4M77A

Crystal structure of lsm2-8 complex, space group i212121
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
100
structure length
83
Chain Sequence
TLKDYLNKRVVIILVDGESLIASLNGFDKNTNLFLTNVFNRISKEFISKAQLLRGSEIALVGLIDAENDDSLIENEHVIWEKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
total genus 13
structure length 83
sequence length 100
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m77A00
2RD1A 5GMKl 3RKXA 3JCMh 3M4GA 4M75D 1X01A 2E10A 5GAMd 2VXEA 1I81A 2EAYA 4M75C 3JB9H 1U1TA 1HXDA 4PJOB 3GIBA 5LJ5g 5LJ5j 3RIRA 4M7AA 4C92E 3JCMW 4M7DF 4OP0A 3BW1A 4M75A 1N9SA 4A54A 1KQ1A 1B34B 3RKYA 5LJ3f 2EJFA 3L2ZA 5LJ5h 2ZGWA 5LJ5d 5DY9A 4C8QG 4M7DE 4JRIA 3EFRA 3SWNB 4QVCA 2RB6A 4C92D 5CAIA 5I21A 4NL2A 2YLBA 4M77D 5GMKh 5GMKi 5GAN3 3JB9F 4C92C 4XTVA 4M77C 3V8JA 2I2LA 5GAN6 4XTUA 4PJOE 3HSBA 3RUXA 3V7CA 4XU2A 4F7UA 3SB2A 5GANf 1I5LA 1BIBA 2DVEA 4M7DD 2EJ9A 4HA8A 2YLCA 4M7DB 3JCMf 4C92A 5GAMh 4M77A 4RCBA 4XU1A 4M7AF 2DXUA 3FIFA 5GAN7 4PJOD 2DXTA 2VC8A 1JBMA 5GAN8 4PJOC 3L1AA 1Y96B 2JN0A 4M78F 4X9CA 3JB9D 4M7AG 5GANe 5GAOl 4J6WA 4C8QF 2DEQA 4QVDA 4M75G 4X9DA 3PGGA 4M78G 1WNLA 4PJOA 4M78E 1LJOA 3JCMX 2DJZA 4RCCA 3HFOA 1WQ7A 4XU3A 3JCMQ 4HT9A 3SWNC 1YCYA 4C8QE 4V2SA 4EMKB 2E41A 1LOJA 5GAOn 4M7AB 1WQWA 3QUIA 4XTYA 2FB7A 4PNOA 3RESA 2RA2A 3RERA 3V8KA 5LJ3e 5GAOr 5LJ3g 2DZ9A 3V7SA 5LJ3j 4JLIA 1D3BA 1I8FA 4M78B 3BY7A 3QO3A 3SWNA 4C8QD 2E64A 1N9RA 4XTXA 4MMKA 5GMKm 5GAN4 4M7DC 4C8QB 4C8QC 2EJGA 3V8LA 1LNXA 1TH7A 4M77G 5GAMf 2DZCA 4M75F 5LJ3d 1MGQA 2K57A 3JCMJ 2Y90A 3VU3C 3JB9G 4M7DA 4MMLA 5GANg 1M8VA 5GANj 2VXFA 4M7AE 3JB9J 3JB9I 3JCMe 3RKWA 3QHSA 4M75E 2YHTA 4JRKA 3JCMg 2RM4A 5GAOq 4DQ2A 1U1SA 1HK9A 2HNIA 4J6XA 1Y96A 5LJ5f 1I4K1 5GANh 3INZA 4XQ3A 5GANd 4F7UF 4EMKC 2EWNA 4M7AD 3V7RA 2DTOA 1B34A 5GAOp 3JCMd 4HT8A 2DTHA 4M7AC 4A53A 3HFNA 4NL3A 4C92F 3BFMA 3EFSA 4M75B 4M77F 4WF2A 4M78D 3JCMV 4F7UG 5GAN5 1JRIA 4F7UE 4M78C 1BIAA 4EMKA 4J6YA 5LJ5e 2DKGA 4XU0A 4C92G 1H641 1WPYA 1M5Q1 3FB9A 3JCMc 4M77E 5GMKe 3AHUA 4NOYA 5GMKj 5LJ3h 2DTIA 3FJPA 4XTZA 1KQ2A 4XTWA 4M78A 4N0AC 4EMHA 4PJOF 4M7DG 4C8QA 4F7UB 5GAOm 1D3BB 2E1HA 2E65A 3JCMP 4JUVA 4C92B 5GAMe 5GAMg 4M77B 4PJOG 5GAMj 4J5YA 2FYKA 2QTXA 3BDUA 4N0AA 4EMGA 3JCMb 5GAN2 3QSUA 4Y91A 2CGHA
chains in the Genus database with same CATH superfamily
3LYIA 3VYGA 4RTZA 4A4KA 1MUZA 1TSFA 3M9QA 3PIOA 1GCQA 3OMGA 3LH5A 3OYCA 3VV0A 7AT1B 1M1KU 1B3QA 2GFUA 2DIQA 2LX7A 4E47A 4LNPA 2VV5A 1VQLT 1M90C 2L3QA 5FU7C 4R0KA 4KULA 2DD4A 5J3BA 1VQOA 2HKNA 3GBQA 3LW5E 5IHIA 2DVEA 1Q81R 1PD0A 3CQTA 4ZGEB 1ABOA 1PG5B 5CIUA 2MIOA 3CCUQ 1X27A 3PT9A 4M78F 2JN0A 5KCOA 1VQLQ 3CCLT 3PMTA 4M75G 2O4XA 3S6WA 2D9TA 3OW2S 3HKSA 1TUGB 3JCMX 2DJZA 4DBFA 3CBPA 5J26A 3VS2A 3PTAA 4EMKB 2CT3A 3TVTA 1NEGA 4M7AB 4JRPA 3M0UA 2M1HA 4XTYA 2FVUA 3OSVA 1YWOA 5LJ3g 1UHFA 1VQ4A 4IUQA 3OYIA 1Y07A 2JTEA 4DBHA 2MWOA 5DLQE 3CCLQ 4MMLA 3QDFA 3H9NA 3RKWA 2FHDA 2V8IA 1RI9A 1RAGB 3H0FA 1VQ5T 1VQ5A 1TU0B 3X28B 1IGUA 3GNFB 2JNGA 1NJIR 4M77F 2OAUA 4CC3A 1OZ3A 4GLKA 3TU4K 1SF9A 2V1QA 3OYGA 1WHGA 2P84A 1X6BA 4BUGA 4FSSA 5FU6B 4BY6B 1UHCA 3TREA 3E9FA 5FRMA 4LN2A 2L0AA 1TOVA 1Y57A 3QJYA 2RHIA 2VXEA 5KYWA 3NFCA 2WSFE 8ATCB 3QZ5B 4WCIA 1YFNA 1M2VB 1OX8A 4QW2A 4CC4B 1QVGP 4A4HA 4TVRA 4GY5A 2DF6A 3CEYA 2D1XA 1SRMA 4HA8A 1M9SA 2VGNA 3LWIA 3OYMA 2FG0A 2KAFA 1Y96B 2ZPIB 3A5ZB 2P0QA 1OPKA 1Y7XA 4D8KA 2E5QA 2M51A 4OMMA 3SWNC 5KE2A 2P4TA 2M9UA 2YRVA 3ASKA 4L5GA 3SWNA 5FW9A 3JCMJ 2DLPA 1UTIA 4FW2A 4RTUA 2JOYA 4JJDA 5GAOq 2CH4W 1UGSB 1ZLMA 2QGGA 2HDAA 2HNIA 5CKHA 1YI2T 1YI2A 5GANh 4XQ3A 1SRLA 3TEEA 5GAOp 3H41A 1ZSZC 3EFSA 2V8KA 2KMTA 2DKGA 5GJVB 1H641 1WPYA 2HSEB 4MZMA 4PJLA 4QKUA 1VQMA 4M4ZA 1ZSZA 5GMKj 4RG2A 3OS5A 1QMCA 2J06A 4BE2A 2HSPA 2BTTA 5A0DA 2DA9A 1K8AR 3NTKA 4FCYA 2XD0A 3CPWA 1N5ZA 4N4HA 3RKXA 3CC4T 2KGTA 2YUQA 3U23A 3OYNA 4MDWA 1YBYA 2VUBA 1VQKQ 4QVZA 3RKYA 4FT2A 5LJ5h 4C5GA 4HCBA 4JPBW 4J8OA 4BI4A 1AOJA 1AT1B 2CZ6B 2F5TX 4F7UA 4AG2C 3CC4Q 3FDRA 2JM8A 1YIJA 2YLCA 2FZCB 5GAN7 5FROA 2DM1A 4PFZA 1VIFA 3UA6A 4P5NA 3C95A 5KYNA 1WXBA 4AG1C 1R8OB 2NLUA 4J9CA 3SDZA 2KXCA 1WJSA 4M78G 1BYMA 3L2UA 1T0JA 3QWYA 1KG1A 1LOJA 2E41A 1OU9A 2LTOA 1N27A 3HRSA 3PVQA 1K9MU 3QZ9B 8AT1B 1VQPT 5GAOr 1VQPA 2J7IA 3A8OB 1RAFB 5IH2A 1QQJA 4QQGA 4RTVA 1TS9A 2DZCA 2DL5A 5LJ3d 2K57A 1Q86R 3MKDA 2KK4A 1F1BB 3VU3C 2Y4YA 2MK5A 4FIBA 4JRKA 3UATA 3E2UA 3CMAT 1HK9A 1BK2A 1I4K1 1RUWA 4EMKC 1G5VA 4M7AD 4JJNK 1B34A 3OYLA 4M7AC 4NL3A 2E6ZA 4C92F 1M3AA 4EMKA 1D1CA 5KYYB 2QEXA 5GMKe 1NZ9A 3QKJA 1KQ2A 4HVWA 4DOWA 1NJIU 2YUNA 2EQKA 1KHIA 1LPLA 3CMAQ 2ZZDA 1YWPA 3M5AA 1R0BG 4Y91A 4LXCA 4FW1A 1X6OA 3A8GB 1QCNA 2C06A 3A8HB 2J05A 2PZ1A 1QKWA 3VRZA 1G3WA 2KYMA 2DL4A 2X4XA 3DB4A 1UJYA 2LNHB 2V1RA 3URGA 3CCQT 3CCQA 4YTLA 1PNJA 1KD1R 2LDMA 1KQ1A 1IZ6A 5LJ3f 4E7IA 5FU6C 1RL2A 2DXBA 1QVGA 4BY6C 1PHTA 1IHWA 4HVUA 1MMDA 2QXFA 3CC2A 4HXJA 2K3YA 2YSQA 1JXMA 1W2BP 3CCRQ 1V29B 5GAOl 1M27C 3FC3A 2EYWA 1NJIC 4LDYA 1LJOA 3HFOA 1PSEA 2OI3A 1RAHB 2KROA 1M2VA 1WLPB 2FB7A 3RESA 4Z02A 1WHJA 1X2KA 3T9NA 1M30A 3M54A 3TSWA 1VQ6T 1VQ6A 2GBQA 1LNXA 1RAAB 3D7SB 1E6HA 1X69A 1WHHA 2E70A 2O01E 4M75F 1AWWA 5IHKA 4JDSA 4GBQA 4HVVA 5GANj 3G7ZA 1TTHB 2X4JA 2CYZB 3I56A 2EQUA 2EW3A 4BE0A 4J6XA 3CCEQ 1Y96A 1N6AA 4C0DB 4KUDK 3A8LB 4K11A 3JCMV 1VQ6Q 2QK0A 3OYBA 2GQIA 4VUBA 3SEMA 4XTZA 2CP2A 4BI3A 2IVWA 2LCCA 3HPWA 1M4ZA 2JZ2A 3VKIA 2IG0A 3NMZC 1IREB 4OGCA 1KIKA 1JJ2S 2FO0A 3MO8A 2EYYA 2KXDA 1H8KA 4EIKA 3M4GA 1YCSB 2KY9A 1K8AU 2ZPEB 2ZPGB 4A4FA 2F1LA 2V8JA 1NYGA 2LVMA 2M0OA 1KJWA 5LJ5j 4C92E 2K3BA 4RTXA 4FYVB 3L42A 4LE9A 3TQ7P 3UPUA 4IUTA 1NBEB 1KC8R 1VQ7Q 5GAN3 2O88A 1SSFA 3ER0A 3LGFA 2MCNA 2CZ1B 3MEWA 2L5QA 1MNEA 4X1VA 1ZBXA 4AT1B 2CZ0B 1Q82U 1Q7YU 4FYYB 5CQXA 4ZGDB 3EGUA 2DBMA 3OYYA 5I2SA 2YDLA 2LT4A 1C6VX 4CC7A 2RQTA 4PJJA 5CCAA 3EG1A 4CC2A 1WQWA 1W1FA 1YHQQ 3FLGA 2K6DA 2HMAA 3BY7A 1FMKA 4M78B 1K8AC 2E64A 4XTXA 3KBGA 4MMKA 4IURA 1WFWA 1ZUUA 3OS2A 4HKEA 1MGQA 4E7ZA 3M0RA 2Y90A 1QVFP 3VYHB 2RJCA 4FL6A 4LDXA 1H3HA 2QTVA 3OYJA 3DB3A 1E7OA 1UGPB 2HKQB 1NM7A 2CP7A 2K5LA 4RTYA 3KFVA 1AEYA 2FZGB 5DLOA 1BU1A 2HQXA 1EX4A 2KQWA 2KVQG 1YJNT 4FYWB 1S72T 4XU0A 4C92G 2KNBB 3UA7A 3EG9B 2BIVA 1M90U 2CT4A 4CRIA 2R58A 2LQWA 4JUVA 1HD3A 1QLYA 4M77B 3I35A 4KT0E 3CBMA 1I1JA 2CS7A 2EQIA 3JB9G 1GL5A 1CKAA 3R6NA 3EHRA 1YJNQ 1S72Q 3JB9H 2EFIA 3HHTB 2JW4A 2IIMA 3ZEHA 1N9SA 2XDPA 2QGFB 4QT7A 5I22A 4M7DE 5KYYA 3PVLA 5GMKh 1VQNT 1VQNA 4DBQA 1GFCA 4E7LA 1SHGA 3M57A 1Q86C 3E1SA 4J7FA 3J7AF 3CCST 3CCSA 1W2BA 1PCXA 3L1AA 1QVPA 4RTWA 4ESRA 2BKDN 2HL5C 1X75C 2NUPB 4RG8A 1YP5A 1KSWA 1UJ0A 2X4YA 4C8QE 3HRTA 4AFUC 1VQOT 1T3SA 4D6WA 5D6XA 1GXIE 3V7SA 3UWNA 2EJGA 3OQ5A 1QP2A 1BB9A 3QIIA 4FSXA 