1PC0A

Nmr structure of the archaeal homologue of rnase p protein rpp29
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
61
structure length
61
Chain Sequence
GLMVEVVESPNHSEVGIKGEVVDETQNTLKIMTEKGLKVVAKRGRTFRVWYKGKIMRIKGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Hypothetical protein AF1917
publication title NMR Structure of an Archaeal Homologue of Ribonuclease P Protein Rpp29
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 6
structure length 61
sequence length 61
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2003-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.210 Mainly Beta Roll SH3 type barrels. Ribonuclease P/MRP, subunit p29 1pc0A00
2ZAEA 1OQKA 1PC0A 1TS9A 1TSFA 2KI7A 1V76A
chains in the Genus database with same CATH superfamily
4C92B 1D1AA 1MV3A 1H3ZA 1Q81C 4O6JA 2EYXA 4KBMB 2PUOB 2K3BA 3OBYA 4F7UF 1WPYA 4RTYA 2F69A 4DOVA 3TVTA 4DA4A 1D3BA 4M77E 2CP0A 2EGEA 2QAZA 1XQHA 2LZ6B 3CC7Q 5FLXE 1M2VA 3QSUA 3MP1A 1K8AR 1M8MA 2LMJA 1NPRA 2GBQA 3CCLQ 4F7UG 2MCNA 1GCQA 2DMOA 4C8QF 2RB6A 5CO7A 1K73C 3MPUB 1H3HA 4RUGA 5IN1A 2GQVA 5DLQE 3VKIA 4C0GA 3WVDB 9ATCB 3QJYA 1QKWA 1Z9QA 4NOYA 3CEYA 4M7AC 2HCKA 3KFVA 2DL4A 3CCJT 5FRNA 1YIJA 3HHTB 3EFSA 5GANd 1YWPA 1YFNA 3CPWS 1VQOT 5D6YA 1OX9A 1YJNQ 2J6FA 4YTLA 5FRMA 2IIMA 2MYSA 4B9WA 5GAOl 3MCAB 4PJLA 1QQJA 4EDUA 3IQLA 2DK3A 1NG2A 2DVEA 1W1FA 1ZUUA 1FWZA 3VUBA 1R0CB 2CP5A 4WCIA 1W70A 1VA7A 4M7AB 2M1HA 2F5KA 3G71Q 2QI2A 1YP5A 1HK9A 4C92F 2HMAA 3CC7T 2EQUA 3CD6A 2AHJB 3I5RA 3VUZA 3RESA 1YWOA 1MNEA 4B9XA 3FRNA 3OS5A 4BD3A 2XKOC 4RTXA 1ACMB 5GAMd 2VXEA 3LH0A 2LTOA 4OGCA 3E19A 1RAEB 1JBMA 4E7KA 2CSIA 4RTVA 4D6WA 1M27C 2X9HA 3EG0A 1NM7A 2A3LA 3RMQA 1AWJA 4AG2C 4ANJA 2COYA 2LC4A 2VKNA 1YITQ 2Y90A 2XU8A 5CQYA 4RTUA 3LWHA 1YJNT 1MGQA 5GMKm 4DBFA 4OVAA 1PCXA 5KCOA 2EJFA 1WJQA 2M02A 4GBQA 5CKEA 2KI7A 4ORZA 3SWNA 4MMKA 1WI7A 4J7IA 1TUDA 2KNBB 1N5ZA 3A1PA 3CCQA 2K5LA 2DTIA 3VJPA 2A37A 4XU1A 5GAOm 2RMOA 2DM1A 4M78B 1GCPA 1M8VA 3RKXA 3JB9F 5J39A 3M4GA 1ZSGA 2E6ZA 3QO3A 4EMHA 1FYNA 5CKDA 2RPNA 1PKTA 5HKCA 3EAEA 1ZBJA 2E3HA 2FRWA 2COZA 4JZ3A 1VQ9Q 1OYXA 2FO0A 4OMLA 3C94A 2O4XA 4JRKA 1K8AC 5GJWB 1QVFA 2ZPHB 4XTXA 1U1SA 1GFDA 4PL6A 4GLKA 4NL2A 3HFOA 4RMOA 5AYFA 1Y96A 2JN0A 2DXCA 1YITT 3F70A 4FU6A 1KQSA 2E10A 1NBEB 3PTAA 1AVZC 2FEIA 3MEVA 3L2QA 3L2ZA 2NYSA 2CP6A 3CMAQ 1BU1A 3GPLA 2RQTA 2LQ8A 3CBPA 2DO3A 1WLPB 4DBRA 3BW1A 3J80E 3OSVA 2DYIA 1JQQA 1W4SA 3CCEA 3E1SA 3G4SQ 1AD5A 1ZQ1A 2AK5A 3HP9A 1BI0A 2OAUA 4XTZA 4J9EA 4AG1C 3QXEB 3CC2A 1AWWA 4L59A 2V8IA 2XG8D 2RJEA 4HCCA 4IUQA 4NL3A 2KY9A 2YRCA 3VRZA 1VQ7A 2VVKA 4M78F 2DXBA 1M1FA 2KRMA 3RDVA 1YBYA 1VQ9T 3EG3A 1H641 1N27A 3A5ZB 1VQMT 1TSFA 2YXYA 3EGUA 2PZ1A 4F04B 3FC3A 4HT8A 4BY6C 2QQSA 2KROA 1UGQB 5FU6B 3FJ5A 4BDYA 1K0SA 4M7DB 1FXXA 1OU8A 2HZYA 1EIFA 3CCMQ 3GIBA 2K79A 2R58A 1SEMA 3OS1A 1MNDA 3VS0A 1WX6A 2QEXQ 3CMAT 2NUZA 3H0FA 2DRMA 2HQHA 2OJ2A 3M53A 4M77C 3VV0A 4AMCA 5DLOA 1VQ6Q 2KGTA 2CKKA 2ZCFB 3VYHB 4FCYA 2RJFA 3G4ST 3CCRQ 1EZZB 1JB0E 1QMCA 5KYYA 1OI1A 1WGSA 1CKBA 2CZ1B 4BY6B 1SPKA 5GAOn 4DBHA 1QKXA 1WHGA 1NJIU 4J9GA 1TG0A 2VB6A 3JAME 3EG2A 2W0ZA 2L3PA 3M58A 3P8BB 2RI3A 4BE2A 3M57A 1PSFA 5LJ3d 4M77B 2F2VA 3REBB 3RKWA 1SKUB 2X4JA 1IHVA 1NEBA 4P5NA 2QGGA 1YJ9Q 3OBWA 4PNOA 5CKHA 2V1RA 1XTDA 5I2MA 2MI6A 2DLPA 3BDLA 4Q5WA 3CCMT 2JOYA 1VQKA 3I35A 3M0QA 5KE2A 2QEXT 2KRNA 4M7DF 3CCSA 1RAIB 5IAYA 1VQ6T 1ZSZA 4FIBA 4C0DB 3EGDB 1ZBXA 3GBQA 2YUPA 4RG2A 3CCRT 4OMQA 1PM3A 1I5LA 3PVLA 3LYIA 1WXUA 1RAAB 5D6WA 1C6VX 2DIGA 1Q7YU 5HCKA 3OW2A 1YHQQ 3ZFJA 4AFSC 2AKKA 2FRYA 2XDBA 3A8OB 2KMTA 3KUFA 3CCUQ 4FW2A 1QCNA 4M75C 4QW2A 3QDRB 1T0HA 3H9NA 3JV3A 2EGCA 1Y57A 2E70A 2K4YA 1PD0A 2HL5C 3OYIA 3PMTA 1YJ9T 1JJ2P 2KXDA 2DL3A 3M0PA 1W2BA 3GNGA 2OI3A 2J05A 2QASA 2HKQB 3EHRA 4K11A 2QK0A 2EQMA 1YI2T 3TREA 1N8RU 1QLYA 2FPFA 1BKBA 3CC4A 4O5VA 2L89A 4HCKA 1RLPC 2RQVA 2EQIA 4IUVA 3L2RA 4KH0B 1YCYA 3X26B 1WHKA 2X4YA 1UHCA 5CK9A 1O9SA 4LD9K 4OMPA 3NTHA 3QZ5B 3M9QA 4M75D 2RF0A 4HXJA 