4MDWA

Crystal structure of a duf1541 family protein (ydhk) from bacillus subtilis subsp. subtilis str. 168 at 2.00 a resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
146
structure length
133
Chain Sequence
HEEMDHSGSADVPEGLQESNPYVGSQVIINTSHMGMGAEATVTGAYDTTAYVVSYTPTNGGQRVDHHWVIQEEIDAGDTLQPGDQVILEASHMGMGATAEIDSAETTVYMVDYTSTTSGEVNHKWVTEDELSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein YdhK
publication title Crystal structure of a hypothetical protein (ydhK) from Bacillus subtilis subsp. subtilis str. 168 at 2.00 A resolution
rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Structural genomics, unknown function
total genus 24
structure length 133
sequence length 146
ec nomenclature
pdb deposition date 2013-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07563 DUF1541 Protein of unknown function (DUF1541)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1210 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4mdwA00
4MDWA
chains in the Genus database with same CATH superfamily
3PE0A 2FZCB 1K8AU 4BUGA 1YITA 4E2FB 3A8LB 2DBKA 2HSPA 2V8IA 5GAMg 2C0OA 2JN0A 4FCYA 4C92F 1FMWA 2P4TA 2B8AA 2JS0A 1ZSGA 3PNWC 4AFZC 3G4ST 2JXBA 5LJ3h 3CEYA 3KBGA 3M54A 2CP3A 3MEVA 3NHNA 2EJ9A 1X27A 2KE9A 3UATA 3CCQT 1M4ZA 3MP1A 3FRNA 1A0NB 1AWXA 1G5VA 1P92A 4RMOA 2LCLA 2M1HA 4J9IA 1X01A 1RAFB 1RABB 4JDSA 2QASA 3OA6A 4CI0C 4LDVA 3E2UA 8AT1B 1VQ5Q 2JM8A 3OYNA 1VQNT 1Q82R 4J83A 1S72Q 4Y92A 3JRZA 1K9MU 1UFFA 2FL7A 1ZX6A 2OTJQ 3VKIA 4JZ4A 1WHHA 4OGEA 4PJJA 1KHIA 3HHTB 3X24B 3HRUA 2F69A 3QYHB 3C94A 3V8JA 4AT1B 1ZA2B 4PJMA 1NJIU 2MPXC 2L3PA 2CP5A 2A0FB 4DEXA 2DF6A 3MO8A 1NEGA 4C8QE 4J9BA 1WPYA 4J9GA 4C5HA 4HVWA 2GBQA 4KH0B 2Y4XA 1I5OB 1ZUKA 3V8LA 2P0PA 1W70A 1UE9A 2AT1B 3VV0A 1FMVA 2K5FA 3TSWA 3SD4A 1I1JA 1GXIE 4K11A 5FU7C 3ZL7C 3FJPA 4CC3A 3BFMA 3EG1A 3FDRA 1N6AA 1K0XA 4XU2A 1PSEA 3LGFA 1VQ9Q 2R5MA 4C0DC 4PLIA 2FYKA 3UDCA 4BE1A 2XDBA 2DLPA 5CQXA 3EHRA 1BKBA 3P8HA 2D8HA 1QVGS 4ZGJB 3VS2A 1KD1R 3JSCA 1G3YA 2LQKA 5KYXB 2VGNA 2Y90A 3JB9F 5CQYA 1E6HA 5GAMd 5KH6A 3VU3C 1MNEA 2ABLA 1PNJA 2I2LA 4IIOA 4ELZC 1VQ6A 2PVDB 3SDZA 1YJNQ 2DD4A 3EH1A 4MZMA 3E9GA 4PNOA 2HKQB 2C0IA 1VQLT 1MMDA 2COZA 2WSFE 1H92A 4J9HA 3M5AA 2VYTA 3EFOA 2CKKA 1VQKA 3HL8A 1OI1A 3VS4A 1W4SA 4FSXA 4BE2A 1YFNA 4FL6A 2FPDA 4OMOA 1RI0A 4B9WA 2KI7A 3CBPA 4Z88A 4JS4A 4J9FA 4F7UB 2A28A 1VQMQ 3RKYA 2VGMA 1D0XA 3CC2T 2VKNA 4PKCC 3M59A 3I35A 3CMET 1M90C 1RAHB 1TUDA 4HVVA 2BZYA 2OTLQ 1K76A 2JW4A 2DL5A 5GANh 3OS5A 3LGLA 4QW2A 3OY9A 2JVVA 2VB6A 2KRNA 5I21A 1Z9QA 5J39A 1I8FA 1VQ7A 1YJ9Q 1RAGB 5CKEA 4KRTA 1N8RC 4HA8A 2XI9A 1F1BB 3VS7A 2JMAA 3S3OA 3QJ6A 4R0KA 4KBMB 1IHVA 1WLPB 1SRMA 2RN8A 4IUVA 4F17A 4M77F 2KSSA 1YI2Q 2BZ8A 3VYGA 3CCJT 4FSSA 1YHQQ 4PFOA 2OX7A 4M78D 4OMNA 5IXFA 3HTRA 1EFNA 3OYJA 1Q86U 4IIMA 2K3YA 3SWNC 1AEYA 2QGGA 2RM4A 3HSBA 3I56T 4VUBA 4M75F 2YRVA 4F7UF 4PJOF 2ATCB 2RI2A 2NWMA 4PJNA 1NM7A 2YUOA 1D1CA 4PK4A 5GAN5 1YCYA 3CCEA 3JCMg 1YNZA 2QYZA 5AYFA 2ENMA 2M0OA 1R0BG 5LJ5f 1KQSS 5DLQE 1WNLA 3CCVA 3EFRA 3A8OB 2CP6A 1SPKA 3CCMT 4J6WA 2J6OA 2KRMA 3J81E 3H41A 3CCRQ 4C0FA 3CMAT 1WJQA 2RK1A 2RQUA 3DB3A 1GBQA 5GAMf 1VQ5A 3S3NA 2YSQA 2A7YA 1XTDA 1E7OA 1TUCA 2VVKA 2CREA 2QTVA 3G71T 2KXCA 2EIFA 4HT8A 4O6JA 2BE9B 4JUVA 5GAN8 2RHIA 5IXBA 1KQ1A 2A3LA 1QCFA 2HDAA 3M53A 1B34B 2QGFB 1NPPA 4XTVA 1I5LA 4QKUA 2RHZA 2P4RA 3CCSQ 2AZSA 2ROLA 5CCAA 3KXTA 1VQ4A 4BB7A 5I22A 1RI9A 4JZ3A 4PLLA 5GMKj 1X43A 1VQ8Q 2X4XA 1V1CA 3OYLA 4BDZA 4BI4A 2AKKA 5IAYA 2GQIA 2KK4A 4M75C 1K73R 1U1TA 1YCSB 3FLGA 1C6VX 4PJOC 1UB4A 1UG1A 4M78C 4C5EA 1M3CA 4RUGA 1PKTA 1JB0E 1UGQB 3WXMB 2YUQA 2V1QA 3A5ZB 3M9QA 3S3MA 1AZEA 1NYFA 2EKOA 5CKFA 5FRMA 1HK9A 3GPLA 4IUQA 4OVAA 5C0MA 2A36A 1Y07A 2D6FA 4IUUA 3BW1A 2LP5A 5D6WA 4Y28E 1NLPC 3LW5E 1OX8A 4TVRA 3JCMd 1UJYA 2DTOA 4KGZB 5LJ3j 1YITT 4FW1A 1PWTA 1BIAA 4ESRA 5FU6B 2EVRA 1N9SA 1IREB 1K9MR 4M7AA 4X9CA 1IO6A 1WHJA 5KE2A 5AT1B 3JCMb 5GMKm 2A37A 1JBMA 2L3QA 1U3OA 2DL3A 1AOJA 2DA9A 3LWIA 2K57A 2QQAA 1CSKA 4JJBA 3VYHB 5GAN6 3GOXA 4J5YA 3HP9A 1RACB 1Y0MA 3VUBA 2GTOA 4OMPA 2QQSA 4WCIA 2KVQG 1RAEB 4ME7A 2PUOB 3FJ5A 4KULA 2DTIA 1DJ7B 5J26A 2MWPA 2DD5A 1VYUA 3CPWA 2JM9A 3OYAA 4HVUA 1QCNA 5HK3A 3M0QA 4N0AA 2L0AA 3LWHA 1M1KU 2FPEA 2FRWA 3CCLT 2E3IA 4N4HA 4FU6A 9ATCB 2L3RA 3I55A 4GLKA 2DYIA 2HMAA 1M30A 1ZQ1A 1OQKA 4JJCA 2PQWA 1M27C 2DILA 2RA2A 4J6XA 1ZBJA 2ESWA 2HL5C 2FB7A 2VC8A 4M7AE 3CPWS 3OYFA 1BB9A 5CO7A 4RTZA 1ARKA 4E7JA 1EZZB 1ZSZA 1NYGA 1K73C 1X2QA 3CD6Q 1YP5A 2EPDA 1KIKA 1R8OB 1PRLC 3FC3A 2XHCA 3CC7Q 2B86A 1LJOA 1AWOA 4ZGEB 4BDYA 2O01E 1YJWA 1Q81U 4FIBA 1K8AC 2YRDA 1T3LA 2XU8A 5KE3A 2HKNA 3VRYA 4E47A 2P0KA 1VQOQ 1VQPQ 2M9UA 5KYNA 2DBMA 3MHXA 4C8QC 1IGUA 1QVPA 5FU7B 1KHCA 4L59A 1MNDA 1I4K1 2QK0A 2W10A 3I5SA 3L2WA 4M7DA 3CCRA 3N5BB 3UA6A 3EGDA 2DL8A 4F16A 2CZ6B 1W2BA 1UGSB 1VQKT 2KT8A 2DKGA 3QKJA 1RLQC 2V1RA 3JCMf 3NPFA 3RMQA 5GANj 2L8DA 3F70A 3PIPA 2E41A 2PVOB 5L23A 3OYDA 1IXDA 3V8KA 1HSQA 4C92D 1K9MC 3QWYA 5EG2A 1BI3A 4HT9A 1N9RA 2LT1A 2CZ1B 2VV5A 2FVUA 5I2SA 1N5ZA 3G4SQ 3CCUT 3PIOA 5LJ5g 2P84A 2IPOB 4E7HA 1IRXA 4IURA 2DZCA 2SEMA 1D0ZA 4E6RA 5GAN7 3CCQQ 3OYGA 2EKHA 1NJIC 2GGRA 1W2BS 1G83A 2D0NA 2E64A 2J6KA 3QPHA 4Q5WA 1VQ7T 3NTKA 3M4YA 1WZOA 4MMKA 1Y7XA 1Q86R 1X69A 1VQNQ 2Y4YA 3UA7A 5CVIA 1PD0A 4AG2C 3M55A 1M90R 3UPUA 1KC8U 3RIRA 5A2QE 4Z02A 2JTEA 2QEXA 1J3TA 2BTTA 2KYBA 1RL2A 3TQ7P 2V8KA 2RMOA 1Y96A 4DOWA 2ZAEA 1Y71A 1B07A 1I07A 3TSZA 2QDLA 4MDXA 1N8RR 2DZ9A 4B9XA 3M0TA 1BI1A 3CBMA 1QVFA 2EJGA 2Z0WA 1LCKA 3TCJA 2AK5A 2HL3A 1D1BA 1Q7YU 1XNIA 3KUFA 2SRCA 2ROTA 3QDRB 3T9NA 1MMNA 1MHNA 5GAN2 2I0NA 3CCET 4JRPA 3L1AA 2J6FA 3HFOA 2CP0A 2K7AA 1QKWA 3CCVT 3CC4A 1K9AA 3ZFJA 2YUPA 3LH5A 2D0QB 3KFVA 2RHYA 3DLLA 3JB9D 4C92C 1VIFA 1QVFS 4CC7A 1FXXA 2DL7A 4DBFA 2XKOC 5LJ5d 4D6WA 2E10A 4M7DG 5GMKl 4WF2A 3QWXX 4HCKA 4KUIA 1VQLQ 4A4HA 1AZGB 1NEBA 2XICA 1WFWA 3CQTA 5KYUA 3PTAA 1SHFA 4IUTA 2OJ2A 1OV3A 1U06A 3OYHA 4FYWB 5KYYA 2KEAA 1QQJA 4ORZA 3AT1B 2KT1A 4ANJA 2DNUA 1VQ4T 1UHCA 1PRMC 3CPWP 5CR2A 4N4GA 2O88A 1V76A 2DE0X 2RHUA 1IGQA 2CSIA 4XTYA 1ZBXA 5HKCA 3CMEQ 3OS1A 5A0DA 4L6V5 2YDLA 1G3WA 2O4XA 3HRSA 2V8JA 2ED0A 2LQWA 3SB2A 2DETA 4LDUA 2DPPB 