4MDWA

Crystal structure of a duf1541 family protein (ydhk) from bacillus subtilis subsp. subtilis str. 168 at 2.00 a resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
146
structure length
133
Chain Sequence
b'HEEMDHSGSADVPEGLQESNPYVGSQVIINTSHMGMGAEATVTGAYDTTAYVVSYTPTNGGQRVDHHWVIQEEIDAGDTLQPGDQVILEASHMGMGATAEIDSAETTVYMVDYTSTTSGEVNHKWVTEDELSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein YdhK
publication title Crystal structure of a hypothetical protein (ydhK) from Bacillus subtilis subsp. subtilis str. 168 at 2.00 A resolution
rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Structural genomics, unknown function
total genus 24
structure length 133
sequence length 146
ec nomenclature
pdb deposition date 2013-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07563 DUF1541 Protein of unknown function (DUF1541)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1210 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4mdwA00
4MDWA
chains in the Genus database with same CATH superfamily
4Z89A 4PJOA 1VQMT 1Q81U 3UATA 2X3XD 1VQ5A 1WJQA 4HVUA 4BB7A 1T0JA 5FWCA 2O88A 1OZ2A 3P8BB 1K1ZA 4FT4A 5M9OA 1AWWA 1IXDA 1UHFA 1JJ2S 1Y7XA 1PSEA 2QDYB 1RI0A 4IURA 3TU4K 3QYHB 3G6EA 1I5LA 2YLCA 3M0TA 1KG1A 1BU1A 1M5Q1 5AT1B 3WVDB 4R0KA 1VQPA 3E9GA 4M78D 2O9SA 3P8DA 1VQ9T 1B34A 2QQRA 2HSEB 2RB6A 1AWOA 1YN8A 4M7DG 1VQ7A 3WVEB 3DLLA 2DVJA 3BY7A 2E70A 1FWZA 5CCAA 2Z0WA 3EH2A 2D9TA 1UUEA 2BZYA 4FSSA 4BDYA 2LMJA 1NPRA 3A8HB 1Q81R 1Q7YC 3MHXA 2LQKA 2JM9A 4M7AE 1U8RA 3CPWS 3CCVT 2K2VA 2L5QA 2DL3A 3Q1JA 3QJ6A 4CC3A 1K8AU 1VQKQ 1M3AA 1TS9A 2ED1A 4R55A 1ABQA 3HFOA 1TUDA 1M90C 1WDXA 4R56A 2ZPGB 4OF1A 2M0YA 2KK4A 2V1QA 3CBOA 1QVGP 1YBYA 1MV0B 4C8QE 1ZUUA 2HL5C 4CC2A 3KXTA 1FMVA 1RACB 4M7DF 1YNZA 3DLMA 2G3RA 5GAOm 3I55T 3G71T 1P92A 3JCMg 4M77B 1WLPB 1RI9A 2EFIA 1RAEB 2FYKA 2MPXC 2QI2A 2M9UA 3CC2A 4PK4A 4A63B 1E6HA 5GAN7 2RD1A 2PUKB 4IKFA 2KRSA 2LTOA 3MEWA 3OYIA 4QVDA 2RI3A 3THKA 2JXBA 1M8VA 2E1HA 2YLBA 2KE9A 2HCKA 4M77C 2CP5A 2EQUA 4RG2A 5HK3A 1SF9A 3KBGA 1EFNA 1H3ZA 4F04B 2L8DA 3PMIA 3EH1A 3M0SA 2L3QA 3V8LA 1K4US 3CCEA 3E9FA 5IXFA 2HQXA 1RUWA 2W0ZA 2RM4A 1NYFA 2DTHA 3MKDA 1PD0A 3NHNA 2DRMA 4M77A 2FPFA 1YJNQ 1YJWA 5DM7R 3JCMQ 4EIKA 2EVRA 2X3WD 3MJXA 2H3EB 1D1CA 4XTYA 3UDCA 4ESRA 3OBYA 2LC4A 1RADB 5J39A 1TUGB 1K9MU 2H8HA 5LJ5f 3QPHA 2F5KA 1BCOA 2EGCA 3G6ET 1NBEB 2EQKA 1BI2A 3JB9H 4FW2A 2BE9B 5GAN6 1VQPT 1PHTA 4M7AB 2GFUA 1Q82C 1VQ4A 2MF2A 2HEQA 3RESA 4N4GA 4ZNXA 3M56A 3NTIA 4J9GA 1U06A 1PSFA 4L59A 4DEYA 1QWEA 3VJPA 1QWFA 1F1BB 2FL7A 3L2VA 3CXCP 3CMAA 3GIBA 2P0KA 2DVEA 4VUBA 1NJIC 2CSIA 1Y96B 4M7AC 1G3TA 4EMHA 2AT1B 2MMPA 1WHGA 3EG9B 1D0YA 5DLOA 2KXCA 4Q5WA 3JCMh 1V76A 2ZGWA 1KJWA 2QGFB 3BE3A 4C8QB 3LX7A 4Y92A 5GANe 5LJ5j 1K9MR 3H0HA 4A53A 3G4SQ 3CC7Q 1MV3A 2F1LA 1MMDA 4WF2A 2HNIA 1PC0A 3CCUQ 3E19A 4M7AA 1HJDA 2K7AA 4XTXA 4OB1B 1ZBJA 4JPBW 2QA4A 4C8QC 3RMQA 2BUDA 2OTLQ 5GAN3 2FPEA 4DBRA 1KQSS 3PVLA 1Y96A 1JXOA 3EG9A 2B8AA 1S1NA 2XIDA 1C6VX 2YSQA 3REAB 4RTTA 4M75G 4C0ZA 2AIRB 4C8QA 4EPCA 2LX7A 1QCFA 4C92D 2JTFA 1WPYA 4BE1A 2Y90A 2DTIA 2ZAEA 4M4ZA 5IHKA 2J7IA 4A54A 4XU3A 2PVGB 2AZVA 4GLKA 1WHJA 1IB8A 4KT0E 1TU0B 2KSSA 5FW9A 4QW2A 2E6NA 3SD4A 5IHIA 3TREA 1K9AA 2ED0A 5GAMe 3LGFA 4J9HA 3M58A 3OW2A 5FLXE 1VQLQ 1VQOA 2QQBA 4OGCA 1YITA 3NTKA 1VQNA 3QG1A 3OYBA 5FROA 2WSCE 1IREB 1XTDA 2VYTA 1S72Q 5I2SA 3IQLA 3C95A 2VGMA 3ER0A 4PFZA 1VQ8A 4M75F 4DOWA 2BZXA 5KCOA 2RMOA 4A4FA 2YUNA 2KROA 2IVWA 1VQ4T 2PVDB 5CVIA 1AT1B 4DBHA 2A7YA 3MO8A 1YHQA 3L2UA 3SFMA 2DYIA 1WHLA 4Z02A 3CMAT 3CCRQ 2GF7A 4HCKA 2X4XA 3V7CA 2K3YA 4JUVA 3OY9A 4A4KA 5A0GA 1LJOA 2LZ6B 3CCST 2XHCA 2E5KA 4RTWA 4M78E 2GFAA 5CKEA 1OQKA 3QZ9B 4PLIA 4PJLA 1WI7A 3EGDB 5A0LA 1QCNA 1M9SA 1UGPB 2E4HA 1SRMA 4NS5A 4X34A 3CCQT 4AG2C 3CPWP 3T9NA 4LDUA 3OYEA 1K73C 3L2QA 3OYFA 1EZZB 2GGRA 2HKNA 1VIEA 3HRTA 3C12A 4PLLA 3UF4A 1BK2A 2JZ2A 3CC4Q 1WXTA 2EYXA 1GBQA 3H0IA 3HRSA 4XQ3A 2X9HA 4FCYA 5GAN5 2OAWA 2VKNA 1RAAB 4AFUC 2CP2A 4PJMA 2ECZA 2PUOB 3CCMQ 1Q86U 1VQMA 3UPUA 1QVPA 2RH2A 1AZGB 3FEOA 1B3QA 4FYWB 4HVWA 2L2PA 1G3SA 4C8QG 2CYZB 4O6JA 1M8MA 3JCMX 1V29B 3EGDA 4XU1A 2PTKA 3LH0A 3ZL7C 4QVCA 2KR3A 2PNIA 5KYWA 1YI2Q 1I5OB 1M2VB 2CUBA 5GAOl 3CD6T 5FRMA 2MAMA 3A98A 2FPDA 2CZ0B 4J9BA 2YUOA 1VQOT 4J9IA 1BIBA 2D6FA 4HCZA 2MI6A 4BI4A 3JCMd 2VXFA 1Q86R 3HRUA 1D3BA 2DD5A 5A2QE 2JS0A 5I11A 1QVFA 3OYKA 1G83A 2GTJA 1Q7YU 4LE9A 4B9WA 2LP5A 3F70A 2MYSA 1KC8C 2I2LA 3FRNA 1D1AA 4J7IA 4JJNK 1LVKA 2KDSA 1WNLA 2CGHA 1M2VA 2CH4W 2XDDA 2J06A 4M78B 1YHQT 2E12A 2E3IA 4F7UE 4BI8B 3M54A 4IUPA 1M90U 5I2MA 2EYQA 4OMNA 1IGQA 2DLPA 4XTWA 1U5SA 2COWA 4QQGA 2GNCA 1D1BA 4M7DD 3I55A 3QXEB 2DXCA 4M78C 3S3MA 2A08A 1AVZC 2B86A 1KD1C 2ZCFB 4JJDA 1PKSA 2DO3A 2OTJQ 3M0QA 4YTLA 2LRQA 2BE7D 2XI9A 4K11A 4C0DB 4FYXB 4XU2A 1XOVA 5D6XA 1KFZA 3JCMW 1GCQA 2O9VA 2QEXA 4LD9K 4JRIA 2EKOA 5J26A 1PRMC 1RL2A 1AWXA 4PNOA 1VA7A 4RTYA 1H641 3PFSA 2JTEA 3VRYA 1K76A 4M78A 2DMOA 2VC8A 3FLGA 4C0DC 3A1PA 1M90R 5IXBA 3JB9J 3OS0A 1JXMA 1OI1A 1LOJA 1RAGB 3HTRA 1N8RC 2RK1A 3CCJQ 1R77A 1CSKA 1NEGA 3J80E 1W4SA 1WA7A 2JS2A 2VGNA 1ZSGA 1RAFB 2MCNA 2NYSA 2EW3A 4L5GA 1NM7A 3OSSC 2E64A 1BB9A 5FWBA 3C0CA 3JCMP 1BI0A 4BE2A 4AT1B 2AKKA 3MP6A 4XTUA 3LH5A 3ULRB 3PNWC 3CCLQ 5LJ3f 4J9FA 3JCMf 4MZPA 2K5FA 4MDWA 2KT1A 3OS5A 3VS2A 3TVTA 2W10A 5CKBA 5KYUB 3VS4A 4XTZA 1XNIA 1VQKT 1Q82U 3M53A 3CMEQ 1QP3A 2K4YA 1I81A 1YIJA 4FU6A 4C92E 1M1GA 4C5HA 1ARKA 2ZZDA 5CKFA 5D7UA 1VYTA 1QVGA 2J6KA 2AHJB 1NJIU 3SWNB 2XKOC 2L0AA 3NMZC 2YWWA 4D6WA 2GCXA 2CREA 5GANd 1TOVA 2CZ1B 2RJEA 1G5VA 4D8DA 2BKDN 2QTXA 1OZ3A 3EG0A 3RBBB 2RK2A 2DZ9A 4E7JA 2VB6A 5LJ3j 2CP6A 2K9GA 1HYOA 1VQ9Q 1NYGA 3SWNC 2LQ8A 3OMCA 2FO0A 7AT1B 3E1SA 1PNJA 1TTHB 3HPWA 1V1CA 5KYUA 4ZN1A 4L6V5 2JT4A 2GTOA 4PJNA 2LJ1A 2EQIA 4FL6A 3ME9A 2D1XA 4RTZA 4JRPA 3RERA 1LPLA 1BCMA 3CCVQ 1BIAA 2DEQA 1VOMA 3SWNA 2CZ7B 3TEEA 5KE2A 2DM1A 4HCBA 1K8AR 4Z88A 2HKQB 4OB0B 2LX9A 3X24B 4OB2B 4NOYA 1TUCA 2EKHA 2QEXT 2WSEE 2VV5A 4E7HA 5EG2A 2P84A 1YJ9A 2RJCA 5CK9A 1YJNT 4LD6A 2CS7A 3FB9A 2RJFA 3UT1A 1SHFA 4HA8A 2XG8D 4LDWA 1ZQ1A 1MMAA 1SRLA 3RR6A 3I5RA 5GAMd 3G71Q 3O5ZA 4LDVA 1OU9A 4EMGA 1Y0MA 2KEAA 1OV3A 