1WJQA

Solution structure of the third mbt domain from human kiaa1798 protein
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
107
structure length
107
Chain Sequence
GSSGSSGVKPPHGFQKKMKLEVVDKRNPMFIRVATVADTDDHRVKVHFDGWNNCYDYWIDADSPDIHPVGWCSKTGHPLQPPLSPLELMEASEHGGCSTPGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA1798 protein
publication title Solution structure of the third mbt domain from human KIAA1798 protein
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 7
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2004-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1wjqA01
3MP8A 3QJ6A 4IUPA 3LLRA 2X4YA 1OZ3A 2M1HA 3S6WA 3PFSA 3E9FA 5FRMA 4E7HA 2M0OA 3L2RA 5KE3A 4E7IA 2QQSA 4FU6A 2LRQA 2EQKA 2M16A 1KHCA 2K3XA 2B8AA 2L3RA 2RJEA 2E5QA 3LX7A 3QBYA 1N27A 3OYLA 2F5KA 4QW2A 2K3YA 3ZEHA 2RHYA 4IUVA 2GF7A 2LCCA 3OYCA 4FL6A 2EQMA 4C5IA 3OYGA 1SSFA 4QQDA 4Z02A 3MEWA 2O4XB 2O4XA 2MWPA 4NS5A 4A4GA 5D6YA 2DIGA 3OYJA 3LGFA 3PNWC 5IN1A 5KCHA 2RJFA 2EQJA 2D9TA 2HQEA 3H8ZA 4IUTA 2GFAA 4QVZA 3MO8A 3S3OA 4ZTJA 1MHNA 3NTKA 2IG0A 3Q1JA 3OS0A 4UC4A 5D6XA 2E6NA 3OYBA 2JZ2A 2JTFA 4N4GA 4A4HA 4OVAA 5FRNA 1RI0A 3ASKA 4C5HA 4N4HA 4II1A 3OYKA 3MEVA 3OMGA 2R5MA 3MEUA 4A4EA 3OA6A 4BACA 3OYNA 4E7LA 2PQWA 2X35A 4IUUA 3META 3FEOA 3DB3A 5D6WA 3UWNA 5IAYA 2DIQA 4HCZA 4B9XA 4L59A 3OYMA 2BIVA 4PLLA 3OQ5A 3P8HA 2LDMA 2R5AA 1OI1A 3F70A 4IUQA 2LTOA 4BDZA 3MP6A 4C5EA 2L89A 4C5GA 5J39A 4E7KA 4PL6A 5CIUA 4BD3A 1H3ZA 4LD6A 4GY5A 5FROA 1OZ2A 1XNIA 3UT1A 4RG2A 3OB9A 2L8DA 3L42A 3OS1A 2RHIA 2G3RA 4EDUA 3P8DA 3OYIA 3C4SA 3OY9A 3OYHA 2RI3A 2GFUA 3LGLA 5KH6A 3PMTA 3SD4A 2EKOA 3QKJA 2RHXA 4ZTFA 2NLUA 2XDPA 4PLIA 2RI2A 4B9WA 3OMCA 2R57A 2RHUA 3L2WA 2MWOA 2P0KA 4Q5WA 3S3NA 3OYEA 2QQRA 3FDRA 2EFIA 3M9QA 3GOXA 1WJRA 2RHZA 3CEYA 4QQ6A 3MEAA 2R58A 3NTIA 5KE2A 3L2UA 3H6ZA 3L2QA 2LVMA 2YRVA 5KCOA 3DLMA 3LH0A 3L2VA 2X4WA 2RJDA 3EAEA 3ME9A 3S3MA 1G5VA 3O8VA 5C0MA 1WGSA 3NTHA 3OYDA 3BDLA 2VYTA 2WACA 2BKDN 2HQXA 2EQUA 5M9OA 3FLGA 5J26A 2XK0A 4IKFA 4A4FA 2RJCA 3E9GA 3DB4A 4QQGA 3OS2A 3OYAA 4BDYA 2CKKA 2BUDA 4BE0A 1WJSA 4BE1A 3FC3A 2RO0A 3MP1A 4X34A 5C6SA 2FHDA 3LYIA 4IURA 3PMIA 4CRIA 1WJQA 3KUFA 2RI5A 4BE2A 1OYXA 2DAQA 3QIIA 2X4XA 3OYFA 4E7JA 4N4IA
chains in the Genus database with same CATH superfamily
4IUPA 3EGUA 1VQ9T 3PFSA 2CT3A 3QJYA 1M1GA 2M0OA 4CC3A 3UF4A 3CCEA 4BUGA 1WHGA 1NPRA 5GAN5 1B34B 2QA4T 2VC8A 1QKXA 4YTLA 4QQDA 2MWPA 2QGFB 1S72A 2KVQG 1TUGB 3BDUA 4J9HA 5GAN4 2GBQA 4M78F 4F7UA 9ATCB 4XK8E 1BI3A 2LQWA 3GNFB 1WHLA 3MEVA 2I0NA 3SB2A 2NUTB 2RQTA 2PNIA 2DIQA 4PLLA 4M75B 1FMKA 4L5GA 4F7UE 1X6OA 4IUQA 4XAXB 4M78G 2EKHA 2OAWA 4D8KA 5GANg 2LJ1A 1RADB 3HFOA 4J9EA 1OZ2A 3H0FA 4XTXA 4LXCA 1YI2T 2RHIA 2E4HA 1PSFA 2EKOA 2RHXA 5CVIA 4MZTA 4ZGDB 1ARKA 1WHHA 2AK5A 4Q5WA 2XMFA 1Z9QA 2RD1A 3FB9A 2OX7A 3GNGA 3X20B 4M7AD 1ZA1B 2BZYA 2LNVA 5IHKA 1VQKQ 1WFWA 1Q95G 2HQXA 1M1KR 4J83A 3OBYA 3GPLA 1WIEA 4CI0C 1B07A 2KI7A 1GL5A 3LYIA 2Y4XA 4A54A 2RI5A 1OPLA 2X4XA 4XTUA 2CSIA 2DL3A 1FXXA 4J9GA 4FU6A 2EQKA 3RERA 4OMQA 3VS4A 1LVKA 5GAN8 1ZA2B 4RKUE 1WX6A 3A98A 3V8KA 3JCMc 4QVDA 1KQ1A 2M02A 3HHTB 2DETA 1J3TA 4NS5A 1NM7A 4A4GA 3M0RA 2CT4A 2DXUA 2YUPA 4HVWA 5GAN6 4MMKA 4HT9A 2JMAA 4D8DA 2RH2A 4UC4A 4E7SA 3OYBA 4N4GA 2KRNA 3JSCA 4KGVB 2CS7A 1HK9A 1VQMA 1WZOA 2MAMA 2PQWA 3FEOA 3OW2A 5GMKh 1Q86U 4E2FB 2RM4A 4RTXA 3J7AF 4M7AA 4E7KA 3ZBDA 1UGRB 1PRLC 2EYQA 1AVZC 2XKOC 2DL7A 1MMGA 2CP2A 1TXQA 2DFUA 2GFUA 1VQMT 3CCUT 4ZTFA 5LJ3e 1I1JA 4OMFB 2RQVA 1PM3A 1QKWA 2MWOA 4OB2B 2RK1A 4M7AE 2DJZA 2ZPGB 1ABOA 1M5Q1 1EX4A 5GANj 2HDAA 2DVEA 4PFOA 4RMOA 3L2QA 5KCOA 3ULRB 1W4SA 3L2VA 2COWA 3EAEA 4FYWB 5C0MA 1G3WA 2FG0A 3PTAA 4F14A 1BU1A 1QWEA 4J6YA 1VQ9Q 1RI9A 5GAOn 3OYAA 2DL8A 3UA7A 5DM7R 1YJNQ 5J3BA 1H8KA 4BE1A 2RO0A 2FHDA 4X1VA 3BFMA 4N4IA 3ZFJA 1LJOA 1OZ3A 2XG8D 2DK3A 4JZ3A 4WTOB 3NFCA 1NLOC 2C0IA 2L3RA 5FWBA 4OF1A 1PSEA 4EIKA 2HKNA 2E12A 4J6XA 2X51A 1ZHIA 3LGFA 3PNWC 4GLMA 5LL6S 4EMKB 1QVFP 4IUTA 1RUWA 4M4ZA 5GAMh 1Y57A 3I56A 1VQ6A 2LC4A 2E6NA 1D0ZA 3V7SA 3CCVQ 1VYUA 2L3QA 1YI2Q 1VQLT 3META 4KBMB 4HCZA 1Q86R 5AT1B 1WHKA 2H3JA 3U23A 2M9UA 4KULA 1ZUYA 2ROLA 3G71T 1PKSA 3WVDB 4JUVA 1I81A 4WCIA 5J39A 1OOTA 2DEUA 1Y7XA 4M7DF 1YWOA 1BI1A 2FEIA 5EC7A 2LQ8A 3CBMA 2G3RA 3QO3A 3M59A 2EGCA 3TREA 1MMAA 2FPDA 3OMCA 4P5NA 1UG1A 1RLQC 5LJ5d 3HRSA 2QTXA 2X4JA 1YIJA 4M7DG 1OU9A 1R0BG 4BB7A 3QWYA 3JCMQ 1QVFS 3RKXA 2FPEA 1NJIC 3P8BB 3NTHA 3A5ZB 4DOVA 5M9OA 2ED1A 3IQLA 4A4FA 3DB4A 2EYYA 4DOWA 5DLQE 1WQWA 4C92A 1WJSA 3CC7A 1BIBA 3EGXB 3QIIA 4PJNA 4OMMA 2VB6A 4XTWA 1WPYA 3VS5A 2RK2A 4EMKC 4V2SA 4C92E 3NHNA 1QP3A 2ECZA 4J7FA 4PKCC 4PJOB 1SF9A 3ZEHA 3CXCP 3TQ7P 2DYIA 3OYGA 1VQNQ 2YLBA 5LJ3g 5IXBA 1AWXA 1YJWQ 1D1BA 3PT9A 1Q82U 2D9TA 1I07A 3EG9A 4AFQC 1QCOA 2DL5A 4XU0A 4DBRA 1GFDA 5D6XA 2DKGA 3A1PA 2OTJT 1U8RA 2BZXA 4C5HA 1IHVA 4A4EA 4NL2A 4DBFA 1NEBA 4M77A 2VWFA 2H8HA 3G1JA 1UJYA 2P0PA 2YHTA 2GGRA 2DE0X 4FW2A 1N8RU 4HCCA 1NYFA 5CKBA 1X01A 2L89A 5GMKe 1M9SA 5CIUA 3VUBA 3UT1A 1KIKA 3H41A 3SDZA 4M77E 4AG2C 2YWWA 1VA7A 5CKEA 2P4RA 2LJ3A 4RTVA 4R55A 4B9WA 2I2LA 3CXCS 1IREB 2R57A 4HVUA 4BI4A 3J81E 1UJ0A 1UEBA 3LW5E 3JCMJ 2EFIA 2EPDA 2D8HA 3LWHA 2COZA 2JT4A 3REAB 1UTIA 2ZAEA 4JLIA 2NYSA 2RQRA 3JCMP 3QSUA 3WXMB 2XU8A 2DZ9A 4X34A 4PJOC 1FWZA 1D3BA 1X2KA 3CMAT 4MZPA 1ZSZB 2RB6A 1G3YA 1VQKA 3S6WA 3E9FA 1YBYA 2A08A 2K3XA 3M5AA 5GMKm 1B3QA 1B34A 2F5KA 3L1AA 2K2VA 1M3BA 2EQMA 1Q82R 3J80E 4J9CA 5HKCA 3MEWA 2O4XB 1I8FA 1RLPC 1VQLQ 3SWNB 2BE9B 2O9VA 1VQKT 1M3CA 2JS2A 3TEEA 3I9QA 2KRMA 2HL3A 1QVFA 1WLPB 3CPWP 5GAMe 3OA6A 4BACA 3MEUA 1I5OB 2NUTA 1N8RR 5LJ3j 3OYMA 1M1KC 2BIVA 4M75A 2GQIA 3CMEQ 4FT4A 3CCLT 2DXTA 1TUDA 1V29B 2L2PA 4C5EA 2P4TA 3JV3A 4BY6B 4PL6A 1H3ZA 3CD6A 3OYIA 3C4SA 1WA7A 4HKEA 2KSSA 2RI3A 1UE9A 2PVOB 3QKJA 4M75E 1YJ9Q 1N6AA 5CKHA 3X24B 4O6JA 2QEXQ 4LUEA 2O2OA 1Q81U 4OGEA 1MMDA 4M77B 4OMOA 4N0AA 2V26A 4A63B 2JUFA 4QKUA 1JXOA 3QYHB 1C6VX 4C8QF 3VKIA 2E6ZA 3V8JA 2LX9A 2MPXC 2Z0WA 3HRUA 5I11A 3VRYA 1ZSZC 4NOYA 3VS1A 3CCST 2Y90A 4RTTA 5A2QE 1YN8A 2LQNA 4PFPA 3G4SA 2DZCA 2YLCA 1IHWA 3A8HB 3KUFA 1WXUA 3TCJA 3EG3A 4C92C 5GAOl 5GAMd 3QPHA 3PIOA 2A28A 3RMSA 1XJWB 2X4YA 3SWNC 4RCCA 5KE3A 1GBQA 1YFNA 1VQ9A 5GAMf 4LDXA 3LX7A 2AZVA 2WSCE 1RAFB 2OTJQ 3CCJQ 1SSFA 1IRXA 2QA4A 4ME7A 4VUBA 5DLOA 2YXYA 3CXCA 4XTYA 4KT0E 5LJ5h 3UPUA 2RJFA 3I5SA 1O75A 3H8ZA 3JRZA 4LDYA 3MO8A 3REBB 2GNCA 1YCYA 1OQKA 4KUIA 4BY6C 2E5KA 2JTFA 5GAOq 2KQWA 1YJNT 2RQUA 2F1LA 1Y71A 5ECAA 2VKNA 4X9CA 3UWNA 3OQ5A 2LDMA 2R5AA 2KT8A 1E6GA 1PNJA 4M77C 1GCQA 4FSXA 2FO0A 4GY5A 4FYYB 4LUDA 4HCKA 4F16A 4EDUA 3EG0A 1QLYA 1YNZA 5GAN3 1YI2A 4PLIA 3OSVA 