2MOXA 5L8RE 1B7TA 3PGGA 3VS1A 1UEBA 1VYTA 2QQ9A 3G6EA 1Q86C 2L89A 2O2OA 3SHWA 3I9QA 2E3HA 3CC7A 4FYYB 4RKUE 5FWBA 2FZGB 4M7AB 1OPLA 1ZUUA 2DIGA 2VXEA 4RTYA 3D7SB 1YWOA 2EGAA 3M0SA 2D9TA 4N4IA 4QQGA 4NL3A 3TREA 3INZA 4M77D 3ULRB 3CCJQ 2DXTA 2QDYB 1SKUB 2E65A 3OYYA 3WVEB 2VWFA 2XK0A 4PFPA 1ZLMA 2E6NA 4EMKB 2PUKB 4EDUA 5GJWB 3DKMA 1WJRA 5CKBA 1GRIA 2WACA 3I56Q 1KK7A 2EFIA 3UF4A 4J9DA 3JCMh 4M75D 1M1KR 4E7ZA 2E5KA 1M1FA 2K5LA 2ZCFB 1W2BP 4PJOD 4J8OA 2QA4A 4GBQA 4C0ZA 3CXCA 3EG3A 3EGUA 1TH7A 2DM1A 5GMKe 4OP0A 1X6GA 2RPNA 1RUWA 1W1FA 3CCMQ 2KXDA 3EGXA 4GLMA 1PC0A 3OMGA 2FG0A 1WQ7A 2DEQA 2EGEA 3CMAQ 2PVGB 2DJQA 4FT2A 4BY6B 4KH1B 3O8VA 2K3XA 3RKXA 5FRNA 1UJ0A 1PD1A 4IUPA 1U1SA 4M7AF 3G71Q 2G6FX 3I55T 2FZKB 3OS2A 1M2VA 3X20B 1ZSZB 1OZ3A 2JT4A 2QAZA 1G3TA 1VUBA 5FLXE 3RR6A 2DJZA 1PKSA 4ZTFA 6AT1B 2L2PA 5LJ3e 1WHKA 1BBZA 2MMPA 3ZBDA 3OYCA 2DTHA 1TXQA 5D6XA 1S72A 4JRQA 3RESA 1Q82U 5DLOA 2OTJA 4OB1B 2ZPFB 3C4SA 2XD0A 5LJ5j 4M77C 2HZYA 4LDWA 4M7DB 3SWNA 5M9OA 4XTXA 3V7RA 3OYMA 1YJWT 1QVFP 3VS6A 2RB6A 1UDLA 2L3SA 3MP8A 1YIJQ 2CYZB 2RJEA 2O9VA 4KT0E 3L2VA 5GAMj 2W0ZA 2LCCA 3M57A 4LD6A 1QP2A 1QW1A 4X9DA 3FEOA 2HNIA 5IH2A 4Z89A 4BD3A 2CH4A 3CCRT 4ATOA 7AT1B 5LL6S 3ZEHA 4LNPA 2AKLA 1QMCA 3O5ZA 1D0YA 4RCCA 1K8AR 3C0CA 3V7CA 1QP3A 1AWJA 1XJWB 1YITQ 1GFCA 4NL2A 4LE9A 1VQ9A 1RLPC 4EIKA 4QQ6A 4ZTJA 3M0RA 1S1NA 1TG0A 1JO8A 1BYMA 1C1AA 4AFQC 1KD1U 1WXBA 1X75C 3JB9J 2EYXA 1RAAB 1KC8R 1BIBA 5I2MA 1LVKA 2YT6A 1G8XA 4M77A 1JQQA 4HCCA 4OMQA 1NE8A 5HK0A 1JXMA 1UGRB 3PVLA 3OYIA 3MPUB 5CIUA 3H0IA 3JCMW 1M1KC 1WX6A 2F2WA 2MWOA 3CPFA 1YJNA 3JCMQ 3QG1A 2YXYA 1T3SA 2M02A 2CUDA 3EFSA 3MEAA 3BDLA 2DO3A 2M16A 4FW2A 2COYA 3JCMV 2YWWA 4M7DF 2EJFA 2LQNA 4C8QD 3MEUA 4M75A 4LDYA 3CBOA 4PJOA 5DY9A 2DEUA 1WA7A 5IT9E 2LRQA 4NOYA 1Q95G 1NJIR 1SSFA 2QEXT 4M78A 1VQMA 2KDSA 3EG9A 4RG2A 1W6XA 2VASA 3CCLQ 2GF7A 2MIOA 4XTWA 1ZA1B 2K5IA 3JB9G 2OTLA 3LH0A 5J3BA 3NTHA 2KAFA 1O75A 2AHJB 1SRLA 1Q81C 3HFNA 3E19A 2RI3A 5KCOA 4A54A 2MAMA 4LDXA 1CKBA 1LOJA 1YJ9A 2D1XA 3S6WA 2DERA 4LUEA 3V7SA 5GANe 2CSQA 2LVMA 5KYWA 1TOVA 1BCMA 2PTKA 3H6ZA 2A08A 3I56A 2E4HA 3CC4T 2AIRB 3URGA 3JV3A 2KQWA 4ZNXA 2IIMA 3OYKA 1LNXA 2RH2A 2QQRA 1YI2A 3L2RA 4MZPA 1YHQA 2DRMA 1O9SA 4CRIA 3VS3A 2XMFA 4BE0A 3G7ZA 1TU0B 3RDVA 1JJ2A 4V2SA 3R6NA 1NZ9A 3BDUA 2CDTA 3CXCP 1N27A 2LX9A 2L5QA 1VOMA 4M78E 5CK9A 1VQKQ 4OMFB 4KUDK 3MKDA 2M0YA 4CC4B 3EFOB 2YUNA 5A0GA 3GNGA 2HAXA 2MF2A 5LJ5h 4EMGA 1FMKA 3RERA 1QWEA 1VQ6T 2FRYA 3UT1A 3TEEA 1B3QA 1UUEA 4M77G 3M4GA 2C0TA 1UHFA 2DK3A 3CCUQ 4C0DB 2GNCA 1KC8C 4DOVA 2BE7D 1UGVA 3U23A 4WTOB 5GAMh 2X4WA 3GBQA 1IZ6A 2J7IA 3JAME 4MDWA 3RUXA 4A4FA 2YHTA 5HY6A 2NUPA 1VQ7Q 2OI3A 1ACMB 1VA7A 1GCQC 3X25B 1C0MA 3G6ET 2RJDA 4M75G 2EAYA 3CC7T 2CUBA 4F7UG 4PJOG 2X35A 1SSHA 5FU6C 2LC4A 2R57A 3WVDB 3CCSA 4M78G 2OAWA 4JLIA 1Q7YC 1YIJA 1H3ZA 4O5VA 2LCSA 3VJPA 4XK8E 1JEGA 3SEMA 1VQ8A 3OW2A 2NYSA 4BI3A 3HKSA 2RI5A 2K3BA 3QIIA 3MJXA 2GFUA 4DEYA 4C8QA 3QXEB 2HQHA 2EQJA 1WHGA 2CT4A 2LTOA 1K0SA 2K2MA 3EGXB 5FW9A 2GQVA 2MK5A 3MCAB 3REAB 2DVJA 1HYOA 2K2VA 2DMOA 2QA4T 5GAN4 4X34A 4MZTA 1FWZA 3CCEQ 4M7DE 1M3BA 3EG2A 1OU8A 2CS7A 1GCQA 3GP8A 3CCVQ 3SFMA 3OW2S 2CT3A 4E7IA 1M8MA 1M2VB 2KNBB 4A4KA 4JRKA 3OB9A 4PFZA 2LJ3A 3PT9A 5GMKi 1PG5B 4GY5A 2OAUA 3VRZA 2CZ7B 3L2UA 3QJYA 4X1VA 4C5GA 3EH2A 4QQDA 1SEMA 1WDXA 4RCBA 2F5KA 3HPWA 3M0UA 4DA4A 1M1GA 1QLYA 3TU4K 2CGHA 5FWCA 3C95A 3JB9H 2P0QA 2EQMA 2CH4W 1AVZC 2ZPGB 2LZ6B 5LJ3g 3SWNB 1KJWA 1QVGA 3QUIA 3CCLA 1M9SA 1VQ4Q 4II1A 2WSEE 3FIFA 3X28B 4Z8AA 5KCHA 4LXCA 4MMLA 1VQ5T 1WXUA 1S72T 2OTJT 1NG2A 3MEWA 2RJFA 4OMLA 3OSSC 5GAOm 4XU0A 2RO0A 2ZPBB 2GTJA 4YTLA 5GAOn 1BK2A 1VYVA 3LYIA 2LNVA 5HCKA 3QBYA 4HCZA 5GAN3 3ER0A 5IN1A 1WXTA 1OOTA 2FHDA 3JCMc 2KR3A 3NMZC 1WYXA 3PMIA 4JRIA 3A8HB 3P8DA 4D8KA 3REBB 2ED1A 4OB2B 3A1PA 3CC2Q 1G3SA 1HD3A 3LX7A 1D09B 2F1LA 2O31A 1PSFA 4F04B 1CKAA 3META 1SF9A 1R77A 1U8RA 2RJCA 1GFDA 3JCMJ 2HD0A 2DVEA 3ME9A 4M77B 3FB9A 4A63B 1MGQA 2DRKA 1VQ9T 2KBTA 1D1AA 4QVZA 1KQ2A 4C8QG 4EMHA 4C92A 1K1ZA 2RQTA 1K4US 1X6BA 3CD6A 2KGTA 5ECAA 4LN2A 4OB0B 1IHWA 4DBHA 1JJ2P 1D3BA 2DYBA 2BUDA 3A8MB 1TS9A 3DLMA 4M75B 1VQOA 1VQPA 4PJOB 2EGCA 3TVTA 1BI0A 5GAOp 1YJNT 4M78B 2JNGA 4E7KA 1H8KA 3EG9B 3L2QA 2GCXA 3CCUA 3VS5A 1KG1A 3M56A 3RBBB 1WHMA 5LJ3d 4DBRA 2BZXA 1BCOA 4JPBW 5LJ5e 2E1HA 3E1SA 3E9FA 1OPKA 1PHTA 1WHLA 5A0LA 1ABOA 2K79A 2O9SA 4RTWA 1ZUYA 2YLCA 2CP7A 2NUTA 4J6YA 2V26A 1JU5C 4KGXB 1VQMT 1MUZA 3EHQA 3VUZA 2ECZA 1OX9A 1AWWA 1Q82C 1AD5A 5GAMe 2VXFA 1H3HA 3I55Q 3G4SA 1M2OA 2QI2A 3VS0A 3L2ZA 4F14A 4M7AD 5KYWB 1NBEB 4DBQA 2CZ0B 2R58A 3H9NA 2OTLT 1MV3A 4A4EA 3CCQA 2XDDA 2NUZA 3OS0A 2KY9A 2DXBA 3H0FA 1KQSA 4C92E 1T0HA 2BIVA 2DAQA 3MP6A 1HXDA 5GANg 1TSFA 3M58A 5GAOr 1YJ9T 3R6OA 2HQEA 1Y57A 1VQNA 4FT4A 4CC2A 4M4ZA 4QVCA 2LNHB 2HBWA 3JB9I 5DM7R 1KFZA 2QQBA 3OSVA 2PNIA 5IHNA 2EYWA 1MMAA 2XDPA 3OW2P 2MCNA 1M90U 4J9EA 2H8HA 1M3AA 3CXCS 2PU9B 1RAIB 2RD1A 1Q81R 3GF5A 3G1JA 1YJWQ 1YI2T 2X3XD 1NPRA 2XG8D 4M78F 1ZHIA 4XTUA 4C0GA 1YHQT 4EPCA 1SG5A 2JTMA 3IQLA 3P8BB 2BKDN 3X26B 4ZN3A 1N8RU 4HXJA 4D8DA 2EQKA 2RQVA 1FX7A 4XU3A 4Y91A 1KD1C 3OYEA 2JOYA 3A98A 3ASKA 3EG0A 2ZPHB 4JJNK 2X3WD 1VIEA 1LPLA 4OMMA 1R0CB 2DXUA 8ATCB 1H641 2M51A 3EGDB 4C92G 2EW3A 2QXFA 2DFUA 3OQ5A 4HKEA 4AFSC 4J7FA 2HBPA 1WI7A 2COWA 2X4JA 4FM4B 3JCMP 4OGCA 1YN8A 2EQIA 1YBYA 2E6ZA 2NLUA 5IHKA 1TWBA 3RKWA 3GIBA 2NUPB 2KMTA 4OB3B 2LDMA 3AHUA 4NS5A 2R5AA 2VUBA 1AHJB 1IB8A 1PCXA 3NTIA 2JJ9A 2RQWA 1WJSA 2QG9B 2HEQA 4XAXB 5I11A 2E5QA 4M7AC 1JXOA 4A53A 2HSEB 3HRTA 1M8VA 1QVGP 1FYNA 3J7AF 3BE3A 1HJDA 4JS5A 1VQLA 2J05A 1OYXA 2KRSA 1BI2A 2LQ8A 1OEBA 4JJDA 4XTZA 5KYXA 2F5TX 2LX7A 2EWNA 2ZPEB 4M7DD 4C8QB 3GLXA 5LJ3f 5GANd 1BU1A 2H3JA 3CCST 2EYQA 4EMKC 3OYBA 1PM3A 1YIJT 2IVWA 4AMCA 5EC7A 2QEXQ 3H0HA 1Z9ZA 3JCMX 4AG1C 1QWFA 4JLGA 3CC2A 1VQ8T 2YRCA 5GAOl 3J80E 2E70A 1Y96B 1AT1B 3CMEA 2KROA 2LT4A 3OBYA 4LD9K 2C06A 4N0AC 1UGPB 4E7SA 3PVQA 2D8JA 4OF1A 2X51A 4F7UA 1EIFA 1Q7YR 2HQXA 3QZ5B 2JZ2A 5C6SA 3QO3A 1YWPA 2WSCE 1GL5A 1I0CA 2ZZDA 4RTXA 1EX4A 1X6OA 1TTHB 2K4YA 2FPFA 3A8GB 3QDFA 1OULA 2EBPA 1UECA 2EYZA 4BY6C 1OZ2A 1U5SA 3PMTA 3CC4Q 4BI8B 3PFSA 4PL6A 3CCJA 2LJ1A 4QVDA 4ZGDB 