1VQ4Q

The structure of the transition state analogue "daa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 20
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1vq4Q00
1KD1R 1VQMQ 3I55Q 1N8RR 3CC4Q 3CCSQ 1JJ2P 3CCEQ 1YJ9Q 2OTLQ 2QEXQ 1M1KR 1VQPQ 3CMEQ 1K8AR 3CCJQ 1QVFP 1YI2Q 1VQ6Q 3G4SQ 3CD6Q 1VQKQ 3OW2P 3I56Q 1W2BP 1Q7YR 1KQSP 1KC8R 3CC7Q 2OTJQ 3CCRQ 1VQNQ 3CMAQ 3CXCP 1YIJQ 1QVGP 1NJIR 1VQ4Q 1VQLQ 1Q86R 2QA4Q 1YJNQ 3CCQQ 1VQ7Q 1K73R 1K9MR 3CCUQ 1VQ8Q 3CC2Q 3CCLQ 1YITQ 1S72Q 1VQ5Q 1VQ9Q 3CPWP 3G6EQ 3G71Q 1Q81R 1Q82R 1YHQQ 1YJWQ 3CCVQ 3CCMQ 1M90R 1VQOQ
chains in the Genus database with same CATH superfamily
4LD9K 1A0NB 3A8GB 3OYGA 3SWNA 1KQSS 4M7DG 3CCEQ 1GXIE 2KRSA 1M1GA 4QW2A 3OY9A 1YCSB 3C0CA 2Y90A 4OB2B 4PLLA 4M75F 1Y07A 5GAMg 1YCYA 4LDVA 4M7AB 1BYMA 2RQVA 3GPLA 1Q82R 2MOXA 3EFRA 5KCHA 4R56A 1YHQQ 2KNBB 1NLPC 4M7AE 4RTXA 3EG0A 1NJIU 1H92A 2SEMA 1NJIC 3EH1A 1QVFA 1M1FA 2GQVA 4B9XA 4ZN1A 1U3OA 3OYBA 5CKBA 2BE9B 3UA6A 2XICA 2VB6A 3KXTA 1M90R 4QKUA 2DL8A 3QWYA 4FT4A 5GAMe 3M57A 1G3YA 2KR3A 3VYGA 5FU7B 2QQSA 5IH2A 1M1KR 1YI2T 1AEYA 2Z0WA 1WNLA 3M4YA 4E6RA 1R8OB 3JB9I 2OTJA 3CCRQ 1BI0A 4J6XA 3SB2A 2K5FA 1K4US 5GAN7 1S1NA 5KYWB 1VQ5Q 2HDAA 1YN8A 2YLCA 3RNJA 3OBYA 5D6WA 2WSFE 1VQ7A 2ZPIB 2G6FX 1WFWA 3OYKA 5LJ3j 3HP9A 3SWNB 1X6OA 1WHHA 2A0FB 4FYWB 1UHFA 1TXQA 1EX4A 1M3CA 2PVDB 4F7UA 4EIKA 3M56A 1YWOA 2E5KA 2QQRA 2QEXT 2X3XD 4BI8B 3VS7A 2MAMA 2DRKA 2O2OA 3FEOA 1N8RR 4RCBA 1E6GA 4C92E 1ARKA 3QZ5B 2C0IA 2QQAA 1MGQA 3L2UA 1YJNQ 2D6FA 1LOJA 2EYWA 3PIPA 1H3HA 4HA8A 2GQIA 3MEAA 3QIIA 1PSEA 3MEVA 5LJ5j 1KD1R 1UE9A 5KE3A 3JCMd 3PFSA 1I8FA 1BI3A 1C6VX 2A3LA 3OBWA 5J3BA 2L5QA 3EG2A 3CEYA 2RK1A 3JSCA 3A98A 2M16A 3QKJA 1RAFB 1Q86C 3OYEA 2COYA 3JRZA 1KG1A 1CKAA 9ATCB 1V29B 1W2BP 2BZYA 4V2SA 2YRCA 3RESA 1IB8A 4J9IA 2MCNA 3MPUB 5CKHA 1QP3A 4EMGA 3A8OB 1AZGB 5IXBA 1VQKA 2KXDA 4A63B 4AFSC 4KGVB 2LNHB 4M77F 4C8QG 4D8KA 1ZLMA 4OGEA 2RNAA 1GRIA 1OULA 2DTOA 1UEBA 4M78A 2RM4A 5D6XA 3X20B 2O9SA 5CCAA 1PG5B 1MNEA 1W2BS 3CMEQ 3G1JA 1YI2Q 1IZ6A 4ELZC 4JZ4A 3SDZA 3URGA 4J83A 7AT1B 4XTVA 2DPPB 1JRIA 1AD5A 1TWBA 5GAN8 3DKMA 5IHIA 4NOYA 1ZBJA 1ZSGA 4PFPA 3H9NA 4HVUA 3CXCA 2VKNA 3EGXB 1PHTA 2FB7A 3THKA 3KBGA 2YSQA 2R5AA 1HSQA 2RQRA 2ENMA 4AT1B 1G2BA 5GJVB 1XQHA 3CPWA 3BDLA 1DJ7B 4BB7A 1JEGA 2FZGB 2DBMA 4M77A 1PRLC 1PNJA 2KT8A 4LDXA 2MMPA 3OS2A 4LUDA 2DLPA 3TVTA 3OYIA 1RI9A 3OYCA 3G6ET 2ZPGB 4OVAA 5GMKm 2RJCA 3OMGA 3CBMA 4K11A 2XHCA 3LWIA 4HCCA 2J05A 3VS4A 3LGLA 1HXDA 4EMKB 5GAN6 3I56T 3CCLQ 1AWJA 3ZEHA 4KRTA 2QTVA 2MI6A 2OAUA 5GANd 1N9RA 2CUDA 4NL2A 2KYMA 1OEBA 3R6NA 2M02A 2XI9A 2JZ2A 4HKEA 4M78B 3JCMf 4R0KA 4CC3A 4ZNXA 4N4IA 1K73U 1YIJQ 1OPLA 1R0BG 2RN8A 1Q86R 3X25B 3CMAA 3EGDA 1VQ5T 2K9GA 2CUBA 1Z9QA 5I2MA 2I0NA 4M75D 3CCRT 1I81A 1QVGA 1VQ9A 2CKKA 2PVGB 5L8RE 4DOWA 4HCKA 2EQUA 1VOMA 4IURA 4B9WA 2KE9A 4CC7A 2V8IA 2HQXA 1VQOA 2QG9B 2X4YA 2K5LA 2O4XA 1VQMA 1X43A 2DM1A 2JT4A 3C4SA 2C06A 3QDRB 2B8AA 4BD3A 3JCMb 2P0KA 3MKDA 1TS9A 4IIOA 3CXCS 4PJMA 2E64A 5HK3A 4M4ZA 3JCMe 4KT0E 3UPUA 1NM7A 2GNCA 2MWPA 4BI3A 1I5OB 4J9HA 5IAYA 3JCMQ 3OS1A 2LQKA 2AZSA 5J39A 2JTFA 1T3LA 4CC2A 1K73R 1SSFA 4J9EA 1UGQB 1UGRB 3OYAA 4C5GA 4FYYB 1Q95G 2DD5A 4DBQA 2RQWA 5ECAA 1WGSA 5HK0A 4KULA 1UECA 4RG2A 3CCET 1V1CA 5KYWA 2RHXA 3JCMW 2F5KA 3CCQQ 2XMFA 3V8KA 2QGFB 2AKKA 1RADB 1TU0B 2F69A 1D1CA 1QW1A 1KQ2A 2W10A 3VUBA 2HZYA 3PIOA 2F1LA 1IRXA 1NYGA 4GLKA 1BU1A 2HL5C 5IHNA 2E1HA 5GAOq 1UFFA 3CCUQ 4ORZA 4QQ6A 2FPEA 2LCCA 4PJNA 2KY9A 2H3EB 2YT6A 4M78D 2D0NA 4UC4A 3PE0A 5KYXA 2GCXA 2H8HA 3CCST 2EVRA 3M0SA 3EGXA 3J80E 3G71T 3ZFJA 2XDBA 2EW3A 2K4YA 1VQLA 4O6JA 4J7IA 3M0TA 2HMAA 5GAOm 1BI1A 1FMVA 1GBRA 2M1HA 1QVFP 4FL6A 2KXCA 2CREA 4C92B 4XU2A 1MV0B 1K76A 3OW2S 4M7DE 1H3ZA 2CGHA 2FO0A 2YUOA 2QASA 2MWOA 4GBQA 2PNIA 1OYXA 3BDUA 4JRQA 1O9SA 4OB3B 3PVLA 4JLIA 5GAMf 1Q7YU 2M0OA 4FW2A 2QDYB 4M7AF 1E6HA 2DYBA 1QWEA 1BB9A 4M78E 2VXFA 3OYFA 2JN0A 2LX7A 2DL5A 3SFMA 4JJCA 2O01E 2MPXC 1X69A 4M7DD 2ECZA 2EYQA 3UDCA 2FZKB 2O88A 3GNFB 5GMKi 3NTKA 1I07A 1I4K1 1BCOA 2EAYA 3CC7A 4M7AA 3L2QA 2BKDN 4YTLA 5EC7A 1G5VA 3LH0A 2L89A 2Y4YA 2HBWA 1KHIA 1FX7A 5LJ5h 4OMQA 1OQKA 3X26B 1G8XA 