4PJOC

Minimal u1 snrnp
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
86
structure length
86
Chain Sequence
b'GSGSVKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small nuclear ribonucleoprotein Sm D3
publication title Crystal structure of human U1 snRNP, a small nuclear ribonucleoprotein particle, reveals the mechanism of 5' splice site recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Splicing
total genus 14
structure length 86
sequence length 86
chains with identical sequence Q, c, q
ec nomenclature
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4pjoC00
4XU0A 5GAOp 4OP0A 4M78A 4V2SA 1B34B 3FIFA 4C8QE 3PGGA 4PJOF 5LJ5e 3EFSA 5GANd 2DVEA 5GAN5 4M7DA 2DJZA 4XTUA 3V8KA 2E1HA 4M78F 3JCMJ 3JB9H 2DXUA 1D3BB 5GAOn 4RCBA 4M7AG 2E10A 3RESA 5GMKj 2E65A 2FB7A 2DXTA 3V7RA 5GAOq 3JCMP 4XU2A 4M77B 5GAOm 4M7AC 4JRKA 2EJ9A 3JCMW 1WPYA 3JCMc 2QTXA 4F7UG 1WQWA 4XU3A 4EMKC 2CGHA 3HFNA 3RKYA 4N0AA 4EMGA 4MMLA 1H641 4M75D 5DY9A 3JCMf 5LJ5g 3RERA 1BIBA 2DEQA 4M75B 2YHTA 3HSBA 4WF2A 3RKWA 3VU3C 5GMKl 3JB9D 4HA8A 4XTZA 4PNOA 4C8QG 2DTIA 1JRIA 5LJ3h 4M75E 2EWNA 1LJOA 2VC8A 3RUXA 1Y96A 3INZA 2E64A 5GMKe 5LJ3e 3JCMd 4RCCA 5GAMj 4C8QC 3JB9I 3EFRA 4C92D 3QHSA 3SWNC 4C92B 4Y91A 5GAMf 5GANh 4JUVA 3JCMe 5GANe 4M7AA 4XTXA 4PJOD 4M77D 3JCMb 4PJOB 2K57A 4X9CA 1N9RA 1BIAA 1HXDA 4JLIA 4EMKA 1M5Q1 4M7AF 2I2LA 4M78B 2Y90A 2YLBA 4C92E 4F7UA 5LJ5h 3QSUA 2ZGWA 3V7CA 4M7DD 2EJGA 5LJ3g 4M7DB 5GAMd 2VXEA 4M77G 4F7UF 4PJOE 2DTOA 4M77E 1LOJA 5GAN6 5GAN7 3AHUA 4HT9A 5GMKi 2E41A 1HK9A 4M77C 3HFOA 2RA2A 4J6XA 1WNLA 2DTHA 4J6WA 1LNXA 3JCMg 5GAMe 5GANg 2VXFA 4M75G 4M7DE 5GMKh 4C8QA 3SB2A 2RM4A 4M75C 3SWNA 3BDUA 3JB9J 4C8QF 4X9DA 3JB9G 4JRIA 1N9SA 1U1TA 1I4K1 3JCMh 1JBMA 3L1AA 3JCMX 1M8VA 1B34A 3L2ZA 3QUIA 4QVCA 3JB9F 2DZ9A 3GIBA 5GAMg 2YLCA 4M78D 4C92G 1X01A 1I8FA 2DZCA 1D3BA 1Y96B 1KQ2A 3BW1A 4C92C 5GAOr 4PJOG 3JCMQ 3QO3A 5LJ5d 5GAN8 2RB6A 5CAIA 4PJOA 4M77A 4EMHA 1YCYA 2RD1A 4J5YA 3RKXA 2HNIA 3M4GA 4M78G 5GAOl 4XQ3A 5GAMh 4M7AD 4M7AB 4PJOC 4XTYA 4M78E 4M77F 4M7DG 4M78C 4EMKB 4XTWA 1I5LA 3BFMA 2EAYA 4J6YA 1MGQA 4M75A 4QVDA 3V7SA 5I21A 4F7UB 3FJPA 4M7DC 5LJ5j 5LJ3j 4M7DF 3RIRA 3V8JA 4DQ2A 2DKGA 4M75F 5GAN2 4HT8A 2EJFA 1WQ7A 4M7AE 1TH7A 5LJ5f 2JN0A 1I81A 5LJ3f 3V8LA 4NOYA 5GAN4 5GMKm 2FYKA 5GANj 1KQ1A 4F7UE 5GAN3 1U1SA 4C8QD 4XTVA 4A54A 5GANf 4C8QB 4C92A 4N0AC 4A53A 4NL2A 4XU1A 3SWNB 3JCMV 3FB9A 5LJ3d 4C92F 4NL3A 3BY7A 4MMKA
chains in the Genus database with same CATH superfamily
1W70A 3M53A 3FIFA 1Y71A 1MMDA 2GTOA 2X9HA 4QW2A 4XTUA 5KYWB 4DA4A 1HD3A 2RH2A 1PSFA 2FB7A 3EHRA 3CEYA 3I56Q 4B9WA 1E6GA 1VYTA 1IREB 1WQWA 1NEGA 4J9IA 1EZZB 1H641 4M75B 4C5GA 2LT1A 2PVDB 3CQTA 4IUQA 3HPWA 1BK2A 5KYNA 4KH0B 4KGZB 1M2VA 1WHHA 1DJ7B 2LCCA 3I35A 2H3EB 2V1QA 3OW2S 4OGCA 4HVUA 4B9XA 2JNGA 3LLRA 1WA7A 3MPUB 4ELZC 2YXYA 3QPHA 3E9GA 1VQKQ 3VUZA 1ZBXA 2WSEE 3RMSA 3CC2T 2KDSA 1XNIA 1HK9A 2A7YA 3CCSA 4IKFA 5GAMe 1W1FA 1WNLA 3CMAQ 1TS9A 4C8QA 1VIEA 1AVZC 4M75C 3X20B 1G3SA 1UG1A 1WHKA 1I4K1 1QVGA 3OYNA 4E7LA 3META 3TEEA 4QVCA 3GIBA 2KVQG 1QLYA 4HCZA 1IHVA 1VQ8T 2CH4A 2DF6A 3GOXA 3CCVT 4NS5A 3RBBB 3FEOA 1VQ6Q 4BUGA 2LX7A 3MP8A 3QO3A 3CPWA 4M77A 2RD1A 2KAFA 2KRNA 3BFMA 4RG8A 2EAYA 3V7SA 2J7IA 5LJ5j 5KCOA 4MZTA 2MPXC 3WVDB 5GAN4 4M4ZA 3HP9A 1N5ZA 1U1SA 2LDMA 1YBYA 3CCMQ 4NL2A 1WLPB 5IH2A 2DL7A 1N8RR 3MJXA 4VUBA 2HQEA 2LX9A 4X1VA 3M56A 5GANd 3V8KA 1D1CA 1JXOA 3JRZA 1JEGA 4J9HA 5GAOm 2PVOB 2EJ9A 3HFNA 3MEVA 1AZGB 4TVRA 3OYAA 5DY9A 4JZ3A 2ABLA 4J9DA 3HSBA 4KBMB 1NBEB 2A36A 3OSVA 3M9QA 1KSWA 4KUIA 4ZTJA 1Q81C 5LJ5h 3REBB 2DXBA 2V8JA 3QIIA 5GAMf 4BE1A 2P0QA 2NWMA 1VQPQ 1ACMB 1WHMA 3OYKA 1T0HA 2YLBA 2CP2A 2KMTA 4CI0C 2VUBA 3OYGA 4HCCA 1TUGB 4RTVA 1QKWA 4OVAA 4MDWA 2KT1A 4BE0A 1I1JA 1B07A 2GF7A 3HHTB 2K7AA 2MIOA 1QVFP 1QCFA 2DL3A 3CC7T 2QA4Q 1SHGA 3CCQA 2R5AA 5CQXA 1AWWA 1UGSB 1WXBA 1UGQB 4EMHA 5GAOl 3FLGA 1XQHA 1BYMA 4XTYA 1YJWQ 1KQSP 3MEAA 3UA7A 4RTUA 1GRIA 4PKCC 1WJSA 3SFMA 1G83A 4LUDA 4HT8A 3SEMA 4M75F 4M7AE 2LQ8A 1I0CA 1RAIB 1WDXA 4NOYA 2MYSA 1ZLMA 2R5MA 1R0CB 4FU6A 1MMAA 1V29B 4PJOA 1FXXA 3C94A 4RTWA 4E6RA 2MWPA 3DLLA 4E7JA 4BDYA 1WX6A 2R57A 3V7RA 1UECA 2NUPB 1D09B 2L8DA 3A8MB 1UGRB 5CKBA 1OEBA 4MMLA 3RNJA 2VASA 3CC2A 1BIBA 2HMAA 4BE2A 1G3TA 5CK9A 2XHCA 1BBZA 2EYYA 4HA8A 2CP7A 3OYHA 4OMNA 3MHXA 2EQIA 2XI9A 3URGA 4JUVA 2PUKB 5A0DA 1VQ8A 4EMKA 4KGVB 3CCVA 2I2LA 4OMQA 1VQ4T 4F7UA 1WIEA 4JS5A 2WSCE 2GQIA 1IRXA 3J80E 3G71Q 1AWOA 4RMOA 2BE9B 5GMKi 2E41A 3F70A 3HFOA 2DA9A 4CC3A 4ZN3A 3CCLT 1N9SA 3QJYA 1CKAA 2C06A 3CD6T 3H0FA 2AKLA 1ZA2B 1OPLA 4GLMA 2DZCA 4OB3B 1IZ6A 1M8MA 1Y96B 2KT8A 3QZ9B 1Q82U 1QQJA 2HKNA 4M7AD 2CUBA 2CZ1B 5KYUB 2J6FA 1H8KA 2D8HA 2W10A 1YIJT 1I5LA 3NMZC 4EIKA 2V1RA 3I9QA 1T0JA 2GQVA 3L2UA 4A4EA 3CCEA 4BI4A 1QVFA 2CZ6B 1JJ2A 5GANf 4A54A 4A53A 4IUTA 1WXTA 3JCMV 1VQ9Q 1KQSA 2LJ1A 4V2SA 4C8QE 4HKEA 5LL6S 4P5NA 1XOVA 1K8AC 1M27C 1W6XA 3P8BB 4RCBA 5GMKj 1UUEA 4C0FA 1Q86U 2D0NA 2FZKB 4OMFB 3TQ7P 2KI7A 3CCUA 1VQ7Q 4A4GA 3VRZA 4ZGDB 2LP5A 1PKTA 1MV3A 3OYFA 2O9VA 1RUWA 3CC7A 3NTKA 2K2VA 3CC4T 4JRQA 1U3OA 4Q5WA 3EG9B 2IIMA 4PJNA 3DB3A 2KXDA 3DLMA 3NHNA 3G6ET 2CH4W 1N6AA 4HT9A 1QWEA 2ZPBB 3FDRA 1VQMQ 3CCRT 4J6WA 3PNWC 1VQNT 4M75G 3Q1JA 5GMKh 2H8HA 2M16A 1M1KU 4JLGA 3QZ5B 2CT3A 2RHZA 4N4GA 3JCMh 2O4XA 3JAME 1VQOT 1E6HA 1K4US 3A8HB 1RI9A 4LDVA 2QEXA 1K9MU 3THKA 3OMCA 2D9TA 3EGXB 2NYSA 3BW1A 4ZGJB 5CAIA 2H3JA 1MHNA 1QMCA 2KROA 2ZPHB 3M57A 2XIDA 3OS2A 1BB9A 1K76A 2RJEA 1ZUUA 2D1XA 5GAN2 2DXCA 2EJFA 3I5SA 4BY6B 2JN0A 4B6MA 1YP5A 2DVJA 1H92A 5GMKm 2CSQA 2FRWA 1KG1A 2ATCB 4C8QD 2DAQA 4XU1A 5DM7R 1KC8U 3VUBA 1TG0A 4DBRA 3FB9A 2Z0WA 5IAYA 2QG9B 2V26A 1GCQC 3PMIA 2HAXA 4M7DA 5HKCA 4C0DB 1K0SA 4AT1B 2ENMA 5IXFA 5D6YA 1VQ4A 3E19A 3EGUA 3QDRB 4FSXA 2OTLT 3EAEA 1ZUYA 4LDYA 4BD3A 4DBQA 3I55Q 2DEQA 2P0PA 2DX1A 4BY6C 5M9OA 1YI2Q 2MF2A 4LD6A 3CCLA 1B7TA 2VC8A 3EGDA 4C0ZA 5KE2A 2K9GA 1YN8A 2BZ8A 3CD6A 4IUVA 1UJYA 1ZSZA 3PVQA 3GLXA 2VGMA 3CXCS 1A0NB 4FYWB 5C6SA 2DL8A 1HXDA 3TSWA 2KSSA 4M78B 3CMET 3QSUA 2EBPA 3M0RA 2JOYA 5CIUA 3V7CA 2FG0A 1MMNA 4C0DC 6AT1B 4O6JA 2XU8A 4PJOE 3UT1A 5GANg 5KYYA 2VB6A 4QQ6A 2L3PA 4J9GA 3H0HA 2L3QA 1S72T 4OMLA 3SWNA 3PTAA 3E1SA 2OTJT 4PK4A 1T3SA 1PD1A 3OW2P 2XDPA 1D3BA 1H3HA 2HZYA 1UEBA 3M55A 3UA6A 4J5YA 4JJCA 1Q82R 1NJIU 4JJNK 4J9FA 3M54A 4M78E 1BKBA 4M78C 4JJDA 2QI2A 3I56T 4QVDA 3RMQA 1SG5A 2DK3A 1FX7A 3QBYA 1Q7YC 3QWYA 3V8LA 1OU9A 2AK5A 4F7UE 5GAN3 1ZHIA 4C92A 1M3AA 1VA7A 4A63B 1KJWA 2QQSA 5KYXA 4XU0A 5GAOp 4E7HA 3H41A 4E47A 1FWZA 2BE7D 3P8HA 2PNIA 2VVKA 5IN1A 1JO8A 2DBKA 3CC4A 3A98A 5FLXE 3JCMP 4XU2A 1Q86R 5FU6B 3G6EA 3CMAT 3IQLA 5D6XA 3CCRA 2ZPFB 4FYXB 4Z88A 2GGRA 2L2PA 1VQNA 1VOMA 2A0FB 1W2BS 