4MDWA

Crystal structure of a duf1541 family protein (ydhk) from bacillus subtilis subsp. subtilis str. 168 at 2.00 a resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
146
structure length
133
Chain Sequence
HEEMDHSGSADVPEGLQESNPYVGSQVIINTSHMGMGAEATVTGAYDTTAYVVSYTPTNGGQRVDHHWVIQEEIDAGDTLQPGDQVILEASHMGMGATAEIDSAETTVYMVDYTSTTSGEVNHKWVTEDELSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein YdhK
publication title Crystal structure of a hypothetical protein (ydhK) from Bacillus subtilis subsp. subtilis str. 168 at 2.00 A resolution
rcsb
source organism Bacillus subtilis subsp. subtilis
total genus 24
structure length 133
sequence length 146
ec nomenclature
pdb deposition date 2013-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07563 DUF1541 Protein of unknown function (DUF1541)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1210 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4mdwA00
4MDWA
chains in the Genus database with same CATH superfamily
3EGXA 3QWXX 1G3YA 1B07A 3BFMA 3CC2T 2CSIA 5A0GA 2ENMA 3OYFA 2V8KA 3CCVQ 3EGDB 1R0BG 1ZBJA 1O9SA 1VQPT 4BE0A 3SB2A 2K2VA 4J83A 4EMKB 1X2QA 5GAOl 3MPUB 4KGZB 4P5NA 5IHNA 2FRWA 2X3XD 2H8HA 1VQ7T 1RAEB 2L3SA 1Y57A 4C8QB 2JMAA 5IXBA 1Q82C 4EPCA 1KQSA 2LP5A 5CO7A 1D0XA 1YIJT 2FHDA 3JAME 1WZOA 3AT1B 1YP5A 2KRMA 2P84A 2G6FX 1KIKA 4ESRA 4IUQA 1WFWA 2DXTA 2B8AA 4JJDA 4XTZA 3VS3A 1DJ7B 1K9MC 3TEEA 2LZ6B 5GANh 1BK2A 4J9CA 2NUZA 5KE3A 3LH0A 4RTZA 4XU2A 1N8RU 2ROTA 2A0FB 2DL4A 3S6WA 4FYYB 3CC4A 1KHIA 1GCQA 2D0QB 2BTTA 2CKKA 3CBOA 1N8RR 3CD6A 1LPLA 2NUTB 4AMCA 1AWXA 4D6WA 2K3YA 1VQNQ 2JW4A 2JN0A 2O4XA 4X9CA 1S72A 5CKBA 4EDUA 2COWA 3V7SA 1RUWA 2ZPBB 1GCQC 3JB9F 1UHFA 3BE3A 2E6ZA 1GBRA 2EYXA 4PJLA 5KCHA 1BU1A 3JCMV 2QEXT 5I2MA 1WPYA 2FPDA 4JRKA 3JCMg 3CCRA 4FW1A 2DK3A 3FB9A 1VQMQ 1U3OA 1Q81C 2QXFA 4ZGJB 4M77A 3JB9I 3QDFA 5KYXB 3H0HA 1YWOA 3X26B 4FSSA 2KNBB 1HYOA 2YXYA 2V8JA 2EKHA 3L2ZA 2K79A 4ANJA 2RO0A 4OB1B 4ATOA 4M77F 5D6YA 2PVDB 4ME7A 4MZMA 1W2BP 1VQ6Q 1UGVA 1G3TA 2LCCA 2YLBA 3HTRA 1UE9A 2EFIA 3RERA 3QG1A 1ZSGA 5FROA 4LN2A 2E65A 3F70A 3X20B 4F7UE 5GAN7 1ABQA 1SG5A 1E6GA 1Y0MA 2O01E 4IUPA 3GLXA 1RACB 3MHXA 3T9NA 3CCEA 2QA4A 3CCLA 1UJYA 2VVKA 3META 4QVDA 4QT7A 2YRVA 1D1CA 1YI2A 4A63B 3P8DA 1M3BA 3KBGA 3V7CA 3CCJQ 2HMAA 2EPDA 5KYWB 2CZ6B 5HK3A 1BIBA 2WACA 2VB6A 3EG1A 3J80E 1YCYA 5DLOA 3QXEB 4Z88A 3OW2P 3EAEA 2CZ1B 3QPHA 1YJWQ 3M57A 4LNPA 4DEXA 4F7UB 2COZA 4A4EA 5J26A 3FC3A 4D8KA 2K4YA 2PVOB 2A3LA 2DZCA 4C0FA 2KYMA 1NYGA 3CMAA 2LCSA 1XQHA 2EQJA 4BDZA 4PFZA 3QKJA 3EGDA 1YHQA 2EQIA 4C92E 2PTKA 3OB9A 2RI3A 3EG9B 3O5ZA 4J6YA 3IQLA 4LUDA 1IGQA 3MO8A 4V2SA 2DRKA 2RJFA 2E4HA 4EMKA 3REBB 1WHMA 1QWFA 2DL3A 4FU6A 4TVRA 4E7LA 3QBYA 2COYA 4C0DB 3CC7Q 3I56Q 5LJ3d 4OMNA 5HKCA 1YJ9T 3NTHA 1VQKA 3FDRA 1KQ1A 4CRIA 4C8QA 2VYTA 2CZ0B 1UDLA 3NPFA 4DBHA 1R0CB 3Q1JA 2FL7A 3MEAA 1KC8R 3CCST 4J9IA 1M90R 1BIAA 3RDVA 4ZGEB 3J7AF 4EMKC 4HCCA 2QTVA 3CMEQ 2KK4A 2RJEA 1QLYA 1GCPA 2RQTA 2KR3A 4MZTA 5CCAA 4C8QF 1Z9ZA 1JXMA 2L2PA 1QVGP 1KFZA 2C06A 2G3RA 2ZZDA 2EWNA 3M58A 2DEUA 3CCMQ 1B34B 2L5QA 4OB3B 1YITQ 3ASKA 2EQMA 1MMDA 2RHXA 4X34A 4FL6A 1IREB 3OYIA 3PTAA 2NUTA 1YWPA 1JJ2P 2HQHA 4YTLA 5LJ5e 2OTLT 5AT1B 1VYTA 3HHTB 3CCQT 5CKHA 2LNHB 2PNIA 1UFFA 4NL3A 2Y4XA 3SWNC 1K8AU 1I5OB 4R55A 1CKAA 1VQOA 1M4ZA 1S1NA 1VQNA 2KVQG 3OMCA 1K8AR 3JCMW 1K9AA 3URGA 2L3PA 3UDCA 5KYXA 3G71Q 3PVLA 2AZVA 4M75E 2QASA 1EIFA 5GJVB 4R56A 1I81A 1QCNA 2DM1A 3HSBA 1LCKA 2EIFA 1N9RA 3LX7A 2DLPA 2LT4A 3X25B 2IG0A 4PJOE 1ZSZB 3G4ST 2X4YA 5ECAA 3A5ZB 3JV3A 3ZEHA 2YWWA 1PWTA 1KC8C 4FCYA 1M90C 1VQ6A 2Z0WA 4XU3A 2L0AA 2V1RA 2P0PA 3FIFA 4F7UG 5DLQE 5DM7R 2KE9A 1VQLT 3RMSA 3CXCS 1UGQB 2P4TA 2XDDA 3JCMc 2H3JA 1AT1B 3CXCA 4OF1A 1SHFA 1GFDA 2CS7A 2CP0A 5CIUA 1SSFA 5KYNA 5KYWA 4XTYA 3VS4A 3X24B 4EMGA 5CR2A 2PUOB 2E5KA 5C0MA 2RJCA 3V7RA 3CC2Q 4LDVA 4XQ3A 2RN8A 3EG2A 3HRTA 1PRMC 2DVJA 4N4GA 1T0JA 3A98A 3NHNA 1W70A 4F7UA 3UA6A 2F2XA 2OAWA 3O8VA 4J6XA 4AG1C 1VQPQ 2DFUA 1G3WA 2E5QA 2LC4A 2M1HA 2JTFA 4F14A 1VA7A 1UEBA 1TUCA 3NTIA 4J9HA 4C92D 1TTHB 3ME9A 1BI0A 4M78E 3M9QA 2JM8A 1WA7A 1UJ0A 2RQVA 1YJWA 5CKFA 3M0UA 2F5KA 4JPBW 3EG9A 4Z8AA 3QHSA 1I07A 1VQ7Q 3CPWS 2RK1A 1NLOC 1M2VB 4C92G 1RI0A 4E7ZA 1NPPA 2ZPHB 3LH5A 2PQWA 4JS5A 4X1VA 5GAOp 2EYWA 2CP2A 1Q86C 3CC4T 1D3BB 3QWYA 2KEAA 4N0AA 3CD6T 2F2WA 1RAGB 2GGRA 2FZCB 2QAZA 1GL5A 1OV3A 2J6KA 1WQ7A 4HVVA 1QP2A 3S3NA 1YN8A 1U5SA 1ACMB 2VXEA 5D7UA 1NG2A 4KUDK 1S72T 2B86A 4HVWA 1D1AA 4HT9A 2JS0A 1BCMA 2IPOB 2OJ2A 1IXDA 4M7DA 4IUVA 1H92A 2D8JA 4WCIA 4N0AC 1X01A 3GIBA 2LJ0A 2RHUA 3VS5A 4XU1A 3CCRT 1I0CA 3CMEA 1B34A 3VYHB 1YNZA 5LJ3j 4ZNXA 4BD3A 2EBPA 2LNVA 1MNDA 2OI3A 3C95A 1BCOA 2BKDN 2LCLA 2RK2A 1ZUUA 5AYFA 4VUBA 4M7DF 3JSCA 1IHVA 4JZ4A 1AWJA 4FT2A 5HCKA 1KG1A 1PC0A 5LJ5g 2L3RA 1BB9A 2JTEA 3RBBB 4E7KA 4FT4A 1X6BA 4C92C 1IGUA 1Q7YU 2O9VA 1Y7XA 2QEXQ 1YITA 2RQRA 5KE2A 4IKFA 2XG8D 1JBMA 2EYZA 4O6JA 1RAAB 2FEIA 5GAN2 2E1HA 2HAXA 1I1JA 2HBPA 3MEVA 3INZA 2JT4A 3OYHA 4PLLA 1IZ6A 1VYUA 2CP6A 4FM4B 1QVFA 1PHTA 4A4HA 4NOYA 1N5ZA 2F2VA 4J6WA 1KD1U 4BI3A 1M1KU 1M8MA 3FEOA 1KQSS 2JVVA 3DB4A 3HRSA 4OB2B 5GMKe 2DETA 1C6VX 2DD4A 3OMGA 1KD1R 3DLLA 3LGFA 4HCZA 1M1KR 1ZBXA 4HCBA 4M75D 1LNXA 1WHHA 3HP9A 1B7TA 4BE2A 4HVUA 2QQRA 2RJDA 4J7FA 2E3HA 5GAN6 3PMTA 3VRZA 4XAXB 1OYXA 4LDYA 2QGGA 4OGEA 1RL2A 3CEYA 3CCET 1G5VA 2RHIA 4M75G 2QA4T 1OU9A 4JDSA 3I5RA 1XNIA 3OYLA 4JRPA 2ZCFB 4PJOD 3G71A 1YI2T 2NLUA 5FWBA 2QQAA 4HT8A 1D1BA 3RNJA 1AWOA 1NJIU 1ZX6A 1ZSZA 2LX7A 5A2QE 2CP3A 3H9NA 1U1SA 1VQ5T 4C5GA 1ARKA 3OYMA 4PJOG 2XU8A 3D7SB 1NJIR 4BB7A 3SD4A 1X27A 2AZSA 2GTJA 3SWNB 1VQ9A 3OYYA 2DBKA 4E2FB 2DJQA 1FMVA 2FB7A 4XK8E 4LXCA 3OYBA 1ZSZC 3RIRA 1Y96B 4M7AE 5CQXA 4E7HA 5GAMd 1VQ4A 2SRCA 3CMAT 1VQ8A 3FJ5A 3L2VA 3THKA 1WI7A 4PFPA 1O75A 5IXFA 1G2BA 1YHQT 1M27C 4J9BA 2FVUA 2KRNA 5GJWB 3KFVA 2YDLA 3M0RA 1BYMA 3SEMA 2LVMA 2PZ1A 2DIQA 2MF2A 4ZTFA 1QQJA 1TOVA 2X51A 4M75C 5IHIA 1IHWA 3CCUA 2K5FA 2DL5A 1WQWA 5GANd 2CZ7B 1VQKT 2RMOA 4E47A 2YUOA 3LWIA 2VUBA 3PIPA 5LJ5f 1MV3A 1BI1A 2DA9A 4FYVB 4M78D 1W6XA 2FG0A 1K76A 4CC2A 1OX8A 4PJOC 3PIOA 4X9DA 4JLIA 2DPPB 2RPNA 2L8DA 4LD6A 4M7AB 2DYIA 4A4FA 2K7AA 