4M77A

Crystal structure of lsm2-8 complex, space group i212121
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
100
structure length
83
Chain Sequence
b'TLKDYLNKRVVIILVDGESLIASLNGFDKNTNLFLTNVFNRISKEFISKAQLLRGSEIALVGLIDAENDDSLIENEHVIWEKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
total genus 13
structure length 83
sequence length 100
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m77A00
3RKYA 3M4GA 4PJOC 3JCMd 1B34B 4M75C 4EMHA 3BY7A 4C92C 2CGHA 2EWNA 4JRKA 4M77C 4PJOF 3RUXA 5LJ3j 1D3BB 4HA8A 4XU2A 5GAMd 4EMKB 4PJOB 4M7AG 4M75D 4XTUA 3JCMc 4M78E 4C92D 1I4K1 5GAMe 4XU1A 5GAN6 4M77D 1U1SA 2EJ9A 4N0AC 4J6WA 5GMKh 4Y91A 1TH7A 2RM4A 5DY9A 2I2LA 2VC8A 4F7UE 4XTVA 2EJFA 3EFRA 4WF2A 1M5Q1 3SWNB 4A53A 5GMKe 5LJ5h 2VXFA 1LOJA 5GANh 5GAOr 3FB9A 3BFMA 4PNOA 4QVDA 2DZ9A 2HNIA 4M78C 4RCCA 1BIAA 4M78A 3JCMh 2DTOA 4PJOG 2YLCA 5GANe 5GAN2 4M7AE 5GAOp 4M7DB 1JRIA 1I8FA 3V7CA 5GAN7 4C8QB 1X01A 4M78D 4MMLA 5GAN5 3SB2A 5GAN4 4QVCA 5GAOm 5I21A 5GAMh 1KQ2A 4JLIA 3V7RA 3JCMe 4M7DE 4M75A 4C92A 4M77A 3JB9J 1WQ7A 5LJ5f 4C8QE 1WQWA 5LJ3h 1WNLA 3JCMJ 4JUVA 4XTYA 1N9SA 2QTXA 2E41A 5GAOl 4M7AC 4MMKA 4N0AA 3FIFA 4JRIA 3JB9G 5LJ3d 4M7AA 4M7DG 4PJOE 5LJ3e 2ZGWA 4M7AD 4J6YA 2YHTA 4C8QG 4M7DC 1I5LA 1H641 1U1TA 2E64A 1I81A 3INZA 1WPYA 2E1HA 2EAYA 4C8QC 3RERA 1LNXA 2RD1A 2DKGA 5LJ5g 2Y90A 5GANg 5GAOq 4XQ3A 2DXTA 4M75F 4EMKC 4HT9A 3RESA 2DXUA 4C92F 3L1AA 4F7UA 4M77F 4PJOA 4J5YA 4M75B 2DJZA 3FJPA 2E10A 3PGGA 3JCMg 3V8JA 4C92B 4M77B 3JCMQ 3JCMW 1HXDA 4PJOD 3QUIA 4X9CA 5CAIA 5LJ5j 4XTWA 5GAMg 5GANf 1JBMA 3BDUA 4HT8A 4OP0A 3SWNC 2FYKA 2EJGA 3JCMV 4J6XA 3JCMf 2RB6A 1HK9A 2DZCA 1N9RA 3AHUA 3QHSA 4XTXA 1Y96A 3HFNA 4RCBA 3V8LA 5GAMf 3QO3A 4M7DA 2RA2A 4M78F 4M75G 3V7SA 3RIRA 4C92G 4EMGA 3JB9H 3L2ZA 2DTIA 1MGQA 4M77G 4M78B 4C8QA 4NL3A 3JB9D 4M7DD 1BIBA 2VXEA 4NOYA 5GAN3 4F7UF 2DEQA 1B34A 3HFOA 5LJ3f 3VU3C 4C8QD 4V2SA 3RKXA 4F7UB 5GMKj 1YCYA 1D3BA 3JCMP 3QSUA 4EMKA 1LJOA 2FB7A 3JCMb 2K57A 4X9DA 4A54A 2DVEA 2YLBA 3HSBA 5GMKm 2JN0A 5GANj 4NL2A 3V8KA 1KQ1A 4M7AF 5GAN8 4M75E 3BW1A 4M7AB 4C92E 3SWNA 4DQ2A 4M77E 4M78G 3EFSA 4XTZA 3JCMX 5LJ3g 3JB9F 1Y96B 2E65A 5GMKi 3RKWA 3GIBA 5LJ5d 4M7DF 5GAOn 5GANd 4F7UG 5LJ5e 5GMKl 5GAMj 4C8QF 2DTHA 4XU0A 1M8VA 3JB9I 4XU3A
chains in the Genus database with same CATH superfamily
3QIIA 5D7UA 3CMET 1VQMT 2E3IA 3JCMd 1M9SA 3MEAA 1VQOQ 5D6XA 1PD0A 3QYGB 4ZNXA 3CCRT 2F2VA 1BU1A 4FW2A 2D8JA 4M78E 3ZL7C 1Q81C 1BI1A 3CC2A 2XG8D 4N0AC 4E7SA 5GMKh 4E7JA 5GJWB 2K7AA 4AMCA 1Z9QA 4DOVA 5AT1B 2GF7A 4KUDK 1KQSS 1BCMA 1K0SA 5GANe 1YJNA 4RKUE 2DD5A 5AYFA 2HQXA 2RHZA 3CC4Q 5FLXE 1ZLMA 2MAMA 4FCYA 4C8QE 1WQWA 4E7HA 1KC8C 3TSZA 2DERA 3G4ST 2VASA 1GFCA 1ZSZB 2V1RA 3H6ZA 4M7AA 2F69A 2AIRB 4M7DG 2QASA 2VV5A 4RG2A 2YHTA 2RPNA 3PE0A 5KYYA 4D8DA 4FYWB 2EYZA 1I81A 1PD1A 4FYYB 2J6FA 2DYBA 2Y90A 3ZBDA 4PJNA 1UGPB 2KY9A 2WSEE 4M75B 2EYXA 3JB9J 4J9IA 3NTHA 4E6RA 1N5ZA 1M3CA 1G83A 2O9VA 4BUGA 5GANf 4QKUA 4BD3A 1JJ2A 2AZVA 2DMOA 2EJGA 3MHXA 2E70A 1V1CA 2YXYA 4Q5WA 5I22A 1HJDA 1ZBJA 5EG2A 1IREB 1Q82R 1EFNA 4RUGA 5L23A 3CPWP 1BIBA 1PKSA 1YWOA 1OPKA 2XIDA 1C6VX 5I11A 1WI7A 2W10A 4HCKA 1AWOA 1C1AA 4LDYA 2LJ0A 1BI2A 2M0YA 4FW1A 1TU0B 2J7IA 2X4XA 3LGLA 3VRYA 5A0GA 1RAHB 4RMOA 1MNDA 3JCMc 5GAN6 1BI3A 2R5MA 1QP2A 3OSSC 5LL6S 1D09B 4WF2A 1G5VA 2L89A 1VQOT 2PVGB 2RO0A 3P8HA 5CIUA 3NTKA 4LE9A 4PLIA 4RCCA 5FROA 4OGEA 3M53A 2YLCA 4BDZA 2XHCA 5I2MA 3CCMT 3MEUA 2GNCA 3I5RA 1NBEB 5IAYA 3JV3A 4RTTA 1M3BA 1FX7A 1WZOA 2H3JA 2OTLQ 2PNIA 1XTDA 4OB0B 2E41A 4M7AC 1M8MA 3FIFA 4J9BA 2YSQA 3M54A 1N27A 3CC4T 5DLOA 1KHIA 2QGFB 1H641 3UDCA 1K1ZA 3TVTA 2W0ZA 2MOXA 5KCHA 3HRTA 2CSIA 3CBOA 4LUDA 1QVFP 2DXUA 4J5YA 4J7IA 5J26A 1BYMA 4C92B 4X9CA 2QDYB 3OW2S 4HT8A 2M1HA 2HQEA 3SWNC 1SKUB 1QCNA 2ROLA 3CCEQ 3CCLT 2HSEB 3I55A 2ECZA 2QG9B 2IPOB 2QQSA 3G6EA 1GCPA 5IHIA 1HYOA 2DZCA 2QQAA 4J9DA 1LVKA 1GXIE 4L6V5 3HKSA 2RQRA 4FSSA 5IN1A 1HD3A 3RIRA 2V26A 4ZGJB 3OYMA 1IXDA 3VRZA 4J8OA 1AEYA 1H3ZA 2P84A 2LTOA 4HCCA 1YCSB 1KQSP 1SRLA 2AT1B 1YJ9A 3OMGA 3CCQA 4BI3A 1YITQ 1MV3A 4PJLA 3TSWA 3MP1A 1D1AA 5CQYA 3REAB 1KC8U 2KK4A 5A0DA 1I1JA 4ESRA 2EFIA 2HSPA 2A37A 4M75D 1VQ9Q 1VYTA 1M5Q1 2B86A 4TVRA 2LT4A 2FG0A 3WVDB 1AWWA 5FWCA 1TUCA 1VYVA 2LQKA 3V7CA 3OYDA 4JLIA 2Y4XA 5CKEA 3VS5A 3EHRA 2DD4A 1WYXA 3OYAA 5LJ3h 2DYIA 4EPCA 2HKNA 4LD6A 1PHTA 4JZ3A 4LDXA 4M7DC 2OTLT 4ZTFA 2RF0A 1AHJB 3I35A 5KYXB 2PQWA 1UEBA 3RMSA 5IH2A 4JJNK 2LCSA 4M77B 1VQNQ 5LJ5j 1VQPQ 1QKWA 3BDUA 3VS3A 4ZTJA 5IT9E 2CSQA 4CC2A 1EZZB 3AHUA 3J7AF 1AD5A 1VOMA 5GAMf 2D8HA 4EMGA 3CCET 4JJDA 2LJ3A 3H9NA 4F04B 2ED0A 5GMKj 3VKIA 2DJQA 5A2QE 1U06A 4EMKA 2C0IA 5CKFA 3OYKA 3M0TA 2XDBA 1ZSZA 2DILA 4DQ2A 3G71Q 2E65A 4IUVA 1K76A 1K8AR 3OS1A 1Q7YC 1UGVA 2E5QA 4XU3A 1H3HA 1NJIC 2PUKB 4GLMA 4MZMA 1YHQA 4BI8B 2L5QA 3SHWA 2HD0A 1YITT 4PFOA 2OJ2A 2RNAA 3LWIA 2QQ9A 4C92D 3SEMA 1QWFA 2CZ1B 3X24B 4XTVA 1M4ZA 4J7FA 2KYBA 1FMWA 4BI4A 3FJ5A 1VQ9T 1ZUKA 2JTFA 4PJOG 5GAN2 1GFDA 5GAOp 3OW2P 2FO0A 3LX7A 4IUTA 4MDXA 2DRKA 3JCMe 4JS5A 2V1QA 2MCNA 4IKFA 3I5SA 1ZBXA 1ZA2B 1VQKQ 1VQ6T 1AWXA 1GRIA 4PJOE 2J6KA 1QLYA 2ZPFB 2HDAA 1WJQA 1RAGB 1ABQA 1MV0B 1SEMA 4DEYA 1VQ4A 4ZGEB 3OA6A 2AKLA 1QKXA 1TUDA 3CC7A 1IGQA 1H92A 3A8HB 3TCJA 4WTOB 2BZXA 2QXFA 4BDYA 4RG8A 3JCMf 1Y96A 4LDVA 5CK9A 4RCBA 2RQWA 1VQPT 1JEGA 3P8DA 2A3LA 2L8DA 4M78B 3JB9D 1M90C 1I5OB 1D3BA 3ASKA 1FMVA 1W70A 3PT9A 1ZSZC 1YI2T 2DVEA 3LLRA 2JN0A 1X27A 3E9FA 1YBYA 3R6NA 2KYMA 1JU5C 2KMTA 1F1BB 2M9UA 2RHIA 5GAOn 3CMAA 2KSSA 3LWHA 1PWTA 3C0CA 1UGQB 1SSFA 4N4IA 2CP2A 2K2VA 2VYTA 1SSHA 4Z02A 4M75C 4EMHA 1M2OA 4MZTA 3VS6A 2EWNA 3G71T 4IIMA 1B7TA 3TU4K 1OZ2A 2OX7A 2R58A 2HL5C 2LQ8A 2RJFA 4M77D 4A4EA 1K9MC 4IIOA 5DY9A 3L2UA 3CCUA 1WJRA 2XK0A 3CMEQ 1B3QA 5CQXA 1VQMQ 2VXFA 3DLMA 2DAQA 2RI2A 3CCRQ 1VQLQ 1YNZA 2J06A 3QJYA 2GFUA 1M1KC 4M7DB 4DBFA 1I8FA 2KXCA 2O31A 3SB2A 2AK5A 2BZ8A 3CEYA 2RMOA 1M1FA 4AFQC 3HL8A 2KGTA 3UT1A 3GBQA 4MMKA 4N0AA 5KYUB 5CKHA 4ZN1A 2EPDA 4KUIA 3EHQA 3LYIA 5HK0A 2E1HA 3GP8A 2CT3A 1RABB 1UDLA 3OYIA 1VQKT 2GQIA 5HCKA 1GCQC 5FWBA 4KRTA 4A63B 1NLOC 5I2SA 1HXDA 2A08A 1Q7YU 3AT1B 3OMCA 1NJIU 3VYGA 3MCAB 1AWJA 1VQ5A 2PZ1A 4E7IA 2PVOB 2RHXA 1Y07A 3OYLA 3M0RA 3M55A 3L2ZA 2DTIA 4NL3A 2VGMA 2GFAA 1RLQC 3X25B 2JM8A 2DK3A 3CCVQ 4PJMA 2JM9A 3CCJA 2QTVA 1WX6A 2EQUA 5KYNA 4JJCA 3D7SB 1QP3A 3JB9F 2IIMA 3OSVA 2RJEA 1SHGA 2QI2A 1E7OA 4ORZA 3UPUA 1D1BA 2EQJA 4QT7A 2EGAA 4C92C 5LJ3j 2ZPEB 2CKKA 1X75C 3EFOA 3UWNA 3VUBA 5D6WA 1WGSA 2CUDA 4OB3B 4A4FA 2WACA 5LJ5h 1LOJA 5GANh 1TS9A 2VKNA 3QG1A 2MPXC 3L2VA 2NUPA 4Y28E 2JUFA 1IO6A 4M78D 3JB9I 4QVCA 2YRVA 2NUTA 1G3WA 1VQLT 2QAZA 1TSFA 4RTZA 4Y92A 1M90U 3CCMQ 1RAEB 2HAXA 4C8QG 1D0XA 1I5LA 3QKJA 2E64A 