1WJQA

Solution structure of the third mbt domain from human kiaa1798 protein
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
107
structure length
107
Chain Sequence
GSSGSSGVKPPHGFQKKMKLEVVDKRNPMFIRVATVADTDDHRVKVHFDGWNNCYDYWIDADSPDIHPVGWCSKTGHPLQPPLSPLELMEASEHGGCSTPGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the third mbt domain from human KIAA1798 protein
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords KIAA1798 protein
total genus 7
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2004-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1wjqA01
2P0KA 3QKJA 3ME9A 3MP6A 2WACA 3OYMA 2RI2A 2O4XA 2M0OA 2DAQA 2QQRA 2E5QA 5J39A 4NS5A 4ZTFA 4Z02A 5M9OA 2RJFA 2RO0A 3LGLA 3E9FA 3OMCA 4B9XA 3PMIA 4QQ6A 2M16A 3S3NA 5J26A 3O8VA 2D9TA 4N4IA 3DB4A 2RHYA 2E6NA 4EDUA 5IAYA 2BIVA 3L2RA 4N4HA 2GFAA 3OMGA 4ZTJA 3OYCA 4UC4A 2L8DA 5C6SA 4X34A 2HQXA 4IUVA 3CEYA 3L2UA 3FC3A 3OYEA 3MP8A 5FROA 5KE3A 2LCCA 5FRMA 4B9WA 3GOXA 3MEVA 5KE2A 2GFUA 5C0MA 4BE1A 3OYGA 3OYAA 5KCHA 3OS2A 1OZ3A 1MHNA 4C5EA 3L2QA 2FHDA 2K3YA 2DIGA 2XK0A 3EAEA 2LDMA 3Q1JA 3KUFA 3MEUA 4BE0A 3P8DA 2RI3A 4C5HA 3H8ZA 3L2VA 2MWPA 4E7JA 3UWNA 5FRNA 4LD6A 3UT1A 2YRVA 4FU6A 2NLUA 2LRQA 3FLGA 4PL6A 4BACA 3LGFA 3OS0A 4E7LA 2R57A 2GF7A 3OS1A 2XDPA 2JTFA 3L2WA 3OYNA 3DB3A 5D6WA 4QQGA 2RJCA 3MP1A 3OY9A 2G3RA 3OYBA 5D6XA 2RHUA 1OZ2A 3SD4A 4IKFA 1KHCA 4IUUA 3MO8A 4L59A 2EQMA 3QIIA 4QW2A 2DIQA 2RI5A 3META 2R58A 5IN1A 3OYLA 2RHZA 4QQDA 4BDYA 3S6WA 4E7HA 4A4HA 3S3OA 1WJRA 2EQKA 2EQJA 3OB9A 4N4GA 4A4GA 4A4FA 3QJ6A 2RHXA 3OQ5A 4PLIA 1WJSA 4Q5WA 2R5MA 3LLRA 3PFSA 2X4WA 1OYXA 2HQEA 4PLLA 3PNWC 3P8HA 3OYJA 4BDZA 4E7IA 2O4XB 3NTKA 2EFIA 2L3RA 4BD3A 4IURA 2MWOA 4GY5A 2F5KA 4A4EA 2K3XA 2RJDA 3MEAA 1WJQA 4II1A 4C5IA 4IUTA 1H3ZA 2VYTA 4RG2A 2LVMA 1RI0A 3S3MA 4HCZA 3LX7A 5CIUA 3NTHA 2QQSA 3OYKA 2M1HA 3L42A 2CKKA 2X4YA 5KH6A 3OYHA 3H6ZA 2RHIA 3ASKA 3OYIA 1N27A 2BKDN 5D6YA 2RJEA 2PQWA 3DLMA 3OYFA 4IUPA 1WGSA 4BE2A 3PMTA 2JZ2A 2LTOA 3OA6A 2IG0A 2EKOA 3FEOA 3LH0A 1XNIA 3MEWA 1SSFA 4IUQA 3BDLA 4QVZA 3C4SA 2X4XA 2L89A 4C5GA 4E7KA 3FDRA 3ZEHA 3LYIA 2B8AA 3QBYA 4CRIA 4FL6A 1G5VA 1OI1A 2R5AA 2BUDA 3F70A 3M9QA 3NTIA 4OVAA 5KCOA 2X35A 2EQUA 3E9GA 3OYDA
chains in the Genus database with same CATH superfamily
2J6OA 1K4US 1I5OB 3G7ZA 3VKIA 2MMPA 2K5IA 4C92F 3ULRB 2V26A 3O8VA 5LJ5d 2QEXQ 3JCMP 2DO3A 2VXEA 1PG5B 2KYMA 2AHJB 4FYXB 4P5NA 3VJPA 1G2BA 3VU3C 3FC3A 1VQPA 4ZN3A 3FJPA 3GPLA 3PTAA 1YN8A 2CZ0B 4XU0A 1WXTA 1VQ6T 1MHNA 3L2QA 1GFCA 3M0UA 1JJ2P 2F69A 2JM8A 2L5QA 1ZHIA 2CSIA 4RTTA 1ZUUA 1KJWA 1T0HA 3V7SA 2MWPA 3X20B 4E7JA 4FW1A 4JRQA 1YNZA 5GMKj 1M1KU 2LRQA 2K3BA 1XOVA 2D0QB 2JMCA 2JTFA 3G4ST 3G4SQ 4JLIA 5LJ3e 4EMKA 1UEBA 2RHUA 2LX9A 1KHCA 3CCMA 1VQOQ 1UGSB 4QQDA 3SWNB 2KSSA 2EQKA 2EQJA 2JN0A 1C1AA 5IHKA 4DOWA 3H0HA 4LDWA 2HAXA 4GY5A 4FYWB 1M4ZA 1AVZC 5AYFA 4AMCA 5GAN4 3CCRA 1ZA1B 1ZSZB 5IHIA 2QQSA 4J83A 1U3OA 4VUBA 2RN8A 2ZAEA 2EYQA 3T9NA 2VXFA 5CQXA 2YUOA 4DBQA 3CCJQ 1SSFA 2LX7A 4OB0B 1W4SA 2COZA 1KQ1A 1YP5A 2R5AA 2OAWA 3WVEB 1VQ4Q 2A36A 3VYHB 2KROA 4M77A 5I2SA 2P4TA 5FWBA 3CC2A 3PIPA 3KFVA 2X9HA 5GMKm 2W0ZA 3E9FA 3TVTA 3CCEQ 5J26A 4E7SA 4C8QF 1SPKA 4M4ZA 3VS3A 2DJQA 2KEAA 4HVVA 4ZN1A 2DTOA 4ZTJA 1EX4A 1MMGA 5FROA 1T0JA 3JB9D 5KCHA 1YHQT 2GTOA 1YJNT 3L1AA 2KRSA 4J9IA 2LNVA 1K0SA 1GXIE 2FVUA 5FU7B 3L2WA 2QA4A 2P0QA 4C8QB 3OYLA 2HNIA 3JCMf 3RNJA 2RB6A 3S3OA 3THKA 2EJ9A 2QA4Q 1G83A 1WHKA 1KQ2A 3OQ5A 2YUPA 1AD5A 2YWWA 2XDDA 2E5KA 2DXTA 1UGQB 1X6BA 3FJ5A 2FZGB 2DZ9A 3JCMh 3NFCA 2F5KA 4A4EA 4KRTA 1A0NB 2JS0A 4ZGJB 4RTYA 4KGVB 4JJCA 3VS4A 2LJ1A 2Y4YA 2CKKA 2DVEA 3EGUA 3M53A 4LUEA 2NUZA 1VQ5Q 2E4HA 3UA6A 5IH2A 3I56A 1C6VX 1XNIA 2KBTA 4PFOA 2ZGWA 3VUZA 4F16A 4IIOA 1ZBJA 1TH7A 3LYIA 3ZEHA 2DBMA 4FYVB 2X35A 1KG1A 3HP9A 4BY6C 8ATCB 1VQKA 1PD0A 4PJOF 1PKSA 3GNGA 3CCEA 3CMAA 3EH1A 5CR2A 3HRSA 4RMOA 1MV0B 3OMCA 3EHQA 4WCIA 1M5Q1 5LJ3j 3U23A 2XI9A 4HXJA 3EG9B 4M7DD 1X2KA 4AT1B 2NYSA 1RLQC 4E2FB 2LJ0A 2DJZA 1RI9A 4R56A 1Q81C 1K9MC 2GFUA 1QP3A 3VRZA 3GLXA 3VS1A 2ROLA 2FHDA 3JSCA 3M57A 3PVQA 3L2ZA 1KQSP 3CCQQ 2J6KA 2IVWA 3M58A 2YXYA 5GANg 3INZA 1JXMA 4KGXB 4BACA 2DRMA 2DERA 2E1HA 1UGPB 3OYNA 1GCQA 1E6GA 3EG9A 2IIMA 4LDVA 5D6XA 1K1ZA 1VIEA 2AIRB 1VQ5T 1Q81U 4L59A 4OMOA 3CCQA 2RI5A 4OGCA 2FPDA 4QVCA 2CP7A 4JJBA 5GAOq 2DXUA 1X75C 2X4WA 2HQEA 4BDZA 1AWWA 1QWEA 2DNUA 4OB1B 1GBQA 2K3XA 1ZSZC 4ESRA 3MPUB 4C5IA 4OP0A 1NLPC 3CC2Q 1VIFA 3PIOA 4F14A 1ZQ1A 5ECAA 2CREA 1FWZA 2C06A 3VV0A 2IG0A 2EKOA 2L3QA 3BW1A 2VV5A 4J9FA 4MZMA 1Q86U 3CCSQ 1NBEB 1F1BB 3M0TA 1B07A 1OU8A 1QCFA 3AT1B 3V8JA 2VVKA 4LD9K 2GTJA 3FIFA 2E12A 4PJOD 3EGXA 3CC2T 1ZUYA 5M9OA 4RTXA 3DLLA 2EGAA 2LT4A 1SRMA 1M1KC 3CPFA 2X51A 3X25B 1P92A 2DMOA 4ZNXA 1K73C 2GFAA 2ECZA 5GAN5 4IUVA 4OMFB 1M8MA 4LDUA 2VWFA 1VQ7T 4KULA 3PGGA 4BE1A 4BUGA 2RK2A 1WX6A 1RACB 4DQ2A 1S1NA 4M77G 2LT1A 4E7ZA 4AG1C 5FU7C 2DZCA 2VUBA 2KXDA 5GAN2 3OS0A 2XDPA 3JB9J 4E6RA 5D6WA 4FYYB 1YJNA 3M5AA 2DILA 4IKFA 3MO8A 3RMQA 1T3LA 4E7HA 1RAFB 2HCKA 4FCYA 2XG8D 2ZPGB 4M77B 1S72Q 1J3TA 4PFZA 3QYGB 2LNHB 2PVOB 2L3SA 1FXXA 1RAGB 2OTJQ 3X28B 2F2WA 2KR3A 3CC4T 3A5ZB 2FYKA 3M59A 4M78F 2MIOA 1NYGA 2ZPEB 3L42A 2X4JA 5L8RE 4Y92A 4BE2A 1Q82U 1N9SA 1QWFA 1X69A 3GP8A 1VQMQ 1TTHB 4BY6B 3JCMX 3KBGA 3P8BB 1YJWQ 1IO6A 2BUDA 3RIRA 1WHGA 3OW2P 2CP3A 3I56T 1BU1A 2E5QA 4M77F 4PK4A 5GJVB 4ELYC 3LGLA 3PMIA 4QQ6A 1N8RC 4N4IA 1D09B 2HDAA 2ZPBB 1QKWA 4LNPA 3EGDB 3JCMb 3A8HB 2BIVA 2KQWA 2O31A 3X26B 1VQ8Q 3NGPA 2JXBA 1YITT 1YJNQ 4M77E 3TSZA 1M2OA 2QQBA 4KGZB 3G6EQ 5KE3A 1YJWT 1VQ9T 1MMNA 4QT7A 4C92A 1VQ6A 4MMLA 5GAN3 4C8QD 5L23A 2L0AA 3QG1A 1LNXA 4C5EA 2K6DA 3CD6A 1OX9A 4BE0A 2BE7D 2FB7A 2O88A 4JUVA 4C0FA 3R6NA 4LD6A 3HSBA 1VQLT 1CKAA 2K9GA 1BYMA 1NEBA 1D1BA 1EZZB 4ME7A 4MDXA 1ZBXA 2MI6A 1VYTA 3X24B 3S6WA 2AT1B 1UECA 3OB9A 1VQMT 1M9SA 1VQ4T 2RQWA 4M77D 4XTWA 3I5SA 3LLRA 1NJIU 1FMVA 4Y28E 1YJ9T 1LVKA 2V8JA 4BI4A 1JJ2S 1IHVA 2EBPA 4JRIA 1RAEB 1M90C 2DL8A 2DL7A 4AFSC 1ZLMA 2RNAA 4PJOC 2LVMA 4PKCC 4M75G 4HT8A 3NTHA 4OMPA 1WHJA 2C0OA 2XMFA 2JVVA 3O5ZA 3E1SA 3OYFA 1B3QA 4IUPA 5GANh 2DE0X 5CKDA 4J9BA 2OTLT 3MEWA 3UATA 4CC2A 3SDZA 4RUGA 2WSCE 2KGTA 4KH0B 2CZ6B 3FDRA 3RBBB 2D8HA 2E3IA 2WSEE 3VS0A 3QWYA 2F2XA 4M75C 3OYMA 1I8FA 4PJOA 2LMJA 1YI2Q 1PNJA 2JNGA 4KUIA 4M7AC 1HSQA 1KHIA 2D0NA 1M30A 2CH4A 5LJ3g 4OGEA 3EGDA 2DX1A 3OYCA 1LOJA 2DA9A 2QK0A 4PNOA 2AZSA 3CEYA 5LJ5f 4HCKA 1HXDA 5LJ3h 1M1GA 1QVFP 4M7DG 2CZ1B 3CMAT 4J9EA 5IT9E 2KVQG 4GBQA 5EG2A 4D6WA 4MMKA 3EFOB 2E6ZA 3KUFA 1BI0A 1VQ8A 2ZPFB 3J7AF 5KYNA 1Y96B 1M2VA 1HYOA 1UB4A 3EFOA 2EIFA 1I07A 3OYYA 4M77C 4FT4A 2DIQA 4C8QG 4M7DC 2EYWA 2R5MA 1KIKA 3PFSA 