3BW1A 4M7AF 1QWFA 1MV0B 2F2WA 1SG5A 1D1AA 3FDRA 2JS0A 3THKA 3X26B 3L2UA 4AT1B 5IXFA 1U1SA 4NL3A 3RR6A 2KGTA 3M0TA 1W1FA 2LVMA 3AT1B 1Q7YU 4KH1B 2JW4A 2JM8A 3CMAQ 2AKKA 3CCVT 1QVPA 5I22A 1C0MA 1JRIA 4M7AG 2RJCA 1NYGA 2FYKA 2LZ6B 1PWTA 5GAMg 3FC3A 3C94A 2COYA 1LPLA 1Q86C 3CC4T 2JOYA 2RQWA 3RDVA 3QZ5B 5A0GA 1UDLA 2EGEA 2M16A 1KHCA 4JRQA 1M90U 4J5YA 2RF0A 4J8OA 5GAOr 3FIFA 5KYNA 4EMKA 1QVGP 3CCLQ 4QVZA 3MKDA 2L3PA 2DRMA 2JZ2A 1BI0A 2MMPA 2NUZA 4PJOD 1VQNA 1GFCA 2V8JA 3CPWA 4E7ZA 5GAN2 2H3EB 3R6OA 4B9XA 4Y91A 2HZYA 2LJ0A 5GMKi 2XDBA 1OI1A 3JB9J 4CC4B 3CPFA 2DXCA 1K8AU 2PVGB 4M75C 1SHGA 2W0ZA 2E10A 4RTWA 4DA4A 2CH4A 2ZPHB 2JJ9A 3KXTA 5A0DA 2DVJA 1AZGB 1X75C 1VQNT 1GBRA 3G7ZA 5D7UA 1P92A 1X69A 3CCUA 2FL7A 4F17A 3CCSQ 1QQJA 2EW3A 1YJWT 3S3NA 5HK0A 3GOXA 1VQOQ 1Q7YR 1EIFA 2FRYA 2J05A 3MEAA 2HNIA 5IT9E 1K4US 1NE8A 5KE2A 2GQVA 4C0GA 4N0AC 2O01E 5HK3A 1I4K1 1QVGS 1UGQB 1G5VA 3JCMh 1BIAA 1M8VA 1K1ZA 2LP5A 2DTOA 5KYXB 1EFNA 4M78A 4ATOA 2AKLA 2CKKA 2BUDA 1VIEA 1IGQA 3QHSA 3QZ9B 1JQQA 1WJQA 3EGXA 2GTOA 3X25B 1KSWA 2D8JA 2V8KA 2CREA 5CQXA 3MP8A 4M78E 1AT1B 2KK4A 2L5QA 3QUIA 1I5LA 1GRIA 1SRMA 2DA9A 2RJEA 4PJOA 3MCAB 2PVDB 4QW2A 3PIPA 3H0HA 1VQ8T 1K73U 2DNUA 2DRKA 3RMQA 3OBWA 2DIGA 4LDWA 2HBPA 2GFAA 1R8OB 4HA8A 5LJ5e 1MHNA 2DBMA 3NTKA 3PE0A 4PJOE 2DF6A 3CC2Q 3M54A 3VS6A 3RKYA 4OVAA 3ASKA 1YCSB 4C8QB 4II1A 2ZPBB 2F69A 1WI7A 1TH7A 2DJQA 2SRCA 2FZKB 2VGMA 1VQ5T 4DEXA 1M4ZA 1K8AR 3CCMT 1VQLA 4C92D 4RUGA 2FRWA 4LD9K 3A8OB 1LCKA 3VS7A 3G71A 2ZPIB 1V1CA 5FROA 2BE7D 2KNBB 4RTUA 2LT1A 3OY9A 3OYHA 1VQPT 1GCQC 5GANh 3CCEQ 2PTKA 2RI2A 2XDDA 5KYYB 1ZUKA 2DM1A 2JVVA 4PJJA 2DPPB 4OMNA 2KAFA 3FJ5A 2KYBA 1S72Q 3H6ZA 1Q82C 2DTIA 1JU5C 1XTDA 2X4WA 2L0AA 3S3MA 2M0YA 3O8VA 4JJCA 4JRKA 4OB0B 3VYHB 3CC4Q 2WACA 1YJ9A 3FLGA 2ZGWA 3E9GA 4JZ4A 1BBZA 3CMET 4DBHA 4MMLA 5GAOp 3CCRT 2QQAA 4BE0A 1MV3A 4M77D 1FMVA 1N8RC 3EG1A 2CP5A 1ZSZA 1M2OA 3GLXA 2ZPFB 1U5SA 5LJ5f 2W10A 1YJ9T 2QEXT 1KQ2A 1K73R 2HCKA 1N27A 4K11A 4M78B 1JO8A 2YSQA 2CP3A 4C8QC 5CR2A 4BI8B 2O4XA 3DLLA 1YITQ 3SWNA 5D6YA 5KCHA 2EQJA 2CZ1B 7AT1B 2ESWA 2MYSA 1ACMB 1QVGA 2V1QA 5DY9A 1SPKA 5FRNA 3GIBA 1H3HA 4HT8A 3UATA 2OTJA 3OYNA 4IUUA 2X35A 4PJMA 3MHXA 4FYVB 5FU6B 2ZPEB 4AMCA 4LDUA 3F70A 1ZLMA 2DERA 2V8IA 4FT2A 3EHRA 5CO7A 3SHWA 3M57A 2J06A 3CCJT 4BI3A 3PGGA 4D6WA 2HKQB 2MK5A 2ROTA 1X27A 3OSSC 2AIRB 2MI6A 4LN2A 3N5BB 2CYZB 1RL2A 3OYEA 1OU8A 3M9QA 2DTHA 4EMHA 2K7AA 5I2SA 4KUDK 1VUBA 2EVRA 3FRNA 4A53A 1DJ7B 1WGSA 3OYDA 5EG2A 5GJVB 2XK0A 5LJ5g 1JB0E 1JJ2P 1IZ6A 1TS9A 2C06A 4M78C 4M75D 4CRIA 3SEMA 2EJFA 1VQ8Q 3CMAA 1SSHA 2KY9A 2DX1A 3WVEB 2M1HA 1VYVA 3PVQA 4E7IA 3I55Q 2LRQA 3ER0A 3EGDB 3EFRA 4M7DA 3GBQA 2GF7A 2HBWA 2ZCFB 4FL6A 1D0XA 4J6WA 2HQHA 4MZMA 1VQ5Q 1UHFA 3UA6A 3E1SA 3CCMQ 2MCNA 1JXMA 2D0QB 1AWJA 4M7DE 1ZBJA 3OS0A 3CQTA 3V7CA 1N9SA 3CBOA 3M0UA 1VOMA 2K79A 1PD1A 1JJ2S 1KC8U 4IIMA 4FCYA 1VQPQ 2HSPA 1A0NB 2DEQA 2E41A 4PJLA 3CCLA 1OV3A 3HPWA 1U06A 3JCMd 1PG5B 2EJ9A 4FSSA 2NUPB 2K9GA 2L8DA 5CAIA 1TSFA 3JCMf 2EYZA 2YT6A 3LGLA 4JJNK 3PMTA 5CCAA 2D6FA 2MF2A 4OGCA 2CGHA 2F2XA 1CSKA 4F7UF 1U1TA 3CEYA 4XU2A 1QCFA 3CCRQ 1JBMA 2XD0A 3UDCA 1KFZA 2YRVA 1Y96B 2RA2A 1GCPA 4ORZA 2MOXA 3RKWA 4ELZC 2CDTA 2ED0A 1VQ4T 1UGPB 1TUCA 3CCSA 4F7UG 5A0LA 1RAAB 4R0KA 2K2MA 1UFFA 4FYXB 1YHQT 1FMWA 4ZNXA 1AZEA 2VASA 3CCQQ 1TG0A 1D09B 2KR3A 1Y07A 3VUZA 3ZL7C 4CC7A 1WYXA 2DMOA 2J6OA 5LJ5j 4R56A 2E5QA 2P84A 2EGAA 2CUDA 2HSEB 2QI2A 1VQOT 2K3YA 3M55A 2K5LA 2EBPA 4FM4B 1G3SA 3OYJA 1BCMA 5IN1A 1PC0A 1UB4A 1Q7YC 1M1FA 1B7TA 3O5ZA 5LJ3h 3Q1JA 1OPKA 4LNPA 5GANd 1KC8R 2VGNA 4M7DB 2KXCA 2R5MA 3HTRA 1YJNA 1SEMA 1IO6A 2QTVA 5GANf 3M58A 3CC7Q 2EYWA 4RTYA 1QP2A 3QDFA 2KRSA 1TOVA 1K9MU 1PKTA 3C95A 1E6HA 1D0YA 4JRIA 1ABQA 2AHJB 5KH6A 2PUKB 1FYNA 4C0FA 4E6RA 1BYMA 3L2WA 2DBKA 2QQRA 2JTEA 2KROA 3VYGA 2QAZA 4RG8A 4A4KA 1M30A 1WXTA 2K5FA 1M3AA 2LCLA 3HL8A 3CC2T 2EAYA 4EPCA 2KE9A 3JB9I 4J9DA 3GP8A 1M2VB 1OX8A 3M53A 3AHUA 1KD1U 1H92A 4QT7A 4JS5A 3BDLA 4DEYA 1VIFA 2EQUA 3CCVA 1Q81R 5KYXA 5AYFA 2XI9A 1F1BB 1K76A 1S1NA 1ZUUA 2A37A 3C0CA 2Y4YA 5C6SA 1JJ2A 3PMIA 1ZX6A 1K8AC 3X28B 1T3SA 3JCMV 3CC4A 3BE3A 3CCET 4KGZB 5FRMA 4J9FA 3LWIA 2G6FX 3M0PA 2GTJA 1RAEB 4Z8AA 1Y0MA 1YP5A 1U3OA 1S72T 2MIOA 4M7DC 1UUEA 4JDSA 1JEGA 1K0SA 1W6XA 2J7IA 1WDXA 1E7OA 2VXEA 4PJOF 1M27C 1UGSB 3TVTA 1K9AA 1RI0A 5I21A 4C8QA 3HSBA 2QQ9A 2O9SA 1WXBA 4M78D 5CQYA 4AG1C 4L59A 1YITA 4ESRA 1K9MR 2QXFA 3M4GA 4PJOG 5GMKl 3G6EQ 5FU7B 4BD3A 1IGUA 4ZN3A 5KYWB 4C8QE 5GMKj 2F2VA 3KBGA 4KGXB 1H641 1IB8A 1AWWA 2NLUA 5KYYA 4F04B 1YITT 4KH0B 1RACB 2P0KA 2DYBA 3EHQA 3NMZC 1VQ4Q 1K73C 1WQ7A 2VUBA 1YJWA 1KD1R 2R58A 2KYMA 2DD5A 2IIMA 1YHQQ 2HMAA 4AFSC 1K0XA 2D1XA 1RABB 1G2BA 4XTZA 3H9NA 1HYOA 1G83A 4C0ZA 2X3WD 5L8RE 3OS2A 1UECA 2OTLQ 1KK7A 4OB1B 1MNDA 1BK2A 3MP1A 4PNOA 1XOVA 4HVVA 4ZN1A 1NPPA 1OYXA 3JCMW 2IPOB 2M51A 1W70A 3FJPA 2DXBA 1IXDA 4JJBA 3VS0A 4HXJA 4MDXA 3CD6Q 3L2RA 4JLGA 1MUZA 3OYLA 2K3BA 4KRTA 4IIOA 2RN8A 4ZGEB 4OB3B 1VQ7Q 1MNEA 4Y92A 1VQ8A 4JJDA 2RPNA 1W2BP 3V8LA 1ZSGA 4L6V5 4XQ3A 4F7UB 3S3OA 4ZTJA 3I55A 1YWPA 4C92F 5FU7C 1M90R 4N4HA 5GAMj 5IAYA 1R0CB 1VQ5A 3G4SQ 2J6KA 3M0SA 1MMNA 2CP7A 2ENMA 2A0FB 3CCMA 2LTOA 3DKMA 1X6GA 4QVCA 4C92G 3I55T 2HAXA 2PZ1A 4RCBA 1NEGA 2CH4W 2X3XD 2A36A 3MPUB 2YUNA 1VQPA 2E1HA 1C1AA 2YRDA 2KMTA 2QA4Q 1W2BS 3NTIA 1RAGB 2IVWA 3LH0A 2AT1B 3ME9A 1I0CA 2C0OA 2YUQA 4B6MA 3RESA 4M77F 3VS3A 2KBTA 4OP0A 8AT1B 1ZQ1A 4FIBA 2JTMA 4GLKA 1OEBA 3JB9F 5FWCA 4BDYA 2CZ6B 2E64A 2OI3A 3CMEA 2GCXA 2BTTA 2CSQA 5CKDA 1NLPC 3EFSA 3CCRA 3A8GB 3M0QA 2K57A 4ANJA 1X43A 1EZZB 3PVLA 3T9NA 4C0DB 5I2MA 4J9IA 3C12A 4M77G 5LJ3d 1AWOA 3GF5A 2CZ7B 1QCNA 1G8XA 3JB9G 4E7HA 2V1RA 5LJ3f 2EIFA 1TU0B 2K4YA 3EGDA 3QBYA 4LE9A 2E3IA 2QEXA 1X2QA 1ZBXA 2LCCA 3E2UA 3INZA 2O88A 1WHMA 1CKBA 1WHJA 1KG1A 1BKBA 3CCQA 2QG9B 1G3TA 3CBPA 3JB9D 3I56T 1VQ6T 2CZ0B 2HQEA 2DO3A 2EQIA 2XHCA 3EH2A 2RMOA 1QW1A 3QG1A 3R6NA 4JS4A 4EMGA 3SFMA 4E7LA 3QXEB 5D6WA 3EFOA 2ZZDA 3P8HA 3CCQT 3RBBB 8ATCB 1SRLA 2QASA 4M7AB 4LD6A 2NWMA 5FW9A 2NUPA 3OB9A 3L42A 2ABLA 3OS1A 2QDYB 1KQSP 1D1CA 2EYXA 2O31A 5KYUA 3SD4A 3NGPA 2LT4A 5GAOm 2HEQA 3I35A 1V76A 4M7DD 3CCJA 1PCXA 5HY6A 4PFZA 4CC2A 1YIJT 2KT1A 3H0IA 3JAME 1AD5A 2VV5A 4J7IA 4QQ6A 3HFNA 1LNXA 2LCSA 2QQBA 1Y96A 2RJDA 2VVKA 1Z9ZA 1N9RA 4C0DC 4M75F 5J26A 1PD0A 2QGGA 3CC7T 4DBQA 2A7YA 1KC8C 6AT1B 2KXDA 3JCMb 3A8LB 4IURA 4ZGJB 4OMPA 2FZCB 1N5ZA 3OYFA 4E7JA 5CK9A 3RNJA 2OAUA 3RIRA 4M75G 2DD4A 4HCBA 1KQSS 4X9DA 2QQSA 3VV0A 3QDRB 1AOJA 1UGVA 2B8AA 4RTZA 4Z89A 3JCMe 3L2ZA 2RHYA 4IUVA 1VQMQ 4C5IA 3QYGB 3CCUQ 1HJDA 3OYYA 1NBEB 1SHFA 4JPBW 1SKUB 2XICA 4TVRA 2EWNA 3A8MB 1NJIU 2E65A 2PUOB 1W2BA 