2BZXA

Atomic model of crkl-sh3c monomer
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
60
structure length
60
Chain Sequence
b'PVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRK-LIKE PROTEIN
publication title The C-Terminal SH3 Domain of Crkl as a Dynamic Dimerization Module Transiently Exposing a Nuclear Export Signal.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sh3 domain
total genus 7
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2005-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2bzxA00
3I5SA 2DBKA 1OPLA 2YDLA 3NPFA 3FJ5A 3EHQA 2DJQA 2J6OA 5ECAA 1GCQA 1NEBA 5IH2A 4OMMA 4RUGA 2HBWA 2ABLA 2LP5A 2RPNA 1WDXA 4HXJA 3UA6A 1U5SA 5EC7A 5FWCA 2CT4A 2J05A 2ESWA 2X3WD 4ESRA 2HCKA 2HSPA 2FRYA 2DL3A 4ZNXA 2SEMA 2AKLA 1RLPC 4RTWA 1EFNA 2K2MA 1NYGA 1YNZA 1KJWA 1MUZA 4RTTA 1KFZA 2RQWA 4D8KA 3NMZC 2KT1A 2H8HA 1RI9A 1T3SA 3EG1A 3SEMA 1AWJA 1GCQC 3I5RA 2AKKA 5GJWB 2C0IA 2PTKA 4OMLA 4AFUC 2O31A 1JEGA 1Y0MA 2CUDA 1T3LA 1ABOA 2F2VA 1H3HA 4J9HA 1SEMA 1MV0B 1VA7A 1NLPC 3PE0A 1H8KA 4K11A 2ED1A 1JU5C 5HCKA 1AWWA 2OAWA 2CSIA 2NUZA 3GBQA 2RNAA 2OJ2A 1TUDA 2RQRA 2JT4A 2O9VA 3I35A 1GL5A 2C0OA 5IXFA 3H41A 4AFZC 2J06A 3REBB 4F14A 2J6KA 2K79A 2RQTA 2KYMA 1W6XA 2PNIA 4F16A 3TSWA 2K7AA 3VS7A 4AFSC 1YN8A 1ZBJA 2RQVA 4AG2C 2GTJA 4CC2A 2YUNA 2JM9A 2DA9A 4CC4B 5IXBA 2G6FX 1AZGB 1VYTA 1HJDA 2X3XD 1UJYA 2EYWA 4J9GA 3VS4A 2DL4A 3JV3A 1SRMA 2KT8A 1V1CA 2DL8A 2HEQA 1K0XA 1SHGA 1ZX6A 2LQWA 3H0IA 1H92A 2O9SA 1WLPB 3A98A 3EG2A 2DBMA 2K3BA 1JO8A 2D1XA 1M30A 1QLYA 4Z88A 5FW9A 1UG1A 1X6BA 2GQIA 2BTTA 1WXBA 2J6FA 3SHWA 2LNHB 4E6RA 1K4US 1ZUYA 1GBQA 4OMOA 2DL5A 4JZ4A 2DX1A 4OMNA 1CKAA 1U3OA 1T0JA 2KROA 4OMPA 2PZ1A 3KFVA 4KRTA 1AWOA 3CQTA 1RUWA 2CT3A 2FRWA 1Y57A 2A28A 1UECA 2LJ3A 2AZVA 4J9CA 2DF6A 2EYYA 4RTUA 4FSSA 4X1VA 3TSZA 5IHKA 3H0FA 4RTZA 1OEBA 1LCKA 2JMCA 2EGAA 2LCSA 4QT7A 2JMAA 2L3PA 2YUPA 4A63B 4J9BA 1E6GA 1I07A 2CSQA 2ROLA 4M4ZA 1WFWA 1NM7A 1UTIA 1X6GA 1T0HA 2JS0A 4RTVA 3M0RA 2GNCA 3UATA 1VYUA 2BZXA 1E7OA 1QWFA 2EGCA 4F17A 2O88A 1BU1A 4GBQA 4J9EA 1JXOA 4EIKA 2GTOA 1UFFA 1JXMA 4DEYA 2EQIA 4J9DA 3NGPA 1S1NA 2JXBA 3ZL7C 2DL7A 2CH4W 3VS0A 1UDLA 1UJ0A 2MOXA 2KR3A 1M3AA 1N5ZA 1I1JA 2KXDA 1M27C 1M8MA 3THKA 2W10A 1Z9ZA 1XOVA 2E5KA 1YWPA 3R6NA 2W0ZA 3M0PA 2YT6A 3EGUA 1G83A 2RQUA 1QKWA 2CREA 4HVUA 1WA7A 3H0HA 2KRSA 3RBBB 2KXCA 4LN2A 4HVWA 2NWMA 2DYBA 2YUQA 1GBRA 1QKXA 1A0NB 1G2BA 1WI7A 1WXTA 1CSKA 1BBZA 2KEAA 2EYXA 1Z9QA 2QDLA 3VRYA 4ORZA 2SRCA 4RTXA 1K1ZA 5IHNA 1IO6A 5I22A 1YP5A 3EHRA 1BB9A 4J9FA 1WYXA 2FPEA 1K0SA 3VS3A 2C0TA 1X43A 1NYFA 1TUCA 1ABQA 4OMQA 2EYZA 2EVRA 4RTYA 2V1QA 1M3BA 4Z89A 3UA7A 1AZEA 1SHFA 4IIMA 1KSWA 2GGRA 3VS5A 1YCSB 4LUDA 2EBPA 3PVQA 1K76A 2ED0A 3QWYA 4AFQC 1E6HA 2DLPA 4JJBA 1OV3A 2LX7A 1X2QA 2O2OA 3TVTA 1U06A 1X2KA 4JPBW 1RLQC 2AZSA 1KIKA 1FYNA 1WX6A 2RN8A 1X27A 1PKTA 2LZ6B 2P4RA 3REAB 1WXUA 4CC3A 2LMJA 2KGTA 1SRLA 1OOTA 2M51A 3I9QA 1OPKA 1JQQA 2A08A 2MCNA 2AK5A 2A36A 2JS2A 2FEIA 2FG0A 2FPFA 2JM8A 1MV3A 2FO0A 2RMOA 1HSQA 1AD5A 2JTEA 3IQLA 4WCIA 2BZYA 5IHIA 2K9GA 2D0NA 3EG3A 2F2XA 3VRZA 2L3SA 1HD3A 4D8DA 4JZ3A 2GBQA 3O5ZA 1GRIA 2IIMA 2OI3A 1NLOC 1ZUUA 2EKHA 1W70A 1SPKA 1W1FA 2JW4A 2L0AA 2D8JA 2DVJA 4GLMA 2EPDA 2EW3A 3M0QA 1B07A 4HCKA 3VS1A 1TG0A 2LJ1A 4R0KA 1ARKA 1GFDA 1AOJA 1PNJA 2DILA 1PKSA 1PRMC 1PRLC 2YUOA 3M0SA 3RNJA 2L3QA 1SSHA 2XMFA 4JJDA 2V1RA 2ROTA 2KRNA 2KRMA 1J3TA 5I11A 2FPDA 5GJVB 2MIOA 2L2PA 2DM1A 1UE9A 1FMKA 4LUEA 1NG2A 3VS6A 1BK2A 2I0NA 2RF0A 2DMOA 2J7IA 4LNPA 4CC7A 1UHCA 2ENMA 2ECZA 1AWXA 2CH4A 2KYBA 3EG0A 4AG1C 2VVKA 4Y92A 3C0CA 2D8HA 2LJ0A 1ZSGA 1WIEA 2VWFA 4HVVA 1PHTA 3ULRB 1CKBA 2DE0X 3M0UA 3UF4A 2HDAA 2DRMA 2F2WA 1ZUKA 1UHFA 3NHNA 1M3CA 1YWOA 1PWTA 3QWXX 3VS2A 2K6DA 1VYVA 5L23A 2CDTA 3M0TA 2A37A 2M0YA 2DRKA 1QCFA 1GFCA 1K9AA 2YSQA 3U23A 2KE9A 1ZLMA 2B86A 1QWEA 4JJCA 2BZ8A 1I0CA 2KBTA 1AVZC 4LE9A 2VKNA 2EGEA 4Z8AA 2DNUA 2CUBA 1AEYA 1X69A 3PVLA 1NEGA 4IIOA 1UGVA 1B3QA 3LH5A 5FWBA 4DEXA 2LQNA 4J9IA 1GCPA 2KNBB 1UUEA
chains in the Genus database with same CATH superfamily
2DBKA 4PJOD 3CPWP 3EHQA 2DJQA 1GCQA 4HCCA 1VQPA 4X9DA 5EC7A 2EQMA 2CT4A 1ZSZA 2ESWA 4ESRA 2LCLA 2DL3A 3A8OB 3CC2A 4ZNXA 3N5BB 4PFOA 1YI2A 5IN1A 4C92C 3VKIA 1NYGA 1YNZA 4RTTA 5I2SA 3JB9G 3T9NA 4BB7A 2H8HA 2DO3A 2R5AA 2XI9A 5CQYA 1NPRA 5GAOq 1M1GA 5GJWB 3MO8A 1O9SA 1JEGA 1U8RA 1Y0MA 1WQWA 5AT1B 2CUDA 3OS5A 4A4KA 4BE0A 1VA7A 1NLPC 2LCCA 1H8KA 2RH2A 4K11A 3LW5E 2V26A 2L5QA 2DYIA 2NUZA 4XTXA 4XU0A 1PSEA 1XJWB 2JT4A 3CCJT 4AFZC 3EFOB 4J5YA 2FZKB 4A4FA 4F16A 1GXIE 3TSWA 2K7AA 4DA4A 4AFSC 3SDZA 3G71T 4B6MA 1SSFA 4C8QA 2QA4T 1WJRA 5LJ5g 4MDXA 2JM9A 1RACB 4ATOA 2G6FX 2WSCE 1K8AC 1VYTA 3QDRB 1HJDA 2RHUA 3S6WA 2X3XD 2D6FA 2E12A 3JV3A 3CC2Q 4OP0A 5CAIA 4E7SA 2LQWA 1C0MA 2PUKB 3EG2A 5GAOp 2DBMA 1JO8A 2HAXA 4Z88A 1UG1A 1RADB 5GAN3 1X6BA 4UC4A 4PJOE 1M90C 4C92G 3GF5A 4L59A 3PFSA 3FIFA 3CCSA 1WXBA 4ZN3A 4OB0B 2RO0A 1G3WA 1GBQA 4OMOA 4BE2A 4E2FB 4C92B 5CIUA 3PMTA 1TTHB 3V7SA 4LD6A 2KROA 4OMPA 5GMKm 1VQ5A 3RDVA 2EIFA 2FRWA 4ZTFA 2PUOB 3GOXA 1VQ6A 4J9CA 3SFMA 4RTZA 1OEBA 3NTKA 3NFCA 4BDZA 1S72Q 2LCSA 4QT7A 5I21A 5GANh 2JMAA 1BIAA 2JNGA 3GLXA 3FJPA 3CCQQ 2KY9A 3CXCP 3TREA 3QYHB 1NM7A 1UTIA 1WZOA 2B8AA 3M55A 4NS5A 3CCRA 1VYUA 2BZXA 1G3TA 2DETA 3UPUA 4FL6A 2DKGA 4DBRA 3G6ET 3CCSQ 1Q81R 3CD6T 4J9EA 3CMAQ 1VQLT 1UFFA 4QQDA 5FU6C 1I5LA 2EQIA 2F1LA 3NGPA 3OYHA 1VQ8Q 1UDLA 4M75F 1M3AA 2QDYB 4LD9K 3C12A 1M1FA 1VQKT 1I1JA 4M7AD 1VQ5Q 1M2VA 1KQSS 1EZZB 1QVGP 1O75A 5GAOl 1JRIA 4A4HA 1QKWA 4OB2B 2HL3A 2LT1A 2NWMA 4Q5WA 3OYDA 1VQMA 2RD1A 1W2BS 4QQGA 1WXTA 2RK2A 1OZ3A 2PVGB 2KEAA 2EYXA 2DIQA 2HQHA 1H641 5IHNA 4KH1B 4B9XA 5I22A 1MMAA 2DAQA 4LDVA 3CCRQ 1N9RA 4IUTA 2FPEA 1K0SA 5D6XA 2C0TA 1KC8C 4KBMB 1WJSA 1V76A 2QTVA 4OMQA 4MZMA 1M3BA 2HL5C 1VQ9Q 3C4SA 3UA7A 5C6SA 1Y07A 4FM4B 2GGRA 3PVQA 3GNGA 4RG8A 2M02A 4D6WA 4PJOA 1E6HA 2DLPA 2OAUA 4JJBA 1OV3A 2LX7A 3M4GA 5GMKh 4OGCA 2O2OA 2HNIA 3DLLA 2HQEA 2K4YA 1KIKA 4F04B 4NL2A 4XAXB 5GANg 4A4GA 4JUVA 1X27A 4KT0E 2ZPEB 5GAMg 2E65A 4R55A 1NJIR 4IUUA 4M7AG 3OYKA 1QVFS 1SRLA 4E7HA 4OF1A 4QW2A 2IVWA 4BUGA 2A36A 