4PJOC

Minimal u1 snrnp
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
86
structure length
86
Chain Sequence
GSGSVKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Splicing
molecule keywords Small nuclear ribonucleoprotein Sm D3
publication title Crystal structure of human U1 snRNP, a small nuclear ribonucleoprotein particle, reveals the mechanism of 5' splice site recognition.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 86
sequence length 86
chains with identical sequence Q, c, q
ec nomenclature
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4pjoC00
2VXEA 1B34A 1I81A 5LJ5g 4PJOA 4XU0A 3HSBA 4XQ3A 1JBMA 4C8QB 5GMKj 4M77B 4M78F 2CGHA 4XTWA 5LJ3g 5LJ3d 4C8QE 4M75G 2EJGA 4M77E 3GIBA 4XTZA 1U1TA 4M7AA 4C92G 1WQ7A 5GMKh 5GANh 5GANj 1WQWA 2RM4A 5GAOn 1MGQA 3RERA 1HXDA 1M5Q1 3BY7A 1JRIA 2EJ9A 3SWNC 1KQ1A 2YLCA 3RESA 2YLBA 4EMKB 4QVDA 5I21A 4M78A 3JCMW 3JCMP 2DTOA 4XU3A 5GAOl 3QUIA 4M7DC 2DZCA 1Y96B 4J6YA 3JCMc 4N0AC 4F7UB 3FIFA 2E1HA 3JB9H 4M7DD 1WPYA 4F7UE 5GMKm 3BDUA 4M7DB 5LJ3f 4C8QC 3QSUA 4M77C 3JCMV 5GMKe 4M7DE 4M75D 4RCCA 3EFSA 2Y90A 3V8JA 4A54A 4F7UF 5GAN4 4M75B 5GAOr 3RKWA 3FJPA 3JB9J 4M75E 4M7DF 1U1SA 3JB9I 1I8FA 4PJOG 2DTIA 5GAN8 2E64A 4XTXA 3JCMQ 5GMKi 4EMKC 5GAN5 2EAYA 4C8QF 4M77F 1H641 4HT9A 4M7AG 1WNLA 2E65A 3RKXA 3SWNA 1KQ2A 1Y96A 5GAMj 3AHUA 1LOJA 3QO3A 4NL3A 4V2SA 3V8KA 4HA8A 2I2LA 4J6WA 5GAMh 2EWNA 5GMKl 3JB9G 2VC8A 1N9SA 4N0AA 4OP0A 3JCMh 5LJ5j 3SB2A 5GAOq 4M78G 3HFOA 1D3BB 1I4K1 1TH7A 2DTHA 3L2ZA 4M75C 2RA2A 4M77A 4C8QA 4EMGA 5GAN6 5CAIA 4WF2A 3INZA 4JRIA 2RD1A 4XTYA 4XU1A 4C92C 5GANe 5LJ5h 4X9DA 5GANf 4HT8A 4JRKA 4C92D 3PGGA 1B34B 5DY9A 4C92B 4M7AD 2E10A 4JLIA 4C92E 4EMHA 5GANg 3L1AA 4EMKA 4M7AB 5LJ5d 5GANd 2DVEA 2VXFA 4M75F 4M7AE 4MMKA 1N9RA 4QVCA 4C92F 3HFNA 3JCMe 2YHTA 4NOYA 3JB9D 4A53A 3QHSA 3JCMf 4MMLA 4F7UA 4XTVA 5GAN2 4M78D 3RUXA 2HNIA 4XU2A 5GAMg 2DXTA 4M7DA 1LNXA 4M78B 5GAMd 3JCMg 3RKYA 4M78E 5GAN7 4JUVA 4X9CA 4C8QD 3JCMd 1M8VA 2JN0A 5LJ3j 3JB9F 4M75A 3V7CA 2FYKA 4Y91A 4C92A 4PJOC 4XTUA 1BIAA 5LJ3h 5GAOp 1HK9A 3M4GA 4C8QG 3JCMb 4M77G 2DXUA 4PJOD 4M7AC 3BFMA 4PJOB 3V8LA 1X01A 3RIRA 4PJOE 1I5LA 3EFRA 3JCMX 2DZ9A 2QTXA 1BIBA 4NL2A 5GAMe 2RB6A 3BW1A 4PJOF 3FB9A 5GAMf 5GAN3 2ZGWA 4M78C 4PNOA 4J5YA 3JCMJ 2DKGA 3SWNB 2E41A 4M7AF 1D3BA 1YCYA 2K57A 5LJ5e 2DJZA 4J6XA 5LJ3e 1LJOA 5GAOm 5LJ5f 2FB7A 4F7UG 2DEQA 3V7SA 4RCBA 3V7RA 4DQ2A 2EJFA 4M7DG 3VU3C 4M77D
chains in the Genus database with same CATH superfamily
4XQ3A 4M75G 2MAMA 2OAUA 1VQ8Q 3THKA 2QDYB 4ZN1A 3I56Q 2LQ8A 3UATA 4QVDA 5EG2A 1X2QA 4Q5WA 5KYNA 1ABOA 4MZMA 4LUEA 1VQMT 4M75D 2NUPB 5CVIA 3UF4A 1NZ9A 3CPWA 2L3QA 1Z9QA 2QEXT 4O6JA 1M3CA 4PJOG 5C6SA 1GCQC 4ZGEB 3G71Q 1G3YA 1WHMA 5CKDA 4OGCA 2K2MA 5AYFA 1X6GA 2HSEB 2K79A 5HY6A 2RI2A 5GAMh 2D0QB 2VC8A 4RTYA 2AZSA 4C0FA 2HDAA 4LE9A 5CO7A 1OI1A 2ZPGB 1NYFA 3INZA 4XTYA 4C92C 4R56A 3C4SA 1SSHA 4C92B 1SSFA 2P84A 1LVKA 1UGQB 3CC7A 3JCMe 3EGDA 3CC2T 3QZ9B 2LT4A 2OI3A 3VKIA 2MOXA 1I0CA 4M78B 4JUVA 3M0PA 4Y91A 2EYYA 5LJ3h 2AIRB 2HL3A 3QXEB 5IXFA 1JU5C 2QXFA 3RNJA 1UGVA 3LYIA 1G5VA 3JCMX 1X43A 2VB6A 2K5FA 4JPBW 1K76A 4BY6C 4F14A 1QP2A 1YCYA 1N6AA 4BY6B 2L5QA 3V7SA 4M7DG 3CEYA 5LJ5g 2RI5A 5GMKj 3KUFA 3G71A 1RL2A 4FM4B 3CCSQ 4JLGA 4RG8A 3VS0A 3BE3A 2DL4A 2PQWA 4ZTFA 1MMNA 2BZYA 1WJRA 2MK5A 2MYSA 1KK7A 3JCMP 1JJ2P 2KQWA 4M7DD 3FIFA 5GMKm 1WXUA 2YUOA 1QWEA 2CYZB 4RCCA 2ATCB 3WVEB 5GAOr 2D6FA 3SHWA 2KI7A 1N8RU 2MI6A 1I8FA 3VS1A 4EMKC 4Z02A 1NBEB 1M2VB 4C0GA 1WDXA 2VGMA 4BB7A 2XK0A 3CPWP 4J9GA 1KD1C 5FRMA 1WXTA 4CRIA 3CCUT 4M75C 3H0IA 1GRIA 1VQOA 4C92E 5IXBA 3L1AA 3HTRA 3A8HB 2KY9A 4IUUA 3HKSA 4C92F 4II1A 1TUDA 4NOYA 3M59A 2HBPA 2PVGB 3E19A 3QHSA 2NUZA 2XG8D 2HNIA 5CQYA 4HCKA 1GBRA 2ZPHB 2RJDA 2G6FX 4M78E 2CP2A 4LDVA 4FSXA 2RF0A 2QQ9A 4PJOC 2DD4A 1XNIA 4XK8E 2EQKA 1GL5A 2RN8A 3WVDB 4HVVA 4PJOB 1G8XA 2RQWA 1IGUA 1F1BB 1QQJA 1B3QA 1D0XA 3OYEA 2QDLA 3JAME 1WHHA 2RJEA 1CSKA 1ZSGA 4BACA 1I81A 2CSQA 3HRUA 2OTLT 3KFVA 4OB2B 4XTWA 2EQJA 5CIUA 4NS5A 3NTHA 2P0PA 4M7AA 3GF5A 2KK4A 2A36A 1JXMA 5GAOn 1M4ZA 1BBZA 2XDPA 4E7KA 1JRIA 2V1QA 2YLBA 2EGAA 3KXTA 1VQ6T 2EKOA 3LGLA 2FPDA 3QYGB 1WX6A 2X3XD 3QWXX 4PJJA 1VQ8T 2DD5A 3LH5A 1W2BS 3I56T 4CC2A 1R0BG 1KC8R 2V26A 2KSSA 3I55A 1KC8U 1PNJA 1TS9A 3CXCA 1ZBJA 1WHJA 1PKSA 2CP3A 5I2MA 1UTIA 1FMKA 3OQ5A 1TUGB 4QVZA 1Y96A 2FEIA 1Y7XA 1G3WA 2CKKA 4PFPA 1HJDA 3PIOA 2W10A 2O2OA 4ZN3A 1VQLA 2O88A 5CAIA 4XU1A 1ZQ1A 2CUBA 4JRKA 2PVOB 1VQ5Q 2RHUA 4FSSA 1W70A 3TSZA 3H6ZA 3CCVQ 2L3RA 4M75F 2KR3A 1GXIE 1VQ9Q 4AMCA 3M0RA 2YSQA 3LLRA 4F7UA 4JZ3A 2CREA 4RTXA 1UDLA 1T0JA 1QKXA 1UHFA 1UFFA 2EGCA 1AVZC 4XTUA 5KYXB 2RJCA 3MO8A 3CCLT 2YDLA 1VQKT 2RHIA 2HMAA 4QKUA 3FJ5A 1ZSZB 1D0ZA 4RTVA 1PG5B 4PJOE 2RH2A 3EFOA 3VV0A 2DPPB 5IN1A 4PJOF 2DEUA 2DILA 4ORZA 2DJQA 1I1JA 3NHNA 2JMCA 2M0OA 4PFOA 4C5GA 2YRDA 2MPXC 5DLQE 3QDRB 3J81E 1R8OB 3GIBA 1SPKA 3CCMQ 4PL6A 5I22A 3A8MB 2KRNA 1W6XA 2X4YA 3LH0A 1NJIC 1G3TA 1YWPA 2E4HA 3BY7A 1NG2A 2JOYA 3SWNC 2BUDA 2KEAA 3ZL7C 1VQ4T 5KYYB 1MUZA 1AEYA 2JTEA 3H0FA 5CKEA 1KD1R 1VQ5A 1KG1A 3QSUA 1KD1U 1UJ0A 2XHCA 4KH1B 3CCVA 3H0HA 3FJPA 2KAFA 1VQ9A 3JB9I 5HK3A 1IGQA 1WA7A 4HT9A 2LCCA 4HCBA 4FYWB 1BU1A 3VRZA 2EPDA 2L3SA 1M1KR 2DL3A 2ZCFB 5L23A 1BKBA 2CP0A 4BUGA 3HFOA 2KBTA 3CXCP 4OMPA 1TH7A 2E5KA 3HHTB 4E2FB 2HKNA 3H8ZA 3OS1A 1Q82R 4EMHA 1OOTA 4OB0B 2PUKB 2DK3A 1N9RA 3HFNA 2RJFA 4KGXB 1YJWA 1PC0A 5FU6C 4XTVA 2X4WA 3NTKA 4MDWA 3PVQA 2M9UA 1CKAA 3P8HA 3VS5A 1KQSS 3RKYA 5FU6B 3CMEA 5CK9A 2EIFA 3M0QA 2RHZA 3CCMA 2CS7A 2D9TA 4AT1B 2DBMA 2JW4A 5GAOp 2J7IA 5A0DA 3JCMb 4J9HA 4LUDA 1EZZB 2D0NA 2QQBA 3HL8A 2DKGA 2VUBA 4O5VA 1D3BA 3HPWA 1MNEA 2JTFA 2ZPIB 3F70A 5A0LA 4L6V5 2WACA 3CCEQ 2CP7A 2WSEE 1VQ7Q 1KHIA 2C0IA 2CZ0B 4C8QB 4M77B 4A63B 3MEVA 4MDXA 2NWMA 4IURA 5GANh 2FRYA 3G4SQ 1MGQA 1WZOA 2XKOC 4FW1A 4DBFA 4XU3A 2KROA 2M0YA 4KBMB 2J06A 4ZGJB 3OYKA 2RQUA 3A1PA 4AG2C 4K11A 2KE9A 3OB9A 3S3MA 4PJNA 2R58A 4A54A 2KYMA 2HD0A 3A8GB 3JB9J 2CZ1B 2R57A 5HK0A 2DXCA 4J9BA 4GLMA 2QEXA 2ED0A 1NM7A 3V8KA 1R77A 3LWHA 1U06A 1UGSB 1N9SA 3G6EA 1TXQA 1AWJA 1K1ZA 3EG9B 1IO6A 1I4K1 2CT4A 2PZ1A 4M78G 3S3OA 4B9WA 1J3TA 1FWZA 4WF2A 4A4KA 1D09B 1JEGA 4C92D 5CR2A 4C5EA 2BZ8A 5GANd 1RADB 4LNPA 2YUPA 3CCQT 1VQ7A 4M78D 3QWYA 3H9NA 2X3WD 3ASKA 1EX4A 2XDDA 1RACB 3JB9F 3SD4A 4Z8AA 1Z9ZA 3MJXA 2KNBB 2FL7A 3MPUB 2COWA 3A5ZB 1UECA 2NLUA 4E7IA 1IZ6A 2RQRA 3SDZA 4ELZC 1ARKA 2GFAA 2RB6A 2FZCB 3RBBB 1TUCA 2Z0WA 2LQKA 2DEQA 2EJFA 2QGGA 1H92A 2MWPA 3EAEA 2DVJA 3OBYA 1RAIB 2DYBA 4C8QE 4M77E 4F04B 5D7UA 2VVKA 3MKDA 4AFUC 4OMOA 1I07A 1QVGA 2YLCA 1Q86R 4D8DA 1IREB 1E7OA 2BTTA 3M0TA 1H3ZA 2EBPA 3EGDB 4J6YA 1YI2Q 4FL6A 2YUNA 1NPPA 5M9OA 1WPYA 2F1LA 4D6WA 2WSFE 