4PJOC

Minimal u1 snrnp
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
86
structure length
86
Chain Sequence
GSGSVKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small nuclear ribonucleoprotein Sm D3
publication title Crystal structure of human U1 snRNP, a small nuclear ribonucleoprotein particle, reveals the mechanism of 5' splice site recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Splicing
total genus 14
structure length 86
sequence length 86
chains with identical sequence Q, c, q
ec nomenclature
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4pjoC00
5GMKh 1I81A 3JB9F 3JCMe 2DTHA 3V8JA 4M75G 4PJOB 5GMKj 4XQ3A 5GAMf 5GAN7 4M7DC 4M77D 4M78C 5CAIA 4M77A 5GMKl 5LJ3e 2YHTA 5LJ5j 3EFSA 5GANh 3QHSA 1N9SA 2E41A 4C92F 4C92E 1TH7A 1D3BA 1WQWA 1HXDA 2VC8A 4XTYA 2E65A 2EJGA 4EMGA 5GAN8 5GANj 4M7DF 4M7DE 4M78E 5LJ5d 4Y91A 4M77F 2EJFA 5I21A 2EWNA 3QO3A 4XTVA 3JB9H 1BIBA 1U1SA 4F7UF 4F7UE 5LJ5f 3SWNA 4JUVA 4A53A 3AHUA 4MMLA 5GANf 1BIAA 2VXEA 4M78B 2DXUA 4XU0A 5GAMd 4EMKA 1HK9A 3RKXA 4QVDA 3SB2A 2QTXA 1WNLA 4C92C 5LJ5g 2K57A 4PJOG 5GAOl 4M7AG 4PJOD 3M4GA 4M7AD 3L1AA 4M75D 2RB6A 4PJOA 4XU2A 4M7AA 4M75A 3JCMh 4NOYA 1I5LA 4C8QG 5GAOn 4M77C 4C8QD 2RM4A 4JLIA 4C8QA 3V7SA 2VXFA 1WPYA 3EFRA 3L2ZA 5GAMg 5LJ3h 4HA8A 2EAYA 2FYKA 3JCMc 5GAOp 3INZA 5LJ3j 4J6XA 4NL3A 1H641 3FJPA 3QUIA 4M77E 4XTZA 1Y96B 4EMHA 2JN0A 5GANd 4HT8A 1LOJA 2DVEA 3JCMf 4C92B 2DZ9A 5GAN2 5LJ5e 3BY7A 1M8VA 5GMKm 3RUXA 2E64A 1I4K1 3HSBA 4M78G 4M7DB 1M5Q1 3V8LA 4J6YA 4N0AC 3JB9I 1LNXA 4M77B 5LJ3f 2DZCA 2RD1A 1B34B 2E10A 1I8FA 1LJOA 4XU1A 3GIBA 2I2LA 4F7UB 4PJOC 4M7AC 4M75C 2EJ9A 2YLCA 3BFMA 4OP0A 4PNOA 4RCCA 5GAMe 5GANg 4HT9A 5GAN3 3BW1A 5LJ3g 4XTUA 5GAN4 4C8QC 3JB9G 3FIFA 1KQ1A 4X9CA 3QSUA 2RA2A 3V8KA 4A54A 4DQ2A 3JB9J 4PJOE 1YCYA 4MMKA 4PJOF 4M7AE 4M75E 4M75F 3V7CA 3JCMd 2E1HA 3JCMP 4M7AF 2FB7A 1U1TA 5GMKe 5GAOm 2ZGWA 4RCBA 5GAN6 3V7RA 1Y96A 4C8QE 4WF2A 3RKYA 4C92G 2CGHA 4C8QF 2DTIA 4C92D 3JCMb 3JCMQ 3JCMJ 2Y90A 4J5YA 5LJ3d 3JCMV 3SWNC 4C92A 1KQ2A 4M7DG 4XTWA 1WQ7A 3RIRA 3RERA 4M7DD 4V2SA 4XU3A 4M75B 4M7AB 4M78D 3VU3C 4M7DA 4M77G 5GANe 3PGGA 4EMKC 4M78A 5LJ5h 5GAOr 5GMKi 3JCMX 5GAN5 3JCMg 1MGQA 2YLBA 1N9RA 1B34A 4C8QB 4F7UG 2DJZA 3RKWA 1D3BB 2DKGA 4F7UA 3BDUA 4X9DA 2HNIA 4J6WA 2DXTA 3HFOA 2DEQA 3JCMW 4M78F 5GAMh 3JB9D 1X01A 3RESA 2DTOA 5GAMj 5GAOq 1JBMA 3HFNA 3SWNB 1JRIA 4JRIA 3FB9A 4NL2A 4XTXA 4EMKB 5DY9A 4N0AA 4JRKA 4QVCA
chains in the Genus database with same CATH superfamily
1KC8R 2F1LA 4DBFA 2L2PA 2ZPHB 2XMFA 3QXEB 1G83A 3X25B 1IREB 2X4JA 4LDUA 1RLPC 2KYBA 3R6OA 5CKEA 2DIGA 3EH1A 3SFMA 2ZPBB 1RADB 2KDSA 4EIKA 1JQQA 2NYSA 3KBGA 5EC7A 3Q1JA 5GAMd 3CCET 3OYIA 3JCMh 2E4HA 2A36A 2LNVA 4LDXA 1VQKA 1OOTA 2KRNA 1W6XA 3H9NA 3I5SA 3MP6A 1VQ7Q 2K5FA 1ZUYA 4IUPA 1BBZA 2EGAA 2LP5A 5IAYA 1M8VA 3V8LA 1D0YA 3R6NA 1VQOQ 1RUWA 3M54A 2ZAEA 2I2LA 5A0DA 2QTVA 3TU4K 2DETA 3OW2S 2OAUA 2ZZDA 4HT9A 3REAB 3EG2A 4X9CA 3PT9A 2C0OA 3CCVQ 2JNGA 2KY9A 3PVQA 2W0ZA 1M1KR 3L2VA 1M3BA 1NLOC 4M7AB 1ACMB 3M56A 3EG9B 1XJWB 4Z89A 1JJ2A 1K76A 1VQNT 5L8RE 3L2WA 3VS0A 5CIUA 3MHXA 3I55A 1X75C 3M0TA 4C5IA 1Y7XA 3UDCA 1BI3A 1SPKA 3CCRA 5FU7B 3E9GA 2EQIA 1M90C 2KQWA 1JXMA 3T9NA 4FSSA 4O5VA 2V26A 2WSCE 1CKAA 1TG0A 4PKCC 1YIJA 2YHTA 1VQ9A 2E41A 2FPEA 4C92F 4C92E 2DO3A 2J6KA 4IURA 4Y28E 1KC8C 1W2BP 3MEAA 3ASKA 2CT4A 4OF1A 3ULRB 1W70A 8AT1B 1WIEA 2OAWA 4LDYA 4C8QG 2A28A 1IGQA 3V7SA 2HQXA 5KE2A 2YRDA 1M3CA 5KYWA 2RQTA 5IHNA 4ZN3A 1VQMA 2HAXA 2OTLT 2K3BA 3F70A 3PE0A 1JU5C 2JJ9A 1PD0A 2GNCA 1VQLT 1VQ5T 1ZBXA 4N0AC 3MJXA 1PNJA 2RD1A 4E7LA 2E10A 1TWBA 3ZFJA 1N8RR 2KR3A 2EQUA 1YJWQ 3NTKA 2JOYA 1UECA 2K9GA 3SEMA 1YFNA 1XQHA 1D1AA 2JMAA 2ED0A 1K9AA 3CPWA 3VS3A 1P92A 2LCLA 3NGPA 4PFZA 2H3JA 4OMNA 1VIFA 2D0QB 1ZUKA 1WJQA 2E5QA 3EGUA 1KIKA 2HD0A 2GQVA 1MV3A 1I07A 4M78F 4OMOA 3VJPA 1GRIA 1M1KC 2MWPA 1M9SA 1WJSA 1K0XA 2EPDA 2ENMA 3X20B 4N0AA 1RABB 2QXFA 4DA4A 1G3TA 1K73U 1VQ8A 1Q81R 1SHGA 2GBQA 2I0NA 3VUBA 4M77A 5GMKl 2DMOA 1TH7A 1GCQC 4LD6A 5D6XA 4DBRA 4KT0E 5HK3A 5GAN5 1KQSA 4PJMA 4BUGA 1IXDA 4GLKA 2CZ7B 1N27A 4M7AD 4ZGJB 3FLGA 5HCKA 3M0PA 1VQPA 2VKNA 2DA9A 4NOYA 1QVGA 3CCUT 2DL8A 2MMPA 3GF5A 4IUQA 4OB3B 3VUZA 4CC3A 1JB0E 2F2VA 1QKWA 4XTZA 4KUIA 1QVFP 3I56A 5GANd 1S1NA 5DLQE 3M0QA 5GJVB 1UFFA 4C92B 2J6OA 5GAN2 1Y57A 2ZPGB 5LJ5e 3EGDA 4QKUA 3CEYA 1V76A 1M5Q1 1HSQA 1KD1U 1ABOA 2DZCA 3CD6A 3CMET 2OJ2A 3CMAA 4FT4A 1Y71A 1GCQA 4A4GA 4BE2A 4N4GA 1TOVA 2DL4A 5CQXA 2RA2A 4R55A 8ATCB 1M30A 4MZMA 1VQ6T 1D0XA 1YITA 2XG8D 3OMGA 5GAN6 1Y96A 4C92G 2KYMA 2QA4A 3FEOA 1OI1A 2RHXA 2DAQA 3OYLA 3L2QA 2D9TA 1N8RC 3HRSA 1OV3A 1K0SA 3DLLA 5EG2A 3M5AA 1F1BB 2O2OA 2Z0WA 4FCYA 1UTIA 1K9MU 3MPUB 5GAMj 2D8JA 5GAOq 2PVDB 3SWNB 1WI7A 2ROTA 2D8HA 4AMCA 1KSWA 1WXTA 2RQVA 2DTHA 4OMQA 4C5HA 4J9CA 1ZA2B 3LYIA 2YUPA 2DBKA 4J9FA 2H8HA 2LQ8A 1N9SA 1WA7A 4DOVA 1VYUA 3A8GB 1VQ7T 2WSEE 2FZCB 4PFOA 2BTTA 5IXFA 3NHNA 5I21A 2DNUA 2EWNA 4IUUA 2CREA 3EG0A 3G4ST 3C4SA 2KSSA 2C0TA 1U06A 4BDZA 4M78B 1WYXA 1SRLA 5CCAA 1IO6A 5LJ5g 2KRSA 1WHMA 1VQOT 1ZA1B 5FWCA 1UE9A 2E3IA 2HKQB 2QGGA 1WPYA 1FX7A 5D6YA 4JS5A 2B8AA 2QQ9A 4A4KA 5I2SA 4LXCA 3CCVT 2JM9A 1Q95G 2JN0A 1PSFA 2OI3A 3RUXA 4M78G 1LNXA 3CPFA 2OTJA 3M0SA 2CZ1B 1KK7A 3GOXA 3JSCA 4XU1A 1WXBA 2E6NA 4M7AC 4OP0A 1QWEA 3BW1A 3MKDA 3M4YA 2RMOA 4B6MA 4MMKA 3JCMd 1YJ9Q 1U1TA 2DL5A 2GTJA 2XU8A 1RAIB 3S3OA 4M75B 4VUBA 3EGXB 4AFZC 1ZSZB 2O31A 2M51A 3BE3A 1ZUUA 3OYMA 5KCHA 4LD9K 3M59A 1RI0A 2RI3A 2XI9A 2LT4A 3P8BB 4XTXA 2A3LA 4FYVB 5GMKh 2K2VA 3V8JA 4M75G 3CXCS 3QWXX 3H6ZA 2DILA 5FLXE 2DK3A 1Q86R 2KNBB 3EG9A 3SDZA 3X28B 2VASA 3MO8A 2HQEA 2AKLA 4TVRA 3VS4A 4IUTA 2RK2A 5D6WA 1H92A 1QCOA 1QQJA 3H0IA 1OU9A 1NYFA 4QW2A 2DX1A 1LPLA 2XKOC 4J9HA 5KYYB 4C8QA 2VXFA 2EVRA 3SHWA 1NPRA 5GAOp 2FG0A 4CC4B 9ATCB 4J6XA 3A8MB 1S72T 1O9SA 1V1CA 3G7ZA 4XK8E 4AFUC 4HT8A 5HK0A 3G71A 1VQ4T 2QQSA 2LCSA 1G8XA 2ROLA 3HSBA 1BCOA 1M2VB 2COZA 5ECAA 3C0CA 4LN2A 1B34B 2RN8A 1NYGA 1UHCA 1FWZA 3CBPA 2EJ9A 4PNOA 1AEYA 3UATA 3OW2P 4HCZA 2O9VA 4M7AE 4M7AF 1X6OA 1UB4A 5FU6B 1NJIU 2YSQA 3N5BB 1Q82U 3RKYA 3JCMb 3JCMQ 2EFIA 2QI2A 3JCMJ 2Y90A 3JCMV 4V2SA 4M78D 1BB9A 4MZTA 1WHLA 1YIJQ 1OPKA 2YLBA 2LCCA 5C0MA 2EQKA 3CCUQ 1DJ7B 2M16A 3THKA 5FRNA 1ARKA 2QYZA 4JZ4A 2MI6A 2BZXA 1VIEA 2FO0A 2NUTB 2HCKA 2BUDA 1JO8A 2KEAA 2L3RA 2YT6A 4QVCA 1WDXA 1TUCA 4A4HA 2IIMA 5GAN7 2DD4A 1OU8A 3M55A 2DYBA 3CC4A 4WCIA 5LJ5j 1M90R 1E6HA 1TXQA 5GANj 1G3YA 4R0KA 1Q7YU 2QAZA 3ZBDA 2EJFA 4XTVA 3LLRA 1YWOA 4JRPA 2EYQA 1FXXA 4JUVA 4HVUA 3CCQQ 4RTZA 1Q86C 1WFWA 3M0UA 1K1ZA 4C92C 2PU9B 4D6WA 4M75D 5J39A 2K3XA 1MMNA 2IVWA 5CK9A 1XTDA 2HMAA 2RQUA 5LJ3h 3DB3A 2AHJB 4HA8A 1NBEB 4F16A 4NL3A 4RTWA 3TEEA 4MZPA 3LH0A 2V8IA 4OVAA 