4PJOC

Minimal u1 snrnp
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
86
structure length
86
Chain Sequence
GSGSVKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human U1 snRNP, a small nuclear ribonucleoprotein particle, reveals the mechanism of 5' splice site recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Splicing
molecule keywords Small nuclear ribonucleoprotein Sm D3
total genus 14
structure length 86
sequence length 86
chains with identical sequence Q, c, q
ec nomenclature
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4pjoC00
3V7RA 4PJOD 4M77A 5GANe 2DEQA 5GANj 4XU1A 3M4GA 4N0AC 4EMKC 5GMKl 4XQ3A 2YHTA 2VXFA 3PGGA 5GAOm 2EJFA 4J6XA 3V7SA 5GAN7 2DTIA 4M77E 3SWNB 3V8KA 4M77D 2E65A 5CAIA 2ZGWA 3V7CA 4C92G 2FYKA 1LJOA 4M75B 3QO3A 4C92C 3JCMc 1B34B 5LJ5e 1LOJA 3JCMW 4XU3A 5GANh 3JCMP 2EJ9A 4PNOA 3RUXA 5LJ3e 3JCMV 3FB9A 5DY9A 4DQ2A 5GMKh 5GMKi 2DXUA 1BIAA 4M78D 4M78C 5GANd 4J6YA 4EMKA 4M75G 5LJ3f 3RESA 4M75C 2DKGA 4C92B 4C8QF 4PJOG 5GAN6 1M5Q1 5GAMh 1I5LA 1WNLA 1D3BA 4M7DD 3JB9G 1M8VA 4M7AC 3VU3C 4A53A 5GAOl 1Y96B 4M7DB 5LJ5j 3GIBA 1KQ2A 4JRKA 2E41A 4F7UE 2VXEA 4JRIA 4PJOF 5LJ5d 2CGHA 5GAN3 4J6WA 4M77C 2EAYA 1D3BB 4M77G 1BIBA 2K57A 3JCMd 3JB9F 1I8FA 2RA2A 2RB6A 4NL2A 5GAOn 3JCMe 1TH7A 3JCMb 2DTHA 4JUVA 4EMKB 5LJ5h 3RERA 2I2LA 3HFNA 4EMGA 4M7AD 4M7AB 5LJ3h 4M78A 4M7DC 2RD1A 4N0AA 5GAOq 1HK9A 3JB9J 2EJGA 3BDUA 4C92A 3HSBA 4PJOA 3QSUA 4M7AA 3JCMg 5GAMd 3EFRA 3JCMQ 5I21A 4C8QE 4C8QD 4XU2A 5GAMe 1MGQA 4XU0A 5GAOr 3HFOA 3INZA 3RKXA 1JBMA 4XTZA 4HA8A 3RKWA 5LJ3j 5GAOp 5GANf 3BFMA 4XTUA 3JB9I 1N9RA 1U1SA 4F7UG 2HNIA 4XTWA 2EWNA 3V8LA 4QVDA 1B34A 4C8QB 5GAMf 3RKYA 4C92F 2FB7A 4M78B 3AHUA 4M7AF 4M78E 3JB9D 1H641 3JCMh 1YCYA 2YLBA 4JLIA 4XTVA 4PJOC 1Y96A 4F7UF 4NOYA 4QVCA 4NL3A 4M75D 1U1TA 4M75E 1WQWA 4M7DE 4Y91A 4M7AG 4PJOE 4X9DA 4V2SA 5LJ5g 4MMLA 2DZCA 5GAMj 3JCMf 3L1AA 1I4K1 4RCCA 4HT8A 4M77B 2YLCA 3FJPA 3SWNC 3JCMJ 2E64A 2DXTA 5GAN4 2DJZA 4M78F 1N9SA 2DTOA 2VC8A 3RIRA 3SWNA 2E10A 4F7UA 1KQ1A 1WQ7A 4C92D 4OP0A 2Y90A 4C92E 4F7UB 4M7AE 4M7DG 5GMKm 3BW1A 5GAMg 3JCMX 5GAN5 4WF2A 3SB2A 5LJ5f 2RM4A 4M75A 2E1HA 4A54A 4J5YA 4M7DA 5LJ3g 3FIFA 3QHSA 1I81A 4M78G 3L2ZA 4X9CA 1WPYA 4M77F 3EFSA 4XTXA 4EMHA 4MMKA 4RCBA 2DVEA 4HT9A 4C8QA 1JRIA 2DZ9A 3QUIA 5GAN8 5GAN2 5GANg 4XTYA 1HXDA 5LJ3d 4C8QC 4M7DF 3BY7A 4M75F 1LNXA 4C8QG 5GMKe 5GMKj 3JB9H 2JN0A 2QTXA 1X01A 3V8JA 4PJOB
chains in the Genus database with same CATH superfamily
1JQQA 3S3MA 2ATCB 4N0AC 1X6OA 1WDXA 2CH4W 3PGGA 3SWNB 4C92G 4M75B 4FSSA 5LJ5e 2D0NA 2YWWA 4B9XA 3OYLA 3CCUT 5DY9A 3G1JA 1UFFA 4Q5WA 1PRLC 3CMET 4C8QF 3NFCA 4DBRA 4C0GA 2B8AA 3PFSA 5DLOA 5GAN6 1K4US 2J06A 2RQTA 2I0NA 2C06A 2VYTA 1TUCA 3CD6A 4C5IA 2OTJA 2EQMA 1I1JA 2BZ8A 1TH7A 1JB0E 1N5ZA 5KH6A 1KFZA 1R0BG 2EQIA 2EW3A 1HK9A 2RK2A 4C92A 1W1FA 1TS9A 2CZ0B 3I55Q 1UTIA 5CQYA 1IREB 1Q86C 1RABB 3JB9I 2HNIA 4M78E 3I5RA 1YBYA 3FLGA 3TQ7P 4IURA 4PJOE 3NPFA 5HY6A 1W2BP 1TSFA 1KHIA 2FVUA 2DMOA 5LJ5g 2CP6A 1WI7A 4E7JA 4HT8A 1KG1A 3Q1JA 2K3BA 3VYGA 4OP0A 1C1AA 3KBGA 2E1HA 2QEXT 2KNBB 3WVEB 1M90R 2RI2A 3REBB 1M3AA 2JTMA 1MMGA 3HRTA 1S72T 2DNUA 2JUFA 1BU1A 1GRIA 5I22A 2FO0A 2WACA 4M7DF 2FRWA 4OB1B 2ED0A 2QA4T 2CP7A 4WCIA 2YHTA 4F16A 1MMNA 5KYNA 3TSZA 3MEUA 1JJ2S 2OTJQ 1YI2A 4E47A 1YITQ 1VOMA 2OX7A 1BIAA 4Y28E 1VQ6T 1ZSGA 9ATCB 1JJ2P 1VQ6Q 1R0CB 1XOVA 5KYXB 1VQ5Q 1A0NB 3VU3C 4A53A 1BB9A 3GIBA 2YSQA 1KD1U 1KQ2A 1QP3A 3NGPA 2FPFA 1V76A 3I56T 1K73R 2X3XD 4N4HA 1ZLMA 1YP5A 2DPPB 2YDLA 4JUVA 4BACA 1QLYA 4C0DB 3A8MB 3P8HA 3EG2A 4K11A 5CR2A 1K1ZA 4R55A 2FPEA 2JZ2A 2DF6A 2FRYA 4GY5A 1U1SA 1EFNA 4C0DC 3M5AA 4IKFA 4KH0B 2RJDA 3PNWC 3CC2A 4FYWB 2DXBA 3EH1A 3SHWA 4M75E 4M7DE 1K8AU 3CCMT 2QDYB 2V8JA 2E4HA 4DBQA 1VQKQ 2CS7A 1VQ7T 4M77B 3D7SB 1K0SA 3TVTA 3PMIA 4F7UA 2DTOA 5KYYA 5HK0A 2Y90A 3J81E 2P4TA 2OTLT 1QMCA 1HD3A 3T9NA 5AYFA 2DBMA 2CP3A 3FDRA 3EGXB 1KQSA 1VIFA 2QTVA 4CC4B 2RQUA 4CC3A 5CCAA 3UDCA 4VUBA 2V1RA 3QDFA 3TSWA 1B3QA 1PC0A 1M9SA 3X25B 2HEQA 3V7RA 4B9WA 3CCRT 1RI9A 4FW1A 4FYXB 1IHWA 2XDPA 4RTWA 2VXFA 3URGA 1VUBA 5GAN7 3G4ST 2ZGWA 5FROA 2M51A 1KD1C 2MPXC 2DERA 2K3YA 3ZEHA 2C0OA 4JJNK 1F1BB 2FZGB 4PFPA 2KMTA 3GOXA 2ESWA 1FXXA 2E5KA 2PNIA 2KRNA 2E41A 3J7AF 1SPKA 2VXEA 4JRIA 1EIFA 3H0FA 4NL2A 3X28B 2BE9B 2BZYA 3RNJA 1MNDA 4C5GA 2JMAA 3QSUA 6AT1B 2E6ZA 4ATOA 2DX1A 5EC7A 4AFZC 5CKFA 1N9RA 5D6YA 2XK0A 2XDDA 1YHQT 3OSSC 4XTVA 2KAFA 3EFOB 4BY6B 4MMLA 1HYOA 2OTLA 4MDXA 1K9MU 5FU6C 2DIQA 2EPDA 1WX6A 1UB4A 1IHVA 1WQ7A 4C92D 1DJ7B 4M7AE 4KRTA 5GMKm 4AFSC 2XU8A 1G8XA 2P0KA 1M2VB 4J5YA 2K7AA 2CYZB 2QGGA 4M77F 2O88A 2ZPIB 4XTXA 1AT1B 3OS5A 1WXTA 4JJBA 5LL6S 5KCHA 2L0AA 2G3RA 5GMKe 1UHCA 3AT1B 2CT3A 2CKKA 1U5SA 3MO8A 3VS2A 2NUTB 1QCOA 2AZVA 2A36A 2LT4A 2FYKA 2EJ9A 5C6SA 1ZBJA 2X35A 4F14A 4PKCC 5GMKh 3M0SA 3CCUQ 2DXUA 3KXTA 4E7ZA 1QKXA 1ARKA 3RESA 1VQNA 4RTXA 1M30A 4OMQA 3CCLT 3C94A 2LC4A 2ZCFB 2DL3A 4RTTA 5CIUA 1IGUA 5GJWB 4PJMA 1YI2T 4LDWA 3KFVA 3L42A 4LD9K 2RHYA 5CKBA 3EFRA 1RL2A 4FW2A 2DM1A 4XU2A 2IG0A 2CZ7B 1P92A 1QVFA 2J05A 1OQKA 2AT1B 2Z0WA 1M1FA 5FW9A 3M55A 3AHUA 3LWIA 1QQJA 1WHLA 2PU9B 2PVOB 3C95A 3P8DA 2HL3A 1WHKA 1Q81C 1VQOA 1KQSS 1WLPB 1ABQA 2DZCA 3L1AA 1OOTA 3CCJA 1VQMQ 2E5QA 2R5AA 4BI8B 4HCCA 2X4YA 1KQ1A 3DKMA 2EQKA 3JSCA 2DL4A 1VYUA 4A4GA 1XTDA 4LE9A 2QYZA 1NBEB 3G7ZA 5LJ3g 2ZPEB 3OW2P 1QW1A 3QYHB 4MMKA 3A8OB 3OS0A 1VQOT 2DEUA 1KSWA 1LNXA 1BCMA 3JB9H 2MYSA 2DD5A 3MP1A 2QA4Q 4OMMA 4QVZA 3CMAA 4PJOB 4BB7A 2L2PA 4M77A 1N8RR 3OW2S 4BY6C 4XQ3A 4LUEA 5KYYB 4MDWA 1S72Q 3MEWA 3S3NA 4PJLA 4C92C 1KC8C 1NPRA 1BCOA 1K76A 1AEYA 4RMOA 1QKWA 4GLKA 1M1KR 2X3WD 4M75G 4C92B 3E9FA 4ESRA 3E1SA 1M8VA 3CCLA 2PVDB 1PWTA 4LXCA 2W0ZA 5CK9A 2P4RA 1S1NA 4KT0E 1Y07A 3HRSA 1YITT 3RERA 3NMZC 2MI6A 4N0AA 2CT4A 2RPNA 3JCMg 4EIKA 1YNZA 1WZOA 2BUDA 4IIMA 5GAMe 5GAOr 4M4ZA 3CC7T 5LJ3j 3RKWA 3G4SQ 4LDXA 3G6ET 2E12A 1AVZC 2BTTA 4LDUA 4PK4A 1GFDA 1GCQC 2O4XB 4AMCA 2RN8A 2YLBA 2DO3A 4Z8AA 4RTVA 1U8RA 4E7LA 4Z88A 1YWOA 1E7OA 2ZPFB 1YJWA 2L3PA 3EGDB 2OAUA 4OMFB 4TVRA 4A4HA 1WJSA 4D8DA 1ZUKA 2HQEA 1FMKA 1FWZA 1T0JA 2XDBA 1VQ5T 4J9FA 1VQLT 2VWFA 3S3OA 1NM7A 4N4IA 1QWFA 2HQXA 2DVEA 3OMCA 2L3QA 2FL7A 3VUZA 1NEGA 2QTXA 3LH5A 3ZL7C 3TCJA 3SFMA 4PJOD 2D6FA 1YHQA 1XJWB 1QVFS 2D8JA 1D1CA 4HCKA 4DOWA 3FJ5A 2K5LA 4WTOB 4M77E 4QKUA 3I56Q 5KYWB 1X6GA 5DM7R 4IUTA 3I5SA 3A1PA 2QGFB 5GJVB 1QVFP 2MIOA 1V29B 1AWJA 2O2OA 1QP2A 2QQ9A 2YUNA 3EHRA 1Z9QA 2H3JA 1MV3A 5KYWA 1W6XA 1Y96B 1IO6A 4BDYA 4C0ZA 1OULA 2ZPHB 4IUUA 4L59A 1WYXA 2I2LA 5C0MA 3BE3A 2ZAEA 1BKBA 2COZA 2PTKA 1BI2A 2VB6A 2HAXA 1QCFA 1NJIR 3OYMA 3CPWP 4FYYB 4RTYA 1AWOA 2XICA 2LQ8A 4QQGA 3VRYA 3QBYA 3CCUA 3TU4K 3U23A 5GAMf 1NJIC 1VQLQ 2RQVA 4F7UF 5CKHA 