1VQ4Q

The structure of the transition state analogue "daa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 20
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1vq4Q00
1VQMQ 3CMAQ 1YITQ 1VQKQ 1VQLQ 2QEXQ 3OW2P 1YHQQ 1QVFP 3CCVQ 1KD1R 1N8RR 1KQSP 1YJ9Q 3I55Q 1M90R 1Q7YR 1K73R 1YIJQ 1VQOQ 3CCSQ 3G4SQ 3CD6Q 1VQPQ 1Q86R 2OTLQ 1JJ2P 3CC7Q 1K9MR 3CCEQ 2QA4Q 1S72Q 1VQ7Q 1VQ9Q 3CCUQ 3CCLQ 1K8AR 1VQ4Q 1QVGP 3I56Q 3G71Q 1VQNQ 3CCRQ 1YJNQ 1Q81R 1M1KR 1W2BP 1NJIR 3CPWP 3CXCP 3CC4Q 3CC2Q 3CCMQ 3CCJQ 1Q82R 1VQ8Q 1VQ5Q 2OTJQ 1YJWQ 3G6EQ 1VQ6Q 3CMEQ 1YI2Q 3CCQQ 1KC8R
chains in the Genus database with same CATH superfamily
4J7IA 3CMAQ 3KBGA 1G8XA 3QDRB 3OYJA 3HRTA 4M75A 4XK8E 2MOXA 5J3BA 2DRMA 1VQOQ 1KK7A 4AG2C 3MP6A 3CC7Q 4LDXA 2RHXA 2E1HA 2LDMA 2XHCA 3INZA 1K76A 4KGXB 4PNOA 1WFWA 1TG0A 3MPUB 5GAN8 3RMSA 1O9SA 4KUIA 2RN8A 2L3SA 3L42A 1AVZC 1D0ZA 1M90R 4L59A 1T0JA 3LWHA 1M1KC 4D8KA 3OYFA 5KYUB 2GFAA 1WHKA 1UGPB 4QVZA 2CS7A 3URGA 3TVTA 2K4YA 2BZXA 2V8KA 3S6WA 1D09B 4LXCA 4F17A 2EGCA 2BKDN 4LD6A 3MEUA 3QWYA 1QKXA 1AWWA 3CC4T 2PUOB 4FYVB 1BI1A 1K8AU 3A1PA 2BTTA 5C6SA 1UJYA 4RCBA 1OV3A 1RAFB 2D1XA 4A4FA 5KYWA 2DERA 4ZTJA 2AK5A 2CDTA 3JAME 1RAGB 1RLPC 1NLPC 3OYGA 2W10A 2HKQB 1YJ9Q 2DD5A 2K57A 4OF1A 3JCMe 3JB9F 1BI0A 3UT1A 5EG2A 3EFOA 2ROLA 2BE9B 4AFZC 4J9BA 1K1ZA 2A7YA 2YRCA 6AT1B 1MNEA 1QCFA 1FX7A 2DILA 4DBFA 1YIJT 2DL8A 5GAMe 1X2QA 1WXUA 2E5QA 3M54A 3LYIA 4KGVB 3S3NA 2LNHB 2Y90A 3L2WA 3H8ZA 2E6ZA 1K9MC 4CRIA 3G71T 3CPWS 1GBRA 1AT1B 1BI3A 3HTRA 3BDUA 4X9DA 4C0ZA 5KCHA 4XTWA 3D7SB 4M7DB 1G3YA 4JDSA 4PJOF 1WZOA 1U3OA 2D8HA 4M78D 3FB9A 3JCMg 4MMLA 4DBQA 1FMKA 2YRVA 1PC0A 3JCMW 4M75G 4C5GA 1K73U 1XJWB 5FWCA 2DFUA 1SG5A 3JCMJ 2DEUA 1TH7A 4HCCA 1WJRA 5GAMg 1WXTA 2F69A 2DO3A 2P0QA 2E5KA 3JSCA 3CCQT 4M78A 3H41A 1WQ7A 4GLMA 1BKBA 3DLLA 2V8IA 1KHIA 3OYYA 4NOYA 3G6EQ 3JCMQ 4J6YA 2ZPHB 3CPWA 4M4ZA 5IXFA 4PLLA 2QDLA 5KH6A 1QVPA 3QJYA 4J7FA 1XNIA 4C5EA 2DTHA 4M77B 1PSEA 4RTVA 4BE2A 3PTAA 4PFPA 1UE9A 5AYFA 1VQLQ 1ZUYA 5KYXB 1KD1U 5GAOl 3LGLA 1KQSP 3ASKA 4EMKA 3PNWC 4M7AE 3GLXA 4A4EA 2KROA 4FW1A 3QG1A 1U06A 4L6V5 1OPKA 1IHVA 3CPFA 1QVGP 2HNIA 1RI9A 1RADB 3VS3A 2JXBA 1Y57A 3ZBDA 3OBYA 1MHNA 1D1CA 2HL3A 4ELZC 1UTIA 3J80E 1D3BA 1KHCA 4QW2A 4HCBA 4LN2A 1N5ZA 1YITA 5GAOq 4CC4B 2YUNA 1IREB 1W70A 4QKUA 3CXCS 1D0XA 2DXBA 2KXDA 5GMKl 1I81A 3V7SA 2QG9B 3M0PA 4F7UE 4LE9A 4PJJA 2OI3A 3REAB 4X9CA 3A8HB 1OU8A 3EGXB 1AWJA 5I2MA 3I56A 2DL3A 3CCMA 2I2LA 2XDBA 2I0NA 1BB9A 3M0RA 2DVJA 5GAN5 2MYSA 3OYAA 3PIPA 1WIEA 2RHYA 4J9GA 2OAUA 4JLIA 4ZGEB 3QPHA 2SRCA 4N0AA 3QIIA 4PJOB 3NMZC 3CCRA 1M1KR 3TQ7P 4DBHA 3M0SA 1VQKA 2AZVA 3CXCA 1TTHB 4A4GA 4C8QF 1NPPA 3GBQA 4E7SA 4JS4A 1OQKA 1Q86U 1RUWA 3CD6Q 3OMCA 3TREA 3NPFA 3QZ9B 1SKUB 3X20B 1YP5A 1OEBA 2VXFA 4QT7A 4RTWA 4BE0A 1Q82U 2RD1A 2X9HA 1N8RC 1WDXA 4M7AA 2PNIA 1YITQ 3LH0A 4K11A 1X6GA 4M75C 3VRYA 2L3PA 5AT1B 2DTIA 4AT1B 2KI7A 1VOMA 1YFNA 4NL3A 1GCQC 4M7DD 1VQPQ 1JJ2P 1YI2T 3OYBA 2QGFB 2QQ9A 2ZGWA 2VGNA 3L2UA 1IGQA 1D0YA 3UA7A 2QDYB 1H3HA 2CP6A 1RI0A 2RI2A 2CP2A 2K5LA 8AT1B 4F7UA 2F5TX 3X25B 2QXFA 1C6VX 2JN0A 1BYMA 3FIFA 1UEBA 4FM4B 2JS0A 2QYZA 1VQ7Q 1IGUA 5FRMA 1T3SA 5I22A 3EG0A 3CCRQ 3CC2Q 5KYYB 3OYNA 2RHIA 5FLXE 2PTKA 3MP1A 3CMEA 1Y07A 2QAZA 2XMFA 2Y4YA 2YLBA 4VUBA 2O01E 3VU3C 3RKWA 2EGAA 4L5GA 1M5Q1 3UWNA 4PJLA 1JQQA 5IHKA 4M77D 5GAOr 5A2QE 1GFCA 2JNGA 2QQBA 4OMPA 1I1JA 2DE0X 3CC4A 2HSPA 5LJ3j 2DTOA 2ZAEA 3CCJQ 1OX8A 2OJ2A 4J6WA 1M90C 3C95A 3QJ6A 1PG5B 3QDFA 1XOVA 4X1VA 3DB3A 2XICA 4XAXB 1LVKA 5FU7C 3PMIA 3OYDA 3FRNA 2YUOA 2YUPA 1WJSA 4DEYA 4XU2A 1ABQA 1SEMA 2FL7A 3BFMA 1VQ8Q 1SF9A 1UUEA 2PVGB 2JZ2A 3G4ST 2LJ0A 4C8QB 3JB9D 1ABOA 1YIJA 5D6XA 1BU1A 2RJEA 4V2SA 2VWFA 4Z8AA 2E4HA 5DLOA 3KUFA 1UHFA 1T3LA 2NUTA 5GAMd 3OYHA 3G71A 1Q81R 2P4RA 2F2VA 1RLQC 4M7AG 3CMEQ 4IUTA 4PL6A 3TCJA 3RR6A 4CC2A 4DOWA 2KRSA 1VQ9T 1KFZA 1M1FA 2FZCB 4E6RA 5CKBA 1FXXA 4PJOD 1H92A 5GAMj 2QQRA 1ZBXA 1PD1A 1TU0B 4PKCC 4TVRA 3OBWA 2HZYA 2X4YA 3MKDA 5GAOm 3MHXA 3CCQA 2VXEA 2KE9A 4A54A 4F7UG 1NE8A 1SPKA 5CK9A 2HCKA 4KRTA 2FO0A 2CP7A 2HDAA 4C5HA 3PVLA 4OGEA 2C06A 2VUBA 2AKKA 2J06A 2CZ0B 3JCMf 2F5KA 1TWBA 3CXCP 2QASA 2RJDA 5GMKm 