4M77A

Crystal structure of lsm2-8 complex, space group i212121
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
100
structure length
83
Chain Sequence
TLKDYLNKRVVIILVDGESLIASLNGFDKNTNLFLTNVFNRISKEFISKAQLLRGSEIALVGLIDAENDDSLIENEHVIWEKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
molecule keywords U6 snRNA-associated Sm-like protein LSm8
total genus 13
structure length 83
sequence length 100
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m77A00
4C8QG 3PGGA 1I4K1 5GAOl 4M78F 2DKGA 2VXFA 4F7UB 3RERA 4J6XA 4NL3A 1KQ1A 3V7CA 3V7RA 3JCMd 3JB9G 2FYKA 4HT8A 4JRIA 3FB9A 4M7AE 4XTYA 5GAN5 2E1HA 2JN0A 4M7DF 1WQ7A 1TH7A 4C92F 3BFMA 4XU0A 4J6YA 5GANf 4M75F 4X9DA 4NL2A 5GAMf 4PJOA 4M77G 4JRKA 4M77A 4Y91A 4PJOD 3JCMe 3SWNC 4M7AC 2DVEA 3JCMc 3AHUA 3JB9J 4PJOE 4M75A 3JCMh 4RCCA 4PNOA 2YLBA 1LNXA 2EWNA 4J5YA 4C92G 4EMKB 1HK9A 1I8FA 3HFOA 2RD1A 1D3BB 3M4GA 4XU1A 4EMKC 5GMKi 4M7DA 4M7DG 5GANe 5GMKl 2VXEA 3BY7A 5GAN4 4M78E 4M7AB 3SWNB 3JCMQ 2K57A 1D3BA 1M5Q1 2DTOA 4M77E 4M75G 5GAOp 4M78A 3JCMf 4V2SA 2QTXA 1N9RA 4C8QF 1JBMA 5LJ5h 3INZA 4N0AC 4C8QA 3GIBA 2DTHA 3V8KA 4M7AG 2DTIA 2EJFA 4C92E 5GAN7 5GAMh 2Y90A 4PJOC 5GANh 3L2ZA 1BIAA 5GAMg 4M78G 4A54A 1X01A 4WF2A 5GANg 1M8VA 1WPYA 1B34B 2DZ9A 2DZCA 5LJ5d 3JCMV 5GAN2 3JB9D 2EJ9A 2DEQA 4M78C 4F7UF 5LJ5j 5GANd 4PJOB 1Y96A 4M77C 5GAMd 5GAOr 4A53A 4F7UA 1YCYA 4EMHA 4J6WA 5GAMe 3RKWA 1WNLA 4C8QC 2VC8A 5LJ3h 4M7DC 1JRIA 5GAN8 3JCMP 4C92B 1WQWA 5GAOn 5LJ5e 4C92C 4PJOG 5LJ3g 4N0AA 5CAIA 5LJ5f 2DXTA 4M75C 2E65A 3JCMW 1H641 4XQ3A 4XU3A 5GAN6 1N9SA 4HA8A 4C92D 2E64A 2EJGA 1I5LA 4M7AF 5LJ3d 3RKXA 3RIRA 5GMKh 2ZGWA 4XTVA 5LJ3j 4C8QD 3QO3A 4OP0A 5GANj 3QUIA 1MGQA 4JUVA 3RUXA 3SB2A 5I21A 4M75D 3L1AA 2E41A 1U1SA 2CGHA 3V8JA 4M7DD 5GAN3 2EAYA 3JB9I 4C92A 3JCMX 2E10A 3RESA 3JCMg 1KQ2A 2RM4A 5GAOm 3HSBA 3QSUA 5LJ3e 5GMKe 2YLCA 5GMKj 5GMKm 4QVDA 5GAOq 4XTUA 4XU2A 4EMKA 4XTZA 4M77D 4XTXA 1Y96B 4M78D 3FIFA 4PJOF 4NOYA 2HNIA 4QVCA 3FJPA 4JLIA 3JB9H 2I2LA 4F7UE 4X9CA 4MMKA 4M78B 1LJOA 2YHTA 3VU3C 5GAMj 4C8QE 3JCMb 1I81A 4RCBA 4M7DE 3BW1A 4M77F 3JB9F 1HXDA 2RB6A 3HFNA 5DY9A 1LOJA 2DJZA 1U1TA 3RKYA 4M75E 4EMGA 3QHSA 3BDUA 2DXUA 3EFSA 3SWNA 4M75B 4M7AA 1B34A 3V7SA 3JCMJ 4F7UG 3EFRA 4M77B 4DQ2A 5LJ5g 4XTWA 2FB7A 4HT9A 2RA2A 5LJ3f 4C8QB 4M7AD 3V8LA 1BIBA 4MMLA 4M7DB
chains in the Genus database with same CATH superfamily
2MWOA 5GAOl 4J9GA 3LGLA 1KQ1A 4AG2C 3FDRA 1IXDA 2JM9A 4FSXA 4BDZA 4X1VA 2QEXT 4NL2A 3MP8A 1W2BA 1MMAA 2I0NA 2JVVA 3CBMA 2DVEA 3JB9J 4PLIA 3CPWP 3CC2T 4QKUA 1IREB 4BUGA 3ER0A 4EMKC 2RD1A 4XU1A 2ZPFB 3EAEA 3G6EA 2DTOA 3CCMQ 1KSWA 2ZZDA 4ATOA 1U06A 2EKHA 2YWWA 1W6XA 1VQ4Q 1B7TA 1C0MA 4HVVA 4E7HA 2F2XA 4JDSA 4M78C 2NLUA 4Y28E 5EC7A 4IUQA 4AFSC 5FRNA 2ZAEA 1UE9A 3QWYA 4EIKA 1GCPA 4N0AA 2A28A 1QCFA 2COYA 2VVKA 2H8HA 1GCQC 2LNHB 4BI3A 1YHQA 1HD3A 2DJQA 4AMCA 3G71Q 2R5MA 3QDFA 1PRLC 2EAYA 1VQMT 4KRTA 3EFOA 4OMNA 2GQIA 5LJ3e 2J05A 1UJ0A 1VYUA 3T9NA 2KRNA 1AWXA 1RADB 1Z9ZA 3CPWS 4B6MA 3LW5E 2I2LA 4F7UE 4M78B 1F1BB 1VQNQ 3JCMb 1RUWA 1BK2A 3S3MA 2EFIA 2E3IA 1PRMC 4OGEA 4YTLA 3G1JA 3V7SA 1VQPA 4M77B 2DYIA 1ZBJA 4C8QB 3VUBA 3H0HA 2VXFA 1Q82R 1RAGB 2IIMA 2FEIA 1N8RR 3TREA 3VS7A 4JRIA 2DVJA 5FROA 4EDUA 1ZA2B 1X75C 2AIRB 3GNGA 1ZX6A 1M90R 2HMAA 1YN8A 3JCMe 4HXJA 2KBTA 5KYXA 4PJOE 3JCMc 2K2MA 4M75A 3QDRB 1MMDA 2RQVA 2RJFA 1Q95G 2Z0WA 1PSFA 1X69A 3DKMA 4M7DA 5DM7R 1YJWA 2RF0A 4AT1B 1YJNA 1RABB 1VQ8T 1BYMA 2LT4A 2K57A 2CDTA 3OW2P 1LPLA 1VIFA 3INZA 2C0IA 2DX1A 1YI2A 3I55A 1ZUUA 1CKBA 2HSEB 2CSQA 4CRIA 1JXOA 2RJDA 4JRPA 1FMWA 2PNIA 1WI7A 1UDLA 3QWXX 3A8HB 4EMHA 4FU6A 5KCOA 1M3CA 5GAOn 5LJ5e 1R0CB 1GBRA 2E65A 3VYGA 1BI1A 1H641 5A0DA 4DA4A 5GAN6 3I56T 2X35A 1VQLT 3GPLA 3EHQA 1CKAA 5FLXE 1K9MC 2ZGWA 1SKUB 2VWFA 3LH0A 4OP0A 4C8QD 3GF5A 1VYVA 2CZ0B 4F17A 3QG1A 3G6ET 2DL3A 3MP6A 3I56Q 3UF4A 1IGUA 1PHTA 4OMMA 2E10A 4BY6C 1KQ2A 1X6BA 1RL2A 2YLCA 5GMKj 5GAOq 2EGCA 2DIQA 4IUTA 1Q86R 4M78D 2AKLA 1JXMA 1P92A 1M2VB 2WSEE 3QIIA 2O4XB 5J39A 3MKDA 3I56A 1I81A 3CCVA 3MPUB 4E47A 1Q81R 1HXDA 2YSQA 5IN1A 3N5BB 4N4IA 3EG0A 4LDYA 3JAME 2H3JA 4HT9A 3M4YA 5LJ3f 4F7UB 3OS5A 1Y71A 2M02A 3ZBDA 1X27A 2DD4A 1QP2A 2DFUA 5A0GA 3HP9A 5GANf 2KRMA 4C0DC 3CC7T 2Y4YA 1RI9A 3VS6A 5FRMA 3JCMh 2QI2A 1NM7A 2EQUA 1YJWT 2K3BA 1VQ7T 1N27A 2RPNA 5CIUA 1M8MA 2VXEA 5GAN4 1TUDA 3EG9A 2CREA 3HTRA 2GCXA 1N8RC 3EG3A 5CVIA 3L2VA 5GAMg 5C6SA 2MWPA 4OMFB 4RTUA 4J6WA 3CCSA 1TWBA 5HK0A 2K4YA 2A08A 2AT1B 5LJ5f 1EX4A 1PG5B 1KQSA 2X4YA 2KEAA 1U3OA 5D6YA 4HA8A 4ZTFA 2Y4XA 1I5LA 2QXFA 1WXUA 1FYNA 2A7YA 2QTVA 4F16A 2LT1A 4OMLA 2IVWA 4ZGEB 8ATCB 2E41A 2C0OA 2EKOA 1S1NA 1QKXA 4ZN3A 3KXTA 2ZCFB 4OVAA 3G71T 1UGPB 5GMKm 4QVDA 4J7FA 5D6WA 2P84A 1AWJA 3ULRB 3CC4T 2J6FA 1Q81U 1LJOA 2YXYA 1WJQA 1VQ6T 1H3ZA 5KYUA 2DBMA 3BDUA 1VQNT 1NZ9A 3V8LA 1BIBA 3EGDB 2RJEA 2E3HA 2FYKA 4XTYA 1UGRB 3I9QA 4FL6A 1ZQ1A 4A4EA 5IHKA 1AD5A 4XU0A 1R0BG 2PUOB 1VQKA 2QQBA 4ORZA 3MEAA 4OB3B 4PNOA 3OYYA 2GGRA 2C0TA 5CKDA 3KBGA 4D8KA 1SEMA 1NYFA 3EFOB 2HKNA 2F1LA 1D3BA 2LCLA 3GLXA 1N9RA 4C8QF 2K2VA 2QEXA 5IHIA 1D09B 3CCRA 4C0GA 5J26A 4B9XA 1VQMQ 3VV0A 2DYBA 5LJ5j 2QAZA 2DIGA 4PL6A 1VYTA 2HQHA 4M7DC 1JRIA 1M1KU 4KGVB 2OTLA 4JJDA 3CQTA 1OULA 1FMKA 2CT3A 5CO7A 1I1JA 2OTJT 1LVKA 4P5NA 3RKXA 3RIRA 4M7DD 4E2FB 3SB2A 1M1KC 1VQLQ 4ZTJA 3TSZA 2L0AA 4PK4A 3A5ZB 3NFCA 3OYAA 3A98A 1W2BS 2JS0A 4PJMA 1YHQT 1ZBXA 5A2QE 3OMCA 3M0TA 3QJ6A 2L2PA 4ME7A 2HZYA 1AWWA 1U5SA 2MMPA 4Z02A 5FU7C 1QW1A 4CI0C 1UEBA 3QZ9B 1KIKA 1VQ9A 1TXQA 2CZ1B 2HDAA 1MUZA 3L2UA 2PTKA 2JMAA 1KFZA 4JPBW 1ARKA 2K5FA 2MCNA 4J9FA 1X2QA 4M4ZA 1YIJQ 4NL3A 1E6GA 3MHXA 3X20B 2JN0A 2V8IA 1HJDA 2JOYA 2RHXA 1VQ9Q 1M2OA 1KG1A 3VS4A 4Y91A 1YI2Q 5DLOA 1VQOA 1VQ9T 1VQOT 5HCKA 2KR3A 2RK1A 1VQ4A 3A8OB 1O9SA 3VRZA 5CKHA 3CBPA 1OX9A 4GLKA 5GANe 1QVGP 2OI3A 2P4TA 2ROTA 4M78A 2QTXA 4PFPA 4RTZA 2DTHA 3PVQA 4LUDA 3L2ZA 2EQMA 1QCOA 1YHQQ 3VJPA 4F7UF 1OPLA 2SRCA 3L2WA 4JJCA 3CMEA 3IQLA 1FWZA 1KQSP 3CXCS 3BDLA 1N9SA 4C92D 2E64A 2EIFA 2AZVA 2CZ7B 5I11A 3CMEQ 2PU9B 2A37A 1G3TA 4C92A 1QKWA 4LDXA 2F2WA 1RI0A 2PVGB 3HSBA 4C5GA 1QVGA 4R55A 1HSQA 2CZ6B 3X26B 4XU2A 3CMET 3FIFA 2HNIA 4ZN1A 4A4HA 5CQXA 2XDBA 2YRDA 3PMTA 2K5IA 4PJJA 4Z8AA 1NJIC 2K3YA 1OQKA 5KYWA 3OQ5A 1NG2A 2BZ8A 1JEGA 1UFFA 3EFRA 4ZGDB 4M7AE 2FL7A 1YITQ 3NTKA 4QQDA 3GP8A 3BE3A 3P8DA 8AT1B 3CCQQ 1AHJB 2LZ6B 4RKUE 5FWCA 2FPEA 2XKOC 1M1FA 5FU6B 4HCBA 3FB9A 3M59A 2V1QA 1M90U 3C0CA 3L2QA 4IUUA 4LUEA 1SF9A 2PUKB 1YITA 2MF2A 4RCCA 2BTTA 4MDWA 4CC3A 3H0IA 1K1ZA 2GFUA 1D3BB 2AHJB 2HL3A 1QVFS 2RN8A 2RI2A 4MZTA 3VS1A 5GAMh 2E4HA 2HD0A 2QQRA 4IURA 1GCQA 1G5VA 2LJ0A 2M0OA 3QYHB 3OYEA 2D1XA 3I55T 3X28B 3JCMV 2ESWA 1CSKA 2R57A 5FU6C 5GJWB 3NGPA 4A4GA 3OS0A 