1WHLA 2EQUA 2Y90A 2K5IA 4IUTA 3EG0A 3RKWA 2QQSA 1WLPB 2HQXA 2E64A 1BCOA 3OYFA 2K9GA 3CC4Q 5GAN5 4PJLA 1H641 1WNLA 2HBWA 1WI7A 2D8HA 2DL8A 4KT0E 1K9AA 4HA8A 2EWNA 4OP0A 3REAB 1N27A 2BKDN 1RI9A 3L2ZA 2DA9A 1S72Q 2YRVA 4PJMA 2PUOB 2DAQA 3EG2A 1XOVA 2KMTA 2RQVA 1A0NB 1QCOA 2G3RA 2CZ6B 2DNUA 4MZTA 5I11A 4QVCA 3M58A 3PNWC 4DBRA 5GAN2 2MWOA 3RUXA 1AOJA 1OULA 4C0DC 5GAN7 3JCMd 4C0DB 2GNCA 2HEQA 1YJ9A 4FT4A 1KC8C 2OJ2A 4PJOD 1AD5A 3A8OB 3GBQA 1GFCA 3OSVA 4F16A 1AHJB 6AT1B 1V29B 2BIVA 2QTXA 2VWFA 1RAEB 3MP6A 1YI2A 3BW1A 1VQNT 2A28A 3MEAA 1C0MA 2ZGWA 4M78C 2LC4A 1SHGA 5LJ5f 5CKBA 2QG9B 1G3SA 3CC4A 4VUBA 2EJGA 2JMAA 4XTZA 3CCET 2OTLA 2BZXA 4RUGA 1E6HA 4RTZA 3WXMB 1QLYA 3RESA 1VQOQ 4P5NA 1VQPQ 1X69A 1MHNA 3QUIA 2O4XA 1S72A 3G4ST 2A7YA 1UG1A 1RI0A 2E1HA 2RK1A 4FW2A 3BDUA 2DRKA 2LX9A 1K9MC 1SG5A 1QVGP 1RAHB 1SF9A 2DTIA 1KJWA 2JXBA 1YITA 2COYA 3VYHB 3QO3A 4NL3A 5KCOA 2I2LA 3M4YA 3FRNA 3QG1A 2K7AA 1UGPB 5DY9A 4AG1C 2E10A 4JLIA 1R0CB 2QI2A 5GANg 1GCQA 2RI3A 3ER0A 2FPEA 2KT1A 1OPLA 4M7AB 4LDXA 2ENMA 1BI3A 4MMKA 2KVQG 4J9CA 1YN8A 3VS2A 1MMAA 2LTOA 1QCFA 4X34A 2DXTA 3MEWA 2GTJA 3HP9A 4PLIA 1ZUKA 1O9SA 4C92A 1V76A 1HD3A 2DL5A 1WXBA 2JVVA 2L2PA 2LJ1A 2XU8A 3V8LA 1X01A 5KYWA 2VGNA 1VQPA 3EFRA 5A2QE 3R6NA 3OSSC 4C0ZA 3I55Q 1D1BA 2GQIA 3QPHA 1KSWA 1G83A 3META 4DOVA 4QQDA 1WIEA 1XQHA 2GTOA 1M1KC 1Q81R 5LJ3e 1LJOA 5D6WA 4E7HA 3V7RA 1B34A 5D6YA 2CT3A 4OMLA 4M78F 2JTMA 3CD6Q 2QAZA 2H3EB 5GMKh 4J9IA 5EC7A 1VQLQ 4JRQA 1Q82C 1K8AC 1M5Q1 1TU0B 4KRTA 2LJ0A 2J05A 2V8KA 2DX1A 4QQGA 1UHCA 4C5HA 4F7UB 2QA4A 4HCCA 1MV3A 1RLPC 4PK4A 3OW2S 2YXYA 1W4SA 1KFZA 3TSWA 1YHQA 4WTOB 1ACMB 2IPOB 3CC7T 4J7FA 2KRSA 3EGUA 1PRMC 1MMDA 3EFOB 4ZGDB 1EIFA 3L2VA 5FW9A 4D8KA 4OMQA 3E9GA 3JB9G 3EH2A 4JS5A 2M16A 2LRQA 5KE2A 1RUWA 2DTHA 3DB3A 4EMGA 1FMVA 2L3PA 4HT8A 1M30A 5IH2A 3M54A 2RHXA 2AKLA 2YUQA 2P0QA 4EMKA 2EQIA 3FEOA 4M7AE 3OYNA 1ZLMA 3JB9D 1I5OB 3UWNA 4RTWA 5HKCA 1U3OA 4BI4A 2IVWA 1M90R 2K2VA 3JCMg 1M90U 3G71T 3CD6A 4X9CA 4M75A 4C8QG 4CC7A 4M77G 1H3HA 4JZ4A 4BE1A 3J80E 1BIBA 4NL2A 5LL6S 3CMAA 4IIMA 3D7SB 2CH4W 5GAMf 3GP8A 1QP3A 4ESRA 4J6XA 2ZPFB 1K9MR 1OEBA 3VU3C 1WHKA 4M77D 4C8QD 1K9MU 4PJOA 1ZSZC 2JUFA 4BDZA 2B8AA 3X26B 1W2BA 3OY9A 1YIJQ 3C94A 1HXDA 3P8DA 1PRLC 5HCKA 5I21A 1IRXA 2MF2A 1BI2A 2KRMA 3LGFA 1QVFS 1OZ3A 4N0AC 3JB9H 3CCRQ 1UUEA 4F7UE 3OYDA 2KXDA 5KYUA 1ZUYA 1TG0A 1YJWQ 5LJ3f 2P4TA 3PVLA 3LW5E 4F7UF 3EG3A 3TREA 2K3YA 2O31A 4KGVB 4BI8B 3CMEQ 3MHXA 3U23A 4RMOA 3OS0A 1T0HA 2MMPA 2EAYA 8ATCB 1K0XA 2ROLA 1C1AA 2I0NA 2F5TX 2X35A 2EW3A 2ZZDA 3MEUA 3UT1A 1TTHB 2KYBA 3CCST 1FXXA 2AZVA 4RKUE 5AT1B 2ED1A 5LJ5j 3MP1A 3OA6A 3CCJA 1D3BB 1PD0A 3UDCA 2OTJA 2RPNA 4JRIA 2P4RA 1DJ7B 1PM3A 4GY5A 5GJVB 1BCMA 7AT1B 4OB1B 1G2BA 1WFWA 5KH6A 2DYIA 1Q86C 1WGSA 2W0ZA 4JS4A 4XU2A 5A0GA 4M7DA 1LNXA 8AT1B 3CCQA 1M1KU 2LCSA 3V7CA 1NEGA 4GLKA 1OU9A 4N4IA 3CBPA 1YIJA 3M0SA 1QVFA 3GNFB 2LQNA 2PNIA 1K8AR 3ZEHA 1JXOA 3VJPA 2A3LA 1PD1A 2GFUA 5FWCA 2K6DA 5L8RE 1Q82U 1QW1A 1K8AU 2SEMA 3CCRA 5GAN3 2B86A 2OX7A 2SRCA 1YJNA 1VIEA 3E2UA 2CZ7B 3DB4A 2QEXQ 3M0UA 4KUDK 2DM1A 5IHKA 3I55T 2DF6A 3JV3A 2QASA 3HSBA 2LMJA 3G6EQ 1ZA2B 3ZFJA 1XTDA 5J3BA 4JJNK 1B7TA 1VYVA 2XICA 3PTAA 4LDWA 1UEBA 2HSPA 1X75C 2AHJB 2VYTA 3G1JA 1VQLT 3MP8A 2C0OA 1OU8A 1SRLA 1W2BP 4HVUA 4C8QC 4M77C 3JCMV 2X51A 1H8KA 5GAN4 3P8BB 3CC2Q 4CC4B 3OS5A 5GAN8 5KYYA 3SWNA 1NE8A 3AHUA 2NUTB 1IXDA 3NFCA 2DLPA 3ZBDA 2DIGA 2RA2A 4R55A 3O8VA 3EGXB 1M9SA 3FLGA 1PWTA 2ECZA 2ESWA 2FHDA 1VQMA 3A8LB 2LT1A 1VYTA 2CSIA 2AKKA 1KQSA 3CBOA 3VUZA 9ATCB 3OS2A 1BB9A 3EHQA 2HQHA 4A53A 3OYIA 2EVRA 2L0AA 3PE0A 5IHNA 4F17A 4IUVA 4L59A 1VIFA 2LQWA 4KUIA 1D1AA 2GGRA 2OAWA 4OGEA 2FYKA 1SKUB 1HK9A 3TVTA 2F5KA 2DERA 1YBYA 4LD9K 1K73R 1AWWA 1P92A 3J7AF 1I5LA 2LNHB 1IHVA 1D1CA 1TOVA 1K73U 3UA7A 5FLXE 2DO3A 3PMTA 4A4FA 1PSFA 2VV5A 1VQ5T 1BI0A 1MNDA 5LJ5e 4RCBA 3CCVT 3CC2A 2Y4YA 1OQKA 1VQ9T 4FIBA 1PHTA 1VYUA 1JBMA 1UE9A 4RTUA 3T9NA 3DLLA 4EDUA 4DBHA 3CCUQ 4E6RA 2HAXA 2LCLA 2QQRA 3M57A 4J9DA 4FU6A 3VS6A 1JJ2S 2KDSA 3GLXA 4AFQC 4A4HA 4KGZB 1IB8A 3X28B 1YJ9Q 4Y92A 4C8QF 3X20B 4M77F 4ATOA 4M7AG 4AFZC 5GAMj 3CMET 2XDBA 3CPWS 3CCMT 2HL5C 3QJ6A 1Q86U 3JCMh 1Q81C 2Y4XA 1Q7YR 3FDRA 1B07A 1XJWB 1M27C 1HYOA 2RK2A 3PIPA 2LZ6B 4OMMA 3ME9A 3QJYA 1WJSA 3I35A 4M7AD 4J83A 4M4ZA 5KE3A 2OTLQ 2QYZA 3EG9A 1GBQA 4ANJA 1N5ZA 3OYLA 1KQSP 2O4XB 5LJ3j 2D1XA 2F69A 3EG1A 1JJ2A 4FYVB 2DBKA 3L2RA 3CCUA 1VQ6Q 3VS4A 4A4EA 2DETA 3CPFA 3X24B 5IAYA 1KHCA 3CQTA 4Y28E 4Z89A 3OYAA 4BDYA 2K3XA 4YTLA 3GPLA 2K57A 1YITQ 2DJZA 3X25B 4CC3A 4F7UG 1VA7A 1ZA1B 2XI9A 2VXEA 4DBQA 5FWBA 4ME7A 4LD6A 1OPKA 2JM8A 2RM4A 2EKHA 3UPUA 4B9XA 1KQ1A 5CCAA 2FRWA 3G6ET 2LDMA 2EYZA 3JCMc 3PT9A 1M90C 5KCHA 1Y0MA 1TWBA 2ZAEA 3N5BB 3VS3A 2J6KA 2LJ3A 1LPLA 1BYMA 4J7IA 2F2XA 3C0CA 2ZPEB 3RR6A 4LDYA 3OYHA 3SFMA 2E5QA 1D0YA 4HVWA 4IIOA 3OYCA 2A37A 4JDSA 1VQ7T 1OV3A 4MZPA 5KYWB 5CKFA 2O9SA 3HRTA 2JS2A 2CDTA 2LX7A 3CCLQ 1VQKQ 3RMSA 3GNGA 3L2UA 3SB2A 4KH0B 1VQ6A 3R6OA 1VQ8A 1NYGA 5J39A 1YNZA 2RD1A 5FROA 2E12A 5GANf 3I56A 3QYHB 1AZGB 3PGGA 1B34B 3URGA 2DIQA 1S1NA 4IUQA 4FYYB 2COZA 1U8RA 2KT8A 2YHTA 4UC4A 4DEXA 1HSQA 5GAMd 1UGRB 2NUPA 1JO8A 2CH4A 3DKMA 3TCJA 4OMNA 4XAXB 1NLPC 1RAFB 2O9VA 1VQ4Q 2QA4Q 3M4GA 4RTTA 4M7AC 2YWWA 3RIRA 2M51A 1Y07A 1YHQQ 4J9FA 5GAMe 3FB9A 3EHRA 4ZNXA 2JNGA 1TSFA 4BE2A 5CKHA 1Y71A 2FZGB 2QGFB 1N8RR 4L5GA 3QBYA 2IIMA 5LJ3d 3SEMA 3OBWA 4OB3B 2EYWA 2K4YA 3CCLA 1VQKA 3QDFA 4EMKB 2P0KA 4M78A 1X2KA 3JCMW 2DTOA 2DZCA 2H3JA 2X9HA 1Y96B 1BK2A 2EYQA 3E1SA 2BE7D 1Q81U 4FT2A 2E6ZA 4M75B 1U1SA 2K3BA 2X4XA 4ZTJA 4B6MA 2CP6A 3GOXA 1EFNA 1AZEA 4AFSC 5DM7R 2XIDA 3OMGA 1FMWA 3JRZA 4N4GA 3TQ7P 3CXCS 1YJ9T 1T3SA 3CMAQ 2BE9B 1VQ4A 4E47A 3M9QA 1UB4A 3NTIA 3CCSA 2VASA 1YI2T 4OVAA 4QT7A 5DLOA 2DVEA 2JT4A 2A08A 2LP5A 1YP5A 1MV0B 3JCMf 3M55A 2YRCA 4BE0A 2RNAA 2J6OA 1KIKA 2CP5A 1UJYA 5D6XA 5GJWB 3CC4T 2JS0A 2JN0A 3LX7A 1NPRA 5KYUB 1QWFA 3RDVA 2PU9B 2V1RA 1ZX6A 4J9EA 2E3HA 3QKJA 1M2VA 2DZ9A 1S72T 3OYJA 2VKNA 5C0MA 2HQEA 1VUBA 2LVMA 2WSCE 3JSCA 4M7AF 4A4GA 1M3AA 2RO0A 4EPCA 1ABQA 4E7ZA 1OX8A 2XD0A 2H8HA 4J8OA 2ABLA 1ZUUA 2PVDB 1YITT 3I5SA 2HZYA 3CCJQ 1M2OA 3M53A 2OTJQ 3OW2A 3KBGA 2E6NA 2KGTA 3L2WA 5IT9E 4M7DC 1CKBA 3EH1A 1FX7A 2DL7A 4M7DB 5GMKe 1PSEA 3EFSA 4ELYC 3V8JA 3CCQQ 4M75E 1JB0E 4CI0C 4JJDA 3A98A 3QIIA 1M1FA 1X27A 5CQXA 1K73C 3VRYA 4E7LA 4R0KA 2R5AA 1JQQA 1K4US 3UA6A 1GFDA 2F2WA 4V2SA 4GBQA 4C5IA 1ZHIA 2L8DA 5GAN6 2JM9A 1YJNQ 1VQOT 4DEYA 1SEMA 1VQPT 3HRSA 3ULRB 2DRMA 1OYXA 4JRPA 1NLOC 4JJBA 2QQAA 1SRMA 3M56A 2PTKA 4MMLA 1GCPA 1YFNA 2EYXA 1RAAB 1PKTA 5GAMg 1RABB 2ROTA 1M8VA 4E7JA 1OX9A 1V1CA 4PFZA 2EFIA 1E6GA 2YT6A 2E70A 3CBMA 2HCKA 1M3BA 1NEBA 1QKWA 2L89A 2QA4T 3E9FA 1OZ2A 2GQVA 3I9QA 