1PRMC 4ZTJA 4M75A 1BIAA 3MO8A 4ZTFA 3M55A 3CCEA 5DLOA 4LD6A 2LQNA 2KBTA 1BIBA 1VQNA 4HCZA 4O5VA 1NG2A 3EAEA 3RKYA 4OMOA 1PD1A 1ZA2B 4C92A 3GF5A 4DA4A 1LVKA 4M78F 5FU7C 1X27A 2K5IA 2LX9A 1UDLA 3CD6A 2COZA 3UF4A 5A2QE 2JMAA 4Y28E 2AKLA 3I55Q 2DFUA 3O5ZA 1SRMA 2EJGA 4JRKA 3QHSA 2DBKA 1RLQC 2V8JA 1SKUB 1FXXA 1TSFA 3DLLA 1KHCA 1D0YA 2WSEE 2JW4A 2F2WA 2KMTA 1ZX6A 4M7DA 1WQWA 2O9VA 3SWNC 5DY9A 3UT1A 2MYSA 5I21A 3P8HA 1MMAA 5CQXA 2YHTA 2DTHA 1FMKA 2K2VA 2CYZB 8ATCB 4MZTA 4X1VA 4C5EA 4ELYC 1N6AA 2DO3A 1Q82U 4ME7A 1WLPB 2BUDA 4QVZA 4QT7A 4HVWA 2EQIA 3VRYA 1RL2A 1YI2A 3TSZA 2DYIA 5GAMj 2RK2A 3PGGA 1QMCA 5GMKj 1HD3A 1XJWB 4C8QD 3I9QA 1FYNA 2K79A 5HKCA 2JM8A 2IPOB 2BZXA 2GTJA 3QYGB 4IUTA 2DXBA 4JS4A 3CCLA 3A1PA 4M7AD 2KRMA 3QXEB 4ZGJB 2LCLA 2QXFA 4TVRA 3RIRA 2NUPB 2QAZA 4JDSA 1TTHB 4ATOA 2KI7A 3E1SA 4RG8A 3PMTA 1KD1C 1AWOA 4A4HA 4IKFA 3BY7A 2COWA 2EQJA 1NPPA 2JMCA 3VUZA 1YJNT 2LJ1A 1TG0A 4A53A 2RHUA 5IT9E 3NPFA 4RTVA 3I5RA 1SF9A 4OGCA 1K9MR 3ASKA 3OYHA 2PZ1A 1IHVA 4N0AC 5GANe 5GMKl 2O4XB 3CC4A 3M59A 1RABB 1RAIB 2QEXQ 3RR6A 1KQ1A 2EGCA 1WPYA 1PC0A 2X4JA 4IUVA 2ZPEB 3JCMP 1XOVA 1T3SA 5GMKh 2XDDA 4Z89A 5IXFA 2LC4A 4F04B 1T0HA 4BACA 2P4TA 2QTXA 5CVIA 1F1BB 3TREA 3RBBB 2VWFA 2VC8A 2RJFA 3REBB 1SPKA 4RTWA 2LT4A 5GAMd 3VS2A 3QDFA 1CSKA 1NE8A 1VQ6A 4IUQA 1RLPC 3EFOB 3OYMA 2HKNA 2M9UA 1H641 3I35A 1K1ZA 2FRYA 3M54A 3OYJA 2V1RA 4NS5A 3G6EA 1ZUKA 1RAGB 3VU3C 5GANf 3EH2A 1YNZA 4BDYA 4X9DA 3QZ9B 5GAMh 3FJPA 4AFQC 2DEUA 1IREB 1S72T 1NPRA 1GCQC 1PCXA 2YWWA 3L2RA 1AOJA 3OYYA 3CCQA 5GANg 1VQNT 2D9TA 5GANh 4M78C 4E7HA 3CC2A 2I2LA 5KCOA 1YWPA 3VS5A 2HCKA 1UGSB 3C12A 3HKSA 1VQ4T 1Q86U 1PKTA 2EGAA 4FSSA 1JO8A 4E7KA 3CD6T 1YHQT 5KYNA 1YJWT 2F2XA 2EIFA 2KAFA 2F5TX 1W70A 3M9QA 1M27C 2GBQA 4XTZA 2LVMA 1N8RC 2QDLA 1X75C 2JJ9A 2GFAA 5CO7A 2KK4A 1MNDA 1QKXA 1VQOT 2LDMA 2RPNA 2MIOA 4Z8AA 2RJDA 2IG0A 4WF2A 2OTLT 4VUBA 4E7JA 1B7TA 3V8JA 1VQLQ 5EG2A 2H3JA 3CCMT 2L3QA 2CP6A 4OF1A 2CZ0B 1MV3A 2ZCFB 3L2ZA 2QQBA 2AHJB 3JCMh 4RTUA 4FT2A 3L2WA 2NLUA 4MMKA 3JCMg 2D1XA 1NEGA 1M8VA 2RHYA 2V1QA 2QEXA 4L59A 2YXYA 3CMAQ 3L2VA 2K57A 3JB9F 4RUGA 2J6OA 3FIFA 1YITT 1JU5C 3M4GA 1VQ9Q 3CPFA 2JUFA 2OAWA 4XTYA 5CAIA 1VQMT 5KYYA 2HEQA 2CH4A 1VQKT 4GLMA 1U8RA 2ZGWA 2J6FA 3SHWA 1ZQ1A 3UATA 3UWNA 1B34A 4J9DA 4M78G 4AG1C 3JV3A 3OW2P 1BK2A 1Q7YR 1Q81C 2HD0A 2VVKA 1NYFA 2ZAEA 3FDRA 4AMCA 5KE2A 2FG0A 4C5IA 1HYOA 3TSWA 1NZ9A 5LJ5g 5CKFA 2LZ6B 3X28B 1QQJA 2K3BA 5HCKA 3CC4Q 2VYTA 3G71A 1JB0E 4F7UB 2EKOA 2DXTA 5M9OA 1Y96A 3J7AF 2P4RA 4N0AA 1YJ9A 2EFIA 3META 2BIVA 2E65A 4PJOA 1Y71A 1LNXA 3G4SA 3ULRB 1ZUUA 3LW5E 2IIMA 2CP0A 1VYVA 2QA4T 1VQOQ 1RAEB 1PWTA 1YJNA 2LCSA 1YJ9Q 3QSUA 4HT8A 5IN1A 3HSBA 2DJZA 2NYSA 3CC2T 3JCMc 1UGPB 3CC7Q 4BY6C 1X01A 4M75E 2L2PA 1BI2A 1HK9A 1VQ8A 1YJWQ 1GBQA 2FHDA 5CQYA 2GFUA 4ZGEB 4E7IA 3OQ5A 3M53A 3REAB 3S3NA 3P8BB 5AYFA 4EDUA 1PM3A 1OX8A 2FPFA 2KROA 5CIUA 2KEAA 4DBFA 1BKBA 3PNWC 5KYUB 1GCPA 2HQEA 2XIDA 2OTJQ 1SHGA 3GOXA 2X9HA 1VQNQ 4WTOB 2JS0A 1QCFA 2DVEA 2EQKA 1S72Q 2ZPFB 1IGQA 1I0CA 5GMKe 2KYBA 2NWMA 4J7FA 1M3BA 5CKEA 2NUTA 1KQSA 4AFZC 1W6XA 4E2FB 2G3RA 2LNVA 1SSHA 4LDWA 1QCNA 2DERA 4E47A 4J5YA 2J06A 4BY6B 4PFZA 1NEBA 1Q81R 3AHUA 3WVEB 3X24B 1B34B 1Y7XA 3U23A 4WCIA 1MMGA 2CZ6B 4II1A 4HCBA 2NUTB 1BBZA 3HRUA 4JPBW 2XG8D 1K73C 1VQ5A 3I5SA 4J9BA 1NJIR 4J9CA 1ABQA 4E7LA 3CCVA 1KD1U 4L5GA 3PTAA 2RF0A 3EFSA 1YHQA 2K3YA 1I5LA 3VS6A 3O8VA 1AZEA 1FWZA 2J6KA 3C95A 3ME9A 1K9MC 5A0DA 3OS0A 5FLXE 3I56A 5CR2A 1M90C 5L23A 1VQPQ 4OMPA 2QI2A 1M9SA 4M75C 4C8QC 1JJ2S 2DJQA 2YUPA 5LJ3h 2XDPA 1K9AA 5HY6A 2DETA 4XAXB 1M5Q1 1D3BB 2QGGA 1X2KA 4NL3A 3S3OA 1TUCA 2ESWA 3QJYA 2K2MA 4PLIA 3JCMJ 4OB0B 2P84A 4PK4A 1WA7A 3CCJQ 1IXDA 1YP5A 3BE3A 4FW1A 1WJQA 2YUNA 1IGUA 3BW1A 4M7AG 3EG9A 4Q5WA 1IHWA 3H6ZA 4BI4A 2X4WA 3M0UA 4PJLA 1M3AA 3IQLA 3L42A 1W2BA 2KDSA 5CKDA 4C8QB 3G4SQ 4PJOC 4JRPA 5C0MA 1QWFA 1M1KU 1RAHB 3EHQA 2PVOB 4MZMA 2RHIA 2QK0A 2ZPBB 2A28A 1N5ZA 1K8AC 4X9CA 4F14A 1JJ2P 3CCMA 1T0JA 3FJ5A 1WI7A 2HSPA 4C0DB 3Q1JA 4ESRA 3DLMA 3INZA 1OU9A 2CP7A 3RKWA 4LE9A 3CPWS 3WXMB 4DBRA 2ZPHB 2XU8A 3OSVA 2W0ZA 5LJ3e 3H41A 1Y0MA 3DB4A 1YBYA 1Y57A 4PJOD 3CCSA 3OW2A 3G4ST 4B6MA 2DL3A 