2DL7A 1VQOQ 2LX7A 3E19A 3SFMA 1JB0E 2EGAA 5IH2A 2X3WD 1M9SA 2J6KA 5CKBA 2KQWA 2KRSA 1ABQA 1J3TA 2ZPHB 2CUBA 4ESRA 1M1GA 3CC2A 2J6OA 3PNWC 2RI5A 3FEOA 2KNBB 3EGDA 4ELYC 1IHVA 4XTZA 3L2RA 3GBQA 2K5LA 2CT4A 2CS7A 1XQHA 1BBZA 4JS4A 3M0RA 3O8VA 3CCST 1H92A 1X43A 2LRQA 4IIMA 2XMFA 5CQYA 2O4XA 3CCSQ 3LWIA 3VUZA 3SWNA 1UECA 4DQ2A 2MPXC 1MNEA 3MEUA 2DKGA 2D0QB 4J6XA 4RUGA 1NJIR 2EYQA 4Q5WA 3JB9G 1HYOA 2EPDA 5AT1B 2KT1A 4C5HA 4AFUC 1JQQA 1QVPA 4M7AC 3AHUA 2NUTA 1KK7A 4EPCA 1AVZC 1NPRA 4L6V5 2KDSA 4E7KA 2QASA 4CC7A 5LL6S 2HAXA 2DLPA 2CSIA 2KXCA 4XK8E 2O01E 3UWNA 3WXMB 4RMOA 5LJ5h 2ZPIB 2WACA 2ZPGB 2CP2A 3V8KA 1KC8C 4JRQA 1Q86C 1KC8R 2P0PA 3M55A 4GLMA 2RQTA 4WF2A 1M8VA 1G3SA 4DEYA 3TSWA 1VQ5T 2QQ9A 2EGEA 2JS2A 2F5KA 2MI6A 3CCVT 1VQLA 2DK3A 3JCMP 1WQWA 2ENMA 2LJ1A 4A63B 1PCXA 5ECAA 4M75C 3CMAA 1MV0B 2O9VA 4LD6A 2COWA 3QUIA 2O88A 3L1AA 1PSEA 3JB9I 3JCMX 2K6DA 2VKNA 5CKFA 3J7AF 1JJ2P 2EQJA 2KYMA 1N5ZA 2DERA 2YRVA 3H0FA 2L3QA 3FJPA 2EBPA 2E5QA 5A0LA 1KD1R 1N6AA 1K0XA 4KGZB 2RHYA 5D6XA 1VQPQ 2KE9A 1H8KA 1OX8A 3VS5A 1U1TA 1YITT 4E6RA 3FLGA 3HPWA 4M75B 3CXCP 2OTJA 3M57A 2XDDA 4M7DB 4FW2A 4R0KA 4LDUA 2XU8A 2FPFA 4J6YA 3C95A 1SSFA 1GFCA 1UGSB 5GAMf 4PJOA 2BUDA 3KFVA 2B86A 2DXBA 1UG1A 4C92G 1KJWA 1D0XA 3G4SA 4M78E 3JCMQ 2DL5A 1QMCA 2VUBA 1T0JA 2NUPA 1FX7A 3H8ZA 1Q81C 3I55Q 3GIBA 3FJ5A 3SDZA 1S72A 1EFNA 2RHIA 2VV5A 3EGXA 4A54A 2FZKB 4ELZC 2GNCA 4PJLA 2IG0A 5GAMd 3CCUQ 4DOVA 4QQ6A 3UPUA 5GAN8 5KYNA 5LJ3g 2MIOA 2GTOA 1GRIA 2NYSA 2M16A 5CR2A 5IT9E 3M5AA 1OEBA 3RNJA 2ATCB 4DBRA 1T3LA 4E7IA 2QDLA 3LGFA 3ZL7C 1NE8A 1WHHA 4HCKA 1K0SA 5KYYA 4PKCC 1KHCA 1M27C 2CP6A 4FM4B 2YHTA 3SD4A 4QW2A 2CYZB 2W0ZA 1VOMA 4M75E 1D1AA 1NYGA 1NEBA 2QQAA 3PTAA 3A8GB 2NWMA 3CD6Q 2RJCA 2QA4T 1YJNT 1VQ8A 2J06A 4C5IA 1YNZA 2BE9B 2ZPBB 2RO0A 4HT8A 1SRLA 3ZEHA 3G71A 1VQKQ 1S72T 1TH7A 1WLPB 4J9EA 1Q7YU 2QG9B 4MDXA 1Y7XA 4KT0E 2FG0A 4PJOD 4BE2A 4F04B 3VS0A 4PJNA 1XOVA 1YJ9A 2DXCA 3L42A 4OF1A 4M7DG 4B9WA 4BB7A 4IIOA 2JNGA 2JUFA 4J9IA 1YJWQ 3D7SB 2DO3A 3DB3A 4A4KA 1QQJA 4FYWB 3CCRQ 1V29B 3FRNA 2DEUA 2D8JA 1VQ5Q 4D8DA 2SEMA 3OYCA 2K79A 2LTOA 3A8MB 4JLGA 4J7IA 5LJ5d 4J9BA 1E6HA 2FVUA 1Y96A 3U23A 3P8HA 1PKTA 5I2SA 1RAEB 3RKWA 3G7ZA 3M9QA 4BD3A 1B3QA 5CAIA 1BI2A 3PIPA 2KY9A 3CCEQ 1VQ7A 1IHWA 1IZ6A 1WHJA 1TU0B 4LN2A 5GMKh 4LXCA 4XTVA 5LJ3j 5GANj 3QO3A 3OYKA 3PIOA 4A4FA 3CC7A 1A0NB 1ZSZA 2F2VA 2DM1A 4BACA 1QWEA 3E9GA 1DJ7B 3I5SA 1ZHIA 2RM4A 3R6NA 2YUPA 1X6GA 4IKFA 2RI3A 1BB9A 3JB9H 4X9CA 1WHLA 4KH0B 3CCLA 3F70A 4MZMA 3CC4Q 2VGNA 5EG2A 3HFNA 2R5AA 4VUBA 1UJYA 3JCMJ 2VB6A 4XTWA 2O2OA 2QA4A 1X6OA 3PGGA 3LH5A 2JZ2A 1SSHA 3V7RA 2WSCE 1VQ4T 2XHCA 1YWOA 4C92F 3CCQT 1AEYA 1K76A 2BKDN 3NHNA 4FSSA 4OMQA 3SWNC 1MHNA 3HRUA 4F14A 4J5YA 4OB1B 3M58A 1HK9A 3OYDA 3UA6A 3CCMA 3LLRA 1N8RU 2RQUA 5GMKl 1QWFA 2ED0A 1FMVA 2X51A 2GBQA 1TTHB 2BIVA 3OYFA 4C92E 2K3XA 3EGXB 3CCJT 6AT1B 3LWHA 1X01A 1WPYA 3CCUA 1XNIA 3JB9D 4Z88A 4NS5A 2XIDA 4KH1B 5GAOr 1YI2T 1W1FA 2HSPA 2QYZA 2LQ8A 3KUFA 2QGFB 2V26A 4JS5A 3EG9B 4XQ3A 1NEGA 3REAB 1VQPT 1OU8A 1WHKA 2LNVA 4IUPA 3VRYA 2KAFA 4C0ZA 4R56A 2M9UA 1IGQA 1I07A 1YJ9T 2E70A 1ZSZC 3RESA 2L3RA 1ABOA 3M53A 2P4RA 1WJRA 3G4ST 3C94A 4M77D 4C5EA 5CCAA 4HCZA 4O6JA 1R77A 4RTYA 3R6OA 1WXBA 2OAUA 1OYXA 2QQSA 3CCET 4C8QE 5KCHA 4L59A 1K8AU 3BW1A 4M77F 3CPWA 3UATA 4EMGA 5IHNA 3NTIA 1YIJA 3MEVA 4MMLA 1TOVA 4XAXB 2XICA 4GY5A 1OV3A 3JV3A 1OPKA 2X4WA 1D1BA 4QQGA 2MYSA 3M0QA 3OMGA 2ABLA 1QP3A 1K73U 2X4JA 2YUQA 2EVRA 4DBFA 3OY9A 1VQ6Q 3MJXA 2DAQA 3RMSA 3CCMT 2LQNA 2JTFA 4RG2A 3X24B 2DRMA 3E1SA 1ZLMA 1KHIA 2GQVA 2PZ1A 4LNPA 4WCIA 1WFWA 3JCMf 4V2SA 1K73R 1YP5A 2DL8A 3I5RA 3URGA 5DLQE 3CCQA 2DTIA 4IUVA 4PJOC 4BI8B 5GANh 1YBYA 3EH2A 4O5VA 1VQ6A 3HRSA 2D8HA 2LP5A 4PJOB 3E9FA 4M77C 2L5QA 1X2KA 2DD5A 2DNUA 5GAMe 3CCEA 2VC8A 5LJ3h 3CCLQ 3QBYA 5GJVB 4J9DA 2KYBA 3C12A 2RK2A 2EJGA 2JXBA 2DL4A 1BKBA 4OB2B 1OZ2A 4LD9K 2CGHA 3V8JA 1E7OA 4KUIA 2P0KA 1Y57A 2HQEA 1RAHB 5GMKe 1MMGA 2LJ3A 3NPFA 2CP7A 2JW4A 3RMQA 1W70A 1AZEA 1M90C 2CP3A 1K4US 4RTVA 4OB0B 4BI4A 2JMCA 4FYYB 2YT6A 2O9SA 1BI0A 3OS1A 2HKQB 2RB6A 4FIBA 2FZGB 2D6FA 4BE1A 3EFSA 2EQIA 2HBWA 2WSFE 4M7AA 3PMIA 4TVRA 2CUDA 2FB7A 2AKKA 2RNAA 3CCJA 3MP1A 1I4K1 4M78F 3ZFJA 1B07A 1WZOA 3UT1A 5IAYA 2V8JA 4JRKA 3RDVA 1ZSZB 1IO6A 2YLBA 1LNXA 1LCKA 4PLLA 3EG1A 5KH6A 4HCCA 1UB4A 4LDWA 2CH4A 3PVLA 2L3PA 3ME9A 1MMNA 2EYYA 4M75G 5M9OA 4BY6B 4AFQC 5GAN7 2KI7A 1K9AA 2K9GA 1BIAA 3OYGA 1VQKT 3EGUA 5GANg 1ZUYA 5GAN2 2EJ9A 2G6FX 1UTIA 2QDYB 3CC7Q 1V1CA 1YCYA 1GL5A 1WX6A 2IPOB 2NUPB 3QXEB 3JCMW 3HL8A 1WDXA 2RMOA 3HKSA 2FZCB 3QKJA 3OYBA 3PT9A 5CKEA 1NLOC 3S3OA 3CBOA 1SG5A 3JCMg 3RBBB 2DMOA 1Y96B 3JRZA 5IXFA 3H9NA 2VGMA 4D6WA 4JLIA 4OMOA 3VS2A 2KVQG 1WYXA 4KUDK 2EQKA 1Q82C 1M3BA 2NUZA 3JB9F 1H3HA 2OTLT 1LOJA 3I35A 1ZUKA 3QYGB 1BCOA 3CEYA 3OBYA 1YIJT 1ZSGA 2NUTB 1NPPA 2KGTA 2KMTA 1PNJA 3RR6A 3P8BB 4C8QA 1MNDA 3DLMA 2DBKA 4J9CA 1M30A 2L3SA 3HHTB 5D7UA 1AOJA 2CKKA 2E1HA 1RAIB 2GF7A 3CC2Q 4OGCA 4C0FA 5L23A 4M77A 1TUCA 2FO0A 2X4XA 4K11A 1WIEA 1K8AC 3M0SA 5KE3A 2L89A 5FU7B 1VUBA 2LCSA 3TU4K 2OTJQ 4DEXA 1KC8U 1JBMA 5FW9A 2FRWA 1RAAB 7AT1B 5KYXB 2EJFA 3WVDB 3A1PA 1VA7A 2M1HA 2DZ9A 2DEQA 1G8XA 1KQSS 2MAMA 5IXBA 3CMAQ 4J8OA 2GTJA 2A3LA 2COZA 4C92C 1WA7A 1NLPC 5AYFA 3CCVQ 4XU3A 3SEMA 4M7AF 2HCKA 2XI9A 5LJ3d 2LCCA 4LE9A 1MGQA 5I21A 2RHUA 2CH4W 3CCJQ 2JTMA 3GOXA 1D0ZA 3MO8A 3META 2FPDA 3C4SA 1NBEB 5I2MA 3OBWA 3H41A 2G3RA 3QSUA 1SRMA 1QVGS 1TG0A 4HVUA 4XTUA 2BE7D 2BZXA 2RH2A 4PJOF 4NOYA 2XK0A 3REBB 4QT7A 3DLLA 3J81E 3LYIA 3EG2A 2KXDA 3VU3C 3VS3A 1EZZB 2KROA 4Y92A 2E12A 1I5OB 1FXXA 2OX7A 4E7ZA 4ANJA 3J80E 1JU5C 1PD0A 4Z89A 2M0YA 1W4SA 1VIEA 1WXTA 4C8QG 4E7LA 1ACMB 3RERA 2FRYA 4WTOB 3JCMd 2D9TA 2OJ2A 1XTDA 2YUOA 1QCNA 1WQ7A 2P0QA 4BE0A 4JZ3A 2B8AA 2LMJA 4X9DA 3VYHB 2E5KA 1T3SA 5FWBA 2DPPB 1WJSA 2EWNA 4EMKB 4BDYA 3HFOA 3M4GA 5GMKi 2V1RA 3BY7A 1M5Q1 3E2UA 3CD6T 2D0NA 2OAWA 1SHFA 4N0AC 1VQ8Q 1PKSA 4M7AG 5L8RE 1GXIE 4JJBA 2KT8A 1GBQA 1BCMA 3CCUT 3PE0A 1B34B 2DZCA 1Z9QA 1QLYA 2F69A 2HL5C 3AT1B 1G3WA 2LDMA 1WNLA 2K7AA 1JJ2S 1YWPA 2KK4A 4PJOG 2ROLA 3X25B 2LX9A 1M1KR 1IRXA 4FYXB 3OYLA 2KSSA 3CCRT 4PFZA 1K73C 4JUVA 3RUXA 3OYNA 4FT2A 3THKA 4KBMB 4DBQA 2CP5A 2C06A 1WHGA 3EHRA 1C1AA 2CP0A 2H3EB 4CC2A 1OOTA 1UHCA 2R58A 2XDPA 1RACB 4KGXB 2JM8A 2F5TX 2X9HA 3CPFA 3O5ZA 4QVCA 3CMAT 2LC4A 1G2BA 4MMKA 1VQMA 4LDVA 4RCBA 4HVWA 4J83A 1K8AR 1VQ5A 2QA4Q 3H6ZA 3FC3A 1QVFP 2QGGA 3JSCA 2OTLQ 1AZGB 1V76A 1UHFA 1RAFB 2YRCA 5HK3A 3A8LB 2QEXQ 1VQNA 3M54A 5GAN5 4M7DF 5KYUB 3LX7A 1G83A 1W2BP 3ASKA 3PFSA 1OZ3A 4M75F 3UDCA 5J3BA 2M51A 3CXCA 1VQ7Q 1QVFA 4L5GA 1R8OB 4QVZA 3CC4A 2VYTA 1Q82U 4DOWA 1NJIU 1I8FA 2O31A 9ATCB 2RQRA 5HKCA 4M7AB 4M77E 1PWTA 5GAOp 3OYHA 