1YWOA 3KFVA 4RTVA 4PJOG 2H3JA 3CXCA 3RNJA 2DBMA 4Z8AA 3RDVA 3QO3A 1M3CA 3OA6A 2DEUA 1Z9QA 2DA9A 1ACMB 3RKWA 3NTHA 4C92B 2EWNA 1VQ6Q 3MCAB 2QG9B 4M75D 4XTVA 2DL4A 4CRIA 3JB9G 2P4TA 4KGXB 3BFMA 3QKJA 1W2BS 4RKUE 3GBQA 2OJ2A 3M0RA 1M3BA 2KBTA 1GRIA 3VS7A 3I56A 4BACA 4AMCA 2K5IA 4ELYC 5DLQE 2ROTA 3C94A 2O4XB 2K3XA 4C92C 1FYNA 1M4ZA 2KY9A 5GAOp 1YIJT 3RIRA 1QVFS 3CC7T 1VQ5Q 2LJ0A 4JZ3A 4LUDA 4QQ6A 3CCSA 2SEMA 5IAYA 3TCJA 1G2BA 3CPFA 4MZMA 5LJ5e 2QDLA 2XK0A 2GBQA 4C5IA 2CT4A 4C92A 4PJOF 3G6EQ 1X01A 3HHTB 4RG8A 1QP2A 2DL8A 1VQPQ 2DJZA 2KQWA 1ZSZB 3CCQA 3JB9F 2MWPA 1VQ7Q 2YT6A 1ZUYA 3QDRB 2O4XA 2JM8A 3SHWA 1VYVA 1T3LA 2XMFA 1OEBA 3I35A 1CKAA 2JMCA 5HKCA 2C0OA 1K73U 2BZ8A 3A8OB 1FXXA 1ZSZC 1X6BA 2K2MA 2KT8A 4EMKB 2LQWA 3OYDA 1JU5C 1UDLA 4J83A 4DQ2A 3MP1A 2F2VA 3FDRA 2DD4A 2RQTA 3WXMB 5LJ5g 2RNAA 3EG2A 4KH0B 5GANg 2CKKA 1SSHA 5GJWB 1KHCA 2DX1A 4EMKC 2Y4YA 1YJ9T 1UGQB 4B9XA 5IH2A 2QYZA 3GP8A 2RI2A 4OB3B 2DETA 4OMMA 1E7OA 3QIIA 3OMGA 1YP5A 4LN2A 1S72T 4M7DE 3CD6A 1WX6A 2C06A 3H6ZA 1K73R 4ZTFA 1X75C 2YUQA 4F16A 2QASA 1GCPA 3QDFA 4EMKA 2K6DA 3O8VA 2CZ6B 3CC2Q 3LGLA 1X69A 2MOXA 4M77G 2EYYA 4O5VA 3QBYA 2RPNA 2VASA 1N6AA 3VKIA 4E2FB 3I5SA 4AFSC 4LDXA 1I07A 1X43A 2DKGA 3S6WA 4KRTA 3E2UA 3RMSA 3JB9I 1OU8A 3A8GB 1AOJA 4F14A 5CIUA 4OVAA 3D7SB 1KC8U 3I56T 3ASKA 5GMKj 2RHZA 3VS5A 3CCEQ 1K0XA 4RCBA 4RMOA 5C0MA 4KUIA 1JJ2P 1OULA 4JS4A 1QVGS 5GAMg 2A36A 3V7SA 2COYA 3CPWA 1R0BG 4LNPA 1SG5A 1WJRA 5FU7B 1JO8A 2V8JA 1YJWQ 4XK8E 2X4WA 4C0GA 2LNVA 3OYAA 4FIBA 4JS5A 3GF5A 2QAZA 4Y28E 2FB7A 2KVQG 2XD0A 2JVVA 2FRWA 4M77F 5LJ5h 1O9SA 5FU7C 1KD1U 2JNGA 5GANh 5DY9A 1VQ4Q 2YRCA 1I8FA 1PG5B 4HT9A 2A3LA 1WZOA 1XJWB 4M7AG 2EQJA 1G8XA 2DL7A 1T3SA 1HSQA 3CMAQ 2V1RA 1O75A 1D09B 2EQMA 3C4SA 4FM4B 2BIVA 3REBB 4V2SA 2DXUA 1BYMA 1BI1A 2KYBA 1T0HA 2HBWA 4JLGA 2J05A 4KGVB 1YI2T 3M9QA 2FRYA 3S3OA 1GFCA 1XQHA 1N8RU 4M7DB 1KHIA 4ZGJB 1BI3A 1PCXA 1QKXA 1H8KA 4OGEA 2RO0A 3R6OA 2HBPA 4XU0A 3VS1A 4QVZA 1KD1R 1Z9ZA 2J6FA 2LT1A 3S3NA 1IO6A 2M16A 2HZYA 4M7DC 3X28B 2QA4Q 4GY5A 1UGSB 1ZHIA 2DF6A 4ME7A 2IPOB 2O31A 2K5LA 2LQNA 1VQKA 4M7AF 1IZ6A 9ATCB 2EJGA 4BI3A 3CXCS 2P0QA 2X51A 5GAMh 5CKDA 2KAFA 1MGQA 2DJQA 2M02A 3DB4A 5FU6B 4M7DA 3EAEA 5I22A 5KYYB 4WTOB 3X26B 2WSFE 2ENMA 3KUFA 3M4GA 3OYCA 1SPKA 1TXQA 2RHXA 2DXTA 2LJ3A 2DIQA 3X20B 2P4RA 4C8QF 3OYHA 5FU6C 5CR2A 2ZPFB 4DOVA 3JCMV 3MP8A 2LDMA 2RJDA 2PQWA 2RHUA 2OTJT 1VQOQ 4JRKA 3UA7A 2E3HA 1WXBA 5ECAA 2EPDA 4BD3A 1G3YA 1W2BP 1YITQ 1M27C 1VQNQ 1MUZA 3EFOB 2IG0A 1PWTA 3EFSA 3PT9A 4M75E 1K0SA 5I21A 4ATOA 1WGSA 5KYYA 2DXBA 3EG3A 3JCMJ 3DB3A 2D0QB 2RQWA 3G7ZA 3M59A 1VQ8Q 2E6ZA 1Q7YR 1WHHA 1WYXA 4D8KA 4X9CA 1DJ7B 5HY6A 2EBPA 4FSXA 1FX7A 3V7RA 5GAOq 2NUPB 2RQVA 3QZ5B 3CCJT 3OYYA 4OMLA 2JUFA 3L42A 4KBMB 2EYWA 4FYYB 1YHQQ 3LLRA 1YJNA 2EGEA 3OSVA 2DZCA 4CC7A 3QYGB 3J7AF 3FJ5A 1OX9A 1WXUA 1U1TA 4AG1C 3JCMc 1W6XA 2EIFA 1EIFA 2LCSA 3I9QA 2DK3A 1OPLA 2HAXA 4PFOA 1LCKA 2E10A 3OBWA 1MNDA 2C0IA 2RQRA 2ZPBB 3LYIA 1HK9A 3OYLA 1D0ZA 4E7ZA 2LCCA 2DYBA 4C5GA 2ESWA 3EG1A 5GAN8 1KQSP 2AZSA 2NLUA 1X6OA 2M51A 4EDUA 2LCLA 2R5AA 2VXEA 3VYGA 4JZ4A 2NUPA 5EC7A 2YDLA 2FHDA 1GFDA 2YUPA 3OW2S 3A8MB 1AHJB 3BDLA 4MMKA 6AT1B 2X35A 4C5EA 2IIMA 2EJ9A 1X2QA 3TQ7P 3VS3A 4XAXB 4HKEA 2CP7A 2E41A 1OOTA 3A8LB 3G4SA 3CC7A 1IHVA 3J81E 1VQMQ 1AD5A 1BKBA 3CCUA 3PTAA 1NZ9A 2KXDA 1N5ZA 3SEMA 1QKWA 3X25B 4F7UB 2YRVA 3EFRA 3L2ZA 3TSZA 5LJ5d 3VV0A 2OTLA 1X27A 1KK7A 4RUGA 1VYUA 5GAN4 2V8KA 2FZGB 5LJ3e 3JCMe 4PJOD 4MZTA 5CAIA 2LNHB 1M30A 4JRQA 4M75B 4HT8A 3OQ5A 2JMAA 4PL6A 1RLPC 1PM3A 3CBMA 3JB9D 2F5TX 3VS6A 3VRZA 2HSPA 1R8OB 1Q82R 1TG0A 3PE0A 2R5MA 2RA2A 1N9SA 2OAUA 1M1KC 1WFWA 4M75C 4IUQA 5IHNA 2CP0A 1UGVA 1OYXA 4PJJA 1UG1A 4KGZB 5L8RE 2ZPHB 1WIEA 1NJIR 4IIOA 4KUDK 5D6YA 4OMPA 2RI5A 4F7UA 4J9CA 2DRKA 4PKCC 2KYMA 5L23A 1OX8A 1RAHB 2DFUA 4JJCA 1VQLA 5LJ3g 4UC4A 4M75A 4JDSA 2DBKA 4J7FA 4IUVA 2HD0A 3DKMA 2VUBA 2QQSA 4E7LA 4J6YA 2COZA 3OYJA 2QK0A 4IUUA 1S72A 1NLOC 4M78G 4PFPA 3M4YA 4LXCA 3G1JA 4DBFA 1MMNA 4N0AC 4BY6B 1QCOA 1VQ6T 3L2RA 3I55Q 4N4HA 2ZPEB 1JB0E 1NEBA 1M1FA 3FIFA 1RAIB 5GMKm 3UWNA 1QMCA 4CC4B 1UJ0A 4C0FA 1Q81C 4BY6C 2JTMA 3EGXB 2QEXQ 1MHNA 3CCRA 5CO7A 1IHWA 3NPFA 4N0AA 1TSFA 2KRNA 1VQ5T 4OP0A 1WJSA 2NUTB 3HFNA 2K79A 3EHRA 1ZUKA 2DNUA 4ZTJA 1EX4A 1UTIA 1QLYA 2A28A 3QWXX 2YHTA 2RQUA 1YCSB 1WHMA 2Y4XA 5GANf 3OYGA 2CT3A 3G4ST 3JCMb 5IT9E 3QSUA 1B07A 4M78F 2JW4A 2LT4A 3BW1A 4IUTA 1A0NB 1UHCA 3CCUT 2KI7A 1NE8A 2EYZA 1KIKA 1AWJA 2PVOB 1VQ7T 1KSWA 5FRNA 1KQ2A 1UJYA 4Y91A 2ROLA 2OTLT 4WCIA 3JV3A 3CC4A 2MK5A 1VIFA 3EGXA 4DA4A 1U1SA 4FYVB 1X6GA 4M77D 1PD1A 1Y07A 1LNXA 4P5NA 5KYNA 1G3WA 1K8AC 3CEYA 2NUTA 1M2OA 5LJ3h 3GNGA 4E47A 4J5YA 2O01E 3CCMA 3ZBDA 4A4GA 3RUXA 4BDZA 1YIJQ 5GANj 2E65A 3EHQA 8AT1B 4E7IA 2D8JA 2R57A 3M0UA 2XDBA 4OMOA 2YXYA 5KCHA 2DAQA 3OB9A 1YI2A 2VWFA 8ATCB 5A0DA 2CSQA 1I1JA 3CQTA 5J3BA 3HL8A 5CQYA 2F2WA 4QKUA 4MDXA 1ZLMA 1E6GA 4F7UG 1I0CA 4HXJA 5HK0A 2M0OA 2NUZA 1TWBA 4RCCA 1VQLT 2RHIA 1H3HA 5CQXA 5GAMf 2HMAA 4TVRA 2DIGA 4E7SA 1UB4A 1AZEA 5GAOr 2YRDA 3L2WA 1ZSZA 3CC2T 4RTXA 3R6NA 1UE9A 1QQJA 2OI3A 4E6RA 1VUBA 3PMTA 4ZGDB 2JJ9A 4X9DA 3MEVA 2ATCB 1B7TA 3LWIA 1GBRA 2FG0A 4M7AD 4F17A 3MPUB 4DEXA 2FEIA 3M5AA 3PIPA 4AFZC 2XU8A 2V8IA 4QT7A 3GLXA 4RTUA 1JJ2A 5KH6A 5D6WA 2J6OA 2RHYA 3CCET 4NL2A 5LL6S 3GOXA 2KRMA 1AEYA 2F2XA 3CCRT 5GAMj 5KE3A 2CDTA 2D8HA 3ZEHA 3PVQA 5IN1A 3A5ZB 2BTTA 4CI0C 1YJ9Q 4F7UF 2KGTA 1UFFA 4LDYA 1QW1A 1YJWT 5GMKe 2DL5A 3CBPA 4C8QD 1K9MC 3HKSA 1NPPA 1WHKA 2EJFA 3OS1A 4N4IA 1RLQC 3AT1B 1NLPC 1SKUB 2WACA 3MEUA 1IRXA 4GBQA 2OTJA 3HSBA 3HP9A 2K57A 1ZA2B 2JN0A 1IGUA 3OW2P 1C1AA 3LW5E 3BDUA 2C0TA 5HCKA 2O2OA 1WQWA 3QJYA 3TSWA 2ABLA 3V8JA 4JJBA 1D0XA 4OMQA 3CC4T 1JBMA 5C6SA 4J9EA 4J8OA 2KNBB 1MNEA 4C92G 1Y57A 1FMWA 1ZX6A 2EGAA 4A4HA 4HCCA 2A37A 3CCJA 3VU3C 3M0PA 3PGGA 3I56Q 3CCMT 3ZFJA 1KC8R 2CUDA 1N27A 5AYFA 1U3OA 2VVKA 3U23A 1GXIE 3LWHA 3H9NA 3JSCA 1N9RA 3INZA 4E7KA 3EGUA 4J9DA 3CCSQ 5KYWB 5GAN2 2QA4T 4QQDA 3GNFB 2DE0X 3CCLA 4PJOE 1JQQA 1FMKA 1ABOA 3H0FA 4GLMA 1HD3A 4HVVA 4JLIA 4LUEA 2XDPA 3M55A 3CMEA 2QQ9A 2G6FX 1Q95G 4KH1B 3CCQQ 1W70A 4NL3A 1D3BB 2MWOA 2X4JA 5KYXB 4MMLA 3JRZA 2AK5A 2A0FB 3VS0A 4C92F 3P8HA 2JOYA 