2V1QA 2DAQA 4EDUA 4V2SA 5J26A 1GCPA 2D8HA 4DBFA 4FYVB 3VS1A 2RQWA 4A4FA 3JCMf 2K5IA 1OX9A 3RMSA 3JCMJ 3VS5A 1Y0MA 1D0YA 1FYNA 2X4XA 4J83A 3OQ5A 1M2OA 1PD0A 4C92E 1OPKA 2A0FB 3GF5A 5LJ5f 2KK4A 2NYSA 2BE7D 3L2ZA 4HVVA 1RI0A 2NUPA 1D09B 3PE0A 3EFSA 2G6FX 3RR6A 3M0RA 4IUQA 1QVGP 1WJQA 2HKNA 2HMAA 5GAN2 4PJJA 2AZSA 3CCMA 2LCLA 2KYBA 3QJYA 4E2FB 2X51A 3G71A 1ZSZB 2RHXA 1C6VX 3CCST 2K79A 1RLQC 2LQWA 3L2WA 2QI2A 1YJWQ 4J6XA 3C4SA 1K8AC 4A4EA 2L3RA 5GANh 1Q81R 1K8AR 3EGUA 1Q86R 1BI0A 3VS0A 1H3HA 1LCKA 2CSIA 4M78C 5KYXA 5GANd 1GXIE 1GBQA 1ABOA 2J7IA 4MZMA 3M53A 3LW5E 1T3LA 2M0YA 1M2VA 2D1XA 1WHMA 1UJ0A 3ZBDA 5LJ5d 4J6WA 2CP2A 4M77G 3RDVA 1TWBA 4YTLA 5KYUA 2RHIA 5DLQE 1YHQQ 3H41A 5GAOn 2R5MA 2YRCA 2QQAA 3H0HA 5CQXA 1PSFA 3CC4A 3EFOA 2LRQA 2R58A 4Z89A 5IXFA 1KHCA 3CMEQ 1M27C 3MJXA 2NUTA 2RQRA 2AIRB 2GBQA 2CZ1B 2R57A 2RI3A 3L2QA 1OU8A 2EWNA 2VVKA 4QVDA 1AZEA 4M7AF 3QPHA 2Y4YA 5A0DA 4R56A 4PLIA 1Y96A 2YUOA 2J6OA 1PG5B 3S6WA 1ZUUA 4J9BA 3OA6A 3FJPA 3L2VA 1NYGA 3RIRA 2QEXA 1VQ4Q 1KC8U 1N8RU 2DYBA 4WF2A 2RM4A 1XQHA 2KR3A 2YXYA 1JJ2A 3VV0A 2HZYA 4O6JA 2CP0A 3CCQQ 4X34A 4BE2A 1VQOQ 2DZ9A 4CC2A 2QXFA 1G3TA 5CO7A 3QYGB 1YJNQ 4GBQA 1OYXA 4ELZC 5I2MA 4EMKC 2L89A 3OYEA 3MEAA 1OV3A 1X43A 5CKEA 1LJOA 3JCMc 3CPWA 4XU3A 3THKA 4C5HA 2KY9A 3RUXA 5L8RE 2JVVA 2KT8A 5GMKi 3OYJA 3CD6Q 3CC2T 3CD6T 2HBWA 3H0IA 3I55T 1K73U 5GAMh 4M7DD 4KGVB 2O01E 4M7AC 1ZUYA 2P0PA 1IGQA 2DRKA 1I5OB 1YIJT 2DL7A 1D3BB 4RTZA 1ZSZC 3CMEA 5IN1A 4IUPA 1J3TA 3LYIA 4QQ6A 4M78A 2SEMA 4KUDK 4PJOA 1D1AA 4JRQA 3I56A 2XKOC 1VQMT 1TOVA 4C8QD 1D1BA 1Q86U 2M0OA 4PFOA 1VIEA 4M78B 3REAB 1VQ6A 1YCYA 2KYMA 1U1TA 2RHZA 2X4WA 4KUIA 4Y91A 1VQ5A 3M54A 1JU5C 1VQPQ 4CI0C 4N4GA 1VQPT 1WGSA 1YJ9A 1WHGA 1O9SA 2M02A 2MMPA 3J80E 2VGMA 1M3CA 4J7FA 1I0CA 2KI7A 4OMLA 3CPWS 2M9UA 2PZ1A 1QCNA 3G71Q 1C0MA 5FWBA 4KBMB 1YIJQ 3RMQA 2FG0A 5FLXE 1TU0B 1E6GA 1I07A 3TEEA 3G6EA 3UF4A 1S72A 2PUKB 5GMKj 1M90U 1LPLA 4XK8E 2P84A 3CC2Q 2X9HA 1BI3A 1JXOA 5I2SA 4HCZA 2QDLA 2MK5A 2EVRA 4DBHA 5FU7B 2OTLQ 1Y7XA 1AZGB 2E65A 5KE3A 3V7CA 4DOVA 1PD1A 4F17A 1VQMA 1LOJA 1KQSP 1NPPA 2YUPA 4JDSA 1YWPA 2H8HA 4AFQC 1NG2A 2KBTA 4EMKA 2EGCA 1PKTA 4M75C 2DKGA 3A5ZB 3CCRQ 2DYIA 3DB4A 1NLPC 3WXMB 4OMOA 3VS7A 1VYVA 4D8KA 3DB3A 4CRIA 2LTOA 4M77C 2JTFA 1RAEB 3E2UA 4QW2A 3VS3A 3M0UA 4ZN1A 2RJEA 2CUBA 1T3SA 4EMKB 4AFUC 1JEGA 1KK7A 2RD1A 1UEBA 1M1KU 3H8ZA 2O9VA 4ORZA 1VQ9Q 3RKXA 5GAOp 1M4ZA 1M3BA 4P5NA 1G2BA 4LDVA 2LNHB 4ELYC 3ASKA 1H641 2KQWA 4QVCA 1VQ8T 2CREA 1X75C 4M7AG 1G83A 3VRZA 4PJNA 2C0IA 5GAMj 2F5KA 2DL8A 1I4K1 1R8OB 1K9MC 2ENMA 3KUFA 4RG8A 4JJDA 2DRMA 2K9GA 2RJCA 2A3LA 3NHNA 3QKJA 4BUGA 3LGFA 3MP8A 2EGEA 3HP9A 1HJDA 4J9GA 2EYXA 2LCCA 2J6FA 4BDZA 2OI3A 3LH0A 1VQLA 3CCET 3DLMA 4ANJA 1D0XA 2EFIA 4M75F 4OF1A 3OYFA 1X01A 1GCQA 1X2QA 3EAEA 3P8BB 2RNAA 4A63B 3OYNA 5GANj 2VASA 3ULRB 5GAOm 1KIKA 3H9NA 2IPOB 2EJFA 1RLPC 2JT4A 3HTRA 1B34B 2JNGA 3UT1A 2BZXA 3L2UA 1G3WA 3CC7A 4QQDA 3X20B 2CZ6B 1AD5A 2NWMA 4PJOG 1VQNT 1NLOC 3PVQA 1SF9A 1E6HA 2V26A 3M58A 3MHXA 2F1LA 2DA9A 2KXCA 3OW2A 5FRMA 3FEOA 3HFNA 2XMFA 3OYAA 4KULA 1H92A 4ZNXA 2GQIA 4KGZB 3JRZA 1UGQB 4OB2B 3VKIA 2KGTA 2RHUA 1GBRA 3OYDA 4XTZA 3UWNA 1RUWA 1AWWA 3V8LA 3CCSA 2FB7A 1PCXA 4NOYA 1R77A 2ZPBB 4XAXB 2K2MA 2HDAA 2EQJA 4PL6A 1BYMA 2HBPA 5IAYA 1W2BS 2HCKA 2MOXA 2YLCA 1W70A 2XIDA 1ZSZA 2WSCE 4M7DG 3CCSQ 4J9CA 1K0XA 2RO0A 3CCQT 3CMAQ 5J39A 1G5VA 2EYYA 5KE2A 2BIVA 3QUIA 5GAN8 3NTHA 3HKSA 3BY7A 2OJ2A 5J3BA 2F2VA 3CCJT 3QDRB 2E3HA 3CCVT 4CC7A 2F2XA 3GPLA 4OGCA 4IUVA 4JJCA 4C0FA 2PQWA 3HL8A 1IB8A 4ZTJA 2K5FA 2A37A 4JPBW 1Y71A 4AG1C 3CQTA 2JM8A 4UC4A 1YN8A 2ECZA 1FX7A 5KYUB 1MV0B 3NTIA 3QWXX 1H3ZA 1PNJA 4E6RA 1Y57A 4J9IA 3C12A 1KJWA 2GGRA 4JRKA 1G3SA 2A7YA 2OAWA 2A08A 2CUDA 2K57A 1QVGS 3META 5CVIA 1PKSA 3G4SA 2MWPA 1SSFA 3OYYA 1NZ9A 1CKAA 2GTOA 3HSBA 3BDUA 4RKUE 4M7AA 3CCRA 1MGQA 3EG1A 1MMAA 3GNGA 1QVPA 3EG9B 4JRPA 1TG0A 5I11A 1EZZB 1N6AA 2Y4XA 1VQ4T 3HRUA 3R6NA 2DE0X 4RTUA 5A0GA 1N8RC 4PJOC 1WQWA 4LN2A 1ZQ1A 1MHNA 1UE9A 1TXQA 2DIGA 3JAME 2RK1A 1RADB 3BW1A 3ME9A 3PIOA 1UECA 3G6EQ 1K9MR 4M7DA 4A54A 1YFNA 2QQSA 3G71T 5FU6B 4OB0B 4X9CA 3M57A 1VQ9A 1M8MA 1VQKT 2X4JA 2LJ0A 3CCMQ 4E7SA 3VJPA 2LQNA 4L6V5 1ZHIA 3DLLA 4GLMA 2LQKA 4XU1A 3CXCP 2KROA 1LVKA 3OSVA 3QIIA 1PRMC 4L5GA 1OEBA 4MZPA 4JLGA 2IVWA 5LJ3e 1UDLA 3JCMV 3F70A 2K4YA 1EX4A 3GLXA 3OY9A 3MP6A 2COYA 1YITA 5IXBA 1NJIU 1ZA2B 2FPDA 4M78D 3TREA 5IHIA 4J6YA 3EHQA 3C0CA 2DD4A 3QWYA 1I5LA 2F69A 1Q7YC 3GNFB 4PJOF 1AWXA 1AHJB 3JCMd 3X24B 1Q82U 3JCMe 3H6ZA 4ZGEB 2PVGB 1KD1R 3IQLA 5A0LA 2F5TX 4FIBA 2W10A 5M9OA 4LD6A 2AHJB 5GAMd 3JCMQ 3OS2A 4LDYA 2KT1A 5CKDA 1VQ7Q 2LVMA 2GNCA 3VYHB 3BDLA 4HA8A 4QT7A 3BFMA 4F7UG 2WSFE 2KSSA 4C92F 4PFZA 4HCBA 2E3IA 1FMWA 1W4SA 2ROTA 2AKKA 4NL3A 2BKDN 1SKUB 2GQVA 4O5VA 4J8OA 3QZ5B 3CCVA 2NLUA 5GAN4 4NS5A 5FRNA 2E10A 4Z02A 2NUPB 4JZ4A 5EG2A 4A4KA 4KH1B 3OYHA 1I81A 4M78G 2V8KA 8AT1B 1Q7YU 3EG9A 3CCQA 4ZGDB 3ZFJA 1UGRB 2MAMA 2HL5C 1MUZA 5D7UA 2F2WA 3WVDB 1ZX6A 1Z9ZA 1CKBA 1IRXA 3V8JA 2DXCA 1YJ9Q 1SSHA 1X27A 5GANe 2DEQA 3ER0A 4J9HA 3M4GA 2JS0A 3PMTA 1WIEA 1N27A 3SD4A 3OYIA 2DTIA 3UA7A 1X69A 2KEAA 2J6KA 2JOYA 4OGEA 2EKHA 3OS1A 2FZCB 2EGAA 1BK2A 3JV3A 5FWCA 3R6OA 2EYZA 1UGVA 5LJ3f 1VQNQ 4FT2A 4E7HA 2A28A 2CP5A 3M0PA 1M5Q1 2QASA 1WNLA 3JB9G 3PT9A 5GAOl 2KRSA 5LJ5j 1K9AA 2H3EB 1ZBXA 3OYCA 2K2VA 4FSXA 2JTEA 2EAYA 3GP8A 1Q82C 2RB6A 5A2QE 3EG0A 5LJ5h 2MWOA 5LJ3h 3A8GB 1UJYA 1B07A 1U06A 4OB3B 1UGPB 2VV5A 3OYGA 1NYFA 2JM9A 2RJFA 2LNVA 3HFOA 1JBMA 1WXUA 4ZGJB 1B34A 3UA6A 3JB9D 1YI2Q 3CCEQ 2LX9A 4BI3A 4AG2C 2LMJA 4C5EA 4OMNA 1SG5A 1VQKA 2KXDA 2QK0A 4R0KA 1YJ9T 2DK3A 2GCXA 3VS4A 1WHHA 4D6WA 2GF7A 3OBWA 4F7UB 4BI4A 4FL6A 4KGXB 3QHSA 3CMAT 1AOJA 3M4YA 3CCEA 1WPYA 5IHNA 1UG1A 2YRVA 3EH2A 2K3XA 1RAFB 1KC8R 1M1KC 1UHFA 5LJ3d 4C8QG 3OYBA 3LWHA 4BE0A 4Y92A 4FCYA 4OMPA 1YJNT 4F04B 1OPLA 1PSEA 1NE8A 3V7SA 3QO3A 4LNPA 2GTJA 2VKNA 1M1GA 3PTAA 4DEYA 5D6WA 4J7IA 4ME7A 2D9TA 2FEIA 4J9DA 2FZKB 2CSQA 1SHFA 3I55A 3CXCA 2QEXQ 2MCNA 1K73C 1D3BA 4BE1A 2XD0A 1MMDA 3CC4Q 5ECAA 3MKDA 2KVQG 5GAN3 2MF2A 5IHKA 2YT6A 3JB9F 2OTJT 4LUDA 2ROLA 3LLRA 2JJ9A 2DJQA 2M1HA 2M16A 1Q82R 2YRDA 1MNEA 1IXDA 1OZ2A 5GAOq 3PVLA 3JB9J 4OVAA 1RACB 1GL5A 1OI1A 1QWEA 2PUOB 5I21A 2EYQA 1FMVA 2JS2A 1X6BA 3M56A 2L5QA 2C0TA 2FHDA 2HD0A 2YUQA 4C8QB 3CCVQ 3RBBB 3JCMh 2XHCA 1H8KA 4HKEA 2EKOA 4X9DA 1JO8A 2B86A 2XI9A 1TUDA 3M59A 3N5BB 4RCCA 4B6MA 2E64A 1YCSB 3CCJQ 2HKQB 2LZ6B 1PHTA 5IT9E 5GAMg 2CH4A 3SB2A 2WSEE 4M75A 2LJ1A 2LCSA 3FIFA 1V1CA 2QQRA 1X2KA 1UUEA 3MPUB 1VQ7A 3X26B 3CBOA 1BBZA 2L8DA 2E6NA 4JS5A 1VQ9T 2ZPGB 2E70A 2EQUA 3A8LB 4HVUA 2V8IA 1WFWA 3CC4T 1VQ8Q 1BI1A 3V8KA 4M77D 2QQBA 4DEXA 1TUGB 5CAIA 4JZ3A 3LGLA 2EBPA 4II1A 3MCAB 