1WJQA

Solution structure of the third mbt domain from human kiaa1798 protein
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
107
structure length
107
Chain Sequence
b'GSSGSSGVKPPHGFQKKMKLEVVDKRNPMFIRVATVADTDDHRVKVHFDGWNNCYDYWIDADSPDIHPVGWCSKTGHPLQPPLSPLELMEASEHGGCSTPGSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA1798 protein
publication title Solution structure of the third mbt domain from human KIAA1798 protein
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 7
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2004-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1wjqA01
4GY5A 3L42A 5M9OA 3EAEA 5KE2A 4A4FA 2G3RA 4ZTFA 2RJEA 2HQXA 3O8VA 1WGSA 2X4YA 4IUQA 4PL6A 5C6SA 3LYIA 4QQDA 4C5EA 3L2WA 2BUDA 3MP1A 2JTFA 3S3NA 3S3MA 2LVMA 4A4EA 3PNWC 4E7JA 3OYHA 3OYMA 4E7LA 3MEWA 2NLUA 2CKKA 5FROA 2EQKA 2L8DA 2BIVA 1WJSA 3H6ZA 3LGFA 3OMGA 1RI0A 2E6NA 2YRVA 3P8HA 4EDUA 3FEOA 3NTIA 3OMCA 3PMTA 5D6WA 2QQSA 3OYAA 1WJRA 1OI1A 3CEYA 5J39A 3L2QA 4QW2A 4FU6A 3UT1A 4II1A 4X34A 2R57A 3OY9A 3MO8A 3MP6A 3OYDA 4IKFA 3OYBA 3QBYA 4E7HA 3S6WA 2X4XA 3E9FA 4L59A 3E9GA 3GOXA 4E7IA 4QQ6A 2GFUA 4UC4A 4C5GA 5FRNA 2O4XB 3MEVA 2RHUA 4C5IA 3NTKA 3KUFA 3LGLA 4Q5WA 4N4GA 3S3OA 2R58A 1G5VA 3FLGA 5KCHA 2O4XA 2DIQA 3DB3A 2M16A 2EQMA 3META 4BE2A 2GF7A 2IG0A 5KCOA 3C4SA 1N27A 4OVAA 2M1HA 2MWOA 3OYFA 5C0MA 3PFSA 4A4GA 1OYXA 2VYTA 3ASKA 3MP8A 3OYCA 3Q1JA 3QKJA 4BDZA 4LD6A 2R5AA 5D6YA 4IUPA 2XK0A 3LH0A 2LRQA 1WJQA 2LTOA 3OS2A 3OQ5A 3L2UA 3UWNA 2WACA 3NTHA 2RO0A 3F70A 3OYGA 3OYJA 3OA6A 2PQWA 5CIUA 3OS1A 3FDRA 3L2VA 2EFIA 4BDYA 2EKOA 2K3XA 5KH6A 1SSFA 2RI3A 3OYLA 2X4WA 4PLLA 4C5HA 4BE1A 2FHDA 2L3RA 4NS5A 2RHYA 4PLIA 2MWPA 3M9QA 3P8DA 4ZTJA 2RHIA 3DB4A 2E5QA 3LX7A 4CRIA 3LLRA 2BKDN 4IUVA 2DIGA 2RHXA 2XDPA 4FL6A 2DAQA 4RG2A 3ZEHA 1KHCA 2JZ2A 2R5MA 2RJFA 5J26A 2D9TA 2GFAA 2K3YA 2LCCA 3OB9A 2RJCA 3QIIA 4N4HA 4IUUA 4A4HA 4BE0A 3OS0A 5D6XA 1OZ3A 1XNIA 4QQGA 2RI5A 4IUTA 3OYIA 5FRMA 2P0KA 2EQUA 4BACA 2HQEA 2B8AA 2RJDA 3MEUA 2M0OA 1H3ZA 3ME9A 3OYKA 3QJ6A 3SD4A 4HCZA 4N4IA 4Z02A 3PMIA 5IN1A 4BD3A 3H8ZA 3DLMA 2RHZA 1OZ2A 4B9XA 2LDMA 4E7KA 3FC3A 2QQRA 3MEAA 5KE3A 2F5KA 2L89A 4B9WA 5IAYA 4IURA 3L2RA 2RI2A 4QVZA 3BDLA 3OYEA 1MHNA 3OYNA 2X35A 2EQJA
chains in the Genus database with same CATH superfamily
1VQ9A 2DZCA 4PJOF 4ZGJB 3EG9A 1GCQA 1NPRA 4C92A 2BE9B 4EMKC 1YIJQ 1K9MR 4C5EA 3JCMc 2LMJA 5IT9E 3NFCA 2NLUA 4M78C 3QG1A 3BFMA 1ZLMA 3VUZA 3CCET 1RI0A 1ABOA 1VQKA 3PMTA 4AFUC 2M51A 3UT1A 1RAHB 2GCXA 3ZBDA 1KC8U 3OY9A 4BI4A 4RCCA 1FXXA 3HFOA 4PFPA 1VQNQ 4E7HA 1XTDA 2DKGA 3VS6A 2X4XA 4F16A 2YLCA 4PNOA 2QA4A 1EIFA 3MEVA 2CZ7B 4AG2C 4C92G 2B86A 2LNVA 2LJ0A 1ZA2B 1VQ6A 4F7UF 1QVFP 2VYTA 1T3SA 2K6DA 1D1AA 3H0HA 3RMQA 1QCNA 3RIRA 4FYYB 1WJQA 1K9AA 2DFUA 4C8QA 1B07A 3C94A 1BI3A 1NYFA 2DILA 4JJNK 1NE8A 3FDRA 3CC2T 1UFFA 2GTJA 2EFIA 2X4WA 3G7ZA 5AT1B 2XMFA 2QG9B 3EH1A 1I5LA 1ZBJA 2LJ1A 4M77D 2DXCA 4CRIA 1JBMA 4PJLA 2HMAA 1QKWA 4KULA 2LQ8A 2R5MA 2GFAA 3I5SA 4A63B 5CKDA 1AEYA 1I07A 1D0XA 3GNFB 4BE0A 2ZPFB 4JPBW 5CKHA 3M0TA 2COZA 3MEUA 2KMTA 4JLGA 3PMIA 3C0CA 2ABLA 5IXBA 1VA7A 4A54A 3EGDB 4M78D 1QKXA 1R0CB 4M7DA 5I2MA 2DXTA 1QVGS 5GAN4 3M56A 4O6JA 1IHVA 3INZA 4P5NA 4L6V5 5GAN3 2KSSA 1Y57A 4EMHA 2JW4A 3JCMW 2L3QA 4KBMB 2OJ2A 2EYYA 2QEXT 2CH4W 4E7LA 2XKOC 1ZQ1A 3N5BB 3CMEA 2MPXC 1TUGB 3FJPA 3M55A 1G3YA 1WXTA 1PKSA 2LT4A 4FSXA 1ZSZC 1YJNA 2CSIA 1OI1A 2RNAA 4J7IA 2LX9A 1BCOA 2NUPA 2H3EB 3S6WA 3E9FA 4M77B 1J3TA 1K8AU 2KE9A 3VS0A 2DVJA 4E2FB 1VQ9T 1M1KC 1QWEA 2K57A 2VWFA 3UPUA 4XTXA 4KT0E 1VIEA 1U5SA 4RMOA 3CPWP 2HCKA 2MCNA 4OMOA 4EMKB 1IZ6A 5FWCA 3EFOB 1UUEA 4OB1B 5I21A 4XTYA 4E47A 5GMKe 2EYWA 4LD6A 4M78B 2RN8A 1M30A 4R56A 5CKEA 3OYJA 1KFZA 1HK9A 3V7RA 3JB9G 4M75A 3UDCA 1M2VA 2PZ1A 2AIRB 3JV3A 3CCJA 1X75C 3OYYA 2QA4T 5CK9A 4ZGDB 3OB9A 5HK3A 2W10A 2V8JA 2P0KA 1VQ6T 1WFWA 3SD4A 4BB7A 3QDFA 1SPKA 3FC3A 1VQ8T 2CREA 2M0YA 2EAYA 5LJ5h 4AT1B 2J05A 1BU1A 2NYSA 4JJBA 2OTJQ 1R77A 1M1KU 4A4FA 1NZ9A 1G83A 3WVDB 3QXEB 1WA7A 4L5GA 5GAOq 2JTEA 4M7AE 2NUTA 4R55A 1M8VA 5GAOn 5DM7R 1Q86U 2YRDA 3J81E 1T0JA 4E7JA 4IIMA 2YHTA 3CD6T 2QTVA 2SEMA 1S72A 1YI2Q 1ZBXA 4BUGA 5GAMh 4GBQA 2DO3A 3UA7A 3OMCA 2QQSA 1U3OA 1VYVA 2Y4YA 4XAXB 3PE0A 1HJDA 1W2BA 3CCQA 4RTTA 3E1SA 2XIDA 3E9GA 2K4YA 4QQ6A 1NM7A 3OSVA 3JCMh 4C0ZA 2CT3A 2Z0WA 5KYWB 1H3HA 2C0IA 4N4GA 4PJOA 4KH1B 2O4XA 3HP9A 2HSEB 2RM4A 3BDUA 1VQMQ 4XU0A 3HKSA 3Q1JA 1TOVA 1MMDA 3CMET 2FG0A 1Q81R 4BY6C 4ZN1A 3H9NA 4GLKA 4MZTA 1NJIR 1ZSZB 1UG1A 1TTHB 1LJOA 2DYBA 5KH6A 1SHGA 5KYXA 4BE1A 4NS5A 1BKBA 1YJ9Q 1N9RA 4WTOB 2E5KA 3DB4A 5IHNA 1S1NA 4DBFA 2FYKA 2H3JA 1GL5A 1UJ0A 1QVFS 2JNGA 4J7FA 5D6XA 5FRMA 4IUTA 3JB9J 2DYIA 5IN1A 4F7UA 2D6FA 4AFQC 1M4ZA 4B9XA 3TU4K 5GMKi 3JCMb 4QVZA 3OYNA 1U1SA 3QSUA 2VGMA 4M77F 3HRTA 1QCFA 2KROA 3O8VA 1BBZA 3LWIA 1JJ2P 4LN2A 2DEUA 4X9CA 3V7SA 1N8RC 5I22A 1BI1A 3CCJT 1MGQA 2PVOB 4FYWB 2VXFA 3BE3A 1OU8A 4J9DA 5CQYA 3JB9H 5LJ5f 3X20B 2FZGB 1F1BB 4O5VA 3HRSA 3CBPA 4F7UG 2DTHA 2XU8A 1R8OB 1WPYA 1AD5A 4ORZA 1TWBA 3I35A 2YUQA 4ME7A 3CC4A 2VXEA 1BI0A 3BW1A 2DJZA 4E7IA 1QCOA 1OEBA 1EZZB 2LC4A 2K79A 2VGNA 4ZGEB 3NHNA 5GAMf 1G3TA 5ECAA 5KCHA 3CXCP 1JRIA 4C8QF 4D8DA 2CP3A 1VQ4Q 3CCST 1UGSB 5A0GA 2M02A 1S72T 4OMLA 3I56Q 1Q82R 3JCMf 3H0FA 1MNEA 2CH4A 2FVUA 2KRSA 1D3BB 1I4K1 3OS1A 1ZX6A 1KQSP 3VKIA 2RI3A 4M78E 1RABB 2L3RA 5IH2A 1N8RU 4PJJA 1KC8R 4OMPA 3EG1A 4C0FA 3CPWS 2HKNA 1NG2A 2E6ZA 3C95A 2KRNA 3M59A 3CCLQ 3OW2P 4JS5A 1JXOA 4Z02A 1I5OB 3CC7A 4XTWA 4J8OA 4D8KA 2GNCA 1PKTA 3OBWA 4B9WA 1YHQA 3CCEQ 1M1FA 2CP7A 1X6BA 1DJ7B 2EQJA 2QXFA 2A7YA 2RJEA 5IXFA 4DEXA 2F2VA 5C6SA 5LJ3e 1RAAB 4PFZA 4DEYA 3QO3A 2EVRA 2E41A 1WJSA 3G6ET 2KBTA 4MZMA 1YCSB 1RI9A 3SDZA 3RBBB 2K5LA 3OS5A 4NOYA 2YXYA 2CYZB 2BZXA 5GMKm 1U1TA 2ESWA 2FZKB 3QWXX 5GANe 2K2MA 2LQNA 3CC2Q 4Q5WA 2AK5A 4ZNXA 2PNIA 2X9HA 3GNGA 5LJ3g 3RNJA 4F17A 3H0IA 4FM4B 4Z88A 5FU7C 4LUDA 4M75F 1AWJA 1R0BG 5D6YA 1M5Q1 4J9FA 2CP0A 4M7AD 1N9SA 2BE7D 2CZ1B 5GANd 1WHHA 1YN8A 2NWMA 1M2OA 1NBEB 1SRMA 1WDXA 4LDXA 2MWPA 1K0SA 3IQLA 1WHGA 5GMKj 2RHXA 3NGPA 5CKFA 1QVGA 3VS1A 4ANJA 2AZVA 3CCMT 2CP2A 1BYMA 2Y4XA 1IREB 2K5FA 4MZPA 1BK2A 4N4IA 4BD3A 2ECZA 3DLMA 1KC8C 2ZAEA 2QQRA 1BB9A 1VIFA 5IAYA 4YTLA 4CC3A 5FWBA 2JN0A 3VS2A 4OMFB 3M54A 4XU3A 3I55Q 2QEXA 2E65A 1I81A 1FMWA 2OTLQ 1JEGA 2GQIA 1EX4A 3JCMJ 4J9EA 4E6RA 3PNWC 3OYMA 1VQ9Q 2OX7A 3T9NA 1YBYA 1M3BA 2L8DA 3P8BB 3OMGA 4J9HA 4N0AA 4M7AB 3QZ5B 2DJQA 3OYAA 1OULA 1LCKA 3E2UA 3VYGA 4II1A 4X34A 3CC7T 2R57A 3OSSC 2OI3A 5CO7A 2ZPHB 3OYDA 3V7CA 3OYBA 3JSCA 1YHQT 3GOXA 1VQKQ 2XHCA 4HVUA 4CC2A 3VJPA 1JJ2S 4C92C 2L3SA 4ATOA 1GRIA 4M77A 3CPFA 2QQAA 3MHXA 