3IQLA 2YRDA 5IXBA 2DXTA 4F7UA 1S1NA 4KH0B 3OY9A 2RHUA 1BKBA 2LX7A 2QEXQ 2M16A 1CKAA 2X3XD 4R55A 1HK9A 3MJXA 3A8LB 3M5AA 3X26B 3Q1JA 3TEEA 1K9MU 1K73R 2QA4T 4DEXA 4M7DD 2ED1A 2FPFA 2DETA 4F7UF 2FPEA 3CCLQ 4V2SA 2DE0X 1R8OB 1RAIB 4LUEA 4KGZB 1BI0A 3JCMb 2WSFE 3G7ZA 5GMKm 1M1KU 4M7AF 1NPPA 1T3LA 3SWNA 2EQIA 2FZKB 2FVUA 2KQWA 3CCVT 4GY5A 4AFUC 1M2VA 4JJBA 1NPRA 2K5IA 1QQJA 2RQUA 1OV3A 4M77C 3QDFA 1YJNQ 1Z9ZA 2CZ6B 2IG0A 3EG0A 2J6OA 2A28A 1K9AA 3WVEB 2EJFA 2E6NA 3OYJA 2QYZA 3LH0A 1XQHA 3E19A 5ECAA 2M0OA 4M78A 2DIGA 1WXBA 3CD6A 5GAN4 3X20B 2OTLA 1QVPA 1JJ2S 2ABLA 3OBWA 4IUPA 4BE1A 1KD1C 2FHDA 2FZCB 1UUEA 4JUVA 4AFZC 4X1VA 6AT1B 1D0ZA 2XDDA 2OAWA 4WCIA 5M9OA 3U23A 1VQ7T 1UG1A 1U1TA 1NEGA 1Q86C 3CCSA 2RD1A 5LJ5g 3A1PA 3OYNA 5GANg 2J05A 3MPUB 1B07A 3RESA 3M0PA 1RI0A 1Q81R 2ZCFB 3L2RA 3EH2A 3QUIA 2EW3A 1W4SA 1OU8A 4XTWA 4E2FB 3I56T 2O01E 2R5AA 3L2QA 3JCMV 1UJYA 3PMTA 3KFVA 4II1A 4M7DA 4BY6C 2VUBA 3MP8A 1G3TA 4DBRA 2QEXT 1MHNA 1KG1A 2CREA 3RKXA 3SD4A 4ZGDB 2V8KA 1AT1B 2VVKA 4DBQA 2Y4YA 1ZQ1A 2P0QA 1KC8R 4X9DA 1X6BA 1C0MA 1YITA 4E7ZA 5KYUA 1PKTA 2DL3A 4J9HA 1X69A 5FU6B 4RTXA 2RK2A 4M7DF 1R77A 2DTHA 1M8VA 2D9TA 4N4HA 2OTJA 2F2WA 2GGRA 4PJOB 1TUGB 3MP6A 2ESWA 3RDVA 1WDXA 2I2LA 2YT6A 4QVZA 2ATCB 4A53A 1N8RC 4A4GA 1YJNT 2RK1A 3A8MB 3FC3A 2OI3A 4M78C 1ARKA 1BIAA 1VIFA 4PFPA 1D1CA 1JO8A 1ZX6A 4ATOA 4AG2C 5I21A 5GAMh 2JMAA 1QMCA 3E9GA 5FU7B 4Z89A 3EGXB 2DBKA 4KT0E 4BE0A 2A7YA 2R57A 1YIJA 4OB1B 5IXFA 2XDPA 2CH4A 5L8RE 3BDLA 3I55Q 4C8QC 3RERA 1LNXA 4HVVA 2X35A 2XI9A 3ZEHA 1RUWA 5DM7R 4LNPA 2LCCA 1VQNA 4N4GA 1VQPA 1M27C 2ROTA 1OX9A 3SDZA 1VQ6Q 1R0CB 4HT9A 4PLLA 3L1AA 2O2OA 2CP0A 1DJ7B 3JCMW 2X9HA 3I9QA 1JBMA 2FYKA 1JQQA 5FW9A 3NMZC 3MKDA 2ENMA 3CPFA 2K6DA 1QW1A 2X4YA 4J9CA 1G3YA 2GBQA 3CCQQ 3V7SA 1XOVA 3RNJA 1A0NB 2XICA 4NOYA 1FYNA 3VU3C 1W6XA 2RHYA 1RADB 4EDUA 5KYWB 1V76A 3HRUA 2NWMA 4A4HA 2JOYA 5GANj 2RI5A 2HBWA 1QCFA 9ATCB 1JJ2P 1ABOA 3KXTA 1KD1U 1U3OA 5HY6A 5GMKl 2MWPA 1M1GA 1RLPC 2DL7A 2BIVA 1YI2Q 2PTKA 1B34B 1OPLA 2I0NA 2E4HA 1ACMB 4EIKA 4NS5A 2XMFA 1OYXA 1Q86U 2RM4A 2VC8A 2C0OA 3VS4A 3A98A 1MMNA 1SG5A 1EX4A 3H41A 2HQHA 2VB6A 3JCMh 2DTOA 1ZUUA 2L3SA 3PTAA 2V8JA 4OVAA 3PIOA 4M75A 5HKCA 3M58A 4M4ZA 4XTYA 2KAFA 1NEBA 1PNJA 1PC0A 2LDMA 2WSCE 1MMGA 2CP5A 1BK2A 2A36A 3CBMA 2EIFA 3BE3A 1MUZA 5D6YA 4LD9K 3R6OA 4BY6B 2K5LA 4D6WA 2BKDN 4M75F 2DVJA 4IURA 4X34A 1VQ8Q 3I55T 4PJOD 3G6ET 2M51A 1KK7A 5GAMg 2MI6A 2PU9B 2RB6A 4OMMA 2LVMA 4A4KA 3HFNA 3DLLA 2NYSA 3V8LA 3QO3A 3META 2KVQG 1S72Q 1OQKA 4OB2B 3JB9H 1YWPA 3HFOA 1X43A 2KBTA 1N8RU 3JCMP 4PJJA 1PRLC 1GCQA 2F5KA 8ATCB 1YHQQ 3CCQT 5DLQE 4RTVA 4GBQA 3FLGA 4FT4A 3L2WA 2BUDA 4XTZA 3EAEA 1NLPC 5LJ3g 3JRZA 5GMKi 4YTLA 2YUPA 2DF6A 4K11A 4RTWA 1GBQA 1PSFA 3GNGA 4QW2A 3RUXA 1GBRA 2L3QA 2RJCA 1NE8A 4HCBA 3CMEA 1VQMA 2DPPB 1U1SA 1GL5A 1SF9A 1TH7A 3FEOA 4DOWA 3CCRA 4ELZC 1FMKA 1OEBA 4PNOA 2KROA 3REBB 2EBPA 3H8ZA 1AZGB 4J9GA 4QQ6A 4ZN3A 5GAOm 4OMQA 1X01A 4C8QB 4C0FA 2JTMA 4F17A 4C92A 4B9WA 1WQ7A 3CC7Q 3QDRB 3OB9A 4LN2A 2KNBB 2GQVA 2KT8A 2Z0WA 2JVVA 3G4SA 2EYYA 4B6MA 5CVIA 2XD0A 2HCKA 3INZA 1Q7YR 2F1LA 1T0HA 2HKQB 1WXUA 1NJIR 1RI9A 2DKGA 3EG1A 1OOTA 4XQ3A 5J39A 2ZPHB 4C92F 2JMCA 4PJOA 3JCMg 3S3OA 4CRIA 1UGSB 4RTUA 3QPHA 2GCXA 4J6XA 1T0JA 2JJ9A 4AT1B 1N9RA 1K0XA 4E7LA 3EG9B 5GJVB 5HK3A 1VQ8T 3H0IA 2CYZB 1J3TA 3GNFB 3LGFA 1MGQA 2JW4A 3ER0A 3OYBA 3GPLA 1XJWB 3L42A 2LC4A 4OGCA 4C5HA 2CS7A 1S72T 2K57A 2QA4Q 1MNEA 4F16A 4J83A 4LXCA 1YHQT 4F7UG 5GAMj 1T3SA 3M0QA 4OF1A 3BY7A 2MF2A 1IRXA 1V29B 2BTTA 4HA8A 1MMDA 2CZ7B 4M7AG 1I4K1 5C0MA 2DL8A 2CT4A 2O4XB 4F7UE 2JS0A 4KGVB 1W2BA 1UJ0A 2QQBA 2GTJA 1RAAB 2L2PA 1M3AA 3FB9A 3QZ9B 2A0FB 1M90R 2F2XA 4JPBW 4C0ZA 1VQOA 4UC4A 4M7AE 3VS2A 5KYXA 1Q82C 1KQ2A 2H8HA 2K9GA 3V7RA 5KYWA 2X4WA 4M77A 3CCMA 2JXBA 1WNLA 2EGEA 2QTXA 4QQGA 5FU6C 4RTYA 2HBPA 2DXCA 2ZGWA 1WXTA 1KJWA 1IHWA 1EIFA 3HP9A 2PUOB 1IZ6A 2EAYA 3KUFA 3CC4A 3CC7T 4HKEA 5KH6A 1UFFA 5GAOq 1UB4A 1OULA 4PJOC 1W2BS 3X28B 4M77F 1IHVA 3FJPA 3JSCA 1K9MR 3C95A 1IGUA 1VQ7Q 2DO3A 3NGPA 3HHTB 4OP0A 2PVDB 3CCJQ 2K3YA 3OQ5A 3HTRA 2AZSA 2L3RA 1VA7A 4JRPA 2FRYA 1P92A 3CCLA 1M1KR 3QYHB 1WHMA 2RA2A 4OMFB 2LZ6B 3I56Q 1WFWA 4C8QD 5FU7C 1QVGA 3QWXX 2JZ2A 1UHCA 2ZPBB 5FRNA 1CKBA 4NL2A 3CMAT 2HMAA 3EGDB 4BE2A 1ZSGA 2COWA 5C6SA 3GIBA 1U5SA 2HL3A 5LJ5e 2B8AA 3S3MA 3RKYA 3QJ6A 4ME7A 1YJWQ 2RH2A 1JXOA 1KIKA 4EMKB 3CCUT 4FYXB 1UGRB 3DKMA 7AT1B 5GMKe 2O88A 3CC2Q 3O8VA 1WHHA 1QVGS 3M9QA 2EYWA 4QQDA 2DEUA 3RR6A 4C5EA 1JRIA 4M7DE 1FWZA 4XK8E 2K79A 5LJ5f 3OYEA 2ZZDA 3URGA 5GAOl 2YUNA 4P5NA 2IVWA 1UTIA 4J6YA 2DM1A 3J80E 4FT2A 1WPYA 2MMPA 2E6ZA 4IUQA 4PFZA 2AHJB 1PCXA 4B9XA 1NG2A 2LT1A 2C0TA 3THKA 3V8JA 1N6AA 2E10A 1IB8A 8AT1B 2YRCA 1VQ5T 2DIQA 3VS1A 1K73U 1TG0A 2K5FA 1WHJA 1ZHIA 3NTIA 2XU8A 2KI7A 4XTXA 3E2UA 4FU6A 3MEWA 2EQMA 4M78F 4C0DC 3MO8A 4C8QA 2L0AA 2SEMA 3C4SA 3CCJT 4OMPA 1YCYA 4FYVB 3A8OB 3QSUA 3CCEA 3OYFA 2CP7A 4ELYC 3EG2A 2YLBA 4JZ4A 2KR3A 1OU9A 1Q82U 1NZ9A 3EFSA 1WHGA 4HCZA 3HPWA 1Y96B 3RKWA 3OW2A 1Y7XA 2O9SA 4FSXA 5CKDA 4C8QF 2K4YA 3DB4A 3LH5A 3M56A 2RQTA 2CUBA 2F5TX 2CGHA 1NYFA 1D3BB 3VJPA 3CD6Q 3TQ7P 2EQKA 3NPFA 4Y91A 1D0YA 1UE9A 1YJWT 2LP5A 2BE9B 4IUUA 1WJSA 3EG9A 3BFMA 4C0GA 1W2BP 3OYYA 1FXXA 2V8IA 4JLGA 2K3XA 1SRMA 1ZA1B 2C06A 2DBMA 3F70A 2QK0A 3CCSQ 1VQ9A 3CC2T 1YFNA 1W1FA 3M4YA 1JXMA 1N9SA 4FL6A 4R0KA 2FEIA 4CC7A 1Q81U 1VQ6A 1K8AC 3TREA 1AOJA 3C94A 1ZUYA 2DJZA 3JCMQ 4MDWA 1G2BA 3GF5A 1LPLA 2YUQA 5CAIA 2D0NA 2E5KA 2O4XA 2COZA 3QBYA 2CDTA 1RL2A 2LNHB 2KDSA 3EG3A 4M75G 1I0CA 1YP5A 2D6FA 3PIPA 3G6EQ 3JAME 4HXJA 5GAN3 1WHKA 1KD1R 1BB9A 4CI0C 5KE3A 1OZ3A 2OTJQ 3OBYA 4Z8AA 4A54A 1QVGP 4J9FA 3HSBA 4C5IA 1KQ1A 4M75E 1E6HA 3BW1A 4AG1C 1YI2A 1RACB 3CXCA 1I07A 1Q86R 5LJ5d 1PM3A 2KEAA 5GANd 1YJ9Q 4OMOA 3M4GA 4BACA 2JNGA 2KRMA 2NUZA 1Q95G 3QZ5B 1UECA 4XTUA 5GAMe 3GLXA 3DB3A 3G71A 2CP3A 4AFSC 3PVLA 4R56A 4KGXB 2DL4A 3CD6T 1MMAA 4QVDA 2HEQA 2JT4A 2M02A 3S3NA 4LDUA 1YIJQ 1O75A 5GAN7 4MMLA 5J3BA 3QXEB 2OAUA 1H8KA 1VIEA 2KRNA 2YUOA 3EFOB 3FDRA 3H0FA 3CXCS 3JCMJ 3G1JA 1X2QA 1PRMC 2FPDA 2GTOA 3EGDA 3CCST 5LJ3e 3OS0A 1X6GA 1KHCA 5KCOA 2NUPB 3M57A 1VQ8A 4JDSA 2DX1A 2LX9A 2CH4W 4C0DB 3CBPA 2NUTB 1NM7A 4XAXB 2DFUA 1VQKA 2QGGA 3E1SA 4OMLA 2YDLA 3EH1A 2QDLA 1S72A 1N8RR 4O5VA 3OS2A 4OMNA 2LMJA 3QHSA 1Y0MA 4HVWA 4C92G 4CC3A 3HRSA 1BBZA 5LJ3f 4F7UB 1RAFB 3J81E 4FIBA 1CSKA 1KSWA 2ZPGB 2NLUA 3PMIA 3C12A 3V8KA 4LDWA 5GAN8 1TTHB 2E3HA 2FZGB 5CR2A 4C92E 1HSQA 2P4TA 4M7AB 4FM4B 1NYGA 4O6JA 3JCMX 2ZPIB 3VS7A 3VV0A 5KYYB 2RJDA 2OTJT 3OYCA 4JS4A 2ZAEA 4CC4B 1Y57A 2VWFA 3M0UA 4JRKA 3ULRB 2MWOA 3OS5A 4XU2A 3UF4A 1YJ9T 4XU1A 1X6OA 2EJ9A 4J6WA 2AKKA 3OYGA 1K8AU 3OYHA 3WXMB 3M59A 3SWNB 2E12A 2FRWA 