2ZPIB 1OEBA 3HKSA 3G6EA 4JS5A 4JS4A 4EMGA 5KYXA 2JT4A 1YHQT 1G3TA 1M2VB 2HD0A 3H41A 1HYOA 2MK5A 2R5AA 1RI0A 5CIUA 1IZ6A 1D0YA 1MMNA 2DTOA 3G7ZA 3SEMA 2DEQA 1VIFA 2E12A 3JCMb 3CCUT 2LQWA 1YCSB 2BIVA 2BKDN 3HPWA 4WF2A 1WHMA 2D1XA 1TH7A 4LN2A 5GAN7 1PRMC 3WVEB 1LNXA 4RG8A 4FYXB 1KD1U 1WA7A 1KJWA 5FW9A 1OULA 2FB7A 4CC3A 4C0FA 4OMNA 2RNAA 3EGXB 1BIBA 1NYFA 2KRSA 5CVIA 3OYHA 1RAFB 2NUTA 2QQ9A 1IHWA 3CCVQ 2MWOA 3CMEA 4XU0A 5GAN2 3HRUA 3JCMW 2PQWA 1VYUA 2K3XA 4RTTA 1MMGA 3UA7A 1ABQA 1HD3A 5IHNA 1YIJQ 1PRLC 1GBQA 2LCCA 1BYMA 3M0RA 1RI9A 1WHHA 2YHTA 4N0AA 2KR3A 2LT1A 1I81A 4N4HA 3SWNC 1G5VA 2OTJQ 2DZCA 1SSFA 1TTHB 2NUPA 4FSSA 5C6SA 3OYYA 1S72A 1NE8A 3L42A 1VUBA 2D0QB 3X24B 4LUEA 2FZKB 3I9QA 4BI4A 2CZ6B 1WFWA 3C4SA 3RKYA 2PVOB 2IG0A 2V26A 5CQXA 2CSQA 5CCAA 4PJOG 2JZ2A 2DBMA 1UUEA 2CT3A 4JJBA 4ELYC 1X6GA 1QCFA 2V1QA 2FYKA 2DA9A 1ZA1B 3CCVT 4JRPA 3MKDA 1K4US 4PFZA 4LDYA 3VRYA 2ED0A 5EC7A 1XOVA 2PVGB 1YIJT 1G3SA 3C12A 2E64A 1K9MR 1WJRA 2CZ0B 5GMKl 4E7JA 1RACB 1YJWQ 3TQ7P 4E7ZA 2KT8A 1I0CA 4PFOA 2OTJT 1AWOA 1WQWA 4PJOA 2DL7A 1Q82U 1U1TA 3HSBA 5I22A 1KC8R 4C8QG 3I55Q 1N6AA 1M1GA 2DEUA 2QDLA 3UF4A 2DAQA 3X28B 1Q81U 2QG9B 1LVKA 3META 2ESWA 4A54A 3OYDA 2EKOA 3E2UA 4PLLA 1JJ2S 3X20B 1PHTA 4A4GA 1B3QA 5KYUA 2ZGWA 3QZ9B 2DFUA 2W10A 1OX8A 2RO0A 4F7UA 1QWEA 4J9HA 4MDWA 4Y92A 1UGVA 1VYVA 1VYTA 3EH2A 4FL6A 4KT0E 2F2XA 1VQ4Q 4KH1B 3SHWA 3EH1A 1X75C 1K73U 3EG9B 3VS4A 2FL7A 3CCJA 3G1JA 2LP5A 1WHLA 2C0OA 3ZL7C 3CCLT 1UJ0A 3OYGA 3V8KA 1WJSA 4C8QA 3OY9A 1BBZA 1VQOA 1WYXA 2FZCB 3M55A 2C0TA 4C92G 3NPFA 2KYMA 2PTKA 1NJIR 4ZTJA 4Y28E 3M0TA 3E9FA 4J6YA 1YJWT 4RTWA 2RN8A 2RQRA 1KG1A 2R57A 4F14A 4KGVB 1NLPC 3I55T 3V7CA 3VS2A 4M75E 2L8DA 1LPLA 1NZ9A 2PUKB 1BI1A 3MP6A 3OMCA 4E7LA 3CC7A 2HL3A 1VIEA 1NYGA 1BIAA 1VQ8Q 3CC2Q 2P84A 1UTIA 8ATCB 3CPWA 4PKCC 4J7FA 3Q1JA 4FYVB 3L2UA 1AZGB 3ZBDA 1D0ZA 2YUNA 4OF1A 3G71T 4QKUA 3H8ZA 3TSZA 3RERA 4C92A 2MIOA 2QQRA 4J6XA 1VQ4T 2DXUA 3M56A 3RIRA 1VQPQ 4MZMA 4BDZA 2VGMA 4DEYA 3C0CA 2DE0X 4PJJA 4M7AF 2DERA 2X3WD 2L3SA 1N9SA 1I1JA 2BZ8A 1YJNA 3UWNA 2EQJA 1H92A 4A53A 3JB9G 2O01E 2JM8A 3OSSC 4M7AG 4LNPA 4LD6A 2RI5A 3VU3C 2DRKA 2ATCB 1S1NA 2QQBA 4PJMA 1TXQA 2XDPA 1M3CA 3M5AA 4PLIA 5FU7C 1K9MC 1WHJA 4QQDA 3U23A 1Y71A 4Y91A 1KHCA 2GQIA 4F7UE 4QVCA 2FPEA 3DLLA 3JCMP 1LCKA 1VQ8T 3CC2T 2MOXA 5KE3A 2IPOB 3VS6A 1K1ZA 1OU9A 3JCMJ 4QT7A 5GMKe 1KC8C 3BY7A 1Q86R 1I4K1 1WZOA 2JTFA 2ENMA 5HY6A 2FG0A 2P0QA 1QP2A 1IREB 3FB9A 1VQPT 2X4XA 2M16A 4JPBW 3RBBB 4OGEA 5FU7B 2C06A 3FEOA 2KT1A 3A8HB 4KGZB 1K8AU 1SRLA 2H3JA 2YRDA 1YITA 2CGHA 2M51A 4CI0C 2VC8A 3FDRA 2JTEA 5GMKj 4A63B 4IURA 3GNFB 1VQKQ 1G3WA 2YLBA 1XNIA 4X34A 3OYLA 3LLRA 4BI8B 3EFOB 2K2VA 2X35A 4E7SA 1OZ2A 2J6OA 1WQ7A 2X51A 3QWXX 4M78G 4FSXA 5GAN5 2EKHA 4XQ3A 1NJIC 4JRIA 4XAXB 2E65A 2KE9A 2I2LA 1BB9A 1UE9A 2OTLQ 2V8JA 2LDMA 4EMKA 3FIFA 2DTHA 2HBPA 2Z0WA 2RHZA 5LL6S 4DBQA 1LOJA 2KVQG 1VQ9A 1TWBA 4AFZC 1U3OA 1MMDA 4LXCA 1VQMA 3BE3A 2EJ9A 4CC2A 2D9TA 3PT9A 4LDVA 4OMMA 3MHXA 2CREA 4M78A 1QVPA 1QWFA 3M0SA 3CBMA 3QG1A 3RNJA 1PC0A 3OYFA 5GAN8 1VQKT 2GFAA 3CMAA 4BE1A 1ZLMA 2E5KA 4E7HA 2CDTA 4ELZC 4OB2B 4KGXB 4XU3A 3GOXA 1M90R 1YN8A 4DOWA 2JVVA 2AIRB 3G4SA 2JM9A 1TU0B 1IB8A 4ZGEB 1UDLA 1UFFA 3HFNA 4F17A 1VQLQ 2OTLT 4MMLA 4LDXA 2DXTA 4RCCA 2HDAA 2VYTA 3I56A 1HXDA 4OB3B 3FLGA 1I07A 4Z88A 3ER0A 2EJGA 2PVDB 2RHIA 5KYWB 1E6HA 2EYQA 4N0AC 4M7DG 2LJ3A 2YLCA 4KULA 5J26A 4J9CA 1Q86C 5KYNA 4XTUA 5GAOq 2RHUA 2KBTA 2FPDA 4XTYA 3CCMA 4QQGA 1GRIA 1SG5A 1T0JA 3PIOA 1TUCA 1RAHB 4RKUE 2QEXA 3OS2A 3JCMQ 1UJYA 2WACA 3VS1A 4N4IA 4XTVA 4A4KA 5GANe 2F1LA 1VQ6A 4JJCA 4M77F 1EFNA 2KAFA 4C5IA 4HVVA 1C1AA 2K57A 1VQ5Q 2DL5A 3CCRA 3OYNA 3R6OA 1VQLT 3ASKA 2K2MA 4HCZA 2XI9A 1UECA 4M7DA 1T3SA 1VOMA 4IKFA 4M77G 2B8AA 1D09B 2RQUA 4ZGJB 3M54A 2AZVA 4QVDA 2DETA 1GCQC 2ED1A 2FHDA 2XK0A 1OZ3A 2QYZA 5IXBA 4M75B 2J06A 4AFQC 2LVMA 2DIQA 5GANj 3AHUA 3HRTA 2GTJA 4A4HA 2DD5A 3VS3A 4D8KA 5GMKh 3MJXA 2QA4A 1VQNQ 4PJOC 2DVJA 2EBPA 5GAMe 1D3BB 1Z9ZA 2HBWA 4KRTA 3QBYA 