1T3LA 3C12A 2DMOA 3SWNB 3TU4K 1AWOA 3QZ5B 1YHQT 4OMFB 1Q95G 1O75A 1MMGA 1Q7YC 3AT1B 4XU0A 5LJ3g 2ZPBB 5GANj 2JZ2A 2CGHA 1WHGA 1U1TA 2FG0A 1WQ7A 4IUPA 1WQWA 4TVRA 4LDUA 3VUBA 3PFSA 3IQLA 1VQMQ 1M1GA 2GF7A 4FYXB 5GAOl 2MCNA 2GCXA 2EQMA 5KYXA 3OW2P 4M7DE 2QTVA 2E3IA 1ZSZA 3Q1JA 1AT1B 4M7DF 3MCAB 2D8JA 1U5SA 3TEEA 3OMCA 3PMIA 1KQ2A 3FC3A 2F2VA 3CD6T 4X1VA 2O01E 4RG2A 4J6WA 2LNVA 3LWIA 4HXJA 4N0AA 1WYXA 3REBB 3H41A 5LJ5h 1VQNQ 4N4HA 2R5MA 3CMAT 2HKQB 3NGPA 2AT1B 4DA4A 2CUDA 2VXFA 4FCYA 2DE0X 1M8MA 2RQTA 2V8IA 3C95A 3NPFA 3VYGA 4QW2A 2QK0A 3RMQA 1BIAA 1PCXA 4PLLA 4HCZA 2DXUA 4LN2A 3BFMA 2FPFA 1X6OA 4Z88A 4J5YA 4E7SA 2E41A 2MIOA 3OYMA 1QMCA 3BDLA 1VOMA 3G7ZA 4PKCC 2GBQA 4HKEA 1ZBXA 5LJ5d 4KULA 3S3NA 3I5RA 4C92G 3RERA 1LCKA 2AK5A 2EJ9A 5FRNA 3CCJT 4WCIA 3O5ZA 5J26A 1AWXA 1VQNA 2OTJT 1QVFP 2J6FA 1QVPA 2A0FB 4IKFA 1QVGS 5ECAA 4EIKA 2XMFA 4OF1A 2V8JA 5IHIA 2M02A 4XTXA 3JCMQ 5GMKi 3CCEA 4BI3A 2E65A 3RKXA 1Y57A 2EGEA 2C06A 1LOJA 1X6BA 2M1HA 5GMKl 5GAOq 1YIJT 1K0SA 1RAGB 4C8QA 4M77A 5FU7C 3G4SA 5GANe 2IG0A 1N8RC 4X9DA 5FU7B 3L2QA 3CCRT 1NJIR 2K5LA 1IHWA 3DLMA 1YJWT 1YJNT 1NJIU 3OYBA 2FO0A 2NUTA 1YWOA 3NMZC 1FYNA 1BI1A 1WJQA 1W1FA 1QCNA 5I2SA 3EGXA 3OYGA 4LXCA 2X4JA 3L42A 1RLQC 1C6VX 2RHYA 3M5AA 1Q7YU 2KXCA 2NYSA 3S6WA 4QQ6A 2RMOA 4DOWA 1YCSB 3VS7A 1SHFA 2C0TA 4PNOA 2DFUA 2DXBA 3JCMJ 3OYYA 4JJCA 5GAOm 3CC7Q 2FB7A 2JJ9A 4DQ2A 2FVUA 4BD3A 2FZKB
chains in the Genus database with same CATH topology
1K9MU 2CZ0B 4PJOA 4XQ3A 4C8QB 4L5GA 4M77B 2JUFA 3QBYA 4BDZA 5LJ3d 4M75G 2MAMA 2OAUA 3MEVA 2B8AA 4MDXA 3OBWA 4OB3B 4IURA 5GANh 2K4YA 3X26B 1W2BA 3OY9A 1MGQA 3C94A 1HXDA 3P8DA 1VQKA 3CCLA 2QDYB 4ZN1A 2XKOC 2LQ8A 4EMKB 4QVDA 5I21A 2MF2A 2P0KA 5EG2A 4M78A 3JCMW 2DTOA 4Q5WA 1BI2A 4XU3A 2DZCA 1QVFS 2H3JA 3LGFA 1Y96B 1OZ3A 4N0AC 4KBMB 3JB9H 4ZGJB 3OYKA 2EYQA 4MZMA 3E1SA 4F7UE 3OYDA 5LJ3f 3OB9A 3S3MA 2P4TA 1VQMT 1Q81U 4FT2A 4M75D 2R58A 3LW5E 2E6ZA 4A54A 4F7UF 5CVIA 2HD0A 4M75B 1NZ9A 3A8GB 3TREA 4BI8B 2K3YA 2CZ1B 3CPWA 1U1SA 2QEXT 3JB9J 4O6JA 3MHXA 2R57A 5HK0A 4RMOA 3OS0A 4PJOG 5C6SA 2DXCA 4ZGEB 2X4XA 4ZTJA 2QEXA 2MMPA 2EAYA 1G3YA 3GOXA 5CKDA 4OGCA 2F5TX 2X35A 5AYFA 2ZZDA 5DM7R 2XIDA 3OMGA 3MEUA 3UT1A 3V8KA 1UGSB 3JRZA 2RI2A 4N4GA 5HY6A 5GAMh 3LWHA 1FXXA 2D0QB 2VC8A 1N9SA 4RKUE 3CXCS 3CCST 1VQ4A 3G6EA 5LJ5j 4E47A 3MP1A 4M78G 3OA6A 3CCJA 1D3BB 1I4K1 3M9QA 1UB4A 4C0FA 3NTIA 3CCSA 4B9WA 3S3OA 3UDCA 5CO7A 1OI1A 2ZPGB 1FWZA 4WF2A 3INZA 4JRIA 4XTYA 4C92C 4A4KA 4R56A 3C4SA 4C92D 1DJ7B 1YI2T 4OVAA 4C92B 5CR2A 1SSFA 4GY5A 5DLOA 4C5EA 5GANd 2DVEA 4OB1B 1UGQB 3CC7A 3JCMe 3JCMf 5KH6A 3M55A 3CCQT 4BE0A 1VQ7A 3QZ9B 2LT4A 3CC2T 1Q86C 4M78D 1WGSA 4JS4A 3VKIA 4XU2A 5A0GA 4M7DA 5D6XA 1LNXA 3ASKA 4M78B 3CCQA 3CC4T 1M1KU 2OTJA 4JUVA 2XDDA 2JN0A 3LX7A 3JB9F 3V7CA 3SD4A 1NPRA 4GLKA 4Y91A 4N4IA 3CBPA 2FL7A 5LJ3h 1YIJA 3QXEB 3A5ZB 2NLUA 2PU9B 1QVFA 3GNFB 2QXFA 4E7IA 1IZ6A 3QKJA 3ZEHA 3LYIA 3VJPA 3SDZA 2A3LA 4ELZC 3JCMX 2GFUA 1G5VA 2DZ9A 2GFAA 5L8RE 1Q82U 1QW1A 2RB6A 1S72T 1K8AU 3OYJA 3CCRA 5C0MA 2K5FA 5GAN3 4BY6C 2HQEA 1VUBA 2LVMA 2WSCE 1YJNA 1VIEA 3JSCA 2CZ7B 3DB4A 4M7AF 4A4GA 1QP2A 1YCYA 1N6AA 4BY6B 2LQKA 2L5QA 2RO0A 2DEQA 3V7SA 4KUDK 2EJFA 4EPCA 3I55T 4M7DG 3CEYA 2MWPA 5LJ5g 2RI5A 4J8OA 2XD0A 3EAEA 5GMKj 3KUFA 3G71A 3HSBA 3OBYA 2PVDB 4C8QE 1YITT 4M77E 3ZFJA 1RL2A 1XTDA 4FM4B 5J3BA 4JJNK 3M53A 2XICA 4JLGA 3OW2A 3PTAA 4LDWA 1UEBA 3KBGA 4RG8A 2E6NA 1QVGA 1X75C 2PQWA 2AHJB 2YLCA 3L2WA 4ZTFA 1IREB 1WJRA 1H3ZA 2VYTA 3JCMP 5IT9E 1VQLT 4M7DC 3MP8A 1FX7A 2KQWA 4J6YA 4FL6A 3FIFA 1NPPA 5M9OA 4M7DD 1WPYA 5GMKm 4M7DB 4C8QC 4D6WA 4M77C 3JCMV 1PSEA 2WSFE 5GMKe 2CYZB 4RCCA 3EFSA 2EQUA 4ELYC 3WVEB 2Y90A 3V8JA 5GAN4 2K5IA 4IUTA 5GAOr 2D6FA 3RKWA 3P8BB 4M75E 1N8RU 1JB0E 4CI0C 2MI6A 1I8FA 2QQSA 3OS5A 5GAN8 2HQXA 2E64A 3QIIA 1M1FA 3OYFA 5CQXA 1K73C 4EMKC 5GAN5 4Z02A 1H641 4E7LA 1WNLA 2R5AA 3SWNA 1NE8A 3AHUA 4C0GA 4KT0E 2VGMA 4BB7A 4V2SA 4HA8A 2XK0A 2EWNA 4C5IA 4OP0A 1N27A 1ZHIA 2BKDN 1KD1C 5FRMA 3NFCA 2L8DA 4CRIA 3CCUT 3ZBDA 3L2ZA 2DIGA 4M75C 2RA2A 5GAN6 4R55A 3O8VA 1VQOT 1M9SA 3FLGA 2YRVA 1VQPT 3HRSA 2PUOB 2FHDA 2DAQA 1VQOA 1VQMA 3A8LB 2LT1A 1XOVA 1KQSA 2KMTA 1OYXA 3CBOA 4JRPA 4C92E 2G3RA 2CZ6B 3L1AA 3VUZA 4MZTA 3A8HB 2KY9A 4QVCA 4IUUA 3OS2A 3HKSA 2QQAA 4II1A 4C92F 4NOYA 3M59A 4A53A 2HBPA 2PVGB 3E19A 3M56A 3M58A 3PNWC 3QHSA 4MMLA 3OYIA 5GAN2 2MWOA 2XG8D 3RUXA 2HNIA 5CQYA 5GAMg 4C0DC 2ZPHB 4IUVA 4L59A 2RJDA 1VIFA 4M78E 5GAN7 3JCMd 4C8QD 4LDVA 1M8VA 4E7JA 4FSXA 4KUIA 4C0DB 4OGEA 2QQ9A 2FYKA 1YJ9A 4PJOC 4FT4A 2DD4A 1XNIA 1KC8C 1HK9A 4PJOD 2EFIA 3A8OB 2F5KA 4XK8E 1YBYA 2EQKA 4LD9K 3WVDB 4PJOB 2E70A 3CBMA 1P92A 3OSVA 1AHJB 3J7AF 1I5LA 1V29B 2BIVA 1K73U 2QTXA 3MP6A 1YI2A 1VQNT 3BW1A 2L89A 5FLXE 2QA4T 3E9FA 1OZ2A 2DO3A 3MEAA 3PMTA 4A4FA 2GQVA 2ZGWA 4M78C 2VV5A 1PSFA 1VQ5T 3C12A 3OYEA 2LC4A 3SWNB 3TU4K 1BI0A 5LJ5e 3QZ5B 1YHQT 3JAME 4OMFB 5LJ5f 1O75A 2RJEA 5CKBA 4RCBA 3CCVT 3CC2A 2Y4YA 1VQ9T 4FIBA 1Q7YC 4BACA 1I81A 3HRUA 1G3SA 4XU0A 2OTLT 5LJ3g 1JBMA 3CC4A 2ZPBB 4OB2B 2JZ2A 2CGHA 2EQJA 4VUBA 4XTWA 5GANj 3T9NA 2EJGA 5CIUA 4NS5A 3NTHA 4XTZA 3DLLA 1U1TA 2P0PA 3GF5A 1WQ7A 2OTLA 2KK4A 4IUPA 3CCET 4M7AA 1WQWA 4TVRA 4EDUA 4LDUA 5GAOn 3VUBA 1M4ZA 3PFSA 3WXMB 2XDPA 2HAXA 4E7KA 1JRIA 2LCLA 1YJ9T 3RESA 2YLBA 2QQRA 3M57A 4P5NA 4FU6A 3KXTA 1M1GA 1VQ6T 2EKOA 3LGLA 2GF7A 1MHNA 5GAOl 3QUIA 1JJ2S 3QYGB 1VQ8T 2KDSA 2O4XA 3GLXA 1S72A 3G4ST 2A7YA 1RI0A 2DD5A 2E1HA 2RK1A 1W2BS 3BDUA 2GCXA 3I56T 2EQMA 1K9MC 2LX9A 4M7DE 4A4HA 3Q1JA 4M7DF 2KSSA 3I55A 1KC8U 3X28B 3CXCA 2DTIA 3MCAB 1YITA 4C8QF 3X20B 4M77F 4ATOA 5I2MA 4M7AG 3OQ5A 3TEEA 3OMCA 3PMIA 4QVZA 1Y96A 1KQ2A 5GAMj 1Y7XA 3VYHB 3FC3A 1G3WA 3CMET 2CKKA 2XDBA 3QO3A 4NL3A 3CPWS 3CD6T 3CCMT 5KCOA 2O01E 3QJ6A 2I2LA 4J6WA 2LNVA 3M4YA 4RG2A 3LWIA 1Q86U 4N0AA 3JCMh 3FRNA 3PIOA 1Q81C 3QG1A 2Y4XA 4ZN3A 1VQLA 5CAIA 3FDRA 5LJ5h 4XU1A 1ZQ1A 4N4HA 2RK2A 4JRKA 2PVOB 3PIPA 2R5MA 1UGPB 2RHUA 3ME9A 3CMAT 5DY9A 3QJYA 1WJSA 4M7AD 2E10A 4JLIA 2QI2A 5GANg 2RI3A 3ER0A 4J83A 4M7AB 3H6ZA 4DA4A 4LDXA 2L3RA 2VXFA 4M75F 1GXIE 1BI3A 4MMKA 2V8IA 3C95A 2KVQG 5KE3A 3LLRA 4F7UA 2LTOA 4X34A 2DXTA 3MEWA 3HP9A 3VYGA 4PLIA 3OYLA 2O4XB 4QW2A 3RMQA 1O9SA 5LJ3j 2F69A 4C92A 4XTUA 1BIAA 2RJCA 1JJ2A 4PLLA 3MO8A 3L2RA 4HCZA 2JVVA 3CCLT 2DXUA 3CCUA 1VQKT 2RHIA 4A4EA 2XU8A 3BFMA 3V8LA 1X01A 3CPFA 4PJOE 1X6OA 2RH2A 3X24B 2VGNA 5IAYA 1VQPA 3VV0A 3EFRA 2DPPB 5A2QE 5IN1A 1KHCA 3OSSC 4C0ZA 4Y28E 4PJOF 3OYAA 4BDYA 2K3XA 3QPHA 3META 4YTLA 4J5YA 4DOVA 4BD3A 4QQDA 1XQHA 2E41A 1M1KC 3GPLA 2K57A 3OYMA 2DJZA 3X25B 5LJ3e 1LJOA 3BDLA 5D6WA 4E7HA 4F7UG 3V7RA 2XI9A 3G7ZA 2M0OA 4PKCC 4C5GA 2VXEA 1B34A 5DLQE 5D6YA 3QDRB 4HKEA 1ZBXA 4ME7A 3J81E 1R8OB 4M78F 5LJ5d 2JTMA 3GIBA 