4MDWA

Crystal structure of a duf1541 family protein (ydhk) from bacillus subtilis subsp. subtilis str. 168 at 2.00 a resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
146
structure length
133
Chain Sequence
HEEMDHSGSADVPEGLQESNPYVGSQVIINTSHMGMGAEATVTGAYDTTAYVVSYTPTNGGQRVDHHWVIQEEIDAGDTLQPGDQVILEASHMGMGATAEIDSAETTVYMVDYTSTTSGEVNHKWVTEDELSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein (ydhK) from Bacillus subtilis subsp. subtilis str. 168 at 2.00 A resolution
rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein YdhK
total genus 24
structure length 133
sequence length 146
ec nomenclature
pdb deposition date 2013-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07563 DUF1541 Protein of unknown function (DUF1541)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1210 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4mdwA00
4MDWA
chains in the Genus database with same CATH superfamily
4OMNA 1VIEA 2SEMA 5GAMf 2K5FA 1D1AA 2O01E 5LJ5g 3M55A 3CC4T 3LWHA 1WHJA 2VGNA 1TOVA 1JU5C 1WX6A 3CCQA 3GPLA 1N5ZA 2MIOA 2ROLA 1ZSGA 3RR6A 1EIFA 1LNXA 4PFPA 1WGSA 3LGFA 1OPKA 1NEBA 2DRKA 2R57A 3L42A 1ZX6A 3CCET 2L3SA 2NWMA 3OYCA 3EFOB 3I55T 4L6V5 4LDVA 3CMET 1TU0B 4M78F 1YITT 2E64A 4R56A 2W0ZA 1JO8A 1WHKA 2KGTA 4EMKC 1G3WA 2COWA 1WQWA 3QSUA 2LVMA 1K4US 1NEGA 1HSQA 3CXCP 2OTLA 3QO3A 3TQ7P 4K11A 3V7CA 2VUBA 1YIJT 1OV3A 2GTOA 2X4YA 2RD1A 1T3SA 4MDWA 2YUPA 4Z8AA 4ZTFA 1Y96A 4DOWA 4DEXA 3EHQA 2CDTA 4LDWA 2K2MA 4XTXA 2MMPA 2DIGA 1F1BB 1VQOA 3OS0A 2RA2A 1YIJA 1G3YA 3OYIA 5GAOn 1N8RC 2RB6A 4M7AE 1B3QA 4J9HA 3CQTA 3OYDA 3C94A 5GANd 1OQKA 2DBKA 2KE9A 3HRSA 1YHQT 3SFMA 4FIBA 2BZ8A 2LNHB 3OB9A 4PJOC 1M90U 2VV5A 5DY9A 5IHIA 3JCMb 2CSIA 1Y07A 2GFAA 1KHIA 3QYGB 1BYMA 2DYIA 3FC3A 5CCAA 5LJ3j 4L5GA 8ATCB 3G4SQ 3M58A 2Y4XA 2DVEA 2CH4A 4IURA 1JEGA 2RHZA 4EIKA 4M75F 5EG2A 3JSCA 1VQ8A 2DD4A 3G4SA 2JTEA 3EFRA 4DA4A 2KSSA 2CREA 3EHRA 3INZA 2LT4A 1M27C 4XU1A 4RTWA 1M3BA 1NPRA 4GLMA 2EIFA 3OYHA 4HT8A 2A7YA 3CCLT 2EQJA 2P0QA 1B7TA 2EKOA 4C8QG 2MAMA 4BI8B 1Y57A 5GANh 1FMVA 1KFZA 3GNFB 4C5GA 1SG5A 3T9NA 2ZAEA 2FB7A 2X3WD 3VS3A 3JV3A 5FU7C 3CMEQ 4Z88A 3SDZA 5LJ3g 1VQ9Q 5AT1B 2NUZA 3E1SA 2LCSA 2DL3A 4AG2C 3QKJA 4LN2A 1KIKA 5LJ5h 2EQMA 1Q7YR 3CCVQ 2CZ1B 4CC2A 3V8LA 1JXOA 3EGDB 4M78B 4J8OA 3UPUA 3MCAB 5GAMd 2DBMA 3RKYA 2FG0A 4HVUA 3CCVT 3L1AA 3CC7T 2EVRA 3HP9A 2KRSA 2QA4A 5D6XA 3TEEA 2A08A 3GLXA 4C8QF 2D8JA 3SWNB 1VIFA 1DJ7B 2CZ0B 1U8RA 4M7DA 2K57A 3MJXA 4R55A 1M90C 2EGAA 1QVFA 4E7JA 2KI7A 2HAXA 1MHNA 2KDSA 2DD5A 3META 2RHYA 4C8QA 4EPCA 1LPLA 2QAZA 4FYYB 1PWTA 4IIMA 2K7AA 1G83A 3CCMT 2L3QA 1K8AC 1M1FA 4M78C 5LJ5f 2JS2A 2ZPIB 2V1QA 2X4XA 2CP6A 5LJ3f 3OQ5A 4MMKA 8AT1B 4PJLA 2QA4Q 5FRNA 2FRYA 2OTJT 4OVAA 1NLOC 1YI2T 4XQ3A 2DJQA 2KT1A 2DTHA 1KQSA 1UEBA 4PL6A 3LLRA 3FEOA 1Q81R 2E3IA 3BY7A 2BTTA 3RBBB 1MMDA 2VASA 1YI2A 1G8XA 3EH2A 4RUGA 2DLPA 4M75B 1Z9ZA 2QEXT 2YLCA 4JJDA 4F14A 1P92A 2L5QA 2QG9B 1AT1B 2J6KA 2JZ2A 4OMMA 3G4ST 4FCYA 1K73C 1W6XA 3HRUA 2FO0A 1TUCA 1KQ1A 5GAN3 3X24B 1ZLMA 1VYTA 5LJ3e 3PFSA 2HSPA 3QUIA 5GAN7 3M0TA 2RI3A 1M1GA 3CCQQ 4P5NA 4AT1B 5FRMA 2NYSA 1D09B 2GNCA 3OW2S 3GF5A 2DA9A 3A8GB 2HEQA 2JJ9A 5CKFA 3G1JA 1H8KA 2X4WA 4J6YA 4KGZB 1K8AU 3DKMA 2B8AA 3JB9H 1YN8A 1M5Q1 4AG1C 4M7AB 2EGCA 1UECA 1YIJQ 2Z0WA 3I55Q 3X28B 2DVJA 2XIDA 4F17A 5KH6A 1IGQA 3EG0A 4R0KA 5IHKA 2HKNA 4HT9A 2LCLA 4PJJA 1B34B 5GAN2 2MYSA 4OMPA 4M7AF 2L8DA 4DBQA 3OYEA 5IAYA 4JS4A 5GAOr 1EFNA 3KUFA 4J9EA 3JCMe 3SEMA 1IHVA 4X9DA 1RUWA 1OOTA 1UJ0A 3QZ5B 4AFUC 1OU8A 3V8KA 5I2SA 4N4IA 3S3OA 2HL5C 3OYJA 1YJWA 4M77F 1X75C 3P8DA 3X20B 2KMTA 2A37A 4M78E 5CAIA 5HCKA 4ELYC 1M2VB 1R8OB 2DZ9A 2DL7A 2EKHA 2YUNA 4OMFB 4Z89A 5KYXB 3EG9B 4VUBA 1QP2A 3BW1A 4MZMA 3HHTB 5FWCA 4M7AG 1AWOA 4F7UE 4Y28E 1SSHA 2AT1B 1IB8A 3ZEHA 1E6HA 1TUDA 2ZPEB 4KUIA 2RQRA 3LH5A 1Z9QA 2PUOB 1QVPA 1YCSB 3M0SA 1G5VA 3G6EA 1X6BA 3H41A 3OYAA 4JJBA 5GAMe 4F16A 2BZXA 1ABOA 1RAAB 3M5AA 3G71T 4F7UB 1YJ9A 2VC8A 5DM7R 4ZN1A 4JJNK 2R5MA 5KCOA 4BY6B 2V8IA 1SHGA 2HL3A 2L3PA 1YITA 2CT4A 4JLGA 3QYHB 5KE3A 3OBWA 1MV3A 1GFDA 3CCEQ 2DMOA 3WVDB 2EYZA 4J6WA 1W1FA 4CC7A 3EFSA 3I56Q 2H8HA 2RJDA 2LTOA 4PKCC 2GFUA 3VKIA 3OYGA 2SRCA 2I2LA 3QDRB 4FSSA 1W2BS 2XHCA 1QCOA 2E41A 5KYUA 4BI3A 1RACB 1QKXA 2GCXA 2QQAA 5FW9A 5J26A 2ECZA 3JCMW 3CC4A 2DF6A 2O9VA 2C06A 1M9SA 3I9QA 5CIUA 1D0XA 2LMJA 3NFCA 1VQKA 3M0QA 3TVTA 2AZVA 3VS2A 1VA7A 1VQOQ 3RKWA 4N0AA 3REBB 1KG1A 2X51A 2VB6A 3SHWA 1OYXA 1KQSP 2ED1A 2EJGA 2LRQA 5LJ3d 3CCMA 4JRQA 1WXTA 1K0XA 2QTXA 4QW2A 3TSZA 2FRWA 3CC4Q 4F7UF 2O4XA 4C8QE 1VQ7A 1Q82R 4KRTA 1YJNA 4FW1A 1YWOA 2NLUA 1WJQA 1VQPA 3PVLA 1M1KC 5CKBA 4XU3A 2O31A 1LOJA 2E70A 2DTIA 5DLQE 5KE2A 1HD3A 1YWPA 4IUVA 2J6FA 3GP8A 2V8JA 2OTLT 3OS5A 3CCST 2D6FA 1OX8A 3A1PA 3JCMP 2E5QA 1SEMA 2FPFA 3MEUA 1ABQA 3QJ6A 4CRIA 4C0GA 2DXTA 2RHXA 3NMZC 2JTMA 3OW2P 4M7AC 1LCKA 1K1ZA 3DLLA 1VQLQ 4NOYA 4M75G 1AWJA 3CCJQ 1QVFP 1TTHB 4HCCA 3CCUQ 4E7HA 2RQTA 2HMAA 1NJIC 1KD1U 1VQPQ 2DILA 1I8FA 3CCJA 4X34A 2ESWA 1I5OB 5FROA 2GBQA 5GAOm 3ZL7C 1M1KR 2ZZDA 3QXEB 2F5KA 1UJYA 5L23A 1TH7A 1QVGA 3BDUA 3X26B 5A2QE 3CC2T 3L2UA 1PSEA 1W2BA 3CMAA 2QYZA 2HKQB 2PU9B 2EPDA 1BCMA 4F7UG 4FT2A 3OYFA 4C0FA 2YSQA 4J9BA 1GCQA 3DLMA 5J3BA 1ZBXA 1N6AA 5LL6S 4M77G 3RUXA 3JCMX 4Q5WA 2PUKB 2LJ3A 1AZGB 2JTFA 1MUZA 2F2WA 3JCMh 4D8KA 2F5TX 2QEXQ 4M77B 4B9XA 4PJOE 3VYGA 2KRMA 2NUTA 1PM3A 4TVRA 2LP5A 5FLXE 2DZCA 2DRMA 2XDBA 2LT1A 1TXQA 2COZA 2E12A 3C4SA 3PT9A 1WLPB 4KH0B 1GCQC 2NUPA 4ZGEB 5GAN4 3CCUA 1RLPC 4RMOA 3EAEA 3LWIA 3PNWC 4A4HA 1Q86U 2YRDA 1N8RR 5KYYA 3N5BB 5CVIA 1XNIA 3UA6A 4AMCA 3CMAT 2BKDN 1J3TA 5CO7A 3NTIA 3PVQA 2XICA 1Y96B 1XTDA 2YUQA 3UDCA 3EG1A 2G6FX 3DB4A 3HPWA 4GBQA 4JRIA 2OJ2A 5HKCA 1CKBA 4PLIA 4ZGJB 4LDUA 3CCJT 3JB9I 3HFOA 1X2QA 4M7DE 3L2WA 1SRMA 3OSSC 2DX1A 2K79A 4DOVA 1SPKA 2RI2A 3CCEA 1UGPB 2RJCA 3MP6A 5GANf 3OYYA 2X4JA 3I56A 2E65A 1QLYA 3CCSQ 1WI7A 3AT1B 2BZYA 2WSEE 1WQ7A 5GAOl 2A0FB 5A0LA 1WJSA 1PD1A 1PRMC 3OYLA 2ZGWA 2GGRA 4OB0B 4RTXA 2ZPGB 2RQWA 5C6SA 3M54A 2NUPB 3BE3A 1AWWA 2MCNA 2MWPA 4DBHA 2YDLA 2LCCA 2EFIA 4M75C 2XI9A 1VQ9A 3ASKA 4KH1B 4OGEA 3UATA 4B6MA 1YJNQ 2WSCE 2ED0A 1BI0A 2MPXC 4XTVA 1X6GA 3ULRB 