3NGPA 1W1FA 1MMGA 4ZN3A 5GMKi 2HDAA 3GPLA 2L3PA 1J3TA 1SEMA 1N8RR 3MEAA 1YWPA 1VQ9A 2AKLA 2EAYA 1YCYA 1W2BA 2DPPB 1ZBXA 3H41A 3NFCA 3VUZA 4ORZA 1TH7A 3SB2A 1SHGA 1YITT 1VQNT 3OYNA 4OMFB 2QXFA 5LJ3d 3N5BB 1ZA1B 1Y71A 4KULA 2R58A 5KYXA 5GJVB 4ELZC 1HXDA 3H8ZA 4IIMA 2KMTA 3CD6Q 3CCVA 2PZ1A 3QWYA 5GMKh 2FZKB 4BE0A 1VQ8T 2PU9B 1H92A 2L89A 1SSFA 2QQAA 5GAOn 2CH4A 4ANJA 1C0MA 4DBQA 3QHSA 5GMKl 1PKTA 1PRLC 2XICA 2OX7A 3FJPA 2HL3A 2MIOA 2V26A 3L1AA 2I0NA 2K3BA 3QUIA 1WQ7A 4FW1A 1M1KU 3URGA 1UEBA 2L3SA 1NG2A 1GL5A 3M57A 2E5QA 1GCQC 1KQ1A 1QVFP 1JRIA 1UECA 3VYHB 4BUGA 3G71A 1JEGA 3PIOA 2DILA 2HQEA 3SDZA 4PJOB 2D0NA 3FC3A 2HQHA 1KQSA 2CP3A 4A4EA 4ZGEB 2RF0A 3RKXA 2LVMA 4J6WA 3RKYA 1R0CB 1UGRB 2GQVA 2QGGA 2X4YA 2RN8A 2SRCA 1RABB 4II1A 2L3RA 1X2KA 4X1VA 3V8KA 4J6XA 1VQ6A 4PJOC 1CKBA 3OYMA 1I4K1 2P0PA 3EFOA 3AHUA 2M1HA 3JAME 2QTVA 3META 3CCLT 2F69A 1B34B 4M77E 1M1KR 5CKHA 3OS2A 2FVUA 4FT2A 3UA6A 1OPKA 2GQIA 1YFNA 2DTOA 2NWMA 1Q86C 2DERA 2ZPIB 2FZCB 3CMET 4B6MA 1BBZA 3VUBA 4AFQC
chains in the Genus database with same CATH topology
4XU1A 4PJOA 3FIFA 1VQMT 1Q81U 2C06A 3H6ZA 1VQ5A 5GMKm 3UWNA 3LH0A 4ZTFA 4QVCA 1WJQA 1X75C 4BB7A 4C0FA 1Q81C 1OZ2A 3P8BB 4FT4A 4BY6C 2JTMA 1MHNA 5M9OA 5CO7A 3CCRA 5GAOl 3CD6T 4EMKA 3O8VA 4N0AA 1JJ2S 5FRMA 2MAMA 2CZ6B 1Y7XA 3LGLA 1PSEA 2QDYB 1RI0A 2CZ0B 4M77G 4OP0A 1VQ5T 4IURA 3TU4K 1WJSA 3QYHB 3G6EA 2YLCA 3HFNA 3QBYA 4O5VA 1I5LA 1KG1A 1M5Q1 1VQOT 3WVDB 1N6AA 3VKIA 4ZTJA 1VQPA 4LDXA 3E9GA 1BIBA 4M78D 2DKGA 2D6FA 4HCZA 3P8DA 3S6WA 2MI6A 1VQ9T 1B34A 2QQRA 3RMSA 3JB9I 2YHTA 4BI4A 3JCMd 2VXFA 3A8GB 2RB6A 3HRUA 1D3BA 2DD5A 2Y4XA 1VQ7A 4M7DG 3WVEB 3DLLA 5A2QE 5GANf 3OYGA 5CIUA 3G4ST 3JCMb 3BY7A 5IT9E 2E70A 4OVAA 1FWZA 1QVFA 3QSUA 5CCAA 4M78F 2LT4A 3BW1A 4IUTA 3OYKA 1KC8U 3I56T 3ASKA 5GMKj 3CCUT 1Q7YU 2RHZA 2D9TA 4BDYA 1NE8A 4B9WA 4RCBA 4RMOA 5C0MA 4KUIA 3F70A 1NPRA 1KC8C 3A8HB 2I2LA 2PVOB 3FRNA 1Q7YC 1VQ7T 4JS4A 5FRNA 1KQ2A 4Y91A 4J7IA 4JJNK 3MHXA 5GAMg 2LQKA 1QVGS 3V7SA 4M7AE 3CPWA 2KDSA 1U8RA 3CPWS 3CCVT 2OTLT 1WNLA 2K2VA 2CGHA 2L5QA 3CC4A 1VIFA 1WJRA 3Q1JA 3QJ6A 5FU7B 2XDDA 1K8AU 4DA4A 2V8JA 4M78B 1U1SA 4M77D 4XK8E 1Y07A 1YHQT 1LNXA 2X4WA 4P5NA 1G3WA 2LNVA 4C0GA 2E12A 3CEYA 3OYAA 1K8AC 3CD6A 4F7UE 4FIBA 4BI8B 4JS5A 5LJ3h 3M54A 3GF5A 3GNGA 4IUPA 4E47A 4R55A 1M90U 4J5YA 2O01E 5I2MA 4Y28E 3HFOA 2EYQA 3CCMA 2FB7A 3ZBDA 2KVQG 4XTWA 2XD0A 1M90C 4QQGA 4R56A 2JVVA 2ZPGB 4M77F 4OF1A 5LJ5h 4A4GA 3I55A 1O9SA 4M7DD 5FU7C 3RUXA 3QXEB 2KK4A 4BDZA 2JNGA 1KD1U 5GANh 2DXCA 4M78C 3S3MA 5DY9A 5GANj 2E65A 3CBOA 1YBYA 1KD1C 1I8FA 4C8QE 4E7IA 4HT9A 2A3LA 2ZCFB 2R57A 4M7AG 3KXTA 2DO3A 2EQJA 2XDBA 4M7DF 3DLMA 4YTLA 2G3RA 5GAOm 3I55T 3G71T 2LRQA 1P92A 2XI9A 2DAQA 3OB9A 3JCMg 4C0DB 5KCHA 1YI2A 4XU2A 5A0DA 1XOVA 5D6XA 1O75A 3JCMW 4M77B 5J3BA 3HL8A 5CQYA 2EFIA 2QEXA 2FYKA 2EQMA 4LD9K 4JRIA 2EKOA 3C4SA 5J26A 4MDXA 1RL2A 2M9UA 2QI2A 4FM4B 4F7UG 4PNOA 2BIVA 3CC2A 4V2SA 2DXUA 1BYMA 1H641 3PFSA 5HK0A 1BI1A 5GAN7 2M0OA 2RD1A 2PUKB 4IKFA 4RCCA 4M78A 1VQLT 2RHIA 4JLGA 5CQXA 5GAMf 2VC8A 2LTOA 3FLGA 3M9QA 2DIGA 3MEWA 4TVRA 4QVDA 2RI3A 3OYIA 3S3OA 4M7DB 1XQHA 1N8RU 1KHIA 1UB4A 1M8VA 2E1HA 2YLBA 4ZGJB 5GAOr 4C0DC 1BI3A 3L2WA 3JB9J 4OGEA 3OS0A 1OI1A 1LOJA 4M77C 1N8RC 3CC2T 2EQUA 4RG2A 2RK1A 5HK3A 2RO0A 3R6OA 3KBGA 1H3ZA 2L8DA 2HBPA 3PMIA 4XU0A 1VUBA 3PMTA 4QVZA 3J80E 4ZGDB 2LT1A 3S3NA 1W4SA 4X9DA 3V8LA 2M16A 3MEVA 3LWIA 3CCEA 2VGNA 4M7AD 4M7DC 3X28B 4GY5A 1UGSB 1ZHIA 3M5AA 3PIPA 2XU8A 4L5GA 2V8IA 3E9FA 2HQXA 3OSSC 2E64A 2RM4A 3GLXA 4ME7A 1JJ2A 2DTHA 5KH6A 3JCMP 4M77A 2K5LA 5D6WA 2RHYA 1BI0A 4BE2A 4NL2A 1VQKA 3CCET 1IZ6A 1YJWA 2EJGA 5DM7R 3JCMQ 4M7AF 3MP6A 4XTUA 4BI3A 3CXCS 3PNWC 5LL6S 2P0QA 3GOXA 5LJ3f 3JCMf 5GAMh 3CCRT 4XTYA 3UDCA 5GAMj 4MZPA 5CKDA 2K5FA 3OBYA 2LC4A 4MDWA 5KE3A 2KAFA 1MGQA 3OS5A 3ZEHA 5J39A 5FU6B 3DB4A 3A5ZB 5IN1A 3EAEA 5CKBA 4CI0C 3QPHA 4F7UF 5LJ5f 2F5KA 4XTZA 1XNIA 3G6ET 1VQKT 4LDYA 2EQKA 1QW1A 1YJWT 1BI2A 5GMKe 1Q82U 3CBPA 4C8QD 1K9MC 3X26B 3JB9H 3M53A 2WSFE 5GAN6 1VQPT 3KUFA 3M4GA 4M7AB 1QP3A 2GFUA 2K4YA 3OYCA 1I81A 3HKSA 1YIJA 1Q82C 1VQ4A 4FU6A 2RHXA 1M1GA 1NPPA 4C92E 2EJFA 2MF2A 2DXTA 4C5HA 3OS1A 4N4IA 3RESA 4N4GA 2ZZDA 5CKFA 2DIQA 3M56A 2WACA 3MEUA 3NTIA 3X20B 1QVGA 2OTJA 1PSFA 4L59A 2AHJB 1NJIU 4C8QF 3OYHA 5FU6C 3HSBA 3VJPA 3SWNB 2FL7A 3L2VA 3HP9A 2XKOC 5CR2A 3CMAA 2K57A 3GIBA 2ZPFB 2JN0A 2P0KA 2DVEA 4VUBA 1NJIC 4DOVA 3JCMV 3MP8A 3LW5E 3BDUA 1Y96B 2LDMA 4D6WA 4M7AC 1G3TA 2RJDA 2GCXA 4EMHA 2MMPA 5GANd 2CZ1B 2RJEA 1G5VA 2PQWA 2RHUA 1WQWA 3QJYA 2BKDN 5DLOA 2QTXA 2OTJT 1OZ3A 4JRKA 4Q5WA 3JCMh 2RK2A 2DZ9A 3V8JA 4E7JA 5LJ3j 2ZGWA 4BD3A 1G3YA 3CC4T 1JBMA 4C8QB 5C6SA 3SWNC 2LQ8A 3LX7A 3OMCA 5GANe 2IG0A 4J8OA 3E1SA 5LJ5j 3EFSA 4C92G 3PT9A 3HPWA 4A53A 4M75E 4HCCA 4A4HA 4ZN1A 4L6V5 5I21A 4ATOA 3CCJA 1WGSA 2DXBA 3VU3C 4WF2A 3PGGA 3JCMJ 2HNIA 2D0QB 3DB3A 3G7ZA 3M59A 3E19A 3ZFJA 3CCMT 4M7AA 2E6ZA 4FL6A 1N27A 4XTXA 3ME9A 4X9CA 1DJ7B 4OB1B 5AYFA 5HY6A 2QA4A 4C8QC 3RMQA 4JRPA 2BUDA 1GXIE 3LWHA 3RERA 4FSXA 1FX7A 1BIAA 2DEQA 3V7RA 5GAOq 3QZ5B 5GAN3 3CCJT 3OYYA 3JSCA 1N9RA 3SWNA 2CZ7B 2JUFA 3L42A 3TEEA 3INZA 5KE2A 4E7KA 4KBMB 1KQSS 4HCBA 5GAN2 3LLRA 1Y96A 1YJNA 3OSVA 2LX9A 4OB0B 2DZCA 4OB2B 3X24B 4QQDA 2QA4T 3GNFB 3QYGB 3J7AF 3CCLA 4NOYA 4PJOE 2B8AA 2XIDA 2QEXT 1U1TA 2WSEE 2VV5A 4M75G 3JCMc 4E7HA 5EG2A 4C0ZA 2EIFA 1EIFA 4JLIA 4C8QA 4EPCA 1YJ9A 2RJCA 2DK3A 4C92D 5CK9A 2JTFA 1YJNT 1WPYA 2CS7A 4LD6A 4BE1A 2HAXA 3FB9A 2E10A 2RJFA 2Y90A 2DTIA 2XDPA 3M55A 3OBWA 3UT1A 3CMEA 2QQ9A 2ZPBB 3LYIA 2XG8D 1HK9A 4HA8A 4LDWA 1ZQ1A 3OYLA 4NL3A 1D3BB 2LCCA 2MWOA 2X4JA 4MMLA 4A54A 3JRZA 4XU3A 4C5GA 5GAMd 2PVGB 4C92F 5GAN8 4GLKA 3P8HA 4LDVA 4KT0E 4EMGA 2KSSA 2NLUA 2JOYA 1X6OA 4EDUA 2LCLA 4QW2A 2R5AA 2VXEA 3VYGA 2E6NA 3SD4A 3TREA 2FHDA 4PJOG 2H3JA 5GAMe 3CXCA 3LGFA 3M58A 4ZN3A 3OW2A 3OW2S 5FLXE 4BACA 3A8MB 1VQOA 3QO3A 3OA6A 5GMKi 3GPLA 2QQBA 1AHJB 3BDLA 3NTHA 4MMKA 2X35A 3RKWA 2EWNA 4C5EA 4C92B 4OGCA 1YITA 3MEAA 3MCAB 3NTKA 4M75D 1VQNA 1VQ9A 4XTVA 2EJ9A 4CRIA 3JB9G 2P4TA 2EAYA 3QG1A 3OYBA 3BFMA 5FROA 1YCYA 2WSCE 4XAXB 1W2BA 3QKJA 1W2BS 2DPPB 1IREB 4HKEA 4RKUE 2E41A 1XTDA 2VYTA 1ZBXA 3NFCA 5I2SA 3A8LB 3G4SA 3C95A 3VUZA 