2DERA 2FEIA 4XU3A 1LJOA 1HSQA 1K73C 4LDUA 2VB6A 1JJ2A 2BZYA 2YXYA 1YHQT 2QTXA 4EPCA 4WTOB 2D0NA 1Q82U 3CCEA 3OYEA 1RAIB 1X75C 3I55A 2MWPA 2VYTA 3L2QA 3LGFA 4D8DA 2JOYA 3J81E 2GBQA 2MI6A 1WHHA 4KGZB 2OI3A 3M58A 1ZUUA 2NUTB 3S3NA 2EKHA 3JCMV 3HSBA 4JLGA 1G3SA 1SPKA 1W1FA 2JW4A 2XDDA 4JRQA 3TU4K 1M1KR 2D8JA 3CCUQ 3QSUA 1PC0A 4M75C 2OTJT 1G3YA 2EPDA 2EW3A 3M0QA 3OBWA 1ZHIA 1VQ4T 2XDBA 4HCKA 4II1A 3GIBA 1ARKA 4YTLA 2VC8A 2JZ2A 1PRMC 1PRLC 3G71Q 5GAMf 5CK9A 2A0FB 2F69A 4PJJA 5HY6A 1B34B 3CC7T 2FPDA 5CKBA 5GJVB 4M7DF 3ER0A 3JB9H 2V8JA 1NG2A 1VQNT 1EIFA 1UHCA 2ENMA 2XU8A 2ECZA 4C5EA 2DZCA 3AHUA 2EKOA 1VQOT 3I55Q 3EG0A 2R58A 2YHTA 2X4WA 2COWA 4HVVA 1ZSGA 4M77E 2QEXQ 1WJQA 2DE0X 2O4XB 1K9MR 2DRMA 1ZUKA 2M9UA 2DXUA 3CCMA 1Q7YU 1JJ2P 4FU6A 4OGEA 1R77A 3QWXX 3OYGA 3Q1JA 1ZQ1A 2A37A 5HK0A 1C6VX 4BI8B 1QCFA 4M75G 1VQPT 3H6ZA 2YSQA 1VUBA 1YITQ 2KE9A 3ZFJA 2XD0A 1AVZC 2VKNA 3JB9J 2FZCB 1AEYA 4M75B 4ZTJA 4A54A 1QQJA 1UGVA 3JRZA 1YI2T 5FWBA 2LT4A 3V7RA 1G8XA 3EG9A 4J9IA 1GCPA 1RAGB 3PTAA 5GMKe 2E4HA 2M0OA 5CKEA 5GAOm 1IB8A 2GFAA 3FJ5A 2AHJB 2LQKA 3QKJA 5ECAA 5LJ3j 4M78D 3WVEB 2HBWA 5KYYA 2BE7D 2QQBA 1YJNA 4HXJA 2DIGA 3CCVQ 2GCXA 3UA6A 1U5SA 1YJ9T 1BI1A 2JN0A 3QBYA 3RKWA 5GAN5 2VASA 3JCMQ 3I56A 2SEMA 3CMEA 3CCMQ 2OTLT 2HKNA 1KJWA 4M7AA 3RKYA 1KFZA 3CC4T 4D8KA 5LJ3g 3NMZC 2K57A 2EQJA 1T3SA 5CKDA 9ATCB 5GMKl 3GNFB 1PSFA 4EDUA 2AKKA 3KXTA 2C0IA 2PTKA 4AFUC 3OYNA 2F2VA 1MV0B 2ZPFB 2EWNA 3CPFA 5HCKA 4C8QE 4LDXA 2FB7A 4M7DD 2OJ2A 2CP3A 3G4SQ 2C0OA 3BE3A 2J06A 2J6KA 4RMOA 4J7IA 2RQTA 3URGA 2O01E 3SD4A 3V8KA 2H3EB 3MEAA 3VS7A 5GAOr 5D6WA 2RK1A 2GTJA 1XQHA 1ZA1B 2DA9A 2L89A 1WQ7A 3VS4A 5CR2A 2KT8A 3OYBA 2JUFA 4F7UF 3TQ7P 4M78G 5LJ3f 1YIJQ 1K0XA 2JVVA 1SHGA 3QHSA 1YBYA 1WLPB 3A98A 2D1XA 1VIEA 1LNXA 1VQ6T 2CP0A 4N4HA 2GQIA 4XTYA 4M77A 3OYMA 2BTTA 1D3BA 2K5FA 2J6FA 4ME7A 3SHWA 3OMCA 2QQSA 2DL5A 2JTFA 3C94A 1MMDA 4JZ4A 3X24B 5I2MA 3MEWA 2QQ9A 2EJGA 2PZ1A 2KDSA 3KFVA 3META 3OYCA 1IREB 2X4JA 3CQTA 3SB2A 1UECA 3E1SA 5M9OA 1HYOA 2LJ3A 2CP5A 2EYYA 4M7DG 2KSSA 4FSSA 1MMNA 5IHKA 2E6ZA 1LCKA 2JMCA 2AT1B 4A53A 1ACMB 1Q86U 2YRCA 4M7DB 3A8HB 3JCMc 2L3PA 4J9BA 4C92D 4PJOC 2GQVA 2CSQA 4MMLA 1OULA 4GLKA 1FX7A 6AT1B 1X6GA 3E9FA 4RTVA 3UATA 1QWFA 2DFUA 2O88A 3MP8A 3CCLQ 4KH0B 3L1AA 1C1AA 4VUBA 3UWNA 1WHLA 1VQMT 1Q81C 3OYAA 4J9DA 1S1NA 5KYWA 4JS4A 2JXBA 5KE2A 2XG8D 4KGVB 4NOYA 3AT1B 5LJ5j 3NTIA 2KR3A 1P92A 1HK9A 3JCMW 1M27C 3E9GA 3THKA 3BY7A 3PMIA 1UGPB 4J6XA 3EGDB 2VUBA 3L2RA 3M0PA 2E1HA 3RR6A 2RQUA 3CXCA 3A5ZB 3HRSA 4HVUA 3QDFA 3H0HA 2KXCA 2VV5A 4LN2A 1KHIA 4BI3A 1S72A 1GBRA 1QKXA 4MDWA 1Y7XA 1QCNA 1Z9QA 3LWHA 3CCQA 4ORZA 7AT1B 3V7CA 1X6OA 3MP6A 2FVUA 3VYGA 2KK4A 4JRIA 5GAN8 5CVIA 1ZA2B 2HSEB 1NE8A 3E19A 3VU3C 2IPOB 1X43A 1TUCA 3JCMd 2EYZA 3A8LB 3CMAA 2V1QA 2DTOA 2EFIA 1G5VA 1SKUB 1QVGA 4XQ3A 4IIMA 3OA6A 3M5AA 1YCSB 4PFPA 1VQ8A 3QWYA 1QP2A 4MMKA 5AYFA 4FT2A 3CBMA 4LDWA 3EFRA 4FYVB 2PVDB 3L2ZA 1X2QA 2HQXA 3CCET 1X2KA 4M78A 2WSFE 1BI2A 5LJ5f 5GAN2 4FW2A 1U1TA 4E7KA 3REAB 1WXUA 1MHNA 4QVCA 1Q82R 4BI4A 1NJIC 2LNVA 4HCZA 2YRVA 3PT9A 1JQQA 2MCNA 3LWIA 2AK5A 2NUPB 2FG0A 3CC4Q 3FLGA 2RMOA 4JRPA 2JTEA 1AD5A 2EAYA 4F7UG 3DKMA 3QUIA 3X26B 3L2UA 2F2XA 3VRZA 1HD3A 3QIIA 1OYXA 4F7UB 1VQ9A 4L5GA 1BIBA 2MMPA 1KQSA 1M1KC 3LYIA 1BCMA 1YJWQ 1TG0A 5DLQE 1R0BG 1PNJA 2G3RA 4HT9A 1WNLA 3OYFA 3M0SA 4FT4A 1TSFA 3SWNC 3RNJA 4JJNK 2CZ7B 1W2BA 1MNDA 2ROTA 1UGRB 3KUFA 3G1JA 2L2PA 2MF2A 4JRKA 2DM1A 4LUEA 3VS6A 2I0NA 2QI2A 3EAEA 2DMOA 2DXCA 1Q7YR 1OX9A 4MZTA 3OS0A 3OSSC 4XTZA 1XNIA 3EFOA 4Y28E 3VYHB 2KYBA 1VQ7T 2GFUA 2VVKA 3RIRA 2DK3A 2PU9B 3C0CA 3HP9A 3HRTA 2WSEE 4XTVA 1PD1A 2HDAA 5FRMA 2F2WA 5GMKi 3L42A 5GANj 1K9MC 5CCAA 4N0AA 1M3CA 3QXEB 5GAMj 1Q95G 3CCUA 1PWTA 4RCBA 2X35A 1N8RU 2K6DA 5CO7A 2FHDA 3M0TA 1AT1B 2K5LA 1BCOA 1GFCA 3KBGA 4AMCA 3G71A 1YJNT 1QVFA 4C8QF 4JJCA 2KBTA 4LE9A 2EQKA 4Z8AA 5FU6B 1KQSP 3MJXA 2CUBA 2P0QA 4OB1B 3I56T 1RABB 4EMKC 1X69A 1D09B 4IIOA 3CMET 1YFNA 1B3QA 2LQNA 4C92A 1NBEB 4C5HA 4E7ZA 1TXQA 3I5SA 5KYYB 3SWNB 1OPLA 1KD1U 3NPFA 3MP1A 1W2BP 2J6OA 4M77C 4M7AE 1NEBA 1WHGA 5IH2A 4OMMA 4PK4A 4RUGA 2ABLA 2QYZA 2RPNA 1WDXA 2RHXA 5FWCA 2J05A 4KUDK 2X3WD 5A0LA 2QEXA 2HSPA 2FRYA 4QKUA 2NYSA 3OBYA 2AKLA 2KAFA 2RJDA 4BE1A 1Y96B 4FSXA 2K2MA 4M75D 3JCMh 1H3ZA 1I5OB 3CCJQ 1QW1A 1RI9A 2FZGB 3EG1A 3SEMA 3GP8A 5GANf 1GCQC 3I5RA 2O31A 1YITA 1TU0B 2QA4Q 1OZ2A 5KYXB 1SEMA 1ZSZC 4X34A 3INZA 4HKEA 3ZBDA 1TUDA 2RQRA 3S3MA 4PL6A 3I35A 5J39A 1GL5A 1QVFP 2LVMA 4F14A 3REBB 2K79A 4C0DC 4FYWB 2PVOB 2CGHA 3RUXA 1YN8A 4EMKB 2YUNA 2WACA 3HTRA 5IXBA 3CCVA 5CQXA 1AZGB 2DPPB 3EGXB 4QQ6A 5KE3A 1UJYA 3MCAB 4J9GA 1SRMA 3M54A 1V1CA 1QMCA 3OW2S 1IGUA 1D3BB 2K3BA 1M30A 4N4GA 1K8AU 2DTHA 2VGNA 2DTIA 1YCYA 4RKUE 4C8QC 1WPYA 1FMVA 4DOVA 3JB9F 1K4US 3LX7A 2DZ9A 2A7YA 5KYUB 2LRQA 3DLMA 2QQAA 2DX1A 3CC2T 3J7AF 2XICA 2E5QA 2CZ1B 1U3OA 1M90U 3HL8A 5CKHA 5KCOA 2L8DA 1Q86R 2E10A 3OS1A 3A8GB 3JCMX 3G4SA 2CT3A 5L8RE 2M1HA 3JAME 2RI2A 2DJZA 2AZVA 1M9SA 1UGSB 4RTUA 1ZSZB 3TSZA 1M5Q1 3OYLA 4ZGEB 3G6EQ 4E7LA 3CD6Q 2NLUA 1RI0A 3E2UA 1VQLQ 1D1CA 3VUZA 3BW1A 1BI3A 2F5KA 4A63B 5GAN7 1E6GA 2OX7A 1YIJA 1VQKQ 1IHVA 4PJOF 2CP6A 1UB4A 2ROLA 4M4ZA 2QGGA 1X01A 1T0HA 2JS0A 2QQRA 4IURA 3S3OA 3DB3A 1E7OA 2EGCA 2LTOA 3WVDB 4F17A 3EFSA 1BU1A 4IUVA 4N4IA 3JCMP 4EIKA 1RAEB 3BFMA 1S72T 4DEYA 3JCMe 2DEQA 3CCQT 3VS0A 2YWWA 4HA8A 2MOXA 2NUTA 2CS7A 1N5ZA 2COZA 2E64A 4XK8E 2CZ6B 1M8MA 2W10A 4C8QB 2YLCA 1Z9ZA 1XOVA 2W0ZA 2YT6A 2BIVA 3CCST 1G83A 3RMSA 3CMAT 1WA7A 5IAYA 5A0DA 3RBBB 2VXEA 2DD4A 4HVWA 1B34A 2PQWA 3LGLA 3CPWS 4DBHA 1G2BA 1NZ9A 1WI7A 1CSKA 1BBZA 2E70A 4J7FA 4C0GA 2X4YA 3RESA 3VRYA 1VQ5T 1K1ZA 3PIOA 3HPWA 4OMFB 3EHRA 2MWOA 1B7TA 1WYXA 2XDPA 3VUBA 5GAMd 2CP7A 3CCLA 1ABQA 3ASKA 1D1AA 3MEVA 4M78E 1AZEA 4E47A 2R5MA 4J6WA 5FROA 1K76A 3RKXA 1KC8U 1DJ7B 4AFQC 3OSVA 4PKCC 1FXXA 3EH1A 5KH6A 2XKOC 3FRNA 2QASA 2KMTA 3CCRT 3FEOA 1QVPA 1TH7A 1RAFB 1YHQQ 4JPBW 5FRNA 1RLQC 2AZSA 4GY5A 1VOMA 3VJPA 2AIRB 2ZCFB 2LMJA 2KGTA 3X28B 3PIPA 1XTDA 1OOTA 2M51A 4KGXB 2D9TA 1Q82C 3JCMJ 1OPKA 2A08A 3LLRA 4C5IA 4M75A 2JS2A 2OTJQ 1D0ZA 2R57A 2JM8A 1TUGB 1VQ4Q 1HXDA 