4R55A 2J06A 4EMKA 1ZSZC 2RQRA 2F2VA 2FO0A 2ZGWA 4C8QF 3Q1JA 2KYMA 1G2BA 1XQHA 4QT7A 1T0JA 4RTVA 4M77E 3EAEA 2HCKA 4BACA 1OU9A 3OBWA 5CAIA 2JMCA 4LUDA 1WIEA 2XIDA 1GCPA 4HCBA 2JUFA 2K9GA 1NLOC 3NFCA 4RTTA 2JS2A 5KYUB 4C5IA 2G3RA 4J9CA 5GAOq 4KGVB 1JRIA 3L42A 5KYYB 1I81A 4RTUA 1QCOA 4M7DC 5GJVB 2DXCA 2JTFA 4FYXB 1VQ6Q 3JCMe 2MYSA 3CCMA 2CP2A 4M75E 2MI6A 4F7UE 4ELYC 4PJOE 2K6DA 3QSUA 2F2XA 3CMAA 2EQUA 2X4YA 2DX1A 4FYVB 2GFAA 1TUGB 2O4XB 4J7IA 3C12A 3BY7A 1ABQA 4L5GA 1KQSP 3RNJA 3G71A 3I5RA 1WGSA 4C92B 3G6EQ 4DQ2A 1V29B 2RF0A 3QZ9B 3THKA 1X2KA 1RADB 4A4GA 1KSWA 5D6YA 1JJ2S 2LJ0A 4E7LA 1D3BB 4IKFA 1MMGA 2LMJA 3QHSA 5GANf 2H3EB 3LLRA 3M0PA 5CKHA 3DB4A 5CKDA 1SHGA 2X9HA 1MV0B 2RK2A 2YLBA 5IHIA 3H8ZA 5D7UA 1B34A 3CD6T 3GNFB 4B6MA 4R56A 1WQWA 4UC4A 5GMKh 2DIQA 2RNAA 4ZN1A 1GBRA 3QYGB 1QKXA 2ZPIB 1M5Q1 1VQOT 4M7AG 1VQPT 2QTXA 1UTIA 2PZ1A 4RG8A 2AZVA 2NUTB 2QA4Q 3NGPA 2EYYA 3RMSA 5FROA 4P5NA 4XQ3A 2RHXA 2FEIA 4PJLA 3UWNA 1K73U 2DL4A 1XOVA 4AFUC 1E6GA 4XU1A 3OMCA 2IG0A 2E12A
chains in the Genus database with same CATH topology
3ME9A 2KVQG 4M77B 5D6XA 1S72A 4JRQA 3FB9A 1MGQA 3RESA 1Q82U 5DLOA 4ME7A 2OTJA 1K8AU 4OB1B 1VQ9T 4BUGA 2PUOB 1YITA 2ZPFB 4KULA 2DTIA 3C4SA 4QVZA 3A8LB 1KQ2A 1DJ7B 4C8QG 2V8IA 5J26A 2MWPA 4C92A 4EMHA 2DD5A 5LJ5j 4M77C 3OYAA 3CPWA 5HK3A 4LDWA 5GAMg 4N0AA 3CD6A 4M7DB 2JN0A 4C92F 4OB0B 3SWNA 2P4TA 5M9OA 3LWHA 2B8AA 1M1KU 4XTXA 3V7RA 3OYMA 1YJWT 3PNWC 3CCLT 1D3BA 4N4HA 2BUDA 2RB6A 3A8MB 4FU6A 3G4ST 2L3RA 5LJ3h 3MP8A 3I55A 3CEYA 3DLMA 4GLKA 3KBGA 3M54A 3MEVA 2CYZB 2RJEA 2EJ9A 4KT0E 4M75B 1ZQ1A 1VQOA 3L2VA 5GAMj 2LCCA 3M57A 4LD6A 1VQPA 1QP2A 1QW1A 4X9DA 4PJOB 3CCQT 3FEOA 1BI0A 1M4ZA 2HNIA 5GAOp 1YJNT 3MP1A 3FRNA 4M78B 2JNGA 4E7KA 2PQWA 1G5VA 4BD3A 1P92A 2RA2A 4RMOA 2LCLA 3L2QA 2M1HA 2GCXA 4J6XA 3CCUA 1X01A 3OMCA 3OA6A 4JDSA 3CCRT 3M56A 4CI0C 4ATOA 1KG1A 5LL6S 4LDVA 3ZEHA 5LJ3d 3OYNA 2FB7A 1VQNT 2VC8A 4J83A 4M7AE 3JRZA 1K9MU 5LJ5e 4RCCA 2E1HA 2FL7A 3E1SA 3E9FA 1QP3A 3V7CA 3VKIA 3OYFA 3CPWS 5A0LA 5CO7A 4NL2A 4OGEA 1VQ9A 1KHIA 3HHTB 3X24B 4E7JA 4QQ6A 4ZTJA 3HRUA 2YLCA 2F69A 3QYHB 1K73C 3C94A 3V8JA 4J6YA 1BYMA 1R8OB 3FC3A 1VQMT 2XHCA 1NJIU 1LJOA 1KD1U 3VUZA 4ZGEB 4BDYA 2O01E 1YJWA 1Q81U 1Q82C 4FIBA 1X75C 5GAMe 3JB9J 1K8AC 3MO8A 2VXFA 2XU8A 3G4SA 1BIBA 5KE3A 2QI2A 5I2MA 3L2ZA 4E47A 4M7AD 2P0KA 4M77A 4C8QE 4HCCA 1NE8A 1WPYA 2CZ0B 2R58A 5HK0A 4C5HA 2M9UA 2OTLT 1UGRB 3MHXA 4C8QC 2Y4XA 3OYIA 4A4EA 3CCQA 1QVPA 5CIUA 2XDDA 3JCMW 5FU7B 3OS0A 1M1KC 1KHCA 2KY9A 2DXBA 2MWOA 2P0PA 3CPFA 3V8LA 1YJNA 4L59A 3JCMQ 3QG1A 1KQSA 3VV0A 2K5FA 1I4K1 4C92E 3EFSA 3SD4A 4M7DA 3L2WA 3MEAA 2BIVA 2DAQA 3BDLA 1HXDA 3MP6A 5GANg 3CCRA 1GXIE 3N5BB 2DO3A 2M16A 3M58A 5FU7C 5GAOr 3JCMV 3R6OA 1YJ9T 2HQEA 2CZ6B 3FJPA 4M7DF 1W2BA 1UGSB 1VQKT 3BFMA 3FDRA 1N6AA 4FT4A 1VQNA 4XU2A 4QVCA 1PSEA 2DKGA 2EJFA 3QKJA 3JB9I 3LGFA 5DM7R 4C8QD 2R5MA 2QQBA 3OSVA 4C0DC 4PLIA 3MEUA 2FYKA 4M75A 2XDPA 3UDCA 4BE1A 2XDBA 5CQXA 4LDYA 1M90U 1BKBA 3JCMf 3P8HA 3CBOA 4PJOA 3RMQA 5GANj 2L8DA 1QVGS 4ZGJB 5DY9A 3CXCS 2PU9B 3F70A 3PIPA 5IT9E 2LRQA 2E41A 2PVOB 4NOYA 1SSFA 2QEXT 4M78A 2RD1A 3OYDA 1VQMA 3GF5A 2KDSA 3V8KA 4C92D 1K9MC 5EG2A 1YI2T 1G3YA 1BI3A 2LQKA 3JSCA 4RG2A 2VGNA 1N9RA 1NPRA 2LT1A 2XG8D 1ZHIA 2CZ1B 2VV5A 2Y90A 4M78F 4XTUA 4C0GA 2FVUA 2GF7A 4XTWA 4EPCA 5CQYA 5I2SA 3CCUT 3PIOA 5LJ5g 2JTMA 5GAMd 5KH6A 3P8BB 2BKDN 3VU3C 3X26B 4E7HA 3HSBA 2K5IA 4IURA 4ZN3A 2DZCA 3JB9G 1N8RU 2I2LA 2OTLA 3LH0A 2EQKA 3NTHA 5J3BA 5GAN7 1FX7A 2KAFA 2PVDB 4ELZC 3OYGA 1O75A 2AHJB 3SDZA 1NJIC 1VQ6A 4XU3A 2DD4A 4Y91A 1KD1C 3OYEA 4MZMA 2JOYA 1Q81C 3ASKA 3E9GA 4PNOA 2ZPHB 1W2BS 3HFNA 3E19A 2E64A 2RI3A 4JJNK 5KCOA 4Q5WA 3QPHA 4A54A 1VQ7T 1VQLT 1VIEA 3NTKA 3M4YA 2MAMA 2WSFE 4MMKA 1Y7XA 4LDXA 1LOJA 1YJ9A 2DXUA 3M5AA 3S6WA 1H641 2VYTA 2Y4YA 2CKKA 1VQKA 3HL8A 1OI1A 3V7SA 1W4SA 4FSXA 5GANe 4HT9A 4BE2A 4C92G 2QXFA 5CVIA 3OQ5A 4FL6A 3M55A 4HKEA 2LVMA 4J7FA 1RI0A 2HBPA 4B9WA 3UPUA 2X4JA 1KC8U 3CBPA 4FM4B 3JCMP 3H6ZA 4JS4A 3RIRA 3I56A 4OGCA 4F7UB 5A2QE 1YBYA 2E6ZA 2NLUA 3URGA 3RKWA 3CC4T 2KQWA 4Z02A 3GIBA 2QEXA 2KMTA 4OB3B 3OYKA 2LDMA 3RKYA 2VGMA 3AHUA 1LNXA 2RH2A 2QQRA 1RL2A 4NS5A 3CC2T 1YI2A 2R5AA 2V8KA 4PKCC 1Y96A 3L2RA 2VUBA 3M59A 4MZPA 4DOWA 1YHQA 1AHJB 1Y71A 3NTIA 1O9SA 3CMET 1M90C 4CRIA 1WJSA 4MDXA 2DZ9A 4B9XA 4BE0A 4XAXB 1BI1A 5GANh 3OS5A 3G7ZA 3LGLA 2E5QA 1JJ2A 4V2SA 4M7AC 3CBMA 1QVFA 2EJGA 4QW2A 4A53A 3OY9A 3TCJA 2JVVA 1NZ9A 3BDUA 3HRTA 1M8VA 3J7AF 5I21A 4JS5A 1Q7YU 5J39A 1I8FA 1VQ7A 1N27A 1OYXA 1VQLA 1BI2A 2LX9A 1XNIA 3KUFA 2LQ8A 4XTZA 5CKEA 2L5QA 2F5TX 4M78E 5CK9A 1N8RC 4HA8A 3QDRB 4OMFB 4KUDK 2XI9A 3T9NA 2EWNA 2ZPEB 4M7DD 1MHNA 4C8QB 3GLXA 5GAN2 5A0GA 5LJ3f 5GANd 3GNGA 3S3OA 3CCET 2H3JA 3QJ6A 4JRPA 2HAXA 3L1AA 4KBMB 3CCST 2EYQA 3HFOA 4EMKC 3OYBA 2MF2A 1YIJT 5LJ5h 4EMGA 2IVWA 4IUVA 3CCVT 3CC4A 3RERA 1VQ6T 3ZFJA 4M77F 3UT1A 3TEEA 3JCMX 2KSSA 4JLGA 3CC2A 3VYGA 3CCJT 1VQ8T 2D0QB 2RHYA 4M77G 3DLLA 3M4GA 5GAOl 3J80E 2DK3A 4M78D 2E70A 1Y96B 3JB9D 4C0DB 1KC8C 4C92C 1VIFA 4DOVA 3CMEA 1QVFS 2LT4A 3OBYA 1FXXA 2DTHA 3OYJA 1Q86U 2C06A 4LD9K 4N0AC 2K3YA 5GAMh 1UGPB 2XKOC 3SWNC 2X4WA 2RM4A 5LJ5d 1IZ6A 4D6WA 2E10A 4OF1A 4M7DG 3JAME 4MDWA 3RUXA 5GMKl 4WF2A 4F7UA 1EIFA 4A4FA 2HQXA 3QZ5B 2JZ2A 2YHTA 5C6SA 3QO3A 5HY6A 4KUIA 2WSCE 3I56T 4VUBA 4A4HA 4M75F 2XICA 2YRVA 4F7UF 2ZZDA 3X25B 4PJOF 3G6ET 3PTAA 4IUTA 1X6OA 2RJDA 2K4YA 4M75G 2EAYA 2RI2A 3A8GB 3CC7T 4F7UG 3OYHA 4PJOG 2X35A 5GAN5 1YCYA 3CCEA 3JCMg 5FU6C 3JB9F 2LC4A 2R57A 3WVDB 3CCSA 4M78G 5AYFA 4BY6C 1OZ2A 1VQ4T 2M0OA 4JLIA 5LJ5f 1Q7YC 1KQSS 1YIJA 3PMTA 5DLQE 1H3ZA 1WNLA 4BI8B 4O5VA 5CR2A 3CCVA 3EFRA 3PFSA 3A8OB 4PL6A 3VJPA 4XK8E 4N4GA 3CCMT 4J6WA 2RHUA 3CCJA 1VQ8A 4XTYA 1ZBXA 5HKCA 3OW2A 3J81E 4BI3A 4QVDA 3HKSA 2RI5A 4ZGDB 4R55A 4C0FA 3OS1A 3QIIA 4EMKA 5A0DA 4L6V5 3CMAT 2GFUA 1WJQA 2RK1A 1G3WA 4C8QA 2O4XA 3DB3A 3QXEB 3HRSA 2V8JA 5GAMf 2EQJA 1VQ5A 2ZGWA 3SB2A 4C8QF 3Q1JA 3S3NA 2LTOA 2A7YA 1XTDA 1XQHA 4LDUA 2DPPB 3G71T 4M77E 5L8RE 3EAEA 2EIFA 4BACA 2GQVA 4HT8A 5CAIA 3OBWA 3PGGA 4O6JA 1UEBA 3MCAB 2XIDA 4HCBA 4JUVA 5GAN8 2RHIA 2QQ9A 1KQ1A 2A3LA 2JUFA 3G6EA 2L89A 1Q86C 2K2VA 3NFCA 3M53A 1B34B 2QA4T 1NPPA 4C5IA 3CC7A 2G3RA 