2PVDB 3E9GA 5CQYA 1OEBA 2A37A 3LH0A 3JB9I 3JCMe 1B7TA 1WHLA 2X51A 2YRDA 1VQOQ 2AKKA 4OMFB 2FL7A 3VS5A 1ARKA 4LUDA 3META 1IRXA 2DTHA 1VQ4T 3GLXA 2H3EB 1VIEA 2AK5A 2A28A 4C5EA 2A08A 3N5BB 2EPDA 2GTOA 2VGMA 3G4ST 3G4SA 4M7DG 1BCMA 4II1A 5GAMj 2QTXA 4C0DC 2HQHA 3S3MA 1W70A 1VQ4Q 1HXDA 2JTMA 5CVIA 2EGEA 3AT1B 2QQBA 3HP9A 2OTLT 4OP0A 2OTLA 2KYBA 3QWXX 1TUDA 3G4SQ 2MWPA 3ULRB 1YN8A 2R5MA 1D1AA 4C8QG 1U8RA 1XTDA 1OQKA 5I21A 2RQWA 4Z89A 2L2PA 3V8JA 5IAYA 1VQ5Q 1AWOA 4KGXB 4XU2A 3OYHA 5C0MA 2E5KA 4QQDA 3O8VA 3L2QA 4RCBA 4OGEA 2DXTA 5FRNA 1ZBJA 3PNWC 2RI5A 5AYFA 4KH1B 2RQRA 2DEUA 1AWXA 2CKKA 2MMPA 3M0SA 3PGGA 3A8MB 4PJNA 1M8MA 1WJQA 2CUBA 2DILA 2KR3A 2RN8A 2L89A 5EG2A 2PQWA 9ATCB 1D3BA 2OTJA 3NHNA 1PWTA 3PIPA 2NWMA 2EBPA 3EFOB 4A4EA 3E19A 1AWJA 2PVOB 1M2OA 1M8VA 1QVFA 2F2XA 4B6MA 3P8BB 3VS6A 1T0HA 4DQ2A 4OB3B 2H3JA 2DPPB 3CPFA 4A53A 3CD6T 3CD6A 2Y4XA 4M78D 2JM9A 1QCOA 3H0HA 4M78C 3MPUB 1KC8C 3LWHA 2VVKA 2RK1A 1VQ9A 2ZPHB 4KRTA 4RMOA 1IGQA 4M78A 4N0AC 4PJOF 3EHQA 2AIRB 1M1FA 2LP5A 3R6OA 3ZL7C 1K73R 4IKFA 2YUOA 4C92B 5GAMe 1BI3A 5GAN2 4N0AA 3RBBB 2DRKA 4JS4A 2A36A 4QQ6A 4B9WA 5D6WA 4O6JA 2EIFA 3M0QA 4LD9K 4NS5A 3CC7A 2CP0A 4Z8AA 4RTTA 1KQSS 1VQMT 1ABQA 4C0GA 1W6XA 1FWZA 1QKXA 3OBWA 3L2ZA 4J9FA 3OYAA 2JJ9A 3NPFA 2EKHA 4M77D 4PFOA 3EG9A 1YI2Q 2J6FA 4M77C 3OS1A 1N8RR 3V7CA 3A1PA 1IB8A 4M77A 2KDSA 2DXUA 3IQLA 2KT8A 1FMWA 1VQMQ 2MF2A 2E3IA 1RABB 4J9DA 4X9CA 2C0OA 1P92A 2RMOA 3GPLA 2RJEA 2EKOA 1QP3A 5L8RE 3UDCA 5M9OA 2QQAA 4E2FB 1UEBA 4OF1A 1MMAA 3V8KA 2QQSA 4C0FA 2IPOB 3CMET 3CMEA 1YIJT 2GTJA 2D6FA 1RLPC 2LC4A 4EPCA 2HZYA 4R56A 4BE1A 1NG2A 2LQKA 2QI2A 1U5SA 5GANg 1Q81U 1U1SA 2DBKA 4WTOB 1WIEA 2NUPA 4PLLA 2ZCFB 3BFMA 1YIJQ 4M75B 4F7UE 2M16A 3HTRA 1JU5C 3GF5A 2DERA 5L23A 5IXBA 1K76A 2CDTA 4EMHA 1YNZA 3MCAB 5A0GA 3JCMP 2ZAEA 2KI7A 4UC4A 3CXCS 4OB0B 2AZSA 3JV3A 3VUBA 3TCJA 3P8HA 3JCMh 1G3YA 1VQPQ 2H8HA 1O9SA 1NEBA 2HD0A 2NUTB 1I5OB 1OULA 5LJ5g 2QEXT 4M7AA 3M0TA 1VYVA 3REAB 3QYGB 2LQ8A 1Y71A 1MMNA 2JMCA 2DYBA 2DE0X 2BE7D 1Q81C 1ACMB 2A7YA 4E7SA 3JB9F 4XTUA 2XG8D 4PJOE 3X20B 3SB2A 5HKCA 3ZFJA 5J39A 1OYXA 3CCVA 3C0CA 2LX9A 2QEXQ 5HK3A 5HK0A 3GNGA 2QA4T 2QA4A 4BDYA 3NTHA 1OX9A 3OYDA 5KYXB 3MHXA 3QUIA 1C0MA 4RUGA 2RH2A 4E7HA 3VUZA 5FLXE 2KBTA 2X4WA 2GGRA 1WHKA 3VS3A 3CC2T 5IN1A 1N9RA 1SSHA 2XK0A 2HBPA 1XNIA 1X43A 3V8LA 1QWEA 1UUEA 2EYQA 2Z0WA 3CCQQ 2CP3A 3JCMg 1RAIB 1WGSA 4CI0C 1M1KR 4JLGA 2KT1A 3M56A 1G3TA 3CC2Q 4WF2A 2O4XB 2WACA 2JXBA 1WI7A 5CR2A 4FU6A 1Z9QA 1RACB 2L3SA 2GCXA 3FB9A 3EH2A 3CCJA 2YRCA 1VYUA 2K7AA 3G6ET 3G6EA 1YJ9A 2COZA 1OZ2A 4KBMB 3VS0A 2WSCE 3I56T 3EFOA 1NPRA 4PJOG 3GP8A 4J5YA 1WXUA 3X25B 2RD1A 1VQ8A 1GCPA 3EG0A 3SFMA 3GOXA 1IHVA 1PM3A 2EAYA 4MDXA 2R5AA 1U1TA 2AT1B 3DLMA 2L3PA 4M7DF 1WXTA 2PNIA 3I56Q 1YJWA 1YJWT 3VS1A 4C92D 5GMKi 4E7JA 4C92C 4XTVA 2J6OA 3KXTA 2EYXA 2EJ9A 4C92A 5GAMh 3FIFA 3CCMA 2LRQA 5GAN8 2AKLA 3JB9D 4ZTFA 4C8QF 4QVDA 4X9DA 2RNAA 3MP1A 2MOXA 1LCKA 1BCOA 4X34A 4RCCA 4XU3A 2MAMA 3HL8A 2F2WA 3I55A 3L2VA 4BB7A 1D0YA 2DAQA 3QJ6A 4JJBA 1BBZA 5GMKm 1K73C 4N4GA 4KGVB 3SD4A 4IUVA 4D8DA 4JZ4A 2KRSA 2RM4A 2LZ6B 3RMQA 4AFQC 1U06A 4L59A 1MHNA 2BZXA 2ENMA 5GANd 1ZUYA 1JJ2P 2X3WD 1YITT 1YITA 1UGRB 5CO7A 3LGLA 2RHXA 1W4SA 2D0QB 2RQVA 1SPKA 1M5Q1 3JCMc 4ELZC 4FT4A 5HCKA 3M0PA 4J9GA 1ZSGA 5GAMg 1U3OA 2I0NA 3QYHB 4IIMA 3JCMb 1GFDA 2O9VA 2ROTA 4Y28E 1Q86U 2RF0A 4M75D 1X01A 4BD3A 4M75C 2M0YA 3G71A 3TSZA 3EGXB 2KEAA 2RJFA 3C94A 2D8HA 3MP6A 1DJ7B 4M75A 5A0LA 2FPDA 3CPWS 2XIDA 1K0SA 5LJ5d 5ECAA 1JEGA 4F16A 3HSBA 2NYSA 1MV3A 5D7UA 1AZGB 3ZBDA 5GANf 2CH4A 1BIBA 2P0KA 4M7DD 1NE8A 4FYXB 2LCSA 3OYKA 5KH6A 1AD5A 1WDXA 5I11A 1ZA1B 2NUTA 2D0NA 2R57A 2LQNA 2RJDA 2CREA 4KH0B 2C0IA 4OMQA 2X3XD 2SEMA 1R77A 1Z9ZA 2DYIA 1KD1U 3WVDB 3RERA 5D6YA 4L6V5 2MYSA 2WSEE 1I8FA 1FX7A 5HY6A 4C8QD 4OMLA 2BUDA 4C8QC 2OAWA 1UG1A 1PD1A 1FMVA 2CZ7B 2J6KA 2X35A 2L8DA 2HAXA 1M3BA 2BE9B 2M02A 2V26A 2JTFA 4J9EA 1VQNQ 5LJ5f 2QQ9A 3EH1A 4R55A 2P4RA 2EWNA 4BI8B 2F69A 4HT8A 3JCMd 3RR6A 3CCSQ 5KYXA 1GBQA 3HRUA 1BKBA 4LDWA 2QASA 3CCUT 1RLQC 3CCUA 3BE3A 3AHUA 3THKA 1VQLA 4DOVA 1K9AA 1HYOA 4J9BA 2E3HA 2E65A 2QG9B 3F70A 3H8ZA 3H0IA 3QSUA 2ZPBB 1KD1C 2O31A 1C1AA 3L2WA 1ZQ1A 2PUOB 5CKBA 3OYFA 4PJOB 4ORZA 3RIRA 5AT1B 1CSKA 3P8DA 2DJQA 2FZKB 3CCLA 1K9MR 2XDDA 1B34B 1R0CB 3JAME 2RB6A 2RO0A 1AHJB 5KYUB 2A3LA 1HJDA 2I2LA 2CSQA 2O9SA 4A63B 3JCMf 1V76A 3NGPA 2XICA 1JBMA 2XU8A 1M1KC 4ATOA 3Q1JA 3X24B 2KE9A 1G83A 4J6WA 2DEQA 1QVGS 4OB1B 2GF7A 1WNLA 4Q5WA 4O5VA 1G8XA 3I9QA 4BDZA 4V2SA 2HQEA 3OW2P 1HSQA 2FEIA 4KUIA 1V1CA 4ZN1A 2ESWA 1D09B 3QO3A 4J9IA 1KC8U 1PC0A 4JJCA 3M4YA 2OTLQ 3VS4A 1UB4A 1Y0MA 1RI0A 3JB9J 2F5KA 2XKOC 4F7UF 3OB9A 5A2QE 1JJ2A 4C5IA 1QWFA 4XK8E 3J81E 5FWBA 3I5RA 2ZPFB 2OTJT 1I07A 2GFAA 3S3OA 4NOYA 2DTIA 1WX6A 3X26B 2K2MA 4LDVA 5CKDA 4EMGA 2FYKA 1LVKA 3MJXA 4AFZC 2ED1A 4J83A 4OMPA 1CKBA 1MNDA 5GAMd 3UF4A 2OTJQ 1JXOA 3QG1A 1BI0A 2RPNA 3OMCA 3OY9A 1VQ9T 4ME7A 3REBB 4J9HA 4EDUA 3JCMW 3VJPA 2X9HA 3BW1A 3VRYA 2EVRA 3QBYA 1RAEB 4QVCA 2EYZA 2L3RA 4C0ZA 2LMJA 1JO8A 1WHMA 3BDLA 4PL6A 1I5LA 3CD6Q 2YWWA 4M7AF 3UT1A 1VQ9Q 2DD5A 2QQRA 2K79A 1Q95G 3CC7T 2RHYA 2BZ8A 1TXQA 4IUUA 2DRMA 3EGXA 4M78E 1IXDA 3JSCA 3EG2A 2COWA 2CP5A 3OYEA 1SG5A 4HCZA 2KSSA 5LJ3j 3LX7A 2FPFA 1WYXA 5IXFA 1ZUKA 1D1BA 2F2VA 1TH7A 4JS5A 5GAMf 3CC7Q 5C6SA 3MP8A 2HL3A 1VQKT 1VQKA 4A4GA 2VKNA 3QHSA 2CUDA 5LL6S 1MMGA 4LDUA 4ZTJA 1TWBA 4LD6A 2KRMA 3V7RA 2G6FX 3CC4A 1I0CA 5GAN5 1JRIA 1T3LA 1BIAA 1UDLA 4IIOA 1PRLC 1S1NA 2RI2A 3H6ZA 2DO3A 6AT1B 2MPXC 2ATCB 2W10A 1UE9A 4M77E 2K5FA 1KQSP 2KRNA 2E12A 1OV3A 1VYTA 1Q82R 4ANJA 1Q7YR 2DK3A 1UFFA 3RMSA 2EQJA 3BDUA 2B86A 2LJ3A 1FYNA 3CMEQ 1OU8A 2DNUA 1X6GA 2LCLA 4F04B 2YXYA 2DX1A 2QDLA 1TG0A 1H3ZA 5CKEA 1GRIA 5DY9A 3EGDB 2HBWA 2K5IA 1NPPA 1VUBA 1JQQA 3KUFA 4M7DB 1EIFA 2HCKA 3G1JA 4DA4A 1D0ZA 4PJOD 2JT4A 4PJOC 2BZYA 3MEAA 4KGZB 2AZVA 1XOVA 2DIGA 4PJOA 3CMAA 1QW1A 1PSFA 3FJ5A 1WZOA 3A98A 1TUCA 2DXCA 2FRWA 3OW2A 2DL3A 1EFNA 4GLMA 2E4HA 3CBOA 3FRNA 2RA2A 4PNOA 3I5SA 1M90R 5LJ3e 3JRZA 2DZ9A 1XJWB 1NLPC 5GJWB 1W2BS 4RKUE 5KYUA 4C8QB 2E6NA 4M77G 3CCVT 2FPEA 2K3XA 4M7AE 1BI2A 1D0XA 3SHWA 1OOTA 4F17A 2G3RA 4HCKA 2FRYA 2W0ZA 3CXCP 1K9MC 2DL7A 4PK4A 2LJ0A 4Z88A 2LJ1A 4F7UG 1M3CA 2ED0A 4N4IA 3CCVQ 1OI1A 3M59A 1H92A 3CCRT 3CCRA 3OS0A 1GBRA 3FJPA 1ZX6A 4OMNA 4XTWA 5FU7B 1MV0B 2VWFA 4E7KA 2QA4Q 1KFZA 5GAOm 3WXMB 4AMCA 1KK7A 3NTIA 2YT6A 4FM4B 4OB2B 1X2QA 3OSSC 2CGHA 2QYZA 1KHCA 2JVVA 2E10A 1I81A 2PUKB 1G3SA 2SRCA 3GIBA 2EGAA 2P0PA 3CCJT 4BACA 3C4SA 1YJ9T 1WJRA 2A0FB 4ZN3A 1WA7A 4JRIA 3EFRA 3OA6A 3CCET 3CCEA 2DL8A 3PMIA 1UECA 5IHNA 5DM7R 2K4YA 1VQ8T 3M55A 1K73U 4Y92A 1ZA2B 2QAZA 5EC7A 1J3TA 3CCJQ 4J7IA 4M7AG 1BI1A 