4M77A

Crystal structure of lsm2-8 complex, space group i212121
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
100
structure length
83
Chain Sequence
TLKDYLNKRVVIILVDGESLIASLNGFDKNTNLFLTNVFNRISKEFISKAQLLRGSEIALVGLIDAENDDSLIENEHVIWEKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 13
structure length 83
sequence length 100
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m77A00
5GAMe 4PJOD 4OP0A 5LJ3g 1D3BA 4C8QC 4M77C 4M78E 4XTWA 5GANj 2DTOA 2E10A 4M77F 4Y91A 3JCMe 4HT8A 3HSBA 1I81A 2K57A 4J6XA 4M77G 4C8QG 4MMLA 4M77B 3JCMc 1BIBA 4WF2A 4M75C 4EMKB 2DXUA 4C92D 3RUXA 3M4GA 4M75G 2JN0A 4M78B 3V8JA 4V2SA 2I2LA 5LJ3d 3SWNC 2RD1A 3HFOA 4MMKA 3BY7A 4NL2A 5GMKm 5LJ5g 5GAN4 4NL3A 3JCMW 3V8LA 2DEQA 1B34B 4M7AC 2YLCA 3JCMX 2VXFA 5GANg 4M77A 5GAN7 5GAN2 4QVCA 4XQ3A 4EMKA 5I21A 3JB9D 1Y96B 1YCYA 4C8QE 5GAMg 1I5LA 5GAOm 4QVDA 4M78A 3EFSA 1BIAA 3JCMg 1JBMA 3JCMV 2EJFA 4XTZA 5LJ3h 5LJ5d 1M8VA 4M75E 4C8QF 4RCBA 1HK9A 4C92C 2RM4A 5GANd 1TH7A 4C8QB 4M7AD 1B34A 4M78D 2Y90A 3V7SA 5GMKl 4PNOA 4RCCA 4XU3A 4M75F 3RIRA 3JCMJ 5GAMd 5GAN3 1Y96A 3BW1A 2E41A 4EMHA 4JLIA 4M75B 3JCMd 1I8FA 2CGHA 4XTVA 1H641 4XTYA 4M7AE 4DQ2A 3JB9J 3RERA 3JCMb 5GAN5 4M7DC 1N9SA 5LJ5h 4PJOE 5LJ3f 3BDUA 3EFRA 3QO3A 3SWNB 4M7DG 4M7AF 4C8QA 2DJZA 4F7UF 5GAN8 3GIBA 4N0AC 4PJOF 4M7AG 4PJOC 2DZ9A 2VC8A 2YHTA 4M7AB 4F7UG 5GAMh 3PGGA 3RKXA 4PJOG 4C92E 2EAYA 4HA8A 3FJPA 4M75A 4X9DA 4PJOB 2QTXA 4C8QD 4M77D 4JRKA 5LJ3j 2DXTA 4C92F 4JRIA 2ZGWA 5LJ5f 4EMGA 5GMKh 1JRIA 1LNXA 4M75D 3SWNA 4C92G 2VXEA 4C92B 1WQ7A 2RA2A 3L1AA 5GANf 5GAOp 1LOJA 4M7DE 3RESA 4M7AA 4XU0A 1N9RA 1U1TA 1LJOA 5GAMf 4PJOA 1U1SA 3SB2A 3V8KA 4J6YA 3AHUA 1WQWA 3QHSA 4XTXA 3JCMf 4F7UE 3HFNA 5GAOl 5GAOr 4M7DF 2DTIA 3JB9F 2E1HA 2E65A 5GAN6 4NOYA 5GAOn 5GANh 3JB9G 4M7DB 1KQ1A 3JB9I 3QSUA 4JUVA 4C92A 1M5Q1 4EMKC 1I4K1 1MGQA 1WPYA 3V7CA 3V7RA 4A54A 4F7UB 2YLBA 3RKWA 5LJ3e 5GAMj 3JCMh 4X9CA 2DZCA 4M78C 3JCMQ 4M78F 2DTHA 5GMKe 3JB9H 4J5YA 4M78G 3L2ZA 1X01A 1WNLA 2EWNA 2FYKA 4XU1A 5CAIA 4M7DA 1D3BB 1HXDA 4J6WA 4XTUA 4A53A 5GMKj 2FB7A 2HNIA 3RKYA 5GMKi 1KQ2A 3FB9A 4F7UA 5LJ5e 3JCMP 4XU2A 2EJ9A 4N0AA 4M7DD 5GAOq 4HT9A 3BFMA 2DVEA 2EJGA 3QUIA 5DY9A 3INZA 5GANe 4M77E 2E64A 2RB6A 3VU3C 5LJ5j 3FIFA 2DKGA
chains in the Genus database with same CATH superfamily
4HCBA 2DMOA 3JCMe 1E6GA 2EKHA 1H3HA 2JMAA 4QQ6A 1XOVA 1Y7XA 4FM4B 4M78B 1JJ2A 3VS4A 2RHYA 2MOXA 2L5QA 3DB3A 1TSFA 3BY7A 1AHJB 4TVRA 4KH1B 4RTWA 4IUUA 5GANg 2FRWA 3ZL7C 2HKQB 3H0HA 3OW2P 4C8QE 4BY6B 4LUEA 1E6HA 3EFOB 1SSHA 2EW3A 4RTZA 2DEUA 5FU6C 2HKNA 1Q82R 2J05A 3SFMA 4M78D 5FW9A 3WXMB 5GAMd 4ZGJB 4HKEA 1VQ7Q 2LQNA 2XMFA 1T0JA 2JNGA 2LQ8A 2DF6A 3FJPA 3X28B 3JSCA 5LJ3j 4E6RA 4BDZA 1BBZA 2B86A 3C0CA 2OTLT 2AK5A 2VGNA 4YTLA 5GAMf 3AHUA 1PG5B 1QKWA 1RAGB 2CUDA 1VQLA 5GANh 2K3YA 1Q86U 2LNVA 1ARKA 1D1BA 2LRQA 3NHNA 4HCKA 1EIFA 1VQKA 1OYXA 2DTHA 3OS2A 1NLOC 2COWA 3RKYA 2CH4W 1LPLA 1OPLA 3I56A 5GAOq 1WJQA 1FX7A 5LJ5j 1UHFA 2C0OA 5D6XA 3CCVA 3MEAA 4C8QC 1EX4A 2DTOA 2DILA 2CZ1B 2C0TA 2KI7A 4J6XA 2R5AA 2H8HA 2DXUA 2QA4Q 2LNHB 4OB2B 3MKDA 4HVWA 2KDSA 1IHWA 3EG2A 2FPDA 1YJWT 2H3JA 4R0KA 3E9GA 2X3WD 2P4RA 3OS5A 4NL2A 5GMKm 3CCLQ 1EFNA 3AT1B 3OYBA 2EQUA 2ZPIB 3A8LB 3OYHA 3A5ZB 3JB9D 4RUGA 4J9DA 2FPEA 1TUCA 4QQDA 1RUWA 4OMNA 4EDUA 1YIJT 2ABLA 3CC7T 2BUDA 2FVUA 1QVPA 1S72T 2SRCA 1HSQA 3LH0A 4RTXA 5A2QE 4OMMA 3OBYA 3JCMJ 2QDLA 4OF1A 2OI3A 1BKBA 4KULA 3LGLA 3HHTB 2CZ6B 2DK3A 2HBPA 1M3CA 3JB9J 5GAN5 2GQVA 2V8KA 1TUDA 1B7TA 5GAN8 4HXJA 1N6AA 1M30A 3RKXA 4E7LA 2P0KA 3UDCA 4C92F 3EGXA 1ZA1B 4EMGA 1D0XA 2VXEA 2RA2A 2X4JA 4KT0E 3G71T 4Z88A 2KT1A 1Q7YU 2E6NA 2KRSA 3RESA 1G2BA 4XU0A 1KG1A 1LJOA 4PJOA 1VQ7A 2KBTA 4OB0B 1HD3A 1UGRB 2E1HA 2E65A 4BACA 1M1GA 1FXXA 2BKDN 4XAXB 4EMKC 3V7RA 3H9NA 4A54A 1VOMA 1W6XA 2YUOA 4C0DB 3CXCS 1YWOA 3SHWA 1WNLA 2LTOA 1ZSGA 1KC8R 3TREA 3G6EQ 3CPFA 4QW2A 1WI7A 1IGUA 3VUBA 3EAEA 3INZA 4RKUE 2E3IA 1I5OB 1X2KA 2RB6A 4JDSA 4CRIA 4J83A 2NYSA 4CI0C 1VQ6Q 4RTUA 2MWPA 4M77B 3QYGB 4KGXB 4BE2A 2CP2A 5I22A 1RI9A 1MV0B 2DBKA 2XHCA 1WJSA 2HCKA 4QKUA 4B9WA 5LJ5g 4CC2A 4J7FA 2PVOB 4D8DA 5I21A 1N8RC 4HCZA 1GBQA 5IN1A 4LXCA 5LJ3h 1M8VA 1UUEA 3ZBDA 1YFNA 2FHDA 1AZEA 1X43A 4F14A 1QVGP 2RJCA 2HQEA 3CCLA 1OZ3A 3M9QA 1OULA 4PLIA 2O9SA 5CIUA 5FRMA 5I2SA 3PIOA 5KYXA 4M75A 2BTTA 3CCUQ 2CZ0B 4ZN3A 2LJ3A 4DOVA 3L2WA 1MUZA 2RHUA 2CSQA 2QQAA 2XDPA 5GAOp 5KCHA 4P5NA 1VQKT 3URGA 2RHZA 1ABOA 1RADB 3V8KA 5EG2A 2BZXA 3EG0A 4LDXA 1MNDA 4JJCA 3HTRA 1V29B 4F7UB 3I56T 4JJNK 2R58A 3CCVT 4XK8E 3UT1A 2XI9A 2P0PA 2YWWA 3CCJQ 1O75A 4XU1A 4A53A 2GQIA 2BIVA 4DA4A 5DLOA 3VYHB 2IIMA 1CKAA 3BFMA 4PJJA 5GANe 1SKUB 4BUGA 2XDDA 1X6OA 4PJOD 3J7AF 4XTWA 4D6WA 1M1KC 2ZPHB 4HT8A 3RDVA 3HSBA 3VUZA 4M77G 2QDYB 1M8MA 2HBWA 2JVVA 2ZCFB 4OMOA 3G6EA 1KHIA 1RAEB 3Q1JA 2JMCA 2X35A 1Z9ZA 4R55A 4BE0A 2YLCA 1K8AU 2JUFA 5KYYA 2EQKA 5GAMg 1ZQ1A 1LVKA 2E70A 4FL6A 2RQUA 3GLXA 1QMCA 2F5KA 3RMSA 2E3HA 3CC2Q 1VQ6A 2CZ7B 2Y90A 2FZKB 3VS3A 5HKCA 1J3TA 4A4KA 2P4TA 4EMHA 2KYMA 2DYIA 4XTVA 3JCMb 2O88A 3M57A 4PJOE 4L6V5 1K9MU 1WHJA 3CCQQ 4J8OA 2XD0A 4M7DG 4PLLA 2YUQA 1VQ7T 2L3RA 2DRMA 5A0DA 1SHGA 1JRIA 2BE7D 5IXBA 3MPUB 3THKA 1WQ7A 2E12A 4Q5WA 3GOXA 1RL2A 2EQIA 2MIOA 3OYDA 2RI2A 2DM1A 2GFUA 5IXFA 2DBMA 1CKBA 4F04B 1PC0A 2WSCE 2DL5A 1WIEA 2KQWA 1WZOA 2DO3A 2DIGA 3G71Q 3CCUA 3JCMQ 1ABQA 1VQ9A 5KYNA 3KXTA 3NTKA 1QWFA 1V76A 5IT9E 3META 1VQMT 2QI2A 5C6SA 2X3XD 2EJ9A 4N0AA 1SHFA 5DY9A 2QTXA 2NUTB 4ANJA 4PK4A 1M2VA 4GY5A 1OQKA 1AEYA 3P8DA 2DAQA 3CCJA 3HL8A 2I2LA 5LJ3d 1W2BP 2PZ1A 3REAB 1QCFA 3T9NA 4ELYC 2K6DA 5IAYA 5GAN7 2LX7A 4J9GA 1YCYA 5IHKA 4OB3B 3TVTA 3CCLT 4M78A 3OYKA 4O5VA 1VQPQ 4XTZA 4Z89A 1JJ2S 1NPRA 4M75E 1HK9A 2JZ2A 2K9GA 3NFCA 2RM4A 4LN2A 3JB9H 3FLGA 4BI8B 4XU3A 4ZGDB 1Y57A 2H3EB 2CT4A 1KHCA 3OYIA 3EFOA 1YN8A 1NLPC 5LJ3f 3BDUA 3I5SA 2EGEA 3QPHA 4M7AF 3QBYA 5IHNA 4C5IA 2DZ9A 4JPBW 3C4SA 3U23A 4JZ3A 4C0ZA 1W4SA 2JS0A 2FEIA 2LX9A 3CC2A 3TQ7P 3EG1A 4C92B 3R6NA 2YT6A 2OJ2A 2QEXQ 3OYMA 2QG9B 4M7DF 4QQGA 3CCQA 2YDLA 1VQOQ 1MHNA 3OYLA 4IUQA 1I1JA 2WSFE 4JRQA 4QVZA 3MP1A 1GCQC 1S1NA 5D6YA 3LX7A 4RTYA 3L2ZA 4BI3A 2CT3A 1OI1A 1UG1A 2ENMA 2GFAA 4XTUA 3PFSA 3DB4A 5LL6S 4JS5A 2L0AA 2LJ0A 5AT1B 2JTFA 5LJ5e 1M1KR 3QKJA 2LZ6B 1QVFA 3X20B 2XK0A 1FMWA 3SDZA 3JCMc 3LWHA 1IREB 4M75C 2CDTA 1Y07A 1U8RA 2WACA 3LLRA 4MMKA 2DL3A 3RMQA 4NL3A 2LCLA 2NUPB 1M90C 4ZNXA 3QG1A 4XQ3A 1Y96B 1ZBXA 3CPWA 1K73C 2DD4A 4RTVA 2CP7A 3UA7A 1TWBA 3V7SA 2G3RA 3FJ5A 4RG8A 2X4XA 3BW1A 1I8FA 3ZEHA 1FWZA 4IUVA 4CC7A 2KYBA 1BI3A 3HKSA 2CKKA 3EH2A 4JS4A 2EVRA 2KGTA 2KVQG 2FPFA 3O5ZA 1QCNA 1VQPA 3SD4A 4E7HA 2RK2A 4L59A 2FZGB 4C92G 4KH0B 3PVLA 4J7IA 3EG9B 1WHHA 2NWMA 3CCUT 3A1PA 3HRSA 2JW4A 1VQ9T 