2P0QA 4M7AC 4A4HA 1TTHB 2CUBA 5GJWB 3M4YA 4Z88A 1BI2A 5GAN7 3DB3A 1Q81C 3LH5A 4XTVA 5IHNA 3MP6A 3HRTA 2FZGB 5FU6C 4AFUC 1XNIA 3MJXA 2KDSA 3P8DA 2B86A 2FPFA 2JXBA 2J6FA 4DQ2A 2K6DA 3EFOB 1HXDA 1KHIA 2RHZA 3G6EA 2YUOA 4LDVA 1HSQA 1M2VA 3JB9H 1M8MA 4O5VA 2E70A 1UHCA 1X6BA 3HKSA 3HP9A 1T0HA 5KYUB 4QQGA 2E3HA 1VQ4A 2LNHB 2F5TX 3VS2A 2C0TA 4C92B 1RAHB 1XQHA 2SEMA 3VU3C 5IH2A 3G6ET 5GANe 3QWXX 1OULA 2JM9A 2DAQA 3RUXA 2K5IA 1OX9A 1YHQA 5CKFA 3URGA 3TSZA 1K9MC 3QJ6A 3G71Q 3LLRA 3D7SB 2HL5C 2PU9B 3I56Q 2AZSA 1VQ6Q 2L3SA 2OTLA 4MDWA 1VYTA 2BZ8A 2HD0A 2D0NA 3OYCA 2CP0A 1VQOA 2X9HA 2JN0A 1NG2A 4Z02A 2JMCA 3V7RA 1NJIR 1BB9A 1KJWA 4ELYC 3EG2A 1R77A 2ATCB 3EG9B 4GBQA 1QMCA 2IG0A 1KD1C 2A3LA 2QDLA 1AHJB 2OTLT 2FB7A 3TSWA 3OW2P 4Y28E 3OYKA 3OMGA 4WF2A 2EJGA 1O9SA 2LMJA 2YRCA 1AEYA 1VQ7A 4PK4A 1FX7A 2QK0A 1PRMC 4BDZA 3NPFA 3CD6T 4C5GA 3EH1A 1BCOA 1YIJQ 4JRPA 3BY7A 5KYWA 2DLPA 3KFVA 4RG2A 2OJ2A 1NZ9A 3CPWS 2YDLA 5FLXE 1MGQA 1KQSA 1VQ7T 2DILA 2XDPA 2JNGA 2LX7A 4XU3A 2RHUA 4J9BA 3JCMg 1CKAA 4C8QG 1WJRA 4FW1A 3I5RA 4E47A 4OMLA 1LOJA 5HCKA 3DLMA 1PHTA 1WNLA 5IHIA 3JCMX 3VJPA 1TWBA 2FVUA 2WSEE 3E19A 3VRZA 3CC2A 2VXFA 2CP6A 3TU4K 2DL4A 2VYTA 1RAIB 2BKDN 4XU1A 3OW2S 4IKFA 1GXIE 2WSFE 1HD3A 3M56A 3G4ST 2RNAA 4C8QD 4AFZC 1M90C 2KEAA 1M1KU 1T0JA 2QYZA 1D3BB 2XIDA 5L23A 4BE2A 3OS5A 1T3LA 2LQKA
chains in the Genus database with same CATH topology
5LJ5f 4IUPA 1VQ9T 4MDXA 3S6WA 1YJ9T 3PFSA 3E9FA 3QJYA 1M1GA 2M0OA 3L2RA 4JLGA 2QEXT 3CCEA 1KQ2A 1YBYA 2K3XA 3M5AA 4BUGA 5GMKm 1NPRA 5GAN5 1N27A 3OYLA 1B34B 1B34A 2F5KA 3L1AA 4M78B 2QA4T 2VC8A 2K2VA 2EQMA 4ZGEB 4YTLA 4C8QC 4QQDA 5CR2A 4OB3B 3J80E 5HKCA 3MEWA 2O4XB 1I8FA 2MWPA 2O4XA 4BI8B 3DLLA 1VQ8A 1S72A 2KVQG 3SWNB 3SWNA 5D6YA 1VQKT 3V8LA 3BDUA 5KCHA 2EQJA 5GAN4 4L6V5 4XQ3A 4F7UB 4F7UA 4M78F 3TEEA 2CZ1B 3S3OA 4ZTJA 3I55A 4C92F 5FU7C 1QVFA 1QVGA 4XK8E 5DY9A 5FRNA 1BI3A 3GIBA 5GAMe 3GNFB 4N4HA 3OA6A 3MEVA 4BACA 3MEUA 4HT8A 2OTJA 3SB2A 3OYNA 4IUUA 2X35A 5GAMj 5IAYA 2DIQA 5LJ3j 3OYMA 1M1KC 3MHXA 5FU6B 2BIVA 4PLLA 4M75B 4M75A 2ZPEB 1VQ5A 4FT4A 4LDUA 4L5GA 2DXTA 4F7UE 3CCLT 1X6OA 3F70A 1V29B 4IUQA 4XAXB 2LTOA 4M78G 4C5EA 2P4TA 3DKMA 3CCMA 4BY6B 2V8IA 5GANg 4QVCA 4PL6A 4FT2A 3HFOA 4C92G 1H3ZA 3CD6A 3I55T 2HAXA 1OZ2A 5CO7A 4RCBA 4XTXA 1YI2T 2RHIA 3M57A 3OYIA 3C4SA 4HKEA 2KSSA 2RI3A 2PVOB 1PSFA 2EKOA 3QKJA 2RHXA 4M75E 4MZTA 5CVIA 4BI3A 3PGGA 1N6AA 4D6WA 4ZGDB 5CKHA 3X24B 3OSSC 1VQPA 4O6JA 2MI6A 2E1HA 1Q81U 3N5BB 2CYZB 4OGEA 4M77B 1RL2A 4Q5WA 4N0AA 3OYEA 3M9QA 2DTHA 4EMHA 2KMTA 5I2SA 2RD1A 4KUDK 2JUFA 3FB9A 1W2BS 3NTIA 1VUBA 3GNGA 3QYHB 3FRNA 3X20B 4C8QF 2IVWA 3LH0A 3VKIA 4M7AD 2E6ZA 4A53A 3ME9A 2LNVA 1DJ7B 2LX9A 3V8JA 3HRUA 1WGSA 3RESA 4M77F 4NOYA 5EG2A 3OYDA 2HQXA 4OP0A 3CCST 1ZQ1A 2Y90A 2XK0A 4FIBA 2JTMA 4GLKA 4J83A 5LJ5g 1JB0E 5A2QE 3JB9F 3OBYA 3GPLA 4BDYA 2CZ6B 2E64A 4CI0C 3G4SA 2DZCA 2GCXA 3CMEA 5CKDA 1IZ6A 2C06A 2YLCA 3EFSA 3CCRA 3LYIA 3A8HB 4M78C 3A8GB 2Y4XA 4M75D 4CRIA 3KUFA 2RI5A 2K57A 3TCJA 4A54A 4C92C 2X4XA 4XTUA 2EJFA 5GAOl 3CMAA 3T9NA 4C0DB 5I2MA 4M77G 3C12A 3QPHA 5LJ3d 5GAMd 3PIOA 2KY9A 3RMSA 3SWNC 2X4YA 3WVEB 2M1HA 3GF5A 4RCCA 2CZ7B 3JB9G 1FXXA 4E7HA 5KE3A 4E7IA 1VQ9A 5GAMf 4LDXA 4FU6A 2LRQA 2EQKA 5LJ3f 3ER0A 3RERA 2EIFA 2K4YA 3EFRA 3LX7A 4M7DA 3QBYA 2WSCE 2QEXA 1ZBXA 2GF7A 2LCCA 5GAN8 2ZCFB 4FL6A 4J6WA 4RKUE 3INZA 1SSFA 3V8KA 2QA4A 4ME7A 3JCMc 4MZMA 1KG1A 4VUBA 4QVDA 1KQ1A 3HHTB 5DLOA 1BKBA 4XTYA 3CXCA 4NS5A 3CCQA 1G3TA 4KT0E 4A4GA 5LJ5h 3UPUA 3E1SA 3CCJT 2DXUA 3CBPA 5GAN6 2RJFA 3JB9D 4MMKA 4HT9A 3I56T 1VQ6T 2CZ0B 1O75A 2DO3A 2HQEA 3H8ZA 3JRZA 2D0QB 2XHCA 3MO8A 4LDYA 4M7DE 3OS0A 1YCYA 1QW1A 2RH2A 4KUIA 4UC4A 1N9SA 3FJPA 3V7CA 3QG1A 4BY6C 3OYBA 2JTFA 3CBOA 4N4GA 5GAOq 2KQWA 3JSCA 1YJNT 2CS7A 4JS4A 1HK9A 3SFMA 4EMGA 2MAMA 1Y71A 4E7LA 1VQMA 3QXEB 2PQWA 1JJ2S 4X9CA 5D6WA 3FEOA 1KC8U 3UWNA 3OW2A 2ZZDA 5GMKh 3OQ5A 3P8HA 3CCQT 2LDMA 2R5AA 2DEQA 2E41A 1Q86U 4M77C 3CCLA 2RM4A 3HPWA 4M7AB 3J7AF 4E7KA 4M7AA 3ZBDA 3JCMd 1UGRB 2EJ9A 4LD6A 2EYQA 4FSXA 4GY5A 2XKOC 3OB9A 2L8DA 5CAIA 3L42A 3OS1A 4EDUA 2QDYB 3JCMf 2GFUA 3LGLA 5GAN3 4JJNK 1VQMT 3PMTA 3SD4A 5CCAA 1YI2A 2MF2A 4OGCA 2D6FA 3CCUT 2LT4A 5LJ3e 2CGHA 4OMFB 4ZTFA 4PLIA 5GAOm 3OSVA 3BW1A 4M7DD 4M7AF 3CCJA 2MWOA 4OB2B 5HY6A 2RK1A 4F7UF 1YIJT 3FDRA 4M7AE 3JAME 1U1TA 2DJZA 3CEYA 2VV5A 4QQ6A 4J7IA 4XU2A 2ZPGB 3X26B 1M5Q1 3HFNA 5GANj 1LNXA 3L2UA 2DVEA 1U1SA 4NL3A 1JBMA 4RMOA 3UDCA 3L2QA 2XD0A 2QQBA 2LVMA 2YRVA 1W4SA 5KCOA 1Y96B 1Y96A 3L2VA 2RA2A 1Q7YU 2RJDA 3EAEA 5C0MA 1G3WA 3CCVT 1QVPA 3RKWA 3PTAA 4ELZC 1N9RA 4C0DC 4M75F 5J26A 1VQ4T 1JRIA 4M7AG 2RJCA 1UGPB 4J6YA 2FYKA 4F7UG 3CCSA 5GAOn 5A0LA 3OYAA 3CC7T 2A7YA 1KC8C 5DM7R 5J3BA 5GAMg 3FC3A 4BE1A 2RO0A 3JCMb 2FHDA 3A8LB 4IURA 1YHQT 3C94A 4ZGJB 3BFMA 1Q86C 3CC4T 3OYFA 2JOYA 4E7JA 3QZ5B 4N4IA 5CK9A 1Y07A 3VUZA 2OAUA 3RIRA 4M75G 3ZFJA 5A0GA 1LJOA 1OZ3A 1G5VA 2DD4A 2XG8D 2DK3A 4HCBA 1KQSS 3NFCA 5LJ5j 4X9DA 2QQSA 3VV0A 2M16A 3QDRB 1KHCA 4R56A 2B8AA 2L3RA 2E5QA 1PSEA 4OF1A 3JCMe 4JRQA 1M90U 2QI2A 3L2ZA 4J5YA 1VQOT 2K3YA 2E12A 4J6XA 2RHYA 4IUVA 4J8OA 3M55A 4C5IA 3QYGB 2K5LA 5GAOr 1ZHIA 3OYYA 3FIFA 4FM4B 1G3SA 3OYJA 3LGFA 3PNWC 5IN1A 5LL6S 4EMKB 4EMKA 4TVRA 1UB4A 2XICA 1M1FA 2EWNA 4IUTA 3A8MB 1Q7YC 1NJIU 5GAMh 2E65A 2PUOB 4QVZA 5LJ3h 2P0QA 3Q1JA 1W2BA 3I56A 1VQ6A 2LC4A 2E6NA 4M7AC 2JZ2A 5GANd 2VGNA 4A4HA 1BI0A 3M4YA 2MMPA 3V7SA 4M7DB 2R5MA 1YJNA 1VQNA 4PJOD 1VQLT 1BI2A 3META 3DB3A 5GANf 2V8JA 4KBMB 3M58A 5GAN7 4HCZA 4B9XA 3R6OA 5GAN2 3CPWA 1Q81C 4Y91A 2H3JA 5GMKi 2M9UA 4KULA 1QP2A 1OI1A 4XTVA 3JB9J 2XDBA 3G71T 3MP6A 3WVDB 3CPFA 2DXCA 4JUVA 1K8AU 1I81A 3HRTA 5J39A 5FU6C 2PVGB 4M75C 1Y7XA 1K9MU 2E10A 4M7DF 3C95A 1BI1A 1XNIA 4DA4A 4JRIA 2LQ8A 2KDSA 2ZPHB 3CBMA 3KXTA 2G3RA 3P8DA 3QO3A 5A0DA 2AHJB 1VQKA 3M59A 5KH6A 3TREA 1X75C 2PUKB 1VQNT 3G7ZA 4C0FA 1BYMA 3OMCA 1P92A 4DQ2A 4P5NA 2FL7A 3L2WA 3CCUA 1YJWT 1HXDA 5HK0A 5LJ5d 2QQRA 3GOXA 3S3NA 3HRSA 3JCMQ 1EIFA 1KHIA 2RHZA 3G6EA 2QTXA 2X4JA 3MEAA 1YIJA 3VYGA 4M7DG 2HNIA 5IT9E 1NE8A 4RG8A 4A4KA 2GQVA 4BB7A 5KE2A 2K5FA 3HL8A 4LDVA 2LCLA 4C0GA 3CC2T 2EAYA 2O01E 4N0AC 1I4K1 4EPCA 3RKXA 1UGQB 5HK3A 3JB9I 3GP8A 3P8BB 1QVGS 3JCMh 1NJIC 3M53A 1BIAA 3JB9H 3AHUA 1KD1U 1M8VA 3NTHA 4JS5A 3A5ZB 4O5VA 3BDLA 4DOVA 5M9OA 1VIFA 2EQUA 2DTOA 2E70A 3CCVA 3HKSA 4A4FA 3HP9A 5AYFA 2XI9A 4M78A 3DB4A 4QQGA 1VQ4A 4DOWA 2F5TX 5DLQE 4ATOA 2CKKA 2BUDA 1WQWA 4C92B 1WJSA 1XQHA 3VU3C 1BIBA 4C92A 3CC7A 3G6ET 2Y4YA 1VIEA 5GANe 5C6SA 1JJ2A 3PMIA 3QHSA 3QZ9B 1WJQA 2DAQA 3RUXA 2K5IA 3QIIA 3X25B 1YHQA 1K8AC 5CKFA 3URGA 3X28B 2V8KA 5CQXA 1K9MC 4XTWA 1WPYA 3MP8A 3QJ6A 3JCMV 3CC4A 3LLRA 4M78E 3CCET 