1KQSA 3PNWC 4XU2A 3NTKA 4IURA 4N0AC 3MEAA 2PVDB 1XJWB 3G71A 2V1QA 4M78E 1X6GA 4J6WA 4LN2A 5KYWA 2LCLA 4FM4B 3V7RA 4DBHA 3OYKA 3SEMA 5FWCA 2X4YA 3UDCA 4C92C 2RHIA 2DRKA 5KYUA 3RERA 5CKEA 3OYIA 2YUQA 5D6YA 4Z89A 1TG0A 4D8KA 1K73U 5GAN8 4DBFA 2J7IA 3BDLA 3A8OB 2DK3A 5CK9A 1YIJT 2K4YA 3CC4A 1H92A 4FL6A 2ZPIB 4RTUA 1WXUA 3F70A 3E9GA 3QKJA 5AT1B 1VA7A 2RQUA 2XICA 2JMAA 3VS5A 4F17A 2RJFA 4ZGEB 1LPLA 1YIJA 1OX8A 2JOYA 3L2RA 5LJ5g 2CP5A 3QXEB 1N8RR 4UC4A 5DY9A 1VQNT 1YCSB 3SWNA 2NUTB 1HD3A 2E65A 2FZCB 1RADB 1W2BP 4CC7A 1FMKA 3OYGA 1QCOA 5LJ5h 5CKHA 1QCNA 3KXTA 1GCQC 1GRIA 5CQYA 5FU6B 2P84A 2CP0A 3TU4K 1UGVA 1BI2A 2R57A 4M7AE 1IREB 1BCOA 3MP1A 3OYBA 1PRMC 1WPYA 5GAOl 3JB9G 4L6V5 1NLOC 3QIIA 3AHUA 4NL3A 1M1KR 4M7AF 1VQMA 1U5SA 3C94A 2QA4T 1RABB 3IQLA 4DOVA 2XDBA 2K5LA 3HFNA 1KC8U 3A8GB 1PC0A 2BTTA 1Z9QA 5GANf 1EFNA 4M78D 2YRDA 3CD6Q 1BKBA 1K9MR 1X43A 2K79A 4J9DA 1X01A 1M90U 1GL5A 3E19A 3I5RA 3HRTA 4CRIA 4M75B 2CT4A 1OI1A 1EIFA 2A0FB 1UDLA 1MNDA 1QVFS 4M7AB 1JQQA 2RI2A 2L3PA 4Z02A 2QTXA 4PJNA 4HCCA 3CCVQ 3JCMe 3CMET 1K76A 1YWOA 2E6NA 4RCBA 1NE8A 1KD1C 2EVRA 4RTVA 2VGMA 2KDSA 4JLGA 1WZOA 2DEUA 4L5GA 3FRNA 4ORZA 1BI3A 3OS2A 1IGQA 4XTZA 1PKTA 5J3BA 3CCVT 2JUFA 4OMQA 2KXCA 1D3BA 2NUPB 3URGA 4MZTA 1OOTA 4FT2A 2LZ6B 2CT3A 1OU9A 1HK9A 1X2QA 1YITA 1ZA2B 3CMAQ 1Y71A 2G3RA 1RAAB 3HKSA 1OQKA 1PWTA 3G4SA 4QW2A 4E7IA 1Y07A 4BDYA 1Y57A 3CPWP 4M7AD 1VUBA 3QWXX 3A8LB 3VS7A 4EPCA 3PE0A 2HSEB 1OYXA 5HCKA 3VYGA 1RAIB 4JZ4A 3RDVA 3REBB 1KQSS 5GMKi 1YWPA 2RJDA 1OPLA 1WQWA 1WHLA 5IXBA 2GBQA 4C92B 2VYTA 1PCXA 4HCZA 4XTVA 1PRLC 1WI7A 2BE9B 2COYA 2OTLA 4X1VA 1ACMB 1SHGA 5A0GA 3CCRT 1TSFA 3QDRB 2PQWA 2XIDA 2JTEA 2DXCA 2MAMA 1G3TA 1JU5C 2QI2A 4JRKA 1I0CA 4R0KA 2I2LA 2K2VA 4A53A 2DYBA 2O9SA 3CCRQ 3FB9A 4C0DB 3CCSA 4AFQC 1G5VA 1VQOT 2OTLQ 2GNCA 4XTYA 1IXDA 2DYIA 2DVJA 2GCXA 5KCOA 1MMDA 4M78A 1X27A 3QJYA 4X9CA 2M0OA 2DEQA 2OTJA 3EFRA 2LQKA 1SEMA 4R55A 2M16A 5A2QE 4XTUA 1WA7A 9ATCB 1WLPB 3CCMQ 1VQOA 4EDUA 4BB7A 3CXCP 3JB9H 1BIBA 4EMHA 2E41A 1JJ2A 4C92E 1QW1A 4ZGDB 4F7UA 4RKUE 5FRMA 2LCCA 2X3XD 4B9WA 1AWOA 4GLMA 4M78C 1BK2A 1TUGB 1OZ3A 2AKLA 4MZPA 2V8KA 4QKUA 1Q7YR 4C8QC 4JS5A 4QVDA 3OSVA 2D6FA 1O75A 1RAHB 2KE9A 2YRVA 5CKFA 4FU6A 2CP6A 4M7DE 3M56A 4OB2B 4F7UB 1UJYA 4Y91A 1OEBA 1U8RA 2EQIA 1OZ2A 2QTVA 3MCAB 4IUUA 2EQMA 5GJWB 1M27C 2R58A 3CCQT 2HL5C 1O9SA 3JCMV 4F04B 1IGUA 4X9DA 5KYYA 4OMLA 4LDXA 4J9CA 1YJ9A 2M0YA 1D0XA 4PLLA 3V8LA 3P8HA 1I5LA 1VQLQ 4GLKA 3MKDA 1LCKA 4KT0E 3G1JA 2EKHA 3OW2A 1MGQA 1TXQA 1IRXA 2A37A 2E70A 5CKBA 2RA2A 4DEXA 4EMKB 1R0CB 3EH2A 2JZ2A 3OA6A 5FLXE 2EWNA 5KYXB 4HVWA 2RMOA 3CBOA 1VOMA 2NUTA 5A0DA 4IUQA 2L2PA 4YTLA 1YITQ 5I11A 2L89A 1NPPA 3CBMA 3CC7Q 3M9QA 2SEMA 4J7IA 4M75E 2P0KA 3OYDA 1YJWA 1Q82C 1WYXA 4NS5A 3NMZC 3RKWA 1XQHA 1W6XA 1AOJA 2BZ8A 4KUDK 4ELZC 4BI8B 1D3BB 2NUPA 5LL6S 3RESA 3H41A 4J6XA 4C92D 4FSXA 3V8KA 3GOXA 3M54A 3OBYA 5GAMf 1U1SA 1B34B 1G3YA 1RL2A 3VRYA 3MEUA 4C5HA 3CCUT 2JT4A 5GAN7 2QEXA 1JRIA 1CSKA 2CSQA 2P0PA 3CPWS 2J06A 2GF7A 1ZX6A 2GQVA 4J8OA 1VQ9A 1N6AA 1VQNQ 1UJ0A 1BIAA 1MV3A 3HPWA 3BY7A 5IXFA 4XU1A 4N4GA 4PJMA 2QAZA 4M7AA 1M3CA 1AHJB 2FPFA 1YIJQ 2O4XB 4BD3A 1SRLA 2C0TA 2KT1A 2M51A 3CCUQ 1BB9A 2KNBB 1H641 1I4K1 3EG1A 1RI0A 3SWNC 2KT8A 4AFUC 1SKUB 1Y0MA 1G3WA 1CKBA 2FL7A 2M1HA 1RUWA 1QQJA 4PJOE 1AT1B 2PU9B 1N8RU 2CUBA 3JCMg 3DLMA 2LQ8A 1TOVA 1I1JA 2W10A 3PT9A 3C4SA 2HQHA 2KRMA 2ED1A 3ZL7C 3CCST 1M8VA 3CCJA 2QDYB 2YDLA 3DKMA 1M3BA 2YLCA 2OI3A 2F2VA 4FIBA 3G71Q 2MF2A 1D0ZA 2XU8A 2DBKA 3BDUA 2LQWA 5DM7R 3UPUA 2KY9A 3S3NA 2DXBA 1KK7A 2PUOB 4PJOG 5GANd 4JZ3A 4LDYA 2H3JA 3SHWA 4XK8E 2Y90A 1Q81R 2YRCA 2EYZA 4M78B 3OYEA 3PVLA 1VQ9Q 2VB6A 1VQNA 1ZUKA 2DPPB 3I55A 1TWBA 2K7AA 5GAMe 1WXBA 4V2SA 3QZ9B 2FG0A 4FSSA 2AKKA 3JV3A 3EFSA 1KC8R 3H0FA 2JTMA 2LDMA 1BI1A 3P8DA 2FRWA 3MJXA 3TQ7P 1IZ6A 3I55T 2LC4A 4C8QA 1V29B 2QQ9A 4WF2A 4QQGA 2RJCA 4NL2A 4C0ZA 1QVGP 4OMNA 4RCCA 3M0SA 2AK5A 4A4HA 1G3SA 3RKYA 2RQVA 4J7FA 2CYZB 4PLIA 5LJ3f 2EGCA 3OYJA 6AT1B 2KYBA 2DL5A 2LCSA 2PUKB 2EFIA 2L3RA 2QGFB 1U06A 1V1CA 5GANe 1WJQA 2ENMA 2K2MA 2KAFA 3R6OA 1K0XA 4RG2A 3CC4Q 2HBWA 1W2BS 3H6ZA 3ASKA 1QLYA 1YCYA 5KYWB 3LH0A 1HJDA 3LH5A 2VASA 5FW9A 1ABOA 4WTOB 2JW4A 4AG2C 2BZXA 3QBYA 3TCJA 3JCMd 3QUIA 1YI2A 2PNIA 3QDFA 1T3SA 1G8XA 5DLQE 1FYNA 3NPFA 1Y7XA 2DTIA 2ZPHB 2O4XA 3H9NA 1Q86C 2DD5A 3M55A 1YFNA 4B9XA 2D9TA 3CMEA 2LJ3A 2V1RA 3ZFJA 4DEYA 4PJLA 1M2VB 2M9UA 2L8DA 4X34A 3BE3A 2EJGA 2YT6A 2QDLA 2C0IA 3HTRA 1MUZA 3MEVA 2D8JA 1Y96A 4TVRA 3G6ET 3LWIA 3EAEA 3Q1JA 3CCLT 4N0AA 2RI3A 1VQ8T 1H3HA 3L2VA 3BFMA 5FRNA 1WHMA 2B86A 3CD6T 1D0YA 2COWA 3UT1A 3FLGA 4PL6A 3V7CA 1QVFA 4IIMA 3M4YA 2DM1A 1VQPT 3EGXB 2EYXA 5GAMh 3C95A 4AFZC 2VC8A 4NOYA 3G71T 1AWJA 1NEGA 2RHZA 4PJOB 2CGHA 2QYZA 1FX7A 4A4GA 5GANj 2KK4A 3RKXA 2QGGA 2HBPA 4A4FA 1N5ZA 2RHXA 3CXCA 1WJSA 3RMSA 2KMTA 1GCPA 2MOXA 2DD4A 4M78G 4HCBA 2YUNA 2CH4W 3J81E 5EC7A 4DA4A 5KYXA 4E47A 5KH6A 2YSQA 1Q7YC 1FMWA 3EG3A 3RR6A 2PVGB 1WGSA 4JJDA 5GAN6 1KD1R 2ESWA 2FPEA 3VUBA 3M4GA 2X4XA 2FRYA 1S72T 2OAUA 1W70A 1VYUA 2K57A 1B34A 3I9QA 2KRNA 2M02A 3OYHA 2IPOB 4EIKA 2OTJT 5HKCA 4ZTFA 3JRZA 5GAOr 3CBPA 2RO0A 5KYYB 2F1LA 2RQTA 4JRPA 3A1PA 1K8AU 3GBQA 1VYVA 4HKEA 5IHNA 2RHYA 3QSUA 3OMGA 1ABQA 4KBMB 4DBRA 2VKNA 2HZYA 2QXFA 1PD1A 5A0LA 4JS4A 3OW2S 4LUDA 1E7OA 5C0MA 1PHTA 1NYFA 3JCMQ 1R8OB 1QKXA 2WSFE 2F5TX 2DIGA 3JCMc 4J9GA 2O01E 4XQ3A 4D8DA 3H8ZA 4J5YA 4M7DB 2A7YA 3J80E 1JXOA 1Z9ZA 4E7LA 3LGFA 1QP2A 7AT1B 2BZYA 4CI0C 2FEIA 1UGRB 3E2UA 1AWXA 5IN1A 3QHSA 3EHRA 1JB0E 1OULA 1VQLA 2EGEA 3REAB 2PTKA 3CCVA 2KI7A 5D7UA 5GAMd 4II1A 3HRUA 4PJJA 3WVDB 2O9VA 4O6JA 3S3MA 1M1FA 2J6FA 1MNEA 4JJNK 3ZBDA 8AT1B 2A08A 1N27A 1D1AA 5CO7A 4HVUA 2RJEA 2ED0A 4B6MA 3PMTA 2LTOA 3CCLQ 1KC8C 3FEOA 2DF6A 1SG5A 5GAOm 1VQKT 1DJ7B 1RLPC 2RH2A 3H0IA 5GAOn 1K9MU 2HKQB 1WIEA 2D1XA 4OVAA 5I2MA 5GMKh 2WACA 3QO3A 2DAQA 2QQRA 3VS2A 3WXMB 1D1CA 1SSHA 4ANJA 2HD0A 5LJ5j 3DB4A 1PM3A 1YI2T 2RM4A 2CS7A 5GAOp 2GQIA 1UFFA 2XD0A 1LJOA 5FU6C 2ABLA 2YHTA 1H8KA 4C0GA 2QASA 1R0BG 4CC3A 2DLPA 3OYAA 3G6EA 2G6FX 3M0PA 2XK0A 1UE9A 4A54A 1NZ9A 2QQAA 1GBRA 4K11A 3OBWA 4M7AG 3HL8A 3M0RA 1WHHA 4O5VA 1QVGA 5CCAA 2H8HA 4RTZA 3TREA 2O2OA 3L2UA 3OSSC 4MDWA 1PSFA 2EAYA 2QG9B 1B7TA 2HL3A 3CCMT 2P4RA 3CXCS 4M75D 2XHCA 1WFWA 2A28A 2E10A 2JS2A 1BCMA 1Q82R 4IUTA 4XAXB 1H3ZA 2NWMA 3NHNA 3LX7A 4HT9A 2CZ7B 2EJFA 4Z8AA 2JJ9A 1UG1A 4Z88A 2BKDN 4M7DF 1UTIA 3CC7T 1WQ7A 4QVZA 2YLBA 2EW3A 5GAMj 4ATOA 1VQ7A 3JAME 1Q95G 3D7SB 1PSEA 4OB3B 3MP6A 4JPBW 1VQKQ 3SB2A 1UUEA 2VGNA 2EPDA 3C12A 1KFZA 2AZVA 4LE9A 3I56Q 1OPKA 4N4HA 4KH1B 1NM7A 2EYYA 2MCNA 5C6SA 1VQ6Q 2ZZDA 3M0QA 4A63B 1TU0B 5DLOA 1YHQQ 