2VGMA 1TH7A 3ER0A 3SB2A 3J81E 3CC7A 1BKBA 3I56A 3CCUA 1YITT 1K9MU 4M75F 4ELYC 1NZ9A 2K5IA 3PTAA 5DLQE 4DOWA 3C94A 4OMFB 2O4XB 2QXFA 3OYNA 1VQNT 2K3XA 5LJ3d 3N5BB 4C92C 5KCOA 1Y71A 4KULA 4A4FA 3X25B 2R58A 4F7UB 1M4ZA 2KY9A 5GAOp 4ELZC 1HXDA 3H8ZA 2YRVA 2KMTA 1YIJT 2IVWA 1VQ4T 2PVDB 3EFRA 3L2ZA 3RIRA 5LJ5d 3CCVA 3VV0A 2OTLA 3CC7T 5CVIA 1QVFS 5GMKh 1VQ8A 5GAN4 4BE0A 1VQ8T 2V8KA 5LJ3e 2PU9B 3JCMe 4PJOD 4MZTA 2A7YA 4QQ6A 3MO8A 5CAIA 2L89A 3CCSA 1YHQA 3L2UA 4JRQA 1SSFA 3SFMA 2QQAA 4M75B 3TCJA 3OQ5A 5IAYA 5GAOn 4HT8A 4Z02A 3CMAT 3QHSA 2GF7A 4PL6A 3CPFA 4MZMA 5GMKl 2X4XA 5LJ5e 4M7DA 3V7CA 2K3YA 2XICA 3CBMA 4JUVA 3FJPA 2XK0A 3OY9A 4C5IA 4C92A 3L1AA 4A4KA 3JB9D 2F5TX 4PJOF 1X01A 3HHTB 1R8OB 3QUIA 4RG8A 1WQ7A 5A0GA 1LJOA 1QP2A 3CCST 1M1KU 3URGA 1UEBA 2XHCA 2R5MA 2RA2A 1N9SA 2OAUA 2DJZA 2KQWA 1M1KC 4M75C 3CCQA 3M57A 2E5QA 4IUQA 1KQ1A 3JB9F 2MWPA 1JRIA 1OYXA 2GFAA 4M78E 5CKEA 3VYHB 3QDRB 3QZ9B 2O4XA 4PLIA 4BUGA 5L8RE 2ZPHB 3G71A 3PIOA 3SDZA 2HQEA 4KUDK 5D6YA 5A0LA 4PJOB 1M9SA 1UGPB 2RI5A 4F7UA 3FC3A 4PKCC 4NS5A 1KQSA 5HKCA 4X34A 1K73U 4A4EA 3CCQT 4ZGEB 3RKXA 2LVMA 4J6WA 3T9NA 3A8OB 3RKYA 1FXXA 4LDUA 3OYEA 1K73C 3L2QA 1UGRB 3OYFA 1VIEA 2GQVA 1VQLA 3HRTA 4EMKB 2X4YA 3C12A 5LJ3g 4UC4A 4PLLA 4II1A 3OYDA 4M75A 4J83A 2JZ2A 2L3RA 4JDSA 4DQ2A 3MP1A 3FDRA 3V8KA 4J7FA 4IUVA 2HD0A 2DD4A 4J6XA 1VQ6A 4PJOC 3HRSA 3WXMB 3OYMA 1YI2T 3DKMA 1I4K1 2P0PA 4XQ3A 2VUBA 2QQSA 5LJ5g 4E7LA 3AHUA 2M1HA 5GAN5 4J6YA 3OYJA 3JAME 3META 5GANg 3CCLT 2CKKA 2F69A 4IUUA 1S72A 1B34B 4M78G 4M77E 2PUOB 5CKHA 3OS2A 2FVUA 3M4YA 4FT2A 1Q86U 1VQMA 3UPUA 1KHCA 1QVPA 4EMKC 4N0AC 2RH2A 2Y4YA 4BY6B 1YJ9T 3FEOA 1VQ6T 3L2RA 2DTOA 4N4HA 1UGQB 4B9XA 1Q86C 2ZPEB 3GP8A 2RI2A 4OB3B 1G3SA 1JB0E 2ZPIB 3QIIA 3OMGA 4C8QG 2CYZB 3CMET 4O6JA 1S72T 1M1FA 3JCMX 4M7DE 1V29B 3VUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MDW A; 
#chains in the Genus database with same CATH topology
 4Z89 A;  4PJO A;  1VQM T;  1Q81 U;  3UAT A;  2X3X D;  1VQ5 A;  1WJQ A;  4HVU A;  4BB7 A;  1T0J A;  5FWC A;  2O88 A;  1OZ2 A;  3P8B B;  1K1Z A;  4FT4 A;  5M9O A;  1AWW A;  1IXD A;  1UHF A;  1JJ2 S;  1Y7X A;  1PSE A;  2QDY B;  1RI0 A;  4IUR A;  3TU4 K;  3QYH B;  3G6E A;  1I5L A;  2YLC A;  3M0T A;  1KG1 A;  1BU1 A;  1M5Q 1;  5AT1 B;  3WVD B;  4R0K A;  1VQP A;  3E9G A;  4M78 D;  2O9S A;  3P8D A;  1VQ9 T;  1B34 A;  2QQR A;  2HSE B;  2RB6 A;  1AWO A;  1YN8 A;  4M7D G;  1VQ7 A;  3WVE B;  3DLL A;  2DVJ A;  3BY7 A;  2E70 A;  1FWZ A;  5CCA A;  2Z0W A;  3EH2 A;  2D9T A;  1UUE A;  2BZY A;  4FSS A;  4BDY A;  2LMJ A;  1NPR A;  3A8H B;  1Q81 R;  1Q7Y C;  3MHX A;  2LQK A;  2JM9 A;  4M7A E;  1U8R A;  3CPW S;  3CCV T;  2K2V A;  2L5Q A;  2DL3 A;  3Q1J A;  3QJ6 A;  4CC3 A;  1K8A U;  1VQK Q;  1M3A A;  1TS9 A;  2ED1 A;  4R55 A;  1ABQ A;  3HFO A;  1TUD A;  1M90 C;  1WDX A;  4R56 A;  2ZPG B;  4OF1 A;  2M0Y A;  2KK4 A;  2V1Q A;  3CBO A;  1QVG P;  1YBY A;  1MV0 B;  4C8Q E;  1ZUU A;  2HL5 C;  4CC2 A;  3KXT A;  1FMV A;  1RAC B;  4M7D F;  1YNZ A;  3DLM A;  2G3R A;  5GAO m;  3I55 T;  3G71 T;  1P92 A;  3JCM g;  4M77 B;  1WLP B;  1RI9 A;  2EFI A;  1RAE B;  2FYK A;  2MPX C;  2QI2 A;  2M9U A;  3CC2 A;  4PK4 A;  4A63 B;  1E6H A;  5GAN 7;  2RD1 A;  2PUK B;  4IKF A;  2KRS A;  2LTO A;  3MEW A;  3OYI A;  4QVD A;  2RI3 A;  3THK A;  2JXB A;  1M8V A;  2E1H A;  2YLB A;  2KE9 A;  2HCK A;  4M77 C;  2CP5 A;  2EQU A;  4RG2 A;  5HK3 A;  1SF9 A;  3KBG A;  1EFN A;  1H3Z A;  4F04 B;  2L8D A;  3PMI A;  3EH1 A;  3M0S A;  2L3Q A;  3V8L A;  1K4U S;  3CCE A;  3E9F A;  5IXF A;  2HQX A;  1RUW A;  2W0Z A;  2RM4 A;  1NYF A;  2DTH A;  3MKD A;  1PD0 A;  3NHN A;  2DRM A;  4M77 A;  2FPF A;  1YJN Q;  1YJW A;  5DM7 R;  3JCM Q;  4EIK A;  2EVR A;  2X3W D;  3MJX A;  2H3E B;  1D1C A;  4XTY A;  3UDC A;  4ESR A;  3OBY A;  2LC4 A;  1RAD B;  5J39 A;  1TUG B;  1K9M U;  2H8H A;  5LJ5 f;  3QPH A;  2F5K A;  1BCO A;  2EGC A;  3G6E T;  1NBE B;  2EQK A;  1BI2 A;  3JB9 H;  4FW2 A;  2BE9 B;  5GAN 6;  1VQP T;  1PHT A;  4M7A B;  2GFU A;  1Q82 C;  1VQ4 A;  2MF2 A;  2HEQ A;  3RES A;  4N4G A;  4ZNX A;  3M56 A;  3NTI A;  4J9G A;  1U06 A;  1PSF A;  4L59 A;  4DEY A;  1QWE A;  3VJP A;  1QWF A;  1F1B B;  2FL7 A;  3L2V A;  3CXC P;  3CMA A;  3GIB A;  2P0K A;  2DVE A;  4VUB A;  1NJI C;  2CSI A;  1Y96 B;  4M7A C;  1G3T A;  4EMH A;  2AT1 B;  2MMP A;  1WHG A;  3EG9 B;  1D0Y A;  5DLO A;  2KXC A;  4Q5W A;  3JCM h;  1V76 A;  2ZGW A;  1KJW A;  2QGF B;  3BE3 A;  4C8Q B;  3LX7 A;  4Y92 A;  5GAN e;  5LJ5 j;  1K9M R;  3H0H A;  4A53 A;  3G4S Q;  3CC7 Q;  1MV3 A;  2F1L A;  1MMD A;  4WF2 A;  2HNI A;  1PC0 A;  3CCU Q;  3E19 A;  4M7A A;  1HJD A;  2K7A A;  4XTX A;  4OB1 B;  1ZBJ A;  4JPB W;  2QA4 A;  4C8Q C;  3RMQ A;  2BUD A;  2OTL Q;  5GAN 3;  2FPE A;  4DBR A;  1KQS S;  3PVL A;  1Y96 A;  1JXO A;  3EG9 A;  2B8A A;  1S1N A;  2XID A;  1C6V X;  2YSQ A;  3REA B;  4RTT A;  4M75 G;  4C0Z A;  2AIR B;  4C8Q A;  4EPC A;  2LX7 A;  1QCF A;  4C92 D;  2JTF A;  1WPY A;  4BE1 A;  2Y90 A;  2DTI A;  2ZAE A;  4M4Z A;  5IHK A;  2J7I A;  4A54 A;  4XU3 A;  2PVG B;  2AZV A;  4GLK A;  1WHJ A;  1IB8 A;  4KT0 E;  1TU0 B;  2KSS A;  5FW9 A;  4QW2 A;  2E6N A;  3SD4 A;  5IHI A;  3TRE A;  1K9A A;  2ED0 A;  5GAM e;  3LGF A;  4J9H A;  3M58 A;  3OW2 A;  5FLX E;  1VQL Q;  1VQO A;  2QQB A;  4OGC A;  1YIT A;  3NTK A;  1VQN A;  3QG1 A;  3OYB A;  5FRO A;  2WSC E;  1IRE B;  1XTD A;  2VYT A;  1S72 Q;  5I2S A;  3IQL A;  3C95 A;  2VGM A;  3ER0 A;  4PFZ A;  1VQ8 A;  4M75 F;  4DOW A;  2BZX A;  5KCO A;  2RMO A;  4A4F A;  2YUN A;  2KRO A;  2IVW A;  1VQ4 T;  2PVD B;  5CVI A;  1AT1 B;  4DBH A;  2A7Y A;  3MO8 A;  1YHQ A;  3L2U A;  3SFM A;  2DYI A;  1WHL A;  4Z02 A;  3CMA T;  3CCR Q;  2GF7 A;  4HCK A;  2X4X A;  3V7C A;  2K3Y A;  4JUV A;  3OY9 A;  4A4K A;  5A0G A;  1LJO A;  2LZ6 B;  3CCS T;  2XHC A;  2E5K A;  4RTW A;  4M78 E;  2GFA A;  5CKE A;  1OQK A;  3QZ9 B;  4PLI A;  4PJL A;  1WI7 A;  3EGD B;  5A0L A;  1QCN A;  1M9S A;  1UGP B;  2E4H A;  1SRM A;  4NS5 A;  4X34 A;  3CCQ T;  4AG2 C;  3CPW P;  3T9N A;  4LDU A;  3OYE A;  1K73 C;  3L2Q A;  3OYF A;  1EZZ B;  2GGR A;  2HKN A;  1VIE A;  3HRT A;  3C12 A;  4PLL A;  3UF4 A;  1BK2 A;  2JZ2 A;  3CC4 Q;  1WXT A;  2EYX A;  1GBQ A;  3H0I A;  3HRS A;  4XQ3 A;  2X9H A;  4FCY A;  5GAN 5;  2OAW A;  2VKN A;  1RAA B;  4AFU C;  2CP2 A;  4PJM A;  2ECZ A;  2PUO B;  3CCM Q;  1Q86 U;  1VQM A;  3UPU A;  1QVP A;  2RH2 A;  1AZG B;  3FEO A;  1B3Q A;  4FYW B;  4HVW A;  2L2P A;  1G3S A;  4C8Q G;  2CYZ B;  4O6J A;  1M8M A;  3JCM X;  1V29 B;  3EGD A;  4XU1 A;  2PTK A;  3LH0 A;  3ZL7 C;  4QVC A;  2KR3 A;  2PNI A;  5KYW A;  1YI2 Q;  1I5O B;  1M2V B;  2CUB A;  5GAO l;  3CD6 T;  5FRM A;  2MAM A;  3A98 A;  2FPD A;  2CZ0 B;  4J9B A;  2YUO A;  1VQO T;  4J9I A;  1BIB A;  2D6F A;  4HCZ A;  2MI6 A;  4BI4 A;  3JCM d;  2VXF A;  1Q86 R;  3HRU A;  1D3B A;  2DD5 A;  5A2Q E;  2JS0 A;  5I11 A;  1QVF A;  3OYK A;  1G83 A;  2GTJ A;  1Q7Y U;  4LE9 A;  4B9W A;  2LP5 A;  3F70 A;  2MYS A;  1KC8 C;  2I2L A;  3FRN A;  1D1A A;  4J7I A;  4JJN K;  1LVK A;  2KDS A;  1WNL A;  2CGH A;  1M2V A;  2CH4 W;  2XDD A;  2J06 A;  4M78 B;  1YHQ T;  2E12 A;  2E3I A;  4F7U E;  4BI8 B;  3M54 A;  4IUP A;  1M90 U;  5I2M A;  2EYQ A;  4OMN A;  1IGQ A;  2DLP A;  4XTW A;  1U5S A;  2COW A;  4QQG A;  2GNC A;  1D1B A;  4M7D D;  3I55 A;  3QXE B;  2DXC A;  4M78 C;  3S3M A;  2A08 A;  1AVZ C;  2B86 A;  1KD1 C;  2ZCF B;  4JJD A;  1PKS A;  2DO3 A;  2OTJ Q;  3M0Q A;  4YTL A;  2LRQ A;  2BE7 D;  2XI9 A;  4K11 A;  4C0D B;  4FYX B;  4XU2 A;  1XOV A;  5D6X A;  1KFZ A;  3JCM W;  1GCQ A;  2O9V A;  2QEX A;  4LD9 K;  4JRI A;  2EKO A;  5J26 A;  1PRM C;  1RL2 A;  1AWX A;  4PNO A;  1VA7 A;  4RTY A;  1H64 1;  3PFS A;  2JTE A;  3VRY A;  1K76 A;  4M78 A;  2DMO A;  2VC8 A;  3FLG A;  4C0D C;  3A1P A;  1M90 R;  5IXB A;  3JB9 J;  3OS0 A;  1JXM A;  1OI1 A;  1LOJ A;  1RAG B;  3HTR A;  1N8R C;  2RK1 A;  3CCJ Q;  1R77 A;  1CSK A;  1NEG A;  3J80 E;  1W4S A;  1WA7 A;  2JS2 A;  2VGN A;  1ZSG A;  1RAF B;  2MCN A;  2NYS A;  2EW3 A;  4L5G A;  1NM7 A;  3OSS C;  2E64 A;  1BB9 A;  5FWB A;  3C0C A;  3JCM P;  1BI0 A;  4BE2 A;  4AT1 B;  2AKK A;  3MP6 A;  4XTU A;  3LH5 A;  3ULR B;  3PNW C;  3CCL Q;  5LJ3 f;  4J9F A;  3JCM f;  4MZP A;  2K5F A;  4MDW A;  2KT1 A;  3OS5 A;  3VS2 A;  3TVT A;  2W10 A;  5CKB A;  5KYU B;  3VS4 A;  4XTZ A;  1XNI A;  1VQK T;  1Q82 U;  3M53 A;  3CME Q;  1QP3 A;  2K4Y A;  1I81 A;  1YIJ A;  4FU6 A;  4C92 E;  1M1G A;  4C5H A;  1ARK A;  2ZZD A;  5CKF A;  5D7U A;  1VYT A;  1QVG A;  2J6K A;  2AHJ B;  1NJI U;  3SWN B;  2XKO C;  2L0A A;  3NMZ C;  2YWW A;  4D6W A;  2GCX A;  2CRE A;  5GAN d;  1TOV A;  2CZ1 B;  2RJE A;  1G5V A;  4D8D A;  2BKD N;  2QTX A;  1OZ3 A;  3EG0 A;  3RBB B;  2RK2 A;  2DZ9 A;  4E7J A;  2VB6 A;  5LJ3 j;  2CP6 A;  2K9G A;  1HYO A;  1VQ9 Q;  1NYG A;  3SWN C;  2LQ8 A;  3OMC A;  2FO0 A;  7AT1 B;  3E1S A;  1PNJ A;  1TTH B;  3HPW A;  1V1C A;  5KYU A;  4ZN1 A;  4L6V 5;  2JT4 A;  2GTO A;  4PJN A;  2LJ1 A;  2EQI A;  4FL6 A;  3ME9 A;  2D1X A;  4RTZ A;  4JRP A;  3RER A;  1LPL A;  1BCM A;  3CCV Q;  1BIA A;  2DEQ A;  1VOM A;  3SWN A;  2CZ7 B;  3TEE A;  5KE2 A;  2DM1 A;  4HCB A;  1K8A R;  4Z88 A;  2HKQ B;  4OB0 B;  2LX9 A;  3X24 B;  4OB2 B;  4NOY A;  1TUC A;  2EKH A;  2QEX T;  2WSE E;  2VV5 A;  4E7H A;  5EG2 A;  2P84 A;  1YJ9 A;  2RJC A;  5CK9 A;  1YJN T;  4LD6 A;  2CS7 A;  3FB9 A;  2RJF A;  3UT1 A;  1SHF A;  4HA8 A;  2XG8 D;  4LDW A;  1ZQ1 A;  1MMA A;  1SRL A;  3RR6 A;  3I5R A;  5GAM d;  3G71 Q;  3O5Z A;  4LDV A;  1OU9 A;  4EMG A;  1Y0M A;  2KEA A;  1OV3 A;  1YWO A;  3KFV A;  4RTV A;  4PJO G;  2H3J A;  3CXC A;  3RNJ A;  2DBM A;  4Z8A A;  3RDV A;  3QO3 A;  1M3C A;  3OA6 A;  2DEU A;  1Z9Q A;  2DA9 A;  1ACM B;  3RKW A;  3NTH A;  4C92 B;  2EWN A;  1VQ6 Q;  3MCA B;  2QG9 B;  4M75 D;  4XTV A;  2DL4 A;  4CRI A;  3JB9 G;  2P4T A;  4KGX B;  3BFM A;  3QKJ A;  1W2B S;  4RKU E;  3GBQ A;  2OJ2 A;  3M0R A;  1M3B A;  2KBT A;  1GRI A;  3VS7 A;  3I56 A;  4BAC A;  4AMC A;  2K5I A;  4ELY C;  5DLQ E;  2ROT A;  3C94 A;  2O4X B;  2K3X A;  4C92 C;  1FYN A;  1M4Z A;  2KY9 A;  5GAO p;  1YIJ T;  3RIR A;  1QVF S;  3CC7 T;  1VQ5 Q;  2LJ0 A;  4JZ3 A;  4LUD A;  4QQ6 A;  3CCS A;  2SEM A;  5IAY A;  3TCJ A;  1G2B A;  3CPF A;  4MZM A;  5LJ5 e;  2QDL A;  2XK0 A;  2GBQ A;  4C5I A;  2CT4 A;  4C92 A;  4PJO F;  3G6E Q;  1X01 A;  3HHT B;  4RG8 A;  1QP2 A;  2DL8 A;  1VQP Q;  2DJZ A;  2KQW A;  1ZSZ B;  3CCQ A;  3JB9 F;  2MWP A;  1VQ7 Q;  2YT6 A;  1ZUY A;  3QDR B;  2O4X A;  2JM8 A;  3SHW A;  1VYV A;  1T3L A;  2XMF A;  1OEB A;  3I35 A;  1CKA A;  2JMC A;  5HKC A;  2C0O A;  1K73 U;  2BZ8 A;  3A8O B;  1FXX A;  1ZSZ C;  1X6B A;  2K2M A;  2KT8 A;  4EMK B;  2LQW A;  3OYD A;  1JU5 C;  1UDL A;  4J83 A;  4DQ2 A;  3MP1 A;  2F2V A;  3FDR A;  2DD4 A;  2RQT A;  3WXM B;  5LJ5 g;  2RNA A;  3EG2 A;  4KH0 B;  5GAN g;  2CKK A;  1SSH A;  5GJW B;  1KHC A;  2DX1 A;  4EMK C;  2Y4Y A;  1YJ9 T;  1UGQ B;  4B9X A;  5IH2 A;  2QYZ A;  3GP8 A;  2RI2 A;  4OB3 B;  2DET A;  4OMM A;  1E7O A;  3QII A;  3OMG A;  1YP5 A;  4LN2 A;  1S72 T;  4M7D E;  3CD6 A;  1WX6 A;  2C06 A;  3H6Z A;  1K73 R;  4ZTF A;  1X75 C;  2YUQ A;  4F16 A;  2QAS A;  1GCP A;  3QDF A;  4EMK A;  2K6D A;  3O8V A;  2CZ6 B;  3CC2 Q;  3LGL A;  1X69 A;  2MOX A;  4M77 G;  2EYY A;  4O5V A;  3QBY A;  2RPN A;  2VAS A;  1N6A A;  3VKI A;  4E2F B;  3I5S A;  4AFS C;  4LDX A;  1I07 A;  1X43 A;  2DKG A;  3S6W A;  4KRT A;  3E2U A;  3RMS A;  3JB9 I;  1OU8 A;  3A8G B;  1AOJ A;  4F14 A;  5CIU A;  4OVA A;  3D7S B;  1KC8 U;  3I56 T;  3ASK A;  5GMK j;  2RHZ A;  3VS5 A;  3CCE Q;  1K0X A;  4RCB A;  4RMO A;  5C0M A;  4KUI A;  1JJ2 P;  1OUL A;  4JS4 A;  1QVG S;  5GAM g;  2A36 A;  3V7S A;  2COY A;  3CPW A;  1R0B G;  4LNP A;  1SG5 A;  1WJR A;  5FU7 B;  1JO8 A;  2V8J A;  1YJW Q;  4XK8 E;  2X4W A;  4C0G A;  2LNV A;  3OYA A;  4FIB A;  4JS5 A;  3GF5 A;  2QAZ A;  4Y28 E;  2FB7 A;  2KVQ G;  2XD0 A;  2JVV A;  2FRW A;  4M77 F;  5LJ5 h;  1O9S A;  5FU7 C;  1KD1 U;  2JNG A;  5GAN h;  5DY9 A;  1VQ4 Q;  2YRC A;  1I8F A;  1PG5 B;  4HT9 A;  2A3L A;  1WZO A;  1XJW B;  4M7A G;  2EQJ A;  1G8X A;  2DL7 A;  1T3S A;  1HSQ A;  3CMA Q;  2V1R A;  1O75 A;  1D09 B;  2EQM A;  3C4S A;  4FM4 B;  2BIV A;  3REB B;  4V2S A;  2DXU A;  1BYM A;  1BI1 A;  2KYB A;  1T0H A;  2HBW A;  4JLG A;  2J05 A;  4KGV B;  