5FRMA 2KK4A 2L5QA 2PU9B 2RK2A 4EMKC 4V2SA 3QUIA 4C92E 3LWIA 1I5LA 1QP3A 2RJEA 2OTLA 4MDWA 4PKCC 4J7FA 4PJOB 4PJOA 3MCAB 2PVDB 4QW2A 3ZEHA 3PIPA 2HD0A 3OYCA 1VQOA 3OYGA 1S72T 1K73U 2JN0A 1VQ8T 2YLBA 4Z02A 5LJ3g 4M7DC 3V7RA 4JDSA 3RMQA 3OBWA 2DIGA 4ELYC 3PT9A 1Q82U 2VXEA 4LDWA 4PJOF 2D9TA 1UGSB 2HBPA 2GFAA 1R8OB 4HA8A 4XU0A 1MHNA 3NTKA 2IG0A 5LJ5e 2A3LA 1KD1C 4PJOE 3M54A 5D6XA 2DKGA 1QVFS 1AHJB 3RKYA 2OTLT 2OTJT 2FB7A 4OVAA 1RI0A 5I21A 3ASKA 4Y28E 4C8QB 4C5HA 4C8QA 1U8RA 3HSBA 4II1A 3OYKA 3OMGA 2F69A 2EJGA 1O9SA 1TH7A 2QQ9A 2VGMA 2ZPBB 4WF2A 4A4EA 4M78D 4NL2A 5CQYA 1VQ5T 1VQ7A 4M77A 1M4ZA 4L59A 3CCMT 1YITA 1VQLA 4C92D 2P0PA 2YHTA 2QXFA 1FX7A 3M4GA 4LD9K 3A8OB 4PJOG 5GMKl 4BDZA 1N8RU 4HCCA 5CKBA 3CD6T 1X01A 2L89A 4C5GA 5GMKe 5FU7B 1M9SA 5CIUA 3VUBA 2ZPIB 3G71A 4BD3A 4JRPA 3BY7A 5FROA 4ZN3A 3UT1A 4C8QE 4RG2A 5GMKj 1NZ9A 2LT1A 3SDZA 3KBGA 3CPWS 3OY9A 3OYHA 4M77E 1VQPT 1H641 5GANh 5FLXE 1MGQA 5CKEA 1KQSA 2NLUA 1VQ7T 2XDPA 4R55A 2RI2A 2JNGA 4B9WA 2I2LA 2XDDA 3CXCS 1IREB 2R57A 3J81E 4XU3A 2RHUA 4BI4A 1YITT 2P0KA 2JVVA 1UEBA 3LW5E 3JCMJ 1K73C 3JCMg 2DPPB 2EFIA 4C8QG 1WJRA 1WQ7A 3LWHA 2VUBA 2KAFA 1YJWA 2R58A 4E47A 3H6ZA 1Q82C 1LOJA 2DD5A 1WNLA 3DLMA 2DTIA 3JCMX 2X4WA 1XTDA 2FVUA 3VJPA 3S3MA 2WSEE 3E19A 3CC2A 3O8VA 4JRKA 4OB0B 2VXFA 3VYHB 4JLIA 3TU4K 2VYTA 2WACA 1YJ9A 2BKDN 4XTZA 3FLGA 4XU1A 3OW2S 4IKFA 2ZGWA 1GXIE 2WSFE 3E9GA 3M56A 4C0ZA 3G4ST 5L8RE 3CMET 3OS2A 4MMLA 4C8QD 1M90C 3JCMP 5GAOp 3QSUA 4OB1B 3WXMB 3CCRT 2QQAA 4BE0A 1M1KU 2XU8A 2DZ9A 3MP1A 4M77D 4X34A 4PJOC 1FWZA 4PNOA 1XOVA 1D3BB 1D3BA 4ZN1A 2XIDA 1NPPA 1OYXA 4BE2A 3JCMW 1N8RC 3CMAT 4MZPA 2RB6A 3OS5A 3GLXA 2ZPFB 1G3YA 2LQKA 2DXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MP8 A;  3QJ6 A;  4IUP A;  3LLR A;  2X4Y A;  1OZ3 A;  2M1H A;  3S6W A;  3PFS A;  3E9F A;  5FRM A;  4E7H A;  2M0O A;  3L2R A;  5KE3 A;  4E7I A;  2QQS A;  4FU6 A;  2LRQ A;  2EQK A;  2M16 A;  1KHC A;  2K3X A;  2B8A A;  2L3R A;  2RJE A;  2E5Q A;  3LX7 A;  3QBY A;  1N27 A;  3OYL A;  2F5K A;  4QW2 A;  2K3Y A;  3ZEH A;  2RHY A;  4IUV A;  2GF7 A;  2LCC A;  3OYC A;  4FL6 A;  2EQM A;  4C5I A;  3OYG A;  1SSF A;  4QQD A;  4Z02 A;  3MEW A;  2O4X B;  2O4X A;  2MWP A;  4NS5 A;  4A4G A;  5D6Y A;  2DIG A;  3OYJ A;  3LGF A;  3PNW C;  5IN1 A;  5KCH A;  2RJF A;  2EQJ A;  2D9T A;  2HQE A;  3H8Z A;  4IUT A;  2GFA A;  4QVZ A;  3MO8 A;  3S3O A;  4ZTJ A;  1MHN A;  3NTK A;  2IG0 A;  3Q1J A;  3OS0 A;  4UC4 A;  5D6X A;  2E6N A;  3OYB A;  2JZ2 A;  2JTF A;  4N4G A;  4A4H A;  4OVA A;  5FRN A;  1RI0 A;  3ASK A;  4C5H A;  4N4H A;  4II1 A;  3OYK A;  3MEV A;  3OMG A;  2R5M A;  3MEU A;  4A4E A;  3OA6 A;  4BAC A;  3OYN A;  4E7L A;  2PQW A;  2X35 A;  4IUU A;  3MET A;  3FEO A;  3DB3 A;  5D6W A;  3UWN A;  5IAY A;  2DIQ A;  4HCZ A;  4B9X A;  4L59 A;  3OYM A;  2BIV A;  4PLL A;  3OQ5 A;  3P8H A;  2LDM A;  2R5A A;  1OI1 A;  3F70 A;  4IUQ A;  2LTO A;  4BDZ A;  3MP6 A;  4C5E A;  2L89 A;  4C5G A;  5J39 A;  4E7K A;  4PL6 A;  5CIU A;  4BD3 A;  1H3Z A;  4LD6 A;  4GY5 A;  5FRO A;  1OZ2 A;  1XNI A;  3UT1 A;  4RG2 A;  3OB9 A;  2L8D A;  3L42 A;  3OS1 A;  2RHI A;  2G3R A;  4EDU A;  3P8D A;  3OYI A;  3C4S A;  3OY9 A;  3OYH A;  2RI3 A;  2GFU A;  3LGL A;  5KH6 A;  3PMT A;  3SD4 A;  2EKO A;  3QKJ A;  2RHX A;  4ZTF A;  2NLU A;  2XDP A;  4PLI A;  2RI2 A;  4B9W A;  3OMC A;  2R57 A;  2RHU A;  3L2W A;  2MWO A;  2P0K A;  4Q5W A;  3S3N A;  3OYE A;  2QQR A;  3FDR A;  2EFI A;  3M9Q A;  3GOX A;  1WJR A;  2RHZ A;  3CEY A;  4QQ6 A;  3MEA A;  2R58 A;  3NTI A;  5KE2 A;  3L2U A;  3H6Z A;  3L2Q A;  2LVM A;  2YRV A;  5KCO A;  3DLM A;  3LH0 A;  3L2V A;  2X4W A;  2RJD A;  3EAE A;  3ME9 A;  3S3M A;  1G5V A;  3O8V A;  5C0M A;  1WGS A;  3NTH A;  3OYD A;  3BDL A;  2VYT A;  2WAC A;  2BKD N;  2HQX A;  2EQU A;  5M9O A;  3FLG A;  5J26 A;  2XK0 A;  4IKF A;  4A4F A;  2RJC A;  3E9G A;  3DB4 A;  4QQG A;  3OS2 A;  3OYA A;  4BDY A;  2CKK A;  2BUD A;  4BE0 A;  1WJS A;  4BE1 A;  3FC3 A;  2RO0 A;  3MP1 A;  4X34 A;  5C6S A;  2FHD A;  3LYI A;  4IUR A;  3PMI A;  4CRI A;  1WJQ A;  3KUF A;  2RI5 A;  4BE2 A;  1OYX A;  2DAQ A;  3QII A;  2X4X A;  3OYF A;  4E7J A;  4N4I A; 
#chains in the Genus database with same CATH topology
 4IUP A;  3EGU A;  1VQ9 T;  3PFS A;  2CT3 A;  3QJY A;  1M1G A;  2M0O A;  4CC3 A;  3UF4 A;  3CCE A;  4BUG A;  1WHG A;  1NPR A;  5GAN 5;  1B34 B;  2QA4 T;  2VC8 A;  1QKX A;  4YTL A;  4QQD A;  2MWP A;  2QGF B;  1S72 A;  2KVQ G;  1TUG B;  3BDU A;  4J9H A;  5GAN 4;  2GBQ A;  4M78 F;  4F7U A;  9ATC B;  4XK8 E;  1BI3 A;  2LQW A;  3GNF B;  1WHL A;  3MEV A;  2I0N A;  3SB2 A;  2NUT B;  2RQT A;  2PNI A;  2DIQ A;  4PLL A;  4M75 B;  1FMK A;  4L5G A;  4F7U E;  1X6O A;  4IUQ A;  4XAX B;  4M78 G;  2EKH A;  2OAW A;  4D8K A;  5GAN g;  2LJ1 A;  1RAD B;  3HFO A;  4J9E A;  1OZ2 A;  3H0F A;  4XTX A;  4LXC A;  1YI2 T;  2RHI A;  2E4H A;  1PSF A;  2EKO A;  2RHX A;  5CVI A;  4MZT A;  4ZGD B;  1ARK A;  1WHH A;  2AK5 A;  4Q5W A;  2XMF A;  1Z9Q A;  2RD1 A;  3FB9 A;  2OX7 A;  3GNG A;  3X20 B;  4M7A D;  1ZA1 B;  2BZY A;  2LNV A;  5IHK A;  1VQK Q;  1WFW A;  1Q95 G;  2HQX A;  1M1K R;  4J83 A;  3OBY A;  3GPL A;  1WIE A;  4CI0 C;  1B07 A;  2KI7 A;  1GL5 A;  3LYI A;  2Y4X A;  4A54 A;  2RI5 A;  1OPL A;  2X4X A;  4XTU A;  2CSI A;  2DL3 A;  1FXX A;  4J9G A;  4FU6 A;  2EQK A;  3RER A;  4OMQ A;  3VS4 A;  1LVK A;  5GAN 8;  1ZA2 B;  4RKU E;  1WX6 A;  3A98 A;  3V8K A;  3JCM c;  4QVD A;  1KQ1 A;  2M02 A;  3HHT B;  2DET A;  1J3T A;  4NS5 A;  1NM7 A;  4A4G A;  3M0R A;  2CT4 A;  2DXU A;  2YUP A;  4HVW A;  5GAN 6;  4MMK A;  4HT9 A;  2JMA A;  4D8D A;  2RH2 A;  4UC4 A;  4E7S A;  3OYB A;  4N4G A;  2KRN A;  3JSC A;  4KGV B;  2CS7 A;  1HK9 A;  1VQM A;  1WZO A;  2MAM A;  2PQW A;  3FEO A;  3OW2 A;  5GMK h;  1Q86 U;  4E2F B;  2RM4 A;  4RTX A;  3J7A F;  4M7A A;  4E7K A;  3ZBD A;  1UGR B;  1PRL C;  2EYQ A;  1AVZ C;  2XKO C;  2DL7 A;  1MMG A;  2CP2 A;  1TXQ A;  2DFU A;  2GFU A;  1VQM T;  3CCU T;  4ZTF A;  5LJ3 e;  1I1J A;  4OMF B;  2RQV A;  1PM3 A;  1QKW A;  2MWO A;  4OB2 B;  2RK1 A;  4M7A E;  2DJZ A;  2ZPG B;  1ABO A;  1M5Q 1;  1EX4 A;  5GAN j;  2HDA A;  2DVE A;  4PFO A;  4RMO A;  3L2Q A;  5KCO A;  3ULR B;  1W4S A;  3L2V A;  2COW A;  3EAE A;  4FYW B;  5C0M A;  1G3W A;  2FG0 A;  3PTA A;  4F14 A;  1BU1 A;  1QWE A;  4J6Y A;  1VQ9 Q;  1RI9 A;  5GAO n;  3OYA A;  2DL8 A;  3UA7 A;  5DM7 R;  1YJN Q;  5J3B A;  1H8K A;  4BE1 A;  2RO0 A;  2FHD A;  4X1V A;  3BFM A;  4N4I A;  3ZFJ A;  1LJO A;  1OZ3 A;  2XG8 D;  2DK3 A;  4JZ3 A;  4WTO B;  3NFC A;  1NLO C;  2C0I A;  2L3R A;  5FWB A;  4OF1 A;  1PSE A;  4EIK A;  2HKN A;  2E12 