4PK4A 3S6WA 3QDFA 1MV0B 3BFMA 1YI2A 4PJNA 2BE7D 2YT6A 3V7RA 1IGQA 1QVGS 4MDXA 3DB4A 1E7OA 1QVFP 2LJ1A 3EFRA 5HK3A 2V8KA 2VUBA 3OYJA 3NGPA 1Y07A 1VQ5T 4HCBA 5GAMj 2XIDA 1KQSP 4R0KA 4BUGA 2Y4XA 4V2SA 1B34A 4TVRA 4BI3A 4PJOD 1UGRB 1AEYA 2CH4A 1T3LA 1M90C 1ZUKA 1YHQA 2D8JA 4C8QC 3RMSA 2KYBA 3H0IA 4JZ4A 2BTTA 4XU2A 3PE0A 3LX7A 4J9DA 1PKSA 1KQ1A 3GLXA 2BZXA 3CCUA 4RCBA 2PNIA 4F16A 2K9GA 4F7UB 3LGLA 3EGDA 5GMKi 4M75F 1M30A 1VQNT 1AWXA 1H8KA 3NHNA 3L2VA 2JXBA 3SFMA 1X01A 1KIKA 4C5EA 4L6V5 2ECZA 3JCMX 3CXCP 1M3BA 1ZHIA 2RHXA 1OOTA 4IUPA 2L3RA 1ZA2B 2CP3A 3N5BB 3DKMA 5KH6A 2EIFA 4B6MA 4C5GA 2HSEB 3LGFA 3M4YA 1IRXA 2CYZB 4C8QD 1SHFA 6AT1B 2ROTA 2ROLA 2G3RA 4C0ZA 4ESRA 5HK0A 1WXTA 2M9UA 4C92C 4D8DA 4ZN3A 3OS0A 2A08A 4FT2A 3PFSA 2ZZDA 2F2WA 3CD6Q 3DB3A 3VS7A 2H3EB 3UDCA 3JB9I 2X4WA 4LE9A 2RD1A 3CBOA 4E6RA 2AZSA 2HSPA 5DY9A 3JCMf 3A98A 1IO6A 2DJQA 2L5QA 4X9DA 5CKFA 1JO8A 3SWNB 7AT1B 5GJVB 5J3BA 1SSHA 1Q82C 1V29B 1BI2A 2E41A 2XMFA 4N4GA 2RK2A 1JRIA 3A8LB 3UA6A 1PG5B 2QTVA 4IIOA 4QQ6A 4BB7A 3VS5A 1WDXA 4C92D 3UATA 4HKEA 3A8MB 4IUTA 1WXBA 1M1KU 2EVRA 3INZA 2XICA 1U06A 2G6FX 2KSSA 3M0UA 2EYWA 4JJNK 3LH5A 3ME9A 2O4XB 3CCVA 2E6NA 1JXOA 3CCQQ 4E7IA 4R56A 2QQAA 1ABOA 2ZPFB 1FMVA 2P0KA 1PNJA 1K76A 5C0MA 4LUDA 3EG1A 2JJ9A 3CD6T 1Y96B 3JSCA 5LJ3g 5GANh 3V7SA 5IHKA 1X2QA 1EX4A 2OAWA 5L8RE 1TUGB 5I2SA 2LQNA 2CT4A 4Z8AA 1OV3A 1TS9A 3OYCA 3EGXA 3VYGA 1GL5A 1ZX6A 2LCLA 2LCSA 2DILA 2OTJA 2F5TX 5CAIA 2KQWA 2EW3A 3OW2P 2E1HA 1RL2A 3PMIA 5LJ3e 3T9NA 4II1A 1LJOA 4ZGDB 3QHSA 3CQTA 4IIMA 2E4HA 2HNIA 3JB9D 4M7AD 3V8LA 4EMKC 5GAMh 4JLGA 2I0NA 2GF7A 1X27A 1W2BP 1Q95G 2MAMA 4HVWA 1QVFS 3PIPA 3CCQT 2HAXA 4OB0B 5IHIA 1NLOC 3CCEQ 2RJDA 1OPLA 1R8OB 4FYYB 5A2QE 1KFZA 5LJ3j 5IXFA 5M9OA 4L5GA 1UGSB 2ZPGB 4NS5A 5A0DA 1KQSS 2K6DA 3CCLA 1YNZA 4AT1B 1G83A 4J5YA 4M78C 3OMGA 1JJ2A 4BACA 4DEXA 2J7IA 5KCHA 2BZYA 5ECAA 1VQ7Q 3MP8A 2P0PA 3I5SA 1X2KA 4JDSA 4EMKB 4JRQA 1V1CA 4MZPA 2EYYA 2EAYA 2COWA 1BCOA 1YJWA 1KK7A 3OQ5A 2A28A 2E5QA 1C0MA 5A0GA 2DF6A 1WNLA 2LT4A 1GXIE 3I55A 2JS2A 1KQ2A 5KYYB 2RA2A 2CZ7B 2KEAA 3MEWA 3AT1B 4PJOE 3TU4K 2QXFA 2XDDA 2K7AA 2EQKA 1RABB 1KHIA 3JRZA 5DM7R 4CRIA 3TEEA 2VWFA 1MUZA 5GANf 1CSKA 3CXCS 2JW4A 1Q7YR 4Z89A 1RLQC 3JCMg 2QGFB 3J81E 3GF5A 4PFPA 1JXMA 4M78D 4LDUA 4ZNXA 1ZSZC 3MEAA 3RUXA 2EFIA 1D1CA 1UHFA 3G71A 2K5FA 1QP3A 2LQKA 5CR2A 1KSWA 3CCET 1VQ4A 1GFCA 3SB2A 5LJ5g 2MPXC 1VQMQ 2ABLA 5D6XA 2A0FB 2Y4YA 3OYKA 1RADB 2DZ9A 3A8GB 1UEBA 2EYZA 2DNUA 1VQ7T 3E9GA 1N8RR 3JCMe 4C8QE 4ZTFA 2OX7A 1ZSZB 5GAMf 4M7AA 1X6BA 1U5SA 3ULRB 4GLMA 2R5MA 5IT9E 5LJ5e 1QVGP 3EG9A 2RJCA 3H6ZA 2E3IA 4CC4B 4A4EA 1M5Q1 3OYEA 2J6KA 1J3TA 3QPHA 2LX9A 5FU6C 3L2WA 1K9MU 4FYWB 1VQ8A 2YSQA 3DLMA 3NTIA 3JCMV 4M7DC 3CCSQ 1I5OB 3I56Q 2CP2A 2SEMA 4Z02A 2DYBA 1KC8U 4A4FA 4EIKA 3H0HA 3GP8A 3OYMA 3CXCA 4RTZA 1FX7A 5LJ5j 1K0XA 4ME7A 1VQPA 3R6NA 2LJ0A 2VXFA 1B07A 3S3OA 2K5IA 4C92E 1KD1R 1WIEA 3HTRA 1ARKA 3UPUA 2O2OA 1FMKA 4OMFB 2IVWA 3D7SB 4HVUA 2FZGB 3OA6A 1AZEA 1M4ZA 2O88A 1R77A 3PNWC 3JB9H 4MZTA 3O5ZA 2P4RA 4M7DD 2LNHB 2EGAA 4JLIA 5FWCA 1OQKA 1AOJA 2FVUA 3BDUA 5IH2A 3UT1A 2XHCA 2GCXA 3X25B 1I8FA 4KUDK 3OW2S 4X9CA 3OYBA 5KYXB 2BUDA 3QKJA 3CC4Q 1IXDA 2O9VA 1IGUA 3SDZA 3CCST 2DD4A 2YUOA 2GGRA 3NMZC 3I56T 5LJ3h 5GAN4 2AKLA 2DJZA 2HKNA 4R55A 4X1VA 1G3YA 1U8RA 1A0NB 4ATOA 2L2PA 1W2BS 3LWIA 4C0DC 4FT4A 1K9AA 2CS7A 1R0BG 1Q7YC 1NEGA 5CKBA 4ZN1A 2X3XD 4M77D 2QA4Q 3G6EQ 3FJPA 3WXMB 4M7AE 1B34B 2LRQA 2VV5A 1X43A 2RHYA 4JUVA 2RM4A 2C0IA 5GANg 1V76A 1YI2Q 1SHGA 2CUBA 5I21A 1ZUYA 4J9FA 2NUTB 5GAN3 4E47A 3HL8A 1UGPB 5FWBA 5A0LA 2ZPBB 1UG1A 3MO8A 2LNVA 4J9BA 4WTOB 5GAOr 3ZEHA 4HT9A 2JMAA 1N8RC 3J7AF 4JJDA 2D8HA 2ZAEA 2JMCA 2OTLA 1B7TA 2YRVA 3CC4T 3P8HA 2EWNA 4E2FB 3KXTA 4KUIA 1M3AA 2MMPA 5GAN6 4VUBA 4OP0A 5I11A 1M1KR 3EFOA 1XJWB 2PU9B 3CMEQ 4J8OA 1Y0MA 2A7YA 5GAMg 4GY5A 2VGNA 2ZPEB 3P8DA 2HEQA 2NUPB 1RAGB 3CPFA 1Q82R 4OMOA 1X6OA 3CPWP 3QUIA 2KXCA 2QA4T 8AT1B 3G6ET 1MHNA 2JTMA 4XTWA 2NLUA 3PVQA 1Q81R 2DL8A 3O8VA 2LX7A 2A36A 