1VQ4Q

The structure of the transition state analogue "daa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 20
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1vq4Q00
3OW2P 1VQ5Q 3CCJQ 1VQ4Q 1VQ7Q 1VQ8Q 1K8AR 1QVFP 1JJ2P 3I55Q 3CXCP 3CCRQ 3CCEQ 1YITQ 3CMEQ 1YJNQ 1N8RR 1YHQQ 3CPWP 1KC8R 3CCMQ 1YJ9Q 3CMAQ 1VQMQ 1YI2Q 1K73R 1VQNQ 1M1KR 3CCQQ 1Q86R 1YIJQ 1M90R 1Q82R 1VQLQ 3CCSQ 3G4SQ 1VQ6Q 3CCLQ 3CCUQ 1VQOQ 1KD1R 3CC7Q 3CD6Q 3G71Q 3I56Q 1Q81R 3CCVQ 1YJWQ 3CC4Q 1Q7YR 1NJIR 1VQPQ 1QVGP 1K9MR 2OTJQ 2QEXQ 1S72Q 2QA4Q 1KQSP 3CC2Q 2OTLQ 1W2BP 1VQ9Q 3G6EQ 1VQKQ
chains in the Genus database with same CATH superfamily
3U23A 4DEYA 1ZUKA 5LJ3h 3OA6A 4VUBA 2EQKA 3L2ZA 1RAEB 1VYTA 4QQ6A 5IHNA 1XQHA 2MIOA 1NYGA 4PK4A 5CQYA 1QQJA 1GCPA 5A2QE 2LC4A 2JM9A 3OMGA 2CGHA 4R0KA 3QZ5B 4XTYA 1ZLMA 1VQOT 1ARKA 5IXFA 4Y28E 3A8HB 3QKJA 2ATCB 4LDWA 2OTJT 2CSQA 1VQ8Q 3M4YA 4Y92A 4F7UE 1QVFS 2RH2A 3LH5A 2L3QA 3LGLA 3SFMA 3QDRB 4N0AC 1RAAB 1M4ZA 3E19A 1YIJQ 1XJWB 3OYBA 2GTOA 1M1FA 3CBPA 5KYNA 3EGUA 5GMKm 3CMEA 2F69A 2F2VA 1WXBA 3QWYA 4M77D 3MP8A 1BU1A 4EDUA 2K3BA 3JCMh 3CCSA 1SHFA 4KULA 2O88A 3VUZA 2V1RA 5GAOq 3UA6A 1VQNQ 3HFNA 3VS0A 2E6ZA 2DF6A 1M1KR 4CC7A 3C94A 1WHGA 4JRPA 2B86A 2EYXA 3JCMJ 2CZ6B 2LMJA 1QVGP 4KH0B 2LX7A 2CDTA 3VKIA 1VQ7Q 4M78D 3CCEQ 2D9TA 3FC3A 4PL6A 3E2UA 4M75B 1GBQA 2QQRA 2L89A 3QWXX 3O8VA 3EHRA 4E2FB 1X6GA 2EAYA 3DLMA 3M59A 3V8LA 1Q86C 1MMNA 2AT1B 1KC8U 4C5GA 2LQNA 5DM7R 3FRNA 1PKSA 2CYZB 3A8OB 4Z8AA 4E47A 1TH7A 3M58A 3BDLA 3L2WA 1ABQA 2K3XA 2CS7A 3VRZA 3BW1A 2AIRB 2J6FA 2EJFA 3LGFA 2RJCA 1VQ9Q 4C0DC 1CSKA 1UGSB 3CMEQ 2CZ0B 2JS0A 2MCNA 3PT9A 4M77E 4X9CA 4P5NA 3PVQA 3L2UA 2LP5A 3CCSQ 4IUQA 4J83A 2P0PA 1TUDA 2BE7D 2DTIA 2J05A 3CMAA 2QQ9A 1RUWA 3EG9B 5L23A 1K9AA 4KH1B 4JJNK 2GBQA 3M57A 4OP0A 3QJ6A 4J6XA 1YITT 3OY9A 2MF2A 1YHQT 3SB2A 2RK1A 1VQMT 5KYWA 4M78E 1WQ7A 3V7SA 3HL8A 4AG2C 2HCKA 3GPLA 4JJCA 1T3SA 2AZVA 3RERA 2DXUA 1ZSZB 2FZKB 2FL7A 4B9WA 4LXCA 2KYMA 3PNWC 1QCFA 1NEBA 1VIFA 2EFIA 4FT4A 3S6WA 1YJNQ 2YUOA 1PSFA 2DVJA 1GBRA 1VQLQ 2EJGA 2A7YA 2O9VA 4LDXA 4LN2A 2IVWA 2QGFB 2H3JA 5C0MA 2F2XA 3VRYA 3C4SA 2DZCA 4X34A 4BACA 3R6NA 2ROTA 1IREB 2V26A 4LNPA 2GQVA 1XOVA 4M75D 1SKUB 2JUFA 2GFUA 1K73R 3KUFA 4RTYA 4KGZB 1T0HA 2M0OA 1WA7A 2HKQB 4ZN1A 1KC8C 2QASA 3KBGA 3A1PA 1G3TA 2KR3A 3CCVA 1RLQC 3MKDA 4QVCA 2Y90A 1SF9A 3META 1QP2A 3OYGA 3HSBA 2JW4A 3CMAQ 3HP9A 1M90R 1Q95G 1D09B 3RKWA 1QWFA 1GRIA 1U5SA 4BDYA 2A0FB 5LJ3g 2QDLA 3I5RA 1UHCA 1VYUA 2GQIA 4L5GA 2K57A 2OJ2A 4OGCA 3I35A 4M7DE 2DIQA 4HCBA 4IIMA 3GNGA 4FU6A 2AZSA 3QO3A 1M1KU 4NL3A 2GCXA 4PJOC 3CCJT 2NUPB 3HKSA 4C0DB 2K79A 3WVEB 1JXMA 3M0UA 4AMCA 5CQXA 2QYZA 3JB9D 1C0MA 4DEXA 1BKBA 3GNFB 5FRMA 4XTUA 2KVQG 4OB2B 2PQWA 4RTTA 3G71A 3OYMA 4A63B 2FVUA 4C8QA 3OMCA 1ABOA 3VS6A 3TSZA 4EPCA 2HSPA 3DB3A 5LJ5h 5GANf 4M75E 3CCUT 1RI0A 2C0IA 4C8QF 3WVDB 3VS2A 2RQTA 3HRUA 3DLLA 3QDFA 2FRYA 4YTLA 1VQ5T 3I55T 2DTHA 2JXBA 1W6XA 4ZTJA 1Y96B 5GANe 5HKCA 2MWOA 3UWNA 1QW1A 3RKYA 2QTXA 1PG5B 2C0OA 4JJDA 4F7UG 2VYTA 4XU1A 3TEEA 3G4SA 3OBYA 3JCMd 3A98A 2LNHB 1BK2A 3DKMA 2DXBA 4JS4A 2EQIA 4V2SA 5CKDA 3E9FA 2L5QA 3L1AA 3R6OA 2KRSA 2ECZA 1X43A 1ZQ1A 2V1QA 4ELZC 5KE3A 1AWJA 2OX7A 1NJIR 1BIAA 2K5LA 2E1HA 4HCKA 2EGEA 2YT6A 2KXCA 2B8AA 4KGVB 1YCSB 2HBPA 5GAMh 1IHVA 3T9NA 1T0JA 4RUGA 5CO7A 3L42A 4C92D 4OGEA 2LCLA 5GAOp 2EQMA 4N0AA 3G71Q 5DLQE 4C5EA 3CC7T 3N5BB 2XU8A 3OYYA 1YJWT 7AT1B 1M1KC 2FB7A 1WI7A 3CEYA 5GMKh 3ZEHA 2F5TX 1JU5C 3QYGB 4LDUA 2KAFA 2A08A 5IHKA 2M0YA 2VV5A 3M0PA 5CKHA 2BIVA 4J9HA 4HCZA 4OMLA 1SRLA 2HEQA 3CPFA 1AT1B 3EHQA 1UGVA 1ZBJA 4MMLA 2FHDA 3FIFA 1KFZA 1N6AA 1GL5A 5GAN3 4ME7A 2CZ7B 2QEXA 1OPKA 1WHKA 1WHHA 2NLUA 2MWPA 2LVMA 4OB1B 3TU4K 2RK2A 1X6OA 5KYUA 2VXEA 1YIJT 1SG5A 3C12A 4BE2A 4E7SA 1N8RC 1I5LA 3CCMA 4QQGA 2DJZA 1OULA 2P4TA 3S3MA 4M77G 1M90U 3G6ET 3H6ZA 2YLCA 3I9QA 2HQEA 1VQNT 2EVRA 1QWEA 3INZA 2ESWA 2RA2A 1UGQB 3FDRA 1QVGS 4OB3B 3ER0A 4BY6B 1GFDA 4C92E 5CR2A 4M7AE 2Y4YA 5LJ3j 1D1AA 4OB0B 4M78G 1MMGA 3CCET 2K2VA 2E10A 4JLIA 2YXYA 1MHNA 4ZGJB 1VQ4A 2RN8A 2DLPA 1C6VX 4XTWA 4MDWA 1IZ6A 4XU0A 3JB9H 1OU9A 3OQ5A 3CCQA 2J7IA 3CCLA 3SD4A 3E1SA 3CPWP 2WSCE 8ATCB 2V8KA 