1PC0A

Nmr structure of the archaeal homologue of rnase p protein rpp29
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
61
structure length
61
Chain Sequence
b'GLMVEVVESPNHSEVGIKGEVVDETQNTLKIMTEKGLKVVAKRGRTFRVWYKGKIMRIKGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein AF1917
molecule tags Rna binding protein
source organism Archaeoglobus fulgidus
publication title NMR Structure of an Archaeal Homologue of Ribonuclease P Protein Rpp29
pubmed doi rcsb
total genus 6
structure length 61
sequence length 61
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2003-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.210 Mainly Beta Roll SH3 type barrels. Ribonuclease P/MRP, subunit p29 1pc0A00
1V76A 1TS9A 1PC0A 2KI7A 1TSFA 2ZAEA 1OQKA
chains in the Genus database with same CATH superfamily
1UUEA 4M78B 4PJOE 4A4HA 2BIVA 2P0PA 2YDLA 2LZ6B 3CCJA 1TH7A 4OF1A 1AZGB 4C92B 1YNZA 2LX9A 3SEMA 1YIJT 1AWJA 1XNIA 2X3WD 3FLGA 4M75F 1X27A 2MPXC 3L2RA 2K3XA 2EJGA 5GAOl 5GAMh 4RG8A 1W6XA 4F7UG 2JMCA 4M77C 2IVWA 1KQSP 1JXMA 1FYNA 5GAN5 2Y90A 4FSSA 2XICA 4KH0B 3EGXA 4PLIA 2O9VA 1OI1A 2DTHA 2JTMA 4HXJA 5GAN7 3M4GA 3WXMB 4OMMA 3RMQA 1D0YA 2KYBA 3JCMX 2RO0A 2QQSA 1Q81C 1VQ7A 5GAOm 1PKTA 1AT1B 2JT4A 4V2SA 3KFVA 3OSVA 2E3IA 4HCKA 4M78D 1UJ0A 2SEMA 4M77E 2DD4A 2VXFA 4C92A 4OMOA 4XTZA 4JDSA 1N5ZA 5FRMA 3CCEA 1QWEA 5M9OA 4M78E 1OX9A 1VQMT 1YITA 4PJOB 2YRDA 2AT1B 2E70A 3G71Q 2AKLA 4A4FA 3OYEA 1K0XA 1OU8A 2KGTA 4KBMB 3CPWA 1I8FA 3RESA 4EMGA 2QTXA 3FEOA 1VQ5T 1K76A 2HBPA 4EPCA 2DBMA 1AEYA 1E6GA 3E9FA 2J06A 3VUBA 3PIOA 1W4SA 1YWOA 2PVGB 5AT1B 1G3SA 1KQSA 5AYFA 2LCLA 2NUTB 2P84A 4BACA 2A3LA 3KUFA 4L5GA 4KUDK 1GRIA 3X25B 1WQ7A 1GCQA 2NUTA 4B6MA 1MHNA 2OJ2A 1JJ2S 2CUDA 3BW1A 2DTOA 1YITQ 5IHNA 5GAMd 1G5VA 4GLKA 4HA8A 3JCMV 2A08A 3OS5A 2DEQA 4M75B 2PQWA 1RACB 2ED1A 3FIFA 5I21A 3CMET 6AT1B 2XG8D 3UPUA 4O6JA 2HKNA 4RG2A 3SWNA 3M0PA 1M8MA 1YBYA 2VWFA 4KGZB 4LXCA 5DLQE 1SKUB 2F2VA 3QZ9B 1NZ9A 1VYVA 4L59A 4ELYC 2L3RA 2BUDA 4NL2A 1OYXA 4BI8B 4C8QE 1Q7YC 2PTKA 2XHCA 1AOJA 1MMNA 4C5IA 3HSBA 3JB9G 3JCMe 1M27C 4EMKB 1BIBA 1IRXA 3L2WA 2LMJA 2K3YA 3TSZA 1C0MA 4DA4A 2VV5A 2CH4W 2DX1A 1RL2A 4M75A 3H0HA 1Z9QA 4JLGA 3JV3A 3PVQA 2PVDB 4DOWA 2EGCA 5GAMe 4KH1B 2EYYA 4OMLA 4GBQA 1R0CB 1ABOA 2Y4XA 3S3OA 4M7DE 4ZN3A 4ZTJA 1N6AA 4J8OA 1WHMA 2R5AA 3ASKA 3JCMg 3OS1A 3OYIA 2DEUA 1ZLMA 4BD3A 4PJOC 4M78G 1X6OA 1JJ2P 2LC4A 1M90C 2VC8A 3EAEA 1WXBA 1N8RU 3UWNA 4LUEA 4FW2A 1PSFA 1KHIA 4YTLA 1YJ9T 3SD4A 2NLUA 4M7DF 4LUDA 3SWNB 5FROA 3WVEB 1Q86U 1NEBA 2RQVA 4A53A 2CYZB 4JZ3A 1W1FA 4RTUA 2D8JA 4ORZA 3M53A 2L3QA 4M7DC 2L8DA 1D1CA 5FU6B 1Y07A 2MMPA 2YRVA 2F1LA 4C0ZA 2QA4T 3GPLA 1WDXA 4F7UB 1VQ7Q 2ESWA 1BI2A 2NUZA 1VQOT 4BDYA 1UG1A 2AZVA 1Y96A 1UHFA 2KQWA 4XTVA 4R56A 2C06A 3G71A 5GANe 4N0AC 4NL3A 2HQXA 1WPYA 1IB8A 3MO8A 1QVGP 3A98A 4C92C 2L3SA 1OU9A 2A7YA 4ESRA 3UATA 2ZAEA 1YFNA 1LCKA 2HQEA 4F7UF 2HCKA 1BB9A 1K9MU 1QVFP 1QP3A 5CKEA 1LNXA 1VQ4T 1Q86C 1NM7A 1YN8A 4F04B 1JRIA 2DD5A 1W2BP 3S3NA 1HSQA 1UJYA 5DLOA 3CMEA 4Z02A 3JCMJ 4XTXA 1RI0A 5ECAA 4ZGDB 2XDDA 3MEUA 5LJ3g 4HKEA 2E5QA 3CPFA 4XU3A 2CT3A 2IIMA 3G6EQ 2J05A 2HAXA 5J26A 1M3AA 1K73U 3TREA 1I5LA 4E7ZA 2B86A 3I55Q 2FPFA 1VQ8A 5GMKh 1B7TA 4BY6B 2PUOB 5CK9A 4E7HA 3I9QA 3D7SB 1VQMA 2KE9A 3CQTA 3TQ7P 1VQKT 4XU1A 3OYNA 2RHYA 2EWNA 2RPNA 3FB9A 2COYA 2GF7A 5GAOq 3DB3A 1PHTA 5A0DA 1K4US 2NUPA 1MMAA 4JS4A 1KC8C 4XK8E 3CD6T 1WX6A 4E2FB 1RAEB 2GFAA 4M75G 3I56A 1BCOA 1YI2Q 2KXDA 1Q82U 1H3HA 3MEAA 4D8KA 3QO3A 3L2VA 4FYXB 4MMKA 3TU4K 2E1HA 4FSXA 2RI2A 2GNCA 3VRYA 3FRNA 3CCRQ 1YWPA 3PT9A 2KY9A 2BKDN 2DAQA 1WIEA 5CO7A 3EFSA 2OTLA 4Z89A 2WSEE 4M75C 3QWYA 3J80E 4RUGA 1BCMA 3RKXA 1ZA2B 2EGEA 4M77A 1QVGA 2BZYA 2O4XA 3EG3A 1BI3A 5IHKA 1NYFA 1ZSZA 1N27A 1VYTA 5KYXA 4M7AE 4KUIA 1OPLA 2OTJQ 2DFUA 4C5HA 2QGFB 1GCPA 1PD1A 4J6WA 4MZPA 3OY9A 2I2LA 3E2UA 3P8BB 3G6EA 2AZSA 2GQIA 3QKJA 2CUBA 1CKBA 1KHCA 2AIRB 4AFQC 4FIBA 4M7AF 1S72A 2MWPA 2F5TX 4DBFA 1ZBXA 2KVQG 3VS7A 1ZUYA 3L1AA 3G71T 