5KYYB 4JZ4A 3Q1JA 4N4HA 2FHDA 3OW2S 2Y90A 3TEEA 2HQXA 2V8KA 2VASA 4M78G 1YCSB 3OSVA 1UGVA 2L8DA 2HEQA 4II1A 5GANd 3OYJA 1MV3A 1OI1A 2JJ9A 2PQWA 4A53A 1Q86U 1U8RA 2AK5A 2ED1A 2DA9A 1M4ZA 1Y07A 3QJYA 2QK0A 2PVDB 2E6NA 2MOXA 3TQ7P 4C0DB 4M75D 1SHGA 5GAN3 1PM3A 1JO8A 3OSSC 2J7IA 2EYXA 4ZNXA 1PC0A 3TCJA 5CK9A 4XTXA 4RTXA 2YUNA 1Q7YC 1S72Q 3CD6A 4MZPA 2EYWA 2E6ZA 2LQWA 4FT4A 5GAMj 4KULA 1GFDA 1O75A 3HRTA 4UC4A 3MCAB 1UGQB 2DJZA 3RKYA 4N4GA 2YDLA 4X34A 3MEWA 3OB9A 3QHSA 2DXUA 3G6EQ 3OS2A 3SHWA 4F7UG 1M3AA 1D0YA 5LJ5g 4RTTA 2RA2A 2XD0A 1TSFA 2DILA 4AFZC 1YJ9Q 4J9HA 4RTWA 2LQKA 2ZPEB 3V7CA 1AT1B 4E7JA 2JT4A 5C0MA 3BFMA 4RG8A 4M77G 2LVMA 3WVEB 3OYIA 4E7SA 1D1CA 1I0CA 5HY6A 1TS9A 3CCLT 2BZYA 3OA6A 3SWNB 2PVOB 1PD1A 1K9MR 4GBQA 1EIFA 3GNFB 5I22A 2MK5A 4PFOA 3OYMA 3EH1A 2EW3A 1C6VX 1G3YA 1AWOA 2A0FB 1RLPC 3QPHA 4JJNK 3NMZC 1SPKA 3S3NA 4F7UA 2ECZA 4C8QC 1ZA1B 4C92B 3M0UA 1OU9A 2DXTA 3QZ5B 3NTHA 1K9MU 3TVTA 1WHMA 2EYZA 1RLQC 1JJ2A 2XG8D 2DRKA 4OMPA 2AZSA 4FYVB 3S6WA 2DF6A 1U1SA 2RQWA 5KE2A 5KYWB 5GAOm 1T0HA 2A36A 1UUEA 3UA7A 1WGSA 2X3XD 4FW1A 2RHZA 1BU1A 2DE0X 4AG1C 2W10A 4EMKA 4ZGJB 4DBHA 1KD1U 1Y0MA 3M0PA 3VKIA 3G4SQ 1IB8A 4HKEA 2GFAA 4M7DE 1KD1C 1M2VA 5DY9A 1YFNA 3DB4A 4CC4B 1YJNQ 1XJWB 3OW2A 1Q7YR 4FCYA 2HBPA 3M56A 1B34A 4M7AD 1BI3A 2JTEA 2DETA 1TUGB
chains in the Genus database with same CATH topology
2RJCA 2MWOA 3DLMA 5GAOl 2QA4T 1YJNT 1VQ8A 3LGLA 4NL3A 1KQ1A 3FDRA 4C5IA 2ZPBB 3MHXA 3X20B 2RO0A 4HT8A 3HHTB 2CKKA 2E1HA 2JN0A 4FSXA 3ZEHA 3G71A 4BDZA 2V8IA 1S72T 1TH7A 2JOYA 2RHXA 2QEXT 1KG1A 2GF7A 1Q7YU 4MDXA 4NL2A 3MP8A 4OGCA 1Y7XA 4C0FA 1W2BA 4KT0E 4M77A 4Y91A 4PJOD 2JVVA 3CBMA 5DLOA 2DVEA 4BE2A 1VQOA 3JB9J 1VQ9T 1VQOT 2RK1A 1VQ4A 1XOVA 1O9SA 3A8OB 1YJ9A 2DXCA 4PLIA 2X4XA 3CC2T 3L42A 5CKHA 1IREB 3CBPA 4BUGA 4OF1A 3ER0A 4EMKC 2RD1A 2L89A 4XU1A 5KE3A 4M7DG 2ZPFB 3EAEA 4GLKA 5GANe 5FU7B 4B9WA 1VUBA 4BB7A 3G6EA 2JNGA 3TU4K 2JUFA 2DTOA 2P4TA 4M78A 2DO3A 2ZZDA 4ATOA 2QTXA 3DB3A 4A4KA 1KC8U 1JBMA 1V29B 3FRNA 2DTHA 2EJFA 3WVDB 3L2ZA 2EQMA 3OYCA 3OYDA 2LTOA 2M1HA 3A8MB 4E7HA 2DZ9A 4J7IA 4JLGA 5LJ5d 3VJPA 4JDSA 2DEQA 4M78C 4F7UF 2NLUA 4Y28E 2FVUA 3L2WA 4JS4A 1Y96A 4IUQA 3P8HA 1KQSS 5FRNA 2MAMA 5I2SA 3RKWA 3G7ZA 3CMEA 3M9QA 4J8OA 4BD3A 2A3LA 1FWZA 4C92C 4N0AA 5CAIA 1BI2A 3PIPA 2KY9A 3CXCS 5AYFA 3BDLA 4XU3A 1IZ6A 1N9SA 4C92D 1VQ7A 2E64A 2XI9A 4M7AF 5LJ3d 4BI3A 2LCCA 5GMKh 1YHQA 4XTVA 5LJ3j 5GANj 2EIFA 3QO3A 3OYKA 1MGQA 5I21A 3PIOA 4A4FA 2RHUA 3CC7A 2CZ7B 2R5MA 4BACA 2JTMA 3GOXA 3E9GA 2PU9B 2EAYA 3MO8A 3META 1G3TA 1DJ7B 4C92A 1VQMT 3C4SA 1ZHIA 4LDXA 5I2MA 1RI0A 2PVGB 2RM4A 3OBWA 2G3RA 4C5GA 5LJ3e 1QVGA 4R55A 3HSBA 3QSUA 2CZ6B 1QVGS 3X26B 3T9NA 4XTUA 4XU2A 4IKFA 3CMET 2RH2A 3FIFA 4PJOF 2RI3A 4NOYA 2HNIA 2XK0A 4ZN1A 3CPWS 3JB9H 3DLLA 3LW5E 4A4HA 2I2LA 3LYIA 4X9CA 4F7UE 4M78B 5CQXA 3J81E 2XDBA 3VU3C 3CCLA 3F70A 3PMTA 2K5IA 4MZMA 3JCMb 1NJIC 2K3YA 2VGNA 5EG2A 3S3MA 3HFNA 2EFIA 3OQ5A 2R5AA 4VUBA 2E12A 1FXXA 4OGEA 4YTLA 1VQPA 3V7SA 3JCMJ 3EFRA 4M77B 3J80E 4XTWA 4ZGDB 4M7AE 4C8QB 2FL7A 2QA4A 1X6OA 3VUBA 1W4SA 1VIEA 3PGGA 4C8QG 4E7LA 3NTKA 4QQDA 3GP8A 2VXFA 3P8DA 2JZ2A 3RERA 1AHJB 4RKUE 3V7RA 3JCMd 2D9TA 1NJIU 2XKOC 1M1FA 5FU6B 3TREA 4HCBA 4JRIA 2WSCE 3FB9A 3M59A 1VQ4T 1XTDA 2XHCA 5FROA 1WQ7A 4EDUA 2P0QA 4BE0A 1M90U 1X75C 4C92F 2B8AA 3CCQT 3GNGA 4X9DA 3L2QA 3VYHB 4IUUA 2BKDN 3JCMe 3SWNC 4PJOE 2DPPB 1MHNA 2PUKB 3JCMc 1YITA 1WJSA 2MF2A 4M75A 3QDRB 3HRUA 4RCCA 4MDWA 2RJFA 2EWNA 4J5YA 1PSFA 4OB1B 3M58A 1HK9A 3DKMA 2GFUA 4EMKB 3HFOA 5DM7R 1D3BB 3M4GA 5GMKi 3LLRA 3CCMA 2AHJB 1YJWA 1YJNA 1N8RU 1VQ8T 5GMKl 3BY7A 1QVFS 1BYMA 2LT4A 2K57A 1M5Q1 3CD6T 2RI2A 4MZTA 1VIFA 2BIVA 3INZA 4N0AC 3OYFA 1YI2A 4M7AG 5L8RE 4C92E 2K3XA 5GAMh 1GXIE 2HD0A 3CCJT 2QQRA 4IURA 1G5VA 3LWHA 3I55A 3CCUT 1X01A 2M0OA 3QYHB 4CRIA 1WPYA 1B34B 3OYEA 3I55T 1XNIA 2DZCA 2RJDA 3JCMV 3X28B 3CCUA 4JRPA 3JB9D 2R57A 4NS5A 5FU6C 3OS0A 2XIDA 4A4GA 2F69A 5GAOr 1YI2T 3A8HB 1G3WA 4EMHA 4FU6A 2LDMA 1WNLA 5KCOA 3E19A 2LQ8A 1JJ2S 3KUFA 3SFMA 1JB0E 5GAOn 5LJ5e 2KK4A 4PJOG 4BDYA 4JS5A 3X25B 2E65A 2LX9A 1BI1A 1H641 3VYGA 1M9SA 4XQ3A 5A0DA 4DA4A 5GAN6 1VQPT 3I56T 2X35A 5CKBA 1VQLT 2KQWA 3GPLA 3OYLA 5FLXE 2KSSA 1K9MC 2ZGWA 2LNVA 3CCRT 3LH0A 4C8QD 4OP0A 2ZPHB 1K73C 3GF5A 4JUVA 2CZ0B 3RUXA 3QG1A 3OYNA 4FT2A 4IUPA 3G6ET 2KAFA 3MP6A 4KBMB 4C0ZA 4R56A 4M7DA 1M1GA 2M9UA 2C06A 3CC2A 3PNWC 1YJ9T 2E70A 2RI5A 3FEOA 2E10A 3RESA 4BY6C 2L3RA 1KQ2A 3M53A 1WJRA 1RL2A 3G4ST 2YLCA 2R58A 2XDPA 4ELYC 5GMKj 3C94A 5GAOq 4XTZA 3L2RA 2DIQA 4IUTA 4M77D 4M78D 4C5EA 2F5TX 2K5LA 5CCAA 3CPFA 2CS7A 4HCZA 4O6JA 4QVCA 3CMAT 2LC4A 1P92A 1XQHA 4MMKA 1VQMA 3R6OA 4LDVA 2OAUA 2WSEE 1OYXA 3O8VA 2O4XB 2QQSA 3QIIA 4C8QE 5J39A 3I56A 3CCST 3CCET 1I81A 4RCBA 5KCHA 2LRQA 4L59A 4E47A 3CCVA 1K8AU 3BW1A 4M77F 3CPWA 1HXDA 5IN1A 5CQYA 2O4XA 4J83A 1VQ5A 3N5BB 4N4IA 4EMGA 3H6ZA 3LWIA 3VUZA 3FC3A 3NTIA 3SWNA 4LDYA 1YIJA 3JAME 4DQ2A 3JSCA 2H3JA 3MEVA 3M4YA 4HT9A 5LJ3f 4MMLA 3MEUA 4XAXB 2DKGA 2XICA 4GY5A 4F7UB 5HK3A 2D0QB 3A8LB 4J6XA 3OS5A 1Y71A 2EYQA 3ZBDA 2X4WA 4Q5WA 4QQGA 3JB9G 1VQNA 3OMGA 3M54A 5GAN5 2DD4A 4M7DF 1QP2A 3LX7A 5A0GA 3ASKA 3HP9A 1QP3A 4C5HA 5GANf 3PFSA 1OZ3A 4M75F 1K73U 3UDCA 5J3BA 2X4JA 1QVPA 3CXCA 4C0DC 1QVFA 3CC7T 2Y4YA 4M7AC 4L5GA 3AHUA 5FRMA 3OY9A 1R8OB 2QI2A 4QVZA 3JCMh 1VQ7T 3CC4A 2EQUA 4EPCA 2DAQA 2VYTA 3RMSA 4DOWA 3CCMT 1YJWT 1Q82U 1I8FA 1NPRA 2JTFA 1N27A 2KDSA 4L6V5 4RG2A 5CIUA 5HKCA 4E7KA 3X24B 2VXEA 5GAN4 3E1SA 5LL6S 4M7AB 2HAXA 1KHIA 2GQVA 4M77E 5GAOp 3OYHA 4XK8E 3JCMf 2O01E 3UWNA 4V2SA 3WXMB 4RMOA 5LJ5h 2GCXA 2ZPIB 3Q1JA 2WACA 2ZPGB 2FHDA 4N4HA 3URGA 3V8KA 5DLQE 3CCQA 3OW2S 2DTIA 4IUVA 1KC8C 1N8RC 4BI8B 2Y90A 4JRQA 4PJOC 1Q86C 5GANh 1YBYA 4O5VA 5CVIA 3TEEA 3L2VA 2HQXA 2V8KA 2P0PA 5GAMg 1VQ6A 3HRSA 3M55A 5C6SA 4M78G 4WF2A 1M8VA 1G3SA 2MWPA 3OSVA 2L8DA 1VQ5T 4II1A 2QQ9A 5GANd 3OYJA 4PJOB 3E9FA 4M77C 1OI1A 2L5QA 2PQWA 4A53A 3CCVT 2F5KA 2MI6A 4OMFB 2DD5A 4J6WA 5GAMe 3CCEA 1Q86U 2VC8A 3CCSA 5LJ3h 1VQLA 1U8RA 2DK3A 2K4YA 5HK0A 3JCMP 2D6FA 1WQWA 1M4ZA 1Y07A 3QBYA 3QJYA 5LJ5f 1KQSA 4M75C 3CMAA 2X4YA 5D6YA 2PVDB 3C12A 4LD6A 2E6NA 2RK2A 2Y4XA 2EJGA 4HA8A 4ZTFA 1I5LA 2QXFA 2A7YA 3QUIA 1BKBA 4OB2B 2LT1A 4C0DB 2IVWA 1OZ2A 3L1AA 4M75D 4ZGEB 2E41A 4LD9K 1PSEA 2CGHA 3V8JA 5GAN3 2EKOA 3OSSC 3JB9I 4KUIA 3JCMX 2P0KA 4ZN3A 2ZCFB 2HQEA 3KXTA 4OVAA 5CKFA 3G71T 5GMKe 1UGPB 5GMKm 3J7AF 4QVDA 4J7FA 2EQJA 5D6WA 3TCJA 5CK9A 4XTXA 2YRVA 1Q7YC 3RMQA 3CD6A 4MZPA 3CC4T 3FJPA 2E6ZA 1M90C 2E5QA 5A0LA 1Q81U 1N6AA 4OB0B 4BI4A 1LJOA 4FT4A 5GAMj 1BI0A 4KULA 3OS1A 2RHYA 1WJQA 1VQ6T 1O75A 3HRTA 4UC4A 5D6XA 1H3ZA 2RB6A 3MCAB 1UGQB 4FIBA 2DJZA 1YITT 1U1TA 3RKYA 4N4GA 4X34A 3MEWA 3OB9A 3BDUA 