4PJOB 6AT1B 3F70A 4F16A 5KH6A 1UB4A 1Y96B 1XTDA 3JB9J 1PD0A 1VQ4A 2YRDA 2QYZA 2E3HA 2MK5A 2EWNA 4HXJA 4FM4B 4RKUE 5IHKA 4J6YA 1ACMB 3CCVQ 1R77A 1GCQA 2CP3A 3DB3A 3NTHA 1M4ZA 2OTJT 2A37A 4M77E 2PUOB 3CCJT 5FW9A 4JUVA 4Z88A 4C0DC 1LJOA 1WYXA 2BE7D 2FL7A 2P0QA 3M58A 1VQ8T 3CBPA 3H8ZA 2OX7A 2XD0A 1C0MA 1WHGA 4CI0C 1VQ7Q 5KYYB 1RUWA 2PU9B 1WQ7A 3CPWP 1WJRA 2L3RA 2K7AA 4ANJA 1ZSZA 5LJ3f 2V8KA 1OU8A 1WJSA 3E9FA 4JRIA 4LUEA 4ZN3A 4XU1A 1D0XA 1K9MU 1AHJB 1QCOA 1TH7A 1D09B 3SD4A 2X3WD 1N8RU 1W1FA 2WACA 2DA9A 1QVFS 1U5SA 2LP5A 5DLQE 4CC4B 4MDXA 3HTRA 3MP1A 5FWBA 2EBPA 1KJWA 2JVVA 1VIEA 4PKCC 2RH2A 3QPHA 2HSEB 3HRTA 4XK8E 1K8AR 1JXMA 3V7RA 4Z02A 3BFMA 4P5NA 1G83A 4CRIA 2VGMA 1QP2A 3RKXA 5GAOn 2RO0A 2E70A 2SRCA 5LJ5f 2LQ8A 4OMLA 4RCCA 1ZSZC 1VIFA 1N27A 4JLGA 1V76A 5FRMA 3EG1A 1EFNA 2OJ2A 1WXUA 3TEEA 1I1JA 2DXCA 2R58A 3M0RA 3VYHB 1HJDA 3NFCA 1VQKQ 3MEWA 4M77B 1PSFA 2DL4A 2YUQA 1D3BA 1M1KC 4KUDK 3EGUA 2D8HA 4FCYA 1AVZC 3S3MA 1TUDA 1YITQ 5GAN4 1SEMA 1AWWA 1ABOA 5CK9A 4A4KA 1GL5A 3JB9H 4MMLA 1EIFA 3CMAT 3PMIA 2X35A 4LXCA 2K6DA 2DRMA 4PJOE 1N9SA 5DM7R 3VV0A 1KIKA 1QVGP 3E19A 2E6NA 4DEXA 2A7YA 2DX1A 1ZHIA 4PJJA 4FSXA 2YRVA 2ED1A 3GP8A 3CCMQ 1ZSZB 2HQHA 2Y4XA 3LYIA 3EG9B 4JJDA 4C5HA 2F2VA 2OTLQ 3A8MB 4LNPA 3RUXA 2DKGA 5LJ5d 3CCUA 2DL7A 2E12A 4M77C 2JOYA 4M77G 4C8QF 3QWXX 4OMFB 2QA4Q 4Y91A 2EPDA 3QYHB 1KSWA 1OI1A 2RJEA 2O31A 2KRNA 4DBHA 5GAN5 2ATCB 5I22A 2JTMA 4OB1B 3M5AA 3A8HB 4JZ3A 4HT9A 1VA7A 4C8QE 3CMEA 4J9FA 1TOVA 2BTTA 2DEQA 2QA4A 2YDLA 2FPDA 3CC4T 1VQ4Q 4RMOA 2P0PA 5LL6S 2FZCB 4FU6A 4QVCA 1UJ0A 1QKWA 2D8JA 1ZBXA 5KYUA 2L0AA 2KSSA 3P8DA 1JBMA 2E5QA 2HNIA 3QJ6A 1G3TA 1WIEA 1VQPA 3FRNA 2DVJA 3VJPA 4J6WA 3AT1B 1M90U 5FROA 3CXCP 2ED0A 4N4GA 3CCRA 1VQ9T 1M2VA 3WVDB 4HVVA 5LJ3g 2ZZDA 2EYZA 3C94A 4OMNA 4D6WA 3JCMX 1ZUYA 2LJ0A 4JJNK 3LX7A 2HAXA 4M7DC 1X6BA 4XTXA 2XK0A 3MP6A 3HL8A 2B86A 5GAOl 2KGTA 2DD4A 1RAAB 2X4XA 2EYXA 1K0XA 4QVDA 2JM9A 3JB9D 2QQ9A 1YFNA 1AT1B 3I55A 1G3WA 3MHXA 1D1AA 1EZZB 1WHLA 3GNGA 3RERA 2CP2A 5GAOr 3I56Q 2K3XA 2V26A 1J3TA 2RI5A 3G6EQ 1GFDA 1WXBA 4LN2A 1Z9ZA 2R5MA 3CBOA 3MCAB 4M7DB 3E2UA 2PTKA 1M2VB 3HFNA 4EMHA 5AT1B 1WDXA 1PKSA 2DIGA 5D6YA 2DE0X 3PT9A 3CD6Q 1VQ7T 1YITA 4N4HA 1QLYA 2KT1A 4JS5A 3CCJA 1VQ8Q 3FC3A 3OYDA 3RDVA 2DXUA 3MP8A 1KFZA 2VV5A 2DNUA 3LLRA 4BE1A 1TUGB 1KC8U 4QQGA 1WX6A 2RQUA 3T9NA 4A4FA 1R0CB 3CCVT 3N5BB 4DQ2A 4M75G 4BE2A 2LQWA 2VUBA 2RMOA 8AT1B 1SG5A 3V8LA 1SHFA 1OPKA 2JNGA 3VRZA 4XQ3A 4M75B 2YLBA 3CMET 3NGPA 5GAN3 2FRWA 2DIQA 2RD1A 2OTLA 1FMWA 4A4GA 4BUGA 4C0ZA 2M0YA 1X2QA 2CSQA 1MHNA 2CT4A 1LPLA 2DZ9A 3GBQA 2HL3A 2EJ9A 3LH5A 1Q82C 1G3SA 4AFUC 4LDYA 2R57A 3FB9A 2J7IA 2E10A 1K8AU 3R6OA 4XU0A 2LRQA 1D1BA 4C92F 5KYXB 2HBPA 4KH1B 3J81E 2ROTA 4AG2C 3MJXA 3SEMA 1C1AA 2ABLA 3JB9G 2FVUA 4R55A 1U06A 1VYTA 3RMSA 3OSSC 1QVGS 4F7UE 3ER0A 4DOVA 1OZ2A 1OV3A 1ZA1B 4LDUA 2L3SA 2BZ8A 1UHCA 4JJBA 3KUFA 3EGDB 4EPCA 1U1TA 2A08A 4J9GA 2CS7A 3TU4K 3HFOA 2VASA 3HHTB 3TCJA 4E7ZA 1JXOA 2GTOA 2JXBA 4E7SA 3OA6A 2CH4W 3LGFA 2EJFA 2GF7A 2LTOA 1CKBA 4PFOA 4BE0A 4MDWA 1WHJA 4RTTA 3EG3A 3VS3A 2LJ3A 2MF2A 3FLGA 2EYYA 1OOTA 4A54A 5FWCA 3NMZC 1X6GA 3OB9A 1IO6A 4FIBA 1WZOA 2CDTA 5I2SA 3JAME 4F7UF 2DZCA 4C0FA 2LMJA 1M30A 4IUUA 4KH0B 1KC8C 2C0TA 4J8OA 4M77D 1VQPT 1YJWA 4PJOG 4Y92A 3CQTA 4XU3A 4X34A 1JJ2A 3NHNA 4A4EA 4EMKC 5FRNA 3VS1A 2RQTA 3V7SA 4IIMA 3E9GA 3OS5A 1H8KA 1OZ3A 5LJ5e 2AK5A 3JCMV 1S72A 3V7CA 2DF6A 4RTYA 3OYNA 2ROLA 4IUPA 4XTWA 4XTUA 5GAOp 5GANj 3GIBA 1B07A 2M51A 3UA7A 1M8MA 1RI0A 5D7UA 2NUPA 5FU6C 4PL6A 3LWHA 3I55T 3ZBDA 1UGVA 2PQWA 1XNIA 1UTIA 2CP5A 2D0QB 2EGEA 2KVQG 1VYUA 3G7ZA 3CCSQ 1LCKA 4ZGDB 4F17A 2AZVA 1NLOC 1VQ6Q 3QG1A 2RI2A 5GAN2 4C92D 3VKIA 3VS0A 4KGZB 3TQ7P 2RHZA 2GGRA 1OX9A 3CCUT 2LT1A 4OMMA 2A36A 2DAQA 4L6V5 3D7SB 2CSIA 2EKHA 1MUZA 1M2OA 5FU6B 3M0QA 2DMOA 4PJOF 2XKOC 3CC7T 1U1SA 2WSCE 2C0OA 1QVPA 3CC2Q 2E41A 4FYXB 1B3QA 1UUEA 4C0GA 2CT3A 3CCQT 1D0ZA 1YJ9T 4KBMB 2HKQB 3GLXA 2IVWA 4PNOA 2KQWA 4F7UG 1Q7YC 1UJYA 2L3PA 3NTIA 3QO3A 3A8LB 2E6ZA 5J26A 3HRSA 4C8QA 4MZPA 5GJWB 1YIJA 2VGNA 1P92A 1KK7A 1NBEB 2X51A 2JS2A 3HPWA 1SRLA 1MMNA 2AT1B 1K0SA 2FYKA 2VXEA 1VUBA 4EMKA 3H0IA 3RMQA 1Q81U 4DEYA 1WHMA 4KUIA 3ZL7C 3EFOA 5C6SA 1KQSP 2PUKB 2CZ1B 2E3IA 1WXTA 2CZ7B 3G71Q 3M0PA 1E7OA 3PVQA 2L8DA 3H0FA 1VQMQ 3QBYA 4D8DA 2AIRB 2DK3A 1O75A 2E4HA 2RI3A 5A0GA 4OP0A 2EQMA 2NUZA 4RTZA 3H0HA 1MMDA 3KFVA 1KC8R 3QUIA 4FYVB 3A5ZB 4M7AC 3L1AA 2DILA 4M7DF 2RA2A 5I11A 4C92G 4C92C 4KGXB 1WHKA 1RACB 2RB6A 5A0LA 1YIJT 2JTEA 5LJ3d 3S6WA 1W4SA 3OYLA 1VQLT 2DTIA 2OI3A 1UG1A 2FEIA 4GY5A 1GFCA 4QQDA 1AWXA 3OMCA 3MEUA 3EHRA 1BCMA 1JQQA 1VQ6T 3CCLT 4BDZA