4KULA 4LD6A 3S3NA 4C92G 5GMKh 4PL6A 3A8MB 4JRQA 2RM4A 2X4YA 1Q82C 3LH0A 1NJIC 1K8AC 1M5Q1 1G3TA 3RERA 3BY7A 3UPUA 2JOYA 2EJ9A 3SWNC 1KQ1A 4B9XA 2BUDA 5CCAA 1VQ4T 5FRNA 3G6ET 2LDMA 3CCJT 5CKEA 2V8KA 5J26A 4QQGA 1VQNA 2OTJT 4C5HA 1M90C 3JCMc 3PT9A 4F7UB 2QA4A 4HCCA 5KCHA 3OW2S 1VQ5A 3N5BB 1KG1A 1W4SA 1KD1U 3QSUA 1QVPA 4IKFA 1QVGS 1BYMA 1YHQA 4J7IA 2XHCA 2ZPEB 3CCVA 4LDYA 3FJPA 2KAFA 1VQ9A 3OYHA 3SFMA 3JB9I 4OF1A 5HK3A 3CC7T 2E5QA 2V8JA 4J7FA 4XTXA 3JCMQ 3OYCA 5GMKi 4JDSA 1VQ7T 4HT9A 4MZPA 5CKFA 2LCCA 3CCEA 4HCBA 3HRTA 2E65A 3RKXA 4BI3A 4ZGDB 1EIFA 3L2VA 2C06A 1LOJA 2M1HA 3E9GA 2ZCFB 3RMSA 3JB9G 5GMKl 3GNGA 1BKBA 5GAOq 3SB2A 3L2UA 4BUGA 3HFOA 4JS5A 2M16A 2LRQA 1YIJT 1TH7A 3HHTB 5KE2A 3R6OA 2DTHA 4C8QA 3DB3A 4M77A 5FU7C 4EMGA 5J39A 1VQ8A 3G4SA 2RD1A 3H8ZA 5FROA 5GANe 2IG0A 2E12A 1N8RC 4X9DA 5GANf 3I56A 4HT8A 3QYHB 3PGGA 1B34B 5FU7B 2DIQA 2RHXA 3M54A 3URGA 3OS1A 4IUQA 3L2QA 3CCRT 2P0QA 2K5LA 4EMHA 3DLMA 1YJWT 4OB0B 2PUKB 4EMKA 1YJNT 1NJIU 2DK3A 3FEOA 1U8RA 4M7AE 1N9RA 3OYNA 3HFNA 2RJFA 2YHTA 3OYBA 3JB9D 1YJWA 3UWNA 5FU6C 4XTVA 5HKCA 4UC4A 2IVWA 2X4WA 4BI4A 3NTKA 4MDWA 2K2VA 1BI1A 1WJQA 2M9UA 3P8HA 1KQSS 1VQ6A 5GAMd 3JCMg 5I2SA 3OYGA 3RKYA 1M90U 1UGRB 5FU6B 5CK9A 2EIFA 2X4JA 3L42A 4X9CA 3G71T 2RHZA 3CMEA 3CD6A 3CCMA 2CS7A 2RHYA 4M75A 3DKMA 3M5AA 2D9TA 3TCJA 4XAXB 1Q7YU 5GAOp 3M4GA 4C8QG 5A0DA 4M77G 3JCMb 3S6WA 4M7AC 4QQ6A 4DOWA 4BE1A 3J80E 3RIRA 1Y07A 1BIBA 4NL2A 5LL6S 5GAMe 3CMAA 3FB9A 5GAMf 2QQBA 3GP8A 4PNOA 1QP3A 2DXBA 2JNGA 3HL8A 2DKGA 2VUBA 3OYYA 4O5VA 3JCMJ 1D3BA 3HPWA 2JTFA 3F70A 2ZPIB 5A0LA 4J6XA 4L6V5 5GAOm 4BE2A 2WACA 2FB7A 2ZPFB 1Y71A 5CKHA 4DQ2A 2WSEE 2FVUA 1KHIA 3VU3C 4M77D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VXE A;  1B34 A;  1I81 A;  5LJ5 g;  4PJO A;  4XU0 A;  3HSB A;  4XQ3 A;  1JBM A;  4C8Q B;  5GMK j;  4M77 B;  4M78 F;  2CGH A;  4XTW A;  5LJ3 g;  5LJ3 d;  4C8Q E;  4M75 G;  2EJG A;  4M77 E;  3GIB A;  4XTZ A;  1U1T A;  4M7A A;  4C92 G;  1WQ7 A;  5GMK h;  5GAN h;  5GAN j;  1WQW A;  2RM4 A;  5GAO n;  1MGQ A;  3RER A;  1HXD A;  1M5Q 1;  3BY7 A;  1JRI A;  2EJ9 A;  3SWN C;  1KQ1 A;  2YLC A;  3RES A;  2YLB A;  4EMK B;  4QVD A;  5I21 A;  4M78 A;  3JCM W;  3JCM P;  2DTO A;  4XU3 A;  5GAO l;  3QUI A;  4M7D C;  2DZC A;  1Y96 B;  4J6Y A;  3JCM c;  4N0A C;  4F7U B;  3FIF A;  2E1H A;  3JB9 H;  4M7D D;  1WPY A;  4F7U E;  5GMK m;  3BDU A;  4M7D B;  5LJ3 f;  4C8Q C;  3QSU A;  4M77 C;  3JCM V;  5GMK e;  4M7D E;  4M75 D;  4RCC A;  3EFS A;  2Y90 A;  3V8J A;  4A54 A;  4F7U F;  5GAN 4;  4M75 B;  5GAO r;  3RKW A;  3FJP A;  3JB9 J;  4M75 E;  4M7D F;  1U1S A;  3JB9 I;  1I8F A;  4PJO G;  2DTI A;  5GAN 8;  2E64 A;  4XTX A;  3JCM Q;  5GMK i;  4EMK C;  5GAN 5;  2EAY A;  4C8Q F;  4M77 F;  1H64 1;  4HT9 A;  4M7A G;  1WNL A;  2E65 A;  3RKX A;  3SWN A;  1KQ2 A;  1Y96 A;  5GAM j;  3AHU A;  1LOJ A;  3QO3 A;  4NL3 A;  4V2S A;  3V8K A;  4HA8 A;  2I2L A;  4J6W A;  5GAM h;  2EWN A;  5GMK l;  3JB9 G;  2VC8 A;  1N9S A;  4N0A A;  4OP0 A;  3JCM h;  5LJ5 j;  3SB2 A;  5GAO q;  4M78 G;  3HFO A;  1D3B B;  1I4K 1;  1TH7 A;  2DTH A;  3L2Z A;  4M75 C;  2RA2 A;  4M77 A;  4C8Q A;  4EMG A;  5GAN 6;  5CAI A;  4WF2 A;  3INZ A;  4JRI A;  2RD1 A;  4XTY A;  4XU1 A;  4C92 C;  5GAN e;  5LJ5 h;  4X9D A;  5GAN f;  4HT8 A;  4JRK A;  4C92 D;  3PGG A;  1B34 B;  5DY9 A;  4C92 B;  4M7A D;  2E10 A;  4JLI A;  4C92 E;  4EMH A;  5GAN g;  3L1A A;  4EMK A;  4M7A B;  5LJ5 d;  5GAN d;  2DVE A;  2VXF A;  4M75 F;  4M7A E;  4MMK A;  1N9R A;  4QVC A;  4C92 F;  3HFN A;  3JCM e;  2YHT A;  4NOY A;  3JB9 D;  4A53 A;  3QHS A;  3JCM f;  4MML A;  4F7U A;  4XTV A;  5GAN 2;  4M78 D;  3RUX A;  2HNI A;  4XU2 A;  5GAM g;  2DXT A;  4M7D A;  1LNX A;  4M78 B;  5GAM d;  3JCM g;  3RKY A;  4M78 E;  5GAN 7;  4JUV A;  4X9C A;  4C8Q D;  3JCM d;  1M8V A;  2JN0 A;  5LJ3 j;  3JB9 F;  4M75 A;  3V7C A;  2FYK A;  4Y91 A;  4C92 A;  4PJO C;  4XTU A;  1BIA A;  5LJ3 h;  5GAO p;  1HK9 A;  3M4G A;  4C8Q G;  3JCM b;  4M77 G;  2DXU A;  4PJO D;  4M7A C;  3BFM A;  4PJO B;  3V8L A;  1X01 A;  3RIR A;  4PJO E;  1I5L A;  3EFR A;  3JCM X;  2DZ9 A;  2QTX A;  1BIB A;  4NL2 A;  5GAM e;  2RB6 A;  3BW1 A;  4PJO F;  3FB9 A;  5GAM f;  5GAN 3;  2ZGW A;  4M78 C;  4PNO A;  4J5Y A;  3JCM J;  2DKG A;  3SWN B;  2E41 A;  4M7A F;  1D3B A;  1YCY A;  2K57 A;  5LJ5 e;  2DJZ A;  4J6X A;  5LJ3 e;  1LJO A;  5GAO m;  5LJ5 f;  2FB7 A;  4F7U G;  2DEQ A;  3V7S A;  4RCB A;  3V7R A;  4DQ2 A;  2EJF A;  4M7D G;  3VU3 C;  4M77 D; 
#chains in the Genus database with same CATH topology
 4XQ3 A;  4M75 G;  2MAM A;  2OAU A;  1VQ8 Q;  3THK A;  2QDY B;  4ZN1 A;  3I56 Q;  2LQ8 A;  3UAT A;  4QVD A;  5EG2 A;  1X2Q A;  4Q5W A;  5KYN A;  1ABO A;  4MZM A;  4LUE A;  1VQM T;  4M75 D;  2NUP B;  5CVI A;  3UF4 A;  1NZ9 A;  3CPW A;  2L3Q A;  1Z9Q A;  2QEX T;  4O6J A;  1M3C A;  4PJO G;  5C6S A;  1GCQ C;  4ZGE B;  3G71 Q;  1G3Y A;  1WHM A;  5CKD A;  4OGC A;  2K2M A;  5AYF A;  1X6G A;  2HSE B;  2K79 A;  5HY6 A;  2RI2 A;  5GAM h;  2D0Q B;  2VC8 A;  4RTY A;  2AZS A;  4C0F A;  2HDA A;  4LE9 A;  5CO7 A;  1OI1 A;  2ZPG B;  1NYF A;  3INZ A;  4XTY A;  4C92 C;  4R56 A;  3C4S A;  1SSH A;  4C92 B;  1SSF A;  2P84 A;  1LVK A;  1UGQ B;  3CC7 A;  3JCM e;  3EGD A;  3CC2 T;  3QZ9 B;  2LT4 A;  2OI3 A;  3VKI A;  2MOX A;  1I0C A;  4M78 B;  4JUV A;  3M0P A;  4Y91 A;  2EYY A;  5LJ3 h;  2AIR B;  2HL3 A;  3QXE B;  5IXF A;  1JU5 C;  2QXF A;  3RNJ A;  1UGV A;  3LYI A;  1G5V A;  3JCM X;  1X43 A;  2VB6 A;  2K5F A;  4JPB W;  1K76 A;  4BY6 C;  4F14 A;  1QP2 A;  1YCY A;  1N6A A;  4BY6 B;  2L5Q A;  3V7S A;  4M7D G;  3CEY A;  5LJ5 g;  2RI5 A;  5GMK j;  3KUF A;  3G71 A;  1RL2 A;  4FM4 B;  3CCS Q;  4JLG A;  4RG8 A;  3VS0 A;  3BE3 A;  2DL4 A;  2PQW A;  4ZTF A;  1MMN A;  2BZY A;  1WJR A;  2MK5 A;  2MYS A;  1KK7 A;  3JCM P;  1JJ2 P;  2KQW A;  4M7D D;  3FIF A;  5GMK m;  1WXU A;  2YUO A;  1QWE A;  2CYZ B;  4RCC A;  2ATC B;  3WVE B;  5GAO r;  2D6F A;  3SHW A;  2KI7 A;  1N8R U;  2MI6 A;  1I8F A;  3VS1 A;  4EMK C;  4Z02 A;  1NBE B;  1M2V B;  4C0G A;  1WDX A;  2VGM A;  4BB7 A;  2XK0 A;  3CPW P;  4J9G A;  1KD1 C;  5FRM A;  1WXT A;  4CRI A;  3CCU T;  4M75 C;  3H0I A;  1GRI A;  1VQO A;  4C92 E;  5IXB A;  3L1A A;  3HTR A;  3A8H B;  2KY9 A;  4IUU A;  3HKS A;  4C92 F;  4II1 A;  1TUD A;  4NOY A;  3M59 A;  2HBP A;  2PVG B;  3E19 A;  3QHS A;  2NUZ A;  2XG8 D;  2HNI A;  5CQY A;  4HCK A;  1GBR A;  2ZPH B;  2RJD A;  2G6F X;  4M78 E;  2CP2 A;  4LDV A;  4FSX A;  2RF0 A;  2QQ9 A;  4PJO C;  2DD4 A;  1XNI A;  4XK8 E;  2EQK A;  1GL5 A;  2RN8 A;  3WVD B;  4HVV A;  4PJO B;  1G8X A;  2RQW A;  1IGU A;  1F1B B;  1QQJ A;  1B3Q A;  1D0X A;  3OYE A;  2QDL A;  3JAM E;  1WHH