1YI2 T;  3M9Q A;  2FRY A;  3S3O A;  1GFC A;  1XQH A;  1N8R U;  4M7D B;  1KHI A;  4ZGJ B;  1BI3 A;  1PCX A;  1QKX A;  1H8K A;  4OGE A;  2RO0 A;  3R6O A;  2HBP A;  4XU0 A;  3VS1 A;  4QVZ A;  1KD1 R;  1Z9Z A;  2J6F A;  2LT1 A;  3S3N A;  1IO6 A;  2M16 A;  2HZY A;  4M7D C;  3X28 B;  2QA4 Q;  4GY5 A;  1UGS B;  1ZHI A;  2DF6 A;  4ME7 A;  2IPO B;  2O31 A;  2K5L A;  2LQN A;  1VQK A;  4M7A F;  1IZ6 A;  9ATC B;  2EJG A;  4BI3 A;  3CXC S;  2P0Q A;  2X51 A;  5GAM h;  5CKD A;  2KAF A;  1MGQ A;  2DJQ A;  2M02 A;  3DB4 A;  5FU6 B;  4M7D A;  3EAE A;  5I22 A;  5KYY B;  4WTO B;  3X26 B;  2WSF E;  2ENM A;  3KUF A;  3M4G A;  3OYC A;  1SPK A;  1TXQ A;  2RHX A;  2DXT A;  2LJ3 A;  2DIQ A;  3X20 B;  2P4R A;  4C8Q F;  3OYH A;  5FU6 C;  5CR2 A;  2ZPF B;  4DOV A;  3JCM V;  3MP8 A;  2LDM A;  2RJD A;  2PQW A;  2RHU A;  2OTJ T;  1VQO Q;  4JRK A;  3UA7 A;  2E3H A;  1WXB A;  5ECA A;  2EPD A;  4BD3 A;  1G3Y A;  1W2B P;  1YIT Q;  1M27 C;  1VQN Q;  1MUZ A;  3EFO B;  2IG0 A;  1PWT A;  3EFS A;  3PT9 A;  4M75 E;  1K0S A;  5I21 A;  4ATO A;  1WGS A;  5KYY A;  2DXB A;  3EG3 A;  3JCM J;  3DB3 A;  2D0Q B;  2RQW A;  3G7Z A;  3M59 A;  1VQ8 Q;  2E6Z A;  1Q7Y R;  1WHH A;  1WYX A;  4D8K A;  4X9C A;  1DJ7 B;  5HY6 A;  2EBP A;  4FSX A;  1FX7 A;  3V7R A;  5GAO q;  2NUP B;  2RQV A;  3QZ5 B;  3CCJ T;  3OYY A;  4OML A;  2JUF A;  3L42 A;  4KBM B;  2EYW A;  4FYY B;  1YHQ Q;  3LLR A;  1YJN A;  2EGE A;  3OSV A;  2DZC A;  4CC7 A;  3QYG B;  3J7A F;  3FJ5 A;  1OX9 A;  1WXU A;  1U1T A;  4AG1 C;  3JCM c;  1W6X A;  2EIF A;  1EIF A;  2LCS A;  3I9Q A;  2DK3 A;  1OPL A;  2HAX A;  4PFO A;  1LCK A;  2E10 A;  3OBW A;  1MND A;  2C0I A;  2RQR A;  2ZPB B;  3LYI A;  1HK9 A;  3OYL A;  1D0Z A;  4E7Z A;  2LCC A;  2DYB A;  4C5G A;  2ESW A;  3EG1 A;  5GAN 8;  1KQS P;  2AZS A;  2NLU A;  1X6O A;  2M51 A;  4EDU A;  2LCL A;  2R5A A;  2VXE A;  3VYG A;  4JZ4 A;  2NUP A;  5EC7 A;  2YDL A;  2FHD A;  1GFD A;  2YUP A;  3OW2 S;  3A8M B;  1AHJ B;  3BDL A;  4MMK A;  6AT1 B;  2X35 A;  4C5E A;  2IIM A;  2EJ9 A;  1X2Q A;  3TQ7 P;  3VS3 A;  4XAX B;  4HKE A;  2CP7 A;  2E41 A;  1OOT A;  3A8L B;  3G4S A;  3CC7 A;  1IHV A;  3J81 E;  1VQM Q;  1AD5 A;  1BKB A;  3CCU A;  3PTA A;  1NZ9 A;  2KXD A;  1N5Z A;  3SEM A;  1QKW A;  3X25 B;  4F7U B;  2YRV A;  3EFR A;  3L2Z A;  3TSZ A;  5LJ5 d;  3VV0 A;  2OTL A;  1X27 A;  1KK7 A;  4RUG A;  1VYU A;  5GAN 4;  2V8K A;  2FZG B;  5LJ3 e;  3JCM e;  4PJO D;  4MZT A;  5CAI A;  2LNH B;  1M30 A;  4JRQ A;  4M75 B;  4HT8 A;  3OQ5 A;  2JMA A;  4PL6 A;  1RLP C;  1PM3 A;  3CBM A;  3JB9 D;  2F5T X;  3VS6 A;  3VRZ A;  2HSP A;  1R8O B;  1Q82 R;  1TG0 A;  3PE0 A;  2R5M A;  2RA2 A;  1N9S A;  2OAU A;  1M1K C;  1WFW A;  4M75 C;  4IUQ A;  5IHN A;  2CP0 A;  1UGV A;  1OYX A;  4PJJ A;  1UG1 A;  4KGZ B;  5L8R E;  2ZPH B;  1WIE A;  1NJI R;  4IIO A;  4KUD K;  5D6Y A;  4OMP A;  2RI5 A;  4F7U A;  4J9C A;  2DRK A;  4PKC C;  2KYM A;  5L23 A;  1OX8 A;  1RAH B;  2DFU A;  4JJC A;  1VQL A;  5LJ3 g;  4UC4 A;  4M75 A;  4JDS A;  2DBK A;  4J7F A;  4IUV A;  2HD0 A;  3DKM A;  2VUB A;  2QQS A;  4E7L A;  4J6Y A;  2COZ A;  3OYJ A;  2QK0 A;  4IUU A;  1S72 A;  1NLO C;  4M78 G;  4PFP A;  3M4Y A;  4LXC A;  3G1J A;  4DBF A;  1MMN A;  4N0A C;  4BY6 B;  1QCO A;  1VQ6 T;  3L2R A;  3I55 Q;  4N4H A;  2ZPE B;  1JB0 E;  1NEB A;  1M1F A;  3FIF A;  1RAI B;  5GMK m;  3UWN A;  1QMC A;  4CC4 B;  1UJ0 A;  4C0F A;  1Q81 C;  4BY6 C;  2JTM A;  3EGX B;  2QEX Q;  1MHN A;  3CCR A;  5CO7 A;  1IHW A;  3NPF A;  4N0A A;  1TSF A;  2KRN A;  1VQ5 T;  4OP0 A;  1WJS A;  2NUT B;  3HFN A;  2K79 A;  3EHR A;  1ZUK A;  2DNU A;  4ZTJ A;  1EX4 A;  1UTI A;  1QLY A;  2A28 A;  3QWX X;  2YHT A;  2RQU A;  1YCS B;  1WHM A;  2Y4X A;  5GAN f;  3OYG A;  2CT3 A;  3G4S T;  3JCM b;  5IT9 E;  3QSU A;  1B07 A;  4M78 F;  2JW4 A;  2LT4 A;  3BW1 A;  4IUT A;  1A0N B;  1UHC A;  3CCU T;  2KI7 A;  1NE8 A;  2EYZ A;  1KIK A;  1AWJ A;  2PVO B;  1VQ7 T;  1KSW A;  5FRN A;  1KQ2 A;  1UJY A;  4Y91 A;  2ROL A;  2OTL T;  4WCI A;  3JV3 A;  3CC4 A;  2MK5 A;  1VIF A;  3EGX A;  4DA4 A;  1U1S A;  4FYV B;  1X6G A;  4M77 D;  1PD1 A;  1Y07 A;  1LNX A;  4P5N A;  5KYN A;  1G3W A;  1K8A C;  3CEY A;  2NUT A;  1M2O A;  5LJ3 h;  3GNG A;  4E47 A;  4J5Y A;  2O01 E;  3CCM A;  3ZBD A;  4A4G A;  3RUX A;  4BDZ A;  1YIJ Q;  5GAN j;  2E65 A;  3EHQ A;  8AT1 B;  4E7I A;  2D8J A;  2R57 A;  3M0U A;  2XDB A;  4OMO A;  2YXY A;  5KCH A;  2DAQ A;  3OB9 A;  1YI2 A;  2VWF A;  8ATC B;  5A0D A;  2CSQ A;  1I1J A;  3CQT A;  5J3B A;  3HL8 A;  5CQY A;  2F2W A;  4QKU A;  4MDX A;  1ZLM A;  1E6G A;  4F7U G;  1I0C A;  4HXJ A;  5HK0 A;  2M0O A;  2NUZ A;  1TWB A;  4RCC A;  1VQL T;  2RHI A;  1H3H A;  5CQX A;  5GAM f;  2HMA A;  4TVR A;  2DIG A;  4E7S A;  1UB4 A;  1AZE A;  5GAO r;  2YRD A;  3L2W A;  1ZSZ A;  3CC2 T;  4RTX A;  3R6N A;  1UE9 A;  1QQJ A;  2OI3 A;  4E6R A;  1VUB A;  3PMT A;  4ZGD B;  2JJ9 A;  4X9D A;  3MEV A;  2ATC B;  1B7T A;  3LWI A;  1GBR A;  2FG0 A;  4M7A D;  4F17 A;  3MPU B;  4DEX A;  2FEI A;  3M5A A;  3PIP A;  4AFZ C;  2XU8 A;  2V8I A;  4QT7 A;  3GLX A;  4RTU A;  1JJ2 A;  5KH6 A;  5D6W A;  2J6O A;  2RHY A;  3CCE T;  4NL2 A;  5LL6 S;  3GOX A;  2KRM A;  1AEY A;  2F2X A;  3CCR T;  5GAM j;  5KE3 A;  2CDT A;  2D8H A;  3ZEH A;  3PVQ A;  5IN1 A;  3A5Z B;  2BTT A;  4CI0 C;  1YJ9 Q;  4F7U F;  2KGT A;  1UFF A;  4LDY A;  1QW1 A;  1YJW T;  5GMK e;  2DL5 A;  3CBP A;  4C8Q D;  1K9M C;  3HKS A;  1NPP A;  1WHK A;  2EJF A;  3OS1 A;  4N4I A;  1RLQ C;  3AT1 B;  1NLP C;  1SKU B;  2WAC A;  3MEU A;  1IRX A;  4GBQ A;  2OTJ A;  3HSB A;  3HP9 A;  2K57 A;  1ZA2 B;  2JN0 A;  1IGU A;  3OW2 P;  1C1A A;  3LW5 E;  3BDU A;  2C0T A;  5HCK A;  2O2O A;  1WQW A;  3QJY A;  3TSW A;  2ABL A;  3V8J A;  4JJB A;  1D0X A;  4OMQ A;  3CC4 T;  1JBM A;  5C6S A;  4J9E A;  4J8O A;  2KNB B;  1MNE A;  4C92 G;  1Y57 A;  1FMW A;  1ZX6 A;  2EGA A;  4A4H A;  4HCC A;  2A37 A;  3CCJ A;  3VU3 C;  3M0P A;  3PGG A;  3I56 Q;  3CCM T;  3ZFJ A;  1KC8 R;  2CUD A;  1N27 A;  5AYF A;  1U3O A;  2VVK A;  3U23 A;  1GXI E;  3LWH A;  3H9N A;  3JSC A;  1N9R A;  3INZ A;  4E7K A;  3EGU A;  4J9D A;  3CCS Q;  5KYW B;  5GAN 2;  2QA4 T;  4QQD A;  3GNF