2BZXA

Atomic model of crkl-sh3c monomer
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
60
structure length
60
Chain Sequence
PVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sh3 domain
molecule keywords CRK-LIKE PROTEIN
publication title The C-Terminal SH3 Domain of Crkl as a Dynamic Dimerization Module Transiently Exposing a Nuclear Export Signal.
pubmed doi rcsb
source organism Homo sapiens
total genus 7
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2005-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2bzxA00
3NMZC 4DEXA 4K11A 5FWCA 3ULRB 4D8DA 1H8KA 2LQWA 2RNAA 3LH5A 5I22A 2YUQA 2ED1A 1GBQA 2FPFA 4OMOA 2OI3A 3EG3A 2RQVA 2KXDA 2L2PA 1JEGA 4HVWA 2QDLA 3M0QA 1MV0B 1M3AA 4CC4B 3EG1A 1WA7A 1ZUUA 1Y57A 4F16A 1CKAA 1GCQA 4AFUC 2AKLA 2HDAA 2DILA 2FEIA 1UFFA 1QWFA 5IXFA 1ZUKA 3H41A 4AFZC 1VYVA 1K1ZA 4CC7A 4ESRA 2KT1A 2YUPA 3FJ5A 4RTXA 4KRTA 1YNZA 3VS0A 1K0SA 1NM7A 1B07A 4DEYA 3VRZA 1KSWA 2C0OA 2LCSA 1I1JA 2P4RA 2KRNA 1YP5A 2JW4A 1QLYA 2EPDA 2DM1A 2V1QA 1AVZC 3CQTA 1BK2A 1AZGB 1OPLA 2J7IA 3EG0A 3NGPA 2FRYA 2KT8A 1WXUA 1X27A 3QWXX 2EVRA 2DA9A 3PE0A 2K3BA 3H0IA 1OEBA 2KE9A 1MUZA 1SHFA 1YWPA 2E5KA 2PTKA 2B86A 1IO6A 1WX6A 2KRSA 2YUNA 4RTYA 4HCKA 1E7OA 4OMLA 2SEMA 1UUEA 1YWOA 2JS0A 1T0JA 1M3BA 2ENMA 1ARKA 3C0CA 4OMMA 1OV3A 1TUDA 2K9GA 3REBB 3NHNA 2J6OA 3M0RA 2GQIA 2JTEA 2W0ZA 2F2XA 2JXBA 1MV3A 1RI9A 2DLPA 2LP5A 1KJWA 4JJCA 2PZ1A 3PVLA 1X6BA 2YUOA 1T3SA 2X3WD 2DYBA 2CH4W 4J9HA 2YSQA 2EGEA 2RQRA 4IIOA 4RUGA 2DL4A 3M0UA 2L3QA 5HCKA 4AFSC 1PKSA 3UF4A 3VS6A 1M8MA 4JZ4A 1YN8A 2O2OA 2D8JA 4RTUA 1SHGA 1OOTA 4ZNXA 1ZX6A 5IHKA 1FYNA 2PNIA 4J9EA 5ECAA 2SRCA 2DL5A 3THKA 3EHQA 1E6HA 2K79A 1BU1A 4CC3A 4HVUA 1X43A 3UA6A 1WI7A 2BZXA 2H8HA 2KRMA 2OAWA 3R6NA 4LUDA 4J9GA 4RTTA 4JZ3A 2FPDA 1WIEA 4AFQC 2CUDA 1W1FA 4HVVA 2FG0A 1CSKA 3VS4A 1RLPC 1Y0MA 4X1VA 1KFZA 2LZ6B 3M0PA 1GCQC 4EIKA 2ABLA 2D1XA 2BTTA 1KIKA 2ROTA 2RQWA 1T3LA 3SEMA 2EYXA 1U06A 1WXTA 2KEAA 3UA7A 2JS2A 2GBQA 3M0SA 2DRMA 1UDLA 3UATA 1M30A 1U5SA 1JXOA 4ORZA 1UGVA 2EYZA 1I0CA 2LQNA 2L0AA 2MCNA 2YDLA 1A0NB 1RUWA 1U3OA 1JXMA 2L3SA 1LCKA 1SRMA 2RN8A 2AZVA 2GNCA 1G83A 1WLPB 1AWOA 1NYGA 1EFNA 1GL5A 1X2KA 2KGTA 3I5RA 2D0NA 1NG2A 2AKKA 1WYXA 1UG1A 1VYTA 1NEGA 1SEMA 2GTOA 3TVTA 2RMOA 1VYUA 2EYYA 4HXJA 2VKNA 5GJWB 1QWEA 2J6KA 2L3PA 2CT3A 1PWTA 1JU5C 2O9VA 2DF6A 1G2BA 1GCPA 3TSZA 1GRIA 2ROLA 4Z8AA 2A28A 3KFVA 1K4US 2DMOA 2JMCA 2AZSA 1TUCA 2JM8A 2K7AA 1SPKA 3VS2A 4E6RA 1GFDA 2RQTA 1QKWA 1HSQA 1FMKA 1SRLA 1Z9QA 5L23A 2DL3A 1AD5A 3EGUA 4QT7A 1JQQA 1GBRA 2EKHA 2A08A 1UHCA 2YT6A 1UJ0A 1OPKA 2KYBA 2JT4A 1W6XA 1H92A 1NLPC 1UE9A 2ED0A 2LMJA 1X6GA 2K6DA 2KROA 2LJ0A 5FW9A 1HJDA 2I0NA 1UJYA 2J06A 4JJDA 3REAB 2LJ3A 4RTVA 3QWYA 2LJ1A 2CT4A 3H0FA 2G6FX 2IIMA 5FWBA 5I11A 3I5SA 3VS3A 4J9DA 2F2VA 2AK5A 2DBMA 2CUBA 2KYMA 3O5ZA 4RTWA 5IXBA 1ZLMA 5IHIA 1SSHA 2W10A 1UHFA 5IHNA 1CKBA 1M27C 2CREA 4J9BA 3RNJA 1VA7A 2X3XD 3SHWA 5IH2A 2D8HA 1Z9ZA 1ZSGA 1PRMC 4F14A 2DE0X 2K2MA 4JPBW 1K9AA 1AWWA 2EYWA 2EGAA 4F17A 2HBWA 3NPFA 4LNPA 1AWXA 1UTIA 2LX7A 4OMNA 2JM9A 2XMFA 4A63B 4IIMA 1T0HA 4GBQA 1BB9A 2DRKA 2DNUA 4LN2A 1YCSB 4LUEA 2A36A 2DX1A 2HEQA 2EQIA 2DL8A 2M0YA 2RQUA 2HSPA 2EW3A 2DJQA 2O88A 1JO8A 2NUZA 2CSIA 2J6FA 2KR3A 2KNBB 2LNHB 2KXCA 3EG2A 4M4ZA 2DVJA 3VRYA 3VS5A 1V1CA 1I07A 2O9SA 1WFWA 2DBKA 3VS7A 1S1NA 1HD3A 1RLQC 1TG0A 2GGRA 1XOVA 3I35A 4FSSA 2NWMA 2OJ2A 2J05A 2HCKA 2MIOA 1H3HA 4AG1C 4Z88A 2FPEA 2CH4A 4D8KA 2CDTA 4WCIA 1QCFA 2VWFA 1NYFA 4GLMA 1K0XA 4RTZA 2KBTA 3EHRA 1PHTA 2RPNA 2BZ8A 2MOXA 3GBQA 3A98A 2FO0A 3M0TA 4LE9A 2M51A 3JV3A 1BBZA 1GFCA 1PNJA 4Z89A 1J3TA 2EBPA 3H0HA 4J9CA 5GJVB 1NLOC 2FRWA 2CSQA 1PRLC 1ZUYA 1WXBA 4OMPA 2ESWA 4Y92A 1AOJA 1ABOA 2F2WA 4AG2C 4CC2A 1AEYA 1PKTA 1X69A 2DL7A 1W70A 3U23A 3PVQA 1QKXA 1ABQA 3I9QA 3IQLA 2ECZA 1WDXA 4OMQA 3RBBB 1M3CA 2V1RA 1NEBA 1AZEA 4JJBA 3TSWA 3ZL7C 2BZYA 1K76A 2RF0A 5EC7A 1N5ZA 2C0IA 3VS1A 2EGCA 1AWJA 1ZBJA 2VVKA 4J9FA 4R0KA 1X2QA 1B3QA 2GTJA 2A37A 2C0TA 2JMAA 1E6GA 2O31A 1UECA 4J9IA
chains in the Genus database with same CATH superfamily
4JUVA 3NMZC 4M77A 2FHDA 1U8RA 1QCOA 4FL6A 4D8DA 1AT1B 2YHTA 1VQ5A 1VIEA 3P8HA 5FU6B 5I22A 5I21A 2YUQA 2NUPB 5AYFA 4JRIA 4PLLA 5KE2A 1WHMA 4HVWA 3M0QA 1H641 1M3AA 3EG9A 1ZQ1A 1CKAA 1YBYA 4PK4A 3UPUA 1GCQA 3URGA 2AKLA 4XTWA 3QUIA 5A0LA 2FEIA 3A8OB 2OTJQ 1UFFA 1JJ2A 4BUGA 1ZUKA 3G4ST 3S3NA 4Z02A 1QVFA 1B07A 4LXCA 2H3JA 4DEYA 4QVDA 3HFOA 5GMKi 3CCQA 1I1JA 1QVGA 1YP5A 5D7UA 2EPDA 2DM1A 3CQTA 1AZGB 1OPLA 2J7IA 2QDYB 1NJIC 3EG0A 3JCMh 3X25B 2FRYA 3LWHA 1WXUA 5C6SA 4A54A 1BI3A 3H0IA 3QIIA 3CXCA 4PJOC 4OB3B 2E6ZA 1IZ6A 1SHFA 1YWPA 4MZPA 2COYA 3OBYA 1WX6A 2PVDB 5IN1A 3OW2S 1JBMA 3OYGA 5D6YA 2SEMA 1UUEA 3I56Q 3A5ZB 4M75G 3S3OA 2CP6A 4XTZA 3A8MB 1HYOA 2E4HA 2RI2A 2GQIA 3A8HB 1M90R 2F2XA 3I55Q 2JXBA 1RI9A 2P0PA 2DLPA 3QJYA 5FROA 2LP5A 3CCLA 4JJCA 2F5KA 2EQJA 1PD0A 2DYBA 3CCUT 2CH4W 4J6YA 4IIOA 2QEXT 1GXIE 2L3QA 5HCKA 4AFSC 1UGSB 3QDRB 3BDLA 2XI9A 2D8JA 4IUUA 4RTUA 2JOYA 1ZSZB 1WHJA 1Y71A 2PNIA 1BYMA 1PSEA 2DL5A 3EFOA 3E9FA 5GAOn 1Q86C 4DBRA 4PJOG 3M56A 1U1TA 2XHCA 2LT1A 1WI7A 2VB6A 1UGQB 4DA4A 2RH2A 4RTTA 2CYZB 2FPDA 2Y4XA 1U1SA 2RK1A 2DZCA 3J80E 4BE0A 1W1FA 1WQWA 2F5TX 2L8DA 4J7FA 4N4IA 2RJCA 4RCCA 4X1VA 1UGPB 2QA4T 2ABLA 3S3MA 2BTTA 3CCST 1MNEA 1T3LA 1KD1R 4KGZB 1YIJT 4RCBA 1K9MU 2GBQA 3M0SA 5GAMe 4M7AF 1MNDA 3AT1B 1Q82U 3OYDA 2YRCA 1XQHA 3G7ZA 3C94A 3FJPA 2DIGA 5GANd 1KQSA 4PFZA 4FYYB 2MWPA 3CC2A 2EIFA 3JAME 3HHTB 1LCKA 1SRMA 4X9DA 3CCEA 4KBMB 3CCRT 1NZ9A 4M75A 1AWOA 1Y7XA 2COZA 3OMGA 3QBYA 3L1AA 5LL6S 3FDRA 2X35A 3CPWP 1SEMA 1C6VX 3JCMW 1V76A 2J6KA 2L3PA 3G6EQ 5FRMA 3H8ZA 1OULA 4HT9A 1PWTA 2X4WA 1VQ4T 1QW1A 1Y07A 2LT4A 3L2WA 2G3RA 4Z8AA 3KFVA 1VOMA 2AZSA 3META 3MJXA 4DQ2A 1SPKA 3CBMA 4V2SA 2LDMA 4C8QC 1QKWA 1HSQA 2L5QA 3J81E 1FMWA 5L23A 3CCVT 3DB3A 2E12A 2HKQB 1JQQA 5CCAA 2K2VA 3QYHB 4PJOA 8ATCB 5KCOA 3V8KA 2YT6A 4MZMA 1UJ0A 4MDWA 4M7DG 4ZN1A 1VQNT 5KE3A 1S72T 2XIDA 3EH1A 2LTOA 2LJ0A 4PFOA 1YJ9T 3FRNA 3PMIA 2EAYA 4M7AG 4HT8A 4QQGA 3EAEA 1JRIA 2LJ1A 4ZN3A 5GMKl 3H0FA 2G6FX 3GP8A 1UEBA 4LDVA 1YJWQ 5CKBA 1VQ6Q 2X4XA 