5GAN4 4XTVA 4RKUE 4MZTA 4X34A 5GAOq 1I5LA 1FWZA 1JRIA 4M7AB 4M7DE 2RHZA 3L42A 2DIGA 2VXEA 3KXTA 5CCAA 1I81A 1VQ4A 4M7DC 2CS7A 4BB7A 2D9TA 2DXCA 2JTFA 3GP8A 3SFMA 3OW2S 3JCMe 4N4IA 4QQGA 4E7IA 4A4KA 4NL3A 3TREA 3INZA 4JRKA 4M77D 3OB9A 4PLLA 5GMKj 3CCMA 2DXTA 2QDYB 2X4XA 4M75E 2MI6A 2E65A 3PT9A 3OYYA 4BI4A 3OYLA 4F7UE 4ELYC 5IAYA 4BDZA 5GMKi 4GY5A 2KK4A 4PJOE 3QSUA 4M75C 2OAUA 1U1TA 3FLGA 3WVEB 2XD0A 4PJOC 2CZ7B 2XK0A 3QJYA 3L2UA 3CMAA 2E6NA 2EQUA 4EMKB 1UB4A 2X4YA 2PUKB 2GFAA 4EDUA 4C5GA 3DKMA 4M78C 2O4XB 4J7IA 3C12A 1WJRA 4QQDA 3BY7A 5CKBA 4C5EA 1JB0E 1UGQB 3WXMB 4L5GA 4RCBA 2WACA 2F5KA 3G71A 3A5ZB 3HPWA 3M9QA 1M1GA 2EFIA 4DA4A 3TU4K 3S3MA 2CGHA 3JCMh 2EKOA 5CKFA 5FRMA 1WGSA 3C95A 1HK9A 4C92B 4M75D 3JB9H 2P0QA 4DQ2A 1V29B 2EQMA 3QZ9B 1M1FA 2K5LA 2ZCFB 3GPLA 4PJOD 2ZPGB 4IUQA 4J8OA 2QA4A 5LJ3g 4A4GA 3SWNB 4C0ZA 4OVAA 1QVGA 5C0MA 3QUIA 3CXCA 3CCLA 1Y07A 5D6YA 1JJ2S 1M9SA 1TH7A 4E7LA 2D6FA 4II1A 5GMKe 2WSEE 1D3BB 4IKFA 4OP0A 3FIFA 3QHSA 4IUUA 3X28B 5GANf 3BW1A 5KCHA 4MMLA 1VQ5T 3LLRA 5D6WA 4Y28E 3LW5E 1S72T 5CKHA 3DB4A 4TVRA 5CKDA 3JCMd 2DTOA 2OTJT 5LJ3j 1YITT 2RK2A 2YLBA 3MEWA 2RJFA 3OSSC 5GAOm 3OMGA 3H8ZA 1BIAA 4XU0A 2RO0A 2ZPBB 4YTLA 1WQ7A 2DEQA 5FU6B 2PVGB 1N9SA 4FT2A 1B34A 3CD6T 4BY6B 5GAOn 1IREB 3O8VA 4M7AA 3LYIA 3OYCA 2K3XA 3RKXA 5FRNA 3GNFB 2LNVA 4X9CA 4R56A 3QBYA 4HCZA 5GAN3 3ER0A 4IUPA 5IN1A 5KE2A 1WQWA 1U1SA 4UC4A 5GMKh 4M7AF 2FHDA 2DIQA 4ZN1A 5GMKm 3JCMb 3I55T 3JCMc 3OS2A 1JBMA 3QYGB 2ZPIB 1M5Q1 3PMIA 4JRIA 3A8HB 1VQOT 3P8DA 3X20B 1YHQT 4M7AG 1VQPT 2QTXA 4OB2B 4RG8A 3LWIA 1G3SA 1OZ3A 2K57A 2QQAA 3LX7A 3VYHB 3RMSA 5FROA 1G3TA 1VUBA 4P5NA 5FLXE 5GAN6 3GOXA 4XQ3A 1PSFA 4J5YA 2DJZA 2RHXA 3META 4ZTFA 3UWNA 1U8RA 2RJCA 3HP9A 1K73U 1XOVA 5LJ3e 3VUBA 3JCMJ 2HD0A 4XU1A 2MMPA 3ZBDA 2DVEA 2QQSA 2IG0A 2E12A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MDW A; 
#chains in the Genus database with same CATH topology
 3PE0 A;  2FZC B;  1K8A U;  4BUG A;  1YIT A;  4E2F B;  3A8L B;  2DBK A;  2HSP A;  2V8I A;  5GAM g;  2C0O A;  2JN0 A;  4FCY A;  4C92 F;  1FMW A;  2P4T A;  2B8A A;  2JS0 A;  1ZSG A;  3PNW C;  4AFZ C;  3G4S T;  2JXB A;  5LJ3 h;  3CEY A;  3KBG A;  3M54 A;  2CP3 A;  3MEV A;  3NHN A;  2EJ9 A;  1X27 A;  2KE9 A;  3UAT A;  3CCQ T;  1M4Z A;  3MP1 A;  3FRN A;  1A0N B;  1AWX A;  1G5V A;  1P92 A;  4RMO A;  2LCL A;  2M1H A;  4J9I A;  1X01 A;  1RAF B;  1RAB B;  4JDS A;  2QAS A;  3OA6 A;  4CI0 C;  4LDV A;  3E2U A;  8AT1 B;  1VQ5 Q;  2JM8 A;  3OYN A;  1VQN T;  1Q82 R;  4J83 A;  1S72 Q;  4Y92 A;  3JRZ A;  1K9M U;  1UFF A;  2FL7 A;  1ZX6 A;  2OTJ Q;  3VKI A;  4JZ4 A;  1WHH A;  4OGE A;  4PJJ A;  1KHI A;  3HHT B;  3X24 B;  3HRU A;  2F69 A;  3QYH B;  3C94 A;  3V8J A;  4AT1 B;  1ZA2 B;  4PJM A;  1NJI U;  2MPX C;  2L3P A;  2CP5 A;  2A0F B;  4DEX A;  2DF6 A;  3MO8 A;  1NEG A;  4C8Q E;  4J9B A;  1WPY A;  4J9G A;  4C5H A;  4HVW A;  2GBQ A;  4KH0 B;  2Y4X A;  1I5O B;  1ZUK A;  3V8L A;  2P0P A;  1W70 A;  1UE9 A;  2AT1 B;  3VV0 A;  1FMV A;  2K5F A;  3TSW A;  3SD4 A;  1I1J A;  1GXI E;  4K11 A;  5FU7 C;  3ZL7 C;  3FJP A;  4CC3 A;  3BFM A;  3EG1 A;  3FDR A;  1N6A A;  1K0X A;  4XU2 A;  1PSE A;  3LGF A;  1VQ9 Q;  2R5M A;  4C0D C;  4PLI A;  2FYK A;  3UDC A;  4BE1 A;  2XDB A;  2DLP A;  5CQX A;  3EHR A;  1BKB A;  3P8H A;  2D8H A;  1QVG S;  4ZGJ B;  3VS2 A;  1KD1 R;  3JSC A;  1G3Y A;  2LQK A;  5KYX B;  2VGN A;  2Y90 A;  3JB9 F;  5CQY A;  1E6H A;  5GAM d;  5KH6 A;  3VU3 C;  1MNE A;  2ABL A;  1PNJ A;  2I2L A;  4IIO A;  4ELZ C;  1VQ6 A;  2PVD B;  3SDZ A;  1YJN Q;  2DD4 A;  3EH1 A;  4MZM A;  3E9G A;  4PNO A;  2HKQ B;  2C0I A;  1VQL T;  1MMD A;  2COZ A;  2WSF E;  1H92 A;  4J9H A;  3M5A A;  2VYT A;  3EFO A;  2CKK A;  1VQK A;  3HL8 A;  1OI1 A;  3VS4 A;  1W4S A;  4FSX A;  4BE2 A;  1YFN A;  4FL6 A;  2FPD A;  4OMO A;  1RI0 A;  4B9W A;  2KI7 A;  3CBP A;  4Z88 A;  4JS4 A;  4J9F A;  4F7U B;  2A28 A;  1VQM Q;  3RKY A;  2VGM A;  1D0X A;  3CC2 T;  2VKN A;  4PKC C;  3M59 A;  3I35 A;  3CME T;  1M90 C;  1RAH B;  1TUD A;  4HVV A;  2BZY A;  2OTL Q;  1K76 A;  2JW4 A;  2DL5 A;  5GAN h;  3OS5 A;  3LGL A;  4QW2 A;  3OY9 A;  2JVV A;  2VB6 A;  2KRN A;  5I21 A;  1Z9Q A;  5J39 A;  1I8F A;  1VQ7 A;  1YJ9 Q;  1RAG B;  5CKE A;  4KRT A;  1N8R C;  4HA8 A;  2XI9 A;  1F1B B;  3VS7 A;  2JMA A;  3S3O A;  3QJ6 A;  4R0K A;  4KBM B;  1IHV A;  1WLP B;  1SRM A;  2RN8 A;  4IUV A;  4F17 A;  4M77 F;  2KSS A;  1YI2 Q;  2BZ8 A;  3VYG A;  3CCJ T;  4FSS A;  1YHQ Q;  4PFO A;  2OX7 A;  4M78 D;  4OMN A;  5IXF A;  3HTR A;  1EFN A;  3OYJ A;  1Q86 U;  4IIM A;  2K3Y A;  3SWN C;  1AEY A;  2QGG A;  2RM4 A;  3HSB A;  3I56 T;  4VUB A;  4M75 F;  2YRV A;  4F7U F;  4PJO F;  2ATC B;  2RI2 A;  2NWM A;  4PJN A;  1NM7 A;  2YUO A;  1D1C A;  4PK4 A;  5GAN 5;  1YCY A;  3CCE A;  3JCM g;  1YNZ A;  2QYZ A;  5AYF A;  2ENM A;  2M0O A;  1R0B G;  5LJ5 f;  1KQS S;  5DLQ E;  1WNL A;  3CCV A;  3EFR A;  3A8O B;  2CP6 A;  1SPK A;  3CCM T;  4J6W A;  2J6O A;  2KRM A;  3J81 E;  3H41 A;  3CCR Q;  4C0F A;  3CMA T;  1WJQ A;  2RK1 A;  2RQU A;  3DB3 A;  1GBQ A;  5GAM f;  1VQ5 A;  3S3N A;  2YSQ A;  2A7Y A;  1XTD A;  1E7O A;  1TUC A;  2VVK A;  2CRE A;  2QTV A;  3G71 T;  2KXC A;  2EIF A;  4HT8 A;  4O6J A;  2BE9 B;  4JUV A;  5GAN 8;  2RHI A;  5IXB A;  1KQ1 A;  2A3L A;  1QCF A;  2HDA A;  3M53 A;  1B34 B;  2QGF B;  1NPP A;  4XTV A;  1I5L A;  4QKU A;  2RHZ A;  2P4R A;  3CCS Q;  2AZS A;  2ROL A;  5CCA A;  3KXT A;  1VQ4 A;  4BB7 A;  5I22 A;  1RI9 A;  4JZ3 A;  4PLL A;  5GMK j;  1X43 A;  1VQ8 Q;  2X4X A;  1V1C A;  3OYL A;  4BDZ A;  4BI4 A;  2AKK A;  5IAY A;  2GQI A;  2KK4 A;  4M75 C;  1K73 R;  1U1T A;  1YCS B;  3FLG A;  1C6V X;  4PJO C;  1UB4 A;  1UG1 A;  4M78 C;  4C5E A;  1M3C A;  4RUG A;  1PKT A;  1JB0 E;  1UGQ B;  3WXM B;  2YUQ A;  2V1Q A;  3A5Z B;  3M9Q A;  3S3M A;  1AZE A;  1NYF A;  2EKO A;  5CKF A;  5FRM A;  1HK9 A;  3GPL A;  4IUQ A;  4OVA A;  5C0M A;  2A36 A;  1Y07 A;  2D6F A;  4IUU A;  3BW1 A;  2LP5 A;  5D6W A;  4Y28 E;  1NLP C;  3LW5 E;  1OX8 A;  4TVR A;  3JCM d;  1UJY A;  2DTO A;  4KGZ B;  5LJ3 j;  1YIT T;  4FW1 A;  1PWT A;  1BIA A;  4ESR A;  5FU6 B;  2EVR A;  1N9S A;  1IRE B;  1K9M R;  