2RI3A 3G6EQ 4DBRA 1YJ9Q 1O75A 2RHZA 4HCCA 2VYTA 4F14A 4HT9A 1WQ7A 4JRQA 2CSIA 1VQ8Q 2XMFA 2C0TA 4PFPA 4JLIA 2RHUA 2GNCA 2MI6A 3VS7A 3ME9A 3CCMT 1N8RU 1EZZB 2DFUA 4AFSC 2D8JA 2O2OA 4ELYC 1K0XA 1B07A 2K9GA 1YJWQ 4DEXA 1VQ7T 1VQ7A 1M1GA 5KYWB 3INZA 3I55T 3FEOA 1E6GA 1K1ZA 3QDRB 4PKCC 5IT9E 1XQHA 5KE3A 2LT1A 4J6YA 3CCMQ 4ZNXA 2EQMA 3PE0A 1SHFA 1QVFS 5I2MA 4XAXB 3M58A 3S3NA 1KQSA 1SKUB 1D3BB 2XDBA 4E6RA 2EGCA 4IUPA 1VOMA 1A0NB 1G2BA 1AZEA 3I55Q 5GMKl 1YHQT 1NYFA 1YHQA 2OX7A 3L2RA 1PRMC 3J80E 2XHCA 1RADB 2JMAA 2XI9A 1N8RC 4PLIA 4A54A 2GQVA 2EJFA 3DKMA 2ZGWA 1NLOC 1PKTA 3EAEA 3SWNB 5CAIA 3M53A 1OPLA 2YLBA 4NL2A 3PFSA 3RDVA 5GAN6 3RUXA 2HEQA 1YITQ 1UGVA 3OBYA 2VASA 3C12A 4XU1A 3G71T 2VC8A 1AVZC 2DETA 5GANe 2ECZA 1PKSA 3QXEB 2ABLA 2PVGB 3O5ZA 4B9XA 3RNJA 2NUZA 4MZTA 2COYA 2QDYB 3JCMQ 1YCYA 1IO6A 2ROLA 3QPHA 3EG3A 5GAOn 1K4US 2RK2A 1ZSZB 2JUFA 2JS2A 2PTKA 3EGDA 1QCFA 5CKFA 1YJNA 2K2VA 1S72A 3G71Q 4JZ3A 1Q82C 4M7DC 5GAN4 1Q7YC 4ZGJB 3MEVA 2RQUA 4DEYA 5CK9A 2VB6A 4M7DA 2VXFA 4M75E 1ZHIA 2YHTA 2CP6A 2DMOA 2DTOA 4MZPA 2YUPA 3HFNA 4LUEA 3CXCA 5KCHA 3MEUA 4PJMA 2OJ2A 1UGQB 2B8AA 5LJ5e 2PU9B 1VA7A 5FWCA 4OMOA 5LJ3h 2LNVA 1FXXA 4C8QA 4F7UB 1SEMA 3WVEB 4OVAA 3LLRA 2JS0A 3CPWP 2E1HA 2AHJB 1JB0E 2DVJA 4C5HA 1GCQC 3DLLA
chains in the Genus database with same CATH topology
3P8HA 3LYIA 3VYGA 3JCMh 1G3YA 3M4GA 2KY9A 1K8AU 1O9SA 4A4KA 4J83A 3M9QA 5GAMd 3PIOA 2HD0A 2ZPEB 2ZPGB 3OMGA 4A4FA 3QG1A 2V8JA 1BI0A 2LVMA 3OYCA 2M0OA 3OMCA 3OY9A 3VV0A 4ME7A 5LJ5g 1VQ9T 5LJ5j 1M1KU 4EDUA 2QEXT 2GFUA 4C92E 2DIQA 3JCMW 4M7AA 3QYGB 3VJPA 4E47A 2LQ8A 2VV5A 1Y71A 3BW1A 3L42A 1VQLT 1M90C 5FU7C 3QBYA 3UPUA 1Q81C 4IUTA 2A7YA 4KULA 2DD4A 5J3BA 4QVCA 5GAN3 1SSFA 1VQOA 3ER0A 3JB9F 3LGFA 4M7DD 2CZ1B 2L3RA 3MEWA 2L5QA 4C0ZA 4XTUA 4PL6A 2XG8D 3BDLA 4PJOE 3X20B 3LW5E 3SB2A 1I5LA 1VQ4A 2DVEA 5HKCA 3ZFJA 4ZGEB 1ZBXA 5J39A 2CZ0B 1Q82U 5CIUA 1Q7YU 1OYXA 4M7AF 3CCVA 3UT1A 2DD5A 2LX9A 2QQRA 3PT9A 5CQXA 4ZGDB 3CC7T 2RHYA 5HK3A 4M78F 2JN0A 5KCOA 3OYYA 5I2SA 5HK0A 2LT4A 3CCLT 4IUUA 3PMTA 4M75G 2O4XA 3GNGA 3S6WA 2QA4T 2QA4A 4BDYA 2D9TA 3OW2S 3NTHA 3HKSA 4M78E 3JCMX 2DJZA 3CBPA 3OYDA 5J26A 5CCAA 3PTAA 4EMKB 3MHXA 3JSCA 4M7AB 1WQWA 3QUIA 4JRPA 2M1HA 4XTYA 2FVUA 2RH2A 3OSVA 3FLGA 4E7HA 3VUZA 4HCZA 5FLXE 2KSSA 5LJ3j 2X4WA 5LJ3g 3OYEA 3LX7A 3BY7A 4M78B 1K8AC 5IN1A 2E64A 1N9RA 2XK0A 3KBGA 4IUQA 1Y07A 2HBPA 4IURA 1XNIA 4MMKA 3V8LA 3OYIA 1TH7A 3OS2A 4JS5A 5GAMf 2MWOA 5C6SA 2EYQA 3MP8A 4HKEA 1MGQA 5DLQE 2Y90A 1VQKT 1VQKA 4MMLA 3VYHB 2RJCA 4A4GA 4FL6A 4LDXA 3RKWA 3QHSA 3JCMg 2FHDA 2V8IA 3OYJA 3DB3A 1UGPB 1WGSA 5LL6S 4CI0C 4LDUA 4ZTJA 1VQ5T 1VQ5A 2K5LA 4JLGA 3X28B 4LD6A 3GNFB 3V7RA 3M56A 1G3TA 5DLOA 3CC4A 2HQXA 2JNGA 4M77F 4WF2A 2KQWA 2O4XB 2KVQG 2WACA 5GAN5 1JRIA 1YJNT 1BIAA 1S72T 2OAUA 5CR2A 4XU0A 2RI2A 3H6ZA 4FU6A 2DO3A 4C92G 1OZ3A 3FB9A 2GCXA 4GLKA 4M77E 3CCJA 2K5FA 3TU4K 3OYGA 2BIVA 3G6ET 3G6EA 1YJ9A 1M90U 4BUGA 2E12A 5FU6B 1OZ2A 4KBMB 2WSCE 4CRIA 2R58A 4BY6B 3TREA 3I56T 2DK3A 4JUVA 1NPRA 4M77B 4PJOG 2EQJA 4J5YA 3RMSA 3GP8A 3BDUA 3E9FA 4KT0E 3CCLA 5FRMA 3CBMA 2CS7A 3X25B 3JB9G 2RD1A 1VQ8A 3QJYA 3SFMA 2RHIA 3GOXA 2VXEA 2EAYA 3JB9H 4MDXA 2EFIA 2LCLA 2R5AA 1U1TA 3NFCA 2WSFE 3DLMA 3HHTB 4M7DF 3QZ5B 3ZEHA 1N9SA 1H3ZA 2XDPA 4QW2A 5CKEA 1YJWT 5DY9A 1YJWA 4M7DE 4A4HA 4TVRA 2K5IA 4C92D 5GMKh 1NPPA 4GY5A 5GMKi 1VQNT 4E7JA 1VQNA 4C92C 4E7LA 4XTVA 1VUBA 3M57A 3KXTA 3CEYA 1Q86C 3KUFA 3E1SA 4J7FA 3J7AF 2EJ9A 4HA8A 1M9SA 1EIFA 2VGNA 4C92A 3LWIA 5GAMh 3CCSA 3CCST 4M7DB 3OYMA 4DA4A 3FIFA 3CCMA 4PJOD 2LRQA 2KAFA 5GAN8 1W2BA 4PJOC 3L1AA 1QVPA 1Y96B 2ZPIB 3JB9D 4ZTFA 2BKDN 4C8QF 1X75C 3MEAA 4QVDA 4X9DA 4RG8A 3A5ZB 2P0QA 1XOVA 2DIGA 3MP1A 1Y7XA 4PJOA 3CMAA 1QW1A 2E5QA 1PSFA 4X34A 4RCCA 4XU3A 2X4YA 3SWNC 4C8QE 5KE2A 2MAMA 3HRTA 3HL8A 1VQOT 2DXCA 3OW2A 2P4TA 2M9UA 3I55A 4D6WA 5D6XA 3L2VA 4BB7A 2DAQA 3QJ6A 4PNOA 3CBOA 3FRNA 2RA2A 2YRVA 5LJ3e 3ASKA 3JRZA 2DZ9A 4L5GA 3V7SA 1GXIE 3SWNA 5GMKm 1W2BS 3UWNA 1K73C 4RKUE 4N4GA 4C8QB 2E6NA 2EJGA 3OQ5A 1QP2A 4M77G 3CCVT 3QIIA 4FSXA 2PVDB 3JCMJ 3SD4A 2K3XA 3E9GA 5CQYA 4M7AE 1BI2A 4IUVA 3LH0A 3JB9I 3JCMe 2JOYA 2RM4A 5GAOq 1UGSB 3RMQA 5CKHA 2HNIA 2G3RA 4L59A 1MHNA 1YI2T 1YI2A 4OMFB 4XQ3A 5GANh 5GANd 2FL7A 3TEEA 5GAOp 3META 2DTHA 1K9MC 1YITT 1YITA 3EFSA 4F7UG 1UGRB 5CO7A 3LGLA 2RHXA 2V8KA 3GLXA 4N4IA 1VQ4T 1OI1A 2DKGA 1W4SA 2D0QB 2KMTA 3M59A 1VIEA 1H641 1WPYA 1M5Q1 4MZMA 3JCMc 3OS0A 3CCRT 3CCRA 4C5EA 1VQMA 5GMKj 4RG2A 3N5BB 3OS5A 3FJPA 4ELZC 4FT4A 4BE2A 4XTWA 5FU7B 2VGMA 3G4ST 3G4SA 4E7KA 4M7DG 5A0DA 3NTKA 5GAOm 4II1A 3WXMB 2XD0A 3CPWA 3NTIA 5GAMg 5GAMj 3QYHB 3JCMb 2QTXA 4FM4B 4OB2B 3OSSC 4Y28E 2CGHA 1Q86U 4N4HA 3RKXA 4C0DC 4M75D 3CC4T 3S3MA 1X01A 1KHCA 2JVVA 2E10A 4BD3A 1I81A 4M75C 3OYNA 3G71A 2PUKB 4MDWA 1HXDA 1G3SA 2JTMA 5CVIA 2RJFA 3C94A 3GIBA 1YBYA 2QQBA 2VUBA 2P0PA 3MP6A 1DJ7B 3HP9A 4OP0A 3CCJT 3C4SA 4M75A 5A0LA 4BACA 2OTLT 2OTLA 4QVZA 3RKYA 2MWPA 4FT2A 1YJ9T 1WJRA 3CPWS 2XIDA 2R5MA 4C5GA 5LJ5h 5LJ5d 4C8QG 4ZN3A 1U8RA 4HCBA 1XTDA 4J8OA 3EFRA 4JRIA 4BI4A 5I21A 3OA6A 3CCET 3CCEA 2CZ6B 3V8JA 5IAYA 3PMIA 2F5TX 3HSBA 4XU2A 4F7UA 3ZBDA 3OYHA 5GANf 5C0MA 1BIBA 2P0KA 2K4YA 3FDRA 5DM7R 1YIJA 3M55A 4QQDA 1NE8A 1VQ8T 2YLCA 3O8VA 1K73U 3L2QA 4RCBA 4OGEA 5GAN7 2DXTA 5FROA 3OYKA 5KH6A 5FRNA 1VIFA 4P5NA 3C95A 3PNWC 4J7IA 2RI5A 5AYFA 4M7AG 2RI3A 1BI1A 1R8OB 1O75A 2NLUA 2RHZA 2CKKA 2MMPA 3SDZA 1WJSA 3PGGA 4M78G 3A8MB 4HCCA 2VYTA 2R57A 2RJDA 1BYMA 4HT9A 1WQ7A 1WJQA 4JRQA 3L2UA 1KG1A 1LOJA 2E41A 2LTOA 1N27A 3HRSA 2L89A 1KD1U 5EG2A 1K9MU 3QZ9B 2PQWA 3WVDB 3RERA 5D6YA 4L6V5 5GAOr 1VQPA 1VQPT 3A8OB 2WSEE 1D3BA 1I8FA 1FX7A 4JLIA 4QQGA 2RHUA 5HY6A 4C8QD 2OTJA 2BUDA 2MI6A 4C8QC 3PIPA 3ME9A 2DZCA 3CCMT 4A4EA 1N8RU 5LJ3d 3E19A 2K57A 2PVOB 2KK4A 3VU3C 4ELYC 2CZ7B 1M8VA 2X35A 2L8DA 2Y4YA 2HAXA 1QVFA 3P8BB 4FIBA 4JRKA 1VQ7T 1VQ7A 1M1GA 4DQ2A 3CMAT 2JTFA 1HK9A 5LJ5f 1I4K1 2QQ9A 4OB3B 4R55A 3INZA 2H3JA 4EMKC 2EWNA 4BI8B 4M7AD 1G5VA 2DPPB 2F69A 1B34A 3CPFA 3JCMd 3FEOA 3I55T 3OYLA 4JJNK 4A53A 4HT8A 4M7AC 4NL3A 2E6ZA 4C92F 3QDRB 2Y4XA 4PKCC 3CD6A 3CD6T 4M78D 5IT9E 3HRUA 4M78C 1XQHA 1BKBA 4LDWA 4EMKA 2LT1A 4J6YA 5KE3A 3LWHA 3CCUA 2RK1A 2EQMA 3CCUT 1VQ9A 3AHUA 2QEXA 2ZPHB 5GMKe 1NZ9A 1QVFS 3QKJA 1KQ2A 5I2MA 4RMOA 1VQLA 4DOVA 4M78A 4XAXB 4DOWA 3M58A 4N0AC 4XTXA 3S3NA 1NJIU 4PJOF 2EQKA 1KQSA 1KHIA 1M1FA 3R6OA 1D3BB 4IKFA 2XDBA 2E65A 2ZZDA 4IUPA 4C92B 5GAMe 3F70A 3H8ZA 1BI3A 5GAN2 3M5AA 4N0AA 3QSUA 4JS4A 4Y91A 2ZPBB 4QQ6A 5GMKl 4B9WA 5D6WA 1YHQT 1YHQA 1X6OA 3A8GB 1KD1C 4O6JA 2C06A 3L2RA 3A8HB 3L2WA 2EIFA 1ZQ1A 2PUOB 5CKBA 1G3WA 3OYFA 4LD9K 4NS5A 4PJOB 3J80E 2X4XA 3CC7A 2XHCA 3DB4A 3RIRA 1KQSS 3URGA 3P8DA 2XI9A 4C0GA 1VQMT 3CCQT 