3FB9A 4X1VA 4DQ2A 4HVWA 1B7TA 1SRLA 1W2BA 1OX8A 2AK5A 1VQ4A 3M0TA 3A98A 4M7DB 2O31A 5IH2A 1PM3A 4DA4A 2RH2A 3E9GA 2ABLA 2EIFA 1CSKA 3SEMA 3QXEB 4F7UE 4E7KA 1SEMA 1SHGA 8ATCB 3PIPA 2RA2A 3HPWA 1GFCA 3JCMb 1YIJA 4M7AD 4EMGA 3VS6A 4FM4B 4MZTA 2HSPA 3L2RA 4M7DC 4PLLA 4E7IA 2EJGA 2SRCA 1O75A 1ACMB 4C8QE 3HHTB 3OB9A 2KDSA 2D0QB 5KCOA 3CPFA 3QJ6A 2K6DA 4XTUA 3OYKA 1U3OA 3VUBA 3QZ9B 3RKYA 2QA4A 3UPUA 4JLIA 4M75D 2IIMA 2NUZA 1D0ZA 5FU7C 2P0QA 3SWNC 1SRMA 2DXTA 4RUGA 4M78F 3A8HB 1NEBA 3SWNA 2VC8A 1XNIA 4AT1B 4EPCA 1OU9A 2KRMA 5GAN5 3I9QA 3LX7A 1UGSB 1RAGB 2L3SA 3MEVA 3GBQA 4C8QA 1JRIA 3O5ZA 5GANg 1WHJA 3OMGA 4C8QC 1Q7YR 1VQ8A 2LT1A 2DETA 2ED1A 2JN0A 2COWA 1TTHB 5GMKl 1WJRA 2DLPA 3CC7Q 3JCMW 2JMCA 3I35A 3JCMP 2KE9A 4PNOA 1VA7A 3O8VA 4ZN3A 2LDMA 2ZZDA 2GFAA 4RG2A 1T0HA 4ZTFA 1WXBA 3FC3A 2RI5A 4BD3A 3M9QA 2O9SA 1JXMA 3EG3A 2EYWA 5HK3A 3CBPA 2CDTA 1G3YA 2DBKA 2CGHA 2LX7A 3QG1A 1BIBA 2XG8D 1ZA1B 1I8FA 1QVGA 3CEYA 2JXBA 2DTHA 2DFUA 2VUBA 4HXJA 4FT4A 4M7AB 1HSQA 5HCKA 2LP5A 3M0QA 1Q81U 5HKCA 2DVJA 3CXCS 1YJNA 4XU0A 3INZA 1RAHB 5GANf 1RAAB 4XTWA 2HSEB 3EGXA 3UATA 2JW4A 3NTKA 1WA7A 2LJ3A 1IZ6A 2O4XA 5D6XA 1RAIB 3E19A 4J9EA 2GFUA 2QAZA 2QG9B 3EGDA 2DJZA 7AT1B 1N9SA 3CCLQ 3SDZA 1M90C 3JCMX 2AKLA 5L23A 1YJWT 3FRNA 5AT1B 1OZ3A 1VQPA 4JS4A 1Q95G 4EMHA 4RCBA 4HT9A 1VYTA 2HQHA 3OBYA 2RF0A 4XTYA 1HXDA 2RMOA 4FU6A 3CBMA 4IIOA 2VGNA 2DL5A 2DILA
chains in the Genus database with same CATH topology
1BI3A 5I2SA 4BB7A 4HCZA 4M77A 5GANe 3S3MA 2DEQA 3ER0A 3OW2S 3M4GA 4N0AC 1X6OA 4XQ3A 5FU7B 4BY6C 3PMTA 3PGGA 1N27A 3SD4A 4MDWA 1Y7XA 3OYIA 2DTIA 3SWNB 3MEWA 3S3NA 2E65A 5KE3A 3V7CA 4C92G 4DOVA 4M75B 4C92C 1VQMA 5LJ5e 1LOJA 2JOYA 4OGEA 1NPPA 4JDSA 4B9XA 1NPRA 3OYLA 1KC8C 3OS1A 3CCUT 5DY9A 4RMOA 4Q5WA 3R6OA 4GLKA 3CMET 4EMKA 4M75G 3NFCA 5LJ3f 4M75C 2B8AA 2DKGA 3A5ZB 3PFSA 3E9FA 4FT2A 4C0GA 4C92B 5DLOA 5GAN6 1M5Q1 1WNLA 3DB4A 3E1SA 3JB9G 2PVDB 3PT9A 3CCLA 1M8VA 5GAOl 3WXMB 5LJ5j 1ZBXA 3OYCA 2C06A 5CK9A 2K2VA 2VYTA 3DB3A 4CRIA 4KT0E 4FSXA 2LTOA 4M77C 2EAYA 2JTFA 4QW2A 4C5IA 3GP8A 3CD6A 2OTJA 1Q82C 2EQMA 2RB6A 1Y07A 5A2QE 1TH7A 1JB0E 2RJEA 3HRSA 4EMKB 4ZN1A 5LJ5h 1YITT 3RERA 5KH6A 2MWOA 5LJ3h 2MI6A 2RD1A 3A8GB 4N0AA 1HK9A 2RK2A 4C92A 3JCMg 1UEBA 4OB3B 1UGPB 2VV5A 3OYGA 2CZ0B 1M1KU 2BUDA 5GAMe 2RJFA 2LNVA 3H8ZA 5CQYA 5GAOr 1IREB 3HFOA 3RKXA 1Q86C 1JBMA 5LJ3j 3RKWA 5GAOp 3CC7T 4LDXA 1M4ZA 3JB9I 4P5NA 2HNIA 3G6ET 2E12A 4LDVA 4ZGJB 1B34A 4LDUA 2O4XB 4M78E 4ELYC 3ASKA 1H641 3JB9D 4PJOB 1YBYA 3FLGA 4IURA 2YLBA 4PJOE 2DO3A 2KQWA 2LX9A 5HY6A 4QVCA 4E7LA 1U8RA 4BI3A 1VQ8T 1KHIA 2FVUA 1X75C 4C5EA 4M7AG 5LJ5g 5GAMj 2ZPFB 1YJWA 4E7JA 2F5KA 1VQKA 1I4K1 2OAUA 1R8OB 4OMFB 4TVRA 1K9MC 4A4HA 4HT8A 1KG1A 1WJSA 3KUFA 3Q1JA 4RG8A 1YJ9T 2DK3A 2HQEA 3VYGA 2GCXA 4D6WA 4OP0A 1FWZA 2GF7A 2RJCA 2A3LA 3OBWA 3QKJA 4F7UB 4BUGA 3LGFA 3MP8A 3HP9A 3KBGA 2XDBA 4BI4A 2E1HA 4FL6A 2QEXT 2LCCA 3WVEB 1VQ5T 3QHSA 3CMAT 2RI2A 4BDZA 3M4YA 2JTMA 3LH0A 3CCEA 1VQLA 1VQLT 1WPYA 3CCET 3S3OA 3HRTA 1S72T 2JUFA 4N4IA 3DLMA 2YRVA 2HQXA 2K3XA 2DVEA 2WACA 3OMCA 1M1KC 5LJ3d 2EFIA 4M7DF 4M75F 4C8QG 2FL7A 4OF1A 3VUZA 3OYBA 3LWHA 4BE0A 3OYFA 4OB1B 2QTXA 1X01A 3TCJA 3SFMA 2QA4T 1YJNT 4PJOD 2D6FA 1YHQA 3EAEA 3P8BB 3OYNA 5GANj 1QVFS 4DOWA 2YHTA 5GAOm 1PSEA 2K5LA 1NE8A 2EJFA 3V7SA 4M77E 3MEUA 1JJ2S 3QO3A 1B34B 2JNGA 5DM7R 1YI2A 4IUTA 3UT1A 1M1GA 3PTAA 4E47A 3L2UA 5D6WA 1G3WA 4J7IA 1V29B 4ME7A 2D9TA 3CC7A 4C8QF 1BIAA 4QQDA 1QP2A 4Y28E 1VQ6T 3X20B 2CZ6B 2QQ9A 3I55A 3CXCA 4PJOG 1VQNT 1XOVA 1K73C 1D3BA 4BE1A 2H3JA 3VU3C 4A53A 2XD0A 1Y96B 3GIBA 1KD1U 1KQ2A 4BDYA 1QP3A 4C0ZA 2KVQG 3M58A 3MHXA 2ZPHB 5GAN3 3OW2A 2MF2A 3I56T 5FRMA 3JB9F 2OTJT 4N4HA 3FEOA 3LLRA 4IUUA 2DPPB 4L59A 4JUVA 2M1HA 4BACA 2I2LA 2M16A 3HFNA 5C0MA 4C0DB 3A8MB 3CC4A 3OYAA 4KULA 1OZ2A 5GAOq 1BKBA 3P8HA 3JB9J 3JRZA 4OVAA 1BI2A 1OI1A 2PUOB 1UGQB 5CR2A 4OB2B 3VKIA 5I21A 2HAXA 2RHUA 2EYQA 3OYMA 4R55A 3M56A 2L5QA 2JZ2A 4XTZA 3UWNA 3OYDA 2FHDA 2XICA 2LQ8A 4QQGA 4GY5A 2HD0A 1U1SA 3QBYA 4C0DC 3CCUA 3V8LA 3M5AA 4IKFA 3TU4K 3CCSA 4C8QB 5GAMf 1NJIC 2FB7A 2RJDA 3PNWC 3CC2A 3JCMh 2DXBA 4E7HA 4F7UF 4NOYA 5CKHA 2XHCA 4M75E 2ZPBB 4HKEA 2DAQA 1K8AU 2EKOA 4EDUA 4X9DA 4M7DE 4V2SA 5J26A 3CCMT 2QDYB 4XAXB 2V8JA 2EQJA 2XI9A 4A4FA 3JCMf 2K5IA 4PL6A 2CS7A 2HBPA 5IAYA 3M59A 3N5BB 4RCCA 1W2BS 4M77B 2YLCA 1VQ7T 3RMSA 3JCMJ 2E64A 3PMIA 4F7UA 2DTOA 4J83A 2XIDA 2X4XA 3OQ5A 5HK0A 2Y90A 4C92E 3J81E 2WSCE 5IT9E 4M7DG 3GF5A 5GAMg 3SB2A 2P4TA 2WSEE 5LJ5f 4M75A 2OTLT 2KK4A 3FIFA 3T9NA 2QQRA 3L2ZA 2RO0A 1RI0A 3CCQT 5AYFA 5J39A 3FDRA 3EFSA 1VQ7A 1G5VA 4IUQA 3X26B 3CBOA 5KE2A 1WJQA 1KQSA 2L8DA 1VIFA 2BIVA 3QUIA 5GAN8 5GAN2 3NTHA 2LCLA 5CCAA 3UDCA 3CCMA 2E6NA 3HKSA 4JS5A 3BY7A 1VQ9T 4VUBA 5J3BA 3QJYA 2ZPGB 3G71A 3X25B 1M9SA 2E70A 3CCJT 3QDRB 2EQUA 2RHXA 3V7RA 4B9WA 3CCRT 3A8LB 2XDPA 3CCST 3CCVT 2V8IA 3GPLA 4OGCA 2VXFA 3URGA 3L2WA 4IUVA 2QI2A 1VUBA 3CC4T 4J6XA 4C0FA 3C4SA 1BI1A 5GAN7 2PQWA 3V8KA 3HL8A 2QQBA 4M77D 2K5FA 2ZGWA 5CAIA 3G4ST 4ZTJA 5FROA 1Y71A 4A4EA 1K8AC 2L3RA 1KD1C 5GANh 3LGLA 4UC4A 1FX7A 4II1A 3MCAB 3FB9A 4DQ2A 1BI0A 3NTIA 1H3ZA 2K3YA 3ZEHA 4M78C 5GANd 4JJNK 1GXIE 1W2BA 1VQ4A 2KMTA 4MZMA 3GOXA 3M53A 3LW5E 1FXXA 4M7DB 3C12A 3ZBDA 4JRKA 4DA4A 2E41A 3J7AF 2RH2A 3E9GA 4F7UE 2EIFA 2VXEA 3QXEB 1G3SA 4JRIA 5LJ5d 4E7KA 2A7YA 4J6WA 4M77G 1EIFA 2K57A 3PIPA 1QVGS 3META 4YTLA 2RA2A 2RHIA 3HPWA 4NL2A 5DLQE 5GAOn 3JCMb 1YIJA 5CVIA 3X28B 2R5MA 2MWPA 4EMGA 3G4SA 4M7AD 4M7DC 4FM4B 1SSFA 4MZTA 2QQAA 3OYYA 3L2RA 1NZ9A 1PSFA 4PLLA 5CQXA 4C5GA 4E7IA 2EJGA 2LRQA 3BDUA 2R58A 4RKUE 3HSBA 3QSUA 4M7AA 1KHCA 2E6ZA 1O75A 4ATOA 4C8QE 3HHTB 3CCRA 3OB9A 1MGQA 2KDSA 2D0QB 5KCOA 3GNGA 1QVPA 3CPFA 4JRPA 2RI3A 2CZ1B 2R57A 3QJ6A 4XTUA 5CKFA 1N9RA 3OYKA 3L2QA 1N6AA 2Y4XA 1VQ4T 2EWNA 3HRUA 4QVDA 5D6YA 3VUBA 2XK0A 2XDDA 3QZ9B 3QPHA 2Y4YA 3RKYA 1YHQT 4M7AF 3OSSC 5A0DA 2QA4A 5A0GA 1N8RC 3UPUA 4JLIA 4XTVA 4PLIA 1Y96A 4R56A 4PJOC 4M75D 2KAFA 1WQWA 1ZQ1A 4MMLA 5FU7C 3S6WA 4BY6B 1MHNA 2P0QA 2OTLA 4MDXA 1K9MU 5FU6C 3OA6A 3FJPA 3SWNC 2DIQA 3L2VA 2DIGA 2DXTA 4M78F 3A8HB 3RIRA 3SWNA 2VC8A 1UB4A 1XNIA 2QEXA 3JAME 1WQ7A 2RK1A 4C92D 1DJ7B 4EPCA 1KC8U 4M7AE 5GMKm 3BW1A 3ME9A 3PIOA 1N8RU 5GAN5 4WF2A 2XU8A 2RM4A 3LX7A 2P0KA 1UGSB 4M7DA 4A54A 4J5YA 2QQSA 3G71T 5FU6B 1XQHA 4OB0B 3MEVA 4X9CA 3VV0A 2CYZB 1JJ2A 3M57A 4M77F 1VQ9A 2ZPIB 4O6JA 4XTXA 4X34A 3OS5A 1VQKT 2X4JA 4BE2A 5LL6S 4C8QA 1JRIA 2DZ9A 5KCHA 5GANg 3VJPA 3OMGA 2G3RA 4C8QC 2QXFA 5GMKe 1G3TA 5CO7A 1VQ8A 2LT1A 2JN0A 3QYGB 4L6V5 1ZHIA 3DLLA 2CKKA 3MO8A 2LQKA 1OYXA 4XU1A 4ELZC 5I2MA 1WJRA 4EMKC 5GMKl 3OSVA 3QIIA 2L89A 2LT4A 3OYEA 3MEAA 5CKEA 2FYKA 1LJOA 4L5GA 4MZPA 3JCMc 4JLGA 3JCMW 2IVWA 3CPWA 4XU3A 3JCMP 4C5HA 2EJ9A 2KY9A 