3JCMJ 3CCLA 2RK1A 4XTXA 1W2BA 3JCMW 1IHWA 3RUXA 4F7UG 4C8QE 4EMGA 5I21A 4HA8A 2DTHA 1YHQA 4M7DA 2A3LA 4RG8A 1NJIC 5CVIA 1YJ9Q 3OS1A 3N5BB 3DB3A 1Q7YU 2MYSA 1NJIR 2K5FA 2PZ1A 3SD4A 1BBZA 1VQ5A 4J6YA 1TUCA 1V76A 2I0NA 5CAIA 2V8IA 1W1FA 3HHTB 1JBMA 2CDTA 4Q5WA 3SFMA 3LWHA 3QPHA 3CCUA 2ROTA 2MWOA 3CCJT 3UF4A 1JEGA 2FO0A 5HK0A 1R77A 1E6HA 4C0DC 5CIUA 1VQ4A 3CC7A 5KYUB 3I35A 3OS5A 3CQTA 5GMKl 1OV3A 2CUDA 1C0MA 1JO8A 1VQPQ 3A98A 4F7UF 1K8AC 4E7KA 1MMAA 1I81A 1VQ7Q 2OX7A 2RF0A 1QVPA 4XU3A 2DKGA 3ME9A 4A4KA 1YBYA 2RPNA 5J39A 1TS9A 5I22A 2H3EB 4PFPA 2MK5A 1WDXA 5IAYA 1K9AA 3EG0A 3QZ5B 3VS6A 1S72A 2GGRA 1UHFA 2HQXA 4JDSA 3UA7A 2OJ2A 3MP8A 1M90R 1U1TA 2J05A 1TUDA 4M75F 5KE2A 1GFDA 2DL3A 2HKNA 2K3YA 2FZKB 3TEEA 4C92G 4F7UE 1N9RA 2DL4A 1AEYA 3UWNA 4OMMA 4LXCA 3CPWA 2E64A 2NLUA 2HMAA 2QEXT 2SRCA 3HFOA 2HEQA 5LJ5e 2ZCFB 4BI3A 3GF5A 2XKOC 2ATCB 4J9HA 3LW5E 2LP5A 2RQRA 3OY9A 1AZGB 1KSWA 1KD1U 1IB8A 1ARKA 1QVGS 1NG2A 1WNLA 3MHXA 5GMKe 3META 4RTWA 1WJRA 5HK3A 2LQNA 3QJ6A 1XTDA 2RD1A 3JB9F 4EMKC 2E3HA 2DFUA 1QMCA 3GNFB 3QYHB 1SHFA 3CMEQ 1K73R 3A8MB 1UHCA 1Q86R 1K8AR 5HY6A 3C0CA 1ZSGA 3EG2A 2Y4XA 2CP2A 1NPRA 3GIBA 2DETA 1ZSZA 5GAMg 3CCET 4M75A 2X3WD 1SF9A 3ER0A 4C5GA 1M3AA 2B8AA 3JB9I 1AZEA 3I55Q 1X6OA 2MPXC 4OF1A 3TSWA 2HSPA 2Z0WA 4FW2A 3NTIA 2JM9A 2EQUA 4CC4B 5LJ3d
chains in the Genus database with same CATH topology
3QJYA 4X9CA 5HKCA 2OTJT 3G7ZA 2M0OA 3I56T 3VKIA 2DEQA 2E5QA 2MMPA 4M77F 2OTJA 4ZTFA 3JRZA 2K5IA 5GAOr 3EFRA 3CBPA 4C92F 2LQKA 2RO0A 3LGLA 4ELYC 4R55A 3PMIA 4QQ6A 2M16A 5A2QE 3O8VA 4XTUA 4JRPA 1N8RC 1K8AU 5LJ5d 4N4IA 1VQOA 4HKEA 3JCMP 2ZPBB 2DO3A 2RHYA 2VXEA 4BB7A 4EDUA 3JB9H 3JCMb 3A8HB 3QSUA 2BIVA 2KQWA 2AHJB 1BIBA 3X26B 4EMHA 2E41A 4P5NA 3OMGA 3VJPA 1JJ2A 4C92E 4KBMB 1QW1A 3VU3C 4ZGDB 3FC3A 4ZN3A 1VQPA 1YITT 3FJPA 2QXFA 4M77E 3GPLA 4F7UA 2QQBA 3PTAA 5A0LA 4RKUE 5KE3A 2LCCA 5FRMA 4JS4A 1YJWT 3OW2S 1VQ9T 2CZ0B 4B9WA 4XU0A 4C92A 1VQ6A 4M78C 4MMLA 5C0MA 4C8QD 5GAN3 1VQ6T 3JCMQ 1R8OB 3QG1A 1OZ3A 4MZPA 1LNXA 1MHNA 4C5EA 3L2QA 2WSFE 2F5TX 2DIGA 2V8KA 3JCMc 3CD6A 2O01E 2F69A 4XQ3A 4BE0A 2L5QA 1ZHIA 3H8ZA 2FB7A 4C8QC 4JS5A 4JUVA 4QVDA 4J5YA 4C0FA 4M7DB 3V7SA 2MWPA 3OSVA 3X20B 4E7JA 2A7YA 4JRQA 4LD6A 3J80E 2D6FA 1O75A 5CKFA 2YRVA 4FU6A 5GMKj 1M1KU 2LRQA 4E7LA 1XOVA 4M7DE 3LGFA 1VQLT 2D0QB 3M56A 4OB2B 4F7UB 1QP2A 2JTFA 3G4ST 4Y91A 5HK3A 4JLIA 1BYMA 5LJ3e 4EMKA 1U8RA 4CI0C 1UEBA 2RHUA 4ME7A 4MDXA 1UGRB 1ZBXA 1OZ2A 2LX9A 2MI6A 1KHCA 3MCAB 4IUUA 3CCMA 1UGSB 2EQMA 3X24B 5IN1A 2R58A 4QQDA 3CCQT 3S6WA 3SWNB 2KSSA 3QHSA 1O9SA 1JB0E 3JCMV 2EQKA 2EQJA 1M9SA 2JN0A 3OB9A 1VQ4T 1VQMT 4M77D 4X9DA 4XTWA 1VQLA 4LDXA 3LLRA 1YJ9A 1NJIU 4PLLA 4DOWA 3V8LA 3P8HA 4Y28E 4LDWA 1YJ9T 2HAXA 1I5LA 2V8JA 3CCVA 4BI4A 1JJ2S 4GLKA 4GY5A 1M4ZA 5GAMd 4KT0E 5AYFA 4II1A 4JRIA 1M90C 3HRUA 3WVDB 5GAN4 3OW2A 1MGQA 4PJOC 2LVMA 3CCRA 4O6JA 3S3MA 1M1FA 4PKCC 4M75G 4JJNK 3ZBDA 4HT8A 3NTHA 2QQSA 4J83A 2E70A 4VUBA 3T9NA 2EYQA 5CKBA 2RA2A 2JVVA 4EMKB 1N27A 5CO7A 3E1SA 2RJEA 2VXFA 3OYFA 5GANh 4IUPA 5CQXA 3PMTA 2JZ2A 2LTOA 5CKDA 5FLXE 2EWNA 3FEOA 3OA6A 1KC8C 2OTLT 3MEWA 3CBOA 1SSFA 4IUQA 3SDZA 5A0DA 4YTLA 4OB0B 5GAOm 1W4SA 2WSCE 2L89A 1DJ7B 1VQKT 2CZ6B 3FDRA 1NPPA 2RH2A 3CBMA 5GAOn 1KQ1A 1K9MU 2R5AA 2WSEE 3M9QA 3WVEB 4OVAA 4J7IA 5I2MA 4M75E 2P0KA 3OYDA 3VYHB 1YJWA 4M77A 5GMKh 5I2SA 4M75C 1Q82C 2P4TA 2WACA 3QO3A 3OYMA 1I8FA 2DAQA 2QQRA 3CC2A 4PJOA 4NS5A 3PIPA 3RKWA 2JNGA 1XQHA 4KUIA 3WXMB 5GMKm 4M7AC 3E9FA 1KHIA 5J26A 2HD0A 5LJ5j 4C8QF 3DB4A 4KUDK 4ELZC 5LJ3g 4OGEA 1YI2T 2RM4A 4ZN1A 2CS7A 2DTOA 4ZTJA 4BI8B 1D3BB 1LOJA 3OYCA 4PNOA 5GAOp 3CEYA 5LL6S 5LJ5f 3RESA 2XD0A 1LJOA 4J6XA 5FROA 5FU6C 4C92D 2YHTA 3JB9D 4C0GA 4FSXA 1HXDA 3V8KA 3GOXA 5LJ3h 3M54A 3OBYA 1M1GA 5GAMf 4M7DG 3OYAA 2CZ1B 5KCHA 3G6EA 3CMAT 1U1SA 1B34B 5IT9E 1YHQT 1G3YA 1RL2A 2KVQG 2XK0A 5EG2A 4MMKA 3L1AA 4D6WA 1YJNT 2E6ZA 3KUFA 1BI0A 3MEUA 1VQ8A 4C5HA 2ZPFB 4A54A 3J7AF 1Y96B 3CCUT 2LNVA 5GAN7 2QEXA 1JRIA 1NZ9A 1UB4A 2QQAA 2P0PA 3CPWS 1GXIE 2FVUA 2GF7A 3OBWA 5FU7B 4M7AG 3L2WA 3HL8A 4O5VA 2EIFA 1QVGA 5CCAA 2GQVA 3TREA 3OYYA 2QA4A 4J8OA 1VQ9A 1N6AA 4M77C 2P0QA 4FT4A 3L2UA 4C8QB 3OYLA 2HNIA 2DIQA 4C8QG 1BIAA 3OSSC 3JCMf 4MDWA 2RB6A 3HPWA 4M7DC 3BY7A 1PSFA 2EAYA 3S3OA 4XU1A 2EJ9A 4N4GA 1KQ2A 4M7AA 3OQ5A 1AHJB 2XDDA 3CCMT 2R5MA 3PFSA 3CXCS 1KQSA 3PNWC 2DXTA 1UGQB 4M75D 2O4XB 4XU2A 3NTKA 2DZ9A 3JCMh 2XHCA 4IURA 4N0AC 4BD3A 3NFCA 2F5KA 4A4EA 2E10A 3MEAA 2PVDB 3G71A 4M78E 4IUTA 4XAXB 1H3ZA 1H641 1I4K1 4ZGJB 1RI0A 3SWNC 4J6WA 3LX7A 4HT9A 2LCLA 4FM4B 2CZ7B 2EJFA 1G3WA 3V7RA 3OYKA 2Y4YA 2FL7A 2M1HA 2CKKA 2DVEA 2X4YA 3UDCA 4C92C 2RHIA 3RERA 4PJOE 2PU9B 5CKEA 3OYIA 2BKDN 1N8RU 5D6YA 3M53A 4M7DF 3JCMg 3DLMA 1K73U 5GAN8 3CC7T 2LQ8A 3I56A 1XNIA 5GANj 3PT9A 3BDLA 3A8OB 1WQ7A 2ZGWA 4QVZA 3C4SA 2DK3A 3VUZA 5CK9A 2YLBA 1TH7A 2K4YA 3LYIA 3ZEHA 3CCST 1YIJT 3CC4A 5GAMj 4FL6A 1M8VA 4ATOA 3CCJA 2QDYB 2ZPIB 3F70A 2X35A 1KG1A 3DKMA 3E9GA 3HP9A 2YLCA 4BY6C 1VQKA 1VQ7A 3QKJA 3JAME 4PJOF 1PSEA 2XICA 4OB3B 3MP6A 3GNGA 4FIBA 3CCEA 3SB2A 3CMAA 5CR2A 2VGNA 3HRSA 2MF2A 2RJFA 4RMOA 2XU8A 3BDUA 3C12A 3OMCA 4ZGEB 5DM7R 3UPUA 2KY9A 1YIJA 3S3NA 2DXBA 2PUOB 4PJOG 5GANd 1M5Q1 5LJ3j 4LDYA 2JOYA 3L2RA 2XI9A 2H3JA 4N4HA 5LJ5g 4XK8E 2Y90A 3QXEB 4UC4A 5C6SA 4M7DD 4M78B 2ZZDA 5DY9A 1VQNT 3OYEA 3SWNA 5DLOA 1VQNA 2DJZA 2DPPB 3I55A 4R56A 2E65A 1Q81C 5GAMe 4V2SA 1K9MC 3JCMJ 3CCLA 2RK1A 3QZ9B 2GFUA 1QP3A 4XTXA 1W2BA 3OYGA 3GLXA 3JCMW 3EFSA 5LJ5h 2FHDA 2JTMA 3JSCA 3M57A 3RUXA 2LDMA 3L2ZA 1BI1A 5CKHA 3P8DA 4F7UG 4C8QE 4EMGA 5I21A 3KXTA 2IVWA 3M58A 1IZ6A 4HA8A 2DTHA 1YHQA 5CQYA 4M7DA 5FU6B 2A3LA 4RG8A 5GANg 1NJIC 3I55T 3INZA 5CVIA 4BACA 2LC4A 3TU4K 1BI2A 2R57A 4C8QA 1V29B 2QQ9A 3OS1A 3N5BB 2E1HA 1UGPB 4M7AE 3OYNA 3DB3A 1IREB 4WF2A 4QQGA 1Q7YU 2RJCA 3MP1A 4LDVA 4NL2A 4C0ZA 3OYBA 2K5FA 5D6XA 1VIEA 1WPYA 5GAOl 1VQ5T 3SD4A 3JB9G 1VQ5A 4L6V5 4RCCA 1Q81U 4L59A 4J6YA 3QIIA 3CCQA 2RI5A 3AHUA 4OGCA 4NL3A 4M7AF 1VQMA 4A4HA 5CAIA 3C94A 1G3SA 2V8IA 3HHTB 3RKYA 2QA4T 1JBMA 4J7FA 4DOVA 2CYZB 4PLIA 4Q5WA 4QVCA 2XDBA 5GAOq 2DXUA 3SFMA 1X75C 5LJ3f 2X4WA 2K5LA 2HQEA 3OYJA 3QPHA 3LWHA 4BDZA 2PUKB 3HFNA 3CCUA 2EFIA 2L3RA 4OB1B 2MWOA 1KC8U 3CCJT 2K3XA 3A8GB 5GANe 1WJQA 4C5IA 4OP0A 2KAFA 3R6OA 5HK0A 1VIFA 5GANf 4RG2A 3PIOA 4M78D 4C0DC 5CIUA 1VQ4A 1ZQ1A 1W2BS 3CC7A 1BKBA 1FWZA 3H6ZA 3ASKA 1YCYA 3OS5A 1X01A 5GMKl 2C06A 3VV0A 2IG0A 2EKOA 3BW1A 2VV5A 3LH0A 1M90U 4MZMA 1Q86U 1K8AC 4F7UF 3E19A 4E7KA 3QBYA 3HRTA 4CRIA 4M75B 1I81A 1OI1A 3TCJA 3JCMd 1EIFA 1QVPA 3V8JA 3QUIA 1YI2A 1QVFS 4XU3A 4LD9K 2DKGA 5DLQE 4M7AB 3FIFA 1Y7XA 2E12A 2DTIA 1YBYA 3ME9A 4A4KA 3CC2T 4PJOD 2RI2A 2O4XA 