chains in the Genus database with same CATH topology
1KD1R 1VQMQ 3I55Q 1N8RR 3CC4Q 3CCSQ 1JJ2P 3CCEQ 1YJ9Q 2OTLQ 2QEXQ 1M1KR 1VQPQ 3CMEQ 1K8AR 3CCJQ 1QVFP 1YI2Q 1VQ6Q 3G4SQ 3CD6Q 1VQKQ 3OW2P 3I56Q 1W2BP 1Q7YR 1KQSP 1KC8R 3CC7Q 2OTJQ 3CCRQ 1VQNQ 3CMAQ 3CXCP 1YIJQ 1QVGP 1NJIR 1VQ4Q 1VQLQ 1Q86R 2QA4Q 1YJNQ 3CCQQ 1VQ7Q 1K73R 1K9MR 3CCUQ 1VQ8Q 3CC2Q 3CCLQ 1YITQ 1S72Q 1VQ5Q 1VQ9Q 3CPWP 3G6EQ 3G71Q 1Q81R 1Q82R 1YHQQ 1YJWQ 3CCVQ 3CCMQ 1M90R 1VQOQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KD1 R;  1VQM Q;  3I55 Q;  1N8R R;  3CC4 Q;  3CCS Q;  1JJ2 P;  3CCE Q;  1YJ9 Q;  2OTL Q;  2QEX Q;  1M1K R;  1VQP Q;  3CME Q;  1K8A R;  3CCJ Q;  1QVF P;  1YI2 Q;  1VQ6 Q;  3G4S Q;  3CD6 Q;  1VQK Q;  3OW2 P;  3I56 Q;  1W2B P;  1Q7Y R;  1KQS P;  1KC8 R;  3CC7 Q;  2OTJ Q;  3CCR Q;  1VQN Q;  3CMA Q;  3CXC P;  1YIJ Q;  1QVG P;  1NJI R;  1VQ4 Q;  1VQL Q;  1Q86 R;  2QA4 Q;  1YJN Q;  3CCQ Q;  1VQ7 Q;  1K73 R;  1K9M R;  3CCU Q;  1VQ8 Q;  3CC2 Q;  3CCL Q;  1YIT Q;  1S72 Q;  1VQ5 Q;  1VQ9 Q;  3CPW P;  3G6E Q;  3G71 Q;  1Q81 R;  1Q82 R;  1YHQ Q;  1YJW Q;  3CCV Q;  3CCM Q;  1M90 R;  1VQO Q; 
#chains in the Genus database with same CATH topology
 4LD9 K;  1A0N B;  3A8G B;  3OYG A;  3SWN A;  1KQS S;  4M7D G;  3CCE Q;  1GXI E;  2KRS A;  1M1G A;  4QW2 A;  3OY9 A;  1YCS B;  3C0C A;  2Y90 A;  4OB2 B;  4PLL A;  4M75 F;  1Y07 A;  5GAM g;  1YCY A;  4LDV A;  4M7A B;  1BYM A;  2RQV A;  3GPL A;  1Q82 R;  2MOX A;  3EFR A;  5KCH A;  4R56 A;  1YHQ Q;  2KNB B;  1NLP C;  4M7A E;  4RTX A;  3EG0 A;  1NJI U;  1H92 A;  2SEM A;  1NJI C;  3EH1 A;  1QVF A;  1M1F A;  2GQV A;  4B9X A;  4ZN1 A;  1U3O A;  3OYB A;  5CKB A;  2BE9 B;  3UA6 A;  2XIC A;  2VB6 A;  3KXT A;  1M90 R;  4QKU A;  2DL8 A;  3QWY A;  4FT4 A;  5GAM e;  3M57 A;  1G3Y A;  2KR3 A;  3VYG A;  5FU7 B;  2QQS A;  5IH2 A;  1M1K R;  1YI2 T;  1AEY A;  2Z0W A;  1WNL A;  3M4Y A;  4E6R A;  1R8O B;  3JB9 I;  2OTJ A;  3CCR Q;  1BI0 A;  4J6X A;  3SB2 A;  2K5F A;  1K4U S;  5GAN 7;  1S1N A;  5KYW B;  1VQ5 Q;  2HDA A;  1YN8 A;  2YLC A;  3RNJ A;  3OBY A;  5D6W A;  2WSF E;  1VQ7 A;  2ZPI B;  2G6F X;  1WFW A;  3OYK A;  5LJ3 j;  3HP9 A;  3SWN B;  1X6O A;  1WHH A;  2A0F B;  4FYW B;  1UHF A;  1TXQ A;  1EX4 A;  1M3C A;  2PVD B;  4F7U A;  4EIK A;  3M56 A;  1YWO A;  2E5K A;  2QQR A;  2QEX T;  2X3X D;  4BI8 B;  3VS7 A;  2MAM A;  2DRK A;  2O2O A;  3FEO A;  1N8R R;  4RCB A;  1E6G A;  4C92 E;  1ARK A;  3QZ5 B;  2C0I A;  2QQA A;  1MGQ A;  3L2U A;  1YJN Q;  2D6F A;  1LOJ A;  2EYW A;  3PIP A;  1H3H A;  4HA8 A;  2GQI A;  3MEA A;  3QII A;  1PSE A;  3MEV A;  5LJ5 j;  1KD1 R;  1UE9 A;  5KE3 A;  3JCM d;  3PFS A;  1I8F A;  1BI3 A;  1C6V X;  2A3L A;  3OBW A;  5J3B A;  2L5Q A;  3EG2 A;  3CEY A;  2RK1 A;  3JSC A;  3A98 A;  2M16 A;  3QKJ A;  1RAF B;  1Q86 C;  3OYE A;  2COY A;  3JRZ A;  1KG1 A;  1CKA A;  9ATC B;  1V29 B;  1W2B P;  2BZY A;  4V2S A;  2YRC A;  3RES A;  1IB8 A;  4J9I A;  2MCN A;  3MPU B;  5CKH A;  1QP3 A;  4EMG A;  3A8O B;  1AZG B;  5IXB A;  1VQK A;  2KXD A;  4A63 B;  4AFS C;  4KGV B;  2LNH B;  4M77 F;  4C8Q G;  4D8K A;  1ZLM A;  4OGE A;  2RNA A;  1GRI A;  1OUL A;  2DTO A;  1UEB A;  4M78 A;  2RM4 A;  5D6X A;  3X20 B;  2O9S A;  5CCA A;  1PG5 B;  1MNE A;  1W2B S;  3CME Q;  3G1J A;  1YI2 Q;  1IZ6 A;  4ELZ C;  4JZ4 A;  3SDZ A;  3URG A;  4J83 A;  7AT1 B;  4XTV A;  2DPP B;  1JRI A;  1AD5 A;  1TWB A;  5GAN 8;  3DKM A;  5IHI A;  4NOY A;  1ZBJ A;  1ZSG A;  4PFP A;  3H9N A;  4HVU A;  3CXC A;  2VKN A;  3EGX B;  1PHT A;  2FB7 A;  3THK A;  3KBG A;  2YSQ A;  2R5A A;  1HSQ A;  2RQR A;  2ENM A;  4AT1 B;  1G2B A;  5GJV B;  1XQH A;  3CPW A;  3BDL A;  1DJ7 B;  4BB7 A;  1JEG A;  2FZG B;  2DBM A;  4M77 A;  