5C6SA 4PNOA 3RUXA 5L8RE 2X35A 5LJ3e 3O8VA 2JVVA 3JCMV 4ZN3A 2LDMA 2K4YA 2ZZDA 3F70A 2GFAA 3GLXA 4PKCC 4RG2A 5GMKh 5GMKi 2DXUA 3MP6A 3OY9A 3KXTA 1YITA 1NJIU 4M78D 4ZTFA 3TREA 3OYJA 3FC3A 4J6YA 3CC2T 3RESA 3CD6T 1VQNA 2RI5A 4BD3A 3I55T 3M9QA 2DD4A 1K73U 1I5LA 5GAMh 2F69A 4M7DD 2O01E 4M7AC 2P0PA 1Q7YC 5HK3A 3CBPA 3GNFB 3CCLT 1BYMA 3C94A 1G3YA 4PJOF 2LC4A 1YIJT 2CGHA 1AHJB 1D3BB 2ZCFB 1BIBA 2XG8D 3QG1A 5CIUA 3JCMd 3CMEA 1YI2T 3X24B 1I8FA 4LDWA 1Q82U 3CEYA 5IN1A 1QVGA 3JCMe 3H6ZA 4ZGEB 2DTHA 2PVGB 4IUPA 2VUBA 3LYIA 4FT4A 3L42A 4QQ6A 4M7AB 4M78A 4LD9K 5A0LA 2F5TX 4FIBA 4KUDK 4PJOA 5M9OA 4LD6A 4JRQA 2AHJB 3I56A 2RHYA 5CKBA 3EFRA 1RL2A 5GAMd 2XKOC 3JCMQ 3OS2A 4LDYA 5HKCA 1VQMT 1Q81U 3CXCS 5CKDA 4C8QD 4XU2A 2LVMA 1YJNA 4XU0A 3VYHB 3INZA 3BDLA 2IG0A 4HA8A 1Q86U 2CZ7B 1P92A 2M0OA 3BFMA 5GANf 1QVFA 4F7UG 1VIEA 4XTWA 2WSFE 2KSSA 1M1FA 4C92F 3M55A 4M78B 3AHUA 1VQ6A 4HCBA 3LWIA 3NTKA 1YCYA 1IZ6A 1W4SA 2O4XA 4NL3A 5D6XA 1U1TA 2BKDN 2PU9B 2PVOB 2RHZA 2X4WA 3C95A 3P8DA 4KUIA 4Y91A 1Q81C 1VQ5A 2GQVA 3M54A 1VQOA 1KQSS 2DZCA 3E19A 4O5VA 4J8OA 3L1AA 2GFUA 3QZ5B 3CCVA 4CI0C 4N4GA 2NLUA 3CCJA 2E5QA 2R5AA 1WGSA 4BI8B 4NS5A 2DJZA 5GAN4 1N9SA 1VQPT 4HCCA 5FRNA 1YJ9A 2E10A 3SDZA 2X4YA 1KQ1A 1O9SA 2EQKA 3DKMA 4Z02A 2MMPA 5EG2A 3JSCA 3J80E 2VGMA 4A4KA 1M90C 4A4GA 1XTDA 4J7FA 3JCMX 1YJWT 3CPWS 3FRNA 2M9UA 3G7ZA 5LJ3g 3OYHA 1I81A 1OZ3A 2V8KA 4M78G 2ZPEB 1VQPA 1Q7YU 3CCQA 1QW1A 4ZGDB 4JS4A 3QYHB 4KBMB 4EMHA 4MMKA 4RCBA 3RMQA 3A8OB 4HT9A 3ZFJA 1UGRB 2MAMA 5FLXE 3OBYA 3OS0A 3TEEA 1VQOT 4XTYA 1HXDA 3G6EA 1S72A 4FU6A 1LNXA 2PUKB 3CBMA 3WVDB 5GMKj 3JB9H 2DD5A 1M90U 3MP1A 4QVZA 4XK8E 3CMAA 2VGNA 3V8JA 2DXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V7R A;  4PJO D;  4M77 A;  5GAN e;  2DEQ A;  5GAN j;  4XU1 A;  3M4G A;  4N0A C;  4EMK C;  5GMK l;  4XQ3 A;  2YHT A;  2VXF A;  3PGG A;  5GAO m;  2EJF A;  4J6X A;  3V7S A;  5GAN 7;  2DTI A;  4M77 E;  3SWN B;  3V8K A;  4M77 D;  2E65 A;  5CAI A;  2ZGW A;  3V7C A;  4C92 G;  2FYK A;  1LJO A;  4M75 B;  3QO3 A;  4C92 C;  3JCM c;  1B34 B;  5LJ5 e;  1LOJ A;  3JCM W;  4XU3 A;  5GAN h;  3JCM P;  2EJ9 A;  4PNO A;  3RUX A;  5LJ3 e;  3JCM V;  3FB9 A;  5DY9 A;  4DQ2 A;  5GMK h;  5GMK i;  2DXU A;  1BIA A;  4M78 D;  4M78 C;  5GAN d;  4J6Y A;  4EMK A;  4M75 G;  5LJ3 f;  3RES A;  4M75 C;  2DKG A;  4C92 B;  4C8Q F;  4PJO G;  5GAN 6;  1M5Q 1;  5GAM h;  1I5L A;  1WNL A;  1D3B A;  4M7D D;  3JB9 G;  1M8V A;  4M7A C;  3VU3 C;  4A53 A;  5GAO l;  1Y96 B;  4M7D B;  5LJ5 j;  3GIB A;  1KQ2 A;  4JRK A;  2E41 A;  4F7U E;  2VXE A;  4JRI A;  4PJO F;  5LJ5 d;  2CGH A;  5GAN 3;  4J6W A;  4M77 C;  2EAY A;  1D3B B;  4M77 G;  1BIB A;  2K57 A;  3JCM d;  3JB9 F;  1I8F A;  2RA2 A;  2RB6 A;  4NL2 A;  5GAO n;  3JCM e;  1TH7 A;  3JCM b;  2DTH A;  4JUV A;  4EMK B;  5LJ5 h;  3RER A;  2I2L A;  3HFN A;  4EMG A;  4M7A D;  4M7A B;  5LJ3 h;  4M78 A;  4M7D C;  2RD1 A;  4N0A A;  5GAO q;  1HK9 A;  3JB9 J;  2EJG A;  3BDU A;  4C92 A;  3HSB A;  4PJO A;  3QSU A;  4M7A A;  3JCM g;  5GAM d;  3EFR A;  3JCM Q;  5I21 A;  4C8Q E;  4C8Q D;  4XU2 A;  5GAM e;  1MGQ A;  4XU0 A;  5GAO r;  3HFO A;  3INZ A;  3RKX A;  1JBM A;  4XTZ A;  4HA8 A;  3RKW A;  5LJ3 j;  5GAO p;  5GAN f;  3BFM A;  4XTU A;  3JB9 I;  1N9R A;  1U1S A;  4F7U G;  2HNI A;  4XTW A;  2EWN A;  3V8L A;  4QVD A;  1B34 A;  4C8Q B;  5GAM f;  3RKY A;  4C92 F;  2FB7 A;  4M78 B;  3AHU A;  4M7A F;  4M78 E;  3JB9 D;  1H64 1;  3JCM h;  1YCY A;  2YLB A;  4JLI A;  4XTV A;  4PJO C;  1Y96 A;  4F7U F;  4NOY A;  4QVC A;  4NL3 A;  4M75 D;  1U1T A;  4M75 E;  1WQW A;  4M7D E;  4Y91 A;  4M7A G;  4PJO E;  4X9D A;  4V2S A;  5LJ5 g;  4MML A;  2DZC A;  5GAM j;  3JCM f;  3L1A A;  1I4K 1;  4RCC A;  4HT8 A;  4M77 B;  2YLC A;  3FJP A;  3SWN C;  3JCM J;  2E64 A;  2DXT A;  5GAN 4;  2DJZ A;  4M78 F;  1N9S A;  2DTO A;  2VC8 A;  3RIR A;  3SWN A;  2E10 A;  4F7U A;  1KQ1 A;  1WQ7 A;  4C92 D;  4OP0 A;  2Y90 A;  4C92 E;  4F7U B;  4M7A E;  4M7D G;  5GMK m;  3BW1 A;  5GAM g;  3JCM X;  5GAN 5;  4WF2 A;  3SB2 A;  5LJ5 f;  2RM4 A;  4M75 A;  2E1H A;  4A54 A;  4J5Y A;  4M7D A;  5LJ3 g;  3FIF A;  3QHS A;  1I81 A;  4M78 G;  3L2Z A;  4X9C A;  1WPY A;  4M77 F;  3EFS A;  4XTX A;  4EMH A;  4MMK A;  4RCB A;  2DVE A;  4HT9 A;  4C8Q A;  1JRI A;  2DZ9 A;  3QUI A;  5GAN 8;  5GAN 2;  5GAN g;  4XTY A;  1HXD A;  5LJ3 d;  4C8Q C;  4M7D F;  3BY7 A;  4M75 F;  1LNX A;  4C8Q G;  5GMK e;  5GMK j;  3JB9 H;  2JN0 A;  2QTX A;  1X01 A;  3V8J A;  4PJO B; 
#chains in the Genus database with same CATH topology
 1JQQ A;  3S3M A;  2ATC B;  4N0A C;  1X6O A;  1WDX A;  2CH4 W;  3PGG A;  3SWN B;  4C92 G;  4M75 B;  4FSS A;  5LJ5 e;  2D0N A;  2YWW A;  4B9X A;  3OYL A;  3CCU T;  5DY9 A;  3G1J A;  1UFF A;  4Q5W A;  1PRL C;  3CME T;  4C8Q F;  3NFC A;  4DBR A;  4C0G A;  2B8A A;  3PFS A;  5DLO A;  5GAN 6;  1K4U S;  2J06 A;  2RQT A;  2I0N A;  2C06 A;  2VYT A;  1TUC A;  3CD6 A;  4C5I A;  2OTJ A;  2EQM A;  1I1J A;  2BZ8 A;  1TH7 A;  1JB0 E;  1N5Z A;  5KH6 A;  1KFZ A;  1R0B G;  2EQI A;  2EW3 A;  1HK9 A;  2RK2 A;  4C92 A;  1W1F A;  1TS9 A;  2CZ0 B;  3I55 Q;  1UTI A;  5CQY A;  1IRE B;  1Q86 C;  1RAB B;  3JB9 I;  2HNI A;  4M78 E;  3I5R A;  1YBY A;  3FLG A;  3TQ7 P;  4IUR A;  4PJO E;  3NPF A;  5HY6 A;  1W2B P;  1TSF A;  1KHI A;  2FVU A;  2DMO A;  5LJ5 g;  2CP6 A;  1WI7 A;  4E7J A;  4HT8 A;  1KG1 A;  3Q1J A;  2K3B A;  3VYG A;  4OP0 A;  1C1A A;  3KBG A;  2E1H A;  2QEX T;  2KNB B;  3WVE B;  1M90 R;  2RI2 A;  3REB B;  1M3A A;  2JTM A;  1MMG A;  3HRT A;  1S72 T;  2DNU A;  2JUF A;  1BU1 A;  1GRI A;  5I22 A;  2FO0 A;  2WAC A;  4M7D F;  2FRW A;  4OB1 B;  2ED0 A;  2QA4 T;  2CP7 A;  4WCI A;  2YHT A;  4F16 A;  1MMN A;  5KYN A;  3TSZ A;  3MEU A;  1JJ2 S;  2OTJ Q;  1YI2 A;  4E47 A;  1YIT Q;  1VOM A;  2OX7 A;  1BIA A;  4Y28 E;  1VQ6 T;  1ZSG A;  9ATC B;  1JJ2 P;  1VQ6 Q;  1R0C B;  1XOV A;  5KYX B;  1VQ5 Q;  1A0N B;  3VU3 C;  4A53 A;  1BB9 A;  3GIB A;  2YSQ A;  1KD1 U;  1KQ2 A;  1QP3 A;  3NGP A;  2FPF A;  1V76 A;  3I56 T;  1K73 R;  2X3X D;  4N4H A;  1ZLM A;  1YP5 A;  2DPP B;  2YDL A;  4JUV A;  4BAC A;  1QLY A;  4C0D B;  3A8M B;  3P8H A;  3EG2 A;  4K11 A;  5CR2 A;  1K1Z A;  4R55 A;  2FPE A;  2JZ2 A;  2DF6 A;  2FRY A;  4GY5 A;  1U1S A;  1EFN A;  4C0D C;  3M5A A;  4IKF A;  4KH0 B;  2RJD A;  3PNW C;  3CC2 A;  4FYW B;  2DXB A;  3EH1 A;  3SHW A;  4M75 E;  4M7D E;  1K8A U;  3CCM T;  2QDY B;  2V8J A;  2E4H A;  4DBQ A;  1VQK Q;  2CS7 A;  1VQ7 T;  4M77 B;  3D7S B;  1K0S A;  3TVT A;  3PMI A;  4F7U A;  2DTO A;  5KYY A;  5HK0 A;  2Y90 A;  3J81 E;  2P4T A;  2OTL T;  1QMC A;  1HD3 A;  3T9N A;  5AYF A;  2DBM A;  2CP3 A;  3FDR A;  3EGX B;  1KQS A;  1VIF A;  2QTV A;  4CC4 