A;  4J6X A;  2X51 A;  1ZHI A;  3LGF A;  3PNW C;  4GLM A;  5LL6 S;  4EMK B;  1QVF P;  4IUT A;  1RUW A;  4M4Z A;  5GAM h;  1Y57 A;  3I56 A;  1VQ6 A;  2LC4 A;  2E6N A;  1D0Z A;  3V7S A;  3CCV Q;  1VYU A;  2L3Q A;  1YI2 Q;  1VQL T;  3MET A;  4KBM B;  4HCZ A;  1Q86 R;  5AT1 B;  1WHK A;  2H3J A;  3U23 A;  2M9U A;  4KUL A;  1ZUY A;  2ROL A;  3G71 T;  1PKS A;  3WVD B;  4JUV A;  1I81 A;  4WCI A;  5J39 A;  1OOT A;  2DEU A;  1Y7X A;  4M7D F;  1YWO A;  1BI1 A;  2FEI A;  5EC7 A;  2LQ8 A;  3CBM A;  2G3R A;  3QO3 A;  3M59 A;  2EGC A;  3TRE A;  1MMA A;  2FPD A;  3OMC A;  4P5N A;  1UG1 A;  1RLQ C;  5LJ5 d;  3HRS A;  2QTX A;  2X4J A;  1YIJ A;  4M7D G;  1OU9 A;  1R0B G;  4BB7 A;  3QWY A;  3JCM Q;  1QVF S;  3RKX A;  2FPE A;  1NJI C;  3P8B B;  3NTH A;  3A5Z B;  4DOV A;  5M9O A;  2ED1 A;  3IQL A;  4A4F A;  3DB4 A;  2EYY A;  4DOW A;  5DLQ E;  1WQW A;  4C92 A;  1WJS A;  3CC7 A;  1BIB A;  3EGX B;  3QII A;  4PJN A;  4OMM A;  2VB6 A;  4XTW A;  1WPY A;  3VS5 A;  2RK2 A;  4EMK C;  4V2S A;  4C92 E;  3NHN A;  1QP3 A;  2ECZ A;  4J7F A;  4PKC C;  4PJO B;  1SF9 A;  3ZEH A;  3CXC P;  3TQ7 P;  2DYI A;  3OYG A;  1VQN Q;  2YLB A;  5LJ3 g;  5IXB A;  1AWX A;  1YJW Q;  1D1B A;  3PT9 A;  1Q82 U;  2D9T A;  1I07 A;  3EG9 A;  4AFQ C;  1QCO A;  2DL5 A;  4XU0 A;  4DBR A;  1GFD A;  5D6X A;  2DKG A;  3A1P A;  2OTJ T;  1U8R A;  2BZX A;  4C5H A;  1IHV A;  4A4E A;  4NL2 A;  4DBF A;  1NEB A;  4M77 A;  2VWF A;  2H8H A;  3G1J A;  1UJY A;  2P0P A;  2YHT A;  2GGR A;  2DE0 X;  4FW2 A;  1N8R U;  4HCC A;  1NYF A;  5CKB A;  1X01 A;  2L89 A;  5GMK e;  1M9S A;  5CIU A;  3VUB A;  3UT1 A;  1KIK A;  3H41 A;  3SDZ A;  4M77 E;  4AG2 C;  2YWW A;  1VA7 A;  5CKE A;  2P4R A;  2LJ3 A;  4RTV A;  4R55 A;  4B9W A;  2I2L A;  3CXC S;  1IRE B;  2R57 A;  4HVU A;  4BI4 A;  3J81 E;  1UJ0 A;  1UEB A;  3LW5 E;  3JCM J;  2EFI A;  2EPD A;  2D8H A;  3LWH A;  2COZ A;  2JT4 A;  3REA B;  1UTI A;  2ZAE A;  4JLI A;  2NYS A;  2RQR A;  3JCM P;  3QSU A;  3WXM B;  2XU8 A;  2DZ9 A;  4X34 A;  4PJO C;  1FWZ A;  1D3B A;  1X2K A;  3CMA T;  4MZP A;  1ZSZ B;  2RB6 A;  1G3Y A;  1VQK A;  3S6W A;  3E9F A;  1YBY A;  2A08 A;  2K3X A;  3M5A A;  5GMK m;  1B3Q A;  1B34 A;  2F5K A;  3L1A A;  2K2V A;  1M3B A;  2EQM A;  1Q82 R;  3J80 E;  4J9C A;  5HKC A;  3MEW A;  2O4X B;  1I8F A;  1RLP C;  1VQL Q;  3SWN B;  2BE9 B;  2O9V A;  1VQK T;  1M3C A;  2JS2 A;  3TEE A;  3I9Q A;  2KRM A;  2HL3 A;  1QVF A;  1WLP B;  3CPW P;  5GAM e;  3OA6 A;  4BAC A;  3MEU A;  1I5O B;  2NUT A;  1N8R R;  5LJ3 j;  3OYM A;  1M1K C;  2BIV A;  4M75 A;  2GQI A;  3CME Q;  4FT4 A;  3CCL T;  2DXT A;  1TUD A;  1V29 B;  2L2P A;  4C5E A;  2P4T A;  3JV3 A;  4BY6 B;  4PL6 A;  1H3Z A;  3CD6 A;  3OYI A;  3C4S A;  1WA7 A;  4HKE A;  2KSS A;  2RI3 A;  1UE9 A;  2PVO B;  3QKJ A;  4M75 E;  1YJ9 Q;  1N6A A;  5CKH A;  3X24 B;  4O6J A;  2QEX Q;  4LUE A;  2O2O A;  1Q81 U;  4OGE A;  1MMD A;  4M77 B;  4OMO A;  4N0A A;  2V26 A;  4A63 B;  2JUF A;  4QKU A;  1JXO A;  3QYH B;  1C6V X;  4C8Q F;  3VKI A;  2E6Z A;  3V8J A;  2LX9 A;  2MPX C;  2Z0W A;  3HRU A;  5I11 A;  3VRY A;  1ZSZ C;  4NOY A;  3VS1 A;  3CCS T;  2Y90 A;  4RTT A;  5A2Q E;  1YN8 A;  2LQN A;  4PFP A;  3G4S A;  2DZC A;  2YLC A;  1IHW A;  3A8H B;  3KUF A;  1WXU A;  3TCJ A;  3EG3 A;  4C92 C;  5GAO l;  5GAM d;  3QPH A;  3PIO A;  2A28 A;  3RMS A;  1XJW B;  2X4Y A;  3SWN C;  4RCC A;  5KE3 A;  1GBQ A;  1YFN A;  1VQ9 A;  5GAM f;  4LDX A;  3LX7 A;  2AZV A;  2WSC E;  1RAF B;  2OTJ Q;  3CCJ Q;  1SSF A;  1IRX A;  2QA4 A;  4ME7 A;  4VUB A;  5DLO A;  2YXY A;  3CXC A;  4XTY A;  4KT0 E;  5LJ5 h;  3UPU A;  2RJF A;  3I5S A;  1O75 A;  3H8Z A;  3JRZ A;  4LDY A;  3MO8 A;  3REB B;  2GNC A;  1YCY A;  1OQK A;  4KUI A;  4BY6 C;  2E5K A;  2JTF A;  5GAO q;  2KQW A;  1YJN T;  2RQU A;  2F1L A;  1Y71 A;  5ECA A;  2VKN A;  4X9C A;  3UWN A;  3OQ5 A;  2LDM A;  2R5A A;  2KT8 A;  1E6G A;  1PNJ A;  4M77 C;  1GCQ A;  4FSX A;  2FO0 A;  4GY5 A;  4FYY B;  4LUD A;  4HCK A;  4F16 A;  4EDU A;  3EG0 A;  1QLY A;  1YNZ A;  5GAN 3;  1YI2 A;  4PLI A;  3OSV A;  3BW1 A;  4M7A F;  1QWF A;  1MV0 B;  2F2W A;  1SG5 A;  1D1A A;  3FDR A;  2JS0 A;  3THK A;  3X26 B;  3L2U A;  4AT1 B;  5IXF A;  1U1S A;  4NL3 A;  3RR6 A;  2KGT A;  3M0T A;  1W1F A;  2LVM A;  3AT1 B;  1Q7Y U;  4KH1 B;  2JW4 A;  2JM8 A;  3CMA Q;  2AKK A;  3CCV T;  1QVP A;  5I22 A;  1C0M A;  1JRI A;  4M7A G;  2RJC A;  1NYG A;  2FYK A;  2LZ6 B;  1PWT A;  5GAM g;  3FC3 A;  3C94 A;  2COY A;  1LPL A;  1Q86 C;  3CC4 T;  2JOY A;  2RQW A;  3RDV A;  3QZ5 B;  5A0G A;  1UDL A;  2EGE A;  2M16 A;  1KHC A;  4JRQ A;  1M90 U;  4J5Y A;  2RF0 A;  4J8O A;  5GAO r;  3FIF A;  5KYN A;  4EMK A;  1QVG P;  3CCL Q;  4QVZ A;  3MKD A;  2L3P A;  2DRM A;  2JZ2 A;  1BI0 A;  2MMP A;  2NUZ A;  4PJO D;  1VQN A;  1GFC A;  2V8J A;  3CPW A;  4E7Z A;  5GAN 2;  2H3E B;  3R6O A;  4B9X A;  4Y91 A;  2HZY A;  2LJ0 A;  5GMK i;  2XDB A;  1OI1 A;  3JB9 J;  4CC4 B;  3CPF A;  2DXC A;  1K8A U;  2PVG B;  4M75 C;  1SHG A;  2W0Z A;  2E10 A;  4RTW A;  4DA4 A;  2CH4 A;  2ZPH B;  2JJ9 A;  3KXT A;  5A0D A;  2DVJ A;  1AZG B;  1X75 C;  1VQN T;  1GBR A;  3G7Z A;  5D7U A;  1P92 A;  1X69 A;  3CCU A;  2FL7 A;  4F17 A;  3CCS Q;  1QQJ A;  2EW3 A;  1YJW T;  3S3N A;  5HK0 A;  3GOX A;  1VQO Q;  1Q7Y R;  1EIF A;  2FRY A;  2J05 A;  3MEA A;  2HNI A;  5IT9 E;  1K4U S;  1NE8 A;  5KE2 A;  2GQV A;  4C0G A;  4N0A C;  2O01 E;  5HK3 A;  1I4K 1;  1QVG S;  1UGQ B;  1G5V A;  3JCM h;  1BIA A;  1M8V A;  1K1Z A;  2LP5 A;  2DTO A;  5KYX B;  1EFN A;  4M78 A;  4ATO A;  2AKL A;  2CKK A;  2BUD A;  1VIE A;  1IGQ A;  3QHS A;  3QZ9 B;  1JQQ A;  1WJQ A;  3EGX A;  2GTO A;  3X25 B;  1KSW A;  2D8J A;  2V8K A;  2CRE A;  5CQX A;  3MP8 A;  4M78 E;  1AT1 B;  2KK4 A;  2L5Q A;  3QUI A;  1I5L A;  1GRI A;  1SRM A;  2DA9 A;  2RJE A;  4PJO A;  3MCA B;  2PVD B;  4QW2 A;  3PIP A;  3H0H A;  1VQ8 T;  1K73 U;  2DNU A;  2DRK A;  3RMQ A;  3OBW A;  2DIG A;  4LDW A;  2HBP A;  2GFA A;  1R8O B;  4HA8 A;  5LJ5 e;  1MHN A;  2DBM A;  3NTK A;  3PE0 A;  4PJO E;  2DF6 A;  3CC2 Q;  3M54 A;  3VS6 A;  3RKY A;  4OVA A;  3ASK A;  1YCS B;  4C8Q B;  4II1 A;  2ZPB B;  2F69 A;  1WI7 A;  1TH7 A;  2DJQ A;  2SRC A;  2FZK B;  2VGM A;  1VQ5 T;  4DEX A;  1M4Z A;  1K8A R;  3CCM T;  1VQL A;  4C92 D;  4RUG A;  2FRW A;  4LD9 K;  3A8O B;  1LCK A;  3VS7 A;  3G71 A;  2ZPI B;  1V1C A;  5FRO A;  2BE7 D;  2KNB B;  4RTU A;  2LT1 A;  3OY9 A;  3OYH A;  1VQP T;  1GCQ C;  5GAN h;  3CCE Q;  2PTK A;  2RI2 A;  2XDD A;  5KYY B;  1ZUK A;  2DM1 A;  2JVV A;  4PJJ A;  2DPP B;  4OMN A;  2KAF A;  3FJ5 A;  2KYB A;  1S72 Q;  3H6Z A;  1Q82 C;  2DTI A;  1JU5 C;  