2ZPHB 5J39A 1Q86C 4Z02A 2DD5A 5M9OA 3M55A 2QTXA 4HCCA 3DLLA 4B9XA 2LT4A 3JCMe 1M1KC 3CMET 2D9TA 3CMEA 3CPFA 3X25B 2E6NA 5IAYA 1P92A 4RCBA 3ZFJA 3QZ5B 1NE8A 1KD1C 1K73C 2GFAA 2M9UA 5GAN5 2L8DA 1S72A 2VGMA 2HQXA 2KDSA 4IUVA 4JDSA 4JLGA 4OMFB 4X34A 2EJGA 4LDUA 3MP8A 1U1TA 1VQ7T 4KULA 4L5GA 3HSBA 3MEVA 4M75F 5KE2A 3PGGA 4BE1A 1Y96A 3FRNA 4BUGA 2RK2A 1BI3A 3OS2A 4TVRA 4DQ2A 3G6ET 2K3YA 4M77G 4XTZA 3LWIA 3EAEA 3TEEA 2LT1A 3Q1JA 3CCLT 4C92G 4N0AA 2RI3A 4F7UE 1VQ8T 5FU7C 5J3BA 2DZCA 3L2VA 1N9RA 3CCVT 3BFMA 2JUFA 2VUBA 3UWNA 5FRNA 3CD6T 1D3BA 3URGA 3UT1A 3CPWA 4MZTA 2E64A 2NLUA 3FLGA 4PL6A 3V7CA 3HFOA 4FT2A 5LJ5e 5GAN2 2ZCFB 3OS0A 2QEXT 4BI3A 1QVFA 3M4YA 2XDPA 1HK9A 3GF5A 2XKOC 3JB9J 1YITA 1VQPT 5D6WA 3LW5E 5GAMh 1Y71A 3OY9A 2G3RA 3C95A 1KD1U 1YJNA 3M5AA 3HKSA 1QVGS 2VC8A 1WNLA 3MHXA 4NOYA 5GMKe 3G71T 4IKFA 3MO8A 3G4SA 3RMQA 4QW2A 4E7IA 1Y07A 3META 4BDYA 2RHZA 4PJOB 2CGHA 4E7HA 1FX7A 4M7AD 1VUBA 1WJRA 4A4GA 2XG8D 2KK4A 2ZPGB 3A8LB 2HBPA 3RKXA 3QJ6A 4A4FA 4M77B 2RHXA 4EPCA 3CXCA 1WJSA 1XTDA 2RD1A 3RMSA 3QYGB 1OYXA 2KMTA 4EMKC 3VYGA 3JB9F 2DD4A 4M78G 2PVOB 4HCBA 1KQSS 5GMKi 3GNFB 1FXXA 2RJDA 3QYHB 1WQWA 3J81E 3X28B 3A8MB 4C92B 4DA4A 2VYTA 3CC4T 5HY6A 3A5ZB 4HCZA 4XTVA 2FYKA 3M59A 4M78F 2OTLA 2ZPEB 3L42A 4E47A 5KH6A 2Y4XA 1Q7YC 2X4JA 5A0GA 3CCRT 1NPRA 5L8RE 3QDRB 3GIBA 2PQWA 2PVGB 4BE2A 1WGSA 1Q82U 5GAMg 2XIDA 1N9SA 5GAN6 4M75A 3CCET 2DXCA 2MAMA 1G3TA 2QI2A 3VUBA 4JRKA 3M4GA 2X4XA 3GP8A 3ER0A 4BY6B 2I2LA 2K2VA 4C5GA 3JCMX 3KBGA 4A53A 2B8AA 3JB9I 3P8BB 1X6OA 3FB9A 4C0DB 3CCSA 1S72T 1G5VA 4OF1A 1VQOT 2OAUA 4XTYA 2K57A 2BUDA 2GCXA 3NTIA 3RIRA 5KCOA 1B34A 3OYHA 2EQUA 4M78A 5LJ3d
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P0K A;  3QKJ A;  3ME9 A;  3MP6 A;  2WAC A;  3OYM A;  2RI2 A;  2O4X A;  2M0O A;  2DAQ A;  2QQR A;  2E5Q A;  5J39 A;  4NS5 A;  4ZTF A;  4Z02 A;  5M9O A;  2RJF A;  2RO0 A;  3LGL A;  3E9F A;  3OMC A;  4B9X A;  3PMI A;  4QQ6 A;  2M16 A;  3S3N A;  5J26 A;  3O8V A;  2D9T A;  4N4I A;  3DB4 A;  2RHY A;  2E6N A;  4EDU A;  5IAY A;  2BIV A;  3L2R A;  4N4H A;  2GFA A;  3OMG A;  4ZTJ A;  3OYC A;  4UC4 A;  2L8D A;  5C6S A;  4X34 A;  2HQX A;  4IUV A;  3CEY A;  3L2U A;  3FC3 A;  3OYE A;  3MP8 A;  5FRO A;  5KE3 A;  2LCC A;  5FRM A;  4B9W A;  3GOX A;  3MEV A;  5KE2 A;  2GFU A;  5C0M A;  4BE1 A;  3OYG A;  3OYA A;  5KCH A;  3OS2 A;  1OZ3 A;  1MHN A;  4C5E A;  3L2Q A;  2FHD A;  2K3Y A;  2DIG A;  2XK0 A;  3EAE A;  2LDM A;  3Q1J A;  3KUF A;  3MEU A;  4BE0 A;  3P8D A;  2RI3 A;  4C5H A;  3H8Z A;  3L2V A;  2MWP A;  4E7J A;  3UWN A;  5FRN A;  4LD6 A;  3UT1 A;  2YRV A;  4FU6 A;  2NLU A;  2LRQ A;  3FLG A;  4PL6 A;  4BAC A;  3LGF A;  3OS0 A;  4E7L A;  2R57 A;  2GF7 A;  3OS1 A;  2XDP A;  2JTF A;  3L2W A;  3OYN A;  3DB3 A;  5D6W A;  4QQG A;  2RJC A;  3MP1 A;  3OY9 A;  2G3R A;  3OYB A;  5D6X A;  2RHU A;  1OZ2 A;  3SD4 A;  4IKF A;  1KHC A;  4IUU A;  3MO8 A;  4L59 A;  2EQM A;  3QII A;  4QW2 A;  2DIQ A;  2RI5 A;  3MET A;  2R58 A;  5IN1 A;  3OYL A;  2RHZ A;  4QQD A;  4BDY A;  3S6W A;  4E7H A;  4A4H A;  3S3O A;  1WJR A;  2EQK A;  2EQJ A;  3OB9 A;  4N4G A;  4A4G A;  4A4F A;  3QJ6 A;  2RHX A;  3OQ5 A;  4PLI A;  1WJS A;  4Q5W A;  2R5M A;  3LLR A;  3PFS A;  2X4W A;  1OYX A;  2HQE A;  4PLL A;  3PNW C;  3P8H A;  3OYJ A;  4BDZ A;  4E7I A;  2O4X B;  3NTK A;  2EFI A;  2L3R A;  4BD3 A;  4IUR A;  2MWO A;  4GY5 A;  2F5K A;  4A4E A;  2K3X A;  2RJD A;  3MEA A;  1WJQ A;  4II1 A;  4C5I A;  4IUT A;  1H3Z A;  2VYT A;  4RG2 A;  2LVM A;  1RI0 A;  3S3M A;  4HCZ A;  3LX7 A;  5CIU A;  3NTH A;  2QQS A;  3OYK A;  2M1H A;  3L42 A;  2CKK A;  2X4Y A;  5KH6 A;  3OYH A;  3H6Z A;  2RHI A;  3ASK A;  3OYI A;  1N27 A;  2BKD N;  5D6Y A;  2RJE A;  2PQW A;  3DLM A;  3OYF A;  4IUP A;  1WGS A;  4BE2 A;  3PMT A;  2JZ2 A;  2LTO A;  3OA6 A;  2IG0 A;  2EKO A;  3FEO A;  3LH0 A;  1XNI A;  3MEW A;  1SSF A;  4IUQ A;  3BDL A;  4QVZ A;  3C4S A;  2X4X A;  2L89 A;  4C5G A;  4E7K A;  3FDR A;  3ZEH A;  3LYI A;  2B8A A;  3QBY A;  4CRI A;  4FL6 A;  1G5V A;  1OI1 A;  2R5A A;  2BUD A;  3F70 A;  3M9Q A;  3NTI A;  4OVA A;  5KCO A;  2X35 A;  2EQU A;  3E9G A;  3OYD A; 
#chains in the Genus database with same CATH topology
 2J6O A;  1K4U S;  1I5O B;  3G7Z A;  3VKI A;  2MMP A;  2K5I A;  4C92 F;  3ULR B;  2V26 A;  3O8V A;  5LJ5 d;  2QEX Q;  3JCM P;  2DO3 A;  2VXE A;  1PG5 B;  2KYM A;  2AHJ B;  4FYX B;  4P5N A;  3VJP A;  1G2B A;  3VU3 C;  3FC3 A;  1VQP A;  4ZN3 A;  3FJP A;  3GPL A;  3PTA A;  1YN8 A;  2CZ0 B;  4XU0 A;  1WXT A;  1VQ6 T;  1MHN A;  3L2Q A;  1GFC A;  3M0U A;  1JJ2 P;  2F69 A;  2JM8 A;  2L5Q A;  1ZHI A;  2CSI A;  4RTT A;  1ZUU A;  1KJW A;  1T0H A;  3V7S A;  2MWP A;  3X20 B;  4E7J A;  4FW1 A;  4JRQ A;  1YNZ A;  5GMK j;  1M1K U;  2LRQ A;  2K3B A;  1XOV A;  2D0Q B;  2JMC A;  2JTF A;  3G4S T;  3G4S Q;  4JLI A;  5LJ3 e;  4EMK A;  1UEB A;  2RHU A;  2LX9 A;  1KHC A;  3CCM A;  1VQO Q;  1UGS B;  4QQD A;  3SWN B;  2KSS A;  2EQK A;  2EQJ A;  2JN0 A;  1C1A A;  5IHK A;  4DOW A;  3H0H A;  4LDW A;  2HAX A;  4GY5 A;  4FYW B;  1M4Z A;  1AVZ C;  5AYF A;  4AMC A;  5GAN 4;  3CCR A;  1ZA1 B;  1ZSZ B;  5IHI A;  2QQS A;  4J83 A;  1U3O A;  4VUB A;  2RN8 A;  2ZAE A;  2EYQ A;  3T9N A;  2VXF A;  5CQX A;  2YUO A;  4DBQ A;  3CCJ Q;  1SSF A;  2LX7 A;  4OB0 B;  1W4S A;  2COZ A;  1KQ1 A;  1YP5 A;  2R5A A;  2OAW A;  3WVE B;  1VQ4 Q;  2A36 A;  3VYH B;  2KRO A;  4M77 A;  5I2S A;  2P4T A;  5FWB A;  3CC2 A;  3PIP A;  3KFV A;  2X9H A;  5GMK m;  2W0Z A;  3E9F A;  3TVT A;  3CCE Q;  5J26 A;  4E7S A;  4C8Q F;  1SPK A;  4M4Z A;  3VS3 A;  2DJQ A;  2KEA A;  4HVV A;  4ZN1 A;  2DTO A;  4ZTJ A;  1EX4 A;  1MMG A;  5FRO A;  1T0J A;  3JB9 D;  5KCH A;  1YHQ T;  2GTO A;  1YJN T;  3L1A A;  2KRS A;  4J9I A;  2LNV A;  1K0S A;  1GXI E;  2FVU A;  5FU7 B;  3L2W A;  2QA4 A;  2P0Q A;  4C8Q B;  3OYL A;  2HNI A;  3JCM f;  3RNJ A;  2RB6 A;  3S3O A;  3THK A;  2EJ9 A;  2QA4 Q;  1G83 A;  1WHK A;  1KQ2 A;  3OQ5 A;  2YUP A;  1AD5 A;  2YWW A;  2XDD A;  2E5K A;  2DXT A;  1UGQ B;  1X6B A;  3FJ5 A;  2FZG B;  2DZ9 A;  3JCM h;  3NFC A;  2F5K A;  4A4E A;  4KRT A;  1A0N B;  2JS0 A;  4ZGJ B;  4RTY A;  4KGV B;  4JJC A;  3VS4 A;  2LJ1 A;  2Y4Y A;  2CKK A;  2DVE A;  3EGU A;  3M53 A;  4LUE A;  2NUZ A;  1VQ5 Q;  2E4H A;  3UA6 A;  5IH2 A;  3I56 A;  1C6V X;  1XNI A;  2KBT A;  4PFO A;  2ZGW A;  3VUZ A;  4F16 A;  4IIO A;  1ZBJ A;  1TH7 A;  3LYI A;  3ZEH A;  2DBM A;  4FYV B;  2X35 A;  1KG1 A;  3HP9 A;  4BY6 C;  8ATC B;  1VQK A;  1PD0 A;  4PJO F;  1PKS A;  3GNG A;  3CCE A;  3CMA A;  3EH1 A;  5CR2 A;  3HRS A;  4RMO A;  1MV0 B;  3OMC A;  3EHQ A;  4WCI A;  1M5Q 