B;  2RQU A;  4CC3 A;  5CCA A;  3UDC A;  4VUB A;  2V1R A;  3QDF A;  3TSW A;  1B3Q A;  1PC0 A;  1M9S A;  3X25 B;  2HEQ A;  3V7R A;  4B9W A;  3CCR T;  1RI9 A;  4FW1 A;  4FYX B;  1IHW A;  2XDP A;  4RTW A;  2VXF A;  3URG A;  1VUB A;  5GAN 7;  3G4S T;  2ZGW A;  5FRO A;  2M51 A;  1KD1 C;  2MPX C;  2DER A;  2K3Y A;  3ZEH A;  2C0O A;  4JJN K;  1F1B B;  2FZG B;  4PFP A;  2KMT A;  3GOX A;  2ESW A;  1FXX A;  2E5K A;  2PNI A;  2KRN A;  2E41 A;  3J7A F;  1SPK A;  2VXE A;  4JRI A;  1EIF A;  3H0F A;  4NL2 A;  3X28 B;  2BE9 B;  2BZY A;  3RNJ A;  1MND A;  4C5G A;  2JMA A;  3QSU A;  6AT1 B;  2E6Z A;  4ATO A;  2DX1 A;  5EC7 A;  4AFZ C;  5CKF A;  1N9R A;  5D6Y A;  2XK0 A;  2XDD A;  1YHQ T;  3OSS C;  4XTV A;  2KAF A;  3EFO B;  4BY6 B;  4MML A;  1HYO A;  2OTL A;  4MDX A;  1K9M U;  5FU6 C;  2DIQ A;  2EPD A;  1WX6 A;  1UB4 A;  1IHV A;  1WQ7 A;  4C92 D;  1DJ7 B;  4M7A E;  4KRT A;  5GMK m;  4AFS C;  2XU8 A;  1G8X A;  2P0K A;  1M2V B;  4J5Y A;  2K7A A;  2CYZ B;  2QGG A;  4M77 F;  2O88 A;  2ZPI B;  4XTX A;  1AT1 B;  3OS5 A;  1WXT A;  4JJB A;  5LL6 S;  5KCH A;  2L0A A;  2G3R A;  5GMK e;  1UHC A;  3AT1 B;  2CT3 A;  2CKK A;  1U5S A;  3MO8 A;  3VS2 A;  2NUT B;  1QCO A;  2AZV A;  2A36 A;  2LT4 A;  2FYK A;  2EJ9 A;  5C6S A;  1ZBJ A;  2X35 A;  4F14 A;  4PKC C;  5GMK h;  3M0S A;  3CCU Q;  2DXU A;  3KXT A;  4E7Z A;  1QKX A;  1ARK A;  3RES A;  1VQN A;  4RTX A;  1M30 A;  4OMQ A;  3CCL T;  3C94 A;  2LC4 A;  2ZCF B;  2DL3 A;  4RTT A;  5CIU A;  1IGU A;  5GJW B;  4PJM A;  1YI2 T;  4LDW A;  3KFV A;  3L42 A;  4LD9 K;  2RHY A;  5CKB A;  3EFR A;  1RL2 A;  4FW2 A;  2DM1 A;  4XU2 A;  2IG0 A;  2CZ7 B;  1P92 A;  1QVF A;  2J05 A;  1OQK A;  2AT1 B;  2Z0W A;  1M1F A;  5FW9 A;  3M55 A;  3AHU A;  3LWI A;  1QQJ A;  1WHL A;  2PU9 B;  2PVO B;  3C95 A;  3P8D A;  2HL3 A;  1WHK A;  1Q81 C;  1VQO A;  1KQS S;  1WLP B;  1ABQ A;  2DZC A;  3L1A A;  1OOT A;  3CCJ A;  1VQM Q;  2E5Q A;  2R5A A;  4BI8 B;  4HCC A;  2X4Y A;  1KQ1 A;  3DKM A;  2EQK A;  3JSC A;  2DL4 A;  1VYU A;  4A4G A;  1XTD A;  4LE9 A;  2QYZ A;  1NBE B;  3G7Z A;  5LJ3 g;  2ZPE B;  3OW2 P;  1QW1 A;  3QYH B;  4MMK A;  3A8O B;  3OS0 A;  1VQO T;  2DEU A;  1KSW A;  1LNX A;  1BCM A;  3JB9 H;  2MYS A;  2DD5 A;  3MP1 A;  2QA4 Q;  4OMM A;  4QVZ A;  3CMA A;  4PJO B;  4BB7 A;  2L2P A;  4M77 A;  1N8R R;  3OW2 S;  4BY6 C;  4XQ3 A;  4LUE A;  5KYY B;  4MDW A;  1S72 Q;  3MEW A;  3S3N A;  4PJL A;  4C92 C;  1KC8 C;  1NPR A;  1BCO A;  1K76 A;  1AEY A;  4RMO A;  1QKW A;  4GLK A;  1M1K R;  2X3W D;  4M75 G;  4C92 B;  3E9F A;  4ESR A;  3E1S A;  1M8V A;  3CCL A;  2PVD B;  1PWT A;  4LXC A;  2W0Z A;  5CK9 A;  2P4R A;  1S1N A;  4KT0 E;  1Y07 A;  3HRS A;  1YIT T;  3RER A;  3NMZ C;  2MI6 A;  4N0A A;  2CT4 A;  2RPN A;  3JCM g;  4EIK A;  1YNZ A;  1WZO A;  2BUD A;  4IIM A;  5GAM e;  5GAO r;  4M4Z A;  3CC7 T;  5LJ3 j;  3RKW A;  3G4S Q;  4LDX A;  3G6E T;  2E12 A;  1AVZ C;  2BTT A;  4LDU A;  4PK4 A;  1GFD A;  1GCQ C;  2O4X B;  4AMC A;  2RN8 A;  2YLB A;  2DO3 A;  4Z8A A;  4RTV A;  1U8R A;  4E7L A;  4Z88 A;  1YWO A;  1E7O A;  2ZPF B;  1YJW A;  2L3P A;  3EGD B;  2OAU A;  4OMF B;  4TVR A;  4A4H A;  1WJS A;  4D8D A;  1ZUK A;  2HQE A;  1FMK A;  1FWZ A;  1T0J A;  2XDB A;  1VQ5 T;  4J9F A;  1VQL T;  2VWF A;  3S3O A;  1NM7 A;  4N4I A;  1QWF A;  2HQX A;  2DVE A;  3OMC A;  2L3Q A;  2FL7 A;  3VUZ A;  1NEG A;  2QTX A;  3LH5 A;  3ZL7 C;  3TCJ A;  3SFM A;  4PJO D;  2D6F A;  1YHQ A;  1XJW B;  1QVF S;  2D8J A;  1D1C A;  4HCK A;  4DOW A;  3FJ5 A;  2K5L A;  4WTO B;  4M77 E;  4QKU A;  3I56 Q;  5KYW B;  1X6G A;  5DM7 R;  4IUT A;  3I5S A;  3A1P A;  2QGF B;  5GJV B;  1QVF P;  2MIO A;  1V29 B;  1AWJ A;  2O2O A;  1QP2 A;  2QQ9 A;  2YUN A;  3EHR A;  1Z9Q A;  2H3J A;  1MV3 A;  5KYW A;  1W6X A;  1Y96 B;  1IO6 A;  4BDY A;  4C0Z A;  1OUL A;  2ZPH B;  4IUU A;  4L59 A;  1WYX A;  2I2L A;  5C0M A;  3BE3 A;  2ZAE A;  1BKB A;  2COZ A;  2PTK A;  1BI2 A;  2VB6 A;  2HAX A;  1QCF A;  1NJI R;  3OYM A;  3CPW P;  4FYY B;  4RTY A;  1AWO A;  2XIC A;  2LQ8 A;  4QQG A;  3VRY A;  3QBY A;  3CCU A;  3TU4 K;  3U23 A;  5GAM f;  1NJI C;  1VQL Q;  2RQV A;  4F7U F;  5CKH A;  2V1Q A;  2DAQ A;  4EDU A;  4V2S A;  5J26 A;  1GCP A;  2D8H A;  4DBF A;  4FYV B;  3VS1 A;  2RQW A;  4A4F A;  3JCM f;  2K5I A;  1OX9 A;  3RMS A;  3JCM J;  3VS5 A;  1Y0M A;  1D0Y A;  1FYN A;  2X4X A;  4J83 A;  3OQ5 A;  1M2O A;  1PD0 A;  4C92 E;  1OPK A;  2A0F B;  3GF5 A;  5LJ5 f;  2KK4 A;  2NYS A;  2BE7 D;  3L2Z A;  4HVV A;  1RI0 A;  2NUP A;  1D09 B;  3PE0 A;  3EFS A;  2G6F X;  3RR6 A;  3M0R A;  4IUQ A;  1QVG P;  1WJQ A;  2HKN A;  2HMA A;  5GAN 2;  4PJJ A;  2AZS A;  3CCM A;  2LCL A;  2KYB A;  3QJY A;  4E2F B;  2X51 A;  3G71 A;  1ZSZ B;  2RHX A;  1C6V X;  3CCS T;  2K79 A;  1RLQ C;  2LQW A;  3L2W A;  2QI2 A;  1YJW Q;  4J6X A;  3C4S A;  1K8A C;  4A4E A;  2L3R A;  5GAN h;  1Q81 R;  1K8A R;  3EGU A;  1Q86 R;  1BI0 A;  3VS0 A;  1H3H A;  1LCK A;  2CSI A;  4M78 C;  5KYX A;  5GAN d;  1GXI E;  1GBQ A;  1ABO A;  2J7I A;  4MZM A;  3M53 A;  3LW5 E;  1T3L A;  2M0Y A;  1M2V A;  2D1X A;  1WHM A;  1UJ0 A;  3ZBD A;  5LJ5 d;  4J6W A;  2CP2 A;  4M77 G;  3RDV A;  1TWB A;  4YTL A;  5KYU A;  2RHI A;  5DLQ E;  1YHQ Q;  3H41 A;  5GAO n;  2R5M A;  2YRC A;  2QQA A;  3H0H A;  5CQX A;  1PSF A;  3CC4 A;  3EFO A;  2LRQ A;  2R58 A;  4Z89 A;  5IXF A;  1KHC A;  3CME Q;  1M27 C;  3MJX A;  2NUT A;  2RQR A;  2AIR B;  2GBQ A;  2CZ1 B;  2R57 A;  2RI3 A;  3L2Q A;  1OU8 A;  2EWN A;  2VVK A;  4QVD A;  1AZE A;  4M7A F;  3QPH A;  2Y4Y A;  5A0D A;  4R56 A;  4PLI A;  1Y96 A;  2YUO A;  2J6O A;  1PG5 B;  3S6W A;  1ZUU A;  4J9B A;  3OA6 A;  3FJP A;  3L2V A;  1NYG A;  3RIR A;  2QEX A;  1VQ4 Q;  1KC8 U;  1N8R U;  2DYB A;  4WF2 A;  2RM4 A;  1XQH A;  2KR3 A;  2YXY A;  1JJ2 A;  3VV0 A;  2HZY A;  4O6J A;  2CP0 A;  3CCQ Q;  4X34 A;  4BE2 A;  1VQO Q;  2DZ9 A;  4CC2 A;  2QXF A;  1G3T A;  5CO7 A;  3QYG B;  1YJN Q;  4GBQ A;  1OYX A;  4ELZ C;  5I2M A;  4EMK C;  2L89 A;  3OYE A;  3MEA A;  1OV3 A;  1X43 A;  5CKE A;  1LJO A;  3JCM c;  3CPW A;  4XU3 A;  3THK A;  4C5H A;  2KY9 A;  3RUX A;  5L8R E;  2JVV A;  2KT8 A;  5GMK i;  3OYJ A;  3CD6 Q;  3CC2 T;  3CD6 T;  2HBW A;  3H0I A;  3I55 T;  1K73 U;  5GAM h;  4M7D D;  4KGV B;  2O01 E;  4M7A C;  1ZUY A;  2P0P A;  1IGQ A;  2DRK A;  1I5O B;  1YIJ T;  2DL7 A;  1D3B B;  4RTZ A;  1ZSZ C;  3CME A;  5IN1 A;  4IUP A;  1J3T A;  3LYI A;  4QQ6 A;  4M78 A;  2SEM A;  4KUD K;  4PJO A;  1D1A A;  4JRQ A;  3I56 A;  2XKO C;  1VQM T;  1TOV A;  4C8Q D;  1D1B A;  1Q86 U;  2M0O A;  4PFO A;  1VIE A;  4M78 B;  3REA B;  1VQ6 A;  1YCY A;  2KYM A;  1U1T A;  2RHZ A;  2X4W A;  4KUI A;  4Y91 A;  1VQ5 A;  3M54 A;  1JU5 C;  1VQP