4BB7A 1VQ4Q 2KXCA 2QGGA 2E6NA 1BBZA 2J06A 2ABLA 4ME7A 1Q95G 1WHLA 2KAFA 1H3HA 2O2OA 4QVDA 2DO3A 4M77E 2RF0A 2PVGB 1U1SA 3JCMV 3SD4A 4A4KA 5D7UA 5HK0A 2EQUA 1VOMA 1Y71A 4DQ2A 3HSBA 3MEVA 2O88A 2KYBA 5IHNA 1FXXA 1M4ZA 5GJWB 1OULA 1QVFS 2KXDA 1BI1A 2CP3A 3I5SA 5EC7A 3I35A 2V26A 2QDYB 7AT1B 2HNIA 2X3XD 5HY6A 5LJ5d 3VUZA 1E7OA 4OMOA 1YJWQ 2KEAA 2Y4YA 4XU2A 3PIOA 3GBQA 2E6ZA 1QVGS 2XK0A 4M75D 2RQVA 1AZEA 1X01A 3HFNA 3FRNA 1G3TA 5GMKj 5GMKh 3CCUT 2DL8A 1O9SA 1S1NA 2RI5A 3GIBA 2ZPHB 3WVEB 2FZCB 4ESRA 3U23A 1VQ5A 2CYZB 3A5ZB 3QBYA 4J9IA 4IUQA 1Q82U 5KYNA 1FX7A 2DK3A 2ENMA 3VYHB 1K73U 3L2VA 1K9MR 2F2VA 4PJOB 1I81A 4FM4B 2E10A 3FB9A 4JRKA 2HD0A 2YLBA 4A4EA 4J9DA 3MO8A 4YTLA 2C0OA 1QCFA 2HSEB 3OS2A 1ZUKA 5LJ3h 4X9CA 1ZSZB 1QKWA 4RKUE 2M16A 2I0NA 2LQKA 5I22A 1VYVA 2BUDA 1GL5A 4UC4A 1ZA2B 3VS4A 1U5SA 1QMCA 3VS6A 1S72T 4OF1A 4QQ6A 4RCCA 2RK1A 4PK4A 1MV0B 3P8BB 1K0SA 2JOYA 2COYA 2CH4W 2YUOA 1RI0A 2EWNA 3PE0A 4OMQA 1CSKA 2CP5A 1QVGP 4C5HA 3E19A 3CD6Q 2AKKA 2QQSA 4HCZA 1YNZA 5IH2A 5KYYB 4ZTJA 1W2BP 1PG5B 3PGGA 1FWZA 4J83A 1AD5A 2VWFA 2MK5A 2RQUA 3VS0A 3I56T 2DYBA 5CKHA 1UGSB 4C92B 1A0NB 2CZ6B 4M78D 2HBPA 2EJ9A 3I55A 2L0AA 1SHFA 1Y0MA 1EX4A 1KJWA 2WACA 4KGVB 3VRZA 1Q81C 2GQIA 1BI3A 1NM7A 3E2UA 3CBOA 1N27A 4C92C 4RG2A 2QQBA 3MP8A 1I07A 3H6ZA 3VRYA 1YJ9T 4M78G 2MWOA 3OYBA 2FEIA 2DXUA 3S6WA 2H3EB 1JJ2P 3A8OB 3H0FA 2YXYA 3KBGA 5GANg 1UGVA 1I5LA 4V2SA 2P4TA 1UHCA 2ATCB 1AOJA 4M4ZA 3A8HB 2DM1A 2LQ8A 3EH1A 1B34A 1S72A 1TSFA 3V7RA 1M90R 3VS1A 3DB3A 1R77A 9ATCB 4KUDK 3RESA 2KK4A 2R5AA 5CKDA 1D1BA 4BE0A 1NBEB 3QPHA 2X35A 2LQNA 4EDUA 2D1XA 3L2QA 1NJIR 5KYXA 3X25B 2A28A 2JMAA 2G3RA 2BE7D 2DTOA 1ZUYA 4O5VA 4QQDA 1RI9A 3RMSA 3G6EQ 1VQ4A 1UE9A 1AVZC 4PLLA 4XTZA 2GQVA 2KR3A 3UF4A 2RH2A 2DXCA 3A8MB 2FPEA 3C0CA 3VS7A 2DXBA 1IGUA 4M7AD 3HRTA 2CP0A 2JVVA 1BU1A 1GBQA 3EG2A 4J9GA 1YCYA 2QTVA 1BCOA 2RM4A 2C0IA 1RAEB 3SB2A 2CGHA 4QT7A 2CP2A 3CCSA 2K3BA 3QWYA 2M51A 1CKAA 2HCKA 5J39A 2K9GA 1Q82C 2VXEA 3MP1A 3JCMg 3E9FA 3H9NA 4M75A 2PVOB 2K3XA 2CUDA 1QWFA 1YJNT 3WXMB 4DBFA 2CZ7B 3LW5E 5IN1A 5ECAA 3M4GA 2OTJQ 5KYWA 2VKNA 2RMOA 4M7DG 1PHTA 2CSQA 2AZSA 2L2PA 1VQMA 2E4HA 1VQLA 4C92F 1YI2Q 1V76A 3OMCA 3G71A 2D0QB 3CCMQ 4IIOA 2QI2A 2JNGA 2P84A 3HL8A 3PMTA 3QIIA 5GAMh 1VQKT 1VQ9T 1LVKA 2KBTA 2IPOB 1OEBA 4WTOB 1RAHB 4DBRA 2JUFA 1UGQB 1VQ6T 4BE1A 1N9RA 4Y92A 1VQ6Q 4BD3A 2LZ6B 1XOVA 4PJOD 1NYGA 3JCMf 3AHUA 2DPPB 3FJPA 1TS9A 4N4HA 5LJ5e 4J9FA 4IUTA 4LUDA 3QJYA 4JDSA 3JAME 3M4YA 4C92G 4PJOA 2K6DA 2QQRA 3CCLQ 1WXBA 2JS0A 4JPBW 2EQIA 5GAMg 4M77D 5I11A 4C0ZA 2QEXA 3JCMJ 4A53A 3OY9A 3ZBDA 2DFUA 1WFWA 3CMAQ 1EZZB 1PRLC 2IVWA 3E9GA 2K3YA 2EW3A 2XU8A 4BE2A 4F7UA 2RJFA 3VJPA 2OI3A 1UDLA 1WPYA 3L2ZA 1JBMA 4HA8A 3EFOA 4RTUA 3G7ZA 4LXCA 2M1HA 2XKOC 4A4FA 5FU7B 1SF9A 4RTZA 3OS1A 4MZTA 1VQNQ 3JCMc 1K73R 4D8DA 4E7ZA 3OBYA 4PJOG 1X6OA 5D6YA 2W10A 1FYNA 4BI4A 4EMKA 1VQPT 5CKEA 2P0KA 1GCPA 1AWXA 5CR2A 2XD0A 2YRVA 3EG9A 1VQ8Q 1VQ8T 2E1HA 2QDLA 1D0ZA 1ZSZC 4KBMB 4QQGA 3OYMA 2AKLA 4BDYA 4FW2A 3EGDA 4E7KA 4RG8A 3SWNA 2DL4A 1UTIA 2ZCFB 4M7DB 2LC4A 2MI6A 2JXBA 2D9TA 3RKXA 4C0DC 4EMGA 1TG0A 2D8HA 1YBYA 1ZUUA 1WYXA 3VU3C 2QA4T 1KQSS 4EMKB 1OX9A 2EYYA 1VQ4T 3Q1JA 1M8MA 3OSVA 4Z02A 3J81E 4GLKA 4PFZA 2EQKA 3EGXB 3CPWS 1W70A 2XMFA 3RERA 1MMGA 2EYQA 1WHHA 5GMKe 1D3BB 3CBMA 1BI2A 3NHNA 1KD1R 2RHUA 1K8AR 1NE8A 1VQMT 3LGLA 4J9CA 5HK3A 4ATOA 3NTHA 2HQHA 1RL2A 1ZQ1A 2QK0A 1V1CA 5GAOp 1VQKQ 1C6VX 2EYXA 3VS5A 1UGRB 2AK5A 3IQLA 2PTKA 2M9UA 2JM9A 3TU4K 4KULA 4M7DF 2MOXA 3TREA 2HQXA 2DL5A 2FL7A 2EAYA 4JRPA 1ZA1B 5KYWB 4KGXB 1I0CA 2DE0X 1JB0E 1E6GA 1BK2A 5A0GA 2VVKA 1T3LA 2XDPA 4RTYA 2EGEA 2ZPFB 2P0PA 2QQ9A 4J6XA 4FYVB 1HYOA 1YP5A 1UUEA 2OX7A 1MNDA 1VQ7Q 3CCRA 1NZ9A 3CC7Q 1KC8U 1ZHIA 2DERA 5I2MA 4N0AC 3ME9A 4FYXB 1NYFA 1W4SA 1M2VA 2VYTA 3JCMd 1JXMA 3G6ET 3QG1A 1HK9A 3PTAA 3R6OA 1IXDA 1MGQA 4QVCA 3LX7A 4FYWB 4WCIA 1PNJA 3CC2A 4MDXA 4HCKA 1RAGB 3O5ZA 4L59A 1U3OA 3OYNA 4XTWA 4OB1B 2E5KA 2OAWA 4JUVA 1QCNA 2M02A 2ZPBB 2NUTB 3LYIA 3VV0A 1Q7YU 1TUGB 1KD1C 3M0PA 3CC7A 1NLPC 2IG0A 1XQHA 4IUPA 2DNUA 2FVUA 3MEWA 3JB9J 5GMKl 2JMCA 3D7SB 1X43A 1ARKA 1YHQQ 2LQWA 1OI1A 3S3NA 1K9AA 1YFNA 4E7LA 1C0MA 2FYKA 2YHTA 1X69A 3REAB 2DAQA 5GAMj 1WJRA 3RDVA 3OMGA 3LH0A 4M77C 1T0HA 1WA7A 5CQXA 4D6WA 2V1RA 3URGA 3KXTA 1HJDA 5FU6C 1M1KU 4FSXA 3VUBA 4FU6A 1R0BG 4A54A 4JZ4A 1UHFA 3CEYA 4NS5A 4XU0A 3OW2A 2LX7A 2YRCA 1MMAA 2RPNA 3M9QA 4A4GA 5GANj 1WDXA 2DIQA 5FU6B 1VQ7T 3H8ZA 2K5IA 3ZFJA 4M7AA 2EJFA 1JRIA 2BIVA 1BB9A 2EBPA 1BKBA 4C92A 3S3MA 1VQ6A 1KSWA 3M57A 3TSWA 4HVWA 4OGCA 4JZ3A 1RAFB 2F2XA 1PSFA 1GBRA 2KROA 1S72Q 3KFVA 5I21A 2A36A 2FPDA 2J6OA 4C8QB 3L2RA 4PJMA 3CPWA 1Q7YC 5A0DA 5KYUB 4E7SA 6AT1B 1VUBA 4AFZC 5AYFA 1YHQA 1K9MC 3THKA 2HQEA 2J05A 1PC0A 2GF7A 3JRZA 1GFCA 1Y7XA 1D0YA 3BDLA 5KCHA 3EG3A 4A63B 1M3AA 5GAN5 2M0YA 1PD0A 1LJOA 3C12A 4ORZA 2PNIA 1HXDA 3FIFA 4OB2B 3OYKA 4Y91A 2PVDB 1IRXA 2PQWA 2D0NA 2RNAA 1KQ2A 3EGXA 2GTJA 4PFOA 3F70A 2DETA 2HZYA 1H3ZA 1IO6A 1I1JA 3M0UA 4JJCA 1V29B 4XTYA 5CQYA 4F04B 1JJ2S 2KY9A 4II1A 2JW4A 4B9WA 4DEYA 2CUBA 2O4XB 2MF2A 4MMLA 1QW1A 1KC8C 3TCJA 1YJWT 4J7FA 1C1AA 1OU9A 1SRLA 2PZ1A 2LX9A 3HTRA 4ELZC 1WHGA 3P8HA 1K76A 3R6NA 3CMEA 1UFFA 5DLOA 3A98A 1WNLA 2KVQG 4O6JA 2AHJB 4BACA 1Q86C 2QXFA 5L8RE 3QDFA 2XDDA 2FHDA 1KC8R 2EYWA 5GAOq 4BDZA 3UWNA 4ZN3A 2OTJA 4PNOA 4ANJA 1IHWA 2IIMA 2RN8A 1K9MU 3O8VA 4FT4A 1FMKA 2VXFA 1XJWB 3CXCS 1BIBA 2P4RA 5GMKi 4C5EA 3JB9F 4RTTA 4NL3A 2JN0A 2L3RA 3QZ9B 3JCMQ 4RCBA 4FL6A 1UG1A 3HKSA 2YWWA 4M7DD 1X27A 3M0RA 1BIAA 4EMHA 3I5RA 3UT1A 4E7IA 1VYUA 1KK7A 3CCRQ 2KNBB 1ACMB 1TWBA 4OB3B 4BY6C 2OAUA 4CC3A 3G71Q 5CK9A 2QASA 5M9OA 3PMIA 3CCRT 2K4YA 1N8RU 3MKDA 4LDYA 1R0CB 5IT9E 1IREB 1G3SA 2QGFB 5IXFA 2F1LA 3A8LB 1UB4A 1GXIE 5C0MA 2CP7A 3CC2Q 2R58A 3CXCA 4CC4B 2HBWA 3H0IA 1VQLT 4M77A 1WHMA 3JB9G 1YITQ 4AFSC 2DEUA 4LE9A 3MHXA 4J5YA 2JM8A 1Q81U 4M78A 1VQNT 1U1TA 3CD6A 4X1VA 2HDAA 4ZNXA 1M3CA 1O75A 2LDMA 4E6RA 4J7IA 2DKGA 2X9HA 1VQ5Q 1JQQA 3RIRA 5GAN6 2C0TA 2DEQA 4LDXA 2LJ1A 4HXJA 1D1CA 1IZ6A 5D6WA 3CPFA 2VGMA 1OPLA 4E47A 3FJ5A 3CD6T 1G2BA 4C92E 2L89A 4IUUA 4N4GA 1NPPA 1OZ2A 5GMKm 1SKUB 4GY5A 4IKFA 4C0DB 1GRIA 4KT0E 1QQJA 2CKKA 3FDRA 