1TS9A 3D7SB 4WCIA 4FCYA 4M7DE 4E7JA 3QJ6A 4QVZA 2L3SA 1TOVA 1MGQA 3O5ZA 3CC7Q 1GRIA 2IIMA 1V29B 2MK5A 2L0AA 2ZPGB 1K73U 3P8HA 4V2SA 2RI5A 1M2VB 4OB3B 1AHJB 1PCXA 1M4ZA 2FL7A 3VS1A 2LJ1A 4ZN1A 2ZZDA 2DILA 1PKSA 1VQNQ 4ANJA 2LQ8A 3RMQA 2ZPBB 1U1SA 2L3QA 1VQOQ 2E3IA 3PGGA 2RJFA 4JJDA 1YJ9A 2P4TA 3C95A 3DB4A 1J3TA 3CCUT 2MIOA 4PLIA 1BKBA 2OTLA 1FMKA 3MHXA 4M7AF 2P0PA 2K3XA 3TCJA 2RF0A 1WHMA 3CC4A 4CRIA 3QZ5B 4LNPA 1JBMA 3OMGA 1N8RR 1Q7YC 1AWXA 2CH4A 1VQPQ 4PJNA 5EG2A 1JB0E 3ZEHA 4PJOG 4XU1A 1R8OB 2V8IA 3CXCS 2BUDA 4JDSA 4NL3A 2D8HA 1WIEA 2MYSA 3UF4A 3ULRB 3M57A 4QVDA 5DM7R 1UHFA 1YI2Q 3NHNA 4PJOB 2RI3A 4EMGA 3OYIA 1FMWA 1LOJA 3G7ZA 3VS2A 3WXMB 1YJWA 4C0FA 1OQKA 3UT1A 2CDTA 5L23A 1VIFA 1RL2A 4C92E 3JSCA 2I2LA 1RAHB 1D1BA 2K3YA 3U23A 3I55T 1KD1R 1ZLMA 5LJ5e 2B86A 2BZ8A 3QO3A 1I0CA 5D6YA 2QEXT 1YJ9Q 2X9HA 3H9NA 4R56A 3PVLA 1NEGA 3LH5A 1QVGS 4KUIA 3CBOA 5IT9E 4XU2A 5LJ3d 5HK3A 2C06A 2OTLQ 2KNBB 4C5GA 2DXBA 5CKFA 2E3HA 4XTWA 2YDLA 2HZYA 2KVQG 3OS2A 1UGQB 4J8OA 2MAMA 5C0MA 1YITT 4M77F 3X20B 2LP5A 2CZ0B 3A8MB 3VV0A 2HCKA 2M16A 4WF2A 5GAMh 1IZ6A 1RLPC 4RTWA 4PLLA 1N6AA 1EFNA 4OVAA 4M7DA 1MUZA 2BE9B 2RQWA 4F7UE 2KT1A 5A2QE 2K5IA 1IRXA 1AWJA 2D0QB 4Y91A 4OMLA 3HHTB 2HD0A 1FWZA 2EYQA 3CCVT 4E7IA 3X25B 1T3LA 1ABOA 1H3HA 4FIBA 4J9HA 4CI0C 1KG1A 3PE0A 2ED1A 1JU5C 4KULA 1AWWA 2E41A 2OAWA 3CCMT 2CSIA 2DXTA 3GBQA 2RNAA 3O8VA 3QYGB 3TEEA 2O9VA 4M7AC 4C0ZA 1N27A 5IXFA 3H41A 3OYYA 1KQ2A 2KYMA 1W6XA 2PNIA 2DEUA 1ZBXA 1VQ6Q 4J83A 3CBPA 1ZBJA 3A1PA 2RQVA 4AG2C 4CC2A 1K8AR 4X9CA 3EGDA 4IUQA 3RERA 3LH0A 4CC4B 5KCHA 2XHCA 2COYA 2RM4A 2EYWA 1Y71A 2DL4A 2Y90A 2YLBA 2DL8A 2HEQA 2VGMA 1ZX6A 3H0IA 1H92A 3G4ST 2O9SA 4FW1A 3R6OA 1UEBA 4ZGJB 4IKFA 1M90R 1QLYA 5FW9A 3CCJA 2RHYA 2E6NA 2RA2A 3MPUB 2LNHB 4E6RA 5J3BA 4A4EA 2QA4A 1ZUYA 3QG1A 8ATCB 3OB9A 3EG9B 4OMNA 1CKAA 1YIJT 1T0JA 3NTHA 4IUPA 1KK7A 1BYMA 3F70A 4KRTA 1AWOA 1Q86C 1RUWA 2ZGWA 5J26A 1Y57A 2A28A 4HT8A 4M77D 2DF6A 4PJLA 4X1VA 4J6YA 5GAN4 3H0FA 2EGAA 3MEUA 1VQMQ 1PD0A 4M7AB 2V8KA 2ATCB 2YUPA 4B9WA 4ELYC 2LX9A 1I07A 3V8JA 1WFWA 5FU7C 2NUPA 1LPLA 1TWBA 3M0RA 2GNCA 4M78F 4PFZA 5GANe 4GBQA 5LJ5d 1I4K1 1JJ2S 5GAMe 1JXOA 2GTOA 1JXMA 2RB6A 3HKSA 2EJFA 3ZL7C 2DL7A 2CH4W 8AT1B 2H3JA 1UJ0A 3M4YA 4F7UA 3BDUA 4DOWA 3JB9I 1QCOA 2L3RA 3FB9A 3L2WA 1W4SA 2KXDA 2ZPHB 4LXCA 1Q81U 2QK0A 2E5KA 1YWPA 3R6NA 5LJ3h 4BDYA 3CCLT 1OX8A 5GMKj 3PNWC 3EGUA 3OQ5A 2CREA 5D7UA 4MZPA 2KRSA 3G6EA 5DY9A 3M9QA 3CD6A 3OW2A 3P8DA 2KQWA 1KHCA 2RHIA 1VQLA 1IXDA 2DYBA 2YUQA 2RJCA 4M77G 1A0NB 3J80E 2QDLA 2Y4XA 2EQUA 2SRCA 4RTXA 2XIDA 3QZ9B 1IO6A 1VQKA 3L2VA 4JS5A 4M77B 3CEYA 1YP5A 4ELZC 1EX4A 1KC8R 1BB9A 2JTMA 4J9FA 3CCEQ 2RHZA 1OI1A 3VS3A 2ZAEA 4Z02A 1NYFA 4C8QD 4ZGDB 2EVRA 4RTYA 4Z89A 1WHJA 2Y4YA 1SHFA 1KSWA 2CYZB 3VS5A 4LUDA 2EBPA 2ED0A 5FU7B 1OU9A 5HKCA 3EH2A 1WGSA 2HBPA 1IGQA 4TVRA 4M75E 3TVTA 3M59A 1U06A 3V8LA 1WHKA 2F5TX 1F1BB 1FYNA 4BY6C 1VQ7A 1WX6A 2RN8A 4O6JA 1PKTA 2LZ6B 2P4RA 3JCMb 4CC3A 1D0XA 2VXFA 3JCMg 3M53A 2HKQB 3I9QA 4JLIA 2BKDN 4FYYB 2X4XA 4DQ2A 3MKDA 2FPFA 1K73R 4C0DB 1MV3A 2FO0A 2JJ9A 1MNEA 2LDMA 3IQLA 5GAN6 5IHIA 1NJIU 2K9GA 3OW2P 2HMAA 4M78C 3SWNA 3EG3A 5A0GA 2QXFA 1PG5B 1N9SA 4DBQA 3FDRA 4RCCA 4JZ3A 5KYWB 2EJ9A 5LL6S 1NLOC 3UDCA 4PJMA 1W70A 2K2VA 4BD3A 1I81A 3GPLA 2DVJA 1SG5A 4C92F 5KYNA 4GLMA 2P0KA 4C8QG 2IG0A 1B07A 3ME9A 1Y96A 3H8ZA 4L6V5 1GFDA 4R0KA 2RJEA 2YRDA 1KQ1A 1AOJA 1QP3A 1PM3A 1RAAB 3OY9A 4P5NA 2YUOA 3OYJA 3HFOA 2DVEA 2Z0WA 3M56A 1YHQA 1M8VA 1VQ7Q 1SSHA 3JCMf 1M1KU 2XMFA 3CPWA 5GAOn 2GF7A 2V1RA 1SF9A 2KRNA 2KRMA 4EMHA 5I11A 5DLOA 2LC4A 5KYXA 1I8FA 4M7DC 1VQ8T 2A3LA 2MPXC 1UE9A 1YJWT 3P8BB 1BK2A 2ZPIB 2OTJA 5LJ3e 2FYKA 4DBFA 2XK0A 2J7IA 1VQ4A 4BY6B 4CC7A 2CKKA 4BACA 3HRUA 5GANd 1N8RC 2P84A 1YJNQ 3QPHA 4AG1C 2CP2A 4Y92A 2QG9B 2LJ0A 2VWFA 3JB9D 1MMGA 1PHTA 1CKBA 3M0UA 4EMKA 3I56Q 3CC7A 2KI7A 3CMEQ 4AT1B 4XTUA 1D0YA 5LJ5h 1IHWA 3EGXA 3QJYA 1YWOA 3BDLA 2O4XA 3FC3A 1NPPA 4M78B 1VYVA 1OU8A 2DD5A 2M0YA 2DRKA 1LVKA 1VQNA 1M2OA 1K9AA 1K9MU 4RG2A 1QWEA 3HFNA 4O5VA 4LDYA 2EGEA 1R0CB 2DNUA 1KD1C 1VQOA 1VQ9T 4DEXA 2QAZA 2X51A 4N0AC 4PNOA 5KYUA 4FYXB 1BI0A 4HCBA 2QGFB 5FLXE 1UUEA
chains in the Genus database with same CATH topology
3I5SA 2DBKA 1OPLA 2YDLA 3NPFA 3FJ5A 3EHQA 2DJQA 2J6OA 5ECAA 1GCQA 1NEBA 5IH2A 4OMMA 4RUGA 2HBWA 2ABLA 2LP5A 2RPNA 1WDXA 4HXJA 3UA6A 1U5SA 5EC7A 5FWCA 2CT4A 2J05A 2ESWA 2X3WD 4ESRA 2HCKA 2HSPA 2FRYA 2DL3A 4ZNXA 2SEMA 2AKLA 1RLPC 4RTWA 1EFNA 2K2MA 1NYGA 1YNZA 1KJWA 1MUZA 4RTTA 1KFZA 2RQWA 4D8KA 3NMZC 2KT1A 2H8HA 1RI9A 1T3SA 3EG1A 3SEMA 1AWJA 1GCQC 3I5RA 2AKKA 5GJWB 2C0IA 2PTKA 4OMLA 4AFUC 2O31A 1JEGA 1Y0MA 2CUDA 1T3LA 1ABOA 2F2VA 1H3HA 4J9HA 1SEMA 1MV0B 1VA7A 1NLPC 3PE0A 1H8KA 4K11A 2ED1A 1JU5C 5HCKA 1AWWA 2OAWA 2CSIA 2NUZA 3GBQA 2RNAA 2OJ2A 1TUDA 2RQRA 2JT4A 2O9VA 3I35A 1GL5A 2C0OA 5IXFA 3H41A 4AFZC 2J06A 3REBB 4F14A 2J6KA 2K79A 2RQTA 2KYMA 1W6XA 2PNIA 4F16A 3TSWA 2K7AA 3VS7A 4AFSC 1YN8A 1ZBJA 2RQVA 4AG2C 2GTJA 4CC2A 2YUNA 2JM9A 2DA9A 4CC4B 5IXBA 2G6FX 1AZGB 1VYTA 1HJDA 2X3XD 1UJYA 2EYWA 4J9GA 3VS4A 2DL4A 3JV3A 1SRMA 2KT8A 1V1CA 2DL8A 2HEQA 1K0XA 1SHGA 1ZX6A 2LQWA 3H0IA 1H92A 2O9SA 1WLPB 3A98A 3EG2A 2DBMA 2K3BA 1JO8A 2D1XA 1M30A 1QLYA 4Z88A 5FW9A 1UG1A 1X6BA 2GQIA 2BTTA 1WXBA 2J6FA 3SHWA 2LNHB 4E6RA 1K4US 1ZUYA 1GBQA 4OMOA 2DL5A 4JZ4A 2DX1A 4OMNA 1CKAA 1U3OA 1T0JA 2KROA 4OMPA 2PZ1A 3KFVA 4KRTA 1AWOA 3CQTA 1RUWA 2CT3A 2FRWA 1Y57A 2A28A 1UECA 2LJ3A 2AZVA 4J9CA 2DF6A 2EYYA 4RTUA 4FSSA 4X1VA 3TSZA 5IHKA 3H0FA 4RTZA 1OEBA 1LCKA 2JMCA 2EGAA 2LCSA 4QT7A 2JMAA 2L3PA 2YUPA 4A63B 4J9BA 1E6GA 1I07A 2CSQA 2ROLA 4M4ZA 1WFWA 1NM7A 1UTIA 1X6GA 1T0HA 2JS0A 4RTVA 3M0RA 2GNCA 3UATA 1VYUA 2BZXA 1E7OA 1QWFA 2EGCA 4F17A 2O88A 1BU1A 4GBQA 4J9EA 1JXOA 4EIKA 2GTOA 1UFFA 1JXMA 4DEYA 2EQIA 4J9DA 3NGPA 1S1NA 2JXBA 3ZL7C 2DL7A 2CH4W 3VS0A 1UDLA 1UJ0A 2MOXA 2KR3A 1M3AA 1N5ZA 1I1JA 2KXDA 1M27C 1M8MA 3THKA 2W10A 1Z9ZA 1XOVA 2E5KA 1YWPA 3R6NA 2W0ZA 3M0PA 2YT6A 3EGUA 1G83A 2RQUA 1QKWA 2CREA 4HVUA 1WA7A 3H0HA 2KRSA 3RBBB 2KXCA 4LN2A 4HVWA 2NWMA 2DYBA 2YUQA 1GBRA 1QKXA 1A0NB 1G2BA 1WI7A 1WXTA 1CSKA 1BBZA 2KEAA 2EYXA 1Z9QA 