3DKMA

Crystal structure of the hectd1 cph domain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
79
structure length
79
Chain Sequence
b'GRENLYFQGLKYMVPGARVTRGLDWKWRDQDGSPQGEGTVTGELHNGWIDVTWDAGGSNSYRMGAEGKFDLKLAPGYDP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase HECTD1
publication title Crystal structure of the CPH domain of the E3 ubiquitin-protein ligase HECTD1.
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 18
structure length 79
sequence length 79
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2008-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06701 MIB_HERC2 Mib_herc2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.920 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3dkmA00
2DK3A 3DKMA
chains in the Genus database with same CATH superfamily
2EQUA 4M75E 3EG0A 3KBGA 3KXTA 2DL7A 4IUUA 4E7JA 1P92A 2K3YA 3JCMc 3CCSQ 3TCJA 4OMFB 2XMFA 7AT1B 2DL3A 5GAN7 2O31A 3HPWA 2CT4A 2VXFA 3RIRA 4GY5A 4C8QF 1K4US 4MZTA 5IAYA 2A0FB 2EAYA 3HL8A 4X1VA 2CP7A 4J9DA 3E19A 3WXMB 2O01E 4C0DB 3KUFA 5GAN8 4ZNXA 4XTUA 1IREB 3WVEB 2I2LA 2KR3A 3ULRB 2CDTA 5KE3A 1FMKA 2V8IA 3OYGA 3CCQQ 5CKFA 1A0NB 3NGPA 1VQ9A 5LJ5d 1K0SA 2CZ0B 4AG2C 2DFUA 1X6GA 4J9BA 2MAMA 3I55T 2OTLQ 1AWJA 1R77A 3VS3A 4HKEA 1M1FA 4M77G 3JB9G 2KDSA 2JJ9A 2CREA 3E2UA 4OP0A 3QYHB 2NLUA 3G6ET 3G71A 4WTOB 2H3EB 5GANg 4MDWA 5IXBA 3VKIA 2A36A 3OA6A 3OYDA 5KCHA 3CPWS 4RCCA 4XTVA 4XAXB 4ZGDB 3X28B 4BUGA 2K4YA 4MMLA 3V7CA 5GAMd 4M7AG 5GMKh 2HSEB 4R56A 1YBYA 4FT2A 3RESA 5J26A 2FG0A 2DX1A 1C0MA 4M77B 4OMNA 1KQ1A 1KC8C 1ZX6A 2EIFA 1Q86R 4PJOC 2NYSA 3NTHA 4HCZA 2GNCA 1XJWB 1QQJA 3FEOA 3I55Q 3OSVA 5GAMh 3J80E 2OTJT 1QVPA 2X4YA 1OX8A 1U06A 1RUWA 2EYQA 4M77D 3JB9D 2F2WA 3GIBA 4RTWA 2IVWA 3G6EQ 4C92G 2JM9A 2X9HA 1S1NA 1VQ5T 2DK3A 3M0QA 1VQ6T 4C5GA 1TOVA 1EFNA 5IHIA 3MP1A 2IIMA 1VQOA 2EPDA 4BB7A 3EGXA 3X24B 1PWTA 4DBQA 5HY6A 1BI0A 3X25B 2LJ3A 5IN1A 2L0AA 1HSQA 4M7AD 3H6ZA 2QDLA 4C5EA 5KYNA 2C0IA 3CCLA 5KYWA 3HP9A 1K9MC 1XTDA 2WSCE 1RACB 1U1TA 2OTJQ 2MWPA 4DOWA 4BY6C 1WFWA 3LH0A 2D9TA 1M1GA 1JBMA 4EDUA 4C92D 1M8MA 3EGXB 3CCRT 1QWEA 3M0TA 1VQ5Q 3URGA 1K9MR 3CMAT 1YITA 1VQ6Q 3SWNC 2GCXA 2JT4A 1OU8A 3N5BB 4DEYA 3EG1A 1XOVA 5FU6C 2F2XA 3M0RA 1WIEA 3VU3C 3CCVA 2ZGWA 1QKXA 1Q81R 2DKGA 2OAWA 3LLRA 2P0QA 5KYWB 3VYHB 2AT1B 2DE0X 4QW2A 1N8RC 1FWZA 3JB9I 1RADB 2LCCA 2F1LA 4M7DC 5CKHA 1G8XA 2ZAEA 1GCPA 2YRVA 1TSFA 4F7UA 1T0HA 2RMOA 2VC8A 5EG2A 2L3SA 2E41A 5ECAA 1QKWA 2RQRA 1NBEB 4L5GA 3OMGA 2DLPA 1AWWA 2HMAA 4J6YA 1LNXA 1PC0A 3A98A 4FSSA 4LDVA 2XK0A 1M1KU 2XDBA 3I35A 3J7AF 1VQ4A 2JOYA 1AHJB 1SG5A 2DIGA 3H0HA 3CCRQ 2K5IA 4NS5A 1IO6A 2RQVA 3CMAQ 1WHGA 3M57A 1AVZC 3M4GA 3AHUA 3D7SB 2V8JA 1Y71A 4IURA 2RPNA 1YJNA 2PZ1A 3RUXA 4M78A 1YIJT 2O9SA 9ATCB 5GANh 1UB4A 5D6XA 3HHTB 3SD4A 1X6BA 1UGVA 4F7UB 3JCMg 4DBHA 3SFMA 1I8FA 1QW1A 1FXXA 4LDUA 2PUKB 1O9SA 3EG2A 2KE9A 1TS9A 4LN2A 4NOYA 2LDMA 4RUGA 1KQSS 1AD5A 2O4XA 4J6XA 2J06A 2ROTA 2XI9A 4M75C 1YJWA 3TEEA 2PNIA 5LJ3j 2DVJA 5GAOl 2YDLA 3QJ6A 4JS5A 2EGCA 2YLCA 2LNVA 3A1PA 3QKJA 4M78B 3PMTA 2QGGA 3THKA 4HCCA 4NL2A 2L5QA 2QK0A 1R0CB 2AKKA 3FIFA 3PMIA 1MNDA 5FRMA 2EW3A 3TSWA 2LT1A 2DTHA 1W1FA 1YNZA 4PJOG 1E6GA 1YIJQ 2P4RA 3MP6A 3OYLA 1IHWA 4RG2A 3QIIA 1LCKA 1KSWA 2RN8A 2HKQB 1M8VA 1WZOA 1MMAA 4LD9K 2LNHB 1OPKA 2KROA 1T3LA 2KXDA 2JMCA 2O4XB 1Q82C 3M9QA 3OY9A 5LL6S 1QVFP 2PTKA 3UA7A 1VA7A 3LGLA 1RL2A 2G3RA 4GLMA 2FRWA 1D1AA 3M0SA 5CQYA 4UC4A 2YLBA 2K2VA 4X9DA 2JW4A 4N0AC 2DRMA 2NUZA 3OYEA 1UUEA 4Z88A 3LWHA 1N27A 1WXTA 4RG8A 4R55A 3L2ZA 2RF0A 4QVZA 5GAN3 1M90U 1FMWA 2QQBA 3PNWC 2W10A 4PJOD 5A2QE 1B7TA 1OU9A 4BDYA 1SSFA 1JJ2S 1M3BA 2MIOA 2YHTA 4E6RA 5GAOm 1BI1A 3M58A 2YRCA 3CCET 5FROA 1W70A 2X35A 1VQ7A 3V8LA 3GOXA 4KULA 1X01A 3ZEHA 4O6JA 2CS7A 2ED1A 4KH1B 3EH2A 2LTOA 1KD1C 3ZBDA 3HRUA 2EQMA 4ZN1A 2FYKA 2K9GA 2YUNA 3A5ZB 3I56T 3L2RA 4QQDA 2KSSA 3L2UA 1NYGA 3H0IA 4JZ4A 1ZA1B 3OS0A 4M7DG 2CP6A 4JJNK 2HD0A 1ZSGA 1Q7YR 3X26B 1MHNA 2VYTA 4L59A 4Y92A 3SB2A 1ZHIA 1MMDA 1JXOA 4J9FA 3V8KA 3JCMJ 3I5RA 4C5IA 1UG1A 1YCSB 1X75C 2B86A 2FEIA 2V26A 3NPFA 3CCEQ 2Y4YA 5LJ5g 4BI4A 5GMKj 2VUBA 1C1AA 3S3OA 2EYZA 3R6OA 2QEXQ 2E12A 2RQWA 2JTMA 3JRZA 4OF1A 2HBWA 3J81E 1PD0A 2VKNA 1QVGP 1U5SA 1HYOA 1TH7A 1IB8A 3I56Q 3CMEA 4FM4B 3G7ZA 2A7YA 5GAMj 1N9RA 2RO0A 5GJVB 1UGQB 2EKOA 5GAN2 1YJ9T 5D6WA 4F7UF 4M7DD 1IZ6A 3LYIA 1QVFA 2K7AA 4FYYB 2LT4A 1WNLA 1RAAB 3C95A 3P8HA 4IKFA 1VIEA 1WQWA 2FL7A 1VQMA 3PIPA 3CCQA 1Q86U 2AK5A 2EWNA 3UDCA 2DF6A 4C5HA 5FWCA 4M75G 1NPRA 3DB3A 3CD6T 1WYXA 1W2BP 1SHFA 3EG9B 2EQJA 3GP8A 2DO3A 3MEUA 5CKEA 2DTIA 2GQVA 1YP5A 4PFPA 4KGXB 3I9QA 2HQHA 1H3ZA 2DILA 1ABQA 2KNBB 4M78F 3S3MA 1I0CA 2A3LA 1KC8U 5DLOA 4EMKA 5GMKl 1Q95G 2HCKA 1K8AC 1M5Q1 5FLXE 4HA8A 2GTOA 2RD1A 3OYYA 2YUOA 5I21A 2RQTA 4J7FA 2D6FA 2CP5A 2X3XD 5FW9A 2W0ZA 1YJ9Q 4BACA 3QBYA 4QKUA 2QA4A 2R57A 3A8GB 3JCMW 3SDZA 1JEGA 3EGUA 4JRIA 1WJRA 1MNEA 1KFZA 5CR2A 4DBFA 5GJWB 3JCMe 1K8AR 3LWIA 2COYA 1PSFA 3UT1A 2DEUA 4ZN3A 4CC4B 1BI2A 4EMHA 4NL3A 4M75D 3PGGA 3CD6Q 1GBRA 1ZUYA 1MV3A 2A28A 1G3SA 3HFOA 2HL3A 3GLXA 1M2VB 3G6EA 1WJSA 3BDLA 1RAEB 3BFMA 1QP2A 2A37A 1K9MU 1SPKA 5C0MA 1SHGA 1PKTA 1YHQA 1ZSZC 4RMOA 2R5AA 2ABLA 4J9GA 2CKKA 3JV3A 3MJXA 5LJ3e 3MPUB 1Y0MA 3EFOB 3DKMA 1ARKA 2RK1A 3M0PA 3TU4K 3CC2T 2JZ2A 3M0UA 5AYFA 2DA9A 4D8KA 4HT9A 4DA4A 2P0KA 3CC4T 2M9UA 5GMKm 1W6XA 5GANj 3CC7T 1D09B 2LC4A 5A0GA 4M77A 5KYUB 1N8RU 2LJ1A 4QQ6A 1Z9QA 1WGSA 1OI1A 2CGHA 1VQNT 1YI2A 1VQPA 3C4SA 2L89A 1RAHB 3OS1A 4DBRA 2DL5A 5LJ5h 5KCOA 2O9VA 2DAQA 4OB2B 1OX9A 2DBMA 1Q86C 2CH4W 4HVVA 1MV0B 1D0YA 2E5KA 4ZTFA 4XTYA 2HQXA 1W2BA 4M7AA 4J6WA 3CC2Q 2HQEA 1VQ8A 3RMQA 1UECA 4RCBA 2EFIA 2EKHA 3CPFA 2XDDA 2DNUA 1JU5C 2FHDA 3CC4Q 5CKDA 2BTTA 5KYXA 3CC7Q 2J6OA 3GF5A 2E64A 3M56A 2JM8A 2D0NA 3H41A 2ESWA 4C92A 1AZEA 1M27C 4VUBA 4ELZC 3OW2P 1M4ZA 1T0JA 3BY7A 2JXBA 4M7AB 3JCMf 4A53A 3JB9H 3NMZC 3OYKA 2CZ6B 4J9IA 1RABB 2K5FA 2CT3A 1W4SA 1LPLA 1IGUA 1N9SA 3QO3A 3EFRA 3G71T 4C8QC 1E7OA 3E1SA 1PG5B 4ESRA 2PVGB 2JNGA 2V8KA 2LQWA 2ECZA 4M77E 5DY9A 5KYXB 2G6FX 3V7SA 1PRMC 5IH2A 2R5MA 4OB3B 3QYGB 2YSQA 4C92B 2ZPHB 2VWFA 5LJ3f 2LCLA 2LMJA 4PLIA 4JRKA 1Q81C 2M02A 