1VQ4Q

The structure of the transition state analogue "daa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 20
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1vq4Q00
1K9MR 3CD6Q 1Q86R 1YHQQ 3CXCP 1M1KR 3I55Q 3CCLQ 3CCSQ 3CC2Q 1VQOQ 1S72Q 3CC7Q 1VQ4Q 1VQNQ 1Q7YR 3CC4Q 3OW2P 3CMEQ 1KC8R 1NJIR 1VQ7Q 3G6EQ 2QA4Q 1K73R 1YJ9Q 1M90R 3CCEQ 3CPWP 1VQ5Q 1QVFP 3CCRQ 1VQMQ 3CCJQ 1VQ6Q 1YI2Q 3G71Q 1YIJQ 3G4SQ 1VQ8Q 1VQ9Q 1VQPQ 3CCUQ 1W2BP 1N8RR 2OTLQ 2OTJQ 1Q81R 1YJWQ 1KD1R 1K8AR 1JJ2P 1VQLQ 3CMAQ 1KQSP 3CCQQ 3CCVQ 3I56Q 1QVGP 1VQKQ 2QEXQ 1YITQ 1YJNQ 3CCMQ 1Q82R
chains in the Genus database with same CATH superfamily
3JCMV 1YJNA 2BE7D 3HKSA 4M7DD 5GAMf 1WXBA 1JEGA 2DL5A 2CZ7B 3BE3A 2L5QA 4AFQC 2BZYA 2RA2A 5GMKh 4AG2C 3CCRA 1M30A 4LN2A 4ME7A 2AHJB 4MDWA 3SDZA 1K9MC 3CCSQ 4IUVA 2GNCA 2YUNA 1VQNQ 3I55A 3CCST 3BDUA 5KYWB 1VQNT 3ASKA 5GJWB 3JB9F 3VS4A 4GBQA 2HKNA 2DXUA 4PJOD 2IVWA 1RI0A 2X3WD 4L59A 4BY6B 1LCKA 1X6BA 1G3SA 3C12A 3FLGA 3HSBA 3VS6A 2J6FA 1M1KU 2KRNA 3A8GB 2M0YA 3MO8A 4PJOE 2CP0A 1UFFA 3CC4A 2E3HA 2JW4A 4OVAA 3FJPA 2DK3A 3MCAB 1YI2Q 3R6NA 1M27C 1TUCA 1YI2T 1OU9A 1Q81R 4DBQA 3PVQA 2X4JA 1QKXA 3E1SA 5C0MA 1BI2A 2K3BA 5KYUA 1OX8A 2RJEA 2KBTA 3VS1A 3NPFA 4LXCA 2IIMA 4XTYA 1GCQC 1D09B 1MNDA 2I2LA 4N0AC 2XDDA 4FSXA 5GAN2 3G7ZA 1I1JA 5CO7A 3BY7A 2EGEA 1SG5A 2GTJA 2DIQA 3GP8A 1NJIC 4C0DB 4JLGA 3NMZC 3WVEB 2E65A 4FU6A 3A5ZB 1NYGA 3CMEQ 1K73U 3H0FA 3G6EQ 3CMET 1K0XA 1QVPA 4DEXA 3G6ET 4MMLA 3MHXA 2BKDN 2NWMA 4M75A 2KYBA 2E5QA 1AEYA 2BZXA 4QW2A 1OPLA 3U23A 3HP9A 3JAME 4N4IA 3LWHA 2CZ1B 2QYZA 3VJPA 4A4GA 2IPOB 3X26B 1YJ9Q 3QYGB 4AG1C 3TSWA 1D0XA 1YJ9T 1S1NA 3CCJQ 2DNUA 4ZN3A 3CCJT 4E7SA 2OTLQ 1KD1R 2E12A 1QQJA 2RQTA 3CCUA 3CCVQ 2OTLT 2CP7A 3MEAA 3PMIA 2O31A 2KAFA 3CCVT 5GANd 4M7DC 3V7CA 1OPKA 3L2RA 2EFIA 2QQBA 4M7DG 3GOXA 5HK3A 3WVDB 4GLMA 4C92A 5GANj 2KI7A 2DIGA 4KH1B 5LJ3j 3QG1A 4EMKB 5CVIA 1VQLQ 4EIKA 5FU6B 3FEOA 1UGPB 2K5LA 1VQLT 2E10A 2D6FA 4XTZA 1SF9A 2D0NA 4CI0C 1EFNA 1M1KC 2JNGA 2V8JA 2YRVA 2LX9A 1XQHA 2LJ3A 3ZL7C 1ARKA 4BD3A 1VQ5A 2EJFA 4KBMB 2LZ6B 2V8IA 1W6XA 4PJOG 2MCNA 3VRZA 1NG2A 1QVGS 2JM8A 3A8OB 1V76A 3OYBA 2V1RA 5A0LA 2DAQA 4OB2B 1G8XA 1QP2A 3PIOA 2DRKA 3EG9A 1OV3A 1QMCA 2Y4XA 2CUBA 1M90R 2FZCB 3T9NA 1M2VB 4X9DA 2HBPA 2KNBB 2VV5A 1MMAA 2JXBA 2DZ9A 3A8HB 6AT1B 4RUGA 1VQPQ 5GAN4 2SRCA 1VQPT 3M0TA 4JPBW 3M4GA 5L8RE 4NOYA 4BY6C 1Q82R 2RK2A 3JSCA 1M8MA 2DTOA 1X75C 4OMNA 2ZPGB 1RADB 3NTIA 4PLIA 3SFMA 1M8VA 2FZGB 3CBOA 4HCCA 4KT0E 3CPWP 1W4SA 3EGXA 4LDYA 2M9UA 4C92F 2XDPA 1VIFA 1N9SA 2HAXA 2D9TA 3RMSA 1UG1A 2CKKA 1UHCA 2D8HA 2E70A 4XU1A 5IHNA 2CDTA 5KYXA 2VYTA 3MJXA 1G83A 3CD6A 1Y96A 2EAYA 1K9AA 3MKDA 1OX9A 2DKGA 3JCMb 5GANg 1PKSA 4PK4A 2LTOA 5LJ3g 1BB9A 1EIFA 3HL8A 3G71Q 2CUDA 3X20B 1R77A 1JXMA 3G71T 1WQWA 3RKXA 5GAN6 1OZ2A 1I5OB 2EYXA 4KGXB 3PFSA 3I9QA 4HCBA 4Z88A 4M77A 1Y71A 4LDXA 2P0KA 1WX6A 4C0DC 4Z89A 3L2QA 4HKEA 2E64A 1QVFS 1KJWA 3J81E 1XTDA 2C0TA 1IRXA 3AT1B 2O4XB 2RHUA 4C0FA 1WFWA 4PLLA 4C5GA 3RERA 3QJYA 1ZBXA 2QDLA 4XTXA 4JUVA 3QSUA 4C8QA 3CC2Q 2XMFA 4CRIA 2QGGA 2P4RA 1K73R 3JCMc 2DL7A 5LJ3h 3FC3A 1W2BS 2ZGWA 4B9XA 4FYXB 3I5SA 3OYCA 1JJ2A 2K5FA 2YRDA 3PTAA 1WA7A 4PL6A 3SD4A 4M7AA 3SB2A 2KR3A 2GFUA 1KC8U 2DEUA 3I35A 1Q7YR 3JCMX 3MP1A 1IO6A 3SWNB 1X6OA 2GF7A 2MAMA 4L6V5 3CQTA 2EQUA 4ZTFA 1C0MA 2EYYA 4F7UA 2DX1A 3SEMA 4FT4A 1Y0MA 2KDSA 1B07A 1ZBJA 1I5LA 2WSCE 2VWFA 4EMKC 1JU5C 3JCMJ 3THKA 5A2QE 4M78B 4C5IA 4MZTA 1YHQQ 3H8ZA 5FU6C 4BE2A 3LH5A 2LC4A 3GIBA 1YHQT 3VRYA 2SEMA 5FRMA 1M3BA 2MIOA 2KRSA 4LDUA 3JB9I 4HT9A 2RO0A 4IUUA 1T0JA 2CP6A 1MMNA 3G4ST 2K2MA 3OYEA 2L3QA 3JCMf 2OAUA 1UGRB 3JCMP 2JTFA 3EG2A 2P4TA 2F2VA 3M56A 2R5MA 4E7IA 2DM1A 5IHIA 4M78D 1QVFP 4Y91A 1XJWB 4IKFA 4HT8A 1OOTA 1VQ6A 4BUGA 4E7KA 3REBB 3S3OA 2AKKA 1U1TA 3OYLA 2LCCA 2JM9A 3CMAA 2L3SA 4M7AF 4IUTA 2DD4A 2CP5A 1M9SA 3QJ6A 4AMCA 3L2WA 3OYIA 1SSFA 3JB9H 3EG3A 4FYVB 4F7UF 3OBWA 3V8JA 3M4YA 1Y7XA 4ATOA 1KQSP 3M53A 5GMKe 1WXTA 3G1JA 3EG0A 2GQIA 4QVZA 2PVGB 1FMKA 3CBPA 2KT8A 2JOYA 2H3EB 1KK7A 2EJ9A 4K11A 3CCRQ 1WHLA 1PRMC 3CCRT 4LDWA 4MDXA 1TH7A 1AZEA 1YJWQ 3NTKA 4RTYA 1YJWT 4OMQA 4HVVA 2L8DA 4A54A 2RN8A 1UUEA 3I55Q 1AWOA 