A;  2RJE A;  1CSK A;  1ZSG A;  4BAC A;  1I81 A;  2CSQ A;  3HRU A;  2OTL T;  3KFV A;  4OB2 B;  4XTW A;  2EQJ A;  5CIU A;  4NS5 A;  3NTH A;  2P0P A;  4M7A A;  3GF5 A;  2KK4 A;  2A36 A;  1JXM A;  5GAO n;  1M4Z A;  1BBZ A;  2XDP A;  4E7K A;  1JRI A;  2V1Q A;  2YLB A;  2EGA A;  3KXT A;  1VQ6 T;  2EKO A;  3LGL A;  2FPD A;  3QYG B;  1WX6 A;  2X3X D;  3QWX X;  4PJJ A;  1VQ8 T;  2DD5 A;  3LH5 A;  1W2B S;  3I56 T;  4CC2 A;  1R0B G;  1KC8 R;  2V26 A;  2KSS A;  3I55 A;  1KC8 U;  1PNJ A;  1TS9 A;  3CXC A;  1ZBJ A;  1WHJ A;  1PKS A;  2CP3 A;  5I2M A;  1UTI A;  1FMK A;  3OQ5 A;  1TUG B;  4QVZ A;  1Y96 A;  2FEI A;  1Y7X A;  1G3W A;  2CKK A;  4PFP A;  1HJD A;  3PIO A;  2W10 A;  2O2O A;  4ZN3 A;  1VQL A;  2O88 A;  5CAI A;  4XU1 A;  1ZQ1 A;  2CUB A;  4JRK A;  2PVO B;  1VQ5 Q;  2RHU A;  4FSS A;  1W70 A;  3TSZ A;  3H6Z A;  3CCV Q;  2L3R A;  4M75 F;  2KR3 A;  1GXI E;  1VQ9 Q;  4AMC A;  3M0R A;  2YSQ A;  3LLR A;  4F7U A;  4JZ3 A;  2CRE A;  4RTX A;  1UDL A;  1T0J A;  1QKX A;  1UHF A;  1UFF A;  2EGC A;  1AVZ C;  4XTU A;  5KYX B;  2RJC A;  3MO8 A;  3CCL T;  2YDL A;  1VQK T;  2RHI A;  2HMA A;  4QKU A;  3FJ5 A;  1ZSZ B;  1D0Z A;  4RTV A;  1PG5 B;  4PJO E;  2RH2 A;  3EFO A;  3VV0 A;  2DPP B;  5IN1 A;  4PJO F;  2DEU A;  2DIL A;  4ORZ A;  2DJQ A;  1I1J A;  3NHN A;  2JMC A;  2M0O A;  4PFO A;  4C5G A;  2YRD A;  2MPX C;  5DLQ E;  3QDR B;  3J81 E;  1R8O B;  3GIB A;  1SPK A;  3CCM Q;  4PL6 A;  5I22 A;  3A8M B;  2KRN A;  1W6X A;  2X4Y A;  3LH0 A;  1NJI C;  1G3T A;  1YWP A;  2E4H A;  3BY7 A;  1NG2 A;  2JOY A;  3SWN C;  2BUD A;  2KEA A;  3ZL7 C;  1VQ4 T;  5KYY B;  1MUZ A;  1AEY A;  2JTE A;  3H0F A;  5CKE A;  1KD1 R;  1VQ5 A;  1KG1 A;  3QSU A;  1KD1 U;  1UJ0 A;  2XHC A;  4KH1 B;  3CCV A;  3H0H A;  3FJP A;  2KAF A;  1VQ9 A;  3JB9 I;  5HK3 A;  1IGQ A;  1WA7 A;  4HT9 A;  2LCC A;  4HCB A;  4FYW B;  1BU1 A;  3VRZ A;  2EPD A;  2L3S A;  1M1K R;  2DL3 A;  2ZCF B;  5L23 A;  1BKB A;  2CP0 A;  4BUG A;  3HFO A;  2KBT A;  3CXC P;  4OMP A;  1TH7 A;  2E5K A;  3HHT B;  4E2F B;  2HKN A;  3H8Z A;  3OS1 A;  1Q82 R;  4EMH A;  1OOT A;  4OB0 B;  2PUK B;  2DK3 A;  1N9R A;  3HFN A;  2RJF A;  4KGX B;  1YJW A;  1PC0 A;  5FU6 C;  4XTV A;  2X4W A;  3NTK A;  4MDW A;  3PVQ A;  2M9U A;  1CKA A;  3P8H A;  3VS5 A;  1KQS S;  3RKY A;  5FU6 B;  3CME A;  5CK9 A;  2EIF A;  3M0Q A;  2RHZ A;  3CCM A;  2CS7 A;  2D9T A;  4AT1 B;  2DBM A;  2JW4 A;  5GAO p;  2J7I A;  5A0D A;  3JCM b;  4J9H A;  4LUD A;  1EZZ B;  2D0N A;  2QQB A;  3HL8 A;  2DKG A;  2VUB A;  4O5V A;  1D3B A;  3HPW A;  1MNE A;  2JTF A;  2ZPI B;  3F70 A;  5A0L A;  4L6V 5;  2WAC A;  3CCE Q;  2CP7 A;  2WSE E;  1VQ7 Q;  1KHI A;  2C0I A;  2CZ0 B;  4C8Q B;  4M77 B;  4A63 B;  3MEV A;  4MDX A;  2NWM A;  4IUR A;  5GAN h;  2FRY A;  3G4S Q;  1MGQ A;  1WZO A;  2XKO C;  4FW1 A;  4DBF A;  4XU3 A;  2KRO A;  2M0Y A;  4KBM B;  2J06 A;  4ZGJ B;  3OYK A;  2RQU A;  3A1P A;  4AG2 C;  4K11 A;  2KE9 A;  3OB9 A;  3S3M A;  4PJN A;  2R58 A;  4A54 A;  2KYM A;  2HD0 A;  3A8G B;  3JB9 J;  2CZ1 B;  2R57 A;  5HK0 A;  2DXC A;  4J9B A;  4GLM A;  2QEX A;  2ED0 A;  1NM7 A;  3V8K A;  1R77 A;  3LWH A;  1U06 A;  1UGS B;  1N9S A;  3G6E A;  1TXQ A;  1AWJ A;  1K1Z A;  3EG9 B;  1IO6 A;  1I4K 1;  2CT4 A;  2PZ1 A;  4M78 G;  3S3O A;  4B9W A;  1J3T A;  1FWZ A;  4WF2 A;  4A4K A;  1D09 B;  1JEG A;  4C92 D;  5CR2 A;  4C5E A;  2BZ8 A;  5GAN d;  1RAD B;  4LNP A;  2YUP A;  3CCQ T;  1VQ7 A;  4M78 D;  3QWY A;  3H9N A;  2X3W D;  3ASK A;  1EX4 A;  2XDD A;  1RAC B;  3JB9 F;  3SD4 A;  4Z8A A;  1Z9Z A;  3MJX A;  2KNB B;  2FL7 A;  3MPU B;  2COW A;  3A5Z B;  1UEC A;  2NLU A;  4E7I A;  1IZ6 A;  2RQR A;  3SDZ A;  4ELZ C;  1ARK A;  2GFA A;  2RB6 A;  2FZC B;  3RBB B;  1TUC A;  2Z0W A;  2LQK A;  2DEQ A;  2EJF A;  2QGG A;  1H92 A;  2MWP A;  3EAE A;  2DVJ A;  3OBY A;  1RAI B;  2DYB A;  4C8Q E;  4M77 E;  4F04 B;  5D7U A;  2VVK A;  3MKD A;  4AFU C;  4OMO A;  1I07 A;  1QVG A;  2YLC A;  1Q86 R;  4D8D A;  1IRE B;  1E7O A;  2BTT A;  3M0T A;  1H3Z A;  2EBP A;  3EGD B;  4J6Y A;  1YI2 Q;  4FL6 A;  2YUN A;  1NPP A;  5M9O A;  1WPY A;  2F1L A;  4D6W A;  2WSF E;  1WHL A;  2EQU A;  2Y90 A;  2K5I A;  4IUT A;  3EG0 A;  3RKW A;  2QQS A;  1WLP B;  2HQX A;  2E64 A;  1BCO A;  3OYF A;  2K9G A;  3CC4 Q;  5GAN 5;  4PJL A;  1H64 1;  1WNL A;  2HBW A;  1WI7 A;  2D8H A;  2DL8 A;  4KT0 E;  1K9A A;  4HA8 A;  2EWN A;  4OP0 A;  3REA B;  1N27 A;  2BKD N;  1RI9 A;  3L2Z A;  2DA9 A;  1S72 Q;  2YRV A;  4PJM A;  2PUO B;  2DAQ A;  3EG2 A;  1XOV A;  2KMT A;  2RQV A;  1A0N B;  1QCO A;  2G3R A;  2CZ6 B;  2DNU A;  4MZT A;  5I11 A;  4QVC A;  3M58 A;  3PNW C;  4DBR A;  5GAN 2;  2MWO A;  3RUX A;  1AOJ A;  1OUL A;  4C0D C;  5GAN 7;  3JCM d;  4C0D B;  2GNC A;  2HEQ A;  1YJ9 A;  4FT4 A;  1KC8 C;  2OJ2 A;  4PJO D;  1AD5 A;  3A8O B;  3GBQ A;  1GFC A;  3OSV A;  4F16 A;  1AHJ B;  6AT1 B;  1V29 B;  2BIV A;  2QTX A;  2VWF A;  1RAE B;  3MP6 A;  1YI2 A;  3BW1 A;  1VQN T;  2A28 A;  3MEA A;  1C0M A;  2ZGW A;  4M78 C;  2LC4 A;  1SHG A;  5LJ5 f;  5CKB A;  2QG9 B;  1G3S A;  3CC4 A;  4VUB A;  2EJG A;  2JMA A;  4XTZ A;  3CCE T;  2OTL A;  2BZX A;  4RUG A;  1E6H A;  4RTZ A;  3WXM B;  1QLY A;  3RES A;  1VQO Q;  4P5N A;  1VQP Q;  1X69 A;  1MHN A;  3QUI A;  2O4X A;  1S72 A;  3G4S T;  2A7Y A;  1UG1 A;  1RI0 A;  2E1H A;  2RK1 A;  4FW2 A;  3BDU A;  2DRK A;  2LX9 A;  1K9M C;  1SG5 A;  1QVG P;  1RAH B;  1SF9 A;  2DTI A;  1KJW A;  2JXB A;  1YIT A;  2COY A;  3VYH B;  3QO3 A;  4NL3 A;  5KCO A;  2I2L A;  3M4Y A;  3FRN A;  3QG1 A;  2K7A A;  1UGP B;  5DY9 A;  4AG1 C;  2E10 A;  4JLI A;  1R0C B;  2QI2 A;  5GAN g;  1GCQ A;  2RI3 A;  3ER0 A;  2FPE A;  2KT1 A;  1OPL A;  4M7A B;  4LDX A;  2ENM A;  1BI3 A;  4MMK A;  2KVQ G;  4J9C A;  1YN8 A;  3VS2 A;  1MMA A;  2LTO A;  1QCF A;  4X34 A;  2DXT A;  3MEW A;  2GTJ A;  3HP9 A;  4PLI A;  1ZUK A;  1O9S A;  4C92 A;  1V76 A;  1HD3 A;  2DL5 A;  1WXB A;  2JVV A;  2L2P A;  2LJ1 A;  2XU8 A;  3V8L A;  1X01 A;  5KYW A;  2VGN A;  1VQP A;  3EFR A;  5A2Q E;  3R6N A;  3OSS C;  4C0Z A;  3I55 Q;  1D1B A;  2GQI A;  3QPH A;  1KSW A;  1G83 A;  3MET A;  4DOV A;  4QQD A;  1WIE A;  1XQH A;  2GTO A;  1M1K C;  1Q81 R;  5LJ3 e;  1LJO A;  5D6W A;  4E7H A;  3V7R A;  1B34 A;  5D6Y A;  2CT3 A;  4OML A;  4M78 F;  2JTM A;  3CD6 Q;  2QAZ A;  2H3E B;  5GMK h;  4J9I A;  5EC7 A;  1VQL Q;  4JRQ A;  1Q82 C;  1K8A C;  1M5Q 1;  1TU0 B;  4KRT A;  2LJ0 A;  2J05 A;  2V8K A;  2DX1 A;  4QQG A;  1UHC A;  4C5H A;  4F7U B;  2QA4 A;  4HCC A;  1MV3 A;  1RLP C;  4PK4 A;  3OW2 S;  2YXY A;  1W4S A;  1KFZ A;  3TSW A;  1YHQ A;  4WTO B;  1ACM B;  2IPO B;  3CC7 T;  4J7F A;  2KRS A;  3EGU A;  1PRM C;  1MMD A;  3EFO B;  4ZGD B;  1EIF A;  