4M7A A;  4X9C A;  1IO6 A;  1WHJ A;  5KE2 A;  5AT1 B;  3JCM b;  5GMK m;  2A37 A;  1JBM A;  2L3Q A;  1U3O A;  2DL3 A;  1AOJ A;  2DA9 A;  3LWI A;  2K57 A;  2QQA A;  1CSK A;  4JJB A;  3VYH B;  5GAN 6;  3GOX A;  4J5Y A;  3HP9 A;  1RAC B;  1Y0M A;  3VUB A;  2GTO A;  4OMP A;  2QQS A;  4WCI A;  2KVQ G;  1RAE B;  4ME7 A;  2PUO B;  3FJ5 A;  4KUL A;  2DTI A;  1DJ7 B;  5J26 A;  2MWP A;  2DD5 A;  1VYU A;  3CPW A;  2JM9 A;  3OYA A;  4HVU A;  1QCN A;  5HK3 A;  3M0Q A;  4N0A A;  2L0A A;  3LWH A;  1M1K U;  2FPE A;  2FRW A;  3CCL T;  2E3I A;  4N4H A;  4FU6 A;  9ATC B;  2L3R A;  3I55 A;  4GLK A;  2DYI A;  2HMA A;  1M30 A;  1ZQ1 A;  1OQK A;  4JJC A;  2PQW A;  1M27 C;  2DIL A;  2RA2 A;  4J6X A;  1ZBJ A;  2ESW A;  2HL5 C;  2FB7 A;  2VC8 A;  4M7A E;  3CPW S;  3OYF A;  1BB9 A;  5CO7 A;  4RTZ A;  1ARK A;  4E7J A;  1EZZ B;  1ZSZ A;  1NYG A;  1K73 C;  1X2Q A;  3CD6 Q;  1YP5 A;  2EPD A;  1KIK A;  1R8O B;  1PRL C;  3FC3 A;  2XHC A;  3CC7 Q;  2B86 A;  1LJO A;  1AWO A;  4ZGE B;  4BDY A;  2O01 E;  1YJW A;  1Q81 U;  4FIB A;  1K8A C;  2YRD A;  1T3L A;  2XU8 A;  5KE3 A;  2HKN A;  3VRY A;  4E47 A;  2P0K A;  1VQO Q;  1VQP Q;  2M9U A;  5KYN A;  2DBM A;  3MHX A;  4C8Q C;  1IGU A;  1QVP A;  5FU7 B;  1KHC A;  4L59 A;  1MND A;  1I4K 1;  2QK0 A;  2W10 A;  3I5S A;  3L2W A;  4M7D A;  3CCR A;  3N5B B;  3UA6 A;  3EGD A;  2DL8 A;  4F16 A;  2CZ6 B;  1W2B A;  1UGS B;  1VQK T;  2KT8 A;  2DKG A;  3QKJ A;  1RLQ C;  2V1R A;  3JCM f;  3NPF A;  3RMQ A;  5GAN j;  2L8D A;  3F70 A;  3PIP A;  2E41 A;  2PVO B;  5L23 A;  3OYD A;  1IXD A;  3V8K A;  1HSQ A;  4C92 D;  1K9M C;  3QWY A;  5EG2 A;  1BI3 A;  4HT9 A;  1N9R A;  2LT1 A;  2CZ1 B;  2VV5 A;  2FVU A;  5I2S A;  1N5Z A;  3G4S Q;  3CCU T;  3PIO A;  5LJ5 g;  2P84 A;  2IPO B;  4E7H A;  1IRX A;  4IUR A;  2DZC A;  2SEM A;  1D0Z A;  4E6R A;  5GAN 7;  3CCQ Q;  3OYG A;  2EKH A;  1NJI C;  2GGR A;  1W2B S;  1G83 A;  2D0N A;  2E64 A;  2J6K A;  3QPH A;  4Q5W A;  1VQ7 T;  3NTK A;  3M4Y A;  1WZO A;  4MMK A;  1Y7X A;  1Q86 R;  1X69 A;  1VQN Q;  2Y4Y A;  3UA7 A;  5CVI A;  1PD0 A;  4AG2 C;  3M55 A;  1M90 R;  3UPU A;  1KC8 U;  3RIR A;  5A2Q E;  4Z02 A;  2JTE A;  2QEX A;  1J3T A;  2BTT A;  2KYB A;  1RL2 A;  3TQ7 P;  2V8K A;  2RMO A;  1Y96 A;  4DOW A;  2ZAE A;  1Y71 A;  1B07 A;  1I07 A;  3TSZ A;  2QDL A;  4MDX A;  1N8R R;  2DZ9 A;  4B9X A;  3M0T A;  1BI1 A;  3CBM A;  1QVF A;  2EJG A;  2Z0W A;  1LCK A;  3TCJ A;  2AK5 A;  2HL3 A;  1D1B A;  1Q7Y U;  1XNI A;  3KUF A;  2SRC A;  2ROT A;  3QDR B;  3T9N A;  1MMN A;  1MHN A;  5GAN 2;  2I0N A;  3CCE T;  4JRP A;  3L1A A;  2J6F A;  3HFO A;  2CP0 A;  2K7A A;  1QKW A;  3CCV T;  3CC4 A;  1K9A A;  3ZFJ A;  2YUP A;  3LH5 A;  2D0Q B;  3KFV A;  2RHY A;  3DLL A;  3JB9 D;  4C92 C;  1VIF A;  1QVF S;  4CC7 A;  1FXX A;  2DL7 A;  4DBF A;  2XKO C;  5LJ5 d;  4D6W A;  2E10 A;  4M7D G;  5GMK l;  4WF2 A;  3QWX X;  4HCK A;  4KUI A;  1VQL Q;  4A4H A;  1AZG B;  1NEB A;  2XIC A;  1WFW A;  3CQT A;  5KYU A;  3PTA A;  1SHF A;  4IUT A;  2OJ2 A;  1OV3 A;  1U06 A;  3OYH A;  4FYW B;  5KYY A;  2KEA A;  1QQJ A;  4ORZ A;  3AT1 B;  2KT1 A;  4ANJ A;  2DNU A;  1VQ4 T;  1UHC A;  1PRM C;  3CPW P;  5CR2 A;  4N4G A;  2O88 A;  1V76 A;  2DE0 X;  2RHU A;  1IGQ A;  2CSI A;  4XTY A;  1ZBX A;  5HKC A;  3CME Q;  3OS1 A;  5A0D A;  4L6V 5;  2YDL A;  1G3W A;  2O4X A;  3HRS A;  2V8J A;  2ED0 A;  2LQW A;  3SB2 A;  2DET A;  4LDU A;  2DPP B;  2MOX A;  5L8R E;  1B7T A;  3PGG A;  3VS1 A;  1UEB A;  1VYT A;  2QQ9 A;  3G6E A;  1Q86 C;  2L89 A;  2O2O A;  3SHW A;  3I9Q A;  2E3H A;  3CC7 A;  4FYY B;  4RKU E;  5FWB A;  2FZG B;  4M7A B;  1OPL A;  1ZUU A;  2DIG A;  2VXE A;  4RTY A;  3D7S B;  1YWO A;  2EGA A;  3M0S A;  2D9T A;  4N4I A;  4QQG A;  4NL3 A;  3TRE A;  3INZ A;  4M77 D;  3ULR B;  3CCJ Q;  2DXT A;  2QDY B;  1SKU B;  2E65 A;  3OYY A;  3WVE B;  2VWF A;  2XK0 A;  4PFP A;  1ZLM A;  2E6N A;  4EMK B;  2PUK B;  4EDU A;  5GJW B;  3DKM A;  1WJR A;  5CKB A;  1GRI A;  2WAC A;  3I56 Q;  1KK7 A;  2EFI A;  3UF4 A;  4J9D A;  3JCM h;  4M75 D;  1M1K R;  4E7Z A;  2E5K A;  1M1F A;  2K5L A;  2ZCF B;  1W2B P;  4PJO D;  4J8O A;  2QA4 A;  4GBQ A;  4C0Z A;  3CXC A;  3EG3 A;  3EGU A;  1TH7 A;  2DM1 A;  5GMK e;  4OP0 A;  1X6G A;  2RPN A;  1RUW A;  1W1F A;  3CCM Q;  2KXD A;  3EGX A;  4GLM A;  1PC0 A;  3OMG A;  2FG0 A;  1WQ7 A;  2DEQ A;  2EGE A;  3CMA Q;  2PVG B;  2DJQ A;  4FT2 A;  4BY6 B;  4KH1 B;  3O8V A;  2K3X A;  3RKX A;  5FRN A;  1UJ0 A;  1PD1 A;  4IUP A;  1U1S A;  4M7A F;  3G71 Q;  2G6F X;  3I55 T;  2FZK B;  3OS2 A;  1M2V A;  3X20 B;  1ZSZ B;  1OZ3 A;  2JT4 A;  2QAZ A;  1G3T A;  1VUB A;  5FLX E;  3RR6 A;  2DJZ A;  1PKS A;  4ZTF A;  6AT1 B;  2L2P A;  5LJ3 e;  1WHK A;  1BBZ A;  2MMP A;  3ZBD A;  3OYC A;  2DTH A;  1TXQ A;  5D6X A;  1S72 A;  4JRQ A;  3RES A;  1Q82 U;  5DLO A;  2OTJ A;  4OB1 B;  2ZPF B;  3C4S A;  2XD0 A;  5LJ5 j;  4M77 C;  2HZY A;  4LDW A;  4M7D B;  3SWN A;  5M9O A;  4XTX A;  3V7R A;  3OYM A;  1YJW T;  1QVF P;  3VS6 A;  2RB6 A;  1UDL A;  2L3S A;  3MP8 A;  1YIJ Q;  2CYZ B;  2RJE A;  2O9V A;  4KT0 E;  3L2V A;  5GAM j;  2W0Z A;  2LCC A;  3M57 A;  4LD6 A;  1QP2 A;  1QW1 A;  4X9D A;  3FEO A;  2HNI A;  5IH2 A;  4Z89 A;  4BD3 A;  2CH4 A;  3CCR T;  4ATO A;  7AT1 B;  5LL6 S;  3ZEH A;  4LNP A;  2AKL A;  1QMC A;  3O5Z A;  1D0Y A;  4RCC A;  1K8A R;  3C0C A;  3V7C A;  1QP3 A;  1AWJ A;  1XJW B;  1YIT Q;  1GFC A;  4NL2 A;  4LE9 A;  1VQ9 A;  1RLP C;  4EIK A;  4QQ6 A;  4ZTJ A;  3M0R A;  1S1N A;  1TG0 A;  1JO8 A;  1BYM A;  1C1A A;  4AFQ C;  1KD1 U;  1WXB A;  1X75 C;  3JB9 J;  2EYX A;  1RAA B;  1KC8 R;  1BIB A;  5I2M A;  1LVK A;  2YT6 A;  1G8X A;  4M77 A;  1JQQ A;  4HCC A;  4OMQ A;  1NE8 A;  5HK0 A;  1JXM A;  1UGR B;  3PVL A;  3OYI A;  3MPU B;  5CIU A;  3H0I A;  3JCM W;  1M1K C;  1WX6 A;  2F2W A;  2MWO A;  3CPF A;  1YJN A;  3JCM Q;  3QG1 A;  2YXY A;  1T3S A;  2M02 A;  2CUD A;  3EFS A;  3MEA A;  3BDL A;  2DO3 A;  2M16 A;  4FW2 A;  2COY A;  3JCM V;  2YWW A;  4M7D F;  2EJF A;  2LQN A;  4C8Q D;  3MEU A;  4M75 A;  4LDY A;  3CBO A;  4PJO A;  5DY9 A;  2DEU A;  1WA7 A;  5IT9 E;  2LRQ A;  4NOY A;  1Q95 G;  1NJI R;  1SSF A;  2QEX T;  4M78 A;  1VQM A;  