1CSKA 3R6NA 4Z8AA 2XDBA 1YI2A 5LJ3d 3CBPA 2ZPHB 4AG2C 3DB4A 4ANJA 1G3YA 4RTXA 3VV0A 3A1PA 1O75A 3BDLA 3C4SA 2EQMA 3J7AF 4KRTA 1OULA 3QYGB 1RAIB 5KYWB 3ULRB 2DVJA 1Q95G 3OSSC 1ABQA 3CCRT 1EX4A 2YUOA 3Q1JA 3CCQT 4RTTA 2LCSA 4QVCA 2LNHB 1M3BA 2LVMA 4JJBA 4C92G 3JCMb 1VQ9T 2L0AA 2QYZA 1D1AA 1ZSZB 2JOYA 5CQYA 2FB7A 4CC4B 2CP3A 2EIFA 1T0HA 2K79A 2COWA 4OB0B 3OYKA 2PVOB 4N4GA 2GFUA 1YIJQ 5D7UA 1VIFA 1LVKA 3EHRA 4R0KA 3BE3A 1M1KR 3QBYA 3OQ5A 3VS4A 2EW3A 4PJJA 1MUZA 2M51A 3GNFB 1K8AC 1YJWA 2V8JA 5C6SA 4E7SA 3CCQQ 2E3HA 1U06A 2CGHA 2YRCA 3HHTB 4X9CA 2EGAA 4C0DC 5IAYA 2W10A 4DEXA 1IZ6A 1R8OB 1WXUA 2KNBB 3G6ET 1KG1A 4A4KA 5GAOn 2X4XA 3DLLA 4CI0C 2RQRA 3RNJA 1Q82C 1D09B 2D8HA 2JM9A 2A37A 3UF4A 2QEXT 4JPBW 2KRNA 2EQJA 5KYUB 2ZPGB 4C0DB 3JCMd 2LDMA 3WVDB 1ZHIA 1KJWA 4PFPA 5KCHA 2CH4A 2LQWA 4VUBA 3OYDA 3M54A 1M1GA 1TUDA 1IXDA 1WJRA 5FU7B 1VQPA 2P4RA 3CEYA 2KBTA 1ZUUA 4DEYA 5CKDA 4QQGA 5KYNA 2DJZA 1HK9A 3RUXA 1XJWB 1K73C 2RA2A 9ATCB 3V7RA 1EIFA 2QQAA 1Q81U 4JLIA 3HRUA 3INZA 1WHJA 2DL7A 1PC0A 4JZ4A 4QQDA 3I5SA 1UECA 4EMKC 2LNVA 2EYQA 3NPFA 3VU3C 1UE9A 3M0UA 1QKXA 2ZGWA 3FJPA 5HCKA 2QQ9A 4KULA 3N5BB 4C92D 1BIAA 2XMFA 2AK5A 4J9BA 3HL8A 2LJ0A 4BE2A 2MOXA 1ZSGA 1UFFA 1WI7A 2EVRA 1VQOQ 1EZZB 2DJQA 2QQBA 3JSCA 5A2QE 1VQ5A 3CC2Q 4CC3A 2ZPFB 5DY9A 1Q7YU 3LGLA 1VQLQ 1TSFA 1YHQA 3GP8A 3A8HB 3KXTA 1YJ9Q 3EFRA 2FPDA 2E6ZA 3AHUA 1E6HA 5I22A 5GANg 4LDWA 4HVWA 3CCVT 1WHHA 3CCMA 3C95A 1U1SA 2KYMA 3OA6A 3M0RA 1MNEA 2X4YA 2DYBA 2VYTA 1I5OB 1G8XA 4C8QA 1VQKQ 5KH6A 3BDUA 1MMDA 3A8OB 3L2ZA 2CP2A 2LT1A 3CMAQ 2F5KA 2RHIA 3OYFA 3HPWA 1RADB 2FL7A 2EBPA 3P8HA 4J9CA 5CVIA 4FL6A 2QAZA 1VQ6T 3EFOA 2E65A 2JJ9A 2V1RA 3MP8A 4IUTA 3CCUQ 5EG2A 4OMNA 5IXBA 2D1XA 4EMHA 1JBMA 1D1BA 4HVVA 2QG9B 1Q86R 3QHSA 1XQHA 3G4SQ 4FYWB 4ELZC 2NWMA 2KK4A 2K5IA 4NS5A 2RB6A 2H3EB 1VQOA 5HK0A 1DJ7B 1OV3A 4PLLA 2WACA 1VQ6Q 1K9MR 4M78F 2FRWA 2XIDA 4GY5A 2EPDA 1RAFB 2R57A 4M78C 4OGEA 1IGQA 2RJDA 3VS0A 1WYXA 3BFMA 2A28A 4RTZA 1Z9ZA 4MDWA 2JS0A 4FT2A 4C0FA 1SHGA 2EQUA 1ZX6A 1PSEA 2P4TA 1E7OA 1X2QA 5FW9A 3HTRA 1YJ9A 1YJWT 2XDPA 2DILA 5KYYA 4Y92A 1UGQB 2QQRA 1VQLA 2G3RA 1KQ1A 4OGCA 4ZN1A 3JB9F 3V8KA 4RCBA 1Y0MA 1K9AA 4C92E 4IKFA 4XQ3A 1K9MC 5LJ5d 1YJNQ 4ZNXA 1Q82R 2QEXA 1WHLA 2FO0A 4XTWA 4JJCA 5J3BA 1M9SA 3OB9A 4XAXB 3M9QA 1AHJB 3HFOA 3HRSA 2VASA 3LX7A 1WHKA 2AKKA 3ZFJA 2DIGA 4LN2A 3ME9A 2YHTA 3S3MA 4J9DA 2EAYA 2EYZA 4LNPA 4IUPA 3VS5A 3CPWS 2KEAA 1NJIR 3OS0A 3NTHA 1UGPB 1A0NB 2Y4YA 2ZZDA 2JNGA 4J5YA 8ATCB 2LJ1A 1YHQT 1VQ8T 4M77B 1I1JA 2OAUA 2L2PA 2QA4A 1BI0A 3JRZA 1QVGS 4FCYA 2F2WA 1S1NA 2RM4A 2JUFA 1ZQ1A 2DKGA 1UHCA 4IUUA 2QEXQ 1M3CA 4M7DG 3OYLA 2YUPA 1RLQC 2O88A 4N0AA 2E12A 2OI3A 5GAN6 1TUGB 5A0LA 3PMTA 4Q5WA 1WZOA 1X2KA 2ZPIB 3X28B 1FXXA 3LW5E 5CQXA 3M5AA 4IURA 2DZ9A 3VS6A 3BY7A 3R6OA 1T0JA 2YWWA 3M4YA 1R0BG 4EMKA 1VQLT 3CCUT 5HY6A 5IN1A 1NLOC 1ZUKA 3A8MB 2K57A 2A0FB 1TOVA 3V8LA 1Y7XA 4PJOD 1M2OA 3HRTA 2YLBA 4M75E 4KGVB 3MKDA 1VQKA 3UA7A 1UGVA 3O5ZA 3ZL7C 3RERA 3LH0A 2ATCB 3L2UA 3A8LB 4J6XA 2K6DA 4EIKA 3LWHA 1G3TA 4J6YA 3I56T 1VQ8Q 3QDRB 4E7IA 4ATOA 1UDLA 1QW1A 3I56Q 4RKUE 1R77A 5LJ5e 1BYMA 1TU0B 1X75C 2NUPB 5GAOp 3JCMQ 2ROTA 4PJOF 4M78A 3ER0A 3CCJQ 3OYGA 2K5LA 1C1AA 1ARKA 2YT6A 2CSQA 3QZ5B 3CMAA 2DF6A 2D0NA 4J7IA 4AFUC 3CBOA 4J83A 3ZEHA 4KGXB 4II1A 4JRKA 1WQWA 5GAMj 2L89A 4MZMA 1RAHB 3QXEB 5KCOA 1TS9A 2K7AA 1I07A 3JB9H 3GF5A 4K11A 2CZ7B 4DQ2A 2QDLA 4M7DB 1VQNT 2F2XA 1KC8R 2EYWA 2RI5A 5KYUA 1JEGA 3REBB 2XKOC 1H3ZA 4FYVB 3OW2S 1V29B 1V76A 4MZTA 1JXOA 1HYOA 1M1FA 2YXYA 3ZBDA 1UTIA 5GMKi 1HJDA 3I35A 2FZCB 2ZPEB 3EGDB 3H0IA 3M0SA 3MJXA 3NTKA 1PM3A 3X20B 2W0ZA 1X69A 2DIQA 2LT4A 3FJ5A 5FU6C 3RKYA 5GAMg 4PL6A 2KR3A 3CD6A 4E7LA 2X4WA 2LQNA 4AFSC 1JU5C 4XU0A 3CCET 5FU7C 3CXCS 4XU2A 4F7UE 4QW2A 2AHJB 1HD3A 2CP6A 4HT8A 3CCUA 4J7FA 1QVPA 1QWFA 5IHIA 4NOYA 3L2QA 3GNGA 4A4GA 1U1TA 3CC7Q 5CAIA 2RHZA 4JRIA 1NLPC 2X4JA 1NJIC 2V8IA 2I0NA 4WTOB 2FEIA 2RF0A 2X9HA 1PG5B 2VVKA 4BB7A 2MCNA 3GBQA 1D0ZA 4HCZA 4QT7A 1Q81R 3EFOB 2KXCA 4J9HA 3C94A 