1K8AC 3OB9A 1NJIC 2AKKA 3M56A 5L8RE 1VA7A 3FC3A 3F70A 1SRMA 3CCMQ 2PUKB 1T0HA 2LVMA 4BDYA 2OAUA 1YCSB 3A8HB 2E4HA 1HXDA 2CP6A 1KQSA 1RACB 4PFZA 2QEXA 1AOJA 3MEWA 2LP5A 1CSKA 3CCJT 2ZPGB 1ZUYA 3L2RA 5GAMe 1VQOA 2W10A 4M78E 2ED0A 3REBB 3LYIA 4C8QG 1UGSB 5CQXA 1YNZA 2VASA 1VQMQ 2HSPA 4X1VA 1YP5A 1GFCA 1ZSZB 5I11A 4KUIA 1H3ZA 2DFUA 3J81E 1B34B 4M77A 5GAN2 3D7SB 1MNEA 3KUFA 4J9HA 4C5GA 1WHMA 5J26A 3L2QA 3JCMV 4FYXB 1Y71A 2M1HA 1UGQB 4BE1A 2K4YA 1QWEA 2V1RA 4AT1B 1F1BB 5GAN3 3OW2A 4ZTFA 4AFQC 2KK4A 5KH6A 5GJVB 1X6GA 4DEYA 3CC2T 4DQ2A 2YRCA 3VRZA 3OBWA 1AVZC 2V1QA 1YWPA 4N0AC 2JM8A 1D0ZA 2X9HA 4CC4B 2EAYA 3CCQT 3CCET 3L2VA 2ZGWA 1R77A 1G3TA 3S6WA 1Q82U 4KUDK 3LH5A 2EKOA 3M0QA 2M16A 4J6YA 1SF9A 3KFVA 1IRXA 2AT1B 1VIFA 2F69A 5FU7B 2DETA 2DL8A 4Z8AA 1WXTA 2K3BA 2BZ8A 6AT1B 1NG2A 4FIBA 4A4FA 2HL5C 4M78C 1ZLMA 2JJ9A 1GRIA 2RJDA 4DBRA 1EZZB 2LQWA 2JM9A 3QZ9B 5CKHA 5GMKi 4F7UA 1NEGA 1KD1C 2A37A 1E7OA 5DLQE 4BY6C 2L3QA 1BI0A 5CO7A 3RNJA 1KJWA 1P92A 1WLPB 1Q81C 5LJ3g 1QLYA 4FW1A 1I81A 1TG0A 2YRVA 4L5GA 3CCMA 4PFPA 2XKOC 3J80E 1M90R 1G3WA 3HFOA 2RJEA 2D9TA 3M59A 1PD1A 1K73R 2AKLA 2EYXA 2K5LA 1M2OA 1GL5A 3HRUA 2KXCA 4N4GA 4C8QF 4JJBA 2OAWA 3C94A 2VYTA 1NYFA 1VQMA 1VQPT 4N4HA 5C0MA 3M53A 2K3XA 4Y92A 2CGHA 2XICA 2EGCA 2RQVA 3RERA 1IHVA 4OB1B 5KYWB 3EFRA 2OX7A 3CD6Q 3SWNB 3FDRA 1D09B 3ME9A 2QQ9A 4M7AB 3I35A 3OYEA 1FMKA 4OVAA 4M77D 3LW5E 3QZ5B 1C1AA 2LCCA 4OMFB 3P8BB 4E7IA 1NJIR 1YI2Q 3CBPA 5KE3A 4ORZA 1OZ2A 1X2QA 1WQWA 1XQHA 3QHSA 4XTXA 2D0QB 3JV3A 1I07A 4M7DB 1AWOA 2PNIA 1PWTA 4JUVA 2QEXT 1KIKA 2ZZDA 1KK7A 5FROA 1RAFB 2EQJA 2J6OA 4M78F 1WXBA 2F2WA 1VQ9Q 1VQOT 1YJ9Q 3M58A 1I0CA 4FYYB 4FSXA 2HNIA 1BU1A 2GCXA 1B3QA 4M7DD 2KNBB 2DVEA 1UE9A 4M77E 3FIFA 3FEOA 1MMDA 3ER0A 2K2MA 1BYMA 2M02A 1WX6A 4WF2A 1YITQ 1MMNA 3NPFA 4RTTA 2NUTA 1VQ5Q 2DE0X 2VV5A 1G83A 2AIRB 2DEQA 3OYCA 1KC8U 3UATA 2HZYA 4QVCA 2K5FA 2MI6A 1QCOA 1WGSA 4IKFA 5ECAA 3X25B 3OYAA 3A8OB 1TS9A 3I55Q 1VYUA 2SEMA 4C5EA 3RIRA 1Y0MA 1RLPC 2DA9A 2HD0A 4A4HA 1H641 4XTYA 3GNFB 4J9CA 5HY6A 2MWOA 3QO3A 4NS5A 4MZMA 3GIBA 1Q86C 4M7AG 4C0DC 3BDLA 4LD6A 4JJDA 2J7IA 1QVGA 1UJ0A 3PMTA 3GP8A 4A63B 2L2PA 2F1LA 4FT2A 2AZVA 3H6ZA 5FWCA 3OY9A 2A3LA 2MYSA 4GBQA 2QAZA 1C0MA 1U1TA 2DD5A 3SB2A 4F7UE 1YBYA 2ZPBB 3JB9F 5J39A 3CCEQ 3CD6A 2A0FB 1KQ1A 1VQ4Q 3E2UA 3EGDB 2MAMA 4C92A 1M5Q1 2GTJA 1MGQA 2D1XA 2DZCA 1UB4A 1QKXA 2DIQA 1D3BB 4J6WA 2PTKA 1YI2A 1WYXA 2FB7A 1W70A 3CCMT 3VKIA 2PVGB 1BB9A 2QK0A 1Q81R 2DLPA 1G3YA 3A98A 3LWIA 4B6MA 2E64A 2Y4YA 4ZGEB 2J06A 1JO8A 4Y91A 1GCPA 2K57A 2C06A 4MMLA 1NEBA 4ME7A 3UWNA 1A0NB 4JZ4A 1YJ9A 5D6WA 1QVFS 1AWXA 1QQJA 5KYUB 3JCMW 5CKDA 2OTJQ 2GGRA 1T3SA 3HPWA 1JXOA 1WHGA 1BIAA 3OS0A 2B8AA 1YITA 2NUPA 3VYGA 4OMLA 4C0GA 4GLMA 2LDMA 1Y96A 1Q7YC 1MV3A 2MPXC 1VYVA 1XJWB 2BE9B 1VQ5A 2ZPEB 3CPWS 1RAAB 1N8RR 5AYFA 4PJOC 1X27A 3G4SQ 1RLQC 1GFDA 2RF0A 2DRKA 3OYJA 3OSSC 5CCAA 3UF4A 2PVDB 3OYNA 4Y28E 1MMAA 2V8JA 4VUBA 5D7UA 3I55A 5FU6B 2LCSA 3S3MA 3QJ6A 1ZA2B 2IPOB 1R8OB 3S3NA 2ED1A 3CBMA 2J6KA 2HEQA 1JEGA 3EG9A 1PM3A 5LJ3e 3RKWA 3WVDB 1C6VX 4LDUA 5CR2A 2JT4A 1X01A 3OYYA 1UTIA 4WCIA 4EPCA 5GMKj 1JB0E 2ECZA 2NUZA 5FRNA 3M55A 4PJMA 2HDAA 3QWXX 3CCEA 1JJ2P 2AZSA 1AT1B 1VQ4A 2KMTA 3GF5A 5L23A 3CBOA 4MZTA 3PE0A 1KQSS 5IHIA 4C92D 3M4GA 4M75G 2A28A 3E1SA 2HL3A 2ROTA 2DXBA 2O31A 1M9SA 3OMGA 3WVEB 2CREA 5CKEA 2DVJA 3EH1A 4FYVB 1O9SA 3M0SA 3CCSQ 1ZSZA 3TU4K 1W2BA 4Z02A 2KR3A 4OMPA 4C8QB 1B34A 5KE2A 4RMOA 3MEVA 2ZPFB 3JCMd 4ESRA 1UHCA 2K79A 1Q86R 1OU8A 2M51A 2P84A 8ATCB 3CCRQ 2KXDA 2OTJA 3KBGA 2A08A 4J9BA 1M4ZA 1FYNA 1AWJA 1NM7A 2DJZA 4F7UF 3CMAQ 4PJOF 3PGGA 4C92E 4HA8A 2QQRA 4RG2A 3VJPA 1M1FA 3OW2S 3PTAA 4C8QD 3CD6T 1ZUUA 3VRYA 2K5IA 3L42A 1PD0A 2KRMA 5IH2A 4KGZB 1WHKA 1WJRA 4E7JA 1VQNQ 2FG0A 4KRTA 1ZX6A 4DOWA 1X6BA 4DEXA 4FU6A 4D8KA 2RMOA 5KCOA 2RQWA 3JCMf 1QW1A 3CEYA 1YI2T 2DXCA 4PJLA 2XDBA 3JB9I 3G4SA 2ATCB 3VS1A 2O4XB 3G1JA 2KRNA 3A8MB 1M27C 3PT9A 1H92A 4ATOA 2EWNA 1AWWA 1UJYA 2EPDA 4XU2A 1YJ9T 2COYA 2KSSA 2QASA 4CC3A 1KFZA 4QT7A 1ACMB 2V26A 5FWBA 3LGFA 1HYOA 2D0NA 3G7ZA 4EMKB 1KSWA 2CP0A 3RUXA 5FLXE 3V8JA 2HSEB 2CUBA 1YITT 1SSFA 1K9MC 3DLMA 3JCMX 4II1A 2ESWA 2M0OA 4MDWA 2VVKA 8AT1B 2CP5A 1VQ5T 1VQ8A 5GAOm 4QVDA 2A7YA 1Q7YR 3I5RA 1M1KU 4C92C 3IQLA 4N4IA 3JRZA 4FYWB 4M75F 1BCMA 2EYYA 1ZBJA 1M3AA 4AFSC 3I55T 3M0PA 1X69A 3R6OA 2RQTA 2GTOA 4FCYA 3NMZC 2RHXA 2VC8A 3PVQA 1UDLA 4HCCA 3CCSA 4OGEA 5KYWA 3VS5A 2L3PA 4IUTA 5GMKh 3SWNA 1PCXA 5HK3A 1BCOA 2Y4XA 4M7AA 3MO8A 2JS2A 2LQKA 1U1SA 3TSWA 4AFUC 2JOYA 5GAOl 1V1CA 3HFNA 3CCRA 2DTIA 4AG1C 1OPKA 1SPKA 3HP9A 1IXDA 3CMAA 1W1FA 1I4K1 1OV3A 3PIPA 3CC4Q 2ZAEA 2GF7A 2E6ZA 1G3SA 1SRLA 1VQ4T 2F2XA 4M78G 4C0FA 3H41A 4MDXA 4M7DA 5CQYA 1RAIB 2RO0A 2J6FA 1JU5C 2FZCB 3OQ5A 1VQNA 2KT8A 3FB9A 5CVIA 2PQWA 1VIEA 2GNCA 2QGGA 1WHLA 1IGQA 3OYGA 4E7KA 1WFWA 4KGVB 4OP0A 2E10A 4LDYA 1YJNQ 3E19A 3BE3A 2X4YA 2E5KA 1TXQA 2F5TX 1XNIA 2FO0A 3EG3A 4GLKA 2HQHA 1OEBA 2QGFB 4E7SA 2DX1A 3E9FA 4BB7A 3V8LA 2HMAA 5CK9A 3UA6A 2VXFA 2DNUA 3M5AA 1TU0B 1TOVA 2DJQA 3UPUA 2LJ1A 5M9OA 2OTJT 2YRDA 1SG5A 1WXUA 4JRPA 3MJXA 2NLUA 1JQQA 5GMKl 3P8HA 2RQRA 1JXMA 4JLIA 1YHQQ 2MK5A 1R0BG 1ZUKA 3ASKA 1PNJA 7AT1B 1LCKA 1N9SA 2YXYA 3M0RA 2VUBA 3CMEQ 4K11A 1HJDA 1PSEA 3FRNA 2EYQA 3JAME 1D1AA 2VWFA 2P0QA 2CSIA 1IZ6A 3G4ST 4LDWA 2EIFA 4DBHA 5HCKA 2M9UA 5GAOr 3TCJA 1QVGS 3NTIA 3MP8A 4NOYA 4B9XA 3EGUA 3JB9G 3QJYA 4BI4A 2VB6A 1N5ZA 2C0IA 2EQMA 3CXCP 3GBQA 3OMCA 4KBMB 5GAMj 3TSZA 4A4EA 2CH4A 1ZSZC 4J5YA 1K8AR 3M0UA 4ZN1A 4MZPA 3EGDA 2R5MA 1B07A 2KROA 1PKTA 4M4ZA 2EYZA 2EJGA 1UEBA 2X51A 1OOTA 4M7AD 2O01E 1GCQA 1D3BA 3X24B 3CC4A 4LE9A 4AG2C 1ZHIA 3M4YA 2QA4A 1VQ8T 5EC7A 1K9MR 1XTDA 3RBBB 1U06A 3GNGA 1T3LA 4IIOA 3A8GB 1X75C 5A0GA 4HVUA 3JCMg 4DBQA 2EJFA 1YJNA 4EIKA 5KYUA 1VQLT 2EBPA 2RI5A 1PKSA 5HK0A 2LT1A 2LMJA 5GANd 1TH7A 1D0YA 4O6JA 1RI0A 3VS2A 3VS0A 4PNOA 1OX9A 3CCST 4M7AE 2XU8A 1U3OA 2RI3A 5FU7C 5LJ5h 3EGXB 1M90U 1TTHB 2G6FX 1K73U 4PKCC 1GBRA 5DM7R 4PJOB 3CCRT 2OTLQ 2DPPB 3CMAT 3TEEA 2CP3A 3L1AA 5GANf 2O2OA 1YHQA 4M7DE 3CXCA 3L2UA 3MP6A 1WA7A 3QXEB 2IG0A 3VS7A 1VQNT 3CMEA 3V7CA 4R56A 2YLBA 3JCMh 1K76A 4X9CA 1NZ9A 3OA6A 3PNWC 5GMKe 1PSFA 2M0YA 2QTVA 2LC4A 2FYKA 1NPPA 1U5SA 1K0SA 1AZGB 2PU9B 1KQ2A 2IVWA 2CS7A 3MEUA 3VV0A 2K2VA 1UGPB 3H0IA 3ZFJA 1NJIU 3DKMA 2RNAA 4LDVA 2YUPA 1DJ7B 2V8IA 4M77C 1YJWQ 3CQTA 4FSSA 4J9FA 4WTOB 2JTEA 1BIBA 4F17A 1PRLC 2JN0A 1KD1R 4ELZC 1BI1A 3SWNC 2RD1A 1YIJQ 5GAN4 1PHTA 3CC7Q 4M7AC 2O9VA 2DERA 1S72Q 4AFZC 4FT4A 3DLLA 1I5LA 2QQBA 3GPLA 3C95A 2EFIA 5GJWB 4OMQA 2AHJB 3NTHA 1UGVA 4RCBA 2JXBA 4RCCA 3EHRA 3NGPA 2PUOB 1UECA 4A4GA 5KYXB 4M75B 2L3SA 4UC4A 1Q82C 1IB8A 1MMGA 2ROLA 4M7DC 1Q95G 1W2BS 1BK2A 4DBFA 4C8QA 