2CS7A 2FPFA 1X75C 3KUFA 1IXDA 2PQWA 4ME7A 4ZN1A 2LNHB 2EIFA 2M0YA 5GAMj 1Z9ZA 1VQ5Q 2LNVA 2M0OA 4PJOD 2DNUA 4J9BA 1WHJA 8ATCB 2YSQA 3OS5A 1M90C 2JMCA 2K2MA 3AHUA 1G8XA 3EFOB 3SD4A 3C4SA 4AFSC 1M3BA 4KUDK 5FU6C 1QCNA 2QQ9A 3SB2A 2RF0A 2G3RA 3BDUA 1M1KR 3JB9G 1Y7XA 4DBHA 1NYGA 1B34A 4M78D 4JRPA 2NUTA 2XG8D 5L23A 4ESRA 3JV3A 4AG1C 2KYBA 2K5FA 2DBMA 4ATOA 5LJ5d 2BZYA 3VS4A 1D1AA 3RKXA 5GAMh 4OMOA 4QKUA 7AT1B 2ZPEB 1LPLA 1OX9A 2YUOA 2X4WA 2OAWA 2DD5A 3OW2A 4FYYB 3OYIA 1T3LA 4EDUA 4RG2A 3HTRA 4BI8B 1KC8R 4LN2A 4PFZA 2DILA 1YHQT 3OYYA 3CCQQ 5CKFA 1VQPT 2E1HA 3HRSA 4M78F 2DXUA 3DKMA 1D1BA 3CMEA 2QQBA 2O31A 2VKNA 1WPYA 4KT0E 4PL6A 3LX7A 4WF2A 2W0ZA 4GBQA 5J3BA 3QDFA 2KYMA 1EX4A 1S72A 4PNOA 2EQUA 4R0KA 1Q81U 2IPOB 4RCCA 2OTJA 2QA4T 1YITA 3MKDA 4AFZC 2CP3A 2HSPA 2KRMA 3JCMb 1BIAA 3LWHA 2E70A 1BCMA 2EJGA 3QWXX 3HRTA 2BZXA 2L89A 3UF4A 2GNCA 4ZGEB 4QQGA 4M7DE 3CC2Q 4WCIA 1NE8A 2E6ZA 2MAMA 2FVUA 3GPLA 1OZ2A 2YUNA 4OB0B 5KYYB 2CSIA 3OB9A 1SRLA 2J6OA 4Z89A 2EPDA 5GAN8 3TSZA 2I0NA 1VQ8Q 4M7AB 1ZA1B 1NJIR 4CRIA 1MGQA 2GFUA 3RIRA 3MP1A 4J9CA 1AHJB 5GANj 2GCXA 2XDBA 2KR3A 1PNJA 4E2FB 1JJ2P 1AWXA 1X6BA 3QG1A 5FWCA 3BY7A 2E3HA 4QVZA 4LE9A 1X43A 3J7AF 2IVWA 5FW9A 2EYZA 2LVMA 1KD1C 1OZ3A 1YJNT 2XICA 1LVKA 4M7AC 3JCMc 3G71T 3VS3A 2CGHA 4N0AA 1EIFA 2F5TX 1M30A 2Y4XA 2XD0A 3RKWA 3CCEQ 2RNAA 3G7ZA 2RHXA 2DTIA 3S3MA 2EWNA 2YRDA 3ZL7C 1I5OB 5GANh 5GANe 4XTXA 2JVVA 3VRYA 1UGVA 2LJ3A 4QT7A 4C92E 4M7DD 2RI3A 2COWA 2X4YA 2BTTA 1LNXA 2RJCA 2QQRA 2HBWA 2VGNA 3CCUQ 4C5HA 1K73C 1TSFA 4JRIA 2E5QA 1PSEA 2RQUA 2X3WD 2FZGB 3RDVA 3WVEB 1M8VA 3L2ZA 3QUIA 1AOJA 3G4ST 2QXFA 3VS5A 3MCAB 1YHQA 3CC7Q 1M2VB 1K0XA 4M78G 4LDUA 4PFOA 2VWFA 1O75A 1UFFA 3LGLA 1PG5B 1K9AA 4DOWA 1WI7A 1WZOA 4M7DF 4IURA 1VQ7T 1PHTA 4C8QB 2EKOA 2CP0A 4JS4A 5LJ3d 3A5ZB 2QEXQ 2QA4A 2A3LA 4HXJA 1OPKA 2JW4A 3JCMJ 4R55A 2P84A 2CZ7B 1K8AU 4Y92A 5GAOq 1K1ZA 4HVWA 3UPUA 4M77B 1QP3A 5D7UA 4EMGA 3C95A 5CCAA 1OULA 2FHDA 4X34A 1UE9A 3VU3C 4XTZA 2RI5A 1SEMA 3RUXA 1KQ2A 3INZA 1YJ9Q 4C8QC 1Y57A 1Q81R 3KBGA 2LTOA 4C92D 2VV5A 1Y07A 1KFZA 1MNEA 2LRQA 2O9SA 4IUPA 1M9SA 1NG2A 1N9RA 4M7AF 3OBYA 1VQLT 1IGUA 1RL2A 2QASA 3ULRB 1SHFA 4M77E 3AT1B 1VQ4Q 1LOJA 3A8OB 4M77C 2RA2A 2JM9A 5I2SA 2DYIA 3KXTA 3CCJQ 2RM4A 3S3OA 3VS7A 2DETA 4OMPA 2YDLA 3JCMX 5J26A 4BI3A 3CXCP 4IIMA 2O2OA 3CCLQ 4JPBW 2A28A 2AZVA 1PRMC 4J83A 2AIRB 3CD6Q 5J39A 4OB2B 1Y0MA 1PRLC 1UGPB 4OB1B 1O9SA 1YJNA 2WSFE 2CYZB 2XDDA 4M75A 4J6YA 1GCPA 3G71A 3I55T 3T9NA 4KH1B 1KQ1A 2C0IA 2COZA 4R56A 3D7SB 2G6FX 2OAUA 4XTVA 4F14A 4NL3A 1UJ0A 4C0GA 4OP0A 2CDTA 3PT9A 4RTYA 1XTDA 3G1JA 3EG3A 2MK5A 2EQKA 2WACA 3VV0A 5EG2A 3JCMW 2ZCFB 4JZ4A 1ABOA 2KK4A 1UB4A 5LJ5g 3L2VA 2JM8A 1Q95G 5I22A 3OSSC 4ZTFA 1YWOA 2DYBA 2MCNA 1VYUA 4ZNXA 5ECAA 4FT4A 3OYLA 3FJ5A 2RK1A 1WJQA 2QDLA 4LDXA 1SKUB 2QGGA 3M59A 4Y91A 1VYVA 3VJPA 1FYNA 4M77D 3G4SA 4PJOB 1TOVA 2HQXA 2OJ2A 1SSFA 1HYOA 2NUZA 3CC4Q 3M4YA 4L59A 2DTHA 2HL5C 4L5GA 4ORZA 1MUZA 1KHIA 4C8QF 4X9DA 1VQNQ 2E6NA 2ESWA 4GLKA 2DFUA 2RQWA 4L6V5 1HJDA 3PFSA 3VS6A 5GAOr 1TXQA 1YCYA 4PJOC 4JDSA 1YIJA 4M77F 2L3RA 5KCHA 4EMKB 2DE0X 2LCLA 3QXEB 4F7UB 2L0AA 3CXCA 5I2MA 5LJ3f 3OYJA 2K3YA 1Q7YU 4QQDA 1FMWA 3H0IA 1N8RC 1RACB 2PVGB 4XK8E 1OV3A 1ZQ1A 4MMKA 2DMOA 1VQ5T 3C12A 3EHQA 4KULA 1IHWA 4KRTA 2QYZA 2DIQA 5HCKA 2DLPA 2JZ2A 4M7AG 1X6OA 3P8DA 1K8AR 1VQLA 2FL7A 3CCSQ 3R6OA 3OYDA 2F2WA 2F2VA 4DEXA 4EMKC 1NPRA 2J06A 3GP8A 3RERA 3J81E 3CBOA 3TU4K 2E5KA 2V8IA 4N4HA 2LQNA 3OQ5A 2P4TA 2ZPGB 2K5IA 1M3CA 2DD4A 5CR2A 1JU5C 1MV0B 2K57A 1VQKT 1YNZA 4CC4B 1M90U 1PWTA 4PFPA 2VXEA 2D8JA 1G2BA 4WTOB 1U8RA 1G3WA 2LQWA 3EG1A 1AZEA 2E3IA 1W4SA 4N4IA 3I55A 3LYIA 1VUBA 1VQOA 1EFNA 1S72Q 1OOTA 4CC2A 1VQ6T 1UHCA 2M02A 2OTJQ 1YITQ 1NLOC 2NUPA 3JCMQ 1RI0A 1SF9A 5CKEA 2CREA 3OS1A 2QTVA 3A1PA 3HL8A 2A37A 4Z8AA 3VS0A 2EYQA 4FT2A 3R6NA 3UATA 4BACA 2ZAEA 4AFUC 3CCMT 5L8RE 1XJWB 3UWNA 4XAXB 1M1FA 4RKUE 1K9MR 3PIPA 2X51A 2JJ9A 1IB8A 4J7FA 2ED1A 1OYXA 4HVVA 2O4XB 3GF5A 1KIKA 4PJOF 1S1NA 1MNDA 2ROTA 1WJRA 1GXIE 3HRUA 2DXTA 1QVGS 1ZBJA 4FW2A 2OTLA 1ARKA 3L42A 2DPPB 1RADB 1GBQA 2F69A 2YHTA 3RR6A 2M1HA 4JJBA 2EYXA 3CPWS 1QKXA 3E9FA 1OU8A 2DRMA 4C8QG 3M0TA 4M75E 1LJOA 1Y96A 3JB9I 1H3ZA 2GBQA 2KEAA 2O01E 2RHIA 2P0KA 1ABQA 1C1AA 2EQMA 1J3TA 5KYUA 3OY9A 1UTIA 4X9CA 4JLIA 2D6FA 1D0ZA 3VKIA 4MDXA 3EH2A 1TUDA 1BI3A 2Y90A 1LCKA 2RQRA 5LJ3g 4M7DB 1RLQC 4M77G 4D8DA 3OMGA 4F7UF 3NTHA 4IIOA 4BB7A 5GAN6 2M51A 3JCMg 3QJ6A 2AZSA 2BKDN 1UHFA 2J05A 2B8AA 4PLLA 2ROLA 2OX7A 2DZ9A 1SSHA 1BCOA 1D0XA 2RN8A 1I8FA 2JMAA 3EGDB 1YJWT 2MWOA 2DRKA 3NPFA 2HQHA 3LH5A 1VQ5A 3X26B 1ZSZB 2HNIA 2KRSA 2VYTA 3I56A 4M7DC 3FJPA 2DJQA 2MOXA 3NFCA 2E4HA 3QKJA 2FYKA 3CCET 1Q7YR 1AWJA 3LWIA 1VIFA 4RTZA 2EGEA 3SHWA 3SWNB 1WXUA 1PKSA 1QCOA 2LT4A 4FCYA 3CCVQ 3EG9A 5LJ5e 1NM7A 1D3BB 1KD1U 1YHQQ 3QYHB 1VQKA 3CBPA 1ZSZC 2RHYA 1ZX6A 1RAFB 4JRKA 3VS1A 3OYBA 1FMKA 3CMAA 3M5AA 2HDAA 4MZMA 3GBQA 4J7IA 4M75D 3VYHB 2FZCB 1OQKA 3CCUT 1GCQA 2X35A 4LXCA 4HCBA 5A2QE 4FL6A 2CZ0B 2JTMA 3ZBDA 3EGXA 4GY5A 1UDLA 1YCSB 4AMCA 1E7OA 1NEBA 3E2UA 3SWNC 4C92B 2LQKA 2RK2A 4FW1A 1VQ6A 3L2RA 3OYMA 1IGQA 2JT4A 5KYXB 5KE3A 2OI3A 2JS2A 3LH0A 3LW5E 1IO6A 3HKSA 2ZGWA 3H9NA 4E7IA 2XK0A 2C0OA 5GJVB 1M90R 5KH6A 3NGPA 4RTTA 1QW1A 1RAHB 5GAN7 1GFDA 3FRNA 1N27A 2FPDA 1TU0B 2HBPA 1V76A 3DB4A 3JB9J 2YUPA 3CCMA 1ZSGA 1TUCA 3OYEA 1K73U 1YWPA 5FRMA 2LC4A 3M0UA 4AG2C 2DERA 2EGCA 2QEXT 2A08A 1RAEB 3BE3A 4C92C 1X2QA 4PJOG 2RB6A 3CBMA 3M4GA 5AYFA 2RI2A 1QWFA 4XTWA 1PM3A 2K4YA 2CT4A 2JXBA 2K3XA 1TH7A 5LJ5f 3OS0A 4LNPA 2RMOA 4MZPA 5FU7B 1VQ9T 5CQYA 3PE0A 2FPEA 1FMVA 4KGXB 1YJ9T 3UDCA 2LJ0A 2RJDA 2FRYA 2BIVA 2RJFA 1VQPA 4M78A 1B34B 4O5VA 1U5SA 3PGGA 1GFCA 2QDYB 2DVEA 2K6DA 3JB9H 2NUTB 1CSKA 2QGFB 1M1GA 2YRCA 5DLOA 4C5EA 2E12A 4DOVA 3EG2A 2PTKA 5EC7A 4F7UG 1YJNQ 3LGFA 2NLUA 3C0CA 1V1CA 3EH1A 2R58A 2KE9A 2J6KA 2COYA 5FWBA 3CCJT 3SDZA 2FO0A 5FROA 2RHUA 4D6WA 3PIOA 5FU7C 4BDZA 1OI1A 2E64A 1PC0A 2RO0A 3JCMd 2DO3A 1BI1A 3EFRA 5I11A 5FRNA 3OYCA 2AHJB 3WXMB 1QVFS 3M0QA 1YJWA 4OMMA 2ZPIB 4HCKA 3BDLA 1VQMT 1JJ2S 4FM4B 2GTJA 2KXCA 2DTOA 1WYXA 1CKBA 3X24B 3U23A 1KQSS 4ELYC 2BUDA 3L2QA 5IHKA 2EGAA 5HK3A 2MMPA 4PJMA 1U1TA 5IHIA 1Z9QA 2LCSA 4CC7A 5GAMg 2L3SA 3S3NA 1X01A 1M4ZA 3REAB 2K79A 1Q82C 1JB0E 2HEQA 3MEWA 2RPNA 3MO8A 2PZ1A 3G4SQ 3ME9A 1WHLA 2HL3A 2IG0A 2L5QA 4FSSA 1P92A 3ZEHA 5LJ3j 1WQ7A 3A8LB 2DEUA 5CKDA 2HD0A 5KYWA 2C0TA 1R0BG 5CO7A 2AKKA 4C92F 4E7ZA 1TWBA 4OF1A 5HY6A 2M9UA 3M0PA 1PCXA 3EFSA 2DJZA 4PLIA 5HK0A 5GAOn 3GNGA 1Q86C 3RESA 1KD1R 2E65A 3EFOA 2DM1A 1AD5A 1YIJQ 3S6WA 3ASKA 2MI6A 3VS2A 2KQWA 4LUEA 3RKYA 1U06A 1BU1A 1YI2T 1OX8A 2XKOC 3ER0A 2YRVA 1WHGA 3MEUA 9ATCB 1C0MA 1AT1B 3JB9D 2O88A 2F1LA 2YWWA 3M58A 4AFQC 2EVRA 5LJ3h 