1Y71A 3OYYA 4M7AG 2DE0X 2HSEB 1OOTA 1TWBA 3EGUA 2HDAA 3CCMQ 1IO6A 3CD6Q 2M0OA 1M30A 3PVLA 2GTOA 3CC7T 4O5VA 1AWOA 3QYHB 1O9SA 5I11A 1J3TA 1N8RR 2EJFA 1W70A 2XI9A 1YJWQ 2OTJA 2RH2A 1VA7A 1B34B 1NBEB 5L8RE 1UEBA 5GAN2 4HVUA 1GBQA 1RAGB 3TCJA 2RHUA 1NE8A 5IH2A 1ZA1B 2B8AA 1CKAA 2DXTA 2JMAA 5LJ3h 2DBKA 2DL5A 1WNLA 1SEMA 4Y28E 2K2VA 3SDZA 2PU9B 2GCXA 3G7ZA 4M77F 1X43A 2HQHA 4J9FA 3LH5A 2LX7A 1Y96B 2EKOA 2MF2A 3QIIA 5GANj 2KROA 2EKHA 5LJ5h 5I2MA 5LJ3f 3CC4Q 3C0CA 2GBQA 2QXFA 3X26B 2IPOB 1KQSS 1LJOA 3CMAT 3EG9B 2ABLA 3EG9A 4R55A 4PFZA 1FMKA 4C5GA 3MP1A 1D0XA 1VQNA 1Q7YR 2LTOA 3CCST 2DL8A 2QASA 5HK3A 1WJQA 1M90U 4C8QG 1GL5A 4C8QC 3CCVQ 2MK5A 1X6BA 1X01A 5GANf 1IHVA 2EQIA 1GBRA 4FYYB 1KD1R 5LJ3j 1MGQA 1YITT 1SHFA 4M7AB 4JS5A 1X6GA 2WSFE 3MHXA 2GTJA 3CC7A 2FZKB 3TEEA 1VIEA 2CP0A 4BE0A 1SF9A 3SHWA 3U23A 5KE2A 1SRMA 1UGSB 4IIMA 4C92F 2FZGB 3QPHA 2QI2A 2X51A 5LJ3e 4M7AD 2QA4Q 5IT9E 1OZ2A 2A36A 2RQUA 4QQ6A 2DETA 3PE0A 1RABB 2BZ8A 3H8ZA 2DYIA 2JTFA 1IREB 3PTAA 4J9GA 2K9GA 2RQWA 4LDXA 1XOVA 1NYGA 3JCMc 4C8QD 5GMKl 4JRQA 4MMLA 1VQMQ 3E9GA 4BDZA 2DRMA 3M59A 2D0QB 3I55A 2FHDA 3M0QA 2DMOA 3CCMT 5CKBA 3JB9I 1AD5A 1M2VB 4X9DA 4C8QB 5GMKm 2YUNA 4AMCA 2OTLQ 1VQ4A 5FWBA 1WA7A 4ZTFA 2ENMA 2JTEA 1KIKA 3VRZA 3LGFA 1BKBA 3V7CA 2RJFA 5CKHA 3EG0A 3EG2A 3RIRA 4JJNK 4B9WA 8AT1B 4D6WA 1S72Q 4DBQA 4RMOA 2GQVA 3RDVA 1I4K1 4HCBA 3DLMA 1N9RA 4UC4A 2CZ6B 2L3PA 2VB6A 2DNUA 4TVRA 1RLPC 2M1HA 2C0TA 1M8VA 1M2VA 2ECZA 1MNDA 3QJYA 3QG1A 2RJCA 2DTIA 4CRIA 1JQQA 1PCXA 1N8RC 2KMTA 2K4YA 2HL3A 2JVVA 5LJ5g 2DLPA 3PGGA 3OYBA 2CDTA 2M02A 5GAN4 4C0GA 2CSIA 2M16A 4KT0E 2LQKA 2PNIA 3C12A 2RK1A 2DM1A 3CCSQ 1VQ9Q 3CCRA 1FWZA 4AFZC 1M1KC 1Y57A 1VQ6A 3LLRA 1LOJA 2J6FA 2KT1A 4FT4A 1AWWA 3FC3A 3CMEQ 4OB3B 1GFCA 4X1VA 5CCAA 1VOMA 3NHNA 1BBZA 5GMKe 2O01E 4JUVA 3OW2P 2DXUA 1TG0A 2NYSA 3G4SA 3OMGA 1G2BA 1ACMB 2QTVA 2WSCE 2LQ8A 4PKCC 3EH1A 3H9NA 4OMQA 2DL4A 2M9UA 4XTUA 4EDUA 3E1SA 3OBWA 1S72T 3VS1A 4OMPA 3CXCA 1GCQC 3CC4T 3RMSA 2LJ3A 4HCCA 3JCMW 5GMKj 1PRLC 4E47A 3MEVA 2GGRA 3OW2A 1SRLA 1MV0B 3EG1A 5FWCA 2DERA 1PD0A 2DRKA 3JCMh 1KFZA 3MPUB 4ME7A 2Z0WA 4M7AA 3OYCA 3DKMA 5GJWB 1WXTA 3OS2A 5J39A 2V8KA 2DPPB 5GAOr 1VUBA 3VJPA 3F70A 3M57A 4WF2A 5D6WA 2JS2A 3JAME 4HT9A 2E10A 2VUBA 2KAFA 2H3JA 2XU8A 1W2BS 1OQKA 1KC8U 1PWTA 4M7DD 1H8KA 3T9NA 3LWIA 2HNIA 1U5SA 4QKUA 5GANd 3E19A 2RQTA 2EQKA 5GAN8 3META 3EHQA 1YJNA 2DVEA 2M0YA 2J6OA 3QSUA 1WHGA 5GAN3 1EFNA 5GAMf 4B9XA 4FU6A 2VGNA 3CXCP 1VQPQ 3NFCA 4L6V5 4F7UA 3HFNA 4DBHA 2RHXA 3X24B 4N4HA 2ZCFB 5KYYB 5FRNA 4OP0A 4FW1A 2DO3A 2JW4A 1FMVA 3QUIA 1N9SA 3CPWP 1QCNA 4JJDA 2DL3A 3SB2A 3LYIA 2OTJT 1KSWA 2V1QA 2YLCA 3J81E 2HSPA 2YSQA 2E5KA 4Z88A 3S6WA 2HKQB 3CCLQ 2COZA 2CREA 1B07A 3CCLT 1AVZC 4E7JA 2J6KA 1PRMC 2CS7A 1AWXA 1UB4A 3A8GB 4J9EA 1VQ5Q 1VQPT 3SWNC 3IQLA 1JB0E 3THKA 1YHQQ 1I81A 3CCEQ 3MCAB 1PKSA 3OYAA 3QJ6A 3CC2T 3CCVA 3UA6A 3L42A 3KBGA 2O2OA 1QKWA 1VQNQ 2VGMA 4M77D 3JB9D 2G6FX 3OBYA 5LL6S 1M4ZA 5A0GA 3A5ZB 1FMWA 3NMZC 4C8QF 5IXFA 2OAWA 3GIBA 2VKNA 1SPKA 2OX7A 4DBRA 1GXIE 2MIOA 3UDCA 1KQ2A 2F69A 4CC7A 4PNOA 3CC4A 3CCLA 2E4HA 2RJEA 2P0KA 3VYHB 5FLXE 1QQJA 2JXBA 1JJ2A 1KD1C 7AT1B 3TSWA 3EGDA 1OZ3A 4MDXA 2CKKA 1RUWA 3PNWC 1BI1A 2C0IA 2BE7D 1U8RA 2E64A 1UGRB 3M0TA 4E6RA 1C6VX 2ZPBB 3G1JA 1BK2A 2KRMA 2X35A 1XTDA 2ROLA 4PFOA 1V1CA 4PJLA 1WGSA 3CC2A 3VUZA 2HBWA 4N4IA 2R5MA 2RD1A 4M7AC 3VYGA 1K0SA 2KT8A 2EJ9A 1TTHB 1LPLA 5DM7R 2CP7A 1HXDA 1QMCA 4JRPA 3PIPA 2KSSA 4XTYA 1U3OA 3JCMP 2V26A 1GFDA 4F14A 1NJIU 5GJVB 1RI9A 4M7DA 1P92A 1VYUA 3PMIA 4RTWA 2RNAA 1AZEA 4PJOA 1M5Q1 3RKWA 1D3BB 1VQ4Q 2EFIA 3V7SA 1YIJA 3URGA 1PNJA 5C0MA 4BI4A 4LD6A 3VKIA 2OTLT 3V8JA 1QLYA 3M55A 3OYHA 2MWOA 4CC2A 1M90R 3O8VA 3VS2A 1IHWA 2LCCA 1NEGA 5I2SA 1TUCA 1KD1U 3SFMA 2DK3A 4D8DA 2E6NA 2CZ1B 4BI3A 4RTYA 2HZYA 3NTIA 3REAB 2LRQA 3FDRA 2BE9B 2FVUA 4PK4A 2CP5A 4M77G 4OMFB 1K73R 1W2BA 4ZGEB 1H92A 2D9TA 3HKSA 1B34A 3OMCA 1QVFA 2FPEA 2FG0A 1H641 1YCSB 3H6ZA 4LDYA 1T3LA 3HP9A 3CBMA 5D6YA 4LDVA 1RAAB 1K8AU 2P0QA 1D3BA 