2HQXA 4PJNA 2GBQA 2W0ZA 4F7UG 5GAMh 4PJOG 1Z9QA 2EYWA 3O8VA 2E5QA 3ULRB 4JRKA 2HAXA 2DXTA 3S3OA 4JRIA 4M75D 1LNXA 3QDFA 3I9QA 1RAHB 2RK1A 4FW2A 3N5BB 3M0TA 1LOJA 4F16A 3HRTA 1N9RA 3QYHB 4ZTJA 2VGMA 1H8KA 2QYZA 2RH2A 2YSQA 1OX8A 3QSUA 4LD9K 2WSEE 1UFFA 3OYFA 2OTLA 1K9AA 1QVFP 4C5HA 4E7ZA 4J9EA 5CKFA 2L89A 3CC4T 2QA4T 3JCMP 3C12A 4PFOA 1BI2A 4HT9A 2O4XA 2KY9A 2A36A 2E41A 1VUBA 1N27A 1K0XA 2DKGA 2XIDA 4AMCA 3MHXA 5GANj 4X34A 4M77F 1PRMC 3OS1A 1OU9A 2RHIA 2F2VA 5KYYB 2LT4A 1NYGA 1TUGB 2D8HA 3X26B 3CPWP 2YUNA 4J9IA 1YJNT 1NBEB 4E2FB 4V2SA 2FL7A 3QDRB 5J3BA 4LNPA 2RPNA 2Z0WA 1QP3A 3OSVA 2QQSA 1KD1U 2CYZB 1M3BA 4EMKA 3QWYA 2JTMA 1RABB 2MCNA 1VQ8Q 3EFSA 1Q81U 1JBMA 4IURA 5LJ5d 3SEMA 1YJWA 2KAFA 1SEMA 2BZYA 5CKBA 1G5VA 2X4WA 2L8DA 2EGAA 2I0NA 3RR6A 2D6FA 2VKNA 1YIJA 3CC7A 1GXIE 1VQLQ 4LUDA 1S72A 1YHQT 3H8ZA 2YHTA 3EHQA 1G8XA 4X9DA 1VQKQ 2RN8A 1WDXA 5LJ5f 2DL7A 3CMET 2COZA 3QIIA 9ATCB 4OGCA 2KEAA 1NE8A 4JLGA 3VS6A 1K4US 3I56Q 2R57A 2KE9A 3MCAB 4BD3A 5GAN6 5A0LA 3G6ET 5GAOn 3CCVQ 1KQSP 1N8RU 1IO6A 2D8JA 3H0FA 2RJFA 1WPYA 2MMPA 1K1ZA 2DL4A 3PMIA 3G71A 5I2MA 2MF2A 2XG8D 2QXFA 2K7AA 1AD5A 1VYTA 5CAIA 1M2VB 1VQ6T 1QP2A 4HVVA 4PL6A 1FMVA 1D1CA 2DYBA 1R0CB 1KC8C 3QUIA 2FRYA 4E47A 4IUPA 3VU3C 4IIMA 3M54A
chains in the Genus database with same CATH topology
4HCBA 3FEOA 4E7KA 3ER0A 4OP0A 2E10A 4LDYA 3JCMe 3E19A 4GY5A 2X4YA 3P8DA 1BYMA 2F5TX 4WF2A 2DAQA 4QQ6A 1XOVA 1Y7XA 4FM4B 4M78B 3CCJA 1XNIA 1JJ2A 3HL8A 2RHYA 2I2LA 4GLKA 5LJ3d 2L5QA 3DB3A 3BY7A 2VV5A 1AHJB 4TVRA 3T9NA 3E9FA 4BB7A 3V8LA 2DEQA 4ELYC 5CK9A 5IAYA 4IUUA 5GANg 2VXFA 5GAN7 3OYCA 3M5AA 1KC8U 4QVCA 2K5FA 3UPUA 2MI6A 1YCYA 1WGSA 4C8QE 4BY6B 3X25B 4IKFA 4OB3B 3CCLT 4M78A 3OYAA 3OYKA 4O5VA 5M9OA 4XTZA 2OTJT 1JJ2S 1NPRA 4M75E 5FU6C 1HK9A 2JZ2A 3NFCA 4JRPA 2RM4A 3SFMA 3A8OB 2NLUA 4M78D 5GMKl 3JB9H 3FLGA 3P8HA 4BI8B 4XU3A 4C5EA 3RIRA 3WXMB 4ZGDB 5GAMd 2HD0A 4ZGJB 3OYIA 1KHCA 4HKEA 4JLIA 4A4HA 1H641 4XTYA 3GNFB 3ASKA 5HY6A 2MWOA 1N9SA 5LJ3f 3BDUA 3QO3A 3QPHA 4NS5A 4M7AF 4MZMA 2VUBA 3QBYA 3GIBA 4C5IA 1Q86C 4M7AG 2DZ9A 4C0DC 2JNGA 2LQ8A 3BDLA 3C4SA 4LD6A 4C0ZA 1W4SA 3FJPA 1PSEA 1QVGA 3X28B 2LX9A 3JSCA 3PMTA 3FRNA 5LJ3j 2EYQA 3GP8A 3CC2A 3JAME 4FT2A 2P0QA 3H6ZA 4BDZA 1IZ6A 3OY9A 3G4ST 4C92B 2A3LA 4LDWA 2OTLT 2EIFA 2VGNA 4YTLA 2M9UA 1U1TA 5GAMf 2DD5A 3SB2A 3OYMA 3AHUA 4F7UE 5GAOr 1YBYA 2ZPBB 4M7DF 3TCJA 1QVGS 3NTIA 3JB9F 4QQGA 3CCQA 5J39A 3MP8A 3CD6A 4NOYA 4B9XA 1VQLA 5GANh 3QJYA 3JB9G 1KQ1A 2K3YA 4BI4A 1Q86U 1MHNA 2MAMA 4C92A 2LNVA 3OYLA 4IUQA 1M5Q1 2EQMA 1MGQA 2WSFE 4JRQA 3OMCA 4KBMB 4QVZA 5GAMj 2LRQA 3MP1A 1EIFA 2DZCA 1VQKA 1UB4A 1OYXA 4A4EA 2DTHA 4J5YA 5D6YA 3LX7A 2DIQA 3L2ZA 4BI3A 1OI1A 4ZN1A 3OS2A 1D3BB 2GFAA 4J6WA 4MZPA 3PFSA 4XTUA 2FB7A 1YI2A 2R5MA 3DB4A 3RKYA 5LL6S 3CCMT 4JS5A 3VKIA 2PVGB 2JTFA 5LJ5e 1G3YA 3I56A 5GAOq 3LWIA 2EJGA 3QKJA 1UEBA 1WJQA 1QVFA 1FX7A 2E64A 4M7AD 5LJ5j 2Y4YA 3X20B 4ZGEB 5D6XA 3CCVA 2O01E 2XK0A 3MEAA 1D3BA 4C8QC 2DTOA 4Y91A 2CZ1B 2K57A 3SDZA 4J6XA 2C06A 3X24B 4MMLA 3JCMc 3LWHA 2R5AA 3CC4A 1IREB 4M75C 1ZHIA 3M4YA 2QA4A 2DXUA 1VQ8T 4ME7A 1Y07A 4OB2B 3UWNA 1U8RA 2KDSA 2WACA 1XTDA 1YJ9A 5D6WA 1YJWT 2H3JA 3E9GA 1QVFS 3LLRA 3GNGA 4MMKA 3RMQA 3OS5A 4NL2A 5GMKm 3JCMW 4NL3A 3OYBA 5CKDA 2LCLA 2EQUA 2ZPIB 1M90C 3A8LB 3OYHA 3A5ZB 3QG1A 4XQ3A 3JB9D 3HPWA 1Y96B 1ZBXA 3A8GB 3CPWA 1X75C 1K73C 4QQDA 5A0GA 2DD4A 1YIJT 4EDUA 1BIAA 3JCMg 3OS0A 2EJFA 3CC7T 2BUDA 1YJNA 1VQLT 2FVUA 2RI5A 1QVPA 1S72T 5HK0A 2LT1A 2B8AA 1TH7A 3LH0A 5GANd 4O6JA 5A2QE 1RI0A 3V7SA 2G3RA 3OBYA 4PNOA 4RG8A 3VYGA 4C0GA 3JCMJ 1YITA 4OF1A 2X4XA 2LDMA 1Y96A 3CCST 3BW1A 1Q7YC 1BKBA 4KULA 1I8FA 3LGLA 3HHTB 3ZEHA 1FWZA 2CZ6B 2DK3A 2HBPA 4IUVA 2XU8A 5FU7C 2RI3A 2ZPEB 3CPWS 3JB9J 1VQ5A 4M7AE 5GAN5 5LJ5h 1BI3A 2GQVA 3HKSA 2CKKA 2V8KA 1M90U 4JS4A 5AYFA 4PJOC 5GAN8 2KVQG 1K73U 1N6AA 4PKCC 3RKXA 5DM7R 3OYJA 3OSSC 5CCAA 3CCRT 1VQPA 4E7LA 2PVDB 4PJOB 2P0KA 3OYNA 2DPPB 3UDCA 4Y28E 3SD4A 5FRNA 2V8JA 4C92F 4VUBA 2RK2A 4L59A 4E7HA 3I55A 3CMAT 4EMGA 5FU6B 3TEEA 4C92G 2VXEA 3S3MA 2RA2A 2X4JA 3L1AA 3QJ6A 4J7IA 4KT0E 5GANf 3G71T 1Q7YU 3CCUT 2E6NA 3RESA 1YHQA 4M7DE 1R8OB 4XU0A 1KG1A 3CXCA 3HRSA 3S3NA 1LJOA 1VQ9T 4PJOA 3L2UA 1K8AC 3MP6A 1VQ7A 3OB9A 3CBMA 1NJIC 4OB0B 3QXEB 1UGRB 2E1HA 2E65A 2IG0A 3M56A 5L8RE 4BACA 1VQNT 1M1GA 3FC3A 1FXXA 3CMEA 3F70A 2BKDN 4XAXB 4EMKC 3V7RA 3V7CA 5LJ3e 4A54A 4R56A 2YLBA 3RKWA 3JCMh 4X9CA 3WVDB 4C0DB 2PUKB 1NZ9A 4LDUA 3OA6A 3PNWC 3CXCS 5CR2A 5GMKe 1PSFA 2LVMA 1X01A 1WNLA 3OYYA 4BDYA 2LC4A 2OAUA 2LTOA 2FYKA 3A8HB 1HXDA 3TREA 4EPCA 3CPFA 1JB0E 1NPPA 4QW2A 5GMKj 1KQSA 1KQ2A 2PU9B 2QEXA 2IVWA 2CS7A 3VUBA 3MEUA 3VV0A 3M55A 2K2VA 1UGPB 3MEWA 3EAEA 3ZFJA 2ZPGB 3CCJT 1NJIU 3DKMA 3INZA 4RKUE 3CCEA 2RB6A 3L2RA 4LDVA 4JDSA 5GAMe 1DJ7B 1VQ4A 2KMTA 2V8IA 1VQOA 3GF5A 4M77C 4M78E 4CRIA 3CBOA 4J83A 4MZTA 3LYIA 4C8QG 4CI0C 1KQSS 2MWPA 1UGSB 4M77B 1BIBA 3QYGB 5CQXA 4C92D 4BE2A 3M4GA 4M75G 2JN0A 2XHCA 4ELZC 3E1SA 1WJSA 1BI1A 3SWNC 2RD1A 4KUIA 4B9WA 5LJ5g 1H3ZA 5GAN4 3J81E 4J7FA 2DXBA 1B34B 4M7AC 2PVOB 1M9SA 4M77A 5GAN2 3OMGA 5I21A 3WVEB 5CKEA 3KUFA 4FT4A 3DLLA 4C5GA 1N8RC 1I5LA 4HCZA 5J26A 2QQBA 1O9SA 5IN1A 3L2QA 3GPLA 3JCMV 3C95A 2EFIA 5LJ3h 3TU4K 1W2BA 1M8VA 2AHJB 3NTHA 4RCBA 4Z02A 1Y71A 2M1HA 4C8QB 1B34A 1UGQB 4BE1A 3ZBDA 4RCCA 2K4YA 2PUOB 5KE2A 4A4GA 5GAN3 4RMOA 2FHDA 3OW2A 3MEVA 2ZPFB 4M75B 4UC4A 3JCMd 2KK4A 4ZTFA 5KH6A 1Q82C 2RJCA 2HQEA 3CC2T 4DQ2A 3CCLA 1OZ3A 3M9QA 4M7DC 4PLIA 3OBWA 2OTJA 3KBGA 1W2BS 5CIUA 1M4ZA 4C8QA 2HQXA 5FRMA 2DJZA 4F7UF 5I2SA 3PIOA 4N0AC 4PJOF 4F7UG 5GAMh 3PGGA 4PJOG 4C92E 2EAYA 4HA8A 2QQRA 4M75A 4RG2A 1M1FA 3O8VA 3VJPA 3PTAA 3OW2S 2E5QA 4C8QD 4JRKA 2CZ0B 4ZN3A 3CCQT 2HAXA 3CCET 3CD6T 4DOVA 2DXTA 3L2VA 2K5IA 3L42A 4JRIA 2ZGWA 3S3OA 4M75D 1LNXA 3L2WA 2RHUA 2QQAA 2XDPA 2RK1A 1G3TA 1WJRA 3S6WA 5GAOp 3N5BB 5KCHA 1LOJA 4E7JA 4P5NA 4DOWA 1Q82U 1VQKT 3HRTA 2RHZA 4FU6A 3URGA 4KUDK 1N9RA 2EKOA 3V8KA 3QYHB 2M16A 4J6YA 2VGMA 5KCOA 4ZTJA 3JCMf 1QW1A 5EG2A 3CEYA 2F69A 2RH2A 1VIFA 2DXCA 5FU7B 1YI2T 4LDXA 2XDBA 3JB9I 3QSUA 4LD9K 1V29B 2WSEE 3G4SA 4F7UB 3I56T 4FIBA 4A4FA 3OYFA 2OTLA 4M78C 2O4XB 4JJNK 2R58A 2RJDA 3A8MB 4C5HA 3CCVT 4XK8E 3PT9A 3UT1A 2XI9A 2P0PA 4ATOA 2EWNA 1O75A 4XU1A 5CKFA 4A53A 3QZ9B 2BIVA 2L89A 4DA4A 5CKHA 3CC4T 5GMKi 5DLOA 3VYHB 2QA4T 4F7UA 1KD1C 5DLQE 4BY6C 3C12A 4XU2A 3JCMP 1BI2A 1BI0A 5CO7A 1YJ9T 4HT9A 2O4XA 3BFMA 5GANe 1P92A 2KY9A 2E41A 4BUGA 2KSSA 1VUBA 1X6OA 1N27A 2XDDA 2DKGA 2XIDA 4PJOD 3J7AF 3MHXA 1Q81C 5LJ3g 5GANj 4XTWA 4X34A 4D6WA 4M77F 1M1KC 3LGFA 3OS1A 2ZPHB 4HT8A 3HSBA 1I81A 3VUZA 2YRVA 4L5GA 2RHIA 4M77G 2QDYB 3G7ZA 3CCMA 4EMKB 2LT4A 3RUXA 2XKOC 5FLXE 2JVVA 2ZCFB 3X26B 3J80E 3V8JA 4V2SA 