4E47A 5GAOr 3PNWC 5FRMA 4F14A 2D0QB 2HNIA 4HVUA 1M2VB 2RQVA 5GAN5 2EKOA 3RMQA 1UHFA 4VUBA 5IHKA 3ME9A 2SRCA 3QWYA 1YIJT 2MIOA 2DXBA 3JB9G 1VQLA 2HZYA 2H3EB 1VQNT 5A0LA 5CO7A 1QCOA 2X4JA 2QQRA 4J9EA 3UA7A 4EMKC 2EGCA 2JTEA 1VQ4Q 5CKBA 1TXQA 3A5ZB 2LJ1A 4DBHA 1Y71A 1JB0E 2D1XA 2P0PA 1G3SA 1VYUA 1TOVA 2MK5A 4ANJA 2YWWA 4DA4A 3ZFJA 3CPWA 3GOXA 4KBMB 4M77G 2P4RA 1WHLA 5EC7A 2DEQA 2KT1A 1KFZA 3LW5E 2BZYA 2DLPA 2QA4A 2K2MA 1PSEA 2G6FX 2LCLA 2K3BA 2LRQA 1AZEA 3H0HA 4M77E 2LNVA 2VGNA 2DA9A 1SPKA 3CQTA 1WLPB 2RN8A 1TWBA 4PKCC 1U8RA 3CXCP 3NFCA 4D8KA 3EGUA 3CCVA 3CMAQ 2KRSA 4PJOF 1XNIA 4PL6A 2EYQA 5GAMd 4GLKA 3EGXA 3CPWS 2RI3A 3VYHB 1WIEA 3EFRA 1PG5B 1G8XA 1M30A 3NHNA 2DZ9A 3CCUQ 4L5GA 2DL5A 2L3PA 3G4SQ 3RBBB 1K73C 2LQWA 3A8GB 2JS2A 2DNUA 1O9SA 2BE7D 3O5ZA 1WA7A 5IHNA 4PK4A 1LCKA 3VS0A 4KH1B 3PFSA 4JRIA 5LJ3d 1E6GA 4M7AD 1X2KA 1OX8A 3MEVA 1R0BG 3VUZA 2MYSA 2FL7A 3KBGA 2KE9A 2X51A 3SFMA 4BB7A 1QVFA 1VQ7A 2DRMA 1OI1A 2XKOC 2EKHA 3PGGA 5CCAA 2LQNA 2CP6A 4JRQA 4L59A 2P0KA 3N5BB 4Z88A 3T9NA 1VUBA 2G3RA 3UA6A 3FRNA 3I56A 1VQ4T 4C5GA 1SHFA 1BCOA 1VQ5Q 3S6WA 2VXEA 1B34A 4MZPA 4KULA 1YN8A 2KXDA 2CZ0B 1KQSA 3M0SA 1LJOA 2QEXA 1AVZC 2FB7A 4E7KA 1QVFS 5KE2A 1K4US 2EVRA 4M78G 2X3WD 3PVQA 3UATA 1YJWA 2COYA 3P8BB 4XU0A 1QWEA
chains in the Genus database with same CATH topology
4N4IA 3DB4A 3M56A 2K2VA 3QIIA 3CMET 1VQMT 2VYTA 4Z02A 3JCMd 1B34B 4M75C 4EMHA 1M9SA 2F5TX 4MZTA 2CGHA 2EWNA 3MEAA 3G71T 3TU4K 5D6XA 1D3BB 3QYGB 3VJPA 1OZ2A 3CCRT 2EQKA 4M78E 2R58A 1Q81C 1BI1A 2LQ8A 2RJFA 4M77D 2XG8D 4N0AC 4NS5A 1OYXA 4A4EA 5GMKh 4Y91A 4E7JA 1Q86U 2RM4A 5DY9A 2VC8A 3L2UA 1YJWT 3CCUA 1WJRA 2XK0A 5CQXA 4IUUA 4DOVA 1WJSA 2VXFA 2GF7A 3DLMA 2DAQA 3BFMA 4C0GA 4KUDK 3OYYA 1KQSS 2RI2A 1FXXA 2V8IA 4JLGA 3QJYA 2GFUA 2K3XA 2DTOA 3JCMh 5GANe 1YJNA 4RKUE 1M1KC 4M7DB 1I8FA 2DD5A 5AYFA 2C06A 3PTAA 3F70A 3SB2A 2HQXA 2V8JA 4OVAA 1VQ9A 2RHZA 3CEYA 3PIOA 3CC2T 5FLXE 4M75A 2MAMA 1M1FA 3M4YA 5HKCA 3M58A 4C8QE 1WQWA 3HL8A 4E7HA 1KC8C 4XTYA 1N9SA 2KAFA 3G4ST 3UT1A 4FL6A 4MMKA 4N0AA 3H6ZA 2LDMA 2F69A 2WSCE 4M7AA 5CKHA 4M7DG 4ZN1A 4KUIA 2VV5A 4RG2A 2YHTA 3LYIA 5HK0A 1I81A 1Q81U 1VQ6A 2E1HA 3GP8A 3CBMA 2EIFA 1K8AC 2Y90A 3TREA 3ZBDA 5D6YA 4LD9K 3OYIA 1VQKT 3R6OA 1UGPB 2K5LA 4BY6B 4D6WA 3C94A 2BKDN 4M75F 2KY9A 2WSEE 4M75B 5I2SA 2DJZA 3JB9J 4IURA 3NTHA 4X34A 4MDWA 3JCMQ 1HXDA 3I55T 4PJOD 3GF5A 1UGQB 5CAIA 3G6ET 4BUGA 5GAMg 5GANf 2MI6A 1Q7YU 3OMCA 2O4XA 4BD3A 1JJ2A 1NJIU 2EJGA 3VYGA 3QBYA 2PU9B 2RB6A 3MCAB 1VQ5A 2LVMA 3MHXA 2PVOB 2RHXA 4A4KA 4E7IA 2E70A 3HFNA 3DLLA 1Y07A 3OYLA 1RL2A 3V8LA 3M55A 3QO3A 3META 2KDSA 4Q5WA 2KVQG 5EG2A 4M75G 1IREB 4OB2B 2D6FA 3PIPA 3JB9H 3L2ZA 2DTIA 3JAME 4NL3A 2VGMA 1BIBA 5GAN3 3HFOA 2XIDA 2GFAA 1N8RU 4CI0C 5KE3A 3JCMP 1OZ3A 3X25B 2F5KA 3OBYA 2DK3A 4A54A 3CCJA 3CCQT 5DLQE 3CCMT 3HSBA 3FLGA 1KQ1A 2EQUA 4FT4A 4C5IA 3L2WA 4M75E 2BUDA 4LDYA 3BW1A 1YI2A 4XTZA 3EAEA 1QP3A 5LJ3g 3CXCA 3JRZA 3JB9F 5GMKi 3OSVA 2RJEA 4YTLA 1BI2A 5LJ5d 5GANd 2QI2A 3UPUA 2EQJA 1PSFA 3GNGA 3M4GA 4BACA 2X4XA 4QW2A 2JNGA 4C92C 3LGLA 3RUXA 5LJ3j 2ZPEB 5A0GA 2RJCA 1NE8A 3QZ5B 4HCBA 4RMOA 2CKKA 1X75C 4XTUA 3JCMc 3UWNA 3GLXA 5GAMe 2DPPB 3CMEA 5GAN6 1BI3A 1VQMA 3VUBA 1U1SA 3DB3A 5D6WA 3G71A 1TH7A 3FEOA 1WGSA 2R5MA 4DOWA 1QP2A 3OSSC 5LL6S 4R56A 3CCRA 4ELZC 4WF2A 4OB3B 4A4FA 1G5VA 2L89A 2WACA 5LJ5h 1VQOT 1LOJA 2PVGB 2RO0A 5GANh 3CD6T 3P8HA 4QVDA 4PNOA 5CIUA 3QG1A 3NTKA 3S3NA 4PLIA 4LDUA 4RCCA 3L2VA 5FROA 4OGEA 4Y28E 3M53A 2JUFA 2YLCA 3H8ZA 4BDZA 4QQ6A 1O75A 2XHCA 5I2MA 4ZN3A 5GAN7 4C8QB 1X01A 3MEUA 4M78D 4MMLA 5GAOm 3JB9I 4QVCA 2YRVA 5J3BA 4C0FA 2JTMA 3QXEB 5IAYA 2OAUA 1G3WA 4C92A 1VIEA 4B9WA 3FDRA 1WQ7A 3CXCS 1FX7A 2H3JA 1VQLT 3JCMJ 1XTDA 4OB0B 2E41A 4M7AC 1M90U 3QDRB 3OB9A 3FIFA 3M54A 5LJ3e 2GQVA 3OS0A 3CCST 1N27A 3CC4T 2HAXA 2JVVA 5DLOA 3G4SA 4C8QG 5CVIA 2XD0A 1KHIA 1I5LA 3QKJA 1H641 1KHCA 2E64A 3INZA 3UDCA 5KCOA 3M57A 2DKGA 1VQ8A 5KCHA 4JDSA 2LX9A 4XQ3A 4C0DB 3HRTA 3CBOA 5J39A 2DXTA 2ZPHB 3CBPA 4C92F 2DXUA 4F7UA 4PJOA 4J5YA 4J7IA 4XAXB 5J26A 3JCMg 4C92B 1BYMA 3S3OA 1VQKA 3OY9A 4X9CA 2QDYB 4CRIA 3OW2S 2RHUA 1UGSB 3E1SA 4HT8A 1BKBA 3QPHA 2M1HA 2HQEA 3SWNC 3CCLT 2M16A 1S72A 2GCXA 3I55A 4O5VA 4J6XA 2QQSA 3OS2A 3G6EA 4R55A 1HK9A 2DZCA 1N9RA 2QQAA 3A8LB 3QHSA 4E7LA 5HK3A 3M5AA 1VQ8T 1GXIE 4L6V5 3X26B 2CYZB 3HKSA 3Q1JA 3GNFB 3TEEA 5IN1A 1K9MU 3RIRA 4C92G 4ZGJB 3OYMA 3LGFA 1MGQA 2QA4T 4M7DD 3ER0A 3HRSA 3OYBA 3GPLA 3L42A 4F7UF 2LC4A 5LJ3f 4J8OA 4OGCA 4V2SA 4C5HA 4F7UB 1R8OB 1H3ZA 3J81E 4FIBA 1BI0A 2LTOA 3JCMb 2CS7A 1S72T 2K57A 4HCCA 2ZPGB 2NLUA 2WSFE 3G7ZA 3PMIA 5GMKm 3C12A 3V8KA 1M1KU 4LDWA 4M7AF 5GAN8 1YJ9A 5CR2A 1NPPA 4C92E 4M7AB 2P4TA 3SWNA 3OMGA 4FM4B 3CCQA 4J83A 4O6JA 4BI3A 3JCMX 2FVUA 2ZPIB 3VV0A 2RJDA 2KQWA 2OTJT 1YHQT 3CCVT 3MP1A 4F7UG 3OYCA 4JS4A 5CQYA 5GAMj 1QVFA 4GY5A 2KK4A 1KC8U 5A0DA 1NPRA 4OF1A 2K5IA 3BY7A 2EFIA 4JRKA 4M77C 2MF2A 1V29B 4HA8A 2CZ6B 2MWOA 3OS5A 4XU2A 2CZ7B 2IG0A 4M7AG 4M75D 1I4K1 5C0MA 4XU1A 1YJ9T 1X6OA 2EJ9A 4J6WA 3WVEB 3OYGA 1K8AU 2O4XB 4F7UE 3OYHA 2EJFA 1W2BA 3WXMB 1M5Q1 2E6NA 2QQBA 3M59A 2LT4A 2E12A 4TVRA 3SWNB 4E47A 5GAOr 3OYJA 3PNWC 5FRMA 3FB9A 3WVDB 3QZ9B 3LH0A 1XQHA 2D0QB 2HNIA 3E19A 4C0ZA 2M0OA 4M78A 1VQOA 2DIGA 4UC4A 2LQKA 3CD6A 4M7AE 3V7CA 5GAN5 5GAN4 2EKOA 3RMQA 4VUBA 3X20B 1Q82C 2OTLA 1KQ2A 3ME9A 1QVPA 3OYDA 4JLIA 2Y4XA 1JJ2S 3V7RA 3OBWA 4IUPA 5CKEA 4BE1A 1KD1C 2X4WA 2FHDA 2DD4A 4M77A 3CCMA 3OYAA 5LJ3h 1WNLA 4JUVA 1YIJT 2QTXA 2DXBA 4EPCA 4QQGA 5FU6C 4LD6A 2HBPA 3JB9G 2XDDA 1VQLA 2DXCA 2ZGWA 5M9OA 4LDXA 1VQNT 4M7DC 1VQ7T 1EIFA 1U1TA 3HP9A 2OTLT 2PUOB 1IZ6A 2EAYA 5A0LA 3KUFA 5CO7A 3CCSA 4ZTFA 1Q86C 3CC4A 1AHJB 2RD1A 2X4JA 5LJ5g 3OYNA 4HKEA 5KH6A 5GANg 3CC7T 2QQRA 5GAOq 1UB4A 2PQWA 1UEBA 3RMSA 4EMKC 4PJOC 3RESA 3X28B 4JJNK 1W2BS 4M77F 1RI0A 3FJPA 3JSCA 4M77B 2ZCFB 3L2RA 3QUIA 3C95A 5LJ5j 2DO3A 4XTWA 1W4SA 5CKBA 3BDUA 3HHTB 4OP0A 2PVDB 3A5ZB 3I56T 4ZTJA 2O01E 1Y71A 5IT9E 2R5AA 1JB0E 3L2QA 3JCMV 2K3YA 1G3SA 2P0PA 3OQ5A 3PMTA 2L3RA 4DA4A 3AHUA 4JRPA 3J7AF 1P92A 3CCLA 3ZFJA 5GAMf 3QYHB 4II1A 3CPWA 4OMFB 2RA2A 4BY6C 3GOXA 4M7DA 2VUBA 4KBMB 3MP8A 4EMGA 4M77G 1G3TA 3CCET 2QEXT 1MHNA 1KG1A 2DEQA 4C8QD 5FU7C 3RKXA 3LW5E 5GMKj 3SD4A 4ZGDB 2V8KA 3VKIA 2QA4A 1QVGA 2JZ2A 2Y4YA 4EMKA 5A2QE 1ZQ1A 2P0QA 2ZPBB 1PSEA 5FRNA 5CKFA 4X9DA 3OYKA 1YITA 2XDBA 4NL2A 2LCLA 2LRQA 3CMAT 5FU6B 4DQ2A 4M77E 2LNVA 2RK2A 4BE2A 5C6SA 2E65A 2VGNA 3GIBA 4M7DF 4IUVA 5LJ5e 2B8AA 4PKCC 3OS1A 1U8RA 2DTHA 1Q7YC 3NFCA 3S3MA 2E5QA 2D9TA 1M8VA 4XU3A 3CC2A 1NJIC 4N4HA 3RKYA 2PUKB 3QJ6A 4ME7A 2OTJA 4MZMA 1YHQA 3CCVA 4BI8B 2L5QA 2RH2A 2HD0A 4PJOF 1XNIA 1YITT 4PL6A 2EYQA 4EMKB 5GAMd 2QQ9A 3LWIA 4GLKA 4PJOB 3MP6A 3CCUT 4C92D 