2QDLA 3VRYA 4ORZA 2SRCA 4RTXA 1K1ZA 5IHNA 1IO6A 5I22A 1YP5A 3EHRA 1BB9A 4J9FA 1WYXA 2FPEA 1K0SA 3VS3A 2C0TA 1X43A 1NYFA 1TUCA 1ABQA 4OMQA 2EYZA 2EVRA 4RTYA 2V1QA 1M3BA 4Z89A 3UA7A 1AZEA 1SHFA 4IIMA 1KSWA 2GGRA 3VS5A 1YCSB 4LUDA 2EBPA 3PVQA 1K76A 2ED0A 3QWYA 4AFQC 1E6HA 2DLPA 4JJBA 1OV3A 2LX7A 1X2QA 2O2OA 3TVTA 1U06A 1X2KA 4JPBW 1RLQC 2AZSA 1KIKA 1FYNA 1WX6A 2RN8A 1X27A 1PKTA 2LZ6B 2P4RA 3REAB 1WXUA 4CC3A 2LMJA 2KGTA 1SRLA 1OOTA 2M51A 3I9QA 1OPKA 1JQQA 2A08A 2MCNA 2AK5A 2A36A 2JS2A 2FEIA 2FG0A 2FPFA 2JM8A 1MV3A 2FO0A 2RMOA 1HSQA 1AD5A 2JTEA 3IQLA 4WCIA 2BZYA 5IHIA 2K9GA 2D0NA 3EG3A 2F2XA 3VRZA 2L3SA 1HD3A 4D8DA 4JZ3A 2GBQA 3O5ZA 1GRIA 2IIMA 2OI3A 1NLOC 1ZUUA 2EKHA 1W70A 1SPKA 1W1FA 2JW4A 2L0AA 2D8JA 2DVJA 4GLMA 2EPDA 2EW3A 3M0QA 1B07A 4HCKA 3VS1A 1TG0A 2LJ1A 4R0KA 1ARKA 1GFDA 1AOJA 1PNJA 2DILA 1PKSA 1PRMC 1PRLC 2YUOA 3M0SA 3RNJA 2L3QA 1SSHA 2XMFA 4JJDA 2V1RA 2ROTA 2KRNA 2KRMA 1J3TA 5I11A 2FPDA 5GJVB 2MIOA 2L2PA 2DM1A 1UE9A 1FMKA 4LUEA 1NG2A 3VS6A 1BK2A 2I0NA 2RF0A 2DMOA 2J7IA 4LNPA 4CC7A 1UHCA 2ENMA 2ECZA 1AWXA 2CH4A 2KYBA 3EG0A 4AG1C 2VVKA 4Y92A 3C0CA 2D8HA 2LJ0A 1ZSGA 1WIEA 2VWFA 4HVVA 1PHTA 3ULRB 1CKBA 2DE0X 3M0UA 3UF4A 2HDAA 2DRMA 2F2WA 1ZUKA 1UHFA 3NHNA 1M3CA 1YWOA 1PWTA 3QWXX 3VS2A 2K6DA 1VYVA 5L23A 2CDTA 3M0TA 2A37A 2M0YA 2DRKA 1QCFA 1GFCA 1K9AA 2YSQA 3U23A 2KE9A 1ZLMA 2B86A 1QWEA 4JJCA 2BZ8A 1I0CA 2KBTA 1AVZC 4LE9A 2VKNA 2EGEA 4Z8AA 2DNUA 2CUBA 1AEYA 1X69A 3PVLA 1NEGA 4IIOA 1UGVA 1B3QA 3LH5A 5FWBA 4DEXA 2LQNA 4J9IA 1GCPA 2KNBB 1UUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I5S A;  2DBK A;  1OPL A;  2YDL A;  3NPF A;  3FJ5 A;  3EHQ A;  2DJQ A;  2J6O A;  5ECA A;  1GCQ A;  1NEB A;  5IH2 A;  4OMM A;  4RUG A;  2HBW A;  2ABL A;  2LP5 A;  2RPN A;  1WDX A;  4HXJ A;  3UA6 A;  1U5S A;  5EC7 A;  5FWC A;  2CT4 A;  2J05 A;  2ESW A;  2X3W D;  4ESR A;  2HCK A;  2HSP A;  2FRY A;  2DL3 A;  4ZNX A;  2SEM A;  2AKL A;  1RLP C;  4RTW A;  1EFN A;  2K2M A;  1NYG A;  1YNZ A;  1KJW A;  1MUZ A;  4RTT A;  1KFZ A;  2RQW A;  4D8K A;  3NMZ C;  2KT1 A;  2H8H A;  1RI9 A;  1T3S A;  3EG1 A;  3SEM A;  1AWJ A;  1GCQ C;  3I5R A;  2AKK A;  5GJW B;  2C0I A;  2PTK A;  4OML A;  4AFU C;  2O31 A;  1JEG A;  1Y0M A;  2CUD A;  1T3L A;  1ABO A;  2F2V A;  1H3H A;  4J9H A;  1SEM A;  1MV0 B;  1VA7 A;  1NLP C;  3PE0 A;  1H8K A;  4K11 A;  2ED1 A;  1JU5 C;  5HCK A;  1AWW A;  2OAW A;  2CSI A;  2NUZ A;  3GBQ A;  2RNA A;  2OJ2 A;  1TUD A;  2RQR A;  2JT4 A;  2O9V A;  3I35 A;  1GL5 A;  2C0O A;  5IXF A;  3H41 A;  4AFZ C;  2J06 A;  3REB B;  4F14 A;  2J6K A;  2K79 A;  2RQT A;  2KYM A;  1W6X A;  2PNI A;  4F16 A;  3TSW A;  2K7A A;  3VS7 A;  4AFS C;  1YN8 A;  1ZBJ A;  2RQV A;  4AG2 C;  2GTJ A;  4CC2 A;  2YUN A;  2JM9 A;  2DA9 A;  4CC4 B;  5IXB A;  2G6F X;  1AZG B;  1VYT A;  1HJD A;  2X3X D;  1UJY A;  2EYW A;  4J9G A;  3VS4 A;  2DL4 A;  3JV3 A;  1SRM A;  2KT8 A;  1V1C A;  2DL8 A;  2HEQ A;  1K0X A;  1SHG A;  1ZX6 A;  2LQW A;  3H0I A;  1H92 A;  2O9S A;  1WLP B;  3A98 A;  3EG2 A;  2DBM A;  2K3B A;  1JO8 A;  2D1X A;  1M30 A;  1QLY A;  4Z88 A;  5FW9 A;  1UG1 A;  1X6B A;  2GQI A;  2BTT A;  1WXB A;  2J6F A;  3SHW A;  2LNH B;  4E6R A;  1K4U S;  1ZUY A;  1GBQ A;  4OMO A;  2DL5 A;  4JZ4 A;  2DX1 A;  4OMN A;  1CKA A;  1U3O A;  1T0J A;  2KRO A;  4OMP A;  2PZ1 A;  3KFV A;  4KRT A;  1AWO A;  3CQT A;  1RUW A;  2CT3 A;  2FRW A;  1Y57 A;  2A28 A;  1UEC A;  2LJ3 A;  2AZV A;  4J9C A;  2DF6 A;  2EYY A;  4RTU A;  4FSS A;  4X1V A;  3TSZ A;  5IHK A;  3H0F A;  4RTZ A;  1OEB A;  1LCK A;  2JMC A;  2EGA A;  2LCS A;  4QT7 A;  2JMA A;  2L3P A;  2YUP A;  4A63 B;  4J9B A;  1E6G A;  1I07 A;  2CSQ A;  2ROL A;  4M4Z A;  1WFW A;  1NM7 A;  1UTI A;  1X6G A;  1T0H A;  2JS0 A;  4RTV A;  3M0R A;  2GNC A;  3UAT A;  1VYU A;  2BZX A;  1E7O A;  1QWF A;  2EGC A;  4F17 A;  2O88 A;  1BU1 A;  4GBQ A;  4J9E A;  1JXO A;  4EIK A;  2GTO A;  1UFF A;  1JXM A;  4DEY A;  2EQI A;  4J9D A;  3NGP A;  1S1N A;  2JXB A;  3ZL7 C;  2DL7 A;  2CH4 W;  3VS0 A;  1UDL A;  1UJ0 A;  2MOX A;  2KR3 A;  1M3A A;  1N5Z A;  1I1J A;  2KXD A;  1M27 C;  1M8M A;  3THK A;  2W10 A;  1Z9Z A;  1XOV A;  2E5K A;  1YWP A;  3R6N A;  2W0Z A;  3M0P A;  2YT6 A;  3EGU A;  1G83 A;  2RQU A;  1QKW A;  2CRE A;  4HVU A;  1WA7 A;  3H0H A;  2KRS A;  3RBB B;  2KXC A;  4LN2 A;  4HVW A;  2NWM A;  2DYB A;  2YUQ A;  1GBR A;  1QKX A;  1A0N B;  1G2B A;  1WI7 A;  1WXT A;  1CSK A;  1BBZ A;  2KEA A;  2EYX A;  1Z9Q A;  2QDL A;  3VRY A;  4ORZ A;  2SRC A;  4RTX A;  1K1Z A;  5IHN A;  1IO6 A;  5I22 A;  1YP5 A;  3EHR A;  1BB9 A;  4J9F A;  1WYX A;  2FPE A;  1K0S A;  3VS3 A;  2C0T A;  1X43 A;  1NYF A;  1TUC A;  1ABQ A;  4OMQ A;  2EYZ A;  2EVR A;  4RTY A;  2V1Q A;  1M3B A;  4Z89 A;  3UA7 A;  1AZE A;  1SHF A;  4IIM A;  1KSW A;  2GGR A;  3VS5 A;  1YCS B;  4LUD A;  2EBP A;  3PVQ A;  1K76 A;  2ED0 A;  3QWY A;  4AFQ C;  1E6H A;  2DLP A;  4JJB A;  1OV3 A;  2LX7 A;  1X2Q A;  2O2O A;  3TVT A;  1U06 A;  1X2K A;  4JPB W;  1RLQ C;  2AZS A;  1KIK A;  1FYN A;  1WX6 A;  2RN8 A;  1X27 A;  1PKT A;  2LZ6 B;  2P4R A;  3REA B;  1WXU A;  4CC3 A;  2LMJ A;  2KGT A;  1SRL A;  1OOT A;  2M51 A;  3I9Q A;  1OPK A;  1JQQ A;  2A08 A;  2MCN A;  2AK5 A;  2A36 A;  2JS2 A;  2FEI A;  2FG0 A;  2FPF A;  2JM8 A;  1MV3 A;  2FO0 A;  2RMO A;  1HSQ A;  1AD5 A;  2JTE A;  3IQL A;  4WCI A;  2BZY A;  5IHI A;  2K9G A;  2D0N A;  3EG3 A;  2F2X A;  3VRZ A;  2L3S A;  1HD3 A;  4D8D A;  4JZ3 A;  2GBQ A;  3O5Z A;  1GRI A;  2IIM A;  2OI3 A;  1NLO C;  1ZUU A;  2EKH A;  1W70 A;  1SPK A;  1W1F A;  2JW4 A;  2L0A A;  2D8J A;  2DVJ A;  4GLM A;  2EPD A;  2EW3 A;  3M0Q A;  1B07 A;  4HCK A;  3VS1 A;  1TG0 A;  2LJ1 A;  4R0K A;  1ARK A;  1GFD A;  1AOJ A;  1PNJ A;  2DIL A;  1PKS A;  1PRM C;  1PRL C;  2YUO A;  3M0S A;  3RNJ A;  2L3Q A;  1SSH A;  2XMF A;  4JJD A;  2V1R A;  2ROT A;  2KRN A;  2KRM A;  1J3T A;  5I11 A;  2FPD A;  5GJV B;  2MIO A;  2L2P A;  2DM1 A;  1UE9 A;  1FMK A;  4LUE A;  1NG2 A;  3VS6 A;  1BK2 A;  2I0N A;  2RF0 A;  2DMO A;  2J7I A;  4LNP A;  4CC7 A;  1UHC A;  2ENM A;  2ECZ A;  1AWX A;  2CH4 A;  2KYB A;  3EG0 A;  4AG1 C;  2VVK A;  4Y92 A;  3C0C A;  2D8H A;  2LJ0 A;  1ZSG A;  1WIE A;  2VWF A;  4HVV A;  1PHT A;  3ULR B;  1CKB A;  2DE0 X;  3M0U A;  3UF4 A;  2HDA A;  2DRM A;  2F2W A;  1ZUK A;  1UHF A;  3NHN A;  1M3C A;  1YWO A;  1PWT A;  3QWX X;  3VS2 A;  2K6D A;  1VYV A;  5L23 A;  2CDT A;  3M0T A;  2A37 A;  2M0Y A;  2DRK A;  1QCF A;  1GFC A;  1K9A A;  2YSQ A;  3U23 A;  2KE9 A;  1ZLM A;  2B86 A;  1QWE A;  4JJC A;  2BZ8 A;  1I0C A;  2KBT A;  1AVZ C;  4LE9 A;  2VKN A;  2EGE A;  4Z8A A;  2DNU A;  2CUB A;  1AEY A;  1X69 A;  3PVL A;  1NEG A;  4IIO A;  1UGV A;  1B3Q A;  3LH5 A;  5FWB A;  4DEX A;  2LQN A;  4J9I A;  1GCP A;  2KNB B;  1UUE A; 