Q;  4CI0 C;  4N4G A;  1VQP T;  1WGS A;  1YJ9 A;  1WHG A;  1O9S A;  2M02 A;  2MMP A;  3J80 E;  2VGM A;  1M3C A;  4J7F A;  1I0C A;  2KI7 A;  4OML A;  3CPW S;  2M9U A;  2PZ1 A;  1QCN A;  3G71 Q;  1C0M A;  5FWB A;  4KBM B;  1YIJ Q;  3RMQ A;  2FG0 A;  5FLX E;  1TU0 B;  1E6G A;  1I07 A;  3TEE A;  3G6E A;  3UF4 A;  1S72 A;  2PUK B;  5GMK j;  1M90 U;  1LPL A;  4XK8 E;  2P84 A;  3CC2 Q;  2X9H A;  1BI3 A;  1JXO A;  5I2S A;  4HCZ A;  2QDL A;  2MK5 A;  2EVR A;  4DBH A;  5FU7 B;  2OTL Q;  1Y7X A;  1AZG B;  2E65 A;  5KE3 A;  3V7C A;  4DOV A;  1PD1 A;  4F17 A;  1VQM A;  1LOJ A;  1KQS P;  1NPP A;  2YUP A;  4JDS A;  1YWP A;  2H8H A;  4AFQ C;  1NG2 A;  2KBT A;  4EMK A;  2EGC A;  1PKT A;  4M75 C;  2DKG A;  3A5Z B;  3CCR Q;  2DYI A;  3DB4 A;  1NLP C;  3WXM B;  4OMO A;  3VS7 A;  1VYV A;  4D8K A;  3DB3 A;  4CRI A;  2LTO A;  4M77 C;  2JTF A;  1RAE B;  3E2U A;  4QW2 A;  3VS3 A;  3M0U A;  4ZN1 A;  2RJE A;  2CUB A;  1T3S A;  4EMK B;  4AFU C;  1JEG A;  1KK7 A;  2RD1 A;  1UEB A;  1M1K U;  3H8Z A;  2O9V A;  4ORZ A;  1VQ9 Q;  3RKX A;  5GAO p;  1M4Z A;  1M3B A;  4P5N A;  1G2B A;  4LDV A;  2LNH B;  4ELY C;  3ASK A;  1H64 1;  2KQW A;  4QVC A;  1VQ8 T;  2CRE A;  1X75 C;  4M7A G;  1G83 A;  3VRZ A;  4PJN A;  2C0I A;  5GAM j;  2F5K A;  2DL8 A;  1I4K 1;  1R8O B;  1K9M C;  2ENM A;  3KUF A;  4RG8 A;  4JJD A;  2DRM A;  2K9G A;  2RJC A;  2A3L A;  3NHN A;  3QKJ A;  4BUG A;  3LGF A;  3MP8 A;  2EGE A;  3HP9 A;  1HJD A;  4J9G A;  2EYX A;  2LCC A;  2J6F A;  4BDZ A;  2OI3 A;  3LH0 A;  1VQL A;  3CCE T;  3DLM A;  4ANJ A;  1D0X A;  2EFI A;  4M75 F;  4OF1 A;  3OYF A;  1X01 A;  1GCQ A;  1X2Q A;  3EAE A;  3P8B B;  2RNA A;  4A63 B;  3OYN A;  5GAN j;  2VAS A;  3ULR B;  5GAO m;  1KIK A;  3H9N A;  2IPO B;  2EJF A;  1RLP C;  2JT4 A;  3HTR A;  1B34 B;  2JNG A;  3UT1 A;  2BZX A;  3L2U A;  1G3W A;  3CC7 A;  4QQD A;  3X20 B;  2CZ6 B;  1AD5 A;  2NWM A;  4PJO G;  1VQN T;  1NLO C;  3PVQ A;  1SF9 A;  1E6H A;  2V26 A;  3M58 A;  3MHX A;  2F1L A;  2DA9 A;  2KXC A;  3OW2 A;  5FRM A;  3FEO A;  3HFN A;  2XMF A;  3OYA A;  4KUL A;  1H92 A;  4ZNX A;  2GQI A;  4KGZ B;  3JRZ A;  1UGQ B;  4OB2 B;  3VKI A;  2KGT A;  2RHU A;  1GBR A;  3OYD A;  4XTZ A;  3UWN A;  1RUW A;  1AWW A;  3V8L A;  3CCS A;  2FB7 A;  1PCX A;  4NOY A;  1R77 A;  2ZPB B;  4XAX B;  2K2M A;  2HDA A;  2EQJ A;  4PL6 A;  1BYM A;  2HBP A;  5IAY A;  1W2B S;  2HCK A;  2MOX A;  2YLC A;  1W70 A;  2XID A;  1ZSZ A;  2WSC E;  4M7D G;  3CCS Q;  4J9C A;  1K0X A;  2RO0 A;  3CCQ T;  3CMA Q;  5J39 A;  1G5V A;  2EYY A;  5KE2 A;  2BIV A;  3QUI A;  5GAN 8;  3NTH A;  3HKS A;  3BY7 A;  2OJ2 A;  5J3B A;  2F2V A;  3CCJ T;  3QDR B;  2E3H A;  3CCV T;  4CC7 A;  2F2X A;  3GPL A;  4OGC A;  4IUV A;  4JJC A;  4C0F A;  2PQW A;  3HL8 A;  1IB8 A;  4ZTJ A;  2K5F A;  2A37 A;  4JPB W;  1Y71 A;  4AG1 C;  3CQT A;  2JM8 A;  4UC4 A;  1YN8 A;  2ECZ A;  1FX7 A;  5KYU B;  1MV0 B;  3NTI A;  3QWX X;  1H3Z A;  1PNJ A;  4E6R A;  1Y57 A;  4J9I A;  3C12 A;  1KJW A;  2GGR A;  4JRK A;  1G3S A;  2A7Y A;  2OAW A;  2A08 A;  2CUD A;  2K57 A;  1QVG S;  3MET A;  5CVI A;  1PKS A;  3G4S A;  2MWP A;  1SSF A;  3OYY A;  1NZ9 A;  1CKA A;  2GTO A;  3HSB A;  3BDU A;  4RKU E;  4M7A A;  3CCR A;  1MGQ A;  3EG1 A;  1MMA A;  3GNG A;  1QVP A;  3EG9 B;  4JRP A;  1TG0 A;  5I11 A;  1EZZ B;  1N6A A;  2Y4X A;  1VQ4 T;  3HRU A;  3R6N A;  2DE0 X;  4RTU A;  5A0G A;  1N8R C;  4PJO C;  1WQW A;  4LN2 A;  1ZQ1 A;  1MHN A;  1UE9 A;  1TXQ A;  2DIG A;  3JAM E;  2RK1 A;  1RAD B;  3BW1 A;  3ME9 A;  3PIO A;  1UEC A;  3G6E Q;  1K9M R;  4M7D A;  4A54 A;  1YFN A;  2QQS A;  3G71 T;  5FU6 B;  4OB0 B;  4X9C A;  3M57 A;  1VQ9 A;  1M8M A;  1VQK T;  2X4J A;  2LJ0 A;  3CCM Q;  4E7S A;  3VJP A;  2LQN A;  4L6V 5;  1ZHI A;  3DLL A;  4GLM A;  2LQK A;  4XU1 A;  3CXC P;  2KRO A;  1LVK A;  3OSV A;  3QII A;  1PRM C;  4L5G A;  1OEB A;  4MZP A;  4JLG A;  2IVW A;  5LJ3 e;  1UDL A;  3JCM V;  3F70 A;  2K4Y A;  1EX4 A;  3GLX A;  3OY9 A;  3MP6 A;  2COY A;  1YIT A;  5IXB A;  1NJI U;  1ZA2 B;  2FPD A;  4M78 D;  3TRE A;  5IHI A;  4J6Y A;  3EHQ A;  3C0C A;  2DD4 A;  3QWY A;  1I5L A;  2F69 A;  1Q7Y C;  3GNF B;  4PJO F;  1AWX A;  1AHJ B;  3JCM d;  3X24 B;  1Q82 U;  3JCM e;  3H6Z A;  4ZGE B;  2PVG B;  1KD1 R;  3IQL A;  5A0L A;  2F5T X;  4FIB A;  2W10 A;  5M9O A;  4LD6 A;  2AHJ B;  5GAM d;  3JCM Q;  3OS2 A;  4LDY A;  2KT1 A;  5CKD A;  1VQ7 Q;  2LVM A;  2GNC A;  3VYH B;  3BDL A;  4HA8 A;  4QT7 A;  3BFM A;  4F7U G;  2WSF E;  2KSS A;  4C92 F;  4PFZ A;  4HCB A;  2E3I A;  1FMW A;  1W4S A;  2ROT A;  2AKK A;  4NL3 A;  2BKD N;  1SKU B;  2GQV A;  4O5V A;  4J8O A;  3QZ5 B;  3CCV A;  2NLU A;  5GAN 4;  4NS5 A;  5FRN A;  2E10 A;  4Z02 A;  2NUP B;  4JZ4 A;  5EG2 A;  4A4K A;  4KH1 B;  3OYH A;  1I81 A;  4M78 G;  2V8K A;  8AT1 B;  1Q7Y U;  3EG9 A;  3CCQ A;  4ZGD B;  3ZFJ A;  1UGR B;  2MAM A;  2HL5 C;  1MUZ A;  5D7U A;  2F2W A;  3WVD B;  1ZX6 A;  1Z9Z A;  1CKB A;  1IRX A;  3V8J A;  2DXC A;  1YJ9 Q;  1SSH A;  1X27 A;  5GAN e;  2DEQ A;  3ER0 A;  4J9H A;  3M4G A;  2JS0 A;  3PMT A;  1WIE A;  1N27 A;  3SD4 A;  3OYI A;  2DTI A;  3UA7 A;  1X69 A;  2KEA A;  2J6K A;  2JOY A;  4OGE A;  2EKH A;  3OS1 A;  2FZC B;  2EGA A;  1BK2 A;  3JV3 A;  5FWC A;  3R6O A;  2EYZ A;  1UGV A;  5LJ3 f;  1VQN Q;  4FT2 A;  4E7H A;  2A28 A;  2CP5 A;  3M0P A;  1M5Q 1;  2QAS A;  1WNL A;  3JB9 G;  3PT9 A;  5GAO l;  2KRS A;  5LJ5 j;  1K9A A;  2H3E B;  1ZBX A;  3OYC A;  2K2V A;  4FSX A;  2JTE A;  2EAY A;  3GP8 A;  1Q82 C;  2RB6 A;  5A2Q E;  3EG0 A;  5LJ5 h;  2MWO A;  5LJ3 h;  3A8G B;  1UJY A;  1B07 A;  1U06 A;  4OB3 B;  1UGP B;  2VV5 A;  3OYG A;  1NYF A;  2JM9 A;  2RJF A;  2LNV A;  3HFO A;  1JBM A;  1WXU A;  4ZGJ B;  1B34 A;  3UA6 A;  3JB9 D;  1YI2 Q;  3CCE Q;  2LX9 A;  4BI3 A;  4AG2 C;  2LMJ A;  4C5E A;  4OMN A;  1SG5 A;  1VQK A;  2KXD A;  2QK0 A;  4R0K A;  1YJ9 T;  2DK3 A;  2GCX A;  3VS4 A;  1WHH A;  4D6W A;  2GF7 A;  3OBW A;  4F7U B;  4BI4 A;  4FL6 A;  4KGX B;  3QHS A;  3CMA T;  1AOJ A;  3M4Y A;  3CCE A;  1WPY A;  5IHN A;  1UG1 A;  2YRV A;  3EH2 A;  2K3X A;  1RAF B;  1KC8 R;  1M1K C;  1UHF A;  5LJ3 d;  4C8Q G;  3OYB A;  3LWH A;  4BE0 A;  4Y92 A;  4FCY A;  4OMP A;  1YJN T;  4F04 B;  1OPL A;  1PSE A;  1NE8 A;  3V7S A;  3QO3 A;  4LNP A;  2GTJ A;  2VKN A;  1M1G A;  3PTA A;  4DEY A;  5D6W A;  4J7I A;  4ME7 A;  2D9T A;  2FEI A;  4J9D A;  2FZK B;  2CSQ A;  1SHF A;  3I55 A;  3CXC A;  2QEX Q;  2MCN A;  1K73 C;  1D3B A;  4BE1 A;  2XD0 A;  1MMD A;  3CC4 Q;  5ECA A;  3MKD A;  2KVQ G;  5GAN 3;  2MF2 A;  5IHK A;  2YT6 A;  3JB9 F;  2OTJ T;  4LUD A;  2ROL A;  3LLR A;  2JJ9 A;  2DJQ A;  2M1H A;  2M16 A;  1Q82 R;  2YRD A;  1MNE A;  1IXD A;  1OZ2 A;  5GAO q;  