1MV0B 2FZKB 3I55T 3OW2P 1SHFA 3OS0A 2OI3A 3MPUB 2L0AA 3L1AA 1E7OA 2M16A 1IHVA 4J6YA 2NUPA 1GFDA 2XD0A 1YIJA 2JT4A 1K1ZA 1Q86U 2D1XA 1D1BA 4O5VA 1ZUKA 3M55A 2FRYA 3CC4Q 4FSSA 3CC4T 3JB9D 2RQUA 5GAMj 3RMQA 2M51A 4N4HA 4N0AA 4XTWA 2R58A 4BE1A 2YRCA 2HZYA 4HVWA 2VB6A 1G5VA 5CKHA 2ROLA 2RHZA 2MK5A 4XTVA 5M9OA 1T3LA 3CC7Q 3CC7T 1Z9ZA 1WIEA 4J6XA 5KCHA 4NS5A 2D0QB 5CK9A 3SHWA 1OEBA 3SWNC 4RG2A 2RJDA 3PNWC 2RQWA 2QTXA 1D0ZA 1Q81C 1H3ZA 1UECA 3H0IA 3UPUA 3LW5E 3GLXA 4QVCA 3CXCP 3RUXA 1UJYA 1GL5A 4PJOB 2O2OA 1KC8R 5GAOq 5CKBA 1M90U 3TCJA 1RAAB 3VUZA 2LJ1A 4LDVA 4JDSA 5I11A 4M78G 2NUTA 3LLRA 3EGDA 2HQXA 1LOJA 4F17A 2HSEB 2DTHA 2YSQA 3RR6A 1QVGA 1SSHA 2QGFB 3C4SA 1Q82U 4M7DA 3QYHB 5GAOr 2EKOA 4O6JA 3CCLA 5D6YA 9ATCB 1I81A 1SKUB 2NLUA 1U1SA 1MMGA 1N8RU 2VVKA 4A4HA 2W10A 3CCUQ 2M1HA 2A36A 3CCUT 2IG0A 1UHFA 4AFUC 1WHJA 3CCMA 3VS3A 2D8JA 1NM7A 1DJ7B 1OQKA 5GAMg 4PJOA 1HXDA 2A08A 2GQVA 3ER0A 3OYFA 2HEQA 1K8AU 3S6WA 1KD1C 3EHQA 1M1FA 3Q1JA 1QLYA 2X4WA 4LNPA 5KH6A 2JUFA 5CKDA 2P0PA 2C0IA 4IUPA 5GAN7 4J9FA 3PVLA 1RLQC 1WGSA 1TXQA 2L2PA 2X51A 3M59A 5GAOl 3OYNA 5KYWA 1GXIE 2R57A 4FL6A 1QW1A 3F70A 2YXYA 1IXDA 2KY9A 2L3PA 4E47A 1M1GA 4CC7A 2HSPA 7AT1B 1D3BB 8AT1B 1NE8A 3NHNA 5DY9A 1N9RA 2EQIA 2R5AA 1B3QA 1ZX6A 1ZSZB 2HQHA 5GAMh 2O9VA 1QVFA 2ATCB 4Z02A 3JB9G 2CH4A 3OYKA 2CGHA 2YDLA 1T0HA 2OTJA 1NBEB 2LNVA 3I56A 2XICA 5I2SA 1Q7YU 3E19A 2NYSA 1U8RA 4LD9K 5I21A 3GNGA 2JTMA 3CPWS 4Y28E 1AHJB 4M75E 2K6DA 2K9GA 1M90C 3OY9A 4RTZA 1W2BA 2LNHB 3QXEB 4PJNA 4J9BA 4GY5A 4WF2A 3M58A 2QTVA 1PSEA 1G3WA 1BYMA 1IB8A 1R0BG 3CD6Q 1Q86R 1Q82C 2ZPEB 2LDMA 3CD6T 5LJ3d 5ECAA 4JJCA 3UA6A 4EDUA 4MZMA 1S72A 3N5BB 1RAIB 2RHYA 3H0HA 1ZSGA 2YWWA 1TS9A 2VXFA 2LQNA 2X4YA 1AWXA 2XIDA 4KGVB 4QQ6A 2RJFA 3RKWA 1NEGA 5D6XA 2QASA 2OX7A 1Y57A 1RLPC 2DBKA 2A28A 5CIUA 1AD5A 3D7SB 4C92E 1IGUA 4X9CA 2O88A 4PJOC 4RTVA 5J3BA 2FHDA 3CCEA 4RMOA 2DL3A 3MP6A 2K7AA 3RESA 2VXEA 3H9NA 2RQVA 5GANe 4M75F 4YTLA 5LJ3e 2F5KA 2VUBA 1YWPA 1VQKA 2COWA 2O01E 4ELYC 2EGCA 3S3MA 1E6HA 1MNEA 2DF6A 5IT9E 4JLIA 3OYMA 4JS4A 1N6AA 5DLOA 2V26A 1HYOA 1BKBA 2CP3A 1RAEB 5I22A 5CCAA 4R0KA 2RI2A 1E6GA 2PUKB 1X2KA 1X6GA 3EGUA 4EMKA 1YN8A 2J7IA 2LCSA 2CSIA 2RD1A 3WXMB 3JB9J 4NL3A 1PKTA 2CYZB 1HK9A 3G6EA 5IH2A 1K73C 4EPCA 5LJ5j 2F5TX 3L2VA 1NLOC 2DEQA 1N8RR 3J7AF 1EZZB 4J9EA 1MV3A 2RHXA 1HJDA 2MPXC 1YITA 2KE9A 2YLCA 4HCZA 2LT1A 4OF1A 4OB1B 4IIOA 2JZ2A 1UGVA 1CKBA 3MEWA 1BI1A 5FWCA 3S3NA 2NUZA 3M0UA 4F04B 1Q7YC 1VQ4A 2LVMA 1YJ9A 2X35A 4VUBA 3J80E 1BIAA 3OMCA 5HKCA 3OS1A 1K76A 1M2VA 2HMAA 1K8AR 4AT1B 2OTLA 1GFCA 1Y07A 3CCVA 4PFZA 2F1LA 1WYXA 2MWOA 4V2SA 2VGNA 4OGCA 4FCYA 5LJ5f 1IGQA 1V29B 2AKLA 1X01A 2I0NA 4XTUA 1YP5A 2KGTA 3VUBA 3OMGA 4LUEA 2K79A 2YUOA 1VQ6Q 1G3YA 1ZSZC 1VQ6T 3MP8A 1VQMA 1BCMA 1JQQA 2PUOB 2AZSA 2RI5A 3CMAQ 4JJDA 2W0ZA 3LYIA 2QEXQ 4OMMA 4UC4A 3CMAT 1UGSB 3EFSA 4M77E 2PNIA 3HRUA 4JRQA 3E9GA 2QEXT 3VU3C 5DM7R 1GBRA 1X43A 5J26A 3E9FA 2EWNA 2ROTA 3CC2T 3JV3A 3KUFA 2HBWA 3QKJA 4NL2A 4XU3A 2E41A 2RHIA 1VYTA 1KQSS 2LQWA 1AT1B 1TU0B 2KXCA 4C8QE 2KXDA 1XNIA 3CCQA 3META 1PHTA 4DA4A 4XAXB 3VS2A 5HCKA 1JBMA 4IUQA 4E6RA 3P8BB 3P8HA 4FM4B 3V8LA 4RCCA 4R55A 1YCYA 3TEEA 1AWJA 4DBFA 1H3HA 4M7AE 2ZAEA 2EBPA 3X25B 2O9SA 1LVKA 2O4XA 4FT2A 1PG5B 4PJJA 3ME9A 3FDRA 3OW2S 5CQXA 2YLBA 5GAN5 2H3JA 4OB0B 4M77F 4F7UE 2RB6A 3L42A 4ORZA 1WHGA 5FRNA 1J3TA 1YIJQ 2FEIA 5IXBA 2K3XA 5GMKm 1PD1A 1YIJT 3EFOB 3RIRA 1OZ3A 2CP2A 2K2VA 3QUIA 2FRWA 3JRZA 1ZLMA 1TUGB 3VYHB 5KE2A 2XHCA 1N5ZA 3DB4A 4Z8AA 4C5HA 4CC4B 1VUBA 4DEYA 2XG8D 4C8QF 2K57A 5KYYB 5LJ5h 4ZNXA 3SWNA 2DMOA 2FO0A 3L2ZA 4HXJA 3QDFA 3G71A 1I0CA 3UT1A 1ZA2B 2MF2A 2FG0A 1I8FA 2KK4A 1SPKA 4KUDK 1H8KA 2DILA 1IZ6A 4M78A 5D6WA 5I2MA 4XU2A 1PD0A 2GCXA 1BU1A 3EG1A 1NYFA 3V7SA 1WLPB 2F2WA 3HTRA 2EQKA 2VGMA 1ZUUA 2COZA 1TSFA 1FX7A 1YJNQ 1YFNA 4J9IA 3CXCS 2ENMA 3JCMg 1YJNT 4DBRA 2BIVA 4JZ3A 2YT6A 2EQJA 2FVUA 5GAOm 1U06A 1NPRA 2PVOB 1M4ZA 4P5NA 1RAGB 1QWFA 2EJGA 1VQ9A 1ACMB 2EPDA 5KCOA 4PJMA 2RI3A 3PIPA 3GNFB 2C06A 2FYKA 2XU8A 4II1A 2ED1A 3DKMA 2JS0A 1RABB 2CT3A 2XDBA 2OAWA 2EYZA 1VQOA 1X2QA 1KC8C 1G3TA 2VC8A 3M0PA 4N4GA 3VKIA 3HRTA 4ZGDB 1QCNA 2DERA 1BCOA 3NTHA 2A7YA 