2KI7A 3EG3A 1Y07A 1MV0B 4ANJA 4J9BA 1QMCA 3CC2Q 4JDSA 2G6FX 5GAMe 1HD3A 4HKEA 5GAN4 1YWPA 3KUFA 4A54A 3VS5A 1K4US 2FB7A 1PRLC 5GAOm 3G4SQ 2YDLA 5KYXB 3KXTA 4J5YA 1VQLA 4C92A 3SWNC 3OMCA 5AT1B 1VQ5A 4Z8AA 1AWOA 3PNWC 3HPWA 3PIOA 2DD5A 2HNIA 1PG5B 1NG2A 3OSVA 2L89A 2PVGB 2R58A 4LDVA 2DTOA 2A08A 2LMJA 3A1PA 1D09B 5DY9A 1MMGA 2HSEB 2A7YA 1BKBA 2YUOA 5GAMf 1SSFA 2KMTA 3QDRB 4M78C 2E6ZA 4JJNK 3CC7A 4RUGA 3LGFA 2X4XA 2X3WD 2ESWA 5GAN8 2XDDA 4Y91A 1X2QA 4A4FA 1YI2Q 3CCMA 2GCXA 1U5SA 3OY9A 4HCBA 3SWNA 1T3SA 3P8DA 1B07A 2Y4XA 2M9UA 3CCLT 4BE1A 1FMVA 3EFOA 3CD6Q 2SRCA 4M7AG 4QT7A 3CMAQ 5FW9A 1I5LA 3G1JA 5GAOn 2GQIA 3QJYA 1NZ9A 2HSPA 5GAMg 1AHJB 2F69A 3QUIA 1YITQ 2XIDA 1YJ9T 2QA4Q 3VV0A 2DM1A 1HJDA 1QLYA 1YNZA 2E64A 1RAGB 2CZ6B 2O4XB 3X26B 3S3NA 3O5ZA 3HHTB 2MAMA 4M75C 4FW2A 2YLCA 2DRKA 4UC4A 2PVOB 1ZSZC 1KFZA 3E2UA 1IB8A 2GFUA 2V1RA 1MMDA 1QP2A 3OS5A 4J7FA 3OYJA 1YJNA 1PM3A 4WF2A 1EZZB 2BIVA 2LX7A 2QGFB 2GF7A 5I22A 1QVPA 3OYHA 1NPPA 4A4EA 1VQKT 3RKWA 2NWMA 4LNPA 3GBQA 3CQTA 3UPUA 1PWTA 2DEQA 1AT1B 1S72Q 1K8AR 3HFNA 1VQ6A 2CP5A 1SRMA 1VQ4Q 1VOMA 1M1FA 1BI1A 3JCMP 2LX9A 2PZ1A 3S3MA 1AZEA 1FYNA 1QKXA 1VUBA 1AZGB 1R0BG 3U23A 3EGXA 4F14A 3TVTA 1ZSZA 3EFSA 3CCJA 5CQYA 2AKKA 1E7OA 2H3EB 1KC8U 1VYTA 4M78E 2M02A 1RL2A 1QVFA 2LJ1A 2BZYA 4F7UF 4F7UE 2KGTA 3RNJA 4BB7A 1XOVA 4GBQA 3AHUA 2KROA 4FW1A 1WNLA 2KRMA 4AT1B 2JTEA 2IG0A 1QWFA 1TSFA 1BI2A 5CR2A 2QEXA 3FRNA 1LCKA 1KD1C 3A5ZB 4II1A 5HY6A 4F04B 3I55T 1YHQA 1VQ7A 3FJPA 2ZCFB 2EYXA 3CCRT 4L59A 1RAFB 2DVEA 4GY5A 4PL6A 2Y4YA 2XICA 4E7SA 5FU6C 2V8KA 2P4RA 3OYAA 4J7IA 1YIJT 1VQ9T 2DIQA 3BFMA 2J6FA 1Y0MA 2MWOA 3J80E 1MNDA 5KYYA 5KE3A 3CCSQ 4M75E 4M75F 3CCVA 2L5QA 2BE9B 2RJFA 2HBWA 1OEBA 3H0HA 1C1AA 4HCKA 3RERA 5IXBA 3TSWA 5GANe 1OX8A 2AIRB 1JEGA 1M2VA 1B34A 1D3BB 3RBBB 1M1KU 2YXYA 3OYBA 3I9QA 1ABQA 1IRXA 4J6WA 4ELYC 1VQMT 1OZ2A 4B9WA 2LT1A 2P4TA 4E7HA 3I5RA 3TQ7P 4JRKA 1WX6A 3CCQT 1QP3A 4ATOA 2L8DA 3CXCP 2MK5A 3EG1A 1BU1A 2LJ0A 4CC2A 1YN8A 1JJ2S 3QHSA 3HRUA 1K8AC 3VKIA 1ZHIA 2VC8A 4OMFB 1PKSA 1NLPC 2ATCB 4M77F 2VGNA 3WXMB 3KFVA 2F2XA 1C6VX 2JXBA 4L6V5 3G71Q 2K7AA 5LJ5f 2VV5A 5A0GA 2NUTA 4J9EA 5GANf 2EBPA 4QVDA 1HK9A 4FIBA 1OULA 1JXOA 1KJWA 4D8DA 4PJOD 1AWXA 1A0NB 2RB6A 3CC2T 2ED1A 4ZNXA 4CRIA 1NJIR 1NEGA 3OYDA 1MHNA 2EAYA 2A0FB 3INZA 3JV3A 4EMHA 4D8KA 4ZGEB 3MEWA 5KYNA 4N4HA 3RR6A 5CKDA 2MCNA 2RI5A 1D0ZA 4Z88A 2G3RA 1Z9QA 5IT9E 1QW1A 1VQ8T 1UGPB 4ME7A 4RTXA 1I8FA 2PUOB 4F7UB 5GANg 3C95A 2RHZA 5GAN3 2DXBA 3LGLA 2DLPA 1YJWA 2FPDA 2HL5C 3G6EA 3V8KA 4DQ2A 2OX7A 4E47A 1WGSA 4J8OA 3REBB 2B86A 1IHVA 1N8RU 3M57A 3MEUA 3V7RA 2J05A 5LJ3d 2FRYA 3CCLQ 4XTWA 4JJBA 4M7DD 2FZGB 5GAOr 3CC4Q 5AYFA 3JAME 1QCNA 4F7UG 4C0ZA 2O9SA 3D7SB 1SF9A 1U8RA 5CVIA 4QQDA 2DFUA 1OYXA 2COWA 4JPBW 2RF0A 4Q5WA 4X1VA 4EDUA 1YI2T 4RTVA 3OSSC 1R77A 3CPWS 5KYXA 3JCMe 2QQAA 1UHFA 1G3SA 3CD6T 4DBHA 1BI0A 2XD0A 4IIOA 1D1CA 3QYGB 5D7UA 4E7KA 3CMAT 3HL8A 1M3AA 2K4YA 4OMPA 2RH2A 2R5MA 2YUNA 2LQNA 1WQWA 1D1BA 3M53A 1TUDA 1Q81U 2ZPEB 3O8VA 1R0CB 1YITT 1AD5A 2QA4T 1UGSB 3QDFA 4MMLA 3VS6A 1W4SA 2EGCA 2QTXA 3RDVA 4M7AA 1HYOA 4ELZC 1VQKQ 3OW2A 5KCOA 4BD3A 1O75A 5DM7R 3QZ5B 1CSKA 2QQRA 1H641 2CSIA 3TCJA 3JCMf 3A98A 3BY7A 4DEXA 2DE0X 1KQSS 2DJQA 1NJIC 2EGEA 4M77B 4OMLA 4ZGDB 1I0CA 4N4IA 2JTMA 4PJOC 2C06A 1QVGS 5LJ3g 1VYVA 3MCAB 3FDRA 4ZTJA 2JZ2A 2JS0A 3OS0A 3VYHB 2AT1B 2YUQA 2JW4A 3V7CA 4HCCA 3RMSA 4LUDA 5KH6A 1UJ0A 4DEYA 4GLMA 3SD4A 3A8HB 3VU3C 1Z9ZA 4M77G 4J9DA 5LJ5h 1KG1A 2DF6A 2CP2A 3JCMg 3QJ6A 2O4XA 5IHIA 3CCEA 1X43A 1OZ3A 2RHYA 3I55Q 3FC3A 3HFOA 4KRTA 3OBWA 2P0QA 3CCMQ 2CH4A 2HL3A 1FMKA 1H8KA 3CCRQ 1JRIA 3P8HA 2K5LA 4OB0B 3M58A 4NL2A 1PKTA 5FWBA 2E70A 1GFCA 2KT1A 5GMKj 1WHGA 4M7DC 3WVEB 4JLGA 1VQ9Q 1SEMA 4AG2C 2HDAA 1PRMC 3A8LB 4PLLA 3H8ZA 2CP6A 2L3SA 1H3ZA 4OB1B 2VYTA 4A63B 2VXEA 1IZ6A 1MMAA 1TUGB 2K57A 4IIMA 1M8MA 5CKFA 3L1AA 3ZEHA 2D0NA 1RAHB 4BI3A 1VQNA 2QG9B 3OS2A 4P5NA 4J9IA 4JJCA 2NUPB 2RJEA 2WSFE 3EAEA 3JCMc 1VQMQ 1YJNQ 3CCST 1X6GA 4IUVA 2RI2A 2XK0A 5CO7A 2O88A 4JJDA 5GMKm 1I4K1 2CS7A 3JB9I 2MOXA 2LQKA 4ZN1A 4FM4B 4AFSC 3LH5A 2DYIA 4DBQA 1SSHA 2GGRA 4PJNA 4FSXA 4PLIA 3C12A 4LE9A 3PVLA 1FMWA 3JB9J 4PJOF 4PJOE 1TTHB 2KVQG 1I1JA 2ZGWA 2L3PA 5I11A 2IPOB 4NS5A 1G5VA 4BACA 4BI8B 4F17A 1WQ7A 3RIRA 4IKFA 2ABLA 5CKBA 5GMKi 4HXJA 3CCJQ 1N9RA 4BY6B 1GBQA 2DKGA 1ZSGA 4X9DA 2FRWA 4FL6A 2RQRA 2R5AA 1AWWA 3LX7A 2QDYB 1SHFA 2QASA 2OTLA 1K73R 1AOJA 4JS4A 4E7ZA 3G71T 4C0DC 4EPCA 2RHIA 4MDWA 2PUKB 3VRZA 1VQ8Q 2QDLA 4XQ3A 2QEXQ 2DBMA 4M77D 4KGZB 1ZBJA 4KUDK 2VB6A 3QWYA 3OYKA 2MYSA 1LVKA 1YHQQ 1D3BA 1WJRA 2DERA 1HXDA 4M7DF 4M7DE 1BK2A 1TS9A 6AT1B 4YTLA 1Q86U 4C5EA 3QO3A 3C94A 4AG1C 1W2BA 3ME9A 1AVZC 1WHJA 3AT1B 4HVWA 1VQPQ 5KYUB 1GBRA 2CP3A 2ZPFB 2M0YA 3EFRA 2HBPA 5LJ3j 1RACB 1KD1R 3I56Q 3DLMA 4KH1B 1X6BA 4WTOB 1PSEA 1GCPA 1ZX6A 2C0IA 2FEIA 4KULA 3URGA 3LWHA 2DEUA 2JUFA 1GL5A 3CC4T 4MDXA 4RCCA 4E2FB 2P0KA 1N6AA 4XTUA 1EFNA 2FZKB 5A2QE 1WHHA 5DLOA 2KAFA 4E7IA 1PC0A 2KXDA 4RCBA 2CGHA 2ECZA 3NMZC 4FYWB 2FPFA 3S6WA 5IH2A 4M4ZA 4RKUE 3PGGA 4RTUA 4M78A 1K9MR 3JCMX 3QKJA 4C8QB 2EKOA 4CI0C 4F7UA 3CCUA 2KT8A 4CC7A 2X4YA 2CT3A 2M0OA 2EW3A 3JRZA 2HKNA 3VRYA 3EH2A 3QPHA 1AWJA 2CZ0B 4EMKB 2X35A 3E9FA 3M9QA 4BE0A 1X2KA 4PJOB 3RMQA 4X34A 3CMEA 1JJ2P 3FJ5A 3DB4A 1V29B 2YRCA 1K73C 4RMOA 2RK1A 4R56A 2K79A 3OA6A 1M90U 2DXCA 1H3HA 2JS2A 3CCQA 1YCSB 1OX9A 4RG8A 2X9HA 4PJOG 4M75A 4OGCA 4M77C 2VVKA 2DL3A 4ESRA 3G6EQ 1KHCA 2L3QA 3LWIA 2FYKA 2AZSA 1G2BA 2E12A 1LOJA 1SG5A 3ZL7C 4BI4A 2HQHA 2QQBA 4M7DB 2OTJQ 2JM8A 4E6RA 3CC2A 3CC7T 2XHCA 1X27A 1QCFA 2RJCA 1R8OB 4K11A 3GNFB 3NFCA 3FIFA 1KQ1A 4KBMB 2FHDA 4OB2B 4XAXB 3CCMT 4HVVA 3NPFA 5GMKe 4LDWA 2HEQA 3G4SA 3GLXA 1UEBA 4PJLA 1KQ2A 4M7DG 3BDLA 1PCXA 3CXCA 2HZYA 1VQOA 2NLUA 2L0AA 3M0RA 1MGQA 3OYCA 1EIFA 3PTAA 3BDUA 4Y92A 4FYXB 5GAMh 1WZOA 5M9OA 3OYYA 3RESA 1PHTA 3OB9A 3J7AF 3H0FA 1GXIE 1BYMA 1K9MC 2BZ8A 3CPWP 1UGQB 3JB9F 1NE8A 4B9XA 2F2WA 3IQLA 2CSQA 2DPPB 2DRMA 2CH4W 3MEVA 1EX4A 3OS1A 2X4WA 2RHUA 2EJGA 4QQGA 5LJ5d 2EQJA 4L5GA 3JB9H 1YJNT 1B3QA 1NM7A 1YI2A 1W2BS 1I5OB 1KHIA 2J7IA 4A53A 2JTFA 5GAOl 3VS7A 1C0MA 1M2OA 4JRQA 1RAAB 2AK5A 1UG1A 2E3HA 2JT4A 3DKMA 4AFQC 1GFDA 3E1SA 2BE7D 4C8QD 4RTTA 4JLIA 4C5GA 4C0FA 1B7TA 3VS2A 5IN1A 2EQMA 4BDYA 3NTHA 4C0DB 2CKKA 1MNEA 3UA7A 1UGRB 2D1XA 4M77E 2LQWA 3LW5E 1KQSP 3HTRA 3I35A 2CUBA 3CCEQ 1LJOA 3CCJT 2ZPIB 2COYA 1QVGP 4Z02A 3J81E 1Q82R 4BY6C 1NEBA 2NUPA 3EHRA 5I2MA 2F5TX 1E6GA 1SKUB 3UWNA 3EFOB 2DTIA 5LL6S 1ZQ1A 3OYEA 1XNIA 4XU3A 1UDLA 2P84A 4O6JA 2QEXT 1UUEA 3MP8A 3OYFA 2DXTA 2GFAA 5A0LA 1YHQT 2M1HA 1UGVA 1S72A 1Q81C 5J3BA 1VQ4A 1TU0B 2K5IA 2BKDN 3L2UA 2LVMA 1K8AU 3TREA 3PFSA 1Q7YR 1T3LA 2CUDA 2CYZB 1VQPT 3WVDB 5LJ3e 2EYWA 1VQNQ 1YBYA 