4II1A 5GMKe 5LJ3e 3CPFA 4FIBA 3VYGA 1R77A 2X3XD 4DBFA 4LDWA 3QHSA 5CVIA 4LD9K 3TCJA 3JCMe 1WGSA 3TREA 2YUQA 2CP6A 1ZUKA 1M5Q1 4EPCA 4E7KA 4UC4A 4D8KA 2DL5A 1RAAB 1SRMA 2QQAA 2ZZDA 1VQLQ 3H8ZA 4OGEA 4DEYA 2KGTA 2PU9B 1M1KC 2CUDA 3ZFJA 5IXBA 1GL5A 1D0YA 1SPKA 2JTEA 2KY9A 1K9MC 1RAGB 1VQ9A 2EKHA 1K73R 8AT1B 3JB9F 2YLCA 1YJ9A 2F2XA 1R8OB 1HSQA 5C0MA 2CP5A 3O5ZA 5D6WA 4XQ3A 1W2BP 1X2KA 4M7DG 1RLPC 3G6EQ 3CCST 4PJLA 2HCKA 2QAZA 5I21A 4F17A 3CCRQ 4DQ2A 2DKGA 1VQ7A 4J8OA 4A4HA 2LMJA 1YFNA 3X28B 2X4JA 2D0QB 3CCJA 5AT1B 1KHCA 4N0AC 1KC8C 1VQOQ 4F04B 1N8RU 3KFVA 3M0SA 2CKKA 4A4KA 1GBRA 2DL4A 5CKHA 2PUOB 4RUGA 3L2WA 1G5VA 5GAN5 1JQQA 1MMGA 2E10A 2AT1B 2KNBB 1RABB 3QYGB 2YT6A 1BI2A 1VQMA 4IUUA 2QTXA 1NZ9A 2DIGA 4XU3A 3JCMf 3N5BB 2JS0A 1PD0A 4F16A 5GMKl 2FEIA 2ECZA 2X4XA 1WFWA 1M2OA 2B86A 1KK7A 2V8KA 5IT9E 4YTLA 4C5IA 3O8VA 1JRIA 2EFIA 1X6GA 3PVLA 2HKQB 4Y28E 3A8GB 1F1BB 5A0GA 1AEYA 2F5KA 1X69A 1BI0A 1YITT 4M7AA 4Z02A 2XMFA 3EG0A 1QVGP 1JXMA 2SRCA 4PJJA 4E7SA 1B3QA 5GAMd 3H6ZA 3CPWP 3GNFB 1TTHB 4J6XA 2KBTA 2OTLQ 2JTFA 2VXFA 4FYVB 1G3YA 1I07A 2LZ6B 1JBMA 3L1AA 3JSCA 5IHNA 3X25B 2RQVA 1NLPC 4C92G 2EQJA 4K11A 1C6VX 1QVPA 3TVTA 2GFAA 1NJIC 3MP6A 3CMEQ 2K5LA 4ANJA 3I5RA 3OBWA 4A4FA 2ED0A 5A0LA 3FC3A 2P4RA 1QP2A 3OA6A 2SEMA 3NTIA 3V8JA 2JUFA 4J9EA 5DLQE 5GJWB 1I81A 1YI2A 1NPPA 2QK0A 3PMTA 1X27A 2RQTA 2K3BA 3CCQT 2HSEB 2EW3A 1NYFA 2EYWA 1W2BA 4RTXA 2Y4YA
chains in the Genus database with same CATH topology
3M53A 2LT4A 3FIFA 3PMIA 1Y71A 5LJ5e 2A3LA 2QA4A 2HAXA 4QW2A 4DA4A 4XTUA 4M7DA 3JCMJ 4R55A 1D3BB 2CZ7B 5HKCA 1K8AU 1KD1U 3QYHB 4C0DB 2RH2A 1VQKA 1PSFA 2FB7A 3CBPA 5GAOq 5D6YA 3UPUA 1VQ4A 2RHYA 4M77B 3E19A 4JRKA 3CEYA 3OYBA 4B9WA 1QP3A 3CMAA 3QDRB 1WQWA 1IREB 3M5AA 4MZMA 4FSXA 4EMGA 2OTLT 3EAEA 1H641 3C95A 4J7IA 4LDYA 4M75D 3VYHB 2DEQA 4M75B 4BD3A 5CCAA 2FHDA 2LT1A 2P0PA 2PVDB 4C5GA 4X34A 3CCUT 3VU3C 4BY6C 5M9OA 2X35A 4HCBA 4XTZA 5A2QE 4FL6A 2CZ0B 2MF2A 2JTMA 4LD6A 3ZBDA 4IUQA 2RI5A 3HPWA 3CCLA 3RUXA 2VC8A 4C0ZA 1KQ2A 3INZA 5KE2A 4GY5A 4C8QC 3KBGA 2LTOA 4C92D 3CD6A 4IUVA 2VV5A 1Y07A 3GLXA 1DJ7B 2LCCA 2LQKA 2RK2A 3SWNC 4C92B 2VGMA 2LRQA 3OYMA 3L2RA 3CXCS 3OW2S 4OGCA 4IUPA 1M9SA 4B9XA 5C6SA 5KE3A 1N9RA 1HXDA 3LH0A 3LW5E 1Q81C 4M7AF 3OBYA 2JNGA 2KSSA 3LLRA 4M78B 3CMET 1VQLT 3HKSA 3QSUA 2JOYA 2ZGWA 5CIUA 3V7CA 4ELZC 3QPHA 1RL2A 3E9GA 2XK0A 4O6JA 3VUZA 4C0DC 2XU8A 1ZBXA 4E7IA 3UT1A 2WSEE 4M77E 5KH6A 3RMSA 4IKFA 1LOJA 5GAN7 3CC2T 1QW1A 2KDSA 1XNIA 1HK9A 2A7YA 3A8OB 4M77C 2RA2A 5GAMe 1WNLA 5GANg 3CCSA 4QQ6A 3FRNA 1N27A 4C8QA 5I2SA 3KXTA 1VIEA 2HBPA 1S72T 3DB4A 2RM4A 4M75C 3SWNA 3S3OA 3X20B 3CCMA 1G3SA 3JB9J 1VQ6A 3PTAA 3E1SA 1I4K1 3OYEA 3JCMX 1K73U 5FRMA 2OTJT 5J26A 4BI3A 1QVGA 2LC4A 3OYNA 4E7LA 3META 3TEEA 4QVCA 3GIBA 2KVQG 4HCZA 2XDPA 2QEXT 1D3BA 4J83A 1VQ8T 3GOXA 3CCVT 4NS5A 3FEOA 4BUGA 4C92C 4PJOG 1UEBA 3MP8A 3M55A 2RB6A 3QO3A 3CBMA 3CPWA 4M77A 2RD1A 4J5YA 5J39A 2KAFA 3M4GA 4OB2B 5AYFA 1NJIU 2RI2A 4JJNK 3M54A 4M78E 1BKBA 1UGPB 4OB1B 1O9SA 4M78C 4XTWA 1YJNA 2WSFE 2CYZB 2K4YA 2EAYA 2QI2A 3BFMA 4J6YA 4M75A 4RG8A 3RMQA 3V7SA 4QVDA 3I56T 5LJ5j 2DK3A 1FX7A 3QBYA 5KCOA 4MZTA 2K3XA 3G71A 3I55T 1Q7YC 1TH7A 5LJ5f 3T9NA 3WVDB 3OS0A 3V8LA 5GAN4 1KQ1A 4MZPA 5FU7B 4F7UE 4R56A 3HP9A 5GAN3 1VQ9T 1U1SA 2LDMA 2OAUA 5CQYA 4XTVA 1ZHIA 1YBYA 4C92A 4NL2A 1YJ9T 2QQSA 4NL3A 3UDCA 2RJDA 2BIVA 4VUBA 2RJFA 4XU0A 5GAOp 4E7HA 4C0GA 2HQEA 4M78A 4OP0A 1B34B 2LX9A 4O5VA 3PGGA 4E47A 1VQPA 2QDYB 3M56A 5GANd 2DVEA 1FWZA 3PT9A 3V8KA 3P8HA 3JB9H 5IN1A 1M1GA 1XTDA 3CC4A 5DLOA 2EQKA 4C5EA 3JRZA 2E12A 5FLXE 3JCMP 4XU2A 4DOVA 5GAOm 2PVOB 2WACA 3VV0A 2EJ9A 5EG2A 3JCMW 4F7UG 2ZCFB 3LGFA 5FU6B 3HFNA 3MEVA 2NLUA 3G6EA 3CMAT 5LJ5g 4TVRA 2KK4A 1UB4A 5DY9A 3OYAA 3L2VA 5D6XA 3CCRA 3HSBA 2R58A 2ZPFB 4KBMB 4ZTFA 3OSSC 1VQNA 3CCJT 1W2BS 3SDZA 5FROA 2CS7A 2RHUA 4D6WA 3OSVA 1X75C 3PIOA 3M9QA 4ZTJA 4KUIA 5FU7C 3KUFA 4FT4A 3OYLA 2PQWA 5LJ5h 1OI1A 4ME7A 2RK1A 1WJQA 2DXBA 4ZN1A 2EIFA 2E64A 5GAMj 2V8JA 2RO0A 3JCMd 2DO3A 1BI1A 3EFRA 3QIIA 4LDXA 5GAMf 3M59A 4Y91A 5FRNA 4BE1A 2LNVA 2P0QA 2AHJB 2M0OA 3WXMB 3OYCA 3VJPA 4PJOD 1QVFS 4M77D 3G4SA 4PJOB 3OYKA 1YJWA 2ZPIB 2HQXA 3BDLA 1VQMT 1M90C 2YLBA 3OS5A 1SSFA 4FM4B 1JJ2S 2KMTA 4CI0C 3M4YA 2DTOA 2VUBA 4L59A 3X24B 3OYGA 3AHUA 4HCCA 1KQSS 4OVAA 2DTHA 3SD4A 3C4SA 4L5GA 4ELYC 4KUDK 5FU6C 2BUDA 2QQ9A 4MDWA 3SB2A 3L2QA 2G3RA 4BE0A 1KHIA 3BDUA 5HK3A 2MMPA 4C8QF 4X9DA 3JB9G 1U1TA 2E6NA 1Y7XA 2GF7A 4GLKA 3HHTB 1B34A 4L6V5 3CC7T 5GAMg 3S3NA 4M78D 4JRPA 1X01A 3CCQA 2XG8D 3PFSA 1M4ZA 2R5AA 5CQXA 1Q82C 1UGSB 2K5FA 5GAOr 4ATOA 1JB0E 5LJ5d 1UGQB 3MEWA 4EMHA 1YCYA 5GAOl 3RKXA 3MO8A 3FLGA 1XQHA 3ME9A 5GAMh 4PJOC 4JDSA 4XTYA 1YIJA 1BYMA 4BDZA 3MEAA 4M77F 2IG0A 2L5QA 2L3RA 5KCHA 4EMKB 1P92A 4PKCC 2LCLA 3QXEB 2ZPEB 3ZEHA 1WJSA 3SFMA 4F7UB 5LJ3j 4HT8A 4M7AE 4M75F 2X4WA 2DD5A 1WQ7A 2LQ8A 3CXCA 5I2MA 3OW2A 3A8LB 5LJ3f 3OYIA 2K3YA 3OYJA 1Q7YU 4NOYA 5CKDA 4EDUA 4RG2A 4QQDA 2HD0A 2R5MA 4BI8B 1N8RC 5CO7A 2PVGB 4FU6A 4XK8E 1V29B 4C92F 4PJOA 1ZQ1A 4MMKA 1FXXA 3C94A 1YHQT 4OF1A 5HY6A 1VQ5T 3C12A 2M9UA 3OYYA 4KULA 2MWPA 3EFSA 5CKFA 3DLLA 2DIQA 4E7JA 1VQPT 4BDYA 2DJZA 4PLIA 5HK0A 2E1HA 3HRSA 2JZ2A 4M78F 2DXUA 5GAOn 2R57A 3GNGA 1Q86C 3DKMA 3RESA 4M7AG 1X6OA 2E65A 3P8DA 3V7RA 2L8DA 3A8MB 1VQLA 2FL7A 2QQBA 3R6OA 3S6WA 1UGRB 3ASKA 3OYDA 2MI6A 3CMEA 1WPYA 2KQWA 4KT0E 4PL6A 5CKBA 4EMKC 1NPRA 3LX7A 3RKYA 3GP8A 3RERA 4MMLA 3J81E 3CBOA 1YI2T 2XKOC 3CC2A 1BIBA 3ER0A 2YRVA 3MEUA 4BE2A 4WF2A 1G3TA 5CK9A 5J3BA 3TU4K 2XHCA 3JB9D 2V8IA 4HA8A 1S72A 4PNOA 3M58A 2EQUA 5LJ3h 4II1A 4N4HA 5GMKe 5LJ3e 3OYHA 3CPFA 4FIBA 3OQ5A 4RCCA 3VYGA 1Q81U 2P4TA 2ZPGB 2OTJA 2QA4T 3MHXA 4LDWA 2K5IA 3QHSA 1YITA 2XI9A 2DD4A 5CVIA 4LD9K 3TCJA 4JUVA 3URGA 2PUKB 5CR2A 3JCMe 5A0DA 1WGSA 3JCMb 2K57A 3TREA 1VQ8A 1VQKT 1BIAA 4EMKA 3CCVA 1M5Q1 2I2LA 3LWHA 1VQ4T 4EPCA 4E7KA 2E70A 4UC4A 4F7UA 1M90U 2EJGA 4JS5A 2VXEA 2WSCE 3HRTA 2QQAA 2ZZDA 3J80E 4RMOA 5GMKi 2L89A 2E41A 3F70A 3H8ZA 3HFOA 4OGEA 4ZGEB 4PJOE 1U8RA 1G3WA 4QQGA 4M7DE 2PU9B 1M1KC 3ZFJA 1W4SA 4N4IA 3I55A 1NE8A 3LYIA 4ZN3A 3CCLT 2E6ZA 1VUBA 2MAMA 1VQOA 1N9SA 2FVUA 3QJYA 2C06A 2KY9A 3GPLA 1K9MC 1OZ2A 1VQ9A 3CD6T 4OB0B 1VQ6T 3JB9F 3OB9A 2YLCA 2DZCA 1YJ9A 4OB3B 1IZ6A 1Y96B 1R8OB 3JCMQ 3QZ9B 5GAN8 1Q82U 1RI0A 5CKEA 5C0MA 5D6WA 3OS1A 4M7AD 4XQ3A 3HL8A 4M7AB 4M7DG 2CZ1B 2EYQA 4CRIA 3CCST 4FT2A 1YIJT 1I5LA 1MGQA 4BACA 5I21A 2GFUA 3RIRA 3MP1A 4DQ2A 2DKGA 1VQ7A 1AHJB 2GQVA 4J8OA 4A4EA 3L2UA 3CCEA 4A4HA 5L8RE 4BI4A 3CCMT 1QVFA 3X28B 2X4JA 5GANj 2GCXA 2XDBA 3UWNA 2CZ6B 4XAXB 1M1FA 2D0QB 4RKUE 1JJ2A 3PIPA 5GANf 4A54A 3CCJA 1KHCA 4N0AC 4A53A 1KC8C 3QG1A 4IUTA 3JCMV 4J7FA 1N8RU 1OYXA 3BY7A 4QVZA 2CKKA 2O4XB 1KQSA 3GF5A 4A4KA 5CKHA 4V2SA 