2DO3A 2RMOA 4J6WA 5HY6A 3OSSC 2DL4A 2QQ9A 3CCMQ 4KRTA 2EW3A 2QDYB 3PT9A 5GAMd 2QAZA 3CCMT 2PQWA 2LMJA 3JCMh 2KQWA 1T3SA 2M02A 3M5AA 4M7AG 2MYSA 2EIFA 4BB7A 3EAEA 2WSEE 3QHSA 2E4HA 3CPWA 2YHTA 2QA4A 4E7ZA 4Y92A 1FMVA 1M5Q1 3CEYA 4DBHA 3G4SA 3OS5A 4M4ZA 2G6FX 1QP3A 2DVEA 4B9WA 2J6OA 2HNIA 2FPEA 3OSVA 1WI7A 2DXCA 4J9GA 3URGA 2J6KA 2CSQA 4ZGEB 4KH0B 2HL5C 1SRLA 4FYWB 4JS5A 3QO3A 5GAMe 3I5RA 2BE9B 4AFSC 2KROA 3JCMQ 1MHNA 3P8DA 3OA6A 4KGZB 5A0DA 2BUDA 1KG1A 1VOMA 4KUIA 3PGGA 2Y90A 4A4EA 3OYDA 4M78C 1LJOA 1QWEA 2DRMA 2AIRB 2LT4A 4J83A 2GBQA 2WACA 4J7IA 3AHUA 1CSKA 1JO8A 2DD5A 1VYUA 2DL8A 4CC3A 5GMKl 2JJ9A 2QG9B 2OTJQ 1GCPA 3H6ZA 2HL3A 2OTJT 3MEUA 3I56Q 1O75A 3I56T 2ECZA 1OYXA 1QKWA 2JMCA 4AFZC 1AZGB 2DXTA 2EYQA 4RTXA 4OP0A 3EHRA 1KHIA 1FMWA 2QQRA 4M7DE 1YJWA 3QDRB 2YUQA 1YNZA 2QQSA 3FJ5A 5KYUB 1MMDA 2ZZDA 4HCKA 1S72Q 2EKHA 2DYIA 1S72T 3HFNA 1OU8A 2RK1A 1VQ7A 4R56A 1RACB 3VS0A 3QZ5B 3M9QA 4C0ZA 4EMHA 5IXFA 3ZEHA 3REAB 3H41A 5CAIA 3QZ9B 1Q86C 2QQAA 2ZCFB 2Y4YA 3M0RA 2H8HA 4ELZC 4M75B 3TU4K 3CCEQ 1VQ5Q 1YWOA 3CCET 1I4K1 1VQ5T 2WSFE 1NZ9A 1ZQ1A 3HRSA 1QCOA 3LGFA 2PU9B 4OMLA 1JJ2P 1VQ8A 1GBQA 5CKFA 1JB0E 1VQKQ 2DE0X 3TVTA 3JCMW 1X27A 1VA7A 1VQKT 4A4FA 2C0OA 3TREA 1WPYA 2JTEA 5HK0A 4M7DF 3CC7A 5FLXE 4A53A 3HFOA 3EH2A 1ZHIA 4OB3B 4JRPA 4DQ2A 1HSQA 4ZGJB 4BDZA 2E1HA 2FPDA 4KULA 4LUDA 4WCIA 3QIIA 2CH4W 1FXXA 2DZCA 1NPPA 2QI2A 2MOXA 2LQKA 1X69A 4M75D 5CR2A 3BDLA 4PNOA 1V1CA 1K9MR 1D1CA 2DJZA 3RBBB 4BDYA 4QVDA 2FPFA 3BW1A 2VASA 4D6WA 5IHKA 4C92B 1WNLA 5AT1B 1C6VX 1KFZA 1FWZA 1I07A 5KE3A 4RCBA 1OULA 4PJOF 4F16A 2CZ6B 2DJQA 2JS2A 1KQSA 2QXFA 3M54A 3NFCA 1YITQ 4A4KA 3FB9A 1YITT 2KVQG 1TG0A 3KBGA 1D3BA 1FYNA 1VQ4Q 3ZBDA 3CCSA 1VQ4T 1PCXA 1EX4A 1VQNA 2RF0A 2DVJA 1ABQA 1GRIA 1SEMA 1MGQA 4OGEA 3OYYA 3A8MB 1ZSZA 2CT4A 2B86A 2LCLA 4C92D 1XOVA 1N8RC 2RPNA 5GAOp 3VS7A 5EC7A 1B34B 3EG9B 2Z0WA 4L5GA 3KFVA 4IIMA 3OW2A 4PKCC 1F1BB 3E2UA 4QKUA 2L3RA 1SHGA 2ZPBB 2M0OA 3PE0A 1VQMQ 1QCFA 3LWIA 3VV0A 1VQMT 3VS5A 2YUPA 4BACA 1YI2A 3A1PA 3LX7A 5GAN3 3O5ZA 2AZVA 1K8AC 1NJIR 1PNJA 2XI9A 2DTIA 1M2OA 2PZ1A 2P0QA 4ESRA 1YCSB 4JRKA 4J8OA 3EGXB 3QWYA 2GGRA 4FIBA 2LP5A 1AWWA 3TQ7P 1BI0A 3CCQQ 5KYXB 5A0GA 3CCQT 1Y96B 2VKNA 5LJ5d 1RAFB 4RTWA 1B34A 2LRQA 2V1QA 4EMGA 5GANf 3EH1A 5GJVB 5LJ3f 3CMEA 2DETA 1ABOA 4XK8E 1RL2A 4E7HA 4E7JA 1VYVA 3RKYA 1WJSA 4J9CA 2P84A 3OYJA 4J5YA 5FW9A 4E7LA 4J7FA 4M77B 2GTOA 3OYAA 3CXCA 2KYMA 2ZPHB 2GFAA 2DYBA 1RI9A 4C0GA 1M3CA 4ZN1A 4OMFB 2KSSA 5CQYA 2KMTA 4RTUA 4WTOB 2X9HA 4XU0A 4M75C 3CCJA 1LPLA 1H641 2RM4A 5LJ5e 3IQLA 3FIFA 3QBYA 4C8QB 4M75G 5C6SA 1SRMA 2E3IA 3M0QA 1M1KR 4RKUE 4MMKA 4FW1A 2QK0A 4M77D 3R6OA 4ANJA 1Q95G 2EVRA 2EQMA 1BBZA 1H92A 4M7AB 3EFRA 4OMPA 1C1AA 4ZTJA 3C95A 1VQLA 3UF4A 1U5SA 1CKAA 5FU7B 4DOWA 1TUDA 1VIEA 2HKQB 3QPHA 1N27A 2X4XA 1WXUA 1JXOA 2JVVA 4C8QD 4F7UB 1RAHB 3A98A 4DOVA 3OYGA 1IHWA 2BZ8A 4C92C 4BE0A 2F2XA 2RQRA 4GLKA 2HCKA 3OB9A 3JCMd 1BK2A 5J39A 1PC0A 4C92G 2LQ8A 2PVDB 1QVGP 4BI4A 4PJLA 4JRIA 3OS2A 2K5IA 4M7AD 1UE9A 2E6ZA 4QT7A 3VYGA 3BFMA 4BI3A 1W1FA 1JRIA 5GANh 5LJ5g 8ATCB 5GAOn 2DXBA 3C0CA 2PTKA 1VQ9Q 2ZPIB 1VQ9T 4F14A 1VQPA 3QWXX 4LD6A 5GAN8 2MMPA 3OBYA 4QQDA 1VQOQ 3LH0A 1U3OA 2MI6A 5GMKi 2V8KA 1VQOT 4J9HA 3UWNA 4RTTA 3JCMe 3GBQA 3NGPA 1PRLC 4X1VA 1WQ7A 2X3XD 2ZPFB 3GPLA 2XK0A 3ZFJA 1PSFA 4JZ4A 3L2UA 4TVRA 4X34A 3GF5A 1IREB 2A37A 2JN0A 3HHTB 4MZPA 2B8AA 3CPFA 4B6MA 2QA4Q 4Q5WA 1HD3A 5AYFA 5LL6S 2QA4T 1UB4A 2J06A 2KRMA 4A63B 5FROA 3G4SQ 2RH2A 3LGLA 1D1AA 1TTHB 1W70A 4BI8B 4OMOA 1WJRA 4JJBA 1M3AA 4IURA 2LJ0A 2EGAA 3M57A 3V7RA 3ULRB 1LNXA 1WHKA 5EG2A 1NLPC 1Z9QA 4LE9A 2HDAA 2AK5A 2A0FB 5GMKj 1Q81U 1UEBA 5KYNA 4FYYB 2F69A 3DB3A 1G2BA 5IN1A 1BIBA 3O8VA 1PM3A 3C94A 2QEXA 3EFOA 1RUWA 4M78E 1OI1A 4M77C 3MEVA 2NUPB 3CC2A 2EYWA 2DLPA 2HD0A 4M77G 4D8DA 2DPPB 2MWPA 2AT1B 5KYYA 1K4US 4JJNK 3X24B 4E2FB 2RNAA 1W2BP 1UTIA 3FRNA 2DFUA 3X28B 1K9MU 1P92A 2KEAA 1R0CB 4C8QC 3CCLQ 1KQ2A 1KQ1A 1UDLA 3CCLT 2FL7A 1ZUYA 3RDVA 2KT1A 2LX7A 1ZA1B 4C8QG 4HVUA 4FW2A 2XKOC 3OYHA 2K3YA 1TOVA 3OQ5A 4HA8A 1BI3A 3A8LB 2E6NA 2CREA 1AVZC 1D0YA 2ABLA 4M7AC 2DA9A 1KIKA 1WJQA 1WHMA 3DLLA 3TSZA 1YHQA 5FU7C 2DBMA 2J05A 1VQ7Q 2OJ2A 5DLQE 1R8OB 1VQ7T 4M78F 1K0SA 2CZ0B 1TWBA 3UDCA 2A3LA 3HPWA 1KD1U 1MUZA 1YBYA 1A0NB 2L89A 2CS7A 2ED0A 4F7UG 3KXTA 3INZA 3DLMA 5FWBA 3UATA 3M0SA 2K4YA 3V8KA 2E5KA 1UGQB 2JMAA 2NUTB 2COYA 1KHCA 4PFOA 3EGDB 4D8KA 1GCQA 4C5EA 1KSWA 1WDXA 2RJCA 1VQ8Q 3UA7A 1PWTA 1JJ2S 1VQ8T 4M7DB 1UJ0A 4CC2A 2FB7A 1NJIU 5L23A 2G3RA 1NEBA 1AOJA 5CKEA 3PMTA 2BTTA 4XQ3A 5IAYA 3CBMA 4RG8A 2ESWA 5D7UA 3RNJA 4PFPA 4J9DA 1WZOA 4QQGA 2HQEA 1B7TA 1O9SA 1WHHA