2JNGA 3NTKA 1Q86U 5FROA 1W6XA 3QWYA 2CUDA 1P92A 2O31A 2YWWA 4M78E 1FMWA 1GBRA 1QW1A 4QVZA 1KD1C 3QJ6A 1YJ9A 5LJ3f 4BE0A 5AT1B 2O9SA 5EG2A 1HSQA 2RK1A 3JCMh 1S72Q 1UB4A 2GFUA 1K73R 1AHJB 3LW5E 2EPDA 1BK2A 2HQXA 1VQLA 3JCMd 1MMAA 2K3YA 3MEUA 3SD4A 1TOVA 3RR6A 5LJ5h 2YDLA 4C5HA 2MWPA 4M77A 1DJ7B 3JCMc 1JU5C 5GAOp 2AT1B 5L23A 5LJ5d 4OB1B 3CMET 1BI3A 4XK8E 1Y7XA 4PJOB 2GTOA 4M4ZA 2QDYB 4LDWA 2M0YA 1QCOA 1SF9A 1X69A 2B86A 1HJDA 1D1BA 4AFUC 3TSWA 4J9IA 4J6WA 2CP7A 1JEGA 3THKA 3PGGA 2H8HA 1PSEA 2DBKA 4EPCA 4J83A 2BE9B 5KYUB 1M2OA 2YUQA 4FM4B 4UC4A 1CKAA 2D0NA 2L3QA 3JB9J 3QYGB 1NPPA 2D6FA 2CH4W 3S3MA 1D0XA 2VASA 2P4TA 1M9SA 2WSFE 5KYWA 2DX1A 1VQ5A 2GNCA 1S72T 2DKGA 2SRCA 3V8JA 2KK4A 4M75G 4C8QB 3S3NA 3QIIA 3M59A 2HQEA 1SRMA 1OPKA 2JUFA 1PD1A 2XD0A 3OB9A 1QVGA 4M7DE 4DQ2A 1G2BA 1G8XA 2L0AA 1M90U 1E6GA 3L1AA 3EHQA 2DPPB 1VQNA 3NFCA 2JS0A 3CCJQ 4IUUA 3REAB 4HA8A 1N9RA 2KDSA 2RI2A 4FW1A 1F1BB 5D7UA 4PJOF 2M0OA 3QYHB 1O75A 3OYAA 2WSCE 3HRSA 1M1KC 2QTXA 2MF2A 1AT1B 1VQOQ 2WSEE 3URGA 1BCMA 3C95A 1PWTA 3TCJA 2RQWA 1RUWA 3KBGA 4M75A 2NWMA 5LJ5f 4CC7A 2RH2A
chains in the Genus database with same CATH topology
2ZAEA 1OQKA 1PC0A 1TS9A 1TSFA 2KI7A 1V76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZAE A;  1OQK A;  1PC0 A;  1TS9 A;  1TSF A;  2KI7 A;  1V76 A; 
#chains in the Genus database with same CATH topology
 4C92 B;  1D1A A;  1MV3 A;  1H3Z A;  1Q81 C;  4O6J A;  2EYX A;  4KBM B;  2PUO B;  2K3B A;  3OBY A;  4F7U F;  1WPY A;  4RTY A;  2F69 A;  4DOV A;  3TVT A;  4DA4 A;  1D3B A;  4M77 E;  2CP0 A;  2EGE A;  2QAZ A;  1XQH A;  2LZ6 B;  3CC7 Q;  5FLX E;  1M2V A;  3QSU A;  3MP1 A;  1K8A R;  1M8M A;  2LMJ A;  1NPR A;  2GBQ A;  3CCL Q;  4F7U G;  2MCN A;  1GCQ A;  2DMO A;  4C8Q F;  2RB6 A;  5CO7 A;  1K73 C;  3MPU B;  1H3H A;  4RUG A;  5IN1 A;  2GQV A;  5DLQ E;  3VKI A;  4C0G A;  3WVD B;  9ATC B;  3QJY A;  1QKW A;  1Z9Q A;  4NOY A;  3CEY A;  4M7A C;  2HCK A;  3KFV A;  2DL4 A;  3CCJ T;  5FRN A;  1YIJ A;  3HHT B;  3EFS A;  5GAN d;  1YWP A;  1YFN A;  3CPW S;  1VQO T;  5D6Y A;  1OX9 A;  1YJN Q;  2J6F A;  4YTL A;  5FRM A;  2IIM A;  2MYS A;  4B9W A;  5GAO l;  3MCA B;  4PJL A;  1QQJ A;  4EDU A;  3IQL A;  2DK3 A;  1NG2 A;  2DVE A;  1W1F A;  1ZUU A;  1FWZ A;  3VUB A;  1R0C B;  2CP5 A;  4WCI A;  1W70 A;  1VA7 A;  4M7A B;  2M1H A;  2F5K A;  3G71 Q;  2QI2 A;  1YP5 A;  1HK9 A;  4C92 F;  2HMA A;  3CC7 T;  2EQU A;  3CD6 A;  2AHJ B;  3I5R A;  3VUZ A;  3RES A;  1YWO A;  1MNE A;  4B9X A;  3FRN A;  3OS5 A;  4BD3 A;  2XKO C;  4RTX A;  1ACM B;  5GAM d;  2VXE A;  3LH0 A;  2LTO A;  4OGC A;  3E19 A;  1RAE B;  1JBM A;  4E7K A;  2CSI A;  4RTV A;  4D6W A;  1M27 C;  2X9H A;  3EG0 A;  1NM7 A;  2A3L A;  3RMQ A;  1AWJ A;  4AG2 C;  4ANJ A;  2COY A;  2LC4 A;  2VKN A;  1YIT Q;  2Y90 A;  2XU8 A;  5CQY A;  4RTU A;  3LWH A;  1YJN T;  1MGQ A;  5GMK m;  4DBF A;  4OVA A;  1PCX A;  5KCO A;  2EJF A;  1WJQ A;  2M02 A;  4GBQ A;  5CKE A;  2KI7 A;  4ORZ A;  3SWN A;  4MMK A;  1WI7 A;  4J7I A;  1TUD A;  2KNB B;  1N5Z A;  3A1P A;  3CCQ A;  2K5L A;  2DTI A;  3VJP A;  2A37 A;  4XU1 A;  5GAO m;  2RMO A;  2DM1 A;  4M78 B;  1GCP A;  1M8V A;  3RKX A;  3JB9 F;  5J39 A;  3M4G A;  1ZSG A;  2E6Z A;  3QO3 A;  4EMH A;  1FYN A;  5CKD A;  2RPN A;  1PKT A;  5HKC A;  3EAE A;  1ZBJ A;  2E3H A;  2FRW A;  2COZ A;  4JZ3 A;  1VQ9 Q;  1OYX A;  2FO0 A;  4OML A;  3C94 A;  2O4X A;  4JRK A;  1K8A C;  5GJW B;  1QVF A;  2ZPH B;  4XTX A;  1U1S A;  1GFD A;  4PL6 A;  4GLK A;  4NL2 A;  3HFO A;  4RMO A;  5AYF A;  1Y96 A;  2JN0 A;  2DXC A;  1YIT T;  3F70 A;  4FU6 A;  1KQS A;  2E10 A;  1NBE B;  3PTA A;  1AVZ C;  2FEI A;  3MEV A;  3L2Q A;  3L2Z A;  2NYS A;  2CP6 A;  3CMA Q;  1BU1 A;  3GPL A;  2RQT A;  2LQ8 A;  3CBP A;  2DO3 A;  1WLP B;  4DBR A;  3BW1 A;  3J80 E;  3OSV A;  2DYI A;  1JQQ A;  1W4S A;  3CCE A;  3E1S A;  3G4S Q;  1AD5 A;  1ZQ1 A;  2AK5 A;  3HP9 A;  1BI0 A;  2OAU A;  4XTZ A;  4J9E A;  4AG1 C;  3QXE B;  3CC2 A;  1AWW A;  4L59 A;  2V8I A;  