4RG2A 2R57A 5KYWB 4QQ6A 5FRMA 3HP9A 2EYZA 1ZLMA 2E65A 2JVVA 1WXUA 2GTOA 1U1SA 3I56T 2KXCA 2PNIA 2LZ6B 4XU0A 1U3OA 2O01E 3H41A 1OPLA 4OGEA 2V1QA 2YWWA 2J06A 4KGXB 2RNAA 2W10A 3VYGA 1VA7A 3CBOA 4FYYB 1QVFS 4RTYA 1BCMA 4OMMA 2KE9A 3GPLA 2X3XD 5FU7C 3PIPA 2K2MA 5LJ3f 2VGMA 3UT1A 5GJWB 2FL7A 5KYUA 3UA6A 1T0JA 4C8QC 3JB9G 2D6FA 2AZVA 2PTKA 3L42A 2OTLQ 3A8OB 3CCSA 2QK0A 5FROA 4C92D 1YP5A 1VQLQ 4FU6A 1VQ5Q 1MUZA 4EMKC 1Q82C 7AT1B 3META 3EHQA 1G3WA 3QYHB 3JCMW 2A37A 1M27C 1X01A 2LJ3A 4JRIA 3OYGA 1M1GA 2V8JA 1I81A 4PK4A 2RO0A 2RJDA 2SEMA 5J26A 1UJYA 5CAIA 3CC7Q 4PFPA 2FVUA 5GANh 2KK4A 2RQWA 3HRTA 1YJWT 2CDTA 2RPNA 3HKSA 4XTYA 4EMGA 3G6ET 1RLQC 3OYNA 2WACA 1BIBA 3L2RA 3VS1A 3EGDB 2MPXC 1Q7YC 2XDBA 1IGUA 4E7JA 2JMCA 1BIAA 2DXUA 4EMKA 3RKXA 3SB2A 3X24B 5L23A 2VUBA 3QIIA 2OTJT 3M4GA 2MIOA 4PJOA 4XU2A 3QBYA 4J83A 2RM4A 1J3TA 2K3YA 2YRVA 3ER0A 3L2ZA 2DVJA 1M4ZA 1X69A 2XDPA 2VWFA 3QG1A 3PMTA 4PJJA 1Y96B 3CBMA 3MP1A 2DZ9A 3PMIA 1WLPB 1IHWA 4KH0B 3GP8A 4J6YA 1OQKA 2X51A 4LUEA 5IHKA 3GIBA 1N5ZA 3GNGA 2LRQA 3QZ9B 2EIFA 3OQ5A 1RI9A 1WHKA 2EKHA 1CKBA 2LC4A 4QVZA 3QSUA 4ORZA 2NUZA 1YCYA 2E1HA 4C8QE 1W1FA 4C8QF 4C0GA 2CP7A 2K6DA 4FT2A 2EYYA 2PQWA 4J9GA 3CCLA 3TSZA 2F5KA 4M7DA 3CMEQ 4KGVB 2MF2A 1PD1A 4ZTFA 2DL7A 2KBTA 1RAEB 2LTOA 2DJZA 2CP0A 2LNHB 2LDMA 1T0HA 2E5KA 3UF4A 3NTIA 3JB9D 5CKHA 3E19A 1VQ6Q 1JBMA 4DOWA 4JZ3A 5C6SA 1YJ9A 2P0PA 3FB9A 3OBYA 5HKCA
chains in the Genus database with same CATH topology
5GMKh 3CCQT 1QP3A 2K2VA 4ATOA 2L8DA 3V8JA 4M75G 2ZPHB 3CXCS 4PJOB 3H6ZA 3RMQA 4X34A 3QXEB 5FLXE 2DK3A 3X25B 3CMEA 1JJ2S 1IREB 2X4JA 3DB4A 3SDZA 1V29B 3QHSA 4LDUA 3HRUA 3X28B 1K8AC 3VKIA 1ZHIA 3MO8A 1K73C 4RMOA 2HQEA 2VC8A 4OMFB 3R6OA 5CKEA 4TVRA 2DIGA 2RK1A 4R56A 3SFMA 2ZPBB 4M77F 3WXMB 2VGNA 2KDSA 4IUTA 3OA6A 1Q86U 2RK2A 1M90U 2DXCA 4L6V5 5D6WA 5LJ5f 2VV5A 3KBGA 5A0GA 3Q1JA 5GANf 5GAMd 3CCQA 4QVDA 1HK9A 4FIBA 4RG8A 4PJOG 4PJOD 3CCET 3OYIA 4QW2A 2RB6A 3CC2T 4M75A 3JCMh 2XKOC 2LNVA 4LDXA 4OGCA 4M77C 4CRIA 1VQKA 4C8QA 2VXFA 1KHCA 3MP6A 2K5FA 3OYDA 3LWIA 1MHNA 2EAYA 1NPRA 2FYKA 4IUPA 5GAOp 3INZA 4J6XA 2E12A 3A8MB 1O9SA 3G7ZA 1S72T 4EMHA 4ZGEB 3MEWA 4N4HA 4XK8E 5CKDA 4HT8A 5HK0A 3G71A 1LOJA 2RI5A 4BI4A 1VQ4T 2QQBA 5IAYA 2QQSA 1M8VA 3HSBA 4M7DB 2G3RA 3V8LA 5IT9E 1QW1A 1VQ8T 1UGPB 1B34B 3M54A 4ME7A 1I8FA 3CC2A 1FWZA 2I2LA 2PUOB 3CBPA 4F7UB 2XHCA 5A0DA 3TU4K 2EJ9A 4PNOA 5GANg 3C95A 2RHZA 1R8OB 2RJCA 3OW2S 2OAUA 2ZZDA 4HCZA 3GNFB 3NFCA 5GAN3 4HT9A 2DXBA 3LGLA 1YJWA 3FIFA 1KQ1A 3PT9A 4X9CA 4KBMB 3G6EA 3V8KA 4DQ2A 4E47A 1WGSA 2FHDA 2JNGA 2KY9A 4J8OA 4OB2B 4XAXB 3CCMT 4M7AE 4M7AF 1X6OA 1UB4A 5GMKe 1N8RU 4LDWA 3M57A 5FU6B 3MEUA 3N5BB 1Q82U 1NJIU 3V7RA 3GLXA 3G4SA 3RKYA 3JCMb 3JCMQ 1UEBA 2EFIA 2QI2A 3JCMJ 2Y90A 5LJ3d 3JCMV 1KQ2A 3L2VA 4M7DG 4XTWA 4M7DD 3BDLA 4V2SA 4M7AB 3CXCA 4M78D 4MZTA 1VQOA 5GAOr 2NLUA 3M56A 5AYFA 3JAME 1MGQA 2YLBA 1JJ2A 4F7UG 2LCCA 5C0MA 1EIFA 5L8RE 2EQKA 4C0ZA 3OYCA 3PTAA 3L2WA 1VQNT 3BDUA 5CIUA 1U8RA 5CVIA 3MHXA 4QQDA 1DJ7B 3I55A 2M16A 1X75C 5GAMh 5FRNA 1OYXA 5M9OA 3OYYA 4C5IA 1Y7XA 3RESA 4Q5WA 3UDCA 1BI3A 2MI6A 3OB9A 4EDUA 1YI2T 3J7AF 1VIEA 1GXIE 3CCRA 1BYMA 5FU7B 2BUDA 1K9MC 3E9GA 3OSSC 3CPWS 2L3RA 1UGQB 4QVCA 3JB9F 3JCMe 2QQAA 1NE8A 1M90C 2KQWA 4B9XA 3T9NA 1G3SA 4O5VA 4A4HA 3CD6T 2DPPB 5GAN7 2DD4A 1BI0A 2XD0A 2WSCE 3MEVA 3M55A 3QYGB 4PKCC 4E7KA 1YIJA 3OS1A 3HL8A 2YHTA 1VQ9A 2X4WA 5LJ5j 3CC4A 2K4YA 2RH2A 2E41A 2R5MA 4C92F 4C92E 1WQWA 2DO3A 3M53A 2RHUA 5GANj 1G3YA 2EJGA 4QQGA 1Q7YU 1Q81U 2ZPEB 5LJ5d 2EQJA 3O8VA 4L5GA 3ZBDA 2EJFA 4IURA 3JB9H 4XTVA 3LLRA 1YJNT 1YITT 4JRPA 1YI2A 2EYQA 4Y28E 1W2BS 1KC8C 1FXXA 3MEAA 3ASKA 1KHIA 2QA4T 1UGSB 4JUVA 4A53A 4MMLA 1W4SA 4OF1A 1Q86C 2QTXA 4C92C 2JTFA 2PU9B 4D6WA 5GAOl 4M75D 4JRQA 5J39A 4LDYA 4M7AA 2K3XA 4ELZC 3DKMA 4C8QG 3E1SA 4C8QD 2IVWA 4BE0A 4JLIA 3OW2A 5CK9A 4C5GA 1XTDA 2HQXA 3V7SA 4BD3A 4C0FA 5KE2A 5KCOA 1O75A 5IN1A 5LJ3h 5DM7R 3DB3A 3QZ5B 2AHJB 2EQMA 4HA8A 4BDYA 3NTHA 4C0DB 2CKKA 4ZN3A 4NL3A 2QQRA 1VQMA 1H641 1UGRB 2HAXA 3F70A 4M77E 3TEEA 2OTLT 4MZPA 3LH0A 3TCJA 3LW5E 2V8IA 3JCMf 4OVAA 3BY7A 1VQLT 1Y07A 1KQSS 1VQ5T 1ZBXA 4N0AC 1NJIC 4M77B 2RD1A 4E7LA 2E10A 4ZGDB 1LJOA 4JDSA 4N4IA 2JTMA 4PJOC 3CCJT 5GAMe 2ZPIB 2C06A 3ZFJA 1QVGS 4Z02A 3J81E 4HKEA 5LJ3g 3CMAT 2EQUA 3MCAB 3FDRA 5GAN4 3NTKA 4BY6C 2JOYA 3KUFA 4ZTJA 2JZ2A 3OS0A 4A54A 3VYHB 4HCCA 3V7CA 3RMSA 2FB7A 5I2MA 5KH6A 1XQHA 5GAOm 2F5TX 3UWNA 3KXTA 3CPWA 2DTIA 5LL6S 1ZQ1A 1P92A 2LCLA 1XNIA 4J5YA 4C92A 3SWNC 3OYEA 2H3JA 3OMCA 1VQLA 1VQ5A 1VIFA 3SD4A 2D0QB 2E5QA 1WJQA 3A8HB 4XU3A 3VU3C 4M77G 5LJ5h 1KG1A 2HD0A 2GQVA 3PNWC 4O6JA 3HPWA 3PIOA 2QEXT 3JCMg 3QJ6A 2O4XA 3CCEA 1OZ3A 2DD5A 3MP8A 3OYFA 2HNIA 2RHYA 2DXTA 3FC3A 2GFAA 5A0LA 3HFOA 1YHQT 3OBWA 4M78F 2P0QA 3OSVA 2L89A 2PVGB 2R58A 4LDVA 3VJPA 2M1HA 2DTOA 1M1KC 1S72A 2MWPA 1M9SA 1JRIA 3P8HA 1WJSA 2K5LA 1Q81C 5J3BA 4OB0B 3M58A 4NL2A 1VQ4A 2K5IA 5DY9A 2BKDN 4N0AA 3X20B 2QXFA 3L2UA 4DA4A 2E70A 2A7YA 2LVMA 1K8AU 3TREA 1BKBA 1G3TA 1K73U 5GMKj 1VQ8A 5GAMf 1SSFA 3PFSA 4M7DC 2KMTA 3QDRB 3WVEB 4M78C 4JLGA 2E6ZA 4JJNK 2CYZB 4M77A 3VUBA 3WVDB 5GMKl 5LJ3e 1YBYA 3CC7A 1VQPT 3LGFA 4RG2A 2R57A 5FRMA 4QQ6A 3A8LB 3HP9A 1TH7A 2X4XA 2E65A 2JVVA 5GAN8 2XDDA 4PLLA 4Y91A 4LD6A 3H8ZA 4A4FA 5D6XA 3CCMA 2GCXA 1U1SA 4KT0E 3I56T 3OY9A 1H3ZA 5HK3A 4OB1B 4HCBA 3SWNA 3P8DA 2VYTA 5GAN5 2VXEA 2M9UA 2Y4XA 4XU0A 3CCLT 4BE1A 1KQSA 1IZ6A 4BUGA 2O01E 2K57A 4GLKA 2CZ7B 4M7AG 1N27A 4OGEA 5CKFA 3L1AA 3ZEHA 4ZGJB 4M7AD 3FLGA 1VQPA 4BI3A 4NOYA 1I5LA 5GAOn 1QVGA 3CCUT 1VQNA 3QJYA 1NZ9A 2MMPA 3OS2A 3VYGA 4P5NA 5GAMg 3GF5A 4IUQA 1AHJB 4OB3B 3VUZA 2RJEA 2WSFE 3EAEA 3JCMc 2F69A 3CBOA 3QUIA 1JB0E 3CCST 1QVFS 2XIDA 4KUIA 4IUVA 4XTZA 1YJ9T 2RI2A 3I56A 5GANd 2XK0A 5CO7A 5DLQE 3VV0A 4C92B 5GAN2 2ZPGB 5LJ5e 3GPLA 5GMKm 2E64A 1I4K1 3CEYA 2CS7A 5FU7C 1M5Q1 1KD1U 3PIPA 3JB9I 2CZ6B 2O4XB 5LJ3f 2DZCA 2LQKA 2VGMA 3UT1A 3X26B 3S3NA 4ZN1A 4FM4B 3CMET 3CD6A 3HHTB 2MAMA 2FL7A 3CMAA 4M75C 2YLCA 4FT4A 4FSXA 4PLIA 3C12A 1Y71A 4UC4A 2PVOB 4A4GA 4C8QC 3JB9G 4BE2A 2D6FA 3L42A 4N4GA 4R55A 5CQXA 2GFUA 2RA2A 3JB9J 4PJOF 4PJOE 3A8OB 4MZMA 1QP2A 3OS5A 3CCSA 4J7FA 1VQ6T 2KVQG 3OYJA 1YITA 2XG8D 2ZGWA 1YJNA 3OMGA 5GAN6 1Y96A 4WF2A 4C92G 4NS5A 5FROA 2BIVA 4C92D 2QA4A 1G5VA 4FU6A 3FEOA 4BACA 4BI8B 1OI1A 2RHXA 1WQ7A 3RIRA 2DAQA 3OYLA 2GF7A 2D9TA 3L2QA 4IKFA 1N8RC 4EMKC 3HRSA 5CKBA 1Q82C 5GMKi 3DLLA 1N9RA 1QVPA 4BY6B 3OYHA 1NPPA 4A4EA 1VQKT 3RKWA 2DKGA 3M5AA 5EG2A 3META 4X9DA 1G3WA 4FL6A 3UPUA 2DEQA 3QYHB 3JCMW 1K9MU 2R5AA 1X01A 3LX7A 2QDYB 5GAMj 5GAOq 2OTLA 2PVDB 3HFNA 4JS4A 3SWNB 1VQ6A 4JRIA 3OYGA 3G71T 4C0DC 4EPCA 1M1GA 2RHIA 2V8JA 4MDWA 1M1FA 1BI1A 3JCMP 2PUKB 1I81A 2LX9A 3S3MA 2DTHA 2RO0A 2RJDA 4C5HA 4XQ3A 