3DKMA

Crystal structure of the hectd1 cph domain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
79
structure length
79
Chain Sequence
b'GRENLYFQGLKYMVPGARVTRGLDWKWRDQDGSPQGEGTVTGELHNGWIDVTWDAGGSNSYRMGAEGKFDLKLAPGYDP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase HECTD1
molecule tags Ligase
source organism Homo sapiens
publication title Crystal structure of the CPH domain of the E3 ubiquitin-protein ligase HECTD1.
rcsb
total genus 18
structure length 79
sequence length 79
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2008-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06701 MIB_HERC2 Mib_herc2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.920 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3dkmA00
2DK3A 3DKMA
chains in the Genus database with same CATH superfamily
2QI2A 2QA4A 2KDSA 1MV0B 2O4XA 1QCOA 3E1SA 3VS6A 1RACB 4M75F 1M90R 3QHSA 2E41A 3PFSA 4F7UE 2YT6A 3TQ7P 1M8MA 5GAN6 1HYOA 3CC7T 4BI4A 1PD1A 3QJ6A 3VKIA 1KIKA 2DEUA 3SD4A 1K9MC 1FMKA 5LL6S 2XD0A 1PWTA 2L3PA 2LNHB 3SFMA 3G4ST 3S3OA 3HSBA 1TOVA 2YUNA 4BI3A 4QKUA 1TS9A 2QQ9A 1UB4A 4M7AB 3SEMA 1NEGA 5DLOA 2GQVA 1NZ9A 5D6WA 1TUGB 4MZTA 4CRIA 1X75C 2JTEA 2HCKA 4RUGA 2P4RA 3I5RA 2BKDN 3V8KA 1OYXA 1VQOQ 1X01A 2M0OA 4EMKC 3LLRA 1WIEA 4LDXA 3M0SA 2K57A 1UTIA 2EYWA 2A0FB 4M75C 2YDLA 3A8HB 4BD3A 3EFSA 4XTWA 4PJOA 3MJXA 3UWNA 2H3JA 4WF2A 1LNXA 3RUXA 2VYTA 1SKUB 1YITT 1Q86U 2E3IA 2R5MA 3OYEA 1YJNQ 4Z88A 4J9GA 2XU8A 3V7RA 1VUBA 2DL8A 3HFOA 2E5QA 3TU4K 5CVIA 1YITA 3CCLQ 3H41A 1D09B 3FRNA 3MP8A 1KQ2A 2B8AA 2F2WA 3HKSA 1N9SA 1H8KA 2RQVA 1G3SA 5KYUA 1M1KU 1VQNT 2CH4W 1WJSA 2ZPFB 3S6WA 3R6OA 1W2BS 2V1RA 3C4SA 1PC0A 4C5EA 4OMOA 5HCKA 3HP9A 5GAN5 4HT8A 2RJCA 1IGQA 1BI1A 3JB9G 2C0OA 5J3BA 4AFQC 3X26B 3L2VA 2YRDA 4AT1B 1B7TA 3M54A 2XG8D 1Q82C 4GY5A 3JCMP 3FLGA 1I8FA 5DM7R 4C8QD 2A36A 4F04B 4OMMA 2PNIA 3JV3A 2DTIA 4R0KA 3M53A 4A53A 2PTKA 3RESA 2HDAA 3EG2A 1TSFA 1R0CB 4PNOA 1QVFA 5C0MA 3EGXB 3JCMQ 1G83A 4OGEA 2CS7A 1A0NB 4M7DD 4IUQA 5FW9A 5HK3A 3LX7A 4BB7A 3X25B 4YTLA 4XTZA 2AKKA 5AYFA 1AZEA 2L8DA 2K3YA 2D0QB 1V29B 1D1CA 5KH6A 2K9GA 3LGLA 4CC3A 3EG9A 4M78G 4C8QC 5GMKh 5CK9A 2L3RA 5FU7B 2RHIA 4C92D 1K0XA 5GAN3 4J9BA 2RPNA 4XTVA 1OU8A 1W2BA 2H3EB 3QYGB 3WVEB 1VYTA 5GJVB 3CCQT 2KR3A 1GCQA 4LE9A 3OYGA 2J6FA 2X3WD 2KT8A 2GNCA 3MHXA 4Z02A 1Q95G 2RF0A 4L6V5 2FPEA 3MEWA 4LDYA 5GAOp 1E6HA 2GBQA 4IKFA 3GBQA 1ZUKA 3CMAT 2DO3A 1SPKA 4KBMB 2ZPHB 1AWJA 1UHFA 1ZBJA 3PT9A 3CCRA 2EJFA 2Z0WA 1Q7YU 3BDLA 1KC8R 4AFUC 2E65A 4F7UG 2J7IA 4KULA 2OTLT 2IIMA 8ATCB 2OJ2A 1N8RR 1I0CA 3JAME 3V7CA 4JLGA 4OP0A 1ZLMA 2NLUA 2FZCB 3OS5A 4HCZA 5KE3A 1Q7YC 4E2FB 1S1NA 1VQNA 1OQKA 1UEBA 3A8OB 3L2WA 2DXUA 1FX7A 1YNZA 4OB2B 2LJ0A 3G71A 4PJOE 1PKTA 1WHHA 2JXBA 1I5LA 1M2VB 3URGA 4M7AC 4M77C 4ESRA 1WHMA 1SHFA 4DQ2A 2DVJA 3MPUB 2GTJA 2LJ1A 2XICA 3PTAA 2CT3A 4E6RA 1SRLA 4KGXB 5ECAA 4PJNA 1Y07A 4X34A 1M27C 2J6KA 1M3AA 3E2UA 2K2MA 3FDRA 4V2SA 4XU0A 1BB9A 2K6DA 4N0AA 2KEAA 1I5OB 4C5GA 3X28B 3N5BB 1U3OA 2D1XA 2LC4A 3RIRA 1M90U 2X51A 2DA9A 3LWHA 1WNLA 4OMPA 2B86A 3PIOA 5GANe 2DXBA 4C8QF 2RI5A 3PIPA 5IHIA 5FRMA 4LNPA 3CMAA 1B34A 4RTWA 1OULA 2EGCA 3HTRA 2A37A 3VRYA 3OYKA 2BZXA 1H3HA 5LJ5d 5FU6B 3QJYA 4PJMA 5IN1A 3VYGA 1I1JA 1YHQQ 4AG2C 1QVGS 4ANJA 3P8BB 4XTXA 1UGVA 4M77G 1YCYA 3CCET 1N5ZA 2HSPA 4ZN3A 1TWBA 1QVFP 2JZ2A 1NLPC 4FYWB 5GAN2 2RN8A 4AFSC 4OB0B 4AMCA 2YSQA 1NEBA 3CCEA 1W70A 1PSEA 3O5ZA 4N0AC 1PSFA 2CSQA 1Z9QA 2EQJA 2O2OA 2ZZDA 4KRTA 5GMKm 3OS2A 2FYKA 1R0BG 4J6YA 2M16A 3LH5A 1WDXA 3CMEQ 1KD1R 3MP6A 2G3RA 5GMKi 1QCFA 2BE7D 2J06A 1VQ6Q 2C0TA 3JB9I 4KGZB 3CPWA 2GQIA 5FWBA 1VQ8Q 3I35A 4E7HA 1NM7A 5GMKl 4FYYB 2WSFE 1N8RC 4M7DE 1YJ9A 1ZSZA 3MP1A 1ZQ1A 3C95A 1UE9A 2QEXT 1OV3A 2RHZA 3GLXA 4CC2A 1YHQA 1ZX6A 3QSUA 2P84A 4XTUA 2DAQA 1QVGP 2VKNA 3CMEA 3EGUA 1MNDA 3OMCA 1VQMT 3G71Q 2DZCA 4A4GA 1VIFA 3SB2A 4JRKA 2QQRA 1WZOA 2MF2A 5LJ3h 4D8DA 2RK2A 3V8JA 5IH2A 3OW2P 1VQOA 1YIJA 1RLQC 1R77A 2YUQA 5KCHA 1WPYA 1VQ5A 3FB9A 3D7SB 3JCMb 5GAMh 2FO0A 1H92A 2ABLA 1CSKA 4PK4A 1YI2Q 2HMAA 4J9IA 2WACA 5GAN8 3DLLA 3CCJA 1VQPT 3V7SA 1ZSGA 3C12A 5IXBA 4CC7A 3VS2A 2OAUA 1JJ2P 4MDXA 2O9VA 3RKXA 3CCQA 2G6FX 1YIJQ 1UFFA 4O6JA 2A08A 2HL5C 2PZ1A 3OYJA 2EYQA 4NL2A 3ER0A 3EFOB 3I56A 4AFZC 1YBYA 3EFRA 1ACMB 2MAMA 2YHTA 3CCVA 4HVWA 4XK8E 3OYMA 3JB9F 2BUDA 4XU3A 2F5TX 1TH7A 1UGQB 2VGMA 5KYYB 2PU9B 3R6NA 1NG2A 1G3YA 5LJ3f 3L1AA 3QKJA 3GNFB 2ZPBB 7AT1B 4C0DB 5D6YA 4MDWA 1X6OA 2E4HA 1X6BA 2KGTA 3UDCA 1OEBA 2KYBA 3FEOA 1UJYA 1OPKA 2LJ3A 2YUOA 3RR6A 2DXTA 1OOTA 2CZ1B 2BTTA 1S72T 3G6EA 1QP2A 4B6MA 2AIRB 3QO3A 1AD5A 3CCSQ 1UGPB 2ESWA 3PNWC 4XQ3A 1YJWT 3EGXA 2AZVA 1VQLT 4FIBA 2IPOB 4Y28E 3A8MB 4JJBA 2LTOA 4ZTFA 2A28A 1OU9A 4QQGA 3MEUA 2F69A 3EAEA 1SF9A 4DEXA 5GANj 2DEQA 1GFDA 4HCBA 4HXJA 2HQEA 4FL6A 1AWOA 2LT1A 1KHCA 1EIFA 1N6AA 5LJ5g 2LCCA 4PJOC 3O8VA 1VYUA 2KYMA 1SEMA 2K79A 3E9FA 4M77E 1CKAA 3IQLA 4A63B 4XU2A 2KMTA 1AHJB 2KVQG 3CCMT 1QMCA 2P0PA 4A4HA 3I55Q 2DPPB 4JZ3A 1PRMC 4ELZC 1ZA1B 2FG0A 4ZGJB 2WSEE 4OGCA 3J80E 4DBRA 1SRMA 4QQDA 4HCCA 3LWIA 2VV5A 4M77D 3OS1A 1VQ9Q 3MO8A 1BIBA 2LMJA 3P8DA 3TSZA 2LQWA 3RMQA 1HSQA 2AK5A 4JRIA 4Y91A 1HK9A 1X69A 4A4KA 2E70A 2HAXA 2X3XD 2PVDB 4XU1A 2LP5A 5I2MA 2HQXA 1QLYA 4M75G 5IAYA 1G8XA 2CYZB 3X24B 1ZSZB 5GAMg 2CP6A 2HEQA 3P8HA 1MNEA 1QVFS 5IT9E 3JCMX 3M9QA 2IG0A 4J9FA 4OF1A 2CP2A 2JVVA 2JTFA 1KC8C 1RAIB 4KH1B 4ZNXA 3QG1A 4XTYA 5AT1B 3CCVT 1M1KC 3M0QA 4N4GA 2LX9A 3GNGA 1Q82R 3CC4A 2OTJA 1VQ6A 1VQPQ 4IURA 3JB9J 4QVCA 2OI3A 3UA6A 3SDZA 2COZA 1M9SA 4LD9K 1RI9A 2AKLA 2ZAEA 1JJ2A 1YJ9T 2MYSA 3CCVQ 2DD4A 3CC2A 2RQUA 2XIDA 4M75B 3S3NA 1YHQT 2FHDA 1AOJA 2XMFA 3CC4Q 2LZ6B 3G6ET 2OTJQ 3VS7A 1WQWA 3VUZA 2KXDA 3CC2T 2JJ9A 2RO0A 3BY7A 1WYXA 3OYFA 1EX4A 2VUBA 1B07A 1UJ0A 3QIIA 1D1AA 2EIFA 1YJWA 2OX7A 1YITQ 1BU1A 1KHIA 2X35A 4PKCC 1U8RA 3NPFA 1KD1U 1ZUUA 1GL5A 1NYFA 2FPFA 1FWZA 2LDMA 1Q7YR 5LJ5j 4BDYA 1VQ5T 5J26A 4CC4B 1HD3A 5CQXA 1VQ4A 3HHTB 1KQ1A 3T9NA 1M90C 1WHGA 3CCJT 2RHXA 4FW1A 4RMOA 2QDLA 1QKXA 3L42A 3VRZA 1WXTA 2FL7A 4M75E 4A54A 4F7UF 2KT1A 3HRTA 1OX8A 1VQKT 5GMKe 2L0AA 2HZYA 2QDYB 3EG9B 4TVRA 3I55A 4C0DC 5A0LA 2DM1A 2ED0A 3I56T 2M1HA 