1PRL C;  1PNJ A;  2KT8 A;  4LDX A;  2MMP A;  3OS2 A;  4LUD A;  2DLP A;  3TVT A;  3OYI A;  1RI9 A;  3OYC A;  3G6E T;  2ZPG B;  4OVA A;  5GMK m;  2RJC A;  3OMG A;  3CBM A;  4K11 A;  2XHC A;  3LWI A;  4HCC A;  2J05 A;  3VS4 A;  3LGL A;  1HXD A;  4EMK B;  5GAN 6;  3I56 T;  3CCL Q;  1AWJ A;  3ZEH A;  4KRT A;  2QTV A;  2MI6 A;  2OAU A;  5GAN d;  1N9R A;  2CUD A;  4NL2 A;  2KYM A;  1OEB A;  3R6N A;  2M02 A;  2XI9 A;  2JZ2 A;  4HKE A;  4M78 B;  3JCM f;  4R0K A;  4CC3 A;  4ZNX A;  4N4I A;  1K73 U;  1YIJ Q;  1OPL A;  1R0B G;  2RN8 A;  1Q86 R;  3X25 B;  3CMA A;  3EGD A;  1VQ5 T;  2K9G A;  2CUB A;  1Z9Q A;  5I2M A;  2I0N A;  4M75 D;  3CCR T;  1I81 A;  1QVG A;  1VQ9 A;  2CKK A;  2PVG B;  5L8R E;  4DOW A;  4HCK A;  2EQU A;  1VOM A;  4IUR A;  4B9W A;  2KE9 A;  4CC7 A;  2V8I A;  2HQX A;  1VQO A;  2QG9 B;  2X4Y A;  2K5L A;  2O4X A;  1VQM A;  1X43 A;  2DM1 A;  2JT4 A;  3C4S A;  2C06 A;  3QDR B;  2B8A A;  4BD3 A;  3JCM b;  2P0K A;  3MKD A;  1TS9 A;  4IIO A;  3CXC S;  4PJM A;  2E64 A;  5HK3 A;  4M4Z A;  3JCM e;  4KT0 E;  3UPU A;  1NM7 A;  2GNC A;  2MWP A;  4BI3 A;  1I5O B;  4J9H A;  5IAY A;  3JCM Q;  3OS1 A;  2LQK A;  2AZS A;  5J39 A;  2JTF A;  1T3L A;  4CC2 A;  1K73 R;  1SSF A;  4J9E A;  1UGQ B;  1UGR B;  3OYA A;  4C5G A;  4FYY B;  1Q95 G;  2DD5 A;  4DBQ A;  2RQW A;  5ECA A;  1WGS A;  5HK0 A;  4KUL A;  1UEC A;  4RG2 A;  3CCE T;  1V1C A;  5KYW A;  2RHX A;  3JCM W;  2F5K A;  3CCQ Q;  2XMF A;  3V8K A;  2QGF B;  2AKK A;  1RAD B;  1TU0 B;  2F69 A;  1D1C A;  1QW1 A;  1KQ2 A;  2W10 A;  3VUB A;  2HZY A;  3PIO A;  2F1L A;  1IRX A;  1NYG A;  4GLK A;  1BU1 A;  2HL5 C;  5IHN A;  2E1H A;  5GAO q;  1UFF A;  3CCU Q;  4ORZ A;  4QQ6 A;  2FPE A;  2LCC A;  4PJN A;  2KY9 A;  2H3E B;  2YT6 A;  4M78 D;  2D0N A;  4UC4 A;  3PE0 A;  5KYX A;  2GCX A;  2H8H A;  3CCS T;  2EVR A;  3M0S A;  3EGX A;  3J80 E;  3G71 T;  3ZFJ A;  2XDB A;  2EW3 A;  2K4Y A;  1VQL A;  4O6J A;  4J7I A;  3M0T A;  2HMA A;  5GAO m;  1BI1 A;  1FMV A;  1GBR A;  2M1H A;  1QVF P;  4FL6 A;  2KXC A;  2CRE A;  4C92 B;  4XU2 A;  1MV0 B;  1K76 A;  3OW2 S;  4M7D E;  1H3Z A;  2CGH A;  2FO0 A;  2YUO A;  2QAS A;  2MWO A;  4GBQ A;  2PNI A;  1OYX A;  3BDU A;  4JRQ A;  1O9S A;  4OB3 B;  3PVL A;  4JLI A;  5GAM f;  1Q7Y U;  2M0O A;  4FW2 A;  2QDY B;  4M7A F;  1E6H A;  2DYB A;  1QWE A;  1BB9 A;  4M78 E;  2VXF A;  3OYF A;  2JN0 A;  2LX7 A;  2DL5 A;  3SFM A;  4JJC A;  2O01 E;  2MPX C;  1X69 A;  4M7D D;  2ECZ A;  2EYQ A;  3UDC A;  2FZK B;  2O88 A;  3GNF B;  5GMK i;  3NTK A;  1I07 A;  1I4K 1;  1BCO A;  2EAY A;  3CC7 A;  4M7A A;  3L2Q A;  2BKD N;  4YTL A;  5EC7 A;  1G5V A;  3LH0 A;  2L89 A;  2Y4Y A;  2HBW A;  1KHI A;  1FX7 A;  5LJ5 h;  4OMQ A;  1OQK A;  3X26 B;  1G8X A;  1PRM C;  4ZTJ A;  4M75 A;  1BIA A;  3MO8 A;  4ZTF A;  3M55 A;  3CCE A;  5DLO A;  4LD6 A;  2LQN A;  2KBT A;  1BIB A;  1VQN A;  4HCZ A;  4O5V A;  1NG2 A;  3EAE A;  3RKY A;  4OMO A;  1PD1 A;  1ZA2 B;  4C92 A;  3GF5 A;  4DA4 A;  1LVK A;  4M78 F;  5FU7 C;  1X27 A;  2K5I A;  2LX9 A;  1UDL A;  3CD6 A;  2COZ A;  3UF4 A;  5A2Q E;  2JMA A;  4Y28 E;  2AKL A;  3I55 Q;  2DFU A;  3O5Z A;  1SRM A;  2EJG A;  4JRK A;  3QHS A;  2DBK A;  1RLQ C;  2V8J A;  1SKU B;  1FXX A;  1TSF A;  3DLL A;  1KHC A;  1D0Y A;  2WSE E;  2JW4 A;  2F2W A;  2KMT A;  1ZX6 A;  4M7D A;  1WQW A;  2O9V A;  3SWN C;  5DY9 A;  3UT1 A;  2MYS A;  5I21 A;  3P8H A;  1MMA A;  5CQX A;  2YHT A;  2DTH A;  1FMK A;  2K2V A;  2CYZ B;  8ATC B;  4MZT A;  4X1V A;  4C5E A;  4ELY C;  1N6A A;  2DO3 A;  1Q82 U;  4ME7 A;  1WLP B;  2BUD A;  4QVZ A;  4QT7 A;  4HVW A;  2EQI A;  3VRY A;  1RL2 A;  1YI2 A;  3TSZ A;  2DYI A;  5GAM j;  2RK2 A;  3PGG A;  1QMC A;  5GMK j;  1HD3 A;  1XJW B;  4C8Q D;  3I9Q A;  1FYN A;  2K79 A;  5HKC A;  2JM8 A;  2IPO B;  2BZX A;  2GTJ A;  3QYG B;  4IUT A;  2DXB A;  4JS4 A;  3CCL A;  3A1P A;  4M7A D;  2KRM A;  3QXE B;  4ZGJ B;  2LCL A;  2QXF A;  4TVR A;  3RIR A;  2NUP B;  2QAZ A;  4JDS A;  1TTH B;  4ATO A;  2KI7 A;  3E1S A;  4RG8 A;  3PMT A;  1KD1 C;  1AWO A;  4A4H A;  4IKF A;  3BY7 A;  2COW A;  2EQJ A;  1NPP A;  2JMC A;  3VUZ A;  1YJN T;  2LJ1 A;  1TG0 A;  4A53 A;  2RHU A;  