2KDS A;  3EG9 A;  4RG2 A;  1W6X A;  2VAS A;  3CCL Q;  2GF7 A;  2MIO A;  4XTW A;  1ZA1 B;  2K5I A;  3JB9 G;  2OTL A;  3LH0 A;  5J3B A;  3NTH A;  2KAF A;  1O75 A;  2AHJ B;  1SRL A;  1Q81 C;  3HFN A;  3E19 A;  2RI3 A;  5KCO A;  4A54 A;  2MAM A;  4LDX A;  1CKB A;  1LOJ A;  1YJ9 A;  2D1X A;  3S6W A;  2DER A;  4LUE A;  3V7S A;  5GAN e;  2CSQ A;  2LVM A;  5KYW A;  1TOV A;  1BCM A;  2PTK A;  3H6Z A;  2A08 A;  3I56 A;  2E4H A;  3CC4 T;  2AIR B;  3URG A;  3JV3 A;  2KQW A;  4ZNX A;  2IIM A;  3OYK A;  1LNX A;  2RH2 A;  2QQR A;  1YI2 A;  3L2R A;  4MZP A;  1YHQ A;  2DRM A;  1O9S A;  4CRI A;  3VS3 A;  2XMF A;  4BE0 A;  3G7Z A;  1TU0 B;  3RDV A;  1JJ2 A;  4V2S A;  3R6N A;  1NZ9 A;  3BDU A;  2CDT A;  3CXC P;  1N27 A;  2LX9 A;  2L5Q A;  1VOM A;  4M78 E;  5CK9 A;  1VQK Q;  4OMF B;  4KUD K;  3MKD A;  2M0Y A;  4CC4 B;  3EFO B;  2YUN A;  5A0G A;  3GNG A;  2HAX A;  2MF2 A;  5LJ5 h;  4EMG A;  1FMK A;  3RER A;  1QWE A;  1VQ6 T;  2FRY A;  3UT1 A;  3TEE A;  1B3Q A;  1UUE A;  4M77 G;  3M4G A;  2C0T A;  1UHF A;  2DK3 A;  3CCU Q;  4C0D B;  2GNC A;  1KC8 C;  4DOV A;  2BE7 D;  1UGV A;  3U23 A;  4WTO B;  5GAM h;  2X4W A;  3GBQ A;  1IZ6 A;  2J7I A;  3JAM E;  4MDW A;  3RUX A;  4A4F A;  2YHT A;  5HY6 A;  2NUP A;  1VQ7 Q;  2OI3 A;  1ACM B;  1VA7 A;  1GCQ C;  3X25 B;  1C0M A;  3G6E T;  2RJD A;  4M75 G;  2EAY A;  3CC7 T;  2CUB A;  4F7U G;  4PJO G;  2X35 A;  1SSH A;  5FU6 C;  2LC4 A;  2R57 A;  3WVD B;  3CCS A;  4M78 G;  2OAW A;  4JLI A;  1Q7Y C;  1YIJ A;  1H3Z A;  4O5V A;  2LCS A;  3VJP A;  4XK8 E;  1JEG A;  3SEM A;  1VQ8 A;  3OW2 A;  2NYS A;  4BI3 A;  3HKS A;  2RI5 A;  2K3B A;  3QII A;  3MJX A;  2GFU A;  4DEY A;  4C8Q A;  3QXE B;  2HQH A;  2EQJ A;  1WHG A;  2CT4 A;  2LTO A;  1K0S A;  2K2M A;  3EGX B;  5FW9 A;  2GQV A;  2MK5 A;  3MCA B;  3REA B;  2DVJ A;  1HYO A;  2K2V A;  2DMO A;  2QA4 T;  5GAN 4;  4X34 A;  4MZT A;  1FWZ A;  3CCE Q;  4M7D E;  1M3B A;  3EG2 A;  1OU8 A;  2CS7 A;  1GCQ A;  3GP8 A;  3CCV Q;  3SFM A;  3OW2 S;  2CT3 A;  4E7I A;  1M8M A;  1M2V B;  2KNB B;  4A4K A;  4JRK A;  3OB9 A;  4PFZ A;  2LJ3 A;  3PT9 A;  5GMK i;  1PG5 B;  4GY5 A;  2OAU A;  3VRZ A;  2CZ7 B;  3L2U A;  3QJY A;  4X1V A;  4C5G A;  3EH2 A;  4QQD A;  1SEM A;  1WDX A;  4RCB A;  2F5K A;  3HPW A;  3M0U A;  4DA4 A;  1M1G A;  1QLY A;  3TU4 K;  2CGH A;  5FWC A;  3C95 A;  3JB9 H;  2P0Q A;  2EQM A;  2CH4 W;  1AVZ C;  2ZPG B;  2LZ6 B;  5LJ3 g;  3SWN B;  1KJW A;  1QVG A;  3QUI A;  3CCL A;  1M9S A;  1VQ4 Q;  4II1 A;  2WSE E;  3FIF A;  3X28 B;  4Z8A A;  5KCH A;  4LXC A;  4MML A;  1VQ5 T;  1WXU A;  1S72 T;  2OTJ T;  1NG2 A;  3MEW A;  2RJF A;  4OML A;  3OSS C;  5GAO m;  4XU0 A;  2RO0 A;  2ZPB B;  2GTJ A;  4YTL A;  5GAO n;  1BK2 A;  1VYV A;  3LYI A;  2LNV A;  5HCK A;  3QBY A;  4HCZ A;  5GAN 3;  3ER0 A;  5IN1 A;  1WXT A;  1OOT A;  2FHD A;  3JCM c;  2KR3 A;  3NMZ C;  1WYX A;  3PMI A;  4JRI A;  3A8H B;  3P8D A;  4D8K A;  3REB B;  2ED1 A;  4OB2 B;  3A1P A;  3CC2 Q;  1G3S A;  1HD3 A;  3LX7 A;  1D09 B;  2F1L A;  2O31 A;  1PSF A;  4F04 B;  1CKA A;  3MET A;  1SF9 A;  1R77 A;  1U8R A;  2RJC A;  1GFD A;  3JCM J;  2HD0 A;  2DVE A;  3ME9 A;  4M77 B;  3FB9 A;  4A63 B;  1MGQ A;  2DRK A;  1VQ9 T;  2KBT A;  1D1A A;  4QVZ A;  1KQ2 A;  4C8Q G;  4EMH A;  4C92 A;  1K1Z A;  2RQT A;  1K4U S;  1X6B A;  3CD6 A;  2KGT A;  5ECA A;  4LN2 A;  4OB0 B;  1IHW A;  4DBH A;  1JJ2 P;  1D3B A;  2DYB A;  2BUD A;  3A8M B;  1TS9 A;  3DLM A;  4M75 B;  1VQO A;  1VQP A;  4PJO B;  2EGC A;  3TVT A;  1BI0 A;  5GAO p;  1YJN T;  4M78 B;  2JNG A;  4E7K A;  1H8K A;  3EG9 B;  3L2Q A;  2GCX A;  3CCU A;  3VS5 A;  1KG1 A;  3M56 A;  3RBB B;  1WHM A;  5LJ3 d;  4DBR A;  2BZX A;  1BCO A;  4JPB W;  5LJ5 e;  2E1H A;  3E1S A;  3E9F A;  1OPK A;  1PHT A;  1WHL A;  5A0L A;  1ABO A;  2K79 A;  2O9S A;  4RTW A;  1ZUY A;  2YLC A;  2CP7 A;  2NUT A;  4J6Y A;  2V26 A;  1JU5 C;  4KGX B;  1VQM T;  1MUZ A;  3EHQ A;  3VUZ A;  2ECZ A;  1OX9 A;  1AWW A;  1Q82 C;  1AD5 A;  5GAM e;  2VXF A;  1H3H A;  3I55 Q;  3G4S A;  1M2O A;  2QI2 A;  3VS0 A;  3L2Z A;  4F14 A;  4M7A D;  5KYW B;  1NBE B;  4DBQ A;  2CZ0 B;  2R58 A;  3H9N A;  2OTL T;  1MV3 A;  4A4E A;  3CCQ A;  2XDD A;  2NUZ A;  3OS0 A;  2KY9 A;  2DXB A;  3H0F A;  1KQS A;  4C92 E;  1T0H A;  2BIV A;  2DAQ A;  3MP6 A;  1HXD A;  5GAN g;  1TSF A;  3M58 A;  5GAO r;  1YJ9 T;  3R6O A;  2HQE A;  1Y57 A;  1VQN A;  4FT4 A;  4CC2 A;  4M4Z A;  4QVC A;  2LNH B;  2HBW A;  3JB9 I;  5DM7 R;  1KFZ A;  2QQB A;  3OSV A;  2PNI A;  5IHN A;  2EYW A;  1MMA A;  2XDP A;  3OW2 P;  2MCN A;  1M90 U;  4J9E A;  2H8H A;  1M3A A;  3CXC S;  2PU9 B;  1RAI B;  2RD1 A;  1Q81 R;  3GF5 A;  3G1J A;  1YJW Q;  1YI2 T;  2X3X D;  1NPR A;  2XG8 D;  4M78 F;  1ZHI A;  4XTU A;  4C0G A;  1YHQ T;  4EPC A;  1SG5 A;  2JTM A;  3IQL A;  3P8B B;  2BKD N;  3X26 B;  4ZN3 A;  1N8R U;  4HXJ A;  4D8D A;  2EQK A;  2RQV A;  1FX7 A;  4XU3 A;  4Y91 A;  1KD1 C;  3OYE A;  2JOY A;  3A98 A;  3ASK A;  3EG0 A;  2ZPH B;  4JJN K;  2X3W D;  1VIE A;  1LPL A;  4OMM A;  1R0C B;  2DXU A;  8ATC B;  1H64 1;  2M51 A;  3EGD B;  4C92 G;  2EW3 A;  2QXF A;  2DFU A;  3OQ5 A;  4HKE A;  4AFS C;  4J7F A;  2HBP A;  1WI7 A;  2COW A;  2X4J A;  4FM4 B;  3JCM P;  4OGC A;  1YN8 A;  2EQI A;  1YBY A;  2E6Z A;  2NLU A;  5IHK A;  1TWB A;  3RKW A;  3GIB A;  2NUP B;  2KMT A;  4OB3 B;  2LDM A;  3AHU A;  4NS5 A;  2R5A A;  2VUB A;  1AHJ B;  1IB8 A;  1PCX A;  3NTI A;  2JJ9 A;  2RQW A;  1WJS A;  2QG9 B;  2HEQ A;  4XAX B;  5I11 A;  2E5Q A;  4M7A C;  1JXO A;  4A53 A;  2HSE B;  3HRT A;  1M8V A;  1QVG P;  1FYN A;  3J7A F;  3BE3 A;  1HJD A;  4JS5 A;  1VQL A;  2J05 A;  1OYX A;  2KRS A;  1BI2 A;  2LQ8 A;  1OEB A;  4JJD A;  4XTZ A;  5KYX A;  2F5T X;  2LX7 A;  2EWN A;  2ZPE B;  4M7D D;  4C8Q B;  3GLX A;  5LJ3 f;  5GAN d;  1BU1 A;  2H3J A;  3CCS T;  2EYQ A;  4EMK C;  3OYB A;  1PM3 A;  1YIJ T;  2IVW A;  4AMC A;  5EC7 A;  2QEX Q;  3H0H A;  1Z9Z A;  3JCM X;  4AG1 C;  1QWF A;  4JLG A;  3CC2 A;  1VQ8 T;  2YRC A;  5GAO l;  3J80 E;  2E70 A;  1Y96 B;  1AT1 B;  3CME A;  2KRO A;  2LT4 A;  3OBY A;  4LD9 K;  2C06 A;  4N0A C;  1UGP B;  4E7S A;  3PVQ A;  2D8J A;  4OF1 A;  2X51 A;  4F7U A;  1EIF A;  1Q7Y