2RK1A 4E7JA 1YJWQ 2ECZA 2DKGA 4RTYA 2HAXA 2NWMA 1B34A 4EMKC 4JRPA 5GAMf 2KEAA 3CBOA 2DD4A 5DLQE 2DMOA 4OMLA 2XU8A 3QXEB 2BIVA 1LJOA 2MK5A 2RQRA 1KQSS 1HJDA 4EDUA 2FPFA 1BI2A 1KD1C 2K3BA 4JJDA 2X4JA 2AT1B 2IIMA 3A8OB 2PVDB 1GXIE 5CQYA 3WXMB 4II1A 1BBZA 4OMMA 1NPRA 2CGHA 2RO0A 1YJNT 4HCZA 4AFUC 2KAFA 4E47A 2FHDA 3C0CA 1RAEB 2NYSA 4LDWA 2K7AA 3I55T 4EPCA 4JS5A 4C92D 4A4HA 2LT4A 2O4XA 1ZA1B 2P4TA 2DEQA 3RIRA 1WQWA 3OS1A 1PCXA 2QQAA 4P5NA 1JO8A 5CQXA 1X6OA 3TSWA 4CC7A 4N4GA 2X35A 4A4KA 1GCPA 1SRLA 3P8DA 1G3WA 3CCLQ 3CCUA 3RNJA 3OYIA 1VQNQ 1OULA 2KXCA 1Y71A 4FYXB 3FDRA 2EGEA 1I07A 3T9NA 3L2RA 1W4SA 4UC4A 4ELYC 5FU6B 2CSIA 2BZ8A 1U8RA 3ZFJA 2XG8D 1WHJA 1EX4A 2KRNA 4FYWB 1VQ6T 3A98A 2DJQA 1YNZA 4IUUA 4IIOA 4O6JA 1N27A 2DPPB 2NUPB 4C8QD 4EMGA 1LCKA 2LQ8A 4M7AC 2DL7A 2ZPEB 3P8HA 3SHWA 2LVMA 1Q86C 4OMFB 1QCNA 2C0TA 2M9UA 3M58A 2FG0A 4XTYA 4GBQA 1Y96A 2KDSA 1WLPB 2DZ9A 2RQWA 2QA4Q 2VASA 1K8AR 1SHFA 5CR2A 4IUVA 4XQ3A 3HFNA 3VS7A 3LWIA 1UGVA 2RHZA 1T0HA 4M78E 1JJ2S 4JRQA 3PMTA 5GAOn 1PRMC 1N9RA 4OB0B 2LZ6B 2D0NA 1E7OA 2CH4W 2GQVA 1YCSB 1W1FA 2LX9A 3CCUQ 3L2ZA 4J83A 3MEAA 2XK0A 2SEMA 1FMVA 1U1TA 5M9OA 2QTVA 1KIKA 3SB2A 1VQ5Q 2HSEB 1VA7A 2YUQA 3CCET 3RESA 1MUZA 3EG3A 3LX7A 2FZGB 2ZPIB 2YSQA 5KYNA 3QWXX 2LCCA 4XTXA 5GANe 2DBKA 3M53A 1YHQT 3SD4A 4KULA 4ZN3A 1JJ2A 1CSKA 1NM7A 3OYKA 2KYMA 3OSVA 1RAIB 1GRIA 2RH2A 1MMDA 3FLGA 1ZSZA 3JB9I 2IVWA 1PNJA 1K73R 4EIKA 1JRIA 4ATOA 4OB2B 3H9NA 4OB3B 3AHUA 4E7KA 2A08A 2EWNA 3H0IA 4B9XA 3RMQA 3TSZA 1MMNA 4F16A 5GJWB 1KC8U 2DXCA 3C4SA 4BD3A 4XU1A 2OTLT 5GANg 3QUIA 3J81E 3V8JA 2K3YA 3G4SA 2L2PA 2D6FA 3ER0A 4KGZB 1D1BA 1RAAB 3M57A 2JTEA 2DX1A 1PD0A 5GAN7 2QEXT 3A8MB 4N4IA 3JCMb 1QKWA 3EG9B 5CO7A 2KR3A 4BUGA 5FROA 2ZZDA 1KD1R 1F1BB 2OAWA 3VRZA 2R58A 3SWNC 3O8VA 5GAN3 3R6NA 2P0PA 3NTHA 1UGRB 4JJBA 2KBTA 4BB7A 1VQ9A 4HT9A 3CCVT 1PKTA 1KQ1A 1OX9A 1OOTA 3M0UA 4KT0E 4HVWA 4Y91A 1SSHA 1VQ4T 2COZA 1X2KA 2LRQA 1WJQA 1ZHIA 3O5ZA 4FYYB 1Q81C 2X3XD 1C0MA 2XI9A 1C1AA 3HL8A 3CMAT 1PWTA 1WHMA 1W2BP 1J3TA 3VKIA 1I8FA 5CKFA 4JJNK 1VQOT 3VS2A 5C0MA 3CC7T 1ZBJA 2CREA 3PE0A 2CUBA 4BACA 4CI0C 3MO8A 3G4SQ 2FEIA 3M59A 4HVUA 2VKNA 2F1LA 1PRLC 1H8KA 4M7DE 2EVRA 2F2WA 1S72A 3EHQA 2CT4A 2RJCA 4XU3A 2E64A 1V29B 1KQ2A 1QQJA 2EPDA 2FVUA 4R56A 3OS0A 2HQXA 1EZZB 3ME9A 1SRMA 2KMTA 1Q86R 4AFSC 1WPYA 2JM9A 3SWNB 1HK9A 4A53A 3EG2A 1VQ9Q 4M75F 2EQKA 1YJNA 3OYLA 1A0NB 1RL2A 1Q82R 4ESRA 2CUDA 3M4GA 2E65A 2R5MA 1CKBA 3I55A 3GOXA 3META 3OA6A 3HRUA 2LC4A 4BE1A 3WVEB 2BZYA 1QMCA 4M77E 4M78G 4C0GA 1VQMT 4XTUA 1M30A 2AHJB 2J7IA 1YJ9T 4D6WA 1NYFA 2J6KA 2WSFE 1AWXA 3WVDB 1LPLA 1NBEB 2RI3A 4LUEA 2Y4XA 2COYA 3SDZA 2EJ9A 4D8DA 2JMAA 4JZ4A 3SEMA 1UDLA 2E70A 1VIFA 2VYTA 4ZTFA 3JCMP 1B34B 1S72Q 1HD3A 2A28A 2QQSA 3I56Q 1WHGA 2FPDA 1MMGA 4J9HA 4BDYA 3CCMQ 1VQ6A 2JUFA 2CZ1B 5HY6A 5KE3A 4ZGJB 1N6AA 1M9SA 1TS9A 1Q7YU 4M7DA 1K9AA 2ABLA 2EYZA 4YTLA 5GMKi 1TUGB 3GF5A 4IUPA 2LJ3A 1R77A 1ARKA 1QWFA 1X01A 2GF7A 5CAIA 1FWZA 3PFSA 4BI8B 2K9GA 2HQHA 1OYXA 4X34A 4LDUA 4MDWA 1VQKQ 2KNBB 3JB9H 3HKSA 4FSSA 2RF0A 8ATCB 3G6ET 2RK2A 3SFMA 1U1SA 2DAQA 3M0TA 5A0DA 4FIBA 4PJOE 1E6GA 1DJ7B 2L8DA 4QVDA 4AFQC 3CQTA 1P92A 1V76A 4Z02A 2E6NA 2KGTA 1MV0B 3OYMA 3EFSA 2E10A 3VV0A 4M77A 2P0KA 3EGDB 1K8AC 1K9MU 2M16A 3BDLA 4C0DC 3CCEA 2LQNA 2QI2A 4ME7A 2COWA 4M75B 2DJZA 2FB7A 3CBMA 3MP8A 1VQLT 5KYXA 2B86A 2EQJA 3CEYA 1YCYA 2RM4A 2RI5A 2FPEA 3PIOA 2DBMA 4F14A 3CCST 4M78F 1YHQA 3REBB 5L23A 2EAYA 2O88A 1ZSZC 5GANd 5L8RE 5CKEA 2JM8A 3N5BB 5HK3A 2BUDA 1PKSA 3E2UA 2E3HA 4OMQA 5FW9A 1IO6A 1OPLA 1WX6A 2HD0A 4AMCA 1K0SA 5CKHA 4B9WA 3HP9A 2AZSA 2A0FB 2KT8A 4QQDA 2GTJA 1NEGA 2OTLA 2RA2A 4OP0A 3RKYA 1NJIU 2EQIA 3PGGA 1KC8C 4M78C 1O75A 2L5QA 3CC4Q 1X69A 2Z0WA 3E19A 1N9SA 5CCAA 5GMKh 3UDCA 4C92E 1K73C 3EHRA 3HPWA 4M7DG 2CKKA 1R0CB 5KYWB 2C0IA 4PJOA 1WGSA 3NFCA 2FZKB 1YBYA 1NZ9A 4B6MA 3E9GA 1UG1A 3LH5A 1X43A 1M2VA 3MCAB 2RHUA 2DLPA 1M8MA 2JS2A 1W6XA 4RTZA 2JJ9A 3I35A 4QQ6A 5FU7B 3VJPA 2FRYA 5A0LA 2K2VA 3EFOB 5GANf 3CD6T 3HSBA 5I11A 5CKDA 3CCVA 1K4US 4N4HA 1ZUUA 2LT1A 1YIJQ 2MWPA 4LDYA 3EH2A 3VS4A 2FYKA 3TU4K 2KQWA 2HBWA 2GQIA 2X51A 4OGCA 1YITT 2ENMA 1QP2A 1QLYA 3G71Q 4WTOB 2RMOA 