1QWEA 4WF2A 1MMNA 3UA7A 2WSFE 1SSFA 2F69A 2RO0A 4ZGDB 5GANe 2V8KA 2KYMA 1VQ5T 3CCQT 4BUGA 1X2KA 2B86A 4HVVA 1PKTA 4M75E 3V8JA 1H92A 1MNEA 1AEYA 1M30A 1VQMQ 1ZSZA 1M2OA 3RNJA 3QWXX 4E2FB 4AFQC 1RLQC 3GNGA 1RABB 1KHCA 3MEAA 2A3LA 2Y90A 4JLIA 3J80E 1NG2A 3BFMA 5LJ5j 2K5LA 4XAXB 4LNPA 2O9SA 3CBPA 2AIRB 4CI0C 4NL2A 1H641 4PJOF 3M59A 3H0HA 1PCXA 1I4K1 3NTKA 3NPFA 1RADB 1WIEA 2E3HA 3PIPA 2DJZA 3CPWP 2BE9B 3EGUA 4HCBA 2M0OA 2RK2A 3OA6A 2RHIA 3FLGA 3J7AF 4LD6A 1PKSA 4RTVA 3GOXA 1D3BA 1B07A 1M8VA 3CCLA 1ZBJA 4QVZA 4C5IA 1RAIB 1AHJB 2FZGB 2JT4A 3C95A 1U06A 3M53A 4OMLA 4MZPA 4C8QD 4C92D 4XK8E 4OP0A 5GAN8 2XG8D 1FMWA 3V7SA 1OZ3A 1VQNA 2ROTA 3SWNC 4LD9K 2LJ0A 4JS5A 2KRNA 5IXBA 2FZKB 4QKUA 2CS7A 2YT6A 1T0JA 1N9SA 3ER0A 2K2VA 1NJIU 5FWBA 4XTUA 2H3JA 5GJVB 3CCVA 1WZOA 2RJEA 1JJ2A 3RMQA 3MPUB 3NGPA 1QP3A 3QHSA 1Q86R 2LNVA 2KQWA 1YJ9Q 2KT8A 4LUEA 4C8QC 2OTLQ 4HKEA 1VQOT 3M56A 2CT3A 4PJNA 1WXUA 2J7IA 4M7DC 3JB9D
chains in the Genus database with same CATH topology
3OYAA 4QQ6A 4RCCA 5GAMe 1VIEA 2FVUA 3MEWA 3JB9J 2RK1A 5GMKl 3P8BB 5GAMf 2K5FA 2O01E 2JOYA 3M5AA 5LJ5g 3G71T 3M55A 3CC4T 4F7UB 1RI0A 2VC8A 1YJ9A 1OI1A 3LWHA 2EWNA 4ZN1A 5DM7R 4JJNK 3S3NA 4E7LA 2VGNA 2FYKA 4C5HA 3E19A 2R5MA 2YHTA 5KCOA 3CCQA 3GPLA 2DAQA 2QQSA 2V8IA 4HCZA 4BY6B 5GAMj 1WJRA 4ZTJA 3PGGA 1FWZA 3OMGA 3LH0A 1YITA 4J83A 4M77C 4JLGA 1LNXA 1EIFA 5CQXA 3QYHB 1WGSA 4D6WA 3I56T 3LGFA 5CKHA 3URGA 1UGSB 5KE3A 3KXTA 4C92B 5FU6C 2CZ6B 1M1KU 4M78D 3OBWA 2HBPA 2R57A 3L42A 4FSXA 2EJ9A 3CCET 3VUBA 3WVDB 4FU6A 3I55A 4A54A 3OYCA 4J6WA 3I55T 2WACA 3EFSA 3CEYA 4L6V5 4NS5A 4XU0A 2RJDA 4LDVA 3CMET 2LTOA 1Q81C 3OW2A 1BI3A 4M78F 4PKCC 1YITT 2E64A 2GFUA 3VKIA 3OYGA 3M9QA 4A4GA 2I2LA 4R56A 5GANj 3CBOA 3QDRB 4EMKC 1W2BS 2XHCA 2DIQA 1N27A 1G3WA 5FU6B 4C92C 3H8ZA 1VQ7T 2E41A 2QQBA 4RG2A 1WQWA 2K5IA 3ZFJA 3QSUA 3MP8A 4M7AA 2EJFA 4BI3A 1JRIA 2BIVA 2LVMA 3H6ZA 1BKBA 2GCXA 2QQAA 5J26A 4C92A 3JCMW 3S3MA 1YJ9T 1VQ6A 3CC4A 3M57A 4M78G 4OGCA 2OTLA 2C06A 2MWOA 3OYBA 1M9SA 2DXUA 3QO3A 3S6WA 5CIUA 3A8OB 1JJ2A 1PSFA 3KBGA 5GANg 3NFCA 3V7CA 1I5LA 4V2SA 1VQKA 2VUBA 1YIJT 2P4TA 5I21A 2X4YA 4C8QB 2RD1A 3L2RA 3CPWA 1Q7YC 4MDWA 5A0DA 4ZTFA 3A8HB 2LQ8A 1Y96A 1VUBA 3RKWA 5AYFA 1B34A 4LDWA 4N0AA 4DOWA 1S72A 1KG1A 4XTXA 2MMPA 2DIGA 3V7RA 1YHQA 1K9MC 1OYXA 1VQOA 3DB3A 3OS0A 2HQEA 2EJGA 2RA2A 1YIJA 2GF7A 4KUDK 3RESA 1G3YA 3JRZA 3OYIA 5GAOn 2LRQA 1N8RC 2RB6A 1Y7XA 4M7AE 5LJ3d 3CCMA 3BDLA 5KCHA 4JRQA 2KK4A 5GAN5 3OYDA 1LJOA 3C94A 2R5AA 3C12A 5CKDA 1HXDA 5GANd 4BE0A 2QTXA 3QPHA 2X35A 4EDUA 3L2QA 3FIFA 4QW2A 3HRSA 4OB2B 3X25B 3OYKA 1YHQT 4Y91A 2PVDB 2O4XA 4F7UF 2G3RA 3SFMA 4C8QE 1VQ7A 2DTOA 2PQWA 4FIBA 4O5VA 4QQDA 3RMSA 1VQ4A 1KQ2A 3OB9A 4PJOC 1M90U 2VV5A 5DY9A 1YJNA 3F70A 4PLLA 4XTZA 3JCMb 1H3ZA 1Y07A 2GQVA 2GFAA 1KHIA 2RH2A 1V29B 2DXCA 1WJQA 2NLUA 3A8MB 1VQPA 3QYGB 4XTYA 1M1KC 1BYMA 5CKBA 5CQYA 4XU3A 3FC3A 1LOJA 5CCAA 2DXBA 2E70A 1JJ2S 2DTIA 5DLQE 5KE2A 2KY9A 4II1A 4IUVA 5LJ3j 4M7AD 4L5GA 3GP8A 2V8JA 3HRTA 2OTLT 4B9WA 3OS5A 3CCST 3M58A 2O4XB 2JVVA 2D6FA 2MF2A 2Y4XA 1QW1A 2DVEA 4MMLA 4IURA 2RHZA 1KC8C 3TCJA 4M75F 1YJWT 3JCMP 2E5QA 4J7FA 5EG2A 1YCYA 3JSCA 3MEUA 1VQ8A 4PJOE 2LX9A 2DD4A 3G4SA 3QJ6A 3EFRA 4C0GA 4CRIA 4DA4A 2DXTA 2KSSA 2RM4A 3SB2A 2RHXA 2CGHA 2LT4A 3INZA 4ELZC 2JTMA 3P8HA 4M7AC 3CMEA 4XU1A 3CCSA 5DLOA 3DLLA 5J39A 1NPRA 3OYHA 2EIFA 4NOYA 1WNLA 2KVQG 4M75G 4HT8A 2A7YA 4O6JA 1Q82C 2VXEA 3CCLT 2AHJB 4BACA 4HCCA 1Q86C 2QXFA 5L8RE 2EQJA 3MP1A 3JCMg 2P0QA 2XDDA 3E9FA 4E7HA 4M75A 2EKOA 2PVOB 2FHDA 2K3XA 4C8QG 2MAMA 5GAOq 4BI8B 4BDZA 3UWNA 1NJIC 5GANh 4ZN3A 1KD1U 2OTJA 1YJNT 3WXMB 1I8FA 3GNFB 4C5GA 2CZ7B 4X34A 3CCJA 3LW5E 5IN1A 4PNOA 3T9NA 3M4GA 2FB7A 5FROA 4M7DG 5FU7C 5GAOm 1K9MU 3O8VA 1VQMA 1VQLA 2ZZDA 4FT4A 3QXEB 4C92F 2VXFA 2F5KA 3SDZA 3CXCS 1BIBA 5LJ3g 3OMCA 5GMKi 3E1SA 1TH7A 4C5EA 1QVGA 3QKJA 3BDUA 3G71A 3JB9F 2D0QB 3X26B 5A2QE 5LJ5h 2EQMA 4NL3A 2JN0A 3CC2T 3L2UA 2CZ1B 2L3RA 1PSEA 2QI2A 3CMAA 1W2BA 3QZ9B 3V8LA 2JNGA 3JCMQ 4RCBA 4M78B 2PU9B 4FL6A 4J8OA 4F7UG 3HKSA 3MCAB 3UPUA 4FT2A 5GAMd 3OYFA 4M7DD 3HL8A 4C0FA 1BIAA 3PMTA 3RKYA 3CCVT 3L1AA 3DLMA 5J3BA 3QIIA 1ZBXA 4EMHA 3CC7T 1N6AA 5LL6S 4M77G 3UT1A 3HP9A 3RUXA 4E7IA 5GAMh 2QA4A 5D6XA 1VQKT 3TEEA 3JCMX 1VQ9T 3GLXA 4C8QF 4Q5WA 2PUKB 3SWNB 1VIFA 1DJ7B 2CZ0B 4OB3B 1U8RA 2K57A 4BY6C 4M7DA 2OAUA 4R55A 2JTFA 3JCMh 1M90C 1QVFA 5CK9A 2F5TX 2JUFA 1UGQB 5M9OA 4M77B 4BE1A 4E7JA 2HAXA 1N9RA 4B9XA 1MHNA 2KDSA 2DD5A 3META 3PMIA 2RHYA 3VYGA 2K4YA 4BD3A 4LDYA 4C8QA 3CCRT 1N8RU 1XOVA 5IT9E 4EPCA 4PJOD 1IREB 1G3SA 3JCMf 4TVRA 5FLXE 3AHUA 2DZCA 2DPPB 3FJPA 4N4HA 2LT1A 2XDBA 5LJ5e 2E12A 4IUTA 3A8LB 1UB4A 3C4SA 3PT9A 1GXIE 5C0MA 3QJYA 4JDSA 3JAME 3M4YA 4C92G 3CCMT 2QQRA 4PJOA 2R58A 3CXCA 4ZGEB 1VQLT 5GAN4 1K8AC 4M77A 5GAMg 3CCUA 1M1FA 4M77D 3JB9G 4C0ZA 4M78C 2QEXA 5LJ5f 3JCMJ 2ZPIB 4A53A 3EAEA 4RMOA 3LWIA 2X4XA 5LJ3f 3MHXA 3OQ5A 4MMKA 3ZBDA 3PNWC 4J5YA 4A4HA 3OY9A 1Q86U 5FRNA 3N5BB 1Q81U 4M78A 5CVIA 1XNIA 2OTJT 1VQNT 4OVAA 3CMAT 2BKDN 1U1TA 2IVWA 3E9GA 3NTIA 4XQ3A 5CO7A 1YI2T 2K3YA 3CD6A 2XICA 2XU8A 2DTHA 4BE2A 2LDMA 1O75A 1Y96B 1KQSA 1UEBA 4F7UA 1XTDA 2RJFA 4J7IA 2DKGA 4PL6A 3UDCA 3VJPA 3RIRA 1WPYA 3LLRA 2DEQA 3DB4A 5GAN6 4LDXA 3L2ZA 3FEOA 3HPWA 4JRIA 1JBMA 1IZ6A 5D6WA 4HA8A 3BY7A 3CPFA 5HKCA 2VGMA 4E47A 4PLIA 3G7ZA 3CD6T 2M1HA 4C92E 4ZGJB 4LDUA 2L89A 2XKOC 4IUUA 4A4FA 3CCJT 3JB9I 1YI2A 3HFOA 4M7DE 4N4GA 5FU7B 3L2WA 4M75B 3OSSC 1NPPA 1OZ2A 3OS1A 4MZTA 5GMKm 3JCMc 4GY5A 4DOVA 4IKFA 2QEXT 2YLCA 3OBYA 4C0DB 4PJOG 1X6OA 1P92A 2L5QA 5D6YA 2RI2A 3CCEA 1UGPB 4BI4A 4EMKA 2RJCA 3MP6A 5GANf 4KT0E 5CKEA 2CKKA 1VQPT 2P0KA 3OYYA 2X4JA 3FDRA 2JZ2A 3I56A 5CR2A 2E65A 2XD0A 4WF2A 2YRVA 3G4ST 2WSFE 1VQ8T 2WSEE 1SSFA 1WQ7A 2F69A 1K73C 2RO0A 3HRUA 4ZGDB 2E1HA 5GAOl 4KBMB 4QQGA 5A0LA 5GANe 1KQ1A 1WJSA 2V8KA 3X24B 5GAN3 3OYMA 3OYLA 2ZGWA 1VQ5T 3CCQT 4OB0B 4BDYA 2ZPGB 4E7KA 4RG8A 4BUGA 5LJ3e 3PFSA 3QUIA 3SWNA 4M7DB 2ZCFB 5GAN7 2LC4A 2MI6A 2RI3A 1M1GA 4M75E 5C6SA 3M54A 3V8JA 2D9TA 4P5NA 3RKXA 4C0DC 4EMGA 5FRMA 2MWPA 1YBYA 3VU3C 2QA4T 3OW2S 3GF5A 1KQSS 2LCCA 3A8GB 4EMKB 2EFIA 4M75C 2XI9A 1VQ9A 3GNGA 1VQ4T 4M7DC 5CKFA 3ASKA 3Q1JA 4OGEA 1KHCA 2X4WA 