3CPWS 2CZ1B 2RI3A 3VYHB 2I2LA 3X24B 4XTVA 4QVZA 3EFRA 1UGRB 3DKMA 1M4ZA 4J7FA 4A53A 5GMKe 4A4GA 1N8RC 1YJNT 3O8VA 2RK1A 3A8MB 3FC3A 4BI4A 1QVGS 3M9QA 2DZ9A 4M78C 1BIAA 4L5GA 1VQ9T 2JTFA 4PJOG 4QQDA 5GAN2 1VIFA 5GAOp 4C5EA 1JRIA 1K73C 3A8GB 4ATOA 5I21A 3LX7A 5GAMh 4IUTA 1O9SA 4MDXA 3JCMe 4M7DE 4JS5A 1FWZA 3E9GA 4XK8E 5FU7B 5LJ5f 3OYEA 2ZZDA 3URGA 4IKFA 3PFSA 5GAOl 4KT0E 1ZBXA 4BE0A 4JRIA 1VQ6T 2A7YA 2R57A 5LJ3d 4PJOE 4P5NA 2IVWA 1YIJA 2ZPFB 4M7AD 4J6YA 4OB1B 1WJQA 2XDPA 5L8RE 3J80E 3BDLA 1WPYA 4FT2A 4C8QC 3MEVA 3RERA 1LNXA 2X35A 3VUZA 2XI9A 3ZEHA 5DM7R 2MMPA 2LCCA 3KBGA 2E6ZA 2FL7A 4IUQA 2AHJB 3SFMA 4BB7A 4ZGEB 3OA6A 1VQ4A 1VQNA 1VQ7A 4N4GA 1VQPA 3SDZA 4B9XA 4HT9A 1OI1A 2XKOC 2LT1A 3L1AA 4PLLA 3V8JA 3CC7A 1N6AA 3PGGA 2E10A 1DJ7B 5CCAA 3JCMW 4JRQA 3A8HB 3TCJA 1VQ5T 2DIQA 1JBMA 4L59A 2P0KA 1K9MC 1K73U 2QXFA 2FYKA 3N5BB 1VUBA 2G3RA 3T9NA 4BDYA 4RG8A 2K5FA 3JCMf 3CPFA 1ZHIA 3NTIA 3FRNA 2XU8A 1QW1A 1Y96A 4XTXA 4LDVA 3I56A 1VQ4T 4C5GA 2X4YA 4FU6A 3MEWA 4RCBA 5CK9A 1VQPT 2EQMA 1G3YA 4M78F 4C0DC 3V7SA 3P8DA 2A3LA 2L8DA 3MO8A 4M78B 1XOVA 4C8QA 3JB9D 1M90C 3S6WA 2VXEA 2XICA 4NOYA 3C4SA 1B34A 3CCJT 3VU3C 4MZPA 4KULA 1YCYA 1D3BA 2RHYA 2CZ0B 3A8OB 3ASKA 1KQSA 3QSUA 4EDUA 1LJOA 3OYFA 2QEXA 3CCEA 2FB7A 4ELYC 3HRUA 3PT9A 1YI2T 2DVEA 3LLRA 2YLBA 4E7KA 4A4HA 2JN0A 2JOYA 2RI5A 5GANj 1QVFS 5KE2A 1Q82U 1NZ9A 3E9FA 1YBYA 4M78G 3EFSA 4HCZA 3HPWA 1YJWA 3KXTA 1Y96B 2KMTA 3RKWA 3OW2A 1KD1U 2M9UA 2RHIA 5GAOn 3CMAA 1Y7XA 5HY6A 2KSSA 4FSXA 5CKDA 3P8BB 4C8QF 5GMKl 3LWHA 2MWPA 4XU0A 1M1GA 2K4YA 2BIVA 1SSFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RKY A;  3M4G A;  4PJO C;  3JCM d;  1B34 B;  4M75 C;  4EMH A;  3BY7 A;  4C92 C;  2CGH A;  2EWN A;  4JRK A;  4M77 C;  4PJO F;  3RUX A;  5LJ3 j;  1D3B B;  4HA8 A;  4XU2 A;  5GAM d;  4EMK B;  4PJO B;  4M7A G;  4M75 D;  4XTU A;  3JCM c;  4M78 E;  4C92 D;  1I4K 1;  5GAM e;  4XU1 A;  5GAN 6;  4M77 D;  1U1S A;  2EJ9 A;  4N0A C;  4J6W A;  5GMK h;  4Y91 A;  1TH7 A;  2RM4 A;  5DY9 A;  2I2L A;  2VC8 A;  4F7U E;  4XTV A;  2EJF A;  3EFR A;  4WF2 A;  1M5Q 1;  3SWN B;  4A53 A;  5GMK e;  5LJ5 h;  2VXF A;  1LOJ A;  5GAN h;  5GAO r;  3FB9 A;  3BFM A;  4PNO A;  4QVD A;  2DZ9 A;  2HNI A;  4M78 C;  4RCC A;  1BIA A;  4M78 A;  3JCM h;  2DTO A;  4PJO G;  2YLC A;  5GAN e;  5GAN 2;  4M7A E;  5GAO p;  4M7D B;  1JRI A;  1I8F A;  3V7C A;  5GAN 7;  4C8Q B;  1X01 A;  4M78 D;  4MML A;  5GAN 5;  3SB2 A;  5GAN 4;  4QVC A;  5GAO m;  5I21 A;  5GAM h;  1KQ2 A;  4JLI A;  3V7R A;  3JCM e;  4M7D E;  4M75 A;  4C92 A;  4M77 A;  3JB9 J;  1WQ7 A;  5LJ5 f;  4C8Q E;  1WQW A;  5LJ3 h;  1WNL A;  3JCM J;  4JUV A;  4XTY A;  1N9S A;  2QTX A;  2E41 A;  5GAO l;  4M7A C;  4MMK A;  4N0A A;  3FIF A;  4JRI A;  3JB9 G;  5LJ3 d;  4M7A A;  4M7D G;  4PJO E;  5LJ3 e;  2ZGW A;  4M7A D;  4J6Y A;  2YHT A;  4C8Q G;  4M7D C;  1I5L A;  1H64 1;  1U1T A;  2E64 A;  1I81 A;  3INZ A;  1WPY A;  2E1H A;  2EAY A;  4C8Q C;  3RER A;  1LNX A;  2RD1 A;  2DKG A;  5LJ5 g;  2Y90 A;  5GAN g;  5GAO q;  4XQ3 A;  2DXT A;  4M75 F;  4EMK C;  4HT9 A;  3RES A;  2DXU A;  4C92 F;  3L1A A;  4F7U A;  4M77 F;  4PJO A;  4J5Y A;  4M75 B;  2DJZ A;  3FJP A;  2E10 A;  3PGG A;  3JCM g;  3V8J A;  4C92 B;  4M77 B;  3JCM Q;  3JCM W;  1HXD A;  4PJO D;  3QUI A;  4X9C A;  5CAI A;  5LJ5 j;  4XTW A;  5GAM g;  5GAN f;  1JBM A;  3BDU A;  4HT8 A;  4OP0 A;  3SWN C;  2FYK A;  2EJG A;  3JCM V;  4J6X A;  3JCM f;  2RB6 A;  1HK9 A;  2DZC A;  1N9R A;  3AHU A;  3QHS A;  4XTX A;  1Y96 A;  3HFN A;  4RCB A;  3V8L A;  5GAM f;  3QO3 A;  4M7D A;  2RA2 A;  4M78 F;  4M75 G;  3V7S A;  3RIR A;  4C92 G;  4EMG A;  3JB9 H;  3L2Z A;  2DTI A;  1MGQ A;  4M77 G;  4M78 B;  4C8Q A;  4NL3 A;  3JB9 D;  4M7D D;  1BIB A;  2VXE A;  4NOY A;  5GAN 3;  4F7U F;  2DEQ A;  1B34 A;  3HFO A;  5LJ3 f;  3VU3 C;  4C8Q D;  4V2S A;  3RKX A;  4F7U B;  5GMK j;  1YCY A;  1D3B A;  3JCM P;  3QSU A;  4EMK A;  1LJO A;  2FB7 A;  3JCM b;  2K57 A;  4X9D A;  4A54 A;  2DVE A;  2YLB A;  3HSB A;  5GMK m;  2JN0 A;  5GAN j;  4NL2 A;  3V8K A;  1KQ1 A;  4M7A F;  5GAN 8;  4M75 E;  3BW1 A;  4M7A B;  4C92 E;  3SWN A;  4DQ2 A;  4M77 E;  4M78 G;  3EFS A;  4XTZ A;  3JCM X;  5LJ3 g;  3JB9 F;  1Y96 B;  2E65 A;  5GMK i;  3RKW A;  3GIB A;  5LJ5 d;  4M7D F;  5GAO n;  5GAN d;  4F7U G;  5LJ5 e;  5GMK l;  5GAM j;  4C8Q F;  2DTH A;  4XU0 A;  1M8V A;  3JB9 I;  4XU3 A; 
#chains in the Genus database with same CATH topology
 3QII A;  5D7U A;  3CME T;  1VQM T;  2E3I A;  3JCM d;  1M9S A;  3MEA A;  1VQO Q;  5D6X A;  1PD0 A;  3QYG B;  4ZNX A;  3CCR T;  2F2V A;  1BU1 A;  4FW2 A;  2D8J A;  4M78 E;  3ZL7 C;  1Q81 C;  1BI1 A;  3CC2 A;  2XG8 D;  4N0A C;  4E7S A;  5GMK h;  4E7J A;  5GJW B;  2K7A A;  4AMC A;  1Z9Q A;  4DOV A;  5AT1 B;  2GF7 A;  4KUD K;  1KQS S;  1BCM A;  1K0S A;  5GAN e;  1YJN A;  4RKU E;  2DD5 A;  5AYF A;  2HQX A;  2RHZ A;  3CC4 Q;  5FLX E;  1ZLM A;  2MAM A;  4FCY A;  4C8Q E;  1WQW A;  4E7H A;  1KC8 C;  3TSZ A;  2DER A;  3G4S T;  2VAS A;  1GFC A;  1ZSZ B;  2V1R A;  3H6Z A;  4M7A A;  2F69 A;  2AIR B;  4M7D G;  2QAS A;  2VV5 A;  4RG2 A;  2YHT A;  2RPN A;  3PE0 A;  5KYY A;  4D8D A;  4FYW B;  2EYZ A;  1I81 A;  1PD1 A;  4FYY B;  2J6F A;  2DYB A;  2Y90 A;  3ZBD A;  4PJN A;  1UGP B;  2KY9 A;  2WSE E;  4M75 B;  2EYX A;  3JB9 J;  4J9I A;  3NTH A;  4E6R A;  1N5Z A;  1M3C A;  1G83 A;  2O9V A;  4BUG A;  5GAN f;  4QKU A;  4BD3 A;  1JJ2 A;  2AZV A;  2DMO A;  2EJG A;  3MHX A;  2E70 A;  1V1C A;  2YXY A;  4Q5W A;  5I22 A;  1HJD A;  1ZBJ A;  5EG2 A;  1IRE B;  1Q82 R;  1EFN A;  4RUG A;  5L23 A;  3CPW P;  1BIB A;  1PKS A;  1YWO A;  1OPK A;  2XID A;  1C6V X;  5I11 A;  1WI7 A;  2W10 A;  4HCK A;  1AWO A;  1C1A A;  4LDY A;  2LJ0 A;  1BI2 A;  2M0Y A;  4FW1 A;  1TU0 B;  2J7I A;  2X4X A;  3LGL A;  3VRY A;  5A0G A;  1RAH B;  4RMO A;  1MND A;  3JCM c;  5GAN 6;  1BI3 A;  2R5M A;  1QP2 A;  3OSS C;  5LL6 S;  1D09 B;  4WF2 A;  1G5V A;  2L89 A;  1VQO T;  2PVG B;  2RO0 A;  3P8H A;  5CIU A;  3NTK A;  4LE9 A;  4PLI A;  4RCC A;  5FRO A;  4OGE A;  3M53 A;  2YLC A;  4BDZ A;  2XHC A;  5I2M A;  3CCM T;  3MEU A;  2GNC A;  3I5R A;  1NBE B;  5IAY A;  3JV3 A;  4RTT A;  1M3B A;  1FX7 A;  1WZO A;  2H3J A;  2OTL Q;  2PNI A;  1XTD A;  4OB0 B;  2E41 A;  4M7A C;  1M8M A;  3FIF A;  4J9B A;  2YSQ A;  3M54 A;  1N27 A;  3CC4 T;  5DLO A;  1KHI A;  2QGF B;  1H64 1;  3UDC A;  1K1Z A;  3TVT A;  2W0Z A;  2MOX A;  5KCH A;  3HRT A;  2CSI A;  3CBO A;  4LUD A;  1QVF P;  2DXU A;  4J5Y A;  4J7I A;  5J26 A;  1BYM A;  4C92 B;  4X9C A;  2QDY B;  3OW2 S;  4HT8 A;  2M1H A;  2HQE A;  3SWN C;  1SKU B;  1QCN A;  2ROL A;  3CCE Q;  3CCL T;  2HSE B;  3I55 A;  2ECZ A;  2QG9 B;  