1;  5LJ3 j;  3U23 A;  2XI9 A;  4HXJ A;  3EG9 B;  4M7D D;  1X2K A;  4AT1 B;  2NYS A;  1RLQ C;  4E2F B;  2LJ0 A;  2DJZ A;  1RI9 A;  4R56 A;  1Q81 C;  1K9M C;  2GFU A;  1QP3 A;  3VRZ A;  3GLX A;  3VS1 A;  2ROL A;  2FHD A;  3JSC A;  3M57 A;  3PVQ A;  3L2Z A;  1KQS P;  3CCQ Q;  2J6K A;  2IVW A;  3M58 A;  2YXY A;  5GAN g;  3INZ A;  1JXM A;  4KGX B;  4BAC A;  2DRM A;  2DER A;  2E1H A;  1UGP B;  3OYN A;  1GCQ A;  1E6G A;  3EG9 A;  2IIM A;  4LDV A;  5D6X A;  1K1Z A;  1VIE A;  2AIR B;  1VQ5 T;  1Q81 U;  4L59 A;  4OMO A;  3CCQ A;  2RI5 A;  4OGC A;  2FPD A;  4QVC A;  2CP7 A;  4JJB A;  5GAO q;  2DXU A;  1X75 C;  2X4W A;  2HQE A;  4BDZ A;  1AWW A;  1QWE A;  2DNU A;  4OB1 B;  1GBQ A;  2K3X A;  1ZSZ C;  4ESR A;  3MPU B;  4C5I A;  4OP0 A;  1NLP C;  3CC2 Q;  1VIF A;  3PIO A;  4F14 A;  1ZQ1 A;  5ECA A;  2CRE A;  1FWZ A;  2C06 A;  3VV0 A;  2IG0 A;  2EKO A;  2L3Q A;  3BW1 A;  2VV5 A;  4J9F A;  4MZM A;  1Q86 U;  3CCS Q;  1NBE B;  1F1B B;  3M0T A;  1B07 A;  1OU8 A;  1QCF A;  3AT1 B;  3V8J A;  2VVK A;  4LD9 K;  2GTJ A;  3FIF A;  2E12 A;  4PJO D;  3EGX A;  3CC2 T;  1ZUY A;  5M9O A;  4RTX A;  3DLL A;  2EGA A;  2LT4 A;  1SRM A;  1M1K C;  3CPF A;  2X51 A;  3X25 B;  1P92 A;  2DMO A;  4ZNX A;  1K73 C;  2GFA A;  2ECZ A;  5GAN 5;  4IUV A;  4OMF B;  1M8M A;  4LDU A;  2VWF A;  1VQ7 T;  4KUL A;  3PGG A;  4BE1 A;  4BUG A;  2RK2 A;  1WX6 A;  1RAC B;  4DQ2 A;  1S1N A;  4M77 G;  2LT1 A;  4E7Z A;  4AG1 C;  5FU7 C;  2DZC A;  2VUB A;  2KXD A;  5GAN 2;  3OS0 A;  2XDP A;  3JB9 J;  4E6R A;  5D6W A;  4FYY B;  1YJN A;  3M5A A;  2DIL A;  4IKF A;  3MO8 A;  3RMQ A;  1T3L A;  4E7H A;  1RAF B;  2HCK A;  4FCY A;  2XG8 D;  2ZPG B;  4M77 B;  1S72 Q;  1J3T A;  4PFZ A;  3QYG B;  2LNH B;  2PVO B;  2L3S A;  1FXX A;  1RAG B;  2OTJ Q;  3X28 B;  2F2W A;  2KR3 A;  3CC4 T;  3A5Z B;  2FYK A;  3M59 A;  4M78 F;  2MIO A;  1NYG A;  2ZPE B;  3L42 A;  2X4J A;  5L8R E;  4Y92 A;  4BE2 A;  1Q82 U;  1N9S A;  1QWF A;  1X69 A;  3GP8 A;  1VQM Q;  1TTH B;  4BY6 B;  3JCM X;  3KBG A;  3P8B B;  1YJW Q;  1IO6 A;  2BUD A;  3RIR A;  1WHG A;  3OW2 P;  2CP3 A;  3I56 T;  1BU1 A;  2E5Q A;  4M77 F;  4PK4 A;  5GJV B;  4ELY C;  3LGL A;  3PMI A;  4QQ6 A;  1N8R C;  4N4I A;  1D09 B;  2HDA A;  2ZPB B;  1QKW A;  4LNP A;  3EGD B;  3JCM b;  3A8H B;  2BIV A;  2KQW A;  2O31 A;  3X26 B;  1VQ8 Q;  3NGP A;  2JXB A;  1YIT T;  1YJN Q;  4M77 E;  3TSZ A;  1M2O A;  2QQB A;  4KGZ B;  3G6E Q;  5KE3 A;  1YJW T;  1VQ9 T;  1MMN A;  4QT7 A;  4C92 A;  1VQ6 A;  4MML A;  5GAN 3;  4C8Q D;  5L23 A;  2L0A A;  3QG1 A;  1LNX A;  4C5E A;  2K6D A;  3CD6 A;  1OX9 A;  4BE0 A;  2BE7 D;  2FB7 A;  2O88 A;  4JUV A;  4C0F A;  3R6N A;  4LD6 A;  3HSB A;  1VQL T;  1CKA A;  2K9G A;  1BYM A;  1NEB A;  1D1B A;  1EZZ B;  4ME7 A;  4MDX A;  1ZBX A;  2MI6 A;  1VYT A;  3X24 B;  3S6W A;  2AT1 B;  1UEC A;  3OB9 A;  1VQM T;  1M9S A;  1VQ4 T;  2RQW A;  4M77 D;  4XTW A;  3I5S A;  3LLR A;  1NJI U;  1FMV A;  4Y28 E;  1YJ9 T;  1LVK A;  2V8J A;  4BI4 A;  1JJ2 S;  1IHV A;  2EBP A;  4JRI A;  1RAE B;  1M90 C;  2DL8 A;  2DL7 A;  4AFS C;  1ZLM A;  2RNA A;  4PJO C;  2LVM A;  4PKC C;  4M75 G;  4HT8 A;  3NTH A;  4OMP A;  1WHJ A;  2C0O A;  2XMF A;  2JVV A;  3O5Z A;  3E1S A;  3OYF A;  1B3Q A;  4IUP A;  5GAN h;  2DE0 X;  5CKD A;  4J9B A;  2OTL T;  3MEW A;  3UAT A;  4CC2 A;  3SDZ A;  4RUG A;  2WSC E;  2KGT A;  4KH0 B;  2CZ6 B;  3FDR A;  3RBB B;  2D8H A;  2E3I A;  2WSE E;  3VS0 A;  3QWY A;  2F2X A;  4M75 C;  3OYM A;  1I8F A;  4PJO A;  2LMJ A;  1YI2 Q;  1PNJ A;  2JNG A;  4KUI A;  4M7A C;  1HSQ A;  1KHI A;  2D0N A;  1M30 A;  2CH4 A;  5LJ3 g;  4OGE A;  3EGD A;  2DX1 A;  3OYC A;  1LOJ A;  2DA9 A;  2QK0 A;  4PNO A;  2AZS A;  3CEY A;  5LJ5 f;  4HCK A;  1HXD A;  5LJ3 h;  1M1G A;  1QVF P;  4M7D G;  2CZ1 B;  3CMA T;  4J9E A;  5IT9 E;  2KVQ G;  4GBQ A;  5EG2 A;  4D6W A;  4MMK A;  3EFO B;  2E6Z A;  3KUF A;  1BI0 A;  1VQ8 A;  2ZPF B;  3J7A F;  5KYN A;  1Y96 B;  1M2V A;  1HYO A;  1UB4 A;  3EFO A;  2EIF A;  1I07 A;  3OYY A;  4M77 C;  4FT4 A;  2DIQ A;  4C8Q G;  4M7D C;  2EYW A;  2R5M A;  1KIK A;  3PFS A;  1KQS A;  3PNW C;  4XU2 A;  3NTK A;  4IUR A;  4N0A C;  3MEA A;  2PVD B;  1XJW B;  3G71 A;  2V1Q A;  4M78 E;  1X6G A;  4J6W A;  4LN2 A;  5KYW A;  2LCL A;  4FM4 B;  3V7R A;  4DBH A;  3OYK A;  3SEM A;  5FWC A;  2X4Y A;  3UDC A;  4C92 C;  2RHI A;  2DRK A;  5KYU A;  3RER A;  5CKE A;  3OYI A;  2YUQ A;  5D6Y A;  4Z89 A;  1TG0 A;  4D8K A;  1K73 U;  5GAN 8;  4DBF A;  2J7I A;  3BDL A;  3A8O B;  2DK3 A;  5CK9 A;  1YIJ T;  2K4Y A;  3CC4 A;  1H92 A;  4FL6 A;  2ZPI B;  4RTU A;  1WXU A;  3F70 A;  3E9G A;  3QKJ A;  5AT1 B;  1VA7 A;  2RQU A;  2XIC A;  2JMA A;  3VS5 A;  4F17 A;  2RJF A;  4ZGE B;  1LPL A;  1YIJ A;  1OX8 A;  2JOY A;  3L2R A;  5LJ5 g;  2CP5 A;  3QXE B;  1N8R R;  4UC4 A;  5DY9 A;  1VQN T;  1YCS B;  3SWN A;  2NUT B;  1HD3 A;  2E65 A;  2FZC B;  1RAD B;  1W2B P;  4CC7 A;  1FMK A;  3OYG A;  1QCO A;  5LJ5 h;  5CKH A;  1QCN A;  3KXT A;  1GCQ C;  1GRI A;  5CQY A;  5FU6 B;  2P84 A;  2CP0 A;  3TU4 K;  1UGV A;  1BI2 A;  2R57 A;  4M7A E;  1IRE B;  1BCO A;  3MP1 A;  3OYB A;  1PRM C;  1WPY A;  5GAO l;  3JB9 G;  4L6V 5;  1NLO C;  3QII A;  3AHU A;  4NL3 A;  1M1K R;  4M7A F;  1VQM A;  1U5S A;  3C94 A;  2QA4 T;  1RAB B;  3IQL A;  4DOV A;  2XDB A;  2K5L A;  3HFN A;  1KC8 U;  3A8G B;  1PC0 A;  2BTT A;  1Z9Q A;  5GAN f;  1EFN A;  4M78 D;  2YRD A;  3CD6 Q;  1BKB A;  1K9M R;  1X43 A;  2K79 A;  4J9D A;  1X01 A;  1M90 U;  1GL5 A;  3E19 A;  3I5R A;  3HRT A;  4CRI A;  4M75 B;  2CT4 A;  1OI1 A;  1EIF A;  2A0F B;  1UDL A;  1MND A;  1QVF S;  4M7A B;  1JQQ A;  2RI2 A;  2L3P A;  4Z02 A;  2QTX A;  4PJN A;  4HCC A;  3CCV Q;  3JCM e;  3CME T;  1K76 A;  1YWO A;  2E6N A;  4RCB A;  1NE8 A;  1KD1 C;  2EVR A;  4RTV A;  2VGM A;  2KDS A;  4JLG A;  1WZO A;  2DEU A;  4L5G A;  3FRN A;  4ORZ A;  1BI3 A;  3OS2 A;  1IGQ A;  4XTZ A;  1PKT A;  5J3B A;  3CCV T;  2JUF A;  4OMQ A;  2KXC A;  1D3B A;  2NUP B;  3URG A;  4MZT A;  1OOT A;  4FT2 A;  2LZ6 B;  2CT3 A;  1OU9 A;  1HK9 A;  1X2Q A;  1YIT A;  1ZA2 B;  3CMA Q;  1Y71 A;  2G3R A;  1RAA B;  3HKS A;  1OQK A;  1PWT A;  3G4S A;  4QW2 A;  4E7I A;  1Y07 A;  4BDY A;  1Y57 A;  3CPW P;  4M7A D;  1VUB A;  3QWX X;  3A8L B;  3VS7 A;  4EPC A;  3PE0 A;  2HSE B;  1OYX A;  5HCK A;  3VYG A;  1RAI B;  4JZ4 A;  3RDV A;  3REB B;  1KQS S;  5GMK i;  1YWP A;  2RJD A;  1OPL A;  1WQW A;  1WHL A;  5IXB A;  2GBQ A;  4C92 B;  2VYT A;  1PCX A;  4HCZ A;  4XTV A;  1PRL C;  1WI7 A;  2BE9 B;  2COY A;  2OTL A;  4X1V A;  1ACM B;  1SHG A;  5A0G A;  3CCR T;  1TSF A;  3QDR B;  2PQW A;  2XID A;  2JTE A;  2DXC A;  