1WJQA

Solution structure of the third mbt domain from human kiaa1798 protein
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
107
structure length
107
Chain Sequence
GSSGSSGVKPPHGFQKKMKLEVVDKRNPMFIRVATVADTDDHRVKVHFDGWNNCYDYWIDADSPDIHPVGWCSKTGHPLQPPLSPLELMEASEHGGCSTPGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords KIAA1798 protein
publication title Solution structure of the third mbt domain from human KIAA1798 protein
rcsb
source organism Homo sapiens
total genus 7
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2004-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1wjqA01
2FHDA 4QVZA 4IUPA 3QBYA 5C0MA 3SD4A 3GOXA 5IAYA 2LTOA 2CKKA 1N27A 4E7LA 3UT1A 2XK0A 2M0OA 3OYGA 5FROA 3DLMA 3MO8A 1XNIA 2YRVA 3LGFA 4GY5A 5D6XA 5KE2A 2BUDA 3PNWC 3NTKA 4BDZA 2R57A 2DIGA 2BKDN 4QW2A 4IUUA 4PL6A 4C5GA 2EQKA 3LLRA 3PFSA 5CIUA 2RHUA 5D6YA 3ASKA 3H8ZA 2LVMA 1G5VA 3L2QA 4B9XA 1OZ2A 1OI1A 2HQXA 2R5MA 2G3RA 2R5AA 5KH6A 4BE1A 3BDLA 4IURA 4X34A 2RHYA 4QQGA 2NLUA 2VYTA 3FC3A 4BACA 3MEAA 3QJ6A 4IUTA 3OYCA 3P8DA 3OS0A 3O8VA 3E9GA 5J39A 3OYMA 1WJSA 2M16A 3LH0A 5KCHA 3MEWA 3L2WA 3UWNA 3OA6A 2HQEA 3L2VA 2F5KA 3LGLA 2RJCA 2X4WA 2IG0A 3LYIA 2O4XB 3F70A 4C5HA 3QIIA 4E7JA 2JTFA 3META 2RJEA 2X35A 2RI5A 2XDPA 2DIQA 3DB4A 4A4FA 3MEVA 4C5IA 4ZTJA 2X4YA 4L59A 1RI0A 4A4EA 2E5QA 3ME9A 2LDMA 3MP1A 3OYLA 3OB9A 3Q1JA 4B9WA 4Q5WA 3OYJA 4E7IA 1WJRA 2PQWA 2M1HA 5C6SA 2RI2A 3S3NA 2L89A 3MP6A 1H3ZA 4Z02A 2LRQA 2EFIA 2DAQA 3FLGA 2P0KA 1MHNA 4IUVA 2K3XA 3OYDA 3OYAA 3NTIA 2E6NA 3OYHA 5FRNA 4QQ6A 3OY9A 4N4HA 2EQMA 3L42A 3QKJA 4OVAA 4EDUA 4BE0A 4PLIA 5D6WA 3CEYA 3OS1A 2QQRA 4C5EA 3S3OA 2R58A 4IUQA 2GFAA 2RO0A 5FRMA 3OYKA 2B8AA 4N4IA 2QQSA 3OQ5A 3S6WA 3FDRA 4CRIA 2RHXA 1WGSA 4BE2A 3H6ZA 2BIVA 3PMTA 2RJFA 3C4SA 2L8DA 3M9QA 4II1A 3OYBA 3OYEA 4E7HA 4HCZA 5KCOA 3OYNA 3EAEA 2MWOA 4RG2A 2RHIA 3LX7A 5M9OA 4UC4A 2L3RA 2MWPA 3P8HA 2X4XA 3E9FA 2K3YA 3S3MA 5IN1A 3PMIA 1WJQA 4IKFA 4FL6A 3L2RA 2RJDA 5KE3A 2GFUA 3DB3A 2EKOA 4N4GA 4LD6A 4NS5A 3MP8A 3OYFA 3NTHA 2EQUA 5J26A 4BD3A 2WACA 4PLLA 2RHZA 4A4HA 3OS2A 4A4GA 3FEOA 2D9TA 1SSFA 1OZ3A 2EQJA 3OMGA 4FU6A 4ZTFA 4E7KA 3MEUA 2RI3A 2JZ2A 1OYXA 2O4XA 1KHCA 3OYIA 4QQDA 3ZEHA 3L2UA 2GF7A 4BDYA 3KUFA 3OMCA 2LCCA
chains in the Genus database with same CATH superfamily
2QEXT 2OAUA 3P8BB 4F7UA 5FW9A 3IQLA 5FROA 1NM7A 3O5ZA 3LGFA 2MYSA 3I55A 1WA7A 2EBPA 5CKDA 1RACB 5HK3A 1KQSA 1VQ8T 4PL6A 4M77E 1TTHB 2DX1A 5CIUA 2EGCA 3MPUB 4C92A 1VQLQ 4Z88A 3CCJQ 2QEXQ 4BB7A 2KSSA 4PJMA 3UATA 4IIOA 3PT9A 3QXEB 3HRTA 4QQGA 3CC7T 4BACA 3MEAA 1YWOA 4C8QA 1YWPA 2DTHA 3JCMg 1X01A 4PFZA 1M30A 3BE3A 1X27A 3LGLA 1VQ8Q 4PJOC 2CREA 2JTEA 4C92G 2M9UA 2V1RA 3VRZA 3V7SA 3GPLA 2PQWA 1EZZB 3CC7Q 1M3AA 2DPPB 2KRMA 2LRQA 4M7AF 3J81E 3EG0A 2YUNA 2QGGA 1P92A 1NYFA 1YJWT 4RTWA 3OYAA 5GAOm 3JCMP 3JCMe 3VS2A 2OAWA 2DXCA 4M75F 3S3OA 3E1SA 5LJ5f 4JS5A 3JB9F 1WGSA 4NOYA 3QSUA 3OYBA 1Q82C 1G83A 1TH7A 1D3BB 4V2SA 1YJWQ 4KGVB 8ATCB 3ZL7C 5IN1A 1W6XA 1Q82R 1MV0B 1M1KC 3HRSA 5LJ3f 4A4HA 1VQKA 2EQJA 3VYHB 5FU7B 3EHQA 4DOVA 3CC2T 3CPWS 1MV3A 1RADB 5IXBA 4WCIA 1OULA 1YIJA 2DF6A 1N9RA 3BFMA 2ZPFB 4VUBA 2FVUA 1KD1C 1XJWB 2XI9A 3ZBDA 3UA6A 3M0RA 4BI4A 3M59A 1Y96B 5GAN3 1K8AC 2NYSA 2M02A 2VWFA 1KD1R 4IUUA 1CKBA 1BU1A 2PU9B 3CC2Q 3LLRA 3TCJA 5GAOn 2X3WD 1K8AR 1GBQA 4M7AC 4ZN3A 1LOJA 1F1BB 1EIFA 3LWIA 4C92D 1K9MR 1VQLA 2CT4A 3BDLA 3CCJA 3VKIA 2RN8A 2YUQA 1QVGP 1IGUA 2QEXA 3QJ6A 4OP0A 3EGDB 2QYZA 2HQEA 2RM4A 3CCVT 2RJCA 3M5AA 4BY6C 5A0DA 1Z9QA 1BCOA 3A8GB 2XDPA 2RI5A 1I8FA 1MMAA 4ZGJB 3UA7A 2OX7A 1VQ8A 1QCOA 4M7DB 1QQJA 1TS9A 3JV3A 1O75A 1TOVA 2CUDA 3X26B 3NTIA 2E6NA 2HMAA 3CC7A 1KHIA 4LDYA 3QWXX 3G6EQ 5CO7A 2GFAA 2E3HA 4K11A 4XTZA 1ZBXA 4YTLA 3LWHA 3HP9A 3HKSA 3JCMh 2JT4A 4A53A 1B7TA 1M2VA 1WXUA 5IH2A 3P8HA 2X4XA 4EMKC 2JTMA 1LVKA 3I5SA 4L6V5 4LDUA 2EKOA 1YJWA 3MP8A 1UUEA 5J26A 2DTIA 1M8VA 2XHCA 3GP8A 8AT1B 3HFOA 1OZ3A 4BUGA 1X6BA 2VKNA 3KUFA 2J6FA 1NJIR 5KYWB 2BZYA 2JMAA 5KYUA 5IAYA 1B34B 1JXMA 9ATCB 3KBGA 1ZUUA 2M0OA 1XNIA 1R0CB 3G71T 1YI2Q 2CSQA 2RHUA 2ZZDA 2RQUA 4XU3A 2HQHA 5GAMd 1ZSZC 3QYHB 3CC2A 3CPWP 4AFZC 2RHYA 3KFVA 2KI7A 3BDUA 3OS0A 3OS5A 2ABLA 3MEWA 2DMOA 2ZPBB 2EGEA 1PCXA 1X2QA 5DM7R 1PHTA 2A37A 1G3YA 2GTOA 3CC4Q 4X9CA 2VASA 2K5IA 5GANd 1V76A 1KC8U 3MP1A 2KGTA 4B9WA 4Q5WA 2RI2A 2K6DA 1G2BA 2L89A 2LCSA 1B3QA 3NMZC 4M75E 2XKOC 4M4ZA 4C0GA 5KYXA 3WVDB 2DL7A 4GLKA 4EDUA 4DBQA 2PUOB 4HVVA 2R58A 2KRNA 5GAMg 1IRXA 2RD1A 4LUDA 3H0HA 2KYBA 2RJFA 3M56A 3VS5A 4HCZA 2BZXA 1T0HA 2FL7A 2LP5A 4JPBW 2QA4T 2K2MA 1ZBJA 2ZPGB 3PIOA 3UDCA 5GANg 1T3LA 3EG2A 4RUGA 3MHXA 2DETA 1UB4A 4E7KA 2LJ0A 3L2UA 2LX9A 4PJOB 2FHDA 3EGXA 3A8LB 2QA4Q 3GOXA 2MPXC 1HD3A 1YFNA 2LTOA 3GNFB 2KMTA 1SKUB 5GANe 2LMJA 2YLCA 1FX7A 2DIGA 1I0CA 2K9GA 2YUPA 4QW2A 3EG9B 1D0YA 3PTAA 4M78A 1YI2A 2A0FB 1YJNT 4BI3A 2KBTA 2COYA 2DILA 5CK9A 1UG1A 2NLUA 2CH4W 5D7UA 3VS3A 3URGA 1W2BA 2DRMA 2F2VA 2WSEE 2OTJT 2DL5A 1TU0B 3G71A 1LCKA 4CC7A 2XICA 3CC4A 2Z0WA 5LJ5d 4M78G 1G3SA 1MMGA 4Z02A 2FO0A 5IXFA 3RR6A 1OU9A 3ULRB 1WX6A 3L42A 4C5EA 4E6RA 3ER0A 4JLIA 3OQ5A 2RHXA 3I5RA 1SHGA 3OYNA 5KCOA 4JRQA 4LUEA 4FM4B 4FT4A 1RAGB 1WZOA 2DZCA 4IKFA 1Y57A 2RJDA 5CKHA 4M7AB 1QVFP 1M3BA 4J9CA 5LJ5g 3NHNA 2J06A 3FEOA 1WDXA 2D9TA 4AG1C 2HL5C 3TU4K 2O31A 4FU6A 1IGQA 1AWOA 1ZA2B 2RI3A 2AKKA 2F5TX 1KHCA 5DLOA 2JMCA 3VS7A 4BY6B 4OF1A 2MAMA 2YSQA 3RKXA 4DOWA 2KNBB 2X51A 3C95A 1JO8A 4AFQC 1KG1A 5D6XA 2QA4A 2SRCA 3PNWC 3AT1B 1Z9ZA 3VS4A 2CGHA 1M5Q1 2HD0A 5LJ5e 4OGEA 2FPDA 1KQSS 2COWA 3J80E 1GBRA 1AHJB 1OI1A 4A54A 1MMNA 4C0DC 1RUWA 2G3RA 5GANh 4M78D 3RNJA 2QAZA 1MNDA 2K79A 5GJVB 4Y28E 5J39A 3LH0A 2L0AA 2AK5A 1E7OA 1B34A 1BIAA 3C94A 2X4WA 5LJ3e 2MOXA 4C5IA 4M77C 4EMKB 2HBPA 2ZCFB 1RI0A 3JRZA 1NYGA 3OW2P 1JJ2S 2RMOA 3G7ZA 1BYMA 1YJNA 2K5LA 2XDDA 2P0KA 1CKAA 3M57A 2LNHB 2OTLT 4PJJA 1R8OB 4QQ6A 2KDSA 3M0PA 2RNAA 4OVAA 4ORZA 3SEMA 4AFUC 5GMKi 1BI2A 5GAMf 2CP3A 3H6ZA 1PWTA 3OBYA 4FT2A 4II1A 3OYEA 5HY6A 2OTLQ 1E6HA 1HXDA 2GCXA 3OYYA 3C0CA 3H0FA 3DB3A 5KYYA 4JRKA 2EQUA 3FJPA 3X24B 2CH4A 5GMKl 4RCBA 1VQKT 1QVPA 4OB2B 1K0XA 2A28A 1BIBA 2FZKB 3I56Q 3JCMQ 2C0TA 3CD6T 1D0XA 1KC8R 3NPFA 4QQDA 3EH1A 2FB7A 3MJXA 4C0FA 1IO6A 2E5KA 4AG2C 2E10A 4FSSA 4JJCA 2FEIA 1QP3A 3CD6Q 1UGPB 4F7UF 4AT1B 1G5VA 4PKCC 3N5BB 1OZ2A 2DE0X 4XAXB 1VOMA 1H3HA 1VQLT 5A0LA 3HTRA 2Y4YA 3RKWA 5LJ5h 1TUCA 4M7DE 3H0IA 4X9DA 5GAOr 3AHUA 4C8QF 2O4XB 3F70A 3FRNA 1UHFA 3ZFJA 4E7JA 2JTFA 3SWNA 2DD4A 3OW2A 1PC0A 2QDYB 2LDMA 1VQOT 4E7IA 1WJRA 3S3NA 5LJ3h 3CXCP 1U8RA 4KT0E 4OB1B 3OYHA 2IPOB 2EJGA 4PJOG 4LNPA 2QQ9A 5FRMA 4PFPA 4N4IA 2QQSA 1U5SA 1GCQC 1VQOQ 1S1NA 4OGCA 1JJ2A 5DLQE 2KVQG 