4J9DA 2KK4A 2KYMA 1VQLT 2IG0A 1SSHA 5IHNA 2DEQA 5KYWB 1K8AR 1N8RC 3CCMQ 1D1AA 4E2FB 1YITA 1PRMC 2K2MA 5GANg 2JTMA 4DBFA 1AWWA 4A4EA 1VQMT 3RERA 3EFRA 2EGAA 2HSEB 2HBWA 3NPFA 4LNPA 3UWNA 1G3YA 2XMFA 4BACA 1PSFA 3QHSA 1T0HA 3S6WA 1VQ8T 3CCJQ 3ZEHA 3OSSC 4M78B 2DL8A 4FW2A 3MO8A 4OB2B 1IGQA 3X26B 2EW3A 2O88A 1JO8A 2NUZA 5D6XA 1V1CA 2O9SA 1WFWA 2F1LA 3E9GA 3CBPA 2RK2A 3M59A 5CQYA 3JCMX 4PKCC 1M5Q1 1RLQC 2DEUA 1TG0A 4N0AC 1XOVA 2RHZA 3I35A 2QQBA 2HCKA 3V7RA 4M7DA 2L3RA 4P5NA 4GLMA 2D0QB 1W4SA 4RTZA 3EHRA 4EMKC 3A1PA 3EGXB 4GLKA 2KDSA 2MOXA 3GBQA 2PVGB 1R8OB 3GF5A 4IUQA 2OTLT 3G4SA 4C0FA 3JCMe 4J83A 3CBOA 1UB4A 1YFNA 3FB9A 2E70A 2MI6A 2RM4A 1YI2T 1MMNA 1PRLC 1ZUYA 1WXBA 3VYHB 1Q81U 4OMPA 1YJNT 1KC8R 1X6OA 4C8QA 4BY6B 2DL7A 1QKXA 4OMQA 4JS4A 5LJ5f 1NEBA 1MMDA 4IURA 2YRDA 3SWNB 3TSWA 2BZYA 2RF0A 1YCYA 2BUDA 3VS1A 5LJ3f 1AWJA 3KBGA 1ZBJA 3OQ5A 4BDYA 1X2QA 5EG2A 9ATCB 4A4KA 2DD5A 4M78D 2C06A 1VQ7A 4J9IA 3CPWA 3CCQQ 3L2VA 1K73R 5FU6C 5FLXE 2LQWA 2QTXA 2E5QA 3CCUA 3CC4Q 1M1GA 1IXDA 2DETA 3OYCA 2IPOB 4II1A 4IUTA 3EG3A 5CK9A 4MMKA 3M58A 2JZ2A 1MV0B 4C92B 3EG1A 1Y57A 1Q82C 1W2BP 4M78E 4C8QD 4EMHA 5GAN4 1TUGB 1ZBXA 3H41A 4AFZC 1K1ZA 3CCLQ 2KT1A 2YUPA 2QXFA 2JNGA 2D6FA 3VS0A 1IHVA 3HPWA 4F7UG 2IVWA 2KRNA 1QLYA 4BE2A 2VYTA 2DTHA 1Q7YR 1BK2A 4PNOA 1D3BA 3CCSA 5DY9A 3Q1JA 3QXEB 4C0ZA 1X27A 3QWXX 2EVRA 2K3BA 1WQ7A 1YIJA 1EIFA 1MUZA 2R58A 3E19A 3OYYA 2ZPGB 2E5KA 2PTKA 3C4SA 4HCKA 1E7OA 2VGMA 2M9UA 1YWOA 3DLMA 2JS0A 2PQWA 3MP6A 1M3BA 1OV3A 1I8FA 3REBB 1MMGA 2ATCB 4N0AA 2QYZA 3D7SB 4FT4A 2JTEA 3CCRA 1OZ2A 1M2OA 1WJSA 1MV3A 1B7TA 2A0FB 3I56T 3PVLA 3EH2A 3JRZA 2RD1A 2ZPHB 1Y96B 4J9HA 2M16A 4EMKA 2YSQA 2EGEA 2RQRA 3M0UA 1BI2A 5FU7B 1Q86R 2COWA 1LJOA 1ZSZC 3G1JA 1M8MA 1M9SA 4JZ4A 4ANJA 2O2OA 4A53A 4E7SA 2EFIA 2KSSA 1VQKT 5CKFA 2JVVA 1M90U 2XDDA 3THKA 3R6OA 1E6HA 3MP8A 5A0DA 1BU1A 4M75F 4M77B 4X34A 3CC2Q 2LVMA 3WVDB 3CCEQ 2XICA 1YHQT 1I5LA 5IAYA 2KRMA 3L2UA 2OAWA 3R6NA 4LUDA 1WIEA 2QQ9A 2RHXA 4DOWA 2YLBA 1Y0MA 2LZ6B 4PFPA 4EIKA 4F7UA 3VJPA 3EG9B 3KUFA 2DYIA 2LC4A 5M9OA 2RQWA 4C92E 3SEMA 1U06A 1WXTA 2EJGA 3MPUB 1VQOT 2NUTB 1U5SA 5DM7R 4PJOF 4KGVB 3ER0A 2FZKB 3SD4A 2HZYA 1OQKA 3UDCA 3CC7Q 1X01A 1WJQA 1VQLA 1U3OA 5GAMf 2L3SA 1C1AA 1FWZA 2GNCA 4E7LA 1PC0A 2FL7A 3CC4A 1KD1U 3I5RA 4WF2A 2K5LA 1M1FA 1WYXA 1UG1A 3WXMB 1G8XA 1NEGA 2BKDN 2GTOA 3OYEA 2EYYA 4HXJA 2QI2A 1JU5C 1VQ9T 2DF6A 1FMVA 1G2BA 2VC8A 5DLOA 1OZ3A 2CP0A 2A28A 3OW2P 2JMCA 3BW1A 1PM3A 5L8RE 2JM8A 1FXXA 2E41A 3G6ET 2FVUA 2KQWA 2F69A 1D09B 1GFDA 3JB9I 4XU3A 1EZZB 2RB6A 1FMKA 1SRLA 1TS9A 2RI5A 1AD5A 1R0BG 2RJDA 1GBRA 2EKHA 2CZ6B 1UHCA 2PVOB 1QMCA 1TU0B 1OPKA 3FC3A 1Q81C 2HNIA 4BI8B 4XU0A 1UE9A 3VUZA 1YITQ 2LNVA 2K6DA 2RJEA 1W2BA 4GY5A 2QG9B 1UJYA 2JTFA 2XDPA 3C12A 3REAB 5LJ5g 2ZPEB 3QWYA 5FRNA 4XTVA 1XJWB 2MK5A 5FWBA 4M77E 1HK9A 3GIBA 3I5SA 2HQXA 3CD6T 1N8RR 1V29B 1WHKA 2QGGA 3M9QA 2DBMA 5I2MA 4J5YA 3RESA 3O5ZA 5IXBA 3OYJA 3MEUA 1YJWT 4XU2A 1LVKA 3MEAA 1UHFA 1VQ6T 2LCLA 1CKBA 2CREA 1VQPT 4LD6A 4M7DF 1YJNA 1VA7A 2CP2A 3CMET 4Y28E 3SHWA 5GAN2 2FZCB 2QQSA 5GANe 1BCOA 2B8AA 2GFAA 4FT2A 2D8HA 3JB9D 3OYHA 2YXYA 1SG5A 4JPBW 3J7AF 1WZOA 1K9AA 2QAZA 4IKFA 2MF2A 3QG1A 1UTIA 4FU6A 4C0GA 4IIMA 1BB9A 4M78C 5A0GA 3OYLA 4KUIA 2EQMA 4M75B 2A36A 3RIRA 3G4SQ 1RAEB 1K8AU 1N9SA 2EQIA 2KVQG 4JRPA 1I4K1 3L42A 3X24B 2CSIA 4C8QF 2KR3A 3WVEB 2WSFE 2LNHB 3EG2A 2DVJA 2KI7A 3SFMA 1I07A 3AHUA 3BE3A 5LJ5j 3HKSA 4KULA 1HD3A 1C0MA 5GAOm 2MIOA 3DLLA 3BDUA 1H3HA 1BIBA 3HRSA 1P92A 3M4GA 3PT9A 4EDUA 2CDTA 4WCIA 1QCFA 1NYFA 2EQKA 2HAXA 2KBTA 3CMAT 1PHTA 3A98A 5LJ5h 3CC7A 4PJOB 1VQ7Q 2CKKA 4PLIA 4AMCA 1IRXA 1PNJA 5LJ3h 5KYUB 4C5IA 4O5VA 4XTXA 3H0HA 4JS5A 3CCUQ 1NLOC 2QEXQ 2V8KA 2I2LA 4BY6C 2RI3A 4J6XA 4FW1A 1VQ5T 4CC2A 1M8VA 1AEYA 1X69A 5HY6A 3SWNC 2RHUA 3O8VA 1M3CA 1XTDA 3PTAA 4JJBA 2A3LA 1SKUB 3ZL7C 1M90C 2X9HA 2ZAEA 2C0IA 2JN0A 4XU1A 3JCMc 1B3QA 2A37A 1D1BA 2O4XB 4MDXA 2P0QA 4C8QG 1KC8U 1WJRA 3CEYA 2A7YA 4K11A 2RHYA 5FWCA 3ULRB 2KMTA 4JDSA 1H8KA 3EGDB 2GFUA 2RNAA 3LH5A 2FB7A 1ACMB 3CCSQ 3CCQT 2D9TA 5HKCA 1RAAB 1TH7A 1GBQA 2MWOA 4KT0E 1XNIA 3OW2A 4MZTA 4OMOA 3G71T 1YIJQ 1VUBA 4C92C 3QJ6A 1B34B 3PIPA 2L2PA 3FIFA 1JEGA 4XTUA 2YWWA 5J26A 5KYWA 2DIQA 1ZUUA 4F16A 7AT1B 2DVEA 4AFUC 4M75E 4B9XA 2HDAA 1K73U 3M57A 2LQ8A 3ZBDA 3OSVA 5GAN5 1TSFA 1YHQA 5CIUA 3HTRA 3CCRQ 3MEWA 2RA2A 6AT1B 4RTXA 2PU9B 3VRZA 3RMQA 2PUOB 1BIAA 2C0OA 2P4RA 5KYYB 2EQUA 1BI0A 4M7DB 3LW5E 4Q5WA 3MCAB 4M78A 4BI4A 3NGPA 2KT8A 1VQ4Q 2MMPA 3OS5A 4L59A 4M7AB 4DBHA 4NS5A 3E1SA 2B86A 1VQOA 2KRSA 2VXEA 2H3EB 4PJOE 4OMLA 4PJJA 1M1KR 4XQ3A 3CCVQ 3L2ZA 2MYSA 4OMMA 1TUDA 2K9GA 1Q7YU 4JRKA 3M0RA 2M02A 4AT1B 4F7UF 3E2UA 1WPYA 3QO3A 1X6BA 1T3SA 2X3WD 5FU7C 1WGSA 2FYKA 2RHIA 2VUBA 2OX7A 4RUGA 2DL4A 5KYXB 1YJ9Q 1QVFS 1PKSA 3UF4A 2EJ9A 3LLRA 3FEOA 2NLUA 1YN8A 1G5VA 1D0XA 4A4GA 4QVCA 1SHGA 3GLXA 4ZNXA 1FYNA 5ECAA 1RAIB 2SRCA 4M77C 1N6AA 2K79A 4CC3A 1VQLQ 3CXCS 4BI3A 3UA6A 3M55A 1R77A 2BZXA 5KH6A 3RDVA 5J3BA 3SDZA 1Q86U 1MGQA 2QEXA 3PMTA 2CUDA 1BCMA 4HVVA 2FG0A 1NE8A 3PIOA 1CSKA 1RACB 1NPPA 1KFZA 1GCQC 2CGHA 2D1XA 1K9MC 1KIKA 4DBQA 1RAGB 1VQMQ 2CS7A 1OU9A 2DTOA 2AIRB 4LDXA 2KEAA 2JUFA 2JS2A 3FLGA 4TVRA 2DRMA 1UDLA 4D6WA 3OS1A 4E7IA 1PD1A 1NJIR 1M30A 1VQ8Q 1JXOA 2RO0A 3VV0A 4ORZA 4A4HA 2LQNA 3RUXA 2MCNA 3JCMb 2YDLA 1OI1A 2K3YA 1RUWA 1G3SA 4FYXB 1JXMA 2OTJT 4C92A 1M2VA 2RN8A 2AZVA 1ZHIA 1G83A 1WLPB 4M7DE 1D3BB 4X9CA 1NYGA 4OP0A 2QA4A 1OYXA 1TWBA 2KGTA 1NG2A 2K5FA 3CMEA 5HK3A 4BE1A 1VYTA 4JLIA 3DKMA 1VYUA 2VKNA 5GJWB 4M7AE 3HFNA 2CT3A 4C0DB 2O9VA 2MPXC 3DB4A 1GCPA 3TSZA 5CKDA 1GRIA 2ROLA 2VASA 5CVIA 2BE9B 3P8BB 3OA6A 1K4US 3VYGA 1TUCA 2DXTA 3VS2A 2DJZA 4HCCA 2OTLQ 2Y4YA 1OX9A 2Y90A 1Z9QA 2HBPA 4QT7A 4NL3A 4EMKB 3X20B 3OYFA 1YI2Q 1YJNQ 3I55T 2L89A 2KYBA 1QQJA 2XK0A 2JT4A 1W6XA 2LRQA 1TOVA 2OAUA 2E10A 1LNXA 2LMJA 1RABB 1X6GA 1VQ4A 2KROA 5GAOr 4C92D 4LDYA 3PGGA 1HJDA 2J06A 2ZPBB 4JJDA 2LJ3A 1Y96A 4PJLA 4C5GA 2IIMA 5GAOq 3CCVA 5LJ5d 1RL2A 4IUPA 3VS3A 2QQAA 2AK5A 5KYNA 1KC8C 2CUBA 5LJ3d 1ZLMA 5IHIA 1VQNA 1M4ZA 3LX7A 1M27C 4F7UB 4RG8A 5GAN7 1S72A 4J9BA 3GPLA 3QDFA 3RKWA 1YJ9A 2E65A 4DOVA 