4B6MA 4ZN3A 3EFSA 2R58A 2RQWA 3GPLA 3FLGA 2CT4A 3KXTA 1AWXA 1KQ1A 2E12A 1M1KR 1AZEA 4JJCA 4EMKA 3CCUT 2QA4Q 4EMGA 4BDZA 5HK0A 2EJFA 2R5AA 3EFOA 2OAUA 1HD3A 1VQPA 3FIFA 1VQ6Q 1I8FA 5DY9A 2JTMA 3G4SA 2PQWA 1YFNA 2V1RA 1RAEB 1UHCA 2AZSA 1VQ8Q 2A08A 4HKEA 3OBYA 4ZTJA 2RHIA 4M77G 3CXCS 2FO0A 3A8GB 2FL7A 1AWWA 4MDXA 2C0OA 1VQ8A 2X51A 1PM3A 4QVDA 1TXQA 3M0SA 2HQEA 2PVDB 2HAXA 1SF9A 1WXBA 1LPLA 2LP5A 2PUOB 3QZ9B 1KQSS 2RF0A 1K8AC 3I5RA 3CD6A 2JS0A 2G3RA 2DZ9A 4HCBA 1PD0A 3A8HB 3L2WA 3VS5A 5I2SA 5EG2A 2LVMA 3RR6A 3OYHA 1OOTA 1Y71A 2G6FX 3GLXA 2HNIA 1M3CA 2DL3A 2DM1A 1M27C 2KRMA 1UTIA 3OW2S 4C8QG 3QJYA 4PFOA 4LDVA 3CMEQ 1P92A 3JCMV 2RD1A 4IKFA 2QI2A 2V1QA 1YJNQ 4KGVB 1K73U 1TU0B 1V76A 5GMKh 3NTKA 3KUFA 3LGLA 4FYVB 5KYUB 3S3OA 1G5VA 5KYWA 2DIQA 3META 2M16A 2LQKA 1PCXA 2I0NA 2DBMA 3EGXA 3QKJA 1ZA1B 1U8RA 4C0DC 2AKKA 2QGGA 1XQHA 2XI9A 4J6WA 4M7DG 2O01E 3OQ5A 1QVFA 2YDLA 1VQ5T 3OA6A 1PRMC 1ZSZA 5A0LA 1IB8A 1NPPA 1WHJA 4PLIA 2KT1A 2RQUA 3CCVA 2YUPA 2FPEA 1YWOA 1Q86C 1NLOC 2HZYA 3ZL7C 2VB6A 2HL5C 1KD1U 2LNHB 1NYGA 2D9TA 4Y28E 2KEAA 4N4HA 4A4HA 4HA8A 2YRCA 3CCJQ 4M7AF 3CCRA 2OAWA 4K11A 1D09B 3H8ZA 3MCAB 1YCYA 4KGXB 1VQPT 2P4TA 2IIMA 4JRKA 3G4ST 4PKCC 3SWNC 4Z89A 2KDSA 1YIJT 1WIEA 3S3MA 2HKQB 1QMCA 2L5QA 1UEBA 4A4EA 2DL4A 5D7UA 5CKBA 3H6ZA 1WLPB 1N8RR 2JOYA 3JRZA 3SHWA 1PWTA 1V1CA 2ENMA 4M75G 1MV0B 2J6KA 3PTAA 3M57A 1VQNT 1S72Q 2VASA 3NPFA 5LJ3j 5GAOm 4NL3A 3CCSA 1K9MU 2JVVA 1TUCA 5FRNA 1UGQB 3ULRB 2DNUA 2HBWA 4M4ZA 3CCQQ 3QUIA 1AVZC 3J80E 4KRTA 4OVAA 1PHTA 2KI7A 3X28B 1K4US 4LD9K 2XK0A 4KH0B 3WXMB 3CPWA 1RADB 1FWZA 1JB0E 4ELYC 3UWNA 5GAOl 2EW3A 4TVRA 5GANj 1G3SA 1D3BA 4RTXA 1YNZA 2K3BA 1W6XA 2HEQA 2D0NA 2BKDN 2LT1A 5LJ5e 2BTTA 3M53A 4DBQA 3OYIA 2O9VA 1H3ZA 2EQUA 2B8AA 2M9UA 2WSCE 3OYKA 2P0QA 4HXJA 4E7ZA 1JXMA 2LDMA 1RACB 3MEAA 4JZ4A 3X25B 1VYUA 5HCKA 4D6WA 1FYNA 2ATCB 5IHKA 1G3WA 2LCLA 1X6GA 2MAMA 4PJOG 2HQXA 5GAN8 5GAMe 5LJ5d 4PL6A 3G6EA 2XICA 3CCVT 1UGVA 3X24B 1WQWA 2RMOA 3LGFA 5KYNA 2DERA 3REBB 1SRLA 1XJWB 2C0TA 3FEOA 1YWPA 7AT1B 3JCMe 1KIKA 3CCRT 1WJRA 2DX1A 4KUIA 1V29B 4AMCA 1WNLA 4LXCA 1MNDA 2YT6A 3R6NA 5EC7A 2V8IA 2CS7A 2COWA 5A0DA 1ARKA 5GAMd 1WZOA 2X4JA 1NLPC 2VC8A 1SKUB 3M0UA 3SWNB 4A4KA 2KNBB 1YITA 2GF7A 4M78F 4RTYA 3CC4Q 3JCMd 1OYXA 3VS4A 5FLXE 4BI3A 1OV3A 2E3IA 2HQHA 3G71A 1M9SA 1W1FA 2RB6A 3VV0A 2LRQA 2PUKB 2FPDA 3UF4A 2MYSA 1MUZA 2E1HA 4BDYA 1BIBA 4RKUE 2H8HA 3EGUA 4J6XA 3JCMQ 1VQ7A 4IIOA 3CCMA 2LX7A 1YP5A 1CKAA 2RH2A 2F69A 1C0MA 2XDPA 2RJFA 3SEMA 5CCAA 2RJCA 1OZ3A 1VQLA 1W70A 2RJDA 3R6OA 4C92E 2HDAA 2L3PA 1C1AA 2COYA 1YJWA 2DL8A 3I9QA 3BDLA 5LJ3h 3OYEA 2OTJT 3L42A 1M1GA 1Y96B 3CC7Q 2IPOB 3GF5A 1JQQA 1YHQQ 2F2WA 2CP5A 1GXIE 2QGFB 3TREA 4A53A 1AWOA 4DBRA 5CR2A 2DD5A 2QYZA 1JJ2A 4FCYA 2XDDA 2YWWA 3GP8A 2JUFA 4XQ3A 2DK3A 2WSEE 3TCJA 3NTIA 4BY6B 4X9DA 1B34B 1QP3A 3CEYA 5J39A 3RKYA 4M7AA 2DL5A 6AT1B 2MF2A 4QW2A 3UA6A 4JRPA 2A3LA 4JS4A 2XDBA 4UC4A 3CCUA 4ESRA 1Y7XA 2E64A 2ROLA 4J9GA 2F1LA 4OB3B 5KCOA 4XTVA 2DMOA 3URGA 2A36A 3CXCA 4LDUA 1H641 5HY6A 4OP0A 3OS2A 4M7AG 3NTHA 1ACMB 2DPPB 3BY7A 4QKUA 1E6GA 3OYLA 3NMZC 3LH5A 2WSFE 3A5ZB 1QWFA 4OB0B 2JS2A 4LUEA 2A37A 3LX7A 4XTZA 3SFMA 3PIPA 1KQSA 4HT9A 4AFZC 2DAQA 4M7DE 4CC4B 3REAB 1YITT 1Q81U 2XD0A 2EKHA 4J9IA 5GMKl 1E6HA 3QYHB 1NJIU 1VQOA 1OZ2A 4E7KA 3CMAA 4NL2A 3G71T 2HBPA 3MJXA 3PVLA 1GFDA 1KK7A 1G8XA 5GANg 3RMSA 5KE2A 2QDYB 1FMKA 2EYXA 2ZPEB 2E10A 3RERA 1K8AR 3RESA 1VQ7T 1Y07A 1AT1B 1TS9A 3MP1A 4JRIA 1RAIB 2QEXQ 2JT4A 2EQKA 1I1JA 2HSPA 2YRVA 3GBQA 3EGDA 1VQLT 3L2QA 2MOXA 2DD4A 2L0AA 4DQ2A 1YJWT 1PG5B 4J9CA 5LL6S 5IHIA 3X26B 4L59A 1ZUKA 1WI7A 4Z8AA 2GFUA 2ZPBB 1Y0MA 2P84A 3FB9A 1A0NB 2BZ8A 1X69A 3A1PA 4R0KA 1PSFA 1X27A 1RL2A 5KYUA 4LNPA 4M75E 2MWOA 3MP8A 3HSBA 1VQ5A 1QQJA 5DLOA 2F5TX 4F04B 3PIOA 1GCQC 2WACA 4XU1A 3RKWA 4HCCA 2CGHA 1HYOA 2EKOA 2K3XA 1K76A 4M77C 2J6FA 1VQPQ 2J7IA 4JJDA 2DTIA 2J6OA 3RUXA 3G4SQ 4IUVA 1OPKA 4FL6A 2PVGB 3EG2A 2QQ9A 4WCIA 2C06A 1Q86R 3CCLT 4M78A 1Q82U 8ATCB 2M0OA 2KAFA 2RPNA 2EBPA 1PSEA 1Q7YU 5HKCA 1WQ7A 3FJ5A 2F5KA 1SHFA 1YIJA 4IURA 2AT1B 2RI2A 3PT9A 1UHFA 2EJGA 1K73C 4LE9A 5M9OA 3M4YA 2CUBA 1IO6A 5LJ5j 2EIFA 4Y91A 1OQKA 2FPFA 1E7OA 4JRQA 3HL8A 3UATA 5FU7B 2X3WD 4C8QC 3CD6Q 2BIVA 2JMAA 1VQNA 1IHWA 2VUBA 4OMQA 4M78G 4PJOE 2JM8A 3FRNA 2K9GA 1VQOT 1W4SA 3MO8A 4RUGA 3CMAT 5GAMj 4BI8B 2CP6A 4RTWA 4JZ3A 2EJ9A 1H8KA 3GIBA 3QPHA 4C92D 1KD1C 3DB3A 1ZUUA 2IG0A 2KYBA 5AYFA 3TEEA 1OPLA 3E19A 3M0RA 9ATCB 3SB2A 4M7DC 3LWHA 4IUPA 1X01A 4FIBA 3EFRA 1VUBA 3F70A 4DBHA 5CIUA 3L2VA 1QW1A 2DVEA 4PLLA 1KG1A 4E7SA 4XTUA 2RHYA 2IVWA 4F7UE 3CBOA 4VUBA 3TSWA 4HCKA 1FX7A 1KSWA 1H92A 1Q95G 2JZ2A 1ZHIA 4IUUA 1M90C 1ZSGA 3OS0A 3CCVQ 3QDRB 4OB2B 2PU9B 5KYYB 3QWYA 2ZGWA 2FRYA 2L89A 4C8QD 4PJMA 1BI2A 3A8MB 1MHNA 3EG9B 1UGRB 1K9MC 4GY5A 3I55T 3CCRQ 2O2OA 2GGRA 4ZTFA 4C92B 2QAZA 1WGSA 1Z9QA 2OTLT 2QK0A 1ABQA 2LJ3A 3L1AA 2EGCA 3S3NA 4F14A 3MEWA 3C12A 4QT7A 1O9SA 4JUVA 1RAFB 3M4GA 1W2BP 2E6NA 2JXBA 2KQWA 4EDUA 3KFVA 4M75C 5GAOr 1QVPA 2ROTA 1N5ZA 2DLPA 2AKLA 2V8KA 2O9SA 2DA9A 2QQBA 3MP6A 4PK4A 4M7DD 2EGAA 3VS7A 1VQKT 1UECA 4KGZB 3JAME 1HXDA 4J6YA 1AHJB 5FW9A 4XK8E 2ZPIB 5J3BA 1G2BA 1GBQA 1M90U 3C4SA 3SWNA 1N27A 2VKNA 4RTZA 3QHSA 3PFSA 3CCSQ 3OYCA 5GAN5 4C8QB 1Z9ZA 2LQWA 2X3XD 1MMAA 2KXDA 5I11A 1B3QA 2RK2A 3VS3A 3HRUA 2CZ0B 5GAN6 2V26A 3HFNA 1D1CA 3JB9D 2DTOA 1BCMA 4C5HA 1CSKA 4FSSA 4DOWA 1T3LA 1OX9A 1U06A 3A98A 2KYMA 1OX8A 4WF2A 1M3AA 4CC7A 1SG5A 1WHMA 3AT1B 3QIIA 2LZ6B 2GQVA 1QP2A 3M0PA 1XNIA 4QQGA 2DBKA 3TVTA 2OTJA 4FW1A 3ME9A 4HCZA 1PD1A 3EH2A 4M7DB 1D0YA 4PJOC 3A8LB 2DE0X 2O88A 3RDVA 4M75D 2KK4A 4OMNA 2KT8A 4MMKA 1YI2A 2HL3A 1Y96A 2X4YA 4C0GA 2EYZA 1T0HA 2FB7A 1WXUA 4QQDA 3EG0A 2BUDA 2P0PA 3H41A 4GLMA 3TSZA 2DXBA 3KBGA 1X2KA 2CKKA 2I2LA 5CVIA 4J83A 1X43A 3EGXB 2ED0A 1MMGA 2KVQG 3G6EQ 4C0DB 2GTOA 2LCSA 3AHUA 3VRZA 1B34A 2NUPB 1CKBA 3DKMA 3TQ7P 3LW5E 1MV3A 1JO8A 1X6OA 1B7TA 1I0CA 1VQMA 3M58A 2VVKA 3M0QA 1YJNT 4C5GA 2E4HA 2RQRA 2RHUA 2ED1A 5LJ5g 3PVQA 2SRCA 2E70A 3JCMP 1KJWA 1PRLC 2M1HA 4HT8A 2YUOA 1PC0A 4HVVA 1YJ9A 1YITQ 3LH0A 3G1JA 5CQXA 2RO0A 4M75B 4OMMA 4OGCA 2RQTA 1M2VB 1IXDA 2P4RA 2KY9A 2VV5A 1K1ZA 4C92F 2L2PA 5GAMg 1ZUYA 3G71Q 2ZPGB 2CZ6B 4FT2A 3P8DA 4OF1A 3JCMX 4X1VA 4PJOD 2DIGA 2PTKA 5J26A 1C6VX 3WVEB 3JB9I 1VQ7Q 5FU6C 3JCMg 1D0ZA 3CCMQ 2MI6A 1BIAA 4BACA 2QDLA 2O31A 5GAN7 3M5AA 5KE3A 1UGPB 1RLQC 1TUDA 2D1XA 1FMVA 1VQLQ 1SSHA 2K2VA 3EAEA 1UE9A 4RG8A 2NUTB 2DL7A 3VU3C 4DA4A 4IUQA 1RLPC 1YJWQ 3V8LA 4HVWA 2MK5A 1WX6A 3J7AF 3LYIA 2YUNA 1IGUA 2YLBA 2JTFA 3ER0A 1RAGB 1UDLA 2MIOA 1GFCA 2BZYA 2F2XA 4M77E 4EPCA 3O5ZA 4PJNA 1NEBA 2ZZDA 4FW2A 2JM9A 1WYXA 4EIKA 1LNXA 