3CCQA 4YTLA 4PLIA 1N8RC 2XDDA 2LDMA 1KQ1A 1FWZA 1B34B 1IZ6A 2GQVA 4A54A 5LJ3f 2EJFA 3DKMA 4E7IA 3OBWA 3L2ZA 2ZGWA 5FU6C 1RL2A 2DXBA 3EAEA 3JAME 3SWNB 3OYAA 1QVGA 2RB6A 4BY6C 5CAIA 3M53A 2RO0A 2YLBA 4M77D 4NL2A 1AHJB 2A3LA 3PFSA 2I2LA 4M77C 5GAN6 3OS1A 3RUXA 3V7CA 2QXFA 3CC2A 3OBYA 3C12A 3JCMf 2K3YA 4M77A 4XU1A 3G71T 2KDSA 2DXUA 2XICA 2VC8A 1JBMA 2XU8A 1V29B 2MF2A 1M1KC 4ATOA 4X9CA 3Q1JA 3X24B 5GANe 5GAOl 4J6WA 2DEQA 1P92A 3QXEB 1QVGS 4OB1B 3FC3A 2GF7A 2PVGB 1NJIC 4LDYA 3GPLA 1WNLA 4Q5WA 4B9XA 1LJOA 4O5VA 2RJEA 4MZTA 4BDZA 2QDYB 2EKOA 2HQEA 3HFOA 3JCMQ 1PSEA 1QP3A 1YCYA 4V2SA 5L8RE 3UDCA 3QPHA 5GAOn 5M9OA 4KUIA 2QQAA 2FB7A 3RESA 1UEBA 4OF1A 2RK2A 4Z02A 3V8KA 2JUFA 2QQSA 4C0FA 3CMET 3CMEA 5CKFA 4ZN1A 1YJNA 2K2VA 3QO3A 3T9NA 1YIJT 1S72A 3M54A 1Q82C 1KC8U 5GAN4 4M7DC 1Q7YC 1VQ6T 1VQ6A 1LNXA 4ZGJB 2E70A 3MEVA 2O01E 2D6FA 2LC4A 4M75F 4EPCA 4R56A 3M4YA 5CK9A 4BE1A 2LQKA 1UB4A 4JDSA 4M7DA 2QI2A 5GANg 5GANj 2VXFA 1Q81U 3G7ZA 1RI0A 3JB9J 4M75E 1ZHIA 2X4JA 2CYZB 2YHTA 2EQUA 3I56A 2F5KA 2XKOC 4BE0A 1U1SA 4J6XA 1Y96A 4F7UF 3OB9A 1N6AA 2DTOA 4PLLA 4C0DB 5A2QE 1JJ2A 4C5IA 4KUDK 2ZCFB 4MZPA 3A8LB 3HFNA 4XK8E 3CXCA 5KCHA 3BFMA 4M75B 3JCMV 3J81E 1KC8C 3MEUA 4F7UE 2ZPFB 2OTJT 1UGQB 2B8AA 5LJ5e 2M16A 3OYBA 2PU9B 3GF5A 2GFAA 4VUBA 3S3OA 4NOYA 5LJ3h 2DTIA 4XTZA 4BI3A 4EMHA 2LNVA 1FXXA 4C8QA 4F7UB 2IVWA 4OVAA 2LCCA 3LLRA 3MCAB 3WVEB 3HPWA 1M4ZA 2JZ2A 3VKIA 3X26B 2E1HA 5A0GA 2AHJB 2IG0A 3JCMP 1IREB 4LDVA 4OGCA 1JB0E 4C5HA 4EMGA 2FYKA 5CKDA 1JJ2S 3CC2T 3MO8A 4UC4A 3CXCS 3DLLA 4OB0B 3VUBA 3TCJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RD1 A;  5GMK l;  3RKX A;  3JCM h;  3M4G A;  4M75 D;  1X01 A;  2E10 A;  5GAM d;  2VXE A;  1I81 A;  2EAY A;  4M75 C;  3JB9 H;  1U1T A;  1HXD A;  4PJO B;  3GIB A;  5LJ5 g;  5LJ5 j;  3RIR A;  4M7A A;  4C92 E;  3JCM W;  4M7D F;  4OP0 A;  3BW1 A;  4M75 A;  1N9S A;  4A54 A;  1KQ1 A;  1B34 B;  3RKY A;  5LJ3 f;  2EJF A;  3L2Z A;  5LJ5 h;  2ZGW A;  5LJ5 d;  5DY9 A;  4C8Q G;  4M7D E;  4JRI A;  3EFR A;  3SWN B;  4QVC A;  2RB6 A;  4C92 D;  5CAI A;  5I21 A;  4NL2 A;  2YLB A;  4M77 D;  5GMK h;  5GMK i;  5GAN 3;  3JB9 F;  4C92 C;  4XTV A;  4M77 C;  3V8J A;  2I2L A;  5GAN 6;  4XTU A;  4PJO E;  3HSB A;  3RUX A;  3V7C A;  4XU2 A;  4F7U A;  3SB2 A;  5GAN f;  1I5L A;  1BIB A;  2DVE A;  4M7D D;  2EJ9 A;  4HA8 A;  2YLC A;  4M7D B;  3JCM f;  4C92 A;  5GAM h;  4M77 A;  4RCB A;  4XU1 A;  4M7A F;  2DXU A;  3FIF A;  5GAN 7;  4PJO D;  2DXT A;  2VC8 A;  1JBM A;  5GAN 8;  4PJO C;  3L1A A;  1Y96 B;  2JN0 A;  4M78 F;  4X9C A;  3JB9 D;  4M7A G;  5GAN e;  5GAO l;  4J6W A;  4C8Q F;  2DEQ A;  4QVD A;  4M75 G;  4X9D A;  3PGG A;  4M78 G;  1WNL A;  4PJO A;  4M78 E;  1LJO A;  3JCM X;  2DJZ A;  4RCC A;  3HFO A;  1WQ7 A;  4XU3 A;  3JCM Q;  4HT9 A;  3SWN C;  1YCY A;  4C8Q E;  4V2S A;  4EMK B;  2E41 A;  1LOJ A;  5GAO n;  4M7A B;  1WQW A;  3QUI A;  4XTY A;  2FB7 A;  4PNO A;  3RES A;  2RA2 A;  3RER A;  3V8K A;  5LJ3 e;  5GAO r;  5LJ3 g;  2DZ9 A;  3V7S A;  5LJ3 j;  4JLI A;  1D3B A;  1I8F A;  4M78 B;  3BY7 A;  3QO3 A;  3SWN A;  4C8Q D;  2E64 A;  1N9R A;  4XTX A;  4MMK A;  5GMK m;  5GAN 4;  4M7D C;  4C8Q B;  4C8Q C;  2EJG A;  3V8L A;  1LNX A;  1TH7 A;  4M77 G;  5GAM f;  2DZC A;  4M75 F;  5LJ3 d;  1MGQ A;  2K57 A;  3JCM J;  2Y90 A;  3VU3 C;  3JB9 G;  4M7D A;  4MML A;  5GAN g;  1M8V A;  5GAN j;  2VXF A;  4M7A E;  3JB9 J;  3JB9 I;  3JCM e;  3RKW A;  3QHS A;  4M75 E;  2YHT A;  4JRK A;  3JCM g;  2RM4 A;  5GAO q;  4DQ2 A;  1U1S A;  1HK9 A;  2HNI A;  4J6X A;  1Y96 A;  5LJ5 f;  1I4K 1;  5GAN h;  3INZ A;  4XQ3 A;  5GAN d;  4F7U F;  4EMK C;  2EWN A;  4M7A D;  3V7R A;  2DTO A;  1B34 A;  5GAO p;  3JCM d;  4HT8 A;  2DTH A;  4M7A C;  4A53 A;  3HFN A;  4NL3 A;  4C92 F;  3BFM A;  3EFS A;  4M75 B;  4M77 F;  4WF2 A;  4M78 D;  3JCM V;  4F7U G;  5GAN 5;  1JRI A;  4F7U E;  4M78 C;  1BIA A;  4EMK A;  4J6Y A;  5LJ5 e;  2DKG A;  4XU0 A;  4C92 G;  1H64 1;  1WPY A;  1M5Q 1;  3FB9 A;  3JCM c;  4M77 E;  5GMK e;  3AHU A;  4NOY A;  5GMK j;  5LJ3 h;  2DTI A;  3FJP A;  4XTZ A;  1KQ2 A;  4XTW A;  4M78 A;  4N0A C;  4EMH A;  4PJO F;  4M7D G;  4C8Q A;  4F7U B;  5GAO m;  1D3B B;  2E1H A;  2E65 A;  3JCM P;  4JUV A;  4C92 B;  5GAM e;  5GAM g;  4M77 B;  4PJO G;  5GAM j;  4J5Y A;  2FYK A;  2QTX A;  3BDU A;  4N0A A;  4EMG A;  3JCM b;  5GAN 2;  3QSU A;  4Y91 A;  2CGH A; 
#chains in the Genus database with same CATH topology
 3LYI A;  3VYG A;  4RTZ A;  4A4K A;  1MUZ A;  1TSF A;  3M9Q A;  3PIO A;  1GCQ A;  3OMG A;  3LH5 A;  3OYC A;  3VV0 A;  7AT1 B;  1M1K U;  1B3Q A;  2GFU A;  2DIQ A;  2LX7 A;  4E47 A;  4LNP A;  2VV5 A;  1VQL T;  1M90 C;  2L3Q A;  5FU7 C;  4R0K A;  4KUL A;  2DD4 A;  5J3B A;  1VQO A;  2HKN A;  3GBQ A;  3LW5 E;  5IHI A;  2DVE A;  1Q81 R;  1PD0 A;  3CQT A;  4ZGE B;  1ABO A;  1PG5 B;  5CIU A;  2MIO A;  3CCU Q;  1X27 A;  3PT9 A;  4M78 F;  2JN0 A;  5KCO A;  1VQL Q;  3CCL T;  3PMT A;  4M75 G;  2O4X A;  3S6W A;  2D9T A;  3OW2 S;  3HKS A;  1TUG B;  3JCM X;  2DJZ A;  4DBF A;  3CBP A;  5J26 A;  3VS2 A;  3PTA A;  4EMK B;  2CT3 A;  3TVT A;  1NEG A;  4M7A B;  4JRP A;  3M0U A;  2M1H A;  4XTY A;  2FVU A;  3OSV A;  1YWO A;  5LJ3 g;  1UHF A;  1VQ4 A;  4IUQ A;  3OYI A;  1Y07 A;  2JTE A;  4DBH A;  2MWO A;  5DLQ E;  3CCL Q;  4MML A;  3QDF A;  3H9N A;  3RKW A;  2FHD A;  2V8I A;  1RI9 A;  1RAG B;  3H0F A;  1VQ5 T;  1VQ5 A;  1TU0 B;  3X28 B;  1IGU A;  3GNF B;  2JNG A;  1NJI R;  4M77 F;  2OAU A;  4CC3 A;  1OZ3 A;  4GLK A;  3TU4 K;  1SF9 A;  2V1Q A;  3OYG A;  1WHG A;  2P84 A;  1X6B A;  4BUG A;  4FSS A;  5FU6 B;  4BY6 B;  1UHC A;  3TRE A;  3E9F A;  5FRM A;  4LN2 A;  2L0A A;  1TOV A;  1Y57 A;  3QJY A;  2RHI A;  2VXE A;  5KYW A;  3NFC A;  2WSF E;  8ATC B;  3QZ5 B;  4WCI A;  1YFN A;  1M2V B;  1OX8 A;  4QW2 A;  4CC4 B;  1QVG P;  4A4H A;  4TVR A;  4GY5 A;  2DF6 A;  3CEY A;  2D1X A;  1SRM A;  4HA8 A;  1M9S A;  2VGN A;  3LWI A;  3OYM A;  2FG0 A;  2KAF A;  1Y96 B;  2ZPI B;  3A5Z B;  2P0Q A;  1OPK A;  1Y7X A;  4D8K A;  2E5Q A;  2M51 A;  4OMM A;  3SWN C;  5KE2 A;  2P4T A;  2M9U A;  2YRV A;  3ASK A;  4L5G A;  3SWN A;  5FW9 A;  3JCM J;  2DLP A;  1UTI A;  4FW2 A;  4RTU A;  2JOY A;  4JJD A;  5GAO q;  2CH4 W;  1UGS B;  1ZLM A;  2QGG A;  2HDA A;  2HNI A;  5CKH A;  1YI2 T;  1YI2 A;  5GAN h;  4XQ3 A;  1SRL A;  3TEE A;  5GAO p;  3H41 A;  1ZSZ C;  3EFS A;  2V8K A;  2KMT A;  2DKG A;  5GJV B;  1H64 1;  1WPY A;  2HSE B;  4MZM A;  4PJL A;  4QKU A;  1VQM A;  4M4Z A;  1ZSZ A;  5GMK j;  4RG2 A;  3OS5 A;  1QMC A;  2J06 A;  4BE2 A;  2HSP A;  2BTT A;  5A0D A;  2DA9 A;  1K8A R;  3NTK A;  4FCY A;  2XD0 A;  3CPW A;  1N5Z A;  4N4H A;  3RKX A;  3CC4 T;  