4A4KA 4N4GA 2BTTA 3UPUA 2OTLA 1K1ZA 4OB0B 4BD3A 2J05A 4F17A 3THKA 3RMSA 2JOYA 4J8OA 4KBMB 3ZEHA 1W1FA 4WTOB 4BDYA 2A36A 3CBOA 4C92C 3OMCA 2DVJA 4KRTA 3RERA 4PFOA 2V8JA 3M4YA 4JZ4A 2W10A 2XK0A 1SRLA 5DY9A 5IHNA 3KXTA 4C8QC 1IXDA 3CCST 1J3TA 3NTKA 4HCBA 1WQ7A 1VQ7Q 1DJ7B 4OMMA 1UDLA 2EWNA 1LJOA 2NUPB 1IB8A 2JXBA 2P0QA 4HVUA 4B9XA 3CD6A 1I07A 1VQ4Q 1QMCA 1N9SA 1FMKA 4M75A 2R5AA 4BE1A 4J9EA 1NEBA 3OYMA 1WHJA 2RQRA 2DFUA 5GMKe 3CCSQ 2EPDA 3UWNA 1BB9A 4LDWA 4PJOD 4MDWA 3JB9H 2QI2A 1QCFA 2ROLA 2QG9B 4CI0C 2YDLA 1K9MC 5HK0A 4JZ3A 3OB9A 1MMDA 2BZ8A 2LQ8A 1TWBA 2F1LA 4M75G 5IHIA 1VQ6Q 1RAFB 2YT6A 2LT4A 2NUTB 2EQMA 1WPYA 3JB9G 2DYIA 5FWCA 2MIOA 2B8AA 3WXMB 4N0AA 3G6ET 5CR2A 1VQMT 2JVVA 1UE9A 3C4SA 3CMET 3HRUA 4RG2A 1VQOA 4PNOA 5KYNA 2CS7A 1UJ0A 1E6GA 4IIMA 3JAME 2HSPA 2PVDB 4ZGEB 4PJOE 1AWXA 4J9GA 4RTZA 4C0DB 3GBQA 1VQMQ 1QCNA 2VVKA 1YHQT 2DRKA 3CMEQ 3MEUA 2COZA 2J7IA 4QT7A 1UFFA 1R0BG 5C0MA 1M27C 3VUBA 3JCMX 4C0ZA 2EYZA 4M77B 1KFZA 3OYGA 5I21A 3DLMA 3QDFA 2MMPA 1WLPB 3GF5A 2CP2A 1YHQQ 2R57A 1GL5A 5CKEA 2J6KA 2QDLA 2E41A 3M0UA 1NJIC 1YI2T 2M0YA 5GAOl 2EGAA 1QWEA 1Q95G 3D7SB 2FPEA 3VUZA 4M7AD 2R5MA 3JSCA 3EFOB 2VYTA 3OYCA 2DO3A 1VQ4A 4M75D 1W2BS 2RQTA 1AOJA 1GRIA 3CCSA 1HK9A 1FMVA 1ZQ1A 3JB9D 1WHHA 2HL3A 5GAN7 2LQNA 3CC4T 4RG8A 2KY9A 5GMKh 1OPKA 2OJ2A 1VIEA 3M55A 1ZUKA 1N5ZA 4TVRA 3RKYA 2EFIA 4ANJA 2KEAA 5FU6C 3QPHA 1VQ9Q 1XTDA 4GLMA 2EYQA 4N4HA 2AT1B 3OS1A 2QQRA 2E64A 4NL2A 2AZVA 1SPKA 1C6VX 2LJ3A 3G1JA 1BI3A 4PJLA 4D8DA 2E70A 1FXXA 2EAYA 4ZNXA 4M7AE 1PKTA 3M9QA 3LX7A 4NL3A 1WFWA 2L3RA 2KXDA 1I1JA 6AT1B 2FZCB 1WXBA 3EG3A 5CCAA 3PIPA 4NS5A 1PSEA 2X9HA 2PUKB 5I22A 3CCRQ 2DJZA 3A8OB 1VQPQ 1OYXA 3G6EA 2CZ1B 2GF7A 1VQMA 3M0SA 1PD1A 2OI3A 2Y90A 2DXTA 3QBYA 3SD4A 3CMEA 2QTVA 5IHKA 1JXOA 2CZ7B 2YUOA 2HDAA 1FMWA 1XQHA 1YNZA 4GY5A 3CMAT 2DXBA 2BE7D 4XQ3A 1QP2A 5GJWB 5GAOp 5GAMe 4ESRA 2DD5A 3MCAB 5D6YA 3BY7A 4KH1B 3R6NA 3M54A 5A2QE 1YHQA 1MUZA 1NLPC 4FW2A 1YITQ 3LW5E 1TUGB 2JS0A 4FYXB 4M78F 4HCCA 1N8RU 2DLPA 2GTJA 3CMAQ 1RAHB 1WJSA 2JN0A 2C0OA 1D3BA 2JW4A 1YCYA 5FWBA 1UGVA 2IG0A 2CP5A 3QIIA 4A63B 2EW3A 3VV0A 1I5OB 1NPRA 2ZGWA 2RA2A 1YJ9Q 4AFSC 2O01E 2Y4XA 1LNXA 3MP6A 2GBQA 1OQKA 2CP7A 4F7UB 4ATOA 2EYWA 1MHNA 5FRNA 4F16A 2O9VA 1ABQA 3FIFA 4C92B 2MK5A 5CKFA 1Y0MA 1PRLC 2E4HA 1VQ9A 4FW1A 3OYKA 1W2BP 5GANj 5J3BA 2HAXA 4KULA 2SEMA 4OMLA 2D0NA 1U1SA 1Y96A 2PNIA 3PMTA 2FZGB 4C8QB 2L8DA 3CCET 5AYFA 3HPWA 4L5GA 3HSBA 3JB9I 3INZA 3X25B 1JU5C 5HKCA 2CUBA 1X75C 3L2ZA 3EGDA 1W70A 3CCEQ 2EJ9A 2DYBA 4M77F 1K73U 3CCRA 1RLPC 3QUIA 4M78C 1CSKA 1VQPA 2MI6A 5GAOq 4M7DA 2DK3A 3UT1A 1UJYA 2YRCA 4HA8A 1QLYA 4ME7A 1OEBA 3TREA 1WNLA 1S72T 4X1VA 3NGPA 3QZ5B 1YN8A 1M1KU 3PFSA 3TVTA 3J7AF 4EPCA 2HBWA 4JJDA 2DKGA 1WYXA 1ZX6A 4F14A 4X34A 3FC3A 5LL6S 1TG0A 5GAMh 1QVFA 2ESWA 3E9GA 4M7DG 2K7AA 1S72Q 4QVDA 2AZSA 3EG1A 3CMAA 2WSFE 3DB4A 2X4YA 4KUIA 4A4EA 3OW2S 1K8AU 2LZ6B 4Y91A 2C0IA 4D8KA 4OMPA 1C1AA 2I2LA 1YJ9A 4DEYA 3CBMA 5KYWA 2EYXA 2GNCA 2RB6A 4RKUE 1H92A 2PVOB 4KGXB 2QGFB 2V8IA 2FRWA 3VS0A 4O6JA 3DLLA 3JCMW 2RK1A 5LJ5j 2FYKA 4R55A 3X20B 1VUBA 1JRIA 3TQ7P 4JJNK 5M9OA 1NE8A 1JBMA 3PMIA 3SDZA 1R77A 4DBRA 2O88A 1Y71A 4RMOA 2E12A 2LNVA 3QZ9B 4A4GA 1SSFA 4DBFA 3V8LA 5LJ3j 2LT1A 2P4RA 3REBB 3I56T 3HFNA 5CKBA 1ARKA 1C0MA 3MKDA 4E47A 4EIKA 3CCEA 2L3SA 2E6ZA 4KGZB 1X6OA 2W0ZA 2B86A 1ZSZB 5GAN2 4M7DD 1KC8C 4GBQA 1M2VB 4CC2A 1PM3A 5FU6B 2O2OA 3PVQA 4BI8B 1I5LA 3CCMQ 2DA9A 4JLGA 3L2QA 1RAEB 3BW1A 4CC3A 2JM8A 2VXEA 1W4SA 1OX9A 4MZPA 4XTXA 2QQAA 3VS6A 4D6WA 1QKWA 5AT1B 2MF2A 1SSHA 3L2WA 2JM9A 1SG5A 3QJYA 4RTTA 4HT8A 2VUBA 1S72A 2K3BA 2LQWA 5KYUB 2E5QA 4J9BA 1GXIE 1RI9A 4C92F 3OBWA 3RDVA 2M51A 4RCCA 4PJOA 3CPFA 3M0TA 5D6WA 3FJ5A 2L5QA 2EYYA 2HSEB 1GCQA 5CAIA 3H41A 4IUQA 1M1GA 4CRIA 4XTVA 3CQTA 1RL2A 1AD5A 1G8XA 1IHVA 2QQBA 2LQKA 1KQSP 1VQNQ 1QVGS 1D1BA 2GQVA 3EG9A 2ZPEB 1OV3A 1D1CA 3RIRA 2RHIA 1N8RR 3OSSC 2P4TA 2K3YA 1QW1A 3M4GA 2XMFA 3UF4A 1RAAB 1I81A 2H3EB 5CQYA 1ZUYA 3E2UA 4EMGA 1PD0A 2PVGB 1ACMB 4E2FB 2CP6A 3OMGA 1NEGA 3JCMc 4J7IA 3CXCA 1UGQB 4FYWB 4RTYA 5KYXB 1ZHIA 2HCKA 4HKEA 2ATCB 2KE9A 1WHMA 4J6WA 1JJ2P 2X3XD 3MO8A 3FB9A 2XG8D 3TSZA 4F7UG 1G3WA 1OX8A 2G6FX 2YLBA 2EQKA 3ASKA 1VQ7T 2YRDA 3SWNC 2LVMA 3V8KA 1VYUA 1WQWA 3I9QA 3I56A 5KH6A 3TEEA 4OMFB 4IURA 3CCMA 2MCNA 2ZPHB 1VQ4T 1BCMA 3O8VA 4C8QG 4Y92A 2M16A 2DL3A 5KCHA 4J6XA 2QASA 2VXFA 1Y7XA 1AWWA 4MZMA 3M0QA 2RQWA 3LYIA 4C5HA 1WHLA 2CZ0B 3CCUT 1K73C 3RMQA 2RJEA 1AVZC 2DIQA 4XTYA 3EGXB 4M7AA 2LJ1A 1PSFA 2VB6A 3ME9A 4LDXA 1TSFA 4DEXA 3HL8A 3OYLA 1QKXA 1UHCA 1K73R 4OMNA 1H3ZA 1D0ZA 1UTIA 2AKLA 4IUVA 4AMCA 1VQ5T 1LPLA 3OYDA 1KQ2A 1YCSB 1JB0E 4J83A 1VQ6T 4PLIA 3CCUQ 2FG0A 4M78B 4RTVA 2RO0A 3SHWA 1V1CA 1M1KR 3VS1A 1UEBA 1FWZA 4M7AG 2KYMA 5GAN8 1NG2A 2WSCE 1VQ5Q 4R56A 3U23A 1VQNA 1WXTA 1HSQA 3S3MA 2XU8A 4FL6A 1JEGA 1V29B 4LD6A 5GMKj 3CCLT 2WACA 2YHTA 4B6MA 2CSIA 2DTOA 1VYVA 4HCKA 1QWFA 3E19A 2VGMA 2ENMA 1QVGA 2LCLA 1D09B 4EMKA 3L1AA 1UGSB 2DJQA 2DERA 4M75C 3CCLQ 4JS4A 2YRVA 1ABOA 4C8QD 2H8HA 1Q81U 1T3SA 2ZPIB 2KT1A 2QTXA 5I2SA 2RPNA 5HCKA 4OB3B 2JNGA 2KRSA 2NWMA 1IZ6A 4DQ2A 1OU8A 3CCVQ 3V7CA 2H3JA 2DVEA 2K57A 4F7UE 4DA4A 3GNGA 2KQWA 5GAN6 3GIBA 3G4ST 2D8HA 1TUDA 3META 3QDRB 2X35A 5I11A 4A4FA 4J9DA 1RABB 1ZSZA 4KUDK 4N0AC 4C92E 1VQ7A 2M1HA 5C6SA 1B07A 1U06A 2DAQA 3FLGA 1YBYA 4ELYC 4C8QE 2D6FA 1G3TA 1RAIB 3OY9A 3G4SQ 3OSVA 3CEYA 1VQ9T 4J9IA 4CC4B 1KIKA 1XOVA 4J9FA 4FYYB 3CCUA 2EVRA 2IIMA 1EX4A 3HHTB 4RTXA 4ZN1A 1TXQA 1WJQA 5KE3A 1VQ5A 2DM1A 4J9HA 4PLLA 3TSWA 1GFDA 2CP0A 1VQ6A 2DXUA 3GLXA 4ZTFA 2K4YA 3CPWA 3CCRT 2O4XA 3SB2A 4O5VA 1VQPT 1NBEB 4QVZA 2KAFA 3T9NA 1X69A 3REAB 2CKKA 3G71Q 1WHGA 1SRMA 3JCMf 3L2VA 2VC8A 2FPFA 5KE2A 2BUDA 2A7YA 4BDZA 2HEQA 1EFNA 3CCLA 2BKDN 2E3IA 4QKUA 4C5GA 3A1PA 2C06A 2D1XA 1M90U 3A5ZB 4R0KA 3H8ZA 4J6YA 3LH5A 2HQXA 5CVIA 2VV5A 2K2VA 1MGQA 5KYYB 3M53A 1YITT 3QYGB 4Z89A 4XTUA 3P8DA 1QVFS 1Q86U 2HNIA 3EH2A 2F5KA 2FRYA 1H641 2BE9B 3CCVA 2RQVA 2EJFA 5IT9E 1X2KA 3MEVA 4OMQA 4JJBA 1UECA 1Q7YU 2VGNA 1YJ9T 4MZTA 5GAN5 1BKBA 2P84A 1M8MA 2PZ1A 1NZ9A 2EKHA 1Y07A 2F2XA 4JUVA 4BE0A 2DEUA 4XK8E 4FIBA 1K0SA 4FSXA 1YP5A 3CBPA 2L2PA 3QO3A 3V8JA 3FDRA 3G4SA 4PK4A 4XU1A 1OOTA 3EHRA 5GAMj 1M9SA 2A08A 2JUFA 4E7HA 2AHJB 2ED0A 4F04B 3PE0A 2NUPA 2QXFA 2I0NA 1VYTA 3L2RA 3SWNB 2GFUA 2IVWA 1VA7A 2KK4A 3OS2A 1IHWA 2V8KA 4HVWA 1OPLA 1RLQC 1D1AA 2YWWA 2GGRA 3OYIA 1KK7A 4ZTJA 1X6GA 2P0PA 2KXCA 1N27A 4E7LA 2HZYA 2D0QB 2ROTA 1AZGB 3EFSA 3A8HB 4M7DF 2PTKA 1BBZA 1YJNQ 2NUTA 4LN2A 1HYOA 2HKQB 1BI0A 1UGRB 2V1QA 1BI1A 4KH0B 1N6AA 5GMKm 2ZAEA 3RESA 4OMOA 1IREB 3I35A 5FU7C 2OTJQ 3CCQT 1Q82U 2L3PA 1MNEA 2EQIA 2KT8A 1T0JA 5LJ3d 1ZSGA 