2IPO B;  2QQS A;  3G6E A;  1GCP A;  5IHI A;  1HYO A;  2DZC A;  2QQA A;  4J9D A;  1LVK A;  1GXI E;  4L6V 5;  3HKS A;  2RQR A;  4FSS A;  5IN1 A;  1HD3 A;  3RIR A;  2V26 A;  4ZGJ B;  3OYM A;  1IXD A;  3VRZ A;  4J8O A;  1AEY A;  1H3Z A;  2P84 A;  2LTO A;  4HCC A;  1YCS B;  1KQS P;  1SRL A;  2AT1 B;  1YJ9 A;  3OMG A;  3CCQ A;  4BI3 A;  1YIT Q;  1MV3 A;  4PJL A;  3TSW A;  3MP1 A;  1D1A A;  5CQY A;  3REA B;  1KC8 U;  2KK4 A;  5A0D A;  1I1J A;  4ESR A;  2EFI A;  2HSP A;  2A37 A;  4M75 D;  1VQ9 Q;  1VYT A;  1M5Q 1;  2B86 A;  4TVR A;  2LT4 A;  2FG0 A;  3WVD B;  1AWW A;  5FWC A;  1TUC A;  1VYV A;  2LQK A;  3V7C A;  3OYD A;  4JLI A;  2Y4X A;  5CKE A;  3VS5 A;  3EHR A;  2DD4 A;  1WYX A;  3OYA A;  5LJ3 h;  2DYI A;  4EPC A;  2HKN A;  4LD6 A;  1PHT A;  4JZ3 A;  4LDX A;  4M7D C;  2OTL T;  4ZTF A;  2RF0 A;  1AHJ B;  3I35 A;  5KYX B;  2PQW A;  1UEB A;  3RMS A;  5IH2 A;  4JJN K;  2LCS A;  4M77 B;  1VQN Q;  5LJ5 j;  1VQP Q;  1QKW A;  3BDU A;  3VS3 A;  4ZTJ A;  5IT9 E;  2CSQ A;  4CC2 A;  1EZZ B;  3AHU A;  3J7A F;  1AD5 A;  1VOM A;  5GAM f;  2D8H A;  4EMG A;  3CCE T;  4JJD A;  2LJ3 A;  3H9N A;  4F04 B;  2ED0 A;  5GMK j;  3VKI A;  2DJQ A;  5A2Q E;  1U06 A;  4EMK A;  2C0I A;  5CKF A;  3OYK A;  3M0T A;  2XDB A;  1ZSZ A;  2DIL A;  4DQ2 A;  3G71 Q;  2E65 A;  4IUV A;  1K76 A;  1K8A R;  3OS1 A;  1Q7Y C;  1UGV A;  2E5Q A;  4XU3 A;  1H3H A;  1NJI C;  2PUK B;  4GLM A;  4MZM A;  1YHQ A;  4BI8 B;  2L5Q A;  3SHW A;  2HD0 A;  1YIT T;  4PFO A;  2OJ2 A;  2RNA A;  3LWI A;  2QQ9 A;  4C92 D;  3SEM A;  1QWF A;  2CZ1 B;  3X24 B;  4XTV A;  1M4Z A;  4J7F A;  2KYB A;  1FMW A;  4BI4 A;  3FJ5 A;  1VQ9 T;  1ZUK A;  2JTF A;  4PJO G;  5GAN 2;  1GFD A;  5GAO p;  3OW2 P;  2FO0 A;  3LX7 A;  4IUT A;  4MDX A;  2DRK A;  3JCM e;  4JS5 A;  2V1Q A;  2MCN A;  4IKF A;  3I5S A;  1ZBX A;  1ZA2 B;  1VQK Q;  1VQ6 T;  1AWX A;  1GRI A;  4PJO E;  2J6K A;  1QLY A;  2ZPF B;  2HDA A;  1WJQ A;  1RAG B;  1ABQ A;  1MV0 B;  1SEM A;  4DEY A;  1VQ4 A;  4ZGE B;  3OA6 A;  2AKL A;  1QKX A;  1TUD A;  3CC7 A;  1IGQ A;  1H92 A;  3A8H B;  3TCJ A;  4WTO B;  2BZX A;  2QXF A;  4BDY A;  4RG8 A;  3JCM f;  1Y96 A;  4LDV A;  5CK9 A;  4RCB A;  2RQW A;  1VQP T;  1JEG A;  3P8D A;  2A3L A;  2L8D A;  4M78 B;  3JB9 D;  1M90 C;  1I5O B;  1D3B A;  3ASK A;  1FMV A;  1W70 A;  3PT9 A;  1ZSZ C;  1YI2 T;  2DVE A;  3LLR A;  2JN0 A;  1X27 A;  3E9F A;  1YBY A;  3R6N A;  2KYM A;  1JU5 C;  2KMT A;  1F1B B;  2M9U A;  2RHI A;  5GAO n;  3CMA A;  2KSS A;  3LWH A;  1PWT A;  3C0C A;  1UGQ B;  1SSF A;  4N4I A;  2CP2 A;  2K2V A;  2VYT A;  1SSH A;  4Z02 A;  4M75 C;  4EMH A;  1M2O A;  4MZT A;  3VS6 A;  2EWN A;  3G71 T;  4IIM A;  1B7T A;  3TU4 K;  1OZ2 A;  2OX7 A;  2R58 A;  2HL5 C;  2LQ8 A;  2RJF A;  4M77 D;  4A4E A;  1K9M C;  4IIO A;  5DY9 A;  3L2U A;  3CCU A;  1WJR A;  2XK0 A;  3CME Q;  1B3Q A;  5CQX A;  1VQM Q;  2VXF A;  3DLM A;  2DAQ A;  2RI2 A;  3CCR Q;  1VQL Q;  1YNZ A;  2J06 A;  3QJY A;  2GFU A;  1M1K C;  4M7D B;  4DBF A;  1I8F A;  2KXC A;  2O31 A;  3SB2 A;  2AK5 A;  2BZ8 A;  3CEY A;  2RMO A;  1M1F A;  4AFQ C;  3HL8 A;  2KGT A;  3UT1 A;  3GBQ A;  4MMK A;  4N0A A;  5KYU B;  5CKH A;  4ZN1 A;  2EPD A;  4KUI A;  3EHQ A;  3LYI A;  5HK0 A;  2E1H A;  3GP8 A;  2CT3 A;  1RAB B;  1UDL A;  3OYI A;  1VQK T;  2GQI A;  5HCK A;  1GCQ C;  5FWB A;  4KRT A;  4A63 B;  1NLO C;  5I2S A;  1HXD A;  2A08 A;  1Q7Y U;  3AT1 B;  3OMC A;  1NJI U;  3VYG A;  3MCA B;  1AWJ A;  1VQ5 A;  2PZ1 A;  4E7I A;  2PVO B;  2RHX A;  1Y07 A;  3OYL A;  3M0R A;  3M55 A;  3L2Z A;  2DTI A;  4NL3 A;  2VGM A;  2GFA A;  1RLQ C;  3X25 B;  2JM8 A;  2DK3 A;  3CCV Q;  4PJM A;  2JM9 A;  3CCJ A;  2QTV A;  1WX6 A;  2EQU A;  5KYN A;  4JJC A;  3D7S B;  1QP3 A;  3JB9 F;  2IIM A;  3OSV A;  2RJE A;  1SHG A;  2QI2 A;  1E7O A;  4ORZ A;  3UPU A;  1D1B A;  2EQJ A;  4QT7 A;  2EGA A;  4C92 C;  5LJ3 j;  2ZPE B;  2CKK A;  1X75 C;  3EFO A;  3UWN A;  3VUB A;  5D6W A;  1WGS A;  2CUD A;  4OB3 B;  4A4F A;  2WAC A;  5LJ5 h;  1LOJ A;  5GAN h;  1TS9 A;  2VKN A;  3QG1 A;  2MPX C;  3L2V A;  2NUP A;  4Y28 E;  2JUF A;  1IO6 A;  4M78 D;  3JB9 I;  4QVC A;  2YRV A;  2NUT A;  1G3W A;  1VQL T;  2QAZ A;  1TSF A;  4RTZ A;  4Y92 A;  1M90 U;  3CCM Q;  1RAE B;  2HAX A;  4C8Q G;  1D0X A;  1I5L A;  3QKJ A;  2E64 A;  3IQL A;  2YRD A;  5IXB A;  2DXT A;  4F7U A;  1S1N A;  4KH0 B;  3OY9 A;  2RHU A;  1BKB A;  2LX7 A;  2QEX Q;  2M16 A;  1CKA A;  2X3X D;  4R55 A;  1HK9 A;  3MJX A;  3A8L B;  3M5A A;  3X26 B;  3Q1J A;  3TEE A;  1K9M U;  1K73 R;  2QA4 T;  4DEX A;  4M7D D;  2ED1 A;  2FPF A;  2DET A;  4F7U F;  2FPE A;  3CCL Q;  4V2S A;  2DE0 X;  1R8O B;  1RAI B;  4LUE A;  4KGZ B;  1BI0 A;  3JCM b;  2WSF E;  3G7Z A;  5GMK m;  1M1K U;  4M7A F;  1NPP A;  1T3L A;  3SWN A;  2EQI A;  2FZK B;  2FVU A;  2KQW A;  3CCV T;  4GY5 A;  4AFU C;  1M2V A;  4JJB A;  1NPR A;  2K5I A;  1QQJ A;  2RQU A;  1OV3 A;  4M77 C;  3QDF A;  1YJN Q;  1Z9Z A;  2CZ6 B;  2IG0 A;  3EG0 A;  2J6O A;  2A28 A;  1K9A A;  3WVE B;  2EJF A;  2E6N A;  3OYJ A;  2QYZ A;  3LH0 A;  1XQH A;  3E19 A;  5ECA A;  2M0O A;  4M78 A;  2DIG A;  1WXB A;  3CD6 A;  5GAN 4;  3X20 B;  2OTL A;  1QVP A;  1JJ2 S;  2ABL A;  3OBW A;  4IUP A;  4BE1 A;  1KD1 C;  2FHD A;  2FZC B;  1UUE A;  4JUV A;  4AFZ C;  4X1V A;  6AT1 B;  1D0Z A;  2XDD A;  2OAW A;  4WCI A;  5M9O A;  3U23 A;  1VQ7 T;  1UG1 A;  1U1T A;  1NEG A;  1Q86 C;  3CCS A;  2RD1 A;  5LJ5 g;  3A1P A;  3OYN A;  5GAN g;  2J05 A;  3MPU B;  1B07 A;  3RES A;  3M0P A;  1RI0 A;  1Q81 R;  2ZCF B;  3L2R A;  3EH2 A;  3QUI A;  2EW3 A;  1W4S A;  1OU8 A;  4XTW A;  4E2F B;  3I56 T;  2O01 E;  2R5A A;  3L2Q A;  3JCM V;  1UJY A;  3PMT A;  3KFV A;  4II1 A;  4M7D A;  4BY6 C;  2VUB A;  3MP8 A;  1G3T A;  4DBR A;  2QEX T;  1MHN A;  1KG1 A;  2CRE A;  3RKX A;  3SD4 A;  4ZGD B;  2V8K A;  1AT1 B;  2VVK A;  4DBQ A;  2Y4Y A;  1ZQ1 A;  2P0Q A;  1KC8 R;  4X9D A;  1X6B A;  1C0M A;  1YIT A;  4E7Z A;  5KYU A;  1PKT A;  2DL3 A;  4J9H A;  1X69 A;  5FU6 B;  4RTX A;  2RK2 A;  4M7D F;  1R77 A;  2DTH A;  1M8V A;  2D9T A;  4N4H A;  2OTJ A;  2F2W A;  2GGR A;  4PJO B;  1TUG B;  3MP6 A;  2ESW A;  3RDV A;  1WDX A;  2I2L A;  2YT6 A;  4QVZ A;  2ATC B;  4A53 A;  1N8R C;  4A4G A;  1YJN T;  2RK1 A;  3A8M B;  3FC3 A;  2OI3 A;  4M78 C;  1ARK A;  1BIA A;  1VIF A;  4PFP A;  1D1C A;  1JO8 A;  1ZX6 A;  4ATO A;  4AG2 C;  5I21 A;  5GAM h;  2JMA A;  1QMC A;  3E9G A;  5FU7 B;  4Z89 A;  3EGX B;  2DBK A;  4KT0 E;  4BE0 A;  2A7Y A;  2R57 A;  1YIJ A;  4OB1 B;  5IXF A;  2XDP A;  2CH4 A;  5L8R E;  3BDL A;  3I55 Q;  4C8Q C;  3RER A;  1LNX A;  4HVV A;  2X35 A;  2XI9 A;  3ZEH A;  1RUW A;  5DM7 R;  4LNP A;  2LCC A;  1VQN A;  4N4G A;  