2XG8 D;  2RJE A;  4HCC A;  4IUQ A;  4NL3 A;  2KY9 A;  2YRC A;  3VRZ A;  1VQ7 A;  2VVK A;  4M78 F;  2DXB A;  1M1F A;  2KRM A;  3RDV A;  1YBY A;  1VQ9 T;  3EG3 A;  1H64 1;  1N27 A;  3A5Z B;  1VQM T;  1TSF A;  2YXY A;  3EGU A;  2PZ1 A;  4F04 B;  3FC3 A;  4HT8 A;  4BY6 C;  2QQS A;  2KRO A;  1UGQ B;  5FU6 B;  3FJ5 A;  4BDY A;  1K0S A;  4M7D B;  1FXX A;  1OU8 A;  2HZY A;  1EIF A;  3CCM Q;  3GIB A;  2K79 A;  2R58 A;  1SEM A;  3OS1 A;  1MND A;  3VS0 A;  1WX6 A;  2QEX Q;  3CMA T;  2NUZ A;  3H0F A;  2DRM A;  2HQH A;  2OJ2 A;  3M53 A;  4M77 C;  3VV0 A;  4AMC A;  5DLO A;  1VQ6 Q;  2KGT A;  2CKK A;  2ZCF B;  3VYH B;  4FCY A;  2RJF A;  3G4S T;  3CCR Q;  1EZZ B;  1JB0 E;  1QMC A;  5KYY A;  1OI1 A;  1WGS A;  1CKB A;  2CZ1 B;  4BY6 B;  1SPK A;  5GAO n;  4DBH A;  1QKX A;  1WHG A;  1NJI U;  4J9G A;  1TG0 A;  2VB6 A;  3JAM E;  3EG2 A;  2W0Z A;  2L3P A;  3M58 A;  3P8B B;  2RI3 A;  4BE2 A;  3M57 A;  1PSF A;  5LJ3 d;  4M77 B;  2F2V A;  3REB B;  3RKW A;  1SKU B;  2X4J A;  1IHV A;  1NEB A;  4P5N A;  2QGG A;  1YJ9 Q;  3OBW A;  4PNO A;  5CKH A;  2V1R A;  1XTD A;  5I2M A;  2MI6 A;  2DLP A;  3BDL A;  4Q5W A;  3CCM T;  2JOY A;  1VQK A;  3I35 A;  3M0Q A;  5KE2 A;  2QEX T;  2KRN A;  4M7D F;  3CCS A;  1RAI B;  5IAY A;  1VQ6 T;  1ZSZ A;  4FIB A;  4C0D B;  3EGD B;  1ZBX A;  3GBQ A;  2YUP A;  4RG2 A;  3CCR T;  4OMQ A;  1PM3 A;  1I5L A;  3PVL A;  3LYI A;  1WXU A;  1RAA B;  5D6W A;  1C6V X;  2DIG A;  1Q7Y U;  5HCK A;  3OW2 A;  1YHQ Q;  3ZFJ A;  4AFS C;  2AKK A;  2FRY A;  2XDB A;  3A8O B;  2KMT A;  3KUF A;  3CCU Q;  4FW2 A;  1QCN A;  4M75 C;  4QW2 A;  3QDR B;  1T0H A;  3H9N A;  3JV3 A;  2EGC A;  1Y57 A;  2E70 A;  2K4Y A;  1PD0 A;  2HL5 C;  3OYI A;  3PMT A;  1YJ9 T;  1JJ2 P;  2KXD A;  2DL3 A;  3M0P A;  1W2B A;  3GNG A;  2OI3 A;  2J05 A;  2QAS A;  2HKQ B;  3EHR A;  4K11 A;  2QK0 A;  2EQM A;  1YI2 T;  3TRE A;  1N8R U;  1QLY A;  2FPF A;  1BKB A;  3CC4 A;  4O5V A;  2L89 A;  4HCK A;  1RLP C;  2RQV A;  2EQI A;  4IUV A;  3L2R A;  4KH0 B;  1YCY A;  3X26 B;  1WHK A;  2X4Y A;  1UHC A;  5CK9 A;  1O9S A;  4LD9 K;  4OMP A;  3NTH A;  3QZ5 B;  3M9Q A;  4M75 D;  2RF0 A;  4HXJ A;  2ZPI B;  1OEB A;  3HKS A;  3G6E A;  4JS5 A;  4JS4 A;  4EMG A;  5KYX A;  2JT4 A;  1YHQ T;  1G3T A;  1M2V B;  2HD0 A;  3H41 A;  1HYO A;  2MK5 A;  2R5A A;  1RI0 A;  5CIU A;  1IZ6 A;  1D0Y A;  1MMN A;  2DTO A;  3G7Z A;  3SEM A;  2DEQ A;  1VIF A;  2E12 A;  3JCM b;  3CCU T;  2LQW A;  1YCS B;  2BIV A;  2BKD N;  3HPW A;  4WF2 A;  1WHM A;  2D1X A;  1TH7 A;  4LN2 A;  5GAN 7;  1PRM C;  3WVE B;  1LNX A;  4RG8 A;  4FYX B;  1KD1 U;  1WA7 A;  1KJW A;  5FW9 A;  1OUL A;  2FB7 A;  4CC3 A;  4C0F A;  4OMN A;  2RNA A;  3EGX B;  1BIB A;  1NYF A;  2KRS A;  5CVI A;  3OYH A;  1RAF B;  2NUT A;  2QQ9 A;  1IHW A;  3CCV Q;  2MWO A;  3CME A;  4XU0 A;  5GAN 2;  3HRU A;  3JCM W;  2PQW A;  1VYU A;  2K3X A;  4RTT A;  1MMG A;  3UA7 A;  1ABQ A;  1HD3 A;  5IHN A;  1YIJ Q;  1PRL C;  1GBQ A;  2LCC A;  1BYM A;  3M0R A;  1RI9 A;  1WHH A;  2YHT A;  4N0A A;  2KR3 A;  2LT1 A;  1I81 A;  4N4H A;  3SWN C;  1G5V A;  2OTJ Q;  2DZC A;  1SSF A;  1TTH B;  2NUP A;  4FSS A;  5C6S A;  3OYY A;  1S72 A;  1NE8 A;  3L42 A;  1VUB A;  2D0Q B;  3X24 B;  4LUE A;  2FZK B;  3I9Q A;  4BI4 A;  2CZ6 B;  1WFW A;  3C4S A;  3RKY A;  2PVO B;  2IG0 A;  2V26 A;  5CQX A;  2CSQ A;  5CCA A;  4PJO G;  2JZ2 A;  2DBM A;  1UUE A;  2CT3 A;  4JJB A;  4ELY C;  1X6G A;  1QCF A;  2V1Q A;  2FYK A;  2DA9 A;  1ZA1 B;  3CCV T;  4JRP A;  3MKD A;  1K4U S;  4PFZ A;  4LDY A;  3VRY A;  2ED0 A;  5EC7 A;  1XOV A;  2PVG B;  1YIJ T;  1G3S A;  3C12 A;  2E64 A;  1K9M R;  1WJR A;  2CZ0 B;  5GMK l;  4E7J A;  1RAC B;  1YJW Q;  3TQ7 P;  4E7Z A;  2KT8 A;  1I0C A;  4PFO A;  2OTJ T;  1AWO A;  1WQW A;  4PJO A;  2DL7 A;  1Q82 U;  1U1T A;  3HSB A;  5I22 A;  1KC8 R;  4C8Q G;  3I55 Q;  1N6A A;  1M1G A;  2DEU A;  2QDL A;  3UF4 A;  2DAQ A;  3X28 B;  1Q81 U;  2QG9 B;  1LVK A;  3MET A;  2ESW A;  4A54 A;  3OYD A;  2EKO A;  3E2U A;  4PLL