2QTXA 5GJWB 1LVKA 3QBYA 2A28A 1VQ4A 4KUDK 3EHQA 5GAOp 2W0ZA 1Q7YR 4PJOB 2EGEA 2O4XB 2FEIA 4C5IA 2YSQA 4MMLA 3CCQT 1GBRA 1YI2T 3I56A 2D8JA 3ZFJA 1WHLA 4JDSA 4BE2A 1Q81C 1K0XA 3U23A 2CUDA 3D7SB 3CBMA 4A4GA 3ASKA 3CQTA 2DF6A 1W2BS 5GANh 1NJIC 4XU2A 3CCUQ 4M7AC 1X2QA 2FRWA 4M7DF 3L2UA 2RQVA 2DRMA 5KYXB 1TSFA 4MDWA 2D0QB 2JMCA 1TH7A 4C8QE 4RCBA 3L2ZA 1QVGP 2EQIA 1IRXA 1VQMT 3CCLA 5L23A 3LLRA 4RG2A 2GBQA 3ZEHA 1QLYA 1TG0A 1VOMA 2K3YA 3CCEA 4FYXB 4F7UB 2RI5A 2D8HA 1LOJA 4AG1C 5GAN2 3VRYA 3QJ6A 1D1BA 3EHRA 5GJVB 2RHZA 3JB9F 4J9BA 1YJ9T 3L2RA 3VUBA 2KXCA 2X35A 1SEMA 4FT4A 4JLIA 1VQOQ 2ZCFB 3QYGB 2JJ9A 3CMAQ 2EWNA 5LJ3d 1K73R 1VYTA 2DRKA 5FROA 5L8RE 2FZCB 2MMPA 2A0FB 4QVCA 2RK1A 3P8HA 3MKDA 5A2QE 3HHTB 5D6WA 2QASA 5FU6B 2E3HA 3OW2A 4AFSC 2Y90A 3PGGA 3CC2A 4FU6A 2EYQA 3RKXA 1M8MA 3EG3A 2DETA 4LDYA 1IGQA 4OGEA 1O75A 2KGTA 3DLLA 1OU9A 1HSQA 1UJYA 1PNJA 8AT1B 5LJ3f 3HPWA 2EQMA 2DEQA 3CC4T 2RA2A 2AHJB 5C0MA 3OYFA 1Q82C 1XOVA 1KD1R 3A8OB 1Q7YC 2NUZA 2J06A 5CAIA 4ELZC 2CSQA 2LTOA 2DXUA 1NEGA 4RTUA 1AZGB 1KHIA 3OYGA 4V2SA 1JU5C 1VQ5Q 2XG8D 3V8KA 1SSFA 1EFNA 2FHDA 1WHKA 3VYHB 1VQ4T 3M9QA 1UB4A 2E5QA 5GANf 4LDWA 4N0AC 3V8JA 4CI0C 2KR3A 3THKA 5DLQE 1KHCA 2K7AA 2HD0A 4Y92A 2LCCA 3I56T 1GCPA 1N6AA 4RTVA 1KQ2A 3I55A 2K5IA 1MMNA 1RUWA 2EPDA 3HTRA 2CDTA 1M90R 3MPUB 5KYYA 4DOVA 4J5YA 2OTLA 1AOJA
chains in the Genus database with same CATH topology
4GY5A 1G3WA 2LCLA 2QXFA 3I55T 1VQ9A 2DZCA 2MAMA 4PJOF 4ZGJB 2A7YA 4PJOG 4ZTFA 4C92B 2RJEA 2HQXA 1NPRA 5GAN8 1WGSA 5GAMe 5LJ5d 2OTLT 4PL6A 3G6EA 4C92A 4EMKC 5C6SA 5LJ3e 2XICA 4C5EA 3CCVT 3L1AA 3JCMc 3S3NA 3X24B 3QO3A 1WQWA 5IT9E 3MEWA 3NFCA 2NLUA 3C12A 2E41A 4M78C 1O9SA 1WJSA 4JUVA 3QG1A 3BFMA 3LGFA 3M4GA 3VUZA 3G6ET 3CCET 1RI0A 2E6NA 2KQWA 4EDUA 1VQKA 3FEOA 3PMTA 4M75C 3JCMe 5GAOr 3CCRT 1WJRA 1QVPA 4MZMA 4KUIA 1V29B 3SDZA 1WNLA 3UT1A 2GCXA 3ZBDA 2K5LA 3OS5A 1KC8U 3OY9A 2V8KA 2CS7A 2V8IA 4NOYA 4RCCA 1FXXA 3HFOA 2QQBA 4BI4A 3MP6A 5A0DA 4M7DD 5GAMd 4E7HA 1XTDA 2DKGA 1VQKT 2CYZB 5GMKm 2X4XA 1U1TA 2X4JA 2YLCA 4PNOA 2VC8A 5GANe 3JAME 2QA4A 1EIFA 3MEVA 1HXDA 2CZ7B 4Q5WA 4J6YA 1AHJB 4XK8E 3SWNB 4A4KA 4C92G 3GNGA 1YITA 2LNVA 2ZPIB 5LJ3g 5J3BA 2GF7A 4M78F 1M90U 3C4SA 3SWNA 1N27A 4FM4B 1VQ6A 3QHSA 3JCMd 3PFSA 5FU7C 1OYXA 2VYTA 5FLXE 4F7UF 3OYCA 4BI3A 4M75F 5D6YA 5GAN5 3RMQA 4C8QB 1M5Q1 3G71A 1M9SA 2RB6A 3RIRA 3VV0A 2LRQA 1WJQA 2RK2A 4C8QA 4M7AD 2PUKB 3HRUA 2CZ0B 1N9SA 3C94A 1BI3A 5GAN6 2CZ1B 3HFNA 4JJNK 1NE8A 3FDRA 5GANd 3CC2T 3JB9D 2E1HA 2EFIA 2DTOA 4BDYA 1BIBA 2X4WA 4RKUE 4C5HA 3G7ZA 4J6XA 3JCMQ 1VQ7A 4DOWA 4LDXA 2MWPA 3CCMA 1I5LA 4M77D 2DXCA 4CRIA 1JBMA 2RH2A 2F69A 5GMKj 2RHXA 2XDPA 4WF2A 5CKFA 4KULA 2LQ8A 2R5MA 2RJFA 1QVGA 2GFAA 5CKDA 5CCAA 2RJCA 3QIIA 3GNFB 2GQVA 4BE0A 1QP2A 2ZPFB 1OZ3A 1XNIA 4QQGA 3CCMT 2Y4XA 1IREB 1BYMA 2K5FA 4MZPA 4JLGA 5CKHA 2RJDA 2KMTA 3MEUA 1VQLA 3ME9A 2OTJA 3R6OA 4HCZA 4N4IA 4BD3A 3PMIA 4C92E 3DLMA 1KC8C 2QQRA 4A54A 1YJWA 4M7DB 1VIFA 4M78D 5IAYA 4YTLA 3BDLA 5LJ3h 3OYEA 2JN0A 4PJOC 3A8LB 4M7DA 2OTJT 4OMFB 3M54A 4XU3A 3L42A 4M75D 1M1GA 1Y96B 5I2MA 2DXTA 2QEXA 5GAN4 3M56A 4O6JA 1QVGS 2E65A 2KK4A 3INZA 1YI2A 4MMKA 4P5NA 3GF5A 2X4YA 1Y96A 4L6V5 4C0GA 1I81A 5GAN3 2KSSA 2FB7A 4EMHA 1GXIE 4QQDA 3TREA 2BUDA 2P0PA 4A53A 3JCMW 3JCMJ 4KBMB 2DXBA 3KBGA 3PNWC 2QEXT 3OYMA 5CR2A 3T9NA 2DD5A 4E7LA 1YBYA 2CKKA 1ZQ1A 2XKOC 3N5BB 2I2LA 2L8DA 3FJPA 3P8BB 4J83A 5CVIA 2XDDA 3M55A 3GP8A 2JUFA 4XQ3A 3UPUA 2DK3A 1G3YA 3OMGA 2WSEE 2KVQG 4N0AA 4M7AB 3QZ5B 3TCJA 2LT4A 4C0DB 3NTIA 4FSXA 4X9DA 4BY6B 3OYAA 1QP3A 1B34B 1YJNA 1OI1A 3CEYA 3RKYA 5J39A 4M7AA 2MF2A 3AHUA 4QW2A 1B34A 3VYGA 4II1A 4X34A 3CC7T 4JRPA 2R57A 3DKMA 3OSSC 2A3LA 4J7IA 5CO7A 2LX9A 2ZPHB 3LW5E 3OYDA 3V7CA 3OYBA 3JSCA 1YHQT 4JS4A 3S6WA 1X6OA 3E9FA 3GOXA 1UGRB 4M77B 2XHCA 3M58A 1VQMA 3VJPA 1YJNT 1K8AU 1JJ2S 2XDBA 4C92C 4UC4A 4C5GA 1M1KC 1VQ9T 4ATOA 2RHUA 4M77A 3CPFA 3CCUA 2QQAA 2K57A 3MHXA 4ZN3A 1Y7XA 3EFSA 2R58A 4XTXA 2E64A 1VIEA 3FLGA 4KT0E 5LJ5g 3KXTA 4RMOA 3GPLA 4OB3B 1KQ1A 2E70A 3JCMP 5KCOA 2E12A 4EMKB 1IZ6A 2M1HA 4HT8A 4OB1B 4XTVA 4XTYA 4E47A 3URGA 5I21A 4EMKA 5GMKe 3CCUT 4EMGA 4BDZA 5HK0A 4LD6A 2EJFA 2R5AA 3CXCA 4M78B 4LDUA 1H641 5HY6A 1YJ9A 3LH0A 2OAUA 1VQPA 3FIFA 4OP0A 3OS2A 5CQXA 4M7AG 4R56A 3NTHA 2RO0A 2DPPB 1I8FA 4M75B 2JTMA 5CKEA 5DY9A 3BY7A 4OGCA 3OYJA 3G4SA 2PQWA 2KY9A 2VV5A 1HK9A 3V7RA 3JB9G 4M75A 3UDCA 4C92F 3OYLA 5GAMg 2WSFE 3A5ZB 4HKEA 4OB0B 2ZPGB 2CZ6B 3OBYA 4FT2A 3CCJA 1X75C 3P8DA 4ZTJA 2RHIA 3LX7A 4OF1A 4XTZA 3SFMA 3JCMX 4M77G 3PIPA 4PJOD 3CXCS 1KQSA 4HT9A 3OYYA 2QA4T 2DIGA 2DAQA 3A8GB 2FL7A 5CK9A 4M7DE 4ZGDB 5J26A 4MDXA 1VQ8A 3OB9A 1YITT 1Q81U 3WVEB 3JB9I 2XD0A 5FU6C 5HK3A 3JCMg 4QVDA 5GMKl 2V8JA 2P0KA 2MI6A 1BIAA 2HQEA 2PVDB 4BACA 2HAXA 1VQ6T 3SD4A 4BB7A 2PUOB 3QYHB 1NJIU 3QZ9B 1VQOA 1OZ2A 4E7KA 3FC3A 5GAN7 3M5AA 5KE3A 1UGPB 3CMAA 1VQ8T 4NL2A 2EAYA 5LJ5h 3G71T 2HBPA 1KQSS 1K8AC 5GANg 3RMSA 3EAEA 2K2VA 3VU3C 5KE2A 4RG8A 1NZ9A 2G3RA 4A4FA 4DA4A 2DZ9A 2QDYB 3CD6A 4HCBA 2ZPEB 3QXEB 4IUQA 4L5GA 3WVDB 2E10A 5GAOq 3RERA 3V8LA 4M7AE 3RESA 4R55A 1VQ7T 1Y07A 3A8HB 3J7AF 3LYIA 3L2WA 1M8VA 5GAOn 3MP1A 5EG2A 5I2SA 2YLBA 5DM7R 2JTFA 4JRIA 1Q86U 2LVMA 3ER0A 3J81E 4E7JA 3OYHA 2YHTA 3CD6T 1Y71A 3GLXA 2HNIA 2EQKA 1S72A 1ZBXA 4BUGA 5GAMh 3OW2S 2YRVA 4M77E 4C8QG 4EPCA 2DO3A 3QJYA 3OMCA 2QQSA 1VQLT 2ZZDA 3L2QA 4LDVA 2Y4YA 4XAXB 2DD4A 1W2BA 1LNXA 1P92A 3JCMV 4DQ2A 3CCQA 2RD1A 1YJWT 2QTXA 4IKFA 5LL6S 2QI2A 3QBYA 3E1SA 2XIDA 4L59A 3X26B 1VQ4A 3E9GA 4KUDK 2K4YA 5GAOp 4QQ6A 2GFUA 3OSVA 2ZPBB 3JCMh 3FB9A 4C0ZA 4PJOB 1K73U 5GMKh 2O4XB 4C5IA 3NTKA 3KUFA 3LGLA 4MMLA 4N4GA 4PJOA 1PSFA 3CCQT 3S3OA 1YI2T 1G5VA 2O4XA 2DIQA 3HP9A 3ZFJA 3I56A 3META 2M16A 4JDSA 4BE2A 1RL2A 1Q81C 2RM4A 2LQKA 3CBMA 4M75E 3BDUA 2MWOA 4A4GA 4XU0A 3ASKA 3MP8A 1W2BS 3HSBA 3HKSA 3Q1JA 1VQ5A 3QKJA 5GANh 1NJIC 3CMET 4XU2A 5DLOA 1U8RA 2F5TX 4M7AC 4C0DC 4BY6C 4ZN1A 1XQHA 2XI9A 4J6WA 4M7DF 4GLKA 4M7DG 2O01E 3PIOA 3OQ5A 4MZTA 3L2UA 1QVFA 2WACA 4XU1A 3RKWA 4HCCA 1VQ5T 3OA6A 4MDWA 2CGHA 2D0QB 1TH7A 1LJOA 2EKOA 2K3XA 4C8QE 5KH6A 5A0LA 4BE1A 4M77C 4NS5A 1BKBA 1NPPA 3L2ZA 4PLIA 4RCBA 1M1KU 1N9RA 3CCVA 1VQMT 3DB4A 2DTIA 3CCLA 2FYKA 1Q86C 2H3JA 3RUXA 3LLRA 4IUVA 4RG2A 4FL6A 3ZEHA 1KD1U 2D9TA 2PVGB 2QQ9A 4Y28E 2K3YA 3CCEA 1QVFS 2JNGA 4N4HA 4A4HA 4HA8A 2C06A 4J7FA 5D6XA 5FRMA 4F7UB 2RI5A 4IUTA 3CCLT 3CCRA 4M7AF 4M78A 3JB9J 1LOJA 5GAN2 1Q82U 2M0OA 2KAFA 3QJ6A 5IN1A 1PSEA 4F7UA 3H8ZA 2D6FA 2RHZA 3MCAB 1M4ZA 1YCYA 4B9XA 5HKCA 1Q7YU 1WQ7A 3JB9F 3TU4K 2F5KA 1YIJA 4IURA 1YJ9T 5GMKi 3JCMb 2RI2A 3VUBA 4QVZA 3L2RA 1VQPT 3OYNA 2P4TA 3PT9A 1U1SA 3QSUA 2VGMA 2X35A 2EJGA 4JRKA 4M77F 3HRTA 3G4ST 1K73C 4PKCC 5M9OA 3M4YA 4FT4A 3SWNC 4JLIA 2KDSA 3O8VA 3LWIA 2ZCFB 3QYGB 1YIJT 5LJ5j 2EWNA 1JJ2A 5LJ3d 2EIFA 4X9CA 4Y91A 3V7SA 1N8RC 1BI1A 3CCJT 1MGQA 2PVOB 2VXFA 4JRQA 3S3MA 3HL8A 2L5QA 1UEBA 4A4EA 5CQYA 3JB9H 5FROA 5FU7B 4C8QC 5L8RE 3X20B 5LJ5f 2BIVA 5CKBA 3H6ZA 2MMPA 1VQNA 2VUBA 4O5VA 4QVCA 2RK1A 3P8HA 2JOYA 4M78G 5A2QE 3JRZA 4PJOE 3HRSA 3HHTB 3CBPA 5D6WA 5FU6B 4F7UG 3OW2A 2DTHA 2XU8A 1R8OB 2Y90A 3PGGA 1WPYA 3CC2A 4FU6A 3FRNA 4M75G 1VQOT 3PTAA 3M57A 1VQNT 1W4SA 3MO8A 2EYQA 3RKXA 3CMAT 5GAMj 4BI8B 4ME7A 3CC4A 2VXEA 4LDYA 1BI0A 5LJ3j 5GAOm 3BW1A 2DJZA 4NL3A 4E7IA 3CCSA 2EJ9A 1K9MU 2JVVA 5FRNA 3GIBA 4OGEA 2LC4A 2VGNA 1O75A 3QPHA 3DLLA 1UGQB 4ZGEB 4C92D 1KD1C 5GAMf 1G3TA 5KCHA 1JRIA 3HPWA 3DB3A 3QUIA 2EQMA 5LJ3f 2DEQA 3CC4T 3J80E 4C8QF 2IG0A 5AYFA 3TEEA 4OVAA 3CCST 1UGSB 2RA2A 2AHJB 5C0MA 3OYFA 1Q82C 3E19A 1XOVA 3X28B 3A8OB 5A0GA 1Q7YC 4LD9K 4M7DC 3SB2A 3LWHA 4IUPA 2XK0A 1S72T 5CAIA 3WXMB 3CPWA 1X01A 4ELZC 1FWZA 3JCMf 4FIBA 3EFRA 2LTOA 1JB0E 2FVUA 4ELYC 2DXUA 3UWNA 5GAOl 1VUBA 1D3BB 1I4K1 3F70A 1KHIA 4V2SA 3OYGA 4TVRA 5CIUA 3OS1A 5GANj 2XG8D 1G3SA 3L2VA 1QW1A 3V8KA 3VKIA 1D3BA 1SSFA 2RI3A 4M78E 2DVEA 4PLLA 1KG1A 2FHDA 2L3RA 4XTUA 2RHYA 2IVWA 4F7UE 3CBOA 3VYHB 4VUBA 3M9QA 1VQ4T 1FX7A 1UB4A 1N8RU 2E5QA 5GANf 4LDWA 4C0FA 2BKDN 4N0AC 3V8JA 4CI0C 2LT1A 5DLQE 3CPWS 1KHCA 2JZ2A 2HD0A 5LJ5e 1ZHIA 2LCCA 2E6ZA 3I56T 3C95A 4IUUA 3CMEA 1M90C 3M53A 3OS0A 3OYIA 3M59A 1N6AA 1H3ZA 2EQUA 1KQ2A 2B8AA 3QDRB 2M9UA 2WSCE 3OYKA 2P0QA 4OB2B 2PU9B 3I55A 4JS5A 4Z02A 2K5IA 3CC7A 4XTWA 2LDMA 4J8OA 2ZGWA 3MEAA 3OBWA 3X25B 2L89A 4B9WA 4C8QD 4DOVA 4J5YA 4D6WA 1YHQA 1BI2A 1M1FA 2OTLA 3A8MB 1MHNA 1DJ7B 2EQJA 1K9MC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GY5 A;  3L42 A;  5M9O A;  3EAE A;  5KE2 A;  4A4F A;  2G3R A;  4ZTF A;  2RJE A;  2HQX A;  3O8V A;  1WGS A;  2X4Y A;  4IUQ A;  4PL6 A;  5C6S A;  3LYI A;  4QQD A;  4C5E A;  3L2W A;  2BUD A;  3MP1 A;  2JTF A;  3S3N A;  3S3M A;  2LVM A;  4A4E A;  3PNW C;  4E7J A;  3OYH A;  3OYM A;  4E7L A;  3MEW A;  2NLU A;  2CKK A;  5FRO A;  2EQK A;  2L8D A;  2BIV A;  1WJS A;  3H6Z A;  3LGF A;  3OMG A;  1RI0 A;  2E6N A;  2YRV A;  3P8H A;  4EDU A;  3FEO A;  3NTI A;  3OMC A;  3PMT A;  5D6W A;  2QQS A;  3OYA A;  1WJR A;  1OI1 A;  3CEY A;  5J39 A;  3L2Q A;  4QW2 A;  4FU6 A;  3UT1 A;  4II1 A;  4X34 A;  2R57 A;  3OY9 A;  3MO8 A;  3MP6 A;  3OYD A;  4IKF A;  3OYB A;  3QBY A;  4E7H A;  3S6W A;  2X4X A;  3E9F A;  4L59 A;  3E9G A;  3GOX A;  4E7I A;  4QQ6 A;  2GFU A;  4UC4 A;  4C5G A;  5FRN A;  2O4X B;  3MEV A;  2RHU A;  4C5I A;  3NTK A;  3KUF A;  3LGL A;  4Q5W A;  4N4G A;  3S3O A;  2R58 A;  1G5V A;  3FLG A;  5KCH A;  2O4X A;  2DIQ A;  3DB3 A;  2M16 A;  2EQM A;  3MET A;  4BE2 A;  2GF7 A;  2IG0 A;  5KCO A;  3C4S A;  1N27 A;  4OVA A;  2M1H A;  2MWO A;  3OYF A;  5C0M A;  3PFS A;  4A4G A;  1OYX A;  2VYT A;  3ASK A;  3MP8 A;  3OYC A;  3Q1J A;  3QKJ A;  4BDZ A;  4LD6 A;  2R5A A;  5D6Y A;  4IUP A;  2XK0 A;  3LH0 A;  2LRQ A;  1WJQ A;  2LTO A;  3OS2 A;  3OQ5 A;  3L2U A;  3UWN A;  2WAC A;  3NTH A;  2RO0 A;  3F70 A;  3OYG A;  3OYJ A;  3OA6 A;  2PQW A;  5CIU A;  3OS1 A;  3FDR A;  3L2V A;  2EFI A;  4BDY A;  2EKO A;  2K3X A;  5KH6 A;  1SSF A;  2RI3 A;  3OYL A;  2X4W A;  4PLL A;  4C5H A;  4BE1 A;  2FHD A;  2L3R A;  4NS5 A;  2RHY A;  4PLI A;  2MWP A;  3M9Q A;  3P8D A;  4ZTJ A;  2RHI A;  3DB4 A;  2E5Q A;  3LX7 A;  4CRI A;  3LLR A;  2BKD N;  4IUV A;  2DIG A;  2RHX A;  2XDP A;  4FL6 A;  2DAQ A;  4RG2 A;  3ZEH A;  1KHC A;  2JZ2 A;  2R5M A;  2RJF A;  5J26 A;  2D9T A;  2GFA A;  2K3Y A;  2LCC A;  3OB9 A;  2RJC A;  3QII A;  4N4H A;  4IUU A;  4A4H A;  4BE0 A;  3OS0 A;  5D6X A;  1OZ3 A;  1XNI A;  4QQG A;  2RI5 A;  4IUT A;  3OYI A;  5FRM A;  2P0K A;  2EQU A;  4BAC A;  2HQE A;  2B8A A;  2RJD A;  3MEU A;  2M0O A;  1H3Z A;  3ME9 A;  3OYK A;  3QJ6 A;  3SD4 A;  4HCZ A;  4N4I A;  4Z02 A;  3PMI A;  5IN1 A;  4BD3 A;  3H8Z A;  3DLM A;  2RHZ A;  1OZ2 A;  4B9X A;  2LDM A;  4E7K A;  3FC3 A;  2QQR A;  3MEA A;  5KE3 A;  2F5K A;  2L89 A;  4B9W A;  5IAY A;  4IUR A;  3L2R A;  2RI2 A;  4QVZ A;  3BDL A;  3OYE A;  1MHN A;  3OYN A;  2X35 A;  2EQJ A; 
#chains in the Genus database with same CATH topology
 1VQ9 A;  2DZC A;  4PJO F;  4ZGJ B;  3EG9 A;  1GCQ A;  1NPR A;  4C92 A;  2BE9 B;  4EMK C;  1YIJ Q;  1K9M R;  4C5E A;  3JCM c;  2LMJ A;  5IT9 E;  3NFC A;  2NLU A;  4M78 C;  3QG1 A;  3BFM A;  1ZLM A;  3VUZ A;  3CCE T;  1RI0 A;  1ABO A;  1VQK A;  3PMT A;  4AFU C;  2M51 A;  3UT1 A;  1RAH B;  2GCX A;  3ZBD A;  1KC8 U;  3OY9 A;  4BI4 A;  4RCC A;  1FXX A;  3HFO A;  4PFP A;  1VQN Q;  4E7H A;  1XTD A;  2DKG A;  3VS6 A;  2X4X A;  4F16 A;  2YLC A;  4PNO A;  2QA4 A;  1EIF A;  3MEV A;  2CZ7 B;  4AG2 C;  4C92 G;  2B86 A;  2LNV A;  2LJ0 A;  1ZA2 B;  1VQ6 A;  4F7U F;  1QVF P;  2VYT A;  1T3S A;  2K6D A;  1D1A A;  3H0H A;  3RMQ A;  1QCN A;  3RIR A;  4FYY B;  1WJQ A;  1K9A A;  2DFU A;  4C8Q A;  1B07 A;  3C94 A;  1BI3 A;  1NYF A;  2DIL A;  4JJN K;  1NE8 A;  3FDR A;  3CC2 T;  1UFF A;  2GTJ A;  2EFI A;  2X4W A;  3G7Z A;  5AT1 B;  2XMF A;  2QG9 B;  3EH1 A;  1I5L A;  1ZBJ A;  2LJ1 A;  4M77 D;  2DXC A;  4CRI A;  1JBM A;  4PJL A;  2HMA A;  1QKW A;  4KUL A;  2LQ8 A;  2R5M A;  2GFA A;  3I5S A;  4A63 B;  5CKD A;  1AEY A;  1I07 A;  1D0X A;  3GNF B;  4BE0 A;  2ZPF B;  4JPB W;  5CKH A;  3M0T A;  2COZ A;  3MEU A;  2KMT A;  4JLG A;  3PMI A;  3C0C A;  2ABL A;  5IXB A;  1VA7 A;  4A54 A;  3EGD B;  4M78 D;  1QKX A;  1R0C B;  4M7D A;  5I2M A;  2DXT A;  1QVG S;  5GAN 4;  3M56 A;  4O6J A;  1IHV A;  3INZ A;  4P5N A;  4L6V 5;  5GAN 3;  2KSS A;  1Y57 A;  4EMH A;  2JW4 A;  3JCM W;  2L3Q A;  4KBM B;  2OJ2 A;  2EYY A;  2QEX T;  2CH4 W;  4E7L A;  2XKO C;  1ZQ1 A;  3N5B B;  3CME A;  2MPX C;  1TUG B;  3FJP A;  3M55 A;  1G3Y A;  1WXT A;  1PKS A;  2LT4 A;  4FSX A;  1ZSZ C;  1YJN A;  2CSI A;  1OI1 A;  2RNA A;  4J7I A;  2LX9 A;  1BCO A;  2NUP A;  2H3E B;  3S6W A;  3E9F A;  4M77 B;  1J3T A;  1K8A U;  2KE9 A;  3VS0 A;  2DVJ A;  4E2F B;  1VQ9 T;  1M1K C;  1QWE A;  2K57 A;  2VWF A;  3UPU A;  4XTX A;  4KT0 E;  1VIE A;  1U5S A;  4RMO A;  3CPW P;  2HCK A;  2MCN A;  4OMO A;  4EMK B;  1IZ6 A;  5FWC A;  3EFO B;  1UUE A;  4OB1 B;  5I21 A;  4XTY A;  4E47 A;  5GMK e;  2EYW A;  4LD6 A;  4M78 B;  2RN8 A;  1M30 A;  4R56 A;  5CKE A;  3OYJ A;  1KFZ A;  1HK9 A;  3V7R A;  3JB9 G;  4M75 A;  3UDC A;  1M2V A;  2PZ1 A;  2AIR B;  3JV3 A;  3CCJ A;  1X75 C;  3OYY A;  2QA4 T;  5CK9 A;  4ZGD B;  3OB9 A;  5HK3 A;  2W10 A;  2V8J A;  2P0K A;  1VQ6 T;  1WFW A;  3SD4 A;  4BB7 A;  3QDF A;  1SPK A;  3FC3 A;  1VQ8 T;  2CRE A;  2M0Y A;  2EAY