1VQP A;  1M27 C;  2ROT A;  1OX9 A;  3SDZ A;  1VQ6 Q;  1R0C B;  4HT9 A;  4PLL A;  3L1A A;  2O2O A;  2CP0 A;  1DJ7 B;  3JCM W;  2X9H A;  3I9Q A;  1JBM A;  2FYK A;  1JQQ A;  5FW9 A;  3NMZ C;  3MKD A;  2ENM A;  3CPF A;  2K6D A;  1QW1 A;  2X4Y A;  4J9C A;  1G3Y A;  2GBQ A;  3CCQ Q;  3V7S A;  1XOV A;  3RNJ A;  1A0N B;  2XIC A;  4NOY A;  1FYN A;  3VU3 C;  1W6X A;  2RHY A;  1RAD B;  4EDU A;  5KYW B;  1V76 A;  3HRU A;  2NWM A;  4A4H A;  2JOY A;  5GAN j;  2RI5 A;  2HBW A;  1QCF A;  9ATC B;  1JJ2 P;  1ABO A;  3KXT A;  1KD1 U;  1U3O A;  5HY6 A;  5GMK l;  2MWP A;  1M1G A;  1RLP C;  2DL7 A;  2BIV A;  1YI2 Q;  2PTK A;  1B34 B;  1OPL A;  2I0N A;  2E4H A;  1ACM B;  4EIK A;  4NS5 A;  2XMF A;  1OYX A;  1Q86 U;  2RM4 A;  2VC8 A;  2C0O A;  3VS4 A;  3A98 A;  1MMN A;  1SG5 A;  1EX4 A;  3H41 A;  2HQH A;  2VB6 A;  3JCM h;  2DTO A;  1ZUU A;  2L3S A;  3PTA A;  2V8J A;  4OVA A;  3PIO A;  4M75 A;  5HKC A;  3M58 A;  4M4Z A;  4XTY A;  2KAF A;  1NEB A;  1PNJ A;  1PC0 A;  2LDM A;  2WSC E;  1MMG A;  2CP5 A;  1BK2 A;  2A36 A;  3CBM A;  2EIF A;  3BE3 A;  1MUZ A;  5D6Y A;  4LD9 K;  3R6O A;  4BY6 B;  2K5L A;  4D6W A;  2BKD N;  4M75 F;  2DVJ A;  4IUR A;  4X34 A;  1VQ8 Q;  3I55 T;  4PJO D;  3G6E T;  2M51 A;  1KK7 A;  5GAM g;  2MI6 A;  2PU9 B;  2RB6 A;  4OMM A;  2LVM A;  4A4K A;  3HFN A;  3DLL A;  2NYS A;  3V8L A;  3QO3 A;  3MET A;  2KVQ G;  1S72 Q;  1OQK A;  4OB2 B;  3JB9 H;  1YWP A;  3HFO A;  1X43 A;  2KBT A;  1N8R U;  3JCM P;  4PJJ A;  1PRL C;  1GCQ A;  2F5K A;  8ATC B;  1YHQ Q;  3CCQ T;  5DLQ E;  4RTV A;  4GBQ A;  3FLG A;  4FT4 A;  3L2W A;  2BUD A;  4XTZ A;  3EAE A;  1NLP C;  5LJ3 g;  3JRZ A;  5GMK i;  4YTL A;  2YUP A;  2DF6 A;  4K11 A;  4RTW A;  1GBQ A;  1PSF A;  3GNG A;  4QW2 A;  3RUX A;  1GBR A;  2L3Q A;  2RJC A;  1NE8 A;  4HCB A;  3CME A;  1VQM A;  2DPP B;  1U1S A;  1GL5 A;  1SF9 A;  1TH7 A;  3FEO A;  4DOW A;  3CCR A;  4ELZ C;  1FMK A;  1OEB A;  4PNO A;  2KRO A;  3REB B;  2EBP A;  3H8Z A;  1AZG B;  4J9G A;  4QQ6 A;  4ZN3 A;  5GAO m;  4OMQ A;  1X01 A;  4C8Q B;  4C0F A;  2JTM A;  4F17 A;  4C92 A;  4B9W A;  1WQ7 A;  3CC7 Q;  3QDR B;  3OB9 A;  4LN2 A;  2KNB B;  2GQV A;  2KT8 A;  2Z0W A;  2JVV A;  3G4S A;  2EYY A;  4B6M A;  5CVI A;  2XD0 A;  2HCK A;  3INZ A;  1Q7Y R;  2F1L A;  1T0H A;  2HKQ B;  1WXU A;  1NJI R;  1RI9 A;  2DKG A;  3EG1 A;  1OOT A;  4XQ3 A;  5J39 A;  2ZPH B;  4C92 F;  2JMC A;  4PJO A;  3JCM g;  3S3O A;  4CRI A;  1UGS B;  4RTU A;  3QPH A;  2GCX A;  4J6X A;  1T0J A;  2JJ9 A;  4AT1 B;  1N9R A;  1K0X A;  4E7L A;  3EG9 B;  5GJV B;  5HK3 A;  1VQ8 T;  3H0I A;  2CYZ B;  1J3T A;  3GNF B;  3LGF A;  1MGQ A;  2JW4 A;  3ER0 A;  3OYB A;  3GPL A;  1XJW B;  3L42 A;  2LC4 A;  4OGC A;  4C5H A;  2CS7 A;  1S72 T;  2K57 A;  2QA4 Q;  1MNE A;  4F16 A;  4J83 A;  4LXC A;  1YHQ T;  4F7U G;  5GAM j;  1T3S A;  3M0Q A;  4OF1 A;  3BY7 A;  2MF2 A;  1IRX A;  1V29 B;  2BTT A;  4HA8 A;  1MMD A;  2CZ7 B;  4M7A G;  1I4K 1;  5C0M A;  2DL8 A;  2CT4 A;  2O4X B;  4F7U E;  2JS0 A;  4KGV B;  1W2B A;  1UJ0 A;  2QQB A;  2GTJ A;  1RAA B;  2L2P A;  1M3A A;  3FB9 A;  3QZ9 B;  2A0F B;  1M90 R;  2F2X A;  4JPB W;  4C0Z A;  1VQO A;  4UC4 A;  4M7A E;  3VS2 A;  5KYX A;  1Q82 C;  1KQ2 A;  2H8H A;  2K9G A;  3V7R A;  5KYW A;  2X4W A;  4M77 A;  3CCM A;  2JXB A;  1WNL A;  2EGE A;  2QTX A;  4QQG A;  5FU6 C;  4RTY A;  2HBP A;  2DXC A;  2ZGW A;  1WXT A;  1KJW A;  1IHW A;  1EIF A;  3HP9 A;  2PUO B;  1IZ6 A;  2EAY A;  3KUF A;  3CC4 A;  3CC7 T;  4HKE A;  5KH6 A;  1UFF A;  5GAO q;  1UB4 A;  1OUL A;  4PJO C;  1W2B S;  3X28 B;  4M77 F;  1IHV A;  3FJP A;  3JSC A;  1K9M R;  3C95 A;  1IGU A;  1VQ7 Q;  2DO3 A;  3NGP A;  3HHT B;  4OP0 A;  2PVD B;  3CCJ Q;  2K3Y A;  3OQ5 A;  3HTR A;  2AZS A;  2L3R A;  1VA7 A;  4JRP A;  2FRY A;  1P92 A;  3CCL A;  1M1K R;  3QYH B;  1WHM A;  2RA2 A;  4OMF B;  2LZ6 B;  3I56 Q;  1WFW A;  4C8Q D;  5FU7 C;  1QVG A;  3QWX X;  2JZ2 A;  1UHC A;  2ZPB B;  5FRN A;  1CKB A;  4NL2 A;  3CMA T;  2HMA A;  3EGD B;  4BE2 A;  1ZSG A;  2COW A;  5C6S A;  3GIB A;  1U5S A;  2HL3 A;  5LJ5 e;  2B8A A;  3S3M A;  3RKY A;  3QJ6 A;  4ME7 A;  1YJW Q;  2RH2 A;  1JXO A;  1KIK A;  4EMK B;  3CCU T;  4FYX B;  1UGR B;  3DKM A;  7AT1 B;  5GMK e;  2O88 A;  3CC2 Q;  3O8V A;  1WHH A;  1QVG S;  3M9Q A;  2EYW A;  4QQD A;  2DEU A;  3RR6 A;  4C5E A;  1JRI A;  4M7D E;  1FWZ A;  4XK8 E;  2K79 A;  5LJ5 f;  3OYE A;  2ZZD A;  3URG A;  5GAO l;  2YUN A;  4P5N A;  2IVW A;  1UTI A;  4J6Y A;  2DM1 A;  3J80 E;  4FT2 A;  1WPY A;  2MMP A;  2E6Z A;  4IUQ A;  4PFZ A;  2AHJ B;  1PCX A;  4B9X A;  1NG2 A;  2LT1 A;  2C0T A;  3THK A;  3V8J A;  1N6A A;  2E10 A;  1IB8 A;  8AT1 B;  2YRC A;  1VQ5 T;  2DIQ A;  3VS1 A;  1K73 U;  1TG0 A;  2K5F A;  1WHJ A;  1ZHI A;  3NTI A;  2XU8 A;  2KI7 A;  4XTX A;  3E2U A;  4FU6 A;  3MEW A;  2EQM A;  4M78 F;  4C0D C;  3MO8 A;  4C8Q A;  2L0A A;  2SEM A;  3C4S A;  3CCJ T;  4OMP A;  1YCY A;  4FYV B;  3A8O B;  3QSU A;  3CCE A;  3OYF A;  2CP7 A;  4ELY C;  3EG2 A;  2YLB A;  4JZ4 A;  2KR3 A;  1OU9 A;  1Q82 U;  1NZ9 A;  3EFS A;  1WHG A;  4HCZ A;  3HPW A;  1Y96 B;  3RKW A;  3OW2 A;  1Y7X A;  2O9S A;  4FSX A;  5CKD A;  4C8Q F;  2K4Y A;  3DB4 A;  3LH5 A;  3M56 A;  2RQT A;  2CUB A;  2F5T X;  2CGH A;  1NYF A;  1D3B B;  3VJP A;  3CD6 Q;  3TQ7 P;  2EQK A;  3NPF A;  4Y91 A;  1D0Y A;  1UE9 A;  1YJW T;  2LP5 A;  2BE9 B;  4IUU A;  1WJS A;  3EG9 A;  3BFM A;  4C0G A;  1W2B P;  3OYY A;  1FXX A;  2V8I A;  4JLG A;  2K3X A;  1SRM A;  1ZA1 B;  2C06 A;  2DBM A;  3F70 A;  2QK0 A;  3CCS Q;  1VQ9 A;  3CC2 T;  1YFN A;  1W1F A;  3M4Y A;  1JXM A;  1N9S A;  4FL6 A;  4R0K A;  2FEI A;  4CC7 A;  1Q81 U;  1VQ6 A;  1K8A C;  3TRE A;  1AOJ A;  3C94 A;  1ZUY A;  2DJZ A;  3JCM Q;  4MDW A;  1G2B A;  3GF5 A;  1LPL A;  2YUQ A;  5CAI A;  2D0N A;  2E5K A;  2O4X A;  2COZ A;  3QBY A;  2CDT A;  1RL2 A;  2LNH B;  2KDS A;  3EG3 A;  4M75 G;  1I0C A;  1YP5 A;  2D6F A;  3PIP A;  3G6E Q;  3JAM E;  4HXJ A;  5GAN 3;  1WHK A;  1KD1 R;  1BB9 A;  4CI0 C;  5KE3 A;  1OZ3 A;  2OTJ Q;  3OBY A;  4Z8A A;  4A54 A;  1QVG P;  4J9F A;  3HSB A;  4C5I A;  1KQ1 A;  4M75 E;  1E6H A;  3BW1 A;  4AG1 C;  1YI2 A;  1RAC B;  3CXC A;  1I07 A;  1Q86 R;  5LJ5 d;  1PM3 A;  2KEA A;  5GAN d;  1YJ9 Q;  4OMO A;  3M4G A;  4BAC A;  2JNG A;  2KRM A;  2NUZ A;  1Q95 G;  3QZ5 B;  1UEC A;  4XTU A;  5GAM e;  3GLX A;  3DB3 A;  3G71 A;  2CP3 A;  4AFS C;  3PVL A;  4R56 A;  4KGX B;  2DL4 A;  3CD6 T;  1MMA A;  4QVD A;  2HEQ A;  2JT4 A;  2M02 A;  3S3N A;  4LDU A;  1YIJ Q;  1O75 A;  5GAN 7;  4MML A;  5J3B A;  3QXE B;  2OAU A;  1H8K A;  1VIE A;  2KRN A;  2YUO A;  3EFO B;  3FDR A;  3H0F A;  3CXC S;  3JCM J;  3G1J A;  1X2Q A;  1PRM C;  2FPD