5IH2A 1Z9ZA 1ZSGA 3GNGA 2DE0X 1N8RU 2ZCFB 4FM4B 2O01E 2NUPA 2EYWA 3NTHA 5GAN6 5GANf 1SSFA 3JCMV 1AWXA 4OMNA 2JM9A 4JRQA 2V8JA 1K73C 1IREB 1QP3A 4M75C 1MHNA 2DRKA 2RJFA 2DNUA 5GMKm 4LN2A 2QK0A 2M1HA 4N4GA 3RMSA 2HSPA 2DJQA 2EWNA 1R0CB 3JSCA 3HP9A 2KNBB 2NUTA 2DERA 4M4ZA 3TQ7P 3RKYA 1ZA2B 2GQVA 3VRYA 2XD0A 8AT1B 3QKJA 1N9RA 1VIFA 2DKGA 3VS7A 1S1NA 5GAN8 2DAQA 1KG1A 3G71A 1VQMA 2GGRA 4FSSA 2NWMA 2OJ2A 2CZ1B 4HCBA 4AG1C 2E3HA 2CH4A 3L2QA 2DFUA 1VQ8A 2VWFA 4M77D 1K0XA 4HKEA 3OYAA 2CZ7B 2HMAA 3VU3C 1Q7YC 4LE9A 3JV3A 3M54A 1GFCA 2DK3A 2HQHA 1J3TA 4QQ6A 2EBPA 2AHJB 3QYGB 4OF1A 4KH1B 1VQ7T 2E64A 1KQ1A 3M53A 3C95A 1AOJA 3EFOB 2F2WA 2E6NA 1PKTA 4NOYA 1TTHB 3IQLA 2X4YA 3I9QA 1VQKQ 4OGEA 3M5AA 1WDXA 3OMCA 2YRVA 1X75C 2V1RA 4J6WA 5LJ3g 2K5IA 1N5ZA 3PFSA 3OYIA 2HL3A 4ZGEB 1WNLA 1N27A 5GAOp 2P4TA 2OTLA 1ZSZA 4E7JA 4J9FA 4ELZC 1YHQQ 2GTJA 3F70A 2HKNA 1WHGA 2C0TA 2DZ9A 1D1CA 1UECA 4E7KA 4XK8E 2PUKB 3LGFA 4F7UE 2DXCA 4M78F 2GF7A 5J39A 1YI2A 1WHHA 4DEXA 4N4HA 5CR2A 2E1HA 4C5HA 4ZGDB 4E47A 4BD3A 2R5AA 2BE7D 2ED1A 3HRTA 2FPFA 3CCMT 2OI3A 2RQVA 2KXDA 2R5MA 1VQOQ 2QDLA 1OX8A 4CC4B 1G3WA 1WA7A 2CP5A 2DPPB 4YTLA 5GMKj 2K57A 4QKUA 2DILA 1JB0E 3V7CA 3X28B 1QWFA 5IXFA 2LX9A 3CCJT 1VYVA 4ESRA 4CC7A 3FJ5A 4KRTA 1YNZA 3BY7A 1K0SA 1NM7A 4HCZA 1KSWA 4M7DC 2LCSA 5GAMd 4B6MA 2JW4A 4ME7A 3HRUA 2V1QA 1AVZC 1LOJA 5LJ3j 2CZ0B 4KH0B 5GMKh 2HQEA 3CPWS 3VUBA 4F04B 2QASA 4MMLA 1VQ9Q 1NBEB 3JB9H 4HA8A 4M7AC 2DA9A 3PE0A 1RI0A 2BIVA 3V8LA 1OEBA 4UC4A 2KE9A 1D0YA 2ZGWA 1IO6A 2FZGB 1KQ2A 2YUNA 3H6ZA 1RAFB 4RTYA 2CP3A 3KXTA 5AT1B 1MMAA 2MAMA 1T0JA 2ENMA 5C0MA 3C0CA 1O9SA 4CI0C 2DXBA 1ARKA 1SF9A 4M78G 4Y91A 3NHNA 2J6OA 2OTJA 3L2RA 2W0ZA 4ZGJB 5D6WA 1KHIA 2XDBA 1KJWA 3JCMf 1BI1A 2PZ1A 5HK0A 3JB9J 2YUOA 4ZTJA 4J8OA 3CPFA 4OVAA 4PL6A 5KYUA 3RKXA 3VS6A 3HL8A 1M1KU 1FX7A 1LPLA 2ZZDA 2JJ9A 1OOTA 1I5OB 4QVZA 1ZX6A 5IHKA 4J9EA 4OB1B 2K3XA 2DO3A 3OB9A 4A4FA 3CD6Q 4C92F 4M75D 4JJNK 3EHQA 4BDZA 4HVUA 1X43A 3I56A 3TREA 3TCJA 2H8HA 1K9MR 3ME9A 3LYIA 4LDUA 1TXQA 2LCCA 4J9GA 1OU8A 4JZ3A 3V8JA 1VQPQ 1Q82R 3LH0A 3A8GB 4AFQC 2QA4Q 4IUVA 1O75A 3H9NA 3I55A 5A2QE 3T9NA 3CMEQ 1PCXA 4EMGA 2O4XA 3VKIA 4E7ZA 4B9WA 3VS4A 1RLPC 2V26A 4FIBA 4L5GA 3M0PA 3CC4T 4ATOA 3EFSA 1VQKA 2E3IA 4LDWA 2ROTA 2P84A 4QQDA 2KAFA 2EYXA 2QTVA 3EGDA 3UA7A 4PJOD 4BB7A 3LGLA 3UATA 4ELYC 3OS2A 4R56A 3NTKA 5DLQE 3MKDA 1IGUA 4KUDK 1UGVA 2EYZA 1I0CA 2L0AA 5CAIA 5GAMg 3P8DA 1A0NB 1B34A 2VGNA 3MEVA 2WACA 3OBWA 1PG5B 1KD1C 4OB0B 2DTIA 5CO7A 3OYMA 3JCMJ 3CCLT 1DJ7B 1QP2A 2EYQA 1IHWA 1EFNA 4OGCA 1GL5A 4XAXB 1X2KA 2D0NA 2AKKA 4PJMA 2RMOA 3TVTA 2X51A 4C0DC 1NJIU 2AT1B 1QVPA 3OYBA 1QWEA 4VUBA 3QSUA 3N5BB 1RAHB 2P0KA 4C92G 5KYYA 3CMAQ 2DMOA 2VXFA 2CP7A 4FSXA 2K7AA 2YLCA 4E6RA 2RQTA 3QZ9B 3INZA 3TU4K 4M77F 2DL3A 3EGUA 1VQNQ 4C8QB 1NPRA 4M7AA 3EGXA 2A08A 1S72Q 3M4YA 4KGXB 1JJ2S 3V7SA 3NTIA 1JJ2P 4NL2A 4FCYA 4EPCA 1G3TA 1H92A 1VQ5Q 5GANj 1NLPC 1QVFP 1QVGS 2ED0A 1VQ9A 1QVGP 1RADB 3JCMd 5GAMj 5FW9A 2LQKA 2I0NA 4R55A 3HSBA 2QQRA 3G6EA 4RTVA 4RG2A 3GOXA 2CT4A 5KYXA 2GCXA 3PNWC 3LWIA 4QW2A 3CXCP 5I11A 4PJNA 3MP1A 3SWNA 2F2VA 5GANh 1BKBA 3BFMA 3CC2T 2DXUA 5CKEA 3CCET 4RTWA 2X4JA 5GAMh 2W10A 4ZTFA 4M7DD 1EX4A 2M0OA 1F1BB 3OYNA 4FYVB 5CQXA 3RNJA 2QGFB 2X3XD 3G71Q 3ASKA 5GAOl 4LD9K 2Z0WA 2ZPIB 2KY9A 4M7AD 3OYKA 2NYSA 4F14A 3JB9F 2XG8D 1UGRB 3CD6A 1HXDA 4F17A 2LX7A 1K8AC 4A63B 4GBQA 1M2VB 1KK7A 3MHXA 1KHCA 4M77G 3OY9A 1W2BS 1YJWA 1YCSB 4LUEA 2DX1A 5KCHA 1VQ6A 2HEQA 4RKUE 4C5EA 2M0YA 2RQUA 2EJFA 1VQPA 3GNFB 3CC7T 2J6FA 3A8LB 2KXCA 3VS5A 2R57A 2DBKA 4XTYA 3QPHA 4RMOA 3CCMA 2J05A 2HD0A 1H3ZA 3UT1A 4Z88A 2FPEA 2WSEE 4FYWB 5GAN3 2EKOA 4D8KA 1Q81R 2XKOC 4WTOB 2WSCE 3OS0A 3QZ5B 2RPNA 2BZ8A 4C8QE 3TEEA 3JCMP 2FO0A 1QCNA 3M0TA 2M51A 3CCJA 1BBZA 5IT9E 5GMKe 1Q95G 4Z89A 1KQSS 4JLGA 1KQSP 5GJVB 4J9CA 2VV5A 3JCMg 2FRWA 2CSQA 4OMFB 1WHLA 2V8IA 2ESWA 5LJ5e 2XU8A 4O6JA 4Y92A 3RR6A 1ABOA 1M1KC 4AG2C 4L6V5 3JB9G 4E7HA 3U23A 3SB2A 1W70A 3PVQA 1YITT 1ABQA 5LJ3e 1D0ZA 2ECZA 3NFCA 3RBBB 3CMAA 1AZEA 4CRIA 2ZPFB 2K4YA 4J7IA 5I2SA 3JCMQ 1K76A 5EC7A 3ZFJA 2EGCA 1I81A 2VVKA 4R0KA 2DD4A 1E6GA 2JMAA 1IB8A 2O31A 2HL5C 5CKHA 1ZA1B 1AHJB
chains in the Genus database with same CATH topology
3NMZC 4DEXA 4K11A 5FWCA 3ULRB 4D8DA 1H8KA 2LQWA 2RNAA 3LH5A 5I22A 2YUQA 2ED1A 1GBQA 2FPFA 4OMOA 2OI3A 3EG3A 2RQVA 2KXDA 2L2PA 1JEGA 4HVWA 2QDLA 3M0QA 1MV0B 1M3AA 4CC4B 3EG1A 1WA7A 1ZUUA 1Y57A 4F16A 1CKAA 1GCQA 4AFUC 2AKLA 2HDAA 2DILA 2FEIA 1UFFA 1QWFA 5IXFA 1ZUKA 3H41A 4AFZC 1VYVA 1K1ZA 4CC7A 4ESRA 2KT1A 2YUPA 3FJ5A 4RTXA 4KRTA 1YNZA 3VS0A 1K0SA 1NM7A 1B07A 4DEYA 3VRZA 1KSWA 2C0OA 2LCSA 1I1JA 2P4RA 2KRNA 1YP5A 2JW4A 1QLYA 2EPDA 2DM1A 2V1QA 1AVZC 3CQTA 1BK2A 1AZGB 1OPLA 2J7IA 3EG0A 3NGPA 2FRYA 2KT8A 1WXUA 1X27A 3QWXX 2EVRA 2DA9A 3PE0A 2K3BA 3H0IA 1OEBA 2KE9A 1MUZA 1SHFA 1YWPA 2E5KA 2PTKA 2B86A 1IO6A 1WX6A 2KRSA 2YUNA 4RTYA 4HCKA 1E7OA 4OMLA 2SEMA 1UUEA 1YWOA 2JS0A 1T0JA 1M3BA 2ENMA 1ARKA 3C0CA 4OMMA 1OV3A 1TUDA 2K9GA 3REBB 3NHNA 2J6OA 3M0RA 2GQIA 2JTEA 2W0ZA 2F2XA 2JXBA 1MV3A 1RI9A 2DLPA 2LP5A 1KJWA 4JJCA 2PZ1A 3PVLA 1X6BA 2YUOA 1T3SA 2X3WD 2DYBA 2CH4W 4J9HA 2YSQA 2EGEA 2RQRA 4IIOA 4RUGA 2DL4A 3M0UA 2L3QA 5HCKA 4AFSC 1PKSA 3UF4A 3VS6A 1M8MA 4JZ4A 1YN8A 2O2OA 2D8JA 4RTUA 1SHGA 1OOTA 4ZNXA 1ZX6A 5IHKA 1FYNA 2PNIA 4J9EA 5ECAA 2SRCA 2DL5A 3THKA 3EHQA 1E6HA 2K79A 1BU1A 4CC3A 4HVUA 1X43A 3UA6A 1WI7A 2BZXA 2H8HA 2KRMA 2OAWA 3R6NA 4LUDA 4J9GA 4RTTA 4JZ3A 2FPDA 1WIEA 4AFQC 2CUDA 1W1FA 4HVVA 2FG0A 1CSKA 3VS4A 1RLPC 1Y0MA 4X1VA 1KFZA 2LZ6B 3M0PA 1GCQC 4EIKA 2ABLA 2D1XA 2BTTA 1KIKA 2ROTA 2RQWA 1T3LA 3SEMA 2EYXA 1U06A 1WXTA 2KEAA 3UA7A 2JS2A 2GBQA 3M0SA 2DRMA 1UDLA 3UATA 1M30A 1U5SA 1JXOA 4ORZA 1UGVA 2EYZA 1I0CA 2LQNA 2L0AA 2MCNA 2YDLA 1A0NB 1RUWA 1U3OA 1JXMA 2L3SA 1LCKA 1SRMA 2RN8A 2AZVA 2GNCA 1G83A 1WLPB 1AWOA 1NYGA 1EFNA 1GL5A 1X2KA 2KGTA 3I5RA 2D0NA 1NG2A 2AKKA 1WYXA 1UG1A 1VYTA 1NEGA 1SEMA 2GTOA 3TVTA 2RMOA 1VYUA 2EYYA 4HXJA 2VKNA 5GJWB 1QWEA 2J6KA 2L3PA 2CT3A 1PWTA 1JU5C 2O9VA 2DF6A 1G2BA 1GCPA 3TSZA 1GRIA 2ROLA 4Z8AA 2A28A 3KFVA 1K4US 2DMOA 2JMCA 2AZSA 1TUCA 2JM8A 2K7AA 1SPKA 3VS2A 4E6RA 