3FLGA 3QHSA 2DXUA 3HPWA 3EFSA 3OS2A 4M75B 2WSFE 4BE1A 3PMIA 1VQNT 4M7AA 2OTJA 1NZ9A 4TVRA 4F7UG 3M57A 5LJ5g 2FB7A 2RA2A 2XDDA 3CCJA 2XD0A 3V8LA 1BIBA 4M7DB 3MP1A 1I4K1 4M78F 3ZFJA 2LQKA 2RJEA 2ZPEB 3V7CA 2FYKA 4XTYA 4E7JA 1UGRB 4LDUA 5C0MA 4FL6A 1ZQ1A 3UT1A 4A4EA 2XU8A 3BFMA 4XU0A 4J6YA 5IAYA 3C95A 1SSFA 2V8JA 1UGSB 5GAMf 4RG8A 4PJOA 4M77G 4JRKA 2PUOB 2LVMA 2QQBA 1VQKA 2BUDA 3WVEB 3MEAA 4OB3B 3OYIA 4PNOA 2YLBA 1LNXA 2DXBA 4PLLA 3OYYA 5HY6A 4C92G 5KH6A 4HCCA 3CCLT 1UB4A 4LDWA 5CKDA 3KBGA 3OA6A 3G4SA 4M78E 3ME9A 3SWNB 3JCMQ 2PVOB 1D3BA 2LCLA 4M75G 5M9OA 3GLXA 2VUBA 1EIFA 1N9RA 1FX7A 3GNFB 4BY6B 4C8QF 3H8ZA 1Q81C 2K2VA 3OYMA 3GIBA 2QEXA 3SDZA 5GAN7 1S72A 2RHIA 2VV5A 3CCRA 1BIAA 4C0GA 5J26A 3OYGA 4B9XA 1VQKT 5GANg 4A54A 1G3YA 3VV0A 5GAN2 4ELZC 2EJ9A 3QPHA 4JJNK 5LJ5j 2QDYB 2DIGA 2IG0A 5GAMd 3S3NA 4PL6A 1YCYA 4F7UA 4DOVA 4QQ6A 4C8QC 3UPUA 4M7DC 1JRIA 5GAN8 1M1KU 4C92B 5LJ3g 2OTLA 2DXTA 3QXEB 3QZ5B 3JCMW 3HL8A 3NTHA 5CO7A 1K9MU 2OTJT 2M16A 5CR2A 3HKSA 5IT9E 1JJ2A 3M5AA 4P5NA 3QKJA 3OYBA 3RKXA 3RIRA 4M7DD 2XG8D 3SB2A 1M1KC 3PT9A 5CKEA 3S6WA 1U1SA 4ZTJA 3S3OA 3CBOA 3A5ZB 3NFCA 5KE2A 4E7IA 3OYAA 3JCMg 5GAOm 1W2BS 3LGFA 1WGSA 1ZBXA 5A2QE 1YHQT 2RHZA 3OMCA 1NE8A 4EMKA 4ZGJB 1KD1U 1Y96B 3JRZA 3QJ6A 2VGMA 4ME7A 3VKIA 4D6WA 4JLIA 4PKCC 1KHCA 2KVQG 2MMPA 4FM4B 2YHTA 4Z02A 5FU7C 1QW1A 4HKEA 3SD4A 4CI0C 2GFAA 4KUDK 2EQKA 4M7DE 4QW2A 1Q82C 1UEBA 2CYZB 1KD1C 3QZ9B 3JB9F 5DY9A 1LOJA 2OTLT 1VQ9A 2CZ1B 3QYGB 3CEYA 3DB4A 4M75E 3OBYA 3L2UA 3OW2A 1YIJT 2HBPA 1NPPA 3M56A 1B34A 1K8AC 2KMTA 4M7AD 2QQAA 1BI3A 3PTAA 2K5FA 3A8GB 3P8BB 4C8QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C8Q G;  3PGG A;  1I4K 1;  5GAO l;  4M78 F;  2DKG A;  2VXF A;  4F7U B;  3RER A;  4J6X A;  4NL3 A;  1KQ1 A;  3V7C A;  3V7R A;  3JCM d;  3JB9 G;  2FYK A;  4HT8 A;  4JRI A;  3FB9 A;  4M7A E;  4XTY A;  5GAN 5;  2E1H A;  2JN0 A;  4M7D F;  1WQ7 A;  1TH7 A;  4C92 F;  3BFM A;  4XU0 A;  4J6Y A;  5GAN f;  4M75 F;  4X9D A;  4NL2 A;  5GAM f;  4PJO A;  4M77 G;  4JRK A;  4M77 A;  4Y91 A;  4PJO D;  3JCM e;  3SWN C;  4M7A C;  2DVE A;  3JCM c;  3AHU A;  3JB9 J;  4PJO E;  4M75 A;  3JCM h;  4RCC A;  4PNO A;  2YLB A;  1LNX A;  2EWN A;  4J5Y A;  4C92 G;  4EMK B;  1HK9 A;  1I8F A;  3HFO A;  2RD1 A;  1D3B B;  3M4G A;  4XU1 A;  4EMK C;  5GMK i;  4M7D A;  4M7D G;  5GAN e;  5GMK l;  2VXE A;  3BY7 A;  5GAN 4;  4M78 E;  4M7A B;  3SWN B;  3JCM Q;  2K57 A;  1D3B A;  1M5Q 1;  2DTO A;  4M77 E;  4M75 G;  5GAO p;  4M78 A;  3JCM f;  4V2S A;  2QTX A;  1N9R A;  4C8Q F;  1JBM A;  5LJ5 h;  3INZ A;  4N0A C;  4C8Q A;  3GIB A;  2DTH A;  3V8K A;  4M7A G;  2DTI A;  2EJF A;  4C92 E;  5GAN 7;  5GAM h;  2Y90 A;  4PJO C;  5GAN h;  3L2Z A;  1BIA A;  5GAM g;  4M78 G;  4A54 A;  1X01 A;  4WF2 A;  5GAN g;  1M8V A;  1WPY A;  1B34 B;  2DZ9 A;  2DZC A;  5LJ5 d;  3JCM V;  5GAN 2;  3JB9 D;  2EJ9 A;  2DEQ A;  4M78 C;  4F7U F;  5LJ5 j;  5GAN d;  4PJO B;  1Y96 A;  4M77 C;  5GAM d;  5GAO r;  4A53 A;  4F7U A;  1YCY A;  4EMH A;  4J6W A;  5GAM e;  3RKW A;  1WNL A;  4C8Q C;  2VC8 A;  5LJ3 h;  4M7D C;  1JRI A;  5GAN 8;  3JCM P;  4C92 B;  1WQW A;  5GAO n;  5LJ5 e;  4C92 C;  4PJO G;  5LJ3 g;  4N0A A;  5CAI A;  5LJ5 f;  2DXT A;  4M75 C;  2E65 A;  3JCM W;  1H64 1;  4XQ3 A;  4XU3 A;  5GAN 6;  1N9S A;  4HA8 A;  4C92 D;  2E64 A;  2EJG A;  1I5L A;  4M7A F;  5LJ3 d;  3RKX A;  3RIR A;  5GMK h;  2ZGW A;  4XTV A;  5LJ3 j;  4C8Q D;  3QO3 A;  4OP0 A;  5GAN j;  3QUI A;  1MGQ A;  4JUV A;  3RUX A;  3SB2 A;  5I21 A;  4M75 D;  3L1A A;  2E41 A;  1U1S A;  2CGH A;  3V8J A;  4M7D D;  5GAN 3;  2EAY A;  3JB9 I;  4C92 A;  3JCM X;  2E10 A;  3RES A;  3JCM g;  1KQ2 A;  2RM4 A;  5GAO m;  3HSB A;  3QSU A;  5LJ3 e;  5GMK e;  2YLC A;  5GMK j;  5GMK m;  4QVD A;  5GAO q;  4XTU A;  4XU2 A;  4EMK A;  4XTZ A;  4M77 D;  4XTX A;  1Y96 B;  4M78 D;  3FIF A;  4PJO F;  4NOY A;  2HNI A;  4QVC A;  3FJP A;  4JLI A;  3JB9 H;  2I2L A;  4F7U E;  4X9C A;  4MMK A;  4M78 B;  1LJO A;  2YHT A;  3VU3 C;  5GAM j;  4C8Q E;  3JCM b;  1I81 A;  4RCB A;  4M7D E;  3BW1 A;  4M77 F;  3JB9 F;  1HXD A;  2RB6 A;  3HFN A;  5DY9 A;  1LOJ A;  2DJZ A;  1U1T A;  3RKY A;  4M75 E;  4EMG A;  3QHS A;  3BDU A;  2DXU A;  3EFS A;  3SWN A;  4M75 B;  4M7A A;  1B34 A;  3V7S A;  3JCM J;  4F7U G;  3EFR A;  4M77 B;  4DQ2 A;  5LJ5 g;  4XTW A;  2FB7 A;  4HT9 A;  2RA2 A;  5LJ3 f;  4C8Q B;  4M7A D;  3V8L A;  1BIB A;  4MML A;  4M7D B; 
#chains in the Genus database with same CATH topology
 2MWO A;  5GAO l;  4J9G A;  3LGL A;  1KQ1 A;  4AG2 C;  3FDR A;  1IXD A;  2JM9 A;  4FSX A;  4BDZ A;  4X1V A;  2QEX T;  4NL2 A;  3MP8 A;  1W2B A;  1MMA A;  2I0N A;  2JVV A;  3CBM A;  2DVE A;  3JB9 J;  4PLI A;  3CPW P;  3CC2 T;  4QKU A;  1IRE B;  4BUG A;  3ER0 A;  4EMK C;  2RD1 A;  4XU1 A;  2ZPF B;  3EAE A;  3G6E A;  2DTO A;  3CCM Q;  1KSW A;  2ZZD A;  4ATO A;  1U06 A;  2EKH A;  2YWW A;  1W6X A;  1VQ4 Q;  1B7T A;  1C0M A;  4HVV A;  4E7H A;  2F2X A;  4JDS A;  4M78 C;  2NLU A;  4Y28 E;  5EC7 A;  4IUQ A;  4AFS C;  5FRN A;  2ZAE A;  1UE9 A;  3QWY A;  4EIK A;  1GCP A;  4N0A A;  2A28 A;  1QCF A;  2COY A;  2VVK A;  2H8H A;  1GCQ C;  2LNH B;  4BI3 A;  1YHQ A;  1HD3 A;  2DJQ A;  4AMC A;  3G71 Q;  2R5M A;  3QDF A;  1PRL C;  2EAY A;  1VQM T;  4KRT A;  3EFO A;  4OMN A;  2GQI A;  5LJ3 e;  2J05 A;  1UJ0 A;  1VYU A;  3T9N A;  2KRN A;  1AWX A;  1RAD B;  1Z9Z A;  3CPW S;  4B6M A;  3LW5 E;  2I2L A;  4F7U E;  4M78 B;  1F1B B;  1VQN Q;  3JCM b;  1RUW A;  1BK2 A;  3S3M A;  2EFI A;  2E3I A;  1PRM C;  4OGE A;  4YTL A;  3G1J A;  3V7S A;  1VQP A;  4M77 B;  2DYI A;  1ZBJ A;  4C8Q B;  3VUB A;  3H0H A;  2VXF A;  1Q82 R;  1RAG B;  2IIM A;  2FEI A;  1N8R R;  3TRE A;  3VS7 A;  4JRI A;  2DVJ A;  5FRO A;  4EDU A;  1ZA2 B;  1X75 C;  2AIR B;  3GNG A;  1ZX6 A;  1M90 R;  2HMA A;  1YN8 A;  3JCM e;  4HXJ A;  2KBT A;  5KYX A;  4PJO E;  3JCM c;  2K2M A;  4M75 A;  3QDR B;  1MMD A;  2RQV A;  2RJF A;  1Q95 G;  2Z0W A;  1PSF A;  1X69 A;  3DKM A;  4M7D A;  5DM7 R;  1YJW A;  2RF0 A;  4AT1 B;  1YJN A;  1RAB B;  1VQ8 T;  1BYM A;  2LT4 A;  2K57 A;  2CDT A;  3OW2 P;  1LPL A;  1VIF A;  3INZ A;  2C0I A;  2DX1 A;  1YI2 A;  3I55 A;  1ZUU A;  1CKB A;  2HSE B;  2CSQ A;  4CRI A;  1JXO A;  2RJD A;  4JRP A;  1FMW A;  2PNI A;  1WI7 A;  1UDL A;  3QWX X;  3A8H B;  4EMH A;  4FU6 A;  5KCO A;  1M3C A;  5GAO n;  5LJ5 e;  1R0C B;  1GBR A;  2E65 A;  3VYG A;  1BI1 A;  1H64 1;  5A0D A;  4DA4 A;  5GAN 6;  3I56 T;  2X35 A;  1VQL T;  3GPL A;  3EHQ A;  1CKA A;  5FLX E;  1K9M C;  2ZGW A;  1SKU B;  2VWF A;  3LH0 A;  4OP0 A;  4C8Q D;  3GF5 A;  1VYV A;  2CZ0 B;  4F17 A;  3QG1 A;  3G6E T;  2DL3 A;  3MP6 A;  3I56 Q;  3UF4 A;  1IGU A;  1PHT A;  