1VUBA 3LYIA 4M77D 5J26A 5CAIA 4KUDK 2FVUA 3EFSA 5GANh 5CQYA 2KK4A 2LQ8A 3OYKA 1N9SA 4DOVA 3CCJA 1KC8U 1D3BA 1WJRA 3HRTA 1YJWT 1HXDA 3HKSA 4XTYA 4EMGA 4M7DF 3G6ET 4M7DE 3A8GB 1VQ7T 2WSEE 4M78E 1RL2A 4YTLA 5I21A 2EWNA 4C5EA 3QO3A 3C94A 4IUUA 2WACA 3OYNA 1QVFA 1BIBA 3L2RA 3G4ST 4F7UF 4F7UE 1W2BA 3C4SA 3ME9A 2KSSA 1Q7YC 2XDBA 4E7JA 4BB7A 1XOVA 3CC7T 4BDZA 1BIAA 4M78B 3AHUA 2DXUA 4EMKA 3RKXA 3SB2A 3X24B 5CCAA 1WNLA 1VQOT 2VUBA 3QIIA 5LJ5g 2OTJT 2IG0A 3M4GA 1BI2A 4PJOA 4XU2A 5CR2A 2QEXA 3FRNA 3QBYA 4J83A 1KD1C 2RM4A 3A5ZB 4II1A 5HY6A 1WPYA 1FX7A 2K3YA 2YRVA 2ZPFB 3EFRA 3ER0A 3L2ZA 5D6YA 2HBPA 3I55T 4JS5A 1M4ZA 2B8AA 2QQ9A 2XDPA 4A4KA 5I2SA 3QG1A 1YHQA 1VQ7A 3PMTA 5LJ3j 3CCVT 3FJPA 2ZCFB 3DLMA 1Y96B 3CBMA 3CCRT 2JN0A 4L59A 1PSFA 3MP1A 2DVEA 4GY5A 4PL6A 2DZ9A 2Y4YA 3PMIA 2XICA 3RUXA 1PSEA 4M78G 5FU6C 2V8KA 3GP8A 4J6YA 1LNXA 3CPFA 4KULA 3URGA 3LWHA 2CZ1B 2OTJA 2JUFA 3OYAA 3GOXA 3JSCA 4J7IA 4XU1A 3CC4T 1YIJT 3GIBA 2E6NA 1VQ9T 2DIQA 3GNGA 2LRQA 4M7AC 3QZ9B 2EIFA 4OP0A 3BFMA 4MDXA 4RCCA 3OQ5A 2MWOA 3J80E 2P0KA 3BW1A 1N6AA 4XTUA 2LC4A 3M4YA 4QVZA 3QSUA 5KE3A 1YCYA 4MMKA 5A2QE 4M75E 4M75F 3JCMd 3CCVA 2E1HA 5DLOA 2KAFA 1U1TA 2L5QA 2RJFA 4E7IA 4RCBA 4C8QE 4C8QF 2CGHA 4C0GA 4FT2A 2XU8A 3S6WA 2PQWA 3RERA 3CCLA 3S3OA 4M75B 2F5KA 4VUBA 4M7DA 4RKUE 5GANe 3PGGA 4M78A 2MF2A 3JCMX 3QKJA 4ZTFA 4C8QB 1B34A 2EKOA 2LTOA 2DJZA 1D3BB 1M1KU 4CI0C 2LDMA 3OYBA 4F7UA 3CCUA 4ELYC 4J6WA 2X4YA 3NTIA 2M0OA 1VQMT 3OYMA 3JB9D 5KCHA 5CKHA 3M59A 1OZ2A 4B9WA 1RI0A 2RI3A 2XI9A 3E19A 4LD9K 1JBMA 3JRZA 4DOWA 2LT1A 2LT4A 2P4TA 3P8BB 5C6SA 3QPHA 4E7HA 1YJ9A 2P0PA 3FB9A 2CZ0B 3OBYA 2A3LA 2X35A 4XTXA 4EMKB 5HKCA 4JRKA 3E9FA 3M9QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GMK h;  1I81 A;  3JB9 F;  3JCM e;  2DTH A;  3V8J A;  4M75 G;  4PJO B;  5GMK j;  4XQ3 A;  5GAM f;  5GAN 7;  4M7D C;  4M77 D;  4M78 C;  5CAI A;  4M77 A;  5GMK l;  5LJ3 e;  2YHT A;  5LJ5 j;  3EFS A;  5GAN h;  3QHS A;  1N9S A;  2E41 A;  4C92 F;  4C92 E;  1TH7 A;  1D3B A;  1WQW A;  1HXD A;  2VC8 A;  4XTY A;  2E65 A;  2EJG A;  4EMG A;  5GAN 8;  5GAN j;  4M7D F;  4M7D E;  4M78 E;  5LJ5 d;  4Y91 A;  4M77 F;  2EJF A;  5I21 A;  2EWN A;  3QO3 A;  4XTV A;  3JB9 H;  1BIB A;  1U1S A;  4F7U F;  4F7U E;  5LJ5 f;  3SWN A;  4JUV A;  4A53 A;  3AHU A;  4MML A;  5GAN f;  1BIA A;  2VXE A;  4M78 B;  2DXU A;  4XU0 A;  5GAM d;  4EMK A;  1HK9 A;  3RKX A;  4QVD A;  3SB2 A;  2QTX A;  1WNL A;  4C92 C;  5LJ5 g;  2K57 A;  4PJO G;  5GAO l;  4M7A G;  4PJO D;  3M4G A;  4M7A D;  3L1A A;  4M75 D;  2RB6 A;  4PJO A;  4XU2 A;  4M7A A;  4M75 A;  3JCM h;  4NOY A;  1I5L A;  4C8Q G;  5GAO n;  4M77 C;  4C8Q D;  2RM4 A;  4JLI A;  4C8Q A;  3V7S A;  2VXF A;  1WPY A;  3EFR A;  3L2Z A;  5GAM g;  5LJ3 h;  4HA8 A;  2EAY A;  2FYK A;  3JCM c;  5GAO p;  3INZ A;  5LJ3 j;  4J6X A;  4NL3 A;  1H64 1;  3FJP A;  3QUI A;  4M77 E;  4XTZ A;  1Y96 B;  4EMH A;  2JN0 A;  5GAN d;  4HT8 A;  1LOJ A;  2DVE A;  3JCM f;  4C92 B;  2DZ9 A;  5GAN 2;  5LJ5 e;  3BY7 A;  1M8V A;  5GMK m;  3RUX A;  2E64 A;  1I4K 1;  3HSB A;  4M78 G;  4M7D B;  1M5Q 1;  3V8L A;  4J6Y A;  4N0A C;  3JB9 I;  1LNX A;  4M77 B;  5LJ3 f;  2DZC A;  2RD1 A;  1B34 B;  2E10 A;  1I8F A;  1LJO A;  4XU1 A;  3GIB A;  2I2L A;  4F7U B;  4PJO C;  4M7A C;  4M75 C;  2EJ9 A;  2YLC A;  3BFM A;  4OP0 A;  4PNO A;  4RCC A;  5GAM e;  5GAN g;  4HT9 A;  5GAN 3;  3BW1 A;  5LJ3 g;  4XTU A;  5GAN 4;  4C8Q C;  3JB9 G;  3FIF A;  1KQ1 A;  4X9C A;  3QSU A;  2RA2 A;  3V8K A;  4A54 A;  4DQ2 A;  3JB9 J;  4PJO E;  1YCY A;  4MMK A;  4PJO F;  4M7A E;  4M75 E;  4M75 F;  3V7C A;  3JCM d;  2E1H A;  3JCM P;  4M7A F;  2FB7 A;  1U1T A;  5GMK e;  5GAO m;  2ZGW A;  4RCB A;  5GAN 6;  3V7R A;  1Y96 A;  4C8Q E;  4WF2 A;  3RKY A;  4C92 G;  2CGH A;  4C8Q F;  2DTI A;  4C92 D;  3JCM b;  3JCM Q;  3JCM J;  2Y90 A;  4J5Y A;  5LJ3 d;  3JCM V;  3SWN C;  4C92 A;  1KQ2 A;  4M7D G;  4XTW A;  1WQ7 A;  3RIR A;  3RER A;  4M7D D;  4V2S A;  4XU3 A;  4M75 B;  4M7A B;  4M78 D;  3VU3 C;  4M7D A;  4M77 G;  5GAN e;  3PGG A;  4EMK C;  4M78 A;  5LJ5 h;  5GAO r;  5GMK i;  3JCM X;  5GAN 5;  3JCM g;  1MGQ A;  2YLB A;  1N9R A;  1B34 A;  4C8Q B;  4F7U G;  2DJZ A;  3RKW A;  1D3B B;  2DKG A;  4F7U A;  3BDU A;  4X9D A;  2HNI A;  4J6W A;  2DXT A;  3HFO A;  2DEQ A;  3JCM W;  4M78 F;  5GAM h;  3JB9 D;  1X01 A;  3RES A;  2DTO A;  5GAM j;  5GAO q;  1JBM A;  3HFN A;  3SWN B;  1JRI A;  4JRI A;  3FB9 A;  4NL2 A;  4XTX A;  4EMK B;  5DY9 A;  4N0A A;  4JRK A;  4QVC A; 
#chains in the Genus database with same CATH topology
 1KC8 R;  2F1L A;  4DBF A;  2L2P A;  2ZPH B;  2XMF A;  3QXE B;  1G83 A;  3X25 B;  1IRE B;  2X4J A;  4LDU A;  1RLP C;  2KYB A;  3R6O A;  5CKE A;  2DIG A;  3EH1 A;  3SFM A;  2ZPB B;  1RAD B;  2KDS A;  4EIK A;  1JQQ A;  2NYS A;  3KBG A;  5EC7 A;  3Q1J A;  5GAM d;  3CCE T;  3OYI A;  3JCM h;  2E4H A;  2A36 A;  2LNV A;  4LDX A;  1VQK A;  1OOT A;  2KRN A;  1W6X A;  3H9N A;  3I5S A;  3MP6 A;  1VQ7 Q;  2K5F A;  1ZUY A;  4IUP A;  1BBZ A;  2EGA A;  2LP5 A;  5IAY A;  1M8V A;  3V8L A;  1D0Y A;  3R6N A;  1VQO Q;  1RUW A;  3M54 A;  2ZAE A;  2I2L A;  5A0D A;  2QTV A;  3TU4 K;  2DET A;  3OW2 S;  2OAU A;  2ZZD A;  4HT9 A;  3REA B;  3EG2 A;  4X9C A;  3PT9 A;  2C0O A;  3CCV Q;  2JNG A;  2KY9 A;  3PVQ A;  2W0Z A;  1M1K R;  3L2V A;  1M3B A;  1NLO C;  4M7A B;  1ACM B;  3M56 A;  3EG9 B;  1XJW B;  4Z89 A;  1JJ2 A;  1K76 A;  1VQN T;  5L8R E;  3L2W A;  3VS0 A;  5CIU A;  3MHX A;  3I55 A;  1X75 C;  3M0T A;  4C5I A;  1Y7X A;  3UDC A;  1BI3 A;  1SPK A;  3CCR A;  5FU7 B;  3E9G A;  2EQI A;  1M90 C;  2KQW A;  1JXM A;  3T9N A;  4FSS A;  4O5V A;  2V26 A;  2WSC E;  1CKA A;  1TG0 A;  4PKC C;  1YIJ A;  2YHT A;  1VQ9 A;  2E41 A;  2FPE A;  4C92 F;  4C92 E;  2DO3 A;  2J6K A;  4IUR A;  4Y28 E;  1KC8 C;  1W2B P;  3MEA A;  3ASK A;  2CT4 A;  4OF1 A;  3ULR B;  1W70 A;  8AT1 B;  1WIE A;  2OAW A;  4LDY A;  4C8Q G;  2A28 A;  1IGQ A;  3V7S A;  2HQX A;  5KE2 A;  2YRD A;  1M3C A;  5KYW A;  2RQT A;  5IHN A;  4ZN3 A;  1VQM A;  2HAX A;  2OTL T;  2K3B A;  3F70 A;  3PE0 A;  1JU5 C;  2JJ9 A;  1PD0 A;  2GNC A;  1VQL T;  1VQ5 T;  1ZBX A;  4N0A C;  3MJX A;  1PNJ A;  2RD1 A;  4E7L A;  2E10 A;  1TWB A;  3ZFJ A;  1N8R R;  2KR3 A;  2EQU A;  1YJW Q;  3NTK A;  2JOY A;  1UEC A;  2K9G A;  3SEM A;  1YFN A;  1XQH A;  1D1A A;  2JMA A;  2ED0 A;  1K9A A;  3CPW A;  3VS3 A;  1P92 A;  2LCL A;  3NGP A;  4PFZ A;  2H3J A;  4OMN A;  1VIF A;  2D0Q B;  1ZUK A;  1WJQ A;  2E5Q A;  3EGU A;  1KIK A;  2HD0 A;  2GQV A;  1MV3 A;  1I07 A;  4M78 F;  4OMO A;  3VJP A;  1GRI A;  1M1K C;  2MWP A;  1M9S A;  1WJS A;  1K0X A;  2EPD A;  2ENM A;  3X20 B;  4N0A A;  1RAB B;  2QXF A;  4DA4 A;  1G3T A;  