1GFDA 2RQTA 1QKWA 1HSQA 1FMKA 1SRLA 1Z9QA 5L23A 2DL3A 1AD5A 3EGUA 4QT7A 1JQQA 1GBRA 2EKHA 2A08A 1UHCA 2YT6A 1UJ0A 1OPKA 2KYBA 2JT4A 1W6XA 1H92A 1NLPC 1UE9A 2ED0A 2LMJA 1X6GA 2K6DA 2KROA 2LJ0A 5FW9A 1HJDA 2I0NA 1UJYA 2J06A 4JJDA 3REAB 2LJ3A 4RTVA 3QWYA 2LJ1A 2CT4A 3H0FA 2G6FX 2IIMA 5FWBA 5I11A 3I5SA 3VS3A 4J9DA 2F2VA 2AK5A 2DBMA 2CUBA 2KYMA 3O5ZA 4RTWA 5IXBA 1ZLMA 5IHIA 1SSHA 2W10A 1UHFA 5IHNA 1CKBA 1M27C 2CREA 4J9BA 3RNJA 1VA7A 2X3XD 3SHWA 5IH2A 2D8HA 1Z9ZA 1ZSGA 1PRMC 4F14A 2DE0X 2K2MA 4JPBW 1K9AA 1AWWA 2EYWA 2EGAA 4F17A 2HBWA 3NPFA 4LNPA 1AWXA 1UTIA 2LX7A 4OMNA 2JM9A 2XMFA 4A63B 4IIMA 1T0HA 4GBQA 1BB9A 2DRKA 2DNUA 4LN2A 1YCSB 4LUEA 2A36A 2DX1A 2HEQA 2EQIA 2DL8A 2M0YA 2RQUA 2HSPA 2EW3A 2DJQA 2O88A 1JO8A 2NUZA 2CSIA 2J6FA 2KR3A 2KNBB 2LNHB 2KXCA 3EG2A 4M4ZA 2DVJA 3VRYA 3VS5A 1V1CA 1I07A 2O9SA 1WFWA 2DBKA 3VS7A 1S1NA 1HD3A 1RLQC 1TG0A 2GGRA 1XOVA 3I35A 4FSSA 2NWMA 2OJ2A 2J05A 2HCKA 2MIOA 1H3HA 4AG1C 4Z88A 2FPEA 2CH4A 4D8KA 2CDTA 4WCIA 1QCFA 2VWFA 1NYFA 4GLMA 1K0XA 4RTZA 2KBTA 3EHRA 1PHTA 2RPNA 2BZ8A 2MOXA 3GBQA 3A98A 2FO0A 3M0TA 4LE9A 2M51A 3JV3A 1BBZA 1GFCA 1PNJA 4Z89A 1J3TA 2EBPA 3H0HA 4J9CA 5GJVB 1NLOC 2FRWA 2CSQA 1PRLC 1ZUYA 1WXBA 4OMPA 2ESWA 4Y92A 1AOJA 1ABOA 2F2WA 4AG2C 4CC2A 1AEYA 1PKTA 1X69A 2DL7A 1W70A 3U23A 3PVQA 1QKXA 1ABQA 3I9QA 3IQLA 2ECZA 1WDXA 4OMQA 3RBBB 1M3CA 2V1RA 1NEBA 1AZEA 4JJBA 3TSWA 3ZL7C 2BZYA 1K76A 2RF0A 5EC7A 1N5ZA 2C0IA 3VS1A 2EGCA 1AWJA 1ZBJA 2VVKA 4J9FA 4R0KA 1X2QA 1B3QA 2GTJA 2A37A 2C0TA 2JMAA 1E6GA 2O31A 1UECA 4J9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NMZ C;  4DEX A;  4K11 A;  5FWC A;  3ULR B;  4D8D A;  1H8K A;  2LQW A;  2RNA A;  3LH5 A;  5I22 A;  2YUQ A;  2ED1 A;  1GBQ A;  2FPF A;  4OMO A;  2OI3 A;  3EG3 A;  2RQV A;  2KXD A;  2L2P A;  1JEG A;  4HVW A;  2QDL A;  3M0Q A;  1MV0 B;  1M3A A;  4CC4 B;  3EG1 A;  1WA7 A;  1ZUU A;  1Y57 A;  4F16 A;  1CKA A;  1GCQ A;  4AFU C;  2AKL A;  2HDA A;  2DIL A;  2FEI A;  1UFF A;  1QWF A;  5IXF A;  1ZUK A;  3H41 A;  4AFZ C;  1VYV A;  1K1Z A;  4CC7 A;  4ESR A;  2KT1 A;  2YUP A;  3FJ5 A;  4RTX A;  4KRT A;  1YNZ A;  3VS0 A;  1K0S A;  1NM7 A;  1B07 A;  4DEY A;  3VRZ A;  1KSW A;  2C0O A;  2LCS A;  1I1J A;  2P4R A;  2KRN A;  1YP5 A;  2JW4 A;  1QLY A;  2EPD A;  2DM1 A;  2V1Q A;  1AVZ C;  3CQT A;  1BK2 A;  1AZG B;  1OPL A;  2J7I A;  3EG0 A;  3NGP A;  2FRY A;  2KT8 A;  1WXU A;  1X27 A;  3QWX X;  2EVR A;  2DA9 A;  3PE0 A;  2K3B A;  3H0I A;  1OEB A;  2KE9 A;  1MUZ A;  1SHF A;  1YWP A;  2E5K A;  2PTK A;  2B86 A;  1IO6 A;  1WX6 A;  2KRS A;  2YUN A;  4RTY A;  4HCK A;  1E7O A;  4OML A;  2SEM A;  1UUE A;  1YWO A;  2JS0 A;  1T0J A;  1M3B A;  2ENM A;  1ARK A;  3C0C A;  4OMM A;  1OV3 A;  1TUD A;  2K9G A;  3REB B;  3NHN A;  2J6O A;  3M0R A;  2GQI A;  2JTE A;  2W0Z A;  2F2X A;  2JXB A;  1MV3 A;  1RI9 A;  2DLP A;  2LP5 A;  1KJW A;  4JJC A;  2PZ1 A;  3PVL A;  1X6B A;  2YUO A;  1T3S A;  2X3W D;  2DYB A;  2CH4 W;  4J9H A;  2YSQ A;  2EGE A;  2RQR A;  4IIO A;  4RUG A;  2DL4 A;  3M0U A;  2L3Q A;  5HCK A;  4AFS C;  1PKS A;  3UF4 A;  3VS6 A;  1M8M A;  4JZ4 A;  1YN8 A;  2O2O A;  2D8J A;  4RTU A;  1SHG A;  1OOT A;  4ZNX A;  1ZX6 A;  5IHK A;  1FYN A;  2PNI A;  4J9E A;  5ECA A;  2SRC A;  2DL5 A;  3THK A;  3EHQ A;  1E6H A;  2K79 A;  1BU1 A;  4CC3 A;  4HVU A;  1X43 A;  3UA6 A;  1WI7 A;  2BZX A;  2H8H A;  2KRM A;  2OAW A;  3R6N A;  4LUD A;  4J9G A;  4RTT A;  4JZ3 A;  2FPD A;  1WIE A;  4AFQ C;  2CUD A;  1W1F A;  4HVV A;  2FG0 A;  1CSK A;  3VS4 A;  1RLP C;  1Y0M A;  4X1V A;  1KFZ A;  2LZ6 B;  3M0P A;  1GCQ C;  4EIK A;  2ABL A;  2D1X A;  2BTT A;  1KIK A;  2ROT A;  2RQW A;  1T3L A;  3SEM A;  2EYX A;  1U06 A;  1WXT A;  2KEA A;  3UA7 A;  2JS2 A;  2GBQ A;  3M0S A;  2DRM A;  1UDL A;  3UAT A;  1M30 A;  1U5S A;  1JXO A;  4ORZ A;  1UGV A;  2EYZ A;  1I0C A;  2LQN A;  2L0A A;  2MCN A;  2YDL A;  1A0N B;  1RUW A;  1U3O A;  1JXM A;  2L3S A;  1LCK A;  1SRM A;  2RN8 A;  2AZV A;  2GNC A;  1G83 A;  1WLP B;  1AWO A;  1NYG A;  1EFN A;  1GL5 A;  1X2K A;  2KGT A;  3I5R A;  2D0N A;  1NG2 A;  2AKK A;  1WYX A;  1UG1 A;  1VYT A;  1NEG A;  1SEM A;  2GTO A;  3TVT A;  2RMO A;  1VYU A;  2EYY A;  4HXJ A;  2VKN A;  5GJW B;  1QWE A;  2J6K A;  2L3P A;  2CT3 A;  1PWT A;  1JU5 C;  2O9V A;  2DF6 A;  1G2B A;  1GCP A;  3TSZ A;  1GRI A;  2ROL A;  4Z8A A;  2A28 A;  3KFV A;  1K4U S;  2DMO A;  2JMC A;  2AZS A;  1TUC A;  2JM8 A;  2K7A A;  1SPK A;  3VS2 A;  4E6R A;  1GFD A;  2RQT A;  1QKW A;  1HSQ A;  1FMK A;  1SRL A;  1Z9Q A;  5L23 A;  2DL3 A;  1AD5 A;  3EGU A;  4QT7 A;  1JQQ A;  1GBR A;  2EKH A;  2A08 A;  1UHC A;  2YT6 A;  1UJ0 A;  1OPK A;  2KYB A;  2JT4 A;  1W6X A;  1H92 A;  1NLP C;  1UE9 A;  2ED0 A;  2LMJ A;  1X6G A;  2K6D A;  2KRO A;  2LJ0 A;  5FW9 A;  1HJD A;  2I0N A;  1UJY A;  2J06 A;  4JJD A;  3REA B;  2LJ3 A;  4RTV A;  3QWY A;  2LJ1 A;  2CT4 A;  3H0F A;  2G6F X;  2IIM A;  5FWB A;  5I11 A;  3I5S A;  3VS3 A;  4J9D A;  2F2V A;  2AK5 A;  2DBM A;  2CUB A;  2KYM A;  3O5Z A;  4RTW A;  5IXB A;  1ZLM A;  5IHI A;  1SSH A;  2W10 A;  1UHF A;  5IHN A;  1CKB A;  1M27 C;  2CRE A;  4J9B A;  3RNJ A;  1VA7 A;  2X3X D;  3SHW A;  5IH2 A;  2D8H A;  1Z9Z A;  1ZSG A;  1PRM C;  4F14 A;  2DE0 X;  2K2M A;  4JPB W;  1K9A A;  1AWW A;  2EYW A;  2EGA A;  4F17 A;  2HBW A;  3NPF A;  4LNP A;  1AWX A;  1UTI A;  2LX7 A;  4OMN A;  2JM9 A;  2XMF A;  4A63 B;  4IIM A;  1T0H A;  4GBQ A;  1BB9 A;  2DRK A;  2DNU A;  4LN2 A;  1YCS B;  4LUE A;  2A36 A;  2DX1 A;  2HEQ A;  2EQI A;  2DL8 A;  2M0Y A;  2RQU A;  2HSP A;  2EW3 A;  2DJQ A;  2O88 A;  1JO8 A;  2NUZ A;  2CSI A;  2J6F A;  2KR3 A;  2KNB B;  2LNH B;  2KXC A;  3EG2 A;  4M4Z A;  2DVJ A;  3VRY A;  3VS5 A;  1V1C A;  1I07 A;  2O9S A;  1WFW A;  2DBK A;  3VS7 A;  1S1N A;  1HD3 A;  1RLQ C;  1TG0 A;  2GGR A;  1XOV A;  3I35 A;  4FSS A;  2NWM A;  2OJ2 A;  2J05 A;  2HCK A;  2MIO A;  1H3H A;  4AG1 C;  4Z88 A;  2FPE A;  2CH4 A;  4D8K A;  2CDT A;  4WCI A;  1QCF A;  2VWF A;  1NYF A;  4GLM A;  1K0X A;  4RTZ A;  2KBT A;  3EHR A;  1PHT A;  2RPN A;  2BZ8 A;  2MOX A;  3GBQ A;  3A98 A;  2FO0 A;  3M0T A;  4LE9 A;  2M51 A;  3JV3 A;  1BBZ A;  1GFC A;  1PNJ A;  4Z89 A;  1J3T A;  2EBP A;  3H0H A;  4J9C A;  5GJV B;  1NLO C;  2FRW A;  2CSQ A;  1PRL C;  1ZUY A;  1WXB A;  4OMP A;  2ESW A;  4Y92 A;  1AOJ A;  1ABO A;  2F2W A;  4AG2 C;  4CC2 A;  1AEY A;  1PKT A;  1X69 A;  2DL7 A;  1W70 A;  3U23 A;  3PVQ A;  1QKX A;  1ABQ A;  3I9Q A;  3IQL A;  2ECZ A;  1WDX A;  4OMQ A;  3RBB B;  1M3C A;  2V1R A;  1NEB A;  1AZE A;  4JJB A;  3TSW A;  3ZL7 C;  2BZY A;  1K76 A;  2RF0 A;  5EC7 A;  1N5Z A;  2C0I A;  3VS1 A;  2EGC A;  1AWJ A;  1ZBJ A;  2VVK A;  4J9F A;  4R0K A;  1X2Q A;  1B3Q A;  2GTJ A;  2A37 A;  2C0T A;  2JMA A;  1E6G A;  2O31 A;  1UEC A;  4J9I A; 