A;  2GTO A;  3EGD A;  3CCS T;  5LJ3 e;  3OS0 A;  1X6G A;  1KHC A;  5KCO A;  2NUP B;  3M57 A;  1VQ8 A;  4JDS A;  2DX1 A;  2LX9 A;  2CH4 W;  4C0D B;  3CBP A;  2NUT B;  1NM7 A;  4XAX B;  2DFU A;  1VQK A;  2QGG A;  3E1S A;  4OML A;  2YDL A;  3EH1 A;  2QDL A;  1S72 A;  1N8R R;  4O5V A;  3OS2 A;  4OMN A;  2LMJ A;  3QHS A;  1Y0M A;  4HVW A;  4C92 G;  4CC3 A;  3HRS A;  1BBZ A;  5LJ3 f;  4F7U B;  1RAF B;  3J81 E;  4FIB A;  1CSK A;  1KSW A;  2ZPG B;  2NLU A;  3PMI A;  3C12 A;  3V8K A;  4LDW A;  5GAN 8;  1TTH B;  2E3H A;  2FZG B;  5CR2 A;  4C92 E;  1HSQ A;  2P4T A;  4M7A B;  4FM4 B;  1NYG A;  4O6J A;  3JCM X;  2ZPI B;  3VS7 A;  3VV0 A;  5KYY B;  2RJD A;  2OTJ T;  3OYC A;  4JS4 A;  2ZAE A;  4CC4 B;  1Y57 A;  2VWF A;  3M0U A;  4JRK A;  3ULR B;  2MWO A;  3OS5 A;  4XU2 A;  3UF4 A;  1YJ9 T;  4XU1 A;  1X6O A;  2EJ9 A;  4J6W A;  2AKK A;  3OYG A;  1K8A U;  3OYH A;  3WXM B;  3M59 A;  3SWN B;  2E12 A;  2FRW A;  4E47 A;  5GAO r;  3PNW C;  5FRM A;  4F14 A;  2D0Q B;  2HNI A;  4HVU A;  1M2V B;  2RQV A;  5GAN 5;  2EKO A;  3RMQ A;  1UHF A;  4VUB A;  5IHK A;  3ME9 A;  2SRC A;  3QWY A;  1YIJ T;  2MIO A;  2DXB A;  3JB9 G;  1VQL A;  2HZY A;  2H3E B;  1VQN T;  5A0L A;  5CO7 A;  1QCO A;  2X4J A;  2QQR A;  4J9E A;  3UA7 A;  4EMK C;  2EGC A;  2JTE A;  1VQ4 Q;  5CKB A;  1TXQ A;  3A5Z B;  2LJ1 A;  4DBH A;  1Y71 A;  1JB0 E;  2D1X A;  2P0P A;  1G3S A;  1VYU A;  1TOV A;  2MK5 A;  4ANJ A;  2YWW A;  4DA4 A;  3ZFJ A;  3CPW A;  3GOX A;  4KBM B;  4M77 G;  2P4R A;  1WHL A;  5EC7 A;  2DEQ A;  2KT1 A;  1KFZ A;  3LW5 E;  2BZY A;  2DLP A;  2QA4 A;  2K2M A;  1PSE A;  2G6F X;  2LCL A;  2K3B A;  2LRQ A;  1AZE A;  3H0H A;  4M77 E;  2LNV A;  2VGN A;  2DA9 A;  1SPK A;  3CQT A;  1WLP B;  2RN8 A;  1TWB A;  4PKC C;  1U8R A;  3CXC P;  3NFC A;  4D8K A;  3EGU A;  3CCV A;  3CMA Q;  2KRS A;  4PJO F;  1XNI A;  4PL6 A;  2EYQ A;  5GAM d;  4GLK A;  3EGX A;  3CPW S;  2RI3 A;  3VYH B;  1WIE A;  3EFR A;  1PG5 B;  1G8X A;  1M30 A;  3NHN A;  2DZ9 A;  3CCU Q;  4L5G A;  2DL5 A;  2L3P A;  3G4S Q;  3RBB B;  1K73 C;  2LQW A;  3A8G B;  2JS2 A;  2DNU A;  1O9S A;  2BE7 D;  3O5Z A;  1WA7 A;  5IHN A;  4PK4 A;  1LCK A;  3VS0 A;  4KH1 B;  3PFS A;  4JRI A;  5LJ3 d;  1E6G A;  4M7A D;  1X2K A;  1OX8 A;  3MEV A;  1R0B G;  3VUZ A;  2MYS A;  2FL7 A;  3KBG A;  2KE9 A;  2X51 A;  3SFM A;  4BB7 A;  1QVF A;  1VQ7 A;  2DRM A;  1OI1 A;  2XKO C;  2EKH A;  3PGG A;  5CCA A;  2LQN A;  2CP6 A;  4JRQ A;  4L59 A;  2P0K A;  3N5B B;  4Z88 A;  3T9N A;  1VUB A;  2G3R A;  3UA6 A;  3FRN A;  3I56 A;  1VQ4 T;  4C5G A;  1SHF A;  1BCO A;  1VQ5 Q;  3S6W A;  2VXE A;  1B34 A;  4MZP A;  4KUL A;  1YN8 A;  2KXD A;  2CZ0 B;  1KQS A;  3M0S A;  1LJO A;  2QEX A;  1AVZ C;  2FB7 A;  4E7K A;  1QVF S;  5KE2 A;  1K4U S;  2EVR A;  4M78 G;  2X3W D;  3PVQ A;  3UAT A;  1YJW A;  2COY A;  3P8B B;  4XU0 A;  1QWE A; 
#chains in the Genus database with same CATH homology
 4N4I A;  3DB4 A;  3M56 A;  2K2V A;  3QII A;  3CME T;  1VQM T;  2VYT A;  4Z02 A;  3JCM d;  1B34 B;  4M75 C;  4EMH A;  1M9S A;  2F5T X;  4MZT A;  2CGH A;  2EWN A;  3MEA A;  3G71 T;  3TU4 K;  5D6X A;  1D3B B;  3QYG B;  3VJP A;  1OZ2 A;  3CCR T;  2EQK A;  4M78 E;  2R58 A;  1Q81 C;  1BI1 A;  2LQ8 A;  2RJF A;  4M77 D;  2XG8 D;  4N0A C;  4NS5 A;  1OYX A;  4A4E A;  5GMK h;  4Y91 A;  4E7J A;  1Q86 U;  2RM4 A;  5DY9 A;  2VC8 A;  3L2U A;  1YJW T;  3CCU A;  1WJR A;  2XK0 A;  5CQX A;  4IUU A;  4DOV A;  1WJS A;  2VXF A;  2GF7 A;  3DLM A;  2DAQ A;  3BFM A;  4C0G A;  4KUD K;  3OYY A;  1KQS S;  2RI2 A;  1FXX A;  2V8I A;  4JLG A;  3QJY A;  2GFU A;  2K3X A;  2DTO A;  3JCM h;  5GAN e;  1YJN A;  4RKU E;  1M1K C;  4M7D B;  1I8F A;  2DD5 A;  5AYF A;  2C06 A;  3PTA A;  3F70 A;  3SB2 A;  2HQX A;  2V8J A;  4OVA A;  1VQ9 A;  2RHZ A;  3CEY A;  3PIO A;  3CC2 T;  5FLX E;  4M75 A;  2MAM A;  1M1F A;  3M4Y A;  5HKC A;  3M58 A;  4C8Q E;  1WQW A;  3HL8 A;  4E7H A;  1KC8 C;  4XTY A;  1N9S A;  2KAF A;  3G4S T;  3UT1 A;  4FL6 A;  4MMK A;  4N0A A;  3H6Z A;  2LDM A;  2F69 A;  2WSC E;  4M7A A;  5CKH A;  4M7D G;  4ZN1 A;  4KUI A;  2VV5 A;  4RG2 A;  2YHT A;  3LYI A;  5HK0 A;  1I81 A;  1Q81 U;  1VQ6 A;  2E1H A;  3GP8 A;  3CBM A;  2EIF A;  1K8A C;  2Y90 A;  3TRE A;  3ZBD A;  5D6Y A;  4LD9 K;  3OYI A;  1VQK T;  3R6O A;  1UGP B;  2K5L A;  4BY6 B;  4D6W A;  3C94 A;  2BKD N;  4M75 F;  2KY9 A;  2WSE E;  4M75 B;  5I2S A;  2DJZ A;  3JB9 J;  4IUR A;  3NTH A;  4X34 A;  4MDW A;  3JCM Q;  1HXD A;  3I55 T;  4PJO D;  3GF5 A;  1UGQ B;  5CAI A;  3G6E T;  4BUG A;  5GAM g;  5GAN f;  2MI6 A;  1Q7Y U;  3OMC A;  2O4X A;  4BD3 A;  1JJ2 A;  1NJI U;  2EJG A;  3VYG A;  3QBY A;  2PU9 B;  2RB6 A;  3MCA B;  1VQ5 A;  2LVM A;  3MHX A;  2PVO B;  2RHX A;  4A4K A;  4E7I A;  2E70 A;  3HFN A;  3DLL A;  1Y07 A;  3OYL A;  1RL2 A;  3V8L A;  3M55 A;  3QO3 A;  3MET A;  2KDS A;  4Q5W A;  2KVQ G;  5EG2 A;  4M75 G;  1IRE B;  4OB2 B;  2D6F A;  3PIP A;  3JB9 H;  3L2Z A;  2DTI A;  3JAM E;  4NL3 A;  2VGM A;  1BIB A;  5GAN 3;  3HFO A;  2XID A;  2GFA A;  1N8R U;  4CI0 C;  5KE3 A;  3JCM P;  1OZ3 A;  3X25 B;  2F5K A;  3OBY A;  2DK3 A;  4A54 A;  3CCJ A;  3CCQ T;  5DLQ E;  3CCM T;  3HSB A;  3FLG A;  1KQ1 A;  2EQU A;  4FT4 A;  4C5I A;  3L2W A;  4M75 E;  2BUD A;  4LDY A;  3BW1 A;  1YI2 A;  4XTZ A;  3EAE A;  1QP3 A;  5LJ3 g;  3CXC A;  3JRZ A;  3JB9 F;  5GMK i;  3OSV A;  2RJE A;  4YTL A;  1BI2 A;  5LJ5 d;  5GAN d;  2QI2 A;  3UPU A;  2EQJ A;  1PSF A;  3GNG A;  3M4G A;  4BAC A;  2X4X A;  4QW2 A;  2JNG A;  4C92 C;  3LGL A;  3RUX A;  5LJ3 j;  2ZPE B;  5A0G A;  2RJC A;  1NE8 A;  3QZ5 B;  4HCB A;  4RMO A;  2CKK A;  1X75 C;  4XTU A;  3JCM c;  3UWN A;  3GLX A;  5GAM e;  2DPP B;  3CME A;  5GAN 6;  1BI3 A;  1VQM A;  3VUB A;  1U1S A;  3DB3 A;  5D6W A;  3G71 A;  1TH7 A;  3FEO A;  1WGS A;  2R5M A;  4DOW A;  1QP2 A;  3OSS C;  5LL6 S;  4R56 A;  3CCR A;  4ELZ C;  4WF2 A;  4OB3 B;  4A4F A;  1G5V A;  2L89 A;  2WAC A;  5LJ5 h;  1VQO T;  1LOJ A;  2PVG B;  2RO0 A;  5GAN h;  3CD6 T;  3P8H A;  4QVD A;  4PNO A;  5CIU A;  3QG1 A;  3NTK A;  3S3N A;  4PLI A;  4LDU A;  4RCC A;  3L2V A;  5FRO A;  4OGE A;  4Y28 E;  3M53 A;  2JUF A;  2YLC A;  3H8Z A;  4BDZ A;  4QQ6 A;  1O75 A;  2XHC A;  5I2M A;  4ZN3 A;  5GAN 7;  4C8Q B;  1X01 A;  3MEU A;  4M78 D;  4MML A;  5GAO m;  3JB9 I;  4QVC A;  2YRV A;  5J3B A;  4C0F A;  2JTM A;  3QXE B;  5IAY A;  2OAU A;  1G3W A;  4C92 A;  1VIE A;  4B9W A;  3FDR A;  1WQ7 A;  3CXC S;  1FX7 A;  2H3J A;  1VQL T;  3JCM J;  1XTD A;  4OB0 B;  2E41 A;  4M7A C;  1M90 U;  3QDR B;  3OB9 A;  3FIF A;  3M54 A;  5LJ3 e;  2GQV A;  3OS0 A;  3CCS T;  1N27 A;  3CC4 T;  2HAX A;  2JVV A;  5DLO A;  3G4S A;  4C8Q G;  5CVI A;  2XD0 