B;  2DE0 X;  3CCL A;  4PJO E;  1JQQ A;  1FMK A;  1ABO A;  3H0F A;  4GLM A;  1HD3 A;  4HVV A;  4JLI A;  4LUE A;  2XDP A;  3M55 A;  3CME A;  2QQ9 A;  2G6F X;  1Q95 G;  4KH1 B;  3CCQ Q;  1W70 A;  4NL3 A;  1D3B B;  2MWO A;  2X4J A;  5KYX B;  4MML A;  3JRZ A;  2AK5 A;  2A0F B;  3VS0 A;  4C92 F;  3P8H A;  2JOY A;  3NGP A;  1W1F A;  1MMG A;  4ZN3 A;  5GMK i;  2HDA A;  3GPL A;  2L3P A;  1J3T A;  1SEM A;  1N8R R;  3MEA A;  1YWP A;  1VQ9 A;  2AKL A;  2EAY A;  1YCY A;  1W2B A;  2DPP B;  1ZBX A;  3H41 A;  3NFC A;  3VUZ A;  4ORZ A;  1TH7 A;  3SB2 A;  1SHG A;  1YIT T;  1VQN T;  3OYN A;  4OMF B;  2QXF A;  5LJ3 d;  3N5B B;  1ZA1 B;  1Y71 A;  4KUL A;  2R58 A;  5KYX A;  5GJV B;  4ELZ C;  1HXD A;  3H8Z A;  4IIM A;  2KMT A;  3CD6 Q;  3CCV A;  2PZ1 A;  3QWY A;  5GMK h;  2FZK B;  4BE0 A;  1VQ8 T;  2PU9 B;  1H92 A;  2L89 A;  1SSF A;  2QQA A;  5GAO n;  2CH4 A;  4ANJ A;  1C0M A;  4DBQ A;  3QHS A;  5GMK l;  1PKT A;  1PRL C;  2XIC A;  2OX7 A;  3FJP A;  2HL3 A;  2MIO A;  2V26 A;  3L1A A;  2I0N A;  2K3B A;  3QUI A;  1WQ7 A;  4FW1 A;  1M1K U;  3URG A;  1UEB A;  2L3S A;  1NG2 A;  1GL5 A;  3M57 A;  2E5Q A;  1GCQ C;  1KQ1 A;  1QVF P;  1JRI A;  1UEC A;  3VYH B;  4BUG A;  3G71 A;  1JEG A;  3PIO A;  2DIL A;  2HQE A;  3SDZ A;  4PJO B;  2D0N A;  3FC3 A;  2HQH A;  1KQS A;  2CP3 A;  4A4E A;  4ZGE B;  2RF0 A;  3RKX A;  2LVM A;  4J6W A;  3RKY A;  1R0C B;  1UGR B;  2GQV A;  2QGG A;  2X4Y A;  2RN8 A;  2SRC A;  1RAB B;  4II1 A;  2L3R A;  1X2K A;  4X1V A;  3V8K A;  4J6X A;  1VQ6 A;  4PJO C;  1CKB A;  3OYM A;  1I4K 1;  2P0P A;  3EFO A;  3AHU A;  2M1H A;  3JAM E;  2QTV A;  3MET A;  3CCL T;  2F69 A;  1B34 B;  4M77 E;  1M1K R;  5CKH A;  3OS2 A;  2FVU A;  4FT2 A;  3UA6 A;  1OPK A;  2GQI A;  1YFN A;  2DTO A;  2NWM A;  1Q86 C;  2DER A;  2ZPI B;  2FZC B;  3CME T;  4B6M A;  1BBZ A;  3VUB A;  4AFQ C; 
#chains in the Genus database with same CATH homology
 4XU1 A;  4PJO A;  3FIF A;  1VQM T;  1Q81 U;  2C06 A;  3H6Z A;  1VQ5 A;  5GMK m;  3UWN A;  3LH0 A;  4ZTF A;  4QVC A;  1WJQ A;  1X75 C;  4BB7 A;  4C0F A;  1Q81 C;  1OZ2 A;  3P8B B;  4FT4 A;  4BY6 C;  2JTM A;  1MHN A;  5M9O A;  5CO7 A;  3CCR A;  5GAO l;  3CD6 T;  4EMK A;  3O8V A;  4N0A A;  1JJ2 S;  5FRM A;  2MAM A;  2CZ6 B;  1Y7X A;  3LGL A;  1PSE A;  2QDY B;  1RI0 A;  2CZ0 B;  4M77 G;  4OP0 A;  1VQ5 T;  4IUR A;  3TU4 K;  1WJS A;  3QYH B;  3G6E A;  2YLC A;  3HFN A;  3QBY A;  4O5V A;  1I5L A;  1KG1 A;  1M5Q 1;  1VQO T;  3WVD B;  1N6A A;  3VKI A;  4ZTJ A;  1VQP A;  4LDX A;  3E9G A;  1BIB A;  4M78 D;  2DKG A;  2D6F A;  4HCZ A;  3P8D A;  3S6W A;  2MI6 A;  1VQ9 T;  1B34 A;  2QQR A;  3RMS A;  3JB9 I;  2YHT A;  4BI4 A;  3JCM d;  2VXF A;  3A8G B;  2RB6 A;  3HRU A;  1D3B A;  2DD5 A;  2Y4X A;  1VQ7 A;  4M7D G;  3WVE B;  3DLL A;  5A2Q E;  5GAN f;  3OYG A;  5CIU A;  3G4S T;  3JCM b;  3BY7 A;  5IT9 E;  2E70 A;  4OVA A;  1FWZ A;  1QVF A;  3QSU A;  5CCA A;  4M78 F;  2LT4 A;  3BW1 A;  4IUT A;  3OYK A;  1KC8 U;  3I56 T;  3ASK A;  5GMK j;  3CCU T;  1Q7Y U;  2RHZ A;  2D9T A;  4BDY A;  1NE8 A;  4B9W A;  4RCB A;  4RMO A;  5C0M A;  4KUI A;  3F70 A;  1NPR A;  1KC8 C;  3A8H B;  2I2L A;  2PVO B;  3FRN A;  1Q7Y C;  1VQ7 T;  4JS4 A;  5FRN A;  1KQ2 A;  4Y91 A;  4J7I A;  4JJN K;  3MHX A;  5GAM g;  2LQK A;  1QVG S;  3V7S A;  4M7A E;  3CPW A;  2KDS A;  1U8R A;  3CPW S;  3CCV T;  2OTL T;  1WNL A;  2K2V A;  2CGH A;  2L5Q A;  3CC4 A;  1VIF A;  1WJR A;  3Q1J A;  3QJ6 A;  5FU7 B;  2XDD A;  1K8A U;  4DA4 A;  2V8J A;  4M78 B;  1U1S A;  4M77 D;  4XK8 E;  1Y07 A;  1YHQ T;  1LNX A;  2X4W A;  4P5N A;  1G3W A;  2LNV A;  4C0G A;  2E12 A;  3CEY A;  3OYA A;  1K8A C;  3CD6 A;  4F7U E;  4FIB A;  4BI8 B;  4JS5 A;  5LJ3 h;  3M54 A;  3GF5 A;  3GNG A;  4IUP A;  4E47 A;  4R55 A;  1M90 U;  4J5Y A;  2O01 E;  5I2M A;  4Y28 E;  3HFO A;  2EYQ A;  3CCM A;  2FB7 A;  3ZBD A;  2KVQ G;  4XTW A;  2XD0 A;  1M90 C;  4QQG A;  4R56 A;  2JVV A;  2ZPG B;  4M77 F;  4OF1 A;  5LJ5 h;  4A4G A;  3I55 A;  1O9S A;  4M7D D;  5FU7 C;  3RUX A;  3QXE B;  2KK4 A;  4BDZ A;  2JNG A;  1KD1 U;  5GAN h;  2DXC A;  4M78 C;  3S3M A;  5DY9 A;  5GAN j;  2E65 A;  3CBO A;  1YBY A;  1KD1 C;  1I8F A;  4C8Q E;  4E7I A;  4HT9 A;  2A3L A;  2ZCF B;  2R57 A;  4M7A G;  3KXT A;  2DO3 A;  2EQJ A;  2XDB A;  4M7D F;  3DLM A;  4YTL A;  2G3R A;  5GAO m;  3I55 T;  3G71 T;  2LRQ A;  1P92 A;  2XI9 A;  2DAQ A;  3OB9 A;  3JCM g;  4C0D B;  5KCH A;  1YI2 A;  4XU2 A;  5A0D A;  1XOV A;  5D6X A;  1O75 A;  3JCM W;  4M77 B;  5J3B A;  3HL8 A;  5CQY A;  2EFI A;  2QEX A;  2FYK A;  2EQM A;  4LD9 K;  4JRI A;  2EKO A;  3C4S A;  5J26 A;  4MDX A;  1RL2 A;  2M9U A;  2QI2 A;  4FM4 B;  4F7U G;  4PNO A;  2BIV A;  3CC2 A;  4V2S A;  2DXU A;  1BYM A;  1H64 1;  3PFS A;  5HK0 A;  1BI1 A;  5GAN 7;  2M0O A;  2RD1 A;  2PUK B;  4IKF A;  4RCC A;  4M78 A;  1VQL T;  2RHI A;  4JLG A;  5CQX A;  5GAM f;  2VC8 A;  2LTO A;  3FLG A;  3M9Q A;  2DIG A;  3MEW A;  4TVR A;  4QVD A;  2RI3 A;  3OYI A;  3S3O A;  4M7D B;  1XQH A;  1N8R U;  1KHI A;  1UB4 A;  1M8V A;  2E1H A;  2YLB A;  4ZGJ B;  5GAO r;  4C0D C;  1BI3 A;  3L2W A;  3JB9 J;  4OGE A;  3OS0 A;  1OI1 A;  1LOJ A;  4M77 C;  1N8R C;  3CC2 T;  2EQU A;  4RG2 A;  2RK1 A;  5HK3 A;  2RO0 A;  3R6O A;  3KBG A;  1H3Z A;  2L8D A;  2HBP A;  3PMI A;  4XU0 A;  1VUB A;  3PMT A;  4QVZ A;  3J80 E;  4ZGD B;  2LT1 A;  3S3N A;  1W4S A;  4X9D A;  3V8L A;  2M16 A;  3MEV A;  3LWI A;  3CCE A;  2VGN A;  4M7A D;  4M7D C;  3X28 B;  4GY5 A;  1UGS B;  1ZHI A;  3M5A A;  3PIP A;  2XU8 A;  4L5G A;  2V8I A;  3E9F A;  2HQX A;  3OSS C;  2E64 A;  2RM4 A;  3GLX A;  4ME7 A;  1JJ2 A;  2DTH A;  5KH6 A;  3JCM P;  4M77 A;  2K5L A;  5D6W A;  2RHY A;  1BI0 A;  4BE2 A;  4NL2 A;  1VQK A;  3CCE T;  1IZ6 A;  1YJW A;  2EJG A;  5DM7 R;  3JCM Q;  4M7A F;  3MP6 A;  4XTU A;  4BI3 A;  3CXC S;  3PNW C;  5LL6 S;  2P0Q A;  3GOX A;  5LJ3 f;  3JCM f;  5GAM h;  3CCR T;  4XTY A;  3UDC A;  5GAM j;  4MZP A;  5CKD A;  2K5F A;  3OBY A;  2LC4 A;  4MDW A;  5KE3 A;  2KAF A;  1MGQ A;  3OS5 A;  3ZEH A;  5J39 A;  5FU6 B;  3DB4 A;  3A5Z B;  5IN1 A;  3EAE A;  5CKB A;  4CI0 C;  3QPH A;  4F7U F;  5LJ5 f;  2F5K A;  4XTZ A;  1XNI A;  3G6E T;  1VQK