1NZ9A 4R56A 4HT8A 3OYHA 2DZ9A 1TUCA 5KYWB 1QKXA 5KCHA 5D6WA 2QA4T 1LOJA 3LWIA 1QCOA 1VQ9T 4EMHA 1Y57A 4LD9K 3GBQA 2IIMA 1B34A 3MEVA 2X4WA 3OYAA 2FPEA 3GIBA 1D1BA 2CP3A 3LW5E 3QXEB 2I0NA 2K2MA 2V8JA 2KROA 4FYVB 3NTIA 1I8FA 3M4GA 2E65A 2KYBA 1K73C 1JQQA 3ZBDA 2O4XA 3VUBA 1AD5A 1PSEA 3M53A 3MEUA 1WJRA 5CAIA 2OTLA 5LJ5g 2EYYA 3RUXA 1NJIU 2L2PA 1R8OB 2ED1A 1RAIB 4M7DG 1QCNA 2DILA 1W1FA 4KGXB 2R5AA 3TVTA 3I56T 1N27A 2VGMA 5FU6C 2JMCA 4LUEA 1S72T 1M90C 1VQ4Q 1JRIA 1QKWA 2CP5A 2VC8A 1FYNA 3UA7A 4ELYC 1BCOA 1ZA2B 1U06A 1YWOA 1YJNT 3CCQQ 1U3OA 1XNIA 2HQXA 4GLKA 2E64A 3CCLQ 4F7UA 2KT1A 4F16A 1VQLT 1G8XA 2E3IA 3Q1JA 1UFFA 3V7RA 2CP6A 4FW1A 4F14A 1AZGB 4J9IA 5LJ5d 2CUBA 1WFWA 2XK0A 1VQPT 2RHZA 4BD3A 2CUDA 3VS3A 1JJ2P 1PM3A 1UUEA 4DOVA 3EG1A 2JTMA 2DK3A 2R58A 2LT1A 4OVAA 1JEGA 1WXUA 4M75G 4PJOA 1GCQC 2RNAA 4Y91A 2ZPIB 3LX7A 4PFZA 4KUIA 1I07A 1D1CA 4OMPA 5CVIA 2LCCA 3MO8A 1V76A 3MEWA 4PJOF 3SEMA 1EIFA 1K1ZA 1N9RA 3OSSC 3O5ZA 1K0XA 4O5VA 3V7CA 1KQ2A 3QUIA 4PJLA 4OMFB 4E7IA 1HXDA 4C8QB 2D6FA 2DFUA 1FWZA 2D8JA 1HYOA 3GLXA 1K0SA 1M8VA 2OTLQ 2HDAA 2E12A 2CP7A 2DBKA 3L2VA 2X4XA 4A4KA 1VQOA 1M30A 2R5MA 1N8RR 2OTJA 2DPPB 2L8DA 3OYJA 2DNUA 5GAMd 1PD1A 4C0ZA 4JLGA 1TOVA 3JB9I 3UDCA 4L6V5 2K3YA 1AOJA 2ABLA 2E41A 1RADB 1RAFB 5C6SA 4IUTA 4X1VA 4C0FA 1G5VA 1ZHIA 1NJIC 3VS1A 1IHWA 2BE9B 2RJDA 5J26A 1VQKA 4E7HA 2RQRA 1E6GA 2ZGWA 2HL5C 2FZGB 9ATCB 5LJ3f 1Z9QA 4XAXB 4M77A 1OZ3A 3SWNA 2XIDA 2EYZA 3PIOA 2DM1A 4E7ZA 2DKGA 4BI3A 2ENMA 4IIOA 1AWWA 5FU6B 5LJ3e 2C06A 4D8DA 1H641 1GFCA 1HJDA 1ZBXA 3LWHA 1X75C 4XTZA 1G3YA 4FL6A 3EG0A 5KE2A 2LTOA 3I5SA 3QYHB 3EFOA 5GANh 1PRMC 2ZZDA 4CC3A 2AHJB 1NEGA 2FPFA 1OQKA 4A4GA 2F2WA 2X4YA 5FWCA 3RNJA 3OS2A 1BCMA 4DBRA 3G1JA 1K8AC 1VQOQ 3RMSA 3REBB 4J9BA 5IXBA 3JCMf 2QGGA 2OTJQ 3PGGA 3JCMX 1HK9A 5HCKA 3ULRB 1QVFP 5FWBA 1LVKA 1N5ZA 4HT9A 4C8QD 3JCMe 4HCCA 4K11A 1YP5A 1O75A 2ROLA 2PTKA 2KE9A 4XK8E 2LT4A 1WPYA 4OMQA 2JOYA 4C92G 4M7AG 3GP8A 2CH4A 5LJ5j 1E6HA 3G71T 3M9QA 4RTWA 3EGDA 4GBQA 1JO8A 4J9GA 1VQ6A 1WYXA 3HHTB 4ZGEB 1VQKQ 1M5Q1 3H8ZA 2MYSA 1PCXA 2QAZA 1I1JA 1VIEA 1RL2A 2RM4A 1MV3A 2Z0WA 2O2OA 4Z02A 2QTVA 1N9SA 2K9GA 1YITA 1YHQA 2AKKA 1VQMA 2DVEA 3CD6T 2FRWA 2DRMA 3HRTA 4RCCA 4DOWA 2X51A 3JCMQ 1OV3A 1TUGB 2DAQA 2EQUA 2KSSA 4CI0C 3X24B 2WSFE 2FPDA 2FO0A 1OOTA 1SEMA 4PJMA 1TWBA 4M7DA 2PVOB 1OEBA 2DJQA 2YUQA 1RAGB 4BI4A 1BB9A 2CSIA 2PU9B 4FW2A 4QKUA 1SRMA 1WHJA 5AT1B 1PNJA 2VB6A 3UPUA 4II1A 2EKOA 3TQ7P 1WXTA 1Q82C 5FU7C 4AFZC 5M9OA 4M7DF 3JB9J 2JTEA 2DYIA 2CT3A 3JCMP 5GAN5 5GAMj 1I0CA 1M8MA 4JDSA 2DA9A 1PC0A 1YI2T 3JCMg 4A4EA 2W0ZA 2RI2A 4C8QE 2DMOA 2YRVA 1N8RU 2DXTA 2LJ0A 1I4K1 3NGPA 3BDUA 3RMQA 1M2OA 5GMKj 1YFNA 3PFSA 5J3BA 1JBMA 1UJ0A 2DIGA 3M56A 2XD0A 1B34B 1VQ6Q 2L3RA 5GAN2 2XHCA 4RMOA 1H8KA 3CCVQ 3HRSA 2RI5A 4AT1B 5GAN6 1W2BP 3A8GB 2QK0A 3QPHA 5HK3A 4NS5A 1YHQQ 3KFVA 4BDZA 3CPWS 2O4XB 2D1XA 2X3WD 4JRIA 4CC4B 3CCRT 2KY9A 4BUGA 1QVPA 2RHXA 1MUZA 1D0ZA 4R55A 3CCJA 4M77C 2BKDN 1TG0A 1F1BB 5HK0A 3SWNC 2DL3A 3PE0A 3J80E 3EG2A 2YRDA 3H9NA 2CT4A 4RG2A 4J6WA 2KRNA 1KD1C 1BYMA 3FJPA 1S1NA 5IHIA 1KIKA 4RTZA 2DX1A 2HZYA 3FB9A 2XG8D 3OBWA 3CPWA 2GGRA 1MMDA 3TCJA 4PNOA 4M78C 2OI3A 1KJWA 4F7UB 1KQSP 3CC4T 4ATOA 4JRQA 3CCUA 2E3HA 3CC2T 3VJPA 2BUDA 3C0CA 3OYKA 3PIPA 4LUDA 1H92A 5FRNA 4F04B 4RKUE 4DBQA 2RMOA 1VQ5A 1X6BA 4QT7A 5L8RE 3I55A 2GNCA 2IPOB 2KEAA 4PJOB 1MV0B 1UHFA 1EX4A 1GCQA 3AT1B 3RESA 2XKOC 3EFSA 1K4US 3NFCA 1FMVA 4FYYB 1VUBA 1K8AR 2XI9A 2H8HA 3OYIA 1K73U 1VQ8T 1IXDA 5KYYA 5GAN7 2DL4A 2COYA 5EG2A 1X01A 2A3LA 3G4SQ 3CCQT 4Z89A 1M2VA 3A8LB 3CCLT 4DBFA 1UJYA 5D7UA 1OX9A 3CCJQ 2XMFA 3TSWA 2PUKB 2NYSA 3QHSA 2J6OA 2DETA 4HA8A 5LJ5f 3DB4A 3NMZC 5IAYA 1NLPC 1P92A 5A0GA 5DLOA 1I81A 2PZ1A 2RQUA 2DRKA 5LJ5e 5GANd 4JUVA 1YJWA 3C95A 5GMKl 4M7DC 1VQ7T 4C5HA 3CQTA 1Q7YC 4JZ4A 4OMMA 1WDXA 2K7AA 4IUVA 1JJ2A 1E7OA 4EMKA 4C92A 4M7AA 4BE0A 3X20B 1ZUUA 3CCUQ 2CKKA 1PWTA 3OYDA 1WJSA 2RHYA 1W4SA 1J3TA 2L3SA 2HBWA 2DD4A 2X9HA 8AT1B 4E7KA 1VQ5Q 4M77B 4M4ZA 3J81E 2A37A 3HFOA 4C92F 1U8RA 4M7AF 5DY9A 1R0BG 1B3QA 3SWNB 4E6RA 3MEAA 2AK5A 2EIFA 4A4HA 4ORZA 2F1LA 3EGXA 4J9FA 3S3OA 2QI2A 3OYLA 4MZPA 1Q82R 3M0QA 3EH2A 3VU3C 1Y71A 