4OMM A;  2E10 A;  4BY6 C;  1KQ2 A;  1X6B A;  1RL2 A;  2YLC A;  5GMK j;  5GAO q;  2EGC A;  2DIQ A;  4IUT A;  1Q86 R;  4M78 D;  2AKL A;  1JXM A;  1P92 A;  1M2V B;  2WSE E;  3QII A;  2O4X B;  5J39 A;  3MKD A;  3I56 A;  1I81 A;  3CCV A;  3MPU B;  4E47 A;  1Q81 R;  1HXD A;  2YSQ A;  5IN1 A;  3N5B B;  4N4I A;  3EG0 A;  4LDY A;  3JAM E;  2H3J A;  4HT9 A;  3M4Y A;  5LJ3 f;  4F7U B;  3OS5 A;  1Y71 A;  2M02 A;  3ZBD A;  1X27 A;  2DD4 A;  1QP2 A;  2DFU A;  5A0G A;  3HP9 A;  5GAN f;  2KRM A;  4C0D C;  3CC7 T;  2Y4Y A;  1RI9 A;  3VS6 A;  5FRM A;  3JCM h;  2QI2 A;  1NM7 A;  2EQU A;  1YJW T;  2K3B A;  1VQ7 T;  1N27 A;  2RPN A;  5CIU A;  1M8M A;  2VXE A;  5GAN 4;  1TUD A;  3EG9 A;  2CRE A;  3HTR A;  2GCX A;  1N8R C;  3EG3 A;  5CVI A;  3L2V A;  5GAM g;  5C6S A;  2MWP A;  4OMF B;  4RTU A;  4J6W A;  3CCS A;  1TWB A;  5HK0 A;  2K4Y A;  2A08 A;  2AT1 B;  5LJ5 f;  1EX4 A;  1PG5 B;  1KQS A;  2X4Y A;  2KEA A;  1U3O A;  5D6Y A;  4HA8 A;  4ZTF A;  2Y4X A;  1I5L A;  2QXF A;  1WXU A;  1FYN A;  2A7Y A;  2QTV A;  4F16 A;  2LT1 A;  4OML A;  2IVW A;  4ZGE B;  8ATC B;  2E41 A;  2C0O A;  2EKO A;  1S1N A;  1QKX A;  4ZN3 A;  3KXT A;  2ZCF B;  4OVA A;  3G71 T;  1UGP B;  5GMK m;  4QVD A;  4J7F A;  5D6W A;  2P84 A;  1AWJ A;  3ULR B;  3CC4 T;  2J6F A;  1Q81 U;  1LJO A;  2YXY A;  1WJQ A;  1VQ6 T;  1H3Z A;  5KYU A;  2DBM A;  3BDU A;  1VQN T;  1NZ9 A;  3V8L A;  1BIB A;  3EGD B;  2RJE A;  2E3H A;  2FYK A;  4XTY A;  1UGR B;  3I9Q A;  4FL6 A;  1ZQ1 A;  4A4E A;  5IHK A;  1AD5 A;  4XU0 A;  1R0B G;  2PUO B;  1VQK A;  2QQB A;  4ORZ A;  3MEA A;  4OB3 B;  4PNO A;  3OYY A;  2GGR A;  2C0T A;  5CKD A;  3KBG A;  4D8K A;  1SEM A;  1NYF A;  3EFO B;  2HKN A;  2F1L A;  1D3B A;  2LCL A;  3GLX A;  1N9R A;  4C8Q F;  2K2V A;  2QEX A;  5IHI A;  1D09 B;  3CCR A;  4C0G A;  5J26 A;  4B9X A;  1VQM Q;  3VV0 A;  2DYB A;  5LJ5 j;  2QAZ A;  2DIG A;  4PL6 A;  1VYT A;  2HQH A;  4M7D C;  1JRI A;  1M1K U;  4KGV B;  2OTL A;  4JJD A;  3CQT A;  1OUL A;  1FMK A;  2CT3 A;  5CO7 A;  1I1J A;  2OTJ T;  1LVK A;  4P5N A;  3RKX A;  3RIR A;  4M7D D;  4E2F B;  3SB2 A;  1M1K C;  1VQL Q;  4ZTJ A;  3TSZ A;  2L0A A;  4PK4 A;  3A5Z B;  3NFC A;  3OYA A;  3A98 A;  1W2B S;  2JS0 A;  4PJM A;  1YHQ T;  1ZBX A;  5A2Q E;  3OMC A;  3M0T A;  3QJ6 A;  2L2P A;  4ME7 A;  2HZY A;  1AWW A;  1U5S A;  2MMP A;  4Z02 A;  5FU7 C;  1QW1 A;  4CI0 C;  1UEB A;  3QZ9 B;  1KIK A;  1VQ9 A;  1TXQ A;  2CZ1 B;  2HDA A;  1MUZ A;  3L2U A;  2PTK A;  2JMA A;  1KFZ A;  4JPB W;  1ARK A;  2K5F A;  2MCN A;  4J9F A;  1X2Q A;  4M4Z A;  1YIJ Q;  4NL3 A;  1E6G A;  3MHX A;  3X20 B;  2JN0 A;  2V8I A;  1HJD A;  2JOY A;  2RHX A;  1VQ9 Q;  1M2O A;  1KG1 A;  3VS4 A;  4Y91 A;  1YI2 Q;  5DLO A;  1VQO A;  1VQ9 T;  1VQO T;  5HCK A;  2KR3 A;  2RK1 A;  1VQ4 A;  3A8O B;  1O9S A;  3VRZ A;  5CKH A;  3CBP A;  1OX9 A;  4GLK A;  5GAN e;  1QVG P;  2OI3 A;  2P4T A;  2ROT A;  4M78 A;  2QTX A;  4PFP A;  4RTZ A;  2DTH A;  3PVQ A;  4LUD A;  3L2Z A;  2EQM A;  1QCO A;  1YHQ Q;  3VJP A;  4F7U F;  1OPL A;  2SRC A;  3L2W A;  4JJC A;  3CME A;  3IQL A;  1FWZ A;  1KQS P;  3CXC S;  3BDL A;  1N9S A;  4C92 D;  2E64 A;  2EIF A;  2AZV A;  2CZ7 B;  5I11 A;  3CME Q;  2PU9 B;  2A37 A;  1G3T A;  4C92 A;  1QKW A;  4LDX A;  2F2W A;  1RI0 A;  2PVG B;  3HSB A;  4C5G A;  1QVG A;  4R55 A;  1HSQ A;  2CZ6 B;  3X26 B;  4XU2 A;  3CME T;  3FIF A;  2HNI A;  4ZN1 A;  4A4H A;  5CQX A;  2XDB A;  2YRD A;  3PMT A;  2K5I A;  4PJJ A;  4Z8A A;  1NJI C;  2K3Y A;  1OQK A;  5KYW A;  3OQ5 A;  1NG2 A;  2BZ8 A;  1JEG A;  1UFF A;  3EFR A;  4ZGD B;  4M7A E;  2FL7 A;  1YIT Q;  3NTK A;  4QQD A;  3GP8 A;  3BE3 A;  3P8D A;  8AT1 B;  3CCQ Q;  1AHJ B;  2LZ6 B;  4RKU E;  5FWC A;  2FPE A;  2XKO C;  1M1F A;  5FU6 B;  4HCB A;  3FB9 A;  3M59 A;  2V1Q A;  1M90 U;  3C0C A;  3L2Q A;  4IUU A;  4LUE A;  1SF9 A;  2PUK B;  1YIT A;  2MF2 A;  4RCC A;  2BTT A;  4MDW A;  4CC3 A;  3H0I A;  1K1Z A;  2GFU A;  1D3B B;  2AHJ B;  2HL3 A;  1QVF S;  2RN8 A;  2RI2 A;  4MZT A;  3VS1 A;  5GAM h;  2E4H A;  2HD0 A;  2QQR A;  4IUR A;  1GCQ A;  1G5V A;  2LJ0 A;  2M0O A;  3QYH B;  3OYE A;  2D1X A;  3I55 T;  3X28 B;  3JCM V;  2ESW A;  1CSK A;  2R57 A;  5FU6 C;  5GJW B;  3NGP A;  4A4G A;  3OS0 A;  2DL7 A;  1VQO Q;  2LX7 A;  3E19 A;  3SFM A;  1JB0 E;  2EGA A;  5IH2 A;  2X3W D;  1M9S A;  2J6K A;  5CKB A;  2KQW A;  2KRS A;  1ABQ A;  1J3T A;  2ZPH B;  2CUB A;  4ESR A;  1M1G A;  3CC2 A;  2J6O A;  3PNW C;  2RI5 A;  3FEO A;  2KNB B;  3EGD A;  4ELY C;  1IHV A;  4XTZ A;  3L2R A;  3GBQ A;  2K5L A;  2CT4 A;  2CS7 A;  1XQH A;  1BBZ A;  4JS4 A;  3M0R A;  3O8V A;  3CCS T;  1H92 A;  1X43 A;  2LRQ A;  4IIM A;  2XMF A;  5CQY A;  2O4X A;  3CCS Q;  3LWI A;  3VUZ A;  3SWN A;  1UEC A;  4DQ2 A;  2MPX C;  1MNE A;  3MEU A;  2DKG A;  2D0Q B;  4J6X A;  4RUG A;  1NJI R;  2EYQ A;  4Q5W A;  3JB9 G;  1HYO A;  2EPD A;  5AT1 B;  2KT1 A;  4C5H A;  4AFU C;  1JQQ A;  1QVP A;  4M7A C;  3AHU A;  2NUT A;  1KK7 A;  4EPC A;  1AVZ C;  1NPR A;  4L6V 5;  2KDS A;  4E7K A;  2QAS A;  4CC7 A;  5LL6 S;  2HAX A;  2DLP A;  2CSI A;  2KXC A;  4XK8 E;  2O01 E;  3UWN A;  3WXM B;  4RMO A;  5LJ5 h;  2ZPI B;  2WAC A;  2ZPG B;  2CP2 A;  3V8K A;  1KC8 C;  4JRQ A;  1Q86 C;  1KC8 R;  2P0P A;  3M55 A;  4GLM A;  2RQT A;  4WF2 A;  1M8V A;  1G3S A;  4DEY A;  3TSW A;  1VQ5 T;  2QQ9 A;  2EGE A;  2JS2 A;  2F5K A;  2MI6 A;  3CCV T;  1VQL A;  2DK3 A;  3JCM P;  1WQW A;  2ENM A;  2LJ1 A;  4A63 B;  1PCX A;  5ECA A;  4M75 C;  3CMA A;  1MV0 B;  2O9V A;  4LD6 A;  2COW A;  3QUI A;  2O88 A;  3L1A A;  1PSE A;  3JB9 I;  3JCM X;  2K6D A;  2VKN A;  5CKF A;  3J7A F;  1JJ2 P;  2EQJ A;  2KYM A;  1N5Z A;  2DER A;  2YRV A;  3H0F A;  2L3Q A;  3FJP A;  2EBP A;  2E5Q A;  5A0L A;  1KD1 R;  1N6A A;  1K0X A;  4KGZ B;  2RHY A;  5D6X A;  1VQP Q;  2KE9 A;  1H8K A;  1OX8 A;  3VS5 A;  1U1T A;  1YIT T;  4E6R A;  3FLG A;  3HPW A;  4M75 B;  3CXC P;  2OTJ A;  3M57 A;  2XDD A;  4M7D B;  4FW2 A;  4R0K A;  4LDU A;  2XU8 A;  2FPF A;  4J6Y A;  3C95 A;  1SSF A;  1GFC A;  1UGS B;  5GAM f;  4PJO A;  2BUD A;  3KFV A;  2B86 A;  2DXB A;  1UG1 A;  4C92 G;  1KJW A;  1D0X A;  3G4S A;  4M78 E;  3JCM Q;  2DL5 A;  1QMC A;  2VUB A;  1T0J A;  2NUP A;  1FX7 A;  3H8Z A;  1Q81 C;  3I55 Q;  3GIB A;  3FJ5 A;  3SDZ A;  1S72 A;  1EFN A;  2RHI A;  2VV5 A;  3EGX A;  4A54 A;  2FZK B;  4ELZ C;  2GNC A;  4PJL A;  2IG0 A;  5GAM d;  3CCU Q;  4DOV A;  4QQ6 A;  3UPU A;  5GAN 8;  5KYN A;  5LJ3 g;  2MIO A;  2GTO A;  1GRI A;  2NYS A;  2M16 A;  5CR2 A;  5IT9 E;  3M5A A;  1OEB A;  3RNJ A;  2ATC B;  4DBR A;  1T3L A;  4E7I A;  2QDL A;  3LGF A;  3ZL7 C;  1NE8 A;  1WHH A;  4HCK A;  1K0S A;  5KYY A;  4PKC C;  1KHC A;  1M27 C;  