4RMOA 2PZ1A 1KSWA 4OB1B 3X26B 3CMAA 4C8QE 1VQPT 4KUDK 2BE7D 4R55A 2GNCA 3ZL7C 4HVVA 4M77G 1W2BS 1VQOA 1QP3A 2KRMA 2R5AA 1QVFA 5GANh 2V1RA 3DKMA 4ZNXA 1TSFA 2EYYA 2LNVA 3H0FA 3M0QA 4J9CA 2MI6A 2YDLA 2YRDA 1M3CA 4OMNA 5KE2A 3V8LA 2ATCB 3CCQQ 4M78B 1PM3A 1M3AA 2M02A 3OS2A 2DETA 2LCSA 4J6XA 1VQ7T 1AD5A 2CP3A 2M0OA 3L1AA 3CCRT 2DZCA 3MEWA 3CC2T 4M7AF 2EJGA 5KYYA 5IHNA 1MMAA 3OSSC 1GL5A 4C92A 4N0AC 5CVIA 2LJ1A 3JB9G 1QVGA 1WNLA 1UECA 1N8RU 2E3IA 1W2BA 3FJPA 2GTOA 2PU9B 1EFNA 1SHGA 2DXUA 4M75D 2MPXC 2JTFA 3CCJT 2E41A 1IB8A 2OTJT 4WCIA 4F7UF 1WI7A 4EMKB 3OQ5A 2K5FA 3H0HA 2CP5A 4NS5A 4O5VA 3GIBA 5A0GA 4JUVA 4NL2A 2O31A 5GAN2 1VQMA 3OW2P 5GMKe 2RB6A 1YJ9A 4Y92A 4PJOG 2CH4A 4DBRA 1D3BB 1NLOC 1GCQA 5IT9E 1PSFA 2NLUA 4MZTA 4BI3A 1VQ8T 4Z89A 4E2FB 1JBMA 2CT3A 3RERA 1M3BA 1Q82C 1WHHA 4C8QA 2X3WD 3RDVA 2QGGA 5D6YA 1YI2A 2HEQA 4JLGA 1V1CA 2KSSA 2W0ZA 5LJ3e 4J9EA 1OZ3A 1VYTA 4M7DC 1QWEA 2AKLA 2D8JA 5LJ5e 1WXBA 1JXOA 3CMET 5ECAA 4M77F 4DOVA 2DRKA 1Q7YC 2M1HA 5IN1A 2J6OA 1R8OB 1KJWA 1M90U 1WYXA 2DK3A 3AT1B 2MIOA 4J9DA 3GPLA 1G3TA 2A3LA 2GGRA 3MEVA 3RUXA 5LJ3g 4FSXA 1RACB 2CP0A 2L3QA 4RG8A 5DM7R 5IAYA 2XIDA 3G1JA 3G6EA 5LJ5g 1G83A 1KC8R 1JU5C 1VQMQ 1M2OA 3RBBB 4J8OA 4WF2A 2CZ7B 4XU0A 1M1GA 4M77C 4M7AB 1G5VA 4KH1B 1D1AA 2J05A 1B7TA 3F70A 3UPUA 1M27C 2JOYA 1YJWT 3C94A 2X4XA 3JRZA 4C92G 2XDDA 3G7ZA 1KG1A 3NTIA 4Z88A 3J7AF 3QHSA 4HT8A 2GFUA 2VC8A 3M56A 1AEYA 1YI2Q 2V1QA 2YHTA 1VQLA 2RPNA 3QO3A 5HKCA 3JCMX 4RCCA 1AOJA 2LQKA 2ZPBB 4HA8A 3S3OA 4GY5A 3CCSA 2L3RA 3EG1A 2O9SA 2KK4A 3L2QA 2YLCA 4F7UB 1H641 9ATCB 2HQEA 4E7LA 2IPOB 1B3QA 5GAN6 3EGUA 4A63B 4IURA 5EC7A 2FRWA 3A5ZB 3UATA 1LNXA 3DB4A 1QVFP 5IH2A 3V8KA 2C0OA 1NEBA 1AZEA 4JRIA 5J26A 3FEOA 1OU9A 4C8QG 4ANJA 1AZGB 1IHWA 5J39A 5FWBA 2GCXA 2CSQA 4RG2A 2DM1A 2DL5A 1NYGA 3NTKA 2DIGA 4Q5WA 2VB6A 2V8JA 3CCLT 1VQNT 4PJOC 1Y7XA 3BY7A 1HYOA 1NG2A 1NJIC 1QCOA 2LMJA 2VGMA 5LL6S 2PUKB 2LQWA 2P84A 1TXQA 3DLMA 2R57A 2JW4A 5I21A 2G3RA 2K6DA 4ORZA 4LNPA 2ED0A 4GLKA 3CCSQ 3CD6A 2RQUA 2NUPA 1AHJB 2EYQA 3KFVA 4BDZA 2LP5A 4BI4A 1K0XA 4JPBW 2NUTB 1FYNA 1YWOA 4MZMA 4J9IA 2D9TA 5D6WA 2HMAA 2QTXA 4C92F 3OS5A 2QA4T 5KYUA 1Y0MA 3VUBA 2EBPA 1JXMA 1GFDA 1VQPA 1S1NA 2X4WA 3A8GB 3Q1JA 1IRXA 1JB0E 3V7RA 1FMWA 5D7UA 1ZQ1A 4HXJA 3M5AA 3FJ5A 2YXYA 3CCUT 3M55A 2M51A 3OY9A 2RJFA 3LGFA 1OZ2A 2YT6A 4BY6C 1VQ5T 4RTUA 2MCNA 1VQ7A 1WHLA 2GBQA 4C92C 4KBMB 3CC2A 4JZ3A 2LX7A 4C0FA 1M2VB 1M4ZA 4JRKA 1QW1A 1I0CA 4KH0B 1XQHA 3UF4A 2YWWA 4M7AD 4J5YA 3IQLA 2KY9A 1Q7YR 2EQUA 3U23A 3JCMV 2B8AA 2DF6A 3PT9A 4ZGDB 1M1KU 3HRSA 4QVCA 3THKA 3FC3A 3CCJA 4XTVA 2DYIA 1TUDA 2OTJA 4RUGA 7AT1B 4OMOA 1ZSGA 2L0AA 3VYGA 3NHNA 4PFZA 2KT1A 4DA4A 4ZN1A 1MV3A 3OYEA 2MMPA 5CIUA 5HCKA 4F04B 3VYHB 2DA9A 5I2SA 1JEGA 1AWOA 2O2OA 4IUQA 4PJMA 1B07A 3OW2S 3EAEA 4LD9K 3GNFB 2ROTA 1YJNQ 4C8QC 1VQ8A 4PLIA 4PK4A 2DVEA 2LCLA 4QQGA 1RABB 2V26A 3JV3A 3QSUA 2RQVA 2H3EB 1R0BG 3QKJA 3LLRA 2A36A 2CZ6B 1HXDA 3I55Q 4FL6A 1IZ6A 4MZPA 4RTXA 1BCOA 2O4XB 5FRNA 3OB9A 1X27A 1K9MR 3EG9A 4LUDA 2XKOC 3EH1A 2EW3A 1TUCA 5GMKj 2H3JA 2XDPA 4BY6B 1PHTA 5LJ3d 3RKXA 2KYBA 3LW5E 4C92B 1Z9QA 3E1SA 5LJ5d 2EIFA 2L89A 2DNUA 2HBPA 3VUZA 1OI1A 3GNGA 4FW2A 2EYXA 2XD0A 5DY9A 3OW2A 1EIFA 2ZCFB 1ACMB 1VYVA 3GP8A 2VVKA 3CPWP 2HKNA 2OTJQ 1VQ6Q 1MGQA 4AG1C 3BE3A 4Y28E 3BW1A 5LJ5j 2QK0A 2AIRB 1Z9ZA 1MNDA 2EJFA 1VUBA 2ED1A 2A37A 4E7IA 1YN8A 2EQMA 2JT4A 2G6FX 2PVOB 1UGQB 3HFOA 2MAMA 3S3MA 1Y96B 1NJIR 1UJ0A 1IXDA 3P8BB 1ZA2B 1YJWA 1XTDA 3JCMd 3E9FA 1RAHB 2E12A 4R0KA 2JTMA 1BK2A 5GANj 3EGXA 3M4YA 1I4K1 3PVQA 2J6FA 3KXTA 3I5RA 2K3XA 2IG0A 5LJ3f 2PQWA 4HKEA 4EMHA 4IKFA 3UA6A 2NUZA 3L2VA 2OX7A 4FT2A 5LJ5f 3CBPA 3V7CA 3ULRB 1UB4A 2QEXA 3M9QA 2DL4A 3SWNA 2JMCA 1UHCA 3JCMc 1LOJA 4FU6A 1GBQA 5GAOp 3CCEQ 3ZEHA 3MJXA 2K79A 1TOVA 1Q81U 4MMKA 1QVFS 2CYZB 1SSFA 2ZPGB 1VIEA 4FCYA 4C0DB 2ESWA 1BIBA 1I5OB 4PJNA 2DIQA 5LJ3h 1YHQQ 2WSCE 3QYGB 3I5SA 1HSQA 3JB9J 5LJ5h 4M75E 3VS1A 2DXTA 1ZSZB 3CCLA 1VQ4A 1VQNA 4E7HA 3VS6A 2F2XA 2M0YA 1CKAA 2EKHA 2WACA 3EFRA 5FU6C 3OYCA 2H8HA 1X6BA 4CC3A 1S72T 2RQTA 3I56T 3QBYA 1BCMA 2K5IA 1UGSB 3TEEA 3CCMT 5HK0A 4DQ2A 2OTLQ 3CC7A 4IIMA 1I5LA 3NGPA 1YWPA 4RTTA 4J9FA 5IXBA 2WSEE 4HCKA 4OVAA 5KCOA 3VS0A 4RKUE 3R6OA 2QEXQ 4E7ZA 1QVGS 3JCMh 3C12A 1G2BA 3VS5A 1N8RR 4DEXA 3I9QA 2ZPFB 2EFIA 3QZ5B 2O9VA 2HL5C 5IHIA 2QA4A 1G3SA 4MDXA 2LTOA 1VQKT 1E6HA 2D0QB 4C5IA 5GAMh 1M8VA 1ZX6A 2DYBA 1Q95G 2KVQG 4XTZA 1VYUA 3QYHB 2JVVA 5GJVB 2EKOA 3A8LB 1ZUKA 1H3ZA 3CCVQ 2K2MA 4PFOA 1UFFA 1ZLMA 2MWOA 3X28B 3HHTB 3H6ZA 1U5SA 1KQSA 2MF2A 2EYWA 2VV5A 1VQ4Q 1X75C 3X24B 1BIAA 4M7DF 3OMGA 4LDVA 5GAN4 1WA7A 1VQ5A 2RNAA 4JJCA 3EGDA 4FT4A