3KXTA 3G4SQ 4JZ4A 2VC8A 1Y7XA 3A1PA 4C92F 1VQMA 3QUIA 4F17A 3LW5E 2RQRA 3CQTA 2RQWA 3CC7Q 2K3XA 2ZGWA 1NE8A 1D0YA 2E1HA 4C92G 5A2QE 1KG1A 2PVGB 2MWOA 1K73C 4JUVA 3A98A 4M78B 1RAAB 5LJ5e 3L2RA 3AHUA 4RCBA 1NPRA 1S72A 4RTYA 3OY9A 2DTOA 1IHVA 1VOMA 5GANg 1BYMA 2YLCA 2MOXA 4BACA 4E7JA 4C8QB 3EHRA 2GF7A 2GFUA 3CPWP 1AZGB 3RERA 1TU0B 1WA7A 2MCNA 3CBMA 1E6GA 2XK0A 3UATA 1F1BB 1VQ8A 1T3LA 1UGSB 1G5VA 2LNVA 5J39A 2E12A 3G4SA 2CZ7B 5LJ5f 2Y90A 3H0IA 4N4IA 3PVQA 1VQ5Q 1G2BA 5KCOA 1YJNT 1E7OA 1D0ZA 4C5HA 2LCSA 1YI2A 2ROLA 3QXEB 3ZL7C 1LOJA 1Q82U 4QW2A 2QTVA 4L59A 1M1FA 4QVZA 2V8KA 1VQ7T 4K11A 5KYNA 2DERA 2DK3A 1H641 1NJIC 1V1CA 3OMGA 2E5KA 1KK7A 5DY9A 4DOWA 1M8VA 2X4JA 2KRNA 3UT1A 1TUDA 4EMKB 5CKEA 3I56Q 4UC4A 1VA7A 5D7UA 2XDBA 1VQ4Q 2GCXA 2LRQA 2JT4A 3CXCA 1K4US 1LVKA 2I2LA 1RAEB 1XOVA 4C0FA 3OQ5A 2WSCE 5CO7A 4IUUA 1BCOA 1IHWA 4F16A 4J8OA 4VUBA 2NUTA 2MI6A 5IHKA 1PHTA 1T0JA 3OW2S 2QQBA 4F7UB 3H9NA 5LJ3g 4GBQA 3OYDA 5GAMd 2EAYA 1DJ7B 1PNJA 4RTZA 1OX9A 2X4WA 2RH2A 3DKMA 2C06A 2CP7A 3E9GA 2QASA 1BI0A 3UPUA 3OYHA 4J9EA 3CCMA 2MPXC 3OA6A 1RL2A 2V1QA 3G7ZA 3OSVA 5GJWB 3M4GA 2RD1A 5I11A 3OS0A 3CC4T 4E7KA 2OTJT 4C8QA 3U23A 2NUPA 3KUFA 4EMHA 1QKWA 3ZEHA 4MMLA 3JCMV 2EGAA 2RHUA 1VQKQ 1MV3A 2FRYA 2XKOC 1LPLA 3CMET 1K1ZA 3SHWA 1RUWA 5LJ3d 2BIVA 1I81A 1SHGA 5I2SA 1UG1A 2K2VA 1VQOT 4EMGA 3PMIA 5CAIA 4M77A 1GRIA 2QEXA 3EGDA 1K0SA 5GAMf 3TEEA 1JXMA 5L8RE 1D0XA 5CKHA 1YCSB 3JCMh 2W10A 4M78E 3OSSC 3M56A 1VQPA 4LD6A 4EMKA 3CC2Q 3HRSA 1UUEA 2LQ8A 1VQ4T 1NPPA 4C92C 1VQ9A 3KBGA 1XJWB 2SEMA 8AT1B 4GLMA 3J7AF 2GTOA 2DD5A 1X43A 2CUDA 2E64A 3UF4A 4DA4A 2KRSA 5KE2A 2HL3A 5GAMe 1BBZA 3BDUA 3LH0A 2EQMA 3M5AA 4NOYA 4EIKA 3JB9D 5KYXB 1J3TA 2K3BA 3GPLA 1XQHA 4NL3A 3RBBB 1B3QA 2KSSA 2ZPEB 1G3WA 1SSHA 3OYLA 4Q5WA 4C8QG 4BUGA 2HKNA 4X9DA 3V8LA 4BE1A 2EBPA 3META 4M75D 2DXCA 1FMWA 3L2QA 2M9UA 1MHNA 2LQNA 1YP5A 4PJOF 1BK2A 1ZA2B 3VS5A 1K76A 4PFZA 2O31A 4ME7A 4BE2A 1D3BA 4PJJA 3QYHB 2JS2A 1VQLA 4LDUA 3CCJQ 4F7UA 1M3BA 3GF5A 1WJRA 2BZ8A 2L89A 1VQ9T 2NUTB 2EYXA 1K73U 1VQMQ 2CKKA 2QAZA 1R8OB 1QQJA 1PD0A 3JB9H 1QCNA 2EGEA 2MK5A 2Y4XA 3E19A 2O88A 2DBMA 4M78D 1VYVA 4C92A 5LJ3e 2DL5A 3CD6T 4RKUE 3J81E 2KNBB 4IUTA 1WQ7A 4C0ZA 4KT0E 1K9AA 3M55A 3M4YA 1IGUA 1U1SA 1Y57A 1SG5A 3FJPA 1AEYA 1BKBA 2P0KA 3QDFA 2FRWA 4LDWA 1C0MA 4QQ6A 2O4XB 1VQ6T 2E6ZA 2DRMA 2QGGA 1GBRA 2CP3A 5GAOn 2ED1A 1WHLA 5I21A 2DILA 2RJFA 3H6ZA 2AZSA 4R56A 1Z9ZA 3M57A 5GMKj 1X2QA 3OYBA 3G1JA 4JS5A 2FPDA 3CCST 1YIJT 5CKDA 2K4YA 1WHKA 1BCMA 1VQ8T 2RHYA 4OMQA 5A0DA 1BI2A 3HPWA 1JXOA 3H8ZA 3MEVA 4M7AE 5GAOl 3DB4A 1W1FA 1WJQA 2XDPA 2DLPA 9ATCB 4IIMA 4NS5A 2BE9B 4J7FA 4E7ZA 2F2VA 1ZHIA 2AHJB 2FEIA 2ZPGB 2MIOA 4PJOD 1IXDA 1AVZC 2COWA 1M2OA 1V76A 4B9XA 2DIQA 2JOYA 2LCLA 2AT1B 2Y4YA 1HJDA 5I22A 1Y96A 5A0GA 2VXFA 3ZBDA 1JEGA 1GXIE 2V8IA 4CI0C 2DFUA 2EYZA 4FSSA 2KRMA 1T3SA 3JCMc 5GAOr 4E47A 2KQWA 2EJGA 2NYSA 2DYIA 4DBHA 1WXUA 2PVOB 3VV0A 4A4EA 4JLIA 3OYAA 1QVPA 1PCXA 2XDDA 2KE9A 1K73R 5GAMj 3CBPA 4PJOB 1IO6A 4HVVA 4E7SA 2JMCA 3LYIA 4ZGEB 3NMZC 3C0CA 1Y96B 2GFAA 4M75A 2P0QA 1RAFB 3EG0A 1QW1A 4D6WA 2NWMA 4PL6A 1QP3A 4ELYC 1WX6A 2VXEA 3M0RA 1PKSA 3VU3C 4A4FA 1NJIU 1VQ7Q 2CZ0B 2PUOB 3BE3A 1N9RA 3TSWA 4IUVA 2X4YA 3QBYA 4FCYA 2RK1A 2DYBA 5LJ3j 3DLMA 3I55T 2D8HA 2NUPB 1IREB 2DRKA 3EG3A 1M1GA 4FU6A 3GOXA 2ECZA 2RA2A 5FU7C 4QVDA 2JMAA 4M7AG 4FT4A 5CCAA 2DETA 2IVWA 3JCMd 3QPHA 2W0ZA 1SSFA 1FYNA 2BZYA 2JN0A 3EHQA 1AWWA 3EH1A 1KQSP 2QQSA 4O5VA 1ZBXA 2RJEA 3CD6Q 2RI2A 4J9DA 1RADB 3CCUA 2OTLA 2DKGA 3RKWA 2EQUA 4BY6C 1CKBA 2HD0A 2EQIA 3MKDA 1WFWA 2JM8A 4C0GA 2ATCB 5DLQE 4JJDA 1T0HA 2YRVA 2D6FA 2CUBA 1KC8U 4BDZA 4HKEA 5KYUB 1M1KR 1FMVA 1S72Q 2QK0A 3EG1A 1M5Q1 3FIFA 2RM4A 2ROTA 3OYYA 2QA4T 1P92A 3CCMQ 2OAWA 1Q81R 4JRQA 2LX7A 2DMOA 2L3SA 1JU5C 4KGVB 3QZ9B 1M3CA 2P4TA 4II1A 1KJWA 2QG9B 1GCQC 4J83A 4MMKA 4M7DF 2DNUA 3CCRQ 3MCAB 2CGHA 3QWYA 1UDLA 1YJ9Q 1YWOA 3SWNA 4ZN1A 6AT1B 1JJ2S 5KYXA 4JJNK 2R58A 4ATOA 1IZ6A 1K8AR 5M9OA 4EPCA 3SWNB 3OW2A 1K8AC 1IB8A 3NGPA 5HY6A 4PLIA 3JCMW 4M7AA 1YJNA 1MUZA 2KI7A 4DBQA 4DBFA 4RG2A 3A8GB 3HFNA 4HVUA 1JB0E 2EKHA 4C8QE 1TG0A 3CEYA 1W6XA 2A7YA 1UHCA 3I5SA 4WCIA 1VQ7A 2EFIA 2HBPA 3CBOA 1U1TA 1ZSZC 4RTTA 2LVMA 1U06A 3G6EQ 4RTXA 4J6WA 2KY9A 1OPLA 2EPDA 3RDVA 3TCJA 4X1VA 3GP8A 3CCLT 5FRNA 3HRUA 4FW2A 2HSEB 3RMSA 4E7IA 3CPFA 3M0UA 4JS4A 3X20B 5GAN7 4Y92A 2FZGB 2VASA 2K5IA 2YLBA 4FYXB 3RNJA 4ZTJA 3JCMe 5KYWA 4WTOB 1D3BB 1GCPA 1EFNA 1JRIA 2VWFA 2RJDA 1WHJA 2KROA 1HXDA 5D6XA 5KYWB 3QZ5B 5GANf 1Q81C 3M58A 4MZMA 3CPWS 2VB6A 2K5LA 4PLLA 5LJ5h 1M30A 3CCUT 2SRCA 2QTXA 1UECA 2L2PA 4ORZA 3UA7A 2ZPIB 5IHNA 1LCKA 4M77B 1YFNA 5EC7A 1YN8A 1GBQA 4LXCA 3VS0A 3PMTA 2O9SA 3JCMg 3CCQQ 4P5NA 3FJ5A 4MZPA 4M77F 2JUFA 1PRLC 2MWPA 4J9HA 2DJQA 5FLXE 4N4HA 4FT2A 5C6SA 4F14A 1BIAA 1I4K1 3TREA 2DJZA 4OB1B 2DVEA 3PVLA 2KK4A 1JQQA 1ZUYA 2H8HA 3F70A 2X9HA 2ENMA 3REAB 2YRCA 1MGQA 2K7AA 4BY6B 2QYZA 2EKOA 5GANh 2QEXQ 2F5KA 1AWXA 4B9WA 3PGGA 2L5QA 2RQTA 1H3ZA 1WI7A 3H0FA 1TXQA 1NLOC 2CSIA 2JS0A 5EG2A 1JO8A 1ARKA 4RCCA 4C5IA 2LQKA 1Q86C 2V8JA 4OMFB 4KUIA 2CP5A 4DOVA 2EQKA 3TVTA 2RNAA 2HBWA 5CIUA 2KBTA 3JRZA 2QQAA 2M02A 2CZ6B 3OB9A 2YUPA 2QA4Q 2RI3A 2DL3A 3INZA 3BW1A 4FYVB 2HQHA 1LJOA 1RABB 4EDUA 3QWXX 4JPBW 3HL8A 3ULRB 5L23A 1WLPB 5CKFA 3I9QA 1C1AA 2O01E 4AG1C 2F1LA 5FU6C 1RLPC 3LGFA 4Z89A 2RMOA 3C94A 1M2VA 4HA8A 4HCKA 3VS3A 4KH0B 2D8JA 2F2XA 4J5YA 3ZFJA 3CXCS 1K8AU 2I0NA 2K5FA 4QT7A 1AT1B 1KQSA 2D0NA 2EW3A 1OI1A 2QXFA 3VUBA 2GGRA 5HK0A 1RI0A 3A8LB 1XNIA 3JCMf 2JTMA 4PFOA 2ZCFB 1RAGB 4PJOG 1TUCA 3VYHB 4L5GA 4D8KA 3NFCA 3G71T 4FSXA 3VJPA 4RTVA 3CD6A 3SWNC 4M7DB 4X9CA 2C0IA 3CXCP 3JSCA 1ABOA 4M7DA 3S3MA 3PE0A 1I07A 4OMNA 5FROA 1N8RU 2MMPA 5GAOq 2VGNA 2VVKA 1UGRB 3CMAQ 1Y71A 2PQWA 4IUPA 2JM9A 1YI2T 1NJIR 5HKCA 1TTHB 1N27A 1QWFA 2XHCA 1XTDA 2DL4A 5CKBA 3L2UA 4JJCA 3M0PA 1WXBA 4LUDA 2QGFB 3OYNA 2DTHA 1KQSS 4ZGDB 2J05A 3DB3A 3FC3A 3A5ZB 3L2ZA 2YWWA 5KYYA 3CC7A 1WGSA 4R55A 1JBMA 2R57A 1X2KA 3NHNA 3Q1JA 1VQLQ 1NBEB 1YJWQ 1OZ3A 3JCMJ 2CT4A 4FM4B 4XAXB 5GAN4 1PG5B 4OVAA 1X27A 3NTKA 1Y0MA 4HT9A 2L3QA 3CCEQ 3GIBA 4BE0A 4M7AD 4OB3B 3AT1B 4PFPA 3NTHA 3OBWA 1G3TA 4JRPA 3EH2A 4IIOA 1VQNQ 3RKYA 3M0TA 3EGDB 2D9TA 1ABQA 1MMAA 4M78F 4LUEA 4C92E 1MMNA 2M51A 5FWCA 1K9MR 4M7AF 2DBKA 3VS1A 1PM3A 2XI9A 3EFOA 3CCUQ 4J7IA 2R5AA 3MEAA 4M78A 2E6NA 2YXYA 3H0HA 1MMDA 4KUDK 4M7DG 2V26A 1D1BA 4BI8B 5IXFA 1O75A 1W4SA 3ASKA 2E3HA 1FXXA 2EJ9A 4PJLA 4Z8AA 2DX1A 4LN2A 1QWEA 2DL7A 1Q86R 4OMLA 2FB7A 3CCLA 1M4ZA 1GFCA 1X6GA 3QDRB 1Q81U 4J9CA 3ME9A 2LT4A 3NTIA 4C92B 4J6XA 5GAOm 2M0YA 4M4ZA 2A3LA 1O9SA 2HNIA 1MMGA 1QVGA 2EYYA 2J6OA 1KFZA 2COYA 2KAFA 3THKA 2RB6A 2FZKB 2CH4A 2CP0A 1IRXA 4GLKA 4RG8A 3BFMA 3WXMB 3KFVA 1VQKA 3OYIA 2DIGA 3VS4A 1C6VX 1VIEA 1BI3A 1U5SA 1YWPA 2KXCA 4RTUA 2CREA 2DF6A 4E7LA 5CR2A 3OYCA 1OZ2A 2PUKB 3M59A 4JDSA 1KSWA 2E10A 4M78C 1NYGA 1KD1C 3WVDB 1K9MU 3REBB 4LDVA 2FVUA 3CCRT 5CQYA 4DEYA 3OBYA 2EVRA 4M7DC 1EZZB 1RAHB 2CDTA 2JNGA 1B34B 2HKQB 2NUZA 2DZ9A 2X4XA 2EWNA 5GANd 2JW4A 1W2BP 2DE0X 3CCSA 2OTLQ