R;  2HQX A;  3QZ5 B;  2JZ2 A;  5C6S A;  3QO3 A;  1YWP A;  2WSC E;  1GL5 A;  1I0C A;  2ZZD A;  4RTX A;  1EX4 A;  1X6O A;  1TTH B;  2K4Y A;  2FPF A;  3A8G B;  3QDF A;  1OUL A;  2EBP A;  1UEC A;  2EYZ A;  4BY6 C;  1OZ2 A;  1U5S A;  3PMT A;  3CC4 Q;  4BI8 B;  3PFS A;  4PL6 A;  3CCJ A;  2LJ1 A;  4QVD A;  4ZGD B;  4R55 A;  2J06 A;  4EMK A;  1ZSZ C;  2RQR A;  2F2V A;  2FO0 A;  2ZGW A;  4C8Q F;  3Q1J A;  2KYM A;  1G2B A;  1XQH A;  4QT7 A;  1T0J A;  4RTV A;  4M77 E;  3EAE A;  2HCK A;  4BAC A;  1OU9 A;  3OBW A;  5CAI A;  2JMC A;  4LUD A;  1WIE A;  2XID A;  1GCP A;  4HCB A;  2JUF A;  2K9G A;  1NLO C;  3NFC A;  4RTT A;  2JS2 A;  5KYU B;  4C5I A;  2G3R A;  4J9C A;  5GAO q;  4KGV B;  1JRI A;  3L42 A;  5KYY B;  1I81 A;  4RTU A;  1QCO A;  4M7D C;  5GJV B;  2DXC A;  2JTF A;  4FYX B;  1VQ6 Q;  3JCM e;  2MYS A;  3CCM A;  2CP2 A;  4M75 E;  2MI6 A;  4F7U E;  4ELY C;  4PJO E;  2K6D A;  3QSU A;  2F2X A;  3CMA A;  2EQU A;  2X4Y A;  2DX1 A;  4FYV B;  2GFA A;  1TUG B;  2O4X B;  4J7I A;  3C12 A;  3BY7 A;  1ABQ A;  4L5G A;  1KQS P;  3RNJ A;  3G71 A;  3I5R A;  1WGS A;  4C92 B;  3G6E Q;  4DQ2 A;  1V29 B;  2RF0 A;  3QZ9 B;  3THK A;  1X2K A;  1RAD B;  4A4G A;  1KSW A;  5D6Y A;  1JJ2 S;  2LJ0 A;  4E7L A;  1D3B B;  4IKF A;  1MMG A;  2LMJ A;  3QHS A;  5GAN f;  2H3E B;  3LLR A;  3M0P A;  5CKH A;  3DB4 A;  5CKD A;  1SHG A;  2X9H A;  1MV0 B;  2RK2 A;  2YLB A;  5IHI A;  3H8Z A;  5D7U A;  1B34 A;  3CD6 T;  3GNF B;  4B6M A;  4R56 A;  1WQW A;  4UC4 A;  5GMK h;  2DIQ A;  2RNA A;  4ZN1 A;  1GBR A;  3QYG B;  1QKX A;  2ZPI B;  1M5Q 1;  1VQO T;  4M7A G;  1VQP T;  2QTX A;  1UTI A;  2PZ1 A;  4RG8 A;  2AZV A;  2NUT B;  2QA4 Q;  3NGP A;  2EYY A;  3RMS A;  5FRO A;  4P5N A;  4XQ3 A;  2RHX A;  2FEI A;  4PJL A;  3UWN A;  1K73 U;  2DL4 A;  1XOV A;  4AFU C;  1E6G A;  4XU1 A;  3OMC A;  2IG0 A;  2E12 A; 
#chains in the Genus database with same CATH homology
 3ME9 A;  2KVQ G;  4M77 B;  5D6X A;  1S72 A;  4JRQ A;  3FB9 A;  1MGQ A;  3RES A;  1Q82 U;  5DLO A;  4ME7 A;  2OTJ A;  1K8A U;  4OB1 B;  1VQ9 T;  4BUG A;  2PUO B;  1YIT A;  2ZPF B;  4KUL A;  2DTI A;  3C4S A;  4QVZ A;  3A8L B;  1KQ2 A;  1DJ7 B;  4C8Q G;  2V8I A;  5J26 A;  2MWP A;  4C92 A;  4EMH A;  2DD5 A;  5LJ5 j;  4M77 C;  3OYA A;  3CPW A;  5HK3 A;  4LDW A;  5GAM g;  4N0A A;  3CD6 A;  4M7D B;  2JN0 A;  4C92 F;  4OB0 B;  3SWN A;  2P4T A;  5M9O A;  3LWH A;  2B8A A;  1M1K U;  4XTX A;  3V7R A;  3OYM A;  1YJW T;  3PNW C;  3CCL T;  1D3B A;  4N4H A;  2BUD A;  2RB6 A;  3A8M B;  4FU6 A;  3G4S T;  2L3R A;  5LJ3 h;  3MP8 A;  3I55 A;  3CEY A;  3DLM A;  4GLK A;  3KBG A;  3M54 A;  3MEV A;  2CYZ B;  2RJE A;  2EJ9 A;  4KT0 E;  4M75 B;  1ZQ1 A;  1VQO A;  3L2V A;  5GAM j;  2LCC A;  3M57 A;  4LD6 A;  1VQP A;  1QP2 A;  1QW1 A;  4X9D A;  4PJO B;  3CCQ T;  3FEO A;  1BI0 A;  1M4Z A;  2HNI A;  5GAO p;  1YJN T;  3MP1 A;  3FRN A;  4M78 B;  2JNG A;  4E7K A;  2PQW A;  1G5V A;  4BD3 A;  1P92 A;  2RA2 A;  4RMO A;  2LCL A;  3L2Q A;  2M1H A;  2GCX A;  4J6X A;  3CCU A;  1X01 A;  3OMC A;  3OA6 A;  4JDS A;  3CCR T;  3M56 A;  4CI0 C;  4ATO A;  1KG1 A;  5LL6 S;  4LDV A;  3ZEH A;  5LJ3 d;  3OYN A;  2FB7 A;  1VQN T;  2VC8 A;  4J83 A;  4M7A E;  3JRZ A;  1K9M U;  5LJ5 e;  4RCC A;  2E1H A;  2FL7 A;  3E1S A;  3E9F A;  1QP3 A;  3V7C A;  3VKI A;  3OYF A;  3CPW S;  5A0L A;  5CO7 A;  4NL2 A;  4OGE A;  1VQ9 A;  1KHI A;  3HHT B;  3X24 B;  4E7J A;  4QQ6 A;  4ZTJ A;  3HRU A;  2YLC A;  2F69 A;  3QYH B;  1K73 C;  3C94 A;  3V8J A;  4J6Y A;  1BYM A;  1R8O B;  3FC3 A;  1VQM T;  2XHC A;  1NJI U;  1LJO A;  1KD1 U;  3VUZ A;  4ZGE B;  4BDY A;  2O01 E;  1YJW A;  1Q81 U;  1Q82 C;  4FIB A;  1X75 C;  5GAM e;  3JB9 J;  1K8A C;  3MO8 A;  2VXF A;  2XU8 A;  3G4S A;  1BIB A;  5KE3 A;  2QI2 A;  5I2M A;  3L2Z A;  4E47 A;  4M7A D;  2P0K A;  4M77 A;  4C8Q E;  4HCC A;  1NE8 A;  1WPY A;  2CZ0 B;  2R58 A;  5HK0 A;  4C5H A;  2M9U A;  2OTL T;  1UGR B;  3MHX A;  4C8Q C;  2Y4X A;  3OYI A;  4A4E A;  3CCQ A;  1QVP A;  5CIU A;  2XDD A;  3JCM W;  5FU7 B;  3OS0 A;  1M1K C;  1KHC A;  2KY9 A;  2DXB A;  2MWO A;  2P0P A;  3CPF A;  3V8L A;  1YJN A;  4L59 A;  3JCM Q;  3QG1 A;  1KQS A;  3VV0 A;  2K5F A;  1I4K 1;  4C92 E;  3EFS A;  3SD4 A;  4M7D A;  3L2W A;  3MEA A;  2BIV A;  2DAQ A;  3BDL A;  1HXD A;  3MP6 A;  5GAN g;  3CCR A;  1GXI E;  3N5B B;  2DO3 A;  2M16 A;  3M58 A;  5FU7 C;  5GAO r;  3JCM V;  3R6O A;  1YJ9 T;  2HQE A;  2CZ6 B;  3FJP A;  4M7D F;  1W2B A;  1UGS B;  1VQK T;  3BFM A;  3FDR A;  1N6A A;  4FT4 A;  1VQN A;  4XU2 A;  4QVC A;  1PSE A;  2DKG A;  2EJF A;  3QKJ A;  3JB9 I;  3LGF A;  5DM7 R;  4C8Q D;  2R5M A;  2QQB A;  3OSV A;  4C0D C;  4PLI A;  3MEU A;  2FYK A;  4M75 A;  2XDP A;  3UDC A;  4BE1 A;  2XDB A;  5CQX A;  4LDY A;  1M90 U;  1BKB A;  3JCM f;  3P8H A;  3CBO A;  4PJO A;  3RMQ A;  5GAN j;  2L8D A;  1QVG S;  4ZGJ B;  5DY9 A;  3CXC S;  2PU9 B;  3F70 A;  3PIP A;  5IT9 E;  2LRQ A;  2E41 A;  2PVO B;  4NOY A;  1SSF A;  2QEX T;  4M78 A;  2RD1 A;  3OYD A;  1VQM A;  3GF5 A;  2KDS A;  3V8K A;  4C92 D;  1K9M C;  5EG2 A;  1YI2 T;  1G3Y A;  1BI3 A;  2LQK A;  3JSC A;  4RG2 A;  2VGN A;  1N9R A;  1NPR A;  2LT1 A;  2XG8 D;  1ZHI A;  2CZ1 B;  2VV5 A;  2Y90 A;  4M78 F;  4XTU A;  4C0G A;  2FVU A;  2GF7 A;  4XTW A;  4EPC A;  5CQY A;  5I2S A;  3CCU T;  3PIO A;  5LJ5 g;  2JTM A;  5GAM d;  5KH6 A;  3P8B B;  2BKD N;  3VU3 C;  3X26 B;  4E7H A;  3HSB A;  2K5I A;  4IUR A;  4ZN3 A;  2DZC A;  3JB9 G;  1N8R U;  2I2L A;  2OTL A;  3LH0 A;  2EQK A;  3NTH A;  5J3B A;  5GAN 7;  1FX7 A;  2KAF A;  2PVD B;  4ELZ C;  3OYG A;  1O75 A;  2AHJ B;  3SDZ A;  1NJI C;  1VQ6 A;  4XU3 A;  2DD4 A;  4Y91 A;  1KD1 C;  3OYE A;  4MZM A;  2JOY A;  1Q81 C;  3ASK A;  3E9G A;  4PNO A;  2ZPH B;  1W2B S;  3HFN A;  3E19 A;  2E64 A;  2RI3 A;  4JJN K;  5KCO A;  4Q5W A;  3QPH A;  4A54 A;  1VQ7 T;  1VQL T;  1VIE A;  3NTK A;  3M4Y A;  2MAM A;  2WSF E;  4MMK A;  1Y7X A;  4LDX A;  1LOJ A;  1YJ9 A;  2DXU A;  3M5A A;  3S6W A;  1H64 1;  2VYT A;  2Y4Y A;  2CKK A;  1VQK A;  3HL8 A;  1OI1 A;  3V7S A;  1W4S A;  4FSX A;  5GAN e;  4HT9 A;  4BE2 A;  4C92 G;  2QXF A;  5CVI A;  3OQ5 A;  4FL6 A;  3M55 A;  4HKE A;  2LVM A;  4J7F