1YJNT 2FL7A 3QDRB 5J3BA 3G6EA 1G3WA 1KHIA 3HFOA 2RJEA 2D9TA 3M59A 1QP3A 1SSFA 3Q1JA 1YITT 3OSVA 2QQSA 1K9MC 3DLMA 1KD1U 2X35A 4R55A 2CYZB 4BE0A 2YLCA 3JCMX 1K8AU 4II1A 2M0OA 4MDWA 2K5LA 4EMKA 2JUFA 2EQKA 2JTMA 5GAMg 1VQ5T 1VQ8A 5GAOm 4QVDA 1ZQ1A 2E70A 2A7YA 3EFSA 3HRUA 4N4GA 4FL6A 1Q81U 1JBMA 4IURA 3GLXA 5LJ5d 1YJWA 4C8QF 1M1KU 2KAFA 2F5KA 3RMSA 4C92C 3C94A 4N4IA 2VYTA 1VQ6A 2CZ7B 5CKBA 1G5VA 2Y90A 3JRZA 2X4WA 5HKCA 4M75F 2L8DA 4A4KA 1VQMA 2P4TA 1VQPT 4N4HA 4EMHA 3M53A 5C0MA 2K3XA 2CGHA 4XTVA 2XICA 2D6FA 3RERA 3JCMb 3I55T 1YIJA 4OB1B 3M57A 4PJOE 4L6V5 3EFRA 1K9MU 3CC7A 1GXIE 4J8OA 3SWNB 2XD0A 3FDRA 4M7DG 3R6OA 1S72A 1YHQT 4PLLA 3ME9A 2QQ9A 2RHXA 3H8ZA 2VC8A 2YHTA 4M7AB 1VQ7T 3OYEA 4OVAA 4X9DA 4HCCA 3CCSA 4M77D 4OGEA 2L3RA 3LW5E 5A0DA 3QZ5B 5LJ5f 4IUTA 3CMET 2LCCA 1JRIA 3SWNA 4OMFB 3P8BB 3QIIA 5GMKh 4E7IA 4OGCA 5HK3A 1WQ7A 2E12A 2Y4XA 3CBPA 5KE3A 4M7AA 4Q5WA 1NE8A 3MO8A 2LQKA 3GOXA 1RL2A 4JLGA 1OZ2A 1U1SA 2GFUA 2RI2A 3OYDA 2JOYA 1WQWA 1XQHA 3QHSA 4XTXA 5GAOl 2D0QB 3HFNA 3CCRA 2R57A 2DTIA 3MCAB 4BD3A 5GAN6 5A0LA 3G6ET 5GAOn 2WSCE 4M7DB 3HP9A 2KQWA 3CMAA 4JUVA 2QEXT 1N8RU 2DO3A 1I4K1 1WPYA 2RJFA 2MMPA 2DIGA 2ZZDA 3PMIA 5FROA 5I2MA 3G71A 2MF2A 3PIPA 3CCUA 2GF7A 2E6ZA 2EQJA 3JCMQ 2XG8D 2QXFA 1G3SA 4M78F 1VQ9A 1VQ4T 3KXTA 3NTKA 4M78G 1VQOT 3M58A 4C0FA 4MDXA 5CAIA 4M7DA 5CQYA 2RO0A 1VQ6T 1QP2A 5IT9E 3OQ5A 4PL6A 4FSXA 1VQNA 2HNIA 3META 3FB9A 5CVIA 2GCXA 2PQWA 2QI2A 5C6SA 1VIEA 1VQMT 2EJ9A 4N0AA 4M7DD 1KC8C 3OYGA 2DVEA 3QUIA 5DY9A 4E47A 4IUPA 4M77E 2QTXA 3VU3C 3FIFA 3M54A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAM e;  4PJO D;  4OP0 A;  5LJ3 g;  1D3B A;  4C8Q C;  4M77 C;  4M78 E;  4XTW A;  5GAN j;  2DTO A;  2E10 A;  4M77 F;  4Y91 A;  3JCM e;  4HT8 A;  3HSB A;  1I81 A;  2K57 A;  4J6X A;  4M77 G;  4C8Q G;  4MML A;  4M77 B;  3JCM c;  1BIB A;  4WF2 A;  4M75 C;  4EMK B;  2DXU A;  4C92 D;  3RUX A;  3M4G A;  4M75 G;  2JN0 A;  4M78 B;  3V8J A;  4V2S A;  2I2L A;  5LJ3 d;  3SWN C;  2RD1 A;  3HFO A;  4MMK A;  3BY7 A;  4NL2 A;  5GMK m;  5LJ5 g;  5GAN 4;  4NL3 A;  3JCM W;  3V8L A;  2DEQ A;  1B34 B;  4M7A C;  2YLC A;  3JCM X;  2VXF A;  5GAN g;  4M77 A;  5GAN 7;  5GAN 2;  4QVC A;  4XQ3 A;  4EMK A;  5I21 A;  3JB9 D;  1Y96 B;  1YCY A;  4C8Q E;  5GAM g;  1I5L A;  5GAO m;  4QVD A;  4M78 A;  3EFS A;  1BIA A;  3JCM g;  1JBM A;  3JCM V;  2EJF A;  4XTZ A;  5LJ3 h;  5LJ5 d;  1M8V A;  4M75 E;  4C8Q F;  4RCB A;  1HK9 A;  4C92 C;  2RM4 A;  5GAN d;  1TH7 A;  4C8Q B;  4M7A D;  1B34 A;  4M78 D;  2Y90 A;  3V7S A;  5GMK l;  4PNO A;  4RCC A;  4XU3 A;  4M75 F;  3RIR A;  3JCM J;  5GAM d;  5GAN 3;  1Y96 A;  3BW1 A;  2E41 A;  4EMH A;  4JLI A;  4M75 B;  3JCM d;  1I8F A;  2CGH A;  4XTV A;  1H64 1;  4XTY A;  4M7A E;  4DQ2 A;  3JB9 J;  3RER A;  3JCM b;  5GAN 5;  4M7D C;  1N9S A;  5LJ5 h;  4PJO E;  5LJ3 f;  3BDU A;  3EFR A;  3QO3 A;  3SWN B;  4M7D G;  4M7A F;  4C8Q A;  2DJZ A;  4F7U F;  5GAN 8;  3GIB A;  4N0A C;  4PJO F;  4M7A G;  4PJO C;  2DZ9 A;  2VC8 A;  2YHT A;  4M7A B;  4F7U G;  5GAM h;  3PGG A;  3RKX A;  4PJO G;  4C92 E;  2EAY A;  4HA8 A;  3FJP A;  4M75 A;  4X9D A;  4PJO B;  2QTX A;  4C8Q D;  4M77 D;  4JRK A;  5LJ3 j;  2DXT A;  4C92 F;  4JRI A;  2ZGW A;  5LJ5 f;  4EMG A;  5GMK h;  1JRI A;  1LNX A;  4M75 D;  3SWN A;  4C92 G;  2VXE A;  4C92 B;  1WQ7 A;  2RA2 A;  3L1A A;  5GAN f;  5GAO p;  1LOJ A;  4M7D E;  3RES A;  4M7A A;  4XU0 A;  1N9R A;  1U1T A;  1LJO A;  5GAM f;  4PJO A;  1U1S A;  3SB2 A;  3V8K A;  4J6Y A;  3AHU A;  1WQW A;  3QHS A;  4XTX A;  3JCM f;  4F7U E;  3HFN A;  5GAO l;  5GAO r;  4M7D F;  2DTI A;  3JB9 F;  2E1H A;  2E65 A;  5GAN 6;  4NOY A;  5GAO n;  5GAN h;  3JB9 G;  4M7D B;  1KQ1 A;  3JB9 I;  3QSU A;  4JUV A;  4C92 A;  1M5Q 1;  4EMK C;  1I4K 1;  1MGQ A;  1WPY A;  3V7C A;  3V7R A;  4A54 A;  4F7U B;  2YLB A;  3RKW A;  5LJ3 e;  5GAM j;  3JCM h;  4X9C A;  2DZC A;  4M78 C;  3JCM Q;  4M78 F;  2DTH A;  5GMK e;  3JB9 H;  4J5Y A;  4M78 G;  3L2Z A;  1X01 A;  1WNL A;  2EWN A;  2FYK A;  4XU1 A;  5CAI A;  4M7D A;  1D3B B;  1HXD A;  4J6W A;  4XTU A;  4A53 A;  5GMK j;  2FB7 A;  2HNI A;  3RKY A;  5GMK i;  1KQ2 A;  3FB9 A;  4F7U A;  5LJ5 e;  3JCM P;  4XU2 A;  2EJ9 A;  4N0A A;  4M7D D;  5GAO q;  4HT9 A;  3BFM A;  2DVE A;  2EJG A;  3QUI A;  5DY9 A;  3INZ A;  5GAN e;  4M77 E;  2E64 A;  2RB6 A;  3VU3 C;  5LJ5 j;  3FIF A;  2DKG A; 
#chains in the Genus database with same CATH topology
 4HCB A;  2DMO A;  3JCM e;  1E6G A;  2EKH A;  1H3H A;  2JMA A;  4QQ6 A;  1XOV A;  1Y7X A;  4FM4 B;  4M78 B;  1JJ2 A;  3VS4 A;  2RHY A;  2MOX A;  2L5Q A;  3DB3 A;  1TSF A;  3BY7 A;  1AHJ B;  4TVR A;  4KH1 B;  4RTW A;  4IUU A;  5GAN g;  2FRW A;  3ZL7 C;  2HKQ B;  3H0H A;  3OW2 P;  4C8Q E;  4BY6 B;  4LUE A;  1E6H A;  3EFO B;  1SSH A;  2EW3 A;  4RTZ A;  2DEU A;  5FU6 C;  2HKN A;  1Q82 R;  2J05 A;  3SFM A;  4M78 D;  5FW9 A;  3WXM B;  5GAM d;  4ZGJ B;  4HKE A;  1VQ7 Q;  2LQN A;  2XMF A;  1T0J A;  2JNG A;  2LQ8 A;  2DF6 A;  3FJP A;  3X28 B;  3JSC A;  5LJ3 j;  4E6R A;  4BDZ A;  1BBZ A;  2B86 A;  3C0C A;  2OTL T;  2AK5 A;  2VGN A;  4YTL A;  5GAM f;  3AHU A;  1PG5 B;  1QKW A;  1RAG B;  2CUD A;  1VQL A;  5GAN h;  2K3Y A;  1Q86 U;  2LNV A;  1ARK A;  1D1B A;  2LRQ A;  3NHN A;  4HCK A;  1EIF A;  1VQK A;  1OYX A;  2DTH A;  3OS2 A;  1NLO C;  2COW A;  3RKY A;  2CH4 W;  1LPL A;  1OPL A;  3I56 A;  5GAO q;  1WJQ A;  1FX7 A;  5LJ5 j;  1UHF A;  2C0O A;  5D6X A;  3CCV A;  3MEA A;  4C8Q C;  1EX4 A;  2DTO A;  2DIL A;  2CZ1 B;  2C0T A;  2KI7 A;  4J6X A;  2R5A A;  2H8H A;  2DXU A;  2QA4 Q;  2LNH B;  4OB2 B;  3MKD A;  4HVW A;  2KDS A;  1IHW A;  3EG2 A;  2FPD A;  1YJW T;  2H3J A;  4R0K A;  3E9G A;  2X3W D;  2P4R A;  3OS5 A;  4NL2 A;  5GMK m;  3CCL Q;  1EFN A;  3AT1 B;  3OYB A;  2EQU A;  2ZPI B;  3A8L B;  3OYH A;  3A5Z B;  3JB9 D;  4RUG A;  4J9D A;  2FPE A;  1TUC A;  4QQD A;  1RUW A;  4OMN A;  4EDU A;  1YIJ T;  2ABL A;  3CC7 T;  2BUD A;  2FVU A;  1QVP A;  1S72 T;  2SRC A;  1HSQ A;  3LH0 A;  4RTX A;  5A2Q E;  4OMM A;  3OBY A;  3JCM J;  2QDL A;  4OF1 A;  2OI3 A;  1BKB A;  4KUL A;  3LGL A;  3HHT B;  2CZ6 B;  2DK3 A;  2HBP A;  1M3C A;  3JB9 J;  5GAN 5;  2GQV A;  2V8K A;  1TUD A;  1B7T A;  5GAN 8;  4HXJ A;  1N6A A;  1M30 A;  3RKX A;  4E7L A;  2P0K A;  3UDC A;  4C92 F;  3EGX A;  1ZA1 B;  4EMG A;  1D0X A;  2VXE A;  2RA2 A;  2X4J A;  4KT0 E;  3G71 T;  4Z88 A;  2KT1 A;  1Q7Y U;  2E6N A;  2KRS A;  3RES A;  1G2B A;  4XU0 A;  1KG1 A;  1LJO A;  4PJO A;  1VQ7 A;  2KBT A;  4OB0 B;  1HD3 A;  1UGR B;  2E1H A;  2E65 A;  4BAC A;  1M1G A;  1FXX A;  2BKD N;  4XAX B;  4EMK C;  3V7R A;  3H9N A;  4A54 A;  1VOM A;  1W6X A;  2YUO A;  4C0D B;  3CXC S;  