4C8QE 3J7AF 2PUOB 4HKEA 4PJOF 5LL6S 2IVWA 4P5NA 2LVMA 3L2WA 1XOVA 5GAN5 1K8AC 1WJRA 1KD1C 1G5VA 1GXIE 1OZ3A 3HRUA 3P8BB 2E10A 4RCBA 5GMKj 1YJNT 2DXTA 4C0FA 1Q86U 2XICA 3QYGB 1QVGS 1BI2A 1VQMA 4M7AC 4IUUA 3JCMc 2QTXA 1NZ9A 3G71T 2DIGA 4XU3A 4OMFB 2OTLA 2CGHA 3L42A 4N0AA 2DPPB 3JCMf 3N5BB 1EIFA 2F69A 3CCUA 2YHTA 2F5TX 2M1HA 2Y4XA 3CPWS 2XD0A 3RKWA 4A4GA 4ZGDB 5GMKl 3E9FA 2X4XA 2XDDA 3G7ZA 2V8KA 2RHXA 2DTIA 4YTLA 4C5IA 3O8VA 4C8QG 1JRIA 5IT9E 2EFIA 2EWNA 1LJOA 4M75E 3S3MA 1Y96A 3JB9I 1H3ZA 4Y28E 3A8GB 2O01E 2RHIA 5A0GA 2F5KA 2P0KA 2EQMA 3OYFA 5GANh 1BI0A 5GANe 3CC7A 4XTXA 4Z02A 1YITT 2JVVA 4M7AA 3NTKA 3OY9A 4X9CA 4JLIA 2K2VA 3VKIA 3CC4T 4JRQA 2D6FA 4MDXA 1BI3A 2Y90A 4Q5WA 4C92E 4M7DD 3DB3A 5LJ3g 2RI3A 4M7DB 3DLMA 4M77G 2X4YA 5GAMd 3G6ET 3OMGA 4F7UF 3NTHA 1N6AA 3H6ZA 4BB7A 5GAN6 2ZPBB 3FDRA 3GNFB 4HT9A 3CCRT 3JCMg 4J6XA 3PNWC 1LNXA 3QJ6A 2RJCA 2QQRA 2BKDN 2JTFA 2VXFA 4J6WA 4M75G 1VQNT 2VGNA 3Q1JA 5GMKh 2M16A 1G3YA 1M1KU 4C5HA 2B8AA 4JLGA 1K73C 3QZ5B 4JRIA 2RHZA 4N4GA 2E5QA 1PSEA 4PLLA 3JCMh 1JBMA 3L1AA 3JSCA 3WVEB 2O4XA 3JAME 1M8VA 1VQOT 3X25B 3L2ZA 3A8HB 3QUIA 4LDVA 1K9MU 2QEXA 2DZ9A 4C92G 1I8FA 3G4ST 3OMCA 2D9TA 2EQJA 1YJWT 3BW1A 2MWOA 2QXFA 1QVPA 3MCAB 1YHQA 1VQ5A 4ZGJB 5CAIA 3X26B 2GFAA 1NJIC 2H3JA 2HNIA 3MP6A 4M78G 1MHNA 4LDUA 2K5LA 2VYTA 2ZPHB 3OBWA 1O75A 4A4FA 3M57A 2XIDA 5A0LA 3LGLA 3OS2A 3I56A 3FC3A 1QP2A 3OA6A 4DOWA 2RJEA 3FJPA 4M7DC 4M7DF 3NTIA 4IURA 3V8JA 2JUFA 5GAN2 2DXCA 2EJFA 5DLQE 4BY6B 2JN0A 1I81A 1VQ7T 3NFCA 3QKJA 5GMKm 2FYKA 1YI2A 3CCET 1KG1A 1NPPA 3LWIA 1VIFA 3PMTA 4C8QD 4C8QB 2EKOA 2DAQA 4XU1A 3SWNB 5DM7R 3CCQT 3VUBA 4JS4A 1KC8U 3FB9A 5LJ3d 5IAYA 1W2BA 3A5ZB 2Y4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XU0 A;  5GAO p;  4OP0 A;  4M78 A;  4V2S A;  1B34 B;  3FIF A;  4C8Q E;  3PGG A;  4PJO F;  5LJ5 e;  3EFS A;  5GAN d;  2DVE A;  5GAN 5;  4M7D A;  2DJZ A;  4XTU A;  3V8K A;  2E1H A;  4M78 F;  3JCM J;  3JB9 H;  2DXU A;  1D3B B;  5GAO n;  4RCB A;  4M7A G;  2E10 A;  3RES A;  5GMK j;  2E65 A;  2FB7 A;  2DXT A;  3V7R A;  5GAO q;  3JCM P;  4XU2 A;  4M77 B;  5GAO m;  4M7A C;  4JRK A;  2EJ9 A;  3JCM W;  1WPY A;  3JCM c;  2QTX A;  4F7U G;  1WQW A;  4XU3 A;  4EMK C;  2CGH A;  3HFN A;  3RKY A;  4N0A A;  4EMG A;  4MML A;  1H64 1;  4M75 D;  5DY9 A;  3JCM f;  5LJ5 g;  3RER A;  1BIB A;  2DEQ A;  4M75 B;  2YHT A;  3HSB A;  4WF2 A;  3RKW A;  3VU3 C;  5GMK l;  3JB9 D;  4HA8 A;  4XTZ A;  4PNO A;  4C8Q G;  2DTI A;  1JRI A;  5LJ3 h;  4M75 E;  2EWN A;  1LJO A;  2VC8 A;  3RUX A;  1Y96 A;  3INZ A;  2E64 A;  5GMK e;  5LJ3 e;  3JCM d;  4RCC A;  5GAM j;  4C8Q C;  3JB9 I;  3EFR A;  4C92 D;  3QHS A;  3SWN C;  4C92 B;  4Y91 A;  5GAM f;  5GAN h;  4JUV A;  3JCM e;  5GAN e;  4M7A A;  4XTX A;  4PJO D;  4M77 D;  3JCM b;  4PJO B;  2K57 A;  4X9C A;  1N9R A;  1BIA A;  1HXD A;  4JLI A;  4EMK A;  1M5Q 1;  4M7A F;  2I2L A;  4M78 B;  2Y90 A;  2YLB A;  4C92 E;  4F7U A;  5LJ5 h;  3QSU A;  2ZGW A;  3V7C A;  4M7D D;  2EJG A;  5LJ3 g;  4M7D B;  5GAM d;  2VXE A;  4M77 G;  4F7U F;  4PJO E;  2DTO A;  4M77 E;  1LOJ A;  5GAN 6;  5GAN 7;  3AHU A;  4HT9 A;  5GMK i;  2E41 A;  1HK9 A;  4M77 C;  3HFO A;  2RA2 A;  4J6X A;  1WNL A;  2DTH A;  4J6W A;  1LNX A;  3JCM g;  5GAM e;  5GAN g;  2VXF A;  4M75 G;  4M7D E;  5GMK h;  4C8Q A;  3SB2 A;  2RM4 A;  4M75 C;  3SWN A;  3BDU A;  3JB9 J;  4C8Q F;  4X9D A;  3JB9 G;  4JRI A;  1N9S A;  1U1T A;  1I4K 1;  3JCM h;  1JBM A;  3L1A A;  3JCM X;  1M8V A;  1B34 A;  3L2Z A;  3QUI A;  4QVC A;  3JB9 F;  2DZ9 A;  3GIB A;  5GAM g;  2YLC A;  4M78 D;  4C92 G;  1X01 A;  1I8F A;  2DZC A;  1D3B A;  1Y96 B;  1KQ2 A;  3BW1 A;  4C92 C;  5GAO r;  4PJO G;  3JCM Q;  3QO3 A;  5LJ5 d;  5GAN 8;  2RB6 A;  5CAI A;  4PJO A;  4M77 A;  4EMH A;  1YCY A;  2RD1 A;  4J5Y A;  3RKX A;  2HNI A;  3M4G A;  4M78 G;  5GAO l;  4XQ3 A;  5GAM h;  4M7A D;  4M7A B;  4PJO C;  4XTY A;  4M78 E;  4M77 F;  4M7D G;  4M78 C;  4EMK B;  4XTW A;  1I5L A;  3BFM A;  2EAY A;  4J6Y A;  1MGQ A;  4M75 A;  4QVD A;  3V7S A;  5I21 A;  4F7U B;  3FJP A;  4M7D C;  5LJ5 j;  5LJ3 j;  4M7D F;  3RIR A;  3V8J A;  4DQ2 A;  2DKG A;  4M75 F;  5GAN 2;  4HT8 A;  2EJF A;  1WQ7 A;  4M7A E;  1TH7 A;  5LJ5 f;  2JN0 A;  1I81 A;  5LJ3 f;  3V8L A;  4NOY A;  5GAN 4;  5GMK m;  2FYK A;  5GAN j;  1KQ1 A;  4F7U E;  5GAN 3;  1U1S A;  4C8Q D;  4XTV A;  4A54 A;  5GAN f;  4C8Q B;  4C92 A;  4N0A C;  4A53 A;  4NL2 A;  4XU1 A;  3SWN B;  3JCM V;  3FB9 A;  5LJ3 d;  4C92 F;  4NL3 A;  3BY7 A;  4MMK A; 
#chains in the Genus database with same CATH topology
 1W70 A;  3M53 A;  3FIF A;  1Y71 A;  1MMD A;  2GTO A;  2X9H A;  4QW2 A;  4XTU A;  5KYW B;  4DA4 A;  1HD3 A;  2RH2 A;  1PSF A;  2FB7 A;  3EHR A;  3CEY A;  3I56 Q;  4B9W A;  1E6G A;  1VYT A;  1IRE B;  1WQW A;  1NEG A;  4J9I A;  1EZZ B;  1H64 1;  4M75 B;  4C5G A;  2LT1 A;  2PVD B;  3CQT A;  4IUQ A;  3HPW A;  1BK2 A;  5KYN A;  4KH0 B;  4KGZ B;  1M2V A;  1WHH A;  1DJ7 B;  2LCC A;  3I35 A;  2H3E B;  2V1Q A;  3OW2 S;  4OGC A;  4HVU A;  4B9X A;  2JNG A;  3LLR A;  1WA7 A;  3MPU B;  4ELZ C;  2YXY A;  3QPH A;  3E9G A;  1VQK Q;  3VUZ A;  1ZBX A;  2WSE E;  3RMS A;  3CC2 T;  2KDS A;  1XNI A;  1HK9 A;  2A7Y A;  3CCS A;  4IKF A;  5GAM e;  1W1F A;  1WNL A;  3CMA Q;  1TS9 A;  4C8Q A;  1VIE A;  1AVZ C;  4M75 C;  3X20 B;  1G3S A;  1UG1 A;  1WHK A;  1I4K 1;  1QVG A;  3OYN A;  4E7L A;  3MET A;  3TEE A;  4QVC A;  3GIB A;  2KVQ G;  1QLY A;  4HCZ A;  1IHV A;  1VQ8 T;  2CH4 A;  2DF6 A;  3GOX A;  3CCV T;  4NS5 A;  3RBB B;  3FEO A;  1VQ6 Q;  4BUG A;  2LX7 A;  3MP8 A;  3QO3 A;  3CPW A;  4M77 A;  2RD1 A;  2KAF A;  2KRN A;  3BFM A;  4RG8 A;  2EAY A;  3V7S A;  2J7I A;  5LJ5 j;  5KCO A;  4MZT A;  2MPX C;  3WVD B;  5GAN 4;  4M4Z A;  3HP9 A;  1N5Z A;  1U1S A;  2LDM A;  1YBY A;  3CCM Q;  4NL2 A;  1WLP B;  5IH2 A;  2DL7 A;  1N8R R;  3MJX A;  4VUB A;  2HQE A;  2LX9 A;  4X1V A;  3M56 A;  5GAN d;  3V8K A;  1D1C A;  1JXO A;  3JRZ A;  1JEG A;  4J9H A;  5GAO m;  2PVO B;  2EJ9 A;  3HFN A;  3MEV A;  1AZG B;  4TVR A;  3OYA A;  5DY9 A;  4JZ3 A;  2ABL A;  4J9D A;  3HSB A;  4KBM B;  1NBE B;  2A36 A;  3OSV A;  3M9Q A;  1KSW A;  4KUI A;  4ZTJ A;  1Q81 C;  5LJ5 h;  3REB B;  2DXB A;  2V8J A;  3QII A;  5GAM f;  4BE1 A;  2P0Q A;  2NWM A;  1VQP Q;  1ACM B;  1WHM A;  3OYK A;  1T0H A;  2YLB A;  2CP2 A;  2KMT A;  4CI0 C;  2VUB A;  3OYG A;  4HCC A;  1TUG B;  4RTV A;  1QKW A;  4OVA A;  4MDW A;  2KT1 A;  4BE0 A;  1I1J A;  1B07 A;  2GF7 A;  3HHT B;  2K7A A;  2MIO A;  1QVF P;  1QCF A;  2DL3 A;  3CC7 T;  2QA4 Q;  1SHG A;  3CCQ A;  2R5A A;  5CQX A;  1AWW A;  1UGS B;  1WXB A;  1UGQ B;  4EMH A;  5GAO l;  3FLG A;  1XQH A;  1BYM A;  4XTY A;  1YJW Q;  1KQS P;  3MEA A;  