3L2V A;  5FW9 A;  4D8K A;  4OMQ A;  3E9G A;  3JB9 G;  3EH2 A;  4JS5 A;  2M16 A;  2LRQ A;  5KE2 A;  1RUW A;  2DTH A;  3DB3 A;  4EMG A;  1FMV A;  2L3P A;  4HT8 A;  1M30 A;  5IH2 A;  3M54 A;  2RHX A;  2AKL A;  2YUQ A;  2P0Q A;  4EMK A;  2EQI A;  3FEO A;  4M7A E;  3OYN A;  1ZLM A;  3JB9 D;  1I5O B;  3UWN A;  4RTW A;  5HKC A;  1U3O A;  4BI4 A;  2IVW A;  1M90 R;  2K2V A;  3JCM g;  1M90 U;  3G71 T;  3CD6 A;  4X9C A;  4M75 A;  4C8Q G;  4CC7 A;  4M77 G;  1H3H A;  4JZ4 A;  4BE1 A;  3J80 E;  1BIB A;  4NL2 A;  5LL6 S;  3CMA A;  4IIM A;  3D7S B;  2CH4 W;  5GAM f;  3GP8 A;  1QP3 A;  4ESR A;  4J6X A;  2ZPF B;  1K9M R;  1OEB A;  3VU3 C;  1WHK A;  4M77 D;  4C8Q D;  1K9M U;  4PJO A;  1ZSZ C;  2JUF A;  4BDZ A;  2B8A A;  3X26 B;  1W2B A;  3OY9 A;  1YIJ Q;  3C94 A;  1HXD A;  3P8D A;  1PRL C;  5HCK A;  5I21 A;  1IRX A;  2MF2 A;  1BI2 A;  2KRM A;  3LGF A;  1QVF S;  1OZ3 A;  4N0A C;  3JB9 H;  3CCR Q;  1UUE A;  4F7U E;  3OYD A;  2KXD A;  5KYU A;  1ZUY A;  1TG0 A;  1YJW Q;  5LJ3 f;  2P4T A;  3PVL A;  3LW5 E;  4F7U F;  3EG3 A;  3TRE A;  2K3Y A;  2O31 A;  4KGV B;  4BI8 B;  3CME Q;  3MHX A;  3U23 A;  4RMO A;  3OS0 A;  1T0H A;  2MMP A;  2EAY A;  8ATC B;  1K0X A;  2ROL A;  1C1A A;  2I0N A;  2F5T X;  2X35 A;  2EW3 A;  2ZZD A;  3MEU A;  3UT1 A;  1TTH B;  2KYB A;  3CCS T;  1FXX A;  2AZV A;  4RKU E;  5AT1 B;  2ED1 A;  5LJ5 j;  3MP1 A;  3OA6 A;  3CCJ A;  1D3B B;  1PD0 A;  3UDC A;  2OTJ A;  2RPN A;  4JRI A;  2P4R A;  1DJ7 B;  1PM3 A;  4GY5 A;  5GJV B;  1BCM A;  7AT1 B;  4OB1 B;  1G2B A;  1WFW A;  5KH6 A;  2DYI A;  1Q86 C;  1WGS A;  2W0Z A;  4JS4 A;  4XU2 A;  5A0G A;  4M7D A;  1LNX A;  8AT1 B;  3CCQ A;  1M1K U;  2LCS A;  3V7C A;  1NEG A;  4GLK A;  1OU9 A;  4N4I A;  3CBP A;  1YIJ A;  3M0S A;  1QVF A;  3GNF B;  2LQN A;  2PNI A;  1K8A R;  3ZEH A;  1JXO A;  3VJP A;  2A3L A;  1PD1 A;  2GFU A;  5FWC A;  2K6D A;  5L8R E;  1Q82 U;  1QW1 A;  1K8A U;  2SEM A;  3CCR A;  5GAN 3;  2B86 A;  2OX7 A;  2SRC A;  1YJN A;  1VIE A;  3E2U A;  2CZ7 B;  3DB4 A;  2QEX Q;  3M0U A;  4KUD K;  2DM1 A;  5IHK A;  3I55 T;  2DF6 A;  3JV3 A;  2QAS A;  3HSB A;  2LMJ A;  3G6E Q;  1ZA2 B;  3ZFJ A;  1XTD A;  5J3B A;  4JJN K;  1B7T A;  1VYV A;  2XIC A;  3PTA A;  4LDW A;  1UEB A;  2HSP A;  1X75 C;  2AHJ B;  2VYT A;  3G1J A;  1VQL T;  3MP8 A;  2C0O A;  1OU8 A;  1SRL A;  1W2B P;  4HVU A;  4C8Q C;  4M77 C;  3JCM V;  2X51 A;  1H8K A;  5GAN 4;  3P8B B;  3CC2 Q;  4CC4 B;  3OS5 A;  5GAN 8;  5KYY A;  3SWN A;  1NE8 A;  3AHU A;  2NUT B;  1IXD A;  3NFC A;  2DLP A;  3ZBD A;  2DIG A;  2RA2 A;  4R55 A;  3O8V A;  3EGX B;  1M9S A;  3FLG A;  1PWT A;  2ECZ A;  2ESW A;  2FHD A;  1VQM A;  3A8L B;  2LT1 A;  1VYT A;  2CSI A;  2AKK A;  1KQS A;  3CBO A;  3VUZ A;  9ATC B;  3OS2 A;  1BB9 A;  3EHQ A;  2HQH A;  4A53 A;  3OYI A;  2EVR A;  2L0A A;  3PE0 A;  5IHN A;  4F17 A;  4IUV A;  4L59 A;  1VIF A;  2LQW A;  4KUI A;  1D1A A;  2GGR A;  2OAW A;  4OGE A;  2FYK A;  1SKU B;  1HK9 A;  3TVT A;  2F5K A;  2DER A;  1YBY A;  4LD9 K;  1K73 R;  1AWW A;  1P92 A;  3J7A F;  1I5L A;  2LNH B;  1IHV A;  1D1C A;  1TOV A;  1K73 U;  3UA7 A;  5FLX E;  2DO3 A;  3PMT A;  4A4F A;  1PSF A;  2VV5 A;  1VQ5 T;  1BI0 A;  1MND A;  5LJ5 e;  4RCB A;  3CCV T;  3CC2 A;  2Y4Y A;  1OQK A;  1VQ9 T;  4FIB A;  1PHT A;  1VYU A;  1JBM A;  1UE9 A;  4RTU A;  3T9N A;  3DLL A;  4EDU A;  4DBH A;  3CCU Q;  4E6R A;  2HAX A;  2LCL A;  2QQR A;  3M57 A;  4J9D A;  4FU6 A;  3VS6 A;  1JJ2 S;  2KDS A;  3GLX A;  4AFQ C;  4A4H A;  4KGZ B;  1IB8 A;  3X28 B;  1YJ9 Q;  4Y92 A;  4C8Q F;  3X20 B;  4M77 F;  4ATO A;  4M7A G;  4AFZ C;  5GAM j;  3CME T;  2XDB A;  3CPW S;  3CCM T;  2HL5 C;  3QJ6 A;  1Q86 U;  3JCM h;  1Q81 C;  2Y4X A;  1Q7Y R;  3FDR A;  1B07 A;  1XJW B;  1M27 C;  1HYO A;  2RK2 A;  3PIP A;  2LZ6 B;  4OMM A;  3ME9 A;  3QJY A;  1WJS A;  3I35 A;  4M7A D;  4J83 A;  4M4Z A;  5KE3 A;  2OTL Q;  2QYZ A;  3EG9 A;  1GBQ A;  4ANJ A;  1N5Z A;  3OYL A;  1KQS P;  2O4X B;  5LJ3 j;  2D1X A;  2F69 A;  3EG1 A;  1JJ2 A;  4FYV B;  2DBK A;  3L2R A;  3CCU A;  1VQ6 Q;  3VS4 A;  4A4E A;  2DET A;  3CPF A;  3X24 B;  5IAY A;  1KHC A;  3CQT A;  4Y28 E;  4Z89 A;  3OYA A;  4BDY A;  2K3X A;  4YTL A;  3GPL A;  2K57 A;  1YIT Q;  2DJZ A;  3X25 B;  4CC3 A;  4F7U G;  1VA7 A;  1ZA1 B;  2XI9 A;  2VXE A;  4DBQ A;  5FWB A;  4ME7 A;  4LD6 A;  1OPK A;  2JM8 A;  2RM4 A;  2EKH A;  3UPU A;  4B9X A;  1KQ1 A;  5CCA A;  2FRW A;  3G6E T;  2LDM A;  2EYZ A;  3JCM c;  3PT9 A;  1M90 C;  5KCH A;  1Y0M A;  1TWB A;  2ZAE A;  3N5B B;  3VS3 A;  2J6K A;  2LJ3 A;  1LPL A;  1BYM A;  4J7I A;  2F2X A;  3C0C A;  2ZPE B;  3RR6 A;  4LDY A;  3OYH A;  3SFM A;  2E5Q A;  1D0Y A;  4HVW A;  4IIO A;  3OYC A;  2A37 A;  4JDS A;  1VQ7 T;  1OV3 A;  4MZP A;  5KYW B;  5CKF A;  2O9S A;  3HRT A;  2JS2 A;  2CDT A;  2LX7 A;  3CCL Q;  1VQK Q;  3RMS A;  3GNG A;  3L2U A;  3SB2 A;  4KH0 B;  1VQ6 A;  3R6O A;  1VQ8 A;  1NYG A;  5J39 A;  1YNZ A;  2RD1 A;  5FRO A;  2E12 A;  5GAN f;  3I56 A;  3QYH B;  1AZG B;  3PGG A;  1B34 B;  3URG A;  2DIQ A;  1S1N A;  4IUQ A;  4FYY B;  2COZ A;  1U8R A;  2KT8 A;  2YHT A;  4UC4 A;  4DEX A;  1HSQ A;  5GAM d;  1UGR B;  2NUP A;  1JO8 A;  2CH4 A;  3DKM A;  3TCJ A;  4OMN A;  4XAX B;  1NLP C;  1RAF B;  2O9V A;  1VQ4 Q;  2QA4 Q;  3M4G A;  4RTT A;  4M7A C;  2YWW A;  3RIR A;  2M51 A;  1Y07 A;  1YHQ Q;  4J9F A;  5GAM e;  3FB9 A;  3EHR A;  4ZNX A;  2JNG A;  1TSF A;  4BE2 A;  5CKH A;  1Y71 A;  2FZG B;  2QGF B;  1N8R R;  4L5G A;  3QBY A;  2IIM A;  5LJ3 d;  3SEM A;  3OBW A;  4OB3 B;  2EYW A;  2K4Y A;  3CCL A;  1VQK A;  3QDF A;  4EMK B;  2P0K A;  4M78 A;  1X2K A;  3JCM W;  2DTO A;  2DZC A;  2H3J A;  2X9H A;  1Y96 B;  1BK2 A;  2EYQ A;  3E1S A;  2BE7 D;  1Q81 U;  4FT2 A;  2E6Z A;  4M75 B;  1U1S A;  2K3B A;  2X4X A;  4ZTJ A;  4B6M A;  2CP6 A;  3GOX A;  1EFN A;  1AZE A;  4AFS C;  5DM7 R;  2XID A;  3OMG A;  1FMW A;  3JRZ A;  4N4G A;  3TQ7 P;  3CXC S;  1YJ9 T;  1T3S A;  3CMA Q;  2BE9 B;  1VQ4 A;  4E47 A;  3M9Q A;  1UB4 A;  3NTI A;  3CCS A;  2VAS A;  1YI2 T;  4OVA A;  4QT7 A;  5DLO A;  2DVE A;  2JT4 A;  2A08 A;  2LP5 A;  1YP5 A;  1MV0 B;  3JCM f;  3M55 A;  2YRC A;  4BE0 A;  2RNA A;  2J6O A;  1KIK A;  2CP5 A;  1UJY A;  5D6X A;  5GJW B;  3CC4 T;  2JS0 A;  2JN0 A;  3LX7 A;  1NPR A;  5KYU B;  1QWF A;  3RDV A;  2PU9 B;  2V1R A;  1ZX6 A;  4J9E A;  2E3H A;  3QKJ A;  1M2V A;  2DZ9 A;  1S72 T;  3OYJ A;  2VKN A;  5C0M A;  2HQE A;  1VUB A;  2LVM A;  2WSC E;  3JSC A;  4M7A F;  4A4G A;  1M3A A;  2RO0 A;  4EPC A;  1ABQ A;  4E7Z A;  1OX8 A;  2XD0 A;  2H8H A;  4J8O A;  2ABL A;  1ZUU A;  2PVD B;  1YIT T;  3I5S A;  2HZY A;  3CCJ Q;  1M2O A;  3M53 A;  2OTJ Q;  3OW2 A;  3KBG A;  2E6N A;  2KGT A;  3L2W A;  5IT9 