3NTKA 3I5SA 5IAYA 2RF0A 4BDYA 1TXQA 1PKSA 4M78G 1YJ9Q 4LDXA 2DF6A 1UG1A 4L6V5 4OVAA 2VV5A 4PLIA 5LJ3f 1OOTA 1M2VA 2IIMA 2QDYB 4AT1B 3G6EQ 2VXFA 2EVRA 4RCBA 3LGLA 3JRZA 3CCSQ 4IURA 3RKXA 1SRMA 4Z02A 3PNWC 3I55A 3E9FA 1D3BA 5CKDA 2CT3A 5KH6A 5GAMe 5LJ5h 1N9SA 4FIBA 4QQDA 2RI2A 2M51A 3TU4K 1YJNA 1TWBA 1PRLC 5GMKi 1C0MA 2RA2A 1MMAA 1RLQC 2X9HA 1N8RC 1OQKA 3H41A 2OTJA 2AT1B 2EGCA 3HFNA 1G8XA 5LJ3h 1VQOT 2HDAA 2FPFA 5GMKj 3UF4A 3L2UA 4RTVA 2M0YA 2KROA 2HL3A 1QKWA 5FRMA 2KAFA 2OTLQ 1ABOA 3L2QA 3CCQQ 2FPEA 4RTTA 4M78C 2YRCA 2KRSA 2DL7A 2K2MA 2L3QA 5EG2A 2JTMA 2X4JA 2EYQA 3QZ9B 2CGHA 4DA4A 2MWOA 1V76A 2K3BA 2ZGWA 1SEMA 4WF2A 4D8DA 3PT9A 4EIKA 1M9SA 5A0DA 2ED0A 3VS0A 3CCVA 1JB0E 1VYVA 2DVEA 2FRYA 5A0LA 4M4ZA 5CAIA 3VKIA 1MGQA 1VQ6T 4RTWA 1MHNA 2DJZA 2I0NA 4F16A 1MMGA 2HD0A 2PUKB 4ZTJA 1KHCA 5IN1A 4QQ6A 5GAN4 3GBQA 3EG0A 3G4SQ 1WHGA 3I9QA 2EAYA 3A8LB 3CPWP 3EFSA 1JQQA 2XICA 2KMTA 2AKLA 2HNIA 2DKGA 1NM7A 1K0SA 4C92B 1RADB 2QGFB 4KRTA 3VS7A 3HFOA 1M2OA 3EHQA 4LDUA 1XOVA 4Y28E 4AFZC 5HY6A 1I8FA 4K11A 1XJWB 2KYBA 2HL5C 2M16A 2HKQB 3SWNA 1TSFA 4A4GA 1Y71A 3VS2A 3V8LA 4M7AD 3A8GB 3L2WA 1MNEA 1KK7A 2BE7D 4JZ3A 1QCFA 3VV0A 1Y96A 3VYGA 2AIRB 2XMFA 5GMKm 3QUIA 2FZKB 1WHJA 2NYSA 1OEBA 1RAIB 1JEGA 3V8JA 4M7AG 1YJWT 3M54A 3PVQA 3EH1A 4GLMA 4XU0A 2CYZB 5LJ3e 2LQNA 1WXBA 4XTUA 2XDBA 2QTXA 1PKTA 2WSFE 2V8IA 3OS2A 1BKBA 1QVPA 1N27A 4LUEA 3EGUA 2EW3A 1W2BA 3E9GA 3UATA 1VQMA 3CBMA 4Y91A 3L2RA 3P8BB 3E19A 5GAMj 1NYFA 2BZYA 3P8HA 2A36A 3MP1A 1OPKA 1GXIE 1QKXA 3ZBDA 2H3EB 1MMNA 3JCMd 2HQXA 3QO3A 1UGPB 2DNUA 4RTUA 4OGCA 2EQUA 5D6XA 1VIFA 4M7AA 2Y90A 2M0OA 1KQSP 4QKUA 1AVZC 2D8HA 1WHLA 3UA7A 4A4KA 5C6SA 1X2KA 1M8VA 4J8OA 3U23A 2DRMA 3RKWA 2MMPA 4LDWA 1FWZA 2MOXA 1IRXA 3CD6Q 5KYYB 1NEBA 2VWFA 4M77E 2J6OA 1K73U 2DMOA 3OYJA 2DERA 1PNJA 5GANj 1M5Q1 3A1PA 4M7AC 1K73R 3OYKA 4MMKA 4AG2C 1S72Q 1YJ9A 3KXTA 2QK0A 4M75B 3M55A 1HK9A 2E10A 3G6EA 2FO0A 2EGEA 1WHKA 3UT1A 4UC4A 2V26A 3HPWA 3MP6A 2A28A 1F1BB 2RHZA 5L23A 1X6OA 2EJ9A 1QMCA 3OW2A 1YITT 3CCRQ 2DTIA 4MZPA 4C5HA 4J9EA 5FWCA 1WJQA 4IUUA 4PJOB 1KQ2A 2LQ8A 2DXCA 4XTXA 5GMKh 3CCJA 2ESWA 3QIIA 2KY9A 2W10A 4QVZA 2EQKA 2JOYA 1E6HA 4Z89A 3OYDA 4RG2A 2PVGB 1D09B 1OI1A 4B9WA 3TREA 5M9OA 2BZ8A 1AZGB 4QVCA 2XHCA 2KT8A 4WTOB 3J81E 1PM3A 3JCMe 2RB6A 1RAHB 4FYXB 2VGNA 4OMPA 1K8AC 3VS6A 3TCJA 1NLPC 1B3QA 4F7UF 2R5AA 3N5BB 4E7JA 1Q82U 3EFOB 3MJXA 2DL8A 3OBYA 2HQEA 3OYGA 5FU7C 2HCKA 2VC8A 3H0FA 4PL6A 3RMQA 4PNOA 3MP8A 3G71T 2AK5A 2SEMA 4JRIA 3OSVA 4BI8B 1V29B 3PGGA 3QDRB 3UPUA 1ZA2B 3OY9A 1YIJQ 2GF7A 3AHUA 5FRNA 1WIEA 1KJWA 2O88A 4JJCA 2KGTA 5GAN8 2D0NA 3H0IA 1WLPB 5J3BA 3OYEA 1K9MU 2QA4Q 1VQ9T 1UHCA 2K9GA 3PFSA 1AZEA 2KBTA 4L5GA 2MI6A 1YI2Q 2C0IA 4QW2A 1K9MR 3WXMB 1RLPC 1QVGA 5GAN5 2D9TA 3CC7A 3I56A 2ZPFB 3JB9H 1SF9A 2D6FA 5J39A 1VQ4T 4F04B 1WX6A 2DBMA 4IIMA 1VQ8T 4AFSC 1VQ5Q 6AT1B 1OULA 4MMLA 2KXCA 4M78B 2FZGB 2K3XA 3RESA 2E70A 4C92A 2F69A 2A37A 1JJ2S 2KT1A 1WJSA 3JCMQ 3WVEB 1JJ2A 1E7OA 3RUXA 2XKOC 2F5TX 1XTDA 3TSZA 4C5IA 1X43A 3X28B 4C8QE 4C92F 5GAMf 3CCUT 4PFOA 4BE1A 1SPKA 3CCMA 1YHQQ 4Q5WA 1U1TA 1Q81U 4JRQA 1QP3A 4B6MA 1TU0B 5FU6B 5CVIA 1Q7YR 3BDLA 1QVFS 4KGXB 2RHYA 3G7ZA 2JZ2A 1Q81R 4BY6C 5I11A 3JCMP 7AT1B 5LJ3g 4CI0C 5IHKA 4E7IA 2QQSA 2LX9A 1ZA1B 1VQKQ 3C4SA 3DLMA 5GANf 3BDUA 2LQWA 4HKEA 2E12A 4O5VA 3CPFA 3JB9D 4MDXA 4J9FA 1QCOA 2JXBA 1NZ9A 2RM4A 4Y92A 5CKEA 3OS5A 2CSQA 4RTYA 2K57A 5GAMh 3I55T 4ELZC 2ABLA 4GY5A 3QJYA 2X3WD 3CCLT 3I35A 1TS9A 5HK0A 3S3MA 2E6NA 3JB9G 2QDLA 2DEQA 2X4WA 3M0QA 1WJRA 1YJNT 5FW9A 4PJNA 4GLKA 2KI7A 5GAOr 2X4XA 1W1FA 3C0CA 2K6DA 5EC7A 4N4IA 1C1AA 1D0ZA 1FX7A 1U8RA 4M77D 3LW5E 2OTJT 1TG0A 2VGMA 1HD3A 5KYYA 4PJMA 2M9UA 1I4K1 4GBQA 2M02A 3ZFJA 4M77G 3V8KA 4ORZA 2OX7A 4M75A 2J06A 4RUGA 5GAOn 1AD5A 1WYXA 5D6WA 2VASA 1JU5C 4KUIA 4NL2A 4J7IA 1VQOQ 4C5EA 3VU3C 1UGRB 1SSHA 1TUGB 3TQ7P 4JJNK 3M59A 2YUQA 2LQKA 4M75F 3PMIA 3FJPA 2LTOA 2DE0X 4PJOA 4QQGA 3FRNA 4AFQC 3OS1A 4II1A 3CCVT 4IUTA 1GBQA 2ROLA 1FMWA 3JCMX 1Q7YC 4OMOA 1ZHIA 3M0SA 1T3LA 2GTOA 2DO3A 1IB8A 1K4US 3M53A 4PJOF 2JM9A 2BIVA 4KBMB 3M56A 1H3ZA 3VJPA 4RCCA 2HEQA 2JS2A 3CC2A 2XIDA 5GAOm 5I21A 1KD1C 3GPLA 2RNAA 1BBZA 3FLGA 1M1KC 2JMCA 2QYZA 2EJGA 1PSFA 3EFOA 1H3HA 2GCXA 3A8HB 2AKKA 4MDWA 2GQIA 2F1LA 1VQPA 1I5LA 4M77C 4HXJA 2KXDA 1SKUB 2K5LA 2YLCA 2I2LA 3VS1A 5CQYA 2HSPA 1OX9A 1J3TA 1VQ7A 2R58A 2MYSA 1CSKA 2DD5A 1H8KA 1KSWA 1YIJA 4DBRA 5KYUB 9ATCB 4A54A 1HJDA 4LE9A 5IT9E 2CH4A 4C0ZA 1NJIC 3OS0A 3OYAA 4HCKA 3TVTA 4FSXA 2EKOA 5GAOq 2JJ9A 1Y07A 1NBEB 4M78A 1M30A 1V1CA 4NS5A 1LJOA 1WXTA 4XTWA 3QYGB 1SRLA 1AHJB 1R77A 2RQWA 3RKYA 5CK9A 1VQNT 1R8OB 2MPXC 4KH1B 3GF5A 2A08A 2IVWA 4E7SA 5GANe 3CXCP 5GMKl 1W4SA 5FU7B 2RQUA 4C8QD 1VOMA 2J7IA 1AWWA 1VQ5A 1PD1A 4M78F 1UTIA 4DBFA 1GFCA 3C94A 1YFNA 1OZ3A 3GP8A 3EHRA 1VQMT 4C8QG 2R57A 3EFRA 5I2SA 1QWEA 3TSWA 3ULRB 1RI9A 3GNGA 1VIEA 1ZQ1A 2O9SA 4M7DE 3GOXA 1FYNA 3EH2A 1MV0B 1OZ2A 1P92A 1WNLA 2DIGA 2HSEB 5LJ5d 2MK5A 2QEXA 1PCXA 2KSSA 2KQWA 4L59A 3C12A 1LVKA 2X35A 4KGVB 3DB3A 5FU6C 2LJ3A 4PK4A 2DILA 3ER0A 4HA8A 2P0KA 2ED1A 2CUDA 2DXBA 2CUBA 3JCMf 4JS4A 4ZN3A 3JB9J 3OA6A 2LDMA 3M4YA 3NFCA 1KC8U 4BUGA 2OAUA 3R6OA 1M90U 1X75C 3G6ET 1U06A 3LWHA 2Y4YA 1WXUA 1PG5B 1UGSB 5GAN3 4PJJA 3VUZA 3OBWA 3QYHB 1M1FA 4R0KA 1G83A 1IO6A 2NWMA 3QJ6A 1M3CA 2BUDA 4OMQA 2YSQA 5KCOA 4M7DB 1VQLQ 4BY6B 3G1JA 4C8QC 2LMJA 2CDTA 4RG8A 4ELYC 3CCJT 2YUPA 1OPLA 3RR6A 2NUPB 4RTXA 3SHWA 3OQ5A 2W0ZA 1T3SA 2L89A 2WSEE 4C0GA 3JCMh 3M0PA 2CH4W 2XI9A 3EGXB 2R5MA 2YRDA 2DZ9A 2ZAEA 1JXOA 2ECZA 3WVDB 3LLRA 3S3OA 1UECA 2YT6A 3OYNA 4DBQA 2J05A 3ZL7C 2P0QA 3A8OB 3HRUA 3H8ZA 4OB0B 3QZ5B 2MWPA 3REAB 2GNCA 1W2BS 2E41A 4OMMA 4A53A 1ZLMA 3PE0A 2EGAA 3M4GA 1TUDA 1EZZB 1M1GA 2KDSA 2CT4A 4OMLA 4XTVA 2ZPGB 1QVFP 2V1QA 5I22A 3OYCA 2FYKA 1CKBA 4J9GA 2WSCE 1G3SA 4DOWA 1UUEA 1GRIA 1NPRA 3CC7T 1AEYA 3I56T 3E1SA 3L42A 2DTOA 2ZPEB 1Q86U 1Z9QA 2QG9B 2XD0A 1JO8A 1TH7A 3UWNA 2DXUA 3MKDA 2LJ1A 3CC4Q 1Q86R 4ZGDB 1JRIA 2O2OA 1VQ9Q 4J5YA 5L8RE 4M7AF 5GAMg 3CMET 3MCAB 3M5AA 2HKNA 3MEUA 3BW1A 1UB4A 3JCMJ 1NEGA 1K0XA 1VQ4Q 1VQ8Q 4AFUC 3CBPA 3OSSC 2CP5A 4N4HA 4RMOA 3OW2S 3JCMb 1FMKA 1RAFB 3CCMT 3CCSA 1PD0A 5KYUA 4FYWB 2EJFA 4DQ2A 1N6AA 