1XTD A;  2X4W A;  2L0A A;  3S3M A;  2M0Y A;  3O8V A;  4JJC A;  4JRK A;  4OB0 B;  3VYH B;  3CC4 Q;  2WAC A;  1YJ9 A;  3FLG A;  2ZGW A;  3E9G A;  4JZ4 A;  1BBZ A;  3CME T;  4DBH A;  4MML A;  5GAO p;  3CCR T;  2QQA A;  4BE0 A;  1MV3 A;  4M77 D;  1FMV A;  1N8R C;  3EG1 A;  2CP5 A;  1ZSZ A;  1M2O A;  3GLX A;  2ZPF B;  1U5S A;  5LJ5 f;  2W10 A;  1YJ9 T;  2QEX T;  1KQ2 A;  1K73 R;  2HCK A;  1N27 A;  4K11 A;  4M78 B;  1JO8 A;  2YSQ A;  2CP3 A;  4C8Q C;  5CR2 A;  4BI8 B;  2O4X A;  3DLL A;  1YIT Q;  3SWN A;  5D6Y A;  5KCH A;  2EQJ A;  2CZ1 B;  7AT1 B;  2ESW A;  2MYS A;  1ACM B;  1QVG A;  2V1Q A;  5DY9 A;  1SPK A;  5FRN A;  3GIB A;  1H3H A;  4HT8 A;  3UAT A;  2OTJ A;  3OYN A;  4IUU A;  2X35 A;  4PJM A;  3MHX A;  4FYV B;  5FU6 B;  2ZPE B;  4AMC A;  4LDU A;  3F70 A;  1ZLM A;  2DER A;  2V8I A;  4FT2 A;  3EHR A;  5CO7 A;  3SHW A;  3M57 A;  2J06 A;  3CCJ T;  4BI3 A;  3PGG A;  4D6W A;  2HKQ B;  2MK5 A;  2ROT A;  1X27 A;  3OSS C;  2AIR B;  2MI6 A;  4LN2 A;  3N5B B;  2CYZ B;  1RL2 A;  3OYE A;  1OU8 A;  3M9Q A;  2DTH A;  4EMH A;  2K7A A;  5I2S A;  4KUD K;  1VUB A;  2EVR A;  3FRN A;  4A53 A;  1DJ7 B;  1WGS A;  3OYD A;  5EG2 A;  5GJV B;  2XK0 A;  5LJ5 g;  1JB0 E;  1JJ2 P;  1IZ6 A;  1TS9 A;  2C06 A;  4M78 C;  4M75 D;  4CRI A;  3SEM A;  2EJF A;  1VQ8 Q;  3CMA A;  1SSH A;  2KY9 A;  2DX1 A;  3WVE B;  2M1H A;  1VYV A;  3PVQ A;  4E7I A;  3I55 Q;  2LRQ A;  3ER0 A;  3EGD B;  3EFR A;  4M7D A;  3GBQ A;  2GF7 A;  2HBW A;  2ZCF B;  4FL6 A;  1D0X A;  4J6W A;  2HQH A;  4MZM A;  1VQ5 Q;  1UHF A;  3UA6 A;  3E1S A;  3CCM Q;  2MCN A;  1JXM A;  2D0Q B;  1AWJ A;  4M7D E;  1ZBJ A;  3OS0 A;  3CQT A;  3V7C A;  1N9S A;  3CBO A;  3M0U A;  1VOM A;  2K79 A;  1PD1 A;  1JJ2 S;  1KC8 U;  4IIM A;  4FCY A;  1VQP Q;  2HSP A;  1A0N B;  2DEQ A;  2E41 A;  4PJL A;  3CCL A;  1OV3 A;  3HPW A;  1U06 A;  3JCM d;  1PG5 B;  2EJ9 A;  4FSS A;  2NUP B;  2K9G A;  2L8D A;  5CAI A;  1TSF A;  3JCM f;  2EYZ A;  2YT6 A;  3LGL A;  4JJN K;  3PMT A;  5CCA A;  2D6F A;  2MF2 A;  4OGC A;  2CGH A;  2F2X A;  1CSK A;  4F7U F;  1U1T A;  3CEY A;  4XU2 A;  1QCF A;  3CCR Q;  1JBM A;  2XD0 A;  3UDC A;  1KFZ A;  2YRV A;  1Y96 B;  2RA2 A;  1GCP A;  4ORZ A;  2MOX A;  3RKW A;  4ELZ C;  2CDT A;  2ED0 A;  1VQ4 T;  1UGP B;  1TUC A;  3CCS A;  4F7U G;  5A0L A;  1RAA B;  4R0K A;  2K2M A;  1UFF A;  4FYX B;  1YHQ T;  1FMW A;  4ZNX A;  1AZE A;  2VAS A;  3CCQ Q;  1TG0 A;  1D09 B;  2KR3 A;  1Y07 A;  3VUZ A;  3ZL7 C;  4CC7 A;  1WYX A;  2DMO A;  2J6O A;  5LJ5 j;  4R56 A;  2E5Q A;  2P84 A;  2EGA A;  2CUD A;  2HSE B;  2QI2 A;  1VQO T;  2K3Y A;  3M55 A;  2K5L A;  2EBP A;  4FM4 B;  1G3S A;  3OYJ A;  1BCM A;  5IN1 A;  1PC0 A;  1UB4 A;  1Q7Y C;  1M1F A;  1B7T A;  3O5Z A;  5LJ3 h;  3Q1J A;  1OPK A;  4LNP A;  5GAN d;  1KC8 R;  2VGN A;  4M7D B;  2KXC A;  2R5M A;  3HTR A;  1YJN A;  1SEM A;  1IO6 A;  2QTV A;  5GAN f;  3M58 A;  3CC7 Q;  2EYW A;  4RTY A;  1QP2 A;  3QDF A;  2KRS A;  1TOV A;  1K9M U;  1PKT A;  3C95 A;  1E6H A;  1D0Y A;  4JRI A;  1ABQ A;  2AHJ B;  5KH6 A;  2PUK B;  1FYN A;  4C0F A;  4E6R A;  1BYM A;  3L2W A;  2DBK A;  2QQR A;  2JTE A;  2KRO A;  3VYG A;  2QAZ A;  4RG8 A;  4A4K A;  1M30 A;  1WXT A;  2K5F A;  1M3A A;  2LCL A;  3HL8 A;  3CC2 T;  2EAY A;  4EPC A;  2KE9 A;  3JB9 I;  4J9D A;  3GP8 A;  1M2V B;  1OX8 A;  3M53 A;  3AHU A;  1KD1 U;  1H92 A;  4QT7 A;  4JS5 A;  3BDL A;  4DEY A;  1VIF A;  2EQU A;  3CCV A;  1Q81 R;  5KYX A;  5AYF A;  2XI9 A;  1F1B B;  1K76 A;  1S1N A;  1ZUU A;  2A37 A;  3C0C A;  2Y4Y A;  5C6S A;  1JJ2 A;  3PMI A;  1ZX6 A;  1K8A C;  3X28 B;  1T3S A;  3JCM V;  3CC4 A;  3BE3 A;  3CCE T;  4KGZ B;  5FRM A;  4J9F A;  3LWI A;  2G6F X;  3M0P A;  2GTJ A;  1RAE B;  4Z8A A;  1Y0M A;  1YP5 A;  1U3O A;  1S72 T;  2MIO A;  4M7D C;  1UUE A;  4JDS A;  1JEG A;  1K0S A;  1W6X A;  2J7I A;  1WDX A;  1E7O A;  2VXE A;  4PJO F;  1M27 C;  1UGS B;  3TVT A;  1K9A A;  1RI0 A;  5I21 A;  4C8Q A;  3HSB A;  2QQ9 A;  2O9S A;  1WXB A;  4M78 D;  5CQY A;  4AG1 C;  4L59 A;  1YIT A;  4ESR A;  1K9M R;  2QXF A;  3M4G A;  4PJO G;  5GMK l;  3G6E Q;  5FU7 B;  4BD3 A;  1IGU A;  4ZN3 A;  5KYW B;  4C8Q E;  5GMK j;  2F2V A;  3KBG A;  4KGX B;  1H64 1;  1IB8 A;  1AWW A;  2NLU A;  5KYY A;  4F04 B;  1YIT T;  4KH0 B;  1RAC B;  2P0K A;  2DYB A;  3EHQ A;  3NMZ C;  1VQ4 Q;  1K73 C;  1WQ7 A;  2VUB A;  1YJW A;  1KD1 R;  2R58 A;  2KYM A;  2DD5 A;  2IIM A;  1YHQ Q;  2HMA A;  4AFS C;  1K0X A;  2D1X A;  1RAB B;  1G2B A;  4XTZ A;  3H9N A;  1HYO A;  1G83 A;  4C0Z A;  2X3W D;  5L8R E;  3OS2 A;  1UEC A;  2OTL Q;  1KK7 A;  4OB1 B;  1MND A;  1BK2 A;  3MP1 A;  4PNO A;  1XOV A;  4HVV A;  4ZN1 A;  1NPP A;  1OYX A;  3JCM W;  2IPO B;  2M51 A;  1W70 A;  3FJP A;  2DXB A;  1IXD A;  4JJB A;  3VS0 A;  4HXJ A;  4MDX A;  3CD6 Q;  3L2R A;  4JLG A;  1MUZ A;  3OYL A;  2K3B A;  4KRT A;  4IIO A;  2RN8 A;  4ZGE B;  4OB3 B;  1VQ7 Q;  1MNE A;  4Y92 A;  1VQ8 A;  4JJD A;  2RPN A;  1W2B P;  3V8L A;  1ZSG A;  4L6V 5;  4XQ3 A;  4F7U B;  3S3O A;  4ZTJ A;  3I55 A;  1YWP A;  4C92 F;  5FU7 C;  1M90 R;  4N4H A;  5GAM j;  5IAY A;  1R0C B;  1VQ5 A;  3G4S Q;  2J6K A;  3M0S A;  1MMN A;  2CP7 A;  2ENM A;  2A0F B;  3CCM A;  2LTO A;  3DKM A;  1X6G A;  4QVC A;  4C92 G;  3I55 T;  2HAX A;  2PZ1 A;  4RCB A;  1NEG A;  2CH4 W;  2X3X D;  2A36 A;  3MPU B;  2YUN A;  1VQP A;  2E1H A;  1C1A A;  2YRD A;  2KMT A;  2QA4 Q;  1W2B S;  3NTI A;  1RAG B;  2IVW A;  3LH0 A;  2AT1 B;  3ME9 A;  1I0C A;  2C0O A;  2YUQ A;  4B6M A;  3RES A;  4M77 F;  3VS3 A;  2KBT A;  4OP0 A;  8AT1 B;  1ZQ1 A;  4FIB A;  2JTM A;  4GLK A;  1OEB A;  3JB9 F;  5FWC A;  4BDY A;  2CZ6 B;  2E64 A;  2OI3 A;  3CME A;  2GCX A;  2BTT A;  2CSQ A;  5CKD A;  1NLP C;  3EFS A;  3CCR A;  3A8G B;  3M0Q A;  2K57 A;  4ANJ A;  1X43 A;  1EZZ B;  3PVL A;  3T9N A;  4C0D B;  5I2M A;  4J9I A;  3C12 A;  4M77 G;  5LJ3 d;  1AWO A;  3GF5 A;  2CZ7 B;  1QCN A;  1G8X A;  3JB9 G;  4E7H A;  2V1R A;  5LJ3 f;  2EIF A;  1TU0 B;  2K4Y A;  3EGD A;  3QBY A;  4LE9 A;  2E3I A;  2QEX A;  1X2Q A;  1ZBX A;  2LCC A;  3E2U A;  3INZ A;  2O88 A;  1WHM A;  1CKB A;  1WHJ A;  1KG1 A;  1BKB A;  3CCQ A;  2QG9 B;  1G3T A;  3CBP A;  3JB9 D;  3I56 T;  1VQ6 T;  2CZ0 B;  2HQE A;  2DO3 A;  2EQI A;  2XHC A;  3EH2 A;  2RMO A;  1QW1 A;  3QG1 A;  3R6N A;  4JS4 A;  4EMG A;  3SFM A;  4E7L A;  3QXE B;  5D6W A;  3EFO A;  2ZZD A;  3P8H A;  3CCQ T;  3RBB B;  8ATC B;  1SRL A;  2QAS A;  4M7A B;  4LD6 A;  2NWM A;  5FW9 A;  2NUP A;  3OB9 A;  3L42 A;  2ABL A;  3OS1 A;  2QDY B;  1KQS P;  1D1C A;  2EYX A;  2O31 A;  5KYU A;  3SD4 A;  3NGP A;  2LT4 A;  5GAO m;  2HEQ A;  3I35 A;  1V76 A;  4M7D D;  3CCJ A;  1PCX A;  5HY6 A;  4PFZ A;  4CC2 A;  1YIJ T;  2KT1 A;  3H0I A;  3JAM E;  1AD5 A;  2VV5 A;  4J7I A;  4QQ6 A;  3HFN A;  1LNX A;  2LCS A;  2QQB A;  1Y96 A;  2RJD A;  2VVK A;  1Z9Z A;  1N9R A;  4C0D C;  4M75 F;  5J26 A;  1PD0 A;  2QGG A;  3CC7 T;  4DBQ A;  2A7Y A;  1KC8 C;  6AT1 B;  2KXD A;  3JCM b;  3A8L B;  4IUR A;  4ZGJ B;  4OMP A;  2FZC B;  1N5Z A;  3OYF A;  4E7J A;  5CK9 A;  3RNJ A;  2OAU A;  3RIR A;  4M75 G;  2DD4 A;  4HCB A;  1KQS S;  4X9D A;  2QQS A;  3VV0 A;  3QDR B;  1AOJ A;  1UGV A;  2B8A A;  4RTZ A;  4Z89 A;  3JCM e;  3L2Z A;  2RHY A;  4IUV A;  1VQM Q;  4C5I A;  3QYG B;  3CCU Q;  1HJD A;  3OYY A;  1NBE B;  1SHF A;  4JPB W;  1SKU B;  2XIC A;  4TVR A;  2EWN A;  3A8M B;  1NJI U;  2E65 A;  2PUO B;  1W2B A;  2P0Q A;  4M7A C;  4A4H A;  1TTH B;  2CUB A;  5GJW B;  3M4Y A;  4Z88 A;  1BI2 A;  5GAN 7;  3DB3 A;  1Q81 C;  3LH5 A;  4XTV A;  5IHN A;  3MP6 A;  3HRT A;  2FZG B;  5FU6 C;  4AFU C;  1XNI A;  3MJX A;  2KDS A;  3P8D A;  2B86 A;  2FPF A;  2JXB A;  2J6F A;  4DQ2 A;  2K6D A;  3EFO B;  1HXD A;  1KHI A;  2RHZ A;  3G6E A;  2YUO A;  4LDV A;  1HSQ A;  1M2V A;  3JB9 H;  1M8M A;  4O5V A;  2E70 A;  1UHC A;  1X6B A;  3HKS A;  3HP9 A;  1T0H A;  5KYU B;  4QQG A;  2E3H A;  1VQ4 A;  2LNH B;  2F5T X;  3VS2 A;  2C0T A;  4C92 B;  1RAH B;  1XQH A;  2SEM A;  3VU3 C;  5IH2 A;  3G6E T;  5GAN e;  3QWX X;  1OUL A;  2JM9 A;  2DAQ A;  3RUX A;  2K5I A;  1OX9 A;  1YHQ A;  5CKF A;  3URG A;  3TSZ A;  1K9M C;  3QJ6 A;  3G71 Q;  3LLR A;  3D7S B;  2HL5 C;  2PU9 B;  3I56 Q;  2AZS A;  1VQ6 Q;  2L3S A;  2OTL A;  4MDW A;  1VYT A;  2BZ8 A;  2HD0 A;  2D0N A;  3OYC A;  2CP0 A;  1VQO A;  2X9H A;  2JN0 A;  1NG2 A;  4Z02 A;  2JMC A;  3V7R A;  1NJI R;  1BB9 A;  1KJW A;  4ELY C;  3EG2 A;  1R77 A;  2ATC B;  3EG9 B;  4GBQ A;  1QMC A;  2IG0 A;  1KD1 C;  2A3L A;  2QDL A;  1AHJ B;  2OTL T;  2FB7 A;  3TSW A;  3OW2 P;  4Y28 E;  3OYK A;  3OMG A;  4WF2 A;  2EJG A;  1O9S A;  2LMJ A;  2YRC A;  1AEY A;  1VQ7 A;  4PK4 A;  1FX7 A;  2QK0 A;  1PRM C;  4BDZ A;  3NPF A;  3CD6 T;  4C5G A;  3EH1 A;  1BCO A;  1YIJ Q;  4JRP A;  3BY7 A;  5KYW A;  2DLP A;  3KFV A;  4RG2 A;  2OJ2 A;  1NZ9 A;  3CPW S;  2YDL A;  5FLX E;  1MGQ A;  1KQS A;  1VQ7 T;  2DIL A;  2XDP A;  2JNG A;  2LX7 A;  4XU3 A;  2RHU A;  4J9B A;  3JCM g;  1CKA A;  4C8Q G;  1WJR A;  4FW1 A;  3I5R A;  4E47 A;  4OML A;  1LOJ A;  5HCK A;  3DLM A;  1PHT A;  1WNL A;  5IHI A;  3JCM X;  3VJP A;  1TWB A;  2FVU A;  2WSE E;  3E19 A;  3VRZ A;  3CC2 A;  2VXF A;  2CP6 A;  3TU4 K;  2DL4 A;  2VYT A;  1RAI B;  2BKD N;  4XU1 A;  3OW2 S;  4IKF A;  1GXI E;  2WSF E;  1HD3 A;  3M56 A;  3G4S T;  2RNA A;  4C8Q D;  4AFZ C;  1M90 C;  2KEA A;  1M1K U;  1T0J A;  2QYZ A;  1D3B B;  2XID A;  5L23 A;  4BE2 A;  3OS5 A;  1T3L A;  2LQK A; 
#chains in the Genus database with same CATH homology
 5LJ5 f;  4IUP A;  1VQ9 T;  4MDX A;  3S6W A;  1YJ9 T;  3PFS A;  3E9F A;  3QJY A;  1M1G A;  2M0O A;  3L2R A;  4JLG A;  2QEX T;  3CCE A;  1KQ2 A;  1YBY A;  2K3X A;  3M5A A;  4BUG A;  5GMK m;  1NPR A;  5GAN 5;  1N27 A;  3OYL A;  1B34 B;  1B34 A;  2F5K A;  3L1A A;  4M78 B;  2QA4 T;  2VC8 A;  2K2V A;  2EQM A;  4ZGE B;  4YTL A;  4C8Q C;  4QQD A;  5CR2 A;  4OB3 B;  3J80 E;  5HKC A;  3MEW A;  2O4X B;  1I8F A;  2MWP A;  2O4X A;  4BI8 B;  3DLL A;  1VQ8 A;  1S72 A;  2KVQ G;  3SWN B;  3SWN A;  5D6Y A;  1VQK T;  3V8L A;  3BDU A;  5KCH A;  2EQJ A;  5GAN 4;  4L6V 5;  4XQ3 A;  4F7U B;  4F7U A;  4M78 F;  3TEE A;  2CZ1 B;  3S3O A;  4ZTJ A;  3I55 A;  4C92 F;  5FU7 C;  1QVF A;  1QVG A;  4XK8 E;  5DY9 A;  5FRN A;  1BI3 A;  3GIB A;  5GAM e;  3GNF B;  4N4H A;  3OA6 A;  3MEV A;  4BAC A;  3MEU A;  4HT8 A;  2OTJ A;  3SB2 A;  3OYN A;  4IUU A;  2X35 A;  5GAM j;  5IAY A;  2DIQ A;  5LJ3 j;  3OYM A;  1M1K C;  3MHX A;  5FU6 B;  2BIV A;  4PLL A;  4M75 B;  4M75 A;  2ZPE B;  1VQ5 A;  4FT4 A;  4LDU A;  4L5G A;  2DXT A;  4F7U E;  3CCL T;  1X6O A;  3F70 A;  1V29 B;  4IUQ A;  4XAX B;  2LTO A;  4M78 G;  4C5E A;  2P4T A;  3DKM A;  3CCM A;  4BY6 B;  2V8I A;  5GAN g;  4QVC A;  4PL6 A;  4FT2 A;  3HFO A;  4C92 G;  1H3Z A;  3CD6 A;  3I55 T;  2HAX A;  1OZ2 A;  5CO7 A;  4RCB A;  4XTX A;  1YI2 T;  2RHI A;  3M57 A;  3OYI A;  3C4S A;  4HKE A;  2KSS A;  2RI3 A;  2PVO B;  1PSF A;  2EKO A;  3QKJ A;  2RHX A;  4M75 E;  4MZT A;  5CVI A;  4BI3 A;  3PGG A;  1N6A A;  4D6W A;  4ZGD B;  5CKH A;  3X24 B;  3OSS C;  1VQP A;  4O6J A;  2MI6 A;  2E1H A;  1Q81 U;  3N5B B;  2CYZ B;  4OGE A;  4M77 B;  1RL2 A;  4Q5W A;  4N0A A;  3OYE A;  3M9Q A;  2DTH A;  4EMH A;  2KMT A;  5I2S A;  2RD1 A;  4KUD K;  2JUF A;  3FB9 A;  1W2B S;  3NTI A;  1VUB A;  3GNG A;  3QYH B;  3FRN A;  3X20 B;  4C8Q F;  2IVW A;  3LH0 A;  3VKI A;  4M7A D;  2E6Z A;  4A53 A;  3ME9 A;  2LNV A;  1DJ7 B;  2LX9 A;  3V8J A;  3HRU A;  1WGS A;  3RES A;  4M77 F;  4NOY A;  5EG2 A;  3OYD A;  2HQX A;  4OP0 A;  3CCS T;  1ZQ1 A;  2Y90 A;  2XK0 A;  4FIB A;  2JTM A;  4GLK A;  4J83 A;  5LJ5 g;  1JB0 E;  5A2Q E;  3JB9 F;  3OBY A;  3GPL A;  4BDY A;  2CZ6 B;  2E64 A;  4CI0 C;  3G4S A;  2DZC A;  2GCX A;  3CME A;  5CKD A;  1IZ6 A;  2C06 A;  2YLC A;  3EFS A;  3CCR A;  3LYI A;  3A8H B;  4M78 C;  3A8G B;  2Y4X A;  4M75 D;  4CRI A;  3KUF A;  2RI5 A;  2K57 A;  3TCJ A;  4A54 A;  4C92 C;  2X4X A;  4XTU A;  2EJF A;  5GAO l;  3CMA A;  3T9N A;  4C0D B;  5I2M A;  4M77 G;  3C12 A;  3QPH A;  5LJ3 d;  5GAM d;  3PIO A;  2KY9 A;  3RMS A;  3SWN C;  2X4Y A;  3WVE B;  2M1H A;  3GF5 A;  4RCC A;  2CZ7 B;  3JB9 G;  1FXX A;  4E7H A;  5KE3 A;  4E7I A;  1VQ9 A;  5GAM f;  4LDX A;  4FU6 A;  2LRQ A;  2EQK A;  5LJ3 f;  3ER0 A;  3RER A;  2EIF A;  2K4Y A;  3EFR A;  3LX7 A;  4M7D A;  3QBY A;  2WSC E;  2QEX A;  1ZBX A;  2GF7 A;  2LCC A;  5GAN 8;  2ZCF B;  4FL6 A;  4J6W A;  4RKU E;  3INZ A;  1SSF A;  3V8K A;  2QA4 A;  4ME7 A;  3JCM c;  4MZM A;  1KG1 A;  4VUB A;  4QVD A;  1KQ1 A;  3HHT B;  5DLO A;  1BKB A;  4XTY A;  3CXC A;  4NS5 A;  3CCQ A;  1G3T A;  4KT0 E;  4A4G A;  5LJ5 h;  3UPU A;  3E1S A;  3CCJ T;  2DXU A;  3CBP A;  5GAN 6;  2RJF A;  3JB9 D;  4MMK A;  4HT9 A;  3I56 T;  1VQ6 T;  2CZ0 B;  1O75 A;  2DO3 A;  2HQE A;  3H8Z A;  3JRZ A;  2D0Q B;  2XHC A;  3MO8 A;  4LDY A;  4M7D E;  3OS0 A;  1YCY A;  1QW1 A;  2RH2 A;  4KUI A;  4UC4 A;  1N9S A;  3FJP A;  3V7C A;  3QG1 A;  4BY6 C;  3OYB A;  2JTF A;  3CBO A;  4N4G A;  5GAO q;  2KQW A;  3JSC A;  1YJN T;  2CS7 A;  4JS4 A;  1HK9 A;  3SFM A;  4EMG A;  2MAM A;  1Y71 A;  4E7L A;  1VQM A;  3QXE B;  2PQW A;  1JJ2 S;  4X9C A;  5D6W A;  3FEO A;  1KC8 U;  3UWN A;  3OW2 A;  2ZZD A;  5GMK h;  3OQ5 A;  3P8H A;  3CCQ T;  2LDM A;  2R5A A;  2DEQ A;  2E41 A;  1Q86 U;  4M77 C;  