1K73 U;  1VQ8 A;  1Q81 R;  1SHG A;  2GBQ A;  2I0N A;  3VUB A;  4M77 A;  5GMK l;  2DMO A;  1TH7 A;  1GCQ C;  4LD6 A;  5D6X A;  4DBR A;  4KT0 E;  5HK3 A;  5GAN 5;  1KQS A;  4PJM A;  4BUG A;  1IXD A;  4GLK A;  2CZ7 B;  1N27 A;  4M7A D;  4ZGJ B;  3FLG A;  5HCK A;  3M0P A;  1VQP A;  2VKN A;  2DA9 A;  4NOY A;  1QVG A;  3CCU T;  2DL8 A;  2MMP A;  3GF5 A;  4IUQ A;  4OB3 B;  3VUZ A;  4CC3 A;  1JB0 E;  2F2V A;  1QKW A;  4XTZ A;  4KUI A;  1QVF P;  3I56 A;  5GAN d;  1S1N A;  5DLQ E;  3M0Q A;  5GJV B;  1UFF A;  4C92 B;  2J6O A;  5GAN 2;  1Y57 A;  2ZPG B;  5LJ5 e;  3EGD A;  4QKU A;  3CEY A;  1V76 A;  1M5Q 1;  1HSQ A;  1KD1 U;  1ABO A;  2DZC A;  3CD6 A;  3CME T;  2OJ2 A;  3CMA A;  4FT4 A;  1Y71 A;  1GCQ A;  4A4G A;  4BE2 A;  4N4G A;  1TOV A;  2DL4 A;  5CQX A;  2RA2 A;  4R55 A;  8ATC B;  1M30 A;  4MZM A;  1VQ6 T;  1D0X A;  1YIT A;  2XG8 D;  3OMG A;  5GAN 6;  1Y96 A;  4C92 G;  2KYM A;  2QA4 A;  3FEO A;  1OI1 A;  2RHX A;  2DAQ A;  3OYL A;  3L2Q A;  2D9T A;  1N8R C;  3HRS A;  1OV3 A;  1K0S A;  3DLL A;  5EG2 A;  3M5A A;  1F1B B;  2O2O A;  2Z0W A;  4FCY A;  1UTI A;  1K9M U;  3MPU B;  5GAM j;  2D8J A;  5GAO q;  2PVD B;  3SWN B;  1WI7 A;  2ROT A;  2D8H A;  4AMC A;  1KSW A;  1WXT A;  2RQV A;  2DTH A;  4OMQ A;  4C5H A;  4J9C A;  1ZA2 B;  3LYI A;  2YUP A;  2DBK A;  4J9F A;  2H8H A;  2LQ8 A;  1N9S A;  1WA7 A;  4DOV A;  1VYU A;  3A8G B;  1VQ7 T;  2WSE E;  2FZC B;  4PFO A;  2BTT A;  5IXF A;  3NHN A;  5I21 A;  2DNU A;  2EWN A;  4IUU A;  2CRE A;  3EG0 A;  3G4S T;  3C4S A;  2KSS A;  2C0T A;  1U06 A;  4BDZ A;  4M78 B;  1WYX A;  1SRL A;  5CCA A;  1IO6 A;  5LJ5 g;  2KRS A;  1WHM A;  1VQO T;  1ZA1 B;  5FWC A;  1UE9 A;  2E3I A;  2HKQ B;  2QGG A;  1WPY A;  1FX7 A;  5D6Y A;  4JS5 A;  2B8A A;  2QQ9 A;  4A4K A;  5I2S A;  4LXC A;  3CCV T;  2JM9 A;  1Q95 G;  2JN0 A;  1PSF A;  2OI3 A;  3RUX A;  4M78 G;  1LNX A;  3CPF A;  2OTJ A;  3M0S A;  2CZ1 B;  1KK7 A;  3GOX A;  3JSC A;  4XU1 A;  1WXB A;  2E6N A;  4M7A C;  4OP0 A;  1QWE A;  3BW1 A;  3MKD A;  3M4Y A;  2RMO A;  4B6M A;  4MMK A;  3JCM d;  1YJ9 Q;  1U1T A;  2DL5 A;  2GTJ A;  2XU8 A;  1RAI B;  3S3O A;  4M75 B;  4VUB A;  3EGX B;  4AFZ C;  1ZSZ B;  2O31 A;  2M51 A;  3BE3 A;  1ZUU A;  3OYM A;  5KCH A;  4LD9 K;  3M59 A;  1RI0 A;  2RI3 A;  2XI9 A;  2LT4 A;  3P8B B;  4XTX A;  2A3L A;  4FYV B;  5GMK h;  2K2V A;  3V8J A;  4M75 G;  3CXC S;  3QWX X;  3H6Z A;  2DIL A;  5FLX E;  2DK3 A;  1Q86 R;  2KNB B;  3EG9 A;  3SDZ A;  3X28 B;  2VAS A;  3MO8 A;  2HQE A;  2AKL A;  4TVR A;  3VS4 A;  4IUT A;  2RK2 A;  5D6W A;  1H92 A;  1QCO A;  1QQJ A;  3H0I A;  1OU9 A;  1NYF A;  4QW2 A;  2DX1 A;  1LPL A;  2XKO C;  4J9H A;  5KYY B;  4C8Q A;  2VXF A;  2EVR A;  3SHW A;  1NPR A;  5GAO p;  2FG0 A;  4CC4 B;  9ATC B;  4J6X A;  3A8M B;  1S72 T;  1O9S A;  1V1C A;  3G7Z A;  4XK8 E;  4AFU C;  4HT8 A;  5HK0 A;  3G71 A;  1VQ4 T;  2QQS A;  2LCS A;  1G8X A;  2ROL A;  3HSB A;  1BCO A;  1M2V B;  2COZ A;  5ECA A;  3C0C A;  4LN2 A;  1B34 B;  2RN8 A;  1NYG A;  1UHC A;  1FWZ A;  3CBP A;  2EJ9 A;  4PNO A;  1AEY A;  3UAT A;  3OW2 P;  4HCZ A;  2O9V A;  4M7A E;  4M7A F;  1X6O A;  1UB4 A;  5FU6 B;  1NJI U;  2YSQ A;  3N5B B;  1Q82 U;  3RKY A;  3JCM b;  3JCM Q;  2EFI A;  2QI2 A;  3JCM J;  2Y90 A;  3JCM V;  4V2S A;  4M78 D;  1BB9 A;  4MZT A;  1WHL A;  1YIJ Q;  1OPK A;  2YLB A;  2LCC A;  5C0M A;  2EQK A;  3CCU Q;  1DJ7 B;  2M16 A;  3THK A;  5FRN A;  1ARK A;  2QYZ A;  4JZ4 A;  2MI6 A;  2BZX A;  1VIE A;  2FO0 A;  2NUT B;  2HCK A;  2BUD A;  1JO8 A;  2KEA A;  2L3R A;  2YT6 A;  4QVC A;  1WDX A;  1TUC A;  4A4H A;  2IIM A;  5GAN 7;  2DD4 A;  1OU8 A;  3M55 A;  2DYB A;  3CC4 A;  4WCI A;  5LJ5 j;  1M90 R;  1E6H A;  1TXQ A;  5GAN j;  1G3Y A;  4R0K A;  1Q7Y U;  2QAZ A;  3ZBD A;  2EJF A;  4XTV A;  3LLR A;  1YWO A;  4JRP A;  2EYQ A;  1FXX A;  4JUV A;  4HVU A;  3CCQ Q;  4RTZ A;  1Q86 C;  1WFW A;  3M0U A;  1K1Z A;  4C92 C;  2PU9 B;  4D6W A;  4M75 D;  5J39 A;  2K3X A;  1MMN A;  2IVW A;  5CK9 A;  1XTD A;  2HMA A;  2RQU A;  5LJ3 h;  3DB3 A;  2AHJ B;  4HA8 A;  1NBE B;  4F16 A;  4NL3 A;  4RTW A;  3TEE A;  4MZP A;  3LH0 A;  2V8I A;  4OVA A;  2KI7 A;  3EG3 A;  1Y07 A;  1MV0 B;  4ANJ A;  4J9B A;  1QMC A;  3CC2 Q;  4JDS A;  2G6F X;  5GAM e;  1HD3 A;  4HKE A;  5GAN 4;  1YWP A;  3KUF A;  4A54 A;  3VS5 A;  1K4U S;  2FB7 A;  1PRL C;  5GAO m;  3G4S Q;  2YDL A;  5KYX B;  3KXT A;  4J5Y A;  1VQL A;  4C92 A;  3SWN C;  3OMC A;  5AT1 B;  1VQ5 A;  4Z8A A;  1AWO A;  3PNW C;  3HPW A;  3PIO A;  2DD5 A;  2HNI A;  1PG5 B;  1NG2 A;  3OSV A;  2L89 A;  2PVG B;  2R58 A;  4LDV A;  2DTO A;  2A08 A;  2LMJ A;  3A1P A;  1D09 B;  5DY9 A;  1MMG A;  2HSE B;  2A7Y A;  1BKB A;  2YUO A;  5GAM f;  1SSF A;  2KMT A;  3QDR B;  4M78 C;  2E6Z A;  4JJN K;  3CC7 A;  4RUG A;  3LGF A;  2X4X A;  2X3W D;  2ESW A;  5GAN 8;  2XDD A;  4Y91 A;  1X2Q A;  4A4F A;  1YI2 Q;  3CCM A;  2GCX A;  1U5S A;  3OY9 A;  4HCB A;  3SWN A;  1T3S A;  3P8D A;  1B07 A;  2Y4X A;  2M9U A;  3CCL T;  4BE1 A;  1FMV A;  3EFO A;  3CD6 Q;  2SRC A;  4M7A G;  4QT7 A;  3CMA Q;  5FW9 A;  1I5L A;  3G1J A;  5GAO n;  2GQI A;  3QJY A;  1NZ9 A;  2HSP A;  5GAM g;  1AHJ B;  2F69 A;  3QUI A;  1YIT Q;  2XID A;  1YJ9 T;  2QA4 Q;  3VV0 A;  2DM1 A;  1HJD A;  1QLY A;  1YNZ A;  2E64 A;  1RAG B;  2CZ6 B;  2O4X B;  3X26 B;  3S3N A;  3O5Z A;  3HHT B;  2MAM A;  4M75 C;  4FW2 A;  2YLC A;  2DRK A;  4UC4 A;  2PVO B;  1ZSZ C;  1KFZ A;  3E2U A;  1IB8 A;  2GFU A;  2V1R A;  1MMD A;  1QP2 A;  3OS5 A;  4J7F A;  3OYJ A;  1YJN A;  1PM3 A;  4WF2 A;  1EZZ B;  2BIV A;  2LX7 A;  2QGF B;  2GF7 A;  5I22 A;  1QVP A;  3OYH A;  1NPP A;  4A4E A;  1VQK T;  3RKW A;  2NWM A;  4LNP A;  3GBQ A;  3CQT A;  3UPU A;  1PWT A;  2DEQ A;  1AT1 B;  1S72 Q;  1K8A R;  3HFN A;  1VQ6 A;  2CP5 A;  1SRM A;  1VQ4 Q;  1VOM A;  1M1F A;  1BI1 A;  3JCM P;  2LX9 A;  2PZ1 A;  3S3M A;  1AZE A;  1FYN A;  1QKX A;  1VUB A;  1AZG B;  1R0B G;  3U23 A;  3EGX A;  4F14 A;  3TVT A;  1ZSZ A;  3EFS A;  3CCJ A;  5CQY A;  2AKK A;  1E7O A;  2H3E B;  1KC8 U;  1VYT A;  4M78 E;  2M02 A;  1RL2 A;  1QVF A;  2LJ1 A;  2BZY A;  4F7U F;  4F7U E;  2KGT A;  3RNJ A;  4BB7 A;  1XOV A;  4GBQ A;  3AHU A;  2KRO A;  4FW1 A;  1WNL A;  2KRM A;  4AT1 B;  2JTE A;  2IG0 A;  1QWF A;  1TSF A;  1BI2 A;  5CR2 A;  2QEX A;  3FRN A;  1LCK A;  1KD1 C;  3A5Z B;  4II1 A;  5HY6 A;  4F04 B;  3I55 T;  1YHQ A;  1VQ7 A;  3FJP A;  2ZCF B;  2EYX A;  3CCR T;  4L59 A;  1RAF B;  2DVE A;  4GY5 A;  4PL6 A;  2Y4Y A;  2XIC A;  4E7S A;  5FU6 C;  2V8K A;  2P4R A;  3OYA A;  4J7I A;  1YIJ T;  1VQ9 T;  2DIQ A;  3BFM A;  2J6F A;  1Y0M A;  2MWO A;  3J80 E;  1MND A;  5KYY A;  5KE3 A;  3CCS Q;  4M75 E;  4M75 F;  3CCV A;  2L5Q A;  2BE9 B;  2RJF A;  