chains in the Genus database with same CATH topology
1VQMQ 3CMAQ 1YITQ 1VQKQ 1VQLQ 2QEXQ 3OW2P 1YHQQ 1QVFP 3CCVQ 1KD1R 1N8RR 1KQSP 1YJ9Q 3I55Q 1M90R 1Q7YR 1K73R 1YIJQ 1VQOQ 3CCSQ 3G4SQ 3CD6Q 1VQPQ 1Q86R 2OTLQ 1JJ2P 3CC7Q 1K9MR 3CCEQ 2QA4Q 1S72Q 1VQ7Q 1VQ9Q 3CCUQ 3CCLQ 1K8AR 1VQ4Q 1QVGP 3I56Q 3G71Q 1VQNQ 3CCRQ 1YJNQ 1Q81R 1M1KR 1W2BP 1NJIR 3CPWP 3CXCP 3CC4Q 3CC2Q 3CCMQ 3CCJQ 1Q82R 1VQ8Q 1VQ5Q 2OTJQ 1YJWQ 3G6EQ 1VQ6Q 3CMEQ 1YI2Q 3CCQQ 1KC8R
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQM Q;  3CMA Q;  1YIT Q;  1VQK Q;  1VQL Q;  2QEX Q;  3OW2 P;  1YHQ Q;  1QVF P;  3CCV Q;  1KD1 R;  1N8R R;  1KQS P;  1YJ9 Q;  3I55 Q;  1M90 R;  1Q7Y R;  1K73 R;  1YIJ Q;  1VQO Q;  3CCS Q;  3G4S Q;  3CD6 Q;  1VQP Q;  1Q86 R;  2OTL Q;  1JJ2 P;  3CC7 Q;  1K9M R;  3CCE Q;  2QA4 Q;  1S72 Q;  1VQ7 Q;  1VQ9 Q;  3CCU Q;  3CCL Q;  1K8A R;  1VQ4 Q;  1QVG P;  3I56 Q;  3G71 Q;  1VQN Q;  3CCR Q;  1YJN Q;  1Q81 R;  1M1K R;  1W2B P;  1NJI R;  3CPW P;  3CXC P;  3CC4 Q;  3CC2 Q;  3CCM Q;  3CCJ Q;  1Q82 R;  1VQ8 Q;  1VQ5 Q;  2OTJ Q;  1YJW Q;  3G6E Q;  1VQ6 Q;  3CME Q;  1YI2 Q;  3CCQ Q;  1KC8 R; 
#chains in the Genus database with same CATH topology
 4J7I A;  3CMA Q;  3KBG A;  1G8X A;  3QDR B;  3OYJ A;  3HRT A;  4M75 A;  4XK8 E;  2MOX A;  5J3B A;  2DRM A;  1VQO Q;  1KK7 A;  4AG2 C;  3MP6 A;  3CC7 Q;  4LDX A;  2RHX A;  2E1H A;  2LDM A;  2XHC A;  3INZ A;  1K76 A;  4KGX B;  4PNO A;  1WFW A;  1TG0 A;  3MPU B;  5GAN 8;  3RMS A;  1O9S A;  4KUI A;  2RN8 A;  2L3S A;  3L42 A;  1AVZ C;  1D0Z A;  1M90 R;  4L59 A;  1T0J A;  3LWH A;  1M1K C;  4D8K A;  3OYF A;  5KYU B;  2GFA A;  1WHK A;  1UGP B;  4QVZ A;  2CS7 A;  3URG A;  3TVT A;  2K4Y A;  2BZX A;  2V8K A;  3S6W A;  1D09 B;  4LXC A;  4F17 A;  2EGC A;  2BKD N;  4LD6 A;  3MEU A;  3QWY A;  1QKX A;  1AWW A;  3CC4 T;  2PUO B;  4FYV B;  1BI1 A;  1K8A U;  3A1P A;  2BTT A;  5C6S A;  1UJY A;  4RCB A;  1OV3 A;  1RAF B;  2D1X A;  4A4F A;  5KYW A;  2DER A;  4ZTJ A;  2AK5 A;  2CDT A;  3JAM E;  1RAG B;  1RLP C;  1NLP C;  3OYG A;  2W10 A;  2HKQ B;  1YJ9 Q;  2DD5 A;  2K57 A;  4OF1 A;  3JCM e;  3JB9 F;  1BI0 A;  3UT1 A;  5EG2 A;  3EFO A;  2ROL A;  2BE9 B;  4AFZ C;  4J9B A;  1K1Z A;  2A7Y A;  2YRC A;  6AT1 B;  1MNE A;  1QCF A;  1FX7 A;  2DIL A;  4DBF A;  1YIJ T;  2DL8 A;  5GAM e;  1X2Q A;  1WXU A;  2E5Q A;  3M54 A;  3LYI A;  4KGV B;  3S3N A;  2LNH B;  2Y90 A;  3L2W A;  3H8Z A;  2E6Z A;  1K9M C;  4CRI A;  3G71 T;  3CPW S;  1GBR A;  1AT1 B;  1BI3 A;  3HTR A;  3BDU A;  4X9D A;  4C0Z A;  5KCH A;  4XTW A;  3D7S B;  4M7D B;  1G3Y A;  4JDS A;  4PJO F;  1WZO A;  1U3O A;  2D8H A;  4M78 D;  3FB9 A;  3JCM g;  4MML A;  4DBQ A;  1FMK A;  2YRV A;  1PC0 A;  3JCM W;  4M75 G;  4C5G A;  1K73 U;  1XJW B;  5FWC A;  2DFU A;  1SG5 A;  3JCM J;  2DEU A;  1TH7 A;  4HCC A;  1WJR A;  5GAM g;  1WXT A;  2F69 A;  2DO3 A;  2P0Q A;  2E5K A;  3JSC A;  3CCQ T;  4M78 A;  3H41 A;  1WQ7 A;  4GLM A;  1BKB A;  3DLL A;  2V8I A;  1KHI A;  3OYY A;  4NOY A;  3G6E Q;  3JCM Q;  4J6Y A;  2ZPH B;  3CPW A;  4M4Z A;  5IXF A;  4PLL A;  2QDL A;  5KH6 A;  1QVP A;  3QJY A;  4J7F A;  1XNI A;  4C5E A;  2DTH A;  4M77 B;  1PSE A;  4RTV A;  4BE2 A;  3PTA A;  4PFP A;  1UE9 A;  5AYF A;  1VQL Q;  1ZUY A;  5KYX B;  1KD1 U;  5GAO l;  3LGL A;  1KQS P;  3ASK A;  4EMK A;  3PNW C;  4M7A E;  3GLX A;  4A4E A;  2KRO A;  4FW1 A;  3QG1 A;  1U06 A;  4L6V 5;  1OPK A;  1IHV A;  3CPF A;  1QVG P;  2HNI A;  1RI9 A;  1RAD B;  3VS3 A;  2JXB A;  1Y57 A;  3ZBD A;  3OBY A;  1MHN A;  1D1C A;  2HL3 A;  4ELZ C;  1UTI A;  3J80 E;  1D3B A;  1KHC A;  4QW2 A;  4HCB A;  4LN2 A;  1N5Z A;  1YIT A;  5GAO q;  4CC4 B;  2YUN A;  1IRE B;  1W70 A;  4QKU A;  3CXC S;  1D0X A;  