2H8HA 4GLMA 1SSFA 3CCQA 1QP2A 2LP5A 5CIUA 4OVAA 1YP5A 3EH2A 4LDUA 2R58A 3PFSA 4PJOG 5L23A 4QVZA 4OB1B 2IG0A 2HMAA 2EYXA 2JM8A 2K3BA 4X34A 4M4ZA 4ZGJB 1NPRA 5HKCA 2DXCA 4RTVA 1OX8A 4AT1B 4IUVA 2ED0A 2O9SA 3I5RA 2K2MA 4DOVA 1YCYA 3AT1B 1K8AR 1SSHA 1QCFA 4F16A 1G83A 2JN0A 4J9IA 1M1KU 2C0OA 3EGXB 1KK7A 1YJNT 2YUQA 2KI7A 1WLPB 2HEQA 3QDFA 1G3WA 5KYWA 5CR2A 2FYKA 2BTTA 2QGGA 2RI3A 4A63B 3MP6A 1BU1A 1JO8A 2CT4A 1IGUA 2FRYA 1B3QA 3QWXX 5CKFA 1MMGA 1QVFS 2O4XB 1WFWA 3TVTA 2L5QA 2MYSA 2DZCA 2PZ1A 5D6XA 1FX7A 2SRCA 3GLXA 1I0CA 1VQ9A 3M56A 3OYJA 1ZSZC 3GOXA 2XD0A 2DA9A 4AG1C 3I55T 2RN8A 1VQ7T 2PUKB 3G4ST 3VS3A 4C5EA 4IUQA 3M58A 3MEWA 3JCMf 4BUGA 4FM4B 2MI6A 1MV3A 2HL5C 2BZXA 1K1ZA 2CZ0B 4BY6C 4F17A 4LD9K 4BE1A 3RBBB 2QK0A 1NPPA 1TXQA 4PJMA 4OB2B 3H0FA 5LJ5j 2QDYB 2E41A 4A54A 4LE9A 5GANh 2MAMA 2KRSA 2HD0A 1WJSA 2RK2A 4P5NA 4WCIA 3UT1A 2K5FA 3CCSA 1F1BB 2RMOA 5EC7A 2XK0A 2D6FA 1T3SA 3CCJT 4IIOA 3NGPA 4M75D 2DXBA 4A4EA 5KE3A 1OEBA 4PJNA 2J7IA 4Y91A 3P8DA 1QCOA 5KYXB 1ZBJA 3JB9J 4RCCA 4QVDA 2KDSA 1OPKA 3RR6A 4E7KA 5LJ5f 3H41A 1NG2A 3OYMA 1YI2T 2O31A 1SG5A 2JZ2A 2VXEA 2X3XD
chains in the Genus database with same CATH topology
1V76A 1TS9A 1PC0A 2KI7A 1TSFA 2ZAEA 1OQKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V76 A;  1TS9 A;  1PC0 A;  2KI7 A;  1TSF A;  2ZAE A;  1OQK A; 
#chains in the Genus database with same CATH topology
 1UUE A;  4M78 B;  4PJO E;  4A4H A;  2BIV A;  2P0P A;  2YDL A;  2LZ6 B;  3CCJ A;  1TH7 A;  4OF1 A;  1AZG B;  4C92 B;  1YNZ A;  2LX9 A;  3SEM A;  1YIJ T;  1AWJ A;  1XNI A;  2X3W D;  3FLG A;  4M75 F;  1X27 A;  2MPX C;  3L2R A;  2K3X A;  2EJG A;  5GAO l;  5GAM h;  4RG8 A;  1W6X A;  4F7U G;  2JMC A;  4M77 C;  2IVW A;  1KQS P;  1JXM A;  1FYN A;  5GAN 5;  2Y90 A;  4FSS A;  2XIC A;  4KH0 B;  3EGX A;  4PLI A;  2O9V A;  1OI1 A;  2DTH A;  2JTM A;  4HXJ A;  5GAN 7;  3M4G A;  3WXM B;  4OMM A;  3RMQ A;  1D0Y A;  2KYB A;  3JCM X;  2RO0 A;  2QQS A;  1Q81 C;  1VQ7 A;  5GAO m;  1PKT A;  1AT1 B;  2JT4 A;  4V2S A;  3KFV A;  3OSV A;  2E3I A;  4HCK A;  4M78 D;  1UJ0 A;  2SEM A;  4M77 E;  2DD4 A;  2VXF A;  4C92 A;  4OMO A;  4XTZ A;  4JDS A;  1N5Z A;  5FRM A;  3CCE A;  1QWE A;  5M9O A;  4M78 E;  1OX9 A;  1VQM T;  1YIT A;  4PJO B;  2YRD A;  2AT1 B;  2E70 A;  3G71 Q;  2AKL A;  4A4F A;  3OYE A;  1K0X A;  1OU8 A;  2KGT A;  4KBM B;  3CPW A;  1I8F A;  3RES A;  4EMG A;  2QTX A;  3FEO A;  1VQ5 T;  1K76 A;  2HBP A;  4EPC A;  2DBM A;  1AEY A;  1E6G A;  3E9F A;  2J06 A;  3VUB A;  3PIO A;  1W4S A;  1YWO A;  2PVG B;  5AT1 B;  1G3S A;  1KQS A;  5AYF A;  2LCL A;  2NUT B;  2P84 A;  4BAC A;  2A3L A;  3KUF A;  4L5G A;  4KUD K;  1GRI A;  3X25 B;  1WQ7 A;  1GCQ A;  2NUT A;  4B6M A;  1MHN A;  2OJ2 A;  1JJ2 S;  2CUD A;  3BW1 A;  2DTO A;  1YIT Q;  5IHN A;  5GAM d;  1G5V A;  4GLK A;  4HA8 A;  3JCM V;  2A08 A;  3OS5 A;  2DEQ A;  4M75 B;  2PQW A;  1RAC B;  2ED1 A;  3FIF A;  5I21 A;  3CME T;  6AT1 B;  2XG8 D;  3UPU A;  4O6J A;  2HKN A;  4RG2 A;  3SWN A;  3M0P A;  1M8M A;  1YBY A;  2VWF A;  4KGZ B;  4LXC A;  5DLQ E;  1SKU B;  2F2V A;  3QZ9 B;  1NZ9 A;  1VYV A;  4L59 A;  4ELY C;  2L3R A;  2BUD A;  4NL2 A;  1OYX A;  4BI8 B;  4C8Q E;  1Q7Y C;  2PTK A;  2XHC A;  1AOJ A;  1MMN A;  4C5I A;  3HSB A;  3JB9 G;  3JCM e;  1M27 C;  4EMK B;  1BIB A;  1IRX A;  3L2W A;  2LMJ A;  2K3Y A;  3TSZ A;  1C0M A;  4DA4 A;  2VV5 A;  2CH4 W;  2DX1 A;  1RL2 A;  4M75 A;  3H0H A;  1Z9Q A;  4JLG A;  3JV3 A;  3PVQ A;  2PVD B;  4DOW A;  2EGC A;  5GAM e;  4KH1 B;  2EYY A;  4OML A;  4GBQ A;  1R0C B;  1ABO A;  2Y4X A;  3S3O A;  4M7D E;  4ZN3 A;  4ZTJ A;  1N6A A;  4J8O A;  1WHM A;  2R5A A;  3ASK A;  3JCM g;  3OS1 A;  3OYI A;  2DEU A;  1ZLM A;  4BD3 A;  4PJO C;  4M78 G;  1X6O A;  1JJ2 P;  2LC4 A;  1M90 C;  2VC8 A;  3EAE A;  1WXB A;  1N8R U;  3UWN A;  4LUE A;  4FW2 A;  1PSF A;  1KHI A;  4YTL A;  1YJ9 T;  3SD4 A;  2NLU A;  4M7D F;  4LUD A;  3SWN B;  5FRO A;  3WVE B;  1Q86 U;  1NEB A;  2RQV A;  4A53 A;  2CYZ B;  4JZ3 A;  