chains in the Genus database with same CATH topology
1K9MR 3CD6Q 1Q86R 1YHQQ 3CXCP 1M1KR 3I55Q 3CCLQ 3CCSQ 3CC2Q 1VQOQ 1S72Q 3CC7Q 1VQ4Q 1VQNQ 1Q7YR 3CC4Q 3OW2P 3CMEQ 1KC8R 1NJIR 1VQ7Q 3G6EQ 2QA4Q 1K73R 1YJ9Q 1M90R 3CCEQ 3CPWP 1VQ5Q 1QVFP 3CCRQ 1VQMQ 3CCJQ 1VQ6Q 1YI2Q 3G71Q 1YIJQ 3G4SQ 1VQ8Q 1VQ9Q 1VQPQ 3CCUQ 1W2BP 1N8RR 2OTLQ 2OTJQ 1Q81R 1YJWQ 1KD1R 1K8AR 1JJ2P 1VQLQ 3CMAQ 1KQSP 3CCQQ 3CCVQ 3I56Q 1QVGP 1VQKQ 2QEXQ 1YITQ 1YJNQ 3CCMQ 1Q82R
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K9M R;  3CD6 Q;  1Q86 R;  1YHQ Q;  3CXC P;  1M1K R;  3I55 Q;  3CCL Q;  3CCS Q;  3CC2 Q;  1VQO Q;  1S72 Q;  3CC7 Q;  1VQ4 Q;  1VQN Q;  1Q7Y R;  3CC4 Q;  3OW2 P;  3CME Q;  1KC8 R;  1NJI R;  1VQ7 Q;  3G6E Q;  2QA4 Q;  1K73 R;  1YJ9 Q;  1M90 R;  3CCE Q;  3CPW P;  1VQ5 Q;  1QVF P;  3CCR Q;  1VQM Q;  3CCJ Q;  1VQ6 Q;  1YI2 Q;  3G71 Q;  1YIJ Q;  3G4S Q;  1VQ8 Q;  1VQ9 Q;  1VQP Q;  3CCU Q;  1W2B P;  1N8R R;  2OTL Q;  2OTJ Q;  1Q81 R;  1YJW Q;  1KD1 R;  1K8A R;  1JJ2 P;  1VQL Q;  3CMA Q;  1KQS P;  3CCQ Q;  3CCV Q;  3I56 Q;  1QVG P;  1VQK Q;  2QEX Q;  1YIT Q;  1YJN Q;  3CCM Q;  1Q82 R; 
#chains in the Genus database with same CATH topology
 3JCM V;  1YJN A;  2BE7 D;  3HKS A;  4M7D D;  5GAM f;  1WXB A;  1JEG A;  2DL5 A;  2CZ7 B;  3BE3 A;  2L5Q A;  4AFQ C;  2BZY A;  2RA2 A;  5GMK h;  4AG2 C;  3CCR A;  1M30 A;  4LN2 A;  4ME7 A;  2AHJ B;  4MDW A;  3SDZ A;  1K9M C;  3CCS Q;  4IUV A;  2GNC A;  2YUN A;  1VQN Q;  3I55 A;  3CCS T;  3BDU A;  5KYW B;  1VQN T;  3ASK A;  5GJW B;  3JB9 F;  3VS4 A;  4GBQ A;  2HKN A;  2DXU A;  4PJO D;  2IVW A;  1RI0 A;  2X3W D;  4L59 A;  4BY6 B;  1LCK A;  1X6B A;  1G3S A;  3C12 A;  3FLG A;  3HSB A;  3VS6 A;  2J6F A;  1M1K U;  2KRN A;  3A8G B;  2M0Y A;  3MO8 A;  4PJO E;  2CP0 A;  1UFF A;  3CC4 A;  2E3H A;  2JW4 A;  4OVA A;  3FJP A;  2DK3 A;  3MCA B;  1YI2 Q;  3R6N A;  1M27 C;  1TUC A;  1YI2 T;  1OU9 A;  1Q81 R;  4DBQ A;  3PVQ A;  2X4J A;  1QKX A;  3E1S A;  5C0M A;  1BI2 A;  2K3B A;  5KYU A;  1OX8 A;  2RJE A;  2KBT A;  3VS1 A;  3NPF A;  4LXC A;  2IIM A;  4XTY A;  1GCQ C;  1D09 B;  1MND A;  2I2L A;  4N0A C;  2XDD A;  4FSX A;  5GAN 2;  3G7Z A;  1I1J A;  5CO7 A;  3BY7 A;  2EGE A;  1SG5 A;  2GTJ A;  2DIQ A;  3GP8 A;  1NJI C;  4C0D B;  4JLG A;  3NMZ C;  3WVE B;  2E65 A;  4FU6 A;  3A5Z B;  1NYG A;  3CME Q;  1K73 U;  3H0F A;  3G6E Q;  3CME T;  1K0X A;  1QVP A;  4DEX A;  3G6E T;  4MML A;  3MHX A;  2BKD N;  2NWM A;  4M75 A;  2KYB A;  2E5Q A;  1AEY A;  2BZX A;  4QW2 A;  1OPL A;  3U23 A;  3HP9 A;  3JAM E;  4N4I A;  3LWH A;  2CZ1 B;  2QYZ A;  3VJP A;  4A4G A;  2IPO B;  3X26 B;  1YJ9 Q;  3QYG B;  4AG1 C;  3TSW A;  1D0X A;  1YJ9 T;  1S1N A;  3CCJ Q;  2DNU A;  4ZN3 A;  3CCJ T;  4E7S A;  2OTL Q;  1KD1 R;  2E12 A;  1QQJ A;  2RQT A;  3CCU A;  3CCV Q;  2OTL T;  2CP7 A;  3MEA A;  3PMI A;  2O31 A;  2KAF A;  3CCV T;  5GAN d;  4M7D C;  3V7C A;  1OPK A;  3L2R A;  2EFI A;  2QQB A;  4M7D G;  3GOX A;  5HK3 A;  3WVD B;  4GLM A;  4C92 A;  5GAN j;  2KI7 A;  2DIG A;  4KH1 B;  5LJ3 j;  3QG1 A;  4EMK B;  5CVI A;  1VQL Q;  4EIK A;  5FU6 B;  3FEO A;  1UGP B;  2K5L A;  1VQL T;  2E10 A;  2D6F A;  4XTZ A;  1SF9 A;  2D0N A;  4CI0 C;  1EFN A;  1M1K C;  2JNG A;  2V8J A;  2YRV A;  2LX9 A;  1XQH A;  2LJ3 A;  3ZL7 C;  1ARK A;  4BD3 A;  1VQ5 A;  2EJF A;  4KBM B;  2LZ6 B;  2V8I A;  1W6X A;  4PJO G;  2MCN A;  3VRZ A;  1NG2 A;  1QVG S;  2JM8 A;  3A8O B;  1V76 A;  3OYB A;  2V1R A;  5A0L A;  2DAQ A;  4OB2 B;  1G8X A;  1QP2 A;  3PIO A;  2DRK A;  3EG9 A;  1OV3 A;  1QMC A;  2Y4X A;  2CUB A;  1M90 R;  2FZC B;  3T9N A;  1M2V B;  4X9D A;  2HBP A;  2KNB B;  2VV5 A;  1MMA A;  2JXB A;  2DZ9 A;  3A8H B;  6AT1 B;  4RUG A;  1VQP Q;  