2MAM A;  1G3T A;  1JU5 C;  2QI2 A;  4JRK A;  1I0C A;  4R0K A;  2I2L A;  2K2V A;  4A53 A;  2DYB A;  2O9S A;  3CCR Q;  3FB9 A;  4C0D B;  3CCS A;  4AFQ C;  1G5V A;  1VQO T;  2OTL Q;  2GNC A;  4XTY A;  1IXD A;  2DYI A;  2DVJ A;  2GCX A;  5KCO A;  1MMD A;  4M78 A;  1X27 A;  3QJY A;  4X9C A;  2M0O A;  2DEQ A;  2OTJ A;  3EFR A;  2LQK A;  1SEM A;  4R55 A;  2M16 A;  5A2Q E;  4XTU A;  1WA7 A;  9ATC B;  1WLP B;  3CCM Q;  1VQO A;  4EDU A;  4BB7 A;  3CXC P;  3JB9 H;  1BIB A;  4EMH A;  2E41 A;  1JJ2 A;  4C92 E;  1QW1 A;  4ZGD B;  4F7U A;  4RKU E;  5FRM A;  2LCC A;  2X3X D;  4B9W A;  1AWO A;  4GLM A;  4M78 C;  1BK2 A;  1TUG B;  1OZ3 A;  2AKL A;  4MZP A;  2V8K A;  4QKU A;  1Q7Y R;  4C8Q C;  4JS5 A;  4QVD A;  3OSV A;  2D6F A;  1O75 A;  1RAH B;  2KE9 A;  2YRV A;  5CKF A;  4FU6 A;  2CP6 A;  4M7D E;  3M56 A;  4OB2 B;  4F7U B;  1UJY A;  4Y91 A;  1OEB A;  1U8R A;  2EQI A;  1OZ2 A;  2QTV A;  3MCA B;  4IUU A;  2EQM A;  5GJW B;  1M27 C;  2R58 A;  3CCQ T;  2HL5 C;  1O9S A;  3JCM V;  4F04 B;  1IGU A;  4X9D A;  5KYY A;  4OML A;  4LDX A;  4J9C A;  1YJ9 A;  2M0Y A;  1D0X A;  4PLL A;  3V8L A;  3P8H A;  1I5L A;  1VQL Q;  4GLK A;  3MKD A;  1LCK A;  4KT0 E;  3G1J A;  2EKH A;  3OW2 A;  1MGQ A;  1TXQ A;  1IRX A;  2A37 A;  2E70 A;  5CKB A;  2RA2 A;  4DEX A;  4EMK B;  1R0C B;  3EH2 A;  2JZ2 A;  3OA6 A;  5FLX E;  2EWN A;  5KYX B;  4HVW A;  2RMO A;  3CBO A;  1VOM A;  2NUT A;  5A0D A;  4IUQ A;  2L2P A;  4YTL A;  1YIT Q;  5I11 A;  2L89 A;  1NPP A;  3CBM A;  3CC7 Q;  3M9Q A;  2SEM A;  4J7I A;  4M75 E;  2P0K A;  3OYD A;  1YJW A;  1Q82 C;  1WYX A;  4NS5 A;  3NMZ C;  3RKW A;  1XQH A;  1W6X A;  1AOJ A;  2BZ8 A;  4KUD K;  4ELZ C;  4BI8 B;  1D3B B;  2NUP A;  5LL6 S;  3RES A;  3H41 A;  4J6X A;  4C92 D;  4FSX A;  3V8K A;  3GOX A;  3M54 A;  3OBY A;  5GAM f;  1U1S A;  1B34 B;  1G3Y A;  1RL2 A;  3VRY A;  3MEU A;  4C5H A;  3CCU T;  2JT4 A;  5GAN 7;  2QEX A;  1JRI A;  1CSK A;  2CSQ A;  2P0P A;  3CPW S;  2J06 A;  2GF7 A;  1ZX6 A;  2GQV A;  4J8O A;  1VQ9 A;  1N6A A;  1VQN Q;  1UJ0 A;  1BIA A;  1MV3 A;  3HPW A;  3BY7 A;  5IXF A;  4XU1 A;  4N4G A;  4PJM A;  2QAZ A;  4M7A A;  1M3C A;  1AHJ B;  2FPF A;  1YIJ Q;  2O4X B;  4BD3 A;  1SRL A;  2C0T A;  2KT1 A;  2M51 A;  3CCU Q;  1BB9 A;  2KNB B;  1H64 1;  1I4K 1;  3EG1 A;  1RI0 A;  3SWN C;  2KT8 A;  4AFU C;  1SKU B;  1Y0M A;  1G3W A;  1CKB A;  2FL7 A;  2M1H A;  1RUW A;  1QQJ A;  4PJO E;  1AT1 B;  2PU9 B;  1N8R U;  2CUB A;  3JCM g;  3DLM A;  2LQ8 A;  1TOV A;  1I1J A;  2W10 A;  3PT9 A;  3C4S A;  2HQH A;  2KRM A;  2ED1 A;  3ZL7 C;  3CCS T;  1M8V A;  3CCJ A;  2QDY B;  2YDL A;  3DKM A;  1M3B A;  2YLC A;  2OI3 A;  2F2V A;  4FIB A;  3G71 Q;  2MF2 A;  1D0Z A;  2XU8 A;  2DBK A;  3BDU A;  2LQW A;  5DM7 R;  3UPU A;  2KY9 A;  3S3N A;  2DXB A;  1KK7 A;  2PUO B;  4PJO G;  5GAN d;  4JZ3 A;  4LDY A;  2H3J A;  3SHW A;  4XK8 E;  2Y90 A;  1Q81 R;  2YRC A;  2EYZ A;  4M78 B;  3OYE A;  3PVL A;  1VQ9 Q;  2VB6 A;  1VQN A;  1ZUK A;  2DPP B;  3I55 A;  1TWB A;  2K7A A;  5GAM e;  1WXB A;  4V2S A;  3QZ9 B;  2FG0 A;  4FSS A;  2AKK A;  3JV3 A;  3EFS A;  1KC8 R;  3H0F A;  2JTM A;  2LDM A;  1BI1 A;  3P8D A;  2FRW A;  3MJX A;  3TQ7 P;  1IZ6 A;  3I55 T;  2LC4 A;  4C8Q A;  1V29 B;  2QQ9 A;  4WF2 A;  4QQG A;  2RJC A;  4NL2 A;  4C0Z A;  1QVG P;  4OMN A;  4RCC A;  3M0S A;  2AK5 A;  4A4H A;  1G3S A;  3RKY A;  2RQV A;  4J7F A;  2CYZ B;  4PLI A;  5LJ3 f;  2EGC A;  3OYJ A;  6AT1 B;  2KYB A;  2DL5 A;  2LCS A;  2PUK B;  2EFI A;  2L3R A;  2QGF B;  1U06 A;  1V1C A;  5GAN e;  1WJQ A;  2ENM A;  2K2M A;  2KAF A;  3R6O A;  1K0X A;  4RG2 A;  3CC4 Q;  2HBW A;  1W2B S;  3H6Z A;  3ASK A;  1QLY A;  1YCY A;  5KYW B;  3LH0 A;  1HJD A;  3LH5 A;  2VAS A;  5FW9 A;  1ABO A;  4WTO B;  2JW4 A;  4AG2 C;  2BZX A;  3QBY A;  3TCJ A;  3JCM d;  3QUI A;  1YI2 A;  2PNI A;  3QDF A;  1T3S A;  1G8X A;  5DLQ E;  1FYN A;  3NPF A;  1Y7X A;  2DTI A;  2ZPH B;  2O4X A;  3H9N A;  1Q86 C;  2DD5 A;  3M55 A;  1YFN A;  4B9X A;  2D9T A;  3CME A;  2LJ3 A;  2V1R A;  3ZFJ A;  4DEY A;  4PJL A;  1M2V B;  2M9U A;  2L8D A;  4X34 A;  3BE3 A;  2EJG A;  2YT6 A;  2QDL A;  2C0I A;  3HTR A;  1MUZ A;  3MEV A;  2D8J A;  1Y96 A;  4TVR A;  3G6E T;  3LWI A;  3EAE A;  3Q1J A;  3CCL T;  4N0A A;  2RI3 A;  1VQ8 T;  1H3H A;  3L2V A;  3BFM A;  5FRN A;  1WHM A;  2B86 A;  3CD6 T;  1D0Y A;  2COW A;  3UT1 A;  3FLG A;  4PL6 A;  3V7C A;  1QVF A;  4IIM A;  3M4Y A;  2DM1 A;  1VQP T;  3EGX B;  2EYX A;  5GAM h;  3C95 A;  4AFZ C;  2VC8 A;  4NOY A;  3G71 T;  1AWJ A;  1NEG A;  2RHZ A;  4PJO B;  2CGH A;  2QYZ A;  1FX7 A;  4A4G A;  5GAN j;  2KK4 A;  3RKX A;  2QGG A;  2HBP A;  4A4F A;  1N5Z A;  2RHX A;  3CXC A;  1WJS A;  3RMS A;  2KMT A;  1GCP A;  2MOX A;  2DD4 A;  4M78 G;  4HCB A;  2YUN A;  2CH4 W;  3J81 E;  5EC7 A;  4DA4 A;  5KYX A;  4E47 A;  5KH6 A;  2YSQ A;  1Q7Y C;  1FMW A;  3EG3 A;  3RR6 A;  2PVG B;  1WGS A;  4JJD A;  5GAN 6;  1KD1 R;  2ESW A;  2FPE A;  3VUB A;  3M4G A;  2X4X A;  2FRY A;  1S72 T;  2OAU A;  1W70 A;  1VYU A;  2K57 A;  1B34 A;  3I9Q A;  2KRN A;  2M02 A;  3OYH A;  2IPO B;  4EIK A;  2OTJ T;  5HKC A;  4ZTF A;  3JRZ A;  5GAO r;  3CBP A;  2RO0 A;  5KYY B;  2F1L A;  2RQT A;  4JRP A;  3A1P A;  1K8A U;  3GBQ A;  1VYV A;  4HKE A;  5IHN A;  2RHY A;  3QSU A;  3OMG A;  1ABQ A;  4KBM B;  4DBR A;  2VKN A;  2HZY A;  2QXF A;  1PD1 A;  5A0L A;  4JS4 A;  3OW2 S;  4LUD A;  1E7O A;  5C0M A;  1PHT A;  1NYF A;  3JCM Q;  1R8O B;  1QKX A;  2WSF E;  2F5T X;  2DIG A;  3JCM c;  4J9G A;  2O01 E;  4XQ3 A;  4D8D A;  3H8Z A;  4J5Y A;  4M7D B;  2A7Y A;  3J80 E;  1JXO A;  1Z9Z A;  4E7L A;  3LGF A;  1QP2 A;  7AT1 B;  2BZY A;  4CI0 C;  2FEI A;  1UGR B;  3E2U A;  1AWX A;  5IN1 A;  3QHS A;  3EHR A;  1JB0 E;  1OUL A;  1VQL A;  2EGE A;  3REA B;  2PTK A;  3CCV A;  2KI7 A;  5D7U A;  5GAM d;  4II1 A;  3HRU A;  4PJJ A;  3WVD B;  2O9V A;  4O6J A;  3S3M A;  1M1F A;  2J6F A;  1MNE A;  4JJN K;  3ZBD A;  8AT1 B;  2A08 A;  1N27 A;  1D1A A;  5CO7 A;  4HVU A;  2RJE A;  2ED0 A;  4B6M A;  3PMT A;  2LTO A;  3CCL Q;  1KC8 C;  3FEO A;  2DF6 A;  1SG5 A;  5GAO m;  1VQK T;  1DJ7 B;  1RLP C;  2RH2 A;  3H0I A;  5GAO n;  1K9M U;  2HKQ B;  1WIE A;  2D1X A;  4OVA A;  5I2M A;  5GMK h;  2WAC A;  3QO3 A;  2DAQ A;  2QQR A;  3VS2 A;  3WXM B;  1D1C A;  1SSH A;  4ANJ A;  2HD0 A;  5LJ5 j;  3DB4 A;  1PM3 A;  1YI2 T;  2RM4 A;  2CS7 A;  5GAO p;  2GQI A;  1UFF A;  2XD0 A;  1LJO A;  5FU6 C;  2ABL A;  2YHT A;  1H8K A;  4C0G A;  2QAS A;  1R0B G;  4CC3 A;  2DLP A;  3OYA A;  3G6E A;  2G6F X;  3M0P A;  2XK0 A;  1UE9 A;  4A54 A;  1NZ9 A;  2QQA A;  1GBR A;  4K11 A;  3OBW A;  4M7A G;  3HL8 A;  3M0R