1W1F A;  4RTU A;  2D8J A;  4ORZ A;  3M53 A;  2L3Q A;  4M7D C;  2L8D A;  1D1C A;  5FU6 B;  1Y07 A;  2MMP A;  2YRV A;  2F1L A;  4C0Z A;  2QA4 T;  3GPL A;  1WDX A;  4F7U B;  1VQ7 Q;  2ESW A;  1BI2 A;  2NUZ A;  1VQO T;  4BDY A;  1UG1 A;  2AZV A;  1Y96 A;  1UHF A;  2KQW A;  4XTV A;  4R56 A;  2C06 A;  3G71 A;  5GAN e;  4N0A C;  4NL3 A;  2HQX A;  1WPY A;  1IB8 A;  3MO8 A;  1QVG P;  3A98 A;  4C92 C;  2L3S A;  1OU9 A;  2A7Y A;  4ESR A;  3UAT A;  2ZAE A;  1YFN A;  1LCK A;  2HQE A;  4F7U F;  2HCK A;  1BB9 A;  1K9M U;  1QVF P;  1QP3 A;  5CKE A;  1LNX A;  1VQ4 T;  1Q86 C;  1NM7 A;  1YN8 A;  4F04 B;  1JRI A;  2DD5 A;  1W2B P;  3S3N A;  1HSQ A;  1UJY A;  5DLO A;  3CME A;  4Z02 A;  3JCM J;  4XTX A;  1RI0 A;  5ECA A;  4ZGD B;  2XDD A;  3MEU A;  5LJ3 g;  4HKE A;  2E5Q A;  3CPF A;  4XU3 A;  2CT3 A;  2IIM A;  3G6E Q;  2J05 A;  2HAX A;  5J26 A;  1M3A A;  1K73 U;  3TRE A;  1I5L A;  4E7Z A;  2B86 A;  3I55 Q;  2FPF A;  1VQ8 A;  5GMK h;  1B7T A;  4BY6 B;  2PUO B;  5CK9 A;  4E7H A;  3I9Q A;  3D7S B;  1VQM A;  2KE9 A;  3CQT A;  3TQ7 P;  1VQK T;  4XU1 A;  3OYN A;  2RHY A;  2EWN A;  2RPN A;  3FB9 A;  2COY A;  2GF7 A;  5GAO q;  3DB3 A;  1PHT A;  5A0D A;  1K4U S;  2NUP A;  1MMA A;  4JS4 A;  1KC8 C;  4XK8 E;  3CD6 T;  1WX6 A;  4E2F B;  1RAE B;  2GFA A;  4M75 G;  3I56 A;  1BCO A;  1YI2 Q;  2KXD A;  1Q82 U;  1H3H A;  3MEA A;  4D8K A;  3QO3 A;  3L2V A;  4FYX B;  4MMK A;  3TU4 K;  2E1H A;  4FSX A;  2RI2 A;  2GNC A;  3VRY A;  3FRN A;  3CCR Q;  1YWP A;  3PT9 A;  2KY9 A;  2BKD N;  2DAQ A;  1WIE A;  5CO7 A;  3EFS A;  2OTL A;  4Z89 A;  2WSE E;  4M75 C;  3QWY A;  3J80 E;  4RUG A;  1BCM A;  3RKX A;  1ZA2 B;  2EGE A;  4M77 A;  1QVG A;  2BZY A;  2O4X A;  3EG3 A;  1BI3 A;  5IHK A;  1NYF A;  1ZSZ A;  1N27 A;  1VYT A;  5KYX A;  4M7A E;  4KUI A;  1OPL A;  2OTJ Q;  2DFU A;  4C5H A;  2QGF B;  1GCP A;  1PD1 A;  4J6W A;  4MZP A;  3OY9 A;  2I2L A;  3E2U A;  3P8B B;  3G6E A;  2AZS A;  2GQI A;  3QKJ A;  2CUB A;  1CKB A;  1KHC A;  2AIR B;  4AFQ C;  4FIB A;  4M7A F;  1S72 A;  2MWP A;  2F5T X;  4DBF A;  1ZBX A;  2KVQ G;  3VS7 A;  1ZUY A;  3L1A A;  3G71 T;  1CSK A;  3R6N A;  4Z8A A;  2XDB A;  1YI2 A;  5LJ3 d;  3CBP A;  2ZPH B;  4AG2 C;  3DB4 A;  4ANJ A;  1G3Y A;  4RTX A;  3VV0 A;  3A1P A;  1O75 A;  3BDL A;  3C4S A;  2EQM A;  3J7A F;  4KRT A;  1OUL A;  3QYG B;  1RAI B;  5KYW B;  3ULR B;  2DVJ A;  1Q95 G;  3OSS C;  1ABQ A;  3CCR T;  1EX4 A;  2YUO A;  3Q1J A;  3CCQ T;  4RTT A;  2LCS A;  4QVC A;  2LNH B;  1M3B A;  2LVM A;  4JJB A;  4C92 G;  3JCM b;  1VQ9 T;  2L0A A;  2QYZ A;  1D1A A;  1ZSZ B;  2JOY A;  5CQY A;  2FB7 A;  4CC4 B;  2CP3 A;  2EIF A;  1T0H A;  2K79 A;  2COW A;  4OB0 B;  3OYK A;  2PVO B;  4N4G A;  2GFU A;  1YIJ Q;  5D7U A;  1VIF A;  1LVK A;  3EHR A;  4R0K A;  3BE3 A;  1M1K R;  3QBY A;  3OQ5 A;  3VS4 A;  2EW3 A;  4PJJ A;  1MUZ A;  2M51 A;  3GNF B;  1K8A C;  1YJW A;  2V8J A;  5C6S A;  4E7S A;  3CCQ Q;  2E3H A;  1U06 A;  2CGH A;  2YRC A;  3HHT B;  4X9C A;  2EGA A;  4C0D C;  5IAY A;  2W10 A;  4DEX A;  1IZ6 A;  1R8O B;  1WXU A;  2KNB B;  3G6E T;  1KG1 A;  4A4K A;  5GAO n;  2X4X A;  3DLL A;  4CI0 C;  2RQR A;  3RNJ A;  1Q82 C;  1D09 B;  2D8H A;  2JM9 A;  2A37 A;  3UF4 A;  2QEX T;  4JPB W;  2KRN A;  2EQJ A;  5KYU B;  2ZPG B;  4C0D B;  3JCM d;  2LDM A;  3WVD B;  1ZHI A;  1KJW A;  4PFP A;  5KCH A;  2CH4 A;  2LQW A;  4VUB A;  3OYD A;  3M54 A;  1M1G A;  1TUD A;  1IXD A;  1WJR A;  5FU7 B;  1VQP A;  2P4R A;  3CEY A;  2KBT A;  1ZUU A;  4DEY A;  5CKD A;  4QQG A;  5KYN A;  2DJZ A;  1HK9 A;  3RUX A;  1XJW B;  1K73 C;  2RA2 A;  9ATC B;  3V7R A;  1EIF A;  2QQA A;  1Q81 U;  4JLI A;  3HRU A;  3INZ A;  1WHJ A;  2DL7 A;  1PC0 A;  4JZ4 A;  4QQD A;  3I5S A;  1UEC A;  4EMK C;  2LNV A;  2EYQ A;  3NPF A;  3VU3 C;  1UE9 A;  3M0U A;  1QKX A;  2ZGW A;  3FJP A;  5HCK A;  2QQ9 A;  4KUL A;  3N5B B;  4C92 D;  1BIA A;  2XMF A;  2AK5 A;  4J9B A;  3HL8 A;  2LJ0 A;  4BE2 A;  2MOX A;  1ZSG A;  1UFF A;  1WI7 A;  2EVR A;  1VQO Q;  1EZZ B;  