3MEAA 3OSVA 4Z02A 4J6YA 2A3LA 3J81E 4GLKA 1K8AU 2WSCE 2B8AA 3DKMA 3JB9H 1BI0A 1M5Q1 2EQKA 2Y90A 4JLIA 4XTVA 3J80E 3CPWS 4M7AB 3RERA 4BB7A 2EYQA 3BFMA 5LJ5j 2K5LA 2E6NA 4XAXB 3CBPA 5GMKe 1D3BB 4ME7A 3CBMA 3X28B 4CI0C 4NL2A 1BI2A 1H641 2XIDA 4PJOF 3M59A 5KH6A 2RHUA 2KAFA 1NE8A 1VQMT 3LGLA 1I4K1 3NTKA 4QVDA 5HK3A 2DO3A 4M77E 2PVGB 4ATOA 2LCLA 1U1SA 4HT9A 3NTHA 1B34B 3JCMV 3PIPA 5GAN2 3SD4A 4A4KA 2DJZA 5HK0A 1RL2A 1ZQ1A 2EQUA 1Y71A 5GAOp 4M7AF 4DQ2A 4HCBA 2L8DA 3HSBA 2M0OA 2RK2A 3MEVA 3OYEA 1UGRB 2M9UA 3OA6A 1FXXA 2RHIA 1M4ZA 3FLGA 3TU4K 1QVFS 3J7AF 4KULA 4LD6A 4M7DF 5IAYA 1VQ6T 3TREA 2HQXA 3GOXA 2FL7A 1D3BA 4JS4A 2EAYA 4JRPA 3KUFA 5GAOr 1BI1A 3JCMe 4X9DA 1VQ5A 3CCLA 1M8VA 4QVZA 4C5IA 2QDYB 1AHJB 3QZ5B 1JB0E 3C95A 3V8KA 5A0GA 2HNIA 5I2SA 3M53A 4N4IA 4MZPA 5HY6A 4C8QD 3VUZA 4C92D 5LJ5d 2XDPA 4XK8E 2Y4YA 4OP0A 5GAN8 2XG8D 2ZPFB 4XU2A 2P0PA 2QQ9A 3PIOA 4J6XA 3V7SA 3S3OA 3OYJA 1OZ3A 1VQNA 2E6ZA 1YJWA 1QVGS 4M77F 2XK0A 1X75C 4M75D 3P8DA 3SWNC 4LD9K 3CCRA 1NZ9A 3X20B 4JS5A 1KC8U 1X01A 2KMTA 1ZHIA 3HFNA 3FRNA 1G3TA 4M78E 5I2MA 4N0AC 5GMKj 3ME9A 5CAIA 5GMKh 4ELYC 1W4SA 3CCUT 1R8OB 2DZ9A 2CS7A 2VYTA 1O9SA 3JCMd 1N9SA 2RI5A 3ER0A 2K2VA 4OMFB 3G6ET 3QG1A 1NJIU 3GIBA 1HK9A 2ZPHB 3WVEB 3PTAA 4XTUA 2H3JA 3R6OA 3CCVA 4VUBA 1QP2A 2CYZB 2RJEA 1MGQA 3BW1A 3HHTB 3A5ZB 3QBYA 4MZMA 4QVCA 4IUQA 1Q82U 3RMQA 3LX7A 4M7AG 1FX7A 1QP3A 2DK3A 1K73U 3VYHB 3L2VA 4PJOB 1I81A 3QHSA 4FM4B 3CC2A 4MDXA 2E10A 2LNVA 3FB9A 4JRKA 4Y28E 4F7UE 4L59A 2HD0A 3OYNA 2YLBA 4A4EA 2KQWA 3ZEHA 3MO8A 4YTLA 4XTWA 2ZPEB 4KUIA 4OB1B 3OS2A 4JUVA 5LJ3h 4C8QC 4X9CA 4RKUE 2PUOB 2M16A 2ZPBB 3LYIA 4HKEA 3VV0A 1Q7YU 1KD1C 2LQKA 2BUDA 1QVPA 1VQOT 3CC7A 4UC4A 3M56A 2IG0A 1G5VA 1XQHA 3G6EA 4OF1A 1S72T 3JB9D 4IUPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MDW A; 
#chains in the Genus database with same CATH topology
 4OMN A;  1VIE A;  2SEM A;  5GAM f;  2K5F A;  1D1A A;  2O01 E;  5LJ5 g;  3M55 A;  3CC4 T;  3LWH A;  1WHJ A;  2VGN A;  1TOV A;  1JU5 C;  1WX6 A;  3CCQ A;  3GPL A;  1N5Z A;  2MIO A;  2ROL A;  1ZSG A;  3RR6 A;  1EIF A;  1LNX A;  4PFP A;  1WGS A;  3LGF A;  1OPK A;  1NEB A;  2DRK A;  2R57 A;  3L42 A;  1ZX6 A;  3CCE T;  2L3S A;  2NWM A;  3OYC A;  3EFO B;  3I55 T;  4L6V 5;  4LDV A;  3CME T;  1TU0 B;  4M78 F;  1YIT T;  2E64 A;  4R56 A;  2W0Z A;  1JO8 A;  1WHK A;  2KGT A;  4EMK C;  1G3W A;  2COW A;  1WQW A;  3QSU A;  2LVM A;  1K4U S;  1NEG A;  1HSQ A;  3CXC P;  2OTL A;  3QO3 A;  3TQ7 P;  4K11 A;  3V7C A;  2VUB A;  1YIJ T;  1OV3 A;  2GTO A;  2X4Y A;  2RD1 A;  1T3S A;  4MDW A;  2YUP A;  4Z8A A;  4ZTF A;  1Y96 A;  4DOW A;  4DEX A;  3EHQ A;  2CDT A;  4LDW A;  2K2M A;  4XTX A;  2MMP A;  2DIG A;  1F1B B;  1VQO A;  3OS0 A;  2RA2 A;  1YIJ A;  1G3Y A;  3OYI A;  5GAO n;  1N8R C;  2RB6 A;  4M7A E;  1B3Q A;  4J9H A;  3CQT A;  3OYD A;  3C94 A;  5GAN d;  1OQK A;  2DBK A;  2KE9 A;  3HRS A;  1YHQ T;  3SFM A;  4FIB A;  2BZ8 A;  2LNH B;  3OB9 A;  4PJO C;  1M90 U;  2VV5 A;  5DY9 A;  5IHI A;  3JCM b;  2CSI A;  1Y07 A;  2GFA A;  1KHI A;  3QYG B;  1BYM A;  2DYI A;  3FC3 A;  5CCA A;  5LJ3 j;  4L5G A;  8ATC B;  3G4S Q;  3M58 A;  2Y4X A;  2DVE A;  2CH4 A;  4IUR A;  1JEG A;  2RHZ A;  4EIK A;  4M75 F;  5EG2 A;  3JSC A;  1VQ8 A;  2DD4 A;  3G4S A;  2JTE A;  3EFR A;  4DA4 A;  2KSS A;  2CRE A;  3EHR A;  3INZ A;  2LT4 A;  1M27 C;  4XU1 A;  4RTW A;  1M3B A;  1NPR A;  4GLM A;  2EIF A;  3OYH A;  4HT8 A;  2A7Y A;  3CCL T;  2EQJ A;  2P0Q A;  1B7T A;  2EKO A;  4C8Q G;  2MAM A;  4BI8 B;  1Y57 A;  5GAN h;  1FMV A;  1KFZ A;  3GNF B;  4C5G A;  1SG5 A;  3T9N A;  2ZAE A;  2FB7 A;  2X3W D;  3VS3 A;  3JV3 A;  5FU7 C;  3CME Q;  4Z88 A;  3SDZ A;  5LJ3 g;  1VQ9 Q;  5AT1 B;  2NUZ A;  3E1S A;  2LCS A;  2DL3 A;  4AG2 C;  3QKJ A;  4LN2 A;  1KIK A;  5LJ5 h;  2EQM A;  1Q7Y R;  3CCV Q;  2CZ1 B;  4CC2 A;  3V8L A;  1JXO A;  3EGD B;  4M78 B;  4J8O A;  3UPU A;  3MCA B;  5GAM d;  2DBM A;  3RKY A;  2FG0 A;  4HVU A;  3CCV T;  3L1A A;  3CC7 T;  2EVR A;  3HP9 A;  2KRS A;  2QA4 A;  5D6X A;  3TEE A;  2A08 A;  3GLX A;  4C8Q F;  2D8J A;  3SWN B;  1VIF A;  1DJ7 B;  2CZ0 B;  1U8R A;  4M7D A;  2K57 A;  3MJX A;  4R55 A;  1M90 C;  2EGA A;  1QVF A;  4E7J A;  2KI7 A;  2HAX A;  1MHN A;  2KDS A;  2DD5 A;  3MET A;  2RHY A;  4C8Q A;  4EPC A;  1LPL A;  2QAZ A;  4FYY B;  1PWT A;  4IIM A;  2K7A A;  1G83 A;  3CCM T;  2L3Q A;  1K8A C;  1M1F A;  4M78 C;  5LJ5 f;  2JS2 A;  2ZPI B;  2V1Q A;  2X4X A;  2CP6 A;  5LJ3 f;  3OQ5 A;  4MMK A;  8AT1 B;  4PJL A;  2QA4 Q;  5FRN A;  2FRY A;  2OTJ T;  4OVA A;  1NLO C;  1YI2 T;  4XQ3 A;  2DJQ A;  2KT1 A;  2DTH A;  1KQS A;  1UEB A;  4PL6 A;  3LLR A;  3FEO A;  1Q81 R;  2E3I A;  3BY7 A;  2BTT A;  3RBB B;  1MMD A;  2VAS A;  1YI2 A;  1G8X A;  3EH2 A;  4RUG A;  2DLP A;  4M75 B;  1Z9Z A;  2QEX T;  2YLC A;  4JJD A;  4F14 A;  1P92 A;  2L5Q A;  2QG9 B;  1AT1 B;  2J6K A;  2JZ2 A;  4OMM A;  3G4S T;  4FCY A;  1K73 C;  1W6X A;  3HRU A;  2FO0 A;  1TUC A;  1KQ1 A;  5GAN 3;  3X24 B;  1ZLM A;  1VYT A;  5LJ3 e;  3PFS A;  2HSP A;  3QUI A;  5GAN 7;  3M0T A;  2RI3 A;  1M1G A;  3CCQ Q;  4P5N A;  4AT1 B;  5FRM A;  2NYS A;  1D09 B;  2GNC A;  3OW2 S;  3GF5 A;  2DA9 A;  3A8G B;  2HEQ A;  2JJ9 A;  5CKF A;  3G1J A;  1H8K A;  2X4W A;  4J6Y A;  4KGZ B;  1K8A U;  3DKM A;  2B8A A;  3JB9 H;  1YN8 A;  1M5Q 1;  4AG1 C;  4M7A B;  2EGC A;  1UEC A;  1YIJ Q;  2Z0W A;  3I55 Q;  3X28 B;  2DVJ A;  2XID A;  4F17 A;  5KH6 A;  1IGQ A;  3EG0 A;  4R0K A;  5IHK A;  2HKN A;  4HT9 A;  2LCL A;  4PJJ A;  1B34 B;  5GAN 2;  2MYS A;  4OMP A;  4M7A F;  2L8D A;  4DBQ A;  3OYE A;  5IAY A;  4JS4 A;  5GAO r;  1EFN A;  3KUF A;  4J9E A;  3JCM e;  3SEM A;  1IHV A;  4X9D A;  1RUW A;  1OOT A;  1UJ0 A;  3QZ5 B;  4AFU C;  1OU8 A;  3V8K A;  5I2S A;  4N4I A;  3S3O A;  2HL5 C;  3OYJ A;  1YJW A;  4M77 F;  1X75 C;  3P8D A;  3X20 B;  2KMT A;  2A37 A;  4M78 E;  5CAI A;  5HCK A;  4ELY C;  1M2V B;  1R8O B;  2DZ9 A;  2DL7 A;  2EKH A;  2YUN A;  4OMF B;  4Z89 A;  5KYX B;  3EG9 B;  4VUB A;  1QP2 A;  3BW1 A;  4MZM A;  3HHT B;  5FWC A;  4M7A G;  1AWO A;  4F7U E;  4Y28 E;  1SSH A;  2AT1 B;  1IB8 A;  3ZEH A;  1E6H A;  1TUD A;  2ZPE B;  4KUI A;  2RQR