A;  1WHH A;  4O5V A;  1QVG A;  5CCA A;  2H8H A;  4RTZ A;  3TRE A;  2O2O A;  3L2U A;  3OSS C;  4MDW A;  1PSF A;  2EAY A;  2QG9 B;  1B7T A;  2HL3 A;  3CCM T;  2P4R A;  3CXC S;  4M75 D;  2XHC A;  1WFW A;  2A28 A;  2E10 A;  2JS2 A;  1BCM A;  1Q82 R;  4IUT A;  4XAX B;  1H3Z A;  2NWM A;  3NHN A;  3LX7 A;  4HT9 A;  2CZ7 B;  2EJF A;  4Z8A A;  2JJ9 A;  1UG1 A;  4Z88 A;  2BKD N;  4M7D F;  1UTI A;  3CC7 T;  1WQ7 A;  4QVZ A;  2YLB A;  2EW3 A;  5GAM j;  4ATO A;  1VQ7 A;  3JAM E;  1Q95 G;  3D7S B;  1PSE A;  4OB3 B;  3MP6 A;  4JPB W;  1VQK Q;  3SB2 A;  1UUE A;  2VGN A;  2EPD A;  3C12 A;  1KFZ A;  2AZV A;  4LE9 A;  3I56 Q;  1OPK A;  4N4H A;  4KH1 B;  1NM7 A;  2EYY A;  2MCN A;  5C6S A;  1VQ6 Q;  2ZZD A;  3M0Q A;  4A63 B;  1TU0 B;  5DLO A;  1YHQ Q;  3JCM J;  3CCL A;  2RK1 A;  4XTX A;  1W2B A;  3JCM W;  1IHW A;  3RUX A;  4F7U G;  4C8Q E;  4EMG A;  5I21 A;  4HA8 A;  2DTH A;  1YHQ A;  4M7D A;  2A3L A;  4RG8 A;  1NJI C;  5CVI A;  1YJ9 Q;  3OS1 A;  3N5B B;  3DB3 A;  1Q7Y U;  2MYS A;  1NJI R;  2K5F A;  2PZ1 A;  3SD4 A;  1BBZ A;  1VQ5 A;  4J6Y A;  1TUC A;  1V76 A;  2I0N A;  5CAI A;  2V8I A;  1W1F A;  3HHT B;  1JBM A;  2CDT A;  4Q5W A;  3SFM A;  3LWH A;  3QPH A;  3CCU A;  2ROT A;  2MWO A;  3CCJ T;  3UF4 A;  1JEG A;  2FO0 A;  5HK0 A;  1R77 A;  1E6H A;  4C0D C;  5CIU A;  1VQ4 A;  3CC7 A;  5KYU B;  3I35 A;  3OS5 A;  3CQT A;  5GMK l;  1OV3 A;  2CUD A;  1C0M A;  1JO8 A;  1VQP Q;  3A98 A;  4F7U F;  1K8A C;  4E7K A;  1MMA A;  1I81 A;  1VQ7 Q;  2OX7 A;  2RF0 A;  1QVP A;  4XU3 A;  2DKG A;  3ME9 A;  4A4K A;  1YBY A;  2RPN A;  5J39 A;  1TS9 A;  5I22 A;  2H3E B;  4PFP A;  2MK5 A;  1WDX A;  5IAY A;  1K9A A;  3EG0 A;  3QZ5 B;  3VS6 A;  1S72 A;  2GGR A;  1UHF A;  2HQX A;  4JDS A;  3UA7 A;  2OJ2 A;  3MP8 A;  1M90 R;  1U1T A;  2J05 A;  1TUD A;  4M75 F;  5KE2 A;  1GFD A;  2DL3 A;  2HKN A;  2K3Y A;  2FZK B;  3TEE A;  4C92 G;  4F7U E;  1N9R A;  2DL4 A;  1AEY A;  3UWN A;  4OMM A;  4LXC A;  3CPW A;  2E64 A;  2NLU A;  2HMA A;  2QEX T;  2SRC A;  3HFO A;  2HEQ A;  5LJ5 e;  2ZCF B;  4BI3 A;  3GF5 A;  2XKO C;  2ATC B;  4J9H A;  3LW5 E;  2LP5 A;  2RQR A;  3OY9 A;  1AZG B;  1KSW A;  1KD1 U;  1IB8 A;  1ARK A;  1QVG S;  1NG2 A;  1WNL A;  3MHX A;  5GMK e;  3MET A;  4RTW A;  1WJR A;  5HK3 A;  2LQN A;  3QJ6 A;  1XTD A;  2RD1 A;  3JB9 F;  4EMK C;  2E3H A;  2DFU A;  1QMC A;  3GNF B;  3QYH B;  1SHF A;  3CME Q;  1K73 R;  3A8M B;  1UHC A;  1Q86 R;  1K8A R;  5HY6 A;  3C0C A;  1ZSG A;  3EG2 A;  2Y4X A;  2CP2 A;  1NPR A;  3GIB A;  2DET A;  1ZSZ A;  5GAM g;  3CCE T;  4M75 A;  2X3W D;  1SF9 A;  3ER0 A;  4C5G A;  1M3A A;  2B8A A;  3JB9 I;  1AZE A;  3I55 Q;  1X6O A;  2MPX C;  4OF1 A;  3TSW A;  2HSP A;  2Z0W A;  4FW2 A;  3NTI A;  2JM9 A;  2EQU A;  4CC4 B;  5LJ3 d; 
#chains in the Genus database with same CATH homology
 3QJY A;  4X9C A;  5HKC A;  2OTJ T;  3G7Z A;  2M0O A;  3I56 T;  3VKI A;  2DEQ A;  2E5Q A;  2MMP A;  4M77 F;  2OTJ A;  4ZTF A;  3JRZ A;  2K5I A;  5GAO r;  3EFR A;  3CBP A;  4C92 F;  2LQK A;  2RO0 A;  3LGL A;  4ELY C;  4R55 A;  3PMI A;  4QQ6 A;  2M16 A;  5A2Q E;  3O8V A;  4XTU A;  4JRP A;  1N8R C;  1K8A U;  5LJ5 d;  4N4I A;  1VQO A;  4HKE A;  3JCM P;  2ZPB B;  2DO3 A;  2RHY A;  2VXE A;  4BB7 A;  4EDU A;  3JB9 H;  3JCM b;  3A8H B;  3QSU A;  2BIV A;  2KQW A;  2AHJ B;  1BIB A;  3X26 B;  4EMH A;  2E41 A;  4P5N A;  3OMG A;  3VJP A;  1JJ2 A;  4C92 E;  4KBM B;  1QW1 A;  3VU3 C;  4ZGD B;  3FC3 A;  4ZN3 A;  1VQP A;  1YIT T;  3FJP A;  2QXF A;  4M77 E;  3GPL A;  4F7U A;  2QQB A;  3PTA A;  5A0L A;  4RKU E;  5KE3 A;  2LCC A;  5FRM A;  4JS4 A;  1YJW T;  3OW2 S;  1VQ9 T;  2CZ0 B;  4B9W A;  4XU0 A;  4C92 A;  1VQ6 A;  4M78 C;  4MML A;  5C0M A;  4C8Q D;  5GAN 3;  1VQ6 T;  3JCM Q;  1R8O B;  3QG1 A;  1OZ3 A;  4MZP A;  1LNX A;  1MHN A;  4C5E A;  3L2Q A;  2WSF E;  2F5T X;  2DIG A;  2V8K A;  3JCM c;  3CD6 A;  2O01 E;  2F69 A;  4XQ3 A;  4BE0 A;  2L5Q A;  1ZHI A;  3H8Z A;  2FB7 A;  4C8Q C;  4JS5 A;  4JUV A;  4QVD A;  4J5Y A;  4C0F A;  4M7D B;  3V7S A;  2MWP A;  3OSV A;  3X20 B;  4E7J A;  2A7Y A;  4JRQ A;  4LD6 A;  3J80 E;  2D6F A;  1O75 A;  5CKF A;  2YRV A;  4FU6 A;  5GMK j;  1M1K U;  2LRQ A;  4E7L A;  1XOV A;  4M7D E;  3LGF A;  1VQL T;  2D0Q B;  3M56 A;  4OB2 B;  4F7U B;  1QP2 A;  2JTF A;  3G4S T;  4Y91 A;  5HK3 A;  4JLI A;  1BYM A;  5LJ3 e;  4EMK A;  1U8R A;  4CI0 C;  1UEB A;  2RHU A;  4ME7 A;  4MDX A;  1UGR B;  1ZBX A;  1OZ2 A;  2LX9 A;  2MI6 A;  1KHC A;  3MCA B;  4IUU A;  3CCM A;  1UGS B;  2EQM A;  3X24 B;  5IN1 A;  2R58 A;  4QQD A;  3CCQ T;  3S6W A;  3SWN B;  2KSS A;  3QHS A;  1O9S A;  1JB0 E;  3JCM V;  2EQK A;  2EQJ A;  1M9S A;  2JN0 A;  3OB9 A;  1VQ4 T;  1VQM T;  4M77 D;  4X9D A;  4XTW A;  1VQL A;  4LDX A;  3LLR A;  1YJ9 A;  1NJI U;  4PLL A;  4DOW A;  3V8L A;  3P8H A;  4Y28 E;  4LDW A;  1YJ9 T;  2HAX A;  1I5L A;  2V8J A;  3CCV A;  4BI4 A;  1JJ2 S;  4GLK A;  4GY5 A;  1M4Z A;  5GAM d;  4KT0 E;  5AYF A;  4II1 A;  4JRI A;  1M90 C;  3HRU A;  3WVD B;  5GAN 4;  3OW2 A;  1MGQ A;  4PJO C;  2LVM A;  3CCR A;  4O6J A;  3S3M A;  1M1F A;  4PKC C;  4M75 G;  4JJN K;  3ZBD A;  4HT8 A;  3NTH A;  2QQS A;  4J83 A;  2E70 A;  4VUB A;  3T9N A;  2EYQ A;  5CKB A;  2RA2 A;  2JVV A;  4EMK B;  1N27 A;  5CO7 A;  3E1S A;  2RJE A;  2VXF A;  3OYF A;  5GAN h;  4IUP A;  5CQX A;  3PMT A;  2JZ2 A;  2LTO A;  5CKD A;  5FLX E;  2EWN A;  3FEO A;  3OA6 A;  1KC8 C;  2OTL T;  3MEW A;  3CBO A;  1SSF A;  4IUQ A;  3SDZ A;  5A0D A;  4YTL A;  4OB0 B;  5GAO m;  1W4S A;  2WSC E;  2L89 A;  1DJ7 B;  1VQK T;  2CZ6 B;  3FDR A;  1NPP A;  2RH2 A;  3CBM A;  5GAO n;  1KQ1 A;  1K9M U;  2R5A A;  2WSE E;  3M9Q A;  3WVE B;  4OVA A;  4J7I A;  5I2M A;  4M75 E;  2P0K A;  3OYD A;  3VYH B;  1YJW A;  4M77 A;  5GMK h;  5I2S A;  4M75 C;  1Q82 C;  2P4T A;  2WAC A;  3QO3 A;  3OYM A;  1I8F A;  2DAQ A;  2QQR A;  3CC2 A;  4PJO A;  4NS5 A;  3PIP A;  3RKW A;  2JNG A;  1XQH A;  4KUI A;  3WXM B;  5GMK m;  4M7A C;  3E9F A;  1KHI A;  5J26 A;  2HD0 A;  5LJ5 j;  4C8Q F;  3DB4 A;  4KUD K;  4ELZ C;  5LJ3 g;  4OGE A;  1YI2 T;  2RM4 A;  4ZN1 A;  2CS7 A;  2DTO A;  4ZTJ A;  4BI8 B;  1D3B B;  1LOJ A;  3OYC A;  4PNO A;  5GAO p;  3CEY A;  5LL6 S;  5LJ5 f;  3RES A;  2XD0 A;  1LJO A;  4J6X A;  5FRO A;  5FU6 C;  4C92 D;  2YHT A;  3JB9 D;  4C0G A;  4FSX A;  1HXD A;  3V8K A;  3GOX A;  5LJ3 h;  3M54 A;  3OBY A;  1M1G A;  5GAM f;  4M7D G;  3OYA A;  2CZ1 B;  5KCH A;  3G6E A;  3CMA T;  1U1S A;  1B34 B;  5IT9 E;  1YHQ T;  1G3Y A;  1RL2 A;  2KVQ G;  2XK0 A;  5EG2 A;  4MMK A;  3L1A A;  4D6W A;  1YJN T;  2E6Z A;  3KUF A;  1BI0 A;  3MEU A;  1VQ8 A;  4C5H A;  2ZPF B;  4A54 