chains in the Genus database with same CATH topology
3DLLA 2QI2A 4RG2A 2QA4A 2KDSA 3A8GB 3HFNA 3G7ZA 3OSVA 1VQPT 2O4XA 3V7SA 3M4GA 2RD1A 1JB0E 3C12A 3OS0A 3E1SA 4C8QE 3CC4T 3CEYA 4E7KA 2OTJT 2A7YA 2OAUA 4M75F 4C8QA 3QHSA 2E41A 3PFSA 4F7UE 1VQ7A 4MDXA 3KUFA 4EMHA 3RKXA 3CCQA 2EFIA 2HBPA 3CBOA 4O6JA 3ZEHA 5GAN6 1U1TA 3CC7T 4MMLA 3JCMV 3OYJA 2RHUA 2EYQA 4NL2A 2LVMA 4BI4A 2XKOC 3ER0A 3QJ6A 3VKIA 3I56A 1YBYA 3EFRA 3CMET 3SD4A 4J6WA 1K9MC 2KY9A 2MAMA 2YHTA 3CCVA 5LJ3d 5LL6S 2XD0A 3TCJA 4XK8E 3OYMA 2BIVA 1I81A 3GP8A 3JB9F 2BUDA 3CCLT 4XU3A 2F5TX 3SFMA 3G4ST 5FRNA 1TH7A 1UGQB 2VGMA 3HRUA 3S3OA 5I2SA 3HSBA 2PU9B 4BI3A 2K2VA 1G3YA 1VQOT 4EMGA 5LJ3f 3PMIA 3RMSA 3L1AA 5CAIA 2QQ9A 3QKJA 4M77A 4E7IA 3GNFB 1UB4A 2QEXA 4M7AB 5GAMf 3CPFA 4JS4A 5DLOA 3X20B 3TEEA 2ZPBB 5GAN7 4C0DB 5D6YA 2GQVA 5L8RE 1NZ9A 4MDWA 1X6OA 5CKHA 5D6WA 4MZTA 4CRIA 3UDCA 1X75C 2K5IA 2YLBA 3JCMh 2BKDN 3FEOA 3V8KA 1KG1A 4M78E 4ZTJA 3JCMe 3OSSC 1OYXA 3M56A 1D3BB 1X01A 2M0OA 2DXTA 1VQPA 2CZ1B 1JRIA 3LLRA 4LD6A 4EMKA 4EMKC 4LDXA 2RJDA 2K57A 1S72T 3G6EA 1QP2A 1HXDA 3HRSA 4M75C 2LQ8A 5D6XA 3QZ5B 1VQ4T 3A8HB 1NPPA 4BD3A 3QO3A 3EFSA 4XTWA 4C92C 5GANf 1VQ9A 4PJOA 1Q81C 3M58A 2H3JA 4MZMA 3KBGA 3UWNA 3CPWS 3CCJA 4WF2A 1LNXA 2K5LA 3RUXA 2VYTA 3J7AF 1YITT 4PLLA 5LJ5h 1Q86U 2DD5A 2E64A 3CCUT 1UGPB 2QTXA 3PNWC 4XQ3A 1YJWT 2ZPIB 2R5MA 3OYEA 4DA4A 1VQLT 5KE2A 4FIBA 4M77B 4Y28E 3A8MB 2LTOA 4ZTFA 2XU8A 3V7RA 5GAMe 1VUBA 3PMTA 3MEUA 3HFOA 3BDUA 2E5QA 2F69A 3EAEA 3LH0A 4P5NA 4QQGA 3JCMg 3TU4K 5CVIA 2EQMA 3M5AA 1YITA 5GANj 3FRNA 4MZPA 4NOYA 2DEQA 3MP8A 2B8AA 4M77F 2JUFA 1N9SA 3HKSA 1KQ2A 1G3SA 4HCBA 2MWPA 3JB9D 2HQEA 5FLXE 4N4HA 1M1KU 4FT2A 5C6SA 3GPLA 1VQNT 1WJSA 2ZPFB 4FL6A 2LT1A 1KHCA 1BIAA 1XQHA 1EIFA 4NL3A 1I4K1 3S6WA 3R6OA 2DJZA 3TREA 1N6AA 4OB1B 5LJ5g 1W2BS 2DVEA 3C4SA 2KSSA 2LCCA 4C5EA 2ZPEB 2KK4A 1G3WA 4PJOC 3O8VA 3OYLA 4Q5WA 4C8QG 3HP9A 4BUGA 3F70A 5GAN5 3E9FA 4X9DA 2RJCA 3V8LA 4BE1A 4HT8A 4M77E 1MGQA 1BI1A 4BY6B 3JB9G 3META 4M75D 5J3BA 2EKOA 4XU2A 2KMTA 3X26B 3L2VA 1AHJB 2KVQG 5GANh 3CCMT 2P0PA 2DXCA 2F5KA 3L2QA 2M9UA 1MHNA 3M54A 2XG8D 4PJOF 4A4HA 1Q82C 3CCJT 4B9WA 2DPPB 4GY5A 3PGGA 2L5QA 3JCMP 1H3ZA 3FLGA 1I8FA 4ELZC 5DM7R 4ME7A 4C8QD 4ZGJB 4BE2A 1D3BA 2WSEE 4OGCA 3J80E 3QYHB 5EG2A 4QQDA 1Q82U 3LWIA 1VQLA 4HCCA 2DTIA 2VV5A 4RCCA 4M77D 2LQKA 3M53A 4C5IA 2V8JA 4LDUA 1Q86C 3OS1A 4OMFB 4A53A 3MO8A 1BIBA 3P8DA 4KUIA 3GF5A 3RESA 4F7UA 4DOVA 1WJRA 2EQKA 3RMQA 2L89A 4JRIA 5CIUA 1VQ9T 3JRZA 4Y91A 2QQAA 1K73U 2CKKA 1HK9A 2CZ6B 1R8OB 3OB9A 4PNOA 4A4KA 1QVFA 2E70A 5C0MA 2HAXA 2RI3A 3JCMQ 3JB9H 3INZA 3BW1A 4OGEA 2CS7A 4M7DD 4IUQA 1LJOA 2PVDB 4XU1A 4EDUA 2Y4XA 3E19A 5HK3A 4M78D 5I2MA 3LX7A 4BB7A 3X25B 4C92A 2HQXA 4YTLA 5LJ3e 3CD6T 4M75G 4RKUE 4XTZA 3J81E 3HL8A 5IAYA 2CYZB 5AYFA 3X24B 2L8DA 4IUTA 2K3YA 5GAMg 1WQ7A 3P8HA 5CKFA 4KT0E 4C0ZA 2D0QB 1V29B 2O01E 5KH6A 5FU6C 3M55A 3M4YA 1QVFS 3LGFA 3LGLA 5IT9E 1U1SA 3JCMX 3C94A 3M9QA 2IG0A 3FJPA 1BKBA 2P0KA 4OF1A 1KC8C 2JVVA 2JTFA 4M78G 4C8QC 5GMKh 5CK9A 4M7AA 4LDWA 2L3RA 4HA8A 4QQ6A 5FU7B 2O4XB 1VQ6T 2RHIA 4J5YA 3QG1A 3ZFJA 4C92D 2E6ZA 4XTYA 3CCVT 1M1KC 4N4GA 3CXCS 1K8AU 2LX9A 3GNGA 5GAN3 3CC4A 2OTJA 2K5FA 4XTVA 1W2BA 1KQSA 5GAOn 1VQ6A 3QYGB 5I21A 4IURA 3WVEB 1OI1A 2QXFA 3CCQT 4QVCA 3JB9J 2RJFA 3VUBA 5HK0A 3H6ZA 1RI0A 3A8LB 3SDZA 4R56A 1M9SA 4LD9K 1XNIA 3M57A 3JCMf 5GMKj 2JTMA 1JJ2A 3OYBA 2ZCFB 1YJ9T 4PJOG 2DD4A 3OYGA 4JS5A 3VYHB 3CC2A 4L5GA 2XIDA 3NFCA 4M75B 3S3NA 3CCST 1YIJT 5CKDA 2K4YA 3G71T 3MHXA 4FSXA 3VJPA 1YHQT 4Z02A 3CD6A 2FHDA 1VQ8T 2RHYA 5A0DA 1BI2A 4L6V5 3SWNC 3HPWA 3G6ET 3MEWA 4X9CA 3H8ZA 3MEVA 4M7DB 1WQWA 4LDYA 3VUZA 5GAOp 3JSCA 3CC2T 4M7AE 5GAOl 2RO0A 3BY7A 4IKFA 3DB4A 3CMAT 1WJQA 2DO3A 2XDPA 4KBMB 2ZPHB 3OYFA 4M7DA 4NS5A 3S3MA 5FROA 4J7FA 3PT9A 3CCRA 2EJFA 2MMPA 2VUBA 1N8RU 3QIIA 5GAOq 2VGNA 1Q7YU 1UGRB 2EIFA 3BDLA 1YJWA 1ZHIA 2AHJB 1KHIA 2ZPGB 1Y71A 2PQWA 2X35A 2E65A 4PKCC 4F7UG 1U8RA 4KULA 4IUPA 1YI2T 1KD1U 5HKCA 2OTLT 4PJOD 2LDMA 1FWZA 1N27A 5LJ5j 4BDYA 1VQ5T 2XHCA 1XTDA 5J26A 5CKBA 5CQXA 3V7CA 3JAME 4B9XA 3L2UA 1VQ4A 3HHTB 1KQ1A 2DIQA 3T9NA 4JLGA 2JOYA 1M90C 4OP0A 2RHXA 2DTHA 2NLUA 2LCLA 3OS5A 4HCZA 2Y4YA 4ZGDB 5KE3A 3OYNA 1Q7YC 1KQSS 1VQNA 1Y96A 4RMOA 5A0GA 1UEBA 2VXFA 3A8OB 3L2WA 3DB3A 3L42A 2DXUA 3ZBDA 1FX7A 3FC3A 3A5ZB 4OB2B 1GXIE 2V8IA 2FL7A 4M75E 4A54A 3G71A 3L2ZA 4F7UF 3HRTA 3CC7A 1VQKT 1WGSA 5GMKe 4CI0C 4R55A 1JBMA 4PJOE 1I5LA 2R57A 2QDYB 3URGA 4M7AC 3Q1JA 4M77C 4TVRA 3JCMc 5GAOr 4E47A 3I55A 1OZ3A 4C0DC 5A0LA 3JCMJ 4DQ2A 4FM4B 2KQWA 4XAXB 5GAN4 3I56T 2M1HA 3KXTA 4OVAA 2EJGA 3NTKA 2VC8A 2XICA 3PTAA 4HT9A 1Y7XA 4C92F 3GIBA 1VQMA 3QUIA 1Y07A 4X34A 2PVOB 4BE0A 3VV0A 4M7AD 4OB3B 4A4EA 3FDRA 4JLIA 4V2SA 3LW5E 4XU0A 3OYAA 3NTHA 3OBWA 1G3TA 1QVPA 4N0AA 2K3XA 4C5GA 2XDDA 4JRPA 2ZGWA 3X28B 3N5BB 2LC4A 1NE8A 5GAMj 3CBPA 3RIRA 3RKYA 4PJOB 1M90U 2D9TA 3LYIA 4ZGEB 2E1HA 3LWHA 1Y96B 4C92G 5A2QE 1WNLA 3PIOA 2GFAA 5GANe 2DXBA 4M75A 4C8QF 2PVGB 2RI5A 2P0QA 2MWOA 3PIPA 3CMAA 4JUVA 1B34A 4M78B 4M78F 1K73C 1QW1A 4C92E 5LJ5e 3L2RA 4D6WA 4PL6A 1QP3A 4ELYC 2VXEA 3VU3C 4A4FA 3AHUA 1NJIU 4M7AF 2CZ0B 2PUOB 4RCBA 3OYKA 1N9RA 1NPRA 2XI9A 1S72A 4IUVA 3OY9A 2DTOA 2X4YA 3QBYA 4J7IA 2R5AA 3MEAA 2RK1A 4M78A 2E6NA 5LJ3j 5GANg 5LJ5d 3DLMA 5FU6B 1BYMA 3I55T 3QJYA 2YLCA 5IN1A 