A;  5LJ5 h;  4AT1 B;  2J05 A;  1BU1 A;  2NYS A;  4JJB A;  2OTJ Q;  1R77 A;  1M1K U;  4A4F A;  1NZ9 A;  1G83 A;  3WVD B;  3QXE B;  1WA7 A;  4L5G A;  5GAO q;  2JTE A;  4M7A E;  2NUT A;  4R55 A;  1M8V A;  5GAO n;  5DM7 R;  1Q86 U;  2YRD A;  3J81 E;  1T0J A;  4E7J A;  4IIM A;  2YHT A;  3CD6 T;  2QTV A;  2SEM A;  1S72 A;  1YI2 Q;  1ZBX A;  4BUG A;  5GAM h;  4GBQ A;  2DO3 A;  3UA7 A;  3OMC A;  2QQS A;  1U3O A;  1VYV A;  2Y4Y A;  4XAX B;  3PE0 A;  1HJD A;  1W2B A;  3CCQ A;  4RTT A;  3E1S A;  2XID A;  3E9G A;  2K4Y A;  4QQ6 A;  1NM7 A;  3OSV A;  3JCM h;  4C0Z A;  2CT3 A;  2Z0W A;  5KYW B;  1H3H A;  2C0I A;  4N4G A;  4PJO A;  4KH1 B;  2O4X A;  3HP9 A;  2HSE B;  2RM4 A;  3BDU A;  1VQM Q;  4XU0 A;  3HKS A;  3Q1J A;  1TOV A;  1MMD A;  3CME T;  2FG0 A;  1Q81 R;  4BY6 C;  4ZN1 A;  3H9N A;  4GLK A;  4MZT A;  1NJI R;  1ZSZ B;  1UG1 A;  1TTH B;  1LJO A;  2DYB A;  5KH6 A;  1SHG A;  5KYX A;  4BE1 A;  4NS5 A;  1BKB A;  1YJ9 Q;  1N9R A;  4WTO B;  2E5K A;  3DB4 A;  5IHN A;  1S1N A;  4DBF A;  2FYK A;  2H3J A;  1GL5 A;  1UJ0 A;  1QVF S;  2JNG A;  4J7F A;  5D6X A;  5FRM A;  4IUT A;  3JB9 J;  2DYI A;  5IN1 A;  4F7U A;  2D6F A;  4AFQ C;  1M4Z A;  4B9X A;  3TU4 K;  5GMK i;  3JCM b;  4QVZ A;  3OYN A;  1U1S A;  3QSU A;  2VGM A;  4M77 F;  3HRT A;  1QCF A;  2KRO A;  3O8V A;  1BBZ A;  3LWI A;  1JJ2 P;  4LN2 A;  2DEU A;  4X9C A;  3V7S A;  1N8R C;  5I22 A;  1BI1 A;  3CCJ T;  1MGQ A;  2PVO B;  4FYW B;  2VXF A;  3BE3 A;  1OU8 A;  4J9D A;  5CQY A;  3JB9 H;  5LJ5 f;  3X20 B;  2FZG B;  1F1B B;  4O5V A;  3HRS A;  3CBP A;  4F7U G;  2DTH A;  2XU8 A;  1R8O B;  1WPY A;  1AD5 A;  4ORZ A;  1TWB A;  3I35 A;  2YUQ A;  4ME7 A;  3CC4 A;  2VXE A;  1BI0 A;  3BW1 A;  2DJZ A;  4E7I A;  1QCO A;  1OEB A;  1EZZ B;  2LC4 A;  2K79 A;  2VGN A;  4ZGE B;  3NHN A;  5GAM f;  1G3T A;  5ECA A;  5KCH A;  3CXC P;  1JRI A;  4C8Q F;  4D8D A;  2CP3 A;  1VQ4 Q;  3CCS T;  1UGS B;  5A0G A;  2M02 A;  1S72 T;  4OML A;  3I56 Q;  1Q82 R;  3JCM f;  3H0F A;  1MNE A;  2CH4 A;  2FVU A;  2KRS A;  1D3B B;  1I4K 1;  3OS1 A;  1ZX6 A;  1KQS P;  3VKI A;  2RI3 A;  4M78 E;  1RAB B;  2L3R A;  5IH2 A;  1N8R U;  4PJJ A;  1KC8 R;  4OMP A;  3EG1 A;  4C0F A;  3CPW S;  2HKN A;  1NG2 A;  2E6Z A;  3C95 A;  2KRN A;  3M59 A;  3CCL Q;  3OW2 P;  4JS5 A;  1JXO A;  4Z02 A;  1I5O B;  3CC7 A;  4XTW A;  4J8O A;  4D8K A;  2GNC A;  1PKT A;  3OBW A;  4B9W A;  1YHQ A;  3CCE Q;  1M1F A;  2CP7 A;  1X6B A;  1DJ7 B;  2EQJ A;  2QXF A;  2A7Y A;  2RJE A;  5IXF A;  4DEX A;  2F2V A;  5C6S A;  5LJ3 e;  1RAA B;  4PFZ A;  4DEY A;  3QO3 A;  2EVR A;  2E41 A;  1WJS A;  3G6E T;  2KBT A;  4MZM A;  1YCS B;  1RI9 A;  3SDZ A;  3RBB B;  2K5L A;  3OS5 A;  4NOY A;  2YXY A;  2CYZ B;  2BZX A;  5GMK m;  1U1T A;  2ESW A;  2FZK B;  3QWX X;  5GAN e;  2K2M A;  2LQN A;  3CC2 Q;  4Q5W A;  2AK5 A;  4ZNX A;  2PNI A;  2X9H A;  3GNG A;  5LJ3 g;  3RNJ A;  4F17 A;  3H0I A;  4FM4 B;  4Z88 A;  5FU7 C;  4LUD A;  4M75 F;  1AWJ A;  1R0B G;  5D6Y A;  1M5Q 1;  4J9F A;  2CP0 A;  4M7A D;  1N9S A;  2BE7 D;  2CZ1 B;  5GAN d;  1WHH A;  1YN8 A;  2NWM A;  1M2O A;  1NBE B;  1SRM A;  1WDX A;  4LDX A;  2MWP A;  1K0S A;  3IQL A;  1WHG A;  5GMK j;  2RHX A;  3NGP A;  5CKF A;  1QVG A;  3VS1 A;  4ANJ A;  2AZV A;  3CCM T;  2CP2 A;  1BYM A;  2Y4X A;  1IRE B;  2K5F A;  4MZP A;  1BK2 A;  4N4I A;  4BD3 A;  2ECZ A;  3DLM A;  1KC8 C;  2ZAE A;  2QQR A;  1BB9 A;  1VIF A;  5IAY A;  4YTL A;  4CC3 A;  5FWB A;  2JN0 A;  3VS2 A;  4OMF B;  3M54 A;  4XU3 A;  3I55 Q;  2QEX A;  2E65 A;  1I81 A;  1FMW A;  2OTL Q;  1JEG A;  2GQI A;  1EX4 A;  3JCM J;  4J9E A;  4E6R A;  3PNW C;  3OYM A;  1VQ9 Q;  2OX7 A;  3T9N A;  1YBY A;  1M3B A;  2L8D A;  3P8B B;  3OMG A;  4J9H A;  4N0A A;  4M7A B;  3QZ5 B;  2DJQ A;  3OYA A;  1OUL A;  1LCK A;  3E2U A;  3VYG A;  4II1 A;  4X34 A;  3CC7 T;  2R57 A;  3OSS C;  2OI3 A;  5CO7 A;  2ZPH B;  3OYD A;  3V7C A;  3OYB A;  3JSC A;  1YHQ T;  3GOX A;  1VQK Q;  2XHC A;  4HVU A;  4CC2 A;  3VJP A;  1JJ2 S;  4C92 C;  2L3S A;  4ATO A;  1GRI A;  4M77 A;  3CPF A;  2QQA A;  3MHX A;  4B6M A;  4ZN3 A;  3EFS A;  2R58 A;  2RQW A;  3GPL A;  3FLG A;  2CT4 A;  3KXT A;  1AWX A;  1KQ1 A;  2E12 A;  1M1K R;  1AZE A;  4JJC A;  4EMK A;  3CCU T;  2QA4 Q;  4EMG A;  4BDZ A;  5HK0 A;  2EJF A;  2R5A A;  3EFO A;  2OAU A;  1HD3 A;  1VQP A;  3FIF A;  1VQ6 Q;  1I8F A;  5DY9 A;  2JTM A;  3G4S A;  2PQW A;  1YFN A;  2V1R A;  1RAE B;  1UHC A;  2AZS A;  1VQ8 Q;  2A08 A;  4HKE A;  3OBY A;  4ZTJ A;  2RHI A;  4M77 G;  3CXC S;  2FO0 A;  3A8G B;  2FL7 A;  1AWW A;  4MDX A;  2C0O A;  1VQ8 A;  2X51 A;  1PM3 A;  4QVD A;  1TXQ A;  3M0S A;  2HQE A;  2PVD B;  2HAX A;  1SF9 A;  1WXB A;  1LPL A;  2LP5 A;  2PUO B;  3QZ9 B;  1KQS S;  2RF0 A;  1K8A C;  3I5R A;  3CD6 A;  2JS0 A;  2G3R A;  2DZ9 A;  4HCB A;  1PD0 A;  3A8H B;  3L2W A;  3VS5 A;  5I2S A;  5EG2 A;  2LVM A;  3RR6 A;  3OYH A;  1OOT A;  1Y71 A;  2G6F X;  3GLX A;  2HNI A;  1M3C A;  2DL3 A;  2DM1 A;  1M27 C;  2KRM A;  1UTI A;  3OW2 S;  4C8Q G;  3QJY A;  4PFO A;  4LDV A;  3CME Q;  1P92 A;  3JCM V;  2RD1 A;  4IKF A;  2QI2 A;  2V1Q A;  1YJN Q;  4KGV B;  1K73 U;  1TU0 B;  1V76 A;  5GMK h;  3NTK A;  3KUF A;  3LGL A;  4FYV B;  5KYU B;  3S3O A;  1G5V A;  5KYW A;  2DIQ A;  3MET A;  2M16 A;  2LQK A;  1PCX A;  2I0N A;  2DBM A;  3EGX A;  3QKJ A;  1ZA1 B;  1U8R A;  4C0D C;  2AKK A;  2QGG A;  1XQH A;  2XI9 A;  4J6W A;  4M7D G;  2O01 E;  3OQ5 A;  1QVF A;  2YDL A;  1VQ5 T;  3OA6 A;  1PRM C;  1ZSZ A;  5A0L A;  1IB8 A;  1NPP A;  1WHJ A;  4PLI A;  2KT1 A;  2RQU A;  3CCV A;  2YUP A;  2FPE A;  1YWO A;  1Q86 C;  1NLO C;  2HZY A;  3ZL7 C;  2VB6 A;  2HL5 C;  1KD1 U;  2LNH B;  1NYG A;  2D9T A;  4Y28 E;  2KEA A;  4N4H A;  4A4H A;  4HA8 A;  2YRC A;  3CCJ Q;  4M7A F;  3CCR A;  2OAW A;  4K11 A;  1D09 B;  3H8Z A;  3MCA B;  1YCY A;  4KGX B;  1VQP T;  2P4T A;  2IIM A;  4JRK A;  3G4S T;  4PKC C;  3SWN C;  4Z89 A;  2KDS A;  1YIJ T;  1WIE A;  3S3M A;  2HKQ B;  1QMC A;  2L5Q A;  1UEB A;  4A4E A;  2DL4 A;  5D7U A;  5CKB A;  3H6Z A;  1WLP B;  1N8R R;  2JOY A;  3JRZ A;  3SHW A;  1PWT A;  1V1C A;  2ENM A;  4M75 G;  1MV0 B;  2J6K A;  3PTA A;  3M57 A;  1VQN T;  1S72 Q;  2VAS A;  3NPF A;  5LJ3 j;  5GAO m;  4NL3 A;  3CCS A;  1K9M U;  2JVV A;  1TUC A;  5FRN A;  1UGQ B;  3ULR B;  2DNU A;  2HBW A;  4M4Z A;  3CCQ Q;  3QUI A;  1AVZ C;  3J80 E;  4KRT A;  4OVA A;  1PHT A;  2KI7 A;  3X28 B;  1K4U S;  4LD9 K;  2XK0 A;  4KH0 B;  3WXM B;  3CPW A;  1RAD B;  1FWZ A;  1JB0 E;  4ELY C;  3UWN A;  5GAO l;  2EW3 A;  4TVR A;  5GAN j;  1G3S A;  1D3B A;  4RTX A;  1YNZ A;  2K3B A;  1W6X A;  2HEQ A;  2D0N A;  2BKD N;  2LT1 A;  