A;  3J7A F;  1Y96 B;  3CCU T;  2LNV A;  5GAN 7;  2QEX A;  1JRI A;  1NZ9 A;  1UB4 A;  2QQA A;  2P0P A;  3CPW S;  1GXI E;  2FVU A;  2GF7 A;  3OBW A;  5FU7 B;  4M7A G;  3L2W A;  3HL8 A;  4O5V A;  2EIF A;  1QVG A;  5CCA A;  2GQV A;  3TRE A;  3OYY A;  2QA4 A;  4J8O A;  1VQ9 A;  1N6A A;  4M77 C;  2P0Q A;  4FT4 A;  3L2U A;  4C8Q B;  3OYL A;  2HNI A;  2DIQ A;  4C8Q G;  1BIA A;  3OSS C;  3JCM f;  4MDW A;  2RB6 A;  3HPW A;  4M7D C;  3BY7 A;  1PSF A;  2EAY A;  3S3O A;  4XU1 A;  2EJ9 A;  4N4G A;  1KQ2 A;  4M7A A;  3OQ5 A;  1AHJ B;  2XDD A;  3CCM T;  2R5M A;  3PFS A;  3CXC S;  1KQS A;  3PNW C;  2DXT A;  1UGQ B;  4M75 D;  2O4X B;  4XU2 A;  3NTK A;  2DZ9 A;  3JCM h;  2XHC A;  4IUR A;  4N0A C;  4BD3 A;  3NFC A;  2F5K A;  4A4E A;  2E10 A;  3MEA A;  2PVD B;  3G71 A;  4M78 E;  4IUT A;  4XAX B;  1H3Z A;  1H64 1;  1I4K 1;  4ZGJ B;  1RI0 A;  3SWN C;  4J6W A;  3LX7 A;  4HT9 A;  2LCL A;  4FM4 B;  2CZ7 B;  2EJF A;  1G3W A;  3V7R A;  3OYK A;  2Y4Y A;  2FL7 A;  2M1H A;  2CKK A;  2DVE A;  2X4Y A;  3UDC A;  4C92 C;  2RHI A;  3RER A;  4PJO E;  2PU9 B;  5CKE A;  3OYI A;  2BKD N;  1N8R U;  5D6Y A;  3M53 A;  4M7D F;  3JCM g;  3DLM A;  1K73 U;  5GAN 8;  3CC7 T;  2LQ8 A;  3I56 A;  1XNI A;  5GAN j;  3PT9 A;  3BDL A;  3A8O B;  1WQ7 A;  2ZGW A;  4QVZ A;  3C4S A;  2DK3 A;  3VUZ A;  5CK9 A;  2YLB A;  1TH7 A;  2K4Y A;  3LYI A;  3ZEH A;  3CCS T;  1YIJ T;  3CC4 A;  5GAM j;  4FL6 A;  1M8V A;  4ATO A;  3CCJ A;  2QDY B;  2ZPI B;  3F70 A;  2X35 A;  1KG1 A;  3DKM A;  3E9G A;  3HP9 A;  2YLC A;  4BY6 C;  1VQK A;  1VQ7 A;  3QKJ A;  3JAM E;  4PJO F;  1PSE A;  2XIC A;  4OB3 B;  3MP6 A;  3GNG A;  4FIB A;  3CCE A;  3SB2 A;  3CMA A;  5CR2 A;  2VGN A;  3HRS A;  2MF2 A;  2RJF A;  4RMO A;  2XU8 A;  3BDU A;  3C12 A;  3OMC A;  4ZGE B;  5DM7 R;  3UPU A;  2KY9 A;  1YIJ A;  3S3N A;  2DXB A;  2PUO B;  4PJO G;  5GAN d;  1M5Q 1;  5LJ3 j;  4LDY A;  2JOY A;  3L2R A;  2XI9 A;  2H3J A;  4N4H A;  5LJ5 g;  4XK8 E;  2Y90 A;  3QXE B;  4UC4 A;  5C6S A;  4M7D D;  4M78 B;  2ZZD A;  5DY9 A;  1VQN T;  3OYE A;  3SWN A;  5DLO A;  1VQN A;  2DJZ A;  2DPP B;  3I55 A;  4R56 A;  2E65 A;  1Q81 C;  5GAM e;  4V2S A;  1K9M C;  3JCM J;  3CCL A;  2RK1 A;  3QZ9 B;  2GFU A;  1QP3 A;  4XTX A;  1W2B A;  3OYG A;  3GLX A;  3JCM W;  3EFS A;  5LJ5 h;  2FHD A;  2JTM A;  3JSC A;  3M57 A;  3RUX A;  2LDM A;  3L2Z A;  1BI1 A;  5CKH A;  3P8D A;  4F7U G;  4C8Q E;  4EMG A;  5I21 A;  3KXT A;  2IVW A;  3M58 A;  1IZ6 A;  4HA8 A;  2DTH A;  1YHQ A;  5CQY A;  4M7D A;  5FU6 B;  2A3L A;  4RG8 A;  5GAN g;  1NJI C;  3I55 T;  3INZ A;  5CVI A;  4BAC A;  2LC4 A;  3TU4 K;  1BI2 A;  2R57 A;  4C8Q A;  1V29 B;  2QQ9 A;  3OS1 A;  3N5B B;  2E1H A;  1UGP B;  4M7A E;  3OYN A;  3DB3 A;  1IRE B;  4WF2 A;  4QQG A;  1Q7Y U;  2RJC A;  3MP1 A;  4LDV A;  4NL2 A;  4C0Z A;  3OYB A;  2K5F A;  5D6X A;  1VIE A;  1WPY A;  5GAO l;  1VQ5 T;  3SD4 A;  3JB9 G;  1VQ5 A;  4L6V 5;  4RCC A;  1Q81 U;  4L59 A;  4J6Y A;  3QII A;  3CCQ A;  2RI5 A;  3AHU A;  4OGC A;  4NL3 A;  4M7A F;  1VQM A;  4A4H A;  5CAI A;  3C94 A;  1G3S A;  2V8I A;  3HHT B;  3RKY A;  2QA4 T;  1JBM A;  4J7F A;  4DOV A;  2CYZ B;  4PLI A;  4Q5W A;  4QVC A;  2XDB A;  5GAO q;  2DXU A;  3SFM A;  1X75 C;  5LJ3 f;  2X4W A;  2K5L A;  2HQE A;  3OYJ A;  3QPH A;  3LWH A;  4BDZ A;  2PUK B;  3HFN A;  3CCU A;  2EFI A;  2L3R A;  4OB1 B;  2MWO A;  1KC8 U;  3CCJ T;  2K3X A;  3A8G B;  5GAN e;  1WJQ A;  4C5I A;  4OP0 A;  2KAF A;  3R6O A;  5HK0 A;  1VIF A;  5GAN f;  4RG2 A;  3PIO A;  4M78 D;  4C0D C;  5CIU A;  1VQ4 A;  1ZQ1 A;  1W2B S;  3CC7 A;  1BKB A;  1FWZ A;  3H6Z A;  3ASK A;  1YCY A;  3OS5 A;  1X01 A;  5GMK l;  2C06 A;  3VV0 A;  2IG0 A;  2EKO A;  3BW1 A;  2VV5 A;  3LH0 A;  1M90 U;  4MZM A;  1Q86 U;  1K8A C;  4F7U F;  3E19 A;  4E7K A;  3QBY A;  3HRT A;  4CRI A;  4M75 B;  1I81 A;  1OI1 A;  3TCJ A;  3JCM d;  1EIF A;  1QVP A;  3V8J A;  3QUI A;  1YI2 A;  1QVF S;  4XU3 A;  4LD9 K;  2DKG A;  5DLQ E;  4M7A B;  3FIF A;  1Y7X A;  2E12 A;  2DTI A;  1YBY A;  3ME9 A;  4A4K A;  3CC2 T;  4PJO D;  2RI2 A;  2O4X A;  2ZPH B;  5J39 A;  1Q86 C;  4Z02 A;  2DD5 A;  5M9O A;  3M55 A;  2QTX A;  4HCC A;  3DLL A;  4B9X A;  2LT4 A;  3JCM e;  1M1K C;  3CME T;  2D9T A;  3CME A;  3CPF A;  3X25 B;  2E6N A;  5IAY A;  1P92 A;  4RCB A;  3ZFJ A;  3QZ5 B;  1NE8 A;  1KD1 C;  1K73 C;  2GFA A;  2M9U A;  5GAN 5;  2L8D A;  1S72 A;  2VGM A;  2HQX A;  2KDS A;  4IUV A;  4JDS A;  4JLG A;  4OMF B;  4X34 A;  2EJG A;  4LDU A;  3MP8 A;  1U1T A;  1VQ7 T;  4KUL A;  4L5G A;  3HSB A;  3MEV A;  4M75 F;  5KE2 A;  3PGG A;  4BE1 A;  1Y96 A;  3FRN A;  4BUG A;  2RK2 A;  1BI3 A;  3OS2 A;  4TVR A;  4DQ2 A;  3G6E T;  2K3Y A;  4M77 G;  4XTZ A;  3LWI A;  3EAE A;  3TEE A;  2LT1 A;  3Q1J A;  3CCL T;  4C92 G;  4N0A A;  2RI3 A;  4F7U E;  1VQ8 T;  5FU7 C;  5J3B A;  2DZC A;  3L2V A;  1N9R A;  3CCV T;  3BFM A;  2JUF A;  2VUB A;  3UWN A;  5FRN A;  3CD6 T;  1D3B A;  3URG A;  3UT1 A;  3CPW A;  4MZT A;  2E64 A;  2NLU A;  3FLG A;  4PL6 A;  3V7C A;  3HFO A;  4FT2 A;  5LJ5 e;  5GAN 2;  2ZCF B;  3OS0 A;  2QEX T;  4BI3 A;  1QVF A;  3M4Y A;  2XDP A;  1HK9 A;  3GF5 A;  2XKO C;  3JB9 J;  1YIT A;  1VQP T;  5D6W A;  3LW5 E;  5GAM h;  1Y71 A;  3OY9 A;  2G3R A;  3C95 A;  1KD1 U;  1YJN A;  3M5A A;  3HKS A;  1QVG S;  2VC8 A;  1WNL A;  3MHX A;  4NOY A;  5GMK e;  3G71 T;  4IKF A;  3MO8 A;  3G4S A;  3RMQ A;  4QW2 A;  4E7I A;  1Y07 A;  3MET A;  4BDY A;  2RHZ A;  4PJO B;  2CGH A;  4E7H A;  1FX7 A;  4M7A D;  1VUB A;  1WJR A;  4A4G A;  2XG8 D;  2KK4 A;  2ZPG B;  3A8L B;  2HBP A;  3RKX A;  3QJ6 A;  4A4F A;  4M77 B;  2RHX A;  4EPC A;  3CXC A;  1WJS A;  1XTD A;  2RD1 A;  3RMS A;  3QYG B;  1OYX A;  2KMT A;  4EMK C;  3VYG A;  3JB9 F;  2DD4 A;  4M78 G;  2PVO B;  4HCB A;  1KQS S;  5GMK i;  3GNF B;  1FXX A;  2RJD A;  3QYH B;  1WQW A;  3J81 E;  3X28 B;  3A8M B;  4C92 B;  4DA4 A;  2VYT A;  3CC4 T;  5HY6 A;  3A5Z B;  4HCZ A;  4XTV A;  2FYK A;  3M59 A;  4M78 F;  2OTL A;  2ZPE B;  3L42 A;  4E47 A;  5KH6 A;  2Y4X A;  1Q7Y C;  2X4J A;  5A0G A;  3CCR T;  1NPR A;  5L8R E;  3QDR B;  3GIB A;  2PQW A;  2PVG B;  4BE2 A;  1WGS A;  1Q82 U;  5GAM g;  2XID A;  1N9S A;  5GAN 6;  4M75 A;  3CCE T;  2DXC A;  2MAM A;  1G3T A;  2QI2 A;  3VUB A;  4JRK A;  3M4G A;  2X4X A;  3GP8 A;  3ER0 A;  4BY6 B;  2I2L A;  2K2V A;  4C5G A;  3JCM X;  3KBG A;  4A53 A;  2B8A A;  3JB9 I;  3P8B B;  1X6O A;  3FB9 A;  4C0D B;  3CCS A;  1S72 T;  1G5V A;  4OF1 A;  1VQO T;  2OAU A;  4XTY A;  2K57 A;  2BUD A;  2GCX A;  3NTI A;  3RIR A;  5KCO A;  1B34 A;  3OYH A;  2EQU A;  4M78 A;  5LJ3 d; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...