3PVL A;  3JB9 J;  4OVA A;  1RAC B;  1GL5 A;  1OI1 A;  1QWE A;  2PUO B;  5I21 A;  2EYQ A;  1FMV A;  2JS2 A;  1X6B A;  3M56 A;  2L5Q A;  2C0T A;  2FHD A;  2HD0 A;  2YUQ A;  4C8Q B;  3CCV Q;  3RBB B;  3JCM h;  2XHC A;  1H8K A;  4HKE A;  2EKO A;  4X9D A;  1JO8 A;  2B86 A;  2XI9 A;  1TUD A;  3M59 A;  3N5B B;  4RCC A;  4B6M A;  2E64 A;  1YCS B;  3CCJ Q;  2HKQ B;  2LZ6 B;  1PHT A;  5IT9 E;  5GAM g;  2CH4 A;  3SB2 A;  2WSE E;  4M75 A;  2LJ1 A;  2LCS A;  3FIF A;  1V1C A;  2QQR A;  1X2K A;  1UUE A;  3MPU B;  1VQ7 A;  3X26 B;  3CBO A;  1BBZ A;  2L8D A;  2E6N A;  4JS5 A;  1VQ9 T;  2ZPG B;  2E70 A;  2EQU A;  3A8L B;  4HVU A;  2V8I A;  1WFW A;  3CC4 T;  1VQ8 Q;  1BI1 A;  3V8K A;  4M77 D;  2QQB A;  4DEX A;  1TUG B;  5CAI A;  4JZ3 A;  3LGL A;  2EBP A;  4II1 A;  3MCA B;  3FB9 A;  4X1V A;  4DQ2 A;  4HVW A;  1B7T A;  1SRL A;  1W2B A;  1OX8 A;  2AK5 A;  1VQ4 A;  3M0T A;  3A98 A;  4M7D B;  2O31 A;  5IH2 A;  1PM3 A;  4DA4 A;  2RH2 A;  3E9G A;  2ABL A;  2EIF A;  1CSK A;  3SEM A;  3QXE B;  4F7U E;  4E7K A;  1SEM A;  1SHG A;  8ATC B;  3PIP A;  2RA2 A;  3HPW A;  1GFC A;  3JCM b;  1YIJ A;  4M7A D;  4EMG A;  3VS6 A;  4FM4 B;  4MZT A;  2HSP A;  3L2R A;  4M7D C;  4PLL A;  4E7I A;  2EJG A;  2SRC A;  1O75 A;  1ACM B;  4C8Q E;  3HHT B;  3OB9 A;  2KDS A;  2D0Q B;  5KCO A;  3CPF A;  3QJ6 A;  2K6D A;  4XTU A;  3OYK A;  1U3O A;  3VUB A;  3QZ9 B;  3RKY A;  2QA4 A;  3UPU A;  4JLI A;  4M75 D;  2IIM A;  2NUZ A;  1D0Z A;  5FU7 C;  2P0Q A;  3SWN C;  1SRM A;  2DXT A;  4RUG A;  4M78 F;  3A8H B;  1NEB A;  3SWN A;  2VC8 A;  1XNI A;  4AT1 B;  4EPC A;  1OU9 A;  2KRM A;  5GAN 5;  3I9Q A;  3LX7 A;  1UGS B;  1RAG B;  2L3S A;  3MEV A;  3GBQ A;  4C8Q A;  1JRI A;  3O5Z A;  5GAN g;  1WHJ A;  3OMG A;  4C8Q C;  1Q7Y R;  1VQ8 A;  2LT1 A;  2DET A;  2ED1 A;  2JN0 A;  2COW A;  1TTH B;  5GMK l;  1WJR A;  2DLP A;  3CC7 Q;  3JCM W;  2JMC A;  3I35 A;  3JCM P;  2KE9 A;  4PNO A;  1VA7 A;  3O8V A;  4ZN3 A;  2LDM A;  2ZZD A;  2GFA A;  4RG2 A;  1T0H A;  4ZTF A;  1WXB A;  3FC3 A;  2RI5 A;  4BD3 A;  3M9Q A;  2O9S A;  1JXM A;  3EG3 A;  2EYW A;  5HK3 A;  3CBP A;  2CDT A;  1G3Y A;  2DBK A;  2CGH A;  2LX7 A;  3QG1 A;  1BIB A;  2XG8 D;  1ZA1 B;  1I8F A;  1QVG A;  3CEY A;  2JXB A;  2DTH A;  2DFU A;  2VUB A;  4HXJ A;  4FT4 A;  4M7A B;  1HSQ A;  5HCK A;  2LP5 A;  3M0Q A;  1Q81 U;  5HKC A;  2DVJ A;  3CXC S;  1YJN A;  4XU0 A;  3INZ A;  1RAH B;  5GAN f;  1RAA B;  4XTW A;  2HSE B;  3EGX A;  3UAT A;  2JW4 A;  3NTK A;  1WA7 A;  2LJ3 A;  1IZ6 A;  2O4X A;  5D6X A;  1RAI B;  3E19 A;  4J9E A;  2GFU A;  2QAZ A;  2QG9 B;  3EGD A;  2DJZ A;  7AT1 B;  1N9S A;  3CCL Q;  3SDZ A;  1M90 C;  3JCM X;  2AKL A;  5L23 A;  1YJW T;  3FRN A;  5AT1 B;  1OZ3 A;  1VQP A;  4JS4 A;  1Q95 G;  4EMH A;  4RCB A;  4HT9 A;  1VYT A;  2HQH A;  3OBY A;  2RF0 A;  4XTY A;  1HXD A;  2RMO A;  4FU6 A;  3CBM A;  4IIO A;  2VGN A;  2DL5 A;  2DIL A; 
#chains in the Genus database with same CATH homology
 1BI3 A;  5I2S A;  4BB7 A;  4HCZ A;  4M77 A;  5GAN e;  3S3M A;  2DEQ A;  3ER0 A;  3OW2 S;  3M4G A;  4N0A C;  1X6O A;  4XQ3 A;  5FU7 B;  4BY6 C;  3PMT A;  3PGG A;  1N27 A;  3SD4 A;  4MDW A;  1Y7X A;  3OYI A;  2DTI A;  3SWN B;  3MEW A;  3S3N A;  2E65 A;  5KE3 A;  3V7C A;  4C92 G;  4DOV A;  4M75 B;  4C92 C;  1VQM A;  5LJ5 e;  1LOJ A;  2JOY A;  4OGE A;  1NPP A;  4JDS A;  4B9X A;  1NPR A;  3OYL A;  1KC8 C;  3OS1 A;  3CCU T;  5DY9 A;  4RMO A;  4Q5W A;  3R6O A;  4GLK A;  3CME T;  4EMK A;  4M75 G;  3NFC A;  5LJ3 f;  4M75 C;  2B8A A;  2DKG A;  3A5Z B;  3PFS A;  3E9F A;  4FT2 A;  4C0G A;  4C92 B;  5DLO A;  5GAN 6;  1M5Q 1;  1WNL A;  3DB4 A;  3E1S A;  3JB9 G;  2PVD B;  3PT9 A;  3CCL A;  1M8V A;  5GAO l;  3WXM B;  5LJ5 j;  1ZBX A;  3OYC A;  2C06 A;  5CK9 A;  2K2V A;  2VYT A;  3DB3 A;  4CRI A;  4KT0 E;  4FSX A;  2LTO A;  4M77 C;  2EAY A;  2JTF A;  4QW2 A;  4C5I A;  3GP8 A;  3CD6 A;  2OTJ A;  1Q82 C;  2EQM A;  2RB6 A;  1Y07 A;  5A2Q E;  1TH7 A;  1JB0 E;  2RJE A;  3HRS A;  4EMK B;  4ZN1 A;  5LJ5 h;  1YIT T;  3RER A;  5KH6 A;  2MWO A;  5LJ3 h;  2MI6 A;  2RD1 A;  3A8G B;  4N0A A;  1HK9 A;  2RK2 A;  4C92 A;  3JCM g;  1UEB A;  4OB3 B;  1UGP B;  2VV5 A;  3OYG A;  2CZ0 B;  1M1K U;  2BUD A;  5GAM e;  2RJF A;  2LNV A;  3H8Z A;  5CQY A;  5GAO r;  1IRE B;  3HFO A;  3RKX A;  1Q86 C;  1JBM A;  5LJ3 j;  3RKW A;  5GAO p;  3CC7 T;  4LDX A;  1M4Z A;  3JB9 I;  4P5N A;  2HNI A;  3G6E T;  2E12 A;  4LDV A;  4ZGJ B;  1B34 A;  4LDU A;  2O4X B;  4M78 E;  4ELY C;  3ASK A;  1H64 1;  3JB9 D;  4PJO B;  1YBY A;  3FLG A;  4IUR A;  2YLB A;  4PJO E;  2DO3 A;  2KQW A;  2LX9 A;  5HY6 A;  4QVC A;  4E7L A;  1U8R A;  4BI3 A;  1VQ8 T;  1KHI A;  2FVU A;  1X75 C;  4C5E A;  4M7A G;  5LJ5 g;  5GAM j;  2ZPF B;  1YJW A;  4E7J A;  2F5K A;  1VQK A;  1I4K 1;  2OAU A;  1R8O B;  4OMF B;  4TVR A;  1K9M C;  4A4H A;  4HT8 A;  1KG1 A;  1WJS A;  3KUF A;  3Q1J A;  4RG8 A;  1YJ9 T;  2DK3 A;  2HQE A;  3VYG A;  2GCX A;  4D6W A;  4OP0 A;  1FWZ A;  2GF7 A;  2RJC A;  2A3L A;  3OBW A;  3QKJ A;  4F7U B;  4BUG A;  3LGF A;  3MP8 A;  3HP9 A;  3KBG A;  2XDB A;  4BI4 A;  2E1H A;  4FL6 A;  2QEX T;  2LCC A;  3WVE B;  1VQ5 T;  3QHS A;  3CMA T;  2RI2 A;  4BDZ A;  3M4Y A;  2JTM A;  3LH0 A;  3CCE A;  1VQL A;  1VQL T;  1WPY A;  3CCE T;  3S3O A;  3HRT A;  1S72 T;  2JUF A;  4N4I A;  3DLM A;  2YRV A;  2HQX A;  2K3X A;  2DVE A;  2WAC A;  3OMC A;  1M1K C;  5LJ3 d;  2EFI A;  4M7D F;  4M75 F;  4C8Q G;  2FL7 A;  4OF1 A;  3VUZ A;  3OYB A;  3LWH A;  4BE0 A;  3OYF A;  4OB1 B;  2QTX A;  1X01 A;  3TCJ A;  3SFM A;  2QA4 T;  1YJN T;  4PJO D;  2D6F A;  1YHQ A;  3EAE A;  3P8B B;  3OYN A;  5GAN j;  1QVF S;  4DOW A;  2YHT A;  5GAO m;  1PSE A;  2K5L A;  1NE8 A;  2EJF A;  3V7S A;  4M77 E;  3MEU A;  1JJ2 S;  3QO3 A;  1B34 B;  2JNG A;  5DM7 R;  1YI2 A;  4IUT A;  3UT1 A;  1M1G A;  3PTA A;  4E47 A;  3L2U A;  5D6W A;  1G3W A;  4J7I A;  1V29 B;  4ME7 A;  2D9T A;  3CC7 A;  4C8Q F;  1BIA A;  4QQD A;  1QP2 A;  4Y28 E;  1VQ6 T;  3X20 B;  2CZ6 B;  2QQ9 A;  3I55 A;  3CXC A;  4PJO G;  1VQN T;  1XOV A;  1K73 C;  1D3B A;  4BE1 A;  2H3J A;  3VU3 C;  4A53 A;  2XD0 A;  1Y96 B;  3GIB A;  1KD1 U;  1KQ2 A;  4BDY A;  1QP3 A;  4C0Z A;  2KVQ G;  3M58 A;  3MHX A;  2ZPH B;  5GAN 3;  3OW2 A;  2MF2 A;  3I56 T;  5FRM A;  3JB9 F;  2OTJ T;  4N4H A;  3FEO A;  3LLR A;  4IUU A;  2DPP B;  4L59 A;  4JUV A;  2M1H A;  4BAC A;  2I2L A;  2M16 A;  3HFN A;  5C0M A;  4C0D B;  3A8M B;  3CC4 A;  3OYA A;  4KUL A;  1OZ2 A;  5GAO q;  1BKB A;  3P8H A;  3JB9 J;  3JRZ A;  4OVA A;  1BI2 A;  1OI1 A;  2PUO B;  1UGQ B;  5CR2 A;  4OB2 B;  3VKI A;  5I21 A;  2HAX A;  2RHU A;  2EYQ A;  3OYM A;  4R55 A;  3M56 A;  2L5Q A;  2JZ2 A;  4XTZ A;  3UWN A;  