1SHGA 2O4XB 3HL8A 2CREA 4BACA 1HXDA 4EMHA 1ZUKA 5GANg 1T0HA 2C0OA 5IH2A 3R6NA 3MEWA 1EFNA 4IIOA 3L1AA 4JJBA 2ATCB 4B9XA 2YUNA 3CCUQ 4KH0B 1H641 2DYBA 1YCSB 2XK0A 2DX1A 2HZYA 8AT1B 2AHJB 1A0NB 1MUZA 2QQBA 4M77B 4RKUE 4JUVA 2GBQA 2E64A 8ATCB 3SDZA 4CC7A 3QSUA 2CP7A 2E3IA 2D1XA 3M0TA 5LL6S 1ZUYA 4DOVA 3H6ZA 1WGSA 1BI3A 2OTLA 4M7DD 3EG3A 2PU9B 2A7YA 4BI4A 3CCQA 4CC3A 3BY7A 3A8MB 2RH2A 2MCNA 1Q82R 2GFUA 4KULA 1AOJA 1HSQA 1YBYA 1WDXA 2LT1A 4M7DG 2JNGA 1K1ZA 2VKNA 3NMZC 3GNFB 4F17A 2MAMA 1M3AA 3I55Q 3CCEQ 1VUBA 3E2UA 3CCLQ 1X6GA 1QVGS 4ZN1A 1Q95G 5DY9A 3CPWA 4FW2A 2JUFA 3LYIA 5FLXE 1YJNQ 1BI2A 3SFMA 1NE8A 4DEYA 1LOJA 4E6RA 2GFAA 2J6FA 4JLGA 2RD1A 2QI2A 4KT0E 1X69A 2P4RA 1PSEA 1D0YA 1FXXA 2OTJQ 3DKMA 3KUFA 2HBWA 2XDPA 5LJ5j 1K73C 4OMFB 3VRYA 2C0TA 3NGPA 4C0DC 3G4SA 2RI5A 3CQTA 1RABB 2BZXA 2MIOA 2DTHA 4CC4B 4LD9K 2DAQA 2BE9B 2K5IA 2EYYA 3CMAQ 2O31A 4OP0A 2NUPA 1EX4A 1OU8A 2YHTA 1QW1A 2ZPIB 4PKCC 4J9DA 1VQLA 2QQ9A 3HKSA 2GQVA 2LRQA 3VUBA 4M7DC
chains in the Genus database with same CATH topology
3CXCS 3CC2A 1G3YA 4QQ6A 5GAN4 2XIDA 1UGQB 3BFMA 3CC2T 2P4TA 5A0GA 2XDDA 3JCMc 2H3JA 5GAOm 5I21A 2EAYA 1KD1C 3GPLA 3CXCA 3OYFA 3A8LB 2V8KA 3FLGA 1M1KC 3EFSA 4OF1A 2EJGA 1PSFA 2CS7A 2XICA 5CIUA 2GCXA 2KMTA 3A8HB 2HNIA 1O9SA 2DKGA 4MDWA 1SSFA 4C92B 1VQPA 1I5LA 4M77C 4XTYA 1VQPT 3HFOA 3X24B 4M7DF 4EMGA 4BE0A 5CR2A 2PUOB 3SB2A 2K2VA 5C0MA 4LDUA 4J83A 2K5LA 1XOVA 2RJCA 2YLCA 4Y28E 4EMKB 5HY6A 1I8FA 3V7RA 5GAOl 2I2LA 5CQYA 2M16A 1VQ7A 3SWNA 2R58A 4LDVA 4P5NA 4XQ3A 4A4GA 1Y71A 3HRTA 4N4GA 1VQ7T 4C8QB 1Q82C 2DD5A 3V8LA 4M7AD 3A8GB 4EPCA 4F7UA 1KQSA 1YIJA 3L2WA 5CO7A 3O8VA 1YIJT 3VV0A 1Y96A 3VYGA 4A54A 2FHDA 4J6XA 3JAME 5IT9E 1G3WA 2E5QA 2LC4A 2M1HA 2JTFA 3QUIA 4C0ZA 5GMKm 1UEBA 3OS0A 3OYAA 1NJIC 3NTIA 4C92D 3ME9A 1BI0A 4FSXA 4M78E 3M9QA 2EKOA 4IUQA 5GAOq 1YJWA 1Y07A 3V8JA 2DXTA 5CKFA 4M7AG 1YJWT 3M54A 4M78A 3V7CA 2B8AA 4NS5A 1LJOA 4XTWA 2F5KA 4XTZA 3QYGB 1DJ7B 1AHJB 1K9MC 3QHSA 4XU0A 2CYZB 3RKYA 3CPWS 2RK1A 3TEEA 5CK9A 1VQNT 1R8OB 5GANh 4C92G 5LJ3e 3GF5A 5KE3A 4XTUA 1RI0A 2XDBA 2QTXA 2IVWA 3LH0A 5GANe 1NPPA 5GMKl 5IN1A 1W4SA 4XU2A 2WSFE 5FU7B 4C8QD 2V8IA 3OS2A 2ZPHB 1N8RU 1BKBA 1VQ5A 2PQWA 4M78F 4JS5A 1QVPA 5GAOp 1N27A 3C94A 3S6WA 3CC4A 1KHIA 1Q86C 2D0QB 2CKKA 3CBOA 1W2BA 1OZ3A 3E9GA 3CC4T 1D3BB 3GP8A 1VQMA 3CBMA 3CD6A 4Y91A 3L2RA 4N0AA 1VQMT 3P8BB 3E19A 5GAMj 3CD6T 3MP1A 3P8HA 4C8QG 1GXIE 2R57A 3ZBDA 3EFRA 4D6WA 5I2SA 3JCMd 2K3YA 2HQXA 3QO3A 1UGPB 1WQ7A 1QP2A 2JN0A 3S3NA 2O4XA 2VXEA 3GNGA 4X9CA 1S72A 4OGCA 2EQUA 5CKBA 5D6XA 1VIEA 1ZQ1A 4KUDK 4EDUA 4M7DE 3V7SA 1S72T 1VIFA 3GOXA 2Y90A 4M7AA 4HT9A 2ZPBB 2M0OA 3JB9F 4M7DA 4IUVA 1OZ2A 1P92A 1WNLA 2E6ZA 2DIGA 5LJ5d 4A4KA 5C6SA 2QEXA 5KCHA 1M8VA 2KSSA 4J8OA 4N0AC 3RKWA 2KQWA 4L59A 3JCMV 2QEXT 5I2MA 2MMPA 4LDWA 1FWZA 1WPYA 3C12A 1X01A 4JRKA 3GIBA 3JCMg 3CCRA 2X35A 5FU6C 3DB3A 2DK3A 2RHUA 3FB9A 4XU1A 3CCRT 4M77E 3CMEA 1Q81C 1B34A 3VYHB 2QXFA 4ZGJB 5LJ3j 4BD3A 3ER0A 2LNVA 3OYJA 1K73U 3C95A 4HA8A 5GANj 1M5Q1 2BKDN 2LCLA 2P0KA 2RK2A 4M77A 4VUBA 5AYFA 3JSCA 3JB9I 4M7AC 2DXBA 4FT2A 3JCMf 3X26B 4ZN3A 5LJ5g 4JS4A 3JB9J 3OYKA 2L3RA 4MMKA 3OA6A 1KG1A 1YJ9A 2LDMA 2V8JA 3KXTA 3M4YA 3NFCA 3L2ZA 4M75B 3M55A 1HK9A 2E10A 4FT4A 4E7KA 3G6EA 4BUGA 4C92C 2OAUA 1KC8U 2RO0A 3R6OA 3UT1A 4OB1B 4UC4A 3HPWA 1Q7YU 1M90U 1X75C 3MP6A 3G6ET 1Y7XA 4ATOA 3LWHA 2Y4YA 2RHZA 4M77F 5D6YA 2PVDB 1UGSB 1X6OA 1YITA 4ME7A 5KE2A 3VUZA 2XG8D 5GAN3 4IKFA 2EJ9A 1JBMA 3OW2A 1YITT 4O6JA 4MZMA 3OBWA 5GAN2 2E1HA 2HAXA 2DTIA 3QYHB 1M1FA 2HBPA 3MEVA 4MZPA 3INZA 3QJ6A 2BUDA 3OYHA 4PLLA 1IZ6A 1G3TA 4FM4B 4C5HA 5KCOA 1QVFA 1WJQA 2LCCA 4M7DB 4IUUA 4A4HA 4NOYA 4PJOB 2YLBA 4BY6B 4J6WA 1KD1U 4BI3A 4C8QC 2EFIA 1KQ2A 2LQ8A 3QG1A 3RERA 5FROA 1M1KU 2DXCA 4XTXA 3FEOA 5GMKh 1KQSS 3CCJA 2E65A 3F70A 2JVVA 3DB4A 4RG8A 3X20B 3QIIA 4ELYC 3HRSA 4F7UE 4OB2B 2KY9A 5GAN7 5GMKe 3CCJT 2DD4A 2EQKA 3OMGA 4QVZA 2JOYA 3DLLA 3LGFA 3OQ5A 4HCZA 3OYDA 1ZBXA 4RG2A 2PVGB 4HCBA 4M75D 1OI1A 4B9WA 3TREA 2L89A 1LNXA 2WSEE 3HP9A 4C0GA 5M9OA 4BE2A 2QQRA 2RJDA 4J7FA 2O01E 4IUPA 3GLXA 3JCMh 5GAN6 3PMTA 4QVCA 2XHCA 2XI9A 3J81E 3JCMe 2RB6A 2R5MA 3MHXA 4XAXB 1OYXA 2DZ9A 3T9NA 2VGNA 3CCEA 4LDYA 1K8AC 2QA4A 4OGEA 3TCJA 1RL2A 3CEYA 3CCLA 3CCET 1G5VA 2RHIA 3META 4M75G 4F7UF 4QVDA 2QA4T 4JDSA 2YRVA 1XNIA 3OYLA 3WVDB 4JRPA 2R5AA 3N5BB 2ZCFB 3LLRA 4E7JA 3S3OA 1YI2A 1Q82U 3OYNA 4PJOD 3KBGA 2P0QA 2HQEA 3OBYA 2NLUA 3P8DA 3A8OB 5FU7C 2VC8A 3HRUA 4PL6A 3H8ZA 3RMQA 4PNOA 3MP8A 2QQAA 3G71T 4BI8B 4JRIA 4OB0B 3OSVA 4HT8A 2CZ6B 3QZ5B 1V29B 3PGGA 5HK3A 3QDRB 3UPUA 2MWPA 3OY9A 1BIBA 2GF7A 2WACA 5A2QE 1NJIU 3AHUA 1W2BS 5FRNA 3J80E 2E41A 1U1SA 1YCYA 4C5GA 1VQ5T 5DLOA 3QXEB 3OYMA 4PJOG 2XU8A 4A53A 4BB7A 3M4GA 3EAEA 5GAN8 3SD4A 3SWNB 1M1GA 1VQ9A 2CZ1B 2KDSA 3OYYA 3QPHA 5J3BA 3M57A 4XTVA 3OYEA 1K9MU 1VQ9T 2ZPGB 3PFSA 2FB7A 4L5GA 4XK8E 3OYCA 2FYKA 4F7UB 2MI6A 4A4EA 5J26A 3FC3A 4QW2A 2WSCE 3OYBA 1G3SA 3WXMB 3G71A 1QVGA 2K4YA 2PVOB 3RIRA 2A3LA 2DZCA 4C0FA 4DOWA 1Y96B 5GAN5 2D9TA 4M7AE 3CC7A 3CMAA 3I56A 5CQXA 2ZPFB 4E7HA 3JB9H 5GAMd 1NPRA 3CC7T 1VQ4A 3I56T 3E1SA 3L42A 1XQHA 2EQJA 3CMAT 2D6FA 1VQ8A 2DTOA 5J39A 3L2VA 2ZPEB 4BDZA 1VQ4T 1Q86U 3QKJA 1VQ8T 4MMLA 1YHQA 2XD0A 1TH7A 4M78B 1O75A 3UWNA 4C92E 3OB9A 2DXUA 2K3XA 2RI3A 1YHQT 3RESA 2FVUA 4ZGDB 4J6YA 2E70A 4C92A 2F69A 1JRIA 1JJ2S 1WJSA 1VQKA 3JCMQ 1BYMA 3MO8A 4J5YA 2LVMA 5L8RE 4M7AF 3WVEB 5GAMg 3CMET 2DIQA 3MCAB 4V2SA 1JJ2A 2RJFA 2MF2A 3M5AA 3RUXA 4ZTFA 4EMKA 2XKOC 2F5TX 3MEUA 1XTDA 4TVRA 4FU6A 4M75C 4E7LA 3BW1A 1UB4A 3QBYA 4C5IA 4C0DB 3JCMJ 3CCUA 2K5FA 3X28B 4C8QE 5LJ3d 1WQWA 4C92F 5GAMf 3NTHA 5HKCA 3FDRA 3CCUT 1KQ1A 4BE1A 1YJ9T 5GANd 2CZ7B 1VQKT 3CBPA 3OSSC 4CRIA 4C8QA 2VYTA 4E47A 3LWIA 2CZ0B 4N4HA 4RMOA 3OW2S 3JCMb 2VUBA 3CCMA 3PIPA 5LJ5f 3CCMT 3Q1JA 1BI1A 1U1TA 4Q5WA 2FL7A 3CCSA 3MEAA 1QP3A 4JRQA 1Q81U 2EJFA 4DQ2A 4M78D 5FU6B 3CCST 5CVIA 1N6AA 1BIAA 3BDLA 4ZGEB 1QVFS 3J7AF 4EMKC 4HCCA 2O4XB 3HL8A 2RHYA 4PJOC 4BACA 3PIOA 3G7ZA 2JZ2A 2KK4A 2RJEA 4X9DA 4JLIA 4BY6C 2DPPB 3JCMP 1HXDA 5LJ3g 2L8DA 4LD6A 4M7AB 4EMHA 4MZTA 5CCAA 4A4FA 3NTKA 4C8QF 5GANg 5IAYA 4CI0C 3MEWA 4BDYA 2QQSA 4E7IA 3L1AA 4B9XA 4M78G 4LDXA 2LX9A 1H641 