2EKHA 2PNIA 2YLBA 2K5FA 5GAN8 3D7SB 1BI0A 2QEXQ 1YJ9A 2DD5A 3MJXA 1B07A 4M75C 5GAMf 1D3BA 2D0NA 2A28A 1WZOA 3EFOB 3QG1A 2RHUA 1O9SA 2M16A 3OYNA 4FYXB 4FSSA 2O01E 2YDLA 3CCMQ 5IT9E 5J39A 5GAOl 3CMET 4ZN3A 3RDVA 3G6EA 2CP0A 4PJOD 1AHJB 2DL8A 2HD0A 4UC4A 2KT8A 3CCST 2MMPA 2VWFA 1VQNA 1UGRB 3JCMW 1BIBA 4LD6A 2XDBA 2J6KA 5FLXE 3CBOA 1C1AA 2XDPA 3CXCA 1ZA1B 2MAMA 3CCEA 4MDXA 5KYXA 2KRMA 1YJWQ 2H3EB 1AEYA 3MCAB 4E7JA 1X69A 1G2BA 2EYWA 3LLRA 4RTUA 4BI8B 3EGDB 4QQDA 2EW3A 3OS1A 1SHGA 2RQVA 3OW2A 3NPFA 5GAOn 2OAWA 2P0QA 4PJNA 1V1CA 4XU2A 4MMKA 2ZAEA 3OB9A 4HKEA 1EZZB 3VV0A 1KD1R 4AFSC 1UTIA 3P8HA 1WNLA 4HVUA 1QP3A 1M3BA 4WTOB 1YCYA 2XICA 5CKBA 1WJQA 3VS5A 2CH4W 4OMNA 1ZSZC 2JZ2A 2KNBB 4F7UF 2QA4A 2A36A 2QXFA 1YJ9Q 2ED0A 1VQ9A 2ZPGB 2M1HA 4PJJA 5IH2A 4C8QG 4FIBA 1U1SA 4M7DB 4DQ2A 2HAXA 3MP6A 4J8OA 1K8AU 2LDMA 1M27C 4L59A 2O31A 5GAMg 3G6EQ 4PJOE 1OU8A 2CZ1B 1LNXA 1VQKT 1AZEA 4ANJA 3X26B 1QVFA 5AYFA 4J5YA 3URGA 3CMAT 3E9GA 1QLYA 3MP1A 3CBMA 1SSHA 3J7AF 2ZPBB 3S3NA 4E7LA 5GANj 4FT2A 1NPPA 4FM4B 3I56A 2DEQA 4N4HA 4CC2A 1S72A 2M51A 1TSFA 1YNZA 4ZTFA 2KBTA 4KRTA 1IRXA 1YJNA 1K76A 3X28B 2DEUA 1RABB 3EFRA 5GAOm 3QJYA 1VQLA 1HD3A 4HVWA 2EGCA 5I22A 4HVVA 2KDSA 3PTAA 3JB9G 1PD0A 3CXCP 4XU3A 4EMKC 4C92C 2PUOB 1Q81C 1VQPA 4M7AC 1K9MC 2G6FX 4JS5A 4C0GA 2RB6A 4FCYA 4J9DA 3EG3A 2FEIA 1OZ2A 2DL5A 2D8HA 1Q7YR 4JJBA 3JCMV 2QA4Q 2HMAA 2E4HA 1U1TA 2F5KA 3OW2P 2RJEA 4IURA 4BB7A 5KH6A 1NLOC 1CKAA 2JJ9A 1R0CB 4WF2A 1Q82U 2JNGA 2E70A 5GMKi 1UB4A 4J7FA 2D0QB 3SHWA 4M77F 2QQAA 3M55A 1IGQA 4DA4A 2RI3A 1VQ6T 1JXOA 2X4JA 3CCVT 2KMTA 2JN0A 3KXTA 1EFNA 1W2BS 4RG8A 3QBYA 2JTFA 3H0IA 5FROA 4M78A 2ZCFB 2KGTA 4PKCC 5EC7A 4M7DD 4BE1A 4EIKA 2KQWA 5KCOA 4PFPA 3BFMA 5CCAA 1M1GA 1OPLA 3I56Q 4JPBW 4M78F 1D0XA 1WHLA 2PVDB 1RAHB 1FX7A 2NUTA 1S72Q 2DYBA 1OI1A 1AWXA 2EYQA 2RO0A 2HNIA 2X3XD 4CRIA 3M54A 3A8MB 1TXQA 2DL7A 5D6YA 1UGPB 1SSFA 3JCMb 4PFOA 3JSCA 3WXMB 3OYFA 1W2BA 2DO3A 1UECA 1IGUA 1FMKA 3ME9A 1PKTA 1I5OB 2HSEB 1IO6A 2YUPA 1RI9A 2COZA 5KYYB 5GAOr 1MMAA 5CK9A 4EMGA 1KK7A 4LDVA 3THKA 2VASA 1KSWA 1X2KA 4J9CA 1VQPQ 1M2VB 5I2SA 1MGQA 1NM7A 2M02A 5KYUB 1KQSS 2ZPHB 1OYXA 2MK5A 4A4FA 2ZPFB 3UT1A 1Y0MA 1AVZC 4OF1A 2JT4A 1GXIE 1KD1U 3EH1A 1QMCA 3JCMc 1Y07A 6AT1B 4AFQC 2K5IA 4A54A 1T3LA 2K4YA 1UE9A 4KT0E 1YBYA 2HKNA 2LX9A 1BI3A 3L2RA 2K6DA 2G3RA 4D6WA 1SPKA 2EWNA 1NBEB 2C0TA 2QG9B 3V8JA 1KQSA 2P0KA 4ESRA 2VGNA 1V29B 1RLPC 2HQHA 3PVLA 2DTOA 2HL3A 2LQKA 4GLMA 1FMWA 4HXJA 2BTTA 2X35A 4EMKB 4C92B 4M7AB 3G4ST 1ZUYA 4JRKA 3V8KA 1ZSGA 1G3SA 3RR6A 1UDLA 2P4RA 2MOXA 2EBPA 3LH0A 4AG1C 1G3WA 3EGXB 1WLPB 1WIEA 2O9SA 4B9XA 3RBBB 4N4GA 3OYCA 2BZ8A 5I21A 5CIUA 1X2QA 2FZCB 3UATA 2RHIA 3SDZA 1PRLC 1M3AA 4O6JA 5LJ3d 4AFUC 4MZTA 4B6MA 1B7TA 1D3BB 3GOXA 2OAUA 1AWOA 4J9EA 4M75A 3EAEA 2RPNA 3RIRA 4LE9A 4QVZA 5A0DA 3ZFJA 2JM8A 2RF0A 4A53A 2Y4XA 4ZGDB 2LNVA 4M75F 3TREA 3CD6A 2YUNA 5GJVB 1YITQ 4KBMB 5ECAA 4GY5A 4JZ3A 1VQMQ 2LCSA 4N4IA 1IB8A 4BY6C 1Q86R 1NPRA 1Q7YU 1ACMB 2J06A 4RCBA 1Y7XA 1H3ZA 1KHCA 2MPXC 2SEMA 1Q81R 1LCKA 3VYGA 1K9MR 2RD1A 1YWPA 5KYXB 2DE0X 4PLIA 4FYWB 2W10A 3UF4A 2QEXT 1TTHB 2JS2A 2LJ1A 3VYHB 2IG0A 1TU0B 3H0HA 2AKLA 4Z88A 2BZYA 2RQWA 3BY7A 1WX6A 1PHTA 2CREA 3MHXA 3CCMT 2QQSA 4D8KA 4TVRA 3A5ZB 4PJOG 2RJFA 3EG9A 2QQBA 4QVDA 1YI2A 2LQWA 2WACA 1RACB 3JV3A 5GAN4 1YN8A 4XTVA 1KHIA 1VYVA 2R57A 2VKNA 3X25B 5IN1A 4M7AD 1VA7A 2EQJA 3BE3A 3JB9F 1ZSZA 3IQLA 2QDYB 3VS7A 3H41A 5CKFA 2GF7A 1A0NB 1LPLA 1JB0E 2NWMA 5I11A 2VUBA 3PMIA 1VQ4T 1OX8A 1UEBA 1X27A 3PMTA 1G83A 1XTDA 2FG0A 5FU7B 2YRCA 4Q5WA 4QW2A 3CCRA 5GANg 3CD6Q 1FXXA 1BBZA 2YWWA 4C5IA 2YSQA 5I2MA 3RKXA 2V8IA 5A0LA 5LL6S 3ZL7C 3H0FA 1JJ2S 4MZMA 2KXDA 3FLGA 2NUZA 1YJ9T 4OMOA 2I2LA 1Z9ZA 3OS0A 3OSVA 1KQ1A 2EPDA 2EGAA 2FYKA 3NTKA 3M0TA 1ZX6A 1M3CA 1DJ7B 2DERA 1W70A 4WCIA 1H3HA 3CC7A 1MNEA 3L2QA 2COWA 1BI2A 3REAB 4XQ3A 2LQ8A 3CC4A 1KC8R 3CC2A 1TS9A 5GJWB 2LZ6B 1YI2Q 4KUDK 4IUUA 1NE8A 3JAME 3M0RA 3QZ9B 1CKBA 4NL2A 4DBHA 2MI6A 5FW9A 3QSUA 2M9UA 4J7IA 2WSEE 2LJ3A 4PLLA 1VOMA 2SRCA 1MNDA 2P84A 3FEOA 4LDYA 5D6XA 3GF5A 2OTLT 4RTXA 1BI1A 3I55Q 2E5KA 2BZXA 1WGSA 2NUPA 1UG1A 3HTRA 2VXFA 3HPWA 1VQ8A 3G7ZA 5HY6A 3M5AA 2VVKA 2EJ9A 2DBMA 3JRZA 4F17A 2E5QA 2XDDA 1YIJA 3M0SA 1NYFA 4C8QC 1QVGA 2JVVA 4XTXA 3NTHA 3CCRQ 4ZNXA 3CXCS 2GTJA 3P8BB 3NHNA 4M78B 3ASKA 4IKFA 4X9DA 4IUPA 3MPUB 2ZPEB 1WHMA 4FSXA 2E6NA 3LYIA 3F70A 3OYEA 4NOYA 5GAMe 2GFAA 2KI7A 1D0YA 3AHUA 3QIIA 1R77A 2LRQA 2L0AA 2NUTB 4RTVA 2CP2A 2PVGB 3OW2S 2KK4A 3OS5A 1Y96A 1Q86U 1M9SA 4J6YA 3P8DA 5GMKe 1Q81U 5CKEA 1VQ7A 1K9MU 2DXCA 2YHTA 2L3PA 3CC7Q 1HSQA 1KG1A 2JMAA 3CC4Q 1WQWA 1LJOA 3CC2Q 1NG2A 3VS4A 3FJ5A