1YWO A;  3SHW A;  1WNL A;  2LTO A;  1ZSG A;  1KC8 R;  3TRE A;  3G6E Q;  3CPF A;  4QW2 A;  1WI7 A;  1IGU A;  3VUB A;  3EAE A;  3INZ A;  4RKU E;  2E3I A;  1I5O B;  1X2K A;  2RB6 A;  4JDS A;  4CRI A;  4J83 A;  2NYS A;  4CI0 C;  1VQ6 Q;  4RTU A;  2MWP A;  4M77 B;  3QYG B;  4KGX B;  4BE2 A;  2CP2 A;  5I22 A;  1RI9 A;  1MV0 B;  2DBK A;  2XHC A;  1WJS A;  2HCK A;  4QKU A;  4B9W A;  5LJ5 g;  4CC2 A;  4J7F A;  2PVO B;  4D8D A;  5I21 A;  1N8R C;  4HCZ A;  1GBQ A;  5IN1 A;  4LXC A;  5LJ3 h;  1M8V A;  1UUE A;  3ZBD A;  1YFN A;  2FHD A;  1AZE A;  1X43 A;  4F14 A;  1QVG P;  2RJC A;  2HQE A;  3CCL A;  1OZ3 A;  3M9Q A;  1OUL A;  4PLI A;  2O9S A;  5CIU A;  5FRM A;  5I2S A;  3PIO A;  5KYX A;  4M75 A;  2BTT A;  3CCU Q;  2CZ0 B;  4ZN3 A;  2LJ3 A;  4DOV A;  3L2W A;  1MUZ A;  2RHU A;  2CSQ A;  2QQA A;  2XDP A;  5GAO p;  5KCH A;  4P5N A;  1VQK T;  3URG A;  2RHZ A;  1ABO A;  1RAD B;  3V8K A;  5EG2 A;  2BZX A;  3EG0 A;  4LDX A;  1MND A;  4JJC A;  3HTR A;  1V29 B;  4F7U B;  3I56 T;  4JJN K;  2R58 A;  3CCV T;  4XK8 E;  3UT1 A;  2XI9 A;  2P0P A;  2YWW A;  3CCJ Q;  1O75 A;  4XU1 A;  4A53 A;  2GQI A;  2BIV A;  4DA4 A;  5DLO A;  3VYH B;  2IIM A;  1CKA A;  3BFM A;  4PJJ A;  5GAN e;  1SKU B;  4BUG A;  2XDD A;  1X6O A;  4PJO D;  3J7A F;  4XTW A;  4D6W A;  1M1K C;  2ZPH B;  4HT8 A;  3RDV A;  3HSB A;  3VUZ A;  4M77 G;  2QDY B;  1M8M A;  2HBW A;  2JVV A;  2ZCF B;  4OMO A;  3G6E A;  1KHI A;  1RAE B;  3Q1J A;  2JMC A;  2X35 A;  1Z9Z A;  4R55 A;  4BE0 A;  2YLC A;  1K8A U;  2JUF A;  5KYY A;  2EQK A;  5GAM g;  1ZQ1 A;  1LVK A;  2E70 A;  4FL6 A;  2RQU A;  3GLX A;  1QMC A;  2F5K A;  3RMS A;  2E3H A;  3CC2 Q;  1VQ6 A;  2CZ7 B;  2Y90 A;  2FZK B;  3VS3 A;  5HKC A;  1J3T A;  4A4K A;  2P4T A;  4EMH A;  2KYM A;  2DYI A;  4XTV A;  3JCM b;  2O88 A;  3M57 A;  4PJO E;  4L6V 5;  1K9M U;  1WHJ A;  3CCQ Q;  4J8O A;  2XD0 A;  4M7D G;  4PLL A;  2YUQ A;  1VQ7 T;  2L3R A;  2DRM A;  5A0D A;  1SHG A;  1JRI A;  2BE7 D;  5IXB A;  3MPU B;  3THK A;  1WQ7 A;  2E12 A;  4Q5W A;  3GOX A;  1RL2 A;  2EQI A;  2MIO A;  3OYD A;  2RI2 A;  2DM1 A;  2GFU A;  5IXF A;  2DBM A;  1CKB A;  4F04 B;  1PC0 A;  2WSC E;  2DL5 A;  1WIE A;  2KQW A;  1WZO A;  2DO3 A;  2DIG A;  3G71 Q;  3CCU A;  3JCM Q;  1ABQ A;  1VQ9 A;  5KYN A;  3KXT A;  3NTK A;  1QWF A;  1V76 A;  5IT9 E;  3MET A;  1VQM T;  2QI2 A;  5C6S A;  2X3X D;  2EJ9 A;  4N0A A;  1SHF A;  5DY9 A;  2QTX A;  2NUT B;  4ANJ A;  4PK4 A;  1M2V A;  4GY5 A;  1OQK A;  1AEY A;  3P8D A;  2DAQ A;  3CCJ A;  3HL8 A;  2I2L A;  5LJ3 d;  1W2B P;  2PZ1 A;  3REA B;  1QCF A;  3T9N A;  4ELY C;  2K6D A;  5IAY A;  5GAN 7;  2LX7 A;  4J9G A;  1YCY A;  5IHK A;  4OB3 B;  3TVT A;  3CCL T;  4M78 A;  3OYK A;  4O5V A;  1VQP Q;  4XTZ A;  4Z89 A;  1JJ2 S;  1NPR A;  4M75 E;  1HK9 A;  2JZ2 A;  2K9G A;  3NFC A;  2RM4 A;  4LN2 A;  3JB9 H;  3FLG A;  4BI8 B;  4XU3 A;  4ZGD B;  1Y57 A;  2H3E B;  2CT4 A;  1KHC A;  3OYI A;  3EFO A;  1YN8 A;  1NLP C;  5LJ3 f;  3BDU A;  3I5S A;  2EGE A;  3QPH A;  4M7A F;  3QBY A;  5IHN A;  4C5I A;  2DZ9 A;  4JPB W;  3C4S A;  3U23 A;  4JZ3 A;  4C0Z A;  1W4S A;  2JS0 A;  2FEI A;  2LX9 A;  3CC2 A;  3TQ7 P;  3EG1 A;  4C92 B;  3R6N A;  2YT6 A;  2OJ2 A;  2QEX Q;  3OYM A;  2QG9 B;  4M7D F;  4QQG A;  3CCQ A;  2YDL A;  1VQO Q;  1MHN A;  3OYL A;  4IUQ A;  1I1J A;  2WSF E;  4JRQ A;  4QVZ A;  3MP1 A;  1GCQ C;  1S1N A;  5D6Y A;  3LX7 A;  4RTY A;  3L2Z A;  4BI3 A;  2CT3 A;  1OI1 A;  1UG1 A;  2ENM A;  2GFA A;  4XTU A;  3PFS A;  3DB4 A;  5LL6 S;  4JS5 A;  2L0A A;  2LJ0 A;  5AT1 B;  2JTF A;  5LJ5 e;  1M1K R;  3QKJ A;  2LZ6 B;  1QVF A;  3X20 B;  2XK0 A;  1FMW A;  3SDZ A;  3JCM c;  3LWH A;  1IRE B;  4M75 C;  2CDT A;  1Y07 A;  1U8R A;  2WAC A;  3LLR A;  4MMK A;  2DL3 A;  3RMQ A;  4NL3 A;  2LCL A;  2NUP B;  1M90 C;  4ZNX A;  3QG1 A;  4XQ3 A;  1Y96 B;  1ZBX A;  3CPW A;  1K73 C;  2DD4 A;  4RTV A;  2CP7 A;  3UA7 A;  1TWB A;  3V7S A;  2G3R A;  3FJ5 A;  4RG8 A;  2X4X A;  3BW1 A;  1I8F A;  3ZEH A;  1FWZ A;  4IUV A;  4CC7 A;  2KYB A;  1BI3 A;  3HKS A;  2CKK A;  3EH2 A;  4JS4 A;  2EVR A;  2KGT A;  2KVQ G;  2FPF A;  3O5Z A;  1QCN A;  1VQP A;  3SD4 A;  4E7H A;  2RK2 A;  4L59 A;  2FZG B;  4C92 G;  4KH0 B;  3PVL A;  4J7I A;  3EG9 B;  1WHH A;  2NWM A;  3CCU T;  3A1P A;  3HRS A;  2JW4 A;  1VQ9 T;  1K8A C;  3OB9 A;  1NJI C;  2AKK A;  3M56 A;  5L8R E;  1VA7 A;  3FC3 A;  3F70 A;  1SRM A;  3CCM Q;  2PUK B;  1T0H A;  2LVM A;  4BDY A;  2OAU A;  1YCS B;  3A8H B;  2E4H A;  1HXD A;  2CP6 A;  1KQS A;  1RAC B;  4PFZ A;  2QEX A;  1AOJ A;  3MEW A;  2LP5 A;  1CSK A;  3CCJ T;  2ZPG B;  1ZUY A;  3L2R A;  5GAM e;  1VQO A;  2W10 A;  4M78 E;  2ED0 A;  3REB B;  3LYI A;  4C8Q G;  1UGS B;  5CQX A;  1YNZ A;  2VAS A;  1VQM Q;  2HSP A;  4X1V A;  1YP5 A;  1GFC A;  1ZSZ B;  5I11 A;  4KUI A;  1H3Z A;  2DFU A;  3J81 E;  1B34 B;  4M77 A;  5GAN 2;  3D7S B;  1MNE A;  3KUF A;  4J9H A;  4C5G A;  1WHM A;  5J26 A;  3L2Q A;  3JCM V;  4FYX B;  1Y71 A;  2M1H A;  1UGQ B;  4BE1 A;  2K4Y A;  1QWE A;  2V1R A;  4AT1 B;  1F1B B;  5GAN 3;  3OW2 A;  4ZTF A;  4AFQ C;  2KK4 A;  5KH6 A;  5GJV B;  1X6G A;  4DEY A;  3CC2 T;  4DQ2 A;  2YRC A;  3VRZ A;  3OBW A;  1AVZ C;  2V1Q A;  1YWP A;  4N0A C;  2JM8 A;  1D0Z A;  2X9H A;  4CC4 B;  2EAY A;  3CCQ T;  3CCE T;  3L2V A;  2ZGW A;  1R77 A;  1G3T A;  3S6W A;  1Q82 U;  4KUD K;  3LH5 A;  2EKO A;  3M0Q A;  2M16 A;  4J6Y A;  1SF9 A;  3KFV A;  1IRX A;  2AT1 B;  1VIF A;  2F69 A;  5FU7 B;  2DET A;  2DL8 A;  4Z8A A;  1WXT A;  2K3B A;  2BZ8 A;  6AT1 B;  1NG2 A;  4FIB A;  4A4F A;  2HL5 C;  4M78 C;  1ZLM A;  2JJ9 A;  1GRI A;  2RJD A;  4DBR A;  1EZZ B;  2LQW A;  2JM9 A;  3QZ9 B;  5CKH A;  5GMK i;  4F7U A;  1NEG A;  1KD1 C;  2A37 A;  1E7O A;  5DLQ E;  4BY6 C;  2L3Q A;  1BI0 A;  5CO7 A;  3RNJ A;  1KJW A;  1P92 A;  1WLP B;  1Q81 C;  5LJ3 g;  1QLY A;  4FW1 A;  1I81 A;  1TG0 A;  2YRV A;  4L5G A;  3CCM A;  4PFP A;  2XKO C;  3J80 E;  1M90 R;  1G3W A;  3HFO A;  2RJE A;  2D9T A;  3M59 A;  1PD1 A;  1K73 R;  2AKL A;  2EYX A;  2K5L A;  1M2O A;  1GL5 A;  3HRU A;  2KXC A;  4N4G A;  4C8Q F;  4JJB A;  2OAW A;  3C94 A;  2VYT A;  1NYF A;  1VQM A;  1VQP T;  4N4H A;  5C0M A;  3M53 A;  2K3X A;  4Y92 A;  2CGH A;  2XIC A;  2EGC A;  2RQV A;  3RER A;  1IHV A;  4OB1 B;  5KYW B;  3EFR A;  2OX7 A;  3CD6 Q;  3SWN B;  3FDR A;  1D09 B;  3ME9 A;  2QQ9 A;  4M7A B;  3I35 A;  3OYE A;  1FMK A;  4OVA A;  4M77 D;  3LW5 E;  3QZ5 B;  1C1A A;  2LCC A;  4OMF B;  3P8B B;  4E7I A;  1NJI R;  1YI2 Q;  3CBP A;  5KE3 A;  4ORZ A;  1OZ2 A;  1X2Q A;  1WQW A;  1XQH A;  3QHS A;  4XTX A;  2D0Q B;  3JV3 A;  1I07 A;  4M7D B;  1AWO A;  2PNI A;  1PWT A;  4JUV A;  2QEX T;  1KIK A;  2ZZD A;  