#chains in the Genus database with same CATH topology
 2DBK A;  4PJO D;  3CPW P;  3EHQ A;  2DJQ A;  1GCQ A;  4HCC A;  1VQP A;  4X9D A;  5EC7 A;  2EQM A;  2CT4 A;  1ZSZ A;  2ESW A;  4ESR A;  2LCL A;  2DL3 A;  3A8O B;  3CC2 A;  4ZNX A;  3N5B B;  4PFO A;  1YI2 A;  5IN1 A;  4C92 C;  3VKI A;  1NYG A;  1YNZ A;  4RTT A;  5I2S A;  3JB9 G;  3T9N A;  4BB7 A;  2H8H A;  2DO3 A;  2R5A A;  2XI9 A;  5CQY A;  1NPR A;  5GAO q;  1M1G A;  5GJW B;  3MO8 A;  1O9S A;  1JEG A;  1U8R A;  1Y0M A;  1WQW A;  5AT1 B;  2CUD A;  3OS5 A;  4A4K A;  4BE0 A;  1VA7 A;  1NLP C;  2LCC A;  1H8K A;  2RH2 A;  4K11 A;  3LW5 E;  2V26 A;  2L5Q A;  2DYI A;  2NUZ A;  4XTX A;  4XU0 A;  1PSE A;  1XJW B;  2JT4 A;  3CCJ T;  4AFZ C;  3EFO B;  4J5Y A;  2FZK B;  4A4F A;  4F16 A;  1GXI E;  3TSW A;  2K7A A;  4DA4 A;  4AFS C;  3SDZ A;  3G71 T;  4B6M A;  1SSF A;  4C8Q A;  2QA4 T;  1WJR A;  5LJ5 g;  4MDX A;  2JM9 A;  1RAC B;  4ATO A;  2G6F X;  2WSC E;  1K8A C;  1VYT A;  3QDR B;  1HJD A;  2RHU A;  3S6W A;  2X3X D;  2D6F A;  2E12 A;  3JV3 A;  3CC2 Q;  4OP0 A;  5CAI A;  4E7S A;  2LQW A;  1C0M A;  2PUK B;  3EG2 A;  5GAO p;  2DBM A;  1JO8 A;  2HAX A;  4Z88 A;  1UG1 A;  1RAD B;  5GAN 3;  1X6B A;  4UC4 A;  4PJO E;  1M90 C;  4C92 G;  3GF5 A;  4L59 A;  3PFS A;  3FIF A;  3CCS A;  1WXB A;  4ZN3 A;  4OB0 B;  2RO0 A;  1G3W A;  1GBQ A;  4OMO A;  4BE2 A;  4E2F B;  4C92 B;  5CIU A;  3PMT A;  1TTH B;  3V7S A;  4LD6 A;  2KRO A;  4OMP A;  5GMK m;  1VQ5 A;  3RDV A;  2EIF A;  2FRW A;  4ZTF A;  2PUO B;  3GOX A;  1VQ6 A;  4J9C A;  3SFM A;  4RTZ A;  1OEB A;  3NTK A;  3NFC A;  4BDZ A;  1S72 Q;  2LCS A;  4QT7 A;  5I21 A;  5GAN h;  2JMA A;  1BIA A;  2JNG A;  3GLX A;  3FJP A;  3CCQ Q;  2KY9 A;  3CXC P;  3TRE A;  3QYH B;  1NM7 A;  1UTI A;  1WZO A;  2B8A A;  3M55 A;  4NS5 A;  3CCR A;  1VYU A;  2BZX A;  1G3T A;  2DET A;  3UPU A;  4FL6 A;  2DKG A;  4DBR A;  3G6E T;  3CCS Q;  1Q81 R;  3CD6 T;  4J9E A;  3CMA Q;  1VQL T;  1UFF A;  4QQD A;  5FU6 C;  1I5L A;  2EQI A;  2F1L A;  3NGP A;  3OYH A;  1VQ8 Q;  1UDL A;  4M75 F;  1M3A A;  2QDY B;  4LD9 K;  3C12 A;  1M1F A;  1VQK T;  1I1J A;  4M7A D;  1VQ5 Q;  1M2V A;  1KQS S;  1EZZ B;  1QVG P;  1O75 A;  5GAO l;  1JRI A;  4A4H A;  1QKW A;  4OB2 B;  2HL3 A;  2LT1 A;  2NWM A;  4Q5W A;  3OYD A;  1VQM A;  2RD1 A;  1W2B S;  4QQG A;  1WXT A;  2RK2 A;  1OZ3 A;  2PVG B;  2KEA A;  2EYX A;  2DIQ A;  2HQH A;  1H64 1;  5IHN A;  4KH1 B;  4B9X A;  5I22 A;  1MMA A;  2DAQ A;  4LDV A;  3CCR Q;  1N9R A;  4IUT A;  2FPE A;  1K0S A;  5D6X A;  2C0T A;  1KC8 C;  4KBM B;  1WJS A;  1V76 A;  2QTV A;  4OMQ A;  4MZM A;  1M3B A;  2HL5 C;  1VQ9 Q;  3C4S A;  3UA7 A;  5C6S A;  1Y07 A;  4FM4 B;  2GGR A;  3PVQ A;  3GNG A;  4RG8 A;  2M02 A;  4D6W A;  4PJO A;  1E6H A;  2DLP A;  2OAU A;  4JJB A;  1OV3 A;  2LX7 A;  3M4G A;  5GMK h;  4OGC A;  2O2O A;  2HNI A;  3DLL A;  2HQE A;  2K4Y A;  1KIK A;  4F04 B;  4NL2 A;  4XAX B;  5GAN g;  4A4G A;  4JUV A;  1X27 A;  4KT0 E;  2ZPE B;  5GAM g;  2E65 A;  4R55 A;  1NJI R;  4IUU A;  4M7A G;  3OYK A;  1QVF S;  1SRL A;  4E7H A;  4OF1 A;  4QW2 A;  2IVW A;  4BUG A;  2A36 A;  2DER A;  2FEI A;  4XU3 A;  1LJO A;  1HSQ A;  1K73 C;  4LDU A;  2VB6 A;  1JJ2 A;  2BZY A;  2YXY A;  1YHQ T;  2QTX A;  4EPC A;  4WTO B;  2D0N A;  1Q82 U;  3CCE A;  3OYE A;  1RAI B;  1X75 C;  3I55 A;  2MWP A;  2VYT A;  3L2Q A;  3LGF A;  4D8D A;  2JOY A;  3J81 E;  2GBQ A;  2MI6 A;  1WHH A;  4KGZ B;  2OI3 A;  3M58 A;  1ZUU A;  2NUT B;  3S3N A;  2EKH A;  3JCM V;  3HSB A;  4JLG A;  1G3S A;  1SPK A;  1W1F A;  2JW4 A;  2XDD A;  4JRQ A;  3TU4 K;  1M1K R;  2D8J A;  3CCU Q;  3QSU A;  1PC0 A;  4M75 C;  2OTJ T;  1G3Y A;  2EPD A;  2EW3 A;  3M0Q A;  3OBW A;  1ZHI A;  1VQ4 T;  2XDB A;  4HCK A;  4II1 A;  3GIB A;  1ARK A;  4YTL A;  2VC8 A;  2JZ2 A;  1PRM C;  1PRL C;  3G71 Q;  5GAM f;  5CK9 A;  2A0F B;  2F69 A;  4PJJ A;  5HY6 A;  1B34 B;  3CC7 T;  2FPD A;  5CKB A;  5GJV B;  4M7D F;  3ER0 A;  3JB9 H;  2V8J A;  1NG2 A;  1VQN T;  1EIF A;  1UHC A;  2ENM A;  2XU8 A;  2ECZ A;  4C5E A;  2DZC A;  3AHU A;  2EKO A;  1VQO T;  3I55 Q;  3EG0 A;  2R58 A;  2YHT A;  2X4W A;  2COW A;  4HVV A;  1ZSG A;  4M77 E;  2QEX Q;  1WJQ A;  2DE0 X;  2O4X B;  1K9M R;  2DRM A;  1ZUK A;  2M9U A;  2DXU A;  3CCM A;  1Q7Y U;  1JJ2 P;  4FU6 A;  4OGE A;  1R77 A;  3QWX X;  3OYG A;  3Q1J A;  1ZQ1 A;  2A37 A;  5HK0 A;  1C6V X;  4BI8 B;  1QCF A;  4M75 G;  1VQP T;  3H6Z A;  2YSQ A;  1VUB A;  1YIT Q;  2KE9 A;  3ZFJ A;  2XD0 A;  1AVZ C;  2VKN A;  3JB9 J;  2FZC B;  1AEY A;  4M75 B;  4ZTJ A;  4A54 A;  1QQJ A;  1UGV A;  3JRZ A;  1YI2 T;  5FWB A;  2LT4 A;  3V7R A;  1G8X A;  3EG9 A;  4J9I A;  1GCP A;  1RAG B;  3PTA A;  5GMK e;  2E4H A;  2M0O A;  5CKE A;  5GAO m;  1IB8 A;  2GFA A;  3FJ5 A;  2AHJ B;  2LQK A;  3QKJ A;  5ECA A;  5LJ3 j;  4M78 D;  3WVE B;  2HBW A;  5KYY A;  2BE7 D;  2QQB A;  1YJN A;  4HXJ A;  2DIG A;  3CCV Q;  2GCX A;  3UA6 A;  1U5S A;  1YJ9 T;  1BI1 A;  2JN0 A;  3QBY A;  3RKW A;  5GAN 5;  2VAS A;  3JCM Q;  3I56 A;  2SEM A;  3CME A;  3CCM Q;  2OTL T;  2HKN A;  1KJW A;  4M7A A;  3RKY A;  1KFZ A;  3CC4 T;  4D8K A;  5LJ3 g;  3NMZ C;  2K57 A;  2EQJ A;  1T3S A;  5CKD A;  9ATC B;  5GMK l;  3GNF B;  1PSF A;  4EDU A;  2AKK A;  3KXT A;  2C0I A;  2PTK A;  4AFU C;  3OYN A;  2F2V A;  1MV0 B;  2ZPF B;  2EWN A;  3CPF A;  5HCK A;  4C8Q E;  4LDX A;  2FB7 A;  4M7D D;  2OJ2 A;  2CP3 A;  3G4S Q;  2C0O A;  3BE3 A;  2J06 A;  2J6K A;  4RMO A;  4J7I A;  2RQT A;  3URG