5GMKe 1X69A 2K6DA 4PL6A 2DD4A 2COZA 2KYBA 2LQNA 3CCMA 1Q82U 3UWNA 5L8RE 3JAME 4M7AE 3LGFA 2RHXA 2DJQA 1VQKA 3CCUA 1K1ZA 2MOXA 3FRNA 4LXCA 3OYJA 5GAMe 1NPPA 2QQAA 4L6V5 1IXDA 5A0DA 2EGEA 4FYVB 3M4YA 3G71Q 2XD0A 5DLQE 1DJ7B 4E7KA 1YN8A 1HXDA 2YWWA 4JZ3A 4RTZA 3ZFJA 3G4SA 2ZPEB 4HT8A 1GCQC 5FU7B 1S72A 1VQOT 2GFAA 1RAGB 2F2VA 3IQLA 4PJNA 1WDXA 2JTFA 2RH2A 1UJYA 4E7ZA 1H8KA 3QDFA 2RJEA 4IUQA 4ZGJB 1EX4A 2EYYA 2E70A 2E3HA 2VGNA 2HSPA 3OYMA 3CCLT 1G3YA 4F14A 3EGDA 1Q7YU 4O5VA 3FJ5A 3GNFB 1WHMA 1KD1U 2LVMA 4OMMA 4MDXA 2KT1A 3FLGA 1Y96B 3GBQA 1G3WA 1SKUB 4AFUC 1OOTA 3X20B 4A4FA 2PUOB 1U3OA 3VS5A 1KIKA 1ZSZB 1LJOA 2P4TA 3RKWA 3OW2A 2XKOC 3EHQA 1YITT 4GLKA 2L3RA 1VYUA 2K5LA 3CBPA 3FC3A 1VQOQ 1CSKA 1VQLT 4B9WA 4QT7A 4Y91A 4OGEA 2QG9B 2RNAA 3CCVT 1PHTA 2RI5A 1Z9ZA 3QWXX 3HRTA 3QDRB 1G2BA 4RTVA 2L2PA 3EGDB 1WHLA 2NWMA 2EQKA 5CCAA 2GFUA 2ZZDA 3EFSA 2RHUA 3JCMV 4RKUE 4AT1B 4A4GA 2BE9B 4OMLA 4ZTJA 2J6KA 3RNJA 2NUPB 2OJ2A 4PJOA 2QXFA 5CO7A 1D1CA 2DL4A 4M77F 3ZL7C 3CCJT 3CXCP 3Q1JA 4F7UE 1VQ4T 1V76A 5HCKA 1X2KA 2LQ8A 4JPBW 2QEXA 2CZ1B 4FSXA 1YITQ 1WHKA 1JO8A 4J7IA 4QQGA 1JB0E 2XICA 2HAXA 4E47A 1VQLQ 2MF2A 3QUIA 5KYYA 4EMKC 5GAOr 1BKBA 1TTHB 3E9FA 4N4IA 3I56A 3CCVQ 3ME9A 4M7AF 4CRIA 2DPPB 5GAMf 2NUTB 3A8HB 5GANe 4BDZA 5EC7A 4J9CA 1X43A 4RTTA 4WF2A 4E7HA 2KRSA 1BIAA 4PJOB 4M78E 1NEGA 4C8QG 4KUDK 1JXMA 1K9AA 2QASA 4XU1A 4OB0B 1IRXA 2ENMA 1WXBA 4PJMA 4IUTA 2AIRB 3HKSA 1WX6A 2DRKA 1MMNA 2E6NA 1K8AU 2M0YA 1YJWT 2K3BA 1KK7A 3CCJQ 3M53A 4C92F 4BI3A 1VQ4Q 4JRPA 3GNGA 1J3TA 1LOJA 1V1CA 3RBBB 3VJPA 2FZCB 1D3BB 5KYYB 2LZ6B 4B9XA 4V2SA 1NEBA 1Q7YC 3HFNA 4BE2A 1BU1A 4AG1C 4QVCA 2AZVA 5FWBA 2AKLA 4PJOE 1HK9A 2RK2A 4ZGEB 4DQ2A 1K73R 1YJ9A 3VS1A 4C8QD 2QQRA 1ZBJA 1BK2A 5C6SA 3JSCA 3JCMQ 2EBPA 3HRSA 4BY6B 2ATCB 1ZLMA 2M16A 5LJ5j 2HNIA 1PNJA 1R0BG 4LDXA 3CEYA 4PLLA 1YJWQ 2MK5A 1PKSA 2X4XA 1M1KR 1B3QA 3SWNB 4DEXA 5FU6B 2E65A 4MMKA 1BYMA 2PU9B 3V8JA 4F17A 3VS7A 1UEBA 4KT0E 1M9SA 3EG9A 1WI7A 4E2FB 3CCSA 1QVFS 1QMCA 1LVKA 4M7DB 2K57A 5CQXA 3OQ5A 4M4ZA 3CXCA 5HKCA 5I2MA 2CP0A 2KK4A 2KYMA 4YTLA 2KMTA 3UF4A 1VQ7T 2EJFA 2DYBA 4EIKA 3OYNA 3S3NA 1SRMA 4J9HA 2J7IA 4MZPA 2AHJB 3TSZA 1KG1A 2IG0A 3RERA 2C0TA 2KY9A 4PK4A 2M0OA 5GANf 4M75A 3C12A 5CIUA 1UTIA 4CC7A 1EIFA 4D8DA 3QZ9B 3MCAB 2OTLA 5LJ3d 1YWPA 2ZPGB 2E5QA 4ORZA 3RKYA 5GAN5 3AT1B 3O5ZA 2CZ7B 2K2MA 3ASKA 1OULA 3VV0A 3OYCA 2BUDA 1KHCA 1JQQA 2EYWA 2RHZA 1WHHA 1I4K1 3BW1A 1M2VA 4CI0C 4KUIA 1M3CA 1CKAA 1TG0A 2WACA 3QJYA 2H3JA 1YWOA 3FDRA 2RM4A 2WSFE 3M54A 1VQ7Q 2COWA 3OYHA 1ABOA 3JCMX 1QCOA 3CBMA 3CPWP 4Z8AA 2B8AA 3BE3A 2DL8A 4C0GA 4M75B 4EPCA 3EFOA 1UGSB 1TUGB 2DXTA 3CMET 2DIQA 4JUVA 5CAIA 5D7UA 1R8OB 2DEQA 4N0AA 3CC7A 1NJIR 3I55A 4J83A 1AWOA 4HCKA 5HK3A 1NE8A 1M90R 1PM3A 2DD5A 3E9GA 3INZA 4PJOF 2HEQA 2EGAA 4JRQA 4Z02A 1UE9A 1X6OA 2KT8A 3RDVA 3PVQA 1VQMT 2MYSA 2GBQA 5KYUA 1GL5A 3TQ7P 2D0QB 2M51A 2XIDA 3REBB 3VUBA 2QI2A 4TVRA 1QVGS 1PSEA 2EVRA 1Q81U 2O88A 5GAN4 4KGVB 1TU0B 3WVDB 1RLQC 1PRLC 2XG8D 2PVDB 4X9CA 2F5TX 2D1XA 4PJLA 1QVGA 3BDUA 3OS5A 3CMEQ 3GPLA 1MMGA 1N5ZA 1I5OB 2L3QA 1QCNA 2RI3A 1XQHA 3L2VA 3I5SA 2OTJA 1OYXA 2R58A 2QA4T 2HZYA 3HSBA 1TWBA 1GRIA 2LP5A 4FCYA 3PT9A 1VQMQ 1H3HA 3M59A 1W2BS 1VQ5A 2GTJA 1VQ6A 3CQTA 2XU8A 4PKCC 4D6WA 4M78C 5HK0A 2JN0A 2OI3A 3DLMA 3U23A 1M3AA 4KGZB 3O8VA 1T3SA 2VB6A 4RTXA 2FPEA 3PE0A 2ZCFB 2CP3A 2QTVA 1HD3A 1CKBA 2X4WA 4E7SA 1YHQT 2QAZA 2ROLA 2IPOB 2LQKA 1VYVA 2FO0A 2CP2A 2EYXA 3P8BB 4M7DF 5CKBA 5GAOn 2FRYA 1WLPB 2QYZA 1SRLA 1G3TA 3QWYA 2QA4Q 3CPWA 1E6HA 1D0ZA 2DXUA 1VQNQ 4LDYA 2KGTA 1OZ2A 3CCRA 2WSEE 3SEMA 2MI6A 1NLOC 3CMAA 4IUPA 4R0KA 1VQ9T 2VV5A 2Z0WA 4AMCA 4JLGA 2QGFB 5GAOp 4C0ZA 3A8OB 2J6FA 1H92A 1FYNA 5KH6A 4FW1A 1YCYA 3UATA 1Y07A 1YI2T 1VQPT 5I22A 1UFFA 4LUEA 4E7LA 1GFDA 1KC8R 3OBWA 3JCMP 5LJ5e 1YHQQ 4OVAA 2GGRA 2SRCA 2VGMA 2DMOA 3META 2KRMA 4JLIA 4OMQA 2EJ9A 4N4GA 3L2QA 1KJWA 1RAIB 3V7RA 2AZSA 3ER0A 3DB4A 2BZ8A 2K79A 1BCOA 4A54A 1KQSP 1VQ8T 1I1JA 3VS2A 1AWXA 2VASA 3UPUA 2CSIA 4XU3A 4OMOA 1VQ9Q 2OAUA 4M75F 1B07A 1NYFA 4IIOA 4Q5WA 4ELYC 1XNIA 2XHCA 5CVIA 3A8LB 2L3PA 2DETA 1GXIE 1YIJA 1QP3A 2X51A 4J8OA 5GAN6 2V1RA 2JS2A 2RQUA 2XDPA 1UDLA 2EQIA 5GAOq 1YI2Q 1VQPQ 2E3IA 2X4JA 2H8HA 1Y96A 2RB6A 4EMGA 3JB9J 2MPXC 3NTKA 2FZGB 1OV3A 1BIBA 3RMSA 3EHRA 1ZSZA 3H0FA 3VRYA 1VQLA 3EAEA 4C92E 2KBTA 4BE1A 2V1QA 1PD1A 4F16A 2LCSA 3VS0A 3KFVA 4A4EA 4LD6A 1VQ8Q 1K73U 2YUPA 2FZKB 1D1BA 1BBZA 1EZZB 2RI2A 5AT1B 2P84A 4F7UG 1Y7XA 1ZBXA 3G1JA 2ZPIB 1G83A 4F04B 4JJBA 3MKDA 3OW2S 1AZGB 5GANd 3CCJA 1AEYA 1N8RR 2NUPA 4HXJA 3MHXA 4CC3A 4KBMB 2ZPFB 4LE9A 3CCMT 2RHIA 2MWOA 4PNOA 4JS4A 3TVTA 2E10A 2E1HA 3L1AA 4MZMA 4AFSC 1X27A 4J5YA 2JUFA 1JJ2P 1VQKT 3CCUT 1AT1B 5DM7R 3QXEB 4JJCA 3VS4A 2HKNA 2Y90A 3TREA 4ANJA 3OYBA 4GBQA 4M78G 1JRIA 1ZQ1A 3MP8A 2KVQG 2GF7A 3H8ZA 4C0FA 1NZ9A 3L2WA 3OYIA 3G4ST 3QG1A 4FL6A 3CCLQ 2NUTA 1S72T 5LJ5f 3PFSA 3M5AA 2BKDN 1TUDA 1GFCA 2VXEA 2PVOB 2BZXA 4RTUA 5IXFA 4LUDA 3JB9F 1U1SA 2JVVA 5I11A 1OEBA 3PTAA 1RI9A 2DVEA 1WXUA 1UHFA 1BCMA 2RJFA 3CCMQ 1KQSA 3CCEA 2ZPBB 3PVLA 4K11A 2BE7D 4Y28E 3H9NA 2LX7A 2YT6A 4X34A 5LJ3g 1VQKQ 3CCUQ 4CC2A 5A0LA 5I2SA 1YJNT 2YRDA 3VS6A 1D3BA 3RR6A 4M78D 3C0CA 2F5KA 2K3XA 1F1BB 5KE2A 2HBPA 2RJDA 1MUZA 1PCXA 4A4HA 4B6MA 2DJZA 4XTZA 4C8QA 2HDAA 3PIOA 3QHSA 3G4SQ 2KAFA 4RTYA 5M9OA 1NM7A 1K0XA 1S72Q 1KQ2A 4HCBA 2CSQA 1BI3A 4KRTA 4JDSA 2FB7A 2P0PA 4LNPA 1WJQA 4C0DC 1B34A 1VUBA 4JJDA 1NJIU 3OSSC 1O75A 4XQ3A 2FVUA 2JS0A 1Q82R 4FIBA 1TUCA 1D0XA 1G5VA 4AFQC 1K73C 2KQWA 4ATOA 2DBKA 2QDYB 4QVDA 1I07A 3NFCA 2KI7A 2CUBA 1YJNQ 3SWNA 1OPLA 4PFZA 4C8QB 5L23A 3MEAA 3OB9A 4OB1B 1NG2A 8ATCB 4P5NA 3VUZA 3S6WA 1H641 2CH4A 1WA7A 1M1KC 3HTRA 1UGRB 1M2OA 2QEXT 2M1HA 4M7DA 4OMPA 2CUDA 1JJ2A 1GCQA 1YFNA 2OX7A 1UGPB 1B34B 2C0OA 3F70A 4HVWA 3MEVA 1Y57A 4II1A 3M55A 3LW5E 2JTEA 3EG3A 4FYXB 1KHIA 1BB9A 1C6VX 2DYIA 4M77C 8AT1B 4Z89A 3CD6A 1ZUKA 3SHWA 1SEMA 2DZ9A 3CXCS 5FRNA 1WHJA 1KD1R 1SF9A 1IHVA 2RJCA 4C8QE 3CBOA 1RI0A 4AFZC 3OYFA 3QPHA 2CYZB 4N4HA 2E4HA 2YXYA 3JCMd 1GBQA 2GQIA 5IHKA 1RLPC 2C06A 4XU2A 4LDWA 2A08A 3C94A 4KH0B 3L42A 2DTOA 1VOMA 5CK9A 1OQKA 2O2OA 4M7AC 4XTXA 1IGQA 4BD3A 3OMCA 4J9EA 1I81A 2DZCA 3OBYA 1ZUUA 4FYWB 4BI8B 1I5LA 1K76A 3MEWA 2BIVA 5J39A 1FX7A 2RA2A 3VRZA 3OS2A 1VYTA 3JCMh 2QQ9A 4IIMA 1OZ3A 2RHYA 2FPFA 3RKXA 2VVKA 5GMKi 2F69A 2MMPA 4ME7A 1V29B 4A4KA 4C92C 1AOJA 1QCFA 1WQ7A 4PJJA 1UJ0A 2YUQA 4FT4A 5GAMg 2JMAA 3T9NA 3R6NA 2SEMA 3LX7A 3JCMb 2L8DA 4FW2A 2QQSA 4IUVA 5IHNA 2DERA 4M7DE 1HJDA 2DM1A 2KRNA 1QWFA 2Y4XA 3VYGA 4XK8E 5LJ3h 2PQWA 2BZYA 1U8RA 3MO8A 1RAFB 1NJIC 3NTIA 1N6AA 1VIFA 3UA6A 3CC2A 2I0NA 1M90C 2KXCA 2MCNA 3QZ5B 3A8MB 4PFOA 4BE0A 4E7IA 2QTXA 1M30A 3CCST 2DXBA 3REAB 6AT1B 1ACMB 1WPYA 3P8DA 4WCIA 3CC4A 2LRQA 4DOVA 1ZA2B 4HVUA 2D8JA 5FU7C 4FU6A 2E6ZA 5IT9E 2FPDA 2LJ0A 2X3WD 1TXQA 4XU0A 3FB9A 1NLPC 2DXCA 2LX9A 3NHNA 1VQNA 1X2QA 1QLYA 3EH1A 2KEAA 3CCQT 1FMVA 5J3BA 3OYAA 4XTWA 2HL5C 2D8HA 2J05A 3QSUA 2ED0A 2OTLT 1UHCA 3LH5A 1SSHA 4A63B 3FJPA 4EMKB 2EJGA 4OGCA 5D6YA 3DLLA 1MGQA