5ECAA 4LD9K 3RUXA 2DBKA 5GAN4 4MDXA 4JDSA 3Q1JA 2XDBA 1PG5B 2CZ6B 2K5FA 4P5NA 2DNUA 5CQXA 2KROA 4E7SA 1NLOC 1PNJA 2D8JA 2YXYA 3A8MB 3V7RA 3CCQQ 1Q81C 2KR3A 1YITA 1AT1B 3EGUA 1M2OA 2E1HA 1M4ZA 4PJNA 4FCYA 4HT9A 1FYNA 3A98A 4M77A 1Q81R 1KD1U 1ZLMA 2V26A 2CYZB 5L8RE 1KSWA 1K4US 1AZEA 4M75B 1M3CA 3WVEB 2BIVA 2E65A 4HXJA 3C12A 2A3LA 1K9MU 2MWOA 3PVLA 2JJ9A 3JCMb 1K9AA 1KQ1A 4E7ZA 1ZA1B 2JS2A 4EMHA 4M7DC 5LJ3g 3I55T 3EFOA 3OYFA 3NTHA 3RBBB 1NPPA 4DBHA 2L3QA 1A0NB 4M77G 3QHSA 3QWYA 5L23A 4FYVB 1I4K1 2QK0A 1HJDA 2DL8A 3CXCS 2LCCA 5EC7A 2ECZA 5A0GA 4IUPA 2RK2A 3VRYA 1SEMA 3I55Q 2CT3A 4LXCA 4MMLA 2J6OA 1PRMC 3NFCA 3QG1A 2GQIA 1O9SA 1WHKA 1U1TA 4Z8AA 2RF0A 2EIFA 2RH2A 3VJPA 2LC4A 3VYGA 3X28B 1GFCA 2NUZA 4LDVA 3R6OA 1U3OA 4QVCA 2X4JA 1M1FA 7AT1B 3CCMT 3JCMV 4J7FA 1VIFA 4IUTA 5FLXE 3OA6A 2DZ9A 1KJWA 2AIRB 2OTJA 4ZGDB 2CDTA 4L59A 2XD0A 4RTUA 4M78E 3PGGA 3OYJA 2DEQA 4MMKA 1NJIU 3M58A 3JCMJ 2F2WA 1H8KA 2K3XA 4ELZC 4XTWA 3QKJA 1GCPA 1M90C 2F69A 4J5YA 3CCQA 5GANf 2XIDA 2O9SA 5I2MA 1WI7A 3VU3C 4PJOF 1SF9A 3S6WA 4XU2A 4BE2A 1K76A 1M90R 4M77D 1JQQA 1YIJT 1SHFA 1Q86C 3EFRA 3EAEA 1AWJA 1X43A 4UC4A 1VQNT 2MWPA 3E9FA 3DKMA 2DL4A 4XU0A 1WIEA 1VQKQ 1Q86R 3JB9J 2DBMA 2LX7A 5EG2A 2RHZA 1Q7YC 1AEYA 3JCMd 1PKSA 2ED1A 4WF2A 3H9NA 1YIJQ 3SFMA 4JRPA 2HKNA 2JZ2A 1BK2A 1Q7YR 1N8RC 4JRIA 3CCJT 4LE9A
chains in the Genus database with same CATH topology
2Y90A 4BY6B 2DXTA 4OF1A 3QBYA 4EMKA 2MAMA 3L1AA 2QEXT 3SD4A 3CMEA 1UGSB 2OAUA 3RKXA 3P8BB 2CZ7B 4M75C 4DOWA 3C95A 4F7UA 5FROA 1XQHA 4GY5A 4JS4A 2YRVA 3LGFA 2DXBA 5D6XA 2QA4A 3CMAT 3PNWC 4C8QD 4XQ3A 1Q81U 2ZPIB 2QTXA 3I55A 1QP2A 2CGHA 1M5Q1 2HD0A 5CKDA 5LJ5e 5GAOp 5HK3A 4OGEA 5GAMe 5I2SA 1KQSA 4PL6A 4M77E 1VQ8T 1KQSS 2DD5A 3MCAB 4C92A 5CIUA 5D6YA 3J80E 3BY7A 1AHJB 3M54A 4OB3B 5A2QE 2JNGA 1YHQA 4BB7A 3LW5E 2KSSA 1OI1A 4A54A 4C0DC 2G3RA 5GANh 3PT9A 3QXEB 4M78D 3HRTA 4M78F 4HCCA 1IZ6A 4QQGA 4DQ2A 1N8RU 3CC7T 4BACA 3MEAA 4C8QA 4Y28E 5J39A 1WJSA 3LH0A 2DTHA 3JCMg 3V7CA 2JN0A 1D3BA 2H3JA 2DVEA 2K57A 1B34A 1BIAA 1X01A 1YCYA 3LGLA 3C94A 3GNGA 2X4WA 4F7UE 4DA4A 5LJ3e 2KQWA 2IG0A 5GAN6 3G4ST 3GIBA 4PJOC 3QIIA 3META 3QDRB 2X35A 3VV0A 4A4FA 1NPRA 2ZGWA 2RA2A 4M77C 4C5IA 4EMKB 2HBPA 2ZCFB 1RI0A 4KUDK 3JRZA 2O01E 4N0AC 4C92E 4C92G 2Y4XA 2M9UA 3V7SA 3GPLA 1VQ7A 1JJ2S 3G7ZA 1BYMA 2M1HA 1LNXA 2PQWA 5C6SA 1YJNA 3MP6A 4F7UB 2K5LA 2DPPB 2LRQA 2XDDA 4ATOA 4M7AF 2DAQA 3FLGA 3J81E 1YBYA 2P0KA 1P92A 3M57A 1MHNA 4ELYC 1YJWT 3OYAA 2OTLT 5GAOm 3JCMP 4C8QE 5FRNA 2D6FA 1R8OB 1G3TA 4QQ6A 3JCMe 2KDSA 4OVAA 3OY9A 2DXCA 3FIFA 4M75F 3OSVA 3CEYA 4C92B 3S3OA 1VQ9T 3E1SA 5GMKi 5CKFA 1VQ9A 1BI2A 3OYKA 5LJ5f 5GAMf 4JS5A 1XOVA 5J3BA 5GANj 2HAXA 4KULA 3JB9F 1WGSA 3CCUA 1U1SA 3H6ZA 4NOYA 1Y96A 3PMTA 3QSUA 3OBYA 4C8QB 2L8DA 4FT2A 4II1A 3OYBA 3OYEA 3CCET 5AYFA 3HPWA 1Q82C 1TH7A 5HY6A 1D3BB 4L5GA 4V2SA 2GCXA 1HXDA 3HHTB 3OYYA 4ZN1A 3HSBA 3JB9I 5IN1A 3INZA 1WJQA 3X25B 5KE3A 3DB3A 1VQ5A 5HKCA 1X75C 1M1KC 4JRKA 2EQUA 3FJPA 3HRSA 3L2ZA 4PLLA 5LJ3f 3X24B 4RCBA 5GMKl 4A4HA 1QVPA 1VQKT 2DXUA 1VQ6A 4OB2B 3GLXA 1BIBA 1VQKA 2EQJA 3JCMQ 3VYHB 5FU7B 2EJ9A 4ZTFA 2K4YA 3CD6T 4DOVA 3CPWA 3CCRT 3CC2T 2O4XA 4QQDA 3CPWS 2FB7A 4M77F 3SB2A 1K73U 3CCRA 3QUIA 4M78C 4O5VA 1VQPT 4QVZA 1YIJA 4C0FA 1VQPA 2MI6A 2KAFA 1N9RA 3T9NA 5GAOq 3BFMA 2ZPFB 2E10A 2CKKA 4VUBA 2DK3A 2FVUA 4M7DA 3UT1A 1KD1C 3ZBDA 2XI9A 4HA8A 3JCMf 3L2VA 2VC8A 5KE2A 1KG1A 2BUDA 2A7YA 4ME7A 3TREA 4BI4A 3M59A 1Y96B 5GAN3 4BDZA 1K8AC 1WNLA 1S72T 3CCLA 2BKDN 1QP3A 4IUUA 1UGPB 4F7UF 3QZ5B 4C5GA 2C06A 2PU9B 1M1KU 3LLRA 3PFSA 3TCJA 1M90U 3A5ZB 5GAOn 3J7AF 3H8ZA 4EPCA 4J6YA 1G5VA 4PKCC 3N5BB 1OZ2A 4M7AC 4XAXB 2DKGA 2HQXA 4ZN3A 1LOJA 1VQLT 1EIFA 5A0LA 5CVIA 4C92D 3LWIA 2Y4YA 2VV5A 3RKWA 2K2VA 1MGQA 3BDLA 3M53A 4X34A 3QYGB 5LL6S 3VKIA 3FC3A 5LJ5h 3CCJA 2QEXA 3QJ6A 5GAMh 1QVFA 4XTUA 3P8DA 3E9GA 4OP0A 1QVFS 4M7DE 1Q86U 2HNIA 4M7DG 2HQEA 4X9DA 2F5KA 2RM4A 2RJCA 3M5AA 3CCVT 4BY6C 5GAOr 1H641 3AHUA 4C8QF 5A0DA 4QVDA 2O4XB 3F70A 3FRNA 3ZFJA 3CMAA 2WSFE 3CCVA 2JTFA 4E7JA 2EJFA 3SWNA 5IT9E 1VQLA 3A8GB 2XDPA 2DD4A 2RI5A 1I8FA 3DB4A 4ZGJB 3MEVA 3OW2A 2X4YA 4KUIA 4A4EA 3OW2S 1VQ8A 2QDYB 1K8AU 4Y91A 1Q7YU 2LDMA 2VGNA 4M7DB 1VQOT 4E7IA 1YJ9T 1WJRA 3S3NA 4MZTA 2I2LA 5GAN5 1YJ9A 5LJ3h 1O75A 1BKBA 1NZ9A 3X26B 1U8RA 3CBMA 3NTIA 2E6NA 4KT0E 1Y07A 4OB1B 3OYHA 3CC7A 1KHIA 2EJGA 2RB6A 4JUVA 4LDYA 4RKUE 4PJOG 4BE0A 4XK8E 4FIBA 2PVOB 4FSXA 5CO7A 2QQ9A 2GFAA 5FRMA 3CBPA 4N4IA 2QQSA 2V8IA 3QO3A 3V8JA 3FDRA 4XTZA 3G4SA 1ZBXA 4XU1A 4O6JA 3DLLA 3JCMW 2RK1A 5LJ5j 4YTLA 5GAMj 2FYKA 3LWHA 1M9SA 3HP9A 3HKSA 2JUFA 4R55A 3JCMh 3X20B 4OGCA 1VUBA 2AHJB 4E7HA 4A53A 1JJ2A 1JRIA 4JJNK 5DLQE 5M9OA 2QXFA 1NE8A 2KVQG 3P8HA 2X4XA 4EMKC 4A4KA 2JTMA 1JBMA 3PMIA 3SDZA 3L2RA 3SWNB 4L6V5 2GFUA 2IVWA 2EKOA 4LDUA 1Y71A 4N4GA 4RMOA 1YJWA 3UPUA 2OTLA 3MP8A 4OB0B 2E12A 2LNVA 3QZ9B 2DTIA 5J26A 4BD3A 1M8VA 2KK4A 3OS2A 4A4GA 2XHCA 2V8KA 3GP8A 1SSFA 5LJ3j 3V8LA 3HFOA 1OZ3A 4BUGA 2LT1A 3RMSA 2JOYA 3OYIA 4J8OA 4KBMB 3ZEHA 4BDYA 3I56T 3HFNA 5CKBA 3CBOA 4C92C 3KUFA 3OMCA 4ZTJA 3RERA 4E47A 3CCEA 2V8JA 3M4YA 5IAYA 1B34B 2P0PA 1N27A 4E7LA 3KBGA 2E6ZA 2D0QB 2XK0A 5DY9A 2M0OA 1X6OA 3KXTA 4C8QC 1XNIA 3CCST 3EFSA 3NTKA 3G71T 4HCBA 3A8HB 4M7DD 5GAN2 4M7DF 1WQ7A 1KC8C 1DJ7B 5FU6B 2EWNA 2RHUA 2ZZDA 1LJOA 4BI8B 1I5LA 4XU3A 1BI0A 1UGRB 4JLGA 3L2QA 1BI1A 5GAMd 2P0QA 3BW1A 4B9XA 3CD6A 1N6AA 3QYHB 2VXEA 1W4SA 4MZPA 4XTXA 5GMKm 3CC2A 1N9SA 4M75A 2R5AA 4BE1A 3RESA 2QQAA 1IREB 2RHYA 4D6WA 3BDUA 5FU7C 3OS0A 3OYMA 3OS5A 5GMKe 2MF2A 3CCQT 3MEWA 3L2WA 1Q82U 2ZPBB 3UWNA 3QJYA 5DM7R 4LDWA 1G3YA 4PJOD 4HT8A 2VUBA 4MDWA 4X9CA 3JB9H 2K5IA 2QI2A 5LJ3d 1S72A 4CI0C 5GANd 1K9MC 4LD9K 2E5QA 1KC8U 3RUXA 5HK0A 3MP1A 5GAN4 4MDXA 3OB9A 3Q1JA 4JDSA 4Q5WA 4B9WA 2CZ6B 2XDBA 1GXIE 2RI2A 2K5FA 2L89A 4P5NA 2LQ8A 5CQXA 4C92F 4M75E 3V7RA 4M75G 2XKOC 3A8MB 1Q81C 4C0GA 3WVDB 4GLKA 3OBWA 1YITA 2LT4A 4RCCA 4PJOA 2E1HA 4EDUA 1M4ZA 1WPYA 2EQMA 2PUOB 3CPFA 4HT9A 5D6WA 3JB9G 2L5QA 2R58A 4M77A 5CAIA 4IUQA 5GAMg 1KD1U 2B8AA 1M1GA 3WXMB 2CYZB 5L8RE 4N0AA 3G6ET 5CR2A 4CRIA 4XTVA 4M75B 1VQMT 2JVVA 1RL2A 2RD1A 3WVEB 2BIVA 2RJFA 2QQBA 2LQKA 3C4SA 3M56A 2E65A 3CMET 1QVGS 2GQVA 2ZPEB 3C12A 2A3LA 4HCZA 1K9MU 2MWOA 3HRUA 2RHIA 4RG2A 3RIRA 1VQOA 2FL7A 4PNOA 2CS7A 3OSSC 3JCMb 2P4TA 2K3YA 1KQ1A 2QA4T 1QW1A 3JAME 3M4GA 4EMHA 1I81A 4M7DC 2PVDB 2ZPGB 4ZGEB 5LJ3g 3PIOA 3UDCA 5GANg 3OYFA 3I55T 3NTHA 4PJOE 1NPPA 5CQYA 4C0DB 4EMGA 3MHXA 4M77G 3QHSA 2PVGB 1I4K1 1YHQT 1UB4A 3OMGA 3JCMc 4J7IA 3MEUA 3CXCA 4E7KA 1UGQB 3L2UA 3CXCS 1ZHIA 4HKEA 2LX9A 2LCCA 4PJOB 2FHDA 5A0GA 4IUPA 5C0MA 3A8LB 2RK2A 3GOXA 4J6WA 3VUBA 3JCMX 4C0ZA 2LTOA 