4L6V5 4OVAA 2VV5A 4PLIA 5LJ3f 3C4SA 3DLMA 2C06A 2G3RA 2ZZDA 5GANf 3BDUA 2QDYB 2XK0A 4HKEA 2E12A 2EWNA 3M58A 3CPFA 4O5VA 1B34B 2AHJB 2L5QA 2VXFA 4OB3B 4RCBA 3JB9D 4MDXA 3LGLA 3JRZA 2QQBA 4M77B 3ASKA 4IURA 4RKUE 2EQMA 4JUVA 2RHXA 1NZ9A 2RM4A 2E64A 5CKEA 3RKXA 3OS5A 4X34A 4Z02A 3PNWC 3SDZA 3I55A 3E9FA 2K57A 3QSUA 1D3BA 5CKDA 5GAMh 4FL6A 3I55T 4ELZC 1IREB 4GY5A 3OYIA 3PTAA 3QJYA 5KH6A 5GAMe 5LL6S 3CCLT 5HK0A 3S3MA 4DOVA 3H6ZA 2E6NA 3JB9G 1WGSA 5LJ5h 1BI3A 1N9SA 4FIBA 4QQDA 4YTLA 2OTLA 2DEQA 2RI2A 4M7DD 2PU9B 3TU4K 2A7YA 4BI4A 2X4WA 5LJ5e 3CCQA 1YJNA 2OTLT 1WJRA 3HHTB 1YJNT 3CCQT 5GMKi 3BY7A 2RA2A 3A8MB 2RH2A 4GLKA 5CKHA 4NL3A 1N8RC 2GFUA 4KULA 5GAOr 2X4XA 1YBYA 2Y4XA 4N4IA 3SWNC 1K8AU 2LT1A 1FX7A 4M7DG 2OTJA 2JNGA 1U8RA 4M77D 3HFNA 4R55A 3LW5E 3GNFB 2MAMA 2OTJT 1VQOA 1M4ZA 2VGMA 1VQNA 2KVQG 3OMCA 1VUBA 5LJ3h 1VQOT 3JCMW 5GMKj 3L2UA 1QVGS 3URGA 4ZN1A 2M9UA 5DY9A 3CPWA 1I4K1 5FRMA 3UDCA 2KAFA 2JUFA 3LYIA 5FLXE 3ZFJA 3L2QA 4M77G 1BI2A 3SFMA 3V8KA 1NE8A 4M75E 4M78C 1LOJA 1EIFA 2GFAA 4R56A 4M75A 4JLGA 2RD1A 2QI2A 5GAOn 1I81A 4KT0E 1PSEA 5D6WA 1FXXA 5EG2A 2JTMA 4KUIA 2X4JA 3HSBA 2EIFA 3DKMA 2EYQA 3KUFA 3QZ9B 4NL2A 2CGHA 4J7IA 2XDPA 4C5EA 3VU3C 1UGRB 4DA4A 5LJ5j 1N9RA 3LX7A 1K73C 2MWOA 1YI2T 4OMFB 2LT4A 2ZGWA 3M59A 4JJNK 4WF2A 3X25B 2IG0A 2LQKA 4PJOE 3G4SA 4C0DC 2RI5A 4M75F 3PT9A 3PMIA 2DTHA 1H3ZA 3G4ST 3FJPA 2X4YA 2LTOA 4PJOA 4QQGA 1M9SA 3FRNA 5A0DA 3CCVA 4LD9K 2DAQA 3A5ZB 2K5IA 3OS1A 4II1A 3ZEHA 3CCVT 1JB0E 2DVEA 4IUTA 5A0LA 3OYGA 1KC8C 4OP0A 3JCMX 1Q7YC 1M90C 5CAIA 3VKIA 1VQ6A 1MGQA 2YHTA 1ZHIA 1VQ6T 1QW1A 4XU3A 4M7DC 2P0PA 1MHNA 3FIFA 2ZPIB 2DJZA 2DO3A 4PKCC 4F7UG 3M53A 5DLQE 4PJOF 2BIVA 1VQLA 2HD0A 4KBMB 2PUKB 5DM7R 2QQ9A 3HKSA 2GQVA 2LRQA 3M56A 1KHCA 3VJPA 3VUBA 4ZTJA 1VQLT 4RCCA 3RMSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MDW A; 
#chains in the Genus database with same CATH topology
 3EGX A;  3QWX X;  1G3Y A;  1B07 A;  3BFM A;  3CC2 T;  2CSI A;  5A0G A;  2ENM A;  3OYF A;  2V8K A;  3CCV Q;  3EGD B;  1R0B G;  1ZBJ A;  1O9S A;  1VQP T;  4BE0 A;  3SB2 A;  2K2V A;  4J83 A;  4EMK B;  1X2Q A;  5GAO l;  3MPU B;  4KGZ B;  4P5N A;  5IHN A;  2FRW A;  2X3X D;  2H8H A;  1VQ7 T;  1RAE B;  2L3S A;  1Y57 A;  4C8Q B;  2JMA A;  5IXB A;  1Q82 C;  4EPC A;  1KQS A;  2LP5 A;  5CO7 A;  1D0X A;  1YIJ T;  2FHD A;  3JAM E;  1WZO A;  3AT1 B;  1YP5 A;  2KRM A;  2P84 A;  2G6F X;  1KIK A;  4ESR A;  4IUQ A;  1WFW A;  2DXT A;  2B8A A;  4JJD A;  4XTZ A;  3VS3 A;  1DJ7 B;  1K9M C;  3TEE A;  2LZ6 B;  5GAN h;  1BK2 A;  4J9C A;  2NUZ A;  5KE3 A;  3LH0 A;  4RTZ A;  4XU2 A;  1N8R U;  2ROT A;  2A0F B;  2DL4 A;  3S6W A;  4FYY B;  3CC4 A;  1KHI A;  1GCQ A;  2D0Q B;  2BTT A;  2CKK A;  3CBO A;  1N8R R;  3CD6 A;  1LPL A;  2NUT B;  4AMC A;  1AWX A;  4D6W A;  2K3Y A;  1VQN Q;  2JW4 A;  2JN0 A;  2O4X A;  4X9C A;  1S72 A;  5CKB A;  4EDU A;  2COW A;  3V7S A;  1RUW A;  2ZPB B;  1GCQ C;  3JB9 F;  1UHF A;  3BE3 A;  2E6Z A;  1GBR A;  2EYX A;  4PJL A;  5KCH A;  1BU1 A;  3JCM V;  2QEX T;  5I2M A;  1WPY A;  2FPD A;  4JRK A;  3JCM g;  3CCR A;  4FW1 A;  2DK3 A;  3FB9 A;  1VQM Q;  1U3O A;  1Q81 C;  2QXF A;  4ZGJ B;  4M77 A;  3JB9 I;  3QDF A;  5KYX B;  3H0H A;  1YWO A;  3X26 B;  4FSS A;  2KNB B;  1HYO A;  2YXY A;  2V8J A;  2EKH A;  3L2Z A;  2K79 A;  4ANJ A;  2RO0 A;  4OB1 B;  4ATO A;  4M77 F;  5D6Y A;  2PVD B;  4ME7 A;  4MZM A;  1W2B P;  1VQ6 Q;  1UGV A;  1G3T A;  2LCC A;  2YLB A;  3HTR A;  1UE9 A;  2EFI A;  3RER A;  3QG1 A;  1ZSG A;  5FRO A;  4LN2 A;  2E65 A;  3F70 A;  3X20 B;  4F7U E;  5GAN 7;  1ABQ A;  1SG5 A;  1E6G A;  1Y0M A;  2O01 E;  4IUP A;  3GLX A;  1RAC B;  3MHX A;  3T9N A;  3CCE A;  2QA4 A;  3CCL A;  1UJY A;  2VVK A;  3MET A;  4QVD A;  4QT7 A;  2YRV A;  1D1C A;  1YI2 A;  4A63 B;  3P8D A;  1M3B A;  3KBG A;  3V7C A;  3CCJ Q;  2HMA A;  2EPD A;  5KYW B;  2CZ6 B;  5HK3 A;  1BIB A;  2WAC A;  2VB6 A;  3EG1 A;  3J80 E;  1YCY A;  5DLO A;  3QXE B;  4Z88 A;  3OW2 P;  3EAE A;  2CZ1 B;  3QPH A;  1YJW Q;  3M57 A;  4LNP A;  4DEX A;  4F7U B;  2COZ A;  4A4E A;  5J26 A;  3FC3 A;  4D8K A;  2K4Y A;  2PVO B;  2A3L A;  2DZC A;  4C0F A;  2KYM A;  1NYG A;  3CMA A;  2LCS A;  1XQH A;  2EQJ A;  4BDZ A;  4PFZ A;  3QKJ A;  3EGD A;  1YHQ A;  2EQI A;  4C92 E;  2PTK A;  3OB9 A;  2RI3 A;  3EG9 B;  3O5Z A;  4J6Y A;  3IQL A;  4LUD A;  1IGQ A;  3MO8 A;  4V2S A;  2DRK A;  2RJF A;  2E4H A;  4EMK A;  3REB B;  1WHM A;  1QWF A;  2DL3 A;  4FU6 A;  4TVR A;  4E7L A;  3QBY A;  2COY A;  4C0D B;  3CC7 Q;  3I56 Q;  5LJ3 d;  4OMN A;  5HKC A;  1YJ9 T;  3NTH A;  1VQK A;  3FDR A;  1KQ1 A;  4CRI A;  4C8Q A;  2VYT A;  2CZ0 B;  1UDL A;  3NPF A;  4DBH A;  1R0C B;  3Q1J A;  2FL7 A;  3MEA A;  1KC8 R;  3CCS T;  4J9I A;  1M90 R;  1BIA A;  3RDV A;  4ZGE B;  3J7A F;  4EMK C;  4HCC A;  2QTV A;  3CME Q;  2KK4 A;  2RJE A;  1QLY A;  1GCP A;  2RQT A;  2KR3 A;  4MZT A;  5CCA A;  4C8Q F;  1Z9Z A;  1JXM A;  2L2P A;  1QVG P;  1KFZ A;  2C06 A;  2G3R A;  2ZZD A;  2EWN A;  3M58 A;  2DEU A;  3CCM Q;  1B34 B;  2L5Q A;  4OB3 B;  1YIT Q;  3ASK A;  2EQM A;  1MMD A;  2RHX A;  4X34 A;  4FL6 A;  1IRE B;  3OYI A;  3PTA A;  2NUT A;  1YWP A;  1JJ2 P;  2HQH A;  4YTL A;  5LJ5 e;  2OTL T;  5AT1 B;  1VYT A;  3HHT B;  3CCQ T;  5CKH A;  2LNH B;  2PNI A;  1UFF A;  4NL3 A;  2Y4X A;  3SWN C;  1K8A U;  1I5O B;  4R55 A;  1CKA A;  1VQO A;  1M4Z A;  1S1N A;  1VQN A;  2KVQ G;  3OMC A;  1K8A R;  3JCM W;  1K9A A;  3URG A;  2L3P A;  3UDC A;  5KYX A;  3G71 Q;  3PVL A;  2AZV A;  4M75 E;  2QAS A;  1EIF A;  5GJV B;  4R56 A;  1I81 A;  1QCN A;  2DM1 A;  3HSB A;  1LCK A;  2EIF A;  1N9R A;  3LX7 A;  2DLP A;  2LT4 A;  3X25 B;  2IG0 A;  4PJO E;  1ZSZ B;  3G4S T;  2X4Y A;  5ECA A;  3A5Z B;  3JV3 A;  3ZEH A;  2YWW A;  1PWT A;  1KC8 C;  4FCY A;  1M90 C;  1VQ6 A;  2Z0W A;  4XU3 A;  2L0A A;  2V1R A;  2P0P A;  3FIF A;  4F7U G;  5DLQ E;  5DM7 R;  2KE9 A;  1VQL T;  3RMS A;  3CXC S;  1UGQ B;  2P4T A;  2XDD A;  3JCM c;  2H3J A;  1AT1 B;  3CXC A;  4OF1 A;  1SHF A;  1GFD A;  2CS7 A;  2CP0 A;  5CIU A;  1SSF A;  5KYN A;  5KYW A;  4XTY A;  3VS4 A;  3X24 B;  4EMG A;  5CR2 A;  2PUO B;  2E5K A;  5C0M A;  2RJC A;  3V7R A;  3CC2 Q;  