5LJ5 e;  2BTT A;  3M53 A;  4DBQ A;  3OYI A;  2O9V A;  1H3Z A;  2EQU A;  2B8A A;  2M9U A;  2WSC E;  3OYK A;  2P0Q A;  4HXJ A;  4E7Z A;  1JXM A;  2LDM A;  1RAC B;  3MEA A;  4JZ4 A;  3X25 B;  1VYU A;  5HCK A;  4D6W A;  1FYN A;  2ATC B;  5IHK A;  1G3W A;  2LCL A;  1X6G A;  2MAM A;  4PJO G;  2HQX A;  5GAN 8;  5GAM e;  5LJ5 d;  4PL6 A;  3G6E A;  2XIC A;  3CCV T;  1UGV A;  3X24 B;  1WQW A;  2RMO A;  3LGF A;  5KYN A;  2DER A;  3REB B;  1SRL A;  1XJW B;  2C0T A;  3FEO A;  1YWP A;  7AT1 B;  3JCM e;  1KIK A;  3CCR T;  1WJR A;  2DX1 A;  4KUI A;  1V29 B;  4AMC A;  1WNL A;  4LXC A;  1MND A;  2YT6 A;  3R6N A;  5EC7 A;  2V8I A;  2CS7 A;  2COW A;  5A0D A;  1ARK A;  5GAM d;  1WZO A;  2X4J A;  1NLP C;  2VC8 A;  1SKU B;  3M0U A;  3SWN B;  4A4K A;  2KNB B;  1YIT A;  2GF7 A;  4M78 F;  4RTY A;  3CC4 Q;  3JCM d;  1OYX A;  3VS4 A;  5FLX E;  4BI3 A;  1OV3 A;  2E3I A;  2HQH A;  3G71 A;  1M9S A;  1W1F A;  2RB6 A;  3VV0 A;  2LRQ A;  2PUK B;  2FPD A;  3UF4 A;  2MYS A;  1MUZ A;  2E1H A;  4BDY A;  1BIB A;  4RKU E;  2H8H A;  3EGU A;  4J6X A;  3JCM Q;  1VQ7 A;  4IIO A;  3CCM A;  2LX7 A;  1YP5 A;  1CKA A;  2RH2 A;  2F69 A;  1C0M A;  2XDP A;  2RJF A;  3SEM A;  5CCA A;  2RJC A;  1OZ3 A;  1VQL A;  1W70 A;  2RJD A;  3R6O A;  4C92 E;  2HDA A;  2L3P A;  1C1A A;  2COY A;  1YJW A;  2DL8 A;  3I9Q A;  3BDL A;  5LJ3 h;  3OYE A;  2OTJ T;  3L42 A;  1M1G A;  1Y96 B;  3CC7 Q;  2IPO B;  3GF5 A;  1JQQ A;  1YHQ Q;  2F2W A;  2CP5 A;  1GXI E;  2QGF B;  3TRE A;  4A53 A;  1AWO A;  4DBR A;  5CR2 A;  2DD5 A;  2QYZ A;  1JJ2 A;  4FCY A;  2XDD A;  2YWW A;  3GP8 A;  2JUF A;  4XQ3 A;  2DK3 A;  2WSE E;  3TCJ A;  3NTI A;  4BY6 B;  4X9D A;  1B34 B;  1QP3 A;  3CEY A;  5J39 A;  3RKY A;  4M7A A;  2DL5 A;  6AT1 B;  2MF2 A;  4QW2 A;  3UA6 A;  4JRP A;  2A3L A;  4JS4 A;  2XDB A;  4UC4 A;  3CCU A;  4ESR A;  1Y7X A;  2E64 A;  2ROL A;  4J9G A;  2F1L A;  4OB3 B;  5KCO A;  4XTV A;  2DMO A;  3URG A;  2A36 A;  3CXC A;  4LDU A;  1H64 1;  5HY6 A;  4OP0 A;  3OS2 A;  4M7A G;  3NTH A;  1ACM B;  2DPP B;  3BY7 A;  4QKU A;  1E6G A;  3OYL A;  3NMZ C;  3LH5 A;  2WSF E;  3A5Z B;  1QWF A;  4OB0 B;  2JS2 A;  4LUE A;  2A37 A;  3LX7 A;  4XTZ A;  3SFM A;  3PIP A;  1KQS A;  4HT9 A;  4AFZ C;  2DAQ A;  4M7D E;  4CC4 B;  3REA B;  1YIT T;  1Q81 U;  2XD0 A;  2EKH A;  4J9I A;  5GMK l;  1E6H A;  3QYH B;  1NJI U;  1VQO A;  1OZ2 A;  4E7K A;  3CMA A;  4NL2 A;  3G71 T;  2HBP A;  3MJX A;  3PVL A;  1GFD A;  1KK7 A;  1G8X A;  5GAN g;  3RMS A;  5KE2 A;  2QDY B;  1FMK A;  2EYX A;  2ZPE B;  2E10 A;  3RER A;  1K8A R;  3RES A;  1VQ7 T;  1Y07 A;  1AT1 B;  1TS9 A;  3MP1 A;  4JRI A;  1RAI B;  2QEX Q;  2JT4 A;  2EQK A;  1I1J A;  2HSP A;  2YRV A;  3GBQ A;  3EGD A;  1VQL T;  3L2Q A;  2MOX A;  2DD4 A;  2L0A A;  4DQ2 A;  1YJW T;  1PG5 B;  4J9C A;  5LL6 S;  5IHI A;  3X26 B;  4L59 A;  1ZUK A;  1WI7 A;  4Z8A A;  2GFU A;  2ZPB B;  1Y0M A;  2P84 A;  3FB9 A;  1A0N B;  2BZ8 A;  1X69 A;  3A1P A;  4R0K A;  1PSF A;  1X27 A;  1RL2 A;  5KYU A;  4LNP A;  4M75 E;  2MWO A;  3MP8 A;  3HSB A;  1VQ5 A;  1QQJ A;  5DLO A;  2F5T X;  4F04 B;  3PIO A;  1GCQ C;  2WAC A;  4XU1 A;  3RKW A;  4HCC A;  2CGH A;  1HYO A;  2EKO A;  2K3X A;  1K76 A;  4M77 C;  2J6F A;  1VQP Q;  2J7I A;  4JJD A;  2DTI A;  2J6O A;  3RUX A;  3G4S Q;  4IUV A;  1OPK A;  4FL6 A;  2PVG B;  3EG2 A;  2QQ9 A;  4WCI A;  2C06 A;  1Q86 R;  3CCL T;  4M78 A;  1Q82 U;  8ATC B;  2M0O A;  2KAF A;  2RPN A;  2EBP A;  1PSE A;  1Q7Y U;  5HKC A;  1WQ7 A;  3FJ5 A;  2F5K A;  1SHF A;  1YIJ A;  4IUR A;  2AT1 B;  2RI2 A;  3PT9 A;  1UHF A;  2EJG A;  1K73 C;  4LE9 A;  5M9O A;  3M4Y A;  2CUB A;  1IO6 A;  5LJ5 j;  2EIF A;  4Y91 A;  1OQK A;  2FPF A;  1E7O A;  4JRQ A;  3HL8 A;  3UAT A;  5FU7 B;  2X3W D;  4C8Q C;  3CD6 Q;  2BIV A;  2JMA A;  1VQN A;  1IHW A;  2VUB A;  4OMQ A;  4M78 G;  4PJO E;  2JM8 A;  3FRN A;  2K9G A;  1VQO T;  1W4S A;  3MO8 A;  4RUG A;  3CMA T;  5GAM j;  4BI8 B;  2CP6 A;  4RTW A;  4JZ3 A;  2EJ9 A;  1H8K A;  3GIB A;  3QPH A;  4C92 D;  1KD1 C;  3DB3 A;  1ZUU A;  2IG0 A;  2KYB A;  5AYF A;  3TEE A;  1OPL A;  3E19 A;  3M0R A;  9ATC B;  3SB2 A;  4M7D C;  3LWH A;  4IUP A;  1X01 A;  4FIB A;  3EFR A;  1VUB A;  3F70 A;  4DBH A;  5CIU A;  3L2V A;  1QW1 A;  2DVE A;  4PLL A;  1KG1 A;  4E7S A;  4XTU A;  2RHY A;  2IVW A;  4F7U E;  3CBO A;  4VUB A;  3TSW A;  4HCK A;  1FX7 A;  1KSW A;  1H92 A;  1Q95 G;  2JZ2 A;  1ZHI A;  4IUU A;  1M90 C;  1ZSG A;  3OS0 A;  3CCV Q;  3QDR B;  4OB2 B;  2PU9 B;  5KYY B;  3QWY A;  2ZGW A;  2FRY A;  2L89 A;  4C8Q D;  4PJM A;  1BI2 A;  3A8M B;  1MHN A;  3EG9 B;  1UGR B;  1K9M C;  4GY5 A;  3I55 T;  3CCR Q;  2O2O A;  2GGR A;  4ZTF A;  4C92 B;  2QAZ A;  1WGS A;  1Z9Q A;  2OTL T;  2QK0 A;  1ABQ A;  2LJ3 A;  3L1A A;  2EGC A;  3S3N A;  4F14 A;  3MEW A;  3C12 A;  4QT7 A;  1O9S A;  4JUV A;  1RAF B;  3M4G A;  1W2B P;  2E6N A;  2JXB A;  2KQW A;  4EDU A;  3KFV A;  4M75 C;  5GAO r;  1QVP A;  2ROT A;  1N5Z A;  2DLP A;  2AKL A;  2V8K A;  2O9S A;  2DA9 A;  2QQB A;  3MP6 A;  4PK4 A;  4M7D D;  2EGA A;  3VS7 A;  1VQK T;  1UEC A;  4KGZ B;  3JAM E;  1HXD A;  4J6Y A;  1AHJ B;  5FW9 A;  4XK8 E;  2ZPI B;  5J3B A;  1G2B A;  1GBQ A;  1M90 U;  3C4S A;  3SWN A;  1N27 A;  2VKN A;  4RTZ A;  3QHS A;  3PFS A;  3CCS Q;  3OYC A;  5GAN 5;  4C8Q B;  1Z9Z A;  2LQW A;  2X3X D;  1MMA A;  2KXD A;  5I11 A;  1B3Q A;  2RK2 A;  3VS3 A;  3HRU A;  2CZ0 B;  5GAN 6;  2V26 A;  3HFN A;  1D1C A;  3JB9 D;  2DTO A;  1BCM A;  4C5H A;  1CSK A;  4FSS A;  4DOW A;  1T3L A;  1OX9 A;  1U06 A;  3A98 A;  2KYM A;  1OX8 A;  4WF2 A;  1M3A A;  4CC7 A;  1SG5 A;  1WHM A;  3AT1 B;  3QII A;  2LZ6 B;  2GQV A;  1QP2 A;  3M0P A;  1XNI A;  4QQG A;  2DBK A;  3TVT A;  2OTJ A;  4FW1 A;  3ME9 A;  4HCZ A;  1PD1 A;  3EH2 A;  4M7D B;  1D0Y A;  4PJO C;  3A8L B;  2DE0 X;  2O88 A;  3RDV A;  4M75 D;  2KK4 A;  4OMN A;  2KT8 A;  4MMK A;  1YI2 A;  2HL3 A;  1Y96 A;  2X4Y A;  4C0G A;  2EYZ A;  1T0H A;  2FB7 A;  1WXU A;  4QQD A;  3EG0 A;  2BUD A;  2P0P A;  3H41 A;  4GLM A;  3TSZ A;  2DXB A;  3KBG A;  1X2K A;  2CKK A;  2I2L A;  5CVI A;  4J83 A;  1X43 A;  3EGX B;  2ED0 A;  1MMG A;  2KVQ G;  3G6E Q;  4C0D B;  2GTO A;  2LCS A;  3AHU A;  3VRZ A;  1B34 A;  2NUP B;  1CKB A;  3DKM A;  3TQ7 P;  3LW5 E;  1MV3 A;  1JO8 A;  1X6O A;  1B7T A;  1I0C A;  1VQM A;  3M58 A;  2VVK A;  3M0Q A;  1YJN T;  4C5G A;  2E4H A;  2RQR A;  2RHU A;  2ED1 A;  5LJ5 g;  3PVQ A;  2SRC A;  2E70 A;  3JCM P;  1KJW A;  1PRL C;  2M1H A;  4HT8 A;  2YUO A;  1PC0 A;  4HVV A;  1YJ9 A;  1YIT Q;  3LH0 A;  3G1J A;  5CQX A;  2RO0 A;  4M75 B;  4OMM A;  4OGC A;  2RQT A;  1M2V B;  1IXD A;  2P4R A;  2KY9 A;  2VV5 