A;  1KHI A;  1I5L A;  3QKJ A;  1H64 1;  1KHC A;  2E64 A;  3INZ A;  3UDC A;  5KCO A;  3M57 A;  2DKG A;  1VQ8 A;  5KCH A;  4JDS A;  2LX9 A;  4XQ3 A;  4C0D B;  3HRT A;  3CBO A;  5J39 A;  2DXT A;  2ZPH B;  3CBP A;  4C92 F;  2DXU A;  4F7U A;  4PJO A;  4J5Y A;  4J7I A;  4XAX B;  5J26 A;  3JCM g;  4C92 B;  1BYM A;  3S3O A;  1VQK A;  3OY9 A;  4X9C A;  2QDY B;  4CRI A;  3OW2 S;  2RHU A;  1UGS B;  3E1S A;  4HT8 A;  1BKB A;  3QPH A;  2M1H A;  2HQE A;  3SWN C;  3CCL T;  2M16 A;  1S72 A;  2GCX A;  3I55 A;  4O5V A;  4J6X A;  2QQS A;  3OS2 A;  3G6E A;  4R55 A;  1HK9 A;  2DZC A;  1N9R A;  2QQA A;  3A8L B;  3QHS A;  4E7L A;  5HK3 A;  3M5A A;  1VQ8 T;  1GXI E;  4L6V 5;  3X26 B;  2CYZ B;  3HKS A;  3Q1J A;  3GNF B;  3TEE A;  5IN1 A;  1K9M U;  3RIR A;  4C92 G;  4ZGJ B;  3OYM A;  3LGF A;  1MGQ A;  2QA4 T;  4M7D D;  3ER0 A;  3HRS A;  3OYB A;  3GPL A;  3L42 A;  4F7U F;  2LC4 A;  5LJ3 f;  4J8O A;  4OGC A;  4V2S A;  4C5H A;  4F7U B;  1R8O B;  1H3Z A;  3J81 E;  4FIB A;  1BI0 A;  2LTO A;  3JCM b;  2CS7 A;  1S72 T;  2K57 A;  4HCC A;  2ZPG B;  2NLU A;  2WSF E;  3G7Z A;  3PMI A;  5GMK m;  3C12 A;  3V8K A;  1M1K U;  4LDW A;  4M7A F;  5GAN 8;  1YJ9 A;  5CR2 A;  1NPP A;  4C92 E;  4M7A B;  2P4T A;  3SWN A;  3OMG A;  4FM4 B;  3CCQ A;  4J83 A;  4O6J A;  4BI3 A;  3JCM X;  2FVU A;  2ZPI B;  3VV0 A;  2RJD A;  2KQW A;  2OTJ T;  1YHQ T;  3CCV T;  3MP1 A;  4F7U G;  3OYC A;  4JS4 A;  5CQY A;  5GAM j;  1QVF A;  4GY5 A;  2KK4 A;  1KC8 U;  5A0D A;  1NPR A;  4OF1 A;  2K5I A;  3BY7 A;  2EFI A;  4JRK A;  4M77 C;  2MF2 A;  1V29 B;  4HA8 A;  2CZ6 B;  2MWO A;  3OS5 A;  4XU2 A;  2CZ7 B;  2IG0 A;  4M7A G;  4M75 D;  1I4K 1;  5C0M A;  4XU1 A;  1YJ9 T;  1X6O A;  2EJ9 A;  4J6W A;  3WVE B;  3OYG A;  1K8A U;  2O4X B;  4F7U E;  3OYH A;  2EJF A;  1W2B A;  3WXM B;  1M5Q 1;  2E6N A;  2QQB A;  3M59 A;  2LT4 A;  2E12 A;  4TVR A;  3SWN B;  4E47 A;  5GAO r;  3OYJ A;  3PNW C;  5FRM A;  3FB9 A;  3WVD B;  3QZ9 B;  3LH0 A;  1XQH A;  2D0Q B;  2HNI A;  3E19 A;  4C0Z A;  2M0O A;  4M78 A;  1VQO A;  2DIG A;  4UC4 A;  2LQK A;  3CD6 A;  4M7A E;  3V7C A;  5GAN 5;  5GAN 4;  2EKO A;  3RMQ A;  4VUB A;  3X20 B;  1Q82 C;  2OTL A;  1KQ2 A;  3ME9 A;  1QVP A;  3OYD A;  4JLI A;  2Y4X A;  1JJ2 S;  3V7R A;  3OBW A;  4IUP A;  5CKE A;  4BE1 A;  1KD1 C;  2X4W A;  2FHD A;  2DD4 A;  4M77 A;  3CCM A;  3OYA A;  5LJ3 h;  1WNL A;  4JUV A;  1YIJ T;  2QTX A;  2DXB A;  4EPC A;  4QQG A;  5FU6 C;  4LD6 A;  2HBP A;  3JB9 G;  2XDD A;  1VQL A;  2DXC A;  2ZGW A;  5M9O A;  4LDX A;  1VQN T;  4M7D C;  1VQ7 T;  1EIF A;  1U1T A;  3HP9 A;  2OTL T;  2PUO B;  1IZ6 A;  2EAY A;  5A0L A;  3KUF A;  5CO7 A;  3CCS A;  4ZTF A;  1Q86 C;  3CC4 A;  1AHJ B;  2RD1 A;  2X4J A;  5LJ5 g;  3OYN A;  4HKE A;  5KH6 A;  5GAN g;  3CC7 T;  2QQR A;  5GAO q;  1UB4 A;  2PQW A;  1UEB A;  3RMS A;  4EMK C;  4PJO C;  3RES A;  3X28 B;  4JJN K;  1W2B S;  4M77 F;  1RI0 A;  3FJP A;  3JSC A;  4M77 B;  2ZCF B;  3L2R A;  3QUI A;  3C95 A;  5LJ5 j;  2DO3 A;  4XTW A;  1W4S A;  5CKB A;  3BDU A;  3HHT B;  4OP0 A;  2PVD B;  3A5Z B;  3I56 T;  4ZTJ A;  2O01 E;  1Y71 A;  5IT9 E;  2R5A A;  1JB0 E;  3L2Q A;  3JCM V;  2K3Y A;  1G3S A;  2P0P A;  3OQ5 A;  3PMT A;  2L3R A;  4DA4 A;  3AHU A;  4JRP A;  3J7A F;  1P92 A;  3CCL A;  3ZFJ A;  5GAM f;  3QYH B;  4II1 A;  3CPW A;  4OMF B;  2RA2 A;  4BY6 C;  3GOX A;  4M7D A;  2VUB A;  4KBM B;  3MP8 A;  4EMG A;  4M77 G;  1G3T A;  3CCE T;  2QEX T;  1MHN A;  1KG1 A;  2DEQ A;  4C8Q D;  5FU7 C;  3RKX A;  3LW5 E;  5GMK j;  3SD4 A;  4ZGD B;  2V8K A;  3VKI A;  2QA4 A;  1QVG A;  2JZ2 A;  2Y4Y A;  4EMK A;  5A2Q E;  1ZQ1 A;  2P0Q A;  2ZPB B;  1PSE A;  5FRN A;  5CKF A;  4X9D A;  3OYK A;  1YIT A;  2XDB A;  4NL2 A;  2LCL A;  2LRQ A;  3CMA T;  5FU6 B;  4DQ2 A;  4M77 E;  2LNV A;  2RK2 A;  4BE2 A;  5C6S A;  2E65 A;  2VGN A;  3GIB A;  4M7D F;  4IUV A;  5LJ5 e;  2B8A A;  4PKC C;  3OS1 A;  1U8R A;  2DTH A;  1Q7Y C;  3NFC A;  3S3M A;  2E5Q A;  2D9T A;  1M8V A;  4XU3 A;  3CC2 A;  1NJI C;  4N4H A;  3RKY A;  2PUK B;  3QJ6 A;  4ME7 A;  2OTJ A;  4MZM A;  1YHQ A;  3CCV A;  4BI8 B;  2L5Q A;  2RH2 A;  2HD0 A;  4PJO F;  1XNI A;  1YIT T;  4PL6 A;  2EYQ A;  4EMK B;  5GAM d;  2QQ9 A;  3LWI A;  4GLK A;  4PJO B;  3MP6 A;  3CCU T;  4C92 D;  3CPW S;  2CZ1 B;  2RI3 A;  3VYH B;  2I2L A;  3X24 B;  4XTV A;  4QVZ A;  3EFR A;  1UGR B;  3DKM A;  1M4Z A;  4J7F A;  4A53 A;  5GMK e;  4A4G A;  1N8R C;  1YJN T;  3O8V A;  2RK1 A;  3A8M B;  3FC3 A;  4BI4 A;  1QVG S;  3M9Q A;  2DZ9 A;  4M78 C;  1BIA A;  4L5G A;  1VQ9 T;  2JTF A;  4PJO G;  4QQD A;  5GAN 2;  1VIF A;  5GAO p;  4C5E A;  1JRI A;  1K73 C;  3A8G B;  4ATO A;  5I21 A;  3LX7 A;  5GAM h;  4IUT A;  1O9S A;  4MDX A;  3JCM e;  4M7D E;  4JS5 A;  1FWZ A;  3E9G A;  4XK8 E;  5FU7 B;  5LJ5 f;  3OYE A;  2ZZD A;  3URG A;  4IKF A;  3PFS A;  5GAO l;  4KT0 E;  1ZBX A;  4BE0 A;  4JRI A;  1VQ6 T;  2A7Y A;  2R57 A;  5LJ3 d;  4PJO E;  4P5N A;  2IVW A;  1YIJ A;  2ZPF B;  4M7A D;  4J6Y A;  4OB1 B;  1WJQ A;  2XDP A;  5L8R E;  3J80 E;  3BDL A;  1WPY A;  4FT2 A;  4C8Q C;  3MEV A;  3RER A;  1LNX A;  2X35 A;  3VUZ A;  2XI9 A;  3ZEH A;  5DM7 R;  2MMP A;  2LCC A;  3KBG A;  2E6Z A;  2FL7 A;  4IUQ A;  2AHJ B;  3SFM A;  4BB7 A;  4ZGE B;  3OA6 A;  1VQ4 A;  1VQN A;  1VQ7 A;  4N4G A;  1VQP A;  3SDZ A;  4B9X A;  4HT9 A;  1OI1 A;  2XKO C;  2LT1 A;  3L1A A;  4PLL A;  3V8J A;  3CC7 A;  1N6A A;  3PGG A;  2E10 A;  1DJ7 B;  5CCA A;  3JCM W;  4JRQ A;  3A8H B;  3TCJ A;  1VQ5 T;  2DIQ A;  1JBM A;  4L59 A;  2P0K A;  1K9M C;  1K73 U;  2QXF A;  2FYK A;  3N5B B;  1VUB A;  2G3R A;  3T9N A;  4BDY A;  4RG8 A;  2K5F A;  3JCM f;  3CPF A;  1ZHI A;  3NTI A;  3FRN A;  2XU8 A;  1QW1 A;  1Y96 A;  4XTX A;  4LDV A;  3I56 A;  1VQ4 T;  4C5G A;  2X4Y A;  4FU6 A;  3MEW A;  4RCB A;  5CK9 A;  1VQP T;  2EQM A;  1G3Y A;  4M78 F;  4C0D C;  3V7S A;  3P8D A;  2A3L A;  2L8D A;  3MO8 A;  4M78 B;  1XOV A;  4C8Q A;  3JB9 D;  1M90 C;  3S6W A;  2VXE A;  2XIC A;  4NOY A;  3C4S A;  1B34 A;  3CCJ T;  3VU3 C;  4MZP A;  4KUL A;  1YCY A;  1D3B A;  2RHY A;  2CZ0 B;  3A8O B;  3ASK A;  1KQS A;  3QSU A;  4EDU A;  1LJO A;  3OYF A;  2QEX A;  3CCE A;  2FB7 A;  4ELY C;  3HRU A;  3PT9 A;  1YI2 T;  2DVE A;  3LLR A;  2YLB A;  4E7K A;  4A4H A;  2JN0 A;  2JOY A;  2RI5 A;  5GAN j;  1QVF S;  5KE2 A;  1Q82 U;  1NZ9 A;  3E9F A;  1YBY A;  4M78 G;  3EFS A;  4HCZ A;  3HPW A;  1YJW A;  3KXT A;  1Y96 B;  2KMT A;  3RKW A;  3OW2 A;  1KD1 U;  2M9U A;  2RHI A;  5GAO n;  3CMA A;  1Y7X A;  5HY6 A;  2KSS A;  4FSX A;  5CKD A;  3P8B B;  4C8Q F;  5GMK l;  3LWH A;  2MWP A;  4XU0 A;  1M1G A;  2K4Y A;  2BIV A;  1SSF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...