4LDV A;  4XQ3 A;  2RN8 A;  3EG2 A;  3HRT A;  1PRM C;  2DVJ A;  4N4G A;  1T0J A;  3A98 A;  3NHN A;  1W70 A;  4F7U A;  3UA6 A;  2F2X A;  2OAW A;  3O8V A;  4J6X A;  4AG1 C;  1VQP Q;  2DFU A;  1G3W A;  2E5Q A;  2LC4 A;  2M1H A;  2JTF A;  4F14 A;  1VA7 A;  1UEB A;  1TUC A;  3NTI A;  4J9H A;  4C92 D;  1TTH B;  3ME9 A;  1BI0 A;  4M78 E;  3M9Q A;  2JM8 A;  1WA7 A;  1UJ0 A;  2RQV A;  1YJW A;  5CKF A;  3M0U A;  2F5K A;  4JPB W;  3EG9 A;  4Z8A A;  3QHS A;  1I07 A;  1VQ7 Q;  3CPW S;  2RK1 A;  1NLO C;  1M2V B;  4C92 G;  1RI0 A;  4E7Z A;  1NPP A;  2ZPH B;  3LH5 A;  2PQW A;  4JS5 A;  4X1V A;  5GAO p;  2EYW A;  2CP2 A;  1Q86 C;  3CC4 T;  1D3B B;  3QWY A;  2KEA A;  4N0A A;  3CD6 T;  2F2W A;  1RAG B;  2GGR A;  2FZC B;  2QAZ A;  1GL5 A;  1OV3 A;  2J6K A;  1WQ7 A;  4HVV A;  1QP2 A;  3S3N A;  1YN8 A;  1U5S A;  1ACM B;  2VXE A;  5D7U A;  1NG2 A;  4KUD K;  1S72 T;  2B86 A;  4HVW A;  1D1A A;  4HT9 A;  2JS0 A;  1BCM A;  2IPO B;  2OJ2 A;  1IXD A;  4M7D A;  4IUV A;  1H92 A;  2D8J A;  4WCI A;  4N0A C;  1X01 A;  3GIB A;  2LJ0 A;  2RHU A;  3VS5 A;  4XU1 A;  3CCR T;  1I0C A;  3CME A;  1B34 A;  3VYH B;  1YNZ A;  5LJ3 j;  4ZNX A;  4BD3 A;  2EBP A;  2LNV A;  1MND A;  2OI3 A;  3C95 A;  1BCO A;  2BKD N;  2LCL A;  2RK2 A;  1ZUU A;  5AYF A;  4VUB A;  4M7D F;  3JSC A;  1IHV A;  4JZ4 A;  1AWJ A;  4FT2 A;  5HCK A;  1KG1 A;  1PC0 A;  5LJ5 g;  2L3R A;  1BB9 A;  2JTE A;  3RBB B;  4E7K A;  4FT4 A;  1X6B A;  4C92 C;  1IGU A;  1Q7Y U;  2O9V A;  1Y7X A;  2QEX Q;  1YIT A;  2RQR A;  5KE2 A;  4IKF A;  2XG8 D;  1JBM A;  2EYZ A;  4O6J A;  1RAA B;  2FEI A;  5GAN 2;  2E1H A;  2HAX A;  1I1J A;  2HBP A;  3MEV A;  3INZ A;  2JT4 A;  3OYH A;  4PLL A;  1IZ6 A;  1VYU A;  2CP6 A;  4FM4 B;  1QVF A;  1PHT A;  4A4H A;  4NOY A;  1N5Z A;  2F2V A;  4J6W A;  1KD1 U;  4BI3 A;  1M1K U;  1M8M A;  3FEO A;  1KQS S;  2JVV A;  3DB4 A;  3HRS A;  4OB2 B;  5GMK e;  2DET A;  1C6V X;  2DD4 A;  3OMG A;  1KD1 R;  3DLL A;  3LGF A;  4HCZ A;  1M1K R;  1ZBX A;  4HCB A;  4M75 D;  1LNX A;  1WHH A;  3HP9 A;  1B7T A;  4BE2 A;  4HVU A;  2QQR A;  2RJD A;  4J7F A;  2E3H A;  5GAN 6;  3PMT A;  3VRZ A;  4XAX B;  1OYX A;  4LDY A;  2QGG A;  4OGE A;  1RL2 A;  3CEY A;  3CCE T;  1G5V A;  2RHI A;  4M75 G;  2QA4 T;  1OU9 A;  4JDS A;  3I5R A;  1XNI A;  3OYL A;  4JRP A;  2ZCF B;  4PJO D;  3G71 A;  1YI2 T;  2NLU A;  5FWB A;  2QQA A;  4HT8 A;  1D1B A;  3RNJ A;  1AWO A;  1NJI U;  1ZX6 A;  1ZSZ A;  2LX7 A;  5A2Q E;  2CP3 A;  3H9N A;  1U1S A;  1VQ5 T;  4C5G A;  1ARK A;  3OYM A;  4PJO G;  2XU8 A;  3D7S B;  1NJI R;  4BB7 A;  3SD4 A;  1X27 A;  2AZS A;  2GTJ A;  3SWN B;  1VQ9 A;  3OYY A;  2DBK A;  4E2F B;  2DJQ A;  1FMV A;  2FB7 A;  4XK8 E;  4LXC A;  3OYB A;  1ZSZ C;  3RIR A;  1Y96 B;  4M7A E;  5CQX A;  4E7H A;  5GAM d;  1VQ4 A;  2SRC A;  3CMA T;  1VQ8 A;  3FJ5 A;  3L2V A;  3THK A;  1WI7 A;  4PFP A;  1O75 A;  5IXF A;  1G2B A;  1YHQ T;  1M27 C;  4J9B A;  2FVU A;  2KRN A;  5GJW B;  3KFV A;  2YDL A;  3M0R A;  1BYM A;  3SEM A;  2LVM A;  2PZ1 A;  2DIQ A;  2MF2 A;  4ZTF A;  1QQJ A;  1TOV A;  2X51 A;  4M75 C;  5IHI A;  1IHW A;  3CCU A;  2K5F A;  2DL5 A;  1WQW A;  5GAN d;  2CZ7 B;  1VQK T;  2RMO A;  4E47 A;  2YUO A;  3LWI A;  2VUB A;  3PIP A;  5LJ5 f;  1MV3 A;  1BI1 A;  2DA9 A;  4FYV B;  4M78 D;  1W6X A;  2FG0 A;  1K76 A;  4CC2 A;  1OX8 A;  4PJO C;  3PIO A;  4X9D A;  4JLI A;  2DPP B;  2RPN A;  2L8D A;  4LD6 A;  4M7A B;  2DYI A;  4A4F A;  2K7A A;  3NTK A;  3I5S A;  5IAY A;  2RF0 A;  4BDY A;  1TXQ A;  1PKS A;  4M78 G;  1YJ9 Q;  4LDX A;  2DF6 A;  1UG1 A;  4L6V 5;  4OVA A;  2VV5 A;  4PLI A;  5LJ3 f;  1OOT A;  1M2V A;  2IIM A;  2QDY B;  4AT1 B;  3G6E Q;  2VXF A;  2EVR A;  4RCB A;  3LGL A;  3JRZ A;  3CCS Q;  4IUR A;  3RKX A;  1SRM A;  4Z02 A;  3PNW C;  3I55 A;  3E9F A;  1D3B A;  5CKD A;  2CT3 A;  5KH6 A;  5GAM e;  5LJ5 h;  1N9S A;  4FIB A;  4QQD A;  2RI2 A;  2M51 A;  3TU4 K;  1YJN A;  1TWB A;  1PRL C;  5GMK i;  1C0M A;  2RA2 A;  1MMA A;  1RLQ C;  2X9H A;  1N8R C;  1OQK A;  3H41 A;  2OTJ A;  2AT1 B;  2EGC A;  3HFN A;  1G8X A;  5LJ3 h;  1VQO T;  2HDA A;  2FPF A;  5GMK j;  3UF4 A;  3L2U A;  4RTV A;  2M0Y A;  2KRO A;  2HL3 A;  1QKW A;  5FRM A;  2KAF A;  2OTL Q;  1ABO A;  3L2Q A;  3CCQ Q;  2FPE A;  4RTT A;  4M78 C;  2YRC A;  2KRS A;  2DL7 A;  2K2M A;  2L3Q A;  5EG2 A;  2JTM A;  2X4J A;  2EYQ A;  3QZ9 B;  2CGH A;  4DA4 A;  2MWO A;  1V76 A;  2K3B A;  2ZGW A;  1SEM A;  4WF2 A;  4D8D A;  3PT9 A;  4EIK A;  1M9S A;  5A0D A;  2ED0 A;  3VS0 A;  3CCV A;  1JB0 E;  1VYV A;  2DVE A;  2FRY A;  5A0L A;  4M4Z A;  5CAI A;  3VKI A;  1MGQ A;  1VQ6 T;  4RTW A;  1MHN A;  2DJZ A;  2I0N A;  4F16 A;  1MMG A;  2HD0 A;  2PUK B;  4ZTJ A;  1KHC A;  5IN1 A;  4QQ6 A;  5GAN 4;  3GBQ A;  3EG0 A;  3G4S Q;  1WHG A;  3I9Q A;  2EAY A;  3A8L B;  3CPW P;  3EFS A;  1JQQ A;  2XIC A;  2KMT A;  2AKL A;  2HNI A;  2DKG A;  1NM7 A;  1K0S A;  4C92 B;  1RAD B;  2QGF B;  4KRT A;  3VS7 A;  3HFO A;  1M2O A;  3EHQ A;  4LDU A;  1XOV A;  4Y28 E;  4AFZ C;  5HY6 A;  1I8F A;  4K11 A;  1XJW B;  2KYB A;  2HL5 C;  2M16 A;  2HKQ B;  3SWN A;  1TSF A;  4A4G A;  1Y71 A;  3VS2 A;  3V8L A;  4M7A D;  3A8G B;  3L2W A;  1MNE A;  1KK7 A;  2BE7 D;  4JZ3 A;  1QCF A;  3VV0 A;  1Y96 A;  3VYG A;  2AIR B;  2XMF A;  5GMK m;  3QUI A;  2FZK B;  1WHJ A;  2NYS A;  1OEB A;  1RAI B;  1JEG A;  3V8J A;  4M7A G;  1YJW T;  3M54 A;  3PVQ A;  3EH1 A;  4GLM A;  4XU0 A;  2CYZ B;  5LJ3 e;  2LQN A;  1WXB A;  4XTU A;  2XDB A;  2QTX A;  1PKT A;  2WSF E;  2V8I A;  3OS2 A;  1BKB A;  1QVP A;  1N27 A;  4LUE A;  3EGU A;  2EW3 A;  1W2B A;  3E9G A;  3UAT A;  1VQM A;  3CBM A;  4Y91 A;  3L2R A;  3P8B B;  3E19 A;  5GAM j;  1NYF A;  2BZY A;  3P8H A;  2A36 A;  3MP1 A;  1OPK A;  1GXI E;  1QKX A;  3ZBD A;  2H3E B;  1MMN A;  3JCM d;  2HQX A;  3QO3 A;  1UGP B;  2DNU A;  4RTU A;  4OGC A;  2EQU A;  5D6X A;  1VIF A;  4M7A A;  2Y90 A;  2M0O A;  1KQS P;  4QKU A;  1AVZ C;  2D8H A;  1WHL A;  3UA7 A;  4A4K A;  5C6S A;  1X2K A;  1M8V A;  4J8O A;  3U23 A;  2DRM A;  3RKW A;  2MMP A;  4LDW A;  1FWZ A;  2MOX A;  1IRX A;  3CD6 Q;  5KYY B;  1NEB A;  2VWF A;  4M77 E;  2J6O A;  1K73 U;  2DMO A;  3OYJ A;  2DER A;  1PNJ A;  5GAN j;  1M5Q 1;  3A1P A;  4M7A C;  1K73 R;  3OYK A;  4MMK A;  4AG2 C;  1S72 Q;  1YJ9 A;  3KXT A;  2QK0 A;  4M75 B;  3M55 A;  1HK9 A;  2E10 A;  3G6E A;  2FO0 A;  2EGE A;  1WHK A;  3UT1 A;  4UC4 A;  2V26 A;  3HPW A;  3MP6 A;  2A28 A;  1F1B B;  2RHZ A;  5L23 A;  1X6O A;  2EJ9 A;  1QMC A;  3OW2 A;  1YIT T;  3CCR Q;  2DTI A;  4MZP A;  4C5H A;  4J9E A;  5FWC A;  1WJQ A;  4IUU A;  4PJO B;  1KQ2 A;  2LQ8 A;  2DXC A;  4XTX A;  5GMK h;  3CCJ A;  2ESW A;  3QII A;  2KY9 A;  2W10 A;  4QVZ A;  2EQK A;  2JOY A;  1E6H A;  4Z89 A;  3OYD A;  4RG2 A;  2PVG B;  1D09 B;  1OI1 A;  4B9W A;  3TRE A;  5M9O A;  2BZ8 A;  1AZG B;  4QVC A;  2XHC A;  2KT8 A;  4WTO B;  3J81 E;  1PM3 A;  3JCM e;  2RB6 A;  1RAH B;  4FYX B;  2VGN A;  4OMP A;  1K8A C;  3VS6 A;  3TCJ A;  1NLP C;  1B3Q A;  4F7U F;  2R5A A;  3N5B B;  4E7J A;  1Q82 U;  3EFO B;  3MJX A;  2DL8 A;  3OBY A;  2HQE A;  3OYG A;  5FU7 C;  2HCK A;  2VC8 A;  3H0F A;  4PL6 A;  3RMQ A;  4PNO A;  3MP8 A;  3G71 T;  2AK5 A;  2SEM A;  4JRI A;  3OSV A;  4BI8 B;  1V29 B;  3PGG A;  3QDR B;  3UPU A;  1ZA2 B;  3OY9 A;  1YIJ Q;  2GF7 A;  3AHU A;  5FRN A;  1WIE A;  1KJW A;  2O88 A;  4JJC A;  2KGT A;  5GAN 8;  2D0N A;  3H0I A;  1WLP B;  5J3B A;  3OYE A;  1K9M U;  2QA4 Q;  1VQ9 T;  1UHC A;  2K9G A;  3PFS A;  1AZE A;  2KBT A;  4L5G A;  2MI6 A;  1YI2 Q;  2C0I A;  4QW2 A;  1K9M R;  3WXM B;  1RLP C;  1QVG A;  5GAN 5;  2D9T A;  3CC7 A;  3I56 A;  2ZPF B;  3JB9 H;  1SF9 A;  2D6F A;  5J39 A;  1VQ4 T;  4F04 B;  1WX6 A;  2DBM A;  4IIM A;  1VQ8 T;  4AFS C;  1VQ5 Q;  6AT1 B;  1OUL A;  4MML A;  2KXC A;  4M78 B;  2FZG B;  2K3X A;  3RES A;  2E70 A;  4C92 A;  2F69 A;  2A37 A;  1JJ2 S;  2KT1 A;  1WJS A;  3JCM Q;  3WVE B;  1JJ2 A;  1E7O A;  3RUX A;  2XKO C;  2F5T X;  1XTD A;  3TSZ A;  4C5I A;  1X43 A;  3X28 B;  4C8Q E;  4C92 F;  5GAM f;  3CCU T;  4PFO A;  4BE1 A;  1SPK A;  3CCM A;  1YHQ Q;  4Q5W A;  1U1T A;  1Q81 U;  4JRQ A;  1QP3 A;  4B6M A;  1TU0 B;  5FU6 B;  5CVI A;  1Q7Y R;  3BDL A;  1QVF S;  4KGX B;  2RHY A;  3G7Z A;  2JZ2 A;  1Q81 R;  4BY6 C;  5I11 A;  3JCM P;  7AT1 B;  5LJ3 g;  4CI0 C;  5IHK A;  4E7I A;  2QQS A;  2LX9 A;  1ZA1 B;  1VQK Q;  3C4S A;  3DLM A;  5GAN f;  3BDU A;  2LQW A;  4HKE A;  2E12 A;  4O5V A;  3CPF A;  3JB9 D;  4MDX A;  4J9F A;  1QCO A;  2JXB A;  1NZ9 A;  2RM4 A;  4Y92 A;  5CKE A;  3OS5 A;  2CSQ A;  4RTY A;  2K57 A;  5GAM h;  3I55 T;  4ELZ C;  2ABL A;  4GY5 A;  3QJY A;  2X3W D;  3CCL T;  3I35 A;  1TS9 A;  5HK0 A;  3S3M A;  2E6N A;  3JB9 G;  2QDL A;  2DEQ A;  2X4W A;  3M0Q A;  1WJR A;  1YJN T;  5FW9 A;  4PJN A;  4GLK A;  2KI7 A;  5GAO r;  2X4X A;  1W1F A;  3C0C A;  2K6D A;  5EC7 A;  4N4I A;  1C1A A;  1D0Z A;  1FX7 A;  1U8R A;  4M77 D;  3LW5 E;  2OTJ T;  1TG0 A;  2VGM A;  1HD3 A;  5KYY A;  4PJM A;  2M9U A;  1I4K 1;  4GBQ A;  2M02 A;  3ZFJ A;  4M77 G;  3V8K A;  4ORZ A;  2OX7 A;  4M75 A;  2J06 A;  4RUG A;  5GAO n;  1AD5 A;  1WYX A;  5D6W A;  2VAS A;  1JU5 C;  4KUI A;  4NL2 A;  4J7I A;  1VQO Q;  4C5E A;  3VU3 C;  1UGR B;  1SSH A;  1TUG B;  3TQ7 P;  4JJN K;  3M59 A;  2YUQ A;  2LQK A;  4M75 F;  3PMI A;  3FJP A;  2LTO A;  2DE0 X;  4PJO A;  4QQG A;  3FRN A;  4AFQ C;  3OS1 A;  4II1 A;  3CCV T;  4IUT A;  1GBQ A;  2ROL A;  1FMW A;  3JCM X;  1Q7Y C;  4OMO A;  1ZHI A;  3M0S A;  1T3L A;  2GTO A;  2DO3 A;  1IB8 A;  1K4U S;  3M53 A;  4PJO F;  2JM9 A;  2BIV A;  4KBM B;  3M56 A;  1H3Z A;  3VJP A;  4RCC A;  2HEQ A;  2JS2 A;  3CC2 A;  2XID A;  5GAO m;  5I21 A;  1KD1 C;  3GPL A;  2RNA A;  1BBZ A;  3FLG A;  1M1K C;  2JMC A;  2QYZ A;  2EJG A;  1PSF A;  3EFO A;  1H3H A;  2GCX A;  3A8H B;  2AKK A;  4MDW A;  2GQI A;  2F1L A;  1VQP A;  1I5L A;  4M77 C;  4HXJ A;  2KXD A;  1SKU B;  2K5L A;  2YLC A;  2I2L A;  3VS1 A;  5CQY A;  2HSP A;  1OX9 A;  1J3T A;  1VQ7 A;  2R58 A;  2MYS A;  1CSK A;  2DD5 A;  1H8K A;  1KSW A;  1YIJ A;  4DBR A;  5KYU B;  9ATC B;  4A54 A;  1HJD A;  4LE9 A;  5IT9 E;  2CH4 A;  4C0Z A;  1NJI C;  3OS0 A;  3OYA A;  4HCK A;  3TVT A;  4FSX A;  2EKO A;  5GAO q;  2JJ9 A;  1Y07 A;  1NBE B;  4M78 A;  1M30 A;  1V1C A;  4NS5 A;  1LJO A;  1WXT A;  4XTW A;  3QYG B;  1SRL A;  1AHJ B;  1R77 A;  2RQW A;  3RKY A;  5CK9 A;  1VQN T;  1R8O B;  2MPX C;  4KH1 B;  3GF5 A;  2A08 A;  2IVW A;  4E7S A;  5GAN e;  3CXC P;  5GMK l;  1W4S A;  5FU7 B;  2RQU A;  4C8Q D;  1VOM A;  2J7I A;  1AWW A;  1VQ5 A;  1PD1 A;  4M78 F;  1UTI A;  4DBF A;  1GFC A;  3C94 A;  1YFN A;  1OZ3 A;  3GP8 A;  3EHR A;  1VQM T;  4C8Q G;  2R57 A;  3EFR A;  5I2S A;  1QWE A;  3TSW A;  3ULR B;  1RI9 A;  3GNG A;  1VIE A;  1ZQ1 A;  2O9S A;  4M7D E;  3GOX A;  1FYN A;  3EH2 A;  1MV0 B;  1OZ2 A;  1P92 A;  1WNL A;  2DIG A;  2HSE B;  5LJ5 d;  2MK5 A;  2QEX A;  1PCX A;  2KSS A;  2KQW A;  4L59 A;  3C12 A;  1LVK A;  2X35 A;  4KGV B;  3DB3 A;  5FU6 C;  2LJ3 A;  4PK4 A;  2DIL A;  3ER0 A;  4HA8 A;  2P0K A;  2ED1 A;  2CUD A;  2DXB A;  2CUB A;  3JCM f;  4JS4 A;  4ZN3 A;  3JB9 J;  3OA6 A;  2LDM A;  3M4Y A;  3NFC A;  1KC8 U;  4BUG A;  2OAU A;  3R6O A;  1M90 U;  1X75 C;  3G6E T;  1U06 A;  3LWH A;  2Y4Y A;  1WXU A;  1PG5 B;  1UGS B;  5GAN 3;  4PJJ A;  3VUZ A;  3OBW A;  3QYH B;  1M1F A;  4R0K A;  1G83 A;  1IO6 A;  2NWM A;  3QJ6 A;  1M3C A;  2BUD A;  4OMQ A;  2YSQ A;  5KCO A;  4M7D B;  1VQL Q;  4BY6 B;  3G1J A;  4C8Q C;  2LMJ A;  2CDT A;  4RG8 A;  4ELY C;  3CCJ T;  2YUP A;  1OPL A;  3RR6 A;  2NUP B;  4RTX A;  3SHW A;  3OQ5 A;  2W0Z A;  1T3S A;  2L89 A;  2WSE E;  4C0G A;  3JCM h;  3M0P A;  2CH4 W;  2XI9 A;  3EGX B;  2R5M A;  2YRD A;  2DZ9 A;  2ZAE A;  1JXO A;  2ECZ A;  3WVD B;  3LLR A;  3S3O A;  1UEC A;  2YT6 A;  3OYN A;  4DBQ A;  2J05 A;  3ZL7 C;  2P0Q A;  3A8O B;  3HRU A;  3H8Z A;  4OB0 B;  3QZ5 B;  2MWP A;  3REA B;  2GNC A;  1W2B S;  2E41 A;  4OMM A;  4A53 A;  1ZLM A;  3PE0 A;  2EGA A;  3M4G A;  1TUD A;  1EZZ B;  1M1G A;  2KDS A;  2CT4 A;  4OML A;  4XTV A;  2ZPG B;  1QVF P;  2V1Q A;  5I22 A;  3OYC A;  2FYK A;  1CKB A;  4J9G A;  2WSC E;  1G3S A;  4DOW A;  1UUE A;  1GRI A;  1NPR A;  3CC7 T;  1AEY A;  3I56 T;  3E1S A;  3L42 A;  2DTO A;  2ZPE B;  1Q86 U;  1Z9Q A;  2QG9 B;  2XD0 A;  1JO8 A;  1TH7 A;  3UWN A;  2DXU A;  3MKD A;  2LJ1 A;  3CC4 Q;  1Q86 