2CP6 A;  4FM4 B;  2YHT A;  3SD4 A;  4QW2 A;  2CYZ B;  2W0Z A;  1VOM A;  4M75 E;  1D1A A;  1NYG A;  1NEB A;  2QQA A;  3PTA A;  3A8G B;  2NWM A;  3CD6 Q;  2RJC A;  2QA4 T;  1YJN T;  1VQ8 A;  2J06 A;  4C5I A;  1YNZ A;  2BE9 B;  2ZPB B;  2RO0 A;  4HT8 A;  1SRL A;  3ZEH A;  3G71 A;  1VQK Q;  1S72 T;  1TH7 A;  1WLP B;  4J9E A;  1Q7Y U;  2QG9 B;  4MDX A;  1Y7X A;  4KT0 E;  2FG0 A;  4PJO D;  4BE2 A;  4F04 B;  3VS0 A;  4PJN A;  1XOV A;  1YJ9 A;  2DXC A;  3L42 A;  4OF1 A;  4M7D G;  4B9W A;  4BB7 A;  4IIO A;  2JNG A;  2JUF A;  4J9I A;  1YJW Q;  3D7S B;  2DO3 A;  3DB3 A;  4A4K A;  1QQJ A;  4FYW B;  3CCR Q;  1V29 B;  3FRN A;  2DEU A;  2D8J A;  1VQ5 Q;  4D8D A;  2SEM A;  3OYC A;  2K79 A;  2LTO A;  3A8M B;  4JLG A;  4J7I A;  5LJ5 d;  4J9B A;  1E6H A;  2FVU A;  1Y96 A;  3U23 A;  3P8H A;  1PKT A;  5I2S A;  1RAE B;  3RKW A;  3G7Z A;  3M9Q A;  4BD3 A;  1B3Q A;  5CAI A;  1BI2 A;  3PIP A;  2KY9 A;  3CCE Q;  1VQ7 A;  1IHW A;  1IZ6 A;  1WHJ A;  1TU0 B;  4LN2 A;  5GMK h;  4LXC A;  4XTV A;  5LJ3 j;  5GAN j;  3QO3 A;  3OYK A;  3PIO A;  4A4F A;  3CC7 A;  1A0N B;  1ZSZ A;  2F2V A;  2DM1 A;  4BAC A;  1QWE A;  3E9G A;  1DJ7 B;  3I5S A;  1ZHI A;  2RM4 A;  3R6N A;  2YUP A;  1X6G A;  4IKF A;  2RI3 A;  1BB9 A;  3JB9 H;  4X9C A;  1WHL A;  4KH0 B;  3CCL A;  3F70 A;  4MZM A;  3CC4 Q;  2VGN A;  5EG2 A;  3HFN A;  2R5A A;  4VUB A;  1UJY A;  3JCM J;  2VB6 A;  4XTW A;  2O2O A;  2QA4 A;  1X6O A;  3PGG A;  3LH5 A;  2JZ2 A;  1SSH A;  3V7R A;  2WSC E;  1VQ4 T;  2XHC A;  1YWO A;  4C92 F;  3CCQ T;  1AEY A;  1K76 A;  2BKD N;  3NHN A;  4FSS A;  4OMQ A;  3SWN C;  1MHN A;  3HRU A;  4F14 A;  4J5Y A;  4OB1 B;  3M58 A;  1HK9 A;  3OYD A;  3UA6 A;  3CCM A;  3LLR A;  1N8R U;  2RQU A;  5GMK l;  1QWF A;  2ED0 A;  1FMV A;  2X51 A;  2GBQ A;  1TTH B;  2BIV A;  3OYF A;  4C92 E;  2K3X A;  3EGX B;  3CCJ T;  6AT1 B;  3LWH A;  1X01 A;  1WPY A;  3CCU A;  1XNI A;  3JB9 D;  4Z88 A;  4NS5 A;  2XID A;  4KH1 B;  5GAO r;  1YI2 T;  1W1F A;  2HSP A;  2QYZ A;  2LQ8 A;  3KUF A;  2QGF B;  2V26 A;  4JS5 A;  3EG9 B;  4XQ3 A;  1NEG A;  3REA B;  1VQP T;  1OU8 A;  1WHK A;  2LNV A;  4IUP A;  3VRY A;  2KAF A;  4C0Z A;  4R56 A;  2M9U A;  1IGQ A;  1I07 A;  1YJ9 T;  2E70 A;  1ZSZ C;  3RES A;  2L3R A;  1ABO A;  3M53 A;  2P4R A;  1WJR A;  3G4S T;  3C94 A;  4M77 D;  4C5E A;  5CCA A;  4HCZ A;  4O6J A;  1R77 A;  4RTY A;  3R6O A;  1WXB A;  2OAU A;  1OYX A;  2QQS A;  3CCE T;  4C8Q E;  5KCH A;  4L59 A;  1K8A U;  3BW1 A;  4M77 F;  3CPW A;  3UAT A;  4EMG A;  5IHN A;  3NTI A;  1YIJ A;  3MEV A;  4MML A;  1TOV A;  4XAX B;  2XIC A;  4GY5 A;  1OV3 A;  3JV3 A;  1OPK A;  2X4W A;  1D1B A;  4QQG A;  2MYS A;  3M0Q A;  3OMG A;  2ABL A;  1QP3 A;  1K73 U;  2X4J A;  2YUQ A;  2EVR A;  4DBF A;  3OY9 A;  1VQ6 Q;  3MJX A;  2DAQ A;  3RMS A;  3CCM T;  2LQN A;  2JTF A;  4RG2 A;  3X24 B;  2DRM A;  3E1S A;  1ZLM A;  1KHI A;  2GQV A;  2PZ1 A;  4LNP A;  4WCI A;  1WFW A;  3JCM f;  4V2S A;  1K73 R;  1YP5 A;  2DL8 A;  3I5R A;  3URG A;  5DLQ E;  3CCQ A;  2DTI A;  4IUV A;  4PJO C;  4BI8 B;  5GAN h;  1YBY A;  3EH2 A;  4O5V A;  1VQ6 A;  3HRS A;  2D8H A;  2LP5 A;  4PJO B;  3E9F A;  4M77 C;  2L5Q A;  1X2K A;  2DD5 A;  2DNU A;  5GAM e;  3CCE A;  2VC8 A;  5LJ3 h;  3CCL Q;  3QBY A;  5GJV B;  4J9D A;  2KYB A;  3C12 A;  2RK2 A;  2EJG A;  2JXB A;  2DL4 A;  1BKB A;  4OB2 B;  1OZ2 A;  4LD9 K;  2CGH A;  3V8J A;  1E7O A;  4KUI A;  2P0K A;  1Y57 A;  2HQE A;  1RAH B;  5GMK e;  1MMG A;  2LJ3 A;  3NPF A;  2CP7 A;  2JW4 A;  3RMQ A;  1W70 A;  1AZE A;  1M90 C;  2CP3 A;  1K4U S;  4RTV A;  4OB0 B;  4BI4 A;  2JMC A;  4FYY B;  2YT6 A;  2O9S A;  1BI0 A;  3OS1 A;  2HKQ B;  2RB6 A;  4FIB A;  2FZG B;  2D6F A;  4BE1 A;  3EFS A;  2EQI A;  2HBW A;  2WSF E;  4M7A A;  3PMI A;  4TVR A;  2CUD A;  2FB7 A;  2AKK A;  2RNA A;  3CCJ A;  3MP1 A;  1I4K 1;  4M78 F;  3ZFJ A;  1B07 A;  1WZO A;  3UT1 A;  5IAY A;  2V8J A;  4JRK A;  3RDV A;  1ZSZ B;  1IO6 A;  2YLB A;  1LNX A;  1LCK A;  4PLL A;  3EG1 A;  5KH6 A;  4HCC A;  1UB4 A;  4LDW A;  2CH4 A;  3PVL A;  2L3P A;  3ME9 A;  1MMN A;  2EYY A;  4M75 G;  5M9O A;  4BY6 B;  4AFQ C;  5GAN 7;  2KI7 A;  1K9A A;  2K9G A;  1BIA A;  3OYG A;  1VQK T;  3EGU A;  5GAN g;  1ZUY A;  5GAN 2;  2EJ9 A;  2G6F X;  1UTI A;  2QDY B;  3CC7 Q;  1V1C A;  1YCY A;  1GL5 A;  1WX6 A;  2IPO B;  2NUP B;  3QXE B;  3JCM W;  3HL8 A;  1WDX A;  2RMO A;  3HKS A;  2FZC B;  3QKJ A;  3OYB A;  3PT9 A;  5CKE A;  1NLO C;  3S3O A;  3CBO A;  1SG5 A;  3JCM g;  3RBB B;  2DMO A;  1Y96 B;  3JRZ A;  5IXF A;  3H9N A;  2VGM A;  4D6W A;  4JLI A;  4OMO A;  3VS2 A;  2KVQ G;  1WYX A;  4KUD K;  2EQK A;  1Q82 C;  1M3B A;  2NUZ A;  3JB9 F;  1H3H A;  2OTL T;  1LOJ A;  3I35 A;  1ZUK A;  3QYG B;  1BCO A;  3CEY A;  3OBY A;  1YIJ T;  1ZSG A;  2NUT B;  1NPP A;  2KGT A;  2KMT A;  1PNJ A;  3RR6 A;  3P8B B;  4C8Q A;  1MND A;  3DLM A;  2DBK A;  4J9C A;  1M30 A;  2L3S A;  3HHT B;  5D7U A;  1AOJ A;  2CKK A;  2E1H A;  1RAI B;  2GF7 A;  3CC2 Q;  4OGC A;  4C0F A;  5L23 A;  4M77 A;  1TUC A;  2FO0 A;  2X4X A;  4K11 A;  1WIE A;  1K8A C;  3M0S A;  5KE3 A;  2L89 A;  5FU7 B;  1VUB A;  2LCS A;  3TU4 K;  2OTJ Q;  4DEX A;  1KC8 U;  1JBM A;  5FW9 A;  2FRW A;  1RAA B;  7AT1 B;  5KYX B;  2EJF A;  3WVD B;  3A1P A;  1VA7 A;  2M1H A;  2DZ9 A;  2DEQ A;  1G8X A;  1KQS S;  2MAM A;  5IXB A;  3CMA Q;  4J8O A;  2GTJ A;  2A3L A;  2COZ A;  4C92 C;  1WA7 A;  1NLP C;  5AYF A;  3CCV Q;  4XU3 A;  3SEM A;  4M7A F;  2HCK A;  2XI9 A;  5LJ3 d;  2LCC A;  4LE9 A;  1MGQ A;  5I21 A;  2RHU A;  2CH4 W;  3CCJ Q;  2JTM A;  3GOX A;  1D0Z A;  3MO8 A;  3MET A;  2FPD A;  3C4S A;  1NBE B;  5I2M A;  3OBW A;  3H41 A;  2G3R A;  3QSU A;  1SRM A;  1QVG S;  1TG0 A;  4HVU A;  4XTU A;  2BE7 D;  2BZX A;  2RH2 A;  4PJO F;  4NOY A;  2XK0 A;  3REB B;  4QT7 A;  3DLL A;  3J81 E;  3LYI A;  3EG2 A;  2KXD A;  3VU3 C;  3VS3 A;  1EZZ B;  2KRO A;  4Y92 A;  2E12 A;  1I5O B;  1FXX A;  2OX7 A;  4E7Z A;  4ANJ A;  3J80 E;  1JU5 C;  1PD0 A;  4Z89 A;  2M0Y A;  1W4S A;  1VIE A;  1WXT A;  4C8Q G;  4E7L A;  1ACM B;  3RER A;  2FRY A;  4WTO B;  3JCM d;  2D9T A;  2OJ2 A;  1XTD A;  2YUO A;  1QCN A;  1WQ7 A;  2P0Q A;  4BE0 A;  4JZ3 A;  2B8A A;  2LMJ A;  4X9D A;  3VYH B;  2E5K A;  1T3S A;  5FWB A;  2DPP B;  1WJS A;  2EWN A;  4EMK B;  4BDY A;  3HFO A;  3M4G A;  5GMK i;  2V1R A;  3BY7 A;  1M5Q 1;  3E2U A;  3CD6 T;  2D0N A;  2OAW A;  1SHF A;  4N0A C;  1VQ8 Q;  1PKS A;  4M7A G;  5L8R E;  1GXI E;  4JJB A;  2KT8 A;  1GBQ A;  1BCM A;  3CCU T;  3PE0 A;  1B34 B;  2DZC A;  1Z9Q A;  1QLY A;  2F69 A;  2HL5 C;  3AT1 B;  1G3W A;  2LDM A;  1WNL A;  2K7A A;  1JJ2 S;  1YWP A;  2KK4 A;  4PJO G;  2ROL A;  3X25 B;  2LX9 A;  1M1K R;  1IRX