A;  2O01 E;  3SD4 A;  3V8K A;  2H3E B;  3MEA A;  3VS7 A;  5GAO r;  5D6W A;  2RK1 A;  2GTJ A;  1XQH A;  1ZA1 B;  2DA9 A;  2L89 A;  1WQ7 A;  3VS4 A;  5CR2 A;  2KT8 A;  3OYB A;  2JUF A;  4F7U F;  3TQ7 P;  4M78 G;  5LJ3 f;  1YIJ Q;  1K0X A;  2JVV A;  1SHG A;  3QHS A;  1YBY A;  1WLP B;  3A98 A;  2D1X A;  1VIE A;  1LNX A;  1VQ6 T;  2CP0 A;  4N4H A;  2GQI A;  4XTY A;  4M77 A;  3OYM A;  2BTT A;  1D3B A;  2K5F A;  2J6F A;  4ME7 A;  3SHW A;  3OMC A;  2QQS A;  2DL5 A;  2JTF A;  3C94 A;  1MMD A;  4JZ4 A;  3X24 B;  5I2M A;  3MEW A;  2QQ9 A;  2EJG A;  2PZ1 A;  2KDS A;  3KFV A;  3MET A;  3OYC A;  1IRE B;  2X4J A;  3CQT A;  3SB2 A;  1UEC A;  3E1S A;  5M9O A;  1HYO A;  2LJ3 A;  2CP5 A;  2EYY A;  4M7D G;  2KSS A;  4FSS A;  1MMN A;  5IHK A;  2E6Z A;  1LCK A;  2JMC A;  2AT1 B;  4A53 A;  1ACM B;  1Q86 U;  2YRC A;  4M7D B;  3A8H B;  3JCM c;  2L3P A;  4J9B A;  4C92 D;  4PJO C;  2GQV A;  2CSQ A;  4MML A;  1OUL A;  4GLK A;  1FX7 A;  6AT1 B;  1X6G A;  3E9F A;  4RTV A;  3UAT A;  1QWF A;  2DFU A;  2O88 A;  3MP8 A;  3CCL Q;  4KH0 B;  3L1A A;  1C1A A;  4VUB A;  3UWN A;  1WHL A;  1VQM T;  1Q81 C;  3OYA A;  4J9D A;  1S1N A;  5KYW A;  4JS4 A;  2JXB A;  5KE2 A;  2XG8 D;  4KGV B;  4NOY A;  3AT1 B;  5LJ5 j;  3NTI A;  2KR3 A;  1P92 A;  1HK9 A;  3JCM W;  1M27 C;  3E9G A;  3THK A;  3BY7 A;  3PMI A;  1UGP B;  4J6X A;  3EGD B;  2VUB A;  3L2R A;  3M0P A;  2E1H A;  3RR6 A;  2RQU A;  3CXC A;  3A5Z B;  3HRS A;  4HVU A;  3QDF A;  3H0H A;  2KXC A;  2VV5 A;  4LN2 A;  1KHI A;  4BI3 A;  1S72 A;  1GBR A;  1QKX A;  4MDW A;  1Y7X A;  1QCN A;  1Z9Q A;  3LWH A;  3CCQ A;  4ORZ A;  7AT1 B;  3V7C A;  1X6O A;  3MP6 A;  2FVU A;  3VYG A;  2KK4 A;  4JRI A;  5GAN 8;  5CVI A;  1ZA2 B;  2HSE B;  1NE8 A;  3E19 A;  3VU3 C;  2IPO B;  1X43 A;  1TUC A;  3JCM d;  2EYZ A;  3A8L B;  3CMA A;  2V1Q A;  2DTO A;  2EFI A;  1G5V A;  1SKU B;  1QVG A;  4XQ3 A;  4IIM A;  3OA6 A;  3M5A A;  1YCS B;  4PFP A;  1VQ8 A;  3QWY A;  1QP2 A;  4MMK A;  5AYF A;  4FT2 A;  3CBM A;  4LDW A;  3EFR A;  4FYV B;  2PVD B;  3L2Z A;  1X2Q A;  2HQX A;  3CCE T;  1X2K A;  4M78 A;  2WSF E;  1BI2 A;  5LJ5 f;  5GAN 2;  4FW2 A;  1U1T A;  4E7K A;  3REA B;  1WXU A;  1MHN A;  4QVC A;  1Q82 R;  4BI4 A;  1NJI C;  2LNV A;  4HCZ A;  2YRV A;  3PT9 A;  1JQQ A;  2MCN A;  3LWI A;  2AK5 A;  2NUP B;  2FG0 A;  3CC4 Q;  3FLG A;  2RMO A;  4JRP A;  2JTE A;  1AD5 A;  2EAY A;  4F7U G;  3DKM A;  3QUI A;  3X26 B;  3L2U A;  2F2X A;  3VRZ A;  1HD3 A;  3QII A;  1OYX A;  4F7U B;  1VQ9 A;  4L5G A;  1BIB A;  2MMP A;  1KQS A;  1M1K C;  3LYI A;  1BCM A;  1YJW Q;  1TG0 A;  5DLQ E;  1R0B G;  1PNJ A;  2G3R A;  4HT9 A;  1WNL A;  3OYF A;  3M0S A;  4FT4 A;  1TSF A;  3SWN C;  3RNJ A;  4JJN K;  2CZ7 B;  1W2B A;  1MND A;  2ROT A;  1UGR B;  3KUF A;  3G1J A;  2L2P A;  2MF2 A;  4JRK A;  2DM1 A;  4LUE A;  3VS6 A;  2I0N A;  2QI2 A;  3EAE A;  2DMO A;  2DXC A;  1Q7Y R;  1OX9 A;  4MZT A;  3OS0 A;  3OSS C;  4XTZ A;  1XNI A;  3EFO A;  4Y28 E;  3VYH B;  2KYB A;  1VQ7 T;  2GFU A;  2VVK A;  3RIR A;  2DK3 A;  2PU9 B;  3C0C A;  3HP9 A;  3HRT A;  2WSE E;  4XTV A;  1PD1 A;  2HDA A;  5FRM A;  2F2W A;  5GMK i;  3L42 A;  5GAN j;  1K9M C;  5CCA A;  4N0A A;  1M3C A;  3QXE B;  5GAM j;  1Q95 G;  3CCU A;  1PWT A;  4RCB A;  2X35 A;  1N8R U;  2K6D A;  5CO7 A;  2FHD A;  3M0T A;  1AT1 B;  2K5L A;  1BCO A;  1GFC A;  3KBG A;  4AMC A;  3G71 A;  1YJN T;  1QVF A;  4C8Q F;  4JJC A;  2KBT A;  4LE9 A;  2EQK A;  4Z8A A;  5FU6 B;  1KQS P;  3MJX A;  2CUB A;  2P0Q A;  4OB1 B;  3I56 T;  1RAB B;  4EMK C;  1X69 A;  1D09 B;  4IIO A;  3CME T;  1YFN A;  1B3Q A;  2LQN A;  4C92 A;  1NBE B;  4C5H A;  4E7Z A;  1TXQ A;  3I5S A;  5KYY B;  3SWN B;  1OPL A;  1KD1 U;  3NPF A;  3MP1 A;  1W2B P;  2J6O A;  4M77 C;  4M7A E;  1NEB A;  1WHG A;  5IH2 A;  4OMM A;  4PK4 A;  4RUG A;  2ABL A;  2QYZ A;  2RPN A;  1WDX A;  2RHX A;  5FWC A;  2J05 A;  4KUD K;  2X3W D;  5A0L A;  2QEX A;  2HSP A;  2FRY A;  4QKU A;  2NYS A;  3OBY A;  2AKL A;  2KAF A;  2RJD A;  4BE1 A;  1Y96 B;  4FSX A;  2K2M A;  4M75 D;  3JCM h;  1H3Z A;  1I5O B;  3CCJ Q;  1QW1 A;  1RI9 A;  2FZG B;  3EG1 A;  3SEM A;  3GP8 A;  5GAN f;  1GCQ C;  3I5R A;  2O31 A;  1YIT A;  1TU0 B;  2QA4 Q;  1OZ2 A;  5KYX B;  1SEM A;  1ZSZ C;  4X34 A;  3INZ A;  4HKE A;  3ZBD A;  1TUD A;  2RQR A;  3S3M A;  4PL6 A;  3I35 A;  5J39 A;  1GL5 A;  1QVF P;  2LVM A;  4F14 A;  3REB B;  2K79 A;  4C0D C;  4FYW B;  2PVO B;  2CGH A;  3RUX A;  1YN8 A;  4EMK B;  2YUN A;  2WAC A;  3HTR A;  5IXB A;  3CCV A;  5CQX A;  1AZG B;  2DPP B;  3EGX B;  4QQ6 A;  5KE3 A;  1UJY A;  3MCA B;  4J9G A;  1SRM A;  3M54 A;  1V1C A;  1QMC A;  3OW2 S;  1IGU A;  1D3B B;  2K3B A;  1M30 A;  4N4G A;  1K8A U;  2DTH A;  2VGN A;  2DTI A;  1YCY A;  4RKU E;  4C8Q C;  1WPY A;  1FMV A;  4DOV A;  3JB9 F;  1K4U S;  3LX7 A;  2DZ9 A;  2A7Y A;  5KYU B;  2LRQ A;  3DLM A;  2QQA A;  2DX1 A;  3CC2 T;  3J7A F;  2XIC A;  2E5Q A;  2CZ1 B;  1U3O A;  1M90 U;  3HL8 A;  5CKH A;  5KCO A;  2L8D A;  1Q86 R;  2E10 A;  3OS1 A;  3A8G B;  3JCM X;  3G4S A;  2CT3 A;  5L8R E;  2M1H A;  3JAM E;  2RI2 A;  2DJZ A;  2AZV A;  1M9S A;  1UGS B;  4RTU A;  1ZSZ B;  3TSZ A;  1M5Q 1;  3OYL A;  4ZGE B;  3G6E Q;  4E7L A;  3CD6 Q;  2NLU A;  1RI0 A;  3E2U A;  1VQL Q;  1D1C A;  3VUZ A;  3BW1 A;  1BI3 A;  2F5K A;  4A63 B;  5GAN 7;  1E6G A;  2OX7 A;  1YIJ A;  1VQK Q;  1IHV A;  4PJO F;  2CP6 A;  1UB4 A;  2ROL A;  4M4Z A;  2QGG A;  1X01 A;  1T0H A;  2JS0 A;  2QQR A;  4IUR A;  3S3O A;  3DB3 A;  1E7O A;  2EGC A;  2LTO A;  3WVD B;  4F17 A;  3EFS A;  1BU1 A;  4IUV A;  4N4I A;  3JCM P;  4EIK A;  1RAE B;  3BFM A;  1S72 T;  4DEY A;  3JCM e;  2DEQ A;  3CCQ T;  3VS0 A;  2YWW A;  4HA8 A;  2MOX A;  2NUT A;  2CS7 A;  1N5Z A;  2COZ A;  2E64 A;  4XK8 E;  2CZ6 B;  1M8M A;  2W10 A;  4C8Q B;  2YLC A;  1Z9Z A;  1XOV A;  2W0Z A;  2YT6 A;  2BIV A;  3CCS T;  1G83 A;  3RMS A;  3CMA T;  1WA7 A;  5IAY A;  5A0D A;  3RBB B;  2VXE A;  2DD4 A;  4HVW A;  1B34 A;  2PQW A;  3LGL A;  3CPW S;  4DBH A;  1G2B A;  1NZ9 A;  1WI7 A;  1CSK A;  1BBZ A;  2E70 A;  4J7F A;  4C0G A;  2X4Y A;  3RES A;  3VRY A;  1VQ5 T;  