chains in the Genus database with same CATH topology
2EQUA 4C5IA 4M75E 3L2QA 4A4GA 3KBGA 1X75C 3KXTA 3V7RA 3ER0A 4IUUA 3DB4A 4ZTJA 4E7JA 1P92A 2QXFA 4PJOA 2K3YA 2Y4YA 3JCMc 5LJ5g 3TCJA 4A54A 4OMFB 4BI4A 5GMKj 5CO7A 2VUBA 1VQ8T 3S3OA 3R6OA 4M77F 2E12A 5GAN7 3HPWA 2JTMA 3JRZA 2VXFA 3RIRA 4GY5A 4OF1A 4C8QF 4MZTA 3CCJT 3J81E 5IAYA 3Q1JA 3UPUA 2EAYA 4F7UE 4XU3A 3HL8A 1VQ4T 2OAUA 4M75F 1TH7A 3E19A 4Q5WA 2LQ8A 3WXMB 4ELYC 1XNIA 2XHCA 5CVIA 3A8LB 3CMEA 4FM4B 2O01E 1GXIE 3G7ZA 4C0DB 1YIJA 1QP3A 3KUFA 5GAN8 2QEXA 4XTUA 1IREB 2CZ1B 2A7YA 4FSXA 3WVEB 5GAMj 1N9RA 2RO0A 4J8OA 5GAN6 2I2LA 5KE3A 4J7IA 4QQGA 1JB0E 2V8IA 2XDPA 2XICA 3OYGA 5CKFA 2HAXA 1UGQB 2EKOA 4E47A 5LJ5d 5GAN2 1VQ9A 1YJ9T 2CZ0B 2MF2A 3QUIA 4EMKC 5GAOr 1BKBA 3E9FA 4N4IA 5D6WA 5GAOq 3I56A 2X4JA 2MAMA 3ME9A 4F7UF 1IZ6A 3LYIA 2RB6A 1Y96A 2DPPB 4CRIA 3A8HB 4EMGA 5GAMf 5GANe 3I55T 3NTKA 4BDZA 3JB9J 2LT4A 1WNLA 3C95A 1BIBA 3P8HA 4WF2A 1VIEA 1WQWA 3RMSA 2FL7A 4E7HA 1VQMA 4IKFA 4HKEA 3PIPA 1M1FA 1BIAA 4M77G 3CCQA 3JB9G 4PJOB 2KDSA 1VQLA 3EAEA 4M78E 4C92E 4C8QG 4BE1A 4OP0A 1Q86U 4KUDK 3QYHB 2NLUA 4XU1A 3G6ET 3G71A 2EWNA 4OB0B 3UDCA 4C5HA 5GANg 4IUTA 4M75G 4MDWA 1NPRA 3DB3A 3VKIA 3CD6T 3HKSA 4A4EA 4LD6A 3OA6A 3OYDA 5KCHA 3CPWS 4RCCA 4XTVA 1K73U 2E6NA 2EQJA 3GP8A 2DO3A 1K8AU 4XAXB 4ZGDB 4M7DD 3MEUA 5CKEA 3X28B 2DTIA 2GQVA 1YJWT 4BUGA 2K4YA 3M53A 1H3ZA 3S3MA 4M78F 4C92F 4MMLA 3V7CA 5GAMd 4BI3A 2A3LA 2RI2A 4JRPA 3GNGA 4F7UG 1LOJA 1KC8U 1Y7XA 4M7AG 1ZBXA 3VJPA 5GMKh 5DLOA 4R56A 4EMKA 2ZPIB 5GMKl 1D3BB 1K8AC 1M5Q1 5FLXE 4HA8A 1YBYA 4FT2A 3OW2S 4B9XA 2RD1A 3OYYA 3RESA 5J26A 5I21A 5GANd 3CCJA 4V2SA 4M77B 1Q7YC 3HFNA 4J7FA 2D6FA 4BE2A 3MHXA 1KQ1A 1KC8C 2EIFA 4KBMB 2ZPFB 4BACA 4PJOC 3CCMT 3NTHA 3QBYA 4HCZA 2RHIA 2MWOA 4PNOA 4QVCA 4JS4A 2E10A 2QA4A 2R57A 2E1HA 3FEOA 3L1AA 3A8GB 4MZMA 3OSVA 5GAMh 3JCMW 3SDZA 4J5YA 3J80E 2OTJT 1QVPA 1HK9A 4PJOE 2JUFA 2RK2A 1WJRA 2X4YA 4JRIA 4ZGEB 1VQKT 3CCUT 4DQ2A 2EYQA 4M77D 5CR2A 3JB9D 3JCMe 5DM7R 1YJ9A 3QXEB 3GIBA 4C8QD 2IVWA 2QQRA 2Y90A 3TREA 3OYBA 3LWIA 1PSFA 4M78G 3UT1A 4C92G 4ZN3A 1JRIA 1BI2A 4EMHA 3JSCA 4M75D 5C6SA 3JCMQ 4NL3A 1VQ5T 2DK3A 3HRSA 1ZQ1A 3MP8A 3PGGA 4BY6B 2M16A 1VQ6T 4C5GA 5FRMA 5LJ5j 2HNIA 2KVQG 3MP1A 3HFOA 1G3SA 4LDXA 2GF7A 3GLXA 3CEYA 3H8ZA 4BB7A 1NZ9A 4C0FA 4PLLA 1VQOA 3X24B 3L2WA 3OYIA 3G6EA 3G4ST 3QG1A 4FL6A 1WJSA 5HY6A 2X4XA 3BDLA 1BI0A 3BFMA 3X25B 1S72T 5LJ5f 3PFSA 1QP2A 1K9MU 5IN1A 3SWNB 3M5AA 4M7AD 3H6ZA 5C0MA 1YHQA 2BKDN 2VXEA 4RMOA 5FU6B 2PVOB 4C5EA 2R5AA 2E65A 2CKKA 3CCLA 3JB9F 1U1SA 2JVVA 4MMKA 5LJ3e 1BYMA 2PU9B 3V8JA 3HP9A 3PTAA 1K9MC 1UEBA 2DVEA 1XTDA 3DKMA 2RK1A 3TU4K 2RJFA 4KT0E 1KQSA 1M9SA 3CCEA 3CC2T 2ZPBB 3CCSA 2WSCE 1QVFS 4Y28E 4M7DB 2K57A 5CQXA 3OQ5A 1U1TA 2JZ2A 3CXCA 5HKCA 5I2MA 2MWPA 4X34A 2KK4A 5AYFA 4YTLA 2KMTA 4DOWA 5LJ3g 4BY6C 5A0LA 5I2SA 1YJNT 1VQ7T 2EJFA 4HT9A 4DA4A 2P0KA 3LH0A 2D9TA 1M1GA 1D3BA 1JBMA 2M9UA 5GMKm 3CC4T 4EDUA 4M78D 4C92D 3OYNA 2F5KA 2K3XA 3CCRT 3S3NA 5GANj 5KE2A 3CC7T 2LC4A 3URGA 2HBPA 3CMAT 2RJDA 4MZPA 5A0GA 2AHJB 4M77A 1YITA 4A4HA 1KG1A 2DJZA 2IG0A 3SWNC 4XTZA 1N8RU 2GCXA 4C8QA 3RERA 2KY9A 3N5BB 4QQ6A 3PIOA 1XOVA 1WGSA 5FU6C 1OI1A 2CGHA 3QHSA 1VQNT 2M0OA 5GANf 1YI2A 2KAFA 4M75A 1VQPA 3VU3C 3C4SA 2ZGWA 3CCVA 2DKGA 3LLRA 3C12A 2L89A 5CIUA 5M9OA 1EIFA 2P0QA 3OS1A 3QZ9B 3MCAB 3VYHB 2OTLA 4QW2A 5LJ3d 1KQ2A 4HCBA 5LJ5h 5KCOA 1N8RC 1BI3A 2DAQA 2ZPGB 1FWZA 2E5QA 4OB2B 4JDSA 3RKYA 5GAN5 2LCCA 2FB7A 3JB9I 2CZ7B 3ASKA 1Q86C 4M7DC 3VV0A 2P0PA 5CKHA 3OYCA 2BUDA 1WJQA 4C0DC 4ZTFA 1KHCA 4XTYA 1B34A 1VUBA 2YRVA 4F7UA 1NJIU 2HQXA 2VC8A 1W2BA 5EG2A 3OSSC 4M7AA 1O75A 2RHZA 4XQ3A 2FVUA 4J6WA 1I4K1 2HQEA 4FIBA 3BW1A 4CI0C 1G5VA 2E41A 1K73C 2KQWA 4KUIA 2QDYB 4QVDA 1VQ8A 3RMQA 4ATOA 3NFCA 4L5GA 3OMGA 2WACA 4RCBA 2EFIA 2H3JA 3FDRA 3QJYA 2RM4A 4J6YA 3CPFA 2WSFE 1LNXA 2XDDA 4LDVA 3M54A 1M1KU 2XDBA 2XK0A 3J7AF 3SWNA 3OYHA 1VQ4A 2JOYA 1AHJB 2FHDA 4C8QB 2DIGA 3MEAA 3JCMX 3OB9A 5CKDA 4OB1B 3CBMA 4P5NA 2B8AA 3VUZA 3S6WA 1H641 2K5IA 4NS5A 4M75B 4C0GA 3M57A 3GF5A 2E64A 4EPCA 3M56A 3M4GA 3AHUA 1UGSB 2V8JA 1M1KC 1Y71A 4IURA 1YJNA 1UGRB 2DXTA 3CMET 2DIQA 3RUXA 4M78A 4C92A 1YIJT 2QEXT 4JUVA 5CAIA 2M1HA 4VUBA 1R8OB 4M7AF 4M7DA 4ELZC 5GANh 2DEQA 4N0AA 3CC7A 1JJ2A 1M4ZA 1UB4A 3I55A 1UGPB 4J83A 5D6XA 3HHTB 1B34B 3BY7A 3SD4A 4F7UB 4M7AB 3JCMf 3F70A 4A53A 5HK3A 3JB9H 1NE8A 3OYKA 2CZ6B 2DD5A 3E9GA 3MEVA 3JCMg 3INZA 4PJOF 3SFMA 4II1A 1I8FA 1QW1A 1FXXA 2PUKB 4LDUA 1O9SA 1X6OA 4Z02A 3M55A 4JRQA 1VQMT 2K5FA 3LW5E 1W4SA 4NOYA 1N9SA 1KHIA 2LDMA 3QO3A 4M77C 1KQSS 3CD6A 2D0QB 3EFRA 3G71T 2O4XA 4C8QC 4J6XA 2XIDA 3E1SA 3VUBA 2DZ9A 3CXCS 5FRNA 2QI2A 2PVGB 2JNGA 2XI9A 2V8KA 4TVRA 4M77E 5DY9A 4M75C 1YJWA 1QVGS 1PSEA 2RJCA 3TEEA 5LJ3j 5GAOl 3V7SA 4C8QE 1Q81U 3QJ6A 3CBOA 4JS5A 1RI0A 1QVFA 2YLCA 3OYFA 2LNVA 3QPHA 5GAN4 2CYZB 2R5MA 4N4HA 3QKJA 4OB3B 3QYGB 3WVDB 4M78B 4C92B 3PMTA 2ZPHB 3JCMd 2XG8D 2C06A 4HCCA 4NL2A 4XU2A 2L5QA 4LDWA 5LJ3f 2LCLA 2PVDB 3C94A 3FIFA 3PMIA 4X9CA 3L42A 2F5TX 4JRKA 2DTOA 4PLIA 1Q81C 1QVGA 5CK9A 2LT1A 2DTHA 3BDUA 3OS5A 5GMKe 4PJOG 4M7AC 3GPLA 4PL6A 2DD4A 4XTXA 3MP6A 3OYLA 4RG2A 3CCMA 3QIIA 1Q82U 3UWNA 4BD3A 3OMCA 5L8RE 2RI3A 1I81A 1XQHA 2DZCA 3OBYA 3L2VA 3JAME 4M7AE 1M8VA 4BI8B 1I5LA 3LGFA 2OTJA 3MEWA 1OYXA 2BIVA 5J39A 4LD9K 1FX7A 2RA2A 2RHXA 2R58A 3OS2A 