A;  4ATO A;  5CO7 A;  1K73 C;  3JB9 F;  4M77 E;  2LC4 A;  4IUQ A;  3NTK A;  3MHX A;  4ZTF A;  4RCB A;  3F70 A;  5CKH A;  5FU6 C;  2YLB A;  4M7A C;  3I56 T;  4FU6 A;  3QUI A;  4XU2 A;  4BB7 A;  3R6O A;  3M53 A;  4Y91 A;  4DOV A;  4QW2 A;  4MML A;  2ZPB B;  4QQG A;  4J7F A;  4M77 C;  3AHU A;  5EG2 A;  1BYM A;  2HQE A;  2EKO A;  1KHI A;  4IUV A;  3EFR A;  3PMI A;  1RL2 A;  2E6Z A;  2RO0 A;  4GLK A;  4OP0 A;  3L2W A;  2VUB A;  2DXC A;  5I21 A;  3LWH A;  2E65 A;  4M7D G;  1BI1 A;  1I81 A;  2EFI A;  2K5F A;  4OF1 A;  3OY9 A;  1VQO T;  2NLU A;  3G7Z A;  4JRQ A;  2OTJ A;  2XK0 A;  4A4F A;  1U1T A;  4C0G A;  4ZGD B;  3CCJ T;  2F5T X;  4F7U E;  3LWI A;  3CC4 T;  2RA2 A;  1YJ9 T;  2JTM A;  2RJD A;  1V29 B;  4FT2 A;  1VQ6 T;  3MEA A;  1N8R U;  4M7A D;  2E6N A;  2VGN A;  2VYT A;  5GMK h;  3QO3 A;  1JJ2 S;  4M78 E;  2X4Y A;  3CPF A;  2ZZD A;  1Y96 A;  3HPW A;  4ZGJ B;  4E7J A;  2K57 A;  4BI3 A;  5GMK j;  4EMG A;  1BKB A;  1VQ8 A;  2O4X B;  3CC2 T;  2K3Y A;  1OZ2 A;  4M77 D;  5CVI A;  2DTI A;  4N0A C;  4TVR A;  4MMK A;  5FU6 B;  2QXF A;  5GAM e;  4ELY C;  4M7A B;  3JCM h;  5C6S A;  4M75 C;  2K5I A;  3QZ9 B;  3RKY A;  3CCL T;  2DXT A;  1KQS S;  3KBG A;  3MP1 A;  1FWZ A;  2WAC A;  5GAM f;  4M7D A;  1PSF A;  5DM7 R;  3OYH A;  4LDX A;  4FT4 A;  2KAF A;  4BD3 A;  1NPR A;  3JCM J;  4M77 B;  2BIV A;  3CD6 T;  4VUB A;  5J3B A;  5IAY A;  3PIO A;  3HKS A;  2KQW A;  3JCM c;  3ZBD A;  1R8O B;  1QP3 A;  4PJO G;  2C06 A;  1WJR A;  2EQJ A;  3M5A A;  2DEQ A;  2DIQ A;  3C95 A;  1YIJ T;  2RHX A;  4JS4 A;  5CK9 A;  4XU3 A;  4C0Z A;  3FC3 A;  3SWN A;  4QVZ A;  2DZC A;  2MAM A;  2E12 A;  4C0D C;  4L5G A;  4ELZ C;  4GY5 A;  3CCU A;  1K9M C;  3CBO A;  3QPH A;  4C8Q G;  2V8J A;  5FRO A;  3JCM e;  2ZPF B;  3OYA A;  3EAE A;  5J39 A;  5J26 A;  3OYB A;  2E5Q A;  4M78 D;  4N4H A;  1M1K U;  1Y71 A;  4M7A F;  3JCM f;  2FHD A;  3NFC A;  5I2S A;  5FRM A;  4HT8 A;  4XU1 A;  3PFS A;  2K3X A;  2OTJ T;  3HRT A;  5GAO q;  1QVG A;  2DK3 A;  1B34 A;  