2DJQ A;  2QQB A;  3JSC A;  5A2Q E;  1VQ5 A;  3CC2 Q;  4CC3 A;  2ZPF B;  5DY9 A;  1Q7Y U;  3LGL A;  1VQL Q;  1TSF A;  1YHQ A;  3GP8 A;  3A8H B;  3KXT A;  1YJ9 Q;  3EFR A;  2FPD A;  2E6Z A;  3AHU A;  1E6H A;  5I22 A;  5GAN g;  4LDW A;  4HVW A;  3CCV T;  1WHH A;  3CCM A;  3C95 A;  1U1S A;  2KYM A;  3OA6 A;  3M0R A;  1MNE A;  2X4Y A;  2DYB A;  2VYT A;  1I5O B;  1G8X A;  4C8Q A;  1VQK Q;  5KH6 A;  3BDU A;  1MMD A;  3A8O B;  3L2Z A;  2CP2 A;  2LT1 A;  3CMA Q;  2F5K A;  2RHI A;  3OYF A;  3HPW A;  1RAD B;  2FL7 A;  2EBP A;  3P8H A;  4J9C A;  5CVI A;  4FL6 A;  2QAZ A;  1VQ6 T;  3EFO A;  2E65 A;  2JJ9 A;  2V1R A;  3MP8 A;  4IUT A;  3CCU Q;  5EG2 A;  4OMN A;  5IXB A;  2D1X A;  4EMH A;  1JBM A;  1D1B A;  4HVV A;  2QG9 B;  1Q86 R;  3QHS A;  1XQH A;  3G4S Q;  4FYW B;  4ELZ C;  2NWM A;  2KK4 A;  2K5I A;  4NS5 A;  2RB6 A;  2H3E B;  1VQO A;  5HK0 A;  1DJ7 B;  1OV3 A;  4PLL A;  2WAC A;  1VQ6 Q;  1K9M R;  4M78 F;  2FRW A;  2XID A;  4GY5 A;  2EPD A;  1RAF B;  2R57 A;  4M78 C;  4OGE A;  1IGQ A;  2RJD A;  3VS0 A;  1WYX A;  3BFM A;  2A28 A;  4RTZ A;  1Z9Z A;  4MDW A;  2JS0 A;  4FT2 A;  4C0F A;  1SHG A;  2EQU A;  1ZX6 A;  1PSE A;  2P4T A;  1E7O A;  1X2Q A;  5FW9 A;  3HTR A;  1YJ9 A;  1YJW T;  2XDP A;  2DIL A;  5KYY A;  4Y92 A;  1UGQ B;  2QQR A;  1VQL A;  2G3R A;  1KQ1 A;  4OGC A;  4ZN1 A;  3JB9 F;  3V8K A;  4RCB A;  1Y0M A;  1K9A A;  4C92 E;  4IKF A;  4XQ3 A;  1K9M C;  5LJ5 d;  1YJN Q;  4ZNX A;  1Q82 R;  2QEX A;  1WHL A;  2FO0 A;  4XTW A;  4JJC A;  5J3B A;  1M9S A;  3OB9 A;  4XAX B;  3M9Q A;  1AHJ B;  3HFO A;  3HRS A;  2VAS A;  3LX7 A;  1WHK A;  2AKK A;  3ZFJ A;  2DIG A;  4LN2 A;  3ME9 A;  2YHT A;  3S3M A;  4J9D A;  2EAY A;  2EYZ A;  4LNP A;  4IUP A;  3VS5 A;  3CPW S;  2KEA A;  1NJI R;  3OS0 A;  3NTH A;  1UGP B;  1A0N B;  2Y4Y A;  2ZZD A;  2JNG A;  4J5Y A;  8ATC B;  2LJ1 A;  1YHQ T;  1VQ8 T;  4M77 B;  1I1J A;  2OAU A;  2L2P A;  2QA4 A;  1BI0 A;  3JRZ A;  1QVG S;  4FCY A;  2F2W A;  1S1N A;  2RM4 A;  2JUF A;  1ZQ1 A;  2DKG A;  1UHC A;  4IUU A;  2QEX Q;  1M3C A;  4M7D G;  3OYL A;  2YUP A;  1RLQ C;  2O88 A;  4N0A A;  2E12 A;  2OI3 A;  5GAN 6;  1TUG B;  5A0L A;  3PMT A;  4Q5W A;  1WZO A;  1X2K A;  2ZPI B;  3X28 B;  1FXX A;  3LW5 E;  5CQX A;  3M5A A;  4IUR A;  2DZ9 A;  3VS6 A;  3BY7 A;  3R6O A;  1T0J A;  2YWW A;  3M4Y A;  1R0B G;  4EMK A;  1VQL T;  3CCU T;  5HY6 A;  5IN1 A;  1NLO C;  1ZUK A;  3A8M B;  2K57 A;  2A0F B;  1TOV A;  3V8L A;  1Y7X A;  4PJO D;  1M2O A;  3HRT A;  2YLB A;  4M75 E;  4KGV B;  3MKD A;  1VQK A;  3UA7 A;  1UGV A;  3O5Z A;  3ZL7 C;  3RER A;  3LH0 A;  2ATC B;  3L2U A;  3A8L B;  4J6X A;  2K6D A;  4EIK A;  3LWH A;  1G3T A;  4J6Y A;  3I56 T;  1VQ8 Q;  3QDR B;  4E7I A;  4ATO A;  1UDL A;  1QW1 A;  3I56 Q;  4RKU E;  1R77 A;  5LJ5 e;  1BYM A;  1TU0 B;  1X75 C;  2NUP B;  5GAO p;  3JCM Q;  2ROT A;  4PJO F;  4M78 A;  3ER0 A;  3CCJ Q;  3OYG A;  2K5L A;  1C1A A;  1ARK A;  2YT6 A;  2CSQ A;  3QZ5 B;  3CMA A;  2DF6 A;  2D0N A;  4J7I A;  4AFU C;  3CBO A;  4J83 A;  3ZEH A;  4KGX B;  4II1 A;  4JRK A;  1WQW A;  5GAM j;  2L89 A;  4MZM A;  1RAH B;  3QXE B;  5KCO A;  1TS9 A;  2K7A A;  1I07 A;  3JB9 H;  3GF5 A;  4K11 A;  2CZ7 B;  4DQ2 A;  2QDL A;  4M7D B;  1VQN T;  2F2X A;  1KC8 R;  2EYW A;  2RI5 A;  5KYU A;  1JEG A;  3REB B;  2XKO C;  1H3Z A;  4FYV B;  3OW2 S;  1V29 B;  1V76 A;  4MZT A;  1JXO A;  1HYO A;  1M1F A;  2YXY A;  3ZBD A;  1UTI A;  5GMK i;  1HJD A;  3I35 A;  2FZC B;  2ZPE B;  3EGD B;  3H0I A;  3M0S A;  3MJX A;  3NTK A;  1PM3 A;  3X20 B;  2W0Z A;  1X69 A;  2DIQ A;  2LT4 A;  3FJ5 A;  5FU6 C;  3RKY A;  5GAM g;  4PL6 A;  2KR3 A;  3CD6 A;  4E7L A;  2X4W A;  2LQN A;  4AFS C;  1JU5 C;  4XU0 A;  3CCE T;  5FU7 C;  3CXC S;  4XU2 A;  4F7U E;  4QW2 A;  2AHJ B;  1HD3 A;  2CP6 A;  4HT8 A;  3CCU A;  4J7F A;  1QVP A;  1QWF A;  5IHI A;  4NOY A;  3L2Q A;  3GNG A;  4A4G A;  1U1T A;  3CC7 Q;  5CAI A;  2RHZ A;  4JRI A;  1NLP C;  2X4J A;  1NJI C;  2V8I A;  2I0N A;  4WTO B;  2FEI A;  2RF0 A;  