5GAN 4;  2SRC A;  1VQP T;  3M0T A;  4JPB W;  3M4G A;  5L8R E;  4NOY A;  4BY6 C;  1Q82 R;  2RK2 A;  3JSC A;  1M8M A;  2DTO A;  1X75 C;  4OMN A;  2ZPG B;  1RAD B;  3NTI A;  4PLI A;  3SFM A;  1M8V A;  2FZG B;  3CBO A;  4HCC A;  4KT0 E;  3CPW P;  1W4S A;  3EGX A;  4LDY A;  2M9U A;  4C92 F;  2XDP A;  1VIF A;  1N9S A;  2HAX A;  2D9T A;  3RMS A;  1UG1 A;  2CKK A;  1UHC A;  2D8H A;  2E70 A;  4XU1 A;  5IHN A;  2CDT A;  5KYX A;  2VYT A;  3MJX A;  1G83 A;  3CD6 A;  1Y96 A;  2EAY A;  1K9A A;  3MKD A;  1OX9 A;  2DKG A;  3JCM b;  5GAN g;  1PKS A;  4PK4 A;  2LTO A;  5LJ3 g;  1BB9 A;  1EIF A;  3HL8 A;  3G71 Q;  2CUD A;  3X20 B;  1R77 A;  1JXM A;  3G71 T;  1WQW A;  3RKX A;  5GAN 6;  1OZ2 A;  1I5O B;  2EYX A;  4KGX B;  3PFS A;  3I9Q A;  4HCB A;  4Z88 A;  4M77 A;  1Y71 A;  4LDX A;  2P0K A;  1WX6 A;  4C0D C;  4Z89 A;  3L2Q A;  4HKE A;  2E64 A;  1QVF S;  1KJW A;  3J81 E;  1XTD A;  2C0T A;  1IRX A;  3AT1 B;  2O4X B;  2RHU A;  4C0F A;  1WFW A;  4PLL A;  4C5G A;  3RER A;  3QJY A;  1ZBX A;  2QDL A;  4XTX A;  4JUV A;  3QSU A;  4C8Q A;  3CC2 Q;  2XMF A;  4CRI A;  2QGG A;  2P4R A;  1K73 R;  3JCM c;  2DL7 A;  5LJ3 h;  3FC3 A;  1W2B S;  2ZGW A;  4B9X A;  4FYX B;  3I5S A;  3OYC A;  1JJ2 A;  2K5F A;  2YRD A;  3PTA A;  1WA7 A;  4PL6 A;  3SD4 A;  4M7A A;  3SB2 A;  2KR3 A;  2GFU A;  1KC8 U;  2DEU A;  3I35 A;  1Q7Y R;  3JCM X;  3MP1 A;  1IO6 A;  3SWN B;  1X6O A;  2GF7 A;  2MAM A;  4L6V 5;  3CQT A;  2EQU A;  4ZTF A;  1C0M A;  2EYY A;  4F7U A;  2DX1 A;  3SEM A;  4FT4 A;  1Y0M A;  2KDS A;  1B07 A;  1ZBJ A;  1I5L A;  2WSC E;  2VWF A;  4EMK C;  1JU5 C;  3JCM J;  3THK A;  5A2Q E;  4M78 B;  4C5I A;  4MZT A;  1YHQ Q;  3H8Z A;  5FU6 C;  4BE2 A;  3LH5 A;  2LC4 A;  3GIB A;  1YHQ T;  3VRY A;  2SEM A;  5FRM A;  1M3B A;  2MIO A;  2KRS A;  4LDU A;  3JB9 I;  4HT9 A;  2RO0 A;  4IUU A;  1T0J A;  2CP6 A;  1MMN A;  3G4S T;  2K2M A;  3OYE A;  2L3Q A;  3JCM f;  2OAU A;  1UGR B;  3JCM P;  2JTF A;  3EG2 A;  2P4T A;  2F2V A;  3M56 A;  2R5M A;  4E7I A;  2DM1 A;  5IHI A;  4M78 D;  1QVF P;  4Y91 A;  1XJW B;  4IKF A;  4HT8 A;  1OOT A;  1VQ6 A;  4BUG A;  4E7K A;  3REB B;  3S3O A;  2AKK A;  1U1T A;  3OYL A;  2LCC A;  2JM9 A;  3CMA A;  2L3S A;  4M7A F;  4IUT A;  2DD4 A;  2CP5 A;  1M9S A;  3QJ6 A;  4AMC A;  3L2W A;  3OYI A;  1SSF A;  3JB9 H;  3EG3 A;  4FYV B;  4F7U F;  3OBW A;  3V8J A;  3M4Y A;  1Y7X A;  4ATO A;  1KQS P;  3M53 A;  5GMK e;  1WXT A;  3G1J A;  3EG0 A;  2GQI A;  4QVZ A;  2PVG B;  1FMK A;  3CBP A;  2KT8 A;  2JOY A;  2H3E B;  1KK7 A;  2EJ9 A;  4K11 A;  3CCR Q;  1WHL A;  1PRM C;  3CCR T;  4LDW A;  4MDX A;  1TH7 A;  1AZE A;  1YJW Q;  3NTK A;  4RTY A;  1YJW T;  4OMQ A;  4HVV A;  2L8D A;  4A54 A;  2RN8 A;  1UUE A;  3I55 Q;  1AWO A;  1MV0 B;  2FZK B;  3I55 T;  3OW2 P;  1SHF A;  3OS0 A;  2OI3 A;  3MPU B;  2L0A A;  3L1A A;  1E7O A;  2M16 A;  1IHV A;  4J6Y A;  2NUP A;  1GFD A;  2XD0 A;  1YIJ A;  2JT4 A;  1K1Z A;  1Q86 U;  2D1X A;  1D1B A;  4O5V A;  1ZUK A;  3M55 A;  2FRY A;  3CC4 Q;  4FSS A;  3CC4 T;  3JB9 D;  2RQU A;  5GAM j;  3RMQ A;  2M51 A;  4N4H A;  4N0A A;  4XTW A;  2R58 A;  4BE1 A;  2YRC A;  2HZY A;  4HVW A;  2VB6 A;  1G5V A;  5CKH A;  2ROL A;  2RHZ A;  2MK5 A;  4XTV A;  5M9O A;  1T3L A;  3CC7 Q;  3CC7 T;  1Z9Z A;  1WIE A;  4J6X A;  5KCH A;  4NS5 A;  2D0Q B;  5CK9 A;  3SHW A;  1OEB A;  3SWN C;  4RG2 A;  2RJD A;  3PNW C;  2RQW A;  2QTX A;  1D0Z A;  1Q81 C;  1H3Z A;  1UEC A;  3H0I A;  3UPU A;  3LW5 E;  3GLX A;  4QVC A;  3CXC P;  3RUX A;  1UJY A;  1GL5 A;  4PJO B;  2O2O A;  1KC8 R;  5GAO q;  5CKB A;  1M90 U;  3TCJ A;  1RAA B;  3VUZ A;  2LJ1 A;  4LDV A;  4JDS A;  5I11 A;  4M78 G;  2NUT A;  3LLR A;  3EGD A;  2HQX A;  1LOJ A;  4F17 A;  2HSE B;  2DTH A;  2YSQ A;  3RR6 A;  1QVG A;  1SSH A;  2QGF B;  3C4S A;  1Q82 U;  4M7D A;  3QYH B;  5GAO r;  2EKO A;  4O6J A;  3CCL A;  5D6Y A;  9ATC B;  1I81 A;  1SKU B;  2NLU A;  1U1S A;  1MMG A;  1N8R U;  2VVK A;  4A4H A;  2W10 A;  3CCU Q;  2M1H A;  2A36 A;  3CCU T;  2IG0 A;  1UHF A;  4AFU C;  1WHJ A;  3CCM A;  3VS3 A;  2D8J A;  1NM7 A;  1DJ7 B;  1OQK A;  5GAM g;  4PJO A;  1HXD A;  2A08 A;  2GQV A;  3ER0 A;  3OYF A;  2HEQ A;  