4PJOC

Minimal u1 snrnp
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
86
structure length
86
Chain Sequence
GSGSVKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human U1 snRNP, a small nuclear ribonucleoprotein particle, reveals the mechanism of 5' splice site recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Splicing
molecule keywords Small nuclear ribonucleoprotein Sm D3
total genus 14
structure length 86
sequence length 86
chains with identical sequence Q, c, q
ec nomenclature
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4pjoC00
3GIBA 4XTWA 4M7DE 2DJZA 2YLBA 2JN0A 2QTXA 3HFNA 4JUVA 4NOYA 1Y96B 3VU3C 4M75A 4PJOE 2K57A 1LNXA 4XU2A 4M78B 2DZ9A 4C92D 5GAN3 1JRIA 1HXDA 3JB9G 4OP0A 3SWNC 2DEQA 4C8QD 4JLIA 4M75F 3JCMg 2I2LA 2CGHA 2FYKA 4M77D 3JCMb 2DKGA 4WF2A 5GAN6 3JB9I 3BW1A 4XU0A 1I5LA 2E41A 4M7AC 1D3BA 5GMKl 2EJ9A 4M75E 3JCMJ 5LJ3g 2FB7A 4XTZA 3RUXA 4C92B 4C92G 4DQ2A 4X9DA 4EMHA 2E10A 2VXFA 3SB2A 3V7RA 4C92C 4M75D 4EMKC 3JCMQ 3QSUA 5LJ3h 3JCMf 4A54A 1B34B 2EJGA 2RM4A 1M8VA 4XQ3A 3RKXA 5GAOm 1HK9A 3AHUA 4JRIA 4M75B 4C8QE 4M7DB 4PJOC 2EWNA 4X9CA 3FIFA 4XTXA 5LJ3j 1WQ7A 5GAN7 3V7CA 5GAN2 2RA2A 4M7DC 4PJOB 5GAOl 4F7UA 4F7UG 2DVEA 4RCBA 3SWNB 3RERA 5LJ5d 4XTYA 3JB9J 1JBMA 1N9SA 2E65A 4M7AB 1U1SA 4EMKB 1WNLA 4XTVA 3L2ZA 4A53A 5GAN5 4M7AG 4M75C 4M78E 3M4GA 4RCCA 5GMKi 5LJ5g 5CAIA 5GANd 1I4K1 2YLCA 5GAOq 4N0AC 4C8QA 1KQ1A 1N9RA 2E64A 2EAYA 2ZGWA 3BFMA 3JB9F 5GMKe 4PJOD 3JCMX 3JB9H 5GANe 4M7DF 5GAMg 2E1HA 2Y90A 2VXEA 1Y96A 2RD1A 2VC8A 1D3BB 5LJ3f 3JCMh 3V8LA 4J5YA 4M78A 5GMKj 5GAMd 4M7DG 3FJPA 5LJ3d 3PGGA 4XU3A 4PJOG 5GANh 1MGQA 1LOJA 1BIAA 3INZA 4MMKA 4F7UB 5GAOr 1LJOA 3BDUA 1B34A 5GAOn 5GAMe 3JCMe 5GANg 4HT8A 3HSBA 2RB6A 4M7DA 5GAN4 4M7AD 3RKYA 4M78C 3BY7A 5GANf 4PJOA 4M7AE 4M77B 2DTIA 1U1TA 3QHSA 