3GNFB 4M77B 4MMLA 2KMTA 5I21A 3DLMA 3FB9A 2XG8D 3MO8A 4F7UG 3OYGA 3NFCA 3QG1A 2MMPA 1G3WA 5GANe 2YLCA 3GF5A 1O9SA 1FX7A 2R57A 2DIGA 2YLBA 1U1TA 4QW2A 5CKEA 2E41A 2EIFA 2EQKA 2RH2A 1NJIC 1YI2T 3VJPA 2LC4A 3PTAA 3ASKA 4M78A 3SWNC 3VYGA 3X28B 2LVMA 5GAOl 1YI2A 1VQ7T 1YJNT 4LDVA 4BI3A 3V8KA 3R6OA 4QVCA 2X4JA 1WQWA 1M1FA 3VUZA 4M7AD 3CCMT 2R5MA 3JCMV 4J7FA 5KH6A 3I56A 1VIFA 3JSCA 4OMFB 3TEEA 4IURA 5CK9A 3CCMA 2NLUA 2VYTA 2ZPHB 1VQ4T 4IUTA 3OYCA 1YITT 2DO3A 3O8VA 4C8QG 1VQ4A 2M16A 5FLXE 5KCHA 4J6XA 3URGA 4M75D 1W2BA 2VXFA 3OA6A 1Y7XA 2DZ9A 1W2BS 2WSEE 4MZMA 2OTJT 3LYIA 4C5HA 2CZ0B 3CCSA 3CCUT 1HK9A 3RMQA 2RJEA 3G71A 4ZGDB 1ZQ1A 3JB9D 1K73C 2OTJA 2DIQA 5GAN7 2XICA 3CC4T 4L59A 4RG8A 4XTYA 2XD0A 4M7AA 2KY9A 1PSFA 3CC4A 3ME9A 5GMKh 4LDXA 3HL8A 3PGGA 4M78E 5LJ5d 4M78G 3OYLA 1G3SA 2DEQA 3OYJA 4MMKA 1VIEA 3M55A 3RKYA 4TVRA 1NJIU 1H3ZA 3M58A 3JCMJ 4Z02A 2EFIA 4IUVA 5FU6C 2K3XA 3QPHA 4ELZC 3OYDA 1VQ5T 1KQ2A 1XTDA 4XTWA 1JB0E 2EYQA 3L42A 4N4HA 3QKJA 4J83A 1VQ6T 4PLIA 1M90C 2F69A 3OS1A 4J5YA 2QQRA 4M78B 2E64A 4NL2A 2XIDA 4C5EA 5GANf 3CCQA 5I2MA 2RO0A 3VU3C 3ER0A 4JLIA 3OQ5A 4PJOF 3S6WA 1BI3A 2RHXA 4XU2A 4BE2A 2E70A 1FXXA 1UEBA 2EAYA 4M77D 1FWZA 4M7AE 4M7AG 1YIJT 3M9QA 5GAN8 1Q86C 3OYNA 3EFRA 5KCOA 4JRQA 3EAEA 2WSCE 4FM4B 4FT4A 3LX7A 4NL3A 4R56A 4UC4A 1VQNT 2L3RA 2MWPA 2DZCA 3E9FA 3DKMA 1VQNA 3S3MA 2XU8A 4IKFA 4FL6A 4XU0A 2RJDA 5CCAA 3PIPA 3JB9J 1V29B 4LD6A 4NS5A 1PSEA 5CKHA 5GMKj 3CCLT 4M7AB 2WACA 2PUKB 5EG2A 2RHZA 1Q7YC 5LJ5g 2YHTA 3FEOA 3JCMd 2D9TA 2DTOA 3TU4K 4WF2A 2DJZA 3A8OB 3SFMA 4FU6A 4JRPA 2RI3A 2JZ2A 1OYXA 2F5TX 1KHCA 3E19A 2CZ1B 5DLOA 3G6EA 2GF7A 1VQMA 2VGMA 1N8RC 4JRIA 1QVGA 2LCLA 3CCJT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FHD A;  4QVZ A;  4IUP A;  3QBY A;  5C0M A;  3SD4 A;  3GOX A;  5IAY A;  2LTO A;  2CKK A;  1N27 A;  4E7L A;  3UT1 A;  2XK0 A;  2M0O A;  3OYG A;  5FRO A;  3DLM A;  3MO8 A;  1XNI A;  2YRV A;  3LGF A;  4GY5 A;  5D6X A;  5KE2 A;  2BUD A;  3PNW C;  3NTK A;  4BDZ A;  2R57 A;  2DIG A;  2BKD N;  4QW2 A;  4IUU A;  4PL6 A;  4C5G A;  2EQK A;  3LLR A;  3PFS A;  5CIU A;  2RHU A;  5D6Y A;  3ASK A;  3H8Z A;  2LVM A;  1G5V A;  3L2Q A;  4B9X A;  1OZ2 A;  1OI1 A;  2HQX A;  2R5M A;  2G3R A;  2R5A A;  5KH6 A;  4BE1 A;  3BDL A;  4IUR A;  4X34 A;  2RHY A;  4QQG A;  2NLU A;  2VYT A;  3FC3 A;  4BAC A;  3MEA A;  3QJ6 A;  4IUT A;  3OYC A;  3P8D A;  3OS0 A;  3O8V A;  3E9G A;  5J39 A;  3OYM A;  1WJS A;  2M16 A;  3LH0 A;  5KCH A;  3MEW A;  3L2W A;  3UWN A;  3OA6 A;  2HQE A;  3L2V A;  2F5K A;  3LGL A;  2RJC A;  2X4W A;  2IG0 A;  3LYI A;  2O4X B;  3F70 A;  4C5H A;  3QII A;  4E7J A;  2JTF A;  3MET A;  2RJE A;  2X35 A;  2RI5 A;  2XDP A;  2DIQ A;  3DB4 A;  4A4F A;  3MEV A;  4C5I A;  4ZTJ A;  2X4Y A;  4L59 A;  1RI0 A;  4A4E A;  2E5Q A;  3ME9 A;  2LDM A;  3MP1 A;  3OYL A;  3OB9 A;  3Q1J A;  4B9W A;  4Q5W A;  3OYJ A;  4E7I A;  1WJR A;  2PQW A;  2M1H A;  5C6S A;  2RI2 A;  3S3N A;  2L89 A;  3MP6 A;  1H3Z A;  4Z02 A;  2LRQ A;  2EFI A;  2DAQ A;  3FLG A;  2P0K A;  1MHN A;  4IUV A;  2K3X A;  3OYD A;  3OYA A;  3NTI A;  2E6N A;  3OYH A;  5FRN A;  4QQ6 A;  3OY9 A;  4N4H A;  2EQM A;  3L42 A;  3QKJ A;  4OVA A;  4EDU A;  4BE0 A;  4PLI A;  5D6W A;  3CEY A;  3OS1 A;  2QQR A;  4C5E A;  3S3O A;  2R58 A;  4IUQ A;  2GFA A;  2RO0 A;  5FRM A;  3OYK A;  2B8A A;  4N4I A;  2QQS A;  3OQ5 A;  3S6W A;  3FDR A;  4CRI A;  2RHX A;  1WGS A;  4BE2 A;  3H6Z A;  2BIV A;  3PMT A;  2RJF A;  3C4S A;  2L8D A;  3M9Q A;  4II1 A;  3OYB A;  3OYE A;  4E7H A;  4HCZ A;  5KCO A;  3OYN A;  3EAE A;  2MWO A;  4RG2 A;  2RHI A;  3LX7 A;  5M9O A;  4UC4 A;  2L3R A;  2MWP A;  3P8H A;  2X4X A;  3E9F A;  2K3Y A;  3S3M A;  5IN1 A;  3PMI A;  1WJQ A;  4IKF A;  4FL6 A;  3L2R A;  2RJD A;  5KE3 A;  2GFU A;  3DB3 A;  2EKO A;  4N4G A;  4LD6 A;  4NS5 A;  3MP8 A;  3OYF A;  3NTH A;  2EQU A;  5J26 A;  4BD3 A;  2WAC A;  4PLL A;  2RHZ A;  4A4H A;  3OS2 A;  4A4G A;  3FEO A;  2D9T A;  1SSF A;  1OZ3 A;  2EQJ A;  3OMG A;  4FU6 A;  4ZTF A;  4E7K A;  3MEU A;  2RI3 A;  2JZ2 A;  1OYX A;  2O4X A;  1KHC A;  3OYI A;  4QQD A;  3ZEH A;  3L2U A;  2GF7 A;  4BDY A;  3KUF A;  3OMC A;  2LCC A; 
#chains in the Genus database with same CATH topology
 2QEX T;  2OAU A;  3P8B B;  4F7U A;  5FW9 A;  3IQL A;  5FRO A;  1NM7 A;  3O5Z A;  3LGF A;  2MYS A;  3I55 A;  1WA7 A;  2EBP A;  5CKD A;  1RAC B;  5HK3 A;  1KQS A;  1VQ8 T;  4PL6 A;  4M77 E;  1TTH B;  2DX1 A;  5CIU A;  2EGC A;  3MPU B;  4C92 A;  1VQL Q;  4Z88 A;  3CCJ Q;  2QEX Q;  4BB7 A;  2KSS A;  4PJM A;  3UAT A;  4IIO A;  3PT9 A;  3QXE B;  3HRT A;  4QQG A;  3CC7 T;  4BAC A;  3MEA A;  1YWO A;  4C8Q A;  1YWP A;  2DTH A;  3JCM g;  1X01 A;  4PFZ A;  1M30 A;  3BE3 A;  1X27 A;  3LGL A;  1VQ8 Q;  4PJO C;  2CRE A;  2JTE A;  4C92 G;  2M9U A;  2V1R A;  3VRZ A;  3V7S A;  3GPL A;  2PQW A;  1EZZ B;  3CC7 Q;  1M3A A;  2DPP B;  2KRM A;  2LRQ A;  4M7A F;  3J81 E;  3EG0 A;  2YUN A;  2QGG A;  1P92 A;  1NYF A;  1YJW T;  4RTW A;  3OYA A;  5GAO m;  3JCM P;  3JCM e;  3VS2 A;  2OAW A;  2DXC A;  4M75 F;  3S3O A;  3E1S A;  5LJ5 f;  4JS5 A;  3JB9 F;  1WGS A;  4NOY A;  3QSU A;  3OYB A;  1Q82 C;  1G83 A;  1TH7 A;  1D3B B;  4V2S A;  1YJW Q;  4KGV B;  8ATC B;  3ZL7 C;  5IN1 A;  1W6X A;  1Q82 R;  1MV0 B;  1M1K C;  3HRS A;  5LJ3 f;  4A4H A;  1VQK A;  2EQJ A;  3VYH B;  5FU7 B;  3EHQ A;  4DOV A;  3CC2 T;  3CPW S;  1MV3 A;  1RAD B;  5IXB A;  4WCI A;  1OUL A;  1YIJ A;  2DF6 A;  1N9R A;  3BFM A;  2ZPF B;  4VUB A;  2FVU A;  1KD1 C;  1XJW B;  2XI9 A;  3ZBD A;  3UA6 A;  3M0R A;  4BI4 A;  3M59 A;  1Y96 B;  5GAN 3;  1K8A C;  2NYS A;  2M02 A;  2VWF A;  1KD1 R;  4IUU A;  1CKB A;  1BU1 A;  2PU9 B;  3CC2 Q;  3LLR A;  3TCJ A;  5GAO n;  2X3W D;  1K8A R;  1GBQ A;  4M7A C;  4ZN3 A;  1LOJ A;  1F1B B;  1EIF A;  3LWI A;  4C92 D;  1K9M R;  1VQL A;  2CT4 A;  3BDL A;  3CCJ A;  3VKI A;  2RN8 A;  2YUQ A;  1QVG P;  1IGU A;  2QEX A;  3QJ6 A;  4OP0 A;  3EGD B;  2QYZ A;  2HQE A;  2RM4 A;  3CCV T;  2RJC A;  3M5A A;  4BY6 C;  5A0D A;  1Z9Q A;  1BCO A;  3A8G B;  2XDP A;  2RI5 A;  1I8F A;  1MMA A;  4ZGJ B;  3UA7 A;  2OX7 A;  1VQ8 A;  1QCO A;  4M7D B;  1QQJ A;  1TS9 A;  3JV3 A;  1O75 A;  1TOV A;  2CUD A;  3X26 B;  3NTI A;  2E6N A;  2HMA A;  3CC7 A;  1KHI A;  4LDY A;  3QWX X;  3G6E Q;  5CO7 A;  2GFA A;  2E3H A;  4K11 A;  4XTZ A;  1ZBX A;  4YTL A;  3LWH A;  3HP9 A;  3HKS A;  3JCM h;  2JT4 A;  4A53 A;  1B7T A;  1M2V A;  1WXU A;  5IH2 A;  3P8H A;  2X4X A;  4EMK C;  2JTM A;  1LVK A;  3I5S A;  4L6V 5;  4LDU A;  2EKO A;  1YJW A;  3MP8 A;  1UUE A;  5J26 A;  2DTI A;  1M8V A;  2XHC A;  3GP8 A;  8AT1 B;  3HFO A;  1OZ3 A;  4BUG