2EQU A;  2KMT A;  4JUV A;  3A8G B;  4E7L A;  1KHC A;  1M1G A;  2R58 A;  5CKF A;  1BI2 A;  4M77 F;  1M90 C;  3LLR A;  3JRZ A;  3CC7 A;  4P5N A;  4M75 B;  2X35 A;  3HSB A;  3OS2 A;  4PJO A;  3X20 B;  3LGL A;  2R5A A;  4J6X A;  1Y07 A;  5A2Q E;  4HCB A;  2HBP A;  2QI2 A;  2FYK A;  1VQ8 T;  4XTY A;  1G3S A;  2MI6 A;  1Q81 C;  1GXI E;  3VYH B;  5GAN e;  2HD0 A;  5LJ5 h;  3OB9 A;  4C8Q A;  3BW1 A;  1XQH A;  5HY6 A;  2LQK A;  4JJN K;  1ZQ1 A;  2PVD B;  2F5K A;  2YHT A;  3MO8 A;  3BDL A;  3RES A;  2FB7 A;  2PVG B;  4IUU A;  5LJ5 j;  2XDD A;  4KUL A;  1YIT T;  3TRE A;  1BIB A;  3LYI A;  1YI2 T;  3LX7 A;  1PSE A;  2A3L A;  3OSV A;  4C0D B;  5DY9 A;  1S72 A;  1TH7 A;  3V8K A;  2WSF E;  1VQN T;  4M75 G;  2Y90 A;  5KE3 A;  2GF7 A;  4F7U F;  2RJC A;  2IG0 A;  4OB0 B;  2OTL A;  4J83 A;  2I2L A;  2JNG A;  3GPL A;  1UGR B;  3C4S A;  1K8A U;  1JBM A;  2PUO B;  4M78 F;  2EQM A;  2IVW A;  2XU8 A;  3V8L A;  1VQ5 A;  4QQD A;  2LDM A;  2LVM A;  3PGG A;  4IUR A;  3CCU T;  1VQ9 A;  1M1F A;  1UEB A;  2RI5 A;  3HP9 A;  4JLI A;  4NS5 A;  3G6E T;  3N5B B;  2DTO A;  2HNI A;  2M16 A;  3QKJ A;  1W2B S;  3E9G A;  3QJ6 A;  3X26 B;  3OYE A;  3VYG A;  3ME9 A;  2BUD A;  3RER A;  1JRI A;  4L59 A;  1N8R C;  4KT0 E;  5DLO A;  5L8R E;  3V7C A;  4DOW A;  1Q82 C;  2CGH A;  2JUF A;  1VIE A;  3V7R A;  3PMT A;  2QA4 A;  2JZ2 A;  2QDY B;  2DPP B;  2VXE A;  3P8H A;  1JB0 E;  2KDS A;  4IUP A;  4BY6 C;  3CMA A;  4OB3 B;  1IZ6 A;  2HAX A;  2YRV A;  4NL2 A;  4QVD A;  3OYM A;  5A0D A;  2PQW A;  4C5I A;  5C0M A;  3QSU A;  3L2R A;  3JB9 J;  1FXX A;  3L1A A;  3I55 A;  1VQM A;  2XG8 D;  5GAM h;  1UGQ B;  2DTH A;  4LDU A;  1MGQ A;  2GFU A;  3JCM X;  1UGP B;  3DB3 A;  3E9F A;  3OQ5 A;  2QTX A;  4OGC A;  5KCO A;  5GAM j;  2RD1 A;  5HKC A;  1SSF A;  2WSC E;  3M56 A;  3JAM E;  2CYZ B;  2RK2 A;  4C92 E;  4RMO A;  2RI2 A;  4EMK A;  3OSS C;  1Q86 C;  3ASK A;  3RKX A;  1WNL A;  1P92 A;  3A8O B;  5LJ5 g;  4C5E A;  4ZN1 A;  1LJO A;  1YJW A;  4ZN3 A;  4MZM A;  2AHJ B;  3QYH B;  2MF2 A;  3M58 A;  3KXT A;  1X01 A;  2OTL T;  2LCL A;  2MMP A;  2MWO A;  5CQX A;  5KE2 A;  3FRN A;  4C92 C;  4XU0 A;  2XKO C;  5LL6 S;  2O01 E;  1MHN A;  4LDY A;  2XHC A;  3DLM A;  3OYK A;  1G3W A;  5GAN 8;  4X9C A;  3CCR A;  3JCM d;  3INZ A;  3JCM Q;  3UPU A;  4LD9 K;  1YJN A;  5CKB A;  1WJQ A;  3HL8 A;  1VQ9 T;  1OYX A;  4E7K A;  4M78 C;  2DD4 A;  1VQ7 T;  3OYY A;  3DKM A;  1JJ2 A;  4JRI A;  1LNX A;  2DZ9 A;  4BY6 B;  3CXC A;  2X4W A;  3MEU A;  4B9W A;  1VQ4 A;  2JVV A;  1I4K 1;  3MCA B;  2QQA A;  1KQ1 A;  5CR2 A;  2EQK A;  4BE0 A;  5CIU A;  5LJ3 h;  3OYI A;  1K73 U;  5GAN 5;  3JCM W;  3PTA A;  3TU4 K;  5GAN 3;  5M9O A;  2QA4 T;  1XOV A;  2DXU A;  4J6Y A;  4UC4 A;  2LTO A;  4DA4 A;  3QZ5 B;  4MZT A;  3NTI A;  4MDW A;  3OYL A;  4E7I A;  1VIF A;  4XAX B;  5FU7 C;  4BUG A;  2ZPI B;  3CMA T;  1QVF S;  2EJF A;  4C92 D;  2RHZ A;  4OB2 B;  3A8L B;  1D3B B;  1WPY A;  1VQP A;  5FRN A;  4M7A G;  4A54 A;  2EJ9 A;  4RG2 A;  3DLL A;  5GAN h;  3I55 T;  1X75 C;  3L2U A;  1VQM T;  3O8V A;  3MET A;  4E47 A;  3UDC A;  3L42 A;  4XTX A;  3WVD B;  5FLX E;  2P0Q A;  4X9D A;  4M77 G;  4QVC A;  3C12 A;  4C92 B;  1WJS A;  3RMS A;  3RKW A;  2JOY A;  3TEE A;  2R5M A;  5GAM g;  4F7U B;  3CPW S;  3CCM A;  1N9R A;  5LJ3 e;  1M5Q 1;  1KC8 C;  2RI3 A;  5KH6 A;  2Y4Y A;  2ZPH B;  4CRI A;  3T9N A;  1YJW T;  1Q7Y U;  1K8A C;  1M4Z A;  3CBM A;  3PIP A;  5LJ3 f;  1UGS B;  4M78 B;  2M9U A;  2XD0 A;  2ZPE B;  4NL3 A;  3A5Z B;  2O4X A;  3OMC A;  5HK3 A;  3CCV A;  1NZ9 A;  4II1 A;  4JDS A;  2K2V A;  4XK8 E;  3E1S A;  5LJ5 d;  1IRE B;  3CCR T;  4BAC A;  3G4S A;  4OVA A;  4FM4 B;  1YJN T;  4M7A A;  3A8H B;  5CAI A;  1EIF A;  2L3R A;  2P0K A;  2RH2 A;  2RJF A;  2L89 A;  1FX7 A;  1HK9 A;  2EWN A;  5CQY A;  4J7I A;  5GAO n;  4NOY A;  3VU3 C;  3S6W A;  1VQL A;  5GAN f;  1XNI A;  4M7D B;  2D9T A;  4M7D E;  4F7U G;  2QQ9 A;  3BY7 A;  1NJI U;  2PVO B;  3J7A F;  2DAQ A;  2PUK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...