R;  4ZGD B;  1JRI A;  2O2O A;  1VQ9 Q;  4J5Y A;  5L8R E;  4M7A F;  5GAM g;  3CME T;  3MCA B;  3M5A A;  2HKN A;  3MEU A;  3BW1 A;  1UB4 A;  3JCM J;  1NEG A;  1K0X A;  1VQ4 Q;  1VQ8 Q;  4AFU C;  3CBP A;  3OSS C;  2CP5 A;  4N4H A;  4RMO A;  3OW2 S;  3JCM b;  1FMK A;  1RAF B;  3CCM T;  3CCS A;  1PD0 A;  5KYU A;  4FYW B;  2EJF A;  4DQ2 A;  1N6A A;  1SHG A;  2O4X B;  3HL8 A;  2CRE A;  4BAC A;  1HXD A;  4EMH A;  1ZUK A;  5GAN g;  1T0H A;  2C0O A;  5IH2 A;  3R6N A;  3MEW A;  1EFN A;  4IIO A;  3L1A A;  4JJB A;  2ATC B;  4B9X A;  2YUN A;  3CCU Q;  4KH0 B;  1H64 1;  2DYB A;  1YCS B;  2XK0 A;  2DX1 A;  2HZY A;  8AT1 B;  2AHJ B;  1A0N B;  1MUZ A;  2QQB A;  4M77 B;  4RKU E;  4JUV A;  2GBQ A;  2E64 A;  8ATC B;  3SDZ A;  4CC7 A;  3QSU A;  2CP7 A;  2E3I A;  2D1X A;  3M0T A;  5LL6 S;  1ZUY A;  4DOV A;  3H6Z A;  1WGS A;  1BI3 A;  2OTL A;  4M7D D;  3EG3 A;  2PU9 B;  2A7Y A;  4BI4 A;  3CCQ A;  4CC3 A;  3BY7 A;  3A8M B;  2RH2 A;  2MCN A;  1Q82 R;  2GFU A;  4KUL A;  1AOJ A;  1HSQ A;  1YBY A;  1WDX A;  2LT1 A;  4M7D G;  2JNG A;  1K1Z A;  2VKN A;  3NMZ C;  3GNF B;  4F17 A;  2MAM A;  1M3A A;  3I55 Q;  3CCE Q;  1VUB A;  3E2U A;  3CCL Q;  1X6G A;  1QVG S;  4ZN1 A;  1Q95 G;  5DY9 A;  3CPW A;  4FW2 A;  2JUF A;  3LYI A;  5FLX E;  1YJN Q;  1BI2 A;  3SFM A;  1NE8 A;  4DEY A;  1LOJ A;  4E6R A;  2GFA A;  2J6F A;  4JLG A;  2RD1 A;  2QI2 A;  4KT0 E;  1X69 A;  2P4R A;  1PSE A;  1D0Y A;  1FXX A;  2OTJ Q;  3DKM A;  3KUF A;  2HBW A;  2XDP A;  5LJ5 j;  1K73 C;  4OMF B;  3VRY A;  2C0T A;  3NGP A;  4C0D C;  3G4S A;  2RI5 A;  3CQT A;  1RAB B;  2BZX A;  2MIO A;  2DTH A;  4CC4 B;  4LD9 K;  2DAQ A;  2BE9 B;  2K5I A;  2EYY A;  3CMA Q;  2O31 A;  4OP0 A;  2NUP A;  1EX4 A;  1OU8 A;  2YHT A;  1QW1 A;  2ZPI B;  4PKC C;  4J9D A;  1VQL A;  2QQ9 A;  3HKS A;  2GQV A;  2LRQ A;  3VUB A;  4M7D C; 
#chains in the Genus database with same CATH homology
 3CXC S;  3CC2 A;  1G3Y A;  4QQ6 A;  5GAN 4;  2XID A;  1UGQ B;  3BFM A;  3CC2 T;  2P4T A;  5A0G A;  2XDD A;  3JCM c;  2H3J A;  5GAO m;  5I21 A;  2EAY A;  1KD1 C;  3GPL A;  3CXC A;  3OYF A;  3A8L B;  2V8K A;  3FLG A;  1M1K C;  3EFS A;  4OF1 A;  2EJG A;  1PSF A;  2CS7 A;  2XIC A;  5CIU A;  2GCX A;  2KMT A;  3A8H B;  2HNI A;  1O9S A;  2DKG A;  4MDW A;  1SSF A;  4C92 B;  1VQP A;  1I5L A;  4M77 C;  4XTY A;  1VQP T;  3HFO A;  3X24 B;  4M7D F;  4EMG A;  4BE0 A;  5CR2 A;  2PUO B;  3SB2 A;  2K2V A;  5C0M A;  4LDU A;  4J83 A;  2K5L A;  1XOV A;  2RJC A;  2YLC A;  4Y28 E;  4EMK B;  5HY6 A;  1I8F A;  3V7R A;  5GAO l;  2I2L A;  5CQY A;  2M16 A;  1VQ7 A;  3SWN A;  2R58 A;  4LDV A;  4P5N A;  4XQ3 A;  4A4G A;  1Y71 A;  3HRT A;  4N4G A;  1VQ7 T;  4C8Q B;  1Q82 C;  2DD5 A;  3V8L A;  4M7A D;  3A8G B;  4EPC A;  4F7U A;  1KQS A;  1YIJ A;  3L2W A;  5CO7 A;  3O8V A;  1YIJ T;  3VV0 A;  1Y96 A;  3VYG A;  4A54 A;  2FHD A;  4J6X A;  3JAM E;  5IT9 E;  1G3W A;  2E5Q A;  2LC4 A;  2M1H A;  2JTF A;  3QUI A;  4C0Z A;  5GMK m;  1UEB A;  3OS0 A;  3OYA A;  1NJI C;  3NTI A;  4C92 D;  3ME9 A;  1BI0 A;  4FSX A;  4M78 E;  3M9Q A;  2EKO A;  4IUQ A;  5GAO q;  1YJW A;  1Y07 A;  3V8J A;  2DXT A;  5CKF A;  4M7A G;  1YJW T;  3M54 A;  4M78 A;  3V7C A;  2B8A A;  4NS5 A;  1LJO A;  4XTW A;  2F5K A;  4XTZ A;  3QYG B;  1DJ7 B;  1AHJ B;  1K9M C;  3QHS A;  4XU0 A;  2CYZ B;  3RKY A;  3CPW S;  2RK1 A;  3TEE A;  5CK9 A;  1VQN T;  1R8O B;  5GAN h;  4C92 G;  5LJ3 e;  3GF5 A;  5KE3 A;  4XTU A;  1RI0 A;  2XDB A;  2QTX A;  2IVW A;  3LH0 A;  5GAN e;  1NPP A;  5GMK l;  5IN1 A;  1W4S A;  4XU2 A;  2WSF E;  5FU7 B;  4C8Q D;  2V8I A;  3OS2 A;  2ZPH B;  1N8R U;  1BKB A;  1VQ5 A;  2PQW A;  4M78 F;  4JS5 A;  1QVP A;  5GAO p;  1N27 A;  3C94 A;  3S6W A;  3CC4 A;  1KHI A;  1Q86 C;  2D0Q B;  2CKK A;  3CBO A;  1W2B A;  1OZ3 A;  3E9G A;  3CC4 T;  1D3B B;  3GP8 A;  1VQM A;  3CBM A;  3CD6 A;  4Y91 A;  3L2R A;  4N0A A;  1VQM T;  3P8B B;  3E19 A;  5GAM j;  3CD6 T;  3MP1 A;  3P8H A;  4C8Q G;  1GXI E;  2R57 A;  3ZBD A;  3EFR A;  4D6W A;  5I2S A;  3JCM d;  2K3Y A;  2HQX A;  3QO3 A;  1UGP B;  1WQ7 A;  1QP2 A;  2JN0 A;  3S3N A;  2O4X A;  2VXE A;  3GNG A;  4X9C A;  1S72 A;  4OGC A;  2EQU A;  5CKB A;  5D6X A;  1VIE A;  1ZQ1 A;  4KUD K;  4EDU A;  4M7D E;  3V7S A;  1S72 T;  1VIF A;  3GOX A;  2Y90 A;  4M7A A;  4HT9 A;  2ZPB B;  2M0O A;  3JB9 F;  4M7D A;  4IUV A;  1OZ2 A;  1P92 A;  1WNL A;  2E6Z A;  2DIG A;  5LJ5 d;  4A4K A;  5C6S A;  2QEX A;  5KCH A;  1M8V A;  2KSS A;  4J8O A;  4N0A C;  3RKW A;  2KQW A;  4L59 A;  3JCM V;  2QEX T;  5I2M A;  2MMP A;  4LDW A;  1FWZ A;  1WPY A;  3C12 A;  1X01 A;  4JRK A;  3GIB A;  3JCM g;  3CCR A;  2X35 A;  5FU6 C;  3DB3 A;  2DK3 A;  2RHU A;  3FB9 A;  4XU1 A;  3CCR T;  4M77 E;  3CME A;  1Q81 C;  1B34 A;  3VYH B;  2QXF A;  4ZGJ B;  5LJ3 j;  4BD3 A;  3ER0 A;  2LNV A;  3OYJ A;  1K73 U;  3C95 A;  4HA8 A;  5GAN j;  1M5Q 1;  2BKD N;  2LCL A;  2P0K A;  2RK2 A;  4M77 A;  4VUB A;  5AYF A;  3JSC A;  3JB9 I;  4M7A C;  2DXB A;  4FT2 A;  3JCM f;  3X26 B;  4ZN3 A;  5LJ5 g;  4JS4 A;  3JB9 J;  3OYK A;  2L3R A;  4MMK A;  3OA6 A;  1KG1 A;  1YJ9 A;  2LDM A;  2V8J A;  3KXT A;  3M4Y A;  3NFC A;  3L2Z A;  4M75 B;  3M55 A;  1HK9 A;  2E10 A;  4FT4 A;  4E7K A;  3G6E A;  4BUG A;  4C92 C;  2OAU A;  1KC8 U;  2RO0 A;  3R6O A;  3UT1 A;  4OB1 B;  4UC4 A;  3HPW A;  1Q7Y U;  1M90 U;  1X75 C;  3MP6 A;  3G6E T;  1Y7X A;  4ATO A;  3LWH A;  2Y4Y A;  2RHZ A;  4M77 F;  5D6Y A;  2PVD B;  1UGS B;  1X6O A;  1YIT A;  4ME7 A;  5KE2 A;  3VUZ A;  2XG8 D;  5GAN 3;  4IKF A;  2EJ9 A;  1JBM A;  3OW2 A;  1YIT T;  4O6J A;  4MZM A;  3OBW A;  5GAN 2;  2E1H A;  2HAX A;  2DTI A;  3QYH B;  1M1F A;  2HBP A;  3MEV A;  4MZP A;  3INZ A;  3QJ6 A;  2BUD A;  3OYH A;  4PLL A;  1IZ6 A;  1G3T A;  4FM4 B;  4C5H A;  5KCO A;  1QVF A;  1WJQ A;  2LCC A;  4M7D B;  4IUU A;  4A4H A;  4NOY A;  4PJO B;  2YLB A;  4BY6 B;  4J6W A;  1KD1 U;  4BI3 A;  4C8Q C;  2EFI A;  1KQ2 A;  2LQ8 A;  3QG1 A;  3RER A;  5FRO A;  1M1K U;  2DXC A;  4XTX A;  3FEO A;  5GMK h;  1KQS S;  3CCJ A;  2E65 A;  3F70 A;  2JVV A;  3DB4 A;  4RG8 A;  3X20 B;  3QII A;  4ELY C;  3HRS A;  4F7U E;  4OB2 B;  2KY9 A;  5GAN 7;  5GMK e;  3CCJ T;  2DD4 A;  