A;  1JJ2 S;  3X20 B;  1PHT A;  4A4G A;  1B3Q A;  5KYU A;  2ZGW A;  3QZ9 B;  2DFU A;  2W10 A;  1OX8 A;  2RO0 A;  4F7U A;  1QWE A;  4J9H A;  4MDW A;  4Y92 A;  1UGV A;  1VYV A;  1VYT A;  3EH2 A;  4FL6 A;  4KT0 E;  2F2X A;  1VQ4 Q;  4KH1 B;  3SHW A;  3EH1 A;  1X75 C;  1K73 U;  3EG9 B;  3VS4 A;  2FL7 A;  3CCJ A;  3G1J A;  2LP5 A;  1WHL A;  2C0O A;  3ZL7 C;  3CCL T;  1UJ0 A;  3OYG A;  3V8K A;  1WJS A;  4C8Q A;  3OY9 A;  1BBZ A;  1VQO A;  1WYX A;  2FZC B;  3M55 A;  2C0T A;  4C92 G;  3NPF A;  2KYM A;  2PTK A;  1NJI R;  4ZTJ A;  4Y28 E;  3M0T A;  3E9F A;  4J6Y A;  1YJW T;  4RTW A;  2RN8 A;  2RQR A;  1KG1 A;  2R57 A;  4F14 A;  4KGV B;  1NLP C;  3I55 T;  3V7C A;  3VS2 A;  4M75 E;  2L8D A;  1LPL A;  1NZ9 A;  2PUK B;  1BI1 A;  3MP6 A;  3OMC A;  4E7L A;  3CC7 A;  2HL3 A;  1VIE A;  1NYG A;  1BIA A;  1VQ8 Q;  3CC2 Q;  2P84 A;  1UTI A;  8ATC B;  3CPW A;  4PKC C;  4J7F A;  3Q1J A;  4FYV B;  3L2U A;  1AZG B;  3ZBD A;  1D0Z A;  2YUN A;  4OF1 A;  3G71 T;  4QKU A;  3H8Z A;  3TSZ A;  3RER A;  4C92 A;  2MIO A;  2QQR A;  4J6X A;  1VQ4 T;  2DXU A;  3M56 A;  3RIR A;  1VQP Q;  4MZM A;  4BDZ A;  2VGM A;  4DEY A;  3C0C A;  2DE0 X;  4PJJ A;  4M7A F;  2DER A;  2X3W D;  2L3S A;  1N9S A;  1I1J A;  2BZ8 A;  1YJN A;  3UWN A;  2EQJ A;  1H92 A;  4A53 A;  3JB9 G;  2O01 E;  2JM8 A;  3OSS C;  4M7A G;  4LNP A;  4LD6 A;  2RI5 A;  3VU3 C;  2DRK A;  2ATC B;  1S1N A;  2QQB A;  4PJM A;  1TXQ A;  2XDP A;  1M3C A;  3M5A A;  4PLI A;  5FU7 C;  1K9M C;  1WHJ A;  4QQD A;  3U23 A;  1Y71 A;  4Y91 A;  1KHC A;  2GQI A;  4F7U E;  4QVC A;  2FPE A;  3DLL A;  3JCM P;  1LCK A;  1VQ8 T;  3CC2 T;  2MOX A;  5KE3 A;  2IPO B;  3VS6 A;  1K1Z A;  1OU9 A;  3JCM J;  4QT7 A;  5GMK e;  1KC8 C;  3BY7 A;  1Q86 R;  1I4K 1;  1WZO A;  2JTF A;  2ENM A;  5HY6 A;  2FG0 A;  2P0Q A;  1QP2 A;  1IRE B;  3FB9 A;  1VQP T;  2X4X A;  2M16 A;  4JPB W;  3RBB B;  4OGE A;  5FU7 B;  2C06 A;  3FEO A;  2KT1 A;  3A8H B;  4KGZ B;  1K8A U;  1SRL A;  2H3J A;  2YRD A;  1YIT A;  2CGH A;  2M51 A;  4CI0 C;  2VC8 A;  3FDR A;  2JTE A;  5GMK j;  4A63 B;  4IUR A;  3GNF B;  1VQK Q;  1G3W A;  2YLB A;  1XNI A;  4X34 A;  3OYL A;  3LLR A;  4BI8 B;  3EFO B;  2K2V A;  2X35 A;  4E7S A;  1OZ2 A;  2J6O A;  1WQ7 A;  2X51 A;  3QWX X;  4M78 G;  4FSX A;  5GAN 5;  2EKH A;  4XQ3 A;  1NJI C;  4JRI A;  4XAX B;  2E65 A;  2KE9 A;  2I2L A;  1BB9 A;  1UE9 A;  2OTL Q;  2V8J A;  2LDM A;  4EMK A;  3FIF A;  2DTH A;  2HBP A;  2Z0W A;  2RHZ A;  5LL6 S;  4DBQ A;  1LOJ A;  2KVQ G;  1VQ9 A;  1TWB A;  4AFZ C;  1U3O A;  1MMD A;  4LXC A;  1VQM A;  3BE3 A;  2EJ9 A;  4CC2 A;  2D9T A;  3PT9 A;  4LDV A;  4OMM A;  3MHX A;  2CRE A;  4M78 A;  1QVP A;  1QWF A;  3M0S A;  3CBM A;  3QG1 A;  3RNJ A;  1PC0 A;  3OYF A;  5GAN 8;  1VQK T;  2GFA A;  3CMA A;  4BE1 A;  1ZLM A;  2E5K A;  4E7H A;  2CDT A;  4ELZ C;  4OB2 B;  4KGX B;  4XU3 A;  3GOX A;  1M90 R;  1YN8 A;  4DOW A;  2JVV A;  2AIR B;  3G4S A;  2JM9 A;  1TU0 B;  1IB8 A;  4ZGE B;  1UDL A;  1UFF A;  3HFN A;  4F17 A;  1VQL Q;  2OTL T;  4MML A;  4LDX A;  2DXT A;  4RCC A;  2HDA A;  2VYT A;  3I56 A;  1HXD A;  4OB3 B;  3FLG A;  1I07 A;  4Z88 A;  3ER0 A;  2EJG A;  2PVD B;  2RHI A;  5KYW B;  1E6H A;  2EYQ A;  4N0A C;  4M7D G;  2LJ3 A;  2YLC A;  4KUL A;  5J26 A;  4J9C A;  1Q86 C;  5KYN A;  4XTU A;  5GAO q;  2RHU A;  2KBT A;  2FPD A;  4XTY A;  3CCM A;  4QQG A;  1GRI A;  1SG5 A;  1T0J A;  3PIO A;  1TUC A;  1RAH B;  4RKU E;  2QEX A;  3OS2 A;  3JCM Q;  1UJY A;  2WAC A;  3VS1 A;  4N4I A;  4XTV A;  4A4K A;  5GAN e;  2F1L A;  1VQ6 A;  4JJC A;  4M77 F;  1EFN A;  2KAF A;  4C5I A;  4HVV A;  1C1A A;  2K57 A;  1VQ5 Q;  2DL5 A;  3CCR A;  3OYN A;  3R6O A;  1VQL T;  3ASK A;  2K2M A;  4HCZ A;  2XI9 A;  1UEC A;  4M7D A;  1T3S A;  1VOM A;  4IKF A;  4M77 G;  2B8A A;  1D09 B;  2RQU A;  4ZGJ B;  3M54 A;  2AZV A;  4QVD A;  2DET A;  1GCQ C;  2ED1 A;  2FHD A;  2XK0 A;  1OZ3 A;  2QYZ A;  5IXB A;  4M75 B;  2J06 A;  4AFQ C;  2LVM A;  2DIQ A;  5GAN j;  3AHU A;  3HRT A;  2GTJ A;  