A;  3LH5 A;  1Z9Q A;  2PUO B;  1QVP A;  1YCS B;  3M0S A;  1G5V A;  3G6E A;  1X6B A;  3H41 A;  3OYA A;  4JJB A;  5GAM e;  4F16 A;  2BZX A;  1ABO A;  1RAA B;  3M5A A;  3G71 T;  4F7U B;  1YJ9 A;  2VC8 A;  5DM7 R;  4ZN1 A;  4JJN K;  2R5M A;  5KCO A;  4BY6 B;  2V8I A;  1SHG A;  2HL3 A;  2L3P A;  1YIT A;  2CT4 A;  4JLG A;  3QYH B;  5KE3 A;  3OBW A;  1MV3 A;  1GFD A;  3CCE Q;  2DMO A;  3WVD B;  2EYZ A;  4J6W A;  1W1F A;  4CC7 A;  3EFS A;  3I56 Q;  2H8H A;  2RJD A;  2LTO A;  4PKC C;  2GFU A;  3VKI A;  3OYG A;  2SRC A;  2I2L A;  3QDR B;  4FSS A;  1W2B S;  2XHC A;  1QCO A;  2E41 A;  5KYU A;  4BI3 A;  1RAC B;  1QKX A;  2GCX A;  2QQA A;  5FW9 A;  5J26 A;  2ECZ A;  3JCM W;  3CC4 A;  2DF6 A;  2O9V A;  2C06 A;  1M9S A;  3I9Q A;  5CIU A;  1D0X A;  2LMJ A;  3NFC A;  1VQK A;  3M0Q A;  3TVT A;  2AZV A;  3VS2 A;  1VA7 A;  1VQO Q;  3RKW A;  4N0A A;  3REB B;  1KG1 A;  2X51 A;  2VB6 A;  3SHW A;  1OYX A;  1KQS P;  2ED1 A;  2EJG A;  2LRQ A;  5LJ3 d;  3CCM A;  4JRQ A;  1WXT A;  1K0X A;  2QTX A;  4QW2 A;  3TSZ A;  2FRW A;  3CC4 Q;  4F7U F;  2O4X A;  4C8Q E;  1VQ7 A;  1Q82 R;  4KRT A;  1YJN A;  4FW1 A;  1YWO A;  2NLU A;  1WJQ A;  1VQP A;  3PVL A;  1M1K C;  5CKB A;  4XU3 A;  2O31 A;  1LOJ A;  2E70 A;  2DTI A;  5DLQ E;  5KE2 A;  1HD3 A;  1YWP A;  4IUV A;  2J6F A;  3GP8 A;  2V8J A;  2OTL T;  3OS5 A;  3CCS T;  2D6F A;  1OX8 A;  3A1P A;  3JCM P;  2E5Q A;  1SEM A;  2FPF A;  3MEU A;  1ABQ A;  3QJ6 A;  4CRI A;  4C0G A;  2DXT A;  2RHX A;  3NMZ C;  2JTM A;  3OW2 P;  4M7A C;  1LCK A;  1K1Z A;  3DLL A;  1VQL Q;  4NOY A;  4M75 G;  1AWJ A;  3CCJ Q;  1QVF P;  1TTH B;  4HCC A;  3CCU Q;  4E7H A;  2RQT A;  2HMA A;  1NJI C;  1KD1 U;  1VQP Q;  2DIL A;  1I8F A;  3CCJ A;  4X34 A;  2ESW A;  1I5O B;  5FRO A;  2GBQ A;  5GAO m;  3ZL7 C;  1M1K R;  2ZZD A;  3QXE B;  2F5K A;  1UJY A;  5L23 A;  1TH7 A;  1QVG A;  3BDU A;  3X26 B;  5A2Q E;  3CC2 T;  3L2U A;  1PSE A;  1W2B A;  3CMA A;  2QYZ A;  2HKQ B;  2PU9 B;  2EPD A;  1BCM A;  4F7U G;  4FT2 A;  3OYF A;  4C0F A;  2YSQ A;  4J9B A;  1GCQ A;  3DLM A;  5J3B A;  1ZBX A;  1N6A A;  5LL6 S;  4M77 G;  3RUX A;  3JCM X;  4Q5W A;  2PUK B;  2LJ3 A;  1AZG B;  2JTF A;  1MUZ A;  2F2W A;  3JCM h;  4D8K A;  2F5T X;  2QEX Q;  4M77 B;  4B9X A;  4PJO E;  3VYG A;  2KRM A;  2NUT A;  1PM3 A;  4TVR A;  2LP5 A;  5FLX E;  2DZC A;  2DRM A;  2XDB A;  2LT1 A;  1TXQ A;  2COZ A;  2E12 A;  3C4S A;  3PT9 A;  1WLP B;  4KH0 B;  1GCQ C;  2NUP A;  4ZGE B;  5GAN 4;  3CCU A;  1RLP C;  4RMO A;  3EAE A;  3LWI A;  3PNW C;  4A4H A;  1Q86 U;  2YRD A;  1N8R R;  5KYY A;  3N5B B;  5CVI A;  1XNI A;  3UA6 A;  4AMC A;  3CMA T;  2BKD N;  1J3T A;  5CO7 A;  3NTI A;  3PVQ A;  2XIC A;  1Y96 B;  1XTD A;  2YUQ A;  3UDC A;  3EG1 A;  2G6F X;  3DB4 A;  3HPW A;  4GBQ A;  4JRI A;  2OJ2 A;  5HKC A;  1CKB A;  4PLI A;  4ZGJ B;  4LDU A;  3CCJ T;  3JB9 I;  3HFO A;  1X2Q A;  4M7D E;  3L2W A;  1SRM A;  3OSS C;  2DX1 A;  2K79 A;  4DOV A;  1SPK A;  2RI2 A;  3CCE A;  1UGP B;  2RJC A;  3MP6 A;  5GAN f;  3OYY A;  2X4J A;  3I56 A;  2E65 A;  1QLY A;  3CCS Q;  1WI7 A;  3AT1 B;  2BZY A;  2WSE E;  1WQ7 A;  5GAO l;  2A0F B;  5A0L A;  1WJS A;  1PD1 A;  1PRM C;  3OYL A;  2ZGW A;  2GGR A;  4OB0 B;  4RTX A;  2ZPG B;  2RQW A;  5C6S A;  3M54 A;  2NUP B;  3BE3 A;  1AWW A;  2MCN A;  2MWP A;  4DBH A;  2YDL A;  2LCC A;  2EFI A;  4M75 C;  2XI9 A;  1VQ9 A;  3ASK A;  4KH1 B;  4OGE A;  3UAT A;  4B6M A;  1YJN Q;  2WSC E;  2ED0 A;  1BI0 A;  2MPX C;  4XTV A;  1X6G A;  3ULR B;  4BB7 A;  1VQ4 Q;  2KXC A;  2QGG A;  2E6N A;  1BBZ A;  2J06 A;  2ABL A;  4ME7 A;  1Q95 G;  1WHL A;  2KAF A;  1H3H A;  2O2O A;  4QVD A;  2DO3 A;  4M77 E;  2RF0 A;  2PVG B;  1U1S A;  3JCM V;  3SD4 A;  4A4K A;  5D7U A;  5HK0 A;  2EQU A;  1VOM A;  1Y71 A;  4DQ2 A;  3HSB A;  3MEV A;  2O88 A;  2KYB A;  5IHN A;  1FXX A;  1M4Z A;  5GJW B;  1OUL A;  1QVF S;  2KXD A;  1BI1 A;  2CP3 A;  3I5S A;  5EC7 A;  3I35 A;  2V26 A;  2QDY B;  7AT1 B;  2HNI A;  2X3X D;  5HY6 A;  5LJ5 d;  3VUZ A;  1E7O A;  4OMO A;  1YJW Q;  2KEA A;  2Y4Y A;  4XU2 A;  3PIO A;  3GBQ A;  2E6Z A;  1QVG S;  2XK0 A;  4M75 D;  2RQV A;  1AZE A;  1X01 A;  3HFN A;  3FRN A;  1G3T A;  5GMK j;  5GMK h;  3CCU T;  2DL8 A;  1O9S A;  1S1N A;  2RI5 A;  3GIB A;  2ZPH B;  3WVE B;  2FZC B;  4ESR A;  3U23 A;  1VQ5 A;  2CYZ B;  3A5Z B;  3QBY A;  4J9I A;  4IUQ A;  1Q82 U;  5KYN A;  1FX7 A;  2DK3 A;  2ENM A;  3VYH B;  1K73 U;  3L2V A;  1K9M R;  2F2V A;  4PJO B;  1I81 A;  4FM4 B;  2E10 A;  3FB9 A;  4JRK A;  2HD0 A;  2YLB A;  4A4E A;  4J9D A;  3MO8 A;  4YTL A;  2C0O A;  1QCF A;  2HSE B;  3OS2 A;  1ZUK A;  5LJ3 h;  4X9C A;  1ZSZ B;  1QKW A;  4RKU E;  2M16 A;  2I0N A;  2LQK A;  5I22 A;  1VYV A;  2BUD A;  1GL5 A;  4UC4 A;  1ZA2 B;  3VS4 A;  1U5S A;  1QMC A;  3VS6 A;  1S72 T;  4OF1 A;  4QQ6 A;  4RCC A;  2RK1 A;  4PK4 A;  1MV0 B;  3P8B B;  1K0S A;  2JOY A;  2COY A;  2CH4 W;  2YUO A;  1RI0 A;  2EWN A;  3PE0 A;  4OMQ A;  1CSK A;  2CP5 A;  1QVG P;  4C5H A;  3E19 A;  3CD6 Q;  2AKK A;  2QQS A;  4HCZ A;  1YNZ A;  5IH2 A;  5KYY B;  4ZTJ A;  1W2B P;  1PG5 B;  3PGG A;  1FWZ A;  4J83 A;  1AD5 A;  2VWF A;  2MK5 A;  2RQU A;  3VS0 A;  3I56 T;  2DYB A;  5CKH A;  1UGS B;  4C92 B;  1A0N B;  2CZ6 B;  4M78 D;  2HBP A;  2EJ9 A;  3I55 A;  2L0A A;  1SHF A;  1Y0M A;  1EX4 A;  1KJW A;  2WAC A;  4KGV B;  3VRZ A;  1Q81 C;  2GQI A;  1BI3 A;  1NM7 A;  3E2U A;  3CBO A;  1N27 A;  4C92 C;  4RG2 A;  2QQB A;  3MP8 A;  1I07 A;  3H6Z A;  3VRY A;  1YJ9 T;  4M78 G;  2MWO A;  3OYB A;  2FEI A;  2DXU A;  3S6W A;  2H3E B;  1JJ2 P;  3A8O B;  3H0F A;  2YXY A;  3KBG A;  5GAN g;  1UGV A;  1I5L A;  4V2S A;  2P4T A;  1UHC A;  2ATC B;  1AOJ A;  4M4Z A;  3A8H B;  2DM1 A;  2LQ8 A;  3EH1 A;  1B34 A;  1S72 A;  1TSF A;  3V7R A;  1M90 R;  3VS1 A;  3DB3 A;  1R77 A;  9ATC B;  4KUD K;  3RES A;  2KK4 A;  2R5A A;  5CKD A;  1D1B A;  4BE0 A;  1NBE B;  3QPH A;  2X35 A;  2LQN A;  4EDU A;  2D1X A;  3L2Q A;  1NJI R;  5KYX A;  3X25 B;  2A28 A;  2JMA A;  2G3R A;  2BE7 D;  2DTO A;  1ZUY A;  4O5V A;  4QQD A;  1RI9 A;  3RMS A;  3G6E Q;  1VQ4 A;  1UE9 A;  1AVZ C;  4PLL A;  4XTZ A;  2GQV A;  2KR3 A;  3UF4 A;  2RH2 A;  2DXC A;  