1K8A U;  3S6W A;  1KD1 C;  3EHQ A;  1M1F A;  3Q1J A;  1QLY A;  2X4W A;  4LNP A;  5KH6 A;  2JUF A;  5CKD A;  2P0P A;  2C0I A;  4IUP A;  5GAN 7;  4J9F A;  3PVL A;  1RLQ C;  1WGS A;  1TXQ A;  2L2P A;  2X51 A;  3M59 A;  5GAO l;  3OYN A;  5KYW A;  1GXI E;  2R57 A;  4FL6 A;  1QW1 A;  3F70 A;  2YXY A;  1IXD A;  2KY9 A;  2L3P A;  4E47 A;  1M1G A;  4CC7 A;  2HSP A;  7AT1 B;  1D3B B;  8AT1 B;  1NE8 A;  3NHN A;  5DY9 A;  1N9R A;  2EQI A;  2R5A A;  1B3Q A;  1ZX6 A;  1ZSZ B;  2HQH A;  5GAM h;  2O9V A;  1QVF A;  2ATC B;  4Z02 A;  3JB9 G;  2CH4 A;  3OYK A;  2CGH A;  2YDL A;  1T0H A;  2OTJ A;  1NBE B;  2LNV A;  3I56 A;  2XIC A;  5I2S A;  1Q7Y U;  3E19 A;  2NYS A;  1U8R A;  4LD9 K;  5I21 A;  3GNG A;  2JTM A;  3CPW S;  4Y28 E;  1AHJ B;  4M75 E;  2K6D A;  2K9G A;  1M90 C;  3OY9 A;  4RTZ A;  1W2B A;  2LNH B;  3QXE B;  4PJN A;  4J9B A;  4GY5 A;  4WF2 A;  3M58 A;  2QTV A;  1PSE A;  1G3W A;  1BYM A;  1IB8 A;  1R0B G;  3CD6 Q;  1Q86 R;  1Q82 C;  2ZPE B;  2LDM A;  3CD6 T;  5LJ3 d;  5ECA A;  4JJC A;  3UA6 A;  4EDU A;  4MZM A;  1S72 A;  3N5B B;  1RAI B;  2RHY A;  3H0H A;  1ZSG A;  2YWW A;  1TS9 A;  2VXF A;  2LQN A;  2X4Y A;  1AWX A;  2XID A;  4KGV B;  4QQ6 A;  2RJF A;  3RKW A;  1NEG A;  5D6X A;  2QAS A;  2OX7 A;  1Y57 A;  1RLP C;  2DBK A;  2A28 A;  5CIU A;  1AD5 A;  3D7S B;  4C92 E;  1IGU A;  4X9C A;  2O88 A;  4PJO C;  4RTV A;  5J3B A;  2FHD A;  3CCE A;  4RMO A;  2DL3 A;  3MP6 A;  2K7A A;  3RES A;  2VXE A;  3H9N A;  2RQV A;  5GAN e;  4M75 F;  4YTL A;  5LJ3 e;  2F5K A;  2VUB A;  1YWP A;  1VQK A;  2COW A;  2O01 E;  4ELY C;  2EGC A;  3S3M A;  1E6H A;  1MNE A;  2DF6 A;  5IT9 E;  4JLI A;  3OYM A;  4JS4 A;  1N6A A;  5DLO A;  2V26 A;  1HYO A;  1BKB A;  2CP3 A;  1RAE B;  5I22 A;  5CCA A;  4R0K A;  2RI2 A;  1E6G A;  2PUK B;  1X2K A;  1X6G A;  3EGU A;  4EMK A;  1YN8 A;  2J7I A;  2LCS A;  2CSI A;  2RD1 A;  3WXM B;  3JB9 J;  4NL3 A;  1PKT A;  2CYZ B;  1HK9 A;  3G6E A;  5IH2 A;  1K73 C;  4EPC A;  5LJ5 j;  2F5T X;  3L2V A;  1NLO C;  2DEQ A;  1N8R R;  3J7A F;  1EZZ B;  4J9E A;  1MV3 A;  2RHX A;  1HJD A;  2MPX C;  1YIT A;  2KE9 A;  2YLC A;  4HCZ A;  2LT1 A;  4OF1 A;  4OB1 B;  4IIO A;  2JZ2 A;  1UGV A;  1CKB A;  3MEW A;  1BI1 A;  5FWC A;  3S3N A;  2NUZ A;  3M0U A;  4F04 B;  1Q7Y C;  1VQ4 A;  2LVM A;  1YJ9 A;  2X35 A;  4VUB A;  3J80 E;  1BIA A;  3OMC A;  5HKC A;  3OS1 A;  1K76 A;  1M2V A;  2HMA A;  1K8A R;  4AT1 B;  2OTL A;  1GFC A;  1Y07 A;  3CCV A;  4PFZ A;  2F1L A;  1WYX A;  2MWO A;  4V2S A;  2VGN A;  4OGC A;  4FCY A;  5LJ5 f;  1IGQ A;  1V29 B;  2AKL A;  1X01 A;  2I0N A;  4XTU A;  1YP5 A;  2KGT A;  3VUB A;  3OMG A;  4LUE A;  2K79 A;  2YUO A;  1VQ6 Q;  1G3Y A;  1ZSZ C;  1VQ6 T;  3MP8 A;  1VQM A;  1BCM A;  1JQQ A;  2PUO B;  2AZS A;  2RI5 A;  3CMA Q;  4JJD A;  2W0Z A;  3LYI A;  2QEX Q;  4OMM A;  4UC4 A;  3CMA T;  1UGS B;  3EFS A;  4M77 E;  2PNI A;  3HRU A;  4JRQ A;  3E9G A;  2QEX T;  3VU3 C;  5DM7 R;  1GBR A;  1X43 A;  5J26 A;  3E9F A;  2EWN A;  2ROT A;  3CC2 T;  3JV3 A;  3KUF A;  2HBW A;  3QKJ A;  4NL2 A;  4XU3 A;  2E41 A;  2RHI A;  1VYT A;  1KQS S;  2LQW A;  1AT1 B;  1TU0 B;  2KXC A;  4C8Q E;  2KXD A;  1XNI A;  3CCQ A;  3MET A;  1PHT A;  4DA4 A;  4XAX B;  3VS2 A;  5HCK A;  1JBM A;  4IUQ A;  4E6R A;  3P8B B;  3P8H A;  4FM4 B;  3V8L A;  4RCC A;  4R55 A;  1YCY A;  3TEE A;  1AWJ A;  4DBF A;  1H3H A;  4M7A E;  2ZAE A;  2EBP A;  3X25 B;  2O9S A;  1LVK A;  2O4X A;  4FT2 A;  1PG5 B;  4PJJ A;  3ME9 A;  3FDR A;  3OW2 S;  5CQX A;  2YLB A;  5GAN 5;  2H3J A;  4OB0 B;  4M77 F;  4F7U E;  2RB6 A;  3L42 A;  4ORZ A;  1WHG A;  5FRN A;  1J3T A;  1YIJ Q;  2FEI A;  5IXB A;  2K3X A;  5GMK m;  1PD1 A;  1YIJ T;  3EFO B;  3RIR A;  1OZ3 A;  2CP2 A;  2K2V A;  3QUI A;  2FRW A;  3JRZ A;  1ZLM A;  1TUG B;  3VYH B;  5KE2 A;  2XHC A;  1N5Z A;  3DB4 A;  4Z8A A;  4C5H A;  4CC4 B;  1VUB A;  4DEY A;  2XG8 D;  4C8Q F;  2K57 A;  5KYY B;  5LJ5 h;  4ZNX A;  3SWN A;  2DMO A;  2FO0 A;  3L2Z A;  4HXJ A;  3QDF A;  3G71 A;  1I0C A;  3UT1 A;  1ZA2 B;  2MF2 A;  2FG0 A;  1I8F A;  2KK4 A;  1SPK A;  4KUD K;  1H8K A;  2DIL A;  1IZ6 A;  4M78 A;  5D6W A;  5I2M A;  4XU2 A;  1PD0 A;  2GCX