1K1Z A;  3PIO A;  3HPW A;  4OMF B;  3EHR A;  2MWO A;  1B7T A;  1WYX A;  2XDP A;  3VUB A;  5GAM d;  2CP7 A;  3CCL A;  1ABQ A;  3ASK A;  1D1A A;  3MEV A;  4M78 E;  1AZE A;  4E47 A;  2R5M A;  4J6W A;  5FRO A;  1K76 A;  3RKX A;  1KC8 U;  1DJ7 B;  4AFQ C;  3OSV A;  4PKC C;  1FXX A;  3EH1 A;  5KH6 A;  2XKO C;  3FRN A;  2QAS A;  2KMT A;  3CCR T;  3FEO A;  1QVP A;  1TH7 A;  1RAF B;  1YHQ Q;  4JPB W;  5FRN A;  1RLQ C;  2AZS A;  4GY5 A;  1VOM A;  3VJP A;  2AIR B;  2ZCF B;  2LMJ A;  2KGT A;  3X28 B;  3PIP A;  1XTD A;  1OOT A;  2M51 A;  4KGX B;  2D9T A;  1Q82 C;  3JCM J;  1OPK A;  2A08 A;  3LLR A;  4C5I A;  4M75 A;  2JS2 A;  2OTJ Q;  1D0Z A;  2R57 A;  2JM8 A;  1TUG B;  1VQ4 Q;  1HXD A;  1TS9 A;  3D7S B;  4WCI A;  4FCY A;  4M7D E;  4E7J A;  3QJ6 A;  4QVZ A;  2L3S A;  1TOV A;  1MGQ A;  3O5Z A;  3CC7 Q;  1GRI A;  2IIM A;  1V29 B;  2MK5 A;  2L0A A;  2ZPG B;  1K73 U;  3P8H A;  4V2S A;  2RI5 A;  1M2V B;  4OB3 B;  1AHJ B;  1PCX A;  1M4Z A;  2FL7 A;  3VS1 A;  2LJ1 A;  4ZN1 A;  2ZZD A;  2DIL A;  1PKS A;  1VQN Q;  4ANJ A;  2LQ8 A;  3RMQ A;  2ZPB B;  1U1S A;  2L3Q A;  1VQO Q;  2E3I A;  3PGG A;  2RJF A;  4JJD A;  1YJ9 A;  2P4T A;  3C95 A;  3DB4 A;  1J3T A;  3CCU T;  2MIO A;  4PLI A;  1BKB A;  2OTL A;  1FMK A;  3MHX A;  4M7A F;  2P0P A;  2K3X A;  3TCJ A;  2RF0 A;  1WHM A;  3CC4 A;  4CRI A;  3QZ5 B;  4LNP A;  1JBM A;  3OMG A;  1N8R R;  1Q7Y C;  1AWX A;  2CH4 A;  1VQP Q;  4PJN A;  5EG2 A;  1JB0 E;  3ZEH A;  4PJO G;  4XU1 A;  1R8O B;  2V8I A;  3CXC S;  2BUD A;  4JDS A;  4NL3 A;  2D8H A;  1WIE A;  2MYS A;  3UF4 A;  3ULR B;  3M57 A;  4QVD A;  5DM7 R;  1UHF A;  1YI2 Q;  3NHN A;  4PJO B;  2RI3 A;  4EMG A;  3OYI A;  1FMW A;  1LOJ A;  3G7Z A;  3VS2 A;  3WXM B;  1YJW A;  4C0F A;  1OQK A;  3UT1 A;  2CDT A;  5L23 A;  1VIF A;  1RL2 A;  4C92 E;  3JSC A;  2I2L A;  1RAH B;  1D1B A;  2K3Y A;  3U23 A;  3I55 T;  1KD1 R;  1ZLM A;  5LJ5 e;  2B86 A;  2BZ8 A;  3QO3 A;  1I0C A;  5D6Y A;  2QEX T;  1YJ9 Q;  2X9H A;  3H9N A;  4R56 A;  3PVL A;  1NEG A;  3LH5 A;  1QVG S;  4KUI A;  3CBO A;  5IT9 E;  4XU2 A;  5LJ3 d;  5HK3 A;  2C06 A;  2OTL Q;  2KNB B;  4C5G A;  2DXB A;  5CKF A;  2E3H A;  4XTW A;  2YDL A;  2HZY A;  2KVQ G;  3OS2 A;  1UGQ B;  4J8O A;  2MAM A;  5C0M A;  1YIT T;  4M77 F;  3X20 B;  2LP5 A;  2CZ0 B;  3A8M B;  3VV0 A;  2HCK A;  2M16 A;  4WF2 A;  5GAM h;  1IZ6 A;  1RLP C;  4RTW A;  4PLL A;  1N6A A;  1EFN A;  4OVA A;  4M7D A;  1MUZ A;  2BE9 B;  2RQW A;  4F7U E;  2KT1 A;  5A2Q E;  2K5I A;  1IRX A;  1AWJ A;  2D0Q B;  4Y91 A;  4OML A;  3HHT B;  2HD0 A;  1FWZ A;  2EYQ A;  3CCV T;  4E7I A;  3X25 B;  1T3L A;  1ABO A;  1H3H A;  4FIB A;  4J9H A;  4CI0 C;  1KG1 A;  3PE0 A;  2ED1 A;  1JU5 C;  4KUL A;  1AWW A;  2E41 A;  2OAW A;  3CCM T;  2CSI A;  2DXT A;  3GBQ A;  2RNA A;  3O8V A;  3QYG B;  3TEE A;  2O9V A;  4M7A C;  4C0Z A;  1N27 A;  5IXF A;  3H41 A;  3OYY A;  1KQ2 A;  2KYM A;  1W6X A;  2PNI A;  2DEU A;  1ZBX A;  1VQ6 Q;  4J83 A;  3CBP A;  1ZBJ A;  3A1P A;  2RQV A;  4AG2 C;  4CC2 A;  1K8A R;  4X9C A;  3EGD A;  4IUQ A;  3RER A;  3LH0 A;  4CC4 B;  5KCH A;  2XHC A;  2COY A;  2RM4 A;  2EYW A;  1Y71 A;  2DL4 A;  2Y90 A;  2YLB A;  2DL8 A;  2HEQ A;  2VGM A;  1ZX6 A;  3H0I A;  1H92 A;  3G4S T;  2O9S A;  4FW1 A;  3R6O A;  1UEB A;  4ZGJ B;  4IKF A;  1M90 R;  1QLY A;  5FW9 A;  3CCJ A;  2RHY A;  2E6N A;  2RA2 A;  3MPU B;  2LNH B;  4E6R A;  5J3B A;  4A4E A;  2QA4 A;  1ZUY A;  3QG1 A;  8ATC B;  3OB9 A;  3EG9 B;  4OMN A;  1CKA A;  1YIJ T;  1T0J A;  3NTH A;  4IUP A;  1KK7 A;  1BYM A;  3F70 A;  4KRT A;  1AWO A;  1Q86 C;  1RUW A;  2ZGW A;  5J26 A;  1Y57 A;  2A28 A;  4HT8 A;  4M77 D;  2DF6 A;  4PJL A;  4X1V A;  4J6Y A;  5GAN 4;  3H0F A;  2EGA A;  3MEU A;  1VQM Q;  1PD0 A;  4M7A B;  2V8K A;  2ATC B;  2YUP A;  4B9W A;  4ELY C;  2LX9 A;  1I07 A;  3V8J A;  1WFW A;  5FU7 C;  2NUP A;  1LPL A;  1TWB A;  3M0R A;  2GNC A;  4M78 F;  4PFZ A;  5GAN e;  4GBQ A;  5LJ5 d;  1I4K 1;  1JJ2 S;  5GAM e;  1JXO A;  2GTO A;  1JXM A;  2RB6 A;  3HKS A;  2EJF A;  3ZL7 C;  2DL7 A;  2CH4 W;  8AT1 B;  2H3J A;  1UJ0 A;  3M4Y A;  4F7U A;  3BDU A;  4DOW A;  3JB9 I;  1QCO A;  2L3R A;  3FB9 A;  3L2W A;  1W4S A;  2KXD A;  2ZPH B;  4LXC A;  1Q81 U;  2QK0 A;  2E5K A;  1YWP A;  3R6N A;  5LJ3 h;  4BDY A;  3CCL T;  1OX8 A;  5GMK j;  3PNW C;  3EGU A;  3OQ5 A;  2CRE A;  5D7U A;  4MZP A;  2KRS A;  3G6E A;  5DY9 A;  3M9Q A;  3CD6 A;  3OW2 A;  3P8D A;  2KQW A;  1KHC A;  2RHI A;  1VQL A;  1IXD A;  2DYB A;  2YUQ A;  2RJC A;  4M77 G;  1A0N B;  3J80 E;  2QDL A;  2Y4X A;  2EQU A;  2SRC A;  4RTX A;  2XID A;  3QZ9 B;  1IO6 A;  1VQK A;  3L2V A;  4JS5 A;  4M77 B;  3CEY A;  1YP5 A;  4ELZ C;  1EX4 A;  1KC8 R;  1BB9 A;  2JTM A;  4J9F A;  3CCE Q;  2RHZ A;  1OI1 A;  3VS3 A;  2ZAE A;  4Z02 A;  1NYF A;  4C8Q D;  4ZGD B;  2EVR A;  4RTY A;  4Z89 A;  1WHJ A;  2Y4Y A;  1SHF A;  1KSW A;  2CYZ B;  3VS5 A;  4LUD A;  2EBP A;  2ED0 A;  5FU7 B;  1OU9 A;  5HKC A;  3EH2 A;  1WGS A;  2HBP A;  1IGQ A;  4TVR A;  4M75 E;  3TVT A;  3M59 A;  1U06 A;  3V8L A;  1WHK A;  2F5T X;  1F1B B;  1FYN A;  4BY6 C;  1VQ7 A;  1WX6 A;  2RN8 A;  4O6J A;  1PKT A;  2LZ6 B;  2P4R A;  3JCM b;  4CC3 A;  1D0X A;  2VXF A;  3JCM g;  3M53 A;  2HKQ B;  3I9Q A;  4JLI A;  2BKD N;  4FYY B;  2X4X A;  4DQ2 A;  3MKD A;  2FPF A;  1K73 R;  4C0D B;  1MV3 A;  2FO0 A;  2JJ9 A;  1MNE A;  2LDM A;  3IQL A;  5GAN 6;  5IHI A;  1NJI U;  2K9G A;  3OW2 P;  2HMA A;  4M78 C;  3SWN A;  3EG3 A;  5A0G A;  2QXF A;  1PG5 B;  1N9S A;  4DBQ A;  3FDR A;  4RCC A;  4JZ3 A;  5KYW B;  2EJ9 A;  5LL6 S;  1NLO C;  3UDC A;  4PJM A;  1W70 A;  2K2V A;  4BD3 A;  1I81 A;  3GPL A;  2DVJ A;  1SG5 A;  4C92 F;  5KYN A;  4GLM A;  2P0K A;  4C8Q G;  2IG0 A;  1B07 A;  3ME9 A;  1Y96 A;  3H8Z A;  4L6V 5;  1GFD A;  4R0K A;  2RJE A;  2YRD A;  1KQ1 A;  1AOJ A;  1QP3 A;  1PM3 A;  1RAA B;  3OY9 A;  4P5N A;  2YUO A;  3OYJ A;  3HFO A;  2DVE A;  2Z0W A;  3M56 A;  1YHQ A;  1M8V A;  1VQ7 Q;  1SSH A;  3JCM f;  1M1K U;  2XMF A;  3CPW A;  5GAO n;  2GF7 A;  2V1R A;  1SF9 A;  2KRN A;  2KRM A;  4EMH A;  5I11 A;  5DLO A;  2LC4 A;  5KYX A;  1I8F A;  4M7D C;  1VQ8 T;  2A3L A;  2MPX C;  1UE9 A;  1YJW T;  3P8B B;  1BK2 A;  2ZPI B;  2OTJ A;  5LJ3 e;  2FYK A;  4DBF A;  2XK0 A;  2J7I A;  1VQ4 A;  4BY6 B;  4CC7 A;  2CKK A;  4BAC A;  3HRU A;  5GAN d;  1N8R C;  2P84 A;  1YJN Q;  3QPH A;  4AG1 C;  2CP2 A;  4Y92 A;  2QG9 B;  2LJ0 A;  2VWF A;  3JB9 D;  1MMG A;  1PHT A;  1CKB A;  3M0U A;  4EMK A;  3I56 Q;  3CC7 A;  2KI7 A;  3CME Q;  4AT1 B;  4XTU A;  1D0Y A;  5LJ5 h;  1IHW A;  3EGX A;  3QJY A;  1YWO A;  3BDL A;  2O4X A;  3FC3 A;  1NPP A;  4M78 B;  1VYV A;  1OU8 A;  2DD5 A;  2M0Y A;  2DRK A;  1LVK A;  1VQN A;  1M2O A;  1K9A A;  1K9M U;  4RG2 A;  1QWE A;  3HFN A;  4O5V A;  4LDY A;  2EGE A;  1R0C B;  2DNU A;  1KD1 C;  1VQO A;  1VQ9 T;  4DEX A;  2QAZ A;  2X51 A;  4N0A C;  4PNO A;  5KYU A;  4FYX B;  1BI0 A;  4HCB A;  2QGF B;  5FLX E;  1UUE A; 