3QUIA 4M75G 4M77G 1I8FA 4M78G 5I21A 1H641 3RKWA 5GAMh 4MMLA 3JCMV 3V7SA 1YCYA 2EJFA 1M5Q1 5LJ3e 4HA8A 5LJ5f 3JCMP 4JRKA 4C92E 3V8JA 4NL3A 5LJ5j 4J6XA 4M7AF 4C8QC 5GAOp 3EFSA 3L1AA 3RESA 4M77E 5GAMj 4HT9A 4N0AA 4C8QB 3HFOA 5GAMf 4C8QG 2YHTA 4M7AA 4M78D 4C92F 3FB9A 3QO3A 5LJ5h 3JCMd 5GAN8 4C8QF 4PNOA 2DTOA 1WQWA 4F7UE 4M77F 1X01A 1TH7A 3SWNA 3RIRA 5GANj 4EMGA 5LJ5e 4J6YA 5GMKh 4QVCA 2DTHA 4XU1A 2DZCA 5DY9A 3JCMc 4J6WA 4M78F 4NL2A 4Y91A 4F7UF 4QVDA 3JB9D 1KQ2A 1BIBA 4M77C 3EFRA 4C92A 4PJOF 4EMKA 1I81A 4XTUA 3V8KA 2DXUA 5GMKm 4M7DD 2DXTA 2HNIA 1WPYA 3JCMW 4M77A 4V2SA
chains in the Genus database with same CATH superfamily
4NOYA 1WGSA 3VU3C 2EYQA 2LCSA 2DZ9A 2LMJA 3P8HA 1HXDA 4JJCA 1WIEA 1KC8C 3SHWA 1PM3A 2ED0A 4YTLA 4E7ZA 3E1SA 3OYLA 2DNUA 2GNCA 1YJWQ 3CC7Q 2L5QA 2E6ZA 1ZX6A 4GLKA 4LDWA 3TU4K 1JXOA 1YJNT 3QPHA 3UPUA 1N8RU 4OMNA 2K6DA 3H0HA 4C8QE 3V7CA 2EVRA 1K8AC 2EQJA 2LC4A 2KT8A 1QQJA 3I56Q 2GFUA 2X9HA 1SRLA 4JJDA 4E7IA 3H8ZA 4C8QA 3QDFA 3BFMA 4VUBA 2OX7A 4QVZA 3CXCS 2PTKA 4QKUA 1NZ9A 3RMQA 2LT1A 1G2BA 2M0YA 2DF6A 3KUFA 1BIAA 2A0FB 2ZPFB 1U8RA 1MMAA 2R5MA 5I22A 5DLOA 1SEMA 1ABQA 1OX9A 1BCOA 2HEQA 4Q5WA 2EYZA 3CCJQ 3V7SA 1AHJB 1ABOA 2WSEE 1M90C 2AKKA 1BBZA 4C8QG 5IT9E 3D7SB 2FVUA 1I0CA 3OYMA 4IUQA 2L3PA 5GMKh 1Y0MA 4J6WA 1KK7A 3JB9D 4JZ4A 2M02A 4EMKA 5AT1B 2RQUA 2DL5A 1UGQB 4PJLA 4RG2A 3OYHA 2RMOA 1PRMC 1M90U 4BACA 2AT1B 1BU1A 3UA7A 3J81E 2R57A 3CCSQ 8AT1B 2DEQA 3CCUT 4M75F 2B86A 3PT9A 4AFUC 1W2BP 1M4ZA 3A5ZB 2LVMA 1K8AR 2EJ9A 1RL2A 1UG1A 2KYMA 3HL8A 3CPWP 3EGUA 2DBKA 5IAYA 3VS1A 3AHUA 3CXCP 3OW2S 1GBRA 1IZ6A 5GAN2 3URGA 4F7UA 2IIMA 5KYWB 4C5GA 4NS5A 2LZ6B 1IREB 4LDVA 1IGUA 3CBPA 4OMPA 1N9RA 1UDLA 1LPLA 5I2MA 4JRQA 4A4FA 2YRVA 4EPCA 2E1HA 2L8DA 2Y90A 2VXEA 1Y96A 2X3XD 4ZTJA 2PVDB 4J5YA 5FRNA 2M1HA 4F7UB 1PHTA 2EFIA 4OMLA 3C4SA 