1VQKA 3CCUA 3JCMh 2QQ9A 2QA4T 3HSBA 2O4XB 1OZ3A 3FRNA 3OYJA 1Q82C 2RHYA 3M9QA 5GAMe 3OY9A 5LL6S 3RKXA 1NPPA 3PT9A 3LGLA 1RL2A 2G3RA 2QQAA 4L6V5 3M59A 1W2BS 5A0DA 5GMKi 1VQ5A 2F69A 2MMPA 5CQYA 1VQ6A 3M4YA 4ME7A 4UC4A 2YLBA 2XD0A 5DLQE 2K2VA 1V29B 1DJ7B 2XU8A 4PKCC 4X9DA 4A4KA 4M78C 1WQ7A 2JN0A 4C92C 4D6WA 5HK0A 4E7KA 1HXDA 3ZFJA 3DLMA 3G4SA 4FT4A 5GAMg 2ZPEB 4N0AC 3T9NA 4HT8A 5FU7B 3LX7A 3O8VA 1S72A 3JCMb 2L8DA 2GFAA 3OYEA 1VQOT 3LWHA 2QQSA 1N27A 4IUVA 4RG8A 4M7DE 4R55A 3L2ZA 2ZCFB 2Y4XA 4QVZA 4XK8E 3VYGA 5GAN3 2JTFA 2RH2A 1M90U 2QQBA 3PNWC 2RJEA 4IUQA 5LJ3h 2PQWA 4ZGJB 1U8RA 3MO8A 2X4WA 1YHQT 1NJIC 2E70A 4PJOD 5A2QE 3NTIA 1N6AA 2VGNA 1VIFA 2LQKA 3OYMA 3CC2A 3CCLT 1G3YA 4BDYA 1M90C 1SSFA 1JJ2S 1Q7YU 4O5VA 2YHTA 3P8BB 3QZ5B 5CKBA 4M7DF 3A8MB 3GNFB 5GAOn 5GAOm 1BI1A 3M58A 1KD1U 2LVMA 4BE0A 4E7IA 2QTXA 3CCET 1G3TA 4MDXA 5FROA 3CCST 2DXBA 2X35A 1VQ7A 3V8LA 3GOXA 1WPYA 1X01A 4KULA 3CPWA 3P8DA 3ZEHA 3FLGA 1Y96B 2DXUA 2LRQA 3CC4A 4O6JA 1G3WA 2CS7A 4LDYA 1OZ2A 2LTOA 4DOVA 3CCRA 3X20B 2WSEE 4A4FA 2MI6A 2PUOB 1KD1C 5FU7C 4FU6A 2E6ZA 4IUPA 3CMAA 5IT9E 3ZBDA 3HRUA 1VQ9T 2EQMA 4ZN1A 1LJOA 2FYKA 2P4TA 3RKWA 3A5ZB 2VV5A 3I56T 3L2RA 4XU0A 3FB9A 4JLGA 4QQDA 2DXCA 3OW2A 2LX9A 5GAOp 2XKOC 1VQNA 2KSSA 4C0ZA 1YITT 4GLKA 3A8OB 2L3RA 3L2UA 2K5LA 5KH6A 3CBPA 3FC3A 3CCQT 1YCYA 5J3BA 1VQLT 4B9WA 3OYAA 4Y91A 4OGEA 4XTWA 1Y07A 1YI2T 1VQPT 3CCVT 3OS0A 2RI5A 4M7DG 4JJNK 2HD0A 3HRTA 3QSUA 3X26B 4E7LA 1MHNA 2OTLT 3QDRB 2VYTA 4L59A 3OBWA 3JCMP 5LJ5e 3FJPA 2EQKA 3SB2A 1ZHIA 5CCAA 2GFUA 2ZZDA 4OVAA 2VGMA 3EFSA 4EMKB 2EJGA 2RHUA 4RKUE 3JCMV 4OGCA 5D6YA 3META 3V8KA 3JCMJ 4JLIA 3DLLA 2EJ9A 4N4GA 1MGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DK3 A;  3DKM A; 
#chains in the Genus database with same CATH topology
 2EQU A;  4M75 E;  3EG0 A;  3KBG A;  3KXT A;  2DL7 A;  4IUU A;  4E7J A;  1P92 A;  2K3Y A;  3JCM c;  3CCS Q;  3TCJ A;  4OMF B;  2XMF A;  7AT1 B;  2DL3 A;  5GAN 7;  2O31 A;  3HPW A;  2CT4 A;  2VXF A;  3RIR A;  4GY5 A;  4C8Q F;  1K4U S;  4MZT A;  5IAY A;  2A0F B;  2EAY A;  3HL8 A;  4X1V A;  2CP7 A;  4J9D A;  3E19 A;  3WXM B;  2O01 E;  4C0D B;  3KUF A;  5GAN 8;  4ZNX A;  4XTU A;  1IRE B;  3WVE B;  2I2L A;  2KR3 A;  3ULR B;  2CDT A;  5KE3 A;  1FMK A;  2V8I A;  3OYG A;  3CCQ Q;  5CKF A;  1A0N B;  3NGP A;  1VQ9 A;  5LJ5 d;  1K0S A;  2CZ0 B;  4AG2 C;  2DFU A;  1X6G A;  4J9B A;  2MAM A;  3I55 T;  2OTL Q;  1AWJ A;  1R77 A;  3VS3 A;  4HKE A;  1M1F A;  4M77 G;  3JB9 G;  2KDS A;  2JJ9 A;  2CRE A;  3E2U A;  4OP0 A;  3QYH B;  2NLU A;  3G6E T;  3G71 A;  4WTO B;  2H3E B;  5GAN g;  4MDW A;  5IXB A;  3VKI A;  2A36 A;  3OA6 A;  3OYD A;  5KCH A;  3CPW S;  4RCC A;  4XTV A;  4XAX B;  4ZGD B;  3X28 B;  4BUG A;  2K4Y A;  4MML A;  3V7C A;  5GAM d;  4M7A G;  5GMK h;  2HSE B;  4R56 A;  1YBY A;  4FT2 A;  3RES A;  5J26 A;  2FG0 A;  2DX1 A;  1C0M A;  4M77 B;  4OMN A;  1KQ1 A;  1KC8 C;  1ZX6 A;  2EIF A;  1Q86 R;  4PJO C;  2NYS A;  3NTH A;  4HCZ A;  2GNC A;  1XJW B;  1QQJ A;  3FEO A;  3I55 Q;  3OSV A;  5GAM h;  3J80 E;  2OTJ T;  1QVP A;  2X4Y A;  1OX8 A;  1U06 A;  1RUW A;  2EYQ A;  4M77 D;  3JB9 D;  2F2W A;  3GIB A;  4RTW A;  2IVW A;  3G6E Q;  4C92 G;  2JM9 A;  2X9H A;  1S1N A;  1VQ5 T;  2DK3 A;  3M0Q A;  1VQ6 T;  4C5G A;  1TOV A;  1EFN A;  5IHI A;  3MP1 A;  2IIM A;  1VQO A;  2EPD A;  4BB7 A;  3EGX A;  3X24 B;  1PWT A;  4DBQ A;  5HY6 A;  1BI0 A;  3X25 B;  2LJ3 A;  5IN1 A;  2L0A A;  1HSQ A;  4M7A D;  3H6Z A;  2QDL A;  4C5E A;  5KYN A;  2C0I A;  3CCL A;  5KYW A;  3HP9 A;  1K9M C;  1XTD A;  2WSC E;  1RAC B;  1U1T A;  2OTJ Q;  2MWP A;  4DOW A;  4BY6 C;  1WFW A;  3LH0 A;  2D9T A;  1M1G A;  1JBM A;  4EDU A;  4C92 D;  1M8M A;  3EGX B;  3CCR T;  1QWE A;  3M0T A;  1VQ5 Q;  3URG A;  1K9M R;  3CMA T;  1YIT A;  1VQ6 Q;  3SWN C;  2GCX A;  2JT4 A;  1OU8 A;  3N5B B;  4DEY A;  3EG1 A;  1XOV A;  5FU6 C;  2F2X A;  3M0R A;  1WIE A;  3VU3 C;  3CCV A;  2ZGW A;  1QKX A;  1Q81 R;  2DKG A;  2OAW A;  3LLR A;  2P0Q A;  5KYW B;  3VYH B;  2AT1 B;  2DE0 X;  4QW2 A;  1N8R C;  1FWZ A;  3JB9 I;  1RAD B;  2LCC A;  2F1L A;  4M7D C;  5CKH A;  1G8X A;  2ZAE A;  1GCP A;  2YRV A;  1TSF A;  4F7U A;  1T0H A;  2RMO A;  2VC8 A;  5EG2 A;  2L3S A;  2E41 A;  5ECA A;  1QKW A;  2RQR A;  1NBE B;  4L5G A;  3OMG A;  2DLP A;  1AWW A;  2HMA A;  4J6Y A;  1LNX A;  1PC0 A;  3A98 A;  4FSS A;  4LDV A;  2XK0 A;  1M1K U;  2XDB A;  3I35 A;  3J7A F;  1VQ4 A;  2JOY A;  1AHJ B;  1SG5 A;  2DIG A;  3H0H A;  3CCR Q;  2K5I A;  4NS5 A;  1IO6 A;  2RQV A;  3CMA Q;  1WHG A;  3M57 A;  1AVZ C;  3M4G A;  3AHU A;  3D7S B;  2V8J A;  1Y71 A;  4IUR A;  2RPN A;  1YJN A;  2PZ1 A;  3RUX A;  4M78 A;  1YIJ T;  2O9S A;  9ATC B;  5GAN h;  1UB4 A;  5D6X A;  3HHT B;  3SD4 A;  1X6B A;  1UGV A;  4F7U B;  3JCM g;  4DBH A;  3SFM A;  1I8F A;  1QW1 A;  1FXX A;  4LDU A;  2PUK B;  1O9S A;  3EG2 A;  2KE9 A;  1TS9 A;  4LN2 A;  4NOY A;  2LDM A;  4RUG A;  1KQS S;  1AD5 A;  2O4X A;  4J6X A;  2J06 A;  2ROT A;  2XI9 A;  4M75 C;  1YJW A;  3TEE A;  2PNI A;  5LJ3 j;  2DVJ A;  5GAO l;  2YDL A;  3QJ6 A;  4JS5 A;  2EGC A;  2YLC A;  2LNV A;  3A1P A;  3QKJ A;  4M78 B;  3PMT A;  2QGG A;  3THK A;  4HCC A;  4NL2 A;  2L5Q A;  2QK0 A;  1R0C B;  2AKK A;  3FIF A;  3PMI A;  1MND A;  5FRM A;  2EW3 A;  3TSW A;  2LT1 A;  2DTH A;  1W1F A;  1YNZ A;  4PJO G;  1E6G A;  1YIJ Q;  2P4R A;  3MP6 A;  3OYL A;  1IHW A;  4RG2 A;  3QII A;  1LCK A;  1KSW A;  2RN8 A;  2HKQ B;  1M8V A;  1WZO A;  1MMA A;  4LD9 K;  2LNH B;  1OPK A;  2KRO A;  1T3L A;  2KXD A;  2JMC A;  2O4X B;  1Q82 C;  3M9Q A;  3OY9 A;  5LL6 S;  1QVF P;  2PTK A;  3UA7 A;  1VA7 A;  3LGL A;  1RL2 A;  2G3R A;  4GLM A;  2FRW A;  1D1A A;  3M0S A;  5CQY A;  4UC4 A;  2YLB A;  2K2V A;  4X9D A;  2JW4 A;  4N0A C;  2DRM A;  2NUZ A;  3OYE A;  1UUE A;  4Z88 A;  3LWH A;  1N27 A;  1WXT A;  4RG8 A;  4R55 A;  3L2Z A;  2RF0 A;  4QVZ A;  5GAN 3;  1M90 U;  1FMW A;  2QQB A;  3PNW C;  2W10 A;  4PJO D;  5A2Q E;  1B7T A;  1OU9 A;  4BDY A;  1SSF A;  1JJ2 S;  1M3B A;  2MIO A;  2YHT A;  4E6R A;  5GAO m;  1BI1 A;  3M58 A;  2YRC A;  3CCE T;  5FRO A;  1W70 A;  2X35 A;  1VQ7 A;  3V8L A;  3GOX