#chains in the Genus database with same CATH homology
 3I5S A;  2DBK A;  1OPL A;  2YDL A;  3NPF A;  3FJ5 A;  3EHQ A;  2DJQ A;  2J6O A;  5ECA A;  1GCQ A;  1NEB A;  5IH2 A;  4OMM A;  4RUG A;  2HBW A;  2ABL A;  2LP5 A;  2RPN A;  1WDX A;  4HXJ A;  3UA6 A;  1U5S A;  5EC7 A;  5FWC A;  2CT4 A;  2J05 A;  2ESW A;  2X3W D;  4ESR A;  2HCK A;  2HSP A;  2FRY A;  2DL3 A;  4ZNX A;  2SEM A;  2AKL A;  1RLP C;  4RTW A;  1EFN A;  2K2M A;  1NYG A;  1YNZ A;  1KJW A;  1MUZ A;  4RTT A;  1KFZ A;  2RQW A;  4D8K A;  3NMZ C;  2KT1 A;  2H8H A;  1RI9 A;  1T3S A;  3EG1 A;  3SEM A;  1AWJ A;  1GCQ C;  3I5R A;  2AKK A;  5GJW B;  2C0I A;  2PTK A;  4OML A;  4AFU C;  2O31 A;  1JEG A;  1Y0M A;  2CUD A;  1T3L A;  1ABO A;  2F2V A;  1H3H A;  4J9H A;  1SEM A;  1MV0 B;  1VA7 A;  1NLP C;  3PE0 A;  1H8K A;  4K11 A;  2ED1 A;  1JU5 C;  5HCK A;  1AWW A;  2OAW A;  2CSI A;  2NUZ A;  3GBQ A;  2RNA A;  2OJ2 A;  1TUD A;  2RQR A;  2JT4 A;  2O9V A;  3I35 A;  1GL5 A;  2C0O A;  5IXF A;  3H41 A;  4AFZ C;  2J06 A;  3REB B;  4F14 A;  2J6K A;  2K79 A;  2RQT A;  2KYM A;  1W6X A;  2PNI A;  4F16 A;  3TSW A;  2K7A A;  3VS7 A;  4AFS C;  1YN8 A;  1ZBJ A;  2RQV A;  4AG2 C;  2GTJ A;  4CC2 A;  2YUN A;  2JM9 A;  2DA9 A;  4CC4 B;  5IXB A;  2G6F X;  1AZG B;  1VYT A;  1HJD A;  2X3X D;  1UJY A;  2EYW A;  4J9G A;  3VS4 A;  2DL4 A;  3JV3 A;  1SRM A;  2KT8 A;  1V1C A;  2DL8 A;  2HEQ A;  1K0X A;  1SHG A;  1ZX6 A;  2LQW A;  3H0I A;  1H92 A;  2O9S A;  1WLP B;  3A98 A;  3EG2 A;  2DBM A;  2K3B A;  1JO8 A;  2D1X A;  1M30 A;  1QLY A;  4Z88 A;  5FW9 A;  1UG1 A;  1X6B A;  2GQI A;  2BTT A;  1WXB A;  2J6F A;  3SHW A;  2LNH B;  4E6R A;  1K4U S;  1ZUY A;  1GBQ A;  4OMO A;  2DL5 A;  4JZ4 A;  2DX1 A;  4OMN A;  1CKA A;  1U3O A;  1T0J A;  2KRO A;  4OMP A;  2PZ1 A;  3KFV A;  4KRT A;  1AWO A;  3CQT A;  1RUW A;  2CT3 A;  2FRW A;  1Y57 A;  2A28 A;  1UEC A;  2LJ3 A;  2AZV A;  4J9C A;  2DF6 A;  2EYY A;  4RTU A;  4FSS A;  4X1V A;  3TSZ A;  5IHK A;  3H0F A;  4RTZ A;  1OEB A;  1LCK A;  2JMC A;  2EGA A;  2LCS A;  4QT7 A;  2JMA A;  2L3P A;  2YUP A;  4A63 B;  4J9B A;  1E6G A;  1I07 A;  2CSQ A;  2ROL A;  4M4Z A;  1WFW A;  1NM7 A;  1UTI A;  1X6G A;  1T0H A;  2JS0 A;  4RTV A;  3M0R A;  2GNC A;  3UAT A;  1VYU A;  2BZX A;  1E7O A;  1QWF A;  2EGC A;  4F17 A;  2O88 A;  1BU1 A;  4GBQ A;  4J9E A;  1JXO A;  4EIK A;  2GTO A;  1UFF A;  1JXM A;  4DEY A;  2EQI A;  4J9D A;  3NGP A;  1S1N A;  2JXB A;  3ZL7 C;  2DL7 A;  2CH4 W;  3VS0 A;  1UDL A;  1UJ0 A;  2MOX A;  2KR3 A;  1M3A A;  1N5Z A;  1I1J A;  2KXD A;  1M27 C;  1M8M A;  3THK A;  2W10 A;  1Z9Z A;  1XOV A;  2E5K A;  1YWP A;  3R6N A;  2W0Z A;  3M0P A;  2YT6 A;  3EGU A;  1G83 A;  2RQU A;  1QKW A;  2CRE A;  4HVU A;  1WA7 A;  3H0H A;  2KRS A;  3RBB B;  2KXC A;  4LN2 A;  4HVW A;  2NWM A;  2DYB A;  2YUQ A;  1GBR A;  1QKX A;  1A0N B;  1G2B A;  1WI7 A;  1WXT A;  1CSK A;  1BBZ A;  2KEA A;  2EYX A;  1Z9Q A;  2QDL A;  3VRY A;  4ORZ A;  2SRC A;  4RTX A;  1K1Z A;  5IHN A;  1IO6 A;  5I22 A;  1YP5 A;  3EHR A;  1BB9 A;  4J9F A;  1WYX A;  2FPE A;  1K0S A;  3VS3 A;  2C0T A;  1X43 A;  1NYF A;  1TUC A;  1ABQ A;  4OMQ A;  2EYZ A;  2EVR A;  4RTY A;  2V1Q A;  1M3B A;  4Z89 A;  3UA7 A;  1AZE A;  1SHF A;  4IIM A;  1KSW A;  2GGR A;  3VS5 A;  1YCS B;  4LUD A;  2EBP A;  3PVQ A;  1K76 A;  2ED0 A;  3QWY A;  4AFQ C;  1E6H A;  2DLP A;  4JJB A;  1OV3 A;  2LX7 A;  1X2Q A;  2O2O A;  3TVT A;  1U06 A;  1X2K A;  4JPB W;  1RLQ C;  2AZS A;  1KIK A;  1FYN A;  1WX6 A;  2RN8 A;  1X27 A;  1PKT A;  2LZ6 B;  2P4R A;  3REA B;  1WXU A;  4CC3 A;  2LMJ A;  2KGT A;  1SRL A;  1OOT A;  2M51 A;  3I9Q A;  1OPK A;  1JQQ A;  2A08 A;  2MCN A;  2AK5 A;  2A36 A;  2JS2 A;  2FEI A;  2FG0 A;  2FPF A;  2JM8 A;  1MV3 A;  2FO0 A;  2RMO A;  1HSQ A;  1AD5 A;  2JTE A;  3IQL A;  4WCI A;  2BZY A;  5IHI A;  2K9G A;  2D0N A;  3EG3 A;  2F2X A;  3VRZ A;  2L3S A;  1HD3 A;  4D8D A;  4JZ3 A;  2GBQ A;  3O5Z A;  1GRI A;  2IIM A;  2OI3 A;  1NLO C;  1ZUU A;  2EKH A;  1W70 A;  1SPK A;  1W1F A;  2JW4 A;  2L0A A;  2D8J A;  2DVJ A;  4GLM A;  2EPD A;  2EW3 A;  3M0Q A;  1B07 A;  4HCK A;  3VS1 A;  1TG0 A;  2LJ1 A;  4R0K A;  1ARK A;  1GFD A;  1AOJ A;  1PNJ A;  2DIL A;  1PKS A;  1PRM C;  1PRL C;  2YUO A;  3M0S A;  3RNJ A;  2L3Q A;  1SSH A;  2XMF A;  4JJD A;  2V1R A;  2ROT A;  2KRN A;  2KRM A;  1J3T A;  5I11 A;  2FPD A;  5GJV B;  2MIO A;  2L2P A;  2DM1 A;  1UE9 A;  1FMK A;  4LUE A;  1NG2 A;  3VS6 A;  1BK2 A;  2I0N A;  2RF0 A;  2DMO A;  2J7I A;  4LNP A;  4CC7 A;  1UHC A;  2ENM A;  2ECZ A;  1AWX A;  2CH4 A;  2KYB A;  3EG0 A;  4AG1 C;  2VVK A;  4Y92 A;  3C0C A;  2D8H A;  2LJ0 A;  1ZSG A;  1WIE A;  2VWF A;  4HVV A;  1PHT A;  3ULR B;  1CKB A;  2DE0 X;  3M0U A;  3UF4 A;  2HDA A;  2DRM A;  2F2W A;  1ZUK A;  1UHF A;  3NHN A;  1M3C A;  1YWO A;  1PWT A;  3QWX X;  3VS2 A;  2K6D A;  1VYV A;  5L23 A;  2CDT A;  3M0T A;  2A37 A;  2M0Y A;  2DRK A;  1QCF A;  1GFC A;  1K9A A;  2YSQ A;  3U23 A;  2KE9 A;  1ZLM A;  2B86 A;  1QWE A;  4JJC A;  2BZ8 A;  1I0C A;  2KBT A;  1AVZ C;  4LE9 A;  2VKN A;  2EGE A;  4Z8A A;  2DNU A;  2CUB A;  1AEY A;  1X69 A;  3PVL A;  1NEG A;  4IIO A;  1UGV A;  1B3Q A;  3LH5 A;  5FWB A;  4DEX A;  2LQN A;  4J9I A;  1GCP A;  2KNB B;  1UUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...