1IREB 3VYGA 4KUDK 4BACA 4M7DG 4E7JA 4C8QB 4BI8B 1M1GA 4FU6A 3GOXA 2RA2A 1W4SA 1O75A 3ASKA 5FU7C 4QVDA 1QVGS 2GF7A 2GFUA 3P8BB 3RERA 1FXXA 4XTXA 4M7AG 2EJ9A 4M77G 4FT4A 5CCAA 2IVWA 3CBMA 3JCMd 2XK0A 3QPHA 1YCYA 3CCET 1VQ8A 1SSFA 1UGSB 4ZN3A 2FB7A 2JN0A 1G5VA 2JZ2A 3CCLA 1M4ZA 5GAN2 2LNVA 2QQSA 2E12A 3QDRB 4O5VA 1ZBXA 2CZ7B 2Y90A 5J39A 5LJ5f 3G4SA 3ME9A 4N4IA 4OB0B 2RJEA 2LT4A 3NTIA 5KCOA 3CCEA 2RI2A 1YJNT 3CCUA 4C92B 1PSEA 4J6XA 4C5HA 5GAOm 1YI2A 2OTLA 2A3LA 1O9SA 2DKGA 2HNIA 3QXEB 3RKWA 1QVGA 1LOJA 2EQUA 1PSFA 2EQJA 4N0AC 4QW2A 2ZZDA 4BY6C 5GMKm 4L59A 2HD0A 1M1FA 3OS2A 2FYKA 4QVZA 1Q81U 4J6YA 2KAFA 2M16A 2V8KA 1VQ7T 3MP6A 2G3RA 5GMKi 2RB6A 4C0GA 5DLQE 2DK3A 1H641 1NJIC 3OMGA 3JB9I 2YRVA 2D6FA 3CPWA 1KC8U 5DY9A 4HKEA 4DOWA 4BDZA 1M8VA 4GLKA 2X4JA 4RG8A 3BFMA 3UT1A 3WXMB 1VQKA 4E7HA 5GMKl 3OYIA 2DIGA 2WSFE 4EMKB 5CKEA 1M5Q1 1N8RC 3FIFA 1YJ9A 2RM4A 4M7DE 4UC4A 1VIEA 3OYYA 1BI3A 2QA4T 3MP1A 1P92A 1ZQ1A 2XDBA 3C95A 2QEXT 2GCXA 2LRQA 2RHZA 3GLXA 3CXCA 2I2LA 1YHQA 4JRQA 1XOVA 4C0FA 3QSUA 3OQ5A 2WSCE 3QZ9B 4XTUA 4E7LA 5CO7A 5CR2A 4IUUA 2P4TA 3OYCA 4II1A 1OZ2A 2DAQA 4J8OA 3CMEA 4VUBA 3OMCA 1VQMT 4J83A 4MMKA 2PUKB 3M59A 2DZCA 4A4GA 4M7DF 1VIFA 2CGHA 2E10A 3MCAB 4JDSA 4M78C 2MI6A 1KD1C 3WVDB 3SB2A 4JRKA 1K9MU 2QQRA 4LDVA 2FVUA 3OW2S 2MF2A 2QQBA 5LJ3h 4F7UB 5LJ3g 3SWNA 4ZN1A 3OYDA 3CCRT 5GAMd 5CQYA 1JJ2S 2RK2A 3V8JA 4JJNK 2EAYA 2R58A 3OBYA 4ATOA 1VQOA 1DJ7B 1IZ6A 1YIJA 5M9OA 4EPCA 3SWNB 3OW2A 1K8AC 5FRMA 4M7DC 2JNGA 3DKMA 1B34B 2RH2A 2X4WA 5KCHA 2C06A 5HY6A 1WPYA 3E9GA 1VQ5A 1BI0A 2DZ9A 3OYHA 2X4XA 2EWNA 3FB9A 4PLIA 5GANd 3CCMA 3JCMb 3UPUA 5GAMh 3JCMW 1YJNA 3OA6A 1RL2A 3CCSA 5GAN8 2WACA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DK3 A;  3DKM A; 
#chains in the Genus database with same CATH topology
 2QI2 A;  2QA4 A;  2KDS A;  1MV0 B;  2O4X A;  1QCO A;  3E1S A;  3VS6 A;  1RAC B;  4M75 F;  1M90 R;  3QHS A;  2E41 A;  3PFS A;  4F7U E;  2YT6 A;  3TQ7 P;  1M8M A;  5GAN 6;  1HYO A;  3CC7 T;  4BI4 A;  1PD1 A;  3QJ6 A;  3VKI A;  1KIK A;  2DEU A;  3SD4 A;  1K9M C;  1FMK A;  5LL6 S;  2XD0 A;  1PWT A;  2L3P A;  2LNH B;  3SFM A;  3G4S T;  3S3O A;  3HSB A;  1TOV A;  2YUN A;  4BI3 A;  4QKU A;  1TS9 A;  2QQ9 A;  1UB4 A;  4M7A B;  3SEM A;  1NEG A;  5DLO A;  2GQV A;  1NZ9 A;  5D6W A;  1TUG B;  4MZT A;  4CRI A;  1X75 C;  2JTE A;  2HCK A;  4RUG A;  2P4R A;  3I5R A;  2BKD N;  3V8K A;  1OYX A;  1VQO Q;  1X01 A;  2M0O A;  4EMK C;  3LLR A;  1WIE A;  4LDX A;  3M0S A;  2K57 A;  1UTI A;  2EYW A;  2A0F B;  4M75 C;  2YDL A;  3A8H B;  4BD3 A;  3EFS A;  4XTW A;  4PJO A;  3MJX A;  3UWN A;  2H3J A;  4WF2 A;  1LNX A;  3RUX A;  2VYT A;  1SKU B;  1YIT T;  1Q86 U;  2E3I A;  2R5M A;  3OYE A;  1YJN Q;  4Z88 A;  4J9G A;  2XU8 A;  3V7R A;  1VUB A;  2DL8 A;  3HFO A;  2E5Q A;  3TU4 K;  5CVI A;  1YIT A;  3CCL Q;  3H41 A;  1D09 B;  3FRN A;  3MP8 A;  1KQ2 A;  2B8A A;  2F2W A;  3HKS A;  1N9S A;  1H8K A;  2RQV A;  1G3S A;  5KYU A;  1M1K U;  1VQN T;  2CH4 W;  1WJS A;  2ZPF B;  3S6W A;  3R6O A;  1W2B S;  2V1R A;  3C4S A;  1PC0 A;  4C5E A;  4OMO A;  5HCK A;  3HP9 A;  5GAN 5;  4HT8 A;  2RJC A;  1IGQ A;  1BI1 A;  3JB9 G;  2C0O A;  5J3B A;  4AFQ C;  3X26 B;  3L2V A;  2YRD A;  4AT1 B;  1B7T A;  3M54 A;  2XG8 D;  1Q82 C;  4GY5 A;  3JCM P;  3FLG A;  1I8F A;  5DM7 R;  4C8Q D;  2A36 A;  4F04 B;  4OMM A;  2PNI A;  3JV3 A;  2DTI A;  4R0K A;  3M53 A;  4A53 A;  2PTK A;  3RES A;  2HDA A;  3EG2 A;  1TSF A;  1R0C B;  4PNO A;  1QVF A;  5C0M A;  3EGX B;  3JCM Q;  1G83 A;  4OGE A;  2CS7 A;  1A0N B;  4M7D D;  4IUQ A;  5FW9 A;  5HK3 A;  3LX7 A;  4BB7 A;  3X25 B;  4YTL A;  4XTZ A;  2AKK A;  5AYF A;  1AZE A;  2L8D A;  2K3Y A;  2D0Q B;  1V29 B;  1D1C A;  5KH6 A;  2K9G A;  3LGL A;  4CC3 A;  3EG9 A;  4M78 G;  4C8Q C;  5GMK h;  5CK9 A;  2L3R A;  5FU7 B;  2RHI A;  4C92 D;  1K0X A;  5GAN 3;  4J9B A;  2RPN A;  4XTV A;  1OU8 A;  1W2B A;  2H3E B;  3QYG B;  3WVE B;  1VYT A;  5GJV B;  3CCQ T;  2KR3 A;  1GCQ A;  4LE9 A;  3OYG A;  2J6F A;  2X3W D;  2KT8 A;  2GNC A;  3MHX A;  4Z02 A;  1Q95 G;  2RF0 A;  4L6V 5;  2FPE A;  3MEW A;  4LDY A;  5GAO p;  1E6H A;  2GBQ A;  4IKF A;  3GBQ A;  1ZUK A;  3CMA T;  2DO3 A;  1SPK A;  4KBM B;  2ZPH B;  1AWJ A;  1UHF A;  1ZBJ A;  3PT9 A;  3CCR A;  2EJF A;  2Z0W A;  1Q7Y U;  3BDL A;  1KC8 R;  4AFU C;  2E65 A;  4F7U G;  2J7I A;  4KUL A;  2OTL T;  2IIM A;  8ATC B;  2OJ2 A;  1N8R R;  1I0C A;  3JAM E;  3V7C A;  4JLG A;  4OP0 A;  1ZLM A;  2NLU A;  2FZC B;  3OS5 A;  4HCZ A;  5KE3 A;  1Q7Y C;  4E2F B;  1S1N A;  1VQN A;  1OQK A;  1UEB A;  3A8O B;  3L2W A;  2DXU A;  1FX7 A;  1YNZ A;  4OB2 B;  2LJ0 A;  3G71 A;  4PJO E;  1PKT A;  1WHH A;  2JXB A;  1I5L A;  1M2V B;  3URG A;  4M7A C;  4M77 C;  4ESR A;  1WHM A;  1SHF A;  4DQ2 A;  2DVJ A;  3MPU B;  2GTJ A;  2LJ1 A;  2XIC A;  3PTA A;  2CT3 A;  4E6R A;  1SRL A;  4KGX B;  5ECA A;  4PJN A;  1Y07 A;  4X34 A;  1M27 C;  2J6K A;  1M3A A;  3E2U A;  2K2M A;  3FDR A;  4V2S A;  4XU0 A;  1BB9 A;  2K6D A;  4N0A A;  2KEA A;  1I5O B;  4C5G A;  3X28 B;  3N5B B;  1U3O A;  2D1X A;  2LC4 A;  3RIR A;  1M90 U;  2X51 A;  2DA9 A;  3LWH A;  1WNL A;  4OMP A;  2B86 A;  3PIO A;  5GAN e;  2DXB A;  4C8Q F;  2RI5 A;  3PIP A;  5IHI A;  5FRM A;  4LNP A;  3CMA A;  1B34 A;  4RTW A;  1OUL A;  2EGC A;  3HTR A;  2A37 A;  3VRY A;  3OYK A;  2BZX A;  1H3H A;  5LJ5 d;  5FU6 B;  3QJY A;  4PJM A;  5IN1 A;  3VYG A;  1I1J A;  1YHQ Q;  4AG2 C;  1QVG S;  4ANJ A;  3P8B B;  4XTX A;  1UGV A;  4M77 G;  1YCY A;  3CCE T;  1N5Z A;  2HSP A;  4ZN3 A;  1TWB A;  1QVF P;  2JZ2 A;  1NLP C;  4FYW B;  5GAN 2;  2RN8 A;  4AFS C;  4OB0 B;  4AMC A;  2YSQ A;  1NEB A;  3CCE A;  1W70 A;  1PSE A;  3O5Z A;  4N0A C;  1PSF A;  2CSQ A;  1Z9Q A;  2EQJ A;  2O2O A;  2ZZD A;  4KRT A;  5GMK m;  3OS2 A;  2FYK A;  1R0B G;  4J6Y A;  2M16 A;  3LH5 A;  1WDX A;  3CME Q;  1KD1 R;  3MP6 A;  2G3R A;  5GMK i;  1QCF A;  2BE7 D;  2J06 A;  1VQ6 Q;  2C0T A;  3JB9 I;  4KGZ B;  3CPW A;  2GQI A;  5FWB A;  1VQ8 Q;  3I35 A;  4E7H A;  1NM7 A;  5GMK l;  4FYY B;  2WSF E;  1N8R C;  4M7D E;  1YJ9 A;  1ZSZ A;  3MP1 A;  1ZQ1 A;  3C95 A;  1UE9 A;  2QEX T;  1OV3 A;  2RHZ A;  