4A4H A;  2DD5 A;  3VS3 A;  4D8K A;  5GMK h;  3MJX A;  2QA4 A;  1VQN Q;  4PJO C;  2DVJ A;  2EBP A;  5GAM e;  1D3B B;  1Z9Z A;  2HBW A;  4KRT A;  3QBY A;  4PK4 A;  3S6W A;  3QDF A;  1MV0 B;  3BFM A;  1YI2 A;  4PJN A;  2BE7 D;  2YT6 A;  3V7R A;  1IGQ A;  1QVG S;  4MDX A;  3DB4 A;  1E7O A;  1QVF P;  2LJ1 A;  3EFR A;  5HK3 A;  2V8K A;  2VUB A;  3OYJ A;  3NGP A;  1Y07 A;  1VQ5 T;  4HCB A;  5GAM j;  2XID A;  1KQS P;  4R0K A;  4BUG A;  2Y4X A;  4V2S A;  1B34 A;  4TVR A;  4BI3 A;  4PJO D;  1UGR B;  1AEY A;  2CH4 A;  1T3L A;  1M90 C;  1ZUK A;  1YHQ A;  2D8J A;  4C8Q C;  3RMS A;  2KYB A;  3H0I A;  4JZ4 A;  2BTT A;  4XU2 A;  3PE0 A;  3LX7 A;  4J9D A;  1PKS A;  1KQ1 A;  3GLX A;  2BZX A;  3CCU A;  4RCB A;  2PNI A;  4F16 A;  2K9G A;  4F7U B;  3LGL A;  3EGD A;  5GMK i;  4M75 F;  1M30 A;  1VQN T;  1AWX A;  1H8K A;  3NHN A;  3L2V A;  2JXB A;  3SFM A;  1X01 A;  1KIK A;  4C5E A;  4L6V 5;  2ECZ A;  3JCM X;  3CXC P;  1M3B A;  1ZHI A;  2RHX A;  1OOT A;  4IUP A;  2L3R A;  1ZA2 B;  2CP3 A;  3N5B B;  3DKM A;  5KH6 A;  2EIF A;  4B6M A;  4C5G A;  2HSE B;  3LGF A;  3M4Y A;  1IRX A;  2CYZ B;  4C8Q D;  1SHF A;  6AT1 B;  2ROT A;  2ROL A;  2G3R A;  4C0Z A;  4ESR A;  5HK0 A;  1WXT A;  2M9U A;  4C92 C;  4D8D A;  4ZN3 A;  3OS0 A;  2A08 A;  4FT2 A;  3PFS A;  2ZZD A;  2F2W A;  3CD6 Q;  3DB3 A;  3VS7 A;  2H3E B;  3UDC A;  3JB9 I;  2X4W A;  4LE9 A;  2RD1 A;  3CBO A;  4E6R A;  2AZS A;  2HSP A;  5DY9 A;  3JCM f;  3A98 A;  1IO6 A;  2DJQ A;  2L5Q A;  4X9D A;  5CKF A;  1JO8 A;  3SWN B;  7AT1 B;  5GJV B;  5J3B A;  1SSH A;  1Q82 C;  1V29 B;  1BI2 A;  2E41 A;  2XMF A;  4N4G A;  2RK2 A;  1JRI A;  3A8L B;  3UA6 A;  1PG5 B;  2QTV A;  4IIO A;  4QQ6 A;  4BB7 A;  3VS5 A;  1WDX A;  4C92 D;  3UAT A;  4HKE A;  3A8M B;  4IUT A;  1WXB A;  1M1K U;  2EVR A;  3INZ A;  2XIC A;  1U06 A;  2G6F X;  2KSS A;  3M0U A;  2EYW A;  4JJN K;  3LH5 A;  3ME9 A;  2O4X B;  3CCV A;  2E6N A;  1JXO A;  3CCQ Q;  4E7I A;  4R56 A;  2QQA A;  1ABO A;  2ZPF B;  1FMV A;  2P0K A;  1PNJ A;  1K76 A;  5C0M A;  4LUD A;  3EG1 A;  2JJ9 A;  3CD6 T;  1Y96 B;  3JSC A;  5LJ3 g;  5GAN h;  3V7S A;  5IHK A;  1X2Q A;  1EX4 A;  2OAW A;  5L8R E;  1TUG B;  5I2S A;  2LQN A;  2CT4 A;  4Z8A A;  1OV3 A;  1TS9 A;  3OYC A;  3EGX A;  3VYG A;  1GL5 A;  1ZX6 A;  2LCL A;  2LCS A;  2DIL A;  2OTJ A;  2F5T X;  5CAI A;  2KQW A;  2EW3 A;  3OW2 P;  2E1H A;  1RL2 A;  3PMI A;  5LJ3 e;  3T9N A;  4II1 A;  1LJO A;  4ZGD B;  3QHS A;  3CQT A;  4IIM A;  2E4H A;  2HNI A;  3JB9 D;  4M7A D;  3V8L A;  4EMK C;  5GAM h;  4JLG A;  2I0N A;  2GF7 A;  1X27 A;  1W2B P;  1Q95 G;  2MAM A;  4HVW A;  1QVF S;  3PIP A;  3CCQ T;  2HAX A;  4OB0 B;  5IHI A;  1NLO C;  3CCE Q;  2RJD A;  1OPL A;  1R8O B;  4FYY B;  5A2Q E;  1KFZ A;  5LJ3 j;  5IXF A;  5M9O A;  4L5G A;  1UGS B;  2ZPG B;  4NS5 A;  5A0D A;  1KQS S;  2K6D A;  3CCL A;  1YNZ A;  4AT1 B;  1G83 A;  4J5Y A;  4M78 C;  3OMG A;  1JJ2 A;  4BAC A;  4DEX A;  2J7I A;  5KCH A;  2BZY A;  5ECA A;  1VQ7 Q;  3MP8 A;  2P0P A;  3I5S A;  1X2K A;  4JDS A;  4EMK B;  4JRQ A;  1V1C A;  4MZP A;  2EYY A;  2EAY A;  2COW A;  1BCO A;  1YJW A;  1KK7 A;  3OQ5 A;  2A28 A;  2E5Q A;  1C0M A;  5A0G A;  2DF6 A;  1WNL A;  2LT4 A;  1GXI E;  3I55 A;  2JS2 A;  1KQ2 A;  5KYY B;  2RA2 A;  2CZ7 B;  2KEA A;  3MEW A;  3AT1 B;  4PJO E;  3TU4 K;  2QXF A;  2XDD A;  2K7A A;  2EQK A;  1RAB B;  1KHI A;  3JRZ A;  5DM7 R;  4CRI A;  3TEE A;  2VWF A;  1MUZ A;  5GAN f;  1CSK A;  3CXC S;  2JW4 A;  1Q7Y R;  4Z89 A;  1RLQ C;  3JCM g;  2QGF B;  3J81 E;  3GF5 A;  4PFP A;  1JXM A;  4M78 D;  4LDU A;  4ZNX A;  1ZSZ C;  3MEA A;  3RUX A;  2EFI A;  1D1C A;  1UHF A;  3G71 A;  2K5F A;  1QP3 A;  2LQK A;  5CR2 A;  1KSW A;  3CCE T;  1VQ4 A;  1GFC A;  3SB2 A;  5LJ5 g;  2MPX C;  1VQM Q;  2ABL A;  5D6X A;  2A0F B;  2Y4Y A;  3OYK A;  1RAD B;  2DZ9 A;  3A8G B;  1UEB A;  2EYZ A;  2DNU A;  1VQ7 T;  3E9G A;  1N8R R;  3JCM e;  4C8Q E;  4ZTF A;  2OX7 A;  1ZSZ B;  5GAM f;  4M7A A;  1X6B A;  1U5S A;  3ULR B;  4GLM