A;  1BU1 A;  3EG1 A;  1NYF A;  3V7S A;  1WLP B;  2F2W A;  3HTR A;  2EQK A;  2VGM A;  1ZUU A;  2COZ A;  1TSF A;  1FX7 A;  1YJN Q;  1YFN A;  4J9I A;  3CXC S;  2ENM A;  3JCM g;  1YJN T;  4DBR A;  2BIV A;  4JZ3 A;  2YT6 A;  2EQJ A;  2FVU A;  5GAO m;  1U06 A;  1NPR A;  2PVO B;  1M4Z A;  4P5N A;  1RAG B;  1QWF A;  2EJG A;  1VQ9 A;  1ACM B;  2EPD A;  5KCO A;  4PJM A;  2RI3 A;  3PIP A;  3GNF B;  2C06 A;  2FYK A;  2XU8 A;  4II1 A;  2ED1 A;  3DKM A;  2JS0 A;  1RAB B;  2CT3 A;  2XDB A;  2OAW A;  2EYZ A;  1VQO A;  1X2Q A;  1KC8 C;  1G3T A;  2VC8 A;  3M0P A;  4N4G A;  3VKI A;  3HRT A;  4ZGD B;  1QCN A;  2DER A;  1BCO A;  3NTH A;  2A7Y A;  2DO3 A;  2RMO A;  4J6W A;  5HY6 A;  3OSS C;  2DL4 A;  2QQ9 A;  3CCM Q;  4KRT A;  2EW3 A;  2QDY B;  3PT9 A;  5GAM d;  2QAZ A;  3CCM T;  2PQW A;  2LMJ A;  3JCM h;  2KQW A;  1T3S A;  2M02 A;  3M5A A;  4M7A G;  2MYS A;  2EIF A;  4BB7 A;  3EAE A;  2WSE E;  3QHS A;  2E4H A;  3CPW A;  2YHT A;  2QA4 A;  4E7Z A;  4Y92 A;  1FMV A;  1M5Q 1;  3CEY A;  4DBH A;  3G4S A;  3OS5 A;  4M4Z A;  2G6F X;  1QP3 A;  2DVE A;  4B9W A;  2J6O A;  2HNI A;  2FPE A;  3OSV A;  1WI7 A;  2DXC A;  4J9G A;  3URG A;  2J6K A;  2CSQ A;  4ZGE B;  4KH0 B;  2HL5 C;  1SRL A;  4FYW B;  4JS5 A;  3QO3 A;  5GAM e;  3I5R A;  2BE9 B;  4AFS C;  2KRO A;  3JCM Q;  1MHN A;  3P8D A;  3OA6 A;  4KGZ B;  5A0D A;  2BUD A;  1KG1 A;  1VOM A;  4KUI A;  3PGG A;  2Y90 A;  4A4E A;  3OYD A;  4M78 C;  1LJO A;  1QWE A;  2DRM A;  2AIR B;  2LT4 A;  4J83 A;  2GBQ A;  2WAC A;  4J7I A;  3AHU A;  1CSK A;  1JO8 A;  2DD5 A;  1VYU A;  2DL8 A;  4CC3 A;  5GMK l;  2JJ9 A;  2QG9 B;  2OTJ Q;  1GCP A;  3H6Z A;  2HL3 A;  2OTJ T;  3MEU A;  3I56 Q;  1O75 A;  3I56 T;  2ECZ A;  1OYX A;  1QKW A;  2JMC A;  4AFZ C;  1AZG B;  2DXT A;  2EYQ A;  4RTX A;  4OP0 A;  3EHR A;  1KHI A;  1FMW A;  2QQR A;  4M7D E;  1YJW A;  3QDR B;  2YUQ A;  1YNZ A;  2QQS A;  3FJ5 A;  5KYU B;  1MMD A;  2ZZD A;  4HCK A;  1S72 Q;  2EKH A;  2DYI A;  1S72 T;  3HFN A;  1OU8 A;  2RK1 A;  1VQ7 A;  4R56 A;  1RAC B;  3VS0 A;  3QZ5 B;  3M9Q A;  4C0Z A;  4EMH A;  5IXF A;  3ZEH A;  3REA B;  3H41 A;  5CAI A;  3QZ9 B;  1Q86 C;  2QQA A;  2ZCF B;  2Y4Y A;  3M0R A;  2H8H A;  4ELZ C;  4M75 B;  3TU4 K;  3CCE Q;  1VQ5 Q;  1YWO A;  3CCE T;  1I4K 1;  1VQ5 T;  2WSF E;  1NZ9 A;  1ZQ1 A;  3HRS A;  1QCO A;  3LGF A;  2PU9 B;  4OML A;  1JJ2 P;  1VQ8 A;  1GBQ A;  5CKF A;  1JB0 E;  1VQK Q;  2DE0 X;  3TVT A;  3JCM W;  1X27 A;  1VA7 A;  1VQK T;  4A4F A;  2C0O A;  3TRE A;  1WPY A;  2JTE A;  5HK0 A;  4M7D F;  3CC7 A;  5FLX E;  4A53 A;  3HFO A;  3EH2 A;  1ZHI A;  4OB3 B;  4JRP A;  4DQ2 A;  1HSQ A;  4ZGJ B;  4BDZ A;  2E1H A;  2FPD A;  4KUL A;  4LUD A;  4WCI A;  3QII A;  2CH4 W;  1FXX A;  2DZC A;  1NPP A;  2QI2 A;  2MOX A;  2LQK A;  1X69 A;  4M75 D;  5CR2 A;  3BDL A;  4PNO A;  1V1C A;  1K9M R;  1D1C A;  2DJZ A;  3RBB B;  4BDY A;  4QVD A;  2FPF A;  3BW1 A;  2VAS A;  4D6W A;  5IHK A;  4C92 B;  1WNL A;  5AT1 B;  1C6V X;  1KFZ A;  1FWZ A;  1I07 A;  5KE3 A;  4RCB A;  1OUL A;  4PJO F;  4F16 A;  2CZ6 B;  2DJQ A;  2JS2 A;  1KQS A;  2QXF A;  3M54 A;  3NFC A;  1YIT Q;  4A4K A;  3FB9 A;  1YIT T;  2KVQ G;  1TG0 A;  3KBG A;  1D3B A;  1FYN A;  1VQ4 Q;  3ZBD A;  3CCS A;  1VQ4 T;  1PCX A;  1EX4 A;  1VQN A;  2RF0 A;  2DVJ A;  1ABQ A;  1GRI A;  1SEM A;  1MGQ A;  4OGE A;  3OYY A;  3A8M B;  1ZSZ A;  2CT4 A;  2B86 A;  2LCL A;  4C92 D;  1XOV A;  1N8R C;  2RPN A;  5GAO p;  3VS7 A;  5EC7 A;  1B34 B;  3EG9 B;  2Z0W A;  4L5G A;  3KFV A;  4IIM A;  3OW2 A;  4PKC C;  1F1B B;  3E2U A;  4QKU A;  2L3R A;  1SHG A;  2ZPB B;  2M0O A;  3PE0 A;  1VQM Q;  1QCF A;  3LWI A;  3VV0 A;  1VQM T;  3VS5 A;  2YUP A;  4BAC A;  1YI2 A;  3A1P A;  3LX7 A;  5GAN 3;  3O5Z A;  2AZV A;  1K8A C;  1NJI R;  1PNJ A;  2XI9 A;  2DTI A;  1M2O A;  2PZ1 A;  2P0Q A;  4ESR A;  1YCS B;  4JRK A;  4J8O A;  3EGX B;  3QWY A;  2GGR A;  4FIB A;  2LP5 A;  1AWW A;  3TQ7 P;  1BI0 A;  3CCQ Q;  5KYX B;  5A0G A;  3CCQ T;  1Y96 B;  2VKN A;  5LJ5 d;  1RAF B;  4RTW A;  1B34 A;  2LRQ A;  2V1Q A;  4EMG A;  5GAN f;  3EH1 A;  5GJV B;  5LJ3 f;  3CME A;  2DET A;  1ABO A;  4XK8 E;  1RL2 A;  4E7H A;  4E7J A;  1VYV