2KGT A;  2YUQ A;  3U23 A;  3OYN A;  4MDW A;  1YBY A;  2VUB A;  1VQK Q;  4QVZ A;  3RKY A;  4FT2 A;  5LJ5 h;  4C5G A;  4HCB A;  4JPB W;  4J8O A;  4BI4 A;  1AOJ A;  1AT1 B;  2CZ6 B;  2F5T X;  4F7U A;  4AG2 C;  3CC4 Q;  3FDR A;  2JM8 A;  1YIJ A;  2YLC A;  2FZC B;  5GAN 7;  5FRO A;  2DM1 A;  4PFZ A;  1VIF A;  3UA6 A;  4P5N A;  3C95 A;  5KYN A;  1WXB A;  4AG1 C;  1R8O B;  2NLU A;  4J9C A;  3SDZ A;  2KXC A;  1WJS A;  4M78 G;  1BYM A;  3L2U A;  1T0J A;  3QWY A;  1KG1 A;  1LOJ A;  2E41 A;  1OU9 A;  2LTO A;  1N27 A;  3HRS A;  3PVQ A;  1K9M U;  3QZ9 B;  8AT1 B;  1VQP T;  5GAO r;  1VQP A;  2J7I A;  3A8O B;  1RAF B;  5IH2 A;  1QQJ A;  4QQG A;  4RTV A;  1TS9 A;  2DZC A;  2DL5 A;  5LJ3 d;  2K57 A;  1Q86 R;  3MKD A;  2KK4 A;  1F1B B;  3VU3 C;  2Y4Y A;  2MK5 A;  4FIB A;  4JRK A;  3UAT A;  3E2U A;  3CMA T;  1HK9 A;  1BK2 A;  1I4K 1;  1RUW A;  4EMK C;  1G5V A;  4M7A D;  4JJN K;  1B34 A;  3OYL A;  4M7A C;  4NL3 A;  2E6Z A;  4C92 F;  1M3A A;  4EMK A;  1D1C A;  5KYY B;  2QEX A;  5GMK e;  1NZ9 A;  3QKJ A;  1KQ2 A;  4HVW A;  4DOW A;  1NJI U;  2YUN A;  2EQK A;  1KHI A;  1LPL A;  3CMA Q;  2ZZD A;  1YWP A;  3M5A A;  1R0B G;  4Y91 A;  4LXC A;  4FW1 A;  1X6O A;  3A8G B;  1QCN A;  2C06 A;  3A8H B;  2J05 A;  2PZ1 A;  1QKW A;  3VRZ A;  1G3W A;  2KYM A;  2DL4 A;  2X4X A;  3DB4 A;  1UJY A;  2LNH B;  2V1R A;  3URG A;  3CCQ T;  3CCQ A;  4YTL A;  1PNJ A;  1KD1 R;  2LDM A;  1KQ1 A;  1IZ6 A;  5LJ3 f;  4E7I A;  5FU6 C;  1RL2 A;  2DXB A;  1QVG A;  4BY6 C;  1PHT A;  1IHW A;  4HVU A;  1MMD A;  2QXF A;  3CC2 A;  4HXJ A;  2K3Y A;  2YSQ A;  1JXM A;  1W2B P;  3CCR Q;  1V29 B;  5GAO l;  1M27 C;  3FC3 A;  2EYW A;  1NJI C;  4LDY A;  1LJO A;  3HFO A;  1PSE A;  2OI3 A;  1RAH B;  2KRO A;  1M2V A;  1WLP B;  2FB7 A;  3RES A;  4Z02 A;  1WHJ A;  1X2K A;  3T9N A;  1M30 A;  3M54 A;  3TSW A;  1VQ6 T;  1VQ6 A;  2GBQ A;  1LNX A;  1RAA B;  3D7S B;  1E6H A;  1X69 A;  1WHH A;  2E70 A;  2O01 E;  4M75 F;  1AWW A;  5IHK A;  4JDS A;  4GBQ A;  4HVV A;  5GAN j;  3G7Z A;  1TTH B;  2X4J A;  2CYZ B;  3I56 A;  2EQU A;  2EW3 A;  4BE0 A;  4J6X A;  3CCE Q;  1Y96 A;  1N6A A;  4C0D B;  4KUD K;  3A8L B;  4K11 A;  3JCM V;  1VQ6 Q;  2QK0 A;  3OYB A;  2GQI A;  4VUB A;  3SEM A;  4XTZ A;  2CP2 A;  4BI3 A;  2IVW A;  2LCC A;  3HPW A;  1M4Z A;  2JZ2 A;  3VKI A;  2IG0 A;  3NMZ C;  1IRE B;  4OGC A;  1KIK A;  1JJ2 S;  2FO0 A;  3MO8 A;  2EYY A;  2KXD A;  1H8K A;  4EIK A;  3M4G A;  1YCS B;  2KY9 A;  1K8A U;  2ZPE B;  2ZPG B;  4A4F A;  2F1L A;  2V8J A;  1NYG A;  2LVM A;  2M0O A;  1KJW A;  5LJ5 j;  4C92 E;  2K3B A;  4RTX A;  4FYV B;  3L42 A;  4LE9 A;  3TQ7 P;  3UPU A;  4IUT A;  1NBE B;  1KC8 R;  1VQ7 Q;  5GAN 3;  2O88 A;  1SSF A;  3ER0 A;  3LGF A;  2MCN A;  2CZ1 B;  3MEW A;  2L5Q A;  1MNE A;  4X1V A;  1ZBX A;  4AT1 B;  2CZ0 B;  1Q82 U;  1Q7Y U;  4FYY B;  5CQX A;  4ZGD B;  3EGU A;  2DBM A;  3OYY A;  5I2S A;  2YDL A;  2LT4 A;  1C6V X;  4CC7 A;  2RQT A;  4PJJ A;  5CCA A;  3EG1 A;  4CC2 A;  1WQW A;  1W1F A;  1YHQ Q;  3FLG A;  2K6D A;  2HMA A;  3BY7 A;  1FMK A;  4M78 B;  1K8A C;  2E64 A;  4XTX A;  3KBG A;  4MMK A;  4IUR A;  1WFW A;  1ZUU A;  3OS2 A;  4HKE A;  1MGQ A;  4E7Z A;  3M0R A;  2Y90 A;  1QVF P;  3VYH B;  2RJC A;  4FL6 A;  4LDX A;  1H3H A;  2QTV A;  3OYJ A;  3DB3 A;  1E7O A;  1UGP B;  2HKQ B;  1NM7 A;  2CP7 A;  2K5L A;  4RTY A;  3KFV A;  1AEY A;  2FZG B;  5DLO A;  1BU1 A;  2HQX A;  1EX4 A;  2KQW A;  2KVQ G;  1YJN T;  4FYW B;  1S72 T;  4XU0 A;  4C92 G;  2KNB B;  3UA7 A;  3EG9 B;  2BIV A;  1M90 U;  2CT4 A;  4CRI A;  2R58 A;  2LQW A;  4JUV A;  1HD3 A;  1QLY A;  4M77 B;  3I35 A;  4KT0 E;  3CBM A;  1I1J A;  2CS7 A;  2EQI A;  3JB9 G;  1GL5 A;  1CKA A;  3R6N A;  3EHR A;  1YJN Q;  1S72 Q;  3JB9 H;  2EFI A;  3HHT B;  2JW4 A;  2IIM A;  3ZEH A;  1N9S A;  2XDP A;  2QGF B;  4QT7 A;  5I22 A;  4M7D E;  5KYY A;  3PVL A;  5GMK h;  1VQN T;  1VQN A;  4DBQ A;  1GFC A;  4E7L A;  1SHG A;  3M57 A;  1Q86 C;  3E1S A;  4J7F A;  3J7A F;  3CCS T;  3CCS A;  1W2B A;  1PCX A;  3L1A A;  1QVP A;  4RTW A;  4ESR A;  2BKD N;  2HL5 C;  1X75 C;  2NUP B;  4RG8 A;  1YP5 A;  1KSW A;  1UJ0 A;  2X4Y A;  4C8Q E;  3HRT A;  4AFU C;  1VQO T;  1T3S A;  4D6W A;  5D6X A;  1GXI E;  3V7S A;  3UWN A;  2EJG A;  3OQ5 A;  1QP2 A;  1BB9 A;  3QII A;  4FSX A;  2PVD B;  3E9G A;  5CQY A;  1OEB A;  2A37 A;  3LH0 A;  3JB9 I;  3JCM e;  1B7T A;  1WHL A;  2X51 A;  2YRD A;  1VQO Q;  2AKK A;  4OMF B;  2FL7 A;  3VS5 A;  1ARK A;  4LUD A;  3MET A;  1IRX A;  2DTH A;  1VQ4 T;  3GLX A;  2H3E B;  1VIE A;  2AK5 A;  2A28 A;  4C5E A;  2A08 A;  3N5B B;  2EPD A;  2GTO A;  2VGM A;  3G4S T;  3G4S A;  4M7D G;  1BCM A;  4II1 A;  5GAM j;  2QTX A;  4C0D C;  2HQH A;  3S3M A;  1W70 A;  1VQ4 Q;  1HXD A;  2JTM A;  5CVI A;  2EGE A;  3AT1 B;  2QQB A;  3HP9 A;  2OTL T;  4OP0 A;  2OTL A;  2KYB A;  3QWX X;  1TUD A;  3G4S Q;  2MWP A;  3ULR B;  1YN8 A;  2R5M A;  1D1A A;  4C8Q G;  1U8R A;  1XTD A;  1OQK A;  5I21 A;  2RQW A;  4Z89 A;  2L2P A;  3V8J A;  5IAY A;  1VQ5 Q;  1AWO A;  4KGX B;  4XU2 A;  3OYH A;  5C0M A;  2E5K A;  4QQD A;  3O8V A;  3L2Q A;  4RCB A;  4OGE A;  2DXT A;  5FRN A;  1ZBJ A;  3PNW C;  2RI5 A;  5AYF A;  4KH1 B;  2RQR A;  2DEU A;  1AWX A;  2CKK A;  2MMP A;  3M0S A;  3PGG A;  3A8M B;  4PJN A;  1M8M A;  1WJQ A;  2CUB A;  2DIL A;  2KR3 A;  2RN8 A;  2L89 A;  5EG2 A;  2PQW A;  9ATC B;  1D3B A;  2OTJ A;  3NHN A;  1PWT A;  3PIP A;  2NWM A;  2EBP A;  3EFO B;  4A4E A;  3E19 A;  1AWJ A;  2PVO B;  1M2O A;  1M8V A;  1QVF A;  2F2X A;  4B6M A;  3P8B B;  3VS6 A;  1T0H A;  4DQ2 A;  4OB3 B;  2H3J A;  2DPP B;  3CPF A;  4A53 A;  3CD6 T;  3CD6 A;  2Y4X A;  4M78 D;  2JM9 A;  1QCO A;  3H0H A;  4M78 C;  3MPU B;  1KC8 C;  3LWH A;  2VVK A;  2RK1 A;  1VQ9 A;  2ZPH B;  4KRT A;  4RMO A;  1IGQ A;  4M78 A;  4N0A C;  4PJO F;  3EHQ A;  2AIR B;  1M1F A;  2LP5 A;  3R6O A;  3ZL7 C;  1K73 R;  4IKF A;  2YUO A;  4C92 B;  5GAM e;  1BI3 A;  5GAN 2;  4N0A A;  3RBB B;  2DRK A;  4JS4 A;  2A36 A;  4QQ6 A;  4B9W A;  5D6W A;  4O6J A;  2EIF A;  3M0Q A;  4LD9 K;  4NS5 A;  3CC7 A;  2CP0 A;  4Z8A A;  4RTT A;  1KQS S;  1VQM T;  1ABQ A;  4C0G A;  1W6X A;  1FWZ A;  1QKX A;  3OBW A;  3L2Z A;  4J9F A;  3OYA A;  2JJ9 A;  3NPF A;  2EKH A;  4M77 D;  4PFO A;  3EG9 A;  1YI2 Q;  2J6F A;  4M77 C;  3OS1 A;  1N8R R;  3V7C A;  3A1P A;  1IB8 A;  4M77 A;  2KDS A;  2DXU A;  3IQL A;  2KT8 A;  1FMW A;  1VQM Q;  2MF2 A;  2E3I A;  1RAB B;  4J9D A;  4X9C A;  2C0O A;  1P92 A;  2RMO A;  3GPL A;  2RJE A;  2EKO A;  1QP3 A;  5L8R E;  3UDC A;  5M9O A;  2QQA A;  4E2F B;  1UEB A;  4OF1 A;  1MMA A;  3V8K A;  2QQS A;  4C0F A;  2IPO B;  3CME T;  3CME A;  1YIJ T;  2GTJ A;  2D6F A;  1RLP C;  2LC4 