chains in the Genus database with same CATH topology
3OW2P 1VQ5Q 3CCJQ 1VQ4Q 1VQ7Q 1VQ8Q 1K8AR 1QVFP 1JJ2P 3I55Q 3CXCP 3CCRQ 3CCEQ 1YITQ 3CMEQ 1YJNQ 1N8RR 1YHQQ 3CPWP 1KC8R 3CCMQ 1YJ9Q 3CMAQ 1VQMQ 1YI2Q 1K73R 1VQNQ 1M1KR 3CCQQ 1Q86R 1YIJQ 1M90R 1Q82R 1VQLQ 3CCSQ 3G4SQ 1VQ6Q 3CCLQ 3CCUQ 1VQOQ 1KD1R 3CC7Q 3CD6Q 3G71Q 3I56Q 1Q81R 3CCVQ 1YJWQ 3CC4Q 1Q7YR 1NJIR 1VQPQ 1QVGP 1K9MR 2OTJQ 2QEXQ 1S72Q 2QA4Q 1KQSP 3CC2Q 2OTLQ 1W2BP 1VQ9Q 3G6EQ 1VQKQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OW2 P;  1VQ5 Q;  3CCJ Q;  1VQ4 Q;  1VQ7 Q;  1VQ8 Q;  1K8A R;  1QVF P;  1JJ2 P;  3I55 Q;  3CXC P;  3CCR Q;  3CCE Q;  1YIT Q;  3CME Q;  1YJN Q;  1N8R R;  1YHQ Q;  3CPW P;  1KC8 R;  3CCM Q;  1YJ9 Q;  3CMA Q;  1VQM Q;  1YI2 Q;  1K73 R;  1VQN Q;  1M1K R;  3CCQ Q;  1Q86 R;  1YIJ Q;  1M90 R;  1Q82 R;  1VQL Q;  3CCS Q;  3G4S Q;  1VQ6 Q;  3CCL Q;  3CCU Q;  1VQO Q;  1KD1 R;  3CC7 Q;  3CD6 Q;  3G71 Q;  3I56 Q;  1Q81 R;  3CCV Q;  1YJW Q;  3CC4 Q;  1Q7Y R;  1NJI R;  1VQP Q;  1QVG P;  1K9M R;  2OTJ Q;  2QEX Q;  1S72 Q;  2QA4 Q;  1KQS P;  3CC2 Q;  2OTL Q;  1W2B P;  1VQ9 Q;  3G6E Q;  1VQK Q; 
#chains in the Genus database with same CATH topology
 3U23 A;  4DEY A;  1ZUK A;  5LJ3 h;  3OA6 A;  4VUB A;  2EQK A;  3L2Z A;  1RAE B;  1VYT A;  4QQ6 A;  5IHN A;  1XQH A;  2MIO A;  1NYG A;  4PK4 A;  5CQY A;  1QQJ A;  1GCP A;  5A2Q E;  2LC4 A;  2JM9 A;  3OMG A;  2CGH A;  4R0K A;  3QZ5 B;  4XTY A;  1ZLM A;  1VQO T;  1ARK A;  5IXF A;  4Y28 E;  3A8H B;  3QKJ A;  2ATC B;  4LDW A;  2OTJ T;  2CSQ A;  1VQ8 Q;  3M4Y A;  4Y92 A;  4F7U E;  1QVF S;  2RH2 A;  3LH5 A;  2L3Q A;  3LGL A;  3SFM A;  3QDR B;  4N0A C;  1RAA B;  1M4Z A;  3E19 A;  1YIJ Q;  1XJW B;  3OYB A;  2GTO A;  1M1F A;  3CBP A;  5KYN A;  3EGU A;  5GMK m;  3CME A;  2F69 A;  2F2V A;  1WXB A;  3QWY A;  4M77 D;  3MP8 A;  1BU1 A;  4EDU A;  2K3B A;  3JCM h;  3CCS A;  1SHF A;  4KUL A;  2O88 A;  3VUZ A;  2V1R A;  5GAO q;  3UA6 A;  1VQN Q;  3HFN A;  3VS0 A;  2E6Z A;  2DF6 A;  1M1K R;  4CC7 A;  3C94 A;  1WHG A;  4JRP A;  2B86 A;  2EYX A;  3JCM J;  2CZ6 B;  2LMJ A;  1QVG P;  4KH0 B;  2LX7 A;  2CDT A;  3VKI A;  1VQ7 Q;  4M78 D;  3CCE Q;  2D9T A;  3FC3 A;  4PL6 A;  3E2U A;  4M75 B;  1GBQ A;  2QQR A;  2L89 A;  3QWX X;  3O8V A;  3EHR A;  4E2F B;  1X6G A;  2EAY A;  3DLM A;  3M59 A;  3V8L A;  1Q86 C;  1MMN A;  2AT1 B;  1KC8 U;  4C5G A;  2LQN A;  5DM7 R;  3FRN A;  1PKS A;  2CYZ B;  3A8O B;  4Z8A A;  4E47 A;  1TH7 A;  3M58 A;  3BDL A;  3L2W A;  1ABQ A;  2K3X A;  2CS7 A;  3VRZ A;  3BW1 A;  2AIR B;  2J6F A;  2EJF A;  3LGF A;  2RJC A;  1VQ9 Q;  4C0D C;  1CSK A;  1UGS B;  3CME Q;  2CZ0 B;  2JS0 A;  2MCN A;  3PT9 A;  4M77 E;  4X9C A;  4P5N A;  3PVQ A;  3L2U A;  2LP5 A;  3CCS Q;  4IUQ A;  4J83 A;  2P0P A;  1TUD A;  2BE7 D;  2DTI A;  2J05 A;  3CMA A;  2QQ9 A;  1RUW A;  3EG9 B;  5L23 A;  1K9A A;  4KH1 B;  4JJN K;  2GBQ A;  3M57 A;  4OP0 A;  3QJ6 A;  4J6X A;  1YIT T;  3OY9 A;  2MF2 A;  1YHQ T;  3SB2 A;  2RK1 A;  1VQM T;  5KYW A;  4M78 E;  1WQ7 A;  3V7S A;  3HL8 A;  4AG2 C;  2HCK A;  3GPL A;  4JJC A;  1T3S A;  2AZV A;  3RER A;  2DXU A;  1ZSZ B;  2FZK B;  2FL7 A;  4B9W A;  4LXC A;  2KYM A;  3PNW C;  1QCF A;  1NEB A;  1VIF A;  2EFI A;  4FT4 A;  3S6W A;  1YJN Q;  2YUO A;  1PSF A;  2DVJ A;  1GBR A;  1VQL Q;  2EJG A;  2A7Y A;  2O9V A;  4LDX A;  4LN2 A;  2IVW A;  2QGF B;  2H3J A;  5C0M A;  2F2X A;  3VRY A;  3C4S A;  2DZC A;  4X34 A;  4BAC A;  3R6N A;  2ROT A;  1IRE B;  2V26 A;  4LNP A;  2GQV A;  1XOV A;  4M75 D;  1SKU B;  2JUF A;  2GFU A;  1K73 R;  3KUF A;  4RTY A;  4KGZ B;  1T0H A;  2M0O A;  1WA7 A;  2HKQ B;  4ZN1 A;  1KC8 C;  2QAS A;  3KBG A;  3A1P A;  1G3T A;  2KR3 A;  3CCV A;  1RLQ C;  