5IT9 E;  3NPF A;  4RTV A;  3I5R A;  1SF9 A;  4OGC A;  1K9M R;  3ASK A;  3OYH A;  2PZ1 A;  1IHV A;  4N0A C;  5GAN e;  5GMK l;  2O4X B;  3CC4 A;  3M59 A;  1RAB B;  1RAI B;  2QEX Q;  3RR6 A;  1KQ1 A;  2EGC A;  1WPY A;  1PC0 A;  2X4J A;  4IUV A;  2ZPE B;  3JCM P;  1XOV A;  1T3S A;  5GMK h;  2XDD A;  4Z89 A;  5IXF A;  2LC4 A;  4F04 B;  1T0H A;  4BAC A;  2P4T A;  2QTX A;  5CVI A;  1F1B B;  3TRE A;  3RBB B;  2VWF A;  2VC8 A;  2RJF A;  3REB B;  1SPK A;  4RTW A;  2LT4 A;  5GAM d;  3VS2 A;  3QDF A;  1CSK A;  1NE8 A;  1VQ6 A;  4IUQ A;  1RLP C;  3EFO B;  3OYM A;  2HKN A;  2M9U A;  1H64 1;  3I35 A;  1K1Z A;  2FRY A;  3M54 A;  3OYJ A;  2V1R A;  4NS5 A;  3G6E A;  1ZUK A;  1RAG B;  3VU3 C;  5GAN f;  3EH2 A;  1YNZ A;  4BDY A;  4X9D A;  3QZ9 B;  5GAM h;  3FJP A;  4AFQ C;  2DEU A;  1IRE B;  1S72 T;  1NPR A;  1GCQ C;  1PCX A;  2YWW A;  3L2R A;  1AOJ A;  3OYY A;  3CCQ A;  5GAN g;  1VQN T;  2D9T A;  5GAN h;  4M78 C;  4E7H A;  3CC2 A;  2I2L A;  5KCO A;  1YWP A;  3VS5 A;  2HCK A;  1UGS B;  3C12 A;  3HKS A;  1VQ4 T;  1Q86 U;  1PKT A;  2EGA A;  4FSS A;  1JO8 A;  4E7K A;  3CD6 T;  1YHQ T;  5KYN A;  1YJW T;  2F2X A;  2EIF A;  2KAF A;  2F5T X;  1W70 A;  3M9Q A;  1M27 C;  2GBQ A;  4XTZ A;  2LVM A;  1N8R C;  2QDL A;  1X75 C;  2JJ9 A;  2GFA A;  5CO7 A;  2KK4 A;  1MND A;  1QKX A;  1VQO T;  2LDM A;  2RPN A;  2MIO A;  4Z8A A;  2RJD A;  2IG0 A;  4WF2 A;  2OTL T;  4VUB A;  4E7J A;  1B7T A;  3V8J A;  1VQL Q;  5EG2 A;  2H3J A;  3CCM T;  2L3Q A;  2CP6 A;  4OF1 A;  2CZ0 B;  1MV3 A;  2ZCF B;  3L2Z A;  2QQB A;  2AHJ B;  3JCM h;  4RTU A;  4FT2 A;  3L2W A;  2NLU A;  4MMK A;  3JCM g;  2D1X A;  1NEG A;  1M8V A;  2RHY A;  2V1Q A;  2QEX A;  4L59 A;  2YXY A;  3CMA Q;  3L2V A;  2K57 A;  3JB9 F;  4RUG A;  2J6O A;  3FIF A;  1YIT T;  1JU5 C;  3M4G A;  1VQ9 Q;  3CPF A;  2JUF A;  2OAW A;  4XTY A;  5CAI A;  1VQM T;  5KYY A;  2HEQ A;  2CH4 A;  1VQK T;  4GLM A;  1U8R A;  2ZGW A;  2J6F A;  3SHW A;  1ZQ1 A;  3UAT A;  3UWN A;  1B34 A;  4J9D A;  4M78 G;  4AG1 C;  3JV3 A;  3OW2 P;  1BK2 A;  1Q7Y R;  1Q81 C;  2HD0 A;  2VVK A;  1NYF A;  2ZAE A;  3FDR A;  4AMC A;  5KE2 A;  2FG0 A;  4C5I A;  1HYO A;  3TSW A;  1NZ9 A;  5LJ5 g;  5CKF A;  2LZ6 B;  3X28 B;  1QQJ A;  2K3B A;  5HCK A;  3CC4 Q;  2VYT A;  3G71 A;  1JB0 E;  4F7U B;  2EKO A;  2DXT A;  5M9O A;  1Y96 A;  3J7A F;  2P4R A;  4N0A A;  1YJ9 A;  2EFI A;  3MET A;  2BIV A;  2E65 A;  4PJO A;  1Y71 A;  1LNX A;  3G4S A;  3ULR B;  1ZUU A;  3LW5 E;  2IIM A;  2CP0 A;  1VYV A;  2QA4 T;  1VQO Q;  1RAE B;  1PWT A;  1YJN A;  2LCS A;  1YJ9 Q;  3QSU A;  4HT8 A;  5IN1 A;  3HSB A;  2DJZ A;  2NYS A;  3CC2 T;  3JCM c;  1UGP B;  3CC7 Q;  4BY6 C;  1X01 A;  4M75 E;  2L2P A;  1BI2 A;  1HK9 A;  1VQ8 A;  1YJW Q;  1GBQ A;  2FHD A;  5CQY A;  2GFU A;  4ZGE B;  4E7I A;  3OQ5 A;  3M53 A;  3REA B;  3S3N A;  3P8B B;  5AYF A;  4EDU A;  1PM3 A;  1OX8 A;  2FPF A;  2KRO A;  5CIU A;  2KEA A;  4DBF A;  1BKB A;  3PNW C;  5KYU B;  1GCP A;  2HQE A;  2XID A;  2OTJ Q;  1SHG A;  3GOX A;  2X9H A;  1VQN Q;  4WTO B;  2JS0 A;  1QCF A;  2DVE A;  2EQK A;  1S72 Q;  2ZPF B;  1IGQ A;  1I0C A;  5GMK e;  2KYB A;  2NWM A;  4J7F A;  1M3B A;  5CKE A;  2NUT A;  1KQS A;  4AFZ C;  1W6X A;  4E2F B;  2G3R A;  2LNV A;  1SSH A;  4LDW A;  1QCN A;  2DER A;  4E47 A;  4J5Y A;  2J06 A;  4BY6 B;  4PFZ A;  1NEB A;  1Q81 R;  3AHU A;  3WVE B;  3X24 B;  1B34 B;  1Y7X A;  3U23 A;  4WCI A;  1MMG A;  2CZ6 B;  4II1 A;  4HCB A;  2NUT B;  1BBZ A;  3HRU A;  4JPB W;  2XG8 D;  1K73 C;  1VQ5 A;  3I5S A;  4J9B A;  1NJI R;  4J9C A;  1ABQ A;  4E7L A;  3CCV A;  1KD1 U;  4L5G A;  3PTA A;  2RF0 A;  3EFS A;  1YHQ A;  2K3Y A;  1I5L A;  3VS6 A;  3O8V A;  1AZE A;  1FWZ A;  2J6K A;  3C95 A;  3ME9 A;  1K9M C;  5A0D A;  3OS0 A;  5FLX E;  3I56 A;  5CR2 A;  1M90 C;  5L23 A;  1VQP Q;  4OMP A;  2QI2 A;  1M9S A;  4M75 C;  4C8Q C;  1JJ2 S;  2DJQ A;  2YUP A;  5LJ3 h;  2XDP A;  1K9A A;  5HY6 A;  2DET A;  4XAX B;  1M5Q 1;  1D3B B;  2QGG A;  1X2K A;  4NL3 A;  3S3O A;  1TUC A;  2ESW A;  3QJY A;  2K2M A;  4PLI A;  3JCM J;  4OB0 B;  2P84 A;  4PK4 A;  1WA7 A;  3CCJ Q;  1IXD A;  1YP5 A;  3BE3 A;  4FW1 A;  1WJQ A;  2YUN