A;  4EPC A;  2HZY A;  4R56 A;  4BE1 A;  1NG2 A;  2LQK A;  2QI2 A;  1U5S A;  5GAN g;  1Q81 U;  1U1S A;  2DBK A;  4WTO B;  1WIE A;  2NUP A;  4PLL A;  2ZCF B;  3BFM A;  1YIJ Q;  4M75 B;  4F7U E;  2M16 A;  3HTR A;  1JU5 C;  3GF5 A;  2DER A;  5L23 A;  5IXB A;  1K76 A;  2CDT A;  4EMH A;  1YNZ A;  3MCA B;  5A0G A;  3JCM P;  2ZAE A;  2KI7 A;  4UC4 A;  3CXC S;  4OB0 B;  2AZS A;  3JV3 A;  3VUB A;  3TCJ A;  3P8H A;  3JCM h;  1G3Y A;  1VQP Q;  2H8H A;  1O9S A;  1NEB A;  2HD0 A;  2NUT B;  1I5O B;  1OUL A;  5LJ5 g;  2QEX T;  4M7A A;  3M0T A;  1VYV A;  3REA B;  3QYG B;  2LQ8 A;  1Y71 A;  1MMN A;  2JMC A;  2DYB A;  2DE0 X;  2BE7 D;  1Q81 C;  1ACM B;  2A7Y A;  4E7S A;  3JB9 F;  4XTU A;  2XG8 D;  4PJO E;  3X20 B;  3SB2 A;  5HKC A;  3ZFJ A;  5J39 A;  1OYX A;  3CCV A;  3C0C A;  2LX9 A;  2QEX Q;  5HK3 A;  5HK0 A;  3GNG A;  2QA4 T;  2QA4 A;  4BDY A;  3NTH A;  1OX9 A;  3OYD A;  5KYX B;  3MHX A;  3QUI A;  1C0M A;  4RUG A;  2RH2 A;  4E7H A;  3VUZ A;  5FLX E;  2KBT A;  2X4W A;  2GGR A;  1WHK A;  3VS3 A;  3CC2 T;  5IN1 A;  1N9R A;  1SSH A;  2XK0 A;  2HBP A;  1XNI A;  1X43 A;  3V8L A;  1QWE A;  1UUE A;  2EYQ A;  2Z0W A;  3CCQ Q;  2CP3 A;  3JCM g;  1RAI B;  1WGS A;  4CI0 C;  1M1K R;  4JLG A;  2KT1 A;  3M56 A;  1G3T A;  3CC2 Q;  4WF2 A;  2O4X B;  2WAC A;  2JXB A;  1WI7 A;  5CR2 A;  4FU6 A;  1Z9Q A;  1RAC B;  2L3S A;  2GCX A;  3FB9 A;  3EH2 A;  3CCJ A;  2YRC A;  1VYU A;  2K7A A;  3G6E T;  3G6E A;  1YJ9 A;  2COZ A;  1OZ2 A;  4KBM B;  3VS0 A;  2WSC E;  3I56 T;  3EFO A;  1NPR A;  4PJO G;  3GP8 A;  4J5Y A;  1WXU A;  3X25 B;  2RD1 A;  1VQ8 A;  1GCP A;  3EG0 A;  3SFM A;  3GOX A;  1IHV A;  1PM3 A;  2EAY A;  4MDX A;  2R5A A;  1U1T A;  2AT1 B;  3DLM A;  2L3P A;  4M7D F;  1WXT A;  2PNI A;  3I56 Q;  1YJW A;  1YJW T;  3VS1 A;  4C92 D;  5GMK i;  4E7J A;  4C92 C;  4XTV A;  2J6O A;  3KXT A;  2EYX A;  2EJ9 A;  4C92 A;  5GAM h;  3FIF A;  3CCM A;  2LRQ A;  5GAN 8;  2AKL A;  3JB9 D;  4ZTF A;  4C8Q F;  4QVD A;  4X9D A;  2RNA A;  3MP1 A;  2MOX A;  1LCK A;  1BCO A;  4X34 A;  4RCC A;  4XU3 A;  2MAM A;  3HL8 A;  2F2W A;  3I55 A;  3L2V A;  4BB7 A;  1D0Y A;  2DAQ A;  3QJ6 A;  4JJB A;  1BBZ A;  5GMK m;  1K73 C;  4N4G A;  4KGV B;  3SD4 A;  4IUV A;  4D8D A;  4JZ4 A;  2KRS A;  2RM4 A;  2LZ6 B;  3RMQ A;  4AFQ C;  1U06 A;  4L59 A;  1MHN A;  2BZX A;  2ENM A;  5GAN d;  1ZUY A;  1JJ2 P;  2X3W D;  1YIT T;  1YIT A;  1UGR B;  5CO7 A;  3LGL A;  2RHX A;  1W4S A;  2D0Q B;  2RQV A;  1SPK A;  1M5Q 1;  3JCM c;  4ELZ C;  4FT4 A;  5HCK A;  3M0P A;  4J9G A;  1ZSG A;  5GAM g;  1U3O A;  2I0N A;  3QYH B;  4IIM A;  3JCM b;  1GFD A;  2O9V A;  2ROT A;  4Y28 E;  1Q86 U;  2RF0 A;  4M75 D;  1X01 A;  4BD3 A;  4M75 C;  2M0Y A;  3G71 A;  3TSZ A;  3EGX B;  2KEA A;  2RJF A;  3C94 A;  2D8H A;  3MP6 A;  1DJ7 B;  4M75 A;  5A0L A;  2FPD A;  3CPW S;  2XID A;  1K0S A;  5LJ5 d;  5ECA A;  1JEG A;  4F16 A;  3HSB A;  2NYS A;  1MV3 A;  5D7U A;  1AZG B;  3ZBD A;  5GAN f;  2CH4 A;  1BIB A;  2P0K A;  4M7D D;  1NE8 A;  4FYX B;  2LCS A;  3OYK A;  5KH6 A;  1AD5 A;  1WDX A;  5I11 A;  1ZA1 B;  2NUT A;  2D0N A;  2R57 A;  2LQN A;  2RJD A;  2CRE A;  4KH0 B;  2C0I A;  4OMQ A;  2X3X D;  2SEM A;  1R77 A;  1Z9Z A;  2DYI A;  1KD1 U;  3WVD B;  3RER A;  5D6Y A;  4L6V 5;  2MYS A;  2WSE E;  1I8F A;  1FX7 A;  5HY6 A;  4C8Q D;  4OML A;  2BUD A;  4C8Q C;  2OAW A;  1UG1 A;  1PD1 A;  1FMV A;  2CZ7 B;  2J6K A;  2X35 A;  2L8D A;  2HAX A;  1M3B A;  2BE9 B;  2M02 A;  2V26 A;  2JTF A;  4J9E A;  1VQN Q;  5LJ5 f;  2QQ9 A;  3EH1 A;  4R55 A;  2P4R A;  2EWN A;  4BI8 B;  2F69 A;  4HT8 A;  3JCM d;  3RR6 A;  3CCS Q;  5KYX A;  1GBQ A;  3HRU A;  1BKB A;  4LDW A;  2QAS A;  3CCU T;  1RLQ C;  3CCU A;  3BE3 A;  3AHU A;  3THK A;  1VQL A;  4DOV A;  1K9A A;  1HYO A;  4J9B A;  2E3H A;  2E65 A;  2QG9 B;  3F70 A;  3H8Z A;  3H0I A;  3QSU A;  2ZPB B;  1KD1 C;  2O31 A;  1C1A A;  3L2W A;  1ZQ1 A;  2PUO B;  5CKB A;  3OYF A;  4PJO B;  4ORZ A;  3RIR A;  5AT1 B;  1CSK A;  3P8D A;  2DJQ A;  2FZK B;  3CCL A;  1K9M R;  2XDD A;  1B34 B;  1R0C B;  3JAM E;  2RB6 A;  2RO0 A;  1AHJ B;  5KYU B;  2A3L A;  1HJD A;  2I2L A;  2CSQ A;  2O9S A;  4A63 B;  3JCM f;  1V76 A;  3NGP A;  2XIC A;  1JBM A;  2XU8 A;  1M1K C;  4ATO A;  3Q1J A;  3X24 B;  2KE9 A;  1G83 A;  4J6W A;  2DEQ A;  1QVG S;  4OB1 B;  2GF7 A;  1WNL A;  4Q5W A;  4O5V A;  1G8X A;  3I9Q A;  4BDZ A;  4V2S A;  2HQE A;  3OW2 P;  1HSQ A;  2FEI A;  4KUI A;  1V1C A;  4ZN1 A;  2ESW A;  1D09 B;  3QO3 A;  4J9I A;  1KC8 U;  1PC0 A;  4JJC A;  3M4Y A;  2OTL Q;  3VS4 A;  1UB4 A;  1Y0M A;  1RI0 A;  3JB9 J;  2F5K A;  2XKO C;  4F7U F;  3OB9 A;  5A2Q E;  1JJ2 A;  4C5I A;  1QWF A;  4XK8 E;  3J81 E;  5FWB A;  3I5R A;  2ZPF B;  2OTJ T;  1I07 A;  2GFA A;  3S3O A;  4NOY A;  2DTI A;  1WX6 A;  3X26 B;  2K2M A;  4LDV A;  5CKD A;  4EMG A;  2FYK A;  1LVK A;  3MJX A;  4AFZ C;  2ED1 A;  4J83 A;  4OMP A;  1CKB A;  1MND A;  5GAM d;  3UF4 A;  2OTJ Q;  1JXO A;  3QG1 A;  1BI0 A;  2RPN A;  3OMC A;  3OY9 A;  1VQ9 T;  4ME7 A;  3REB B;  4J9H A;  4EDU A;  3JCM W;  3VJP A;  2X9H A;  3BW1 A;  3VRY A;  2EVR A;  3QBY A;  1RAE B;  4QVC A;  2EYZ A;  2L3R A;  4C0Z A;  2LMJ A;  1JO8 A;  1WHM A;  3BDL A;  4PL6 A;  1I5L A;  3CD6 Q;  2YWW A;  4M7A F;  3UT1 A;  1VQ9 Q;  2DD5 A;  2QQR A;  2K79 A;  1Q95 G;  3CC7 T;  2RHY A;  2BZ8 A;  1TXQ A;  4IUU A;  2DRM A;  3EGX A;  4M78 E;  1IXD A;  3JSC A;  3EG2 A;  2COW A;  2CP5 A;  3OYE A;  1SG5 A;  4HCZ A;  2KSS A;  5LJ3 j;  3LX7 A;  2FPF A;  1WYX A;  5IXF A;  1ZUK A;  1D1B A;  2F2V A;  1TH7 A;  4JS5 A;  5GAM f;  3CC7 Q;  5C6S A;  3MP8 A;  2HL3 A;  1VQK T;  1VQK A;  4A4G A;  2VKN A;  3QHS A;  2CUD A;  5LL6 S;  1MMG A;  4LDU A;  4ZTJ A;  1TWB A;  4LD6 A;  2KRM A;  3V7R A;  2G6F X;  3CC4 A;  1I0C A;  5GAN 5;  1JRI A;  1T3L A;  1BIA A;  1UDL A;  4IIO A;  1PRL C;  1S1N A;  2RI2 A;  3H6Z A;  2DO3 A;  6AT1 B;  2MPX C;  2ATC B;  2W10 A;  1UE9 A;  4M77 E;  2K5F A;  1KQS P;  2KRN A;  2E12 A;  1OV3 A;  1VYT A;  1Q82 R;  4ANJ A;  1Q7Y R;  2DK3 A;  1UFF A;  3RMS A;  2EQJ A;  3BDU A;  2B86 A;  2LJ3 A;  1FYN A;  3CME Q;  1OU8 A;  2DNU A;  1X6G A;  2LCL A;  4F04 B;  2YXY A;  2DX1 A;  2QDL A;  1TG0 A;  1H3Z A;  5CKE A;  1GRI A;  5DY9 A;  3EGD B;  2HBW A;  2K5I A;  1NPP A;  1VUB A;  1JQQ A;  3KUF A;  4M7D B;  1EIF A;  2HCK A;  3G1J A;  4DA4 A;  1D0Z A;  4PJO D;  2JT4 A;  4PJO C;  2BZY A;  3MEA A;  4KGZ B;  2AZV A;  1XOV A;  2DIG A;  4PJO A;  3CMA A;  1QW1 A;  1PSF A;  3FJ5 A;  1WZO A;  3A98 A;  1TUC A;  2DXC A;  2FRW A;  3OW2 A;  2DL3 A;  1EFN A;  4GLM A;  2E4H A;  3CBO A;  3FRN A;  2RA2 A;  4PNO A;  3I5S A;  1M90 R;  5LJ3 e;  3JRZ A;  2DZ9 A;  1XJW B;  1NLP C;  5GJW B;  1W2B