3MKD A;  4QVC A;  2Y90 A;  1SF9 A;  3MET A;  1QP2 A;  3OYG A;  3HSB A;  2JW4 A;  3CMA Q;  3HP9 A;  1M90 R;  1Q95 G;  1D09 B;  3RKW A;  1QWF A;  1GRI A;  1U5S A;  4BDY A;  2A0F B;  5LJ3 g;  2QDL A;  3I5R A;  1UHC A;  1VYU A;  2GQI A;  4L5G A;  2K57 A;  2OJ2 A;  4OGC A;  3I35 A;  4M7D E;  2DIQ A;  4HCB A;  4IIM A;  3GNG A;  4FU6 A;  2AZS A;  3QO3 A;  1M1K U;  4NL3 A;  2GCX A;  4PJO C;  3CCJ T;  2NUP B;  3HKS A;  4C0D B;  2K79 A;  3WVE B;  1JXM A;  3M0U A;  4AMC A;  5CQX A;  2QYZ A;  3JB9 D;  1C0M A;  4DEX A;  1BKB A;  3GNF B;  5FRM A;  4XTU A;  2KVQ G;  4OB2 B;  2PQW A;  4RTT A;  3G71 A;  3OYM A;  4A63 B;  2FVU A;  4C8Q A;  3OMC A;  1ABO A;  3VS6 A;  3TSZ A;  4EPC A;  2HSP A;  3DB3 A;  5LJ5 h;  5GAN f;  4M75 E;  3CCU T;  1RI0 A;  2C0I A;  4C8Q F;  3WVD B;  3VS2 A;  2RQT A;  3HRU A;  3DLL A;  3QDF A;  2FRY A;  4YTL A;  1VQ5 T;  3I55 T;  2DTH A;  2JXB A;  1W6X A;  4ZTJ A;  1Y96 B;  5GAN e;  5HKC A;  2MWO A;  3UWN A;  1QW1 A;  3RKY A;  2QTX A;  1PG5 B;  2C0O A;  4JJD A;  4F7U G;  2VYT A;  4XU1 A;  3TEE A;  3G4S A;  3OBY A;  3JCM d;  3A98 A;  2LNH B;  1BK2 A;  3DKM A;  2DXB A;  4JS4 A;  2EQI A;  4V2S A;  5CKD A;  3E9F A;  2L5Q A;  3L1A A;  3R6O A;  2KRS A;  2ECZ A;  1X43 A;  1ZQ1 A;  2V1Q A;  4ELZ C;  5KE3 A;  1AWJ A;  2OX7 A;  1NJI R;  1BIA A;  2K5L A;  2E1H A;  4HCK A;  2EGE A;  2YT6 A;  2KXC A;  2B8A A;  4KGV B;  1YCS B;  2HBP A;  5GAM h;  1IHV A;  3T9N A;  1T0J A;  4RUG A;  5CO7 A;  3L42 A;  4C92 D;  4OGE A;  2LCL A;  5GAO p;  2EQM A;  4N0A A;  3G71 Q;  5DLQ E;  4C5E A;  3CC7 T;  3N5B B;  2XU8 A;  3OYY A;  1YJW T;  7AT1 B;  1M1K C;  2FB7 A;  1WI7 A;  3CEY A;  5GMK h;  3ZEH A;  2F5T X;  1JU5 C;  3QYG B;  4LDU A;  2KAF A;  2A08 A;  5IHK A;  2M0Y A;  2VV5 A;  3M0P A;  5CKH A;  2BIV A;  4J9H A;  4HCZ A;  4OML A;  1SRL A;  2HEQ A;  3CPF A;  1AT1 B;  3EHQ A;  1UGV A;  1ZBJ A;  4MML A;  2FHD A;  3FIF A;  1KFZ A;  1N6A A;  1GL5 A;  5GAN 3;  4ME7 A;  2CZ7 B;  2QEX A;  1OPK A;  1WHK A;  1WHH A;  2NLU A;  2MWP A;  2LVM A;  4OB1 B;  3TU4 K;  2RK2 A;  1X6O A;  5KYU A;  2VXE A;  1YIJ T;  1SG5 A;  3C12 A;  4BE2 A;  4E7S A;  1N8R C;  1I5L A;  3CCM A;  4QQG A;  2DJZ A;  1OUL A;  2P4T A;  3S3M A;  4M77 G;  1M90 U;  3G6E T;  3H6Z A;  2YLC A;  3I9Q A;  2HQE A;  1VQN T;  2EVR A;  1QWE A;  3INZ A;  2ESW A;  2RA2 A;  1UGQ B;  3FDR A;  1QVG S;  4OB3 B;  3ER0 A;  4BY6 B;  1GFD A;  4C92 E;  5CR2 A;  4M7A E;  2Y4Y A;  5LJ3 j;  1D1A A;  4OB0 B;  4M78 G;  1MMG A;  3CCE T;  2K2V A;  2E10 A;  4JLI A;  2YXY A;  1MHN A;  4ZGJ B;  1VQ4 A;  2RN8 A;  2DLP A;  1C6V X;  4XTW A;  4MDW A;  1IZ6 A;  4XU0 A;  3JB9 H;  1OU9 A;  3OQ5 A;  3CCQ A;  2J7I A;  3CCL A;  3SD4 A;  3E1S A;  3CPW P;  2WSC E;  8ATC B;  2V8K A;  1NZ9 A;  4R56 A;  4HT8 A;  3OYH A;  2DZ9 A;  1TUC A;  5KYW B;  1QKX A;  5KCH A;  5D6W A;  2QA4 T;  1LOJ A;  3LWI A;  1QCO A;  1VQ9 T;  4EMH A;  1Y57 A;  4LD9 K;  3GBQ A;  2IIM A;  1B34 A;  3MEV A;  2X4W A;  3OYA A;  2FPE A;  3GIB A;  1D1B A;  2CP3 A;  3LW5 E;  3QXE B;  2I0N A;  2K2M A;  2V8J A;  2KRO A;  4FYV B;  3NTI A;  1I8F A;  3M4G A;  2E65 A;  2KYB A;  1K73 C;  1JQQ A;  3ZBD A;  2O4X A;  3VUB A;  1AD5 A;  1PSE A;  3M53 A;  3MEU A;  1WJR A;  5CAI A;  2OTL A;  5LJ5 g;  2EYY A;  3RUX A;  1NJI U;  2L2P A;  1R8O B;  2ED1 A;  1RAI B;  4M7D G;  1QCN A;  2DIL A;  1W1F A;  4KGX B;  2R5A A;  3TVT A;  3I56 T;  1N27 A;  2VGM A;  5FU6 C;  2JMC A;  4LUE A;  1S72 T;  1M90 C;  1VQ4 Q;  1JRI A;  1QKW A;  2CP5 A;  2VC8 A;  1FYN A;  3UA7 A;  4ELY C;  1BCO A;  1ZA2 B;  1U06 A;  1YWO A;  1YJN T;  3CCQ Q;  1U3O A;  1XNI A;  2HQX A;  4GLK A;  2E64 A;  3CCL Q;  4F7U A;  2KT1 A;  4F16 A;  1VQL T;  1G8X A;  2E3I A;  3Q1J A;  1UFF A;  3V7R A;  2CP6 A;  4FW1 A;  4F14 A;  1AZG B;  4J9I A;  5LJ5 d;  2CUB A;  1WFW A;  2XK0 A;  1VQP T;  2RHZ A;  4BD3 A;  2CUD A;  3VS3 A;  1JJ2 P;  1PM3 A;  1UUE A;  4DOV A;  3EG1 A;  2JTM A;  2DK3 A;  2R58 A;  2LT1 A;  4OVA A;  1JEG A;  1WXU A;  4M75 G;  4PJO A;  1GCQ C;  2RNA A;  4Y91 A;  2ZPI B;  3LX7 A;  4PFZ A;  4KUI A;  1I07 A;  1D1C A;  4OMP A;  5CVI A;  2LCC A;  3MO8 A;  1V76 A;  3MEW A;  4PJO F;  3SEM A;  1EIF A;  