3A8M B;  2FPE A;  3C0C A;  3VS7 A;  2DXB A;  1IGU A;  4M7A D;  3HRT A;  2CP0 A;  2JVV A;  1BU1 A;  1GBQ A;  3EG2 A;  4J9G A;  1YCY A;  2QTV A;  1BCO A;  2RM4 A;  2C0I A;  1RAE B;  3SB2 A;  2CGH A;  4QT7 A;  2CP2 A;  3CCS A;  2K3B A;  3QWY A;  2M51 A;  1CKA A;  2HCK A;  5J39 A;  2K9G A;  1Q82 C;  2VXE A;  3MP1 A;  3JCM g;  3E9F A;  3H9N A;  4M75 A;  2PVO B;  2K3X A;  2CUD A;  1QWF A;  1YJN T;  3WXM B;  4DBF A;  2CZ7 B;  3LW5 E;  5IN1 A;  5ECA A;  3M4G A;  2OTJ Q;  5KYW A;  2VKN A;  2RMO A;  4M7D G;  1PHT A;  2CSQ A;  2AZS A;  2L2P A;  1VQM A;  2E4H A;  1VQL A;  4C92 F;  1YI2 Q;  1V76 A;  3OMC A;  3G71 A;  2D0Q B;  3CCM Q;  4IIO A;  2QI2 A;  2JNG A;  2P84 A;  3HL8 A;  3PMT A;  3QII A;  5GAM h;  1VQK T;  1VQ9 T;  1LVK A;  2KBT A;  2IPO B;  1OEB A;  4WTO B;  1RAH B;  4DBR A;  2JUF A;  1UGQ B;  1VQ6 T;  4BE1 A;  1N9R A;  4Y92 A;  1VQ6 Q;  4BD3 A;  2LZ6 B;  1XOV A;  4PJO D;  1NYG A;  3JCM f;  3AHU A;  2DPP B;  3FJP A;  1TS9 A;  4N4H A;  5LJ5 e;  4J9F A;  4IUT A;  4LUD A;  3QJY A;  4JDS A;  3JAM E;  3M4Y A;  4C92 G;  4PJO A;  2K6D A;  2QQR A;  3CCL Q;  1WXB A;  2JS0 A;  4JPB W;  2EQI A;  5GAM g;  4M77 D;  5I11 A;  4C0Z A;  2QEX A;  3JCM J;  4A53 A;  3OY9 A;  3ZBD A;  2DFU A;  1WFW A;  3CMA Q;  1EZZ B;  1PRL C;  2IVW A;  3E9G A;  2K3Y A;  2EW3 A;  2XU8 A;  4BE2 A;  4F7U A;  2RJF A;  3VJP A;  2OI3 A;  1UDL A;  1WPY A;  3L2Z A;  1JBM A;  4HA8 A;  3EFO A;  4RTU A;  3G7Z A;  4LXC A;  2M1H A;  2XKO C;  4A4F A;  5FU7 B;  1SF9 A;  4RTZ A;  3OS1 A;  4MZT A;  1VQN Q;  3JCM c;  1K73 R;  4D8D A;  4E7Z A;  3OBY A;  4PJO G;  1X6O A;  5D6Y A;  2W10 A;  1FYN A;  4BI4 A;  4EMK A;  1VQP T;  5CKE A;  2P0K A;  1GCP A;  1AWX A;  5CR2 A;  2XD0 A;  2YRV A;  3EG9 A;  1VQ8 Q;  1VQ8 T;  2E1H A;  2QDL A;  1D0Z A;  1ZSZ C;  4KBM B;  4QQG A;  3OYM A;  2AKL A;  4BDY A;  4FW2 A;  3EGD A;  4E7K A;  4RG8 A;  3SWN A;  2DL4 A;  1UTI A;  2ZCF B;  4M7D B;  2LC4 A;  2MI6 A;  2JXB A;  2D9T A;  3RKX A;  4C0D C;  4EMG A;  1TG0 A;  2D8H A;  1YBY A;  1ZUU A;  1WYX A;  3VU3 C;  2QA4 T;  1KQS S;  4EMK B;  1OX9 A;  2EYY A;  1VQ4 T;  3Q1J A;  1M8M A;  3OSV A;  4Z02 A;  3J81 E;  4GLK A;  4PFZ A;  2EQK A;  3EGX B;  3CPW S;  1W70 A;  2XMF A;  3RER A;  1MMG A;  2EYQ A;  1WHH A;  5GMK e;  1D3B B;  3CBM A;  1BI2 A;  3NHN A;  1KD1 R;  2RHU A;  1K8A R;  1NE8 A;  1VQM T;  3LGL A;  4J9C A;  5HK3 A;  4ATO A;  3NTH A;  2HQH A;  1RL2 A;  1ZQ1 A;  2QK0 A;  1V1C A;  5GAO p;  1VQK Q;  1C6V X;  2EYX A;  3VS5 A;  1UGR B;  2AK5 A;  3IQL A;  2PTK A;  2M9U A;  2JM9 A;  3TU4 K;  4KUL A;  4M7D F;  2MOX A;  3TRE A;  2HQX A;  2DL5 A;  2FL7 A;  2EAY A;  4JRP A;  1ZA1 B;  5KYW B;  4KGX B;  1I0C A;  2DE0 X;  1JB0 E;  1E6G A;  1BK2 A;  5A0G A;  2VVK A;  1T3L A;  2XDP A;  4RTY A;  2EGE A;  2ZPF B;  2P0P A;  2QQ9 A;  4J6X A;  4FYV B;  1HYO A;  1YP5 A;  1UUE A;  2OX7 A;  1MND A;  1VQ7 Q;  3CCR A;  1NZ9 A;  3CC7 Q;  1KC8 U;  1ZHI A;  2DER A;  5I2M A;  4N0A C;  3ME9 A;  4FYX B;  1NYF A;  1W4S A;  1M2V A;  2VYT A;  3JCM d;  1JXM A;  3G6E T;  3QG1 A;  1HK9 A;  3PTA A;  3R6O A;  1IXD A;  1MGQ A;  4QVC A;  3LX7 A;  4FYW B;  4WCI A;  1PNJ A;  3CC2 A;  4MDX A;  4HCK A;  1RAG B;  3O5Z A;  4L59 A;  1U3O A;  3OYN A;  4XTW A;  4OB1 B;  2E5K A;  2OAW A;  4JUV A;  1QCN A;  2M02 A;  2ZPB B;  2NUT B;  3LYI A;  3VV0 A;  1Q7Y U;  1TUG B;  1KD1 C;  3M0P A;  3CC7 A;  1NLP C;  2IG0 A;  1XQH A;  4IUP A;  2DNU A;  2FVU A;  3MEW A;  3JB9 J;  5GMK l;  2JMC A;  3D7S B;  1X43 A;  1ARK A;  1YHQ Q;  2LQW A;  1OI1 A;  3S3N A;  1K9A A;  1YFN A;  4E7L A;  1C0M A;  2FYK A;  2YHT A;  1X69 A;  3REA B;  2DAQ A;  5GAM j;  1WJR A;  3RDV A;  3OMG A;  3LH0 A;  4M77 C;  1T0H A;  1WA7 A;  5CQX A;  4D6W A;  2V1R A;  3URG A;  3KXT A;  1HJD A;  5FU6 C;  1M1K U;  4FSX A;  3VUB A;  4FU6 A;  1R0B G;  4A54 A;  4JZ4 A;  1UHF A;  3CEY A;  4NS5 A;  4XU0 A;  3OW2 A;  2LX7 A;  2YRC A;  1MMA A;  2RPN A;  3M9Q A;  4A4G A;  5GAN j;  1WDX A;  2DIQ A;  5FU6 B;  1VQ7 T;  3H8Z A;  2K5I A;  3ZFJ A;  4M7A A;  2EJF A;  1JRI A;  2BIV A;  1BB9 A;  2EBP A;  1BKB A;  4C92 A;  3S3M A;  1VQ6 A;  1KSW A;  3M57 A;  3TSW A;  4HVW A;  4OGC A;  4JZ3 A;  1RAF B;  2F2X A;  1PSF A;  1GBR A;  2KRO A;  1S72 Q;  3KFV A;  5I21 A;  2A36 A;  2FPD A;  2J6O A;  4C8Q B;  3L2R A;  4PJM A;  3CPW A;  1Q7Y C;  5A0D A;  5KYU B;  4E7S A;  6AT1 B;  1VUB A;  4AFZ C;  5AYF A;  1YHQ A;  1K9M C;  3THK A;  2HQE A;  2J05 A;  1PC0 A;  2GF7 A;  3JRZ A;  1GFC A;  1Y7X A;  1D0Y A;  3BDL A;  5KCH A;  3EG3 A;  4A63 B;  1M3A A;  5GAN 5;  2M0Y A;  1PD0 A;  1LJO A;  3C12 A;  4ORZ A;  2PNI A;  1HXD A;  3FIF A;  4OB2 B;  3OYK A;  4Y91 A;  2PVD B;  1IRX A;  2PQW A;  2D0N A;  2RNA A;  1KQ2 A;  3EGX A;  2GTJ A;  4PFO A;  3F70 A;  2DET A;  2HZY A;  1H3Z A;  1IO6 A;  1I1J A;  3M0U A;  4JJC A;  1V29 B;  4XTY A;  5CQY A;  4F04 B;  1JJ2 S;  2KY9 A;  4II1 A;  2JW4 A;  4B9W A;  4DEY A;  2CUB A;  2O4X B;  2MF2 A;  4MML A;  1QW1 A;  1KC8 C;  3TCJ A;  1YJW T;  4J7F A;  1C1A A;  1OU9 A;  1SRL A;  2PZ1 A;  2LX9 A;  3HTR A;  4ELZ C;  1WHG A;  3P8H A;  1K76 A;  3R6N A;  3CME A;  1UFF A;  5DLO A;  3A98 A;  1WNL A;  2KVQ G;  4O6J A;  2AHJ B;  4BAC A;  1Q86 C;  2QXF A;  5L8R E;  3QDF A;  2XDD A;  2FHD A;  1KC8 R;  2EYW A;  5GAO q;  4BDZ A;  3UWN A;  4ZN3 A;  2OTJ A;  4PNO A;  4ANJ A;  1IHW A;  2IIM A;  2RN8 A;  1K9M U;  3O8V A;  4FT4 A;  1FMK A;  2VXF A;  1XJW B;  3CXC S;  1BIB A;  2P4R A;  5GMK i;  4C5E A;  3JB9 F;  4RTT A;  4NL3 A;  2JN0 A;  2L3R A;  3QZ9 B;  3JCM Q;  4RCB A;  4FL6 A;  1UG1 A;  3HKS A;  2YWW A;  4M7D D;  1X27 A;  3M0R A;  1BIA A;  4EMH A;  3I5R A;  3UT1 A;  4E7I A;  1VYU A;  1KK7 A;  3CCR Q;  2KNB B;  1ACM B;  1TWB A;  4OB3 B;  4BY6 C;  2OAU A;  4CC3 A;  3G71 Q;  5CK9 A;  2QAS A;  5M9O A;  3PMI A;  3CCR T;  2K4Y A;  1N8R U;  3MKD A;  4LDY A;  1R0C B;  5IT9 E;  1IRE B;  1G3S A;  2QGF B;  5IXF A;  2F1L A;  3A8L B;  1UB4 A;  1GXI E;  5C0M A;  2CP7 A;  3CC2 Q;  2R58 A;  3CXC A;  4CC4 B;  2HBW A;  3H0I A;  1VQL T;  4M77 A;  1WHM A;  3JB9 G;  1YIT Q;  4AFS C;  2DEU A;  4LE9 A;  3MHX A;  4J5Y A;  2JM8 A;  1Q81 U;  4M78 A;  1VQN T;  1U1T A;  3CD6 A;  4X1V A;  