A;  1IGU A;  3BW1 A;  4M7A G;  3EG9 A;  4Q5W A;  1IHW A;  3H6Z A;  4BI4 A;  2X4W A;  3M0U A;  4PJL A;  1M3A A;  3IQL A;  3L42 A;  1W2B A;  2KDS A;  5CKD A;  4C8Q B;  3G4S Q;  4PJO C;  4JRP A;  5C0M A;  1QWF A;  1M1K U;  1RAH B;  3EHQ A;  2PVO B;  4MZM A;  2RHI A;  2QK0 A;  2ZPB B;  2A28 A;  1N5Z A;  1K8A C;  4X9C A;  4F14 A;  1JJ2 P;  3CCM A;  1T0J A;  3FJ5 A;  1WI7 A;  2HSP A;  4C0D B;  3Q1J A;  4ESR A;  3DLM A;  3INZ A;  1OU9 A;  2CP7 A;  3RKW A;  4LE9 A;  3CPW S;  3WXM B;  4DBR A;  2ZPH B;  2XU8 A;  3OSV A;  2W0Z A;  5LJ3 e;  3H41 A;  1Y0M A;  3DB4 A;  1YBY A;  1Y57 A;  4PJO D;  3CCS A;  3OW2 A;  3G4S T;  4B6M A;  2DL3 A;  4PJO B;  6AT1 B;  3F70 A;  4F16 A;  5KH6 A;  1UB4 A;  1Y96 B;  1XTD A;  3JB9 J;  1PD0 A;  1VQ4 A;  2YRD A;  2QYZ A;  2E3H A;  2MK5 A;  2EWN A;  4HXJ A;  4FM4 B;  4RKU E;  5IHK A;  4J6Y A;  1ACM B;  3CCV Q;  1R77 A;  1GCQ A;  2CP3 A;  3DB3 A;  3NTH A;  1M4Z A;  2OTJ T;  2A37 A;  4M77 E;  2PUO B;  3CCJ T;  5FW9 A;  4JUV A;  4Z88 A;  4C0D C;  1LJO A;  1WYX A;  2BE7 D;  2FL7 A;  2P0Q A;  3M58 A;  1VQ8 T;  3CBP A;  3H8Z A;  2OX7 A;  2XD0 A;  1C0M A;  1WHG A;  4CI0 C;  1VQ7 Q;  5KYY B;  1RUW A;  2PU9 B;  1WQ7 A;  3CPW P;  1WJR A;  2L3R A;  2K7A A;  4ANJ A;  1ZSZ A;  5LJ3 f;  2V8K A;  1OU8 A;  1WJS A;  3E9F A;  4JRI A;  4LUE A;  4ZN3 A;  4XU1 A;  1D0X A;  1K9M U;  1AHJ B;  1QCO A;  1TH7 A;  1D09 B;  3SD4 A;  2X3W D;  1N8R U;  1W1F A;  2WAC A;  2DA9 A;  1QVF S;  1U5S A;  2LP5 A;  5DLQ E;  4CC4 B;  4MDX A;  3HTR A;  3MP1 A;  5FWB A;  2EBP A;  1KJW A;  2JVV A;  1VIE A;  4PKC C;  2RH2 A;  3QPH A;  2HSE B;  3HRT A;  4XK8 E;  1K8A R;  1JXM A;  3V7R A;  4Z02 A;  3BFM A;  4P5N A;  1G83 A;  4CRI A;  2VGM A;  1QP2 A;  3RKX A;  5GAO n;  2RO0 A;  2E70 A;  2SRC A;  5LJ5 f;  2LQ8 A;  4OML A;  4RCC A;  1ZSZ C;  1VIF A;  1N27 A;  4JLG A;  1V76 A;  5FRM A;  3EG1 A;  1EFN A;  2OJ2 A;  1WXU A;  3TEE A;  1I1J A;  2DXC A;  2R58 A;  3M0R A;  3VYH B;  1HJD A;  3NFC A;  1VQK Q;  3MEW A;  4M77 B;  1PSF A;  2DL4 A;  2YUQ A;  1D3B A;  1M1K C;  4KUD K;  3EGU A;  2D8H A;  4FCY A;  1AVZ C;  3S3M A;  1TUD A;  1YIT Q;  5GAN 4;  1SEM A;  1AWW A;  1ABO A;  5CK9 A;  4A4K A;  1GL5 A;  3JB9 H;  4MML A;  1EIF A;  3CMA T;  3PMI A;  2X35 A;  4LXC A;  2K6D A;  2DRM A;  4PJO E;  1N9S A;  5DM7 R;  3VV0 A;  1KIK A;  1QVG P;  3E19 A;  2E6N A;  4DEX A;  2A7Y A;  2DX1 A;  1ZHI A;  4PJJ A;  4FSX A;  2YRV A;  2ED1 A;  3GP8 A;  3CCM Q;  1ZSZ B;  2HQH A;  2Y4X A;  3LYI A;  3EG9 B;  4JJD A;  4C5H A;  2F2V A;  2OTL Q;  3A8M B;  4LNP A;  3RUX A;  2DKG A;  5LJ5 d;  3CCU A;  2DL7 A;  2E12 A;  4M77 C;  2JOY A;  4M77 G;  4C8Q F;  3QWX X;  4OMF B;  2QA4 Q;  4Y91 A;  2EPD A;  3QYH B;  1KSW A;  1OI1 A;  2RJE A;  2O31 A;  2KRN A;  4DBH A;  5GAN 5;  2ATC B;  5I22 A;  2JTM A;  4OB1 B;  3M5A A;  3A8H B;  4JZ3 A;  4HT9 A;  1VA7 A;  4C8Q E;  3CME A;  4J9F A;  1TOV A;  2BTT A;  2DEQ A;  2QA4 A;  2YDL A;  2FPD A;  3CC4 T;  1VQ4 Q;  4RMO A;  2P0P A;  5LL6 S;  2FZC B;  4FU6 A;  4QVC A;  1UJ0 A;  1QKW A;  2D8J A;  1ZBX A;  5KYU A;  2L0A A;  2KSS A;  3P8D A;  1JBM A;  2E5Q A;  2HNI A;  3QJ6 A;  1G3T A;  1WIE A;  1VQP A;  3FRN A;  2DVJ A;  3VJP A;  4J6W A;  3AT1 B;  1M90 U;  5FRO A;  3CXC P;  2ED0 A;  4N4G A;  3CCR A;  1VQ9 T;  1M2V A;  3WVD B;  4HVV A;  5LJ3 g;  2ZZD A;  2EYZ A;  3C94 A;  4OMN A;  4D6W A;  3JCM X;  1ZUY A;  2LJ0 A;  4JJN K;  3LX7 A;  2HAX A;  4M7D C;  1X6B A;  4XTX A;  2XK0 A;  3MP6 A;  3HL8 A;  2B86 A;  5GAO l;  2KGT A;  2DD4 A;  1RAA B;  2X4X A;  2EYX A;  1K0X A;  4QVD A;  2JM9 A;  3JB9 D;  2QQ9 A;  1YFN A;  1AT1 B;  3I55 A;  1G3W A;  3MHX A;  1D1A A;  1EZZ B;  1WHL A;  3GNG A;  3RER A;  2CP2 A;  5GAO r;  3I56 Q;  2K3X A;  2V26 A;  1J3T A;  2RI5 A;  3G6E Q;  1GFD A;  1WXB A;  4LN2 A;  1Z9Z A;  2R5M A;  3CBO A;  3MCA B;  4M7D B;  3E2U A;  2PTK A;  1M2V B;  3HFN A;  4EMH A;  5AT1 B;  1WDX A;  1PKS A;  2DIG A;  5D6Y A;  2DE0 X;  3PT9 A;  3CD6 Q;  1VQ7 T;  1YIT A;  4N4H A;  1QLY A;  2KT1 A;  4JS5 A;  3CCJ A;  1VQ8 Q;  3FC3 A;  3OYD A;  3RDV A;  2DXU A;  3MP8 A;  1KFZ A;  2VV5 A;  2DNU A;  3LLR A;  4BE1 A;  1TUG B;  1KC8 U;  4QQG A;  