3GLX A;  4CC2 A;  1YHQ A;  1ZX6 A;  3QSU A;  2P84 A;  4XTU A;  2DAQ A;  1QVG P;  2VKN A;  3CME A;  3EGU A;  1MND A;  3OMC A;  1VQM T;  3G71 Q;  2DZC A;  4A4G A;  1VIF A;  3SB2 A;  4JRK A;  2QQR A;  1WZO A;  2MF2 A;  5LJ3 h;  4D8D A;  2RK2 A;  3V8J A;  5IH2 A;  3OW2 P;  1VQO A;  1YIJ A;  1RLQ C;  1R77 A;  2YUQ A;  5KCH A;  1WPY A;  1VQ5 A;  3FB9 A;  3D7S B;  3JCM b;  5GAM h;  2FO0 A;  1H92 A;  2ABL A;  1CSK A;  4PK4 A;  1YI2 Q;  2HMA A;  4J9I A;  2WAC A;  5GAN 8;  3DLL A;  3CCJ A;  1VQP T;  3V7S A;  1ZSG A;  3C12 A;  5IXB A;  4CC7 A;  3VS2 A;  2OAU A;  1JJ2 P;  4MDX A;  2O9V A;  3RKX A;  3CCQ A;  2G6F X;  1YIJ Q;  1UFF A;  4O6J A;  2A08 A;  2HL5 C;  2PZ1 A;  3OYJ A;  2EYQ A;  4NL2 A;  3ER0 A;  3EFO B;  3I56 A;  4AFZ C;  1YBY A;  3EFR A;  1ACM B;  2MAM A;  2YHT A;  3CCV A;  4HVW A;  4XK8 E;  3OYM A;  3JB9 F;  2BUD A;  4XU3 A;  2F5T X;  1TH7 A;  1UGQ B;  2VGM A;  5KYY B;  2PU9 B;  3R6N A;  1NG2 A;  1G3Y A;  5LJ3 f;  3L1A A;  3QKJ A;  3GNF B;  2ZPB B;  7AT1 B;  4C0D B;  5D6Y A;  4MDW A;  1X6O A;  2E4H A;  1X6B A;  2KGT A;  3UDC A;  1OEB A;  2KYB A;  3FEO A;  1UJY A;  1OPK A;  2LJ3 A;  2YUO A;  3RR6 A;  2DXT A;  1OOT A;  2CZ1 B;  2BTT A;  1S72 T;  3G6E A;  1QP2 A;  4B6M A;  2AIR B;  3QO3 A;  1AD5 A;  3CCS Q;  1UGP B;  2ESW A;  3PNW C;  4XQ3 A;  1YJW T;  3EGX A;  2AZV A;  1VQL T;  4FIB A;  2IPO B;  4Y28 E;  3A8M B;  4JJB A;  2LTO A;  4ZTF A;  2A28 A;  1OU9 A;  4QQG A;  3MEU A;  2F69 A;  3EAE A;  1SF9 A;  4DEX A;  5GAN j;  2DEQ A;  1GFD A;  4HCB A;  4HXJ A;  2HQE A;  4FL6 A;  1AWO A;  2LT1 A;  1KHC A;  1EIF A;  1N6A A;  5LJ5 g;  2LCC A;  4PJO C;  3O8V A;  1VYU A;  2KYM A;  1SEM A;  2K79 A;  3E9F A;  4M77 E;  1CKA A;  3IQL A;  4A63 B;  4XU2 A;  2KMT A;  1AHJ B;  2KVQ G;  3CCM T;  1QMC A;  2P0P A;  4A4H A;  3I55 Q;  2DPP B;  4JZ3 A;  1PRM C;  4ELZ C;  1ZA1 B;  2FG0 A;  4ZGJ B;  2WSE E;  4OGC A;  3J80 E;  4DBR A;  1SRM A;  4QQD A;  4HCC A;  3LWI A;  2VV5 A;  4M77 D;  3OS1 A;  1VQ9 Q;  3MO8 A;  1BIB A;  2LMJ A;  3P8D A;  3TSZ A;  2LQW A;  3RMQ A;  1HSQ A;  2AK5 A;  4JRI A;  4Y91 A;  1HK9 A;  1X69 A;  4A4K A;  2E70 A;  2HAX A;  2X3X D;  2PVD B;  4XU1 A;  2LP5 A;  5I2M A;  2HQX A;  1QLY A;  4M75 G;  5IAY A;  1G8X A;  2CYZ B;  3X24 B;  1ZSZ B;  5GAM g;  2CP6 A;  2HEQ A;  3P8H A;  1MNE A;  1QVF S;  5IT9 E;  3JCM X;  3M9Q A;  2IG0 A;  4J9F A;  4OF1 A;  2CP2 A;  2JVV A;  2JTF A;  1KC8 C;  1RAI B;  4KH1 B;  4ZNX A;  3QG1 A;  4XTY A;  5AT1 B;  3CCV T;  1M1K C;  3M0Q A;  4N4G A;  2LX9 A;  3GNG A;  1Q82 R;  3CC4 A;  2OTJ A;  1VQ6 A;  1VQP Q;  4IUR A;  3JB9 J;  4QVC A;  2OI3 A;  3UA6 A;  3SDZ A;  2COZ A;  1M9S A;  4LD9 K;  1RI9 A;  2AKL A;  2ZAE A;  1JJ2 A;  1YJ9 T;  2MYS A;  3CCV Q;  2DD4 A;  3CC2 A;  2RQU A;  2XID A;  4M75 B;  3S3N A;  1YHQ T;  2FHD A;  1AOJ A;  2XMF A;  3CC4 Q;  2LZ6 B;  3G6E T;  2OTJ Q;  3VS7 A;  1WQW A;  3VUZ A;  2KXD A;  3CC2 T;  2JJ9 A;  2RO0 A;  3BY7 A;  1WYX A;  3OYF A;  1EX4 A;  2VUB A;  1B07 A;  1UJ0 A;  3QII A;  1D1A A;  2EIF A;  1YJW A;  2OX7 A;  1YIT Q;  1BU1 A;  1KHI A;  2X35 A;  4PKC C;  1U8R A;  3NPF A;  1KD1 U;  1ZUU A;  1GL5 A;  1NYF A;  2FPF A;  1FWZ A;  2LDM A;  1Q7Y R;  5LJ5 j;  4BDY A;  1VQ5 T;  5J26 A;  4CC4 B;  1HD3 A;  5CQX A;  1VQ4 A;  3HHT B;  1KQ1 A;  3T9N A;  1M90 C;  1WHG A;  3CCJ T;  2RHX A;  4FW1 A;  4RMO A;  2QDL A;  1QKX A;  3L42 A;  3VRZ A;  1WXT A;  2FL7 A;  4M75 E;  4A54 A;  4F7U F;  2KT1 A;  3HRT A;  1OX8 A;  1VQK T;  5GMK e;  2L0A A;  2HZY A;  2QDY B;  3EG9 B;  4TVR A;  3I55 A;  4C0D C;  5A0L A;  2DM1 A;  2ED0 A;  3I56 T;  2M1H A;  3KXT A;  3G4S Q;  4JZ4 A;  2VC8 A;  1Y7X A;  3A1P A;  4C92 F;  1VQM A;  3QUI A;  4F17 A;  3LW5 E;  2RQR A;  3CQT A;  2RQW A;  3CC7 Q;  2K3X A;  2ZGW A;  1NE8 A;  1D0Y A;  2E1H A;  4C92 G;  5A2Q E;  1KG1 A;  2PVG B;  2MWO A;  1K73 C;  4JUV A;  3A98 A;  4M78 B;  1RAA B;  5LJ5 e;  3L2R A;  3AHU A;  4RCB A;  1NPR A;  1S72 A;  4RTY A;  3OY9 A;  2DTO A;  1IHV A;  1VOM A;  5GAN g;  1BYM A;  2YLC A;  2MOX A;  4BAC A;  4E7J A;  4C8Q B;  3EHR A;  2GF7 A;  2GFU A;  3CPW P;  1AZG B;  3RER A;  1TU0 B;  1WA7 A;  2MCN A;  3CBM A;  1E6G A;  2XK0 A;  3UAT A;  1F1B B;  1VQ8 A;  1T3L A;  1UGS B;  1G5V A;  2LNV A;  5J39 A;  2E12 A;  3G4S A;  2CZ7 B;  5LJ5 f;  2Y90 A;  3H0I A;  4N4I A;  3PVQ A;  1VQ5 Q;  1G2B A;  5KCO A;  1YJN T;  1E7O A;  1D0Z A;  4C5H A;  2LCS A;  1YI2 A;  2ROL A;  3QXE B;  3ZL7 C;  1LOJ A;  1Q82 U;  4QW2 A;  2QTV A;  4L59 A;  1M1F A;  4QVZ A;  2V8K A;  1VQ7 T;  4K11 A;  5KYN A;  2DER A;  2DK3 A;  1H64 1;  1NJI C;  1V1C A;  3OMG A;  2E5K A;  1KK7 A;  5DY9 A;  4DOW A;  1M8V A;  2X4J A;  2KRN A;  3UT1 A;  1TUD A;  4EMK B;  5CKE A;  3I56 Q;  4UC4 A;  1VA7 A;  5D7U A;  2XDB A;  1VQ4 Q;  2GCX A;  2LRQ A;  2JT4 A;  3CXC A;  1K4U S;  1LVK A;  2I2L A;  1RAE B;  1XOV A;  4C0F A;  3OQ5 A;  2WSC E;  5CO7 A;  4IUU A;  1BCO A;  1IHW A;  4F16 A;  4J8O A;  4VUB A;  2NUT A;  2MI6 A;  5IHK A;  1PHT A;  1T0J A;  3OW2 S;  2QQB A;  4F7U B;  3H9N A;  5LJ3 g;  4GBQ A;  3OYD A;  5GAM d;  2EAY A;  1DJ7 B;  1PNJ A;  4RTZ A;  1OX9 A;  2X4W A;  2RH2 A;  3DKM A;  2C06 A;  2CP7 A;  3E9G A;  2QAS A;  1BI0 A;  3UPU A;  3OYH A;  4J9E A;  3CCM A;  2MPX C;  3OA6 A;  1RL2 A;  2V1Q A;  3G7Z A;  3OSV A;  5GJW B;  3M4G A;  2RD1 A;  5I11 A;  3OS0 A;  3CC4 T;  4E7K A;  2OTJ T;  4C8Q A;  3U23 A;  2NUP A;  3KUF A;  4EMH A;  1QKW A;  3ZEH A;  4MML A;  3JCM V;  2EGA A;  2RHU A;  1VQK Q;  1MV3 A;  2FRY A;  2XKO C;  1LPL A;  3CME T;  1K1Z A;  3SHW A;  1RUW A;  5LJ3 d;  2BIV A;  1I81 A;  1SHG A;  5I2S A;  1UG1 A;  2K2V A;  1VQO T;  4EMG A;  3PMI A;  5CAI A;  4M77 A;  1GRI A;  2QEX A;  3EGD A;  1K0S A;  5GAM f;  3TEE A;  1JXM A;  5L8R E;  1D0X A;  5CKH A;  1YCS B;  3JCM h;  2W10 A;  4M78 E;  3OSS C;  3M56 A;  1VQP A;  4LD6 A;  4EMK A;  3CC2 Q;  3HRS A;  1UUE A;  2LQ8 A;  1VQ4 T;  1NPP A;  4C92 C;  1VQ9 A;  3KBG A;  1XJW B;  2SEM A;  8AT1 B;  4GLM A;  3J7A F;  2GTO A;  2DD5 A;  1X43 A;  2CUD A;  2E64 A;  3UF4 A;  4DA4 A;  2KRS A;  5KE2 A;  2HL3 A;  5GAM e;  1BBZ A;  3BDU A;  3LH0 A;  2EQM A;  3M5A A;  4NOY A;  4EIK A;  3JB9 D;  5KYX