2X9H A;  1PG5 B;  2VVK A;  4BB7 A;  2MCN A;  3GBQ A;  1D0Z A;  4HCZ A;  4QT7 A;  1Q81 R;  3EFO B;  2KXC A;  4J9H A;  3C94 A;  1Y71 A;  3OYY A;  4M7A G;  2DE0 X;  2HSE B;  1OOT A;  1TWB A;  3EGU A;  2HDA A;  3CCM Q;  1IO6 A;  3CD6 Q;  2M0O A;  1M30 A;  3PVL A;  2GTO A;  3CC7 T;  4O5V A;  1AWO A;  3QYH B;  1O9S A;  5I11 A;  1J3T A;  1N8R R;  2EJF A;  1W70 A;  2XI9 A;  1YJW Q;  2OTJ A;  2RH2 A;  1VA7 A;  1B34 B;  1NBE B;  5L8R E;  1UEB A;  5GAN 2;  4HVU A;  1GBQ A;  1RAG B;  3TCJ A;  2RHU A;  1NE8 A;  5IH2 A;  1ZA1 B;  2B8A A;  1CKA A;  2DXT A;  2JMA A;  5LJ3 h;  2DBK A;  2DL5 A;  1WNL A;  1SEM A;  4Y28 E;  2K2V A;  3SDZ A;  2PU9 B;  2GCX A;  3G7Z A;  4M77 F;  1X43 A;  2HQH A;  4J9F A;  3LH5 A;  2LX7 A;  1Y96 B;  2EKO A;  2MF2 A;  3QII A;  5GAN j;  2KRO A;  2EKH A;  5LJ5 h;  5I2M A;  5LJ3 f;  3CC4 Q;  3C0C A;  2GBQ A;  2QXF A;  3X26 B;  2IPO B;  1KQS S;  1LJO A;  3CMA T;  3EG9 B;  2ABL A;  3EG9 A;  4R55 A;  4PFZ A;  1FMK A;  4C5G A;  3MP1 A;  1D0X A;  1VQN A;  1Q7Y R;  2LTO A;  3CCS T;  2DL8 A;  2QAS A;  5HK3 A;  1WJQ A;  1M90 U;  4C8Q G;  1GL5 A;  4C8Q C;  3CCV Q;  2MK5 A;  1X6B A;  1X01 A;  5GAN f;  1IHV A;  2EQI A;  1GBR A;  4FYY B;  1KD1 R;  5LJ3 j;  1MGQ A;  1YIT T;  1SHF A;  4M7A B;  4JS5 A;  1X6G A;  2WSF E;  3MHX A;  2GTJ A;  3CC7 A;  2FZK B;  3TEE A;  1VIE A;  2CP0 A;  4BE0 A;  1SF9 A;  3SHW A;  3U23 A;  5KE2 A;  1SRM A;  1UGS B;  4IIM A;  4C92 F;  2FZG B;  3QPH A;  2QI2 A;  2X51 A;  5LJ3 e;  4M7A D;  2QA4 Q;  5IT9 E;  1OZ2 A;  2A36 A;  2RQU A;  4QQ6 A;  2DET A;  3PE0 A;  1RAB B;  2BZ8 A;  3H8Z A;  2DYI A;  2JTF A;  1IRE B;  3PTA A;  4J9G A;  2K9G A;  2RQW A;  4LDX A;  1XOV A;  1NYG A;  3JCM c;  4C8Q D;  5GMK l;  4JRQ A;  4MML A;  1VQM Q;  3E9G A;  4BDZ A;  2DRM A;  3M59 A;  2D0Q B;  3I55 A;  2FHD A;  3M0Q A;  2DMO A;  3CCM T;  5CKB A;  3JB9 I;  1AD5 A;  1M2V B;  4X9D A;  4C8Q B;  5GMK m;  2YUN A;  4AMC A;  2OTL Q;  1VQ4 A;  5FWB A;  1WA7 A;  4ZTF A;  2ENM A;  2JTE A;  1KIK A;  3VRZ A;  3LGF A;  1BKB A;  3V7C A;  2RJF A;  5CKH A;  3EG0 A;  3EG2 A;  3RIR A;  4JJN K;  4B9W A;  8AT1 B;  4D6W A;  1S72 Q;  4DBQ A;  4RMO A;  2GQV A;  3RDV A;  1I4K 1;  4HCB A;  3DLM A;  1N9R A;  4UC4 A;  2CZ6 B;  2L3P A;  2VB6 A;  2DNU A;  4TVR A;  1RLP C;  2M1H A;  2C0T A;  1M8V A;  1M2V A;  2ECZ A;  1MND A;  3QJY A;  3QG1 A;  2RJC A;  2DTI A;  4CRI A;  1JQQ A;  1PCX A;  1N8R C;  2KMT A;  2K4Y A;  2HL3 A;  2JVV A;  5LJ5 g;  2DLP A;  3PGG A;  3OYB A;  2CDT A;  2M02 A;  5GAN 4;  4C0G A;  2CSI A;  2M16 A;  4KT0 E;  2LQK A;  2PNI A;  3C12 A;  2RK1 A;  2DM1 A;  3CCS Q;  1VQ9 Q;  3CCR A;  1FWZ A;  4AFZ C;  1M1K C;  1Y57 A;  1VQ6 A;  3LLR A;  1LOJ A;  2J6F A;  2KT1 A;  4FT4 A;  1AWW A;  3FC3 A;  3CME Q;  4OB3 B;  1GFC A;  4X1V A;  5CCA A;  1VOM A;  3NHN A;  1BBZ A;  5GMK e;  2O01 E;  4JUV A;  3OW2 P;  2DXU A;  1TG0 A;  2NYS A;  3G4S A;  3OMG A;  1G2B A;  1ACM B;  2QTV A;  2WSC E;  2LQ8 A;  4PKC C;  3EH1 A;  3H9N A;  4OMQ A;  2DL4 A;  2M9U A;  4XTU A;  4EDU A;  3E1S A;  3OBW A;  1S72 T;  3VS1 A;  4OMP A;  3CXC A;  1GCQ C;  3CC4 T;  3RMS A;  2LJ3 A;  4HCC A;  3JCM W;  5GMK j;  1PRL C;  4E47 A;  3MEV A;  2GGR A;  3OW2 A;  1SRL A;  1MV0 B;  3EG1 A;  5FWC A;  2DER A;  1PD0 A;  2DRK A;  3JCM h;  1KFZ A;  3MPU B;  4ME7 A;  2Z0W A;  4M7A A;  3OYC A;  3DKM A;  5GJW B;  1WXT A;  3OS2 A;  5J39 A;  2V8K A;  2DPP B;  5GAO r;  1VUB A;  3VJP A;  3F70 A;  3M57 A;  4WF2 A;  5D6W A;  2JS2 A;  3JAM E;  4HT9 A;  2E10 A;  2VUB A;  2KAF A;  2H3J A;  2XU8 A;  1W2B S;  1OQK A;  1KC8 U;  1PWT A;  4M7D D;  1H8K A;  3T9N A;  3LWI A;  2HNI A;  1U5S A;  4QKU A;  5GAN d;  3E19 A;  2RQT A;  2EQK A;  5GAN 8;  3MET A;  3EHQ A;  1YJN A;  2DVE A;  2M0Y A;  2J6O A;  3QSU A;  1WHG A;  5GAN 3;  1EFN A;  5GAM f;  4B9X A;  4FU6 A;  2VGN A;  3CXC P;  1VQP Q;  3NFC A;  4L6V 5;  4F7U A;  3HFN A;  4DBH A;  2RHX A;  3X24 B;  4N4H A;  2ZCF B;  5KYY B;  5FRN A;  4OP0 A;  4FW1 A;  2DO3 A;  2JW4 A;  1FMV A;  3QUI A;  1N9S A;  3CPW P;  1QCN A;  4JJD A;  2DL3 A;  3SB2 A;  3LYI A;  2OTJ T;  1KSW A;  2V1Q A;  2YLC A;  3J81 E;  2HSP A;  2YSQ A;  2E5K A;  4Z88 A;  3S6W A;  2HKQ B;  3CCL Q;  2COZ A;  2CRE A;  1B07 A;  3CCL T;  1AVZ C;  4E7J A;  2J6K A;  1PRM C;  2CS7 A;  1AWX A;  1UB4 A;  3A8G B;  4J9E A;  1VQ5 Q;  1VQP T;  3SWN C;  3IQL A;  1JB0 E;  3THK A;  1YHQ Q;  1I81 A;  3CCE Q;  3MCA B;  1PKS A;  3OYA A;  3QJ6 A;  3CC2 T;  3CCV A;  3UA6 A;  3L42 A;  3KBG A;  2O2O A;  1QKW A;  1VQN Q;  2VGM A;  4M77 D;  3JB9 D;  2G6F X;  3OBY A;  5LL6 S;  1M4Z A;  5A0G A;  3A5Z B;  1FMW A;  3NMZ C;  4C8Q F;  5IXF A;  2OAW A;  3GIB A;  2VKN A;  1SPK A;  2OX7 A;  4DBR A;  1GXI E;  2MIO A;  3UDC A;  1KQ2 A;  2F69 A;  4CC7 A;  4PNO A;  3CC4 A;  3CCL A;  2E4H A;  2RJE A;  2P0K A;  3VYH B;  5FLX E;  1QQJ A;  2JXB A;  1JJ2 A;  1KD1 C;  7AT1 B;  3TSW A;  3EGD A;  1OZ3 A;  4MDX A;  2CKK A;  1RUW A;  3PNW C;  1BI1 A;  2C0I A;  2BE7 D;  1U8R A;  2E64 A;  1UGR B;  3M0T A;  4E6R A;  1C6V X;  2ZPB B;  3G1J A;  1BK2 A;  2KRM A;  2X35 A;  1XTD A;  2ROL A;  4PFO A;  1V1C A;  4PJL A;  1WGS A;  3CC2 A;  3VUZ A;  2HBW A;  4N4I A;  2R5M A;  2RD1 A;  4M7A C;  3VYG A;  1K0S A;  2KT8 A;  2EJ9 A;  1TTH B;  1LPL A;  5DM7 R;  2CP7 A;  1HXD A;  1QMC A;  4JRP A;  3PIP A;  2KSS A;  4XTY A;  1U3O A;  3JCM P;  2V26 A;  1GFD A;  4F14 A;  1NJI U;  5GJV B;  1RI9 A;  4M7D A;  1P92 A;  1VYU A;  3PMI A;  4RTW A;  2RNA A;  1AZE A;  4PJO A;  1M5Q 1;  3RKW A;  1D3B B;  1VQ4 Q;  2EFI A;  3V7S A;  1YIJ A;  3URG A;  1PNJ A;  5C0M A;  4BI4 A;  4LD6 A;  3VKI A;  2OTL T;  3V8J A;  1QLY A;  3M55 A;  3OYH A;  2MWO A;  4CC2 A;  1M90 R;  3O8V A;  3VS2 A;  1IHW A;  2LCC A;  1NEG A;  5I2S A;  1TUC A;  1KD1 U;  3SFM A;  2DK3 A;  4D8D A;  2E6N A;  2CZ1 B;  4BI3 A;  4RTY A;  2HZY A;  3NTI A;  3REA B;  2LRQ A;  3FDR A;  2BE9 B;  2FVU A;  4PK4 A;  2CP5 A;  4M77 G;  4OMF B;  1K73 R;  1W2B A;  4ZGE B;  1H92 A;  2D9T A;  3HKS A;  1B34 A;  3OMC A;  1QVF A;  2FPE A;  2FG0 A;  1H64 1;  1YCS B;  3H6Z A;  4LDY A;  1T3L A;  3HP9 A;  3CBM A;  5D6Y A;  4LDV A;  1RAA B;  1K8A U;  2P0Q A;  1D3B A;  2H8H A;  4GLM A;  1SSF A;  3CCQ A;  1QP2 A;  2LP5 A;  5CIU A;  4OVA A;  1YP5 A;  3EH2 A;  4LDU A;  2R58 A;  3PFS A;  4PJO G;  5L23 A;  4QVZ A;  4OB1 B;  2IG0 A;  2HMA A;  2EYX A;  2JM8 A;  2K3B A;  4X34 A;  4M4Z A;  4ZGJ B;  1NPR A;  5HKC A;  2DXC A;  4RTV A;  1OX8 A;  4AT1 B;  4IUV A;  2ED0 A;  2O9S A;  3I5R A;  2K2M A;  4DOV A;  1YCY A;  3AT1 B;  1K8A R;  1SSH A;  1QCF A;  4F16 A;  1G83 A;  2JN0 A;  4J9I A;  1M1K U;  2C0O A;  3EGX B;  1KK7 A;  1YJN T;  2YUQ A;  2KI7 A;  1WLP B;  2HEQ A;  3QDF A;  1G3W A;  5KYW A;  5CR2 A;  2FYK A;  2BTT A;  2QGG A;  2RI3 A;  4A63 B;  3MP6 A;  1BU1 A;  1JO8 A;  2CT4 A;  1IGU A;  2FRY A;  1B3Q A;  3QWX X;  5CKF A;  1MMG A;  1QVF S;  2O4X B;  1WFW A;  3TVT A;  2L5Q A;  2MYS A;  2DZC A;  2PZ1 A;  5D6X A;  1FX7 A;  2SRC A;  3GLX A;  1I0C A;  1VQ9 A;  3M56 A;  3OYJ A;  1ZSZ C;  3GOX A;  2XD0 A;  2DA9 A;  4AG1 C;  3I55 T;  2RN8 A;  1VQ7 T;  2PUK B;  3G4S T;  3VS3 A;  4C5E A;  4IUQ A;  3M58 A;  3MEW A;  3JCM f;  4BUG A;  4FM4 B;  2MI6 A;  1MV3 A;  2HL5 C;  2BZX A;  1K1Z A;  2CZ0 B;  4BY6 C;  4F17 A;  4LD9 K;  4BE1 A;  3RBB B;  2QK0 A;  1NPP A;  1TXQ A;  4PJM A;  4OB2 B;  3H0F A;  5LJ5 j;  2QDY B;  2E41 A;  4A54 A;  4LE9 A;  5GAN h;  2MAM A;  2KRS A;  2HD0 A;  1WJS A;  2RK2 A;  4P5N A;  4WCI A;  3UT1 A;  2K5F A;  3CCS A;  1F1B B;  2RMO A;  5EC7 A;  2XK0 A;  2D6F A;  1T3S A;  3CCJ T;  4IIO A;  3NGP A;  4M75 D;  2DXB A;  4A4E A;  5KE3 A;  1OEB A;  4PJN A;  2J7I A;  4Y91 A;  3P8D A;  1QCO A;  5KYX B;  1ZBJ A;  3JB9 J;  4RCC A;  4QVD A;  2KDS A;  1OPK A;  3RR6 A;  4E7K A;  5LJ5 f;  3H41 A;  1NG2 A;  3OYM A;  1YI2 T;  2O31 A;  1SG5 A;  2JZ2 A;  2VXE A;  2X3X D; 
#chains in the Genus database with same CATH homology
 1V76 A;  1TS9 A;  1PC0 A;  2KI7 A;  1TSF A;  2ZAE A;  1OQK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...