2DXB A;  2KXD A;  5GMK l;  1I81 A;  3V7S A;  2QG9 B;  3M0P A;  4F7U E;  4LE9 A;  4PJJ A;  2OI3 A;  3REA B;  4X9C A;  3A8H B;  1OU8 A;  3EGX B;  1AWJ A;  5I2M A;  3I56 A;  2DL3 A;  3CCM A;  2I2L A;  2XDB A;  2I0N A;  1BB9 A;  3M0R A;  2DVJ A;  5GAN 5;  2MYS A;  3OYA A;  3PIP A;  1WIE A;  2RHY A;  4J9G A;  2OAU A;  4JLI A;  4ZGE B;  3QPH A;  2SRC A;  4N0A A;  3QII A;  4PJO B;  3NMZ C;  3CCR A;  1M1K R;  3TQ7 P;  4DBH A;  3M0S A;  1VQK A;  2AZV A;  3CXC A;  1TTH B;  4A4G A;  4C8Q F;  1NPP A;  3GBQ A;  4E7S A;  4JS4 A;  1OQK A;  1Q86 U;  1RUW A;  3CD6 Q;  3OMC A;  3TRE A;  3NPF A;  3QZ9 B;  1SKU B;  3X20 B;  1YP5 A;  1OEB A;  2VXF A;  4QT7 A;  4RTW A;  4BE0 A;  1Q82 U;  2RD1 A;  2X9H A;  1N8R C;  1WDX A;  4M7A A;  2PNI A;  1YIT Q;  3LH0 A;  4K11 A;  1X6G A;  4M75 C;  3VRY A;  2L3P A;  5AT1 B;  2DTI A;  4AT1 B;  2KI7 A;  1VOM A;  1YFN A;  4NL3 A;  1GCQ C;  4M7D D;  1VQP Q;  1JJ2 P;  1YI2 T;  3OYB A;  2QGF B;  2QQ9 A;  2ZGW A;  2VGN A;  3L2U A;  1IGQ A;  1D0Y A;  3UA7 A;  2QDY B;  1H3H A;  2CP6 A;  1RI0 A;  2RI2 A;  2CP2 A;  2K5L A;  8AT1 B;  4F7U A;  2F5T X;  3X25 B;  2QXF A;  1C6V X;  2JN0 A;  1BYM A;  3FIF A;  1UEB A;  4FM4 B;  2JS0 A;  2QYZ A;  1VQ7 Q;  1IGU A;  5FRM A;  1T3S A;  5I22 A;  3EG0 A;  3CCR Q;  3CC2 Q;  5KYY B;  3OYN A;  2RHI A;  5FLX E;  2PTK A;  3MP1 A;  3CME A;  1Y07 A;  2QAZ A;  2XMF A;  2Y4Y A;  2YLB A;  4VUB A;  2O01 E;  3VU3 C;  3RKW A;  2EGA A;  4L5G A;  1M5Q 1;  3UWN A;  4PJL A;  1JQQ A;  5IHK A;  4M77 D;  5GAO r;  5A2Q E;  1GFC A;  2JNG A;  2QQB A;  4OMP A;  1I1J A;  2DE0 X;  3CC4 A;  2HSP A;  5LJ3 j;  2DTO A;  2ZAE A;  3CCJ Q;  1OX8 A;  2OJ2 A;  4J6W A;  1M90 C;  3C95 A;  3QJ6 A;  1PG5 B;  3QDF A;  1XOV A;  4X1V A;  3DB3 A;  2XIC A;  4XAX B;  1LVK A;  5FU7 C;  3PMI A;  3OYD A;  3FRN A;  2YUO A;  2YUP A;  1WJS A;  4DEY A;  4XU2 A;  1ABQ A;  1SEM A;  2FL7 A;  3BFM A;  1VQ8 Q;  1SF9 A;  1UUE A;  2PVG B;  2JZ2 A;  3G4S T;  2LJ0 A;  4C8Q B;  3JB9 D;  1ABO A;  1YIJ A;  5D6X A;  1BU1 A;  2RJE A;  4V2S A;  2VWF A;  4Z8A A;  2E4H A;  5DLO A;  3KUF A;  1UHF A;  1T3L A;  2NUT A;  5GAM d;  3OYH A;  3G71 A;  1Q81 R;  2P4R A;  2F2V A;  1RLQ C;  4M7A G;  3CME Q;  4IUT A;  4PL6 A;  3TCJ A;  3RR6 A;  4CC2 A;  4DOW A;  2KRS A;  1VQ9 T;  1KFZ A;  1M1F A;  2FZC B;  4E6R A;  5CKB A;  1FXX A;  4PJO D;  1H92 A;  5GAM j;  2QQR A;  1ZBX A;  1PD1 A;  1TU0 B;  4PKC C;  4TVR A;  3OBW A;  2HZY A;  2X4Y A;  3MKD A;  5GAO m;  3MHX A;  3CCQ A;  2VXE A;  2KE9 A;  4A54 A;  4F7U G;  1NE8 A;  1SPK A;  5CK9 A;  2HCK A;  4KRT A;  2FO0 A;  2CP7 A;  2HDA A;  4C5H A;  3PVL A;  4OGE A;  2C06 A;  2VUB A;  2AKK A;  2J06 A;  2CZ0 B;  3JCM f;  2F5K A;  1TWB A;  3CXC P;  2QAS A;  2RJD A;  5GMK m;  2RK1 A;  4E7J A;  1YJW Q;  2ECZ A;  2DKG A;  4RTY A;  2HAX A;  2NWM A;  1B34 A;  4EMK C;  4JRP A;  5GAM f;  2KEA A;  3CBO A;  2DD4 A;  5DLQ E;  2DMO A;  4OML A;  2XU8 A;  3QXE B;  2BIV A;  1LJO A;  2MK5 A;  2RQR A;  1KQS S;  1HJD A;  4EDU A;  2FPF A;  1BI2 A;  1KD1 C;  2K3B A;  4JJD A;  2X4J A;  2AT1 B;  2IIM A;  3A8O B;  2PVD B;  1GXI E;  5CQY A;  3WXM B;  4II1 A;  1BBZ A;  4OMM A;  1NPR A;  2CGH A;  2RO0 A;  1YJN T;  4HCZ A;  4AFU C;  2KAF A;  4E47 A;  2FHD A;  3C0C A;  1RAE B;  2NYS A;  4LDW A;  2K7A A;  3I55 T;  4EPC A;  4JS5 A;  4C92 D;  4A4H A;  2LT4 A;  2O4X A;  1ZA1 B;  2P4T A;  2DEQ A;  3RIR A;  1WQW A;  3OS1 A;  1PCX A;  2QQA A;  4P5N A;  1JO8 A;  5CQX A;  1X6O A;  3TSW A;  4CC7 A;  4N4G A;  2X35 A;  4A4K A;  1GCP A;  1SRL A;  3P8D A;  1G3W A;  3CCL Q;  3CCU A;  3RNJ A;  3OYI A;  1VQN Q;  1OUL A;  2KXC A;  1Y71 A;  4FYX B;  3FDR A;  2EGE A;  1I07 A;  3T9N A;  3L2R A;  1W4S A;  4UC4 A;  4ELY C;  5FU6 B;  2CSI A;  2BZ8 A;  1U8R A;  3ZFJ A;  2XG8 D;  1WHJ A;  1EX4 A;  2KRN A;  4FYW B;  1VQ6 T;  3A98 A;  2DJQ A;  1YNZ A;  4IUU A;  4IIO A;  4O6J A;  1N27 A;  2DPP B;  2NUP B;  4C8Q D;  4EMG A;  1LCK A;  2LQ8 A;  4M7A C;  2DL7 A;  2ZPE B;  3P8H A;  3SHW A;  2LVM A;  1Q86 C;  4OMF B;  1QCN A;  2C0T A;  2M9U A;  3M58 A;  2FG0 A;  4XTY A;  4GBQ A;  1Y96 A;  2KDS A;  1WLP B;  2DZ9 A;  2RQW A;  2QA4 Q;  2VAS A;  1K8A R;  1SHF A;  