A;  4FYX B;  3OYL A;  2KSS A;  3CCR T;  4PFZ A;  1K73 C;  4JUV A;  3RUX A;  3OYN A;  4FT2 A;  3THK A;  4KBM B;  4DBQ A;  2CP5 A;  2C06 A;  1WHG A;  3EHR A;  1C1A A;  2CP0 A;  2H3E B;  4CC2 A;  1OOT A;  1UHC A;  2R58 A;  2XDP A;  1RAC B;  4KGX B;  2JM8 A;  2F5T X;  2X9H A;  3CPF A;  3O5Z A;  4QVC A;  3CMA T;  2LC4 A;  1G2B A;  4MMK A;  1VQM A;  4LDV A;  4RCB A;  4HVW A;  4J83 A;  1K8A R;  1VQ5 A;  2QA4 Q;  3H6Z A;  3FC3 A;  1QVF P;  2QGG A;  3JSC A;  2OTL Q;  1AZG B;  1V76 A;  1UHF A;  1RAF B;  2YRC A;  5HK3 A;  3A8L B;  2QEX Q;  1VQN A;  3M54 A;  5GAN 5;  4M7D F;  5KYU B;  3LX7 A;  1G83 A;  1W2B P;  3ASK A;  3PFS A;  1OZ3 A;  4M75 F;  3UDC A;  5J3B A;  2M51 A;  3CXC A;  1VQ7 Q;  1QVF A;  4L5G A;  1R8O B;  4QVZ A;  3CC4 A;  2VYT A;  1Q82 U;  4DOW A;  1NJI U;  1I8F A;  2O31 A;  9ATC B;  2RQR A;  5HKC A;  4M7A B;  4M77 E;  1PWT A;  5GAO p;  3OYH A;  5KYY B;  4JZ4 A;  3Q1J A;  4N4H A;  2FHD A;  3OW2 S;  2Y90 A;  3TEE A;  2HQX A;  2V8K A;  2VAS A;  4M78 G;  1YCS B;  3OSV A;  1UGV A;  2L8D A;  2HEQ A;  4II1 A;  5GAN d;  3OYJ A;  1MV3 A;  1OI1 A;  2JJ9 A;  2PQW A;  4A53 A;  1Q86 U;  1U8R A;  2AK5 A;  2ED1 A;  2DA9 A;  1M4Z A;  1Y07 A;  3QJY A;  2QK0 A;  2PVD B;  2E6N A;  2MOX A;  3TQ7 P;  4C0D B;  4M75 D;  1SHG A;  5GAN 3;  1PM3 A;  1JO8 A;  3OSS C;  2J7I A;  2EYX A;  4ZNX A;  1PC0 A;  3TCJ A;  5CK9 A;  4XTX A;  4RTX A;  2YUN A;  1Q7Y C;  1S72 Q;  3CD6 A;  4MZP A;  2EYW A;  2E6Z A;  2LQW A;  4FT4 A;  5GAM j;  4KUL A;  1GFD A;  1O75 A;  3HRT A;  4UC4 A;  3MCA B;  1UGQ B;  2DJZ A;  3RKY A;  4N4G A;  2YDL A;  4X34 A;  3MEW A;  3OB9 A;  3QHS A;  2DXU A;  3G6E Q;  3OS2 A;  3SHW A;  4F7U G;  1M3A A;  1D0Y A;  5LJ5 g;  4RTT A;  2RA2 A;  2XD0 A;  1TSF A;  2DIL A;  4AFZ C;  1YJ9 Q;  4J9H A;  4RTW A;  2LQK A;  2ZPE B;  3V7C A;  1AT1 B;  4E7J A;  2JT4 A;  5C0M A;  3BFM A;  4RG8 A;  4M77 G;  2LVM A;  3WVE B;  3OYI A;  4E7S A;  1D1C A;  1I0C A;  5HY6 A;  1TS9 A;  3CCL T;  2BZY A;  3OA6 A;  3SWN B;  2PVO B;  1PD1 A;  1K9M R;  4GBQ A;  1EIF A;  3GNF B;  5I22 A;  2MK5 A;  4PFO A;  3OYM A;  3EH1 A;  2EW3 A;  1C6V X;  1G3Y A;  1AWO A;  2A0F B;  1RLP C;  3QPH A;  4JJN K;  3NMZ C;  1SPK A;  3S3N A;  4F7U A;  2ECZ A;  4C8Q C;  1ZA1 B;  4C92 B;  3M0U A;  1OU9 A;  2DXT A;  3QZ5 B;  3NTH A;  1K9M U;  3TVT A;  1WHM A;  2EYZ A;  1RLQ C;  1JJ2 A;  2XG8 D;  2DRK A;  4OMP A;  2AZS A;  4FYV B;  3S6W A;  2DF6 A;  1U1S A;  2RQW A;  5KE2 A;  5KYW B;  5GAO m;  1T0H A;  2A36 A;  1UUE A;  3UA7 A;  1WGS A;  2X3X D;  4FW1 A;  2RHZ A;  1BU1 A;  2DE0 X;  4AG1 C;  2W10 A;  4EMK A;  4ZGJ B;  4DBH A;  1KD1 U;  1Y0M A;  3M0P A;  3VKI A;  3G4S Q;  1IB8 A;  4HKE A;  2GFA A;  4M7D E;  1KD1 C;  1M2V A;  5DY9 A;  1YFN A;  3DB4 A;  4CC4 B;  1YJN Q;  1XJW B;  3OW2 A;  1Q7Y R;  4FCY A;  2HBP A;  3M56 A;  1B34 A;  4M7A D;  1BI3 A;  2JTE A;  2DET A;  1TUG B; 
#chains in the Genus database with same CATH homology
 2RJC A;  2MWO A;  3DLM A;  5GAO l;  2QA4 T;  1YJN T;  1VQ8 A;  3LGL A;  4NL3 A;  1KQ1 A;  3FDR A;  4C5I A;  2ZPB B;  3MHX A;  3X20 B;  2RO0 A;  4HT8 A;  3HHT B;  2CKK A;  2E1H A;  2JN0 A;  4FSX A;  3ZEH A;  3G71 A;  4BDZ A;  2V8I A;  1S72 T;  1TH7 A;  2JOY A;  2RHX A;  2QEX T;  1KG1 A;  2GF7 A;  1Q7Y U;  4MDX A;  4NL2 A;  3MP8 A;  4OGC A;  1Y7X A;  4C0F A;  1W2B A;  4KT0 E;  4M77 A;  4Y91 A;  4PJO D;  2JVV A;  3CBM A;  5DLO A;  2DVE A;  4BE2 A;  1VQO A;  3JB9 J;  1VQ9 T;  1VQO T;  2RK1 A;  1VQ4 A;  1XOV A;  1O9S A;  3A8O B;  1YJ9 A;  2DXC A;  4PLI A;  2X4X A;  3CC2 T;  3L42 A;  5CKH A;  1IRE B;  3CBP A;  4BUG A;  4OF1 A;  3ER0 A;  4EMK C;  2RD1 A;  2L89 A;  4XU1 A;  5KE3 A;  4M7D G;  2ZPF B;  3EAE A;  4GLK A;  5GAN e;  5FU7 B;  4B9W A;  1VUB A;  4BB7 A;  3G6E A;  2JNG A;  3TU4 K;  2JUF A;  2DTO A;  2P4T A;  4M78 A;  2DO3 A;  2ZZD A;  4ATO A;  2QTX A;  3DB3 A;  4A4K A;  1KC8 U;  1JBM A;  1V29 B;  3FRN A;  2DTH A;  2EJF A;  3WVD B;  3L2Z A;  2EQM A;  3OYC A;  3OYD A;  2LTO A;  2M1H A;  3A8M B;  4E7H A;  2DZ9 A;  4J7I A;  4JLG A;  5LJ5 d;  3VJP A;  4JDS A;  2DEQ A;  4M78 C;  4F7U F;  2NLU A;  4Y28 E;  2FVU A;  3L2W A;  4JS4 A;  1Y96 A;  4IUQ A;  3P8H A;  1KQS S;  5FRN A;  2MAM A;  5I2S A;  3RKW A;  3G7Z A;  3CME A;  3M9Q A;  4J8O A;  4BD3 A;  2A3L A;  1FWZ A;  4C92 C;  4N0A A;  5CAI A;  1BI2 A;  3PIP A;  2KY9 A;  3CXC S;  5AYF A;  3BDL A;  4XU3 A;  1IZ6 A;  1N9S A;  4C92 D;  1VQ7 A;  2E64 A;  2XI9 A;  4M7A F;  5LJ3 d;  4BI3 A;  2LCC A;  5GMK h;  1YHQ A;  4XTV A;  5LJ3 j;  5GAN j;  2EIF A;  3QO3 A;  3OYK A;  1MGQ A;  5I21 A;  3PIO A;  4A4F A;  2RHU A;  3CC7 A;  2CZ7 B;  2R5M A;  4BAC A;  2JTM A;  3GOX A;  3E9G A;  2PU9 B;  2EAY A;  3MO8 A;  3MET A;  1G3T A;  1DJ7 B;  4C92 A;  1VQM T;  3C4S A;  1ZHI A;  4LDX A;  5I2M A;  1RI0 A;  2PVG B;  2RM4 A;  3OBW A;  2G3R A;  4C5G A;  5LJ3 e;  1QVG A;  4R55 A;  3HSB A;  3QSU A;  2CZ6 B;  1QVG S;  3X26 B;  3T9N A;  4XTU A;  4XU2 A;  4IKF A;  3CME T;  2RH2 A;  3FIF A;  4PJO F;  2RI3 A;  4NOY A;  2HNI A;  2XK0 A;  4ZN1 A;  3CPW S;  3JB9 H;  3DLL A;  3LW5 E;  4A4H A;  2I2L A;  3LYI A;  4X9C A;  4F7U E;  4M78 B;  5CQX A;  3J81 E;  2XDB A;  3VU3 C;  3CCL A;  3F70 A;  3PMT A;  2K5I A;  4MZM A;  3JCM b;  1NJI C;  2K3Y A;  2VGN A;  5EG2 A;  3S3M A;  3HFN A;  2EFI A;  3OQ5 A;  2R5A A;  4VUB A;  2E12 A;  1FXX A;  4OGE A;  4YTL A;  1VQP A;  3V7S A;  3JCM J;  3EFR A;  4M77 B;  3J80 E;  4XTW A;  4ZGD B;  4M7A E;  4C8Q B;  2FL7 A;  2QA4 A;  1X6O A;  3VUB A;  1W4S A;  1VIE A;  3PGG A;  4C8Q G;  4E7L A;  3NTK A;  4QQD A;  3GP8 A;  2VXF A;  3P8D A;  2JZ2 A;  3RER A;  1AHJ B;  4RKU E;  3V7R A;  3JCM d;  2D9T A;  1NJI U;  2XKO C;  1M1F A;  5FU6 B;  3TRE A;  4HCB A;  4JRI A;  2WSC E;  3FB9 A;  3M59 A;  1VQ4 T;  1XTD A;  2XHC A;  5FRO A;  1WQ7 A;  4EDU A;  2P0Q A;  4BE0 A;  1M90 U;  1X75 C;  4C92 F;  2B8A A;  3CCQ T;  3GNG A;  4X9D A;  3L2Q A;  3VYH B;  4IUU A;  2BKD N;  3JCM e;  3SWN C;  4PJO E;  2DPP B;  1MHN A;  2PUK B;  3JCM c;  1YIT A;  1WJS A;  2MF2 A;  4M75 A;  3QDR B;  3HRU A;  4RCC A;  4MDW A;  2RJF A;  2EWN A;  4J5Y A;  1PSF A;  4OB1 B;  3M58 A;  1HK9 A;  3DKM A;  2GFU A;  4EMK B;  3HFO A;  5DM7 R;  1D3B B;  3M4G A;  5GMK i;  3LLR A;  3CCM A;  2AHJ B;  1YJW A;  1YJN A;  1N8R U;  1VQ8 T;  5GMK l;  3BY7 A;  1QVF S;  1BYM A;  2LT4 A;  2K57 A;  1M5Q 1;  3CD6 T;  2RI2 A;  4MZT A;  1VIF A;  2BIV A;  3INZ A;  4N0A C;  3OYF A;  1YI2 A;  4M7A G;  5L8R E;  4C92 E;  2K3X A;  5GAM h;  1GXI E;  2HD0 A;  3CCJ T;  2QQR A;  4IUR A;  1G5V A;  3LWH A;  3I55 A;  3CCU T;  1X01 A;  2M0O A;  3QYH B;  4CRI A;  1WPY A;  1B34 B;  3OYE A;  3I55 T;  1XNI A;  2DZC A;  2RJD A;  3JCM V;  3X28 B;  3CCU