A;  1X6B A;  2VKN A;  3KUF A;  2J6F A;  1NJI R;  5KYW B;  2BZY A;  2JMA A;  5KYU A;  5IAY A;  1B34 B;  1JXM A;  9ATC B;  3KBG A;  1ZUU A;  2M0O A;  1XNI A;  1R0C B;  3G71 T;  1YI2 Q;  2CSQ A;  2RHU A;  2ZZD A;  2RQU A;  4XU3 A;  2HQH A;  5GAM d;  1ZSZ C;  3QYH B;  3CC2 A;  3CPW P;  4AFZ C;  2RHY A;  3KFV A;  2KI7 A;  3BDU A;  3OS0 A;  3OS5 A;  2ABL A;  3MEW A;  2DMO A;  2ZPB B;  2EGE A;  1PCX A;  1X2Q A;  5DM7 R;  1PHT A;  2A37 A;  1G3Y A;  2GTO A;  3CC4 Q;  4X9C A;  2VAS A;  2K5I A;  5GAN d;  1V76 A;  1KC8 U;  3MP1 A;  2KGT A;  4B9W A;  4Q5W A;  2RI2 A;  2K6D A;  1G2B A;  2L89 A;  2LCS A;  1B3Q A;  3NMZ C;  4M75 E;  2XKO C;  4M4Z A;  4C0G A;  5KYX A;  3WVD B;  2DL7 A;  4GLK A;  4EDU A;  4DBQ A;  2PUO B;  4HVV A;  2R58 A;  2KRN A;  5GAM g;  1IRX A;  2RD1 A;  4LUD A;  3H0H A;  2KYB A;  2RJF A;  3M56 A;  3VS5 A;  4HCZ A;  2BZX A;  1T0H A;  2FL7 A;  2LP5 A;  4JPB W;  2QA4 T;  2K2M A;  1ZBJ A;  2ZPG B;  3PIO A;  3UDC A;  5GAN g;  1T3L A;  3EG2 A;  4RUG A;  3MHX A;  2DET A;  1UB4 A;  4E7K A;  2LJ0 A;  3L2U A;  2LX9 A;  4PJO B;  2FHD A;  3EGX A;  3A8L B;  2QA4 Q;  3GOX A;  2MPX C;  1HD3 A;  1YFN A;  2LTO A;  3GNF B;  2KMT A;  1SKU B;  5GAN e;  2LMJ A;  2YLC A;  1FX7 A;  2DIG A;  1I0C A;  2K9G A;  2YUP A;  4QW2 A;  3EG9 B;  1D0Y A;  3PTA A;  4M78 A;  1YI2 A;  2A0F B;  1YJN T;  4BI3 A;  2KBT A;  2COY A;  2DIL A;  5CK9 A;  1UG1 A;  2NLU A;  2CH4 W;  5D7U A;  3VS3 A;  3URG A;  1W2B A;  2DRM A;  2F2V A;  2WSE E;  2OTJ T;  2DL5 A;  1TU0 B;  3G71 A;  1LCK A;  4CC7 A;  2XIC A;  3CC4 A;  2Z0W A;  5LJ5 d;  4M78 G;  1G3S A;  1MMG A;  4Z02 A;  2FO0 A;  5IXF A;  3RR6 A;  1OU9 A;  3ULR B;  1WX6 A;  3L42 A;  4C5E A;  4E6R A;  3ER0 A;  4JLI A;  3OQ5 A;  2RHX A;  3I5R A;  1SHG A;  3OYN A;  5KCO A;  4JRQ A;  4LUE A;  4FM4 B;  4FT4 A;  1RAG B;  1WZO A;  2DZC A;  4IKF A;  1Y57 A;  2RJD A;  5CKH A;  4M7A B;  1QVF P;  1M3B A;  4J9C A;  5LJ5 g;  3NHN A;  2J06 A;  3FEO A;  1WDX A;  2D9T A;  4AG1 C;  2HL5 C;  3TU4 K;  2O31 A;  4FU6 A;  1IGQ A;  1AWO A;  1ZA2 B;  2RI3 A;  2AKK A;  2F5T X;  1KHC A;  5DLO A;  2JMC A;  3VS7 A;  4BY6 B;  4OF1 A;  2MAM A;  2YSQ A;  3RKX A;  4DOW A;  2KNB B;  2X51 A;  3C95 A;  1JO8 A;  4AFQ C;  1KG1 A;  5D6X A;  2QA4 A;  2SRC A;  3PNW C;  3AT1 B;  1Z9Z A;  3VS4 A;  2CGH A;  1M5Q 1;  2HD0 A;  5LJ5 e;  4OGE A;  2FPD A;  1KQS S;  2COW A;  3J80 E;  1GBR A;  1AHJ B;  1OI1 A;  4A54 A;  1MMN A;  4C0D C;  1RUW A;  2G3R A;  5GAN h;  4M78 D;  3RNJ A;  2QAZ A;  1MND A;  2K79 A;  5GJV B;  4Y28 E;  5J39 A;  3LH0 A;  2L0A A;  2AK5 A;  1E7O A;  1B34 A;  1BIA A;  3C94 A;  2X4W A;  5LJ3 e;  2MOX A;  4C5I A;  4M77 C;  4EMK B;  2HBP A;  2ZCF B;  1RI0 A;  3JRZ A;  1NYG A;  3OW2 P;  1JJ2 S;  2RMO A;  3G7Z A;  1BYM A;  1YJN A;  2K5L A;  2XDD A;  2P0K A;  1CKA A;  3M57 A;  2LNH B;  2OTL T;  4PJJ A;  1R8O B;  4QQ6 A;  2KDS A;  3M0P A;  2RNA A;  4OVA A;  4ORZ A;  3SEM A;  4AFU C;  5GMK i;  1BI2 A;  5GAM f;  2CP3 A;  3H6Z A;  1PWT A;  3OBY A;  4FT2 A;  4II1 A;  3OYE A;  5HY6 A;  2OTL Q;  1E6H A;  1HXD A;  2GCX A;  3OYY A;  3C0C A;  3H0F A;  3DB3 A;  5KYY A;  4JRK A;  2EQU A;  3FJP A;  3X24 B;  2CH4 A;  5GMK l;  4RCB A;  1VQK T;  1QVP A;  4OB2 B;  1K0X A;  2A28 A;  1BIB A;  2FZK B;  3I56 Q;  3JCM Q;  2C0T A;  3CD6 T;  1D0X A;  1KC8 R;  3NPF A;  4QQD A;  3EH1 A;  2FB7 A;  3MJX A;  4C0F A;  1IO6 A;  2E5K A;  4AG2 C;  2E10 A;  4FSS A;  4JJC A;  2FEI A;  1QP3 A;  3CD6 Q;  1UGP B;  4F7U F;  4AT1 B;  1G5V A;  4PKC C;  3N5B B;  1OZ2 A;  2DE0 X;  4XAX B;  1VOM A;  1H3H A;  1VQL T;  5A0L A;  3HTR A;  2Y4Y A;  3RKW A;  5LJ5 h;  1TUC A;  4M7D E;  3H0I A;  4X9D A;  5GAO r;  3AHU A;  4C8Q F;  2O4X B;  3F70 A;  3FRN A;  1UHF A;  3ZFJ A;  4E7J A;  2JTF A;  3SWN A;  2DD4 A;  3OW2 A;  1PC0 A;  2QDY B;  2LDM A;  1VQO T;  4E7I A;  1WJR A;  3S3N A;  5LJ3 h;  3CXC P;  1U8R A;  4KT0 E;  4OB1 B;  3OYH A;  2IPO B;  2EJG A;  4PJO G;  4LNP A;  2QQ9 A;  5FRM A;  4PFP A;  4N4I A;  2QQS A;  1U5S A;  1GCQ C;  1VQO Q;  1S1N A;  4OGC A;  1JJ2 A;  5DLQ E;  2KVQ G;  4A4K A;  4N4G A;  2BTT A;  3UPU A;  2OTL A;  1K1Z A;  4OB0 B;  4BD3 A;  2J05 A;  4F17 A;  3THK A;  3RMS A;  2JOY A;  4J8O A;  4KBM B;  3ZEH A;  1W1F A;  4WTO B;  4BDY A;  2A36 A;  3CBO A;  4C92 C;  3OMC A;  2DVJ A;  4KRT A;  3RER A;  4PFO A;  2V8J A;  3M4Y A;  4JZ4 A;  2W10 A;  2XK0 A;  1SRL A;  5DY9 A;  5IHN A;  3KXT A;  4C8Q C;  1IXD A;  3CCS T;  1J3T A;  3NTK A;  4HCB A;  1WQ7 A;  1VQ7 Q;  1DJ7 B;  4OMM A;  1UDL A;  2EWN A;  1LJO A;  2NUP B;  1IB8 A;  2JXB A;  2P0Q A;  4HVU A;  4B9X A;  3CD6 A;  1I07 A;  1VQ4 Q;  1QMC A;  1N9S A;  1FMK A;  4M75 A;  2R5A A;  4BE1 A;  4J9E A;  1NEB A;  3OYM A;  1WHJ A;  2RQR A;  2DFU A;  5GMK e;  3CCS Q;  2EPD A;  3UWN A;  1BB9 A;  4LDW A;  4PJO D;  4MDW A;  3JB9 H;  2QI2 A;  1QCF A;  2ROL A;  2QG9 B;  4CI0 C;  2YDL A;  1K9M C;  5HK0 A;  4JZ3 A;  3OB9 A;  1MMD A;  2BZ8 A;  2LQ8 A;  1TWB A;  2F1L A;  4M75 G;  5IHI A;  1VQ6 Q;  1RAF B;  2YT6 A;  2LT4 A;  2NUT B;  2EQM A;  1WPY A;  3JB9 G;  2DYI A;  5FWC A;  2MIO A;  2B8A A;  3WXM B;  4N0A A;  3G6E T;  5CR2 A;  1VQM T;  2JVV A;  1UE9 A;  3C4S A;  3CME T;  3HRU A;  4RG2 A;  1VQO A;  4PNO A;  5KYN A;  2CS7 A;  1UJ0 A;  1E6G A;  4IIM A;  3JAM E;  2HSP A;  2PVD B;  4ZGE B;  4PJO E;  1AWX A;  4J9G A;  4RTZ A;  4C0D B;  3GBQ A;  1VQM Q;  1QCN A;  2VVK A;  1YHQ T;  2DRK A;  3CME Q;  3MEU A;  2COZ A;  2J7I A;  4QT7 A;  1UFF A;  1R0B G;  5C0M A;  1M27 C;  3VUB A;  3JCM X;  4C0Z A;  2EYZ A;  4M77 B;  1KFZ A;  3OYG A;  5I21 A;  3DLM A;  3QDF A;  2MMP A;  1WLP B;  3GF5 A;  2CP2 A;  1YHQ Q;  2R57 A;  1GL5 A;  5CKE A;  2J6K A;  2QDL A;  2E41 A;  3M0U A;  1NJI C;  1YI2 T;  2M0Y A;  5GAO l;  2EGA A;  1QWE A;  1Q95 G;  3D7S B;  2FPE A;  3VUZ A;  4M7A D;  2R5M A;  3JSC A;  3EFO B;  2VYT A;  3OYC A;  2DO3 A;  1VQ4 A;  4M75 D;  1W2B S;  2RQT A;  1AOJ A;  1GRI A;  3CCS A;  1HK9 A;  1FMV A;  1ZQ1 A;  3JB9 D;  1WHH A;  2HL3 A;  5GAN 7;  2LQN A;  3CC4 T;  4RG8 A;  2KY9 A;  5GMK h;  1OPK A;  2OJ2 A;  1VIE A;  3M55 A;  1ZUK A;  1N5Z A;  4TVR A;  3RKY A;  2EFI A;  4ANJ A;  2KEA A;  5FU6 C;  3QPH A;  1VQ9 Q;  1XTD A;  4GLM A;  2EYQ A;  4N4H A;  2AT1 B;  3OS1 A;  2QQR A;  2E64 A;  4NL2 A;  2AZV A;  1SPK A;  1C6V X;  2LJ3 A;  3G1J A;  1BI3 A;  4PJL A;  4D8D A;  2E70 A;  1FXX A;  2EAY A;  4ZNX A;  4M7A E;  1PKT A;  3M9Q A;  3LX7 A;  4NL3 A;  1WFW A;  2L3R A;  2KXD A;  1I1J A;  6AT1 B;  2FZC B;  1WXB A;  3EG3 A;  5CCA A;  3PIP A;  4NS5 A;  1PSE A;  2X9H A;  2PUK B;  5I22 A;  3CCR Q;  2DJZ A;  3A8O B;  1VQP Q;  1OYX A;  3G6E A;  2CZ1 B;  2GF7 A;  