1KK7 A;  5FRO A;  1RAF B;  2EQJ A;  2J6O A;  4M78 F;  1WXB A;  2F2W A;  1VQ9 Q;  1VQO T;  1YJ9 Q;  3M58 A;  1I0C A;  4FYY B;  4FSX A;  2HNI A;  1BU1 A;  2GCX A;  1B3Q A;  4M7D D;  2KNB B;  2DVE A;  1UE9 A;  4M77 E;  3FIF A;  3FEO A;  1MMD A;  3ER0 A;  2K2M A;  1BYM A;  2M02 A;  1WX6 A;  4WF2 A;  1YIT Q;  1MMN A;  3NPF A;  4RTT A;  2NUT A;  1VQ5 Q;  2DE0 X;  2VV5 A;  1G83 A;  2AIR B;  2DEQ A;  3OYC A;  1KC8 U;  3UAT A;  2HZY A;  4QVC A;  2K5F A;  2MI6 A;  1QCO A;  1WGS A;  4IKF A;  5ECA A;  3X25 B;  3OYA A;  3A8O B;  1TS9 A;  3I55 Q;  1VYU A;  2SEM A;  4C5E A;  3RIR A;  1Y0M A;  1RLP C;  2DA9 A;  2HD0 A;  4A4H A;  1H64 1;  4XTY A;  3GNF B;  4J9C A;  5HY6 A;  2MWO A;  3QO3 A;  4NS5 A;  4MZM A;  3GIB A;  1Q86 C;  4M7A G;  4C0D C;  3BDL A;  4LD6 A;  4JJD A;  2J7I A;  1QVG A;  1UJ0 A;  3PMT A;  3GP8 A;  4A63 B;  2L2P A;  2F1L A;  4FT2 A;  2AZV A;  3H6Z A;  5FWC A;  3OY9 A;  2A3L A;  2MYS A;  4GBQ A;  2QAZ A;  1C0M A;  1U1T A;  2DD5 A;  3SB2 A;  4F7U E;  1YBY A;  2ZPB B;  3JB9 F;  5J39 A;  3CCE Q;  3CD6 A;  2A0F B;  1KQ1 A;  1VQ4 Q;  3E2U A;  3EGD B;  2MAM A;  4C92 A;  1M5Q 1;  2GTJ A;  1MGQ A;  2D1X A;  2DZC A;  1UB4 A;  1QKX A;  2DIQ A;  1D3B B;  4J6W A;  2PTK A;  1YI2 A;  1WYX A;  2FB7 A;  1W70 A;  3CCM T;  3VKI A;  2PVG B;  1BB9 A;  2QK0 A;  1Q81 R;  2DLP A;  1G3Y A;  3A98 A;  3LWI A;  4B6M A;  2E64 A;  2Y4Y A;  4ZGE B;  2J06 A;  1JO8 A;  4Y91 A;  1GCP A;  2K57 A;  2C06 A;  4MML A;  1NEB A;  4ME7 A;  3UWN A;  1A0N B;  4JZ4 A;  1YJ9 A;  5D6W A;  1QVF S;  1AWX A;  1QQJ A;  5KYU B;  3JCM W;  5CKD A;  2OTJ Q;  2GGR A;  1T3S A;  3HPW A;  1JXO A;  1WHG A;  1BIA A;  3OS0 A;  2B8A A;  1YIT A;  2NUP A;  3VYG A;  4OML A;  4C0G A;  4GLM A;  2LDM A;  1Y96 A;  1Q7Y C;  1MV3 A;  2MPX C;  1VYV A;  1XJW B;  2BE9 B;  1VQ5 A;  2ZPE B;  3CPW S;  1RAA B;  1N8R R;  5AYF A;  4PJO C;  1X27 A;  3G4S Q;  1RLQ C;  1GFD A;  2RF0 A;  2DRK A;  3OYJ A;  3OSS C;  5CCA A;  3UF4 A;  2PVD B;  3OYN A;  4Y28 E;  1MMA A;  2V8J A;  4VUB A;  5D7U A;  3I55 A;  5FU6 B;  2LCS A;  3S3M A;  3QJ6 A;  1ZA2 B;  2IPO B;  1R8O B;  3S3N A;  2ED1 A;  3CBM A;  2J6K A;  2HEQ A;  1JEG A;  3EG9 A;  1PM3 A;  5LJ3 e;  3RKW A;  3WVD B;  1C6V X;  4LDU A;  5CR2 A;  2JT4 A;  1X01 A;  3OYY A;  1UTI A;  4WCI A;  4EPC A;  5GMK j;  1JB0 E;  2ECZ A;  2NUZ A;  5FRN A;  3M55 A;  4PJM A;  2HDA A;  3QWX X;  3CCE A;  1JJ2 P;  2AZS A;  1AT1 B;  1VQ4 A;  2KMT A;  3GF5 A;  5L23 A;  3CBO A;  4MZT A;  3PE0 A;  1KQS S;  5IHI A;  4C92 D;  3M4G A;  4M75 G;  2A28 A;  3E1S A;  2HL3 A;  2ROT A;  2DXB A;  2O31 A;  1M9S A;  3OMG A;  3WVE B;  2CRE A;  5CKE A;  2DVJ A;  3EH1 A;  4FYV B;  1O9S A;  3M0S A;  3CCS Q;  1ZSZ A;  3TU4 K;  1W2B A;  4Z02 A;  2KR3 A;  4OMP A;  4C8Q B;  1B34 A;  5KE2 A;  4RMO A;  3MEV A;  2ZPF B;  3JCM d;  4ESR A;  1UHC A;  2K79 A;  1Q86 R;  1OU8 A;  2M51 A;  2P84 A;  8ATC B;  3CCR Q;  2KXD A;  2OTJ A;  3KBG A;  2A08 A;  4J9B A;  1M4Z A;  1FYN A;  1AWJ A;  1NM7 A;  2DJZ A;  4F7U F;  3CMA Q;  4PJO F;  3PGG A;  4C92 E;  4HA8 A;  2QQR A;  4RG2 A;  3VJP A;  1M1F A;  3OW2 S;  3PTA A;  4C8Q D;  3CD6 T;  1ZUU A;  3VRY A;  2K5I A;  3L42 A;  1PD0 A;  2KRM A;  5IH2 A;  4KGZ B;  1WHK A;  1WJR A;  4E7J A;  1VQN Q;  2FG0 A;  4KRT A;  1ZX6 A;  4DOW A;  1X6B A;  4DEX A;  4FU6 A;  4D8K A;  2RMO A;  5KCO A;  2RQW A;  3JCM f;  1QW1 A;  3CEY A;  1YI2 T;  2DXC A;  4PJL A;  2XDB A;  3JB9 I;  3G4S A;  2ATC B;  3VS1 A;  2O4X B;  3G1J A;  2KRN A;  3A8M B;  1M27 C;  3PT9 A;  1H92 A;  4ATO A;  2EWN A;  1AWW A;  1UJY A;  2EPD A;  4XU2 A;  1YJ9 T;  2COY A;  2KSS A;  2QAS A;  4CC3 A;  1KFZ A;  4QT7 A;  1ACM B;  2V26 A;  5FWB A;  3LGF A;  1HYO A;  2D0N A;  3G7Z A;  4EMK B;  1KSW A;  2CP0 A;  3RUX A;  5FLX E;  3V8J A;  2HSE B;  2CUB A;  1YIT T;  1SSF A;  1K9M C;  3DLM A;  3JCM X;  4II1 A;  2ESW A;  2M0O A;  4MDW A;  2VVK A;  8AT1 B;  2CP5 A;  1VQ5 T;  1VQ8 A;  5GAO m;  4QVD A;  2A7Y A;  1Q7Y R;  3I5R A;  1M1K U;  4C92 C;  3IQL A;  4N4I A;  3JRZ A;  4FYW B;  4M75 F;  1BCM A;  2EYY A;  1ZBJ A;  1M3A A;  4AFS C;  3I55 T;  3M0P A;  1X69 A;  3R6O A;  2RQT A;  2GTO A;  4FCY A;  3NMZ C;  2RHX A;  2VC8 A;  3PVQ A;  1UDL A;  4HCC A;  3CCS A;  4OGE A;  5KYW A;  3VS5 A;  2L3P A;  4IUT A;  5GMK h;  3SWN A;  1PCX A;  5HK3 A;  1BCO A;  2Y4X A;  4M7A A;  3MO8 A;  2JS2 A;  2LQK A;  1U1S A;  3TSW A;  4AFU C;  2JOY A;  5GAO l;  1V1C A;  3HFN A;  3CCR A;  2DTI A;  4AG1 C;  1OPK A;  1SPK A;  3HP9 A;  1IXD A;  3CMA A;  1W1F A;  1I4K 1;  1OV3 A;  3PIP A;  3CC4 Q;  2ZAE A;  2GF7 A;  2E6Z A;  1G3S A;  1SRL A;  1VQ4 T;  2F2X A;  4M78 G;  4C0F A;  3H41 A;  4MDX A;  4M7D A;  5CQY A;  1RAI B;  2RO0 A;  2J6F A;  1JU5 C;  2FZC B;  3OQ5 A;  1VQN A;  2KT8 A;  3FB9 A;  5CVI A;  2PQW A;  1VIE A;  2GNC A;  2QGG A;  1WHL A;  1IGQ A;  3OYG A;  4E7K A;  1WFW A;  4KGV B;  4OP0 A;  2E10 A;  4LDY A;  1YJN Q;  3E19 A;  3BE3 A;  2X4Y A;  2E5K A;  1TXQ A;  2F5T X;  1XNI A;  2FO0 A;  3EG3 A;  4GLK A;  2HQH A;  1OEB A;  2QGF B;  4E7S A;  2DX1 A;  3E9F A;  4BB7 A;  3V8L A;  2HMA A;  5CK9 A;  3UA6 A;  2VXF A;  2DNU A;  3M5A A;  1TU0 B;  1TOV A;  2DJQ A;  3UPU A;  2LJ1 A;  5M9O A;  2OTJ T;  2YRD A;  1SG5 A;  1WXU A;  4JRP A;  3MJX A;  2NLU A;  1JQQ A;  5GMK l;  3P8H A;  2RQR A;  1JXM A;  4JLI A;  1YHQ Q;  2MK5 A;  1R0B G;  1ZUK A;  3ASK A;  1PNJ A;  7AT1 B;  1LCK A;  1N9S A;  2YXY A;  3M0R A;  2VUB A;  3CME Q;  4K11 A;  1HJD A;  1PSE A;  3FRN A;  2EYQ A;  3JAM E;  1D1A A;  2VWF A;  2P0Q A;  2CSI A;  1IZ6 A;  3G4S T;  4LDW A;  2EIF A;  4DBH A;  5HCK A;  2M9U A;  5GAO r;  3TCJ A;  1QVG S;  3NTI A;  3MP8 A;  4NOY A;  4B9X A;  3EGU A;  3JB9 G;  3QJY A;  4BI4 A;  2VB6 A;  1N5Z A;  2C0I A;  2EQM A;  3CXC P;  3GBQ A;  3OMC A;  4KBM B;  5GAM j;  3TSZ A;  4A4E A;  2CH4 A;  1ZSZ C;  4J5Y A;  1K8A R;  3M0U A;  4ZN1 A;  4MZP A;  3EGD A;  2R5M A;  1B07 A;  2KRO A;  1PKT A;  4M4Z A;  2EYZ A;  2EJG A;  1UEB A;  2X51 A;  1OOT A;  4M7A D;  2O01 E;  1GCQ A;  1D3B A;  3X24 B;  3CC4 A;  4LE9 A;  4AG2 C;  1ZHI A;  3M4Y A;  2QA4 A;  1VQ8 T;  5EC7 A;  1K9M R;  1XTD A;  3RBB B;  1U06 A;  3GNG A;  1T3L A;  4IIO A;  3A8G B;  1X75 C;  5A0G A;  4HVU A;  3JCM g;  4DBQ A;  2EJF A;  1YJN A;  4EIK A;  5KYU A;  1VQL T;  2EBP A;  2RI5 A;  1PKS A;  5HK0 A;  2LT1 A;  2LMJ A;  5GAN d;  1TH7 A;  1D0Y A;  4O6J A;  1RI0 A;  3VS2 A;  3VS0 A;  4PNO A;  1OX9 A;  3CCS T;  4M7A E;  2XU8 A;  1U3O A;  2RI3 A;  5FU7 C;  5LJ5 h;  3EGX B;  1M90 U;  1TTH B;  2G6F X;  1K73 U;  4PKC C;  1GBR A;  5DM7 R;  4PJO B;  3CCR T;  2OTL Q;  2DPP B;  3CMA T;  3TEE A;  2CP3 A;  3L1A A;  5GAN f;  2O2O A;  1YHQ A;  4M7D E;  3CXC A;  3L2U A;  