3CCL A;  2RM4 A;  3HPW A;  4M7A B;  3J7A F;  4E7K A;  4M7A A;  3ZBD A;  3JCM d;  1UGR B;  2EJ9 A;  4LD6 A;  2EYQ A;  4FSX A;  4GY5 A;  2XKO C;  3OB9 A;  2L8D A;  5CAI A;  3L42 A;  3OS1 A;  4EDU A;  2QDY B;  3JCM f;  2GFU A;  3LGL A;  5GAN 3;  4JJN K;  1VQM T;  3PMT A;  3SD4 A;  5CCA A;  1YI2 A;  2MF2 A;  4OGC A;  2D6F A;  3CCU T;  2LT4 A;  5LJ3 e;  2CGH A;  4OMF B;  4ZTF A;  4PLI A;  5GAO m;  3OSV A;  3BW1 A;  4M7D D;  4M7A F;  3CCJ A;  2MWO A;  4OB2 B;  5HY6 A;  2RK1 A;  4F7U F;  1YIJ T;  3FDR A;  4M7A E;  3JAM E;  1U1T A;  2DJZ A;  3CEY A;  2VV5 A;  4QQ6 A;  4J7I A;  4XU2 A;  2ZPG B;  3X26 B;  1M5Q 1;  3HFN A;  5GAN j;  1LNX A;  3L2U A;  2DVE A;  1U1S A;  4NL3 A;  1JBM A;  4RMO A;  3UDC A;  3L2Q A;  2XD0 A;  2QQB A;  2LVM A;  2YRV A;  1W4S A;  5KCO A;  1Y96 B;  1Y96 A;  3L2V A;  2RA2 A;  1Q7Y U;  2RJD A;  3EAE A;  5C0M A;  1G3W A;  3CCV T;  1QVP A;  3RKW A;  3PTA A;  4ELZ C;  1N9R A;  4C0D C;  4M75 F;  5J26 A;  1VQ4 T;  1JRI A;  4M7A G;  2RJC A;  1UGP B;  4J6Y A;  2FYK A;  4F7U G;  3CCS A;  5GAO n;  5A0L A;  3OYA A;  3CC7 T;  2A7Y A;  1KC8 C;  5DM7 R;  5J3B A;  5GAM g;  3FC3 A;  4BE1 A;  2RO0 A;  3JCM b;  2FHD A;  3A8L B;  4IUR A;  1YHQ T;  3C94 A;  4ZGJ B;  3BFM A;  1Q86 C;  3CC4 T;  3OYF A;  2JOY A;  4E7J A;  3QZ5 B;  4N4I A;  5CK9 A;  1Y07 A;  3VUZ A;  2OAU A;  3RIR A;  4M75 G;  3ZFJ A;  5A0G A;  1LJO A;  1OZ3 A;  1G5V A;  2DD4 A;  2XG8 D;  2DK3 A;  4HCB A;  1KQS S;  3NFC A;  5LJ5 j;  4X9D A;  2QQS A;  3VV0 A;  2M16 A;  3QDR B;  1KHC A;  4R56 A;  2B8A A;  2L3R A;  2E5Q A;  1PSE A;  4OF1 A;  3JCM e;  4JRQ A;  1M90 U;  2QI2 A;  3L2Z A;  4J5Y A;  1VQO T;  2K3Y A;  2E12 A;  4J6X A;  2RHY A;  4IUV A;  4J8O A;  3M55 A;  4C5I A;  3QYG B;  2K5L A;  5GAO r;  1ZHI A;  3OYY A;  3FIF A;  4FM4 B;  1G3S A;  3OYJ A;  3LGF A;  3PNW C;  5IN1 A;  5LL6 S;  4EMK B;  4EMK A;  4TVR A;  1UB4 A;  2XIC A;  1M1F A;  2EWN A;  4IUT A;  3A8M B;  1Q7Y C;  1NJI U;  5GAM h;  2E65 A;  2PUO B;  4QVZ A;  5LJ3 h;  2P0Q A;  3Q1J A;  1W2B A;  3I56 A;  1VQ6 A;  2LC4 A;  2E6N A;  4M7A C;  2JZ2 A;  5GAN d;  2VGN A;  4A4H A;  1BI0 A;  3M4Y A;  2MMP A;  3V7S A;  4M7D B;  2R5M A;  1YJN A;  1VQN A;  4PJO D;  1VQL T;  1BI2 A;  3MET A;  3DB3 A;  5GAN f;  2V8J A;  4KBM B;  3M58 A;  5GAN 7;  4HCZ A;  4B9X A;  3R6O A;  5GAN 2;  3CPW A;  1Q81 C;  4Y91 A;  2H3J A;  5GMK i;  2M9U A;  4KUL A;  1QP2 A;  1OI1 A;  4XTV A;  3JB9 J;  2XDB A;  3G71 T;  3MP6 A;  3WVD B;  3CPF A;  2DXC A;  4JUV A;  1K8A U;  1I81 A;  3HRT A;  5J39 A;  5FU6 C;  2PVG B;  4M75 C;  1Y7X A;  1K9M U;  2E10 A;  4M7D F;  3C95 A;  1BI1 A;  1XNI A;  4DA4 A;  4JRI A;  2LQ8 A;  2KDS A;  2ZPH B;  3CBM A;  3KXT A;  2G3R A;  3P8D A;  3QO3 A;  5A0D A;  2AHJ B;  1VQK A;  3M59 A;  5KH6 A;  3TRE A;  1X75 C;  2PUK B;  1VQN T;  3G7Z A;  4C0F A;  1BYM A;  3OMC A;  1P92 A;  4DQ2 A;  4P5N A;  2FL7 A;  3L2W A;  3CCU A;  1YJW T;  1HXD A;  5HK0 A;  5LJ5 d;  2QQR A;  3GOX A;  3S3N A;  3HRS A;  3JCM Q;  1EIF A;  1KHI A;  2RHZ A;  3G6E A;  2QTX A;  2X4J A;  3MEA A;  1YIJ A;  3VYG A;  4M7D G;  2HNI A;  5IT9 E;  1NE8 A;  4RG8 A;  4A4K A;  2GQV A;  4BB7 A;  5KE2 A;  2K5F A;  3HL8 A;  4LDV A;  2LCL A;  4C0G A;  3CC2 T;  2EAY A;  2O01 E;  4N0A C;  1I4K 1;  4EPC A;  3RKX A;  1UGQ B;  5HK3 A;  3JB9 I;  3GP8 A;  3P8B B;  1QVG S;  3JCM h;  1NJI C;  3M53 A;  1BIA A;  3JB9 H;  3AHU A;  1KD1 U;  1M8V A;  3NTH A;  4JS5 A;  3A5Z B;  4O5V A;  3BDL A;  4DOV A;  5M9O A;  1VIF A;  2EQU A;  2DTO A;  2E70 A;  3CCV A;  3HKS A;  4A4F A;  3HP9 A;  5AYF A;  2XI9 A;  4M78 A;  3DB4 A;  4QQG A;  1VQ4 A;  4DOW A;  2F5T X;  5DLQ E;  4ATO A;  2CKK A;  2BUD A;  1WQW A;  4C92 B;  1WJS A;  1XQH A;  3VU3 C;  1BIB A;  4C92 A;  3CC7 A;  3G6E T;  2Y4Y A;  1VIE A;  5GAN e;  5C6S A;  1JJ2 A;  3PMI A;  3QHS A;  3QZ9 B;  1WJQ A;  2DAQ A;  3RUX A;  2K5I A;  3QII A;  3X25 B;  1YHQ A;  1K8A C;  5CKF A;  3URG A;  3X28 B;  2V8K A;  5CQX A;  1K9M C;  4XTW A;  1WPY A;  3MP8 A;  3QJ6 A;  3JCM V;  3CC4 A;  3LLR A;  4M78 E;  3CCE T;  5FRM A;  2KK4 A;  2L5Q A;  2PU9 B;  2RK2 A;  4EMK C;  4V2S A;  3QUI A;  4C92 E;  3LWI A;  1I5L A;  1QP3 A;  2RJE A;  2OTL A;  4MDW A;  4PKC C;  4J7F A;  4PJO B;  4PJO A;  3MCA B;  2PVD B;  4QW2 A;  3ZEH A;  3PIP A;  2HD0 A;  3OYC A;  1VQO A;  3OYG A;  1S72 T;  1K73 U;  2JN0 A;  1VQ8 T;  2YLB A;  4Z02 A;  5LJ3 g;  4M7D C;  3V7R A;  4JDS A;  3RMQ A;  3OBW A;  2DIG A;  4ELY C;  3PT9 A;  1Q82 U;  2VXE A;  4LDW A;  4PJO F;  2D9T A;  1UGS B;  2HBP A;  2GFA A;  1R8O B;  4HA8 A;  4XU0 A;  1MHN A;  3NTK A;  2IG0 A;  5LJ5 e;  2A3L A;  1KD1 C;  4PJO E;  3M54 A;  5D6X A;  2DKG A;  1QVF S;  1AHJ B;  3RKY A;  2OTL T;  2OTJ T;  2FB7 A;  4OVA A;  1RI0 A;  5I21 A;  3ASK A;  4Y28 E;  4C8Q B;  4C5H A;  4C8Q A;  1U8R A;  3HSB A;  4II1 A;  3OYK A;  3OMG A;  2F69 A;  2EJG A;  1O9S A;  1TH7 A;  2QQ9 A;  2VGM A;  2ZPB B;  4WF2 A;  4A4E A;  4M78 D;  4NL2 A;  5CQY A;  1VQ5 T;  1VQ7 A;  4M77 A;  1M4Z A;  4L59 A;  3CCM T;  1YIT A;  1VQL A;  4C92 D;  2P0P A;  2YHT A;  2QXF A;  1FX7 A;  3M4G A;  4LD9 K;  3A8O B;  4PJO G;  5GMK l;  4BDZ A;  1N8R U;  4HCC A;  5CKB A;  3CD6 T;  1X01 A;  2L89 A;  4C5G A;  5GMK e;  5FU7 B;  1M9S A;  5CIU A;  3VUB A;  2ZPI B;  3G71 A;  4BD3 A;  4JRP A;  3BY7 A;  5FRO A;  4ZN3 A;  3UT1 A;  4C8Q E;  4RG2 A;  5GMK j;  1NZ9 A;  2LT1 A;  3SDZ A;  3KBG A;  3CPW S;  3OY9 A;  3OYH A;  4M77 E;  1VQP T;  1H64 1;  5GAN h;  5FLX E;  1MGQ A;  5CKE A;  1KQS A;  2NLU A;  1VQ7 T;  2XDP A;  4R55 A;  2RI2 A;  2JNG A;  4B9W A;  2I2L A;  2XDD A;  3CXC S;  1IRE B;  2R57 A;  3J81 E;  4XU3 A;  2RHU A;  4BI4 A;  1YIT T;  2P0K A;  2JVV A;  1UEB A;  3LW5 E;  3JCM J;  1K73 C;  3JCM g;  2DPP B;  2EFI A;  4C8Q G;  1WJR A;  1WQ7 A;  3LWH A;  2VUB A;  2KAF A;  1YJW A;  2R58 A;  4E47 A;  3H6Z A;  1Q82 C;  1LOJ A;  2DD5 A;  1WNL A;  3DLM A;  2DTI A;  3JCM X;  2X4W A;  1XTD A;  2FVU A;  3VJP A;  3S3M A;  2WSE E;  3E19 A;  3CC2 A;  3O8V A;  4JRK A;  4OB0 B;  2VXF A;  3VYH B;  4JLI A;  3TU4 K;  2VYT A;  2WAC A;  1YJ9 A;  2BKD N;  4XTZ A;  3FLG A;  4XU1 A;  3OW2 S;  4IKF A;  2ZGW A;  1GXI E;  2WSF E;  3E9G A;  3M56 A;  4C0Z A;  3G4S T;  5L8R E;  3CME T;  3OS2 A;  4MML A;  4C8Q D;  1M90 C;  3JCM P;  5GAO p;  3QSU A;  4OB1 B;  3WXM B;  3CCR T;  2QQA A;  4BE0 A;  1M1K U;  2XU8 A;  2DZ9 A;  3MP1 A;  4M77 D;  4X34 A;  4PJO C;  1FWZ A;  4PNO A;  1XOV A;  1D3B B;  1D3B A;  4ZN1 A;  2XID A;  1NPP A;  1OYX A;  4BE2 A;  3JCM W;  1N8R C;  3CMA T;  4MZP A;  2RB6 A;  3OS5 A;  3GLX A;  2ZPF B;  1G3Y A;  2LQK A;  2DXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...