A;  1RI0 A;  2HBP A;  4B9W A;  3UPU A;  2X4J A;  1KC8 U;  3CBP A;  4FM4 B;  3JCM P;  3H6Z A;  4JS4 A;  3RIR A;  3I56 A;  4OGC A;  4F7U B;  5A2Q E;  1YBY A;  2E6Z A;  2NLU A;  3URG A;  3RKW A;  3CC4 T;  2KQW A;  4Z02 A;  3GIB A;  2QEX A;  2KMT A;  4OB3 B;  3OYK A;  2LDM A;  3RKY A;  2VGM A;  3AHU A;  1LNX A;  2RH2 A;  2QQR A;  1RL2 A;  4NS5 A;  3CC2 T;  1YI2 A;  2R5A A;  2V8K A;  4PKC C;  1Y96 A;  3L2R A;  2VUB A;  3M59 A;  4MZP A;  4DOW A;  1YHQ A;  1AHJ B;  1Y71 A;  3NTI A;  1O9S A;  3CME T;  1M90 C;  4CRI A;  1WJS A;  4MDX A;  2DZ9 A;  4B9X A;  4BE0 A;  4XAX B;  1BI1 A;  5GAN h;  3OS5 A;  3G7Z A;  3LGL A;  2E5Q A;  1JJ2 A;  4V2S A;  4M7A C;  3CBM A;  1QVF A;  2EJG A;  4QW2 A;  4A53 A;  3OY9 A;  3TCJ A;  2JVV A;  1NZ9 A;  3BDU A;  3HRT A;  1M8V A;  3J7A F;  5I21 A;  4JS5 A;  1Q7Y U;  5J39 A;  1I8F A;  1VQ7 A;  1N27 A;  1OYX A;  1VQL A;  1BI2 A;  2LX9 A;  1XNI A;  3KUF A;  2LQ8 A;  4XTZ A;  5CKE A;  2L5Q A;  2F5T X;  4M78 E;  5CK9 A;  1N8R C;  4HA8 A;  3QDR B;  4OMF B;  4KUD K;  2XI9 A;  3T9N A;  2EWN A;  2ZPE B;  4M7D D;  1MHN A;  4C8Q B;  3GLX A;  5GAN 2;  5A0G A;  5LJ3 f;  5GAN d;  3GNG A;  3S3O A;  3CCE T;  2H3J A;  3QJ6 A;  4JRP A;  2HAX A;  3L1A A;  4KBM B;  3CCS T;  2EYQ A;  3HFO A;  4EMK C;  3OYB A;  2MF2 A;  1YIJ T;  5LJ5 h;  4EMG A;  2IVW A;  4IUV A;  3CCV T;  3CC4 A;  3RER A;  1VQ6 T;  3ZFJ A;  4M77 F;  3UT1 A;  3TEE A;  3JCM X;  2KSS A;  4JLG A;  3CC2 A;  3VYG A;  3CCJ T;  1VQ8 T;  2D0Q B;  2RHY A;  4M77 G;  3DLL A;  3M4G A;  5GAO l;  3J80 E;  2DK3 A;  4M78 D;  2E70 A;  1Y96 B;  3JB9 D;  4C0D B;  1KC8 C;  4C92 C;  1VIF A;  4DOV A;  3CME A;  1QVF S;  2LT4 A;  3OBY A;  1FXX A;  2DTH A;  3OYJ A;  1Q86 U;  2C06 A;  4LD9 K;  4N0A C;  2K3Y A;  5GAM h;  1UGP B;  2XKO C;  3SWN C;  2X4W A;  2RM4 A;  5LJ5 d;  1IZ6 A;  4D6W A;  2E10 A;  4OF1 A;  4M7D G;  3JAM E;  4MDW A;  3RUX A;  5GMK l;  4WF2 A;  4F7U A;  1EIF A;  4A4F A;  2HQX A;  3QZ5 B;  2JZ2 A;  2YHT A;  5C6S A;  3QO3 A;  5HY6 A;  4KUI A;  2WSC E;  3I56 T;  4VUB A;  4A4H A;  4M75 F;  2XIC A;  2YRV A;  4F7U F;  2ZZD A;  3X25 B;  4PJO F;  3G6E T;  3PTA A;  4IUT A;  1X6O A;  2RJD A;  2K4Y A;  4M75 G;  2EAY A;  2RI2 A;  3A8G B;  3CC7 T;  4F7U G;  3OYH A;  4PJO G;  2X35 A;  5GAN 5;  1YCY A;  3CCE A;  3JCM g;  5FU6 C;  3JB9 F;  2LC4 A;  2R57 A;  3WVD B;  3CCS A;  4M78 G;  5AYF A;  4BY6 C;  1OZ2 A;  1VQ4 T;  2M0O A;  4JLI A;  5LJ5 f;  1Q7Y C;  1KQS S;  1YIJ A;  3PMT A;  5DLQ E;  1H3Z A;  1WNL A;  4BI8 B;  4O5V A;  5CR2 A;  3CCV A;  3EFR A;  3PFS A;  3A8O B;  4PL6 A;  3VJP A;  4XK8 E;  4N4G A;  3CCM T;  4J6W A;  2RHU A;  3CCJ A;  1VQ8 A;  4XTY A;  1ZBX A;  5HKC A;  3OW2 A;  3J81 E;  4BI3 A;  4QVD A;  3HKS A;  2RI5 A;  4ZGD B;  4R55 A;  4C0F A;  3OS1 A;  3QII A;  4EMK A;  5A0D A;  4L6V 5;  3CMA T;  2GFU A;  1WJQ A;  2RK1 A;  1G3W A;  4C8Q A;  2O4X A;  3DB3 A;  3QXE B;  3HRS A;  2V8J A;  5GAM f;  2EQJ A;  1VQ5 A;  2ZGW A;  3SB2 A;  4C8Q F;  3Q1J A;  3S3N A;  2LTO A;  2A7Y A;  1XTD A;  1XQH A;  4LDU A;  2DPP B;  3G71 T;  4M77 E;  5L8R E;  3EAE A;  2EIF A;  4BAC A;  2GQV A;  4HT8 A;  5CAI A;  3OBW A;  3PGG A;  4O6J A;  1UEB A;  3MCA B;  2XID A;  4HCB A;  4JUV A;  5GAN 8;  2RHI A;  2QQ9 A;  1KQ1 A;  2A3L A;  2JUF A;  3G6E A;  2L89 A;  1Q86 C;  2K2V A;  3NFC A;  3M53 A;  1B34 B;  2QA4 T;  1NPP A;  4C5I A;  3CC7 A;  2G3R A;  5GAN 4;  4XTV A;  4RKU E;  4MZT A;  4X34 A;  5GAO q;  1I5L A;  1FWZ A;  1JRI A;  4M7A B;  4M7D E;  2RHZ A;  3L42 A;  2DIG A;  2VXE A;  3KXT A;  5CCA A;  1I81 A;  1VQ4 A;  4M7D C;  2CS7 A;  4BB7 A;  2D9T A;  2DXC A;  2JTF A;  3GP8 A;  3SFM A;  3OW2 S;  3JCM e;  4N4I A;  4QQG A;  4E7I A;  4A4K A;  4NL3 A;  3TRE A;  3INZ A;  4JRK A;  4M77 D;  3OB9 A;  4PLL A;  5GMK j;  3CCM A;  2DXT A;  2QDY B;  2X4X A;  4M75 E;  2MI6 A;  2E65 A;  3PT9 A;  3OYY A;  4BI4 A;  3OYL A;  4F7U E;  4ELY C;  5IAY A;  4BDZ A;  5GMK i;  4GY5 A;  2KK4 A;  4PJO E;  3QSU A;  4M75 C;  2OAU A;  1U1T A;  3FLG A;  3WVE B;  2XD0 A;  4PJO C;  2CZ7 B;  2XK0 A;  3QJY A;  3L2U A;  3CMA A;  2E6N A;  2EQU A;  4EMK B;  1UB4 A;  2X4Y A;  2PUK B;  2GFA A;  4EDU A;  4C5G A;  3DKM A;  4M78 C;  2O4X B;  4J7I A;  3C12 A;  1WJR A;  4QQD A;  3BY7 A;  5CKB A;  4C5E A;  1JB0 E;  1UGQ B;  3WXM B;  4L5G A;  4RCB A;  2WAC A;  2F5K A;  3G71 A;  3A5Z B;  3HPW A;  3M9Q A;  1M1G A;  2EFI A;  4DA4 A;  3TU4 K;  3S3M A;  2CGH A;  3JCM h;  2EKO A;  5CKF A;  5FRM A;  1WGS A;  3C95 A;  1HK9 A;  4C92 B;  4M75 D;  3JB9 H;  2P0Q A;  4DQ2 A;  1V29 B;  2EQM A;  3QZ9 B;  1M1F A;  2K5L A;  2ZCF B;  3GPL A;  4PJO D;  2ZPG B;  4IUQ A;  4J8O A;  2QA4 A;  5LJ3 g;  4A4G A;  3SWN B;  4C0Z A;  4OVA A;  1QVG A;  5C0M A;  3QUI A;  3CXC A;  3CCL A;  1Y07 A;  5D6Y A;  1JJ2 S;  1M9S A;  1TH7 A;  4E7L A;  2D6F A;  4II1 A;  5GMK e;  2WSE E;  1D3B B;  4IKF A;  4OP0 A;  3FIF A;  3QHS A;  4IUU A;  3X28 B;  5GAN f;  3BW1 A;  5KCH A;  4MML A;  1VQ5 T;  3LLR A;  5D6W A;  4Y28 E;  3LW5 E;  1S72 T;  5CKH A;  3DB4 A;  4TVR A;  5CKD A;  3JCM d;  2DTO A;  2OTJ T;  5LJ3 j;  1YIT T;  2RK2 A;  2YLB A;  3MEW A;  2RJF A;  3OSS C;  5GAO m;  3OMG A;  3H8Z A;  1BIA A;  4XU0 A;  2RO0 A;  2ZPB B;  4YTL A;  1WQ7 A;  2DEQ A;  5FU6 B;  2PVG B;  1N9S A;  4FT2 A;  1B34 A;  3CD6 T;  4BY6 B;  5GAO n;  1IRE B;  3O8V A;  4M7A A;  3LYI A;  3OYC A;  2K3X A;  3RKX A;  5FRN A;  3GNF B;  2LNV A;  4X9C A;  4R56 A;  3QBY A;  4HCZ A;  5GAN 3;  3ER0 A;  4IUP A;  5IN1 A;  5KE2 A;  1WQW A;  1U1S A;  4UC4 A;  5GMK h;  4M7A F;  2FHD A;  2DIQ A;  4ZN1 A;  5GMK m;  3JCM b;  3I55 T;  3JCM c;  3OS2 A;  1JBM A;  3QYG B;  2ZPI B;  1M5Q 1;  3PMI A;  4JRI A;  3A8H B;  1VQO T;  3P8D A;  3X20 B;  1YHQ T;  4M7A G;  1VQP T;  2QTX A;  4OB2 B;  4RG8 A;  3LWI A;  1G3S A;  1OZ3 A;  2K57 A;  2QQA A;  3LX7 A;  3VYH B;  3RMS A;  5FRO A;  1G3T A;  1VUB A;  4P5N A;  5FLX E;  5GAN 6;  3GOX A;  4XQ3 A;  1PSF A;  4J5Y A;  2DJZ A;  2RHX A;  3MET A;  4ZTF A;  3UWN A;  1U8R A;  2RJC A;  3HP9 A;  1K73 U;  1XOV A;  5LJ3 e;  3VUB A;  3JCM J;  2HD0 A;  4XU1 A;  2MMP A;  3ZBD A;  2DVE A;  2QQS A;  2IG0 A;  2E12 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...