3MP6 A;  1WA7 A;  3QXE B;  2IG0 A;  3VS7 A;  1VQN T;  3CME A;  3V7C A;  4R56 A;  2YLB A;  3JCM h;  1K76 A;  4X9C A;  1NZ9 A;  3OA6 A;  3PNW C;  5GMK e;  1PSF A;  2M0Y A;  2QTV A;  2LC4 A;  2FYK A;  1NPP A;  1U5S A;  1K0S A;  1AZG B;  2PU9 B;  1KQ2 A;  2IVW A;  2CS7 A;  3MEU A;  3VV0 A;  2K2V A;  1UGP B;  3H0I A;  3ZFJ A;  1NJI U;  3DKM A;  2RNA A;  4LDV A;  2YUP A;  1DJ7 B;  2V8I A;  4M77 C;  1YJW Q;  3CQT A;  4FSS A;  4J9F A;  4WTO B;  2JTE A;  1BIB A;  4F17 A;  1PRL C;  2JN0 A;  1KD1 R;  4ELZ C;  1BI1 A;  3SWN C;  2RD1 A;  1YIJ Q;  5GAN 4;  1PHT A;  3CC7 Q;  4M7A C;  2O9V A;  2DER A;  1S72 Q;  4AFZ C;  4FT4 A;  3DLL A;  1I5L A;  2QQB A;  3GPL A;  3C95 A;  2EFI A;  5GJW B;  4OMQ A;  2AHJ B;  3NTH A;  1UGV A;  4RCB A;  2JXB A;  4RCC A;  3EHR A;  3NGP A;  2PUO B;  1UEC A;  4A4G A;  5KYX B;  4M75 B;  2L3S A;  4UC4 A;  1Q82 C;  1IB8 A;  1MMG A;  2ROL A;  4M7D C;  1Q95 G;  1W2B S;  1BK2 A;  4DBF A;  4C8Q A;  2HQX A;  4PJN A;  2GBQ A;  2W0Z A;  4F7U G;  5GAM h;  4PJO G;  1Z9Q A;  2EYW A;  3O8V A;  2E5Q A;  3ULR B;  4JRK A;  2HAX A;  2DXT A;  3S3O A;  4JRI A;  4M75 D;  1LNX A;  3QDF A;  3I9Q A;  1RAH B;  2RK1 A;  4FW2 A;  3N5B B;  3M0T A;  1LOJ A;  4F16 A;  3HRT A;  1N9R A;  3QYH B;  4ZTJ A;  2VGM A;  1H8K A;  2QYZ A;  2RH2 A;  2YSQ A;  1OX8 A;  3QSU A;  4LD9 K;  2WSE E;  1UFF A;  3OYF A;  2OTL A;  1K9A A;  1QVF P;  4C5H A;  4E7Z A;  4J9E A;  5CKF A;  2L89 A;  3CC4 T;  2QA4 T;  3JCM P;  3C12 A;  4PFO A;  1BI2 A;  4HT9 A;  2O4X A;  2KY9 A;  2A36 A;  2E41 A;  1VUB A;  1N27 A;  1K0X A;  2DKG A;  2XID A;  4AMC A;  3MHX A;  5GAN j;  4X34 A;  4M77 F;  1PRM C;  3OS1 A;  1OU9 A;  2RHI A;  2F2V A;  5KYY B;  2LT4 A;  1NYG A;  1TUG B;  2D8H A;  3X26 B;  3CPW P;  2YUN A;  4J9I A;  1YJN T;  1NBE B;  4E2F B;  4V2S A;  2FL7 A;  3QDR B;  5J3B A;  4LNP A;  2RPN A;  2Z0W A;  1QP3 A;  3OSV A;  2QQS A;  1KD1 U;  2CYZ B;  1M3B A;  4EMK A;  3QWY A;  2JTM A;  1RAB B;  2MCN A;  1VQ8 Q;  3EFS A;  1Q81 U;  1JBM A;  4IUR A;  5LJ5 d;  3SEM A;  1YJW A;  2KAF A;  1SEM A;  2BZY A;  5CKB A;  1G5V A;  2X4W A;  2L8D A;  2EGA A;  2I0N A;  3RR6 A;  2D6F A;  2VKN A;  1YIJ A;  3CC7 A;  1GXI E;  1VQL Q;  4LUD A;  1S72 A;  1YHQ T;  3H8Z A;  2YHT A;  3EHQ A;  1G8X A;  4X9D A;  1VQK Q;  2RN8 A;  1WDX A;  5LJ5 f;  2DL7 A;  3CME T;  2COZ A;  3QII A;  9ATC B;  4OGC A;  2KEA A;  1NE8 A;  4JLG A;  3VS6 A;  1K4U S;  3I56 Q;  2R57 A;  2KE9 A;  3MCA B;  4BD3 A;  5GAN 6;  5A0L A;  3G6E T;  5GAO n;  3CCV Q;  1KQS P;  1N8R U;  1IO6 A;  2D8J A;  3H0F A;  2RJF A;  1WPY A;  2MMP A;  1K1Z A;  2DL4 A;  3PMI A;  3G71 A;  5I2M A;  2MF2 A;  2XG8 D;  2QXF A;  2K7A A;  1AD5 A;  1VYT A;  5CAI A;  1M2V B;  1VQ6 T;  1QP2 A;  4HVV A;  4PL6 A;  1FMV A;  1D1C A;  2DYB A;  1R0C B;  1KC8 C;  3QUI A;  2FRY A;  4E47 A;  4IUP A;  3VU3 C;  4IIM A;  3M54 A; 
#chains in the Genus database with same CATH homology
 4HCB A;  3FEO A;  4E7K A;  3ER0 A;  4OP0 A;  2E10 A;  4LDY A;  3JCM e;  3E19 A;  4GY5 A;  2X4Y A;  3P8D A;  1BYM A;  2F5T X;  4WF2 A;  2DAQ A;  4QQ6 A;  1XOV A;  1Y7X A;  4FM4 B;  4M78 B;  3CCJ A;  1XNI A;  1JJ2 A;  3HL8 A;  2RHY A;  2I2L A;  4GLK A;  5LJ3 d;  2L5Q A;  3DB3 A;  3BY7 A;  2VV5 A;  1AHJ B;  4TVR A;  3T9N A;  3E9F A;  4BB7 A;  3V8L A;  2DEQ A;  4ELY C;  5CK9 A;  5IAY A;  4IUU A;  5GAN g;  2VXF A;  5GAN 7;  3OYC A;  3M5A A;  1KC8 U;  4QVC A;  2K5F A;  3UPU A;  2MI6 A;  1YCY A;  1WGS A;  4C8Q E;  4BY6 B;  3X25 B;  4IKF A;  4OB3 B;  3CCL T;  4M78 A;  3OYA A;  3OYK A;  4O5V A;  5M9O A;  4XTZ A;  2OTJ T;  1JJ2 S;  1NPR A;  4M75 E;  5FU6 C;  1HK9 A;  2JZ2 A;  3NFC A;  4JRP A;  2RM4 A;  3SFM A;  3A8O B;  2NLU A;  4M78 D;  5GMK l;  3JB9 H;  3FLG A;  3P8H A;  4BI8 B;  4XU3 A;  4C5E A;  3RIR A;  3WXM B;  4ZGD B;  5GAM d;  2HD0 A;  4ZGJ B;  3OYI A;  1KHC A;  4HKE A;  4JLI A;  4A4H A;  1H64 1;  4XTY A;  3GNF B;  3ASK A;  5HY6 A;  2MWO A;  1N9S A;  5LJ3 f;  3BDU A;  3QO3 A;  3QPH A;  4NS5 A;  4M7A F;  4MZM A;  2VUB A;  3QBY A;  3GIB A;  4C5I A;  1Q86 C;  4M7A G;  2DZ9 A;  4C0D C;  2JNG A;  2LQ8 A;  3BDL A;  3C4S A;  4LD6 A;  4C0Z A;  1W4S A;  3FJP A;  1PSE A;  1QVG A;  3X28 B;  2LX9 A;  3JSC A;  3PMT A;  3FRN A;  5LJ3 j;  2EYQ A;  3GP8 A;  3CC2 A;  3JAM E;  4FT2 A;  2P0Q A;  3H6Z A;  4BDZ A;  1IZ6 A;  3OY9 A;  3G4S T;  4C92 B;  2A3L A;  4LDW A;  2OTL T;  2EIF A;  2VGN A;  4YTL A;  2M9U A;  1U1T A;  5GAM f;  2DD5 A;  3SB2 A;  3OYM A;  3AHU A;  4F7U E;  5GAO r;  1YBY A;  2ZPB B;  4M7D F;  3TCJ A;  1QVG S;  3NTI A;  3JB9 F;  4QQG A;  3CCQ A;  5J39 A;  3MP8 A;  3CD6 A;  4NOY A;  4B9X A;  1VQL A;  5GAN h;  3QJY A;  3JB9 G;  1KQ1 A;  2K3Y A;  4BI4 A;  1Q86 U;  1MHN A;  2MAM A;  4C92 A;  2LNV A;  3OYL A;  4IUQ A;  1M5Q 1;  2EQM A;  1MGQ A;  2WSF E;  4JRQ A;  3OMC A;  4KBM B;  4QVZ A;  5GAM j;  2LRQ A;  3MP1 A;  1EIF A;  2DZC A;  1VQK A;  1UB4 A;  1OYX A;  4A4E A;  2DTH A;  4J5Y A;  5D6Y A;  3LX7 A;  2DIQ A;  3L2Z A;  4BI3 A;  1OI1 A;  4ZN1 A;  3OS2 A;  1D3B B;  2GFA A;  4J6W A;  4MZP A;  3PFS A;  4XTU A;  2FB7 A;  1YI2 A;  2R5M A;  3DB4 A;  3RKY A;  5LL6 S;  3CCM T;  4JS5 A;  3VKI A;  2PVG B;  2JTF A;  5LJ5 e;  1G3Y A;  3I56 A;  5GAO q;  3LWI A;  2EJG A;  3QKJ A;  1UEB A;  1WJQ A;  1QVF A;  1FX7 A;  2E64 A;  4M7A D;  5LJ5 j;  2Y4Y A;  3X20 B;  4ZGE B;  5D6X A;  3CCV A;  2O01 E;  2XK0 A;  3MEA A;  1D3B A;  4C8Q C;  2DTO A;  4Y91 A;  2CZ1 B;  2K57 A;  3SDZ A;  4J6X A;  2C06 A;  3X24 B;  4MML A;  3JCM c;  3LWH A;  2R5A A;  3CC4 A;  1IRE B;  4M75 C;  1ZHI A;  3M4Y A;  2QA4 A;  2DXU A;  1VQ8 T;  4ME7 A;  1Y07 A;  4OB2 B;  3UWN A;  1U8R A;  2KDS A;  2WAC A;  1XTD A;  1YJ9 A;  5D6W A;  1YJW T;  2H3J A;  3E9G A;  1QVF S;  3LLR A;  3GNG A;  4MMK A;  3RMQ A;  3OS5 A;  4NL2 A;  5GMK m;  3JCM W;  4NL3 A;  3OYB A;  5CKD A;  2LCL A;  2EQU A;  2ZPI B;  1M90 C;  3A8L B;  3OYH A;  3A5Z B;  3QG1 A;  4XQ3 A;  3JB9 D;  3HPW A;  1Y96 B;  1ZBX A;  3A8G B;  3CPW A;  1X75 C;  1K73 C;  4QQD A;  5A0G A;  2DD4 A;  1YIJ T;  4EDU A;  1BIA A;  3JCM g;  3OS0 A;  2EJF A;  3CC7 T;  2BUD A;  1YJN A;  1VQL T;  2FVU A;  2RI5 A;  1QVP A;  1S72 T;  5HK0 A;  2LT1 A;  2B8A A;  1TH7 A;  3LH0 A;  5GAN d;  4O6J A;  5A2Q E;  1RI0 A;  3V7S A;  2G3R A;  3OBY A;  4PNO A;  4RG8 A;  3VYG A;  4C0G A;  3JCM J;  1YIT A;  4OF1 A;  2X4X A;  2LDM A;  1Y96 A;  3CCS T;  3BW1 A;  1Q7Y C;  1BKB A;  4KUL A;  1I8F A;  3LGL A;  3HHT B;  3ZEH A;  1FWZ A;  2CZ6 B;  2DK3 A;  2HBP A;  4IUV A;  2XU8 A;  5FU7 C;  2RI3 A;  2ZPE B;  3CPW S;  3JB9 J;  1VQ5 A;  4M7A E;  5GAN 5;  5LJ5 h;  1BI3 A;  2GQV A;  3HKS A;  2CKK A;  2V8K A;  1M90 U;  4JS4 A;  5AYF A;  4PJO C;  5GAN 8;  2KVQ G;  1K73 U;  1N6A A;  4PKC C;  3RKX A;  5DM7 R;  3OYJ A;  3OSS C;  5CCA A;  3CCR T;  1VQP A;  4E7L A;  2PVD B;  4PJO B;  2P0K A;  3OYN A;  2DPP B;  3UDC A;  4Y28 E;  3SD4 A;  5FRN A;  2V8J A;  4C92 F;  4VUB A;  2RK2 A;  4L59 A;  4E7H A;  3I55 A;  3CMA T;  4EMG A;  5FU6 B;  3TEE A;  4C92 G;  2VXE A;  3S3M A;  2RA2 A;  2X4J A;  3L1A A;  3QJ6 A;  4J7I A;  4KT0 E;  5GAN f;  3G71 T;  1Q7Y U;  3CCU T;  2E6N A;  3RES A;  1YHQ A;  4M7D E;  1R8O B;  4XU0 A;  1KG1 A;  3CXC A;  3HRS A;  3S3N A;  1LJO A;  1VQ9 T;  4PJO A;  3L2U A;  1K8A C;  3MP6 A;  1VQ7 A;  3OB9 A;  3CBM A;  1NJI C;  4OB0 B;  3QXE B;  1UGR B;  2E1H A;  2E65 A;  2IG0 A;  3M56 A;  5L8R E;  4BAC A;  1VQN T;  1M1G A;  3FC3 A;  1FXX A;  3CME A;  3F70 A;  2BKD N;  4XAX B;  4EMK C;  3V7R A;  3V7C A;  5LJ3 e;  4A54 A;  4R56 A;  2YLB A;  3RKW A;  3JCM h;  4X9C A;  3WVD B;  4C0D B;  2PUK B;  1NZ9 A;  4LDU A;  3OA6 A;  3PNW C;  3CXC S;  5CR2 A;  5GMK e;  1PSF A;  2LVM A;  1X01 A;  1WNL A;  3OYY A;  4BDY A;  2LC4 A;  2OAU A;  2LTO A;  2FYK A;  3A8H B;  1HXD A;  3TRE A;  4EPC A;  3CPF A;  1JB0 E;  1NPP A;  4QW2 A;  5GMK j;  1KQS A;  1KQ2 A;  2PU9 B;  2QEX A;  2IVW A;  2CS7 A;  3VUB A;  3MEU A;  3VV0 A;  3M55 A;  2K2V A;  1UGP B;  3MEW A;  3EAE A;  3ZFJ A;  2ZPG B;  3CCJ T;  1NJI U;  3DKM A;  3INZ A;  4RKU E;  3CCE A;  2RB6 A;  3L2R A;  4LDV A;  4JDS A;  5GAM e;  1DJ7 B;  1VQ4 A;  2KMT A;  2V8I A;  1VQO A;  3GF5 A;  4M77 C;  4M78 E;  4CRI A;  3CBO A;  4J83 A;  4MZT A;  3LYI A;  4C8Q G;  4CI0 C;  1KQS S;  2MWP A;  1UGS B;  4M77 B;  1BIB A;  3QYG B;  5CQX A;  4C92 D;  4BE2 A;  3M4G A;  4M75 G;  2JN0 A;  2XHC A;  4ELZ C;  3E1S A;  1WJS A;  1BI1 A;  3SWN C;  2RD1 A;  4KUI A;  4B9W A;  5LJ5 g;  1H3Z A;  5GAN 4;  3J81 E;  4J7F A;  2DXB A;  1B34 B;  4M7A C;  2PVO B;  1M9S A;  4M77 A;  5GAN 2;  3OMG A;  5I21 A;  3WVE B;  5CKE A;  3KUF A;  4FT4 A;  3DLL A;  4C5G A;  1N8R C;  1I5L A;  4HCZ A;  5J26 A;  2QQB A;  1O9S A;  5IN1 A;  3L2Q A;  3GPL A;  3JCM V;  3C95 A;  2EFI A;  5LJ3 h;  3TU4 K;  1W2B A;  1M8V A;  2AHJ B;  3NTH A;  4RCB A;  4Z02 A;  1Y71 A;  2M1H A;  4C8Q B;  1B34 A;  1UGQ B;  4BE1 A;  3ZBD A;  4RCC A;  2K4Y A;  2PUO B;  5KE2 A;  4A4G A;  5GAN 3;  4RMO A;  2FHD A;  3OW2 A;  3MEV A;  2ZPF B;  4M75 B;  4UC4 A;  3JCM d;  2KK4 A;  4ZTF A;  5KH6 A;  1Q82 C;  2RJC A;  2HQE A;  3CC2 T;  4DQ2 A;  3CCL A;  1OZ3 A;  3M9Q A;  4M7D C;  4PLI A;  3OBW A;  2OTJ A;  3KBG A;  1W2B S;  5CIU A;  1M4Z A;  4C8Q A;  2HQX A;  5FRM A;  2DJZ A;  4F7U F;  5I2S A;  3PIO A;  4N0A C;  4PJO F;  4F7U G;  5GAM h;  3PGG A;  4PJO G;  4C92 E;  2EAY A;  4HA8 A;  2QQR A;  4M75 A;  4RG2 A;  1M1F A;  3O8V A;  3VJP A;  3PTA A;  3OW2 S;  2E5Q A;  4C8Q D;  4JRK A;  2CZ0 B;  4ZN3 A;  3CCQ T;  2HAX A;  3CCE T;  3CD6 T;  4DOV A;  2DXT A;  3L2V A;  2K5I A;  3L42 A;  4JRI A;  2ZGW A;  3S3O A;  4M75 D;  1LNX A;  3L2W A;  2RHU A;  2QQA A;  2XDP A;  2RK1 A;  1G3T A;  1WJR A;  3S6W A;  5GAO p;  3N5B B;  5KCH A;  1LOJ A;  4E7J A;  4P5N A;  4DOW A;  1Q82 U;  1VQK T;  3HRT A;  2RHZ A;  4FU6 A;  3URG A;  4KUD K;  1N9R A;  2EKO A;  3V8K A;  3QYH B;  2M16 A;  4J6Y A;  2VGM A;  5KCO A;  4ZTJ A;  3JCM f;  1QW1 A;  5EG2 A;  3CEY A;  2F69 A;  2RH2 A;  1VIF A;  2DXC A;  5FU7 B;  1YI2 T;  4LDX A;  2XDB A;  3JB9 I;  3QSU A;  4LD9 K;  1V29 B;  2WSE E;  3G4S A;  4F7U B;  3I56 T;  4FIB A;  4A4F A;  3OYF A;  2OTL A;  4M78 C;  2O4X B;  4JJN K;  2R58 A;  2RJD A;  3A8M B;  4C5H A;  3CCV T;  4XK8 E;  3PT9 A;  3UT1 A;  2XI9 A;  2P0P A;  4ATO A;  2EWN A;  1O75 A;  4XU1 A;  5CKF A;  4A53 A;  3QZ9 B;  2BIV A;  2L89 A;  4DA4 A;  5CKH A;  3CC4 T;  5GMK i;  5DLO A;  3VYH B;  2QA4 T;  4F7U A;  1KD1 C;  5DLQ E;  4BY6 C;  3C12 A;  4XU2 A;  3JCM P;  1BI2 A;  1BI0 A;  5CO7 A;  1YJ9 T;  4HT9 A;  2O4X A;  3BFM A;  5GAN e;  1P92 A;  2KY9 A;  2E41 A;  4BUG A;  2KSS A;  1VUB A;  1X6O A;  1N27 A;  2XDD A;  2DKG A;  2XID A;  4PJO D;  3J7A F;  3MHX A;  1Q81 C;  5LJ3 g;  5GAN j;  4XTW A;  4X34 A;  4D6W A;  4M77 F;  1M1K C;  3LGF A;  3OS1 A;  2ZPH B;  4HT8 A;  3HSB A;  1I81 A;  3VUZ A;  2YRV A;  4L5G A;  2RHI A;  4M77 G;  2QDY B;  3G7Z A;  3CCM A;  4EMK B;  2LT4 A;  3RUX A;  2XKO C;  5FLX E;  2JVV A;  2ZCF B;  3X26 B;  3J80 E;  3V8J A;  4V2S A;  1YJN T;  2FL7 A;  3QDR B;  5J3B A;  3G6E A;  1G3W A;  1KHI A;  3HFO A;  2RJE A;  2D9T A;  3M59 A;  1QP3 A;  1SSF A;  3Q1J A;  1YIT T;  3OSV A;  2QQS A;  1K9M C;  3DLM A;  1KD1 U;  2X35 A;  4R55 A;  2CYZ B;  4BE0 A;  2YLC A;  3JCM X;  1K8A U;  4II1 A;  2M0O A;  4MDW A;  2K5L A;  4EMK A;  2JUF A;  2EQK A;  2JTM A;  5GAM g;  1VQ5 T;  1VQ8 A;  5GAO m;  4QVD A;  1ZQ1 A;  2E70 A;  2A7Y A;  3EFS A;  3HRU A;  4N4G A;  4FL6 A;  1Q81 U;  1JBM A;  4IUR A;  3GLX A;  5LJ5 d;  1YJW A;  4C8Q F;  1M1K U;  2KAF A;  2F5K A;  3RMS A;  4C92 C;  3C94 A;  4N4I A;  2VYT A;  1VQ6 A;  2CZ7 B;  5CKB A;  1G5V A;  2Y90 A;  3JRZ A;  2X4W A;  5HKC A;  4M75 F;  2L8D A;  4A4K A;  1VQM A;  2P4T A;  1VQP T;  4N4H A;  4EMH A;  3M53 A;  5C0M A;  2K3X A;  2CGH A;  4XTV A;  2XIC A;  2D6F A;  3RER A;  3JCM b;  3I55 T;  1YIJ A;  4OB1 B;  3M57 A;  4PJO E;  4L6V 5;  3EFR A;  1K9M U;  3CC7 A;  1GXI E;  4J8O A;  3SWN B;  2XD0 A;  3FDR A;  4M7D G;  3R6O A;  1S72 A;  1YHQ T;  4PLL A;  3ME9 A;  2QQ9 A;  2RHX A;  3H8Z A;  2VC8 A;  2YHT A;  4M7A B;  1VQ7 T;  3OYE A;  4OVA A;  4X9D A;  4HCC A;  3CCS A;  4M77 D;  4OGE A;  2L3R A;  3LW5 E;  5A0D A;  3QZ5 B;  5LJ5 f;  4IUT A;  3CME T;  2LCC A;  1JRI A;  3SWN A;  4OMF B;  3P8B B;  3QII A;  5GMK h;  4E7I A;  4OGC A;  5HK3 A;  1WQ7 A;  2E12 A;  2Y4X A;  3CBP A;  5KE3 A;  4M7A A;  4Q5W A;  1NE8 A;  3MO8 A;  2LQK A;  3GOX A;  1RL2 A;  4JLG A;  1OZ2 A;  1U1S A;  2GFU A;  2RI2 A;  3OYD A;  2JOY A;  1WQW A;  1XQH A;  3QHS A;  4XTX A;  5GAO l;  2D0Q B;  3HFN A;  3CCR A;  2R57 A;  2DTI A;  3MCA B;  4BD3 A;  5GAN 6;  5A0L A;  3G6E T;  5GAO n;  2WSC E;  4M7D B;  3HP9 A;  2KQW A;  3CMA A;  4JUV A;  2QEX T;  1N8R U;  2DO3 A;  1I4K 1;  1WPY A;  2RJF A;  2MMP A;  2DIG A;  2ZZD A;  3PMI A;  5FRO A;  5I2M A;  3G71 A;  2MF2 A;  3PIP A;  3CCU A;  2GF7 A;  2E6Z A;  2EQJ A;  3JCM Q;  2XG8 D;  2QXF A;  1G3S A;  4M78 F;  1VQ9 A;  1VQ4 T;  3KXT A;  3NTK A;  4M78 G;  1VQO T;  3M58 A;  4C0F A;  4MDX A;  5CAI A;  4M7D A;  5CQY A;  2RO0 A;  1VQ6 T;  1QP2 A;  5IT9 E;  3OQ5 A;  4PL6 A;  4FSX A;  1VQN A;  2HNI A;  3MET A;  3FB9 A;  5CVI A;  2GCX A;  2PQW A;  2QI2 A;  5C6S A;  1VIE A;  1VQM T;  2EJ9 A;  4N0A A;  4M7D D;  1KC8 C;  3OYG A;  2DVE A;  3QUI A;  5DY9 A;  4E47 A;  4IUP A;  4M77 E;  2QTX A;  3VU3 C;  3FIF A;  3M54 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...