S;  4RKU E;  5KYU A;  4C8Q B;  2E6N A;  4M77 G;  3CCV T;  2FPE A;  2K3X A;  4M7A E;  1BI2 A;  1D0X A;  3SHW A;  1OOT A;  4F17 A;  2G3R A;  4HCK A;  2FRY A;  2W0Z A;  3CXC P;  1K9M C;  2DL7 A;  4PK4 A;  2LJ0 A;  4Z88 A;  2LJ1 A;  4F7U G;  1M3C A;  2ED0 A;  4N4I A;  3CCV Q;  1OI1 A;  3M59 A;  1H92 A;  3CCR T;  3CCR A;  3OS0 A;  1GBR A;  3FJP A;  1ZX6 A;  4OMN A;  4XTW A;  5FU7 B;  1MV0 B;  2VWF A;  4E7K A;  2QA4 Q;  1KFZ A;  5GAO m;  3WXM B;  4AMC A;  1KK7 A;  3NTI A;  2YT6 A;  4FM4 B;  4OB2 B;  1X2Q A;  3OSS C;  2CGH A;  2QYZ A;  1KHC A;  2JVV A;  2E10 A;  1I81 A;  2PUK B;  1G3S A;  2SRC A;  3GIB A;  2EGA A;  2P0P A;  3CCJ T;  4BAC A;  3C4S A;  1YJ9 T;  1WJR A;  2A0F B;  4ZN3 A;  1WA7 A;  4JRI A;  3EFR A;  3OA6 A;  3CCE T;  3CCE A;  2DL8 A;  3PMI A;  1UEC A;  5IHN A;  5DM7 R;  2K4Y A;  1VQ8 T;  3M55 A;  1K73 U;  4Y92 A;  1ZA2 B;  2QAZ A;  5EC7 A;  1J3T A;  3CCJ Q;  4J7I A;  4M7A G;  1BI1 A;  2RI3 A;  3G6E Q;  4DBR A;  1YJ9 Q;  1O75 A;  2RHZ A;  4HCC A;  2VYT A;  4F14 A;  4HT9 A;  1WQ7 A;  4JRQ A;  2CSI A;  1VQ8 Q;  2XMF A;  2C0T A;  4PFP A;  4JLI A;  2RHU A;  2GNC A;  2MI6 A;  3VS7 A;  3ME9 A;  3CCM T;  1N8R U;  1EZZ B;  2DFU A;  4AFS C;  2D8J A;  2O2O A;  4ELY C;  1K0X A;  1B07 A;  2K9G A;  1YJW Q;  4DEX A;  1VQ7 T;  1VQ7 A;  1M1G A;  5KYW B;  3INZ A;  3I55 T;  3FEO A;  1E6G A;  1K1Z A;  3QDR B;  4PKC C;  5IT9 E;  1XQH A;  5KE3 A;  2LT1 A;  4J6Y A;  3CCM Q;  4ZNX A;  2EQM A;  3PE0 A;  1SHF A;  1QVF S;  5I2M A;  4XAX B;  3M58 A;  3S3N A;  1KQS A;  1SKU B;  1D3B B;  2XDB A;  4E6R A;  2EGC A;  4IUP A;  1VOM A;  1A0N B;  1G2B A;  1AZE A;  3I55 Q;  5GMK l;  1YHQ T;  1NYF A;  1YHQ A;  2OX7 A;  3L2R A;  1PRM C;  3J80 E;  2XHC A;  1RAD B;  2JMA A;  2XI9 A;  1N8R C;  4PLI A;  4A54 A;  2GQV A;  2EJF A;  3DKM A;  2ZGW A;  1NLO C;  1PKT A;  3EAE A;  3SWN B;  5CAI A;  3M53 A;  1OPL A;  2YLB A;  4NL2 A;  3PFS A;  3RDV A;  5GAN 6;  3RUX A;  2HEQ A;  1YIT Q;  1UGV A;  3OBY A;  2VAS A;  3C12 A;  4XU1 A;  3G71 T;  2VC8 A;  1AVZ C;  2DET A;  5GAN e;  2ECZ A;  1PKS A;  3QXE B;  2ABL A;  2PVG B;  3O5Z A;  4B9X A;  3RNJ A;  2NUZ A;  4MZT A;  2COY A;  2QDY B;  3JCM Q;  1YCY A;  1IO6 A;  2ROL A;  3QPH A;  3EG3 A;  5GAO n;  1K4U S;  2RK2 A;  1ZSZ B;  2JUF A;  2JS2 A;  2PTK A;  3EGD A;  1QCF A;  5CKF A;  1YJN A;  2K2V A;  1S72 A;  3G71 Q;  4JZ3 A;  1Q82 C;  4M7D C;  5GAN 4;  1Q7Y C;  4ZGJ B;  3MEV A;  2RQU A;  4DEY A;  5CK9 A;  2VB6 A;  4M7D A;  2VXF A;  4M75 E;  1ZHI A;  2YHT A;  2CP6 A;  2DMO A;  2DTO A;  4MZP A;  2YUP A;  3HFN A;  4LUE A;  3CXC A;  5KCH A;  3MEU A;  4PJM A;  2OJ2 A;  1UGQ B;  2B8A A;  5LJ5 e;  2PU9 B;  1VA7 A;  5FWC A;  4OMO A;  5LJ3 h;  2LNV A;  1FXX A;  4C8Q A;  4F7U B;  1SEM A;  3WVE B;  4OVA A;  3LLR A;  2JS0 A;  3CPW P;  2E1H A;  2AHJ B;  1JB0 E;  2DVJ A;  4C5H A;  1GCQ C;  3DLL A; 
#chains in the Genus database with same CATH homology
 3P8H A;  3LYI A;  3VYG A;  3JCM h;  1G3Y A;  3M4G A;  2KY9 A;  1K8A U;  1O9S A;  4A4K A;  4J83 A;  3M9Q A;  5GAM d;  3PIO A;  2HD0 A;  2ZPE B;  2ZPG B;  3OMG A;  4A4F A;  3QG1 A;  2V8J A;  1BI0 A;  2LVM A;  3OYC A;  2M0O A;  3OMC A;  3OY9 A;  3VV0 A;  4ME7 A;  5LJ5 g;  1VQ9 T;  5LJ5 j;  1M1K U;  4EDU A;  2QEX T;  2GFU A;  4C92 E;  2DIQ A;  3JCM W;  4M7A A;  3QYG B;  3VJP A;  4E47 A;  2LQ8 A;  2VV5 A;  1Y71 A;  3BW1 A;  3L42 A;  1VQL T;  1M90 C;  5FU7 C;  3QBY A;  3UPU A;  1Q81 C;  4IUT A;  2A7Y A;  4KUL A;  2DD4 A;  5J3B A;  4QVC A;  5GAN 3;  1SSF A;  1VQO A;  3ER0 A;  3JB9 F;  3LGF A;  4M7D D;  2CZ1 B;  2L3R A;  3MEW A;  2L5Q A;  4C0Z A;  4XTU A;  4PL6 A;  2XG8 D;  3BDL A;  4PJO E;  3X20 B;  3LW5 E;  3SB2 A;  1I5L A;  1VQ4 A;  2DVE A;  5HKC A;  3ZFJ A;  4ZGE B;  1ZBX A;  5J39 A;  2CZ0 B;  1Q82 U;  5CIU A;  1Q7Y U;  1OYX A;  4M7A F;  3CCV A;  3UT1 A;  2DD5 A;  2LX9 A;  2QQR A;  3PT9 A;  5CQX A;  4ZGD B;  3CC7 T;  2RHY A;  5HK3 A;  4M78 F;  2JN0 A;  5KCO A;  3OYY A;  5I2S A;  5HK0 A;  2LT4 A;  3CCL T;  4IUU A;  3PMT A;  4M75 G;  2O4X A;  3GNG A;  3S6W A;  2QA4 T;  2QA4 A;  4BDY A;  2D9T A;  3OW2 S;  3NTH A;  3HKS A;  4M78 E;  3JCM X;  2DJZ A;  3CBP A;  3OYD A;  5J26 A;  5CCA A;  3PTA A;  4EMK B;  3MHX A;  3JSC A;  4M7A B;  1WQW A;  3QUI A;  4JRP A;  2M1H A;  4XTY A;  2FVU A;  2RH2 A;  3OSV A;  3FLG A;  4E7H A;  3VUZ A;  4HCZ A;  5FLX E;  2KSS A;  5LJ3 j;  2X4W A;  5LJ3 g;  3OYE A;  3LX7 A;  3BY7 A;  4M78 B;  1K8A C;  5IN1 A;  2E64 A;  1N9R A;  2XK0 A;  3KBG A;  4IUQ A;  1Y07 A;  2HBP A;  4IUR A;  1XNI A;  4MMK A;  3V8L A;  3OYI A;  1TH7 A;  3OS2 A;  4JS5 A;  5GAM f;  2MWO A;  5C6S A;  2EYQ A;  3MP8 A;  4HKE A;  1MGQ A;  5DLQ E;  2Y90 A;  1VQK T;  1VQK A;  4MML A;  3VYH B;  2RJC A;  4A4G A;  4FL6 A;  4LDX A;  3RKW A;  3QHS A;  3JCM g;  2FHD A;  2V8I A;  3OYJ A;  3DB3 A;  1UGP B;  1WGS A;  5LL6 S;  4CI0 C;  4LDU A;  4ZTJ A;  1VQ5 T;  1VQ5 A;  2K5L A;  4JLG A;  3X28 B;  4LD6 A;  3GNF B;  3V7R A;  3M56 A;  1G3T A;  5DLO A;  3CC4 A;  2HQX A;  2JNG A;  4M77 F;  4WF2 A;  2KQW A;  2O4X B;  2KVQ G;  2WAC A;  5GAN 5;  1JRI A;  1YJN T;  1BIA A;  1S72 T;  2OAU A;  5CR2 A;  4XU0 A;  2RI2 A;  3H6Z A;  4FU6 A;  2DO3 A;  4C92 G;  1OZ3 A;  3FB9 A;  2GCX A;  4GLK A;  4M77 E;  3CCJ A;  2K5F A;  3TU4 K;  3OYG A;  2BIV A;  3G6E T;  3G6E A;  1YJ9 A;  1M90 U;  4BUG A;  2E12 A;  5FU6 B;  1OZ2 A;  4KBM B;  2WSC E;  4CRI A;  2R58 A;  4BY6 B;  3TRE A;  3I56 T;  2DK3 A;  4JUV A;  1NPR A;  4M77 B;  4PJO G;  2EQJ A;  4J5Y A;  3RMS A;  3GP8 A;  3BDU A;  3E9F A;  4KT0 E;  3CCL A;  5FRM A;  3CBM A;  2CS7 A;  3X25 B;  3JB9 G;  2RD1 A;  1VQ8 A;  3QJY A;  3SFM A;  2RHI A;  3GOX A;  2VXE A;  2EAY A;  3JB9 H;  4MDX A;  2EFI A;  2LCL A;  2R5A A;  1U1T A;  3NFC A;  2WSF E;  3DLM A;  3HHT B;  4M7D F;  3QZ5 B;  3ZEH A;  1N9S A;  1H3Z A;  2XDP A;  4QW2 A;  5CKE A;  1YJW T;  5DY9 A;  1YJW A;  4M7D E;  4A4H A;  4TVR A;  2K5I A;  4C92 D;  5GMK h;  1NPP A;  4GY5 A;  5GMK i;  1VQN T;  4E7J A;  1VQN A;  4C92 C;  4E7L A;  4XTV A;  1VUB A;  3M57 A;  3KXT A;  3CEY A;  1Q86 C;  3KUF A;  3E1S A;  4J7F A;  3J7A F;  2EJ9 A;  4HA8 A;  1M9S A;  1EIF A;  2VGN A;  4C92 A;  3LWI A;  5GAM h;  3CCS A;  3CCS T;  4M7D B;  3OYM A;  4DA4 A;  3FIF A;  3CCM A;  4PJO D;  2LRQ A;  2KAF A;  5GAN 8;  1W2B A;  4PJO C;  3L1A A;  1QVP A;  1Y96 B;  2ZPI B;  3JB9 D;  4ZTF A;  2BKD N;  4C8Q F;  1X75 C;  3MEA A;  4QVD A;  4X9D A;  4RG8 A;  3A5Z B;  2P0Q A;  1XOV A;  2DIG A;  3MP1 A;  1Y7X A;  4PJO A;  3CMA A;  1QW1 A;  2E5Q A;  1PSF A;  4X34 A;  4RCC A;  4XU3 A;  2X4Y A;  3SWN C;  4C8Q E;  5KE2 A;  2MAM A;  3HRT A;  3HL8 A;  1VQO T;  2DXC A;  3OW2 A;  2P4T A;  2M9U A;  3I55 A;  4D6W