5CR2 A;  4IUV A;  4XQ3 A;  3HFN A;  3VS7 A;  3LWI A;  1UGV A;  2RHZ A;  1T0H A;  4M78 E;  1JJ2 S;  4JRQ A;  3PMT A;  5GAO n;  1PRM C;  1N9R A;  4OB0 B;  2LZ6 B;  2D0N A;  1E7O A;  2CH4 W;  2GQV A;  1YCS B;  1W1F A;  2LX9 A;  3CCU Q;  3L2Z A;  4J83 A;  3MEA A;  2XK0 A;  2SEM A;  1FMV A;  1U1T A;  5M9O A;  2QTV A;  1KIK A;  3SB2 A;  1VQ5 Q;  2HSE B;  1VA7 A;  2YUQ A;  3CCE T;  3RES A;  1MUZ A;  3EG3 A;  3LX7 A;  2FZG B;  2ZPI B;  2YSQ A;  5KYN A;  3QWX X;  2LCC A;  4XTX A;  5GAN e;  2DBK A;  3M53 A;  1YHQ T;  3SD4 A;  4KUL A;  4ZN3 A;  1JJ2 A;  1CSK A;  1NM7 A;  3OYK A;  2KYM A;  3OSV A;  1RAI B;  1GRI A;  2RH2 A;  1MMD A;  3FLG A;  1ZSZ A;  3JB9 I;  2IVW A;  1PNJ A;  1K73 R;  4EIK A;  1JRI A;  4ATO A;  4OB2 B;  3H9N A;  4OB3 B;  3AHU A;  4E7K A;  2A08 A;  2EWN A;  3H0I A;  4B9X A;  3RMQ A;  3TSZ A;  1MMN A;  4F16 A;  5GJW B;  1KC8 U;  2DXC A;  3C4S A;  4BD3 A;  4XU1 A;  2OTL T;  5GAN g;  3QUI A;  3J81 E;  3V8J A;  2K3Y A;  3G4S A;  2L2P A;  2D6F A;  3ER0 A;  4KGZ B;  1D1B A;  1RAA B;  3M57 A;  2JTE A;  2DX1 A;  1PD0 A;  5GAN 7;  2QEX T;  3A8M B;  4N4I A;  3JCM b;  1QKW A;  3EG9 B;  5CO7 A;  2KR3 A;  4BUG A;  5FRO A;  2ZZD A;  1KD1 R;  1F1B B;  2OAW A;  3VRZ A;  2R58 A;  3SWN C;  3O8V A;  5GAN 3;  3R6N A;  2P0P A;  3NTH A;  1UGR B;  4JJB A;  2KBT A;  4BB7 A;  1VQ9 A;  4HT9 A;  3CCV T;  1PKT A;  1KQ1 A;  1OX9 A;  1OOT A;  3M0U A;  4KT0 E;  4HVW A;  4Y91 A;  1SSH A;  1VQ4 T;  2COZ A;  1X2K A;  2LRQ A;  1WJQ A;  1ZHI A;  3O5Z A;  4FYY B;  1Q81 C;  2X3X D;  1C0M A;  2XI9 A;  1C1A A;  3HL8 A;  3CMA T;  1PWT A;  1WHM A;  1W2B P;  1J3T A;  3VKI A;  1I8F A;  5CKF A;  4JJN K;  1VQO T;  3VS2 A;  5C0M A;  3CC7 T;  1ZBJ A;  2CRE A;  3PE0 A;  2CUB A;  4BAC A;  4CI0 C;  3MO8 A;  3G4S Q;  2FEI A;  3M59 A;  4HVU A;  2VKN A;  2F1L A;  1PRL C;  1H8K A;  4M7D E;  2EVR A;  2F2W A;  1S72 A;  3EHQ A;  2CT4 A;  2RJC A;  4XU3 A;  2E64 A;  1V29 B;  1KQ2 A;  1QQJ A;  2EPD A;  2FVU A;  4R56 A;  3OS0 A;  2HQX A;  1EZZ B;  3ME9 A;  1SRM A;  2KMT A;  1Q86 R;  4AFS C;  1WPY A;  2JM9 A;  3SWN B;  1HK9 A;  4A53 A;  3EG2 A;  1VQ9 Q;  4M75 F;  2EQK A;  1YJN A;  3OYL A;  1A0N B;  1RL2 A;  1Q82 R;  4ESR A;  2CUD A;  3M4G A;  2E65 A;  2R5M A;  1CKB A;  3I55 A;  3GOX A;  3MET A;  3OA6 A;  3HRU A;  2LC4 A;  4BE1 A;  3WVE B;  2BZY A;  1QMC A;  4M77 E;  4M78 G;  4C0G A;  1VQM T;  4XTU A;  1M30 A;  2AHJ B;  2J7I A;  1YJ9 T;  4D6W A;  1NYF A;  2J6K A;  2WSF E;  1AWX A;  3WVD B;  1LPL A;  1NBE B;  2RI3 A;  4LUE A;  2Y4X A;  2COY A;  3SDZ A;  2EJ9 A;  4D8D A;  2JMA A;  4JZ4 A;  3SEM A;  1UDL A;  2E70 A;  1VIF A;  2VYT A;  4ZTF A;  3JCM P;  1B34 B;  1S72 Q;  1HD3 A;  2A28 A;  2QQS A;  3I56 Q;  1WHG A;  2FPD A;  1MMG A;  4J9H A;  4BDY A;  3CCM Q;  1VQ6 A;  2JUF A;  2CZ1 B;  5HY6 A;  5KE3 A;  4ZGJ B;  1N6A A;  1M9S A;  1TS9 A;  1Q7Y U;  4M7D A;  1K9A A;  2ABL A;  2EYZ A;  4YTL A;  5GMK i;  1TUG B;  3GF5 A;  4IUP A;  2LJ3 A;  1R77 A;  1ARK A;  1QWF A;  1X01 A;  2GF7 A;  5CAI A;  1FWZ A;  3PFS A;  4BI8 B;  2K9G A;  2HQH A;  1OYX A;  4X34 A;  4LDU A;  4MDW A;  1VQK Q;  2KNB B;  3JB9 H;  3HKS A;  4FSS A;  2RF0 A;  8ATC B;  3G6E T;  2RK2 A;  3SFM A;  1U1S A;  2DAQ A;  3M0T A;  5A0D A;  4FIB A;  4PJO E;  1E6G A;  1DJ7 B;  2L8D A;  4QVD A;  4AFQ C;  3CQT A;  1P92 A;  1V76 A;  4Z02 A;  2E6N A;  2KGT A;  1MV0 B;  3OYM A;  3EFS A;  2E10 A;  3VV0 A;  4M77 A;  2P0K A;  3EGD B;  1K8A C;  1K9M U;  2M16 A;  3BDL A;  4C0D C;  3CCE A;  2LQN A;  2QI2 A;  4ME7 A;  2COW A;  4M75 B;  2DJZ A;  2FB7 A;  3CBM A;  3MP8 A;  1VQL T;  5KYX A;  2B86 A;  2EQJ A;  3CEY A;  1YCY A;  2RM4 A;  2RI5 A;  2FPE A;  3PIO A;  2DBM A;  4F14 A;  3CCS T;  4M78 F;  1YHQ A;  3REB B;  5L23 A;  2EAY A;  2O88 A;  1ZSZ C;  5GAN d;  5L8R E;  5CKE A;  2JM8 A;  3N5B B;  5HK3 A;  2BUD A;  1PKS A;  3E2U A;  2E3H A;  4OMQ A;  5FW9 A;  1IO6 A;  1OPL A;  1WX6 A;  2HD0 A;  4AMC A;  1K0S A;  5CKH A;  4B9W A;  3HP9 A;  2AZS A;  2A0F B;  2KT8 A;  4QQD A;  2GTJ A;  1NEG A;  2OTL A;  2RA2 A;  4OP0 A;  3RKY A;  1NJI U;  2EQI A;  3PGG A;  1KC8 C;  4M78 C;  1O75 A;  2L5Q A;  3CC4 Q;  1X69 A;  2Z0W A;  3E19 