3OYD A;  2FHD A;  2XIC A;  2LQ8 A;  4QQG A;  4GY5 A;  2HD0 A;  1U1S A;  3QBY A;  4C0D C;  3CCU A;  3V8L A;  3M5A A;  4IKF A;  3TU4 K;  3CCS A;  4C8Q B;  5GAM f;  1NJI C;  2FB7 A;  2RJD A;  3PNW C;  3CC2 A;  3JCM h;  2DXB A;  4E7H A;  4F7U F;  4NOY A;  5CKH A;  2XHC A;  4M75 E;  2ZPB B;  4HKE A;  2DAQ A;  1K8A U;  2EKO A;  4EDU A;  4X9D A;  4M7D E;  4V2S A;  5J26 A;  3CCM T;  2QDY B;  4XAX B;  2V8J A;  2EQJ A;  2XI9 A;  4A4F A;  3JCM f;  2K5I A;  4PL6 A;  2CS7 A;  2HBP A;  5IAY A;  3M59 A;  3N5B B;  4RCC A;  1W2B S;  4M77 B;  2YLC A;  1VQ7 T;  3RMS A;  3JCM J;  2E64 A;  3PMI A;  4F7U A;  2DTO A;  4J83 A;  2XID A;  2X4X A;  3OQ5 A;  5HK0 A;  2Y90 A;  4C92 E;  3J81 E;  2WSC E;  5IT9 E;  4M7D G;  3GF5 A;  5GAM g;  3SB2 A;  2P4T A;  2WSE E;  5LJ5 f;  4M75 A;  2OTL T;  2KK4 A;  3FIF A;  3T9N A;  2QQR A;  3L2Z A;  2RO0 A;  1RI0 A;  3CCQ T;  5AYF A;  5J39 A;  3FDR A;  3EFS A;  1VQ7 A;  1G5V A;  4IUQ A;  3X26 B;  3CBO A;  5KE2 A;  1WJQ A;  1KQS A;  2L8D A;  1VIF A;  2BIV A;  3QUI A;  5GAN 8;  5GAN 2;  3NTH A;  2LCL A;  5CCA A;  3UDC A;  3CCM A;  2E6N A;  3HKS A;  4JS5 A;  3BY7 A;  1VQ9 T;  4VUB A;  5J3B A;  3QJY A;  2ZPG B;  3G71 A;  3X25 B;  1M9S A;  2E70 A;  3CCJ T;  3QDR B;  2EQU A;  2RHX A;  3V7R A;  4B9W A;  3CCR T;  3A8L B;  2XDP A;  3CCS T;  3CCV T;  2V8I A;  3GPL A;  4OGC A;  2VXF A;  3URG A;  3L2W A;  4IUV A;  2QI2 A;  1VUB A;  3CC4 T;  4J6X A;  4C0F A;  3C4S A;  1BI1 A;  5GAN 7;  2PQW A;  3V8K A;  3HL8 A;  2QQB A;  4M77 D;  2K5F A;  2ZGW A;  5CAI A;  3G4S T;  4ZTJ A;  5FRO A;  1Y71 A;  4A4E A;  1K8A C;  2L3R A;  1KD1 C;  5GAN h;  3LGL A;  4UC4 A;  1FX7 A;  4II1 A;  3MCA B;  3FB9 A;  4DQ2 A;  1BI0 A;  3NTI A;  1H3Z A;  2K3Y A;  3ZEH A;  4M78 C;  5GAN d;  4JJN K;  1GXI E;  1W2B A;  1VQ4 A;  2KMT A;  4MZM A;  3GOX A;  3M53 A;  3LW5 E;  1FXX A;  4M7D B;  3C12 A;  3ZBD A;  4JRK A;  4DA4 A;  2E41 A;  3J7A F;  2RH2 A;  3E9G A;  4F7U E;  2EIF A;  2VXE A;  3QXE B;  1G3S A;  4JRI A;  5LJ5 d;  4E7K A;  2A7Y A;  4J6W A;  4M77 G;  1EIF A;  2K57 A;  3PIP A;  1QVG S;  3MET A;  4YTL A;  2RA2 A;  2RHI A;  3HPW A;  4NL2 A;  5DLQ E;  5GAO n;  3JCM b;  1YIJ A;  5CVI A;  3X28 B;  2R5M A;  2MWP A;  4EMG A;  3G4S A;  4M7A D;  4M7D C;  4FM4 B;  1SSF A;  4MZT A;  2QQA A;  3OYY A;  3L2R A;  1NZ9 A;  1PSF A;  4PLL A;  5CQX A;  4C5G A;  4E7I A;  2EJG A;  2LRQ A;  3BDU A;  2R58 A;  4RKU E;  3HSB A;  3QSU A;  4M7A A;  1KHC A;  2E6Z A;  1O75 A;  4ATO A;  4C8Q E;  3HHT B;  3CCR A;  3OB9 A;  1MGQ A;  2KDS A;  2D0Q B;  5KCO A;  3GNG A;  1QVP A;  3CPF A;  4JRP A;  2RI3 A;  2CZ1 B;  2R57 A;  3QJ6 A;  4XTU A;  5CKF A;  1N9R A;  3OYK A;  3L2Q A;  1N6A A;  2Y4X A;  1VQ4 T;  2EWN A;  3HRU A;  4QVD A;  5D6Y A;  3VUB A;  2XK0 A;  2XDD A;  3QZ9 B;  3QPH A;  2Y4Y A;  3RKY A;  1YHQ T;  4M7A F;  3OSS C;  5A0D A;  2QA4 A;  5A0G A;  1N8R C;  3UPU A;  4JLI A;  4XTV A;  4PLI A;  1Y96 A;  4R56 A;  4PJO C;  4M75 D;  2KAF A;  1WQW A;  1ZQ1 A;  4MML A;  5FU7 C;  3S6W A;  4BY6 B;  1MHN A;  2P0Q A;  2OTL A;  4MDX A;  1K9M U;  5FU6 C;  3OA6 A;  3FJP A;  3SWN C;  2DIQ A;  3L2V A;  2DIG A;  2DXT A;  4M78 F;  3A8H B;  3RIR A;  3SWN A;  2VC8 A;  1UB4 A;  1XNI A;  2QEX A;  3JAM E;  1WQ7 A;  2RK1 A;  4C92 D;  1DJ7 B;  4EPC A;  1KC8 U;  4M7A E;  5GMK m;  3BW1 A;  3ME9 A;  3PIO A;  1N8R U;  5GAN 5;  4WF2 A;  2XU8 A;  2RM4 A;  3LX7 A;  2P0K A;  1UGS B;  4M7D A;  4A54 A;  4J5Y A;  2QQS A;  3G71 T;  5FU6 B;  1XQH A;  4OB0 B;  3MEV A;  4X9C A;  3VV0 A;  2CYZ B;  1JJ2 A;  3M57 A;  4M77 F;  1VQ9 A;  2ZPI B;  4O6J A;  4XTX A;  4X34 A;  3OS5 A;  1VQK T;  2X4J A;  4BE2 A;  5LL6 S;  4C8Q A;  1JRI A;  2DZ9 A;  5KCH A;  5GAN g;  3VJP A;  3OMG A;  2G3R A;  4C8Q C;  2QXF A;  5GMK e;  1G3T A;  5CO7 A;  1VQ8 A;  2LT1 A;  2JN0 A;  3QYG B;  4L6V 5;  1ZHI A;  3DLL A;  2CKK A;  3MO8 A;  2LQK A;  1OYX A;  4XU1 A;  4ELZ C;  5I2M A;  1WJR A;  4EMK C;  5GMK l;  3OSV A;  3QII A;  2L89 A;  2LT4 A;  3OYE A;  3MEA A;  5CKE A;  2FYK A;  1LJO A;  4L5G A;  4MZP A;  3JCM c;  4JLG A;  3JCM W;  2IVW A;  3CPW A;  4XU3 A;  3JCM P;  4C5H A;  2EJ9 A;  2KY9 A;  5C6S A;  4PNO A;  3RUX A;  5L8R E;  2X35 A;  5LJ3 e;  3O8V A;  2JVV A;  3JCM V;  4ZN3 A;  2LDM A;  2K4Y A;  2ZZD A;  3F70 A;  2GFA A;  3GLX A;  4PKC C;  4RG2 A;  5GMK h;  5GMK i;  2DXU A;  3MP6 A;  3OY9 A;  3KXT A;  1YIT A;  1NJI U;  4M78 D;  4ZTF A;  3TRE A;  3OYJ A;  3FC3 A;  4J6Y A;  3CC2 T;  3RES A;  3CD6 T;  1VQN A;  2RI5 A;  4BD3 A;  3I55 T;  3M9Q A;  2DD4 A;  1K73 U;  1I5L A;  5GAM h;  2F69 A;  4M7D D;  2O01 E;  4M7A C;  2P0P A;  1Q7Y C;  5HK3 A;  3CBP A;  3GNF B;  3CCL T;  1BYM A;  3C94 A;  1G3Y A;  4PJO F;  2LC4 A;  1YIJ T;  2CGH A;  1AHJ B;  1D3B B;  2ZCF B;  1BIB A;  2XG8 D;  3QG1 A;  5CIU A;  3JCM d;  3CME A;  1YI2 T;  3X24 B;  1I8F A;  4LDW A;  1Q82 U;  3CEY A;  5IN1 A;  1QVG A;  3JCM e;  3H6Z A;  4ZGE B;  2DTH A;  2PVG B;  4IUP A;  2VUB A;  3LYI A;  4FT4 A;  3L42 A;  4QQ6 A;  4M7A B;  4M78 A;  4LD9 K;  5A0L A;  2F5T X;  4FIB A;  4KUD K;  4PJO A;  5M9O A;  4LD6 A;  4JRQ A;  2AHJ B;  3I56 A;  2RHY A;  5CKB A;  3EFR A;  1RL2 A;  5GAM d;  2XKO C;  3JCM Q;  3OS2 A;  4LDY A;  5HKC A;  1VQM T;  1Q81 U;  3CXC S;  5CKD A;  4C8Q D;  4XU2 A;  2LVM A;  1YJN A;  4XU0 A;  3VYH B;  3INZ A;  3BDL A;  2IG0 A;  4HA8 A;  1Q86 U;  2CZ7 B;  1P92 A;  2M0O A;  3BFM A;  5GAN f;  1QVF A;  4F7U G;  1VIE A;  4XTW A;  2WSF E;  2KSS A;  1M1F A;  4C92 F;  3M55 A;  4M78 B;  3AHU A;  1VQ6 A;  4HCB A;  3LWI A;  3NTK A;  1YCY A;  1IZ6 A;  1W4S A;  2O4X A;  4NL3 A;  5D6X A;  1U1T A;  2BKD N;  2PU9 B;  2PVO B;  2RHZ A;  2X4W A;  3C95 A;  3P8D A;  4KUI A;  4Y91 A;  1Q81 C;  1VQ5 A;  2GQV A;  3M54 A;  1VQO A;  1KQS S;  2DZC A;  3E19 A;  4O5V A;  4J8O A;  3L1A A;  2GFU A;  3QZ5 B;  3CCV A;  4CI0 C;  4N4G A;  2NLU A;  3CCJ A;  2E5Q A;  2R5A A;  1WGS A;  4BI8 B;  4NS5 A;  2DJZ A;  5GAN 4;  1N9S A;  1VQP T;  4HCC A;  5FRN A;  1YJ9 A;  2E10 A;  3SDZ A;  2X4Y A;  1KQ1 A;  1O9S A;  2EQK A;  3DKM A;  4Z02 A;  2MMP A;  5EG2 A;  3JSC A;  3J80 E;  2VGM A;  4A4K A;  1M90 C;  4A4G A;  1XTD A;  4J7F A;  3JCM X;  1YJW T;  3CPW S;  3FRN A;  2M9U A;  3G7Z A;  5LJ3 g;  3OYH A;  1I81 A;  1OZ3 A;  2V8K A;  4M78 G;  2ZPE B;  1VQP A;  1Q7Y U;  3CCQ A;  1QW1 A;  4ZGD B;  4JS4 A;  3QYH B;  4KBM B;  4EMH A;  4MMK A;  4RCB A;  3RMQ A;  3A8O B;  4HT9 A;  3ZFJ A;  1UGR B;  2MAM A;  5FLX E;  3OBY A;  3OS0 A;  3TEE A;  1VQO T;  4XTY A;  1HXD A;  3G6E A;  1S72 A;  4FU6 A;  1LNX A;  2PUK B;  3CBM A;  3WVD B;  5GMK j;  3JB9 H;  2DD5 A;  1M90 U;  3MP1 A;  4QVZ A;  4XK8 E;  3CMA A;  2VGN A;  3V8J A;  2DXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...