#chains in the Genus database with same CATH topology
 4JUV A;  3NMZ C;  4M77 A;  2FHD A;  1U8R A;  1QCO A;  4FL6 A;  4D8D A;  1AT1 B;  2YHT A;  1VQ5 A;  1VIE A;  3P8H A;  5FU6 B;  5I22 A;  5I21 A;  2YUQ A;  2NUP B;  5AYF A;  4JRI A;  4PLL A;  5KE2 A;  1WHM A;  4HVW A;  3M0Q A;  1H64 1;  1M3A A;  3EG9 A;  1ZQ1 A;  1CKA A;  1YBY A;  4PK4 A;  3UPU A;  1GCQ A;  3URG A;  2AKL A;  4XTW A;  3QUI A;  5A0L A;  2FEI A;  3A8O B;  2OTJ Q;  1UFF A;  1JJ2 A;  4BUG A;  1ZUK A;  3G4S T;  3S3N A;  4Z02 A;  1QVF A;  1B07 A;  4LXC A;  2H3J A;  4DEY A;  4QVD A;  3HFO A;  5GMK i;  3CCQ A;  1I1J A;  1QVG A;  1YP5 A;  5D7U A;  2EPD A;  2DM1 A;  3CQT A;  1AZG B;  1OPL A;  2J7I A;  2QDY B;  1NJI C;  3EG0 A;  3JCM h;  3X25 B;  2FRY A;  3LWH A;  1WXU A;  5C6S A;  4A54 A;  1BI3 A;  3H0I A;  3QII A;  3CXC A;  4PJO C;  4OB3 B;  2E6Z A;  1IZ6 A;  1SHF A;  1YWP A;  4MZP A;  2COY A;  3OBY A;  1WX6 A;  2PVD B;  5IN1 A;  3OW2 S;  1JBM A;  3OYG A;  5D6Y A;  2SEM A;  1UUE A;  3I56 Q;  3A5Z B;  4M75 G;  3S3O A;  2CP6 A;  4XTZ A;  3A8M B;  1HYO A;  2E4H A;  2RI2 A;  2GQI A;  3A8H B;  1M90 R;  2F2X A;  3I55 Q;  2JXB A;  1RI9 A;  2P0P A;  2DLP A;  3QJY A;  5FRO A;  2LP5 A;  3CCL A;  4JJC A;  2F5K A;  2EQJ A;  1PD0 A;  2DYB A;  3CCU T;  2CH4 W;  4J6Y A;  4IIO A;  2QEX T;  1GXI E;  2L3Q A;  5HCK A;  4AFS C;  1UGS B;  3QDR B;  3BDL A;  2XI9 A;  2D8J A;  4IUU A;  4RTU A;  2JOY A;  1ZSZ B;  1WHJ A;  1Y71 A;  2PNI A;  1BYM A;  1PSE A;  2DL5 A;  3EFO A;  3E9F A;  5GAO n;  1Q86 C;  4DBR A;  4PJO G;  3M56 A;  1U1T A;  2XHC A;  2LT1 A;  1WI7 A;  2VB6 A;  1UGQ B;  4DA4 A;  2RH2 A;  4RTT A;  2CYZ B;  2FPD A;  2Y4X A;  1U1S A;  2RK1 A;  2DZC A;  3J80 E;  4BE0 A;  1W1F A;  1WQW A;  2F5T X;  2L8D A;  4J7F A;  4N4I A;  2RJC A;  4RCC A;  4X1V A;  1UGP B;  2QA4 T;  2ABL A;  3S3M A;  2BTT A;  3CCS T;  1MNE A;  1T3L A;  1KD1 R;  4KGZ B;  1YIJ T;  4RCB A;  1K9M U;  2GBQ A;  3M0S A;  5GAM e;  4M7A F;  1MND A;  3AT1 B;  1Q82 U;  3OYD A;  2YRC A;  1XQH A;  3G7Z A;  3C94 A;  3FJP A;  2DIG A;  5GAN d;  1KQS A;  4PFZ A;  4FYY B;  2MWP A;  3CC2 A;  2EIF A;  3JAM E;  3HHT B;  1LCK A;  1SRM A;  4X9D A;  3CCE A;  4KBM B;  3CCR T;  1NZ9 A;  4M75 A;  1AWO A;  1Y7X A;  2COZ A;  3OMG A;  3QBY A;  3L1A A;  5LL6 S;  3FDR A;  2X35 A;  3CPW P;  1SEM A;  1C6V X;  3JCM W;  1V76 A;  2J6K A;  2L3P A;  3G6E Q;  5FRM A;  3H8Z A;  1OUL A;  4HT9 A;  1PWT A;  2X4W A;  1VQ4 T;  1QW1 A;  1Y07 A;  2LT4 A;  3L2W A;  2G3R A;  4Z8A A;  3KFV A;  1VOM A;  2AZS A;  3MET A;  3MJX A;  4DQ2 A;  1SPK A;  3CBM A;  4V2S A;  2LDM A;  4C8Q C;  1QKW A;  1HSQ A;  2L5Q A;  3J81 E;  1FMW A;  5L23 A;  3CCV T;  3DB3 A;  2E12 A;  2HKQ B;  1JQQ A;  5CCA A;  2K2V A;  3QYH B;  4PJO A;  8ATC B;  5KCO A;  3V8K A;  2YT6 A;  4MZM A;  1UJ0 A;  4MDW A;  4M7D G;  4ZN1 A;  1VQN T;  5KE3 A;  1S72 T;  2XID A;  3EH1 A;  2LTO A;  2LJ0 A;  4PFO A;  1YJ9 T;  3FRN A;  3PMI A;  2EAY A;  4M7A G;  4HT8 A;  4QQG A;  3EAE A;  1JRI A;  2LJ1 A;  4ZN3 A;  5GMK l;  3H0F A;  2G6F X;  3GP8 A;  1UEB A;  4LDV A;  1YJW Q;  5CKB A;  1VQ6 Q;  2X4X A;  4J9D A;  2KK4 A;  2KYM A;  1VQL T;  2IG0 A;  1SSH A;  5IHN A;  2DEQ A;  5KYW B;  1K8A R;  1N8R C;  3CCM Q;  1D1A A;  4E2F B;  1YIT A;  1PRM C;  2K2M A;  5GAN g;  2JTM A;  4DBF A;  1AWW A;  4A4E A;  1VQM T;  3RER A;  3EFR A;  2EGA A;  2HSE B;  2HBW A;  3NPF A;  4LNP A;  3UWN A;  1G3Y A;  2XMF A;  4BAC A;  1PSF A;  3QHS A;  1T0H A;  3S6W A;  1VQ8 T;  3CCJ Q;  3ZEH A;  3OSS C;  4M78 B;  2DL8 A;  4FW2 A;  3MO8 A;  4OB2 B;  1IGQ A;  3X26 B;  2EW3 A;  2O88 A;  1JO8 A;  2NUZ A;  5D6X A;  1V1C A;  2O9S A;  1WFW A;  2F1L A;  3E9G A;  3CBP A;  2RK2 A;  3M59 A;  5CQY A;  3JCM X;  4PKC C;  1M5Q 1;  1RLQ C;  2DEU A;  1TG0 A;  4N0A C;  1XOV A;  2RHZ A;  3I35 A;  2QQB A;  2HCK A;  3V7R A;  4M7D A;  2L3R A;  4P5N A;  4GLM A;  2D0Q B;  1W4S A;  4RTZ A;  3EHR A;  4EMK C;  3A1P A;  3EGX B;  4GLK A;  2KDS A;  2MOX A;  3GBQ A;  2PVG B;  1R8O B;  3GF5 A;  4IUQ A;  2OTL T;  3G4S A;  4C0F A;  3JCM e;  4J83 A;  3CBO A;  1UB4 A;  1YFN A;  3FB9 A;  2E70 A;  2MI6 A;  2RM4 A;  1YI2 T;  1MMN A;  1PRL C;  1ZUY A;  1WXB A;  3VYH B;  1Q81 U;  4OMP A;  1YJN T;  1KC8 R;  1X6O A;  4C8Q A;  4BY6 B;  2DL7 A;  1QKX A;  4OMQ A;  4JS4 A;  5LJ5 f;  1NEB A;  1MMD A;  4IUR A;  2YRD A;  3SWN B;  3TSW A;  2BZY A;  2RF0 A;  1YCY A;  2BUD A;  3VS1 A;  5LJ3 f;  1AWJ A;  3KBG A;  1ZBJ A;  3OQ5 A;  4BDY A;  1X2Q A;  5EG2 A;  9ATC B;  4A4K A;  2DD5 A;  4M78 D;  2C06 A;  1VQ7 A;  4J9I A;  3CPW A;  3CCQ Q;  3L2V A;  1K73 R;  5FU6 C;  5FLX E;  2LQW A;  2QTX A;  2E5Q A;  3CCU A;  3CC4 Q;  1M1G A;  1IXD A;  2DET A;  3OYC A;  2IPO B;  4II1 A;  4IUT A;  3EG3 A;  5CK9 A;  4MMK A;  3M58 A;  2JZ2 A;  1MV0 B;  4C92 B;  3EG1 A;  1Y57 A;  1Q82 C;  1W2B P;  4M78 E;  4C8Q D;  4EMH A;  5GAN 4;  1TUG B;  1ZBX A;  3H41 A;  4AFZ C;  1K1Z A;  3CCL Q;  2KT1 A;  2YUP A;  2QXF A;  2JNG A;  2D6F A;  3VS0 A;  1IHV A;  3HPW A;  4F7U G;  2IVW A;  2KRN A;  1QLY A;  4BE2 A;  2VYT A;  2DTH A;  1Q7Y R;  1BK2 A;  4PNO A;  1D3B A;  3CCS A;  5DY9 A;  3Q1J A;  3QXE B;  4C0Z A;  1X27 A;  3QWX X;  2EVR A;  2K3B A;  1WQ7 A;  1YIJ A;  1EIF A;  1MUZ A;  2R58 A;  3E19 A;  3OYY A;  2ZPG B;  2E5K A;  2PTK A;  3C4S A;  4HCK A;  1E7O A;  2VGM A;  2M9U A;  1YWO A;  3DLM A;  2JS0 A;  2PQW A;  3MP6 A;  1M3B A;  1OV3 A;  1I8F A;  3REB B;  1MMG A;  2ATC B;  4N0A A;  2QYZ A;  3D7S B;  4FT4 A;  