2HBW A;  1OEB A;  3H0H A;  1C1A A;  4HCK A;  3RER A;  5IXB A;  3TSW A;  5GAN e;  1OX8 A;  2AIR B;  1JEG A;  1M2V A;  1B34 A;  1D3B B;  3RBB B;  1M1K U;  2YXY A;  3OYB A;  3I9Q A;  1ABQ A;  1IRX A;  4J6W A;  4ELY C;  1VQM T;  1OZ2 A;  4B9W A;  2LT1 A;  2P4T A;  4E7H A;  3I5R A;  3TQ7 P;  4JRK A;  1WX6 A;  3CCQ T;  1QP3 A;  4ATO A;  2L8D A;  3CXC P;  2MK5 A;  3EG1 A;  1BU1 A;  2LJ0 A;  4CC2 A;  1YN8 A;  1JJ2 S;  3QHS A;  3HRU A;  1K8A C;  3VKI A;  1ZHI A;  2VC8 A;  4OMF B;  1PKS A;  1NLP C;  2ATC B;  4M77 F;  2VGN A;  3WXM B;  3KFV A;  2F2X A;  1C6V X;  2JXB A;  4L6V 5;  3G71 Q;  2K7A A;  5LJ5 f;  2VV5 A;  5A0G A;  2NUT A;  4J9E A;  5GAN f;  2EBP A;  4QVD A;  1HK9 A;  4FIB A;  1OUL A;  1JXO A;  1KJW A;  4D8D A;  4PJO D;  1AWX A;  1A0N B;  2RB6 A;  3CC2 T;  2ED1 A;  4ZNX A;  4CRI A;  1NJI R;  1NEG A;  3OYD A;  1MHN A;  2EAY A;  2A0F B;  3INZ A;  3JV3 A;  4EMH A;  4D8K A;  4ZGE B;  3MEW A;  5KYN A;  4N4H A;  3RR6 A;  5CKD A;  2MCN A;  2RI5 A;  1D0Z A;  4Z88 A;  2G3R A;  1Z9Q A;  5IT9 E;  1QW1 A;  1VQ8 T;  1UGP B;  4ME7 A;  4RTX A;  1I8F A;  2PUO B;  4F7U B;  5GAN g;  3C95 A;  2RHZ A;  5GAN 3;  2DXB A;  3LGL A;  2DLP A;  1YJW A;  2FPD A;  2HL5 C;  3G6E A;  3V8K A;  4DQ2 A;  2OX7 A;  4E47 A;  1WGS A;  4J8O A;  3REB B;  2B86 A;  1IHV A;  1N8R U;  3M57 A;  3MEU A;  3V7R A;  2J05 A;  5LJ3 d;  2FRY A;  3CCL Q;  4XTW A;  4JJB A;  4M7D D;  2FZG B;  5GAO r;  3CC4 Q;  5AYF A;  3JAM E;  1QCN A;  4F7U G;  4C0Z A;  2O9S A;  3D7S B;  1SF9 A;  1U8R A;  5CVI A;  4QQD A;  2DFU A;  1OYX A;  2COW A;  4JPB W;  2RF0 A;  4Q5W A;  4X1V A;  4EDU A;  1YI2 T;  4RTV A;  3OSS C;  1R77 A;  3CPW S;  5KYX A;  3JCM e;  2QQA A;  1UHF A;  1G3S A;  3CD6 T;  4DBH A;  1BI0 A;  2XD0 A;  4IIO A;  1D1C A;  3QYG B;  5D7U A;  4E7K A;  3CMA T;  3HL8 A;  1M3A A;  2K4Y A;  4OMP A;  2RH2 A;  2R5M A;  2YUN A;  2LQN A;  1WQW A;  1D1B A;  3M53 A;  1TUD A;  1Q81 U;  2ZPE B;  3O8V A;  1R0C B;  1YIT T;  1AD5 A;  2QA4 T;  1UGS B;  3QDF A;  4MML A;  3VS6 A;  1W4S A;  2EGC A;  2QTX A;  3RDV A;  4M7A A;  1HYO A;  4ELZ C;  1VQK Q;  3OW2 A;  5KCO A;  4BD3 A;  1O75 A;  5DM7 R;  3QZ5 B;  1CSK A;  2QQR A;  1H64 1;  2CSI A;  3TCJ A;  3JCM f;  3A98 A;  3BY7 A;  4DEX A;  2DE0 X;  1KQS S;  2DJQ A;  1NJI C;  2EGE A;  4M77 B;  4OML A;  4ZGD B;  1I0C A;  4N4I A;  2JTM A;  4PJO C;  2C06 A;  1QVG S;  5LJ3 g;  1VYV A;  3MCA B;  3FDR A;  4ZTJ A;  2JZ2 A;  2JS0 A;  3OS0 A;  3VYH B;  2AT1 B;  2YUQ A;  2JW4 A;  3V7C A;  4HCC A;  3RMS A;  4LUD A;  5KH6 A;  1UJ0 A;  4DEY A;  4GLM A;  3SD4 A;  3A8H B;  3VU3 C;  1Z9Z A;  4M77 G;  4J9D A;  5LJ5 h;  1KG1 A;  2DF6 A;  2CP2 A;  3JCM g;  3QJ6 A;  2O4X A;  5IHI A;  3CCE A;  1X43 A;  1OZ3 A;  2RHY A;  3I55 Q;  3FC3 A;  3HFO A;  4KRT A;  3OBW A;  2P0Q A;  3CCM Q;  2CH4 A;  2HL3 A;  1FMK A;  1H8K A;  3CCR Q;  1JRI A;  3P8H A;  2K5L A;  4OB0 B;  3M58 A;  4NL2 A;  1PKT A;  5FWB A;  2E70 A;  1GFC A;  2KT1 A;  5GMK j;  1WHG A;  4M7D C;  3WVE B;  4JLG A;  1VQ9 Q;  1SEM A;  4AG2 C;  2HDA A;  1PRM C;  3A8L B;  4PLL A;  3H8Z A;  2CP6 A;  2L3S A;  1H3Z A;  4OB1 B;  2VYT A;  4A63 B;  2VXE A;  1IZ6 A;  1MMA A;  1TUG B;  2K57 A;  4IIM A;  1M8M A;  5CKF A;  3L1A A;  3ZEH A;  2D0N A;  1RAH B;  4BI3 A;  1VQN A;  2QG9 B;  3OS2 A;  4P5N A;  4J9I A;  4JJC A;  2NUP B;  2RJE A;  2WSF E;  3EAE A;  3JCM c;  1VQM Q;  1YJN Q;  3CCS T;  1X6G A;  4IUV A;  2RI2 A;  2XK0 A;  5CO7 A;  2O88 A;  4JJD A;  5GMK m;  1I4K 1;  2CS7 A;  3JB9 I;  2MOX A;  2LQK A;  4ZN1 A;  4FM4 B;  4AFS C;  3LH5 A;  2DYI A;  4DBQ A;  1SSH A;  2GGR A;  4PJN A;  4FSX A;  4PLI A;  3C12 A;  4LE9 A;  3PVL A;  1FMW A;  3JB9 J;  4PJO F;  4PJO E;  1TTH B;  2KVQ G;  1I1J A;  2ZGW A;  2L3P A;  5I11 A;  2IPO B;  4NS5 A;  1G5V A;  4BAC A;  4BI8 B;  4F17 A;  1WQ7 A;  3RIR A;  4IKF A;  2ABL A;  5CKB A;  5GMK i;  4HXJ A;  3CCJ Q;  1N9R A;  4BY6 B;  1GBQ A;  2DKG A;  1ZSG A;  4X9D A;  2FRW A;  4FL6 A;  2RQR A;  2R5A A;  1AWW A;  3LX7 A;  2QDY B;  1SHF A;  2QAS A;  2OTL A;  1K73 R;  1AOJ A;  4JS4 A;  4E7Z A;  3G71 T;  4C0D C;  4EPC A;  2RHI A;  4MDW A;  2PUK B;  3VRZ A;  1VQ8 Q;  2QDL A;  4XQ3 A;  2QEX Q;  2DBM A;  4M77 D;  4KGZ B;  1ZBJ A;  4KUD K;  2VB6 A;  3QWY A;  3OYK A;  2MYS A;  1LVK A;  1YHQ Q;  1D3B A;  1WJR A;  2DER A;  1HXD A;  4M7D F;  4M7D E;  1BK2 A;  1TS9 A;  6AT1 B;  4YTL A;  1Q86 U;  4C5E A;  3QO3 A;  3C94 A;  4AG1 C;  1W2B A;  3ME9 A;  1AVZ C;  1WHJ A;  3AT1 B;  4HVW A;  1VQP Q;  5KYU B;  1GBR A;  2CP3 A;  2ZPF B;  2M0Y A;  3EFR A;  2HBP A;  5LJ3 j;  1RAC B;  1KD1 R;  3I56 Q;  3DLM A;  4KH1 B;  1X6B A;  4WTO B;  1PSE A;  1GCP A;  1ZX6 A;  2C0I A;  2FEI A;  4KUL A;  3URG A;  3LWH A;  2DEU A;  2JUF A;  1GL5 A;  3CC4 T;  4MDX A;  4RCC A;  4E2F B;  2P0K A;  1N6A A;  4XTU A;  1EFN A;  2FZK B;  5A2Q E;  1WHH A;  5DLO A;  2KAF A;  4E7I A;  1PC0 A;  2KXD A;  4RCB A;  2CGH A;  2ECZ A;  3NMZ C;  4FYW B;  2FPF A;  3S6W A;  5IH2 A;  4M4Z A;  4RKU E;  3PGG A;  4RTU A;  4M78 A;  1K9M R;  3JCM X;  3QKJ A;  4C8Q B;  2EKO A;  4CI0 C;  4F7U A;  3CCU A;  2KT8 A;  4CC7 A;  2X4Y A;  2CT3 A;  2M0O A;  2EW3 A;  3JRZ A;  2HKN A;  3VRY A;  3EH2 A;  3QPH A;  1AWJ A;  2CZ0 B;  4EMK B;  2X35 A;  3E9F A;  3M9Q A;  4BE0 A;  1X2K A;  4PJO B;  3RMQ A;  4X34 A;  3CME A;  1JJ2 P;  3FJ5 A;  3DB4 A;  1V29 B;  2YRC A;  1K73 C;  4RMO A;  2RK1 A;  4R56 A;  2K79 A;  3OA6 A;  1M90 U;  2DXC A;  1H3H A;  2JS2 A;  3CCQ A;  1YCS B;  1OX9 A;  4RG8 A;  2X9H A;  4PJO G;  4M75 A;  4OGC A;  4M77 C;  2VVK A;  2DL3 A;  4ESR A;  3G6E Q;  1KHC A;  2L3Q A;  3LWI A;  2FYK A;  2AZS A;  1G2B A;  2E12 A;  1LOJ A;  1SG5 A;  3ZL7 C;  4BI4 A;  2HQH A;  2QQB A;  4M7D B;  2OTJ Q;  2JM8 A;  4E6R A;  3CC2 A;  3CC7 T;  2XHC A;  1X27 A;  1QCF A;  2RJC A;  1R8O B;  4K11 A;  3GNF B;  3NFC A;  3FIF A;  1KQ1 A;  4KBM B;  2FHD A;  4OB2 B;  4XAX B;  3CCM T;  4HVV A;  3NPF A;  5GMK e;  4LDW A;  2HEQ A;  3G4S A;  3GLX A;  1UEB A;  4PJL A;  1KQ2 A;  4M7D G;  3BDL A;  1PCX A;  3CXC A;  2HZY A;  1VQO A;  2NLU A;  2L0A A;  3M0R A;  1MGQ A;  3OYC A;  1EIF A;  3PTA A;  3BDU A;  4Y92 A;  4FYX B;  5GAM h;  1WZO A;  5M9O A;  3OYY A;  3RES A;  1PHT A;  3OB9 A;  3J7A F;  3H0F A;  1GXI E;  1BYM A;  1K9M C;  2BZ8 A;  3CPW P;  1UGQ B;  3JB9 F;  1NE8 A;  4B9X A;  2F2W A;  3IQL A;  2CSQ A;  2DPP B;  2DRM A;  2CH4 W;  3MEV A;  1EX4 A;  3OS1 A;  2X4W A;  2RHU A;  2EJG A;  4QQG A;  5LJ5 d;  2EQJ A;  4L5G A;  3JB9 H;  1YJN T;  1B3Q A;  1NM7 A;  1YI2 A;  1W2B S;  1I5O B;  1KHI A;  2J7I A;  4A53 A;  2JTF A;  5GAO l;  3VS7 A;  1C0M A;  1M2O A;  4JRQ A;  1RAA B;  2AK5 A;  1UG1 A;  2E3H A;  2JT4 A;  3DKM A;  4AFQ C;  1GFD A;  3E1S A;  2BE7 D;  4C8Q