1VQM A;  3M0S A;  1PD1 A;  2OI3 A;  2Y90 A;  2DXT A;  3QBY A;  3SD4 A;  3CME A;  2QTV A;  5IHK A;  1JXO A;  2CZ7 B;  2YUO A;  2HDA A;  1FMW A;  1XQH A;  1YNZ A;  4GY5 A;  3CMA T;  2DXB A;  2BE7 D;  4XQ3 A;  1QP2 A;  5GJW B;  5GAO p;  5GAM e;  4ESR A;  2DD5 A;  3MCA B;  5D6Y A;  3BY7 A;  4KH1 B;  3R6N A;  3M54 A;  5A2Q E;  1YHQ A;  1MUZ A;  1NLP C;  4FW2 A;  1YIT Q;  3LW5 E;  1TUG B;  2JS0 A;  4FYX B;  4M78 F;  4HCC A;  1N8R U;  2DLP A;  2GTJ A;  3CMA Q;  1RAH B;  1WJS A;  2JN0 A;  2C0O A;  1D3B A;  2JW4 A;  1YCY A;  5FWB A;  1UGV A;  2IG0 A;  2CP5 A;  3QII A;  4A63 B;  2EW3 A;  3VV0 A;  1I5O B;  1NPR A;  2ZGW A;  2RA2 A;  1YJ9 Q;  4AFS C;  2O01 E;  2Y4X A;  1LNX A;  3MP6 A;  2GBQ A;  1OQK A;  2CP7 A;  4F7U B;  4ATO A;  2EYW A;  1MHN A;  5FRN A;  4F16 A;  2O9V A;  1ABQ A;  3FIF A;  4C92 B;  2MK5 A;  5CKF A;  1Y0M A;  1PRL C;  2E4H A;  1VQ9 A;  4FW1 A;  3OYK A;  1W2B P;  5GAN j;  5J3B A;  2HAX A;  4KUL A;  2SEM A;  4OML A;  2D0N A;  1U1S A;  1Y96 A;  2PNI A;  3PMT A;  2FZG B;  4C8Q B;  2L8D A;  3CCE T;  5AYF A;  3HPW A;  4L5G A;  3HSB A;  3JB9 I;  3INZ A;  3X25 B;  1JU5 C;  5HKC A;  2CUB A;  1X75 C;  3L2Z A;  3EGD A;  1W70 A;  3CCE Q;  2EJ9 A;  2DYB A;  4M77 F;  1K73 U;  3CCR A;  1RLP C;  3QUI A;  4M78 C;  1CSK A;  1VQP A;  2MI6 A;  5GAO q;  4M7D A;  2DK3 A;  3UT1 A;  1UJY A;  2YRC A;  4HA8 A;  1QLY A;  4ME7 A;  1OEB A;  3TRE A;  1WNL A;  1S72 T;  4X1V A;  3NGP A;  3QZ5 B;  1YN8 A;  1M1K U;  3PFS A;  3TVT A;  3J7A F;  4EPC A;  2HBW A;  4JJD A;  2DKG A;  1WYX A;  1ZX6 A;  4F14 A;  4X34 A;  3FC3 A;  5LL6 S;  1TG0 A;  5GAM h;  1QVF A;  2ESW A;  3E9G A;  4M7D G;  2K7A A;  1S72 Q;  4QVD A;  2AZS A;  3EG1 A;  3CMA A;  2WSF E;  3DB4 A;  2X4Y A;  4KUI A;  4A4E A;  3OW2 S;  1K8A U;  2LZ6 B;  4Y91 A;  2C0I A;  4D8K A;  4OMP A;  1C1A A;  2I2L A;  1YJ9 A;  4DEY A;  3CBM A;  5KYW A;  2EYX A;  2GNC A;  2RB6 A;  4RKU E;  1H92 A;  2PVO B;  4KGX B;  2QGF B;  2V8I A;  2FRW A;  3VS0 A;  4O6J A;  3DLL A;  3JCM W;  2RK1 A;  5LJ5 j;  2FYK A;  4R55 A;  3X20 B;  1VUB A;  1JRI A;  3TQ7 P;  4JJN K;  5M9O A;  1NE8 A;  1JBM A;  3PMI A;  3SDZ A;  1R77 A;  4DBR A;  2O88 A;  1Y71 A;  4RMO A;  2E12 A;  2LNV A;  3QZ9 B;  4A4G A;  1SSF A;  4DBF A;  3V8L A;  5LJ3 j;  2LT1 A;  2P4R A;  3REB B;  3I56 T;  3HFN A;  5CKB A;  1ARK A;  1C0M A;  3MKD A;  4E47 A;  4EIK A;  3CCE A;  2L3S A;  2E6Z A;  4KGZ B;  1X6O A;  2W0Z A;  2B86 A;  1ZSZ B;  5GAN 2;  4M7D D;  1KC8 C;  4GBQ A;  1M2V B;  4CC2 A;  1PM3 A;  5FU6 B;  2O2O A;  3PVQ A;  4BI8 B;  1I5L A;  3CCM Q;  2DA9 A;  4JLG A;  3L2Q A;  1RAE B;  3BW1 A;  4CC3 A;  2JM8 A;  2VXE A;  1W4S A;  1OX9 A;  4MZP A;  4XTX A;  2QQA A;  3VS6 A;  4D6W A;  1QKW A;  5AT1 B;  2MF2 A;  1SSH A;  3L2W A;  2JM9 A;  1SG5 A;  3QJY A;  4RTT A;  4HT8 A;  2VUB A;  1S72 A;  2K3B A;  2LQW A;  5KYU B;  2E5Q A;  4J9B A;  1GXI E;  1RI9 A;  4C92 F;  3OBW A;  3RDV A;  2M51 A;  4RCC A;  4PJO A;  3CPF A;  3M0T A;  5D6W A;  3FJ5 A;  2L5Q A;  2EYY A;  2HSE B;  1GCQ A;  5CAI A;  3H41 A;  4IUQ A;  1M1G A;  4CRI A;  4XTV A;  3CQT A;  1RL2 A;  1AD5 A;  1G8X A;  1IHV A;  2QQB A;  2LQK A;  1KQS P;  1VQN Q;  1QVG S;  1D1B A;  2GQV A;  3EG9 A;  2ZPE B;  1OV3 A;  1D1C A;  3RIR A;  2RHI A;  1N8R R;  3OSS C;  2P4T A;  2K3Y A;  1QW1 A;  3M4G A;  2XMF A;  3UF4 A;  1RAA B;  1I81 A;  2H3E B;  5CQY A;  1ZUY A;  3E2U A;  4EMG A;  1PD0 A;  2PVG B;  1ACM B;  4E2F B;  2CP6 A;  3OMG A;  1NEG A;  3JCM c;  4J7I A;  3CXC A;  1UGQ B;  4FYW B;  4RTY A;  5KYX B;  1ZHI A;  2HCK A;  4HKE A;  2ATC B;  2KE9 A;  1WHM A;  4J6W A;  1JJ2 P;  2X3X D;  3MO8 A;  3FB9 A;  2XG8 D;  3TSZ A;  4F7U G;  1G3W A;  1OX8 A;  2G6F X;  2YLB A;  2EQK A;  3ASK A;  1VQ7 T;  2YRD A;  3SWN C;  2LVM A;  3V8K A;  1VYU A;  1WQW A;  3I9Q A;  3I56 A;  5KH6 A;  3TEE A;  4OMF B;  4IUR A;  3CCM A;  2MCN A;  2ZPH B;  1VQ4 T;  1BCM A;  3O8V A;  4C8Q G;  4Y92 A;  2M16 A;  2DL3 A;  5KCH A;  4J6X A;  2QAS A;  2VXF A;  1Y7X A;  1AWW A;  4MZM A;  3M0Q A;  2RQW A;  3LYI A;  4C5H A;  1WHL A;  2CZ0 B;  3CCU T;  1K73 C;  3RMQ A;  2RJE A;  1AVZ C;  2DIQ A;  4XTY A;  3EGX B;  4M7A A;  2LJ1 A;  1PSF A;  2VB6 A;  3ME9 A;  4LDX A;  1TSF A;  4DEX A;  3HL8 A;  3OYL A;  1QKX A;  1UHC A;  1K73 R;  4OMN A;  1H3Z A;  1D0Z A;  1UTI A;  2AKL A;  4IUV A;  4AMC A;  1VQ5 T;  1LPL A;  3OYD A;  1KQ2 A;  1YCS B;  1JB0 E;  4J83 A;  1VQ6 T;  4PLI A;  3CCU Q;  2FG0 A;  4M78 B;  4RTV A;  2RO0 A;  3SHW A;  1V1C A;  1M1K R;  3VS1 A;  1UEB A;  1FWZ A;  4M7A G;  2KYM A;  5GAN 8;  1NG2 A;  2WSC E;  1VQ5 Q;  4R56 A;  3U23 A;  1VQN A;  1WXT A;  1HSQ A;  3S3M A;  2XU8 A;  4FL6 A;  1JEG A;  1V29 B;  4LD6 A;  5GMK j;  3CCL T;  2WAC A;  2YHT A;  4B6M A;  2CSI A;  2DTO A;  1VYV A;  4HCK A;  1QWF A;  3E19 A;  2VGM A;  2ENM A;  1QVG A;  2LCL A;  1D09 B;  4EMK A;  3L1A A;  1UGS B;  2DJQ A;  2DER A;  4M75 C;  3CCL Q;  4JS4 A;  2YRV A;  1ABO A;  4C8Q D;  2H8H A;  1Q81 U;  1T3S A;  2ZPI B;  2KT1 A;  2QTX A;  5I2S A;  2RPN A;  5HCK A;  4OB3 B;  2JNG A;  2KRS A;  2NWM A;  1IZ6 A;  4DQ2 A;  1OU8 A;  3CCV Q;  3V7C A;  2H3J A;  2DVE A;  2K57 A;  4F7U E;  4DA4 A;  3GNG A;  2KQW A;  5GAN 6;  3GIB A;  3G4S T;  2D8H A;  1TUD A;  3MET A;  3QDR B;  2X35 A;  5I11 A;  4A4F A;  4J9D A;  1RAB B;  1ZSZ A;  4KUD K;  4N0A C;  4C92 E;  1VQ7 A;  2M1H A;  5C6S A;  1B07 A;  1U06 A;  2DAQ A;  3FLG A;  1YBY A;  4ELY C;  4C8Q E;  2D6F A;  1G3T A;  1RAI B;  3OY9 A;  3G4S Q;  3OSV A;  3CEY A;  1VQ9 T;  4J9I A;  4CC4 B;  1KIK A;  1XOV A;  4J9F A;  4FYY B;  3CCU A;  2EVR A;  2IIM A;  1EX4 A;  3HHT B;  4RTX A;  4ZN1 A;  1TXQ A;  1WJQ A;  5KE3 A;  1VQ5 A;  2DM1 A;  4J9H A;  4PLL A;  3TSW A;  1GFD A;  2CP0 A;  1VQ6 A;  2DXU A;  3GLX A;  4ZTF A;  2K4Y A;  3CPW A;  3CCR T;  2O4X A;  3SB2 A;  4O5V A;  1VQP T;  1NBE B;  4QVZ A;  2KAF A;  3T9N A;  1X69 A;  3REA B;  2CKK A;  3G71 Q;  1WHG A;  1SRM A;  3JCM f;  3L2V A;  2VC8 A;  2FPF A;  5KE2 A;  2BUD A;  2A7Y A;  4BDZ A;  2HEQ A;  1EFN A;  3CCL A;  2BKD N;  2E3I A;  4QKU A;  4C5G A;  3A1P A;  2C06 A;  2D1X A;  1M90 U;  3A5Z B;  4R0K A;  3H8Z A;  4J6Y A;  3LH5 A;  2HQX A;  5CVI A;  2VV5 A;  2K2V A;  1MGQ A;  5KYY B;  3M53 A;  1YIT T;  3QYG B;  4Z89 A;  4XTU A;  3P8D A;  1QVF S;  1Q86 U;  2HNI A;  3EH2 A;  2F5K A;  2FRY A;  1H64 1;  2BE9 B;  3CCV A;  2RQV A;  2EJF A;  5IT9 E;  1X2K A;  3MEV A;  4OMQ A;  4JJB A;  1UEC A;  1Q7Y U;  2VGN A;  1YJ9 T;  4MZT A;  5GAN 5;  1BKB A;  2P84 A;  1M8M A;  2PZ1 A;  1NZ9 A;  2EKH A;  1Y07 A;  2F2X A;  4JUV A;  4BE0 A;  2DEU A;  4XK8 E;  4FIB A;  1K0S A;  4FSX A;  1YP5 A;  3CBP A;  2L2P A;  3QO3 