2EQK A;  3OMG A;  4QVZ A;  2JOY A;  3DLL A;  3LGF A;  3OQ5 A;  4HCZ A;  3OYD A;  1ZBX A;  4RG2 A;  2PVG B;  4HCB A;  4M75 D;  1OI1 A;  4B9W A;  3TRE A;  2L89 A;  1LNX A;  2WSE E;  3HP9 A;  4C0G A;  5M9O A;  4BE2 A;  2QQR A;  2RJD A;  4J7F A;  2O01 E;  4IUP A;  3GLX A;  3JCM h;  5GAN 6;  3PMT A;  4QVC A;  2XHC A;  2XI9 A;  3J81 E;  3JCM e;  2RB6 A;  2R5M A;  3MHX A;  4XAX B;  1OYX A;  2DZ9 A;  3T9N A;  2VGN A;  3CCE A;  4LDY A;  1K8A C;  2QA4 A;  4OGE A;  3TCJ A;  1RL2 A;  3CEY A;  3CCL A;  3CCE T;  1G5V A;  2RHI A;  3MET A;  4M75 G;  4F7U F;  4QVD A;  2QA4 T;  4JDS A;  2YRV A;  1XNI A;  3OYL A;  3WVD B;  4JRP A;  2R5A A;  3N5B B;  2ZCF B;  3LLR A;  4E7J A;  3S3O A;  1YI2 A;  1Q82 U;  3OYN A;  4PJO D;  3KBG A;  2P0Q A;  2HQE A;  3OBY A;  2NLU A;  3P8D A;  3A8O B;  5FU7 C;  2VC8 A;  3HRU A;  4PL6 A;  3H8Z A;  3RMQ A;  4PNO A;  3MP8 A;  2QQA A;  3G71 T;  4BI8 B;  4JRI A;  4OB0 B;  3OSV A;  4HT8 A;  2CZ6 B;  3QZ5 B;  1V29 B;  3PGG A;  5HK3 A;  3QDR B;  3UPU A;  2MWP A;  3OY9 A;  1BIB A;  2GF7 A;  2WAC A;  5A2Q E;  1NJI U;  3AHU A;  1W2B S;  5FRN A;  3J80 E;  2E41 A;  1U1S A;  1YCY A;  4C5G A;  1VQ5 T;  5DLO A;  3QXE B;  3OYM A;  4PJO G;  2XU8 A;  4A53 A;  4BB7 A;  3M4G A;  3EAE A;  5GAN 8;  3SD4 A;  3SWN B;  1M1G A;  1VQ9 A;  2CZ1 B;  2KDS A;  3OYY A;  3QPH A;  5J3B A;  3M57 A;  4XTV A;  3OYE A;  1K9M U;  1VQ9 T;  2ZPG B;  3PFS A;  2FB7 A;  4L5G A;  4XK8 E;  3OYC A;  2FYK A;  4F7U B;  2MI6 A;  4A4E A;  5J26 A;  3FC3 A;  4QW2 A;  2WSC E;  3OYB A;  1G3S A;  3WXM B;  3G71 A;  1QVG A;  2K4Y A;  2PVO B;  3RIR A;  2A3L A;  2DZC A;  4C0F A;  4DOW A;  1Y96 B;  5GAN 5;  2D9T A;  4M7A E;  3CC7 A;  3CMA A;  3I56 A;  5CQX A;  2ZPF B;  4E7H A;  3JB9 H;  5GAM d;  1NPR A;  3CC7 T;  1VQ4 A;  3I56 T;  3E1S A;  3L42 A;  1XQH A;  2EQJ A;  3CMA T;  2D6F A;  1VQ8 A;  2DTO A;  5J39 A;  3L2V A;  2ZPE B;  4BDZ A;  1VQ4 T;  1Q86 U;  3QKJ A;  1VQ8 T;  4MML A;  1YHQ A;  2XD0 A;  1TH7 A;  4M78 B;  1O75 A;  3UWN A;  4C92 E;  3OB9 A;  2DXU A;  2K3X A;  2RI3 A;  1YHQ T;  3RES A;  2FVU A;  4ZGD B;  4J6Y A;  2E70 A;  4C92 A;  2F69 A;  1JRI A;  1JJ2 S;  1WJS A;  1VQK A;  3JCM Q;  1BYM A;  3MO8 A;  4J5Y A;  2LVM A;  5L8R E;  4M7A F;  3WVE B;  5GAM g;  3CME T;  2DIQ A;  3MCA B;  4V2S A;  1JJ2 A;  2RJF A;  2MF2 A;  3M5A A;  3RUX A;  4ZTF A;  4EMK A;  2XKO C;  2F5T X;  3MEU A;  1XTD A;  4TVR A;  4FU6 A;  4M75 C;  4E7L A;  3BW1 A;  1UB4 A;  3QBY A;  4C5I A;  4C0D B;  3JCM J;  3CCU A;  2K5F A;  3X28 B;  4C8Q E;  5LJ3 d;  1WQW A;  4C92 F;  5GAM f;  3NTH A;  5HKC A;  3FDR A;  3CCU T;  1KQ1 A;  4BE1 A;  1YJ9 T;  5GAN d;  2CZ7 B;  1VQK T;  3CBP A;  3OSS C;  4CRI A;  4C8Q A;  2VYT A;  4E47 A;  3LWI A;  2CZ0 B;  4N4H A;  4RMO A;  3OW2 S;  3JCM b;  2VUB A;  3CCM A;  3PIP A;  5LJ5 f;  3CCM T;  3Q1J A;  1BI1 A;  1U1T A;  4Q5W A;  2FL7 A;  3CCS A;  3MEA A;  1QP3 A;  4JRQ A;  1Q81 U;  2EJF A;  4DQ2 A;  4M78 D;  5FU6 B;  3CCS T;  5CVI A;  1N6A A;  1BIA A;  3BDL A;  4ZGE B;  1QVF S;  3J7A F;  4EMK C;  4HCC A;  2O4X B;  3HL8 A;  2RHY A;  4PJO C;  4BAC A;  3PIO A;  3G7Z A;  2JZ2 A;  2KK4 A;  2RJE A;  4X9D A;  4JLI A;  4BY6 C;  2DPP B;  3JCM P;  1HXD A;  5LJ3 g;  2L8D A;  4LD6 A;  4M7A B;  4EMH A;  4MZT A;  5CCA A;  4A4F A;  3NTK A;  4C8Q F;  5GAN g;  5IAY A;  4CI0 C;  3MEW A;  4BDY A;  2QQS A;  4E7I A;  3L1A A;  4B9X A;  4M78 G;  4LDX A;  2LX9 A;  1H64 1;  4L6V 5;  4OVA A;  2VV5 A;  4PLI A;  5LJ3 f;  3C4S A;  3DLM A;  2C06 A;  2G3R A;  2ZZD A;  5GAN f;  3BDU A;  2QDY B;  2XK0 A;  4HKE A;  2E12 A;  2EWN A;  3M58 A;  3CPF A;  4O5V A;  1B34 B;  2AHJ B;  2L5Q A;  2VXF A;  4OB3 B;  4RCB A;  3JB9 D;  4MDX A;  3LGL A;  3JRZ A;  2QQB A;  4M77 B;  3ASK A;  4IUR A;  4RKU E;  2EQM A;  4JUV A;  2RHX A;  1NZ9 A;  2RM4 A;  2E64 A;  5CKE A;  3RKX A;  3OS5 A;  4X34 A;  4Z02 A;  3PNW C;  3SDZ A;  3I55 A;  3E9F A;  2K57 A;  3QSU A;  1D3B A;  5CKD A;  5GAM h;  4FL6 A;  3I55 T;  4ELZ C;  1IRE B;  4GY5 A;  3OYI A;  3PTA A;  3QJY A;  5KH6 A;  5GAM e;  5LL6 S;  3CCL T;  5HK0 A;  3S3M A;  4DOV A;  3H6Z A;  2E6N A;  3JB9 G;  1WGS A;  5LJ5 h;  1BI3 A;  1N9S A;  4FIB A;  4QQD A;  4YTL A;  2OTL A;  2DEQ A;  2RI2 A;  4M7D D;  2PU9 B;  3TU4 K;  2A7Y A;  4BI4 A;  2X4W A;  5LJ5 e;  3CCQ A;  1YJN A;  2OTL T;  1WJR A;  3HHT B;  1YJN T;  3CCQ T;  5GMK i;  3BY7 A;  2RA2 A;  3A8M B;  2RH2 A;  4GLK A;  5CKH A;  4NL3 A;  1N8R C;  2GFU A;  4KUL A;  5GAO r;  2X4X A;  1YBY A;  2Y4X A;  4N4I A;  3SWN C;  1K8A U;  2LT1 A;  1FX7 A;  4M7D G;  2OTJ A;  2JNG A;  1U8R A;  4M77 D;  3HFN A;  4R55 A;  3LW5 E;  3GNF B;  2MAM A;  2OTJ T;  1VQO A;  1M4Z A;  2VGM A;  1VQN A;  2KVQ G;  3OMC A;  1VUB A;  5LJ3 h;  1VQO T;  3JCM W;  5GMK j;  3L2U A;  1QVG S;  3URG A;  4ZN1 A;  2M9U A;  5DY9 A;  3CPW A;  1I4K 1;  5FRM A;  3UDC A;  2KAF A;  2JUF A;  3LYI A;  5FLX E;  3ZFJ A;  3L2Q A;  4M77 G;  1BI2 A;  3SFM A;  3V8K A;  1NE8 A;  4M75 E;  4M78 C;  1LOJ A;  1EIF A;  2GFA A;  4R56 A;  4M75 A;  4JLG A;  2RD1 A;  2QI2 A;  5GAO n;  1I81 A;  4KT0 E;  1PSE A;  5D6W A;  1FXX A;  5EG2 A;  2JTM A;  4KUI A;  2X4J A;  3HSB A;  2EIF A;  3DKM A;  2EYQ A;  3KUF A;  3QZ9 B;  4NL2 A;  2CGH A;  4J7I A;  2XDP A;  4C5E A;  3VU3 C;  1UGR B;  4DA4 A;  5LJ5 j;  1N9R A;  3LX7 A;  1K73 C;  2MWO A;  1YI2 T;  4OMF B;  2LT4 A;  2ZGW A;  3M59 A;  4JJN K;  4WF2 A;  3X25 B;  2IG0 A;  2LQK A;  4PJO E;  3G4S A;  4C0D C;  2RI5 A;  4M75 F;  3PT9 A;  3PMI A;  2DTH A;  1H3Z A;  3G4S T;  3FJP A;  2X4Y A;  2LTO A;  4PJO A;  4QQG A;  1M9S A;  3FRN A;  5A0D A;  3CCV A;  4LD9 K;  2DAQ A;  3A5Z B;  2K5I A;  3OS1 A;  4II1 A;  3ZEH A;  3CCV T;  1JB0 E;  2DVE A;  4IUT A;  5A0L A;  3OYG A;  1KC8 C;  4OP0 A;  3JCM X;  1Q7Y C;  1M90 C;  5CAI A;  3VKI A;  1VQ6 A;  1MGQ A;  2YHT A;  1ZHI A;  1VQ6 T;  1QW1 A;  4XU3 A;  4M7D C;  2P0P A;  1MHN A;  3FIF A;  2ZPI B;  2DJZ A;  2DO3 A;  4PKC C;  4F7U G;  3M53 A;  5DLQ E;  4PJO F;  2BIV A;  1VQL A;  2HD0 A;  4KBM B;  2PUK B;  5DM7 R;  2QQ9 A;  3HKS A;  2GQV A;  2LRQ A;  3M56 A;  1KHC A;  3VJP A;  3VUB A;  4ZTJ A;  1VQL T;  4RCC A;  3RMS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...