A;  1N9S A;  5CCA A;  5GMK h;  3UDC A;  4C92 E;  1K73 C;  3EHR A;  3HPW A;  4M7D G;  2CKK A;  1R0C B;  5KYW B;  2C0I A;  4PJO A;  1WGS A;  3NFC A;  2FZK B;  1YBY A;  1NZ9 A;  4B6M A;  3E9G A;  1UG1 A;  3LH5 A;  1X43 A;  1M2V A;  3MCA B;  2RHU A;  2DLP A;  1M8M A;  2JS2 A;  1W6X A;  4RTZ A;  2JJ9 A;  3I35 A;  4QQ6 A;  5FU7 B;  3VJP A;  2FRY A;  5A0L A;  2K2V A;  3EFO B;  5GAN f;  3CD6 T;  3HSB A;  5I11 A;  5CKD A;  3CCV A;  1K4U S;  4N4H A;  1ZUU A;  2LT1 A;  1YIJ Q;  2MWP A;  4LDY A;  3EH2 A;  3VS4 A;  2FYK A;  3TU4 K;  2KQW A;  2HBW A;  2GQI A;  2X51 A;  4OGC A;  1YIT T;  2ENM A;  1QP2 A;  1QLY A;  3G71 Q;  4WTO B;  2RMO A;  4RMO A;  2PZ1 A;  1KSW A;  4OB1 B;  3X26 B;  3CMA A;  4C8Q E;  1VQP T;  4KUD K;  2BE7 D;  4R55 A;  2GNC A;  3ZL7 C;  4HVV A;  4M77 G;  1W2B S;  1VQO A;  1QP3 A;  2KRM A;  2R5A A;  1QVF A;  5GAN h;  2V1R A;  3DKM A;  4ZNX A;  1TSF A;  2EYY A;  2LNV A;  3H0F A;  3M0Q A;  4J9C A;  2MI6 A;  2YDL A;  2YRD A;  1M3C A;  4OMN A;  5KE2 A;  3V8L A;  2ATC B;  3CCQ Q;  4M78 B;  1PM3 A;  1M3A A;  2M02 A;  3OS2 A;  2DET A;  2LCS A;  4J6X A;  1VQ7 T;  1AD5 A;  2CP3 A;  2M0O A;  3L1A A;  3CCR T;  2DZC A;  3MEW A;  3CC2 T;  4M7A F;  2EJG A;  5KYY A;  5IHN A;  1MMA A;  3OSS C;  1GL5 A;  4C92 A;  4N0A C;  5CVI A;  2LJ1 A;  3JB9 G;  1QVG A;  1WNL A;  1UEC A;  1N8R U;  2E3I A;  1W2B A;  3FJP A;  2GTO A;  2PU9 B;  1EFN A;  1SHG A;  2DXU A;  4M75 D;  2MPX C;  2JTF A;  3CCJ T;  2E41 A;  1IB8 A;  2OTJ T;  4WCI A;  4F7U F;  1WI7 A;  4EMK B;  3OQ5 A;  2K5F A;  3H0H A;  2CP5 A;  4NS5 A;  4O5V A;  3GIB A;  5A0G A;  4JUV A;  4NL2 A;  2O31 A;  5GAN 2;  1VQM A;  3OW2 P;  5GMK e;  2RB6 A;  1YJ9 A;  4Y92 A;  4PJO G;  2CH4 A;  4DBR A;  1D3B B;  1NLO C;  1GCQ A;  5IT9 E;  1PSF A;  2NLU A;  4MZT A;  4BI3 A;  1VQ8 T;  4Z89 A;  4E2F B;  1JBM A;  2CT3 A;  3RER A;  1M3B A;  1Q82 C;  1WHH A;  4C8Q A;  2X3W D;  3RDV A;  2QGG A;  5D6Y A;  1YI2 A;  2HEQ A;  4JLG A;  1V1C A;  2KSS A;  2W0Z A;  5LJ3 e;  4J9E A;  1OZ3 A;  1VYT A;  4M7D C;  1QWE A;  2AKL A;  2D8J A;  5LJ5 e;  1WXB A;  1JXO A;  3CME T;  5ECA A;  4M77 F;  4DOV A;  2DRK A;  1Q7Y C;  2M1H A;  5IN1 A;  2J6O A;  1R8O B;  1KJW A;  1M90 U;  1WYX A;  2DK3 A;  3AT1 B;  2MIO A;  4J9D A;  3GPL A;  1G3T A;  2A3L A;  2GGR A;  3MEV A;  3RUX A;  5LJ3 g;  4FSX A;  1RAC B;  2CP0 A;  2L3Q A;  4RG8 A;  5DM7 R;  5IAY A;  2XID A;  3G1J A;  3G6E A;  5LJ5 g;  1G83 A;  1KC8 R;  1JU5 C;  1VQM Q;  1M2O A;  3RBB B;  4J8O A;  4WF2 A;  2CZ7 B;  4XU0 A;  1M1G A;  4M77 C;  4M7A B;  1G5V A;  4KH1 B;  1D1A A;  2J05 A;  1B7T A;  3F70 A;  3UPU A;  1M27 C;  2JOY A;  1YJW T;  3C94 A;  2X4X A;  3JRZ A;  4C92 G;  2XDD A;  3G7Z A;  1KG1 A;  3NTI A;  4Z88 A;  3J7A F;  3QHS A;  4HT8 A;  2GFU A;  2VC8 A;  3M56 A;  1AEY A;  1YI2 Q;  2V1Q A;  2YHT A;  1VQL A;  2RPN A;  3QO3 A;  5HKC A;  3JCM X;  4RCC A;  1AOJ A;  2LQK A;  2ZPB B;  4HA8 A;  3S3O A;  4GY5 A;  3CCS A;  2L3R A;  3EG1 A;  2O9S A;  2KK4 A;  3L2Q A;  2YLC A;  4F7U B;  1H64 1;  9ATC B;  2HQE A;  4E7L A;  2IPO B;  1B3Q A;  5GAN 6;  3EGU A;  4A63 B;  4IUR A;  5EC7 A;  2FRW A;  3A5Z B;  3UAT A;  1LNX A;  3DB4 A;  1QVF P;  5IH2 A;  3V8K A;  2C0O A;  1NEB A;  1AZE A;  4JRI A;  5J26 A;  3FEO A;  1OU9 A;  4C8Q G;  4ANJ A;  1AZG B;  1IHW A;  5J39 A;  5FWB A;  2GCX A;  2CSQ A;  4RG2 A;  2DM1 A;  2DL5 A;  1NYG A;  3NTK A;  2DIG A;  4Q5W A;  2VB6 A;  2V8J A;  3CCL T;  1VQN T;  4PJO C;  1Y7X A;  3BY7 A;  1HYO A;  1NG2 A;  1NJI C;  1QCO A;  2LMJ A;  2VGM A;  5LL6 S;  2PUK B;  2LQW A;  2P84 A;  1TXQ A;  3DLM A;  2R57 A;  2JW4 A;  5I21 A;  2G3R A;  2K6D A;  4ORZ A;  4LNP A;  2ED0 A;  4GLK A;  3CCS Q;  3CD6 A;  2RQU A;  2NUP A;  1AHJ B;  2EYQ A;  3KFV A;  4BDZ A;  2LP5 A;  4BI4 A;  1K0X A;  4JPB W;  2NUT B;  1FYN A;  1YWO A;  4MZM A;  4J9I A;  2D9T A;  5D6W A;  2HMA A;  2QTX A;  4C92 F;  3OS5 A;  2QA4 T;  5KYU A;  1Y0M A;  3VUB A;  2EBP A;  1JXM A;  1GFD A;  1VQP A;  1S1N A;  2X4W A;  3A8G B;  3Q1J A;  1IRX A;  1JB0 E;  3V7R A;  1FMW A;  5D7U A;  1ZQ1 A;  4HXJ A;  3M5A A;  3FJ5 A;  2YXY A;  3CCU T;  3M55 A;  2M51 A;  3OY9 A;  2RJF A;  3LGF A;  1OZ2 A;  2YT6 