A;  1K1Z A;  4C92 F;  2L2P A;  5GAM g;  1ZUY A;  3G71 Q;  2ZPG B;  2CZ6 B;  4FT2 A;  3P8D A;  4OF1 A;  3JCM X;  4X1V A;  4PJO D;  2DIG A;  2PTK A;  5J26 A;  1C6V X;  3WVE B;  3JB9 I;  1VQ7 Q;  5FU6 C;  3JCM g;  1D0Z A;  3CCM Q;  2MI6 A;  1BIA A;  4BAC A;  2QDL A;  2O31 A;  5GAN 7;  3M5A A;  5KE3 A;  1UGP B;  1RLQ C;  1TUD A;  2D1X A;  1FMV A;  1VQL Q;  1SSH A;  2K2V A;  3EAE A;  1UE9 A;  4RG8 A;  2NUT B;  2DL7 A;  3VU3 C;  4DA4 A;  4IUQ A;  1RLP C;  1YJW Q;  3V8L A;  4HVW A;  2MK5 A;  1WX6 A;  3J7A F;  3LYI A;  2YUN A;  1IGU A;  2YLB A;  2JTF A;  3ER0 A;  1RAG B;  1UDL A;  2MIO A;  1GFC A;  2BZY A;  2F2X A;  4M77 E;  4EPC A;  3O5Z A;  4PJN A;  1NEB A;  2ZZD A;  4FW2 A;  2JM9 A;  1WYX A;  4EIK A;  1LNX A;  2QTX A;  5GJW B;  1LVK A;  3QBY A;  2A28 A;  1VQ4 A;  4KUD K;  3EHQ A;  5GAO p;  2W0Z A;  1Q7Y R;  4PJO B;  2EGE A;  2O4X B;  2FEI A;  4C5I A;  2YSQ A;  4MML A;  3CCQ T;  1GBR A;  1YI2 T;  3I56 A;  2D8J A;  3ZFJ A;  1WHL A;  4JDS A;  4BE2 A;  1Q81 C;  1K0X A;  3U23 A;  2CUD A;  3D7S B;  3CBM A;  4A4G A;  3ASK A;  3CQT A;  2DF6 A;  1W2B S;  5GAN h;  1NJI C;  4XU2 A;  3CCU Q;  4M7A C;  1X2Q A;  2FRW A;  4M7D F;  3L2U A;  2RQV A;  2DRM A;  5KYX B;  1TSF A;  4MDW A;  2D0Q B;  2JMC A;  1TH7 A;  4C8Q E;  4RCB A;  3L2Z A;  1QVG P;  2EQI A;  1IRX A;  1VQM T;  3CCL A;  5L23 A;  3LLR A;  4RG2 A;  2GBQ A;  3ZEH A;  1QLY A;  1TG0 A;  1VOM A;  2K3Y A;  3CCE A;  4FYX B;  4F7U B;  2RI5 A;  2D8H A;  1LOJ A;  4AG1 C;  5GAN 2;  3VRY A;  3QJ6 A;  1D1B A;  3EHR A;  5GJV B;  2RHZ A;  3JB9 F;  4J9B A;  1YJ9 T;  3L2R A;  3VUB A;  2KXC A;  2X35 A;  1SEM A;  4FT4 A;  4JLI A;  1VQO Q;  2ZCF B;  3QYG B;  2JJ9 A;  3CMA Q;  2EWN A;  5LJ3 d;  1K73 R;  1VYT A;  2DRK A;  5FRO A;  5L8R E;  2FZC B;  2MMP A;  2A0F B;  4QVC A;  2RK1 A;  3P8H A;  3MKD A;  5A2Q E;  3HHT B;  5D6W A;  2QAS A;  5FU6 B;  2E3H A;  3OW2 A;  4AFS C;  2Y90 A;  3PGG A;  3CC2 A;  4FU6 A;  2EYQ A;  3RKX A;  1M8M A;  3EG3 A;  2DET A;  4LDY A;  1IGQ A;  4OGE A;  1O75 A;  2KGT A;  3DLL A;  1OU9 A;  1HSQ A;  1UJY A;  1PNJ A;  8AT1 B;  5LJ3 f;  3HPW A;  2EQM A;  2DEQ A;  3CC4 T;  2RA2 A;  2AHJ B;  5C0M A;  3OYF A;  1Q82 C;  1XOV A;  1KD1 R;  3A8O B;  1Q7Y C;  2NUZ A;  2J06 A;  5CAI A;  4ELZ C;  2CSQ A;  2LTO A;  2DXU A;  1NEG A;  4RTU A;  1AZG B;  1KHI A;  3OYG A;  4V2S A;  1JU5 C;  1VQ5 Q;  2XG8 D;  3V8K A;  1SSF A;  1EFN A;  2FHD A;  1WHK A;  3VYH B;  1VQ4 T;  3M9Q A;  1UB4 A;  2E5Q A;  5GAN f;  4LDW A;  4N0A C;  3V8J A;  4CI0 C;  2KR3 A;  3THK A;  5DLQ E;  1KHC A;  2K7A A;  2HD0 A;  4Y92 A;  2LCC A;  3I56 T;  1GCP A;  1N6A A;  4RTV A;  1KQ2 A;  3I55 A;  2K5I A;  1MMN A;  1RUW A;  2EPD A;  3HTR A;  2CDT A;  1M90 R;  3MPU B;  5KYY A;  4DOV A;  4J5Y A;  2OTL A;  1AOJ A; 
#chains in the Genus database with same CATH homology
 4GY5 A;  1G3W A;  2LCL A;  2QXF A;  3I55 T;  1VQ9 A;  2DZC A;  2MAM A;  4PJO F;  4ZGJ B;  2A7Y A;  4PJO G;  4ZTF A;  4C92 B;  2RJE A;  2HQX A;  1NPR A;  5GAN 8;  1WGS A;  5GAM e;  5LJ5 d;  2OTL T;  4PL6 A;  3G6E A;  4C92 A;  4EMK C;  5C6S A;  5LJ3 e;  2XIC A;  4C5E A;  3CCV T;  3L1A A;  3JCM c;  3S3N A;  3X24 B;  3QO3 A;  1WQW A;  5IT9 E;  3MEW A;  3NFC A;  2NLU A;  3C12 A;  2E41 A;  4M78 C;  1O9S A;  1WJS A;  4JUV A;  3QG1 A;  3BFM A;  3LGF A;  3M4G A;  3VUZ A;  3G6E T;  3CCE T;  1RI0 A;  2E6N A;  2KQW A;  4EDU A;  1VQK A;  3FEO A;  3PMT A;  4M75 C;  3JCM e;  5GAO r;  3CCR T;  1WJR A;  1QVP A;  4MZM A;  4KUI A;  1V29 B;  3SDZ A;  1WNL A;  3UT1 A;  2GCX A;  3ZBD A;  2K5L A;  3OS5 A;  1KC8 U;  3OY9 A;  2V8K A;  2CS7 A;  2V8I A;  4NOY A;  4RCC A;  1FXX A;  3HFO A;  2QQB A;  4BI4 A;  3MP6 A;  5A0D A;  4M7D D;  5GAM d;  4E7H A;  1XTD A;  2DKG A;  1VQK T;  2CYZ B;  5GMK m;  2X4X A;  1U1T A;  2X4J A;  2YLC A;  4PNO A;  2VC8 A;  5GAN e;  3JAM E;  2QA4 A;  1EIF A;  3MEV A;  1HXD A;  2CZ7 B;  4Q5W A;  4J6Y A;  1AHJ B;  4XK8 E;  3SWN B;  4A4K A;  4C92 G;  3GNG A;  1YIT A;  2LNV A;  2ZPI B;  5LJ3 g;  5J3B A;  2GF7 A;  4M78 F;  1M90 U;  3C4S A;  3SWN A;  1N27 A;  4FM4 B;  1VQ6 A;  3QHS A;  3JCM d;  3PFS A;  5FU7 C;  1OYX A;  2VYT A;  5FLX E;  4F7U F;  3OYC A;  4BI3 A;  4M75 F;  5D6Y A;  5GAN 5;  3RMQ A;  4C8Q B;  1M5Q 1;  3G71 A;  1M9S A;  2RB6 A;  3RIR A;  3VV0 A;  2LRQ A;  1WJQ A;  2RK2 A;  4C8Q A;  4M7A D;  2PUK B;  3HRU A;  2CZ0 B;  1N9S A;  3C94 A;  1BI3 A;  5GAN 6;  2CZ1 B;  3HFN A;  4JJN K;  1NE8 A;  3FDR A;  5GAN d;  3CC2 T;  3JB9 D;  2E1H A;  2EFI A;  2DTO A;  4BDY A;  1BIB A;  2X4W A;  4RKU E;  4C5H A;  3G7Z A;  4J6X A;  3JCM Q;  1VQ7 A;  4DOW A;  4LDX A;  2MWP A;  3CCM A;  1I5L A;  4M77 D;  2DXC A;  4CRI A;  1JBM A;  2RH2 A;  2F69 A;  5GMK j;  2RHX A;  2XDP A;  4WF2 A;  5CKF A;  4KUL A;  2LQ8 A;  2R5M A;  2RJF A;  1QVG A;  2GFA A;  5CKD A;  5CCA A;  2RJC A;  3QII A;  3GNF B;  2GQV A;  4BE0 A;  1QP2 A;  2ZPF B;  1OZ3 A;  1XNI A;  4QQG A;  3CCM T;  2Y4X A;  1IRE B;  1BYM A;  2K5F A;  4MZP A;  4JLG A;  5CKH A;  2RJD A;  2KMT A;  3MEU A;  1VQL A;  3ME9 A;  2OTJ A;  3R6O A;  4HCZ A;  4N4I A;  4BD3 A;  3PMI A;  4C92 E;  3DLM A;  1KC8 C;  2QQR A;  4A54 A;  1YJW A;  4M7D B;  1VIF A;  4M78 D;  5IAY A;  4YTL A;  3BDL A;  5LJ3 h;  3OYE A;  2JN0 A;  4PJO C;  3A8L B;  4M7D A;  2OTJ T;  4OMF B;  3M54 A;  4XU3 A;  3L42 A;  4M75 D;  1M1G A;  1Y96 B;  5I2M A;  2DXT A;  2QEX A;  5GAN 4;  3M56 A;  4O6J A;  1QVG S;  2E65 A;  2KK4 A;  3INZ A;  1YI2 A;  4MMK A;  4P5N A;  3GF5 A;  2X4Y A;  1Y96 A;  4L6V 5;  4C0G A;  1I81 A;  5GAN 3;  2KSS A;  2FB7 A;  4EMH A;  1GXI E;  4QQD A;  3TRE A;  2BUD A;  2P0P A;  4A53 A;  3JCM W;  3JCM J;  4KBM B;  2DXB A;  3KBG A;  3PNW C;  2QEX T;  3OYM A;  5CR2 A;  3T9N A;  2DD5 A;  4E7L A;  1YBY A;  2CKK A;  1ZQ1 A;  2XKO C;  3N5B B;  2I2L A;  2L8D A;  3FJP A;  3P8B B;  4J83 A;  5CVI A;  2XDD A;  3M55 A;  3GP8 A;  2JUF A;  4XQ3 A;  3UPU A;  2DK3 A;  1G3Y A;  3OMG A;  2WSE E;  2KVQ G;  4N0A A;  4M7A B;  3QZ5 B;  3TCJ A;  2LT4 A;  4C0D B;  3NTI A;  4FSX A;  4X9D A;  4BY6 B;  3OYA A;  1QP3 A;  1B34 B;  1YJN A;  1OI1 A;  3CEY A;  3RKY A;  5J39 A;  4M7A A;  2MF2 A;  3AHU A;  4QW2 A;  1B34 A;  3VYG A;  4II1 A;  4X34 A;  3CC7 T;  4JRP A;  2R57 A;  3DKM A;  3OSS C;  2A3L A;  4J7I A;  5CO7 A;  2LX9 A;  2ZPH B;  3LW5 E;  3OYD A;  3V7C A;  3OYB A;  3JSC A;  1YHQ T;  4JS4 A;  3S6W A;  1X6O A;  3E9F A;  3GOX A;  1UGR B;  4M77 B;  2XHC A;  3M58 A;  1VQM A;  3VJP A;  1YJN T;  1K8A U;  1JJ2 S;  2XDB A;  4C92 C;  4UC4 A;  4C5G A;  1M1K C;  1VQ9 T;  4ATO A;  2RHU A;  4M77 A;  3CPF A;  3CCU A;  2QQA A;  2K57 A;  3MHX A;  4ZN3 A;  1Y7X A;  3EFS A;  2R58 A;  