E;  4M7D C;  1CKB A;  3EH1 A;  1FX7 A;  2DL7 A;  4M7D B;  5GMK e;  1PSE A;  3EFS A;  4ELY C;  3V8J A;  3CCQ Q;  4M75 E;  1JB0 E;  4CI0 C;  4JJD A;  3A98 A;  3QII A;  1M1F A;  1X27 A;  5CQX A;  1K73 C;  3VRY A;  4E7L A;  4R0K A;  2R5A A;  1JQQ A;  1K4U S;  3UA6 A;  1GFD A;  2F2W A;  4V2S A;  4GBQ A;  4C5I A;  1ZHI A;  2L8D A;  5GAN 6;  2JM9 A;  1YJN Q;  1VQO T;  4DEY A;  1SEM A;  1VQP T;  3HRS A;  3ULR B;  2DRM A;  1OYX A;  4JRP A;  1NLO C;  4JJB A;  2QQA A;  1SRM A;  3M56 A;  2PTK A;  4MML A;  1GCP A;  1YFN A;  2EYX A;  1RAA B;  1PKT A;  5GAM g;  1RAB B;  2ROT A;  1M8V A;  4E7J A;  1OX9 A;  1V1C A;  4PFZ A;  2EFI A;  1E6G A;  2YT6 A;  2E70 A;  3CBM A;  2HCK A;  1M3B A;  1NEB A;  1QKW A;  2L89 A;  2QA4 T;  3E9F A;  1OZ2 A;  2GQV A;  3I9Q A;  1T3L A;  3C12 A;  2DMO A;  3SWN B;  3TU4 K;  1AWO A;  3QZ5 B;  1YHQ T;  4OMF B;  1Q95 G;  1O75 A;  1MMG A;  1Q7Y C;  3AT1 B;  4XU0 A;  5LJ3 g;  2ZPB B;  5GAN j;  2JZ2 A;  2CGH A;  1WHG A;  1U1T A;  2FG0 A;  1WQ7 A;  4IUP A;  1WQW A;  4TVR A;  4LDU A;  3VUB A;  3PFS A;  3IQL A;  1VQM Q;  1M1G A;  2GF7 A;  4FYX B;  5GAO l;  2MCN A;  2GCX A;  2EQM A;  5KYX A;  3OW2 P;  4M7D E;  2QTV A;  2E3I A;  1ZSZ A;  3Q1J A;  1AT1 B;  4M7D F;  3MCA B;  2D8J A;  1U5S A;  3TEE A;  3OMC A;  3PMI A;  1KQ2 A;  3FC3 A;  2F2V A;  3CD6 T;  4X1V A;  2O01 E;  4RG2 A;  4J6W A;  2LNV A;  3LWI A;  4HXJ A;  4N0A A;  1WYX A;  3REB B;  3H41 A;  5LJ5 h;  1VQN Q;  4N4H A;  2R5M A;  3CMA T;  2HKQ B;  3NGP A;  2AT1 B;  4DA4 A;  2CUD A;  2VXF A;  4FCY A;  2DE0 X;  1M8M A;  2RQT A;  2V8I A;  3C95 A;  3NPF A;  3VYG A;  4QW2 A;  2QK0 A;  3RMQ A;  1BIA A;  1PCX A;  4PLL A;  4HCZ A;  2DXU A;  4LN2 A;  3BFM A;  2FPF A;  1X6O A;  4Z88 A;  4J5Y A;  4E7S A;  2E41 A;  2MIO A;  3OYM A;  1QMC A;  3BDL A;  1VOM A;  3G7Z A;  4PKC C;  2GBQ A;  4HKE A;  1ZBX A;  5LJ5 d;  4KUL A;  3S3N A;  3I5R A;  4C92 G;  3RER A;  1LCK A;  2AK5 A;  2EJ9 A;  5FRN A;  3CCJ T;  4WCI A;  3O5Z A;  5J26 A;  1AWX A;  1VQN A;  2OTJ T;  1QVF P;  2J6F A;  1QVP A;  2A0F B;  4IKF A;  1QVG S;  5ECA A;  4EIK A;  2XMF A;  4OF1 A;  2V8J A;  5IHI A;  2M02 A;  4XTX A;  3JCM Q;  5GMK i;  3CCE A;  4BI3 A;  2E65 A;  3RKX A;  1Y57 A;  2EGE A;  2C06 A;  1LOJ A;  1X6B A;  2M1H A;  5GMK l;  5GAO q;  1YIJ T;  1K0S A;  1RAG B;  4C8Q A;  4M77 A;  5FU7 C;  3G4S A;  5GAN e;  2IG0 A;  1N8R C;  4X9D A;  5FU7 B;  3L2Q A;  3CCR T;  1NJI R;  2K5L A;  1IHW A;  3DLM A;  1YJW T;  1YJN T;  1NJI U;  3OYB A;  2FO0 A;  2NUT A;  1YWO A;  3NMZ C;  1FYN A;  1BI1 A;  1WJQ A;  1W1F A;  1QCN A;  5I2S A;  3EGX A;  3OYG A;  4LXC A;  2X4J A;  3L42 A;  1RLQ C;  1C6V X;  2RHY A;  3M5A A;  1Q7Y U;  2KXC A;  2NYS A;  3S6W A;  4QQ6 A;  2RMO A;  4DOW A;  1YCS B;  3VS7 A;  1SHF A;  2C0T A;  4PNO A;  2DFU A;  2DXB A;  3JCM J;  3OYY A;  4JJC A;  5GAO m;  3CC7 Q;  2FB7 A;  2JJ9 A;  4DQ2 A;  2FVU A;  4BD3 A;  2FZK B; 
#chains in the Genus database with same CATH homology
 1K9M U;  2CZ0 B;  4PJO A;  4XQ3 A;  4C8Q B;  4L5G A;  4M77 B;  2JUF A;  3QBY A;  4BDZ A;  5LJ3 d;  4M75 G;  2MAM A;  2OAU A;  3MEV A;  2B8A A;  4MDX A;  3OBW A;  4OB3 B;  4IUR A;  5GAN h;  2K4Y A;  3X26 B;  1W2B A;  3OY9 A;  1MGQ A;  3C94 A;  1HXD A;  3P8D A;  1VQK A;  3CCL A;  2QDY B;  4ZN1 A;  2XKO C;  2LQ8 A;  4EMK B;  4QVD A;  5I21 A;  2MF2 A;  2P0K A;  5EG2 A;  4M78 A;  3JCM W;  2DTO A;  4Q5W A;  1BI2 A;  4XU3 A;  2DZC A;  1QVF S;  2H3J A;  3LGF A;  1Y96 B;  1OZ3 A;  4N0A C;  4KBM B;  3JB9 H;  4ZGJ B;  3OYK A;  2EYQ A;  4MZM A;  3E1S A;  4F7U E;  3OYD A;  5LJ3 f;  3OB9 A;  3S3M A;  2P4T A;  1VQM T;  1Q81 U;  4FT2 A;  4M75 D;  2R58 A;  3LW5 E;  2E6Z A;  4A54 A;  4F7U F;  5CVI A;  2HD0 A;  4M75 B;  1NZ9 A;  3A8G B;  3TRE A;  4BI8 B;  2K3Y A;  2CZ1 B;  3CPW A;  1U1S A;  2QEX T;  3JB9 J;  4O6J A;  3MHX A;  2R57 A;  5HK0 A;  4RMO A;  3OS0 A;  4PJO G;  5C6S A;  2DXC A;  4ZGE B;  2X4X A;  4ZTJ A;  2QEX A;  2MMP A;  2EAY A;  1G3Y A;  3GOX A;  5CKD A;  4OGC A;  2F5T X;  2X35 A;  5AYF A;  2ZZD A;  5DM7 R;  2XID A;  3OMG A;  3MEU A;  3UT1 A;  3V8K A;  1UGS B;  3JRZ A;  2RI2 A;  4N4G A;  5HY6 A;  5GAM h;  3LWH A;  1FXX A;  2D0Q B;  2VC8 A;  1N9S A;  4RKU E;  3CXC S;  3CCS T;  1VQ4 A;  3G6E A;  5LJ5 j;  4E47 A;  3MP1 A;  4M78 G;  3OA6 A;  3CCJ A;  1D3B B;  1I4K 1;  3M9Q A;  1UB4 A;  4C0F A;  3NTI A;  3CCS A;  4B9W A;  3S3O A;  3UDC A;  5CO7 A;  1OI1 A;  2ZPG B;  1FWZ A;  4WF2 A;  3INZ A;  4JRI A;  4XTY A;  4C92 C;  4A4K A;  4R56 A;  3C4S A;  4C92 D;  1DJ7 B;  1YI2 T;  4OVA A;  4C92 B;  5CR2 A;  1SSF A;  4GY5 A;  5DLO A;  4C5E A;  5GAN d;  2DVE A;  4OB1 B;  1UGQ B;  3CC7 A;  3JCM e;  3JCM f;  5KH6 A;  3M55 A;  3CCQ T;  4BE0 A;  1VQ7 A;  3QZ9 B;  2LT4 A;  3CC2 T;  1Q86 C;  4M78 D;  1WGS A;  4JS4 A;  3VKI A;  4XU2 A;  5A0G A;  4M7D A;  5D6X A;  1LNX A;  3ASK A;  4M78 B;  3CCQ A;  3CC4 T;  1M1K U;  2OTJ A;  4JUV A;  2XDD A;  2JN0 A;  3LX7 A;  3JB9 F;  3V7C A;  3SD4 A;  1NPR A;  4GLK A;  4Y91 A;  4N4I A;  3CBP A;  2FL7 A;  5LJ3 h;  1YIJ A;  3QXE B;  3A5Z B;  2NLU A;  2PU9 B;  1QVF A;  3GNF B;  2QXF A;  4E7I A;  1IZ6 A;  3QKJ A;  3ZEH A;  3LYI A;  3VJP A;  3SDZ A;  2A3L A;  4ELZ C;  3JCM X;  2GFU A;  1G5V A;  2DZ9 A;  2GFA A;  5L8R E;  1Q82 U;  1QW1 A;  2RB6 A;  1S72 T;  1K8A U;  3OYJ A;  3CCR A;  5C0M A;  2K5F A;  5GAN 3;  4BY6 C;  2HQE A;  1VUB A;  2LVM A;  2WSC E;  1YJN A;  1VIE A;  3JSC A;  2CZ7 B;  3DB4 A;  4M7A F;  4A4G A;  1QP2 A;  1YCY A;  1N6A A;  4BY6 B;  2LQK A;  2L5Q A;  2RO0 A;  2DEQ A;  3V7S A;  4KUD K;  2EJF A;  4EPC A;  3I55 T;  4M7D G;  3CEY A;  2MWP A;  5LJ5 g;  2RI5 A;  4J8O A;  2XD0 A;  3EAE A;  5GMK j;  3KUF A;  3G71 A;  3HSB A;  3OBY A;  2PVD B;  4C8Q E;  1YIT T;  4M77 E;  3ZFJ A;  1RL2 A;  1XTD A;  4FM4 B;  5J3B A;  4JJN K;  3M53 A;  2XIC A;  4JLG A;  3OW2 A;  3PTA A;  4LDW A;  1UEB A;  3KBG A;  4RG8 A;  2E6N A;  1QVG A;  1X75 C;  2PQW A;  2AHJ B;  2YLC A;  3L2W A;  4ZTF A;  1IRE B;  1WJR A;  1H3Z A;  2VYT A;  3JCM P;  5IT9 E;  1VQL T;  4M7D C;  3MP8 A;  1FX7 A;  2KQW A;  4J6Y A;  4FL6 A;  3FIF A;  1NPP A;  5M9O A;  4M7D D;  1WPY A;  5GMK m;  4M7D B;  4C8Q C;  4D6W A;  4M77 C;  3JCM V;  1PSE A;  2WSF E;  5GMK e;  2CYZ B;  4RCC A;  3EFS A;  2EQU A;  4ELY C;  3WVE B;  2Y90 A;  3V8J A;  5GAN 4;  2K5I A;  4IUT A;  5GAO r;  2D6F A;  3RKW A;  3P8B B;  4M75 E;  1N8R U;  1JB0 E;  4CI0 C;  2MI6 A;  1I8F A;  2QQS A;  3OS5 A;  5GAN 8;  2HQX A;  2E64 A;  3QII A;  1M1F A;  3OYF A;  5CQX A;  1K73 C;  4EMK C;  5GAN 5;  4Z02 A;  1H64 1;  4E7L A;  1WNL A;  2R5A A;  3SWN A;  1NE8 A;  3AHU A;  4C0G A;  4KT0 E;  2VGM A;  4BB7 A;  4V2S A;  4HA8 A;  2XK0 A;  2EWN A;  4C5I A;  4OP0 A;  1N27 A;  