5GANg 3EGXB 3G6EA 3TEEA 1VQPQ 1U1TA 2ROTA 1VQMT 1OOTA 1SRMA 4FCYA 2M16A 1YHQA 2FO0A 1IXDA 4OMQA 4E2FB 2K4YA 2BUDA 2XKOC 3AT1B 2DVJA 1X6GA 1YIJA 1TG0A 3J7AF 1U06A 1PRLC 4R56A 1VQOT 1S72T 2ED1A 1VYVA 4RTWA 4EIKA 1MV0B 4F7UF 1YHQT 1BIBA 1GFDA 1WHLA 5GMKm 2V1QA 2W0ZA 2C0IA 2L2PA 4PFZA 1OX8A 1BCMA 1XTDA 2K57A 5LL6S 1RAAB 3A8OB 1VQMQ 3R6NA 2NWMA 3X25B 2I2LA 2CGHA 3M54A 2MIOA 3BW1A 2E41A 2CREA 5GMKl 1MMGA 1YCSB 3CCLA 3MEAA 1OZ3A 2KXDA 1VA7A 2HSPA 3SFMA 4E7KA 5DM7R 4ATOA 1YWOA 3FIFA 1Q82R 3I55A 3QXEB 3PMIA 2ZZDA 2QEXT 4PL6A 2E64A 2PVOB 1W2BS 2K5FA 3L2VA 1XOVA 3N5BB 1UHFA 1VQ7T 3V8LA 4HCCA 4M7DG 2QDYB 3FJPA 2RHIA 1H8KA 2COYA 5GANh 1YI2Q 1M2VB 5EC7A 4J9EA 1B34A 1IGQA 2X3WD 2L3SA 2L3RA 1Y07A 2A08A 4UC4A 2R58A 1QVGS 5GAN4 1OQKA 4M77B 1Y71A 2LX9A 1YI2T 3CMET 4MMLA 3NHNA 5LJ3e 2K79A 2LJ0A 2DFUA 2SRCA 3I9QA 4J7FA 4A4HA 5DLQE 1AWXA 3PIPA 5GAOp 2XU8A 4F17A 5GAMf 1W70A 4KRTA 1MNDA 5FROA 3A8MB 5A0GA 2KDSA 3T9NA 3UDCA 1D1CA 3REBB 1TOVA 3X20B 1VQ4Q 4E7LA 2VVKA 2WSCE 3MO8A 1W4SA 3TCJA 3PVQA 3LGLA 3CC4T 2LQKA 2JN0A 3CCEQ 3R6OA 1JRIA 2JTFA 4ZGJB 3X24B 3JB9G 1VQLA 3JCMb 4LUEA 1I5LA 2KY9A 1D3BA 2DYBA 2RO0A 4X9DA 3EFOA 2AZSA 2JJ9A 4O6JA 1G5VA 2RF0A 1HK9A 2O4XB 1QVGP 2DRMA 5EG2A 3SWNB 5KYXA 1D0YA 1VQOQ 1PSFA 3MEVA 1FMWA 4HKEA 4C5HA 4B6MA 3MEUA 4BE1A 2QAZA 1YJNQ 2DEUA 1VQLT 1KFZA 1UHCA 3TVTA 4E6RA 3CCRQ 2P0QA 3THKA 2F2WA 1LOJA 2MI6A 5GAOr 3OYBA 2QQBA 3CC4A 2X4JA 4ME7A 1WHMA 2K3XA 1TS9A 1UGSB 3TQ7P 3NGPA 1QMCA 5IHIA 4C0FA 2DYIA 3V8JA 3CCMQ 2XDBA 2KXCA 3OS1A 4ZN1A 2RHZA 3OSSC 4J9FA 1K1ZA 4IIOA 3CC7A 1Q82U 2YUQA 3EGDA 3OQ5A 2DAQA 4RTZA 3META 3CPWA 4AG1C 2FZKB 5A0DA 2YDLA 1EZZB 1VQKA 3GNFB 4J83A 2HSEB 4GBQA 3EGXA 1JXMA 2X4WA 5CVIA 2P0PA 1PC0A 1VQ8T 4J9DA 3RMSA 2FRYA 4XU2A 1WLPB 4FYXB 1NJIC 4X34A 2DD5A 2ZPGB 2P4TA 2DRKA 5GAN6 2JZ2A 2KAFA 2EKHA 2LTOA 