2JTE A;  3CCR A;  1OZ2 A;  1M2O A;  1WJS A;  1MV3 A;  1B7T A;  2A0F B;  3I56 T;  3PVL A;  3EH2 A;  3JRZ A;  2RD1 A;  2ZPH B;  1Y96 B;  4J9H A;  2M16 A;  4EMK A;  2YSQ A;  2EGE A;  2RQR A;  3M0U A;  1BI2 A;  5FU7 B;  1Q86 R;  2COW A;  1LJO A;  1ZSZ C;  3G1J A;  1M8M A;  1M9S A;  4JZ4 A;  4ANJ A;  2O2O A;  4A53 A;  4E7S A;  2EFI A;  2KSS A;  1VQK T;  5CKF A;  2JVV A;  1M90 U;  2XDD A;  3THK A;  3R6O A;  1E6H A;  3MP8 A;  5A0D A;  1BU1 A;  4M75 F;  4M77 B;  4X34 A;  3CC2 Q;  2LVM A;  3WVD B;  3CCE Q;  2XIC A;  1YHQ T;  1I5L A;  5IAY A;  2KRM A;  3L2U A;  2OAW A;  3R6N A;  4LUD A;  1WIE A;  2QQ9 A;  2RHX A;  4DOW A;  2YLB A;  1Y0M A;  2LZ6 B;  4PFP A;  4EIK A;  4F7U A;  3VJP A;  3EG9 B;  3KUF A;  2DYI A;  2LC4 A;  5M9O A;  2RQW A;  4C92 E;  3SEM A;  1U06 A;  1WXT A;  2EJG A;  3MPU B;  1VQO T;  2NUT B;  1U5S A;  5DM7 R;  4PJO F;  4KGV B;  3ER0 A;  2FZK B;  3SD4 A;  2HZY A;  1OQK A;  3UDC A;  3CC7 Q;  1X01 A;  1WJQ A;  1VQL A;  1U3O A;  5GAM f;  2L3S A;  1C1A A;  1FWZ A;  2GNC A;  4E7L A;  1PC0 A;  2FL7 A;  3CC4 A;  1KD1 U;  3I5R A;  4WF2 A;  2K5L A;  1M1F A;  1WYX A;  1UG1 A;  3WXM B;  1G8X A;  1NEG A;  2BKD N;  2GTO A;  3OYE A;  2EYY A;  4HXJ A;  2QI2 A;  1JU5 C;  1VQ9 T;  2DF6 A;  1FMV A;  1G2B A;  2VC8 A;  5DLO A;  1OZ3 A;  2CP0 A;  2A28 A;  3OW2 P;  2JMC A;  3BW1 A;  1PM3 A;  5L8R E;  2JM8 A;  1FXX A;  2E41 A;  3G6E T;  2FVU A;  2KQW A;  2F69 A;  1D09 B;  1GFD A;  3JB9 I;  4XU3 A;  1EZZ B;  2RB6 A;  1FMK A;  1SRL A;  1TS9 A;  2RI5 A;  1AD5 A;  1R0B G;  2RJD A;  1GBR A;  2EKH A;  2CZ6 B;  1UHC A;  2PVO B;  1QMC A;  1TU0 B;  1OPK A;  3FC3 A;  1Q81 C;  2HNI A;  4BI8 B;  4XU0 A;  1UE9 A;  3VUZ A;  1YIT Q;  2LNV A;  2K6D A;  2RJE A;  1W2B A;  4GY5 A;  2QG9 B;  1UJY A;  2JTF A;  2XDP A;  3C12 A;  3REA B;  5LJ5 g;  2ZPE B;  3QWY A;  5FRN A;  4XTV A;  1XJW B;  2MK5 A;  5FWB A;  4M77 E;  1HK9 A;  3GIB A;  3I5S A;  2HQX A;  3CD6 T;  1N8R R;  1V29 B;  1WHK A;  2QGG A;  3M9Q A;  2DBM A;  5I2M A;  4J5Y A;  3RES A;  3O5Z A;  5IXB A;  3OYJ A;  3MEU A;  1YJW T;  4XU2 A;  1LVK A;  3MEA A;  1UHF A;  1VQ6 T;  2LCL A;  1CKB A;  2CRE A;  1VQP T;  4LD6 A;  4M7D F;  1YJN A;  1VA7 A;  2CP2 A;  3CME T;  4Y28 E;  3SHW A;  5GAN 2;  2FZC B;  2QQS A;  5GAN e;  1BCO A;  2B8A A;  2GFA A;  4FT2 A;  2D8H A;  3JB9 D;  3OYH A;  2YXY A;  1SG5 A;  4JPB W;  3J7A F;  1WZO A;  1K9A A;  2QAZ A;  4IKF A;  2MF2 A;  3QG1 A;  1UTI A;  4FU6 A;  4C0G A;  4IIM A;  1BB9 A;  4M78 C;  5A0G A;  3OYL A;  4KUI A;  2EQM A;  4M75 B;  2A36 A;  3RIR A;  3G4S Q;  1RAE B;  1K8A U;  1N9S A;  2EQI A;  2KVQ G;  4JRP A;  1I4K 1;  3L42 A;  3X24 B;  2CSI A;  4C8Q F;  2KR3 A;  3WVE B;  2WSF E;  2LNH B;  3EG2 A;  2DVJ A;  2KI7 A;  3SFM A;  1I07 A;  3AHU A;  3BE3 A;  5LJ5 j;  3HKS A;  4KUL A;  1HD3 A;  1C0M A;  5GAO m;  2MIO A;  3DLL A;  3BDU A;  1H3H A;  1BIB A;  3HRS A;  1P92 A;  3M4G A;  3PT9 A;  4EDU A;  2CDT A;  4WCI A;  1QCF A;  1NYF A;  2EQK A;  2HAX A;  2KBT A;  3CMA T;  1PHT A;  3A98 A;  5LJ5 h;  3CC7 A;  4PJO B;  1VQ7 Q;  2CKK A;  4PLI A;  4AMC A;  1IRX A;  1PNJ A;  5LJ3 h;  5KYU B;  4C5I A;  4O5V A;  4XTX A;  3H0H A;  4JS5 A;  3CCU Q;  1NLO C;  2QEX Q;  2V8K A;  2I2L A;  4BY6 C;  2RI3 A;  4J6X A;  4FW1 A;  1VQ5 T;  4CC2 A;  1M8V A;  1AEY A;  1X69 A;  5HY6 A;  3SWN C;  2RHU A;  3O8V A;  1M3C A;  1XTD A;  3PTA A;  4JJB A;  2A3L A;  1SKU B;  3ZL7 C;  1M90 C;  2X9H A;  2ZAE A;  2C0I A;  2JN0 A;  4XU1 A;  3JCM c;  1B3Q A;  2A37 A;  1D1B A;  2O4X B;  4MDX A;  2P0Q A;  4C8Q G;  1KC8 U;  1WJR A;  3CEY A;  2A7Y A;  4K11 A;  2RHY A;  5FWC A;  3ULR B;  2KMT A;  4JDS A;  1H8K A;  3EGD B;  2GFU A;  2RNA A;  3LH5 A;  2FB7 A;  1ACM B;  3CCS Q;  3CCQ T;  2D9T A;  5HKC A;  1RAA B;  1TH7 A;  1GBQ A;  2MWO A;  4KT0 E;  1XNI A;  3OW2 A;  4MZT A;  4OMO A;  3G71 T;  1YIJ Q;  1VUB A;  4C92 C;  3QJ6 A;  1B34 B;  3PIP A;  2L2P A;  3FIF A;  1JEG A;  4XTU A;  2YWW A;  5J26 A;  5KYW A;  2DIQ A;  1ZUU A;  4F16 A;  7AT1 B;  2DVE A;  4AFU C;  4M75 E;  4B9X A;  2HDA A;  1K73 U;  3M57 A;  2LQ8 A;  3ZBD A;  3OSV A;  5GAN 5;  1TSF A;  1YHQ A;  5CIU A;  3HTR A;  3CCR Q;  3MEW A;  2RA2 A;  6AT1 B;  4RTX A;  2PU9 B;  3VRZ A;  3RMQ A;  2PUO B;  1BIA A;  2C0O A;  2P4R A;  5KYY B;  2EQU A;  1BI0 A;  4M7D B;  3LW5 E;  4Q5W A;  3MCA B;  4M78 A;  4BI4 A;  3NGP A;  2KT8 A;  1VQ4 Q;  2MMP A;  3OS5 A;  4L59 A;  4M7A B;  4DBH A;  4NS5 A;  3E1S A;  2B86 A;  1VQO A;  2KRS A;  2VXE A;  2H3E B;  4PJO E;  4OML A;  4PJJ A;  1M1K R;  4XQ3 A;  3CCV Q;  3L2Z A;  2MYS A;  4OMM A;  1TUD A;  2K9G A;  1Q7Y U;  4JRK A;  3M0R A;  2M02 A;  4AT1 B;  4F7U F;  3E2U A;  1WPY A;  3QO3 A;  1X6B A;  1T3S A;  2X3W D;  5FU7 C;  1WGS A;  2FYK A;  2RHI A;  2VUB A;  2OX7 A;  4RUG A;  2DL4 A;  5KYX B;  1YJ9 Q;  1QVF S;  1PKS A;  3UF4 A;  2EJ9 A;  3LLR A;  3FEO A;  2NLU A;  1YN8 A;  1G5V A;  1D0X A;  4A4G A;  4QVC A;  1SHG A;  3GLX A;  4ZNX A;  1FYN A;  5ECA A;  1RAI B;  2SRC A;  4M77 C;  1N6A A;  2K79 A;  4CC3 A;  1VQL Q;  3CXC S;  4BI3 A;  3UA6 A;  3M55 A;  1R77 A;  2BZX A;  5KH6 A;  3RDV A;  5J3B A;  3SDZ A;  1Q86 U;  1MGQ A;  2QEX A;  3PMT A;  2CUD A;  1BCM A;  4HVV A;  2FG0 A;  1NE8 A;  3PIO A;  1CSK A;  1RAC B;  1NPP A;  1KFZ A;  1GCQ C;  2CGH A;  2D1X A;  1K9M C;  1KIK A;  4DBQ A;  1RAG B;  1VQM Q;  2CS7 A;  1OU9 A;  2DTO A;  2AIR B;  4LDX A;  2KEA A;  2JUF A;  2JS2 A;  3FLG A;  4TVR A;  2DRM A;  1UDL A;  4D6W A;  3OS1 A;  4E7I A;  1PD1 A;  1NJI R;  1M30 A;  1VQ8 Q;  1JXO A;  2RO0 A;  3VV0 A;  4ORZ A;  4A4H A;  2LQN A;  3RUX A;  2MCN A;  3JCM b;  2YDL A;  1OI1 A;  2K3Y A;  1RUW A;  1G3S A;  4FYX B;  1JXM A;  2OTJ T;  4C92 A;  1M2V A;  2RN8 A;  2AZV A;  1ZHI A;  1G83 A;  1WLP B;  4M7D E;  1D3B B;  4X9C A;  1NYG A;  4OP0 A;  2QA4 A;  1OYX A;  1TWB A;  2KGT A;  1NG2 A;  2K5F A;  3CME A;  5HK3 A;  4BE1 A;  1VYT A;  4JLI A;  3DKM A;  1VYU A;  2VKN A;  5GJW B;  4M7A E;  3HFN A;  2CT3 A;  4C0D B;  2O9V A;  2MPX C;  3DB4 A;  1GCP A;  3TSZ A;  5CKD A;  1GRI A;  2ROL A;  2VAS A;  5CVI A;  2BE9 B;  3P8B B;  3OA6 A;  1K4U S;  3VYG A;  1TUC A;  2DXT