A;  4JRP A;  3JB9 D;  2R57 A;  4NS5 A;  5FU6 C;  3OS0 A;  2XID A;  4A4G A;  2F69 A;  5GAO r;  1YI2 T;  3A8H B;  1G3W A;  4EMH A;  4FU6 A;  2LDM A;  1WNL A;  5KCO A;  3E19 A;  2LQ8 A;  1JJ2 S;  3KUF A;  3SFM A;  1JB0 E;  5GAO n;  5LJ5 e;  2KK4 A;  4PJO G;  4BDY A;  4JS5 A;  3X25 B;  2E65 A;  2LX9 A;  1BI1 A;  1H64 1;  3VYG A;  1M9S A;  4XQ3 A;  5A0D A;  4DA4 A;  5GAN 6;  1VQP T;  3I56 T;  2X35 A;  5CKB A;  1VQL T;  2KQW A;  3GPL A;  3OYL A;  5FLX E;  2KSS A;  1K9M C;  2ZGW A;  2LNV A;  3CCR T;  3LH0 A;  4C8Q D;  4OP0 A;  2ZPH B;  1K73 C;  3GF5 A;  4JUV A;  2CZ0 B;  3RUX A;  3QG1 A;  3OYN A;  4FT2 A;  4IUP A;  3G6E T;  2KAF A;  3MP6 A;  4KBM B;  4C0Z A;  4R56 A;  4M7D A;  1M1G A;  2M9U A;  2C06 A;  3CC2 A;  3PNW C;  1YJ9 T;  2E70 A;  2RI5 A;  3FEO A;  2E10 A;  3RES A;  4BY6 C;  2L3R A;  1KQ2 A;  3M53 A;  1WJR A;  1RL2 A;  3G4S T;  2YLC A;  2R58 A;  2XDP A;  4ELY C;  5GMK j;  3C94 A;  5GAO q;  4XTZ A;  3L2R A;  2DIQ A;  4IUT A;  4M77 D;  4M78 D;  4C5E A;  2F5T X;  2K5L A;  5CCA A;  3CPF A;  2CS7 A;  4HCZ A;  4O6J A;  4QVC A;  3CMA T;  2LC4 A;  1P92 A;  1XQH A;  4MMK A;  1VQM A;  3R6O A;  4LDV A;  2OAU A;  2WSE E;  1OYX A;  3O8V A;  2O4X B;  2QQS A;  3QII A;  4C8Q E;  5J39 A;  3I56 A;  3CCS T;  3CCE T;  1I81 A;  4RCB A;  5KCH A;  2LRQ A;  4L59 A;  4E47 A;  3CCV A;  1K8A U;  3BW1 A;  4M77 F;  3CPW A;  1HXD A;  5IN1 A;  5CQY A;  2O4X A;  4J83 A;  1VQ5 A;  3N5B B;  4N4I A;  4EMG A;  3H6Z A;  3LWI A;  3VUZ A;  3FC3 A;  3NTI A;  3SWN A;  4LDY A;  1YIJ A;  3JAM E;  4DQ2 A;  3JSC A;  2H3J A;  3MEV A;  3M4Y A;  4HT9 A;  5LJ3 f;  4MML A;  3MEU A;  4XAX B;  2DKG A;  2XIC A;  4GY5 A;  4F7U B;  5HK3 A;  2D0Q B;  3A8L B;  4J6X A;  3OS5 A;  1Y71 A;  2EYQ A;  3ZBD A;  2X4W A;  4Q5W A;  4QQG A;  3JB9 G;  1VQN A;  3OMG A;  3M54 A;  5GAN 5;  2DD4 A;  4M7D F;  1QP2 A;  3LX7 A;  5A0G A;  3ASK A;  3HP9 A;  1QP3 A;  4C5H A;  5GAN f;  3PFS A;  1OZ3 A;  4M75 F;  1K73 U;  3UDC A;  5J3B A;  2X4J A;  1QVP A;  3CXC A;  4C0D C;  1QVF A;  3CC7 T;  2Y4Y A;  4M7A C;  4L5G A;  3AHU A;  5FRM A;  3OY9 A;  1R8O B;  2QI2 A;  4QVZ A;  3JCM h;  1VQ7 T;  3CC4 A;  2EQU A;  4EPC A;  2DAQ A;  2VYT A;  3RMS A;  4DOW A;  3CCM T;  1YJW T;  1Q82 U;  1I8F A;  1NPR A;  2JTF A;  1N27 A;  2KDS A;  4L6V 5;  4RG2 A;  5CIU A;  5HKC A;  4E7K A;  3X24 B;  2VXE A;  5GAN 4;  3E1S A;  5LL6 S;  4M7A B;  2HAX A;  1KHI A;  2GQV A;  4M77 E;  5GAO p;  3OYH A;  4XK8 E;  3JCM f;  2O01 E;  3UWN A;  4V2S A;  3WXM B;  4RMO A;  5LJ5 h;  2GCX A;  2ZPI B;  3Q1J A;  2WAC A;  2ZPG B;  2FHD A;  4N4H A;  3URG A;  3V8K A;  5DLQ E;  3CCQ A;  3OW2 S;  2DTI A;  4IUV A;  1KC8 C;  1N8R C;  4BI8 B;  2Y90 A;  4JRQ A;  4PJO C;  1Q86 C;  5GAN h;  1YBY A;  4O5V A;  5CVI A;  3TEE A;  3L2V A;  2HQX A;  2V8K A;  2P0P A;  5GAM g;  1VQ6 A;  3HRS A;  3M55 A;  5C6S A;  4M78 G;  4WF2 A;  1M8V A;  1G3S A;  2MWP A;  3OSV A;  2L8D A;  1VQ5 T;  4II1 A;  2QQ9 A;  5GAN d;  3OYJ A;  4PJO B;  3E9F A;  4M77 C;  1OI1 A;  2L5Q A;  2PQW A;  4A53 A;  3CCV T;  2F5K A;  2MI6 A;  4OMF B;  2DD5 A;  4J6W A;  5GAM e;  3CCE A;  1Q86 U;  2VC8 A;  3CCS A;  5LJ3 h;  1VQL A;  1U8R A;  2DK3 A;  2K4Y A;  5HK0 A;  3JCM P;  2D6F A;  1WQW A;  1M4Z A;  1Y07 A;  3QBY A;  3QJY A;  5LJ5 f;  1KQS A;  4M75 C;  3CMA A;  2X4Y A;  5D6Y A;  2PVD B;  3C12 A;  4LD6 A;  2E6N A;  2RK2 A;  2Y4X A;  2EJG A;  4HA8 A;  4ZTF A;  1I5L A;  2QXF A;  2A7Y A;  3QUI A;  1BKB A;  4OB2 B;  2LT1 A;  4C0D B;  2IVW A;  1OZ2 A;  3L1A A;  4M75 D;  4ZGE B;  2E41 A;  4LD9 K;  1PSE A;  2CGH A;  3V8J A;  5GAN 3;  2EKO A;  3OSS C;  3JB9 I;  4KUI A;  3JCM X;  2P0K A;  4ZN3 A;  2ZCF B;  2HQE A;  3KXT A;  4OVA A;  5CKF A;  3G71 T;  5GMK e;  1UGP B;  5GMK m;  3J7A F;  4QVD A;  4J7F A;  2EQJ A;  5D6W A;  3TCJ A;  5CK9 A;  4XTX A;  2YRV A;  1Q7Y C;  3RMQ A;  3CD6 A;  4MZP A;  3CC4 T;  3FJP A;  2E6Z A;  1M90 C;  2E5Q A;  5A0L A;  1Q81 U;  1N6A A;  4OB0 B;  4BI4 A;  1LJO A;  4FT4 A;  5GAM j;  1BI0 A;  4KUL A;  3OS1 A;  2RHY A;  1WJQ A;  1VQ6 T;  1O75 A;  3HRT A;  4UC4 A;  5D6X A;  1H3Z A;  2RB6 A;  3MCA B;  1UGQ B;  4FIB A;  2DJZ A;  1YIT T;  1U1T A;  3RKY A;  4N4G A;  4X34 A;  3MEW A;  3OB9 A;  3BDU A;  3FLG A;  3QHS A;  2DXU A;  3HPW A;  3EFS A;  3OS2 A;  4M75 B;  2WSF E;  4BE1 A;  3PMI A;  1VQN T;  4M7A A;  2OTJ A;  1NZ9 A;  4TVR A;  4F7U G;  3M57 A;  5LJ5 g;  2FB7 A;  2RA2 A;  2XDD A;  3CCJ A;  2XD0 A;  3V8L A;  1BIB A;  4M7D B;  3MP1 A;  1I4K 1;  4M78 F;  3ZFJ A;  2LQK A;  2RJE A;  2ZPE B;  3V7C A;  2FYK A;  4XTY A;  4E7J A;  1UGR B;  4LDU A;  5C0M A;  4FL6 A;  1ZQ1 A;  3UT1 A;  4A4E A;  2XU8 A;  3BFM A;  4XU0 A;  4J6Y A;  5IAY A;  3C95 A;  1SSF A;  2V8J A;  1UGS B;  5GAM f;  4RG8 A;  4PJO A;  4M77 G;  4JRK A;  2PUO B;  2LVM A;  2QQB A;  1VQK A;  2BUD A;  3WVE B;  3MEA A;  4OB3 B;  3OYI A;  4PNO A;  2YLB A;  1LNX A;  2DXB A;  4PLL A;  3OYY A;  5HY6 A;  4C92 G;  5KH6 A;  4HCC A;  3CCL T;  1UB4 A;  4LDW A;  5CKD A;  3KBG A;  3OA6 A;  3G4S A;  4M78 E;  3ME9 A;  3SWN B;  3JCM Q;  2PVO B;  1D3B A;  2LCL A;  4M75 G;  5M9O A;  3GLX A;  2VUB A;  1EIF A;  1N9R A;  1FX7 A;  3GNF B;  4BY6 B;  4C8Q F;  3H8Z A;  1Q81 C;  2K2V A;  3OYM A;  3GIB A;  2QEX A;  3SDZ A;  5GAN 7;  1S72 A;  2RHI A;  2VV5 A;  3CCR A;  1BIA A;  4C0G A;  5J26 A;  3OYG A;  4B9X A;  1VQK T;  5GAN g;  4A54 A;  1G3Y A;  3VV0 A;  5GAN 2;  4ELZ C;  2EJ9 A;  3QPH A;  4JJN K;  5LJ5 j;  2QDY B;  2DIG A;  2IG0 A;  5GAM d;  3S3N A;  4PL6 A;  1YCY A;  4F7U A;  4DOV A;  4QQ6 A;  4C8Q C;  3UPU A;  4M7D C;  1JRI A;  5GAN 8;  1M1K U;  4C92 B;  5LJ3 g;  2OTL A;  2DXT A;  3QXE B;  3QZ5 B;  3JCM W;  3HL8 A;  3NTH A;  5CO7 A;  1K9M U;  2OTJ T;  2M16 A;  5CR2 A;  3HKS A;  5IT9 E;  1JJ2 A;  3M5A A;  4P5N A;  3QKJ A;  3OYB A;  3RKX A;  3RIR A;  4M7D D;  2XG8 D;  3SB2 A;  1M1K C;  3PT9 A;  5CKE A;  3S6W A;  1U1S A;  4ZTJ A;  3S3O A;  3CBO A;  3A5Z B;  3NFC A;  5KE2 A;  4E7I A;  3OYA A;  3JCM g;  5GAO m;  1W2B S;  3LGF A;  1WGS A;  1ZBX A;  5A2Q E;  1YHQ T;  2RHZ A;  3OMC A;  1NE8 A;  4EMK A;  4ZGJ B;  1KD1 U;  1Y96 B;  3JRZ A;  3QJ6 A;  2VGM A;  4ME7 A;  3VKI A;  4D6W A;  4JLI A;  4PKC C;  1KHC A;  2KVQ G;  2MMP A;  4FM4 B;  2YHT A;  4Z02 A;  5FU7 C;  1QW1 A;  4HKE A;  3SD4 A;  4CI0 C;  2GFA A;  4KUD K;  2EQK A;  4M7D E;  4QW2 A;  1Q82 C;  1UEB A;  2CYZ B;  1KD1 C;  3QZ9 B;  3JB9 F;  5DY9 A;  1LOJ A;  2OTL T;  1VQ9 A;  2CZ1 B;  3QYG B;  3CEY A;  3DB4 A;  4M75 E;  3OBY A;  3L2U A;  3OW2 A;  1YIJ T;  2HBP A;  1NPP A;  3M56 A;  1B34 A;  1K8A C;  2KMT A;  4M7A D;  2QQA A;  1BI3 A;  3PTA A;  2K5F A;  3A8G B;  3P8B B;  4C8Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...