3JCMQ 2EYXA 2P84A 1SPKA 3RKXA 1Q7YU 1ZBJA 3WXMB 1VQNT 5IXBA 1AZEA 4GY5A 5GAN5 3L2ZA 1MHNA 1KC8U 1UJ0A 4M78E 1RAEB 2BIVA 3CMAA 1ZSZA 1M3AA 4E7HA 2ZGWA 3ZL7C 2A37A 2EQKA 1TUDA 1YJNA 2RD1A 4FW2A 1VQKQ 1G3SA 4PJOG 3I35A 3INZA 4MMKA 1PSEA 1G3TA 4BI3A 1A0NB 2V8IA 3HSBA 2D8HA 1UUEA 2ESWA 4DOVA 4KH0B 4HVVA 1D1AA 2WSFE 2EJFA 2K3BA 1QCNA 4A4KA 2GBQA 3EG9B 4NL3A 3PIOA 1RLQC 3IQLA 4PKCC 3L1AA 3E9FA 3HFOA 1KQSA 4M78D 2YUOA 4Z89A 3M56A 4J8OA 5FLXE 2OJ2A 2DTOA 1G3YA 1VQ7Q 2F5KA 3H0IA 1BI0A 4J6YA 4MDXA 1OULA 5KE3A 1VQ6A 1RAIB 1V1CA 1I81A 2DXTA 2HNIA 4RKUE 1ZA1B 2MPXC 4ANJA 4F16A 4KGZB 2QA4Q 3GIBA 4PJOE 2HBPA 3HPWA 4WTOB 1LCKA 5CO7A 2QXFA 1PD0A 2ZAEA 2A7YA 4Z88A 2DKGA 2QQ9A 1KHCA 1ZHIA 1HYOA 3CCMT 1GFCA 2HDAA 4EMHA 1NEBA 1QWEA 1OZ2A 2AK5A 2RM4A 2X51A 4JDSA 3OYGA 4JRPA 1GCQA 3A98A 5D6WA 1FXXA 5C6SA 3CCRT 3KBGA 1VQLQ 2QA4A 2YSQA 1F1BB 2NUTA 1JQQA 3ZEHA 2VV5A 3MPUB 2OTJA 3JCMX 2BE7D 2J6FA 1MMNA 2AIRB 2RK1A 1WJQA 3QZ9B 1OYXA 4M78A 5GMKj 3CC2T 1JO8A 3PGGA 1ZQ1A 2XHCA 4FW1A 3QWYA 4RTVA 2PNIA 3TSWA 3U23A 1WA7A 2RNAA 1VIEA 4M7DA 3RKYA 4OMOA 4KGVB 2RQWA 2NUZA 4KGXB 1GRIA 1K9MR 2CH4A 4C92E 2DBMA 3OA6A 2RHYA 4HT9A 1ZSZC 4OMMA 1NBEB 2LNHB 2HKQB 2HCKA 1Q81U 1YITT 4CRIA 1X2KA 2GGRA 4QQDA 1G3WA 1UGPB 3E19A 4F7UE 2FRWA 3SWNA 2CZ0B 1IO6A 3CC4Q 2DK3A 4CC3A 4FT2A 4QVCA 2C0OA 3Q1JA 1N27A 3UWNA 1Z9ZA 2K9GA 3CCVQ 3LWHA 4A4EA 1VQ4T 2COZA 4RTTA 4XTWA 3TSZA 2VUBA 2K2VA 2WACA 1S1NA 1QVFP 3OS2A 3NTHA 4FM4B 1LVKA 3WVEB 3L2QA 3JCMg 4M77D 2MAMA 1AT1B 3H9NA 2K7AA 3EG0A 2EPDA 3M0QA 1SSFA 4RTYA 1RABB 4XU0A 5ECAA 3QBYA 3OSVA 2D6FA 1VQ5Q 1WHHA 1VYTA 2YRDA 1NPRA 2GQVA 4L6V5 5FRMA 2COWA 2E3HA 2J7IA 3CCQQ 1M1GA 2RHUA 4M75B 1AOJA 4ZTFA 3CCST 1NG2A 2E3IA 3GF5A 4Y92A 5GAOl 3DB4A 1Q86R 2H3JA 4M7AB 4N4HA 3ASKA 1BKBA 2O01E 5FWBA 3JSCA 5CAIA 1I4K1 3OYAA 2XD0A 2JTEA 2HL5C 5GMKe 1M2OA 