A;  3RKY A;  1WJS A;  4J9C A;  2P84 A;  3OYJ A;  4J5Y A;  5FW9 A;  4E7L A;  4J7F A;  4M77 B;  2GTO A;  3OYA A;  3CXC A;  2KYM A;  2ZPH B;  2GFA A;  2DYB A;  1RI9 A;  4C0G A;  1M3C A;  4ZN1 A;  4OMF B;  2KSS A;  5CQY A;  2KMT A;  4RTU A;  4WTO B;  2X9H A;  4XU0 A;  4M75 C;  3CCJ A;  1LPL A;  1H64 1;  2RM4 A;  5LJ5 e;  3IQL A;  3FIF A;  3QBY A;  4C8Q B;  4M75 G;  5C6S A;  1SRM A;  2E3I A;  3M0Q A;  1M1K R;  4RKU E;  4MMK A;  4FW1 A;  2QK0 A;  4M77 D;  3R6O A;  4ANJ A;  1Q95 G;  2EVR A;  2EQM A;  1BBZ A;  1H92 A;  4M7A B;  3EFR A;  4OMP A;  1C1A A;  4ZTJ A;  3C95 A;  1VQL A;  3UF4 A;  1U5S A;  1CKA A;  5FU7 B;  4DOW A;  1TUD A;  1VIE A;  2HKQ B;  3QPH A;  1N27 A;  2X4X A;  1WXU A;  1JXO A;  2JVV A;  4C8Q D;  4F7U B;  1RAH B;  3A98 A;  4DOV A;  3OYG A;  1IHW A;  2BZ8 A;  4C92 C;  4BE0 A;  2F2X A;  2RQR A;  4GLK A;  2HCK A;  3OB9 A;  3JCM d;  1BK2 A;  5J39 A;  1PC0 A;  4C92 G;  2LQ8 A;  2PVD B;  1QVG P;  4BI4 A;  4PJL A;  4JRI A;  3OS2 A;  2K5I A;  4M7A D;  1UE9 A;  2E6Z A;  4QT7 A;  3VYG A;  3BFM A;  4BI3 A;  1W1F A;  1JRI A;  5GAN h;  5LJ5 g;  8ATC B;  5GAO n;  2DXB A;  3C0C A;  2PTK A;  1VQ9 Q;  2ZPI B;  1VQ9 T;  4F14 A;  1VQP A;  3QWX X;  4LD6 A;  5GAN 8;  2MMP A;  3OBY A;  4QQD A;  1VQO Q;  3LH0 A;  1U3O A;  2MI6 A;  5GMK i;  2V8K A;  1VQO T;  4J9H A;  3UWN A;  4RTT A;  3JCM e;  3GBQ A;  3NGP A;  1PRL C;  4X1V A;  1WQ7 A;  2X3X D;  2ZPF B;  3GPL A;  2XK0 A;  3ZFJ A;  1PSF A;  4JZ4 A;  3L2U A;  4TVR A;  4X34 A;  3GF5 A;  1IRE B;  2A37 A;  2JN0 A;  3HHT B;  4MZP A;  2B8A A;  3CPF A;  4B6M A;  2QA4 Q;  4Q5W A;  1HD3 A;  5AYF A;  5LL6 S;  2QA4 T;  1UB4 A;  2J06 A;  2KRM A;  4A63 B;  5FRO A;  3G4S Q;  2RH2 A;  3LGL A;  1D1A A;  1TTH B;  1W70 A;  4BI8 B;  4OMO A;  1WJR A;  4JJB A;  1M3A A;  4IUR A;  2LJ0 A;  2EGA A;  3M57 A;  3V7R A;  3ULR B;  1LNX A;  1WHK A;  5EG2 A;  1NLP C;  1Z9Q A;  4LE9 A;  2HDA A;  2AK5 A;  2A0F B;  5GMK j;  1Q81 U;  1UEB A;  5KYN A;  4FYY B;  2F69 A;  3DB3 A;  1G2B A;  5IN1 A;  1BIB A;  3O8V A;  1PM3 A;  3C94 A;  2QEX A;  3EFO A;  1RUW A;  4M78 E;  1OI1 A;  4M77 C;  3MEV A;  2NUP B;  3CC2 A;  2EYW A;  2DLP A;  2HD0 A;  4M77 G;  4D8D A;  2DPP B;  2MWP A;  2AT1 B;  5KYY A;  1K4U S;  4JJN K;  3X24 B;  4E2F B;  2RNA A;  1W2B P;  1UTI A;  3FRN A;  2DFU A;  3X28 B;  1K9M U;  1P92 A;  2KEA A;  1R0C B;  4C8Q C;  3CCL Q;  1KQ2 A;  1KQ1 A;  1UDL A;  3CCL T;  2FL7 A;  1ZUY A;  3RDV A;  2KT1 A;  2LX7 A;  1ZA1 B;  4C8Q G;  4HVU A;  4FW2 A;  2XKO C;  3OYH A;  2K3Y A;  1TOV A;  3OQ5 A;  4HA8 A;  1BI3 A;  3A8L B;  2E6N A;  2CRE A;  1AVZ C;  1D0Y A;  2ABL A;  4M7A C;  2DA9 A;  1KIK A;  1WJQ A;  1WHM A;  3DLL A;  3TSZ A;  1YHQ A;  5FU7 C;  2DBM A;  2J05 A;  1VQ7 Q;  2OJ2 A;  5DLQ E;  1R8O B;  1VQ7 T;  4M78 F;  1K0S A;  2CZ0 B;  1TWB A;  3UDC A;  2A3L A;  3HPW A;  1KD1 U;  1MUZ A;  1YBY A;  1A0N B;  2L89 A;  2CS7 A;  2ED0 A;  4F7U G;  3KXT A;  3INZ A;  3DLM A;  5FWB A;  3UAT A;  3M0S A;  2K4Y A;  3V8K A;  2E5K A;  1UGQ B;  2JMA A;  2NUT B;  2COY A;  1KHC A;  4PFO A;  3EGD B;  4D8K A;  1GCQ A;  4C5E A;  1KSW A;  1WDX A;  2RJC A;  1VQ8 Q;  3UA7 A;  1PWT A;  1JJ2 S;  1VQ8 T;  4M7D B;  1UJ0 A;  4CC2 A;  2FB7 A;  1NJI U;  5L23 A;  2G3R A;  1NEB A;  1AOJ A;  5CKE A;  3PMT A;  2BTT A;  4XQ3 A;  5IAY A;  3CBM A;  4RG8 A;  2ESW A;  5D7U A;  3RNJ A;  4PFP A;  4J9D A;  1WZO A;  4QQG A;  2HQE A;  1B7T A;  1O9S A;  1WHH A; 
#chains in the Genus database with same CATH homology
 1K9M R;  3CD6 Q;  1Q86 R;  1YHQ Q;  3CXC P;  1M1K R;  3I55 Q;  3CCL Q;  3CCS Q;  3CC2 Q;  1VQO Q;  1S72 Q;  3CC7 Q;  1VQ4 Q;  1VQN Q;  1Q7Y R;  3CC4 Q;  3OW2 P;  3CME Q;  1KC8 R;  1NJI R;  1VQ7 Q;  3G6E Q;  2QA4 Q;  1K73 R;  1YJ9 Q;  1M90 R;  3CCE Q;  3CPW P;  1VQ5 Q;  1QVF P;  3CCR Q;  1VQM Q;  3CCJ Q;  1VQ6 Q;  1YI2 Q;  3G71 Q;  1YIJ Q;  3G4S Q;  1VQ8 Q;  1VQ9 Q;  1VQP Q;  3CCU Q;  1W2B P;  1N8R R;  2OTL Q;  2OTJ Q;  1Q81 R;  1YJW Q;  1KD1 R;  1K8A R;  1JJ2 P;  1VQL Q;  3CMA Q;  1KQS P;  3CCQ Q;  3CCV Q;  3I56 Q;  1QVG P;  1VQK Q;  2QEX Q;  1YIT Q;  1YJN Q;  3CCM Q;  1Q82 R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...