1ZHI A;  2BKD N;  1KD1 C;  5FRM A;  3NFC A;  2L8D A;  4CRI A;  3CCU T;  3ZBD A;  3L2Z A;  2DIG A;  4M75 C;  2RA2 A;  5GAN 6;  4R55 A;  3O8V A;  1VQO T;  1M9S A;  3FLG A;  2YRV A;  1VQP T;  3HRS A;  2PUO B;  2FHD A;  2DAQ A;  1VQO A;  1VQM A;  3A8L B;  2LT1 A;  1XOV A;  1KQS A;  2KMT A;  1OYX A;  3CBO A;  4JRP A;  4C92 E;  2G3R A;  2CZ6 B;  3L1A A;  3VUZ A;  4MZT A;  3A8H B;  2KY9 A;  4QVC A;  4IUU A;  3OS2 A;  3HKS A;  2QQA A;  4II1 A;  4C92 F;  4NOY A;  3M59 A;  4A53 A;  2HBP A;  2PVG B;  3E19 A;  3M56 A;  3M58 A;  3PNW C;  3QHS A;  4MML A;  3OYI A;  5GAN 2;  2MWO A;  2XG8 D;  3RUX A;  2HNI A;  5CQY A;  5GAM g;  4C0D C;  2ZPH B;  4IUV A;  4L59 A;  2RJD A;  1VIF A;  4M78 E;  5GAN 7;  3JCM d;  4C8Q D;  4LDV A;  1M8V A;  4E7J A;  4FSX A;  4KUI A;  4C0D B;  4OGE A;  2QQ9 A;  2FYK A;  1YJ9 A;  4PJO C;  4FT4 A;  2DD4 A;  1XNI A;  1KC8 C;  1HK9 A;  4PJO D;  2EFI A;  3A8O B;  2F5K A;  4XK8 E;  1YBY A;  2EQK A;  4LD9 K;  3WVD B;  4PJO B;  2E70 A;  3CBM A;  1P92 A;  3OSV A;  1AHJ B;  3J7A F;  1I5L A;  1V29 B;  2BIV A;  1K73 U;  2QTX A;  3MP6 A;  1YI2 A;  1VQN T;  3BW1 A;  2L89 A;  5FLX E;  2QA4 T;  3E9F A;  1OZ2 A;  2DO3 A;  3MEA A;  3PMT A;  4A4F A;  2GQV A;  2ZGW A;  4M78 C;  2VV5 A;  1PSF A;  1VQ5 T;  3C12 A;  3OYE A;  2LC4 A;  3SWN B;  3TU4 K;  1BI0 A;  5LJ5 e;  3QZ5 B;  1YHQ T;  3JAM E;  4OMF B;  5LJ5 f;  1O75 A;  2RJE A;  5CKB A;  4RCB A;  3CCV T;  3CC2 A;  2Y4Y A;  1VQ9 T;  4FIB A;  1Q7Y C;  4BAC A;  1I81 A;  3HRU A;  1G3S A;  4XU0 A;  2OTL T;  5LJ3 g;  1JBM A;  3CC4 A;  2ZPB B;  4OB2 B;  2JZ2 A;  2CGH A;  2EQJ A;  4VUB A;  4XTW A;  5GAN j;  3T9N A;  2EJG A;  5CIU A;  4NS5 A;  3NTH A;  4XTZ A;  3DLL A;  1U1T A;  2P0P A;  3GF5 A;  1WQ7 A;  2OTL A;  2KK4 A;  4IUP A;  3CCE T;  4M7A A;  1WQW A;  4TVR A;  4EDU A;  4LDU A;  5GAO n;  3VUB A;  1M4Z A;  3PFS A;  3WXM B;  2XDP A;  2HAX A;  4E7K A;  1JRI A;  2LCL A;  1YJ9 T;  3RES A;  2YLB A;  2QQR A;  3M57 A;  4P5N A;  4FU6 A;  3KXT A;  1M1G A;  1VQ6 T;  2EKO A;  3LGL A;  2GF7 A;  1MHN A;  5GAO l;  3QUI A;  1JJ2 S;  3QYG B;  1VQ8 T;  2KDS A;  2O4X A;  3GLX A;  1S72 A;  3G4S T;  2A7Y A;  1RI0 A;  2DD5 A;  2E1H A;  2RK1 A;  1W2B S;  3BDU A;  2GCX A;  3I56 T;  2EQM A;  1K9M C;  2LX9 A;  4M7D E;  4A4H A;  3Q1J A;  4M7D F;  2KSS A;  3I55 A;  1KC8 U;  3X28 B;  3CXC A;  2DTI A;  3MCA B;  1YIT A;  4C8Q F;  3X20 B;  4M77 F;  4ATO A;  5I2M A;  4M7A G;  3OQ5 A;  3TEE A;  3OMC A;  3PMI A;  4QVZ A;  1Y96 A;  1KQ2 A;  5GAM j;  1Y7X A;  3VYH B;  3FC3 A;  1G3W A;  3CME T;  2CKK A;  2XDB A;  3QO3 A;  4NL3 A;  3CPW S;  3CD6 T;  3CCM T;  5KCO A;  2O01 E;  3QJ6 A;  2I2L A;  4J6W A;  2LNV A;  3M4Y A;  4RG2 A;  3LWI A;  1Q86 U;  4N0A A;  3JCM h;  3FRN A;  3PIO A;  1Q81 C;  3QG1 A;  2Y4X A;  4ZN3 A;  1VQL A;  5CAI A;  3FDR A;  5LJ5 h;  4XU1 A;  1ZQ1 A;  4N4H A;  2RK2 A;  4JRK A;  2PVO B;  3PIP A;  2R5M A;  1UGP B;  2RHU A;  3ME9 A;  3CMA T;  5DY9 A;  3QJY A;  1WJS A;  4M7A D;  2E10 A;  4JLI A;  2QI2 A;  5GAN g;  2RI3 A;  3ER0 A;  4J83 A;  4M7A B;  3H6Z A;  4DA4 A;  4LDX A;  2L3R A;  2VXF A;  4M75 F;  1GXI E;  1BI3 A;  4MMK A;  2V8I A;  3C95 A;  2KVQ G;  5KE3 A;  3LLR A;  4F7U A;  2LTO A;  4X34 A;  2DXT A;  3MEW A;  3HP9 A;  3VYG A;  4PLI A;  3OYL A;  2O4X B;  4QW2 A;  3RMQ A;  1O9S A;  5LJ3 j;  2F69 A;  4C92 A;  4XTU A;  1BIA A;  2RJC A;  1JJ2 A;  4PLL A;  3MO8 A;  3L2R A;  4HCZ A;  2JVV A;  3CCL T;  2DXU A;  3CCU A;  1VQK T;  2RHI A;  4A4E A;  2XU8 A;  3BFM A;  3V8L A;  1X01 A;  3CPF A;  4PJO E;  1X6O A;  2RH2 A;  3X24 B;  2VGN A;  5IAY A;  1VQP A;  3VV0 A;  3EFR A;  2DPP B;  5A2Q E;  5IN1 A;  1KHC A;  3OSS C;  4C0Z A;  4Y28 E;  4PJO F;  3OYA A;  4BDY A;  2K3X A;  3QPH A;  3MET A;  4YTL A;  4J5Y A;  4DOV A;  4BD3 A;  4QQD A;  1XQH A;  2E41 A;  1M1K C;  3GPL A;  2K57 A;  3OYM A;  2DJZ A;  3X25 B;  5LJ3 e;  1LJO A;  3BDL A;  5D6W A;  4E7H A;  4F7U G;  3V7R A;  2XI9 A;  3G7Z A;  2M0O A;  4PKC C;  4C5G A;  2VXE A;  1B34 A;  5DLQ E;  5D6Y A;  3QDR B;  4HKE A;  1ZBX A;  4ME7 A;  3J81 E;  1R8O B;  4M78 F;  5LJ5 d;  2JTM A;  3GIB A;  4KUL A;  4LD6 A;  3S3N A;  4C92 G;  5GMK h;  4PL6 A;  3A8M B;  4JRQ A;  2RM4 A;  2X4Y A;  1Q82 C;  3LH0 A;  1NJI C;  1K8A C;  1M5Q 1;  1G3T A;  3RER A;  3BY7 A;  3UPU A;  2JOY A;  2EJ9 A;  3SWN C;  1KQ1 A;  4B9X A;  2BUD A;  5CCA A;  1VQ4 T;  5FRN A;  3G6E T;  2LDM A;  3CCJ T;  5CKE A;  2V8K A;  5J26 A;  4QQG A;  1VQN A;  2OTJ T;  4C5H A;  1M90 C;  3JCM c;  3PT9 A;  4F7U B;  2QA4 A;  4HCC A;  5KCH A;  3OW2 S;  1VQ5 A;  3N5B B;  1KG1 A;  1W4S A;  1KD1 U;  3QSU A;  1QVP A;  4IKF A;  1QVG S;  1BYM A;  1YHQ A;  4J7I A;  2XHC A;  2ZPE B;  3CCV A;  4LDY A;  3FJP A;  2KAF A;  1VQ9 A;  3OYH A;  3SFM A;  3JB9 I;  4OF1 A;  5HK3 A;  3CC7 T;  2E5Q A;  2V8J A;  4J7F A;  4XTX A;  3JCM Q;  3OYC A;  5GMK i;  4JDS A;  1VQ7 T;  4HT9 A;  4MZP A;  5CKF A;  2LCC A;  3CCE A;  4HCB A;  3HRT A;  2E65 A;  3RKX A;  4BI3 A;  4ZGD B;  1EIF A;  3L2V A;  2C06 A;  1LOJ A;  2M1H A;  3E9G A;  2ZCF B;  3RMS A;  3JB9 G;  5GMK l;  3GNG A;  1BKB A;  5GAO q;  3SB2 A;  3L2U A;  4BUG A;  3HFO A;  4JS5 A;  2M16 A;  2LRQ A;  1YIJ T;  1TH7 A;  3HHT B;  5KE2 A;  3R6O A;  2DTH A;  4C8Q A;  3DB3 A;  4M77 A;  5FU7 C;  4EMG A;  5J39 A;  1VQ8 A;  3G4S A;  2RD1 A;  3H8Z A;  5FRO A;  5GAN e;  2IG0 A;  2E12 A;  1N8R C;  4X9D A;  5GAN f;  3I56 A;  4HT8 A;  3QYH B;  3PGG A;  1B34 B;  5FU7 B;  2DIQ A;  2RHX A;  3M54 A;  3URG A;  3OS1 A;  4IUQ A;  3L2Q A;  3CCR T;  2P0Q A;  2K5L A;  4EMH A;  3DLM A;  1YJW T;  4OB0 B;  2PUK B;  4EMK A;  1YJN T;  1NJI U;  2DK3 A;  3FEO A;  1U8R A;  4M7A E;  1N9R A;  3OYN A;  3HFN A;  2RJF A;  2YHT A;  3OYB A;  3JB9 D;  1YJW A;  3UWN A;  5FU6 C;  4XTV A;  5HKC A;  4UC4 A;  2IVW A;  2X4W A;  4BI4 A;  3NTK A;  4MDW A;  2K2V A;  1BI1 A;  1WJQ A;  2M9U A;  3P8H A;  1KQS S;  1VQ6 A;  5GAM d;  3JCM g;  5I2S A;  3OYG A;  3RKY A;  1M90 U;  1UGR B;  5FU6 B;  5CK9 A;  2EIF A;  2X4J A;  3L42 A;  4X9C A;  3G71 T;  2RHZ A;  3CME A;  3CD6 A;  3CCM A;  2CS7 A;  2RHY A;  4M75 A;  3DKM A;  3M5A A;  2D9T A;  3TCJ A;  4XAX B;  1Q7Y U;  5GAO p;  3M4G A;  4C8Q G;  5A0D A;  4M77 G;  3JCM b;  3S6W A;  4M7A C;  4QQ6 A;  4DOW A;  4BE1 A;  3J80 E;  3RIR A;  1Y07 A;  1BIB A;  4NL2 A;  5LL6 S;  5GAM e;  3CMA A;  3FB9 A;  5GAM f;  2QQB A;  3GP8 A;  4PNO A;  1QP3 A;  2DXB A;  2JNG A;  3HL8 A;  2DKG A;  2VUB A;  3OYY A;  4O5V A;  3JCM J;  1D3B A;  3HPW A;  2JTF A;  3F70 A;  2ZPI B;  5A0L A;  4J6X A;  4L6V 5;  5GAO m;  4BE2 A;  2WAC A;  2FB7 A;  2ZPF B;  1Y71 A;  5CKH A;  4DQ2 A;  2WSE E;  2FVU A;  1KHI A;  3VU3 C;  4M77 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...