D;  4RTT A;  4JLI A;  4C5G A;  4C0F A;  1B7T A;  3VS2 A;  5IN1 A;  2EQM A;  4BDY A;  3NTH A;  4C0D B;  2CKK A;  1MNE A;  3UA7 A;  1UGR B;  2D1X A;  4M77 E;  2LQW A;  3LW5 E;  1KQS P;  3HTR A;  3I35 A;  2CUB A;  3CCE Q;  1LJO A;  3CCJ T;  2ZPI B;  2COY A;  1QVG P;  4Z02 A;  3J81 E;  1Q82 R;  4BY6 C;  1NEB A;  2NUP A;  3EHR A;  5I2M A;  2F5T X;  1E6G A;  1SKU B;  3UWN A;  3EFO B;  2DTI A;  5LL6 S;  1ZQ1 A;  3OYE A;  1XNI A;  4XU3 A;  1UDL A;  2P84 A;  4O6J A;  2QEX T;  1UUE A;  3MP8 A;  3OYF A;  2DXT A;  2GFA A;  5A0L A;  1YHQ T;  2M1H A;  1UGV A;  1S72 A;  1Q81 C;  5J3B A;  1VQ4 A;  1TU0 B;  2K5I A;  2BKD N;  3L2U A;  2LVM A;  1K8A U;  3TRE A;  3PFS A;  1Q7Y R;  1T3L A;  2CUD A;  2CYZ B;  1VQP T;  3WVD B;  5LJ3 e;  2EYW A;  1VQN Q;  1YBY A;  4RG2 A;  2R57 A;  5KYW B;  4QQ6 A;  5FRM A;  3HP9 A;  2EYZ A;  1ZLM A;  2E65 A;  2JVV A;  1WXU A;  2GTO A;  1U1S A;  3I56 T;  2KXC A;  2PNI A;  2LZ6 B;  4XU0 A;  1U3O A;  2O01 E;  3H41 A;  1OPL A;  4OGE A;  2V1Q A;  2YWW A;  2J06 A;  4KGX B;  2RNA A;  2W10 A;  3VYG A;  1VA7 A;  3CBO A;  4FYY B;  1QVF S;  4RTY A;  1BCM A;  4OMM A;  2KE9 A;  3GPL A;  2X3X D;  5FU7 C;  3PIP A;  2K2M A;  5LJ3 f;  2VGM A;  3UT1 A;  5GJW B;  2FL7 A;  5KYU A;  3UA6 A;  1T0J A;  4C8Q C;  3JB9 G;  2D6F A;  2AZV A;  2PTK A;  3L42 A;  2OTL Q;  3A8O B;  3CCS A;  2QK0 A;  5FRO A;  4C92 D;  1YP5 A;  1VQL Q;  4FU6 A;  1VQ5 Q;  1MUZ A;  4EMK C;  1Q82 C;  7AT1 B;  3MET A;  3EHQ A;  1G3W A;  3QYH B;  3JCM W;  2A37 A;  1M27 C;  1X01 A;  2LJ3 A;  4JRI A;  3OYG A;  1M1G A;  2V8J A;  1I81 A;  4PK4 A;  2RO0 A;  2RJD A;  2SEM A;  5J26 A;  1UJY A;  5CAI A;  3CC7 Q;  4PFP A;  2FVU A;  5GAN h;  2KK4 A;  2RQW A;  3HRT A;  1YJW T;  2CDT A;  2RPN A;  3HKS A;  4XTY A;  4EMG A;  3G6E T;  1RLQ C;  3OYN A;  2WAC A;  1BIB A;  3L2R A;  3VS1 A;  3EGD B;  2MPX C;  1Q7Y C;  2XDB A;  1IGU A;  4E7J A;  2JMC A;  1BIA A;  2DXU A;  4EMK A;  3RKX A;  3SB2 A;  3X24 B;  5L23 A;  2VUB A;  3QII A;  2OTJ T;  3M4G A;  2MIO A;  4PJO A;  4XU2 A;  3QBY A;  4J83 A;  2RM4 A;  1J3T A;  2K3Y A;  2YRV A;  3ER0 A;  3L2Z A;  2DVJ A;  1M4Z A;  1X69 A;  2XDP A;  2VWF A;  3QG1 A;  3PMT A;  4PJJ A;  1Y96 B;  3CBM A;  3MP1 A;  2DZ9 A;  3PMI A;  1WLP B;  1IHW A;  4KH0 B;  3GP8 A;  4J6Y A;  1OQK A;  2X51 A;  4LUE A;  5IHK A;  3GIB A;  1N5Z A;  3GNG A;  2LRQ A;  3QZ9 B;  2EIF A;  3OQ5 A;  1RI9 A;  1WHK A;  2EKH A;  1CKB A;  2LC4 A;  4QVZ A;  3QSU A;  4ORZ A;  2NUZ A;  1YCY A;  2E1H A;  4C8Q E;  1W1F A;  4C8Q F;  4C0G A;  2CP7 A;  2K6D A;  4FT2 A;  2EYY A;  2PQW A;  4J9G A;  3CCL A;  3TSZ A;  2F5K A;  4M7D A;  3CME Q;  4KGV B;  2MF2 A;  1PD1 A;  4ZTF A;  2DL7 A;  2KBT A;  1RAE B;  2LTO A;  2DJZ A;  2CP0 A;  2LNH B;  2LDM A;  1T0H A;  2E5K A;  3UF4 A;  3NTI A;  3JB9 D;  5CKH A;  3E19 A;  1VQ6 Q;  1JBM A;  4DOW A;  4JZ3 A;  5C6S A;  1YJ9 A;  2P0P A;  3FB9 A;  3OBY A;  5HKC A; 
#chains in the Genus database with same CATH homology
 5GMK h;  3CCQ T;  1QP3 A;  2K2V A;  4ATO A;  2L8D A;  3V8J A;  4M75 G;  2ZPH B;  3CXC S;  4PJO B;  3H6Z A;  3RMQ A;  4X34 A;  3QXE B;  5FLX E;  2DK3 A;  3X25 B;  3CME A;  1JJ2 S;  1IRE B;  2X4J A;  3DB4 A;  3SDZ A;  1V29 B;  3QHS A;  4LDU A;  3HRU A;  3X28 B;  1K8A C;  3VKI A;  1ZHI A;  3MO8 A;  1K73 C;  4RMO A;  2HQE A;  2VC8 A;  4OMF B;  3R6O A;  5CKE A;  4TVR A;  2DIG A;  2RK1 A;  4R56 A;  3SFM A;  2ZPB B;  4M77 F;  3WXM B;  2VGN A;  2KDS A;  4IUT A;  3OA6 A;  1Q86 U;  2RK2 A;  1M90 U;  2DXC A;  4L6V 5;  5D6W A;  5LJ5 f;  2VV5 A;  3KBG A;  5A0G A;  3Q1J A;  5GAN f;  5GAM d;  3CCQ A;  4QVD A;  1HK9 A;  4FIB A;  4RG8 A;  4PJO G;  4PJO D;  3CCE T;  3OYI A;  4QW2 A;  2RB6 A;  3CC2 T;  4M75 A;  3JCM h;  2XKO C;  2LNV A;  4LDX A;  4OGC A;  4M77 C;  4CRI A;  1VQK A;  4C8Q A;  2VXF A;  1KHC A;  3MP6 A;  2K5F A;  3OYD A;  3LWI A;  1MHN A;  2EAY A;  1NPR A;  2FYK A;  4IUP A;  5GAO p;  3INZ A;  4J6X A;  2E12 A;  3A8M B;  1O9S A;  3G7Z A;  1S72 T;  4EMH A;  4ZGE B;  3MEW A;  4N4H A;  4XK8 E;  5CKD A;  4HT8 A;  5HK0 A;  3G71 A;  1LOJ A;  2RI5 A;  4BI4 A;  1VQ4 T;  2QQB A;  5IAY A;  2QQS A;  1M8V A;  3HSB A;  4M7D B;  2G3R A;  3V8L A;  5IT9 E;  1QW1 A;  1VQ8 T;  1UGP B;  1B34 B;  3M54 A;  4ME7 A;  1I8F A;  3CC2 A;  1FWZ A;  2I2L A;  2PUO B;  3CBP A;  4F7U B;  2XHC A;  5A0D A;  3TU4 K;  2EJ9 A;  4PNO A;  5GAN g;  3C95 A;  2RHZ A;  1R8O B;  2RJC A;  3OW2 S;  2OAU A;  2ZZD A;  4HCZ A;  3GNF B;  3NFC A;  5GAN 3;  4HT9 A;  2DXB A;  3LGL A;  1YJW A;  3FIF A;  1KQ1 A;  3PT9 A;  4X9C A;  4KBM B;  3G6E A;  3V8K A;  4DQ2 A;  4E47 A;  1WGS A;  2FHD A;  2JNG A;  2KY9 A;  4J8O A;  4OB2 B;  4XAX B;  3CCM T;  4M7A E;  4M7A F;  1X6O A;  1UB4 A;  5GMK e;  1N8R U;  4LDW A;  3M57 A;  5FU6 B;  3MEU A;  3N5B B;  1Q82 U;  1NJI U;  3V7R A;  3GLX A;  3G4S A;  3RKY A;  3JCM b;  3JCM Q;  1UEB A;  2EFI A;  2QI2 A;  3JCM J;  2Y90 A;  5LJ3 d;  3JCM V;  1KQ2 A;  3L2V A;  4M7D G;  4XTW A;  4M7D D;  3BDL A;  4V2S A;  4M7A B;  3CXC A;  4M78 D;  4MZT A;  1VQO A;  5GAO r;  2NLU A;  3M56 A;  5AYF A;  3JAM E;  1MGQ A;  2YLB A;  1JJ2 A;  4F7U G;  2LCC A;  5C0M A;  1EIF A;  5L8R E;  2EQK A;  4C0Z A;  3OYC A;  3PTA A;  3L2W A;  1VQN T;  3BDU A;  5CIU A;  1U8R A;  5CVI A;  3MHX A;  4QQD A;  1DJ7 B;  3I55 A;  2M16 A;  1X75 C;  5GAM h;  5FRN A;  1OYX A;  5M9O A;  3OYY A;  4C5I A;  1Y7X A;  3RES A;  4Q5W A;  3UDC A;  1BI3 A;  2MI6 A;  3OB9 A;  4EDU A;  1YI2 T;  3J7A F;  1VIE A;  1GXI E;  3CCR A;  1BYM A;  5FU7 B;  2BUD A;  1K9M C;  3E9G A;  3OSS C;  3CPW S;  2L3R A;  1UGQ B;  4QVC A;  3JB9 F;  3JCM e;  2QQA A;  1NE8 A;  1M90 C;  2KQW A;  4B9X A;  3T9N A;  1G3S A;  4O5V A;  4A4H A;  3CD6 T;  2DPP B;  5GAN 7;  2DD4 A;  1BI0 A;  2XD0 A;  2WSC E;  3MEV A;  3M55 A;  3QYG B;  4PKC C;  4E7K A;  1YIJ A;  3OS1 A;  3HL8 A;  2YHT A;  1VQ9 A;  2X4W A;  5LJ5 j;  3CC4 A;  2K4Y A;  2RH2 A;  2E41 A;  2R5M A;  4C92 F;  4C92 E;  1WQW A;  2DO3 A;  3M53 A;  2RHU A;  5GAN j;  1G3Y A;  2EJG A;  4QQG A;  1Q7Y U;  1Q81 U;  2ZPE B;  5LJ5 d;  2EQJ A;  3O8V A;  4L5G A;  3ZBD A;  2EJF A;  4IUR A;  3JB9 H;  4XTV A;  3LLR A;  1YJN T;  1YIT T;  4JRP A;  1YI2 A;  2EYQ A;  4Y28 E;  1W2B S;  1KC8 C;  1FXX A;  3MEA A;  3ASK A;  1KHI A;  2QA4 T;  1UGS B;  4JUV A;  4A53 A;  4MML A;  1W4S A;  4OF1 A;  1Q86 C;  2QTX A;  4C92 C;  2JTF A;  2PU9 B;  4D6W A;  5GAO l;  4M75 D;  4JRQ A;  5J39 A;  4LDY A;  4M7A A;  2K3X A;  4ELZ C;  3DKM A;  4C8Q G;  3E1S A;  4C8Q D;  2IVW A;  4BE0 A;  4JLI A;  3OW2 A;  5CK9 A;  4C5G A;  1XTD A;  2HQX A;  3V7S A;  4BD3 A;  4C0F A;  5KE2 A;  5KCO A;  1O75 A;  5IN1 A;  5LJ3 h;  5DM7 R;  3DB3 A;  3QZ5 B;  2AHJ B;  2EQM A;  4HA8 A;  4BDY A;  3NTH A;  