A;  3V8J A;  3FDR A;  3G4S A;  4PK4 A;  4XU1 A;  1OOT A;  3EHR A;  5GAM j;  1M9S A;  2A08 A;  2JUF A;  4E7H A;  2AHJ B;  2ED0 A;  4F04 B;  3PE0 A;  2NUP A;  2QXF A;  2I0N A;  1VYT A;  3L2R A;  3SWN B;  2GFU A;  2IVW A;  1VA7 A;  2KK4 A;  3OS2 A;  1IHW A;  2V8K A;  4HVW A;  1OPL A;  1RLQ C;  1D1A A;  2YWW A;  2GGR A;  3OYI A;  1KK7 A;  4ZTJ A;  1X6G A;  2P0P A;  2KXC A;  1N27 A;  4E7L A;  2HZY A;  2D0Q B;  2ROT A;  1AZG B;  3EFS A;  3A8H B;  4M7D F;  2PTK A;  1BBZ A;  1YJN Q;  2NUT A;  4LN2 A;  1HYO A;  2HKQ B;  1BI0 A;  1UGR B;  2V1Q A;  1BI1 A;  4KH0 B;  1N6A A;  5GMK m;  2ZAE A;  3RES A;  4OMO A;  1IRE B;  3I35 A;  5FU7 C;  2OTJ Q;  3CCQ T;  1Q82 U;  2L3P A;  1MNE A;  2EQI A;  2KT8 A;  1T0J A;  5LJ3 d;  1ZSG A;  5ECA A;  4LD9 K;  3RUX A;  2DBK A;  5GAN 4;  4MDX A;  4JDS A;  3Q1J A;  2XDB A;  1PG5 B;  2CZ6 B;  2K5F A;  4P5N A;  2DNU A;  5CQX A;  2KRO A;  4E7S A;  1NLO C;  1PNJ A;  2D8J A;  2YXY A;  3A8M B;  3V7R A;  3CCQ Q;  1Q81 C;  2KR3 A;  1YIT A;  1AT1 B;  3EGU A;  1M2O A;  2E1H A;  1M4Z A;  4PJN A;  4FCY A;  4HT9 A;  1FYN A;  3A98 A;  4M77 A;  1Q81 R;  1KD1 U;  1ZLM A;  2V26 A;  2CYZ B;  5L8R E;  1KSW A;  1K4U S;  1AZE A;  4M75 B;  1M3C A;  3WVE B;  2BIV A;  2E65 A;  4HXJ A;  3C12 A;  2A3L A;  1K9M U;  2MWO A;  3PVL A;  2JJ9 A;  3JCM b;  1K9A A;  1KQ1 A;  4E7Z A;  1ZA1 B;  2JS2 A;  4EMH A;  4M7D C;  5LJ3 g;  3I55 T;  3EFO A;  3OYF A;  3NTH A;  3RBB B;  1NPP A;  4DBH A;  2L3Q A;  1A0N B;  4M77 G;  3QHS A;  3QWY A;  5L23 A;  4FYV B;  1I4K 1;  2QK0 A;  1HJD A;  2DL8 A;  3CXC S;  2LCC A;  5EC7 A;  2ECZ A;  5A0G A;  4IUP A;  2RK2 A;  3VRY A;  1SEM A;  3I55 Q;  2CT3 A;  4LXC A;  4MML A;  2J6O A;  1PRM C;  3NFC A;  3QG1 A;  2GQI A;  1O9S A;  1WHK A;  1U1T A;  4Z8A A;  2RF0 A;  2EIF A;  2RH2 A;  3VJP A;  2LC4 A;  3VYG A;  3X28 B;  1GFC A;  2NUZ A;  4LDV A;  3R6O A;  1U3O A;  4QVC A;  2X4J A;  1M1F A;  7AT1 B;  3CCM T;  3JCM V;  4J7F A;  1VIF A;  4IUT A;  5FLX E;  3OA6 A;  2DZ9 A;  1KJW A;  2AIR B;  2OTJ A;  4ZGD B;  2CDT A;  4L59 A;  2XD0 A;  4RTU A;  4M78 E;  3PGG A;  3OYJ A;  2DEQ A;  4MMK A;  1NJI U;  3M58 A;  3JCM J;  2F2W A;  1H8K A;  2K3X A;  4ELZ C;  4XTW A;  3QKJ A;  1GCP A;  1M90 C;  2F69 A;  4J5Y A;  3CCQ A;  5GAN f;  2XID A;  2O9S A;  5I2M A;  1WI7 A;  3VU3 C;  4PJO F;  1SF9 A;  3S6W A;  4XU2 A;  4BE2 A;  1K76 A;  1M90 R;  4M77 D;  1JQQ A;  1YIJ T;  1SHF A;  1Q86 C;  3EFR A;  3EAE A;  1AWJ A;  1X43 A;  4UC4 A;  1VQN T;  2MWP A;  3E9F A;  3DKM A;  2DL4 A;  4XU0 A;  1WIE A;  1VQK Q;  1Q86 R;  3JB9 J;  2DBM A;  2LX7 A;  5EG2 A;  2RHZ A;  1Q7Y C;  1AEY A;  3JCM d;  1PKS A;  2ED1 A;  4WF2 A;  3H9N A;  1YIJ Q;  3SFM A;  4JRP A;  2HKN A;  2JZ2 A;  1BK2 A;  1Q7Y R;  1N8R C;  4JRI A;  3CCJ T;  4LE9 A; 
#chains in the Genus database with same CATH homology
 2Y90 A;  4BY6 B;  2DXT A;  4OF1 A;  3QBY A;  4EMK A;  2MAM A;  3L1A A;  2QEX T;  3SD4 A;  3CME A;  1UGS B;  2OAU A;  3RKX A;  3P8B B;  2CZ7 B;  4M75 C;  4DOW A;  3C95 A;  4F7U A;  5FRO A;  1XQH A;  4GY5 A;  4JS4 A;  2YRV A;  3LGF A;  2DXB A;  5D6X A;  2QA4 A;  3CMA T;  3PNW C;  4C8Q D;  4XQ3 A;  1Q81 U;  2ZPI B;  2QTX A;  3I55 A;  1QP2 A;  2CGH A;  1M5Q 1;  2HD0 A;  5CKD A;  5LJ5 e;  5GAO p;  5HK3 A;  4OGE A;  5GAM e;  5I2S A;  1KQS A;  4PL6 A;  4M77 E;  1VQ8 T;  1KQS S;  2DD5 A;  3MCA B;  4C92 A;  5CIU A;  5D6Y A;  3J80 E;  3BY7 A;  1AHJ B;  3M54 A;  4OB3 B;  5A2Q E;  2JNG A;  1YHQ A;  4BB7 A;  3LW5 E;  2KSS A;  1OI1 A;  4A54 A;  4C0D C;  2G3R A;  5GAN h;  3PT9 A;  3QXE B;  4M78 D;  3HRT A;  4M78 F;  4HCC A;  1IZ6 A;  4QQG A;  4DQ2 A;  1N8R U;  3CC7 T;  4BAC A;  3MEA A;  4C8Q A;  4Y28 E;  5J39 A;  1WJS A;  3LH0 A;  2DTH A;  3JCM g;  3V7C A;  2JN0 A;  1D3B A;  2H3J A;  2DVE A;  2K57 A;  1B34 A;  1BIA A;  1X01 A;  1YCY A;  3LGL A;  3C94 A;  3GNG A;  2X4W A;  4F7U E;  4DA4 A;  5LJ3 e;  2KQW A;  2IG0 A;  5GAN 6;  3G4S T;  3GIB A;  4PJO C;  3QII A;  3MET A;  3QDR B;  2X35 A;  3VV0 A;  4A4F A;  1NPR A;  2ZGW A;  2RA2 A;  4M77 C;  4C5I A;  4EMK B;  2HBP A;  2ZCF B;  1RI0 A;  4KUD K;  3JRZ A;  2O01 E;  4N0A C;  4C92 E;  4C92 G;  2Y4X A;  2M9U A;  3V7S A;  3GPL A;  1VQ7 A;  1JJ2 S;  3G7Z A;  1BYM A;  2M1H A;  1LNX A;  2PQW A;  5C6S A;  1YJN A;  3MP6 A;  4F7U B;  2K5L A;  2DPP B;  2LRQ A;  2XDD A;  4ATO A;  4M7A F;  2DAQ A;  3FLG A;  3J81 E;  1YBY A;  2P0K A;  1P92 A;  3M57 A;  1MHN A;  4ELY C;  1YJW T;  3OYA A;  2OTL T;  5GAO m;  3JCM P;  4C8Q E;  5FRN A;  2D6F A;  1R8O B;  1G3T A;  4QQ6 A;  3JCM e;  2KDS A;  4OVA A;  3OY9 A;  2DXC A;  3FIF A;  4M75 F;  3OSV A;  3CEY A;  4C92 B;  3S3O A;  1VQ9 T;  3E1S A;  5GMK i;  5CKF A;  1VQ9 A;  1BI2 A;  3OYK A;  5LJ5 f;  5GAM f;  4JS5 A;  1XOV A;  5J3B A;  5GAN j;  2HAX A;  4KUL A;  3JB9 F;  1WGS A;  3CCU A;  1U1S A;  3H6Z A;  4NOY A;  1Y96 A;  3PMT A;  3QSU A;  3OBY A;  4C8Q B;  2L8D A;  4FT2 A;  4II1 A;  3OYB A;  3OYE A;  3CCE T;  5AYF A;  3HPW A;  1Q82 C;  1TH7 A;  5HY6 A;  1D3B B;  4L5G A;  4V2S A;  2GCX A;  1HXD A;  3HHT B;  3OYY A;  4ZN1 A;  3HSB A;  3JB9 I;  5IN1 A;  3INZ A;  1WJQ A;  3X25 B;  5KE3 A;  3DB3 A;  1VQ5 A;  5HKC A;  1X75 C;  1M1K C;  4JRK A;  2EQU A;  3FJP A;  3HRS A;  3L2Z A;  4PLL A;  5LJ3 f;  3X24 B;  4RCB A;  5GMK l;  4A4H A;  1QVP A;  1VQK T;  2DXU A;  1VQ6 A;  4OB2 B;  3GLX A;  1BIB A;  1VQK A;  2EQJ A;  3JCM Q;  3VYH B;  5FU7 B;  2EJ9 A;  4ZTF A;  2K4Y A;  3CD6 T;  4DOV A;  3CPW A;  3CCR T;  3CC2 T;  2O4X A;  4QQD A;  3CPW S;  2FB7 A;  4M77 F;  3SB2 A;  1K73 U;  3CCR A;  3QUI A;  4M78 C;  4O5V A;  1VQP T;  4QVZ A;  1YIJ A;  4C0F A;  1VQP A;  2MI6 A;  2KAF A;  1N9R A;  3T9N A;  5GAO q;  3BFM A;  2ZPF B;  2E10 A;  2CKK A;  4VUB A;  2DK3 A;  2FVU A;  4M7D A;  3UT1 A;  1KD1 C;  3ZBD A;  2XI9 A;  4HA8 A;  3JCM f;  3L2V A;  2VC8 A;  5KE2 A;  1KG1 A;  2BUD A;  2A7Y A;  4ME7 A;  3TRE A;  4BI4 A;  3M59 A;  1Y96 B;  5GAN 3;  4BDZ A;  1K8A C;  1WNL A;  1S72 T;  3CCL A;  2BKD N;  1QP3 A;  4IUU A;  1UGP B;  4F7U F;  3QZ5 B;  4C5G A;  2C06 A;  2PU9 B;  1M1K U;  3LLR A;  3PFS A;  3TCJ A;  1M90 U;  3A5Z B;  5GAO n;  3J7A F;  3H8Z A;  4EPC A;  4J6Y A;  1G5V A;  4PKC C;  3N5B B;  1OZ2 A;  4M7A C;  4XAX B;  2DKG A;  2HQX A;  4ZN3 A;  1LOJ A;  1VQL T;  1EIF A;  5A0L A;  5CVI A;  4C92 D;  3LWI A;  2Y4Y A;  2VV5 A;  3RKW A;  2K2V A;  1MGQ A;  3BDL A;  3M53 A;  4X34 A;  3QYG B;  5LL6 S;  3VKI A;  3FC3 A;  5LJ5 h;  3CCJ A;  2QEX A;  3QJ6 A;  5GAM h;  1QVF A;  4XTU A;  3P8D A;  3E9G A;  4OP0 A;  1QVF S;  4M7D E;  1Q86 U;  2HNI A;  4M7D G;  2HQE A;  4X9D A;  2F5K A;  2RM4 A;  2RJC A;  3M5A A;  3CCV T;  4BY6 C;  