1WX6 A;  2RQU A;  3T9N A;  4A4F A;  1R0C B;  3CCV T;  3N5B B;  4DQ2 A;  4M75 G;  4BE2 A;  2LQW A;  2VUB A;  2RMO A;  8AT1 B;  1SG5 A;  3V8L A;  1SHF A;  1OPK A;  2JNG A;  3VRZ A;  4XQ3 A;  4M75 B;  2YLB A;  3CME T;  3NGP A;  5GAN 3;  2FRW A;  2DIQ A;  2RD1 A;  2OTL A;  1FMW A;  4A4G A;  4BUG A;  4C0Z A;  2M0Y A;  1X2Q A;  2CSQ A;  1MHN A;  2CT4 A;  1LPL A;  2DZ9 A;  3GBQ A;  2HL3 A;  2EJ9 A;  3LH5 A;  1Q82 C;  1G3S A;  4AFU C;  4LDY A;  2R57 A;  3FB9 A;  2J7I A;  2E10 A;  1K8A U;  3R6O A;  4XU0 A;  2LRQ A;  1D1B A;  4C92 F;  5KYX B;  2HBP A;  4KH1 B;  3J81 E;  2ROT A;  4AG2 C;  3MJX A;  3SEM A;  1C1A A;  2ABL A;  3JB9 G;  2FVU A;  4R55 A;  1U06 A;  1VYT A;  3RMS A;  3OSS C;  1QVG S;  4F7U E;  3ER0 A;  4DOV A;  1OZ2 A;  1OV3 A;  1ZA1 B;  4LDU A;  2L3S A;  2BZ8 A;  1UHC A;  4JJB A;  3KUF A;  3EGD B;  4EPC A;  1U1T A;  2A08 A;  4J9G A;  2CS7 A;  3TU4 K;  3HFO A;  2VAS A;  3HHT B;  3TCJ A;  4E7Z A;  1JXO A;  2GTO A;  2JXB A;  4E7S A;  3OA6 A;  2CH4 W;  3LGF A;  2EJF A;  2GF7 A;  2LTO A;  1CKB A;  4PFO A;  4BE0 A;  4MDW A;  1WHJ A;  4RTT A;  3EG3 A;  3VS3 A;  2LJ3 A;  2MF2 A;  3FLG A;  2EYY A;  1OOT A;  4A54 A;  5FWC A;  3NMZ C;  1X6G A;  3OB9 A;  1IO6 A;  4FIB A;  1WZO A;  2CDT A;  5I2S A;  3JAM E;  4F7U F;  2DZC A;  4C0F A;  2LMJ A;  1M30 A;  4IUU A;  4KH0 B;  1KC8 C;  2C0T A;  4J8O A;  4M77 D;  1VQP T;  1YJW A;  4PJO G;  4Y92 A;  3CQT A;  4XU3 A;  4X34 A;  1JJ2 A;  3NHN A;  4A4E A;  4EMK C;  5FRN A;  3VS1 A;  2RQT A;  3V7S A;  4IIM A;  3E9G A;  3OS5 A;  1H8K A;  1OZ3 A;  5LJ5 e;  2AK5 A;  3JCM V;  1S72 A;  3V7C A;  2DF6 A;  4RTY A;  3OYN A;  2ROL A;  4IUP A;  4XTW A;  4XTU A;  5GAO p;  5GAN j;  3GIB A;  1B07 A;  2M51 A;  3UA7 A;  1M8M A;  1RI0 A;  5D7U A;  2NUP A;  5FU6 C;  4PL6 A;  3LWH A;  3I55 T;  3ZBD A;  1UGV A;  2PQW A;  1XNI A;  1UTI A;  2CP5 A;  2D0Q B;  2EGE A;  2KVQ G;  1VYU A;  3G7Z A;  3CCS Q;  1LCK A;  4ZGD B;  4F17 A;  2AZV A;  1NLO C;  1VQ6 Q;  3QG1 A;  2RI2 A;  5GAN 2;  4C92 D;  3VKI A;  3VS0 A;  4KGZ B;  3TQ7 P;  2RHZ A;  2GGR A;  1OX9 A;  3CCU T;  2LT1 A;  4OMM A;  2A36 A;  2DAQ A;  4L6V 5;  3D7S B;  2CSI A;  2EKH A;  1MUZ A;  1M2O A;  5FU6 B;  3M0Q A;  2DMO A;  4PJO F;  2XKO C;  3CC7 T;  1U1S A;  2WSC E;  2C0O A;  1QVP A;  3CC2 Q;  2E41 A;  4FYX B;  1B3Q A;  1UUE A;  4C0G A;  2CT3 A;  3CCQ T;  1D0Z A;  1YJ9 T;  4KBM B;  2HKQ B;  3GLX A;  2IVW A;  4PNO A;  2KQW A;  4F7U G;  1Q7Y C;  1UJY A;  2L3P A;  3NTI A;  3QO3 A;  3A8L B;  2E6Z A;  5J26 A;  3HRS A;  4C8Q A;  4MZP A;  5GJW B;  1YIJ A;  2VGN A;  1P92 A;  1KK7 A;  1NBE B;  2X51 A;  2JS2 A;  3HPW A;  1SRL A;  1MMN A;  2AT1 B;  1K0S A;  2FYK A;  2VXE A;  1VUB A;  4EMK A;  3H0I A;  3RMQ A;  1Q81 U;  4DEY A;  1WHM A;  4KUI A;  3ZL7 C;  3EFO A;  5C6S A;  1KQS P;  2PUK B;  2CZ1 B;  2E3I A;  1WXT A;  2CZ7 B;  3G71 Q;  3M0P A;  1E7O A;  3PVQ A;  2L8D A;  3H0F A;  1VQM Q;  3QBY A;  4D8D A;  2AIR B;  2DK3 A;  1O75 A;  2E4H A;  2RI3 A;  5A0G A;  4OP0 A;  2EQM A;  2NUZ A;  4RTZ A;  3H0H A;  1MMD A;  3KFV A;  1KC8 R;  3QUI A;  4FYV B;  3A5Z B;  4M7A C;  3L1A A;  2DIL A;  4M7D F;  2RA2 A;  5I11 A;  4C92 G;  4C92 C;  4KGX B;  1WHK A;  1RAC B;  2RB6 A;  5A0L A;  1YIJ T;  2JTE A;  5LJ3 d;  3S6W A;  1W4S A;  3OYL A;  1VQL T;  2DTI A;  2OI3 A;  1UG1 A;  2FEI A;  4GY5 A;  1GFC A;  4QQD A;  1AWX A;  3OMC A;  3MEU A;  3EHR A;  1BCM A;  1JQQ A;  1VQ6 T;  3CCL T;  4BDZ A; 
#chains in the Genus database with same CATH homology
 1KD1 R;  1VQM Q;  3I55 Q;  1N8R R;  3CC4 Q;  3CCS Q;  1JJ2 P;  3CCE Q;  1YJ9 Q;  2OTL Q;  2QEX Q;  1M1K R;  1VQP Q;  3CME Q;  1K8A R;  3CCJ Q;  1QVF P;  1YI2 Q;  1VQ6 Q;  3G4S Q;  3CD6 Q;  1VQK Q;  3OW2 P;  3I56 Q;  1W2B P;  1Q7Y R;  1KQS P;  1KC8 R;  3CC7 Q;  2OTJ Q;  3CCR Q;  1VQN Q;  3CMA Q;  3CXC P;  1YIJ Q;  1QVG P;  1NJI R;  1VQ4 Q;  1VQL Q;  1Q86 R;  2QA4 Q;  1YJN Q;  3CCQ Q;  1VQ7 Q;  1K73 R;  1K9M R;  3CCU Q;  1VQ8 Q;  3CC2 Q;  3CCL Q;  1YIT Q;  1S72 Q;  1VQ5 Q;  1VQ9 Q;  3CPW P;  3G6E Q;  3G71 Q;  1Q81 R;  1Q82 R;  1YHQ Q;  1YJW Q;  3CCV Q;  3CCM Q;  1M90 R;  1VQO Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...