2HDA A;  4ZNX A;  1M3C A;  1O75 A;  2LDM A;  4E6R A;  4J7I A;  2DKG A;  2X9H A;  1VQ5 Q;  1JQQ A;  3RIR A;  5GAN 6;  2C0T A;  2DEQ A;  4LDX A;  2LJ1 A;  4HXJ A;  1D1C A;  1IZ6 A;  5D6W A;  3CPF A;  2VGM A;  1OPL A;  4E47 A;  3FJ5 A;  3CD6 T;  1G2B A;  4C92 E;  2L89 A;  4IUU A;  4N4G A;  1NPP A;  1OZ2 A;  5GMK m;  1SKU B;  4GY5 A;  4IKF A;  4C0D B;  1GRI A;  4KT0 E;  1QQJ A;  2CKK A;  3FDR A;  1QWE A;  4WF2 A;  1MMN A;  3UA7 A;  2WSF E;  1SSF A;  2F69 A;  2RO0 A;  4ZGD B;  5GAN e;  2V8K A;  2KYM A;  1VQ5 T;  3CCQ T;  4BUG A;  1X2K A;  2B86 A;  4HVV A;  1PKT A;  4M75 E;  3V8J A;  1H92 A;  1MNE A;  1AEY A;  1M30 A;  1VQM Q;  1ZSZ A;  1M2O A;  3RNJ A;  3QWX X;  4E2F B;  4AFQ C;  1RLQ C;  3GNG A;  1RAB B;  1KHC A;  3MEA A;  2A3L A;  2Y90 A;  4JLI A;  3J80 E;  1NG2 A;  3BFM A;  5LJ5 j;  2K5L A;  4XAX B;  4LNP A;  2O9S A;  3CBP A;  2AIR B;  4CI0 C;  4NL2 A;  1H64 1;  4PJO F;  3M59 A;  3H0H A;  1PCX A;  1I4K 1;  3NTK A;  3NPF A;  1RAD B;  1WIE A;  2E3H A;  3PIP A;  2DJZ A;  3CPW P;  2BE9 B;  3EGU A;  4HCB A;  2M0O A;  2RK2 A;  3OA6 A;  2RHI A;  3FLG A;  3J7A F;  4LD6 A;  1PKS A;  4RTV A;  3GOX A;  1D3B A;  1B07 A;  1M8V A;  3CCL A;  1ZBJ A;  4QVZ A;  4C5I A;  1RAI B;  1AHJ B;  2FZG B;  2JT4 A;  3C95 A;  1U06 A;  3M53 A;  4OML A;  4MZP A;  4C8Q D;  4C92 D;  4XK8 E;  4OP0 A;  5GAN 8;  2XG8 D;  1FMW A;  3V7S A;  1OZ3 A;  1VQN A;  2ROT A;  3SWN C;  4LD9 K;  2LJ0 A;  4JS5 A;  2KRN A;  5IXB A;  2FZK B;  4QKU A;  2CS7 A;  2YT6 A;  1T0J A;  1N9S A;  3ER0 A;  2K2V A;  1NJI U;  5FWB A;  4XTU A;  2H3J A;  5GJV B;  3CCV A;  1WZO A;  2RJE A;  1JJ2 A;  3RMQ A;  3MPU B;  3NGP A;  1QP3 A;  3QHS A;  1Q86 R;  2LNV A;  2KQW A;  1YJ9 Q;  2KT8 A;  4LUE A;  4C8Q C;  2OTL Q;  4HKE A;  1VQO T;  3M56 A;  2CT3 A;  4PJN A;  1WXU A;  2J7I A;  4M7D C;  3JB9 D; 
#chains in the Genus database with same CATH homology
 3OYA A;  4QQ6 A;  4RCC A;  5GAM e;  1VIE A;  2FVU A;  3MEW A;  3JB9 J;  2RK1 A;  5GMK l;  3P8B B;  5GAM f;  2K5F A;  2O01 E;  2JOY A;  3M5A A;  5LJ5 g;  3G71 T;  3M55 A;  3CC4 T;  4F7U B;  1RI0 A;  2VC8 A;  1YJ9 A;  1OI1 A;  3LWH A;  2EWN A;  4ZN1 A;  5DM7 R;  4JJN K;  3S3N A;  4E7L A;  2VGN A;  2FYK A;  4C5H A;  3E19 A;  2R5M A;  2YHT A;  5KCO A;  3CCQ A;  3GPL A;  2DAQ A;  2QQS A;  2V8I A;  4HCZ A;  4BY6 B;  5GAM j;  1WJR A;  4ZTJ A;  3PGG A;  1FWZ A;  3OMG A;  3LH0 A;  1YIT A;  4J83 A;  4M77 C;  4JLG A;  1LNX A;  1EIF A;  5CQX A;  3QYH B;  1WGS A;  4D6W A;  3I56 T;  3LGF A;  5CKH A;  3URG A;  1UGS B;  5KE3 A;  3KXT A;  4C92 B;  5FU6 C;  2CZ6 B;  1M1K U;  4M78 D;  3OBW A;  2HBP A;  2R57 A;  3L42 A;  4FSX A;  2EJ9 A;  3CCE T;  3VUB A;  3WVD B;  4FU6 A;  3I55 A;  4A54 A;  3OYC A;  4J6W A;  3I55 T;  2WAC A;  3EFS A;  3CEY A;  4L6V 5;  4NS5 A;  4XU0 A;  2RJD A;  4LDV A;  3CME T;  2LTO A;  1Q81 C;  3OW2 A;  1BI3 A;  4M78 F;  4PKC C;  1YIT T;  2E64 A;  2GFU A;  3VKI A;  3OYG A;  3M9Q A;  4A4G A;  2I2L A;  4R56 A;  5GAN j;  3CBO A;  3QDR B;  4EMK C;  1W2B S;  2XHC A;  2DIQ A;  1N27 A;  1G3W A;  5FU6 B;  4C92 C;  3H8Z A;  1VQ7 T;  2E41 A;  2QQB A;  4RG2 A;  1WQW A;  2K5I A;  3ZFJ A;  3QSU A;  3MP8 A;  4M7A A;  2EJF A;  4BI3 A;  1JRI A;  2BIV A;  2LVM A;  3H6Z A;  1BKB A;  2GCX A;  2QQA A;  5J26 A;  4C92 A;  3JCM W;  3S3M A;  1YJ9 T;  1VQ6 A;  3CC4 A;  3M57 A;  4M78 G;  4OGC A;  2OTL A;  2C06 A;  2MWO A;  3OYB A;  1M9S A;  2DXU A;  3QO3 A;  3S6W A;  5CIU A;  3A8O B;  1JJ2 A;  1PSF A;  3KBG A;  5GAN g;  3NFC A;  3V7C A;  1I5L A;  4V2S A;  1VQK A;  2VUB A;  1YIJ T;  2P4T A;  5I21 A;  2X4Y A;  4C8Q B;  2RD1 A;  3L2R A;  3CPW A;  1Q7Y C;  4MDW A;  5A0D A;  4ZTF A;  3A8H B;  2LQ8 A;  1Y96 A;  1VUB A;  3RKW A;  5AYF A;  1B34 A;  4LDW A;  4N0A A;  4DOW A;  1S72 A;  1KG1 A;  4XTX A;  2MMP A;  2DIG A;  3V7R A;  1YHQ A;  1K9M C;  1OYX A;  1VQO A;  3DB3 A;  3OS0 A;  2HQE A;  2EJG A;  2RA2 A;  1YIJ A;  2GF7 A;  4KUD K;  3RES A;  1G3Y A;  3JRZ A;  3OYI A;  5GAO n;  2LRQ A;  1N8R C;  2RB6 A;  1Y7X A;  4M7A E;  5LJ3 d;  3CCM A;  3BDL A;  5KCH A;  4JRQ A;  2KK4 A;  5GAN 5;  3OYD A;  1LJO A;  3C94 A;  2R5A A;  3C12 A;  5CKD A;  1HXD A;  5GAN d;  4BE0 A;  2QTX A;  3QPH A;  2X35 A;  4EDU A;  3L2Q A;  3FIF A;  4QW2 A;  3HRS A;  4OB2 B;  3X25 B;  3OYK A;  1YHQ T;  4Y91 A;  2PVD B;  2O4X A;  4F7U F;  2G3R A;  3SFM A;  4C8Q E;  1VQ7 A;  2DTO A;  2PQW A;  4FIB A;  4O5V A;  4QQD A;  3RMS A;  1VQ4 A;  1KQ2 A;  3OB9 A;  4PJO C;  1M90 U;  2VV5 A;  5DY9 A;  1YJN A;  3F70 A;  4PLL A;  4XTZ A;  3JCM b;  1H3Z A;  1Y07 A;  2GQV A;  2GFA A;  1KHI A;  2RH2 A;  1V29 B;  2DXC A;  1WJQ A;  2NLU A;  3A8M B;  1VQP A;  3QYG B;  4XTY A;  1M1K C;  1BYM A;  5CKB A;  5CQY A;  4XU3 A;  3FC3 A;  1LOJ A;  5CCA A;  2DXB A;  2E70 A;  1JJ2 S;  2DTI A;  5DLQ E;  5KE2 A;  2KY9 A;  4II1 A;  4IUV A;  5LJ3 j;  4M7A D;  4L5G A;  3GP8 A;  2V8J A;  3HRT A;  2OTL T;  4B9W A;  3OS5 A;  3CCS T;  3M58 A;  2O4X B;  2JVV A;  2D6F A;  2MF2 A;  2Y4X A;  1QW1 A;  2DVE A;  4MML A;  4IUR A;  2RHZ A;  1KC8 C;  3TCJ A;  4M75 F;  1YJW T;  3JCM P;  2E5Q A;  4J7F A;  5EG2 A;  1YCY A;  3JSC A;  3MEU A;  1VQ8 A;  4PJO E;  2LX9 A;  2DD4 A;  3G4S A;  3QJ6 A;  3EFR A;  4C0G A;  4CRI A;  4DA4 A;  2DXT A;  2KSS A;  2RM4 A;  3SB2 A;  2RHX A;  2CGH A;  2LT4 A;  3INZ A;  4ELZ C;  2JTM A;  3P8H A;  4M7A C;  3CME A;  4XU1 A;  3CCS A;  5DLO A;  3DLL A;  5J39 A;  1NPR A;  3OYH A;  2EIF A;  4NOY A;  1WNL A;  2KVQ G;  4M75 G;  4HT8 A;  2A7Y A;  4O6J A;  1Q82 C;  2VXE A;  3CCL T;  2AHJ B;  4BAC A;  4HCC A;  1Q86 C;  2QXF A;  5L8R E;  2EQJ A;  3MP1 A;  3JCM g;  2P0Q A;  2XDD A;  3E9F A;  4E7H A;  4M75 A;  2EKO A;  2PVO B;  2FHD A;  2K3X A;  4C8Q G;  2MAM A;  5GAO q;  4BI8 B;  4BDZ A;  3UWN A;  1NJI C;  5GAN h;  4ZN3 A;  1KD1 U;  2OTJ A;  1YJN T;  3WXM B;  1I8F A;  3GNF B;  4C5G A;  2CZ7 B;  4X34 A;  3CCJ A;  3LW5 E;  5IN1 A;  4PNO A;  3T9N A;  3M4G A;  2FB7 A;  5FRO A;  4M7D G;  5FU7 C;  5GAO m;  1K9M U;  3O8V A;  1VQM A;  1VQL A;  2ZZD A;  4FT4 A;  3QXE B;  4C92 F;  2VXF A;  2F5K A;  3SDZ A;  3CXC S;  1BIB A;  5LJ3 g;  3OMC A;  5GMK i;  3E1S A;  1TH7 A;  4C5E A;  1QVG A;  3QKJ A;  