1E6HA 3JRZA 2DM1A 3FLGA 5GAMd 1PKTA 2HL3A 1DJ7B 4Z02A 4PJMA 3OYYA 4KUDK 3CMAQ 3OB9A 3ZFJA 5GAMe 2CUDA 3PNWC 1KD1C 3CCMA 3QUIA 1QLYA 3RKWA 3CCJT 4IKFA 4FIBA 5KYNA 1WXTA 4ELYC 1OI1A 3RESA 4KUIA 2JMCA 1EX4A 2VASA 4M7AA 2RI5A 3RDVA 3L2WA 1VQMA 3C94A 6AT1B 2JVVA 1PG5B 4MZTA 4OGCA 1RAFB 3G4ST 1NM7A 4C0DC 5CCAA 3H41A 1M1KU 4FU6A 2DXUA 1IB8A 3DKMA 3I56T 4DBFA 1KIKA 3VUBA 2D9TA 2KGTA 3QJ6A 2QTXA 1Y96B 1VQ7A 4M4ZA 8ATCB 2EYYA 4DEYA 1Z9QA 5HY6A 4FYYB 1K8AU 3HHTB 3HKSA 3L2RA 3NPFA 3MHXA 2QGFB 4DQ2A 3QSUA 3NMZC 2DILA 3LGFA 4JJNK 4A54A 1Y7XA 4LDXA 3VYHB 4JRIA 4CC2A 4J7IA 2DX1A 2F2XA 1K76A 2RJEA 5LJ5d 1WNLA 1M8MA 2JT4A 4PJNA 2C06A 1ZUYA 3CCVA 2PU9B 2CP7A 3PVLA 3JB9F 4OB0B 3OBWA 5FU6B 2RJFA 4M7DF 1QWFA 2J6OA 1D1BA 4AMCA 2DIQA 2RQRA 1D3BB 1AVZC 5LJ3f 1UGVA 2K2MA 1VQ6Q 2G3RA 1K0SA 5LJ3d 1VQNA 3LH0A 1KC8R 5GAOn 3VUZA 3FEOA 3FRNA 1KQSS 4M78C 4PJOA 1JU5C 4RMOA 3GLXA 3A8LB 4JS5A 1QVFA 1PD1A 3LW5E 4HA8A 5LJ5f 1FX7A 1HSQA 1X75C 3ZBDA 3GP8A 4BY6B 1W2BA 4LUDA 1QVGA 4BDYA 3QO3A 2EBPA 5GAN8 3G6EQ 4HCKA 2KK4A 2H3EB 1X6BA 4GLMA 2HQEA 4QVDA 2CKKA 1WHKA 1PNJA 1TXQA 3CBMA 2GF7A 2RJCA 4JUVA 4M75A 3A8GB 1E7OA 3M53A 4R0KA 3G71T 4WF2A 2DO3A 2DXCA 4JPBW 1V76A 2EW3A 3CD6Q 5LJ3g 3RUXA 1VQ5A 2QQSA 3SB2A 2KQWA 5LJ3h 1JJ2A 2X35A 1SHGA 2EJGA 1I07A 1HJDA 5GAOm 4PLLA 2F2VA 1VUBA 2EWNA 2PUKB 2CUBA 2DVEA 4J9BA 3E2UA 2ZCFB 4DEXA 2XI9A 4J9HA 4OF1A 1T0JA 3OYCA 3WVDB 5LJ5g 3OS5A 2SEMA 1R77A 3EG3A 1KQ1A 1Q86U 1NEGA 1CKBA 3ULRB 1TU0B 1VQ8Q 2LNVA 2VC8A 3SDZA 4ZNXA 2VGNA 2FG0A 5HCKA 4XU3A 4PLIA 2QQAA 3PFSA 3QWXX 1MMDA 4O5VA 4JS4A 4HT8A 4HCZA 2RI3A 1X2QA 1RAHB 1QVPA 4RTUA 1M1KR 4M7AE 4JJBA 5I21A 2XMFA 1YIJT 1H641 2CDTA 4OGEA 2YRCA 2NUPB 4PJJA 3VYGA 3HRSA 1M5Q1 4L59A 4DA4A 3JCMP 4JRKA 4L5GA 5LJ5j 4J6XA 1ZSZB 3KFVA 2FPEA 2KR3A 4C8QB 5KH6A 1N8RR 1B07A 4QT7A 5CKDA 2YUNA 4E47A 