5GAO r;  1H64 1;  3AHU A;  4C8Q F;  5A0D A;  4QVD A;  2O4X B;  3F70 A;  3FRN A;  3ZFJ A;  3CMA A;  2WSF E;  3CCV A;  2JTF A;  4E7J A;  2EJF A;  3SWN A;  5IT9 E;  1VQL A;  3A8G B;  2XDP A;  2DD4 A;  2RI5 A;  1I8F A;  3DB4 A;  4ZGJ B;  3MEV A;  3OW2 A;  2X4Y A;  4KUI A;  4A4E A;  3OW2 S;  1VQ8 A;  2QDY B;  1K8A U;  4Y91 A;  1Q7Y U;  2LDM A;  2VGN A;  4M7D B;  1VQO T;  4E7I A;  1YJ9 T;  1WJR A;  3S3N A;  4MZT A;  2I2L A;  5GAN 5;  1YJ9 A;  5LJ3 h;  1O75 A;  1BKB A;  1NZ9 A;  3X26 B;  1U8R A;  3CBM A;  3NTI A;  2E6N A;  4KT0 E;  1Y07 A;  4OB1 B;  3OYH A;  3CC7 A;  1KHI A;  2EJG A;  2RB6 A;  4JUV A;  4LDY A;  4RKU E;  4PJO G;  4BE0 A;  4XK8 E;  4FIB A;  2PVO B;  4FSX A;  5CO7 A;  2QQ9 A;  2GFA A;  5FRM A;  3CBP A;  4N4I A;  2QQS A;  2V8I A;  3QO3 A;  3V8J A;  3FDR A;  4XTZ A;  3G4S A;  1ZBX A;  4XU1 A;  4O6J A;  3DLL A;  3JCM W;  2RK1 A;  5LJ5 j;  4YTL A;  5GAM j;  2FYK A;  3LWH A;  1M9S A;  3HP9 A;  3HKS A;  2JUF A;  4R55 A;  3JCM h;  3X20 B;  4OGC A;  1VUB A;  2AHJ B;  4E7H A;  4A53 A;  1JJ2 A;  1JRI A;  4JJN K;  5DLQ E;  5M9O A;  2QXF A;  1NE8 A;  2KVQ G;  3P8H A;  2X4X A;  4EMK C;  4A4K A;  2JTM A;  1JBM A;  3PMI A;  3SDZ A;  3L2R A;  3SWN B;  4L6V 5;  2GFU A;  2IVW A;  2EKO A;  4LDU A;  1Y71 A;  4N4G A;  4RMO A;  1YJW A;  3UPU A;  2OTL A;  3MP8 A;  4OB0 B;  2E12 A;  2LNV A;  3QZ9 B;  2DTI A;  5J26 A;  4BD3 A;  1M8V A;  2KK4 A;  3OS2 A;  4A4G A;  2XHC A;  2V8K A;  3GP8 A;  1SSF A;  5LJ3 j;  3V8L A;  3HFO A;  1OZ3 A;  4BUG A;  2LT1 A;  3RMS A;  2JOY A;  3OYI A;  4J8O A;  4KBM B;  3ZEH A;  4BDY A;  3I56 T;  3HFN A;  5CKB A;  3CBO A;  4C92 C;  3KUF A;  3OMC A;  4ZTJ A;  3RER A;  4E47 A;  3CCE A;  2V8J A;  3M4Y A;  5IAY A;  1B34 B;  2P0P A;  1N27 A;  4E7L A;  3KBG A;  2E6Z A;  2D0Q B;  2XK0 A;  5DY9 A;  2M0O A;  1X6O A;  3KXT A;  4C8Q C;  1XNI A;  3CCS T;  3EFS A;  3NTK A;  3G71 T;  4HCB A;  3A8H B;  4M7D D;  5GAN 2;  4M7D F;  1WQ7 A;  1KC8 C;  1DJ7 B;  5FU6 B;  2EWN A;  2RHU A;  2ZZD A;  1LJO A;  4BI8 B;  1I5L A;  4XU3 A;  1BI0 A;  1UGR B;  4JLG A;  3L2Q A;  1BI1 A;  5GAM d;  2P0Q A;  3BW1 A;  4B9X A;  3CD6 A;  1N6A A;  3QYH B;  2VXE A;  1W4S A;  4MZP A;  4XTX A;  5GMK m;  3CC2 A;  1N9S A;  4M75 A;  2R5A A;  4BE1 A;  3RES A;  2QQA A;  1IRE B;  2RHY A;  4D6W A;  3BDU A;  5FU7 C;  3OS0 A;  3OYM A;  3OS5 A;  5GMK e;  2MF2 A;  3CCQ T;  3MEW A;  3L2W A;  1Q82 U;  2ZPB B;  3UWN A;  3QJY A;  5DM7 R;  4LDW A;  1G3Y A;  4PJO D;  4HT8 A;  2VUB A;  4MDW A;  4X9C A;  3JB9 H;  2K5I A;  2QI2 A;  5LJ3 d;  1S72 A;  4CI0 C;  5GAN d;  1K9M C;  4LD9 K;  2E5Q A;  1KC8 U;  3RUX A;  5HK0 A;  3MP1 A;  5GAN 4;  4MDX A;  3OB9 A;  3Q1J A;  4JDS A;  4Q5W A;  4B9W A;  2CZ6 B;  2XDB A;  1GXI E;  2RI2 A;  2K5F A;  2L89 A;  4P5N A;  2LQ8 A;  5CQX A;  4C92 F;  4M75 E;  3V7R A;  4M75 G;  2XKO C;  3A8M B;  1Q81 C;  4C0G A;  3WVD B;  4GLK A;  3OBW A;  1YIT A;  2LT4 A;  4RCC A;  4PJO A;  2E1H A;  4EDU A;  1M4Z A;  1WPY A;  2EQM A;  2PUO B;  3CPF A;  4HT9 A;  5D6W A;  3JB9 G;  2L5Q A;  2R58 A;  4M77 A;  5CAI A;  4IUQ A;  5GAM g;  1KD1 U;  2B8A A;  1M1G A;  3WXM B;  2CYZ B;  5L8R E;  4N0A A;  3G6E T;  5CR2 A;  4CRI A;  4XTV A;  4M75 B;  1VQM T;  2JVV A;  1RL2 A;  2RD1 A;  3WVE B;  2BIV A;  2RJF A;  2QQB A;  2LQK A;  3C4S A;  3M56 A;  2E65 A;  3CME T;  1QVG S;  2GQV A;  2ZPE B;  3C12 A;  2A3L A;  4HCZ A;  1K9M U;  2MWO A;  3HRU A;  2RHI A;  4RG2 A;  3RIR A;  1VQO A;  2FL7 A;  4PNO A;  2CS7 A;  3OSS C;  3JCM b;  2P4T A;  2K3Y A;  1KQ1 A;  2QA4 T;  1QW1 A;  3JAM E;  3M4G A;  4EMH A;  1I81 A;  4M7D C;  2PVD B;  2ZPG B;  4ZGE B;  5LJ3 g;  3PIO A;  3UDC A;  5GAN g;  3OYF A;  3I55 T;  3NTH A;  4PJO E;  1NPP A;  5CQY A;  4C0D B;  4EMG A;  3MHX A;  4M77 G;  3QHS A;  2PVG B;  1I4K 1;  1YHQ T;  1UB4 A;  3OMG A;  3JCM c;  4J7I A;  3MEU A;  3CXC A;  4E7K A;  1UGQ B;  3L2U A;  3CXC S;  1ZHI A;  4HKE A;  2LX9 A;  2LCC A;  4PJO B;  2FHD A;  5A0G A;  4IUP A;  5C0M A;  3A8L B;  2RK2 A;  3GOX A;  4J6W A;  3VUB A;  3JCM X;  4C0Z A;  2LTO A;  3GNF B;  4M77 B;  4MML A;  2KMT A;  5I21 A;  3DLM A;  3FB9 A;  2XG8 D;  3MO8 A;  4F7U G;  3OYG A;  3NFC A;  3QG1 A;  2MMP A;  1G3W A;  5GAN e;  2YLC A;  3GF5 A;  1O9S A;  1FX7 A;  2R57 A;  2DIG A;  2YLB A;  1U1T A;  4QW2 A;  5CKE A;  2E41 A;  2EIF A;  2EQK A;  2RH2 A;  1NJI C;  1YI2 T;  3VJP A;  2LC4 A;  3PTA A;  3ASK A;  4M78 A;  3SWN C;  3VYG A;  3X28 B;  2LVM A;  5GAO l;  1YI2 A;  1VQ7 T;  1YJN T;  4LDV A;  4BI3 A;  3V8K A;  3R6O A;  4QVC A;  2X4J A;  1WQW A;  1M1F A;  3VUZ A;  4M7A D;  3CCM T;  2R5M A;  3JCM V;  4J7F A;  5KH6 A;  3I56 A;  1VIF A;  3JSC A;  4OMF B;  3TEE A;  4IUR A;  5CK9 A;  3CCM A;  2NLU A;  2VYT A;  2ZPH B;  1VQ4 T;  4IUT A;  3OYC A;  1YIT T;  2DO3 A;  3O8V A;  4C8Q G;  1VQ4 A;  2M16 A;  5FLX E;  5KCH A;  4J6X A;  3URG A;  4M75 D;  1W2B A;  2VXF A;  3OA6 A;  1Y7X A;  2DZ9 A;  1W2B S;  2WSE E;  4MZM A;  2OTJ T;  3LYI A;  4C5H A;  2CZ0 B;  3CCS A;  3CCU T;  1HK9 A;  3RMQ A;  2RJE A;  3G71 A;  4ZGD B;  1ZQ1 A;  3JB9 D;  1K73 C;  2OTJ A;  2DIQ A;  5GAN 7;  2XIC A;  3CC4 T;  4L59 A;  4RG8 A;  4XTY A;  2XD0 A;  4M7A A;  2KY9 A;  1PSF A;  3CC4 A;  3ME9 A;  5GMK h;  4LDX A;  3HL8 A;  3PGG A;  4M78 E;  5LJ5 d;  4M78 G;  3OYL A;  1G3S A;  2DEQ A;  3OYJ A;  4MMK A;  1VIE A;  3M55 A;  3RKY A;  4TVR A;  1NJI U;  1H3Z A;  3M58 A;  3JCM J;  4Z02 A;  2EFI A;  4IUV A;  5FU6 C;  2K3X A;  3QPH A;  4ELZ C;  3OYD A;  1VQ5 T;  1KQ2 A;  1XTD A;  4XTW A;  1JB0 E;  2EYQ A;  3L42 A;  4N4H A;  3QKJ A;  4J83 A;  1VQ6 T;  4PLI A;  1M90 C;  2F69 A;  3OS1 A;  4J5Y A;  2QQR A;  4M78 B;  2E64 A;  4NL2 A;  2XID A;  4C5E A;  5GAN f;  3CCQ A;  5I2M A;  2RO0 A;  3VU3 C;  3ER0 A;  4JLI A;  3OQ5 A;  4PJO F;  3S6W A;  1BI3 A;  2RHX A;  4XU2 A;  4BE2 A;  2E70 A;  1FXX A;  1UEB A;  2EAY A;  4M77 D;  1FWZ A;  4M7A E;  4M7A G;  1YIJ T;  3M9Q A;  5GAN 8;  1Q86 C;  3OYN A;  3EFR A;  5KCO A;  4JRQ A;  3EAE A;  2WSC E;  4FM4 B;  4FT4 A;  3LX7 A;  4NL3 A;  4R56 A;  4UC4 A;  1VQN T;  2L3R A;  2MWP A;  2DZC A;  3E9F A;  3DKM A;  1VQN A;  3S3M A;  2XU8 A;  4IKF A;  4FL6 A;  4XU0 A;  2RJD A;  5CCA A;  3PIP A;  3JB9 J;  1V29 B;  4LD6 A;  4NS5 A;  1PSE A;  5CKH A;  5GMK j;  3CCL T;  4M7A B;  2WAC A;  2PUK B;  5EG2 A;  2RHZ A;  1Q7Y C;  5LJ5 g;  2YHT A;  3FEO A;  3JCM d;  2D9T A;  2DTO A;  3TU4 K;  4WF2 A;  2DJZ A;  3A8O B;  3SFM A;  4FU6 A;  4JRP A;  2RI3 A;  2JZ2 A;  1OYX A;  2F5T X;  1KHC A;  3E19 A;  2CZ1 B;  5DLO A;  3G6E A;  2GF7 A;  1VQM A;  2VGM A;  1N8R C;  4JRI A;  1QVG A;  2LCL A;  3CCJ T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...