T;  4LDY A;  2EQK A;  1QW1 A;  1YJW T;  1BI2 A;  5GMK e;  1Q82 U;  3CBP A;  4C8Q D;  1K9M C;  3X26 B;  3JB9 H;  3M53 A;  2WSF E;  5GAN 6;  1VQP T;  3KUF A;  3M4G A;  4M7A B;  1QP3 A;  2GFU A;  2K4Y A;  3OYC A;  1I81 A;  3HKS A;  1YIJ A;  1Q82 C;  1VQ4 A;  4FU6 A;  2RHX A;  1M1G A;  1NPP A;  4C92 E;  2EJF A;  2MF2 A;  2DXT A;  4C5H A;  3OS1 A;  4N4I A;  3RES A;  4N4G A;  2ZZD A;  5CKF A;  2DIQ A;  3M56 A;  2WAC A;  3MEU A;  3NTI A;  3X20 B;  1QVG A;  2OTJ A;  1PSF A;  4L59 A;  2AHJ B;  1NJI U;  4C8Q F;  3OYH A;  5FU6 C;  3HSB A;  3VJP A;  3SWN B;  2FL7 A;  3L2V A;  3HP9 A;  2XKO C;  5CR2 A;  3CMA A;  2K57 A;  3GIB A;  2ZPF B;  2JN0 A;  2P0K A;  2DVE A;  4VUB A;  1NJI C;  4DOV A;  3JCM V;  3MP8 A;  3LW5 E;  3BDU A;  1Y96 B;  2LDM A;  4D6W A;  4M7A C;  1G3T A;  2RJD A;  2GCX A;  4EMH A;  2MMP A;  5GAN d;  2CZ1 B;  2RJE A;  1G5V A;  2PQW A;  2RHU A;  1WQW A;  3QJY A;  2BKD N;  5DLO A;  2QTX A;  2OTJ T;  1OZ3 A;  4JRK A;  4Q5W A;  3JCM h;  2RK2 A;  2DZ9 A;  3V8J A;  4E7J A;  5LJ3 j;  2ZGW A;  4BD3 A;  1G3Y A;  3CC4 T;  1JBM A;  4C8Q B;  5C6S A;  3SWN C;  2LQ8 A;  3LX7 A;  3OMC A;  5GAN e;  2IG0 A;  4J8O A;  3E1S A;  5LJ5 j;  3EFS A;  4C92 G;  3PT9 A;  3HPW A;  4A53 A;  4M75 E;  4HCC A;  4A4H A;  4ZN1 A;  4L6V 5;  5I21 A;  4ATO A;  3CCJ A;  1WGS A;  2DXB A;  3VU3 C;  4WF2 A;  3PGG A;  3JCM J;  2HNI A;  2D0Q B;  3DB3 A;  3G7Z A;  3M59 A;  3E19 A;  3ZFJ A;  3CCM T;  4M7A A;  2E6Z A;  4FL6 A;  1N27 A;  4XTX A;  3ME9 A;  4X9C A;  1DJ7 B;  4OB1 B;  5AYF A;  5HY6 A;  2QA4 A;  4C8Q C;  3RMQ A;  4JRP A;  2BUD A;  1GXI E;  3LWH A;  3RER A;  4FSX A;  1FX7 A;  1BIA A;  2DEQ A;  3V7R A;  5GAO q;  3QZ5 B;  5GAN 3;  3CCJ T;  3OYY A;  3JSC A;  1N9R A;  3SWN A;  2CZ7 B;  2JUF A;  3L42 A;  3TEE A;  3INZ A;  5KE2 A;  4E7K A;  4KBM B;  1KQS S;  4HCB A;  5GAN 2;  3LLR A;  1Y96 A;  1YJN A;  3OSV A;  2LX9 A;  4OB0 B;  2DZC A;  4OB2 B;  3X24 B;  4QQD A;  2QA4 T;  3GNF B;  3QYG B;  3J7A F;  3CCL A;  4NOY A;  4PJO E;  2B8A A;  2XID A;  2QEX T;  1U1T A;  2WSE E;  2VV5 A;  4M75 G;  3JCM c;  4E7H A;  5EG2 A;  4C0Z A;  2EIF A;  1EIF A;  4JLI A;  4C8Q A;  4EPC A;  1YJ9 A;  2RJC A;  2DK3 A;  4C92 D;  5CK9 A;  2JTF A;  1YJN T;  1WPY A;  2CS7 A;  4LD6 A;  4BE1 A;  2HAX A;  3FB9 A;  2E10 A;  2RJF A;  2Y90 A;  2DTI A;  2XDP A;  3M55 A;  3OBW A;  3UT1 A;  3CME A;  2QQ9 A;  2ZPB B;  3LYI A;  2XG8 D;  1HK9 A;  4HA8 A;  4LDW A;  1ZQ1 A;  3OYL A;  4NL3 A;  1D3B B;  2LCC A;  2MWO A;  2X4J A;  4MML A;  4A54 A;  3JRZ A;  4XU3 A;  4C5G A;  5GAM d;  2PVG B;  4C92 F;  5GAN 8;  4GLK A;  3P8H A;  4LDV A;  4KT0 E;  4EMG A;  2KSS A;  2NLU A;  2JOY A;  1X6O A;  4EDU A;  2LCL A;  4QW2 A;  2R5A A;  2VXE A;  3VYG A;  2E6N A;  3SD4 A;  3TRE A;  2FHD A;  4PJO G;  2H3J A;  5GAM e;  3CXC A;  3LGF A;  3M58 A;  4ZN3 A;  3OW2 A;  3OW2 S;  5FLX E;  4BAC A;  3A8M B;  1VQO A;  3QO3 A;  3OA6 A;  5GMK i;  3GPL A;  2QQB A;  1AHJ B;  3BDL A;  3NTH A;  4MMK A;  2X35 A;  3RKW A;  2EWN A;  4C5E A;  4C92 B;  4OGC A;  1YIT A;  3MEA A;  3MCA B;  3NTK A;  4M75 D;  1VQN A;  1VQ9 A;  4XTV A;  2EJ9 A;  4CRI A;  3JB9 G;  2P4T A;  2EAY A;  3QG1 A;  3OYB A;  3BFM A;  5FRO A;  1YCY A;  2WSC E;  4XAX B;  1W2B A;  3QKJ A;  1W2B S;  2DPP B;  1IRE B;  4HKE A;  4RKU E;  2E41 A;  1XTD A;  2VYT A;  1ZBX A;  3NFC A;  5I2S A;  3A8L B;  3G4S A;  3C95 A;  3VUZ A;  2VGM A;  1TH7 A;  3ER0 A;  3SB2 A;  3J81 E;  3CC7 A;  1BKB A;  3I56 A;  3CCU A;  1YIT T;  1K9M U;  4M75 F;  4ELY C;  1NZ9 A;  2K5I A;  3PTA A;  5DLQ E;  4DOW A;  3C94 A;  4OMF B;  2O4X B;  2QXF A;  3OYN A;  1VQN T;  2K3X A;  5LJ3 d;  3N5B B;  4C92 C;  5KCO A;  1Y71 A;  4KUL A;  4A4F A;  3X25 B;  2R58 A;  4F7U B;  1M4Z A;  2KY9 A;  5GAO p;  4ELZ C;  1HXD A;  3H8Z A;  2YRV A;  2KMT A;  1YIJ T;  2IVW A;  1VQ4 T;  2PVD B;  3EFR A;  3L2Z A;  3RIR A;  5LJ5 d;  3CCV A;  3VV0 A;  2OTL A;  3CC7 T;  5CVI A;  1QVF S;  5GMK h;  1VQ8 A;  5GAN 4;  4BE0 A;  1VQ8 T;  2V8K A;  5LJ3 e;  2PU9 B;  3JCM e;  4PJO D;  4MZT A;  2A7Y A;  4QQ6 A;  3MO8 A;  5CAI A;  2L89 A;  3CCS A;  1YHQ A;  3L2U A;  4JRQ A;  1SSF A;  3SFM A;  2QQA A;  4M75 B;  3TCJ A;  3OQ5 A;  5IAY A;  5GAO n;  4HT8 A;  4Z02 A;  3CMA T;  3QHS A;  2GF7 A;  4PL6 A;  3CPF A;  4MZM A;  5GMK l;  2X4X A;  5LJ5 e;  4M7D A;  3V7C A;  2K3Y A;  2XIC A;  3CBM A;  4JUV A;  3FJP A;  2XK0 A;  3OY9 A;  4C5I A;  4C92 A;  3L1A A;  4A4K A;  3JB9 D;  2F5T X;  4PJO F;  1X01 A;  3HHT B;  1R8O B;  3QUI A;  4RG8 A;  1WQ7 A;  5A0G A;  1LJO A;  1QP2 A;  3CCS T;  1M1K U;  3URG A;  1UEB A;  2XHC A;  2R5M A;  2RA2 A;  1N9S A;  2OAU A;  2DJZ A;  2KQW A;  1M1K C;  4M75 C;  3CCQ A;  3M57 A;  2E5Q A;  4IUQ A;  1KQ1 A;  3JB9 F;  2MWP A;  1JRI A;  1OYX A;  2GFA A;  4M78 E;  5CKE A;  3VYH B;  3QDR B;  3QZ9 B;  2O4X A;  4PLI A;  4BUG A;  5L8R E;  2ZPH B;  3G71 A;  3PIO A;  3SDZ A;  2HQE A;  4KUD K;  5D6Y A;  5A0L A;  4PJO B;  1M9S A;  1UGP B;  2RI5 A;  4F7U A;  3FC3 A;  4PKC C;  4NS5 A;  1KQS A;  5HKC A;  4X34 A;  1K73 U;  4A4E A;  3CCQ T;  4ZGE B;  3RKX A;  2LVM A;  4J6W A;  3T9N A;  3A8O B;  3RKY A;  1FXX A;  4LDU A;  3OYE A;  1K73 C;  3L2Q A;  1UGR B;  3OYF A;  1VIE A;  2GQV A;  1VQL A;  3HRT A;  4EMK B;  2X4Y A;  3C12 A;  5LJ3 g;  4UC4 A;  4PLL A;  4II1 A;  3OYD A;  4M75 A;  4J83 A;  2JZ2 A;  2L3R A;  4JDS A;  4DQ2 A;  3MP1 A;  3FDR A;  3V8K A;  4J7F A;  4IUV A;  2HD0 A;  2DD4 A;  4J6X A;  1VQ6 A;  4PJO C;  3HRS A;  3WXM B;  3OYM A;  1YI2 T;  3DKM A;  1I4K 1;  2P0P A;  4XQ3 A;  2VUB A;  2QQS A;  5LJ5 g;  4E7L A;  3AHU A;  2M1H A;  5GAN 5;  4J6Y A;  3OYJ A;  3JAM E;  3MET A;  5GAN g;  3CCL T;  2CKK A;  2F69 A;  4IUU A;  1S72 A;  1B34 B;  4M78 G;  4M77 E;  2PUO B;  5CKH A;  3OS2 A;  2FVU A;  3M4Y A;  4FT2 A;  1Q86 U;  1VQM A;  3UPU A;  1KHC A;  1QVP A;  4EMK C;  4N0A C;  2RH2 A;  2Y4Y A;  4BY6 B;  1YJ9 T;  3FEO A;  1VQ6 T;  3L2R A;  2DTO A;  4N4H A;  1UGQ B;  4B9X A;  1Q86 C;  2ZPE B;  3GP8 A;  2RI2 A;  4OB3 B;  1G3S A;  1JB0 E;  2ZPI B;  3QII A;  3OMG A;  4C8Q G;  2CYZ B;  3CME T;  4O6J A;  1S72 T;  1M1F A;  3JCM X;  4M7D E;  1V29 B;  3VUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...