3BDU A;  3G71 A;  3JB9 F;  2D0Q B;  3X26 B;  5A2Q E;  5LJ5 h;  2EQM A;  4NL3 A;  2JN0 A;  3CC2 T;  3L2U A;  2CZ1 B;  2L3R A;  1PSE A;  2QI2 A;  3CMA A;  1W2B A;  3QZ9 B;  3V8L A;  2JNG A;  3JCM Q;  4RCB A;  4M78 B;  2PU9 B;  4FL6 A;  4J8O A;  4F7U G;  3HKS A;  3MCA B;  3UPU A;  4FT2 A;  5GAM d;  3OYF A;  4M7D D;  3HL8 A;  4C0F A;  1BIA A;  3PMT A;  3RKY A;  3CCV T;  3L1A A;  3DLM A;  5J3B A;  3QII A;  1ZBX A;  4EMH A;  3CC7 T;  1N6A A;  5LL6 S;  4M77 G;  3UT1 A;  3HP9 A;  3RUX A;  4E7I A;  5GAM h;  2QA4 A;  5D6X A;  1VQK T;  3TEE A;  3JCM X;  1VQ9 T;  3GLX A;  4C8Q F;  4Q5W A;  2PUK B;  3SWN B;  1VIF A;  1DJ7 B;  2CZ0 B;  4OB3 B;  1U8R A;  2K57 A;  4BY6 C;  4M7D A;  2OAU A;  4R55 A;  2JTF A;  3JCM h;  1M90 C;  1QVF A;  5CK9 A;  2F5T X;  2JUF A;  1UGQ B;  5M9O A;  4M77 B;  4BE1 A;  4E7J A;  2HAX A;  1N9R A;  4B9X A;  1MHN A;  2KDS A;  2DD5 A;  3MET A;  3PMI A;  2RHY A;  3VYG A;  2K4Y A;  4BD3 A;  4LDY A;  4C8Q A;  3CCR T;  1N8R U;  1XOV A;  5IT9 E;  4EPC A;  4PJO D;  1IRE B;  1G3S A;  3JCM f;  4TVR A;  5FLX E;  3AHU A;  2DZC A;  2DPP B;  3FJP A;  4N4H A;  2LT1 A;  2XDB A;  5LJ5 e;  2E12 A;  4IUT A;  3A8L B;  1UB4 A;  3C4S A;  3PT9 A;  1GXI E;  5C0M A;  3QJY A;  4JDS A;  3JAM E;  3M4Y A;  4C92 G;  3CCM T;  2QQR A;  4PJO A;  2R58 A;  3CXC A;  4ZGE B;  1VQL T;  5GAN 4;  1K8A C;  4M77 A;  5GAM g;  3CCU A;  1M1F A;  4M77 D;  3JB9 G;  4C0Z A;  4M78 C;  2QEX A;  5LJ5 f;  3JCM J;  2ZPI B;  4A53 A;  3EAE A;  4RMO A;  3LWI A;  2X4X A;  5LJ3 f;  3MHX A;  3OQ5 A;  4MMK A;  3ZBD A;  3PNW C;  4J5Y A;  4A4H A;  3OY9 A;  1Q86 U;  5FRN A;  3N5B B;  1Q81 U;  4M78 A;  5CVI A;  1XNI A;  2OTJ T;  1VQN T;  4OVA A;  3CMA T;  2BKD N;  1U1T A;  2IVW A;  3E9G A;  3NTI A;  4XQ3 A;  5CO7 A;  1YI2 T;  2K3Y A;  3CD6 A;  2XIC A;  2XU8 A;  2DTH A;  4BE2 A;  2LDM A;  1O75 A;  1Y96 B;  1KQS A;  1UEB A;  4F7U A;  1XTD A;  2RJF A;  4J7I A;  2DKG A;  4PL6 A;  3UDC A;  3VJP A;  3RIR A;  1WPY A;  3LLR A;  2DEQ A;  3DB4 A;  5GAN 6;  4LDX A;  3L2Z A;  3FEO A;  3HPW A;  4JRI A;  1JBM A;  1IZ6 A;  5D6W A;  4HA8 A;  3BY7 A;  3CPF A;  5HKC A;  2VGM A;  4E47 A;  4PLI A;  3G7Z A;  3CD6 T;  2M1H A;  4C92 E;  4ZGJ B;  4LDU A;  2L89 A;  2XKO C;  4IUU A;  4A4F A;  3CCJ T;  3JB9 I;  1YI2 A;  3HFO A;  4M7D E;  4N4G A;  5FU7 B;  3L2W A;  4M75 B;  3OSS C;  1NPP A;  1OZ2 A;  3OS1 A;  4MZT A;  5GMK m;  3JCM c;  4GY5 A;  4DOV A;  4IKF A;  2QEX T;  2YLC A;  3OBY A;  4C0D B;  4PJO G;  1X6O A;  1P92 A;  2L5Q A;  5D6Y A;  2RI2 A;  3CCE A;  1UGP B;  4BI4 A;  4EMK A;  2RJC A;  3MP6 A;  5GAN f;  4KT0 E;  5CKE A;  2CKK A;  1VQP T;  2P0K A;  3OYY A;  2X4J A;  3FDR A;  2JZ2 A;  3I56 A;  5CR2 A;  2E65 A;  2XD0 A;  4WF2 A;  2YRV A;  3G4S T;  2WSF E;  1VQ8 T;  2WSE E;  1SSF A;  1WQ7 A;  2F69 A;  1K73 C;  2RO0 A;  3HRU A;  4ZGD B;  2E1H A;  5GAO l;  4KBM B;  4QQG A;  5A0L A;  5GAN e;  1KQ1 A;  1WJS A;  2V8K A;  3X24 B;  5GAN 3;  3OYM A;  3OYL A;  2ZGW A;  1VQ5 T;  3CCQ T;  4OB0 B;  4BDY A;  2ZPG B;  4E7K A;  4RG8 A;  4BUG A;  5LJ3 e;  3PFS A;  3QUI A;  3SWN A;  4M7D B;  2ZCF B;  5GAN 7;  2LC4 A;  2MI6 A;  2RI3 A;  1M1G A;  4M75 E;  5C6S A;  3M54 A;  3V8J A;  2D9T A;  4P5N A;  3RKX A;  4C0D C;  4EMG A;  5FRM A;  2MWP A;  1YBY A;  3VU3 C;  2QA4 T;  3OW2 S;  3GF5 A;  1KQS S;  2LCC A;  3A8G B;  4EMK B;  2EFI A;  4M75 C;  2XI9 A;  1VQ9 A;  3GNG A;  1VQ4 T;  4M7D C;  5CKF A;  3ASK A;  3Q1J A;  4OGE A;  1KHC A;  2X4W A;  3MEA A;  3OSV A;  4Z02 A;  4J6Y A;  2A3L A;  3J81 E;  4GLK A;  1K8A U;  2WSC E;  2B8A A;  3DKM A;  3JB9 H;  1BI0 A;  1M5Q 1;  2EQK A;  2Y90 A;  4JLI A;  4XTV A;  3J80 E;  3CPW S;  4M7A B;  3RER A;  4BB7 A;  2EYQ A;  3BFM A;  5LJ5 j;  2K5L A;  2E6N A;  4XAX B;  3CBP A;  5GMK e;  1D3B B;  4ME7 A;  3CBM A;  3X28 B;  4CI0 C;  4NL2 A;  1BI2 A;  1H64 1;  2XID A;  4PJO F;  3M59 A;  5KH6 A;  2RHU A;  2KAF A;  1NE8 A;  1VQM T;  3LGL A;  1I4K 1;  3NTK A;  4QVD A;  5HK3 A;  2DO3 A;  4M77 E;  2PVG B;  4ATO A;  2LCL A;  1U1S A;  4HT9 A;  3NTH A;  1B34 B;  3JCM V;  3PIP A;  5GAN 2;  3SD4 A;  4A4K A;  2DJZ A;  5HK0 A;  1RL2 A;  1ZQ1 A;  2EQU A;  1Y71 A;  5GAO p;  4M7A F;  4DQ2 A;  4HCB A;  2L8D A;  3HSB A;  2M0O A;  2RK2 A;  3MEV A;  3OYE A;  1UGR B;  2M9U A;  3OA6 A;  1FXX A;  2RHI A;  1M4Z A;  3FLG A;  3TU4 K;  1QVF S;  3J7A F;  4KUL A;  4LD6 A;  4M7D F;  5IAY A;  1VQ6 T;  3TRE A;  2HQX A;  3GOX A;  2FL7 A;  1D3B A;  4JS4 A;  2EAY A;  4JRP A;  3KUF A;  5GAO r;  1BI1 A;  3JCM e;  4X9D A;  1VQ5 A;  3CCL A;  1M8V A;  4QVZ A;  4C5I A;  2QDY B;  1AHJ B;  3QZ5 B;  1JB0 E;  3C95 A;  3V8K A;  5A0G A;  2HNI A;  5I2S A;  3M53 A;  4N4I A;  4MZP A;  5HY6 A;  4C8Q D;  3VUZ A;  4C92 D;  5LJ5 d;  2XDP A;  4XK8 E;  2Y4Y A;  4OP0 A;  5GAN 8;  2XG8 D;  2ZPF B;  4XU2 A;  2P0P A;  2QQ9 A;  3PIO A;  4J6X A;  3V7S A;  3S3O A;  3OYJ A;  1OZ3 A;  1VQN A;  2E6Z A;  1YJW A;  1QVG S;  4M77 F;  2XK0 A;  1X75 C;  4M75 D;  3P8D A;  3SWN C;  4LD9 K;  3CCR A;  1NZ9 A;  3X20 B;  4JS5 A;  1KC8 U;  1X01 A;  2KMT A;  1ZHI A;  3HFN A;  3FRN A;  1G3T A;  4M78 E;  5I2M A;  4N0A C;  5GMK j;  3ME9 A;  5CAI A;  5GMK h;  4ELY C;  1W4S A;  3CCU T;  1R8O B;  2DZ9 A;  2CS7 A;  2VYT A;  1O9S A;  3JCM d;  1N9S A;  2RI5 A;  3ER0 A;  2K2V A;  4OMF B;  3G6E T;  3QG1 A;  1NJI U;  3GIB A;  1HK9 A;  2ZPH B;  3WVE B;  3PTA A;  4XTU A;  2H3J A;  3R6O A;  3CCV A;  4VUB A;  1QP2 A;  2CYZ B;  2RJE A;  1MGQ A;  3BW1 A;  3HHT B;  3A5Z B;  3QBY A;  4MZM A;  4QVC A;  4IUQ A;  1Q82 U;  3RMQ A;  3LX7 A;  4M7A G;  1FX7 A;  1QP3 A;  2DK3 A;  1K73 U;  3VYH B;  3L2V A;  4PJO B;  1I81 A;  3QHS A;  4FM4 B;  3CC2 A;  4MDX A;  2E10 A;  2LNV A;  3FB9 A;  4JRK A;  4Y28 E;  4F7U E;  4L59 A;  2HD0 A;  3OYN A;  2YLB A;  4A4E A;  2KQW A;  3ZEH A;  3MO8 A;  4YTL A;  4XTW A;  2ZPE B;  4KUI A;  4OB1 B;  3OS2 A;  4JUV A;  5LJ3 h;  4C8Q C;  4X9C A;  4RKU E;  2PUO B;  2M16 A;  2ZPB B;  3LYI A;  4HKE A;  3VV0 A;  1Q7Y U;  1KD1 C;  2LQK A;  2BUD A;  1QVP A;  1VQO T;  3CC7 A;  4UC4 A;  3M56 A;  2IG0 A;  1G5V A;  1XQH A;  3G6E A;  4OF1 A;  1S72 T;  3JB9 D;  4IUP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...