4C0D B;  2CKK A;  4ZN3 A;  4NL3 A;  2QQR A;  1VQM A;  1H64 1;  1UGR B;  2HAX A;  3F70 A;  4M77 E;  3TEE A;  2OTL T;  4MZP A;  3LH0 A;  3TCJ A;  3LW5 E;  2V8I A;  3JCM f;  4OVA A;  3BY7 A;  1VQL T;  1Y07 A;  1KQS S;  1VQ5 T;  1ZBX A;  4N0A C;  1NJI C;  4M77 B;  2RD1 A;  4E7L A;  2E10 A;  4ZGD B;  1LJO A;  4JDS A;  4N4I A;  2JTM A;  4PJO C;  3CCJ T;  5GAM e;  2ZPI B;  2C06 A;  3ZFJ A;  1QVG S;  4Z02 A;  3J81 E;  4HKE A;  5LJ3 g;  3CMA T;  2EQU A;  3MCA B;  3FDR A;  5GAN 4;  3NTK A;  4BY6 C;  2JOY A;  3KUF A;  4ZTJ A;  2JZ2 A;  3OS0 A;  4A54 A;  3VYH B;  4HCC A;  3V7C A;  3RMS A;  2FB7 A;  5I2M A;  5KH6 A;  1XQH A;  5GAO m;  2F5T X;  3UWN A;  3KXT A;  3CPW A;  2DTI A;  5LL6 S;  1ZQ1 A;  1P92 A;  2LCL A;  1XNI A;  4J5Y A;  4C92 A;  3SWN C;  3OYE A;  2H3J A;  3OMC A;  1VQL A;  1VQ5 A;  1VIF A;  3SD4 A;  2D0Q B;  2E5Q A;  1WJQ A;  3A8H B;  4XU3 A;  3VU3 C;  4M77 G;  5LJ5 h;  1KG1 A;  2HD0 A;  2GQV A;  3PNW C;  4O6J A;  3HPW A;  3PIO A;  2QEX T;  3JCM g;  3QJ6 A;  2O4X A;  3CCE A;  1OZ3 A;  2DD5 A;  3MP8 A;  3OYF A;  2HNI A;  2RHY A;  2DXT A;  3FC3 A;  2GFA A;  5A0L A;  3HFO A;  1YHQ T;  3OBW A;  4M78 F;  2P0Q A;  3OSV A;  2L89 A;  2PVG B;  2R58 A;  4LDV A;  3VJP A;  2M1H A;  2DTO A;  1M1K C;  1S72 A;  2MWP A;  1M9S A;  1JRI A;  3P8H A;  1WJS A;  2K5L A;  1Q81 C;  5J3B A;  4OB0 B;  3M58 A;  4NL2 A;  1VQ4 A;  2K5I A;  5DY9 A;  2BKD N;  4N0A A;  3X20 B;  2QXF A;  3L2U A;  4DA4 A;  2E70 A;  2A7Y A;  2LVM A;  1K8A U;  3TRE A;  1BKB A;  1G3T A;  1K73 U;  5GMK j;  1VQ8 A;  5GAM f;  1SSF A;  3PFS A;  4M7D C;  2KMT A;  3QDR B;  3WVE B;  4M78 C;  4JLG A;  2E6Z A;  4JJN K;  2CYZ B;  4M77 A;  3VUB A;  3WVD B;  5GMK l;  5LJ3 e;  1YBY A;  3CC7 A;  1VQP T;  3LGF A;  4RG2 A;  2R57 A;  5FRM A;  4QQ6 A;  3A8L B;  3HP9 A;  1TH7 A;  2X4X A;  2E65 A;  2JVV A;  5GAN 8;  2XDD A;  4PLL A;  4Y91 A;  4LD6 A;  3H8Z A;  4A4F A;  5D6X A;  3CCM A;  2GCX A;  1U1S A;  4KT0 E;  3I56 T;  3OY9 A;  1H3Z A;  5HK3 A;  4OB1 B;  4HCB A;  3SWN A;  3P8D A;  2VYT A;  5GAN 5;  2VXE A;  2M9U A;  2Y4X A;  4XU0 A;  3CCL T;  4BE1 A;  1KQS A;  1IZ6 A;  4BUG A;  2O01 E;  2K57 A;  4GLK A;  2CZ7 B;  4M7A G;  1N27 A;  4OGE A;  5CKF A;  3L1A A;  3ZEH A;  4ZGJ B;  4M7A D;  3FLG A;  1VQP A;  4BI3 A;  4NOY A;  1I5L A;  5GAO n;  1QVG A;  3CCU T;  1VQN A;  3QJY A;  1NZ9 A;  2MMP A;  3OS2 A;  3VYG A;  4P5N A;  5GAM g;  3GF5 A;  4IUQ A;  1AHJ B;  4OB3 B;  3VUZ A;  2RJE A;  2WSF E;  3EAE A;  3JCM c;  2F69 A;  3CBO A;  3QUI A;  1JB0 E;  3CCS T;  1QVF S;  2XID A;  4KUI A;  4IUV A;  4XTZ A;  1YJ9 T;  2RI2 A;  3I56 A;  5GAN d;  2XK0 A;  5CO7 A;  5DLQ E;  3VV0 A;  4C92 B;  5GAN 2;  2ZPG B;  5LJ5 e;  3GPL A;  5GMK m;  2E64 A;  1I4K 1;  3CEY A;  2CS7 A;  5FU7 C;  1M5Q 1;  1KD1 U;  3PIP A;  3JB9 I;  2CZ6 B;  2O4X B;  5LJ3 f;  2DZC A;  2LQK A;  2VGM A;  3UT1 A;  3X26 B;  3S3N A;  4ZN1 A;  4FM4 B;  3CME T;  3CD6 A;  3HHT B;  2MAM A;  2FL7 A;  3CMA A;  4M75 C;  2YLC A;  4FT4 A;  4FSX A;  4PLI A;  3C12 A;  1Y71 A;  4UC4 A;  2PVO B;  4A4G A;  4C8Q C;  3JB9 G;  4BE2 A;  2D6F A;  3L42 A;  4N4G A;  4R55 A;  5CQX A;  2GFU A;  2RA2 A;  3JB9 J;  4PJO F;  4PJO E;  3A8O B;  4MZM A;  1QP2 A;  3OS5 A;  3CCS A;  4J7F A;  1VQ6 T;  2KVQ G;  3OYJ A;  1YIT A;  2XG8 D;  2ZGW A;  1YJN A;  3OMG A;  5GAN 6;  1Y96 A;  4WF2 A;  4C92 G;  4NS5 A;  5FRO A;  2BIV A;  4C92 D;  2QA4 A;  1G5V A;  4FU6 A;  3FEO A;  4BAC A;  4BI8 B;  1OI1 A;  2RHX A;  1WQ7 A;  3RIR A;  2DAQ A;  3OYL A;  2GF7 A;  2D9T A;  3L2Q A;  4IKF A;  1N8R C;  4EMK C;  3HRS A;  5CKB A;  1Q82 C;  5GMK i;  3DLL A;  1N9R A;  1QVP A;  4BY6 B;  3OYH A;  1NPP A;  4A4E A;  1VQK T;  3RKW A;  2DKG A;  3M5A A;  5EG2 A;  3MET A;  4X9D A;  1G3W A;  4FL6 A;  3UPU A;  2DEQ A;  3QYH B;  3JCM W;  1K9M U;  2R5A A;  1X01 A;  3LX7 A;  2QDY B;  5GAM j;  5GAO q;  2OTL A;  2PVD B;  3HFN A;  4JS4 A;  3SWN B;  1VQ6 A;  4JRI A;  3OYG A;  3G71 T;  4C0D C;  4EPC A;  1M1G A;  2RHI A;  2V8J A;  4MDW A;  1M1F A;  1BI1 A;  3JCM P;  2PUK B;  1I81 A;  2LX9 A;  3S3M A;  2DTH A;  2RO0 A;  2RJD A;  4C5H A;  4XQ3 A;  1VUB A;  3LYI A;  4M77 D;  5J26 A;  5CAI A;  4KUD K;  2FVU A;  3EFS A;  5GAN h;  5CQY A;  2KK4 A;  2LQ8 A;  3OYK A;  1N9S A;  4DOV A;  3CCJ A;  1KC8 U;  1D3B A;  1WJR A;  3HRT A;  1YJW T;  1HXD A;  3HKS A;  4XTY A;  4EMG A;  4M7D F;  3G6E T;  4M7D E;  3A8G B;  1VQ7 T;  2WSE E;  4M78 E;  1RL2 A;  4YTL A;  5I21 A;  2EWN A;  4C5E A;  3QO3 A;  3C94 A;  4IUU A;  2WAC A;  3OYN A;  1QVF A;  1BIB A;  3L2R A;  3G4S T;  4F7U F;  4F7U E;  1W2B A;  3C4S A;  3ME9 A;  2KSS A;  1Q7Y C;  2XDB A;  4E7J A;  4BB7 A;  1XOV A;  3CC7 T;  4BDZ A;  1BIA A;  4M78 B;  3AHU A;  2DXU A;  4EMK A;  3RKX A;  3SB2 A;  3X24 B;  5CCA A;  1WNL A;  1VQO T;  2VUB A;  3QII A;  5LJ5 g;  2OTJ T;  2IG0 A;  3M4G A;  1BI2 A;  4PJO A;  4XU2 A;  5CR2 A;  2QEX A;  3FRN A;  3QBY A;  4J83 A;  1KD1 C;  2RM4 A;  3A5Z B;  4II1 A;  5HY6 A;  1WPY A;  1FX7 A;  2K3Y A;  2YRV A;  2ZPF B;  3EFR A;  3ER0 A;  3L2Z A;  5D6Y A;  2HBP A;  3I55 T;  4JS5 A;  1M4Z A;  2B8A A;  2QQ9 A;  2XDP A;  4A4K A;  5I2S A;  3QG1 A;  1YHQ A;  1VQ7 A;  3PMT A;  5LJ3 j;  3CCV T;  3FJP A;  2ZCF B;  3DLM A;  1Y96 B;  3CBM A;  3CCR T;  2JN0 A;  4L59 A;  1PSF A;  3MP1 A;  2DVE A;  4GY5 A;  4PL6 A;  2DZ9 A;  2Y4Y A;  3PMI A;  2XIC A;  3RUX A;  1PSE A;  4M78 G;  5FU6 C;  2V8K A;  3GP8 A;  4J6Y A;  1LNX A;  3CPF A;  4KUL A;  3URG A;  3LWH A;  2CZ1 B;  2OTJ A;  2JUF A;  3OYA A;  3GOX A;  3JSC A;  4J7I A;  4XU1 A;  3CC4 T;  1YIJ T;  3GIB A;  2E6N A;  1VQ9 T;  2DIQ A;  3GNG A;  2LRQ A;  4M7A C;  3QZ9 B;  2EIF A;  4OP0 A;  3BFM A;  4MDX A;  4RCC A;  3OQ5 A;  2MWO A;  3J80 E;  2P0K A;  3BW1 A;  1N6A A;  4XTU A;  2LC4 A;  3M4Y A;  4QVZ A;  3QSU A;  5KE3 A;  1YCY A;  4MMK A;  5A2Q E;  4M75 E;  4M75 F;  3JCM d;  3CCV A;  2E1H A;  5DLO A;  2KAF A;  1U1T A;  2L5Q A;  2RJF A;  4E7I A;  4RCB A;  4C8Q E;  4C8Q F;  2CGH A;  4C0G A;  4FT2 A;  2XU8 A;  3S6W A;  2PQW A;  3RER A;  3CCL A;  3S3O A;  4M75 B;  2F5K A;  4VUB A;  4M7D A;  4RKU E;  5GAN e;  3PGG A;  4M78 A;  2MF2 A;  3JCM X;  3QKJ A;  4ZTF A;  4C8Q B;  1B34 A;  2EKO A;  2LTO A;  2DJZ A;  1D3B B;  1M1K U;  4CI0 C;  2LDM A;  3OYB A;  4F7U A;  3CCU A;  4ELY C;  4J6W A;  2X4Y A;  3NTI A;  2M0O A;  1VQM T;  3OYM A;  3JB9 D;  5KCH A;  5CKH A;  3M59 A;  1OZ2 A;  4B9W A;  1RI0 A;  2RI3 A;  2XI9 A;  3E19 A;  4LD9 K;  1JBM A;  3JRZ A;  4DOW A;  2LT1 A;  2LT4 A;  2P4T A;  3P8B B;  5C6S A;  3QPH A;  4E7H A;  1YJ9 A;  2P0P A;  3FB9 A;  2CZ0 B;  3OBY A;  2A3L A;  2X35 A;  4XTX A;  4EMK B;  5HKC A;  4JRK A;  3E9F A;  3M9Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...