3UA7 A;  4RTU A;  1GRI A;  4PKC C;  1WJS A;  3SFM A;  1G83 A;  4LUD A;  4HT8 A;  3SEM A;  4M75 F;  4M7A E;  2LQ8 A;  1I0C A;  1RAI B;  1WDX A;  4NOY A;  2MYS A;  1ZLM A;  2R5M A;  1R0C B;  4FU6 A;  1MMA A;  1V29 B;  4PJO A;  1FXX A;  3C94 A;  4RTW A;  4E6R A;  2MWP A;  3DLL A;  4E7J A;  4BDY A;  1WX6 A;  2R57 A;  3V7R A;  1UEC A;  2NUP B;  1D09 B;  2L8D A;  3A8M B;  1UGR B;  5CKB A;  1OEB A;  4MML A;  3RNJ A;  2VAS A;  3CC2 A;  1BIB A;  2HMA A;  4BE2 A;  1G3T A;  5CK9 A;  2XHC A;  1BBZ A;  2EYY A;  4HA8 A;  2CP7 A;  3OYH A;  4OMN A;  3MHX A;  2EQI A;  2XI9 A;  3URG A;  4JUV A;  2PUK B;  5A0D A;  1VQ8 A;  4EMK A;  4KGV B;  3CCV A;  2I2L A;  4OMQ A;  1VQ4 T;  4F7U A;  1WIE A;  4JS5 A;  2WSC E;  2GQI A;  1IRX A;  3J80 E;  3G71 Q;  1AWO A;  4RMO A;  2BE9 B;  5GMK i;  2E41 A;  3F70 A;  3HFO A;  2DA9 A;  4CC3 A;  4ZN3 A;  3CCL T;  1N9S A;  3QJY A;  1CKA A;  2C06 A;  3CD6 T;  3H0F A;  2AKL A;  1ZA2 B;  1OPL A;  4GLM A;  2DZC A;  4OB3 B;  1IZ6 A;  1M8M A;  1Y96 B;  2KT8 A;  3QZ9 B;  1Q82 U;  1QQJ A;  2HKN A;  4M7A D;  2CUB A;  2CZ1 B;  5KYU B;  2J6F A;  1H8K A;  2D8H A;  2W10 A;  1YIJ T;  1I5L A;  3NMZ C;  4EIK A;  2V1R A;  3I9Q A;  1T0J A;  2GQV A;  3L2U A;  4A4E A;  3CCE A;  4BI4 A;  1QVF A;  2CZ6 B;  1JJ2 A;  5GAN f;  4A54 A;  4A53 A;  4IUT A;  1WXT A;  3JCM V;  1VQ9 Q;  1KQS A;  2LJ1 A;  4V2S A;  4C8Q E;  4HKE A;  5LL6 S;  4P5N A;  1XOV A;  1K8A C;  1M27 C;  1W6X A;  3P8B B;  4RCB A;  5GMK j;  1UUE A;  4C0F A;  1Q86 U;  2D0N A;  2FZK B;  4OMF B;  3TQ7 P;  2KI7 A;  3CCU A;  1VQ7 Q;  4A4G A;  3VRZ A;  4ZGD B;  2LP5 A;  1PKT A;  1MV3 A;  3OYF A;  2O9V A;  1RUW A;  3CC7 A;  3NTK A;  2K2V A;  3CC4 T;  4JRQ A;  1U3O A;  4Q5W A;  3EG9 B;  2IIM A;  4PJN A;  3DB3 A;  2KXD A;  3DLM A;  3NHN A;  3G6E T;  2CH4 W;  1N6A A;  4HT9 A;  1QWE A;  2ZPB B;  3FDR A;  1VQM Q;  3CCR T;  4J6W A;  3PNW C;  1VQN T;  4M75 G;  3Q1J A;  5GMK h;  2H8H A;  2M16 A;  1M1K U;  4JLG A;  3QZ5 B;  2CT3 A;  2RHZ A;  4N4G A;  3JCM h;  2O4X A;  3JAM E;  1VQO T;  1E6H A;  1K4U S;  3A8H B;  1RI9 A;  4LDV A;  2QEX A;  1K9M U;  3THK A;  3OMC A;  2D9T A;  3EGX B;  2NYS A;  3BW1 A;  4ZGJ B;  5CAI A;  2H3J A;  1MHN A;  1QMC A;  2KRO A;  2ZPH B;  3M57 A;  2XID A;  3OS2 A;  1BB9 A;  1K76 A;  2RJE A;  1ZUU A;  2D1X A;  5GAN 2;  2DXC A;  2EJF A;  3I5S A;  4BY6 B;  2JN0 A;  4B6M A;  1YP5 A;  2DVJ A;  1H92 A;  5GMK m;  2CSQ A;  2FRW A;  1KG1 A;  2ATC B;  4C8Q D;  2DAQ A;  4XU1 A;  5DM7 R;  1KC8 U;  3VUB A;  1TG0 A;  4DBR A;  3FB9 A;  2Z0W A;  5IAY A;  2QG9 B;  2V26 A;  1GCQ C;  3PMI A;  2HAX A;  4M7D A;  5HKC A;  4C0D B;  1K0S A;  4AT1 B;  2ENM A;  5IXF A;  5D6Y A;  1VQ4 A;  3E19 A;  3EGU A;  3QDR B;  4FSX A;  2OTL T;  3EAE A;  1ZUY A;  4LDY A;  4BD3 A;  4DBQ A;  3I55 Q;  2DEQ A;  2P0P A;  2DX1 A;  4BY6 C;  5M9O A;  1YI2 Q;  2MF2 A;  4LD6 A;  3CCL A;  1B7T A;  2VC8 A;  3EGD A;  4C0Z A;  5KE2 A;  2K9G A;  1YN8 A;  2BZ8 A;  3CD6 A;  4IUV A;  1UJY A;  1ZSZ A;  3PVQ A;  3GLX A;  2VGM A;  3CXC S;  1A0N B;  4FYW B;  5C6S A;  2DL8 A;  1HXD A;  3TSW A;  2KSS A;  4M78 B;  3CME T;  3QSU A;  2EBP A;  3M0R A;  2JOY A;  5CIU A;  3V7C A;  2FG0 A;  1MMN A;  4C0D C;  6AT1 B;  4O6J A;  2XU8 A;  4PJO E;  3UT1 A;  5GAN g;  5KYY A;  2VB6 A;  4QQ6 A;  2L3P A;  4J9G A;  3H0H A;  2L3Q A;  1S72 T;  4OML A;  3SWN A;  3PTA A;  3E1S A;  2OTJ T;  4PK4 A;  1T3S A;  1PD1 A;  3OW2 P;  2XDP A;  1D3B A;  1H3H A;  2HZY A;  1UEB A;  3M55 A;  3UA6 A;  4J5Y A;  4JJC A;  1Q82 R;  1NJI U;  4JJN K;  4J9F A;  3M54 A;  4M78 E;  1BKB A;  4M78 C;  4JJD A;  2QI2 A;  3I56 T;  4QVD A;  3RMQ A;  1SG5 A;  2DK3 A;  1FX7 A;  3QBY A;  1Q7Y C;  3QWY A;  3V8L A;  1OU9 A;  2AK5 A;  4F7U E;  5GAN 3;  1ZHI A;  4C92 A;  1M3A A;  1VA7 A;  4A63 B;  1KJW A;  2QQS A;  5KYX A;  4XU0 A;  5GAO p;  4E7H A;  3H41 A;  4E47 A;  1FWZ A;  2BE7 D;  3P8H A;  2PNI A;  2VVK A;  5IN1 A;  1JO8 A;  2DBK A;  3CC4 A;  3A98 A;  5FLX E;  3JCM P;  4XU2 A;  1Q86 R;  5FU6 B;  3G6E A;  3CMA T;  3IQL A;  5D6X A;  3CCR A;  2ZPF B;  4FYX B;  4Z88 A;  2GGR A;  2L2P A;  1VQN A;  1VOM A;  2A0F B;  1W2B S;  2CS7 A;  2FPF A;  1X75 C;  3KUF A;  1IXD A;  2PQW A;  4ME7 A;  4ZN1 A;  2LNH B;  2EIF A;  2M0Y A;  5GAM j;  1Z9Z A;  1VQ5 Q;  2LNV A;  2M0O A;  4PJO D;  2DNU A;  4J9B A;  1WHJ A;  8ATC B;  2YSQ A;  3OS5 A;  1M90 C;  2JMC A;  2K2M A;  3AHU A;  1G8X A;  3EFO B;  3SD4 A;  3C4S A;  4AFS C;  1M3B A;  4KUD K;  5FU6 C;  1QCN A;  2QQ9 A;  3SB2 A;  2RF0 A;  2G3R A;  3BDU A;  1M1K R;  3JB9 G;  1Y7X A;  4DBH A;  1NYG A;  1B34 A;  4M78 D;  4JRP A;  2NUT A;  2XG8 D;  5L23 A;  4ESR A;  3JV3 A;  4AG1 C;  2KYB A;  2K5F A;  2DBM A;  4ATO A;  5LJ5 d;  2BZY A;  3VS4 A;  1D1A A;  3RKX A;  5GAM h;  4OMO A;  4QKU A;  7AT1 B;  2ZPE B;  1LPL A;  1OX9 A;  2YUO A;  2X4W A;  2OAW A;  2DD5 A;  3OW2 A;  4FYY B;  3OYI A;  1T3L A;  4EDU A;  4RG2 A;  3HTR A;  4BI8 B;  1KC8 R;  4LN2 A;  4PFZ A;  2DIL A;  1YHQ T;  3OYY A;  3CCQ Q;  5CKF A;  1VQP T;  2E1H A;  3HRS A;  4M78 F;  2DXU A;  3DKM A;  1D1B A;  3CME A;  2QQB A;  2O31 A;  2VKN A;  1WPY A;  4KT0 E;  4PL6 A;  3LX7 A;  4WF2 A;  2W0Z A;  4GBQ A;  5J3B A;  3QDF A;  2KYM A;  1EX4 A;  1S72 A;  4PNO A;  2EQU A;  4R0K A;  1Q81 U;  2IPO B;  4RCC A;  2OTJ A;  2QA4 T;  1YIT A;  3MKD A;  4AFZ C;  2CP3 A;  2HSP A;  2KRM A;  3JCM b;  1BIA A;  3LWH A;  2E70 A;  1BCM A;  2EJG A;  3QWX X;  3HRT A;  2BZX A;  2L89 A;  3UF4 A;  2GNC A;  4ZGE B;  4QQG A;  4M7D E;  3CC2 Q;  4WCI A;  1NE8 A;  2E6Z A;  2MAM A;  2FVU A;  3GPL A;  1OZ2 A;  2YUN A;  4OB0 B;  5KYY B;  2CSI A;  3OB9 A;  1SRL A;  2J6O A;  4Z89 A;  2EPD A;  5GAN 8;  3TSZ A;  2I0N A;  1VQ8 Q;  4M7A B;  1ZA1 B;  1NJI R;  4CRI A;  1MGQ A;  2GFU A;  3RIR A;  3MP1 A;  4J9C A;  1AHJ B;  5GAN j;  2GCX A;  2XDB A;  2KR3 A;  1PNJ A;  4E2F B;  1JJ2 P;  1AWX A;  1X6B A;  3QG1 A;  5FWC A;  3BY7 A;  2E3H A;  4QVZ A;  4LE9 A;  1X43 A;  3J7A F;  2IVW A;  5FW9 A;  2EYZ A;  2LVM A;  1KD1 C;  1OZ3 A;  1YJN T;  2XIC A;  1LVK A;  4M7A C;  3JCM c;  3G71 T;  3VS3 A;  2CGH A;  4N0A A;  1EIF A;  2F5T X;  1M30 A;  2Y4X A;  2XD0 A;  3RKW A;  3CCE Q;  2RNA A;  3G7Z A;  2RHX A;  2DTI A;  3S3M A;  2EWN A;  2YRD A;  3ZL7 C;  1I5O B;  5GAN h;  5GAN e;  4XTX A;  2JVV A;  3VRY A;  1UGV A;  2LJ3 A;  4QT7 A;  4C92 E;  4M7D D;  2RI3 A;  2COW A;  2X4Y A;  2BTT A;  1LNX A;  2RJC A;  2QQR A;  2HBW A;  2VGN A;  3CCU Q;  4C5H A;  1K73 C;  1TSF A;  4JRI A;  2E5Q A;  1PSE A;  2RQU A;  2X3W D;  2FZG B;  3RDV A;  3WVE B;  1M8V A;  3L2Z A;  3QUI A;  1AOJ A;  3G4S T;  2QXF A;  3VS5 A;  3MCA B;  1YHQ A;  3CC7 Q;  1M2V B;  1K0X A;  4M78 G;  4LDU A;  4PFO A;  2VWF A;  1O75 A;  1UFF A;  3LGL