1K1Z A;  1N9R A;  3OSS C;  3O5Z A;  1K0X A;  4O5V A;  3V7C A;  1KQ2 A;  3QUI A;  4PJL A;  4OMF B;  4E7I A;  1HXD A;  4C8Q B;  2D6F A;  2DFU A;  1FWZ A;  2D8J A;  1HYO A;  3GLX A;  1K0S A;  1M8V A;  2OTL Q;  2HDA A;  2E12 A;  2CP7 A;  2DBK A;  3L2V A;  2X4X A;  4A4K A;  1VQO A;  1M30 A;  2R5M A;  1N8R R;  2OTJ A;  2DPP B;  2L8D A;  3OYJ A;  2DNU A;  5GAM d;  1PD1 A;  4C0Z A;  4JLG A;  1TOV A;  3JB9 I;  3UDC A;  4L6V 5;  2K3Y A;  1AOJ A;  2ABL A;  2E41 A;  1RAD B;  1RAF B;  5C6S A;  4IUT A;  4X1V A;  4C0F A;  1G5V A;  1ZHI A;  1NJI C;  3VS1 A;  1IHW A;  2BE9 B;  2RJD A;  5J26 A;  1VQK A;  4E7H A;  2RQR A;  1E6G A;  2ZGW A;  2HL5 C;  2FZG B;  9ATC B;  5LJ3 f;  1Z9Q A;  4XAX B;  4M77 A;  1OZ3 A;  3SWN A;  2XID A;  2EYZ A;  3PIO A;  2DM1 A;  4E7Z A;  2DKG A;  4BI3 A;  2ENM A;  4IIO A;  1AWW A;  5FU6 B;  5LJ3 e;  2C06 A;  4D8D A;  1H64 1;  1GFC A;  1HJD A;  1ZBX A;  3LWH A;  1X75 C;  4XTZ A;  1G3Y A;  4FL6 A;  3EG0 A;  5KE2 A;  2LTO A;  3I5S A;  3QYH B;  3EFO A;  5GAN h;  1PRM C;  2ZZD A;  4CC3 A;  2AHJ B;  1NEG A;  2FPF A;  1OQK A;  4A4G A;  2F2W A;  2X4Y A;  5FWC A;  3RNJ A;  3OS2 A;  1BCM A;  4DBR A;  3G1J A;  1K8A C;  1VQO Q;  3RMS A;  3REB B;  4J9B A;  5IXB A;  3JCM f;  2QGG A;  2OTJ Q;  3PGG A;  3JCM X;  1HK9 A;  5HCK A;  3ULR B;  1QVF P;  5FWB A;  1LVK A;  1N5Z A;  4HT9 A;  4C8Q D;  3JCM e;  4HCC A;  4K11 A;  1YP5 A;  1O75 A;  2ROL A;  2PTK A;  2KE9 A;  4XK8 E;  2LT4 A;  1WPY A;  4OMQ A;  2JOY A;  4C92 G;  4M7A G;  3GP8 A;  2CH4 A;  5LJ5 j;  1E6H A;  3G71 T;  3M9Q A;  4RTW A;  3EGD A;  4GBQ A;  1JO8 A;  4J9G A;  1VQ6 A;  1WYX A;  3HHT B;  4ZGE B;  1VQK Q;  1M5Q 1;  3H8Z A;  2MYS A;  1PCX A;  2QAZ A;  1I1J A;  1VIE A;  1RL2 A;  2RM4 A;  1MV3 A;  2Z0W A;  2O2O A;  4Z02 A;  2QTV A;  1N9S A;  2K9G A;  1YIT A;  1YHQ A;  2AKK A;  1VQM A;  2DVE A;  3CD6 T;  2FRW A;  2DRM A;  3HRT A;  4RCC A;  4DOW A;  2X51 A;  3JCM Q;  1OV3 A;  1TUG B;  2DAQ A;  2EQU A;  2KSS A;  4CI0 C;  3X24 B;  2WSF E;  2FPD A;  2FO0 A;  1OOT A;  1SEM A;  4PJM A;  1TWB A;  4M7D A;  2PVO B;  1OEB A;  2DJQ A;  2YUQ A;  1RAG B;  4BI4 A;  1BB9 A;  2CSI A;  2PU9 B;  4FW2 A;  4QKU A;  1SRM A;  1WHJ A;  5AT1 B;  1PNJ A;  2VB6 A;  3UPU A;  4II1 A;  2EKO A;  3TQ7 P;  1WXT A;  1Q82 C;  5FU7 C;  4AFZ C;  5M9O A;  4M7D F;  3JB9 J;  2JTE A;  2DYI A;  2CT3 A;  3JCM P;  5GAN 5;  5GAM j;  1I0C A;  1M8M A;  4JDS A;  2DA9 A;  1PC0 A;  1YI2 T;  3JCM g;  4A4E A;  2W0Z A;  2RI2 A;  4C8Q E;  2DMO A;  2YRV A;  1N8R U;  2DXT A;  2LJ0 A;  1I4K 1;  3NGP A;  3BDU A;  3RMQ A;  1M2O A;  5GMK j;  1YFN A;  3PFS A;  5J3B A;  1JBM A;  1UJ0 A;  2DIG A;  3M56 A;  2XD0 A;  1B34 B;  1VQ6 Q;  2L3R A;  5GAN 2;  2XHC A;  4RMO A;  1H8K A;  3CCV Q;  3HRS A;  2RI5 A;  4AT1 B;  5GAN 6;  1W2B P;  3A8G B;  2QK0 A;  3QPH A;  5HK3 A;  4NS5 A;  1YHQ Q;  3KFV A;  4BDZ A;  3CPW S;  2O4X B;  2D1X A;  2X3W D;  4JRI A;  4CC4 B;  3CCR T;  2KY9 A;  4BUG A;  1QVP A;  2RHX A;  1MUZ A;  1D0Z A;  4R55 A;  3CCJ A;  4M77 C;  2BKD N;  1TG0 A;  1F1B B;  5HK0 A;  3SWN C;  2DL3 A;  3PE0 A;  3J80 E;  3EG2 A;  2YRD A;  3H9N A;  2CT4 A;  4RG2 A;  4J6W A;  2KRN A;  1KD1 C;  1BYM A;  3FJP A;  1S1N A;  5IHI A;  1KIK A;  4RTZ A;  2DX1 A;  2HZY A;  3FB9 A;  2XG8 D;  3OBW A;  3CPW A;  2GGR A;  1MMD A;  3TCJ A;  4PNO A;  4M78 C;  2OI3 A;  1KJW A;  4F7U B;  1KQS P;  3CC4 T;  4ATO A;  4JRQ A;  3CCU A;  2E3H A;  3CC2 T;  3VJP A;  2BUD A;  3C0C A;  3OYK A;  3PIP A;  4LUD A;  1H92 A;  5FRN A;  4F04 B;  4RKU E;  4DBQ A;  2RMO A;  1VQ5 A;  1X6B A;  4QT7 A;  5L8R E;  3I55 A;  2GNC A;  2IPO B;  2KEA A;  4PJO B;  1MV0 B;  1UHF A;  1EX4 A;  1GCQ A;  3AT1 B;  3RES A;  2XKO C;  3EFS A;  1K4U S;  3NFC A;  1FMV A;  4FYY B;  1VUB A;  1K8A R;  2XI9 A;  2H8H A;  3OYI A;  1K73 U;  1VQ8 T;  1IXD A;  5KYY A;  5GAN 7;  2DL4 A;  2COY A;  5EG2 A;  1X01 A;  2A3L A;  3G4S Q;  3CCQ T;  4Z89 A;  1M2V A;  3A8L B;  3CCL T;  4DBF A;  1UJY A;  5D7U A;  1OX9 A;  3CCJ Q;  2XMF A;  3TSW A;  2PUK B;  2NYS A;  3QHS A;  2J6O A;  2DET A;  4HA8 A;  5LJ5 f;  3DB4 A;  3NMZ C;  5IAY A;  1NLP C;  1P92 A;  5A0G A;  5DLO A;  1I81 A;  2PZ1 A;  2RQU