A;  5D6X A;  3L2V A;  4BB7 A;  2DAQ A;  3QJ6 A;  4PNO A;  3CBO A;  3FRN A;  2RA2 A;  2YRV A;  5LJ3 e;  3ASK A;  3JRZ A;  2DZ9 A;  4L5G A;  3V7S A;  1GXI E;  3SWN A;  5GMK m;  1W2B S;  3UWN A;  1K73 C;  4RKU E;  4N4G A;  4C8Q B;  2E6N A;  2EJG A;  3OQ5 A;  1QP2 A;  4M77 G;  3CCV T;  3QII A;  4FSX A;  2PVD B;  3JCM J;  3SD4 A;  2K3X A;  3E9G A;  5CQY A;  4M7A E;  1BI2 A;  4IUV A;  3LH0 A;  3JB9 I;  3JCM e;  2JOY A;  2RM4 A;  5GAO q;  1UGS B;  3RMQ A;  5CKH A;  2HNI A;  2G3R A;  4L59 A;  1MHN A;  1YI2 T;  1YI2 A;  4OMF B;  4XQ3 A;  5GAN h;  5GAN d;  2FL7 A;  3TEE A;  5GAO p;  3MET A;  2DTH A;  1K9M C;  1YIT T;  1YIT A;  3EFS A;  4F7U G;  1UGR B;  5CO7 A;  3LGL A;  2RHX A;  2V8K A;  3GLX A;  4N4I A;  1VQ4 T;  1OI1 A;  2DKG A;  1W4S A;  2D0Q B;  2KMT A;  3M59 A;  1VIE A;  1H64 1;  1WPY A;  1M5Q 1;  4MZM A;  3JCM c;  3OS0 A;  3CCR T;  3CCR A;  4C5E A;  1VQM A;  5GMK j;  4RG2 A;  3N5B B;  3OS5 A;  3FJP A;  4ELZ C;  4FT4 A;  4BE2 A;  4XTW A;  5FU7 B;  2VGM A;  3G4S T;  3G4S A;  4E7K A;  4M7D G;  5A0D A;  3NTK A;  5GAO m;  4II1 A;  3WXM B;  2XD0 A;  3CPW A;  3NTI A;  5GAM g;  5GAM j;  3QYH B;  3JCM b;  2QTX A;  4FM4 B;  4OB2 B;  3OSS C;  4Y28 E;  2CGH A;  1Q86 U;  4N4H A;  3RKX A;  4C0D C;  4M75 D;  3CC4 T;  3S3M A;  1X01 A;  1KHC A;  2JVV A;  2E10 A;  4BD3 A;  1I81 A;  4M75 C;  3OYN A;  3G71 A;  2PUK B;  4MDW A;  1HXD A;  1G3S A;  2JTM A;  5CVI A;  2RJF A;  3C94 A;  3GIB A;  1YBY A;  2QQB A;  2VUB A;  2P0P A;  3MP6 A;  1DJ7 B;  3HP9 A;  4OP0 A;  3CCJ T;  3C4S A;  4M75 A;  5A0L A;  4BAC A;  2OTL T;  2OTL A;  4QVZ A;  3RKY A;  2MWP A;  4FT2 A;  1YJ9 T;  1WJR A;  3CPW S;  2XID A;  2R5M A;  4C5G A;  5LJ5 h;  5LJ5 d;  4C8Q G;  4ZN3 A;  1U8R A;  4HCB A;  1XTD A;  4J8O A;  3EFR A;  4JRI A;  4BI4 A;  5I21 A;  3OA6 A;  3CCE T;  3CCE A;  2CZ6 B;  3V8J A;  5IAY A;  3PMI A;  2F5T X;  3HSB A;  4XU2 A;  4F7U A;  3ZBD A;  3OYH A;  5GAN f;  5C0M A;  1BIB A;  2P0K A;  2K4Y A;  3FDR A;  5DM7 R;  1YIJ A;  3M55 A;  4QQD A;  1NE8 A;  1VQ8 T;  2YLC A;  3O8V A;  1K73 U;  3L2Q A;  4RCB A;  4OGE A;  5GAN 7;  2DXT A;  5FRO A;  3OYK A;  5KH6 A;  5FRN A;  1VIF A;  4P5N A;  3C95 A;  3PNW C;  4J7I A;  2RI5 A;  5AYF A;  4M7A G;  2RI3 A;  1BI1 A;  1R8O B;  1O75 A;  2NLU A;  2RHZ A;  2CKK A;  2MMP A;  3SDZ A;  1WJS A;  3PGG A;  4M78 G;  3A8M B;  4HCC A;  2VYT A;  2R57 A;  2RJD A;  1BYM A;  4HT9 A;  1WQ7 A;  1WJQ A;  4JRQ A;  3L2U A;  1KG1 A;  1LOJ A;  2E41 A;  2LTO A;  1N27 A;  3HRS A;  2L89 A;  1KD1 U;  5EG2 A;  1K9M U;  3QZ9 B;  2PQW A;  3WVD B;  3RER A;  5D6Y A;  4L6V 5;  5GAO r;  1VQP A;  1VQP T;  3A8O B;  2WSE E;  1D3B A;  1I8F A;  1FX7 A;  4JLI A;  4QQG A;  2RHU A;  5HY6 A;  4C8Q D;  2OTJ A;  2BUD A;  2MI6 A;  4C8Q C;  3PIP A;  3ME9 A;  2DZC A;  3CCM T;  4A4E A;  1N8R U;  5LJ3 d;  3E19 A;  2K57 A;  2PVO B;  2KK4 A;  3VU3 C;  4ELY C;  2CZ7 B;  1M8V A;  2X35 A;  2L8D A;  2Y4Y A;  2HAX A;  1QVF A;  3P8B B;  4FIB A;  4JRK A;  1VQ7 T;  1VQ7 A;  1M1G A;  4DQ2 A;  3CMA T;  2JTF A;  1HK9 A;  5LJ5 f;  1I4K 1;  2QQ9 A;  4OB3 B;  4R55 A;  3INZ A;  2H3J A;  4EMK C;  2EWN A;  4BI8 B;  4M7A D;  1G5V A;  2DPP B;  2F69 A;  1B34 A;  3CPF A;  3JCM d;  3FEO A;  3I55 T;  3OYL A;  4JJN K;  4A53 A;  4HT8 A;  4M7A C;  4NL3 A;  2E6Z A;  4C92 F;  3QDR B;  2Y4X A;  4PKC C;  3CD6 A;  3CD6 T;  4M78 D;  5IT9 E;  3HRU A;  4M78 C;  1XQH A;  1BKB A;  4LDW A;  4EMK A;  2LT1 A;  4J6Y A;  5KE3 A;  3LWH A;  3CCU A;  2RK1 A;  2EQM A;  3CCU T;  1VQ9 A;  3AHU A;  2QEX A;  2ZPH B;  5GMK e;  1NZ9 A;  1QVF S;  3QKJ A;  1KQ2 A;  5I2M A;  4RMO A;  1VQL A;  4DOV A;  4M78 A;  4XAX B;  4DOW A;  3M58 A;  4N0A C;  4XTX A;  3S3N A;  1NJI U;  4PJO F;  2EQK A;  1KQS A;  1KHI A;  1M1F A;  3R6O A;  1D3B B;  4IKF A;  2XDB A;  2E65 A;  2ZZD A;  4IUP A;  4C92 B;  5GAM e;  3F70 A;  3H8Z A;  1BI3 A;  5GAN 2;  3M5A A;  4N0A A;  3QSU A;  4JS4 A;  4Y91 A;  2ZPB B;  4QQ6 A;  5GMK l;  4B9W A;  5D6W A;  1YHQ T;  1YHQ A;  1X6O A;  3A8G B;  1KD1 C;  4O6J A;  2C06 A;  3L2R A;  3A8H B;  3L2W A;  2EIF A;  1ZQ1 A;  2PUO B;  5CKB A;  1G3W A;  3OYF A;  4LD9 K;  4NS5 A;  4PJO B;  3J80 E;  2X4X A;  3CC7 A;  2XHC A;  3DB4 A;  3RIR A;  1KQS S;  3URG A;  3P8D A;  2XI9 A;  4C0G A;  1VQM T;  3CCQ T;  3CCQ A;  4YTL A;  4PLI A;  1N8R C;  2XDD A;  2LDM A;  1KQ1 A;  1FWZ A;  1B34 B;  1IZ6 A;  2GQV A;  4A54 A;  5LJ3 f;  2EJF A;  3DKM A;  4E7I A;  3OBW A;  3L2Z A;  2ZGW A;  5FU6 C;  1RL2 A;  2DXB A;  3EAE A;  3JAM E;  3SWN B;  3OYA A;  1QVG A;  2RB6 A;  4BY6 C;  5CAI A;  3M53 A;  2RO0 A;  2YLB A;  4M77 D;  4NL2 A;  1AHJ B;  2A3L A;  3PFS A;  2I2L A;  4M77 C;  5GAN 6;  3OS1 A;  3RUX A;  3V7C A;  2QXF A;  3CC2 A;  3OBY A;  3C12 A;  3JCM f;  2K3Y A;  4M77 A;  4XU1 A;  3G71 T;  2KDS A;  2DXU A;  2XIC A;  2VC8 A;  1JBM A;  2XU8 A;  1V29 B;  2MF2 A;  1M1K C;  4ATO A;  4X9C A;  3Q1J A;  3X24 B;  5GAN e;  5GAO l;  4J6W A;  2DEQ A;  1P92 A;  3QXE B;  1QVG S;  4OB1 B;  3FC3 A;  2GF7 A;  2PVG B;  1NJI C;  4LDY A;  3GPL A;  1WNL A;  4Q5W A;  4B9X A;  1LJO A;  4O5V A;  2RJE A;  4MZT A;  4BDZ A;  2QDY B;  2EKO A;  2HQE A;  3HFO A;  3JCM Q;  1PSE A;  1QP3 A;  1YCY A;  4V2S A;  5L8R E;  3UDC A;  3QPH A;  5GAO n;  5M9O A;  4KUI A;  2QQA A;  2FB7 A;  3RES A;  1UEB A;  4OF1 A;  2RK2 A;  4Z02 A;  3V8K A;  2JUF A;  2QQS A;  4C0F A;  3CME T;  3CME A;  5CKF A;  4ZN1 A;  1YJN A;  2K2V A;  3QO3 A;  3T9N A;  1YIJ T;  1S72 A;  3M54 A;  1Q82 C;  1KC8 U;  5GAN 4;  4M7D C;  1Q7Y C;  1VQ6 T;  1VQ6 A;  1LNX A;  4ZGJ B;  2E70 A;  3MEV A;  2O01 E;  2D6F A;  2LC4 A;  4M75 F;  4EPC A;  4R56 A;  3M4Y A;  5CK9 A;  4BE1 A;  2LQK A;  1UB4 A;  4JDS A;  4M7D A;  2QI2 A;  5GAN g;  5GAN j;  2VXF A;  1Q81 U;  3G7Z A;  1RI0 A;  3JB9 J;  4M75 E;  1ZHI A;  2X4J A;  2CYZ B;  2YHT A;  2EQU A;  3I56 A;  2F5K A;  2XKO C;  4BE0 A;  1U1S A;  4J6X A;  1Y96 A;  4F7U F;  3OB9 A;  1N6A A;  2DTO A;  4PLL A;  4C0D B;  5A2Q E;  1JJ2 A;  4C5I A;  4KUD K;  2ZCF B;  4MZP A;  3A8L B;  3HFN A;  4XK8 E;  3CXC A;  5KCH A;  3BFM A;  4M75 B;  3JCM V;  3J81 E;  1KC8 C;  3MEU A;  4F7U E;  2ZPF B;  2OTJ T;  1UGQ B;  2B8A A;  5LJ5 e;  2M16 A;  3OYB A;  2PU9 B;  3GF5 A;  2GFA A;  4VUB A;  3S3O A;  4NOY A;  5LJ3 h;  2DTI A;  4XTZ A;  4BI3 A;  4EMH A;  2LNV A;  1FXX A;  4C8Q A;  4F7U B;  2IVW A;  4OVA A;  2LCC A;  3LLR A;  3MCA B;  3WVE B;  3HPW A;  1M4Z A;  2JZ2 A;  3VKI A;  3X26 B;  2E1H A;  5A0G A;  2AHJ B;  2IG0 A;  3JCM P;  1IRE B;  4LDV A;  4OGC A;  1JB0 E;  4C5H A;  4EMG A;  2FYK A;  5CKD A;  1JJ2 S;  3CC2 T;  3MO8 A;  4UC4 A;  3CXC S;  3DLL A;  4OB0 B;  3VUB A;  3TCJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...