A;  4KUL A;  1X01 A;  3ZEH A;  4O6J A;  2CS7 A;  2ED1 A;  4KH1 B;  3EH2 A;  2LTO A;  1KD1 C;  3ZBD A;  3HRU A;  2EQM A;  4ZN1 A;  2FYK A;  2K9G A;  2YUN A;  3A5Z B;  3I56 T;  3L2R A;  4QQD A;  2KSS A;  3L2U A;  1NYG A;  3H0I A;  4JZ4 A;  1ZA1 B;  3OS0 A;  4M7D G;  2CP6 A;  4JJN K;  2HD0 A;  1ZSG A;  1Q7Y R;  3X26 B;  1MHN A;  2VYT A;  4L59 A;  4Y92 A;  3SB2 A;  1ZHI A;  1MMD A;  1JXO A;  4J9F A;  3V8K A;  3JCM J;  3I5R A;  4C5I A;  1UG1 A;  1YCS B;  1X75 C;  2B86 A;  2FEI A;  2V26 A;  3NPF A;  3CCE Q;  2Y4Y A;  5LJ5 g;  4BI4 A;  5GMK j;  2VUB A;  1C1A A;  3S3O A;  2EYZ A;  3R6O A;  2QEX Q;  2E12 A;  2RQW A;  2JTM A;  3JRZ A;  4OF1 A;  2HBW A;  3J81 E;  1PD0 A;  2VKN A;  1QVG P;  1U5S A;  1HYO A;  1TH7 A;  1IB8 A;  3I56 Q;  3CME A;  4FM4 B;  3G7Z A;  2A7Y A;  5GAM j;  1N9R A;  2RO0 A;  5GJV B;  1UGQ B;  2EKO A;  5GAN 2;  1YJ9 T;  5D6W A;  4F7U F;  4M7D D;  1IZ6 A;  3LYI A;  1QVF A;  2K7A A;  4FYY B;  2LT4 A;  1WNL A;  1RAA B;  3C95 A;  3P8H A;  4IKF A;  1VIE A;  1WQW A;  2FL7 A;  1VQM A;  3PIP A;  3CCQ A;  1Q86 U;  2AK5 A;  2EWN A;  3UDC A;  2DF6 A;  4C5H A;  5FWC A;  4M75 G;  1NPR A;  3DB3 A;  3CD6 T;  1WYX A;  1W2B P;  1SHF A;  3EG9 B;  2EQJ A;  3GP8 A;  2DO3 A;  3MEU A;  5CKE A;  2DTI A;  2GQV A;  1YP5 A;  4PFP A;  4KGX B;  3I9Q A;  2HQH A;  1H3Z A;  2DIL A;  1ABQ A;  2KNB B;  4M78 F;  3S3M A;  1I0C A;  2A3L A;  1KC8 U;  5DLO A;  4EMK A;  5GMK l;  1Q95 G;  2HCK A;  1K8A C;  1M5Q 1;  5FLX E;  4HA8 A;  2GTO A;  2RD1 A;  3OYY A;  2YUO A;  5I21 A;  2RQT A;  4J7F A;  2D6F A;  2CP5 A;  2X3X D;  5FW9 A;  2W0Z A;  1YJ9 Q;  4BAC A;  3QBY A;  4QKU A;  2QA4 A;  2R57 A;  3A8G B;  3JCM W;  3SDZ A;  1JEG A;  3EGU A;  4JRI A;  1WJR A;  1MNE A;  1KFZ A;  5CR2 A;  4DBF A;  5GJW B;  3JCM e;  1K8A R;  3LWI A;  2COY A;  1PSF A;  3UT1 A;  2DEU A;  4ZN3 A;  4CC4 B;  1BI2 A;  4EMH A;  4NL3 A;  4M75 D;  3PGG A;  3CD6 Q;  1GBR A;  1ZUY A;  1MV3 A;  2A28 A;  1G3S A;  3HFO A;  2HL3 A;  3GLX A;  1M2V B;  3G6E A;  1WJS A;  3BDL A;  1RAE B;  3BFM A;  1QP2 A;  2A37 A;  1K9M U;  1SPK A;  5C0M A;  1SHG A;  1PKT A;  1YHQ A;  1ZSZ C;  4RMO A;  2R5A A;  2ABL A;  4J9G A;  2CKK A;  3JV3 A;  3MJX A;  5LJ3 e;  3MPU B;  1Y0M A;  3EFO B;  3DKM A;  1ARK A;  2RK1 A;  3M0P A;  3TU4 K;  3CC2 T;  2JZ2 A;  3M0U A;  5AYF A;  2DA9 A;  4D8K A;  4HT9 A;  4DA4 A;  2P0K A;  3CC4 T;  2M9U A;  5GMK m;  1W6X A;  5GAN j;  3CC7 T;  1D09 B;  2LC4 A;  5A0G A;  4M77 A;  5KYU B;  1N8R U;  2LJ1 A;  4QQ6 A;  1Z9Q A;  1WGS A;  1OI1 A;  2CGH A;  1VQN T;  1YI2 A;  1VQP A;  3C4S A;  2L89 A;  1RAH B;  3OS1 A;  4DBR A;  2DL5 A;  5LJ5 h;  5KCO A;  2O9V A;  2DAQ A;  4OB2 B;  1OX9 A;  2DBM A;  1Q86 C;  2CH4 W;  4HVV A;  1MV0 B;  1D0Y A;  2E5K A;  4ZTF A;  4XTY A;  2HQX A;  1W2B A;  4M7A A;  4J6W A;  3CC2 Q;  2HQE A;  1VQ8 A;  3RMQ A;  1UEC A;  4RCB A;  2EFI A;  2EKH A;  3CPF A;  2XDD A;  2DNU A;  1JU5 C;  2FHD A;  3CC4 Q;  5CKD A;  2BTT A;  5KYX A;  3CC7 Q;  2J6O A;  3GF5 A;  2E64 A;  3M56 A;  2JM8 A;  2D0N A;  3H41 A;  2ESW A;  4C92 A;  1AZE A;  1M27 C;  4VUB A;  4ELZ C;  3OW2 P;  1M4Z A;  1T0J A;  3BY7 A;  2JXB A;  4M7A B;  3JCM f;  4A53 A;  3JB9 H;  3NMZ C;  3OYK A;  2CZ6 B;  4J9I A;  1RAB B;  2K5F A;  2CT3 A;  1W4S A;  1LPL A;  1IGU A;  1N9S A;  3QO3 A;  3EFR A;  3G71 T;  4C8Q C;  1E7O A;  3E1S A;  1PG5 B;  4ESR A;  2PVG B;  2JNG A;  2V8K A;  2LQW A;  2ECZ A;  4M77 E;  5DY9 A;  5KYX B;  2G6F X;  3V7S A;  1PRM C;  5IH2 A;  2R5M A;  4OB3 B;  3QYG B;  2YSQ A;  4C92 B;  2ZPH B;  2VWF A;  5LJ3 f;  2LCL A;  2LMJ A;  4PLI A;  4JRK A;  1Q81 C;  2M02 A;  5GMK e;  1X69 A;  2K6D A;  4PL6 A;  2DD4 A;  2COZ A;  2KYB A;  2LQN A;  3CCM A;  1Q82 U;  3UWN A;  5L8R E;  3JAM E;  4M7A E;  3LGF A;  2RHX A;  2DJQ A;  1VQK A;  3CCU A;  1K1Z A;  2MOX A;  3FRN A;  4LXC A;  3OYJ A;  5GAM e;  1NPP A;  2QQA A;  4L6V 5;  1IXD A;  5A0D A;  2EGE A;  4FYV B;  3M4Y A;  3G71 Q;  2XD0 A;  5DLQ E;  1DJ7 B;  4E7K A;  1YN8 A;  1HXD A;  2YWW A;  4JZ3 A;  4RTZ A;  3ZFJ A;  3G4S A;  2ZPE B;  4HT8 A;  1GCQ C;  5FU7 B;  1S72 A;  1VQO T;  2GFA A;  1RAG B;  2F2V A;  3IQL A;  4PJN A;  1WDX A;  2JTF A;  2RH2 A;  1UJY A;  4E7Z A;  1H8K A;  3QDF A;  2RJE A;  4IUQ A;  4ZGJ B;  1EX4 A;  2EYY A;  2E70 A;  2E3H A;  2VGN A;  2HSP A;  3OYM A;  3CCL T;  1G3Y A;  4F14 A;  3EGD A;  1Q7Y U;  4O5V A;  3FJ5 A;  3GNF B;  1WHM A;  1KD1 U;  2LVM A;  4OMM A;  4MDX A;  2KT1 A;  3FLG A;  1Y96 B;  3GBQ A;  1G3W A;  1SKU B;  4AFU C;  1OOT A;  3X20 B;  4A4F A;  2PUO B;  1U3O A;  3VS5 A;  1KIK A;  1ZSZ B;  1LJO A;  2P4T A;  3RKW A;  3OW2 A;  2XKO C;  3EHQ A;  1YIT T;  4GLK A;  2L3R A;  1VYU A;  2K5L A;  3CBP A;  3FC3 A;  1VQO Q;  1CSK A;  1VQL T;  4B9W A;  4QT7 A;  4Y91 A;  4OGE A;  2QG9 B;  2RNA A;  3CCV T;  1PHT A;  2RI5 A;  1Z9Z A;  3QWX X;  3HRT A;  3QDR B;  1G2B A;  4RTV A;  2L2P A;  3EGD B;  1WHL A;  2NWM A;  2EQK A;  5CCA A;  2GFU A;  2ZZD A;  3EFS A;  2RHU A;  3JCM V;  4RKU E;  4AT1 B;  4A4G A;  2BE9 B;  4OML A;  4ZTJ A;  2J6K A;  3RNJ A;  2NUP B;  2OJ2 A;  4PJO A;  2QXF A;  5CO7 A;  1D1C A;  2DL4 A;  4M77 F;  3ZL7 C;  3CCJ T;  3CXC P;  3Q1J A;  4F7U E;  1VQ4 T;  1V76 A;  5HCK A;  1X2K A;  2LQ8 A;  4JPB W;  2QEX A;  2CZ1 B;  4FSX A;  1YIT Q;  1WHK A;  1JO8 A;  4J7I A;  4QQG A;  1JB0 E;  2XIC A;  2HAX A;  4E47 A;  1VQL Q;  2MF2 A;  3QUI A;  5KYY A;  4EMK C;  5GAO r;  1BKB A;  1TTH B;  3E9F A;  4N4I A;  3I56 A;  3CCV Q;  3ME9 A;  4M7A F;  4CRI A;  2DPP B;  5GAM f;  2NUT B;  3A8H B;  5GAN e;  4BDZ A;  5EC7 A;  4J9C A;  1X43 A;  4RTT A;  4WF2 A;  4E7H A;  2KRS A;  1BIA A;  4PJO B;  4M78 E;  1NEG A;  4C8Q G;  4KUD K;  1JXM A;  1K9A A;  2QAS A;  4XU1 A;  4OB0 B;  1IRX A;  2ENM A;  1WXB A;  4PJM A;  4IUT A;  2AIR B;  3HKS A;  1WX6 A;  2DRK A;  1MMN A;  2E6N A;  1K8A U;  2M0Y A;  1YJW T;  2K3B A;  1KK7 A;  3CCJ Q;  3M53 A;  4C92 F;  4BI3 A;  1VQ4 Q;  4JRP A;  3GNG A;  1J3T A;  1LOJ A;  1V1C A;  3RBB B;  3VJP A;  2FZC B;  1D3B B;  5KYY B;  2LZ6 B;  4B9X A;  4V2S A;  1NEB A;  1Q7Y C;  3HFN A;  4BE2 A;  1BU1 A;  4AG1 C;  4QVC A;  2AZV A;  5FWB A;  2AKL A;  4PJO E;  1HK9 A;  2RK2 A;  