A;  2DRK A;  5LJ5 e;  5GAN d;  4JUV A;  1YJW A;  3C95 A;  5GMK l;  4M7D C;  1VQ7 T;  4C5H A;  3CQT A;  1Q7Y C;  4JZ4 A;  4OMM A;  1WDX A;  2K7A A;  4IUV A;  1JJ2 A;  1E7O A;  4EMK A;  4C92 A;  4M7A A;  4BE0 A;  3X20 B;  1ZUU A;  3CCU Q;  2CKK A;  1PWT A;  3OYD A;  1WJS A;  2RHY A;  1W4S A;  1J3T A;  2L3S A;  2HBW A;  2DD4 A;  2X9H A;  8AT1 B;  4E7K A;  1VQ5 Q;  4M77 B;  4M4Z A;  3J81 E;  2A37 A;  3HFO A;  4C92 F;  1U8R A;  4M7A F;  5DY9 A;  1R0B G;  1B3Q A;  3SWN B;  4E6R A;  3MEA A;  2AK5 A;  2EIF A;  4A4H A;  4ORZ A;  2F1L A;  3EGX A;  4J9F A;  3S3O A;  2QI2 A;  3OYL A;  4MZP A;  1Q82 R;  3M0Q A;  3EH2 A;  3VU3 C;  1Y71 A;  2EKH A;  2PNI A;  2YLB A;  2K5F A;  5GAN 8;  3D7S B;  1BI0 A;  2QEX Q;  1YJ9 A;  2DD5 A;  3MJX A;  1B07 A;  4M75 C;  5GAM f;  1D3B A;  2D0N A;  2A28 A;  1WZO A;  3EFO B;  3QG1 A;  2RHU A;  1O9S A;  2M16 A;  3OYN A;  4FYX B;  4FSS A;  2O01 E;  2YDL A;  3CCM Q;  5IT9 E;  5J39 A;  5GAO l;  3CME T;  4ZN3 A;  3RDV A;  3G6E A;  2CP0 A;  4PJO D;  1AHJ B;  2DL8 A;  2HD0 A;  4UC4 A;  2KT8 A;  3CCS T;  2MMP A;  2VWF A;  1VQN A;  1UGR B;  3JCM W;  1BIB A;  4LD6 A;  2XDB A;  2J6K A;  5FLX E;  3CBO A;  1C1A A;  2XDP A;  3CXC A;  1ZA1 B;  2MAM A;  3CCE A;  4MDX A;  5KYX A;  2KRM A;  1YJW Q;  2H3E B;  1AEY A;  3MCA B;  4E7J A;  1X69 A;  1G2B A;  2EYW A;  3LLR A;  4RTU A;  4BI8 B;  3EGD B;  4QQD A;  2EW3 A;  3OS1 A;  1SHG A;  2RQV A;  3OW2 A;  3NPF A;  5GAO n;  2OAW A;  2P0Q A;  4PJN A;  1V1C A;  4XU2 A;  4MMK A;  2ZAE A;  3OB9 A;  4HKE A;  1EZZ B;  3VV0 A;  1KD1 R;  4AFS C;  1UTI A;  3P8H A;  1WNL A;  4HVU A;  1QP3 A;  1M3B A;  4WTO B;  1YCY A;  2XIC A;  5CKB A;  1WJQ A;  3VS5 A;  2CH4 W;  4OMN A;  1ZSZ C;  2JZ2 A;  2KNB B;  4F7U F;  2QA4 A;  2A36 A;  2QXF A;  1YJ9 Q;  2ED0 A;  1VQ9 A;  2ZPG B;  2M1H A;  4PJJ A;  5IH2 A;  4C8Q G;  4FIB A;  1U1S A;  4M7D B;  4DQ2 A;  2HAX A;  3MP6 A;  4J8O A;  1K8A U;  2LDM A;  1M27 C;  4L59 A;  2O31 A;  5GAM g;  3G6E Q;  4PJO E;  1OU8 A;  2CZ1 B;  1LNX A;  1VQK T;  1AZE A;  4ANJ A;  3X26 B;  1QVF A;  5AYF A;  4J5Y A;  3URG A;  3CMA T;  3E9G A;  1QLY A;  3MP1 A;  3CBM A;  1SSH A;  3J7A F;  2ZPB B;  3S3N A;  4E7L A;  5GAN j;  4FT2 A;  1NPP A;  4FM4 B;  3I56 A;  2DEQ A;  4N4H A;  4CC2 A;  1S72 A;  2M51 A;  1TSF A;  1YNZ A;  4ZTF A;  2KBT A;  4KRT A;  1IRX A;  1YJN A;  1K76 A;  3X28 B;  2DEU A;  1RAB B;  3EFR A;  5GAO m;  3QJY A;  1VQL A;  1HD3 A;  4HVW A;  2EGC A;  5I22 A;  4HVV A;  2KDS A;  3PTA A;  3JB9 G;  1PD0 A;  3CXC P;  4XU3 A;  4EMK C;  4C92 C;  2PUO B;  1Q81 C;  1VQP A;  4M7A C;  1K9M C;  2G6F X;  4JS5 A;  4C0G A;  2RB6 A;  4FCY A;  4J9D A;  3EG3 A;  2FEI A;  1OZ2 A;  2DL5 A;  2D8H A;  1Q7Y R;  4JJB A;  3JCM V;  2QA4 Q;  2HMA A;  2E4H A;  1U1T A;  2F5K A;  3OW2 P;  2RJE A;  4IUR A;  4BB7 A;  5KH6 A;  1NLO C;  1CKA A;  2JJ9 A;  1R0C B;  4WF2 A;  1Q82 U;  2JNG A;  2E70 A;  5GMK i;  1UB4 A;  4J7F A;  2D0Q B;  3SHW A;  4M77 F;  2QQA A;  3M55 A;  1IGQ A;  4DA4 A;  2RI3 A;  1VQ6 T;  1JXO A;  2X4J A;  3CCV T;  2KMT A;  2JN0 A;  3KXT A;  1EFN A;  1W2B S;  4RG8 A;  3QBY A;  2JTF A;  3H0I A;  5FRO A;  4M78 A;  2ZCF B;  2KGT A;  4PKC C;  5EC7 A;  4M7D D;  4BE1 A;  4EIK A;  2KQW A;  5KCO A;  4PFP A;  3BFM A;  5CCA A;  1M1G A;  1OPL A;  3I56 Q;  4JPB W;  4M78 F;  1D0X A;  1WHL A;  2PVD B;  1RAH B;  1FX7 A;  2NUT A;  1S72 Q;  2DYB A;  1OI1 A;  1AWX A;  2EYQ A;  2RO0 A;  2HNI A;  2X3X D;  4CRI A;  3M54 A;  3A8M B;  1TXQ A;  2DL7 A;  5D6Y A;  1UGP B;  1SSF A;  3JCM b;  4PFO A;  3JSC A;  3WXM B;  3OYF A;  1W2B A;  2DO3 A;  1UEC A;  1IGU A;  1FMK A;  3ME9 A;  1PKT A;  1I5O B;  2HSE B;  1IO6 A;  2YUP A;  1RI9 A;  2COZ A;  5KYY B;  5GAO r;  1MMA A;  5CK9 A;  4EMG A;  1KK7 A;  4LDV A;  3THK A;  2VAS A;  1KSW A;  1X2K A;  4J9C A;  1VQP Q;  1M2V B;  5I2S A;  1MGQ A;  1NM7 A;  2M02 A;  5KYU B;  1KQS S;  2ZPH B;  1OYX A;  2MK5 A;  4A4F A;  2ZPF B;  3UT1 A;  1Y0M A;  1AVZ C;  4OF1 A;  2JT4 A;  1GXI E;  1KD1 U;  3EH1 A;  1QMC A;  3JCM c;  1Y07 A;  6AT1 B;  4AFQ C;  2K5I A;  4A54 A;  1T3L A;  2K4Y A;  1UE9 A;  4KT0 E;  1YBY A;  2HKN A;  2LX9 A;  1BI3 A;  3L2R A;  2K6D A;  