A;  1PG5 B;  1K9A A;  4DOW A;  1WI7 A;  1WZO A;  4M7D F;  4IUR A;  1VQ7 T;  1PHT A;  4C8Q B;  2EKO A;  2CP0 A;  4JS4 A;  5LJ3 d;  3A5Z B;  2QEX Q;  2QA4 A;  2A3L A;  4HXJ A;  1OPK A;  2JW4 A;  3JCM J;  4R55 A;  2P84 A;  2CZ7 B;  1K8A U;  4Y92 A;  5GAO q;  1K1Z A;  4HVW A;  3UPU A;  4M77 B;  1QP3 A;  5D7U A;  4EMG A;  3C95 A;  5CCA A;  1OUL A;  2FHD A;  4X34 A;  1UE9 A;  3VU3 C;  4XTZ A;  2RI5 A;  1SEM A;  3RUX A;  1KQ2 A;  3INZ A;  1YJ9 Q;  4C8Q C;  1Y57 A;  1Q81 R;  3KBG A;  2LTO A;  4C92 D;  2VV5 A;  1Y07 A;  1KFZ A;  1MNE A;  2LRQ A;  2O9S A;  4IUP A;  1M9S A;  1NG2 A;  1N9R A;  4M7A F;  3OBY A;  1VQL T;  1IGU A;  1RL2 A;  2QAS A;  3ULR B;  1SHF A;  4M77 E;  3AT1 B;  1VQ4 Q;  1LOJ A;  3A8O B;  4M77 C;  2RA2 A;  2JM9 A;  5I2S A;  2DYI A;  3KXT A;  3CCJ Q;  2RM4 A;  3S3O A;  3VS7 A;  2DET A;  4OMP A;  2YDL A;  3JCM X;  5J26 A;  4BI3 A;  3CXC P;  4IIM A;  2O2O A;  3CCL Q;  4JPB W;  2A28 A;  2AZV A;  1PRM C;  4J83 A;  2AIR B;  3CD6 Q;  5J39 A;  4OB2 B;  1Y0M A;  1PRL C;  1UGP B;  4OB1 B;  1O9S A;  1YJN A;  2WSF E;  2CYZ B;  2XDD A;  4M75 A;  4J6Y A;  1GCP A;  3G71 A;  3I55 T;  3T9N A;  4KH1 B;  1KQ1 A;  2C0I A;  2COZ A;  4R56 A;  3D7S B;  2G6F X;  2OAU A;  4XTV A;  4F14 A;  4NL3 A;  1UJ0 A;  4C0G A;  4OP0 A;  2CDT A;  3PT9 A;  4RTY A;  1XTD A;  3G1J A;  3EG3 A;  2MK5 A;  2EQK A;  2WAC A;  3VV0 A;  5EG2 A;  3JCM W;  2ZCF B;  4JZ4 A;  1ABO A;  2KK4 A;  1UB4 A;  5LJ5 g;  3L2V A;  2JM8 A;  1Q95 G;  5I22 A;  3OSS C;  4ZTF A;  1YWO A;  2DYB A;  2MCN A;  1VYU A;  4ZNX A;  5ECA A;  4FT4 A;  3OYL A;  3FJ5 A;  2RK1 A;  1WJQ A;  2QDL A;  4LDX A;  1SKU B;  2QGG A;  3M59 A;  4Y91 A;  1VYV A;  3VJP A;  1FYN A;  4M77 D;  3G4S A;  4PJO B;  1TOV A;  2HQX A;  2OJ2 A;  1SSF A;  1HYO A;  2NUZ A;  3CC4 Q;  3M4Y A;  4L59 A;  2DTH A;  2HL5 C;  4L5G A;  4ORZ A;  1MUZ A;  1KHI A;  4C8Q F;  4X9D A;  1VQN Q;  2E6N A;  2ESW A;  4GLK A;  2DFU A;  2RQW A;  4L6V 5;  1HJD A;  3PFS A;  3VS6 A;  5GAO r;  1TXQ A;  1YCY A;  4PJO C;  4JDS A;  1YIJ A;  4M77 F;  2L3R A;  5KCH A;  4EMK B;  2DE0 X;  2LCL A;  3QXE B;  4F7U B;  2L0A A;  3CXC A;  5I2M A;  5LJ3 f;  3OYJ A;  2K3Y A;  1Q7Y U;  4QQD A;  1FMW A;  3H0I A;  1N8R C;  1RAC B;  2PVG B;  4XK8 E;  1OV3 A;  1ZQ1 A;  4MMK A;  2DMO A;  1VQ5 T;  3C12 A;  3EHQ A;  4KUL A;  1IHW A;  4KRT A;  2QYZ A;  2DIQ A;  5HCK A;  2DLP A;  2JZ2 A;  4M7A G;  1X6O A;  3P8D A;  1K8A R;  1VQL A;  2FL7 A;  3CCS Q;  3R6O A;  3OYD A;  2F2W A;  2F2V A;  4DEX A;  4EMK C;  1NPR A;  2J06 A;  3GP8 A;  3RER A;  3J81 E;  3CBO A;  3TU4 K;  2E5K A;  2V8I A;  4N4H A;  2LQN A;  3OQ5 A;  2P4T A;  2ZPG B;  2K5I A;  1M3C A;  2DD4 A;  5CR2 A;  1JU5 C;  1MV0 B;  2K57 A;  1VQK T;  1YNZ A;  4CC4 B;  1M90 U;  1PWT A;  4PFP A;  2VXE A;  2D8J A;  1G2B A;  4WTO B;  1U8R A;  1G3W A;  2LQW A;  3EG1 A;  1AZE A;  2E3I A;  1W4S A;  4N4I A;  3I55 A;  3LYI A;  1VUB A;  1VQO A;  1EFN A;  1S72 Q;  1OOT A;  4CC2 A;  1VQ6 T;  1UHC A;  2M02 A;  2OTJ Q;  1YIT Q;  1NLO C;  2NUP A;  3JCM Q;  1RI0 A;  1SF9 A;  5CKE A;  2CRE A;  3OS1 A;  2QTV A;  3A1P A;  3HL8 A;  2A37 A;  4Z8A A;  3VS0 A;  2EYQ A;  4FT2 A;  3R6N A;  3UAT A;  4BAC A;  2ZAE A;  4AFU C;  3CCM T;  5L8R E;  1XJW B;  3UWN A;  4XAX B;  1M1F A;  4RKU E;  1K9M R;  3PIP A;  2X51 A;  2JJ9 A;  1IB8 A;  4J7F A;  2ED1 A;  1OYX A;  4HVV A;  2O4X B;  3GF5 A;  1KIK A;  4PJO F;  1S1N A;  1MND A;  2ROT A;  1WJR A;  1GXI E;  3HRU A;  2DXT A;  1QVG S;  1ZBJ A;  4FW2 A;  2OTL A;  1ARK A;  3L42 A;  2DPP B;  1RAD B;  1GBQ A;  2F69 A;  2YHT A;  3RR6 A;  2M1H A;  4JJB A;  2EYX A;  3CPW S;  1QKX A;  3E9F A;  1OU8 A;  2DRM A;  4C8Q G;  3M0T A;  4M75 E;  1LJO A;  1Y96 A;  3JB9 I;  1H3Z A;  2GBQ A;  2KEA A;  2O01 E;  2RHI A;  2P0K A;  1ABQ A;  1C1A A;  2EQM A;  1J3T A;  5KYU A;  3OY9 A;  1UTI A;  4X9C A;  4JLI A;  2D6F A;  1D0Z A;  3VKI A;  4MDX A;  3EH2 A;  1TUD A;  1BI3 A;  2Y90 A;  1LCK A;  2RQR A;  5LJ3 g;  4M7D B;  1RLQ C;  4M77 G;  4D8D A;  3OMG A;  4F7U F;  3NTH A;  4IIO A;  4BB7 A;  5GAN 6;  2M51 A;  3JCM g;  3QJ6 A;  2AZS A;  2BKD N;  1UHF A;  2J05 A;  2B8A A;  4PLL A;  2ROL A;  2OX7 A;  2DZ9 A;  1SSH A;  1BCO A;  1D0X A;  2RN8 A;  1I8F A;  2JMA A;  3EGD B;  1YJW T;  2MWO A;  2DRK A;  3NPF A;  2HQH A;  3LH5 A;  1VQ5 A;  3X26 B;  1ZSZ B;  2HNI A;  2KRS A;  2VYT A;  3I56 A;  4M7D C;  3FJP A;  2DJQ A;  2MOX A;  3NFC A;  2E4H A;  3QKJ A;  2FYK A;  3CCE T;  1Q7Y R;  1AWJ A;  3LWI A;  1VIF A;  4RTZ A;  2EGE A;  3SHW A;  3SWN B;  1WXU A;  1PKS A;  1QCO A;  2LT4 A;  4FCY A;  3CCV Q;  3EG9 A;  5LJ5 e;  1NM7 A;  1D3B B;  1KD1 U;  1YHQ Q;  3QYH B;  1VQK A;  3CBP A;  1ZSZ C;  2RHY A;  1ZX6 A;  1RAF B;  4JRK A;  3VS1 A;  3OYB A;  1FMK A;  3CMA A;  3M5A A;  2HDA A;  4MZM A;  3GBQ A;  4J7I A;  4M75 D;  3VYH B;  2FZC B;  1OQK A;  3CCU T;  1GCQ A;  2X35 A;  4LXC A;  4HCB A;  5A2Q E;  4FL6 A;  2CZ0 B;  2JTM A;  3ZBD A;  3EGX A;  4GY5 A;  1UDL A;  1YCS B;  4AMC A;  1E7O A;  1NEB A;  3E2U A;  3SWN C;  4C92 B;  2LQK A;  2RK2 A;  4FW1 A;  1VQ6 A;  3L2R A;  3OYM A;  1IGQ A;  2JT4 A;  5KYX B;  5KE3 A;  2OI3 A;  2JS2 A;  3LH0 A;  3LW5 E;  1IO6 A;  3HKS A;  2ZGW A;  3H9N A;  4E7I A;  2XK0 A;  2C0O A;  5GJV B;  1M90 R;  5KH6 A;  3NGP A;  4RTT A;  1QW1 A;  1RAH B;  5GAN 7;  1GFD A;  3FRN A;  1N27 A;  2FPD A;  1TU0 B;  2HBP A;  1V76 A;  3DB4 A;  3JB9 J;  2YUP A;  3CCM A;  1ZSG A;  1TUC A;  3OYE A;  1K73 U;  1YWP A;  5FRM A;  2LC4 A;  3M0U A;  4AG2 C;  2DER A;  2EGC A;  2QEX T;  2A08 A;  1RAE B;  3BE3 A;  4C92 C;  1X2Q A;  4PJO G;  2RB6 A;  3CBM A;  3M4G A;  5AYF A;  2RI2 A;  1QWF A;  4XTW A;  1PM3 A;  2K4Y A;  2CT4 A;  2JXB A;  2K3X A;  1TH7 A;  5LJ5 f;  3OS0 A;  4LNP A;  2RMO A;  4MZP A;  5FU7 B;  1VQ9 T;  5CQY A;  3PE0 A;  2FPE A;  1FMV A;  4KGX B;  1YJ9 T;  3UDC A;  2LJ0 A;  2RJD A;  2FRY A;  2BIV A;  2RJF A;  1VQP A;  4M78 A;  1B34 B;  4O5V A;  1U5S A;  3PGG A;  1GFC A;  2QDY B;  2DVE A;  2K6D A;  3JB9 H;  2NUT B;  1CSK A;  2QGF B;  1M1G A;  2YRC A;  5DLO A;  4C5E A;  2E12 A;  4DOV A;  3EG2 A;  2PTK A;  5EC7 A;  4F7U G;  1YJN Q;  3LGF A;  2NLU A;  3C0C A;  1V1C A;  3EH1 A;  2R58 A;  2KE9 A;  2J6K A;  2COY A;  5FWB A;  3CCJ T;  3SDZ A;  2FO0 A;  5FRO A;  2RHU A;  4D6W A;  3PIO A;  5FU7 C;  4BDZ A;  1OI1 A;  2E64 A;  1PC0 A;  2RO0 A;  3JCM d;  2DO3 A;  1BI1 A;  3EFR A;  5I11 A;  5FRN A;  3OYC A;  2AHJ B;  3WXM B;  1QVF S;  3M0Q A;  1YJW A;  4OMM A;  2ZPI B;  4HCK A;  3BDL A;  1VQM T;  1JJ2 S;  4FM4 B;  2GTJ A;  2KXC A;  2DTO A;  1WYX A;  1CKB A;  3X24 B;  3U23 A;  1KQS S;  4ELY C;  2BUD A;  3L2Q A;  5IHK A;  2EGA A;  5HK3 A;  2MMP A;  4PJM A;  1U1T A;  5IHI A;  1Z9Q A;  2LCS A;  4CC7 A;  5GAM