A;  3VS2 A;  2DJZ A;  4HCC A;  2OTL Q;  2Y4Y A;  1OX9 A;  2Y90 A;  1Z9Q A;  2HBP A;  4QT7 A;  4NL3 A;  4EMK B;  3X20 B;  3OYF A;  1YI2 Q;  1YJN Q;  3I55 T;  2L89 A;  2KYB A;  1QQJ A;  2XK0 A;  2JT4 A;  1W6X A;  2LRQ A;  1TOV A;  2OAU A;  2E10 A;  1LNX A;  2LMJ A;  1RAB B;  1X6G A;  1VQ4 A;  2KRO A;  5GAO r;  4C92 D;  4LDY A;  3PGG A;  1HJD A;  2J06 A;  2ZPB B;  4JJD A;  2LJ3 A;  1Y96 A;  4PJL A;  4C5G A;  2IIM A;  5GAO q;  3CCV A;  5LJ5 d;  1RL2 A;  4IUP A;  3VS3 A;  2QQA A;  2AK5 A;  5KYN A;  1KC8 C;  2CUB A;  5LJ3 d;  1ZLM A;  5IHI A;  1VQN A;  1M4Z A;  3LX7 A;  1M27 C;  4F7U B;  4RG8 A;  5GAN 7;  1S72 A;  4J9B A;  3GPL A;  3QDF A;  3RKW A;  1YJ9 A;  2E65 A;  4DOV A;  5IH2 A;  1Z9Z A;  1ZSG A;  3GNG A;  2DE0 X;  1N8R U;  2ZCF B;  4FM4 B;  2O01 E;  2NUP A;  2EYW A;  3NTH A;  5GAN 6;  5GAN f;  1SSF A;  3JCM V;  1AWX A;  4OMN A;  2JM9 A;  4JRQ A;  2V8J A;  1K73 C;  1IRE B;  1QP3 A;  4M75 C;  1MHN A;  2DRK A;  2RJF A;  2DNU A;  5GMK m;  4LN2 A;  2QK0 A;  2M1H A;  4N4G A;  3RMS A;  2HSP A;  2DJQ A;  2EWN A;  1R0C B;  3JSC A;  3HP9 A;  2KNB B;  2NUT A;  2DER A;  4M4Z A;  3TQ7 P;  3RKY A;  1ZA2 B;  2GQV A;  3VRY A;  2XD0 A;  8AT1 B;  3QKJ A;  1N9R A;  1VIF A;  2DKG A;  3VS7 A;  1S1N A;  5GAN 8;  2DAQ A;  1KG1 A;  3G71 A;  1VQM A;  2GGR A;  4FSS A;  2NWM A;  2OJ2 A;  2CZ1 B;  4HCB A;  4AG1 C;  2E3H A;  2CH4 A;  3L2Q A;  2DFU A;  1VQ8 A;  2VWF A;  4M77 D;  1K0X A;  4HKE A;  3OYA A;  2CZ7 B;  2HMA A;  3VU3 C;  1Q7Y C;  4LE9 A;  3JV3 A;  3M54 A;  1GFC A;  2DK3 A;  2HQH A;  1J3T A;  4QQ6 A;  2EBP A;  2AHJ B;  3QYG B;  4OF1 A;  4KH1 B;  1VQ7 T;  2E64 A;  1KQ1 A;  3M53 A;  3C95 A;  1AOJ A;  3EFO B;  2F2W A;  2E6N A;  1PKT A;  4NOY A;  1TTH B;  3IQL A;  2X4Y A;  3I9Q A;  1VQK Q;  4OGE A;  3M5A A;  1WDX A;  3OMC A;  2YRV A;  1X75 C;  2V1R A;  4J6W A;  5LJ3 g;  2K5I A;  1N5Z A;  3PFS A;  3OYI A;  2HL3 A;  4ZGE B;  1WNL A;  1N27 A;  5GAO p;  2P4T A;  2OTL A;  1ZSZ A;  4E7J A;  4J9F A;  4ELZ C;  1YHQ Q;  2GTJ A;  3F70 A;  2HKN A;  1WHG A;  2C0T A;  2DZ9 A;  1D1C A;  1UEC A;  4E7K A;  4XK8 E;  2PUK B;  3LGF A;  4F7U E;  2DXC A;  4M78 F;  2GF7 A;  5J39 A;  1YI2 A;  1WHH A;  4DEX A;  4N4H A;  5CR2 A;  2E1H A;  4C5H A;  4ZGD B;  4E47 A;  4BD3 A;  2R5A A;  2BE7 D;  2ED1 A;  3HRT A;  2FPF A;  3CCM T;  2OI3 A;  2RQV A;  2KXD A;  2R5M A;  1VQO Q;  2QDL A;  1OX8 A;  4CC4 B;  1G3W A;  1WA7 A;  2CP5 A;  2DPP B;  4YTL A;  5GMK j;  2K57 A;  4QKU A;  2DIL A;  1JB0 E;  3V7C A;  3X28 B;  1QWF A;  5IXF A;  2LX9 A;  3CCJ T;  1VYV A;  4ESR A;  4CC7 A;  3FJ5 A;  4KRT A;  1YNZ A;  3BY7 A;  1K0S A;  1NM7 A;  4HCZ A;  1KSW A;  4M7D C;  2LCS A;  5GAM d;  4B6M A;  2JW4 A;  4ME7 A;  3HRU A;  2V1Q A;  1AVZ C;  1LOJ A;  5LJ3 j;  2CZ0 B;  4KH0 B;  5GMK h;  2HQE A;  3CPW S;  3VUB A;  4F04 B;  2QAS A;  4MML A;  1VQ9 Q;  1NBE B;  3JB9 H;  4HA8 A;  4M7A C;  2DA9 A;  3PE0 A;  1RI0 A;  2BIV A;  3V8L A;  1OEB A;  4UC4 A;  2KE9 A;  1D0Y A;  2ZGW A;  1IO6 A;  2FZG B;  1KQ2 A;  2YUN A;  3H6Z A;  1RAF B;  4RTY A;  2CP3 A;  3KXT A;  5AT1 B;  1MMA A;  2MAM A;  1T0J A;  2ENM A;  5C0M A;  3C0C A;  1O9S A;  4CI0 C;  2DXB A;  1ARK A;  1SF9 A;  4M78 G;  4Y91 A;  3NHN A;  2J6O A;  2OTJ A;  3L2R A;  2W0Z A;  4ZGJ B;  5D6W A;  1KHI A;  2XDB A;  1KJW A;  3JCM f;  1BI1 A;  2PZ1 A;  5HK0 A;  3JB9 J;  2YUO A;  4ZTJ A;  4J8O A;  3CPF A;  4OVA A;  4PL6 A;  5KYU A;  3RKX A;  3VS6 A;  3HL8 A;  1M1K U;  1FX7 A;  1LPL A;  2ZZD A;  2JJ9 A;  1OOT A;  1I5O B;  4QVZ A;  1ZX6 A;  5IHK A;  4J9E A;  4OB1 B;  2K3X A;  2DO3 A;  3OB9 A;  4A4F A;  3CD6 Q;  4C92 F;  4M75 D;  4JJN K;  3EHQ A;  4BDZ A;  4HVU A;  1X43 A;  3I56 A;  3TRE A;  3TCJ A;  2H8H A;  1K9M R;  3ME9 A;  3LYI A;  4LDU A;  1TXQ A;  2LCC A;  4J9G A;  1OU8 A;  4JZ3 A;  3V8J A;  1VQP Q;  1Q82 R;  3LH0 A;  3A8G B;  4AFQ C;  2QA4 Q;  4IUV A;  1O75 A;  3H9N A;  3I55 A;  5A2Q E;  3T9N A;  3CME Q;  1PCX A;  4EMG A;  2O4X A;  3VKI A;  4E7Z A;  4B9W A;  3VS4 A;  1RLP C;  2V26 A;  4FIB A;  4L5G A;  3M0P A;  3CC4 T;  4ATO A;  3EFS A;  1VQK A;  2E3I A;  4LDW A;  2ROT A;  2P84 A;  4QQD A;  2KAF A;  2EYX A;  2QTV A;  3EGD A;  3UA7 A;  4PJO D;  4BB7 A;  3LGL A;  3UAT A;  4ELY C;  3OS2 A;  4R56 A;  3NTK A;  5DLQ E;  3MKD A;  1IGU A;  4KUD K;  1UGV A;  2EYZ A;  1I0C A;  2L0A A;  5CAI A;  5GAM g;  3P8D A;  1A0N B;  1B34 A;  2VGN A;  3MEV A;  2WAC A;  3OBW A;  1PG5 B;  1KD1 C;  4OB0 B;  2DTI A;  5CO7 A;  3OYM A;  3JCM J;  3CCL T;  1DJ7 B;  1QP2 A;  2EYQ A;  1IHW A;  1EFN A;  4OGC A;  1GL5 A;  4XAX B;  1X2K A;  2D0N A;  2AKK A;  4PJM A;  2RMO A;  3TVT A;  2X51 A;  4C0D C;  1NJI U;  2AT1 B;  1QVP A;  3OYB A;  1QWE A;  4VUB A;  3QSU A;  3N5B B;  1RAH B;  2P0K A;  4C92 G;  5KYY A;  3CMA Q;  2DMO A;  2VXF A;  2CP7 A;  4FSX A;  2K7A A;  2YLC A;  4E6R A;  2RQT A;  3QZ9 B;  3INZ A;  3TU4 K;  4M77 F;  2DL3 A;  3EGU A;  1VQN Q;  4C8Q B;  1NPR A;  4M7A A;  3EGX A;  2A08 A;  1S72 Q;  3M4Y A;  4KGX B;  1JJ2 S;  3V7S A;  3NTI A;  1JJ2 P;  4NL2 A;  4FCY A;  4EPC A;  1G3T A;  1H92 A;  1VQ5 Q;  5GAN j;  1NLP C;  1QVF P;  1QVG S;  2ED0 A;  1VQ9 A;  1QVG P;  1RAD B;  3JCM d;  5GAM j;  5FW9 A;  2LQK A;  2I0N A;  4R55 A;  3HSB A;  2QQR A;  3G6E A;  4RTV A;  4RG2 A;  3GOX A;  2CT4 A;  5KYX A;  2GCX A;  3PNW C;  3LWI A;  4QW2 A;  3CXC P;  5I11 A;  4PJN A;  3MP1 A;  3SWN A;  2F2V A;  5GAN h;  1BKB A;  3BFM A;  3CC2 T;  2DXU A;  5CKE A;  3CCE T;  4RTW A;  2X4J A;  5GAM h;  2W10 A;  4ZTF A;  4M7D D;  1EX4 A;  2M0O A;  1F1B B;  3OYN A;  4FYV B;  5CQX A;  3RNJ A;  2QGF B;  2X3X D;  3G71 Q;  3ASK A;  5GAO l;  4LD9 K;  2Z0W A;  2ZPI B;  2KY9 A;  4M7A D;  3OYK A;  2NYS A;  4F14 A;  3JB9 F;  2XG8 D;  1UGR B;  3CD6 A;  1HXD A;  4F17 A;  2LX7 A;  1K8A C;  4A63 B;  4GBQ A;  1M2V B;  1KK7 A;  3MHX A;  1KHC A;  4M77 G;  3OY9 A;  1W2B S;  1YJW A;  1YCS B;  4LUE A;  2DX1 A;  5KCH A;  1VQ6 A;  2HEQ A;  4RKU E;  4C5E A;  2M0Y A;  2RQU A;  2EJF A;  1VQP A;  3GNF B;  3CC7 T;  2J6F A;  3A8L B;  2KXC A;  3VS5 A;  2R57 A;  2DBK A;  4XTY A;  3QPH A;  4RMO A;  3CCM A;  2J05 A;  2HD0 A;  1H3Z A;  3UT1 A;  4Z88 A;  2FPE A;  2WSE E;  4FYW B;  5GAN 3;  2EKO A;  4D8K A;  1Q81 R;  2XKO C;  4WTO B;  2WSC E;  3OS0 A;  3QZ5 B;  2RPN A;  2BZ8 A;  4C8Q E;  3TEE A;  3JCM P;  2FO0 A;  1QCN A;  3M0T A;  2M51 A;  3CCJ A;  1BBZ A;  5IT9 E;  5GMK e;  1Q95 G;  4Z89 A;  1KQS S;  4JLG A;  1KQS P;  5GJV B;  4J9C A;  2VV5 A;  3JCM g;  2FRW A;  2CSQ A;  4OMF B;  1WHL A;  2V8I A;  2ESW A;  5LJ5 e;  2XU8 A;  4O6J A;  4Y92 A;  3RR6 A;  1ABO A;  1M1K C;  4AG2 C;  4L6V 5;  3JB9 G;  4E7H A;  3U23 A;  3SB2 A;  1W70 A;  3PVQ A;  1YIT T;  1ABQ A;  5LJ3 e;  1D0Z A;  2ECZ A;  3NFC A;  3RBB B;  3CMA A;  1AZE A;  4CRI A;  2ZPF B;  2K4Y A;  4J7I A;  5I2S A;  3JCM Q;  1K76 A;  5EC7 A;  3ZFJ A;  2EGC A;  1I81 A;  2VVK A;  4R0K A;  2DD4 A;  1E6G A;  2JMA A;  1IB8 A;  2O31 A;  2HL5 C;  5CKH A;  1ZA1 B;  1AHJ B; 