B;  1J3T A;  2K3B A;  3GPL A;  1XQH A;  4NL3 A;  3RBB B;  1B3Q A;  2KSS A;  2ZPE B;  1G3W A;  1SSH A;  3OYL A;  4Q5W A;  4C8Q G;  4BUG A;  2HKN A;  4X9D A;  3V8L A;  4BE1 A;  2EBP A;  3MET A;  4M75 D;  2DXC A;  1FMW A;  3L2Q A;  2M9U A;  1MHN A;  2LQN A;  1YP5 A;  4PJO F;  1BK2 A;  1ZA2 B;  3VS5 A;  1K76 A;  4PFZ A;  2O31 A;  4ME7 A;  4BE2 A;  1D3B A;  4PJJ A;  3QYH B;  2JS2 A;  1VQL A;  4LDU A;  3CCJ Q;  4F7U A;  1M3B A;  3GF5 A;  1WJR A;  2BZ8 A;  2L89 A;  1VQ9 T;  2NUT B;  2EYX A;  1K73 U;  1VQM Q;  2CKK A;  2QAZ A;  1R8O B;  1QQJ A;  1PD0 A;  3JB9 H;  1QCN A;  2EGE A;  2MK5 A;  2Y4X A;  3E19 A;  2O88 A;  2DBM A;  4M78 D;  1VYV A;  4C92 A;  5LJ3 e;  2DL5 A;  3CD6 T;  4RKU E;  3J81 E;  2KNB B;  4IUT A;  1WQ7 A;  4C0Z A;  4KT0 E;  1K9A A;  3M55 A;  3M4Y A;  1IGU A;  1U1S A;  1Y57 A;  1SG5 A;  3FJP A;  1AEY A;  1BKB A;  2P0K A;  3QDF A;  2FRW A;  4LDW A;  1C0M A;  4QQ6 A;  2O4X B;  1VQ6 T;  2E6Z A;  2DRM A;  2QGG A;  1GBR A;  2CP3 A;  5GAO n;  2ED1 A;  1WHL A;  5I21 A;  2DIL A;  2RJF A;  3H6Z A;  2AZS A;  4R56 A;  1Z9Z A;  3M57 A;  5GMK j;  1X2Q A;  3OYB A;  3G1J A;  4JS5 A;  2FPD A;  3CCS T;  1YIJ T;  5CKD A;  2K4Y A;  1WHK A;  1BCM A;  1VQ8 T;  2RHY A;  4OMQ A;  5A0D A;  1BI2 A;  3HPW A;  1JXO A;  3H8Z A;  3MEV A;  4M7A E;  5GAO l;  3DB4 A;  1W1F A;  1WJQ A;  2XDP A;  2DLP A;  9ATC B;  4IIM A;  4NS5 A;  2BE9 B;  4J7F A;  4E7Z A;  2F2V A;  1ZHI A;  2AHJ B;  2FEI A;  2ZPG B;  2MIO A;  4PJO D;  1IXD A;  1AVZ C;  2COW A;  1M2O A;  1V76 A;  4B9X A;  2DIQ A;  2JOY A;  2LCL A;  2AT1 B;  2Y4Y A;  1HJD A;  5I22 A;  1Y96 A;  5A0G A;  2VXF A;  3ZBD A;  1JEG A;  1GXI E;  2V8I A;  4CI0 C;  2DFU A;  2EYZ A;  4FSS A;  2KRM A;  1T3S A;  3JCM c;  5GAO r;  4E47 A;  2KQW A;  2EJG A;  2NYS A;  2DYI A;  4DBH A;  1WXU A;  2PVO B;  3VV0 A;  4A4E A;  4JLI A;  3OYA A;  1QVP A;  1PCX A;  2XDD A;  2KE9 A;  1K73 R;  5GAM j;  3CBP A;  4PJO B;  1IO6 A;  4HVV A;  4E7S A;  2JMC A;  3LYI A;  4ZGE B;  3NMZ C;  3C0C A;  1Y96 B;  2GFA A;  4M75 A;  2P0Q A;  1RAF B;  3EG0 A;  1QW1 A;  4D6W A;  2NWM A;  4PL6 A;  1QP3 A;  4ELY C;  1WX6 A;  2VXE A;  3M0R A;  1PKS A;  3VU3 C;  4A4F A;  1NJI U;  1VQ7 Q;  2CZ0 B;  2PUO B;  3BE3 A;  1N9R A;  3TSW A;  4IUV A;  2X4Y A;  3QBY A;  4FCY A;  2RK1 A;  2DYB A;  5LJ3 j;  3DLM A;  3I55 T;  2D8H A;  2NUP B;  1IRE B;  2DRK A;  3EG3 A;  1M1G A;  4FU6 A;  3GOX A;  2ECZ A;  2RA2 A;  5FU7 C;  4QVD A;  2JMA A;  4M7A G;  4FT4 A;  5CCA A;  2DET A;  2IVW A;  3JCM d;  3QPH A;  2W0Z A;  1SSF A;  1FYN A;  2BZY A;  2JN0 A;  3EHQ A;  1AWW A;  3EH1 A;  1KQS P;  2QQS A;  4O5V A;  1ZBX A;  2RJE A;  3CD6 Q;  2RI2 A;  4J9D A;  1RAD B;  3CCU A;  2OTL A;  2DKG A;  3RKW A;  2EQU A;  4BY6 C;  1CKB A;  2HD0 A;  2EQI A;  3MKD A;  1WFW A;  2JM8 A;  4C0G A;  2ATC B;  5DLQ E;  4JJD A;  1T0H A;  2YRV A;  2D6F A;  2CUB A;  1KC8 U;  4BDZ A;  4HKE A;  5KYU B;  1M1K R;  1FMV A;  1S72 Q;  2QK0 A;  3EG1 A;  1M5Q 1;  3FIF A;  2RM4 A;  2ROT A;  3OYY A;  2QA4 T;  1P92 A;  3CCM Q;  2OAW A;  1Q81 R;  4JRQ A;  2LX7 A;  2DMO A;  2L3S A;  1JU5 C;  4KGV B;  3QZ9 B;  1M3C A;  2P4T A;  4II1 A;  1KJW A;  2QG9 B;  1GCQ C;  4J83 A;  4MMK A;  4M7D F;  2DNU A;  3CCR Q;  3MCA B;  2CGH A;  3QWY A;  1UDL A;  1YJ9 Q;  1YWO A;  3SWN A;  4ZN1 A;  6AT1 B;  1JJ2 S;  5KYX A;  4JJN K;  2R58 A;  4ATO A;  1IZ6 A;  1K8A R;  5M9O A;  4EPC A;  3SWN B;  3OW2 A;  1K8A C;  1IB8 A;  3NGP A;  5HY6 A;  4PLI A;  3JCM W;  4M7A A;  1YJN A;  1MUZ A;  2KI7 A;  4DBQ A;  4DBF A;  4RG2 A;  3A8G B;  3HFN A;  4HVU A;  1JB0 E;  2EKH A;  4C8Q E;  1TG0 A;  3CEY A;  1W6X A;  2A7Y A;  1UHC A;  3I5S A;  4WCI A;  1VQ7 A;  2EFI A;  2HBP A;  3CBO A;  1U1T A;  1ZSZ C;  4RTT A;  2LVM A;  1U06 A;  3G6E Q;  4RTX A;  4J6W A;  2KY9 A;  1OPL A;  2EPD A;  3RDV A;  3TCJ A;  4X1V A;  3GP8 A;  3CCL T;  5FRN A;  3HRU A;  4FW2 A;  2HSE B;  3RMS A;  4E7I A;  3CPF A;  3M0U A;  4JS4 A;  3X20 B;  5GAN 7;  4Y92 A;  2FZG B;  2VAS A;  2K5I A;  2YLB A;  4FYX B;  3RNJ A;  4ZTJ A;  3JCM e;  5KYW A;  4WTO B;  1D3B B;  1GCP A;  1EFN A;  1JRI A;  2VWF A;  2RJD A;  1WHJ A;  2KRO A;  1HXD A;  5D6X A;  5KYW B;  3QZ5 B;  5GAN f;  1Q81 C;  3M58 A;  4MZM A;  3CPW S;  2VB6 A;  2K5L A;  4PLL A;  5LJ5 h;  1M30 A;  3CCU T;  2SRC A;  2QTX A;  1UEC A;  2L2P A;  4ORZ A;  3UA7 A;  2ZPI B;  5IHN A;  1LCK A;  4M77 B;  1YFN A;  5EC7 A;  1YN8 A;  1GBQ A;  4LXC A;  3VS0 A;  3PMT A;  2O9S A;  3JCM g;  3CCQ Q;  4P5N A;  3FJ5 A;  4MZP A;  4M77 F;  2JUF A;  1PRL C;  2MWP A;  4J9H A;  2DJQ A;  5FLX E;  4N4H A;  4FT2 A;  5C6S A;  4F14 A;  1BIA A;  1I4K 1;  3TRE A;  2DJZ A;  4OB1 B;  2DVE A;  3PVL A;  2KK4 A;  1JQQ A;  1ZUY A;  2H8H A;  3F70 A;  2X9H A;  2ENM A;  3REA B;  2YRC A;  1MGQ A;  2K7A A;  4BY6 B;  2QYZ A;  2EKO A;  5GAN h;  2QEX Q;  2F5K A;  1AWX A;  4B9W A;  3PGG A;  2L5Q A;  2RQT A;  1H3Z A;  1WI7 A;  3H0F A;  1TXQ A;  1NLO C;  2CSI A;  2JS0 A;  5EG2 A;  1JO8 A;  1ARK A;  4RCC A;  4C5I A;  2LQK A;  1Q86 C;  2V8J A;  4OMF B;  4KUI A;  2CP5 A;  4DOV A;  2EQK A;  3TVT A;  2RNA A;  2HBW A;  5CIU A;  2KBT A;  3JRZ A;  2QQA A;  2M02 A;  2CZ6 B;  3OB9 A;  2YUP A;  2QA4 Q;  2RI3 A;  2DL3 A;  3INZ A;  3BW1 A;  4FYV B;  2HQH A;  1LJO A;  1RAB B;  4EDU A;  3QWX X;  4JPB W;  3HL8 A;  3ULR B;  5L23 A;  1WLP B;  5CKF A;  3I9Q A;  1C1A A;  2O01 E;  4AG1 C;  2F1L A;  5FU6 C;  1RLP C;  3LGF A;  4Z89 A;  2RMO A;  3C94 A;  1M2V A;  4HA8 A;  4HCK A;  3VS3 A;  4KH0 B;  2D8J A;  2F2X A;  4J5Y A;  3ZFJ A;  3CXC S;  1K8A U;  2I0N A;  2K5F A;  4QT7 A;  1AT1 B;  1KQS A;  2D0N A;  2EW3 A;  1OI1 A;  2QXF A;  3VUB A;  2GGR A;  5HK0 A;  1RI0 A;  3A8L B;  1XNI A;  3JCM f;  2JTM A;  4PFO A;  2ZCF B;  1RAG B;  4PJO G;  1TUC A;  3VYH B;  4L5G A;  4D8K A;  3NFC A;  3G71 T;  4FSX A;  3VJP A;  4RTV A;  3CD6 A;  3SWN C;  4M7D B;  4X9C A;  2C0I A;  3CXC P;  3JSC A;  1ABO A;  4M7D A;  3S3M A;  3PE0 A;  1I07 A;  4OMN A;  5FRO A;  1N8R U;  2MMP A;  5GAO q;  2VGN A;  2VVK A;  1UGR B;  3CMA Q;  1Y71 A;  2PQW A;  4IUP A;  2JM9 A;  1YI2 T;  1NJI R;  5HKC A;  1TTH B;  1N27 A;  1QWF A;  2XHC A;  1XTD A;  2DL4 A;  5CKB A;  