g;  2L3S A;  3S3N A;  1X01 A;  1M4Z A;  3REA B;  2K79 A;  1Q82 C;  1JB0 E;  2HEQ A;  3MEW A;  2RPN A;  3MO8 A;  2PZ1 A;  3G4S Q;  3ME9 A;  1WHL A;  2HL3 A;  2IG0 A;  2L5Q A;  4FSS A;  1P92 A;  3ZEH A;  5LJ3 j;  1WQ7 A;  3A8L B;  2DEU A;  5CKD A;  2HD0 A;  5KYW A;  2C0T A;  1R0B G;  5CO7 A;  2AKK A;  4C92 F;  4E7Z A;  1TWB A;  4OF1 A;  5HY6 A;  2M9U A;  3M0P A;  1PCX A;  3EFS A;  2DJZ A;  4PLI A;  5HK0 A;  5GAO n;  3GNG A;  1Q86 C;  3RES A;  1KD1 R;  2E65 A;  3EFO A;  2DM1 A;  1AD5 A;  1YIJ Q;  3S6W A;  3ASK A;  2MI6 A;  3VS2 A;  2KQW A;  4LUE A;  3RKY A;  1U06 A;  1BU1 A;  1YI2 T;  1OX8 A;  2XKO C;  3ER0 A;  2YRV A;  1WHG A;  3MEU A;  9ATC B;  1C0M A;  1AT1 B;  3JB9 D;  2O88 A;  2F1L A;  2YWW A;  3M58 A;  4AFQ C;  2EVR A;  5LJ3 h;  4II1 A;  5GMK e;  5LJ3 e;  3CPF A;  4FIB A;  3VYG A;  1R77 A;  2X3X D;  4DBF A;  4LDW A;  3QHS A;  5CVI A;  4LD9 K;  3TCJ A;  3JCM e;  1WGS A;  3TRE A;  2YUQ A;  2CP6 A;  1ZUK A;  1M5Q 1;  4EPC A;  4E7K A;  4UC4 A;  4D8K A;  2DL5 A;  1RAA B;  1SRM A;  2QQA A;  2ZZD A;  1VQL Q;  3H8Z A;  4OGE A;  4DEY A;  2KGT A;  2PU9 B;  1M1K C;  2CUD A;  3ZFJ A;  5IXB A;  1GL5 A;  1D0Y A;  1SPK A;  2JTE A;  2KY9 A;  1K9M C;  1RAG B;  1VQ9 A;  2EKH A;  1K73 R;  8AT1 B;  3JB9 F;  2YLC A;  1YJ9 A;  2F2X A;  1R8O B;  1HSQ A;  5C0M A;  2CP5 A;  3O5Z A;  5D6W A;  4XQ3 A;  1W2B P;  1X2K A;  4M7D G;  1RLP C;  3G6E Q;  3CCS T;  4PJL A;  2HCK A;  2QAZ A;  5I21 A;  4F17 A;  3CCR Q;  4DQ2 A;  2DKG A;  1VQ7 A;  4J8O A;  4A4H A;  2LMJ A;  1YFN A;  3X28 B;  2X4J A;  2D0Q B;  3CCJ A;  5AT1 B;  1KHC A;  4N0A C;  1KC8 C;  1VQO Q;  4F04 B;  1N8R U;  3KFV A;  3M0S A;  2CKK A;  4A4K A;  1GBR A;  2DL4 A;  5CKH A;  2PUO B;  4RUG A;  3L2W A;  1G5V A;  5GAN 5;  1JQQ A;  1MMG A;  2E10 A;  2AT1 B;  2KNB B;  1RAB B;  3QYG B;  2YT6 A;  1BI2 A;  1VQM A;  4IUU A;  2QTX A;  1NZ9 A;  2DIG A;  4XU3 A;  3JCM f;  3N5B B;  2JS0 A;  1PD0 A;  4F16 A;  5GMK l;  2FEI A;  2ECZ A;  2X4X A;  1WFW A;  1M2O A;  2B86 A;  1KK7 A;  2V8K A;  5IT9 E;  4YTL A;  4C5I A;  3O8V A;  1JRI A;  2EFI A;  1X6G A;  3PVL A;  2HKQ B;  4Y28 E;  3A8G B;  1F1B B;  5A0G A;  1AEY A;  2F5K A;  1X69 A;  1BI0 A;  1YIT T;  4M7A A;  4Z02 A;  2XMF A;  3EG0 A;  1QVG P;  1JXM A;  2SRC A;  4PJJ A;  4E7S A;  1B3Q A;  5GAM d;  3H6Z A;  3CPW P;  3GNF B;  1TTH B;  4J6X A;  2KBT A;  2OTL Q;  2JTF A;  2VXF A;  4FYV B;  1G3Y A;  1I07 A;  2LZ6 B;  1JBM A;  3L1A A;  3JSC A;  5IHN A;  3X25 B;  2RQV A;  1NLP C;  4C92 G;  2EQJ A;  4K11 A;  1C6V X;  1QVP A;  3TVT A;  2GFA A;  1NJI C;  3MP6 A;  3CME Q;  2K5L A;  4ANJ A;  3I5R A;  3OBW A;  4A4F A;  2ED0 A;  5A0L A;  3FC3 A;  2P4R A;  1QP2 A;  3OA6 A;  2SEM A;  3NTI A;  3V8J A;  2JUF A;  4J9E A;  5DLQ E;  5GJW B;  1I81 A;  1YI2 A;  1NPP A;  2QK0 A;  3PMT A;  1X27 A;  2RQT A;  2K3B A;  3CCQ T;  2HSE B;  2EW3 A;  1NYF A;  2EYW A;  1W2B A;  4RTX A;  2Y4Y A; 
#chains in the Genus database with same CATH homology
 3M53 A;  2LT4 A;  3FIF A;  3PMI A;  1Y71 A;  5LJ5 e;  2A3L A;  2QA4 A;  2HAX A;  4QW2 A;  4DA4 A;  4XTU A;  4M7D A;  3JCM J;  4R55 A;  1D3B B;  2CZ7 B;  5HKC A;  1K8A U;  1KD1 U;  3QYH B;  4C0D B;  2RH2 A;  1VQK A;  1PSF A;  2FB7 A;  3CBP A;  5GAO q;  5D6Y A;  3UPU A;  1VQ4 A;  2RHY A;  4M77 B;  3E19 A;  4JRK A;  3CEY A;  3OYB A;  4B9W A;  1QP3 A;  3CMA A;  3QDR B;  1WQW A;  1IRE B;  3M5A A;  4MZM A;  4FSX A;  4EMG A;  2OTL T;  3EAE A;  1H64 1;  3C95 A;  4J7I A;  4LDY A;  4M75 D;  3VYH B;  2DEQ A;  4M75 B;  4BD3 A;  5CCA A;  2FHD A;  2LT1 A;  2P0P A;  2PVD B;  4C5G A;  4X34 A;  3CCU T;  3VU3 C;  4BY6 C;  5M9O A;  2X35 A;  4HCB A;  4XTZ A;  5A2Q E;  4FL6 A;  2CZ0 B;  2MF2 A;  2JTM A;  4LD6 A;  3ZBD A;  4IUQ A;  2RI5 A;  3HPW A;  3CCL A;  3RUX A;  2VC8 A;  4C0Z A;  1KQ2 A;  3INZ A;  5KE2 A;  4GY5 A;  4C8Q C;  3KBG A;  2LTO A;  4C92 D;  3CD6 A;  4IUV A;  2VV5 A;  1Y07 A;  3GLX A;  1DJ7 B;  2LCC A;  2LQK A;  2RK2 A;  3SWN C;  4C92 B;  2VGM A;  2LRQ A;  3OYM A;  3L2R A;  3CXC S;  3OW2 S;  4OGC A;  4IUP A;  1M9S A;  4B9X A;  5C6S A;  5KE3 A;  1N9R A;  1HXD A;  3LH0 A;  3LW5 E;  1Q81 C;  4M7A F;  3OBY A;  2JNG A;  2KSS A;  3LLR A;  4M78 B;  3CME T;  1VQL T;  3HKS A;  3QSU A;  2JOY A;  2ZGW A;  5CIU A;  3V7C A;  4ELZ C;  3QPH A;  1RL2 A;  3E9G A;  2XK0 A;  4O6J A;  3VUZ A;  4C0D C;  2XU8 A;  1ZBX A;  4E7I A;  3UT1 A;  2WSE E;  4M77 E;  5KH6 A;  3RMS A;  4IKF A;  1LOJ A;  5GAN 7;  3CC2 T;  1QW1 A;  2KDS A;  1XNI A;  1HK9 A;  2A7Y A;  3A8O B;  4M77 C;  2RA2 A;  5GAM e;  1WNL A;  5GAN g;  3CCS A;  4QQ6 A;  3FRN A;  1N27 A;  4C8Q A;  5I2S A;  3KXT A;  1VIE A;  2HBP A;  1S72 T;  3DB4 A;  2RM4 A;  4M75 C;  3SWN A;  3S3O A;  3X20 B;  3CCM A;  1G3S A;  3JB9 J;  1VQ6 A;  3PTA A;  3E1S A;  1I4K 1;  3OYE A;  3JCM X;  1K73 U;  5FRM A;  2OTJ T;  5J26 A;  4BI3 A;  1QVG A;  2LC4 A;  3OYN A;  4E7L A;  3MET A;  3TEE A;  4QVC A;  3GIB A;  2KVQ G;  4HCZ A;  2XDP A;  2QEX T;  1D3B A;  4J83 A;  1VQ8 T;  3GOX A;  3CCV T;  4NS5 A;  3FEO A;  4BUG A;  4C92 C;  4PJO G;  1UEB A;  3MP8 A;  3M55 A;  2RB6 A;  3QO3 A;  3CBM A;  3CPW A;  4M77 A;  2RD1 A;  4J5Y A;  5J39 A;  2KAF A;  3M4G A;  4OB2 B;  5AYF A;  1NJI U;  2RI2 A;  4JJN K;  3M54 A;  4M78 E;  1BKB A;  1UGP B;  4OB1 B;  1O9S A;  4M78 C;  4XTW A;  1YJN A;  2WSF E;  2CYZ B;  2K4Y A;  2EAY A;  2QI2 A;  3BFM A;  4J6Y A;  4M75 A;  4RG8 A;  3RMQ A;  3V7S A;  4QVD A;  3I56 T;  5LJ5 j;  2DK3 A;  1FX7 A;  3QBY A;  5KCO A;  4MZT A;  2K3X A;  3G71 A;  3I55 T;  1Q7Y C;  1TH7 A;  5LJ5 f;  3T9N A;  3WVD B;  3OS0 A;  3V8L A;  5GAN 4;  1KQ1 A;  4MZP A;  5FU7 B;  4F7U E;  4R56 A;  3HP9 A;  5GAN 3;  1VQ9 T;  1U1S A;  2LDM A;  2OAU A;  5CQY A;  4XTV A;  1ZHI A;  1YBY A;  4C92 A;  4NL2 A;  1YJ9 T;  2QQS A;  4NL3 A;  3UDC A;  2RJD A;  2BIV A;  4VUB A;  2RJF A;  4XU0 A;  5GAO p;  4E7H A;  4C0G A;  2HQE A;  4M78 A;  4OP0 A;  1B34 B;  2LX9 A;  4O5V A;  3PGG A;  4E47 A;  1VQP A;  2QDY B;  3M56 A;  5GAN d;  2DVE A;  1FWZ A;  3PT9 A;  3V8K A;  3P8H A;  3JB9 H;  5IN1 A;  1M1G A;  1XTD A;  3CC4 A;  5DLO A;  2EQK A;  4C5E A;  3JRZ A;  2E12 A;  5FLX E;  3JCM P;  4XU2 A;  4DOV A;  5GAO m;  2PVO B;  2WAC A;  3VV0 A;  2EJ9 A;  5EG2 A;  3JCM W;  4F7U G;  2ZCF B;  3LGF A;  5FU6 B;  3HFN A;  3MEV A;  2NLU A;  3G6E A;  3CMA T;  5LJ5 g;  4TVR A;  2KK4 A;  1UB4 A;  5DY9 A;  3OYA A;  3L2V A;  5D6X A;  3CCR A;  3HSB A;  2R58 A;  2ZPF B;  4KBM B;  4ZTF A;  3OSS C;  1VQN A;  3CCJ T;  1W2B S;  3SDZ A;  5FRO A;  2CS7 A;  2RHU A;  4D6W A;  3OSV A;  1X75 C;  3PIO A;  3M9Q A;  4ZTJ A;  4KUI A;  5FU7 C;  3KUF A;  4FT4 A;  3OYL A;  2PQW A;  5LJ5 h;  1OI1 A;  4ME7 A;  2RK1 A;  1WJQ A;  2DXB A;  4ZN1 A;  2EIF A;  