4ZGE B;  4DQ2 A;  1K73 R;  1YJ9 A;  3VS1 A;  4C8Q D;  2QQR A;  1ZBJ A;  1BK2 A;  5C6S A;  3JSC A;  3JCM Q;  2EBP A;  3HRS A;  4BY6 B;  2ATC B;  1ZLM A;  2M16 A;  5LJ5 j;  2HNI A;  1PNJ A;  1R0B G;  4LDX A;  3CEY A;  4PLL A;  1YJW Q;  2MK5 A;  1PKS A;  2X4X A;  1M1K R;  1B3Q A;  3SWN B;  4DEX A;  5FU6 B;  2E65 A;  4MMK A;  1BYM A;  2PU9 B;  3V8J A;  4F17 A;  3VS7 A;  1UEB A;  4KT0 E;  1M9S A;  3EG9 A;  1WI7 A;  4E2F B;  3CCS A;  1QVF S;  1QMC A;  1LVK A;  4M7D B;  2K57 A;  5CQX A;  3OQ5 A;  4M4Z A;  3CXC A;  5HKC A;  5I2M A;  2CP0 A;  2KK4 A;  2KYM A;  4YTL A;  2KMT A;  3UF4 A;  1VQ7 T;  2EJF A;  2DYB A;  4EIK A;  3OYN A;  3S3N A;  1SRM A;  4J9H A;  2J7I A;  4MZP A;  2AHJ B;  3TSZ A;  1KG1 A;  2IG0 A;  3RER A;  2C0T A;  2KY9 A;  4PK4 A;  2M0O A;  5GAN f;  4M75 A;  3C12 A;  5CIU A;  1UTI A;  4CC7 A;  1EIF A;  4D8D A;  3QZ9 B;  3MCA B;  2OTL A;  5LJ3 d;  1YWP A;  2ZPG B;  2E5Q A;  4ORZ A;  3RKY A;  5GAN 5;  3AT1 B;  3O5Z A;  2CZ7 B;  2K2M A;  3ASK A;  1OUL A;  3VV0 A;  3OYC A;  2BUD A;  1KHC A;  1JQQ A;  2EYW A;  2RHZ A;  1WHH A;  1I4K 1;  3BW1 A;  1M2V A;  4CI0 C;  4KUI A;  1M3C A;  1CKA A;  1TG0 A;  2WAC A;  3QJY A;  2H3J A;  1YWO A;  3FDR A;  2RM4 A;  2WSF E;  3M54 A;  1VQ7 Q;  2COW A;  3OYH A;  1ABO A;  3JCM X;  1QCO A;  3CBM A;  3CPW P;  4Z8A A;  2B8A A;  3BE3 A;  2DL8 A;  4C0G A;  4M75 B;  4EPC A;  3EFO A;  1UGS B;  1TUG B;  2DXT A;  3CME T;  2DIQ A;  4JUV A;  5CAI A;  5D7U A;  1R8O B;  2DEQ A;  4N0A A;  3CC7 A;  1NJI R;  3I55 A;  4J83 A;  1AWO A;  4HCK A;  5HK3 A;  1NE8 A;  1M90 R;  1PM3 A;  2DD5 A;  3E9G A;  3INZ A;  4PJO F;  2HEQ A;  2EGA A;  4JRQ A;  4Z02 A;  1UE9 A;  1X6O A;  2KT8 A;  3RDV A;  3PVQ A;  1VQM T;  2MYS A;  2GBQ A;  5KYU A;  1GL5 A;  3TQ7 P;  2D0Q B;  2M51 A;  2XID A;  3REB B;  3VUB A;  2QI2 A;  4TVR A;  1QVG S;  1PSE A;  2EVR A;  1Q81 U;  2O88 A;  5GAN 4;  4KGV B;  1TU0 B;  3WVD B;  1RLQ C;  1PRL C;  2XG8 D;  2PVD B;  4X9C A;  2F5T X;  2D1X A;  4PJL A;  1QVG A;  3BDU A;  3OS5 A;  3CME Q;  3GPL A;  1MMG A;  1N5Z A;  1I5O B;  2L3Q A;  1QCN A;  2RI3 A;  1XQH A;  3L2V A;  3I5S A;  2OTJ A;  1OYX A;  2R58 A;  2QA4 T;  2HZY A;  3HSB A;  1TWB A;  1GRI A;  2LP5 A;  4FCY A;  3PT9 A;  1VQM Q;  1H3H A;  3M59 A;  1W2B S;  1VQ5 A;  2GTJ A;  1VQ6 A;  3CQT A;  2XU8 A;  4PKC C;  4D6W A;  4M78 C;  5HK0 A;  2JN0 A;  2OI3 A;  3DLM A;  3U23 A;  1M3A A;  4KGZ B;  3O8V A;  1T3S A;  2VB6 A;  4RTX A;  2FPE A;  3PE0 A;  2ZCF B;  2CP3 A;  2QTV A;  1HD3 A;  1CKB A;  2X4W A;  4E7S A;  1YHQ T;  2QAZ A;  2ROL A;  2IPO B;  2LQK A;  1VYV A;  2FO0 A;  2CP2 A;  2EYX A;  3P8B B;  4M7D F;  5CKB A;  5GAO n;  2FRY A;  1WLP B;  2QYZ A;  1SRL A;  1G3T A;  3QWY A;  2QA4 Q;  3CPW A;  1E6H A;  1D0Z A;  2DXU A;  1VQN Q;  4LDY A;  2KGT A;  1OZ2 A;  3CCR A;  2WSE E;  3SEM A;  2MI6 A;  1NLO C;  3CMA A;  4IUP A;  4R0K A;  1VQ9 T;  2VV5 A;  2Z0W A;  4AMC A;  4JLG A;  2QGF B;  5GAO p;  4C0Z A;  3A8O B;  2J6F A;  1H92 A;  1FYN A;  5KH6 A;  4FW1 A;  1YCY A;  3UAT A;  1Y07 A;  1YI2 T;  1VQP T;  5I22 A;  1UFF A;  4LUE A;  4E7L A;  1GFD A;  1KC8 R;  3OBW A;  3JCM P;  5LJ5 e;  1YHQ Q;  4OVA A;  2GGR A;  2SRC A;  2VGM A;  2DMO A;  3MET A;  2KRM A;  4JLI A;  4OMQ A;  2EJ9 A;  4N4G A;  3L2Q A;  1KJW A;  1RAI B;  3V7R A;  2AZS A;  3ER0 A;  3DB4 A;  2BZ8 A;  2K79 A;  1BCO A;  4A54 A;  1KQS P;  1VQ8 T;  1I1J A;  3VS2 A;  1AWX A;  2VAS A;  3UPU A;  2CSI A;  4XU3 A;  4OMO A;  1VQ9 Q;  2OAU A;  4M75 F;  1B07 A;  1NYF A;  4IIO A;  4Q5W A;  4ELY C;  1XNI A;  2XHC A;  5CVI A;  3A8L B;  2L3P A;  2DET A;  1GXI E;  1YIJ A;  1QP3 A;  2X51 A;  4J8O A;  5GAN 6;  2V1R A;  2JS2 A;  2RQU A;  2XDP A;  1UDL A;  2EQI A;  5GAO q;  1YI2 Q;  1VQP Q;  2E3I A;  2X4J A;  2H8H A;  1Y96 A;  2RB6 A;  4EMG A;  3JB9 J;  2MPX C;  3NTK A;  2FZG B;  1OV3 A;  1BIB A;  3RMS A;  3EHR A;  1ZSZ A;  3H0F A;  3VRY A;  1VQL A;  3EAE A;  4C92 E;  2KBT A;  4BE1 A;  2V1Q A;  1PD1 A;  4F16 A;  2LCS A;  3VS0 A;  3KFV A;  4A4E A;  4LD6 A;  1VQ8 Q;  1K73 U;  2YUP A;  2FZK B;  1D1B A;  1BBZ A;  1EZZ B;  2RI2 A;  5AT1 B;  2P84 A;  4F7U G;  1Y7X A;  1ZBX A;  3G1J A;  2ZPI B;  1G83 A;  4F04 B;  4JJB A;  3MKD A;  3OW2 S;  1AZG B;  5GAN d;  3CCJ A;  1AEY A;  1N8R R;  2NUP A;  4HXJ A;  3MHX A;  4CC3 A;  4KBM B;  2ZPF B;  4LE9 A;  3CCM T;  2RHI A;  2MWO A;  4PNO A;  4JS4 A;  3TVT A;  2E10 A;  2E1H A;  3L1A A;  4MZM A;  4AFS C;  1X27 A;  4J5Y A;  2JUF A;  1JJ2 P;  1VQK T;  3CCU T;  1AT1 B;  5DM7 R;  3QXE B;  4JJC A;  3VS4 A;  2HKN A;  2Y90 A;  3TRE A;  4ANJ A;  3OYB A;  4GBQ A;  4M78 G;  1JRI A;  1ZQ1 A;  3MP8 A;  2KVQ G;  2GF7 A;  3H8Z A;  4C0F A;  1NZ9 A;  3L2W A;  3OYI A;  3G4S T;  3QG1 A;  4FL6 A;  3CCL Q;  2NUT A;  1S72 T;  5LJ5 f;  3PFS A;  3M5A A;  2BKD N;  1TUD A;  1GFC A;  2VXE A;  2PVO B;  2BZX A;  4RTU A;  5IXF A;  4LUD A;  3JB9 F;  1U1S A;  2JVV A;  5I11 A;  1OEB A;  3PTA A;  1RI9 A;  2DVE A;  1WXU A;  1UHF A;  1BCM A;  2RJF A;  3CCM Q;  1KQS A;  3CCE A;  2ZPB B;  3PVL A;  4K11 A;  2BE7 D;  4Y28 E;  3H9N A;  2LX7 A;  2YT6 A;  4X34 A;  5LJ3 g;  1VQK Q;  3CCU Q;  4CC2 A;  5A0L A;  5I2S A;  1YJN T;  2YRD A;  3VS6 A;  1D3B A;  3RR6 A;  4M78 D;  3C0C A;  2F5K A;  2K3X A;  1F1B B;  5KE2 A;  2HBP A;  2RJD A;  1MUZ A;  1PCX A;  4A4H A;  4B6M A;  2DJZ A;  4XTZ A;  4C8Q A;  2HDA A;  3PIO A;  3QHS A;  3G4S Q;  2KAF A;  4RTY A;  5M9O A;  1NM7 A;  1K0X A;  1S72 Q;  1KQ2 A;  4HCB A;  2CSQ A;  1BI3 A;  4KRT A;  4JDS A;  2FB7 A;  2P0P A;  4LNP A;  1WJQ A;  4C0D C;  1B34 A;  1VUB A;  4JJD A;  1NJI U;  3OSS C;  1O75 A;  4XQ3 A;  2FVU A;  2JS0 A;  1Q82 R;  4FIB A;  1TUC A;  1D0X A;  1G5V A;  4AFQ C;  1K73 C;  2KQW A;  4ATO A;  2DBK A;  2QDY B;  4QVD A;  1I07 A;  3NFC A;  2KI7 A;  2CUB A;  1YJN Q;  3SWN A;  1OPL A;  4PFZ A;  4C8Q B;  5L23 A;  3MEA A;  3OB9 A;  4OB1 B;  1NG2 A;  8ATC B;  4P5N A;  3VUZ A;  3S6W A;  1H64 1;  2CH4 A;  1WA7 A;  1M1K C;  3HTR A;  1UGR B;  1M2O A;  2QEX T;  2M1H A;  4M7D A;  4OMP A;  2CUD A;  1JJ2 A;  1GCQ A;  1YFN A;  2OX7 A;  1UGP B;  1B34 B;  2C0O A;  3F70 A;  4HVW A;  3MEV A;  1Y57 A;  4II1 A;  3M55 A;  3LW5 E;  