#chains in the Genus database with same CATH homology
 3NMZ C;  4DEX A;  4K11 A;  5FWC A;  3ULR B;  4D8D A;  1H8K A;  2LQW A;  2RNA A;  3LH5 A;  5I22 A;  2YUQ A;  2ED1 A;  1GBQ A;  2FPF A;  4OMO A;  2OI3 A;  3EG3 A;  2RQV A;  2KXD A;  2L2P A;  1JEG A;  4HVW A;  2QDL A;  3M0Q A;  1MV0 B;  1M3A A;  4CC4 B;  3EG1 A;  1WA7 A;  1ZUU A;  1Y57 A;  4F16 A;  1CKA A;  1GCQ A;  4AFU C;  2AKL A;  2HDA A;  2DIL A;  2FEI A;  1UFF A;  1QWF A;  5IXF A;  1ZUK A;  3H41 A;  4AFZ C;  1VYV A;  1K1Z A;  4CC7 A;  4ESR A;  2KT1 A;  2YUP A;  3FJ5 A;  4RTX A;  4KRT A;  1YNZ A;  3VS0 A;  1K0S A;  1NM7 A;  1B07 A;  4DEY A;  3VRZ A;  1KSW A;  2C0O A;  2LCS A;  1I1J A;  2P4R A;  2KRN A;  1YP5 A;  2JW4 A;  1QLY A;  2EPD A;  2DM1 A;  2V1Q A;  1AVZ C;  3CQT A;  1BK2 A;  1AZG B;  1OPL A;  2J7I A;  3EG0 A;  3NGP A;  2FRY A;  2KT8 A;  1WXU A;  1X27 A;  3QWX X;  2EVR A;  2DA9 A;  3PE0 A;  2K3B A;  3H0I A;  1OEB A;  2KE9 A;  1MUZ A;  1SHF A;  1YWP A;  2E5K A;  2PTK A;  2B86 A;  1IO6 A;  1WX6 A;  2KRS A;  2YUN A;  4RTY A;  4HCK A;  1E7O A;  4OML A;  2SEM A;  1UUE A;  1YWO A;  2JS0 A;  1T0J A;  1M3B A;  2ENM A;  1ARK A;  3C0C A;  4OMM A;  1OV3 A;  1TUD A;  2K9G A;  3REB B;  3NHN A;  2J6O A;  3M0R A;  2GQI A;  2JTE A;  2W0Z A;  2F2X A;  2JXB A;  1MV3 A;  1RI9 A;  2DLP A;  2LP5 A;  1KJW A;  4JJC A;  2PZ1 A;  3PVL A;  1X6B A;  2YUO A;  1T3S A;  2X3W D;  2DYB A;  2CH4 W;  4J9H A;  2YSQ A;  2EGE A;  2RQR A;  4IIO A;  4RUG A;  2DL4 A;  3M0U A;  2L3Q A;  5HCK A;  4AFS C;  1PKS A;  3UF4 A;  3VS6 A;  1M8M A;  4JZ4 A;  1YN8 A;  2O2O A;  2D8J A;  4RTU A;  1SHG A;  1OOT A;  4ZNX A;  1ZX6 A;  5IHK A;  1FYN A;  2PNI A;  4J9E A;  5ECA A;  2SRC A;  2DL5 A;  3THK A;  3EHQ A;  1E6H A;  2K79 A;  1BU1 A;  4CC3 A;  4HVU A;  1X43 A;  3UA6 A;  1WI7 A;  2BZX A;  2H8H A;  2KRM A;  2OAW A;  3R6N A;  4LUD A;  4J9G A;  4RTT A;  4JZ3 A;  2FPD A;  1WIE A;  4AFQ C;  2CUD A;  1W1F A;  4HVV A;  2FG0 A;  1CSK A;  3VS4 A;  1RLP C;  1Y0M A;  4X1V A;  1KFZ A;  2LZ6 B;  3M0P A;  1GCQ C;  4EIK A;  2ABL A;  2D1X A;  2BTT A;  1KIK A;  2ROT A;  2RQW A;  1T3L A;  3SEM A;  2EYX A;  1U06 A;  1WXT A;  2KEA A;  3UA7 A;  2JS2 A;  2GBQ A;  3M0S A;  2DRM A;  1UDL A;  3UAT A;  1M30 A;  1U5S A;  1JXO A;  4ORZ A;  1UGV A;  2EYZ A;  1I0C A;  2LQN A;  2L0A A;  2MCN A;  2YDL A;  1A0N B;  1RUW A;  1U3O A;  1JXM A;  2L3S A;  1LCK A;  1SRM A;  2RN8 A;  2AZV A;  2GNC A;  1G83 A;  1WLP B;  1AWO A;  1NYG A;  1EFN A;  1GL5 A;  1X2K A;  2KGT A;  3I5R A;  2D0N A;  1NG2 A;  2AKK A;  1WYX A;  1UG1 A;  1VYT A;  1NEG A;  1SEM A;  2GTO A;  3TVT A;  2RMO A;  1VYU A;  2EYY A;  4HXJ A;  2VKN A;  5GJW B;  1QWE A;  2J6K A;  2L3P A;  2CT3 A;  1PWT A;  1JU5 C;  2O9V A;  2DF6 A;  1G2B A;  1GCP A;  3TSZ A;  1GRI A;  2ROL A;  4Z8A A;  2A28 A;  3KFV A;  1K4U S;  2DMO A;  2JMC A;  2AZS A;  1TUC A;  2JM8 A;  2K7A A;  1SPK A;  3VS2 A;  4E6R A;  1GFD A;  2RQT A;  1QKW A;  1HSQ A;  1FMK A;  1SRL A;  1Z9Q A;  5L23 A;  2DL3 A;  1AD5 A;  3EGU A;  4QT7 A;  1JQQ A;  1GBR A;  2EKH A;  2A08 A;  1UHC A;  2YT6 A;  1UJ0 A;  1OPK A;  2KYB A;  2JT4 A;  1W6X A;  1H92 A;  1NLP C;  1UE9 A;  2ED0 A;  2LMJ A;  1X6G A;  2K6D A;  2KRO A;  2LJ0 A;  5FW9 A;  1HJD A;  2I0N A;  1UJY A;  2J06 A;  4JJD A;  3REA B;  2LJ3 A;  4RTV A;  3QWY A;  2LJ1 A;  2CT4 A;  3H0F A;  2G6F X;  2IIM A;  5FWB A;  5I11 A;  3I5S A;  3VS3 A;  4J9D A;  2F2V A;  2AK5 A;  2DBM A;  2CUB A;  2KYM A;  3O5Z A;  4RTW A;  5IXB A;  1ZLM A;  5IHI A;  1SSH A;  2W10 A;  1UHF A;  5IHN A;  1CKB A;  1M27 C;  2CRE A;  4J9B A;  3RNJ A;  1VA7 A;  2X3X D;  3SHW A;  5IH2 A;  2D8H A;  1Z9Z A;  1ZSG A;  1PRM C;  4F14 A;  2DE0 X;  2K2M A;  4JPB W;  1K9A A;  1AWW A;  2EYW A;  2EGA A;  4F17 A;  2HBW A;  3NPF A;  4LNP A;  1AWX A;  1UTI A;  2LX7 A;  4OMN A;  2JM9 A;  2XMF A;  4A63 B;  4IIM A;  1T0H A;  4GBQ A;  1BB9 A;  2DRK A;  2DNU A;  4LN2 A;  1YCS B;  4LUE A;  2A36 A;  2DX1 A;  2HEQ A;  2EQI A;  2DL8 A;  2M0Y A;  2RQU A;  2HSP A;  2EW3 A;  2DJQ A;  2O88 A;  1JO8 A;  2NUZ A;  2CSI A;  2J6F A;  2KR3 A;  2KNB B;  2LNH B;  2KXC A;  3EG2 A;  4M4Z A;  2DVJ A;  3VRY A;  3VS5 A;  1V1C A;  1I07 A;  2O9S A;  1WFW A;  2DBK A;  3VS7 A;  1S1N A;  1HD3 A;  1RLQ C;  1TG0 A;  2GGR A;  1XOV A;  3I35 A;  4FSS A;  2NWM A;  2OJ2 A;  2J05 A;  2HCK A;  2MIO A;  1H3H A;  4AG1 C;  4Z88 A;  2FPE A;  2CH4 A;  4D8K A;  2CDT A;  4WCI A;  1QCF A;  2VWF A;  1NYF A;  4GLM A;  1K0X A;  4RTZ A;  2KBT A;  3EHR A;  1PHT A;  2RPN A;  2BZ8 A;  2MOX A;  3GBQ A;  3A98 A;  2FO0 A;  3M0T A;  4LE9 A;  2M51 A;  3JV3 A;  1BBZ A;  1GFC A;  1PNJ A;  4Z89 A;  1J3T A;  2EBP A;  3H0H A;  4J9C A;  5GJV B;  1NLO C;  2FRW A;  2CSQ A;  1PRL C;  1ZUY A;  1WXB A;  4OMP A;  2ESW A;  4Y92 A;  1AOJ A;  1ABO A;  2F2W A;  4AG2 C;  4CC2 A;  1AEY A;  1PKT A;  1X69 A;  2DL7 A;  1W70 A;  3U23 A;  3PVQ A;  1QKX A;  1ABQ A;  3I9Q A;  3IQL A;  2ECZ A;  1WDX A;  4OMQ A;  3RBB B;  1M3C A;  2V1R A;  1NEB A;  1AZE A;  4JJB A;  3TSW A;  3ZL7 C;  2BZY A;  1K76 A;  2RF0 A;  5EC7 A;  1N5Z A;  2C0I A;  3VS1 A;  2EGC A;  1AWJ A;  1ZBJ A;  2VVK A;  4J9F A;  4R0K A;  1X2Q A;  1B3Q A;  2GTJ A;  2A37 A;  2C0T A;  2JMA A;  1E6G A;  2O31 A;  1UEC A;  4J9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...