4XTX A;  2E64 A;  1VIE A;  3FLG A;  4KT0 E;  5LJ5 g;  3KXT A;  4RMO A;  3GPL A;  4OB3 B;  1KQ1 A;  2E70 A;  3JCM P;  5KCO A;  2E12 A;  4EMK B;  1IZ6 A;  2M1H A;  4HT8 A;  4OB1 B;  4XTV A;  4XTY A;  4E47 A;  3URG A;  5I21 A;  4EMK A;  5GMK e;  3CCU T;  4EMG A;  4BDZ A;  5HK0 A;  4LD6 A;  2EJF A;  2R5A A;  3CXC A;  4M78 B;  4LDU A;  1H64 1;  5HY6 A;  1YJ9 A;  3LH0 A;  2OAU A;  1VQP A;  3FIF A;  4OP0 A;  3OS2 A;  5CQX A;  4M7A G;  4R56 A;  3NTH A;  2RO0 A;  2DPP B;  1I8F A;  4M75 B;  2JTM A;  5CKE A;  5DY9 A;  3BY7 A;  4OGC A;  3OYJ A;  3G4S A;  2PQW A;  2KY9 A;  2VV5 A;  1HK9 A;  3V7R A;  3JB9 G;  4M75 A;  3UDC A;  4C92 F;  3OYL A;  5GAM g;  2WSF E;  3A5Z B;  4HKE A;  4OB0 B;  2ZPG B;  2CZ6 B;  3OBY A;  4FT2 A;  3CCJ A;  1X75 C;  3P8D A;  4ZTJ A;  2RHI A;  3LX7 A;  4OF1 A;  4XTZ A;  3SFM A;  3JCM X;  4M77 G;  3PIP A;  4PJO D;  3CXC S;  1KQS A;  4HT9 A;  3OYY A;  2QA4 T;  2DIG A;  2DAQ A;  3A8G B;  2FL7 A;  5CK9 A;  4M7D E;  4ZGD B;  5J26 A;  4MDX A;  1VQ8 A;  3OB9 A;  1YIT T;  1Q81 U;  3WVE B;  3JB9 I;  2XD0 A;  5FU6 C;  5HK3 A;  3JCM g;  4QVD A;  5GMK l;  2V8J A;  2P0K A;  2MI6 A;  1BIA A;  2HQE A;  2PVD B;  4BAC A;  2HAX A;  1VQ6 T;  3SD4 A;  4BB7 A;  2PUO B;  3QYH B;  1NJI U;  3QZ9 B;  1VQO A;  1OZ2 A;  4E7K A;  3FC3 A;  5GAN 7;  3M5A A;  5KE3 A;  1UGP B;  3CMA A;  1VQ8 T;  4NL2 A;  2EAY A;  5LJ5 h;  3G71 T;  2HBP A;  1KQS S;  1K8A C;  5GAN g;  3RMS A;  3EAE A;  2K2V A;  3VU3 C;  5KE2 A;  4RG8 A;  1NZ9 A;  2G3R A;  4A4F A;  4DA4 A;  2DZ9 A;  2QDY B;  3CD6 A;  4HCB A;  2ZPE B;  3QXE B;  4IUQ A;  4L5G A;  3WVD B;  2E10 A;  5GAO q;  3RER A;  3V8L A;  4M7A E;  3RES A;  4R55 A;  1VQ7 T;  1Y07 A;  3A8H B;  3J7A F;  3LYI A;  3L2W A;  1M8V A;  5GAO n;  3MP1 A;  5EG2 A;  5I2S A;  2YLB A;  5DM7 R;  2JTF A;  4JRI A;  1Q86 U;  2LVM A;  3ER0 A;  3J81 E;  4E7J A;  3OYH A;  2YHT A;  3CD6 T;  1Y71 A;  3GLX A;  2HNI A;  2EQK A;  1S72 A;  1ZBX A;  4BUG A;  5GAM h;  3OW2 S;  2YRV A;  4M77 E;  4C8Q G;  4EPC A;  2DO3 A;  3QJY A;  3OMC A;  2QQS A;  1VQL T;  2ZZD A;  3L2Q A;  4LDV A;  2Y4Y A;  4XAX B;  2DD4 A;  1W2B A;  1LNX A;  1P92 A;  3JCM V;  4DQ2 A;  3CCQ A;  2RD1 A;  1YJW T;  2QTX A;  4IKF A;  5LL6 S;  2QI2 A;  3QBY A;  3E1S A;  2XID A;  4L59 A;  3X26 B;  1VQ4 A;  3E9G A;  4KUD K;  2K4Y A;  5GAO p;  4QQ6 A;  2GFU A;  3OSV A;  2ZPB B;  3JCM h;  3FB9 A;  4C0Z A;  4PJO B;  1K73 U;  5GMK h;  2O4X B;  4C5I A;  3NTK A;  3KUF A;  3LGL A;  4MML A;  4N4G A;  4PJO A;  1PSF A;  3CCQ T;  3S3O A;  1YI2 T;  1G5V A;  2O4X A;  2DIQ A;  3HP9 A;  3ZFJ A;  3I56 A;  3MET A;  2M16 A;  4JDS A;  4BE2 A;  1RL2 A;  1Q81 C;  2RM4 A;  2LQK A;  3CBM A;  4M75 E;  3BDU A;  2MWO A;  4A4G A;  4XU0 A;  3ASK A;  3MP8 A;  1W2B S;  3HSB A;  3HKS A;  3Q1J A;  1VQ5 A;  3QKJ A;  5GAN h;  1NJI C;  3CME T;  4XU2 A;  5DLO A;  1U8R A;  2F5T X;  4M7A C;  4C0D C;  4BY6 C;  4ZN1 A;  1XQH A;  2XI9 A;  4J6W A;  4M7D F;  4GLK A;  4M7D G;  2O01 E;  3PIO A;  3OQ5 A;  4MZT A;  3L2U A;  1QVF A;  2WAC A;  4XU1 A;  3RKW A;  4HCC A;  1VQ5 T;  3OA6 A;  4MDW A;  2CGH A;  2D0Q B;  1TH7 A;  1LJO A;  2EKO A;  2K3X A;  4C8Q E;  5KH6 A;  5A0L A;  4BE1 A;  4M77 C;  4NS5 A;  1BKB A;  1NPP A;  3L2Z A;  4PLI A;  4RCB A;  1M1K U;  1N9R A;  3CCV A;  1VQM T;  3DB4 A;  2DTI A;  3CCL A;  2FYK A;  1Q86 C;  2H3J A;  3RUX A;  3LLR A;  4IUV A;  4RG2 A;  4FL6 A;  3ZEH A;  1KD1 U;  2D9T A;  2PVG B;  2QQ9 A;  4Y28 E;  2K3Y A;  3CCE A;  1QVF S;  2JNG A;  4N4H A;  4A4H A;  4HA8 A;  2C06 A;  4J7F A;  5D6X A;  5FRM A;  4F7U B;  2RI5 A;  4IUT A;  3CCL T;  3CCR A;  4M7A F;  4M78 A;  3JB9 J;  1LOJ A;  5GAN 2;  1Q82 U;  2M0O A;  2KAF A;  3QJ6 A;  5IN1 A;  1PSE A;  4F7U A;  3H8Z A;  2D6F A;  2RHZ A;  3MCA B;  1M4Z A;  1YCY A;  4B9X A;  5HKC A;  1Q7Y U;  1WQ7 A;  3JB9 F;  3TU4 K;  2F5K A;  1YIJ A;  4IUR A;  1YJ9 T;  5GMK i;  3JCM b;  2RI2 A;  3VUB A;  4QVZ A;  3L2R A;  1VQP T;  3OYN A;  2P4T A;  3PT9 A;  1U1S A;  3QSU A;  2VGM A;  2X35 A;  2EJG A;  4JRK A;  4M77 F;  3HRT A;  3G4S T;  1K73 C;  4PKC C;  5M9O A;  3M4Y A;  4FT4 A;  3SWN C;  4JLI A;  2KDS A;  3O8V A;  3LWI A;  2ZCF B;  3QYG B;  1YIJ T;  5LJ5 j;  2EWN A;  1JJ2 A;  5LJ3 d;  2EIF A;  4X9C A;  4Y91 A;  3V7S A;  1N8R C;  1BI1 A;  3CCJ T;  1MGQ A;  2PVO B;  2VXF A;  4JRQ A;  3S3M A;  3HL8 A;  2L5Q A;  1UEB A;  4A4E A;  5CQY A;  3JB9 H;  5FRO A;  5FU7 B;  4C8Q C;  5L8R E;  3X20 B;  5LJ5 f;  2BIV A;  5CKB A;  3H6Z A;  2MMP A;  1VQN A;  2VUB A;  4O5V A;  4QVC A;  2RK1 A;  3P8H A;  2JOY A;  4M78 G;  5A2Q E;  3JRZ A;  4PJO E;  3HRS A;  3HHT B;  3CBP A;  5D6W A;  5FU6 B;  4F7U G;  3OW2 A;  2DTH A;  2XU8 A;  1R8O B;  2Y90 A;  3PGG A;  1WPY A;  3CC2 A;  4FU6 A;  3FRN A;  4M75 G;  1VQO T;  3PTA A;  3M57 A;  1VQN T;  1W4S A;  3MO8 A;  2EYQ A;  3RKX A;  3CMA T;  5GAM j;  4BI8 B;  4ME7 A;  3CC4 A;  2VXE A;  4LDY A;  1BI0 A;  5LJ3 j;  5GAO m;  3BW1 A;  2DJZ A;  4NL3 A;  4E7I A;  3CCS A;  2EJ9 A;  1K9M U;  2JVV A;  5FRN A;  3GIB A;  4OGE A;  2LC4 A;  2VGN A;  1O75 A;  3QPH A;  3DLL A;  1UGQ B;  4ZGE B;  4C92 D;  1KD1 C;  5GAM f;  1G3T A;  5KCH A;  1JRI A;  3HPW A;  3DB3 A;  3QUI A;  2EQM A;  5LJ3 f;  2DEQ A;  3CC4 T;  3J80 E;  4C8Q F;  2IG0 A;  5AYF A;  3TEE A;  4OVA A;  3CCS T;  1UGS B;  2RA2 A;  2AHJ B;  5C0M A;  3OYF A;  1Q82 C;  3E19 A;  1XOV A;  3X28 B;  3A8O B;  5A0G A;  1Q7Y C;  4LD9 K;  4M7D C;  3SB2 A;  3LWH A;  4IUP A;  2XK0 A;  1S72 T;  5CAI A;  3WXM B;  3CPW A;  1X01 A;  4ELZ C;  1FWZ A;  3JCM f;  4FIB A;  3EFR A;  2LTO A;  1JB0 E;  2FVU A;  4ELY C;  2DXU A;  3UWN A;  5GAO l;  1VUB A;  1D3B B;  1I4K 1;  3F70 A;  1KHI A;  4V2S A;  3OYG A;  4TVR A;  5CIU A;  3OS1 A;  5GAN j;  2XG8 D;  1G3S A;  3L2V A;  1QW1 A;  3V8K A;  3VKI A;  1D3B A;  1SSF A;  2RI3 A;  4M78 E;  2DVE A;  4PLL A;  1KG1 A;  2FHD A;  2L3R A;  4XTU A;  2RHY A;  2IVW A;  4F7U E;  3CBO A;  3VYH B;  4VUB A;  3M9Q A;  1VQ4 T;  1FX7 A;  1UB4 A;  1N8R U;  2E5Q A;  5GAN f;  4LDW A;  4C0F A;  2BKD N;  4N0A C;  3V8J A;  4CI0 C;  2LT1 A;  5DLQ E;  3CPW S;  1KHC A;  2JZ2 A;  2HD0 A;  5LJ5 e;  1ZHI A;  2LCC A;  2E6Z A;  3I56 T;  3C95 A;  4IUU A;  3CME A;  1M90 C;  3M53 A;  3OS0 A;  3OYI A;  3M59 A;  1N6A A;  1H3Z A;  2EQU A;  1KQ2 A;  2B8A A;  3QDR B;  2M9U A;  2WSC E;  3OYK A;  2P0Q A;  4OB2 B;  2PU9 B;  3I55 A;  4JS5 A;  4Z02 A;  2K5I A;  3CC7 A;  4XTW A;  2LDM A;  4J8O A;  2ZGW A;  3MEA A;  3OBW A;  3X25 B;  2L89 A;  4B9W A;  4C8Q D;  4DOV A;  4J5Y A;  4D6W A;  1YHQ A;  1BI2 A;  1M1F A;  2OTL A;  3A8M B;  1MHN A;  1DJ7 B;  2EQJ A;  1K9M C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...