2JTE A;  3EG3 A;  4FYX B;  1KHI A;  1BB9 A;  1C6V X;  2DYI A;  4M77 C;  8AT1 B;  4Z89 A;  3CD6 A;  1ZUK A;  3SHW A;  1SEM A;  2DZ9 A;  3CXC S;  5FRN A;  1WHJ A;  1KD1 R;  1SF9 A;  1IHV A;  2RJC A;  4C8Q E;  3CBO A;  1RI0 A;  4AFZ C;  3OYF A;  3QPH A;  2CYZ B;  4N4H A;  2E4H A;  2YXY A;  3JCM d;  1GBQ A;  2GQI A;  5IHK A;  1RLP C;  2C06 A;  4XU2 A;  4LDW A;  2A08 A;  3C94 A;  4KH0 B;  3L42 A;  2DTO A;  1VOM A;  5CK9 A;  1OQK A;  2O2O A;  4M7A C;  4XTX A;  1IGQ A;  4BD3 A;  3OMC A;  4J9E A;  1I81 A;  2DZC A;  3OBY A;  1ZUU A;  4FYW B;  4BI8 B;  1I5L A;  1K76 A;  3MEW A;  2BIV A;  5J39 A;  1FX7 A;  2RA2 A;  3VRZ A;  3OS2 A;  1VYT A;  3JCM h;  2QQ9 A;  4IIM A;  1OZ3 A;  2RHY A;  2FPF A;  3RKX A;  2VVK A;  5GMK i;  2F69 A;  2MMP A;  4ME7 A;  1V29 B;  4A4K A;  4C92 C;  1AOJ A;  1QCF A;  1WQ7 A;  4PJJ A;  1UJ0 A;  2YUQ A;  4FT4 A;  5GAM g;  2JMA A;  3T9N A;  3R6N A;  2SEM A;  3LX7 A;  3JCM b;  2L8D A;  4FW2 A;  2QQS A;  4IUV A;  5IHN A;  2DER A;  4M7D E;  1HJD A;  2DM1 A;  2KRN A;  1QWF A;  2Y4X A;  3VYG A;  4XK8 E;  5LJ3 h;  2PQW A;  2BZY A;  1U8R A;  3MO8 A;  1RAF B;  1NJI C;  3NTI A;  1N6A A;  1VIF A;  3UA6 A;  3CC2 A;  2I0N A;  1M90 C;  2KXC A;  2MCN A;  3QZ5 B;  3A8M B;  4PFO A;  4BE0 A;  4E7I A;  2QTX A;  1M30 A;  3CCS T;  2DXB A;  3REA B;  6AT1 B;  1ACM B;  1WPY A;  3P8D A;  4WCI A;  3CC4 A;  2LRQ A;  4DOV A;  1ZA2 B;  4HVU A;  2D8J A;  5FU7 C;  4FU6 A;  2E6Z A;  5IT9 E;  2FPD A;  2LJ0 A;  2X3W D;  1TXQ A;  4XU0 A;  3FB9 A;  1NLP C;  2DXC A;  2LX9 A;  3NHN A;  1VQN A;  1X2Q A;  1QLY A;  3EH1 A;  2KEA A;  3CCQ T;  1FMV A;  5J3B A;  3OYA A;  4XTW A;  2HL5 C;  2D8H A;  2J05 A;  3QSU A;  2ED0 A;  2OTL T;  1UHC A;  3LH5 A;  1SSH A;  4A63 B;  3FJP A;  4EMK B;  2EJG A;  4OGC A;  5D6Y A;  3DLL A;  1MGQ A; 
#chains in the Genus database with same CATH homology
 2EQU A;  4C5I A;  4M75 E;  3L2Q A;  4A4G A;  3KBG A;  1X75 C;  3KXT A;  3V7R A;  3ER0 A;  4IUU A;  3DB4 A;  4ZTJ A;  4E7J A;  1P92 A;  2QXF A;  4PJO A;  2K3Y A;  2Y4Y A;  3JCM c;  5LJ5 g;  3TCJ A;  4A54 A;  4OMF B;  4BI4 A;  5GMK j;  5CO7 A;  2VUB A;  1VQ8 T;  3S3O A;  3R6O A;  4M77 F;  2E12 A;  5GAN 7;  3HPW A;  2JTM A;  3JRZ A;  2VXF A;  3RIR A;  4GY5 A;  4OF1 A;  4C8Q F;  4MZT A;  3CCJ T;  3J81 E;  5IAY A;  3Q1J A;  3UPU A;  2EAY A;  4F7U E;  4XU3 A;  3HL8 A;  1VQ4 T;  2OAU A;  4M75 F;  1TH7 A;  3E19 A;  4Q5W A;  2LQ8 A;  3WXM B;  4ELY C;  1XNI A;  2XHC A;  5CVI A;  3A8L B;  3CME A;  4FM4 B;  2O01 E;  1GXI E;  3G7Z A;  4C0D B;  1YIJ A;  1QP3 A;  3KUF A;  5GAN 8;  2QEX A;  4XTU A;  1IRE B;  2CZ1 B;  2A7Y A;  4FSX A;  3WVE B;  5GAM j;  1N9R A;  2RO0 A;  4J8O A;  5GAN 6;  2I2L A;  5KE3 A;  4J7I A;  4QQG A;  1JB0 E;  2V8I A;  2XDP A;  2XIC A;  3OYG A;  5CKF A;  2HAX A;  1UGQ B;  2EKO A;  4E47 A;  5LJ5 d;  5GAN 2;  1VQ9 A;  1YJ9 T;  2CZ0 B;  2MF2 A;  3QUI A;  4EMK C;  5GAO r;  1BKB A;  3E9F A;  4N4I A;  5D6W A;  5GAO q;  3I56 A;  2X4J A;  2MAM A;  3ME9 A;  4F7U F;  1IZ6 A;  3LYI A;  2RB6 A;  1Y96 A;  2DPP B;  4CRI A;  3A8H B;  4EMG A;  5GAM f;  5GAN e;  3I55 T;  3NTK A;  4BDZ A;  3JB9 J;  2LT4 A;  1WNL A;  3C95 A;  1BIB A;  3P8H A;  4WF2 A;  1VIE A;  1WQW A;  3RMS A;  2FL7 A;  4E7H A;  1VQM A;  4IKF A;  4HKE A;  3PIP A;  1M1F A;  1BIA A;  4M77 G;  3CCQ A;  3JB9 G;  4PJO B;  2KDS A;  1VQL A;  3EAE A;  4M78 E;  4C92 E;  4C8Q G;  4BE1 A;  4OP0 A;  1Q86 U;  4KUD K;  3QYH B;  2NLU A;  4XU1 A;  3G6E T;  3G71 A;  2EWN A;  4OB0 B;  3UDC A;  4C5H A;  5GAN g;  4IUT A;  4M75 G;  4MDW A;  1NPR A;  3DB3 A;  3VKI A;  3CD6 T;  3HKS A;  4A4E A;  4LD6 A;  3OA6 A;  3OYD A;  5KCH A;  3CPW S;  4RCC A;  4XTV A;  1K73 U;  2E6N A;  2EQJ A;  3GP8 A;  2DO3 A;  1K8A U;  4XAX B;  4ZGD B;  4M7D D;  3MEU A;  5CKE A;  3X28 B;  2DTI A;  2GQV A;  1YJW T;  4BUG A;  2K4Y A;  3M53 A;  1H3Z A;  3S3M A;  4M78 F;  4C92 F;  4MML A;  3V7C A;  5GAM d;  4BI3 A;  2A3L A;  2RI2 A;  4JRP A;  3GNG A;  4F7U G;  1LOJ A;  1KC8 U;  1Y7X A;  4M7A G;  1ZBX A;  3VJP A;  5GMK h;  5DLO A;  4R56 A;  4EMK A;  2ZPI B;  5GMK l;  1D3B B;  1K8A C;  1M5Q 1;  5FLX E;  4HA8 A;  1YBY A;  4FT2 A;  3OW2 S;  4B9X A;  2RD1 A;  3OYY A;  3RES A;  5J26 A;  5I21 A;  5GAN d;  3CCJ A;  4V2S A;  4M77 B;  1Q7Y C;  3HFN A;  4J7F A;  2D6F A;  4BE2 A;  3MHX A;  1KQ1 A;  1KC8 C;  2EIF A;  4KBM B;  2ZPF B;  4BAC A;  4PJO C;  3CCM T;  3NTH A;  3QBY A;  4HCZ A;  2RHI A;  2MWO A;  4PNO A;  4QVC A;  4JS4 A;  2E10 A;  2QA4 A;  2R57 A;  2E1H A;  3FEO A;  3L1A A;  3A8G B;  4MZM A;  3OSV A;  5GAM h;  3JCM W;  3SDZ A;  4J5Y A;  3J80 E;  2OTJ T;  1QVP A;  1HK9 A;  4PJO E;  2JUF A;  2RK2 A;  1WJR A;  2X4Y A;  4JRI A;  4ZGE B;  1VQK T;  3CCU T;  4DQ2 A;  2EYQ A;  4M77 D;  5CR2 A;  3JB9 D;  3JCM e;  5DM7 R;  1YJ9 A;  3QXE B;  3GIB A;  4C8Q D;  2IVW A;  2QQR A;  2Y90 A;  3TRE A;  3OYB A;  3LWI A;  1PSF A;  4M78 G;  3UT1 A;  4C92 G;  4ZN3 A;  1JRI A;  1BI2 A;  4EMH A;  3JSC A;  4M75 D;  5C6S A;  3JCM Q;  4NL3 A;  1VQ5 T;  2DK3 A;  3HRS A;  1ZQ1 A;  3MP8 A;  3PGG A;  4BY6 B;  2M16 A;  1VQ6 T;  4C5G A;  5FRM A;  5LJ5 j;  2HNI A;  2KVQ G;  3MP1 A;  3HFO A;  1G3S A;  4LDX A;  2GF7 A;  3GLX A;  3CEY A;  3H8Z A;  4BB7 A;  1NZ9 A;  4C0F A;  4PLL A;  1VQO A;  3X24 B;  3L2W A;  3OYI A;  3G6E A;  3G4S T;  3QG1 A;  4FL6 A;  1WJS A;  5HY6 A;  2X4X A;  3BDL A;  1BI0 A;  3BFM A;  3X25 B;  1S72 T;  5LJ5 f;  3PFS A;  1QP2 A;  1K9M U;  5IN1 A;  3SWN B;  3M5A A;  4M7A D;  3H6Z A;  5C0M A;  1YHQ A;  2BKD N;  2VXE A;  4RMO A;  5FU6 B;  2PVO B;  4C5E A;  2R5A A;  2E65 A;  2CKK A;  3CCL A;  3JB9 F;  1U1S A;  2JVV A;  4MMK A;  5LJ3 e;  1BYM A;  2PU9 B;  3V8J A;  3HP9 A;  3PTA A;  1K9M C;  1UEB A;  2DVE A;  1XTD A;  3DKM A;  2RK1 A;  3TU4 K;  2RJF A;  4KT0 E;  1KQS A;  1M9S A;  3CCE A;  3CC2 T;  2ZPB B;  3CCS A;  2WSC E;  1QVF S;  4Y28 E;  4M7D B;  2K57 A;  5CQX A;  3OQ5 A;  1U1T A;  2JZ2 A;  3CXC A;  5HKC A;  5I2M A;  2MWP A;  4X34 A;  2KK4 A;  5AYF A;  4YTL A;  2KMT A;  4DOW A;  5LJ3 g;  4BY6 C;  5A0L A;  5I2S A;  1YJN T;  1VQ7 T;  2EJF A;  4HT9 A;  4DA4 A;  2P0K A;  3LH0 A;  2D9T A;  1M1G A;  1D3B A;  1JBM A;  2M9U