2E64 A;  5GAM j;  2V8J A;  2RO0 A;  3JCM d;  2DO3 A;  1BI1 A;  3EFR A;  3QII A;  4LDX A;  5GAM f;  3M59 A;  4Y91 A;  5FRN A;  4BE1 A;  2LNV A;  2P0Q A;  2AHJ B;  2M0O A;  3WXM B;  3OYC A;  3VJP A;  4PJO D;  1QVF S;  4M77 D;  3G4S A;  4PJO B;  3OYK A;  1YJW A;  2ZPI B;  2HQX A;  3BDL A;  1VQM T;  1M90 C;  2YLB A;  3OS5 A;  1SSF A;  4FM4 B;  1JJ2 S;  2KMT A;  4CI0 C;  3M4Y A;  2DTO A;  2VUB A;  4L59 A;  3X24 B;  3OYG A;  3AHU A;  4HCC A;  1KQS S;  4OVA A;  2DTH A;  3SD4 A;  3C4S A;  4L5G A;  4ELY C;  4KUD K;  5FU6 C;  2BUD A;  2QQ9 A;  4MDW A;  3SB2 A;  3L2Q A;  2G3R A;  4BE0 A;  1KHI A;  3BDU A;  5HK3 A;  2MMP A;  4C8Q F;  4X9D A;  3JB9 G;  1U1T A;  2E6N A;  1Y7X A;  2GF7 A;  4GLK A;  3HHT B;  1B34 A;  4L6V 5;  3CC7 T;  5GAM g;  3S3N A;  4M78 D;  4JRP A;  1X01 A;  3CCQ A;  2XG8 D;  3PFS A;  1M4Z A;  2R5A A;  5CQX A;  1Q82 C;  1UGS B;  2K5F A;  5GAO r;  4ATO A;  1JB0 E;  5LJ5 d;  1UGQ B;  3MEW A;  4EMH A;  1YCY A;  5GAO l;  3RKX A;  3MO8 A;  3FLG A;  1XQH A;  3ME9 A;  5GAM h;  4PJO C;  4JDS A;  4XTY A;  1YIJ A;  1BYM A;  4BDZ A;  3MEA A;  4M77 F;  2IG0 A;  2L5Q A;  2L3R A;  5KCH A;  4EMK B;  1P92 A;  4PKC C;  2LCL A;  3QXE B;  2ZPE B;  3ZEH A;  1WJS A;  3SFM A;  4F7U B;  5LJ3 j;  4HT8 A;  4M7A E;  4M75 F;  2X4W A;  2DD5 A;  1WQ7 A;  2LQ8 A;  3CXC A;  5I2M A;  3OW2 A;  3A8L B;  5LJ3 f;  3OYI A;  2K3Y A;  3OYJ A;  1Q7Y U;  4NOY A;  5CKD A;  4EDU A;  4RG2 A;  4QQD A;  2HD0 A;  2R5M A;  4BI8 B;  1N8R C;  5CO7 A;  2PVG B;  4FU6 A;  4XK8 E;  1V29 B;  4C92 F;  4PJO A;  1ZQ1 A;  4MMK A;  1FXX A;  3C94 A;  1YHQ T;  4OF1 A;  5HY6 A;  1VQ5 T;  3C12 A;  2M9U A;  3OYY A;  4KUL A;  2MWP A;  3EFS A;  5CKF A;  3DLL A;  2DIQ A;  4E7J A;  1VQP T;  4BDY A;  2DJZ A;  4PLI A;  5HK0 A;  2E1H A;  3HRS A;  2JZ2 A;  4M78 F;  2DXU A;  5GAO n;  2R57 A;  3GNG A;  1Q86 C;  3DKM A;  3RES A;  4M7A G;  1X6O A;  2E65 A;  3P8D A;  3V7R A;  2L8D A;  3A8M B;  1VQL A;  2FL7 A;  2QQB A;  3R6O A;  3S6W A;  1UGR B;  3ASK A;  3OYD A;  2MI6 A;  3CME A;  1WPY A;  2KQW A;  4KT0 E;  4PL6 A;  5CKB A;  4EMK C;  1NPR A;  3LX7 A;  3RKY A;  3GP8 A;  3RER A;  4MML A;  3J81 E;  3CBO A;  1YI2 T;  2XKO C;  3CC2 A;  1BIB A;  3ER0 A;  2YRV A;  3MEU A;  4BE2 A;  4WF2 A;  1G3T A;  5CK9 A;  5J3B A;  3TU4 K;  2XHC A;  3JB9 D;  2V8I A;  4HA8 A;  1S72 A;  4PNO A;  3M58 A;  2EQU A;  5LJ3 h;  4II1 A;  4N4H A;  5GMK e;  5LJ3 e;  3OYH A;  3CPF A;  4FIB A;  3OQ5 A;  4RCC A;  3VYG A;  1Q81 U;  2P4T A;  2ZPG B;  2OTJ A;  2QA4 T;  3MHX A;  4LDW A;  2K5I A;  3QHS A;  1YIT A;  2XI9 A;  2DD4 A;  5CVI A;  4LD9 K;  3TCJ A;  4JUV A;  3URG A;  2PUK B;  5CR2 A;  3JCM e;  5A0D A;  1WGS A;  3JCM b;  2K57 A;  3TRE A;  1VQ8 A;  1VQK T;  1BIA A;  4EMK A;  3CCV A;  1M5Q 1;  2I2L A;  3LWH A;  1VQ4 T;  4EPC A;  4E7K A;  2E70 A;  4UC4 A;  4F7U A;  1M90 U;  2EJG A;  4JS5 A;  2VXE A;  2WSC E;  3HRT A;  2QQA A;  2ZZD A;  3J80 E;  4RMO A;  5GMK i;  2L89 A;  2E41 A;  3F70 A;  3H8Z A;  3HFO A;  4OGE A;  4ZGE B;  4PJO E;  1U8R A;  1G3W A;  4QQG A;  4M7D E;  2PU9 B;  1M1K C;  3ZFJ A;  1W4S A;  4N4I A;  3I55 A;  1NE8 A;  3LYI A;  4ZN3 A;  3CCL T;  2E6Z A;  1VUB A;  2MAM A;  1VQO A;  1N9S A;  2FVU A;  3QJY A;  2C06 A;  2KY9 A;  3GPL A;  1K9M C;  1OZ2 A;  1VQ9 A;  3CD6 T;  4OB0 B;  1VQ6 T;  3JB9 F;  3OB9 A;  2YLC A;  2DZC A;  1YJ9 A;  4OB3 B;  1IZ6 A;  1Y96 B;  1R8O B;  3JCM Q;  3QZ9 B;  5GAN 8;  1Q82 U;  1RI0 A;  5CKE A;  5C0M A;  5D6W A;  3OS1 A;  4M7A D;  4XQ3 A;  3HL8 A;  4M7A B;  4M7D G;  2CZ1 B;  2EYQ A;  4CRI A;  3CCS T;  4FT2 A;  1YIJ T;  1I5L A;  1MGQ A;  4BAC A;  5I21 A;  2GFU A;  3RIR A;  3MP1 A;  4DQ2 A;  2DKG A;  1VQ7 A;  1AHJ B;  2GQV A;  4J8O A;  4A4E A;  3L2U A;  3CCE A;  4A4H A;  5L8R E;  4BI4 A;  3CCM T;  1QVF A;  3X28 B;  2X4J A;  5GAN j;  2GCX A;  2XDB A;  3UWN A;  2CZ6 B;  4XAX B;  1M1F A;  2D0Q B;  4RKU E;  1JJ2 A;  3PIP A;  5GAN f;  4A54 A;  3CCJ A;  1KHC A;  4N0A C;  4A53 A;  1KC8 C;  3QG1 A;  4IUT A;  3JCM V;  4J7F A;  1N8R U;  1OYX A;  3BY7 A;  4QVZ A;  2CKK A;  2O4X B;  1KQS A;  3GF5 A;  4A4K A;  5CKH A;  4V2S A;  4C8Q E;  3J7A F;  2PUO B;  4HKE A;  4PJO F;  5LL6 S;  2IVW A;  4P5N A;  2LVM A;  3L2W A;  1XOV A;  5GAN 5;  1K8A C;  1WJR A;  1KD1 C;  1G5V A;  1GXI E;  1OZ3 A;  3HRU A;  3P8B B;  2E10 A;  4RCB A;  5GMK j;  1YJN T;  2DXT A;  4C0F A;  1Q86 U;  2XIC A;  3QYG B;  1QVG S;  1BI2 A;  1VQM A;  4M7A C;  4IUU A;  3JCM c;  2QTX A;  1NZ9 A;  3G71 T;  2DIG A;  4XU3 A;  4OMF B;  2OTL A;  2CGH A;  3L42 A;  4N0A A;  2DPP B;  3JCM f;  3N5B B;  1EIF A;  2F69 A;  3CCU A;  2YHT A;  2F5T X;  2M1H A;  2Y4X A;  3CPW S;  2XD0 A;  3RKW A;  4A4G A;  4ZGD B;  5GMK l;  3E9F A;  2X4X A;  2XDD A;  3G7Z A;  2V8K A;  2RHX A;  2DTI A;  4YTL A;  4C5I A;  3O8V A;  4C8Q G;  1JRI A;  5IT9 E;  2EFI A;  2EWN A;  1LJO A;  4M75 E;  3S3M A;  1Y96 A;  3JB9 I;  1H3Z A;  4Y28 E;  3A8G B;  2O01 E;  2RHI A;  5A0G A;  2F5K A;  2P0K A;  2EQM A;  3OYF A;  5GAN h;  1BI0 A;  5GAN e;  3CC7 A;  4XTX A;  4Z02 A;  1YIT T;  2JVV A;  4M7A A;  3NTK A;  3OY9 A;  4X9C A;  4JLI A;  2K2V A;  3VKI A;  3CC4 T;  4JRQ A;  2D6F A;  4MDX A;  1BI3 A;  2Y90 A;  4Q5W A;  4C92 E;  4M7D D;  3DB3 A;  5LJ3 g;  2RI3 A;  4M7D B;  3DLM A;  4M77 G;  2X4Y A;  5GAM d;  3G6E T;  3OMG A;  4F7U F;  3NTH A;  1N6A A;  3H6Z A;  4BB7 A;  5GAN 6;  2ZPB B;  3FDR A;  3GNF B;  4HT9 A;  3CCR T;  3JCM g;  4J6X A;  3PNW C;  1LNX A;  3QJ6 A;  2RJC A;  2QQR A;  2BKD N;  2JTF A;  2VXF A;  4J6W A;  4M75 G;  1VQN T;  2VGN A;  3Q1J A;  5GMK h;  2M16 A;  1G3Y A;  1M1K U;  4C5H A;  2B8A A;  4JLG A;  1K73 C;  3QZ5 B;  4JRI A;  2RHZ A;  4N4G A;  2E5Q A;  1PSE A;  4PLL A;  3JCM h;  1JBM A;  3L1A A;  3JSC A;  3WVE B;  2O4X A;  3JAM E;  1M8V A;  1VQO T;  3X25 B;  3L2Z A;  3A8H B;  3QUI A;  4LDV A;  1K9M U;  2QEX A;  2DZ9 A;  4C92 G;  1I8F A;  3G4S T;  3OMC A;  2D9T A;  2EQJ A;  1YJW T;  3BW1 A;  2MWO A;  2QXF A;  1QVP A;  3MCA B;  1YHQ A;  1VQ5 A;  4ZGJ B;  5CAI A;  3X26 B;  2GFA A;  1NJI C;  2H3J A;  2HNI A;  3MP6 A;  4M78 G;  1MHN A;  4LDU A;  2K5L A;  2VYT A;  2ZPH B;  3OBW A;  1O75 A;  4A4F A;  3M57 A;  2XID A;  5A0L A;  3LGL A;  3OS2 A;  3I56 A;  3FC3 A;  1QP2 A;  3OA6 A;  4DOW A;  2RJE A;  3FJP A;  4M7D C;  4M7D F;  3NTI A;  4IUR A;  3V8J A;  2JUF A;  5GAN 2;  2DXC A;  2EJF A;  5DLQ E;  4BY6 B;  2JN0 A;  1I81 A;  1VQ7 T;  3NFC A;  3QKJ A;  5GMK m;  2FYK A;  1YI2 A;  3CCE T;  1KG1 A;  1NPP A;  3LWI A;  1VIF A;  3PMT A;  4C8Q D;  4C8Q B;  2EKO A;  2DAQ A;  4XU1 A;  3SWN B;  5DM7 R;  3CCQ T;  3VUB A;  4JS4 A;  1KC8 U;  3FB9 A;  5LJ3 d;  5IAY A;  1W2B A;  3A5Z B;  2Y4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...