2G3R A;  4D6W A;  1SPK A;  2EWN A;  1NBE B;  2C0T A;  2QG9 B;  3V8J A;  1KQS A;  2P0K A;  4ESR A;  2VGN A;  1V29 B;  1RLP C;  2HQH A;  3PVL A;  2DTO A;  2HL3 A;  2LQK A;  4GLM A;  1FMW A;  4HXJ A;  2BTT A;  2X35 A;  4EMK B;  4C92 B;  4M7A B;  3G4S T;  1ZUY A;  4JRK A;  3V8K A;  1ZSG A;  1G3S A;  3RR6 A;  1UDL A;  2P4R A;  2MOX A;  2EBP A;  3LH0 A;  4AG1 C;  1G3W A;  3EGX B;  1WLP B;  1WIE A;  2O9S A;  4B9X A;  3RBB B;  4N4G A;  3OYC A;  2BZ8 A;  5I21 A;  5CIU A;  1X2Q A;  2FZC B;  3UAT A;  2RHI A;  3SDZ A;  1PRL C;  1M3A A;  4O6J A;  5LJ3 d;  4AFU C;  4MZT A;  4B6M A;  1B7T A;  1D3B B;  3GOX A;  2OAU A;  1AWO A;  4J9E A;  4M75 A;  3EAE A;  2RPN A;  3RIR A;  4LE9 A;  4QVZ A;  5A0D A;  3ZFJ A;  2JM8 A;  2RF0 A;  4A53 A;  2Y4X A;  4ZGD B;  2LNV A;  4M75 F;  3TRE A;  3CD6 A;  2YUN A;  5GJV B;  1YIT Q;  4KBM B;  5ECA A;  4GY5 A;  4JZ3 A;  1VQM Q;  2LCS A;  4N4I A;  1IB8 A;  4BY6 C;  1Q86 R;  1NPR A;  1Q7Y U;  1ACM B;  2J06 A;  4RCB A;  1Y7X A;  1H3Z A;  1KHC A;  2MPX C;  2SEM A;  1Q81 R;  1LCK A;  3VYG A;  1K9M R;  2RD1 A;  1YWP A;  5KYX B;  2DE0 X;  4PLI A;  4FYW B;  2W10 A;  3UF4 A;  2QEX T;  1TTH B;  2JS2 A;  2LJ1 A;  3VYH B;  2IG0 A;  1TU0 B;  3H0H A;  2AKL A;  4Z88 A;  2BZY A;  2RQW A;  3BY7 A;  1WX6 A;  1PHT A;  2CRE A;  3MHX A;  3CCM T;  2QQS A;  4D8K A;  4TVR A;  3A5Z B;  4PJO G;  2RJF A;  3EG9 A;  2QQB A;  4QVD A;  1YI2 A;  2LQW A;  2WAC A;  1RAC B;  3JV3 A;  5GAN 4;  1YN8 A;  4XTV A;  1KHI A;  1VYV A;  2R57 A;  2VKN A;  3X25 B;  5IN1 A;  4M7A D;  1VA7 A;  2EQJ A;  3BE3 A;  3JB9 F;  1ZSZ A;  3IQL A;  2QDY B;  3VS7 A;  3H41 A;  5CKF A;  2GF7 A;  1A0N B;  1LPL A;  1JB0 E;  2NWM A;  5I11 A;  2VUB A;  3PMI A;  1VQ4 T;  1OX8 A;  1UEB A;  1X27 A;  3PMT A;  1G83 A;  1XTD A;  2FG0 A;  5FU7 B;  2YRC A;  4Q5W A;  4QW2 A;  3CCR A;  5GAN g;  3CD6 Q;  1FXX A;  1BBZ A;  2YWW A;  4C5I A;  2YSQ A;  5I2M A;  3RKX A;  2V8I A;  5A0L A;  5LL6 S;  3ZL7 C;  3H0F A;  1JJ2 S;  4MZM A;  2KXD A;  3FLG A;  2NUZ A;  1YJ9 T;  4OMO A;  2I2L A;  1Z9Z A;  3OS0 A;  3OSV A;  1KQ1 A;  2EPD A;  2EGA A;  2FYK A;  3NTK A;  3M0T A;  1ZX6 A;  1M3C A;  1DJ7 B;  2DER A;  1W70 A;  4WCI A;  1H3H A;  3CC7 A;  1MNE A;  3L2Q A;  2COW A;  1BI2 A;  3REA B;  4XQ3 A;  2LQ8 A;  3CC4 A;  1KC8 R;  3CC2 A;  1TS9 A;  5GJW B;  2LZ6 B;  1YI2 Q;  4KUD K;  4IUU A;  1NE8 A;  3JAM E;  3M0R A;  3QZ9 B;  1CKB A;  4NL2 A;  4DBH A;  2MI6 A;  5FW9 A;  3QSU A;  2M9U A;  4J7I A;  2WSE E;  2LJ3 A;  4PLL A;  1VOM A;  2SRC A;  1MND A;  2P84 A;  3FEO A;  4LDY A;  5D6X A;  3GF5 A;  2OTL T;  4RTX A;  1BI1 A;  3I55 Q;  2E5K A;  2BZX A;  1WGS A;  2NUP A;  1UG1 A;  3HTR A;  2VXF A;  3HPW A;  1VQ8 A;  3G7Z A;  5HY6 A;  3M5A A;  2VVK A;  2EJ9 A;  2DBM A;  3JRZ A;  4F17 A;  2E5Q A;  2XDD A;  1YIJ A;  3M0S A;  1NYF A;  4C8Q C;  1QVG A;  2JVV A;  4XTX A;  3NTH A;  3CCR Q;  4ZNX A;  3CXC S;  2GTJ A;  3P8B B;  3NHN A;  4M78 B;  3ASK A;  4IKF A;  4X9D A;  4IUP A;  3MPU B;  2ZPE B;  1WHM A;  4FSX A;  2E6N A;  3LYI A;  3F70 A;  3OYE A;  4NOY A;  5GAM e;  2GFA A;  2KI7 A;  1D0Y A;  3AHU A;  3QII A;  1R77 A;  2LRQ A;  2L0A A;  2NUT B;  4RTV A;  2CP2 A;  2PVG B;  3OW2 S;  2KK4 A;  3OS5 A;  1Y96 A;  1Q86 U;  1M9S A;  4J6Y A;  3P8D A;  5GMK e;  1Q81 U;  5CKE A;  1VQ7 A;  1K9M U;  2DXC A;  2YHT A;  2L3P A;  3CC7 Q;  1HSQ A;  1KG1 A;  2JMA A;  3CC4 Q;  1WQW A;  1LJO A;  3CC2 Q;  1NG2 A;  3VS4 A;  3FJ5 A; 
#chains in the Genus database with same CATH homology
 3OW2 P;  1VQ5 Q;  3CCJ Q;  1VQ4 Q;  1VQ7 Q;  1VQ8 Q;  1K8A R;  1QVF P;  1JJ2 P;  3I55 Q;  3CXC P;  3CCR Q;  3CCE Q;  1YIT Q;  3CME Q;  1YJN Q;  1N8R R;  1YHQ Q;  3CPW P;  1KC8 R;  3CCM Q;  1YJ9 Q;  3CMA Q;  1VQM Q;  1YI2 Q;  1K73 R;  1VQN Q;  1M1K R;  3CCQ Q;  1Q86 R;  1YIJ Q;  1M90 R;  1Q82 R;  1VQL Q;  3CCS Q;  3G4S Q;  1VQ6 Q;  3CCL Q;  3CCU Q;  1VQO Q;  1KD1 R;  3CC7 Q;  3CD6 Q;  3G71 Q;  3I56 Q;  1Q81 R;  3CCV Q;  1YJW Q;  3CC4 Q;  1Q7Y R;  1NJI R;  1VQP Q;  1QVG P;  1K9M R;  2OTJ Q;  2QEX Q;  1S72 Q;  2QA4 Q;  1KQS P;  3CC2 Q;  2OTL Q;  1W2B P;  1VQ9 Q;  3G6E Q;  1VQK Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...