A;  5GMK m;  3CC4 T;  4EDU A;  4M78 D;  4C92 D;  3OYN A;  2F5K A;  2K3X A;  3CCR T;  3S3N A;  5GAN j;  5KE2 A;  3CC7 T;  2LC4 A;  3URG A;  2HBP A;  3CMA T;  2RJD A;  4MZP A;  5A0G A;  2AHJ B;  4M77 A;  1YIT A;  4A4H A;  1KG1 A;  2DJZ A;  2IG0 A;  3SWN C;  4XTZ A;  1N8R U;  2GCX A;  4C8Q A;  3RER A;  2KY9 A;  3N5B B;  4QQ6 A;  3PIO A;  1XOV A;  1WGS A;  5FU6 C;  1OI1 A;  2CGH A;  3QHS A;  1VQN T;  2M0O A;  5GAN f;  1YI2 A;  2KAF A;  4M75 A;  1VQP A;  3VU3 C;  3C4S A;  2ZGW A;  3CCV A;  2DKG A;  3LLR A;  3C12 A;  2L89 A;  5CIU A;  5M9O A;  1EIF A;  2P0Q A;  3OS1 A;  3QZ9 B;  3MCA B;  3VYH B;  2OTL A;  4QW2 A;  5LJ3 d;  1KQ2 A;  4HCB A;  5LJ5 h;  5KCO A;  1N8R C;  1BI3 A;  2DAQ A;  2ZPG B;  1FWZ A;  2E5Q A;  4OB2 B;  4JDS A;  3RKY A;  5GAN 5;  2LCC A;  2FB7 A;  3JB9 I;  2CZ7 B;  3ASK A;  1Q86 C;  4M7D C;  3VV0 A;  2P0P A;  5CKH A;  3OYC A;  2BUD A;  1WJQ A;  4C0D C;  4ZTF A;  1KHC A;  4XTY A;  1B34 A;  1VUB A;  2YRV A;  4F7U A;  1NJI U;  2HQX A;  2VC8 A;  1W2B A;  5EG2 A;  3OSS C;  4M7A A;  1O75 A;  2RHZ A;  4XQ3 A;  2FVU A;  4J6W A;  1I4K 1;  2HQE A;  4FIB A;  3BW1 A;  4CI0 C;  1G5V A;  2E41 A;  1K73 C;  2KQW A;  4KUI A;  2QDY B;  4QVD A;  1VQ8 A;  3RMQ A;  4ATO A;  3NFC A;  4L5G A;  3OMG A;  2WAC A;  4RCB A;  2EFI A;  2H3J A;  3FDR A;  3QJY A;  2RM4 A;  4J6Y A;  3CPF A;  2WSF E;  1LNX A;  2XDD A;  4LDV A;  3M54 A;  1M1K U;  2XDB A;  2XK0 A;  3J7A F;  3SWN A;  3OYH A;  1VQ4 A;  2JOY A;  1AHJ B;  2FHD A;  4C8Q B;  2DIG A;  3MEA A;  3JCM X;  3OB9 A;  5CKD A;  4OB1 B;  3CBM A;  4P5N A;  2B8A A;  3VUZ A;  3S6W A;  1H64 1;  2K5I A;  4NS5 A;  4M75 B;  4C0G A;  3M57 A;  3GF5 A;  2E64 A;  4EPC A;  3M56 A;  3M4G A;  3AHU A;  1UGS B;  2V8J A;  1M1K C;  1Y71 A;  4IUR A;  1YJN A;  1UGR B;  2DXT A;  3CME T;  2DIQ A;  3RUX A;  4M78 A;  4C92 A;  1YIJ T;  2QEX T;  4JUV A;  5CAI A;  2M1H A;  4VUB A;  1R8O B;  4M7A F;  4M7D A;  4ELZ C;  5GAN h;  2DEQ A;  4N0A A;  3CC7 A;  1JJ2 A;  1M4Z A;  1UB4 A;  3I55 A;  1UGP B;  4J83 A;  5D6X A;  3HHT B;  1B34 B;  3BY7 A;  3SD4 A;  4F7U B;  4M7A B;  3JCM f;  3F70 A;  4A53 A;  5HK3 A;  3JB9 H;  1NE8 A;  3OYK A;  2CZ6 B;  2DD5 A;  3E9G A;  3MEV A;  3JCM g;  3INZ A;  4PJO F;  3SFM A;  4II1 A;  1I8F A;  1QW1 A;  1FXX A;  2PUK B;  4LDU A;  1O9S A;  1X6O A;  4Z02 A;  3M55 A;  4JRQ A;  1VQM T;  2K5F A;  3LW5 E;  1W4S A;  4NOY A;  1N9S A;  1KHI A;  2LDM A;  3QO3 A;  4M77 C;  1KQS S;  3CD6 A;  2D0Q B;  3EFR A;  3G71 T;  2O4X A;  4C8Q C;  4J6X A;  2XID A;  3E1S A;  3VUB A;  2DZ9 A;  3CXC S;  5FRN A;  2QI2 A;  2PVG B;  2JNG A;  2XI9 A;  2V8K A;  4TVR A;  4M77 E;  5DY9 A;  4M75 C;  1YJW A;  1QVG S;  1PSE A;  2RJC A;  3TEE A;  5LJ3 j;  5GAO l;  3V7S A;  4C8Q E;  1Q81 U;  3QJ6 A;  3CBO A;  4JS5 A;  1RI0 A;  1QVF A;  2YLC A;  3OYF A;  2LNV A;  3QPH A;  5GAN 4;  2CYZ B;  2R5M A;  4N4H A;  3QKJ A;  4OB3 B;  3QYG B;  3WVD B;  4M78 B;  4C92 B;  3PMT A;  2ZPH B;  3JCM d;  2XG8 D;  2C06 A;  4HCC A;  4NL2 A;  4XU2 A;  2L5Q A;  4LDW A;  5LJ3 f;  2LCL A;  2PVD B;  3C94 A;  3FIF A;  3PMI A;  4X9C A;  3L42 A;  2F5T X;  4JRK A;  2DTO A;  4PLI A;  1Q81 C;  1QVG A;  5CK9 A;  2LT1 A;  2DTH A;  3BDU A;  3OS5 A;  5GMK e;  4PJO G;  4M7A C;  3GPL A;  4PL6 A;  2DD4 A;  4XTX A;  3MP6 A;  3OYL A;  4RG2 A;  3CCM A;  3QII A;  1Q82 U;  3UWN A;  4BD3 A;  3OMC A;  5L8R E;  2RI3 A;  1I81 A;  1XQH A;  2DZC A;  3OBY A;  3L2V A;  3JAM E;  4M7A E;  1M8V A;  4BI8 B;  1I5L A;  3LGF A;  2OTJ A;  3MEW A;  1OYX A;  2BIV A;  5J39 A;  4LD9 K;  1FX7 A;  2RA2 A;  2RHX A;  2R58 A;  3OS2 A;  1VQK A;  3CCU A;  3JCM h;  2QQ9 A;  2QA4 T;  3HSB A;  2O4X B;  1OZ3 A;  3FRN A;  3OYJ A;  1Q82 C;  2RHY A;  3M9Q A;  5GAM e;  3OY9 A;  5LL6 S;  3RKX A;  1NPP A;  3PT9 A;  3LGL A;  1RL2 A;  2G3R A;  2QQA A;  4L6V 5;  3M59 A;  1W2B S;  5A0D A;  5GMK i;  1VQ5 A;  2F69 A;  2MMP A;  5CQY A;  1VQ6 A;  3M4Y A;  4ME7 A;  4UC4 A;  2YLB A;  2XD0 A;  5DLQ E;  2K2V A;  1V29 B;  1DJ7 B;  2XU8 A;  4PKC C;  4X9D A;  4A4K A;  4M78 C;  1WQ7 A;  2JN0 A;  4C92 C;  4D6W A;  5HK0 A;  4E7K A;  1HXD A;  3ZFJ A;  3DLM A;  3G4S A;  4FT4 A;  5GAM g;  2ZPE B;  4N0A C;  3T9N A;  4HT8 A;  5FU7 B;  3LX7 A;  3O8V A;  1S72 A;  3JCM b;  2L8D A;  2GFA A;  3OYE A;  1VQO T;  3LWH A;  2QQS A;  1N27 A;  4IUV A;  4RG8 A;  4M7D E;  4R55 A;  3L2Z A;  2ZCF B;  2Y4X A;  4QVZ A;  4XK8 E;  3VYG A;  5GAN 3;  2JTF A;  2RH2 A;  1M90 U;  2QQB A;  3PNW C;  2RJE A;  4IUQ A;  5LJ3 h;  2PQW A;  4ZGJ B;  1U8R A;  3MO8 A;  2X4W A;  1YHQ T;  1NJI C;  2E70 A;  4PJO D;  5A2Q E;  3NTI A;  1N6A A;  2VGN A;  1VIF A;  2LQK A;  3OYM A;  3CC2 A;  3CCL T;  1G3Y A;  4BDY A;  1M90 C;  1SSF A;  1JJ2 S;  1Q7Y U;  4O5V A;  2YHT A;  3P8B B;  3QZ5 B;  5CKB A;  4M7D F;  3A8M B;  3GNF B;  5GAO n;  5GAO m;  1BI1 A;  3M58 A;  1KD1 U;  2LVM A;  4BE0 A;  4E7I A;  2QTX A;  3CCE T;  1G3T A;  4MDX A;  5FRO A;  3CCS T;  2DXB A;  2X35 A;  1VQ7 A;  3V8L A;  3GOX A;  1WPY A;  1X01 A;  4KUL A;  3CPW A;  3P8D A;  3ZEH A;  3FLG A;  1Y96 B;  2DXU A;  2LRQ A;  3CC4 A;  4O6J A;  1G3W A;  2CS7 A;  4LDY A;  1OZ2 A;  2LTO A;  4DOV A;  3CCR A;  3X20 B;  2WSE E;  4A4F A;  2MI6 A;  2PUO B;  1KD1 C;  5FU7 C;  4FU6 A;  2E6Z A;  4IUP A;  3CMA A;  5IT9 E;  3ZBD A;  3HRU A;  1VQ9 T;  2EQM A;  4ZN1 A;  1LJO A;  2FYK A;  2P4T A;  3RKW A;  3A5Z B;  2VV5 A;  3I56 T;  3L2R A;  4XU0 A;  3FB9 A;  4JLG A;  4QQD A;  2DXC A;  3OW2 A;  2LX9 A;  5GAO p;  2XKO C;  1VQN A;  2KSS A;  4C0Z A;  1YIT T;  4GLK A;  3A8O B;  2L3R A;  3L2U A;  2K5L A;  5KH6 A;  3CBP A;  3FC3 A;  3CCQ T;  1YCY A;  5J3B A;  1VQL T;  4B9W A;  3OYA A;  4Y91 A;  4OGE A;  4XTW A;  1Y07 A;  1YI2 T;  1VQP T;  3CCV T;  3OS0 A;  2RI5 A;  4M7D G;  4JJN K;  2HD0 A;  3HRT A;  3QSU A;  3X26 B;  4E7L A;  1MHN A;  2OTL T;  3QDR B;  2VYT A;  4L59 A;  3OBW A;  3JCM P;  5LJ5 e;  3FJP A;  2EQK A;  3SB2 A;  1ZHI A;  5CCA A;  2GFU A;  2ZZD A;  4OVA A;  2VGM A;  3EFS A;  4EMK B;  2EJG A;  2RHU A;  4RKU E;  3JCM V;  4OGC A;  5D6Y A;  3MET A;  3V8K A;  3JCM J;  4JLI A;  3DLL A;  2EJ9 A;  4N4G A;  1MGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...