3L2U A;  4JJC A;  3M0P A;  1WXB A;  4LUD A;  2QGF B;  3OYN A;  2DTH A;  1KQS S;  4ZGD B;  2J05 A;  3DB3 A;  3FC3 A;  3A5Z B;  3L2Z A;  2YWW A;  5KYY A;  3CC7 A;  1WGS A;  4R55 A;  1JBM A;  2R57 A;  1X2K A;  3NHN A;  3Q1J A;  1VQL Q;  1NBE B;  1YJW Q;  1OZ3 A;  3JCM J;  2CT4 A;  4FM4 B;  4XAX B;  5GAN 4;  1PG5 B;  4OVA A;  1X27 A;  3NTK A;  1Y0M A;  4HT9 A;  2L3Q A;  3CCE Q;  3GIB A;  4BE0 A;  4M7A D;  4OB3 B;  3AT1 B;  4PFP A;  3NTH A;  3OBW A;  1G3T A;  4JRP A;  3EH2 A;  4IIO A;  1VQN Q;  3RKY A;  3M0T A;  3EGD B;  2D9T A;  1ABQ A;  1MMA A;  4M78 F;  4LUE A;  4C92 E;  1MMN A;  2M51 A;  5FWC A;  1K9M R;  4M7A F;  2DBK A;  3VS1 A;  1PM3 A;  2XI9 A;  3EFO A;  3CCU Q;  4J7I A;  2R5A A;  3MEA A;  4M78 A;  2E6N A;  2YXY A;  3H0H A;  1MMD A;  4KUD K;  4M7D G;  2V26 A;  1D1B A;  4BI8 B;  5IXF A;  1O75 A;  1W4S A;  3ASK A;  2E3H A;  1FXX A;  2EJ9 A;  4PJL A;  4Z8A A;  2DX1 A;  4LN2 A;  1QWE A;  2DL7 A;  1Q86 R;  4OML A;  2FB7 A;  3CCL A;  1M4Z A;  1GFC A;  1X6G A;  3QDR B;  1Q81 U;  4J9C A;  3ME9 A;  2LT4 A;  3NTI A;  4C92 B;  4J6X A;  5GAO m;  2M0Y A;  4M4Z A;  2A3L A;  1O9S A;  2HNI A;  1MMG A;  1QVG A;  2EYY A;  2J6O A;  1KFZ A;  2COY A;  2KAF A;  3THK A;  2RB6 A;  2FZK B;  2CH4 A;  2CP0 A;  1IRX A;  4GLK A;  4RG8 A;  3BFM A;  3WXM B;  3KFV A;  1VQK A;  3OYI A;  2DIG A;  3VS4 A;  1C6V X;  1VIE A;  1BI3 A;  1U5S A;  1YWP A;  2KXC A;  4RTU A;  2CRE A;  2DF6 A;  4E7L A;  5CR2 A;  3OYC A;  1OZ2 A;  2PUK B;  3M59 A;  4JDS A;  1KSW A;  2E10 A;  4M78 C;  1NYG A;  1KD1 C;  3WVD B;  1K9M U;  3REB B;  4LDV A;  2FVU A;  3CCR T;  5CQY A;  4DEY A;  3OBY A;  2EVR A;  4M7D C;  1EZZ B;  1RAH B;  2CDT A;  2JNG A;  1B34 B;  2HKQ B;  2NUZ A;  2DZ9 A;  2X4X A;  2EWN A;  5GAN d;  2JW4 A;  1W2B P;  2DE0 X;  3CCS A;  2OTL Q; 
#chains in the Genus database with same CATH homology
 3DLL A;  2QI2 A;  4RG2 A;  2QA4 A;  2KDS A;  3A8G B;  3HFN A;  3G7Z A;  3OSV A;  1VQP T;  2O4X A;  3V7S A;  3M4G A;  2RD1 A;  1JB0 E;  3C12 A;  3OS0 A;  3E1S A;  4C8Q E;  3CC4 T;  3CEY A;  4E7K A;  2OTJ T;  2A7Y A;  2OAU A;  4M75 F;  4C8Q A;  3QHS A;  2E41 A;  3PFS A;  4F7U E;  1VQ7 A;  4MDX A;  3KUF A;  4EMH A;  3RKX A;  3CCQ A;  2EFI A;  2HBP A;  3CBO A;  4O6J A;  3ZEH A;  5GAN 6;  1U1T A;  3CC7 T;  4MML A;  3JCM V;  3OYJ A;  2RHU A;  2EYQ A;  4NL2 A;  2LVM A;  4BI4 A;  2XKO C;  3ER0 A;  3QJ6 A;  3VKI A;  3I56 A;  1YBY A;  3EFR A;  3CME T;  3SD4 A;  4J6W A;  1K9M C;  2KY9 A;  2MAM A;  2YHT A;  3CCV A;  5LJ3 d;  5LL6 S;  2XD0 A;  3TCJ A;  4XK8 E;  3OYM A;  2BIV A;  1I81 A;  3GP8 A;  3JB9 F;  2BUD A;  3CCL T;  4XU3 A;  2F5T X;  3SFM A;  3G4S T;  5FRN A;  1TH7 A;  1UGQ B;  2VGM A;  3HRU A;  3S3O A;  5I2S A;  3HSB A;  2PU9 B;  4BI3 A;  2K2V A;  1G3Y A;  1VQO T;  4EMG A;  5LJ3 f;  3PMI A;  3RMS A;  3L1A A;  5CAI A;  2QQ9 A;  3QKJ A;  4M77 A;  4E7I A;  3GNF B;  1UB4 A;  2QEX A;  4M7A B;  5GAM f;  3CPF A;  4JS4 A;  5DLO A;  3X20 B;  3TEE A;  2ZPB B;  5GAN 7;  4C0D B;  5D6Y A;  2GQV A;  5L8R E;  1NZ9 A;  4MDW A;  1X6O A;  5CKH A;  5D6W A;  4MZT A;  4CRI A;  3UDC A;  1X75 C;  2K5I A;  2YLB A;  3JCM h;  2BKD N;  3FEO A;  3V8K A;  1KG1 A;  4M78 E;  4ZTJ A;  3JCM e;  3OSS C;  1OYX A;  3M56 A;  1D3B B;  1X01 A;  2M0O A;  2DXT A;  1VQP A;  2CZ1 B;  1JRI A;  3LLR A;  4LD6 A;  4EMK A;  4EMK C;  4LDX A;  2RJD A;  2K57 A;  1S72 T;  3G6E A;  1QP2 A;  1HXD A;  3HRS A;  4M75 C;  2LQ8 A;  5D6X A;  3QZ5 B;  1VQ4 T;  3A8H B;  1NPP A;  4BD3 A;  3QO3 A;  3EFS A;  4XTW A;  4C92 C;  5GAN f;  1VQ9 A;  4PJO A;  1Q81 C;  3M58 A;  2H3J A;  4MZM A;  3KBG A;  3UWN A;  3CPW S;  3CCJ A;  4WF2 A;  1LNX A;  2K5L A;  3RUX A;  2VYT A;  3J7A F;  1YIT T;  4PLL A;  5LJ5 h;  1Q86 U;  2DD5 A;  2E64 A;  3CCU T;  1UGP B;  2QTX A;  3PNW C;  4XQ3 A;  1YJW T;  2ZPI B;  2R5M A;  3OYE A;  4DA4 A;  1VQL T;  5KE2 A;  4FIB A;  4M77 B;  4Y28 E;  3A8M B;  2LTO A;  4ZTF A;  2XU8 A;  3V7R A;  5GAM e;  1VUB A;  3PMT A;  3MEU A;  3HFO A;  3BDU A;  2E5Q A;  2F69 A;  3EAE A;  3LH0 A;  4P5N A;  4QQG A;  3JCM g;  3TU4 K;  5CVI A;  2EQM A;  3M5A A;  1YIT A;  5GAN j;  3FRN A;  4MZP A;  4NOY A;  2DEQ A;  3MP8 A;  2B8A A;  4M77 F;  2JUF A;  1N9S A;  3HKS A;  1KQ2 A;  1G3S A;  4HCB A;  2MWP A;  3JB9 D;  2HQE A;  5FLX E;  4N4H A;  1M1K U;  4FT2 A;  5C6S A;  3GPL A;  1VQN T;  1WJS A;  2ZPF B;  4FL6 A;  2LT1 A;  1KHC A;  1BIA A;  1XQH A;  1EIF A;  4NL3 A;  1I4K 1;  3S6W A;  3R6O A;  2DJZ A;  3TRE A;  1N6A A;  4OB1 B;  5LJ5 g;  1W2B S;  2DVE A;  3C4S A;  2KSS A;  2LCC A;  4C5E A;  2ZPE B;  2KK4 A;  1G3W A;  4PJO C;  3O8V A;  3OYL A;  4Q5W A;  4C8Q G;  3HP9 A;  4BUG A;  3F70 A;  5GAN 5;  3E9F A;  4X9D A;  2RJC A;  3V8L A;  4BE1 A;  4HT8 A;  4M77 E;  1MGQ A;  1BI1 A;  4BY6 B;  3JB9 G;  3MET A;  4M75 D;  5J3B A;  2EKO A;  4XU2 A;  2KMT A;  3X26 B;  3L2V A;  1AHJ B;  2KVQ G;  5GAN h;  3CCM T;  2P0P A;  2DXC A;  2F5K A;  3L2Q A;  2M9U A;  1MHN A;  3M54 A;  2XG8 D;  4PJO F;  4A4H A;  1Q82 C;  3CCJ T;  4B9W A;  2DPP B;  4GY5 A;  3PGG A;  2L5Q A;  3JCM P;  1H3Z A;  3FLG A;  1I8F A;  4ELZ C;  5DM7 R;  4ME7 A;  4C8Q D;  4ZGJ B;  4BE2 A;  1D3B A;  2WSE E;  4OGC A;  3J80 E;  3QYH B;  5EG2 A;  4QQD A;  1Q82 U;  3LWI A;  1VQL A;  4HCC A;  2DTI A;  2VV5 A;  4RCC A;  4M77 D;  2LQK A;  3M53 A;  4C5I A;  2V8J A;  4LDU A;  1Q86 C;  3OS1 A;  4OMF B;  4A53 A;  3MO8 A;  1BIB A;  3P8D A;  4KUI A;  3GF5 A;  3RES A;  4F7U A;  4DOV A;  1WJR A;  2EQK A;  3RMQ A;  2L89 A;  4JRI A;  5CIU A;  1VQ9 T;  3JRZ A;  4Y91 A;  2QQA A;  1K73 U;  2CKK A;  1HK9 A;  2CZ6 B;  1R8O B;  3OB9 A;  4PNO A;  4A4K A;  1QVF A;  2E70 A;  5C0M A;  2HAX A;  2RI3 A;  3JCM Q;  3JB9 H;  3INZ A;  3BW1 A;  4OGE A;  2CS7 A;  4M7D D;  4IUQ A;  1LJO A;  2PVD B;  4XU1 A;  4EDU A;  2Y4X A;  3E19 A;  5HK3 A;  4M78 D;  5I2M A;  3LX7 A;  4BB7 A;  3X25 B;  4C92 A;  2HQX A;  4YTL A;  5LJ3 e;  3CD6 T;  4M75 G;  4RKU E;  4XTZ A;  3J81 E;  3HL8 A;  5IAY A;  2CYZ B;  5AYF A;  3X24 B;  2L8D A;  4IUT A;  2K3Y A;  5GAM g;  1WQ7 A;  3P8H A;  5CKF A;  4KT0 E;  4C0Z A;  2D0Q B;  1V29 B;  2O01 E;  5KH6 A;  5FU6 C;  3M55 A;  3M4Y A;  1QVF S;  