A;  4BY6 C;  1VQ5 T;  4RTU A;  2MCN A;  1VQ7 A;  1WHL A;  2GBQ A;  4C92 C;  4KBM B;  3CC2 A;  4JZ3 A;  2LX7 A;  4C0F A;  1M2V B;  1M4Z A;  4JRK A;  1QW1 A;  1I0C A;  4KH0 B;  1XQH A;  3UF4 A;  2YWW A;  4M7A D;  4J5Y A;  3IQL A;  2KY9 A;  1Q7Y R;  2EQU A;  3U23 A;  3JCM V;  2B8A A;  2DF6 A;  3PT9 A;  4ZGD B;  1M1K U;  3HRS A;  4QVC A;  3THK A;  3FC3 A;  3CCJ A;  4XTV A;  2DYI A;  1TUD A;  2OTJ A;  4RUG A;  7AT1 B;  4OMO A;  1ZSG A;  2L0A A;  3VYG A;  3NHN A;  4PFZ A;  2KT1 A;  4DA4 A;  4ZN1 A;  1MV3 A;  3OYE A;  2MMP A;  5CIU A;  5HCK A;  4F04 B;  3VYH B;  2DA9 A;  5I2S A;  1JEG A;  1AWO A;  2O2O A;  4IUQ A;  4PJM A;  1B07 A;  3OW2 S;  3EAE A;  4LD9 K;  3GNF B;  2ROT A;  1YJN Q;  4C8Q C;  1VQ8 A;  4PLI A;  4PK4 A;  2DVE A;  2LCL A;  4QQG A;  1RAB B;  2V26 A;  3JV3 A;  3QSU A;  2RQV A;  2H3E B;  1R0B G;  3QKJ A;  3LLR A;  2A36 A;  2CZ6 B;  1HXD A;  3I55 Q;  4FL6 A;  1IZ6 A;  4MZP A;  4RTX A;  1BCO A;  2O4X B;  5FRN A;  3OB9 A;  1X27 A;  1K9M R;  3EG9 A;  4LUD A;  2XKO C;  3EH1 A;  2EW3 A;  1TUC A;  5GMK j;  2H3J A;  2XDP A;  4BY6 B;  1PHT A;  5LJ3 d;  3RKX A;  2KYB A;  3LW5 E;  4C92 B;  1Z9Q A;  3E1S A;  5LJ5 d;  2EIF A;  2L89 A;  2DNU A;  2HBP A;  3VUZ A;  1OI1 A;  3GNG A;  4FW2 A;  2EYX A;  2XD0 A;  5DY9 A;  3OW2 A;  1EIF A;  2ZCF B;  1ACM B;  1VYV A;  3GP8 A;  2VVK A;  3CPW P;  2HKN A;  2OTJ Q;  1VQ6 Q;  1MGQ A;  4AG1 C;  3BE3 A;  4Y28 E;  3BW1 A;  5LJ5 j;  2QK0 A;  2AIR B;  1Z9Z A;  1MND A;  2EJF A;  1VUB A;  2ED1 A;  2A37 A;  4E7I A;  1YN8 A;  2EQM A;  2JT4 A;  2G6F X;  2PVO B;  1UGQ B;  3HFO A;  2MAM A;  3S3M A;  1Y96 B;  1NJI R;  1UJ0 A;  1IXD A;  3P8B B;  1ZA2 B;  1YJW A;  1XTD A;  3JCM d;  3E9F A;  1RAH B;  2E12 A;  4R0K A;  2JTM A;  1BK2 A;  5GAN j;  3EGX A;  3M4Y A;  1I4K 1;  3PVQ A;  2J6F A;  3KXT A;  3I5R A;  2K3X A;  2IG0 A;  5LJ3 f;  2PQW A;  4HKE A;  4EMH A;  4IKF A;  3UA6 A;  2NUZ A;  3L2V A;  2OX7 A;  4FT2 A;  5LJ5 f;  3CBP A;  3V7C A;  3ULR B;  1UB4 A;  2QEX A;  3M9Q A;  2DL4 A;  3SWN A;  2JMC A;  1UHC A;  3JCM c;  1LOJ A;  4FU6 A;  1GBQ A;  5GAO p;  3CCE Q;  3ZEH A;  3MJX A;  2K79 A;  1TOV A;  1Q81 U;  4MMK A;  1QVF S;  2CYZ B;  1SSF A;  2ZPG B;  1VIE A;  4FCY A;  4C0D B;  2ESW A;  1BIB A;  1I5O B;  4PJN A;  2DIQ A;  5LJ3 h;  1YHQ Q;  2WSC E;  3QYG B;  3I5S A;  1HSQ A;  3JB9 J;  5LJ5 h;  4M75 E;  3VS1 A;  2DXT A;  1ZSZ B;  3CCL A;  1VQ4 A;  1VQN A;  4E7H A;  3VS6 A;  2F2X A;  2M0Y A;  1CKA A;  2EKH A;  2WAC A;  3EFR A;  5FU6 C;  3OYC A;  2H8H A;  1X6B A;  4CC3 A;  1S72 T;  2RQT A;  3I56 T;  3QBY A;  1BCM A;  2K5I A;  1UGS B;  3TEE A;  3CCM T;  5HK0 A;  4DQ2 A;  2OTL Q;  3CC7 A;  4IIM A;  1I5L A;  3NGP A;  1YWP A;  4RTT A;  4J9F A;  5IXB A;  2WSE E;  4HCK A;  4OVA A;  5KCO A;  3VS0 A;  4RKU E;  3R6O A;  2QEX Q;  4E7Z A;  1QVG S;  3JCM h;  3C12 A;  1G2B A;  3VS5 A;  1N8R R;  4DEX A;  3I9Q A;  2ZPF B;  2EFI A;  3QZ5 B;  2O9V A;  2HL5 C;  5IHI A;  2QA4 A;  1G3S A;  4MDX A;  2LTO A;  1VQK T;  1E6H A;  2D0Q B;  4C5I A;  5GAM h;  1M8V A;  1ZX6 A;  2DYB A;  1Q95 G;  2KVQ G;  4XTZ A;  1VYU A;  3QYH B;  2JVV A;  5GJV B;  2EKO A;  3A8L B;  1ZUK A;  1H3Z A;  3CCV Q;  2K2M A;  4PFO A;  1UFF A;  1ZLM A;  2MWO A;  3X28 B;  3HHT B;  3H6Z A;  1U5S A;  1KQS A;  2MF2 A;  2EYW A;  2VV5 A;  1VQ4 Q;  1X75 C;  3X24 B;  1BIA A;  4M7D F;  3OMG A;  4LDV A;  5GAN 4;  1WA7 A;  1VQ5 A;  2RNA A;  4JJC A;  3EGD A;  4FT4 A; 
#chains in the Genus database with same CATH homology
 1VQM Q;  3CMA Q;  1YIT Q;  1VQK Q;  1VQL Q;  2QEX Q;  3OW2 P;  1YHQ Q;  1QVF P;  3CCV Q;  1KD1 R;  1N8R R;  1KQS P;  1YJ9 Q;  3I55 Q;  1M90 R;  1Q7Y R;  1K73 R;  1YIJ Q;  1VQO Q;  3CCS Q;  3G4S Q;  3CD6 Q;  1VQP Q;  1Q86 R;  2OTL Q;  1JJ2 P;  3CC7 Q;  1K9M R;  3CCE Q;  2QA4 Q;  1S72 Q;  1VQ7 Q;  1VQ9 Q;  3CCU Q;  3CCL Q;  1K8A R;  1VQ4 Q;  1QVG P;  3I56 Q;  3G71 Q;  1VQN Q;  3CCR Q;  1YJN Q;  1Q81 R;  1M1K R;  1W2B P;  1NJI R;  3CPW P;  3CXC P;  3CC4 Q;  3CC2 Q;  3CCM Q;  3CCJ Q;  1Q82 R;  1VQ8 Q;  1VQ5 Q;  2OTJ Q;  1YJW Q;  3G6E Q;  1VQ6 Q;  3CME Q;  1YI2 Q;  3CCQ Q;  1KC8 R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...