A;  2R5M A;  5IT9 E;  5LJ5 e;  1QVG P;  3EG9 A;  2RJC A;  3H6Z A;  2E3I A;  4CC4 B;  4A4E A;  1M5Q 1;  3OYE A;  2J6K A;  1J3T A;  3QPH A;  2LX9 A;  5FU6 C;  3L2W A;  1K9M U;  4FYW B;  1VQ8 A;  2YSQ A;  3DLM A;  3NTI A;  3JCM V;  4M7D C;  3CCS Q;  1I5O B;  3I56 Q;  2CP2 A;  2SEM A;  4Z02 A;  2DYB A;  1KC8 U;  4A4F A;  4EIK A;  3H0H A;  3GP8 A;  3OYM A;  3CXC A;  4RTZ A;  1FX7 A;  5LJ5 j;  1K0X A;  4ME7 A;  1VQP A;  3R6N A;  2LJ0 A;  2VXF A;  1B07 A;  3S3O A;  2K5I A;  4C92 E;  1KD1 R;  1WIE A;  3HTR A;  1ARK A;  3UPU A;  2O2O A;  1FMK A;  4OMF B;  2IVW A;  3D7S B;  4HVU A;  2FZG B;  3OA6 A;  1AZE A;  1M4Z A;  2O88 A;  1R77 A;  3PNW C;  3JB9 H;  4MZT A;  3O5Z A;  2P4R A;  4M7D D;  2LNH B;  2EGA A;  4JLI A;  5FWC A;  1OQK A;  1AOJ A;  2FVU A;  3BDU A;  5IH2 A;  3UT1 A;  2XHC A;  2GCX A;  3X25 B;  1I8F A;  4KUD K;  3OW2 S;  4X9C A;  3OYB A;  5KYX B;  2BUD A;  3QKJ A;  3CC4 Q;  1IXD A;  2O9V A;  1IGU A;  3SDZ A;  3CCS T;  2DD4 A;  2YUO A;  2GGR A;  3NMZ C;  3I56 T;  5LJ3 h;  5GAN 4;  2AKL A;  2DJZ A;  2HKN A;  4R55 A;  4X1V A;  1G3Y A;  1U8R A;  1A0N B;  4ATO A;  2L2P A;  1W2B S;  3LWI A;  4C0D C;  4FT4 A;  1K9A A;  2CS7 A;  1R0B G;  1Q7Y C;  1NEG A;  5CKB A;  4ZN1 A;  2X3X D;  4M77 D;  2QA4 Q;  3G6E Q;  3FJP A;  3WXM B;  4M7A E;  1B34 B;  2LRQ A;  2VV5 A;  1X43 A;  2RHY A;  4JUV A;  2RM4 A;  2C0I A;  5GAN g;  1V76 A;  1YI2 Q;  1SHG A;  2CUB A;  5I21 A;  1ZUY A;  4J9F A;  2NUT B;  5GAN 3;  4E47 A;  3HL8 A;  1UGP B;  5FWB A;  5A0L A;  2ZPB B;  1UG1 A;  3MO8 A;  2LNV A;  4J9B A;  4WTO B;  5GAO r;  3ZEH A;  4HT9 A;  2JMA A;  1N8R C;  3J7A F;  4JJD A;  2D8H A;  2ZAE A;  2JMC A;  2OTL A;  1B7T A;  2YRV A;  3CC4 T;  3P8H A;  2EWN A;  4E2F B;  3KXT A;  4KUI A;  1M3A A;  2MMP A;  5GAN 6;  4VUB A;  4OP0 A;  5I11 A;  1M1K R;  3EFO A;  1XJW B;  2PU9 B;  3CME Q;  4J8O A;  1Y0M A;  2A7Y A;  5GAM g;  4GY5 A;  2VGN A;  2ZPE B;  3P8D A;  2HEQ A;  2NUP B;  1RAG B;  3CPF A;  1Q82 R;  4OMO A;  1X6O A;  3CPW P;  3QUI A;  2KXC A;  2QA4 T;  8AT1 B;  3G6E T;  1MHN A;  2JTM A;  4XTW A;  2NLU A;  3PVQ A;  1Q81 R;  2DL8 A;  3O8V A;  2LX7 A;  2A36 A;  2JNG A;  3NTK A;  1Q86 U;  5FRO A;  1W6X A;  3QWY A;  2CUD A;  1P92 A;  2O31 A;  2YWW A;  4M78 E;  1FMW A;  1GBR A;  1QW1 A;  4QVZ A;  1KD1 C;  3QJ6 A;  1YJ9 A;  5LJ3 f;  4BE0 A;  5AT1 B;  2O9S A;  5EG2 A;  1HSQ A;  2RK1 A;  3JCM h;  1S72 Q;  1UB4 A;  2GFU A;  1K73 R;  1AHJ B;  3LW5 E;  2EPD A;  1BK2 A;  2HQX A;  1VQL A;  3JCM d;  1MMA A;  2K3Y A;  3MEU A;  3SD4 A;  1TOV A;  3RR6 A;  5LJ5 h;  2YDL A;  4C5H A;  2MWP A;  4M77 A;  1DJ7 B;  3JCM c;  1JU5 C;  5GAO p;  2AT1 B;  5L23 A;  5LJ5 d;  4OB1 B;  3CME T;  1BI3 A;  4XK8 E;  1Y7X A;  4PJO B;  2GTO A;  4M4Z A;  2QDY B;  4LDW A;  2M0Y A;  1QCO A;  1SF9 A;  1X69 A;  2B86 A;  1HJD A;  1D1B A;  4AFU C;  3TSW A;  4J9I A;  4J6W A;  2CP7 A;  1JEG A;  3THK A;  3PGG A;  2H8H A;  1PSE A;  2DBK A;  4EPC A;  4J83 A;  2BE9 B;  5KYU B;  1M2O A;  2YUQ A;  4FM4 B;  4UC4 A;  1CKA A;  2D0N A;  2L3Q A;  3JB9 J;  3QYG B;  1NPP A;  2D6F A;  2CH4 W;  3S3M A;  1D0X A;  2VAS A;  2P4T A;  1M9S A;  2WSF E;  5KYW A;  2DX1 A;  1VQ5 A;  2GNC A;  1S72 T;  2DKG A;  2SRC A;  3V8J A;  2KK4 A;  4M75 G;  4C8Q B;  3S3N A;  3QII A;  3M59 A;  2HQE A;  1SRM A;  1OPK A;  2JUF A;  1PD1 A;  2XD0 A;  3OB9 A;  1QVG A;  4M7D E;  4DQ2 A;  1G2B A;  1G8X A;  2L0A A;  1M90 U;  1E6G A;  3L1A A;  3EHQ A;  2DPP B;  1VQN A;  3NFC A;  2JS0 A;  3CCJ Q;  4IUU A;  3REA B;  4HA8 A;  1N9R A;  2KDS A;  2RI2 A;  4FW1 A;  1F1B B;  5D7U A;  4PJO F;  2M0O A;  3QYH B;  1O75 A;  3OYA A;  2WSC E;  3HRS A;  1M1K C;  2QTX A;  2MF2 A;  1AT1 B;  1VQO Q;  2WSE E;  3URG A;  1BCM A;  3C95 A;  1PWT A;  3TCJ A;  2RQW A;  1RUW A;  3KBG A;  4M75 A;  2NWM A;  5LJ5 f;  4CC7 A;  2RH2 A; 
#chains in the Genus database with same CATH homology
 2ZAE A;  1OQK A;  1PC0 A;  1TS9 A;  1TSF A;  2KI7 A;  1V76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...