3LGF A;  3LGL A;  5IT9 E;  1U1S A;  3JCM X;  3C94 A;  3M9Q A;  2IG0 A;  3FJP A;  1BKB A;  2P0K A;  4OF1 A;  1KC8 C;  2JVV A;  2JTF A;  4M78 G;  4C8Q C;  5GMK h;  5CK9 A;  4M7A A;  4LDW A;  2L3R A;  4HA8 A;  4QQ6 A;  5FU7 B;  2O4X B;  1VQ6 T;  2RHI A;  4J5Y A;  3QG1 A;  3ZFJ A;  4C92 D;  2E6Z A;  4XTY A;  3CCV T;  1M1K C;  4N4G A;  3CXC S;  1K8A U;  2LX9 A;  3GNG A;  5GAN 3;  3CC4 A;  2OTJ A;  2K5F A;  4XTV A;  1W2B A;  1KQS A;  5GAO n;  1VQ6 A;  3QYG B;  5I21 A;  4IUR A;  3WVE B;  1OI1 A;  2QXF A;  3CCQ T;  4QVC A;  3JB9 J;  2RJF A;  3VUB A;  5HK0 A;  3H6Z A;  1RI0 A;  3A8L B;  3SDZ A;  4R56 A;  1M9S A;  4LD9 K;  1XNI A;  3M57 A;  3JCM f;  5GMK j;  2JTM A;  1JJ2 A;  3OYB A;  2ZCF B;  1YJ9 T;  4PJO G;  2DD4 A;  3OYG A;  4JS5 A;  3VYH B;  3CC2 A;  4L5G A;  2XID A;  3NFC A;  4M75 B;  3S3N A;  3CCS T;  1YIJ T;  5CKD A;  2K4Y A;  3G71 T;  3MHX A;  4FSX A;  3VJP A;  1YHQ T;  4Z02 A;  3CD6 A;  2FHD A;  1VQ8 T;  2RHY A;  5A0D A;  1BI2 A;  4L6V 5;  3SWN C;  3HPW A;  3G6E T;  3MEW A;  4X9C A;  3H8Z A;  3MEV A;  4M7D B;  1WQW A;  4LDY A;  3VUZ A;  5GAO p;  3JSC A;  3CC2 T;  4M7A E;  5GAO l;  2RO0 A;  3BY7 A;  4IKF A;  3DB4 A;  3CMA T;  1WJQ A;  2DO3 A;  2XDP A;  4KBM B;  2ZPH B;  3OYF A;  4M7D A;  4NS5 A;  3S3M A;  5FRO A;  4J7F A;  3PT9 A;  3CCR A;  2EJF A;  2MMP A;  2VUB A;  1N8R U;  3QII A;  5GAO q;  2VGN A;  1Q7Y U;  1UGR B;  2EIF A;  3BDL A;  1YJW A;  1ZHI A;  2AHJ B;  1KHI A;  2ZPG B;  1Y71 A;  2PQW A;  2X35 A;  2E65 A;  4PKC C;  4F7U G;  1U8R A;  4KUL A;  4IUP A;  1YI2 T;  1KD1 U;  5HKC A;  2OTL T;  4PJO D;  2LDM A;  1FWZ A;  1N27 A;  5LJ5 j;  4BDY A;  1VQ5 T;  2XHC A;  1XTD A;  5J26 A;  5CKB A;  5CQX A;  3V7C A;  3JAM E;  4B9X A;  3L2U A;  1VQ4 A;  3HHT B;  1KQ1 A;  2DIQ A;  3T9N A;  4JLG A;  2JOY A;  1M90 C;  4OP0 A;  2RHX A;  2DTH A;  2NLU A;  2LCL A;  3OS5 A;  4HCZ A;  2Y4Y A;  4ZGD B;  5KE3 A;  3OYN A;  1Q7Y C;  1KQS S;  1VQN A;  1Y96 A;  4RMO A;  5A0G A;  1UEB A;  2VXF A;  3A8O B;  3L2W A;  3DB3 A;  3L42 A;  2DXU A;  3ZBD A;  1FX7 A;  3FC3 A;  3A5Z B;  4OB2 B;  1GXI E;  2V8I A;  2FL7 A;  4M75 E;  4A54 A;  3G71 A;  3L2Z A;  4F7U F;  3HRT A;  3CC7 A;  1VQK T;  1WGS A;  5GMK e;  4CI0 C;  4R55 A;  1JBM A;  4PJO E;  1I5L A;  2R57 A;  2QDY B;  3URG A;  4M7A C;  3Q1J A;  4M77 C;  4TVR A;  3JCM c;  5GAO r;  4E47 A;  3I55 A;  1OZ3 A;  4C0D C;  5A0L A;  3JCM J;  4DQ2 A;  4FM4 B;  2KQW A;  4XAX B;  5GAN 4;  3I56 T;  2M1H A;  3KXT A;  4OVA A;  2EJG A;  3NTK A;  2VC8 A;  2XIC A;  3PTA A;  4HT9 A;  1Y7X A;  4C92 F;  3GIB A;  1VQM A;  3QUI A;  1Y07 A;  4X34 A;  2PVO B;  4BE0 A;  3VV0 A;  4M7A D;  4OB3 B;  4A4E A;  3FDR A;  4JLI A;  4V2S A;  3LW5 E;  4XU0 A;  3OYA A;  3NTH A;  3OBW A;  1G3T A;  1QVP A;  4N0A A;  2K3X A;  4C5G A;  2XDD A;  4JRP A;  2ZGW A;  3X28 B;  3N5B B;  2LC4 A;  1NE8 A;  5GAM j;  3CBP A;  3RIR A;  3RKY A;  4PJO B;  1M90 U;  2D9T A;  3LYI A;  4ZGE B;  2E1H A;  3LWH A;  1Y96 B;  4C92 G;  5A2Q E;  1WNL A;  3PIO A;  2GFA A;  5GAN e;  2DXB A;  4M75 A;  4C8Q F;  2PVG B;  2RI5 A;  2P0Q A;  2MWO A;  3PIP A;  3CMA A;  4JUV A;  1B34 A;  4M78 B;  4M78 F;  1K73 C;  1QW1 A;  4C92 E;  5LJ5 e;  3L2R A;  4D6W A;  4PL6 A;  1QP3 A;  4ELY C;  2VXE A;  3VU3 C;  4A4F A;  3AHU A;  1NJI U;  4M7A F;  2CZ0 B;  2PUO B;  4RCB A;  3OYK A;  1N9R A;  1NPR A;  2XI9 A;  1S72 A;  4IUV A;  3OY9 A;  2DTO A;  2X4Y A;  3QBY A;  4J7I A;  2R5A A;  3MEA A;  2RK1 A;  4M78 A;  2E6N A;  5LJ3 j;  5GAN g;  5LJ5 d;  3DLM A;  5FU6 B;  1BYM A;  3I55 T;  3QJY A;  2YLC A;  5IN1 A;  1IRE B;  3VYG A;  4KUD K;  4BAC A;  4M7D G;  4E7J A;  4C8Q B;  4BI8 B;  1M1G A;  4FU6 A;  3GOX A;  2RA2 A;  1W4S A;  1O75 A;  3ASK A;  5FU7 C;  4QVD A;  1QVG S;  2GF7 A;  2GFU A;  3P8B B;  3RER A;  1FXX A;  4XTX A;  4M7A G;  2EJ9 A;  4M77 G;  4FT4 A;  5CCA A;  2IVW A;  3CBM A;  3JCM d;  2XK0 A;  3QPH A;  1YCY A;  3CCE T;  1VQ8 A;  1SSF A;  1UGS B;  4ZN3 A;  2FB7 A;  2JN0 A;  1G5V A;  2JZ2 A;  3CCL A;  1M4Z A;  5GAN 2;  2LNV A;  2QQS A;  2E12 A;  3QDR B;  4O5V A;  1ZBX A;  2CZ7 B;  2Y90 A;  5J39 A;  5LJ5 f;  3G4S A;  3ME9 A;  4N4I A;  4OB0 B;  2RJE A;  2LT4 A;  3NTI A;  5KCO A;  3CCE A;  2RI2 A;  1YJN T;  3CCU A;  4C92 B;  1PSE A;  4J6X A;  4C5H A;  5GAO m;  1YI2 A;  2OTL A;  2A3L A;  1O9S A;  2DKG A;  2HNI A;  3QXE B;  3RKW A;  1QVG A;  1LOJ A;  2EQU A;  1PSF A;  2EQJ A;  4N0A C;  4QW2 A;  2ZZD A;  4BY6 C;  5GMK m;  4L59 A;  2HD0 A;  1M1F A;  3OS2 A;  2FYK A;  4QVZ A;  1Q81 U;  4J6Y A;  2KAF A;  2M16 A;  2V8K A;  1VQ7 T;  3MP6 A;  2G3R A;  5GMK i;  2RB6 A;  4C0G A;  5DLQ E;  2DK3 A;  1H64 1;  1NJI C;  3OMG A;  3JB9 I;  2YRV A;  2D6F A;  3CPW A;  1KC8 U;  5DY9 A;  4HKE A;  4DOW A;  4BDZ A;  1M8V A;  4GLK A;  2X4J A;  4RG8 A;  3BFM A;  3UT1 A;  3WXM B;  1VQK A;  4E7H A;  5GMK l;  3OYI A;  2DIG A;  2WSF E;  4EMK B;  5CKE A;  1M5Q 1;  1N8R C;  3FIF A;  1YJ9 A;  2RM4 A;  4M7D E;  4UC4 A;  1VIE A;  3OYY A;  1BI3 A;  2QA4 T;  3MP1 A;  1P92 A;  1ZQ1 A;  2XDB A;  3C95 A;  2QEX T;  2GCX A;  2LRQ A;  2RHZ A;  3GLX A;  3CXC A;  2I2L A;  1YHQ A;  4JRQ A;  1XOV A;  4C0F A;  3QSU A;  3OQ5 A;  2WSC E;  3QZ9 B;  4XTU A;  4E7L A;  5CO7 A;  5CR2 A;  4IUU A;  2P4T A;  3OYC A;  4II1 A;  1OZ2 A;  2DAQ A;  4J8O A;  3CME A;  4VUB A;  3OMC A;  1VQM T;  4J83 A;  4MMK A;  2PUK B;  3M59 A;  2DZC A;  4A4G A;  4M7D F;  1VIF A;  2CGH A;  2E10 A;  3MCA B;  4JDS A;  4M78 C;  2MI6 A;  1KD1 C;  3WVD B;  3SB2 A;  4JRK A;  1K9M U;  2QQR A;  4LDV A;  2FVU A;  3OW2 S;  2MF2 A;  2QQB A;  5LJ3 h;  4F7U B;  5LJ3 g;  3SWN A;  4ZN1 A;  3OYD A;  3CCR T;  5GAM d;  5CQY A;  1JJ2 S;  2RK2 A;  3V8J A;  4JJN K;  2EAY A;  2R58 A;  3OBY A;  4ATO A;  1VQO A;  1DJ7 B;  1IZ6 A;  1YIJ A;  5M9O A;  4EPC A;  3SWN B;  3OW2 A;  1K8A C;  5FRM A;  4M7D C;  2JNG A;  3DKM A;  1B34 B;  2RH2 A;  2X4W A;  5KCH A;  2C06 A;  5HY6 A;  1WPY A;  3E9G A;  1VQ5 A;  1BI0 A;  2DZ9 A;  3OYH A;  2X4X A;  2EWN A;  3FB9 A;  4PLI A;  5GAN d;  3CCM A;  3JCM b;  3UPU A;  5GAM h;  3JCM W;  1YJN A;  3OA6 A;  1RL2 A;  3CCS A;  5GAN 8;  2WAC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...