5LJ5h 1PCXA 4CC4B 2RK2A 2LQWA 1NE8A 1P92A 2HKNA 3CCEA 1H3ZA 1KD1U 3M59A 3UA6A 3C95A 4ORZA 2ECZA 5J3BA 3OYEA 4LE9A 5LJ5e 4QQGA 4WCIA 2NUTB 2FHDA 2OTJQ 1T3LA 4ESRA 3M0PA 3OYDA 4M77A 1QP3A 4V2SA 1QKXA 4CI0C 1Q82C 4JLGA 1LNXA 1WXBA 3JAME 3MKDA 3JB9I 4EMKC 2HMAA 2PVGB 1ACMB 3OBYA 1UTIA 1B34B 1XQHA 2NUPA 3CEYA 1M8VA 4PFOA 5CQYA 4X9CA 4PJOB 4OB1B 4F7UG 4RCBA 1S72A 4BI4A 4MDWA 1I5OB 2A28A 2GCXA 4AT1B 1EIFA 3S3OA 4IURA 1VQKT 2AHJB 3CCET 1KSWA 5A2QE 4J9IA 5CKHA 2JM9A 2H8HA 1QKWA 1ZBXA 2X4XA 3QG1A 2HD0A 1K73C 2LDMA 5CKEA 1CSKA 3O5ZA 2LQNA 3DB3A 2QASA 5CKFA 4M75G 5GAMh 3CCLT 4KBMB 2E5KA 1N5ZA 2CP3A 1UJYA 5KYUA 4M7AF 3ME9A 2CP5A 4C8QC 3I5RA 2J6KA 3RR6A 5D6YA 1QCOA 5FWCA 2CYZB 2D8JA 1N6AA 2KROA 2QGGA 1X69A 1TTHB 1N8RC 3CCRA 3CCUA 2O4XA 4DBQA 2L0AA 4BDZA 2VGMA 5GANj 4X1VA 4EMGA 2JXBA 3VV0A 2RHXA 5FU7C 1MUZA 2DZCA 5DY9A 4NL2A 3EAEA 4XTUA 1GBQA 1Y57A 3EH2A 1X43A 2DJZA 4FSXA 1BI1A 4AG2C 1WX6A 5D7UA 2DL3A 3RBBB 1VQ6T 2JM8A 3G1JA 2FYKA 2HQXA 1MV3A 1V29B 4E7SA 1ARKA 4M7AC 4LXCA 2CH4W 4FYVB 4EDUA 3OS0A 4XTZA 1OPKA 3V7RA 2BKDN 2CT3A 1M2VA 1IHVA 5CQXA 3CBOA 4KH1B 1SSHA 5IXFA 4XQ3A 4Z8AA 3EG1A 1UFFA 1WQ7A 2BTTA 2RA2A 3M5AA 3FJ5A 3OYNA 4XTYA 3CPWS 1JBMA 2LCCA 4M7AG 1AZGB 2ZPBB 1B3QA 2XG8D 1SG5A 4LNPA 1C1AA 1UGRB 2E12A 1WHGA 3JB9H 5I11A 2J05A 2D1XA 5GAMg 2EKOA 3JCMh 5KYYA 5HKCA 4N4GA 2F5TX 3I56A 4BD3A 3QZ5B 1WFWA 5CKBA 5J39A 1VOMA 3E9GA 2DTIA 2I0NA 4M78G 1R0CB 2EIFA 1TUCA 1YCYA 2HZYA 2JNGA 4J9GA 3P8BB 4FYWB 4M77E 3OYIA 5IN1A 3S3MA 2NYSA 2F1LA 2BZ8A 3L42A 4C92F 3QJYA 1WQWA 2LJ1A 4LDYA 4M77F 4II1A 4ZGEB 3RIRA 2QI2A 1SHFA 1X6OA 4XU1A 2O2OA 4M78F 3VJPA 4M77C 3V8KA 4BI8B 2FPDA 4M7DD 3M0UA 4R55A 3I55Q 2GTJA 1VQOA 2Y4XA 4M7DE 2YLBA 2XIDA 5J26A 5GAN3 3EG9A 1YIJQ 1Q81C 4OP0A 3M9QA 1O75A 4C8QD 5AYFA 3CCQA 1PWTA 3G4SA 4F14A 1H3HA 3LWIA 1YWPA 2EGEA 4C92C 2YXYA 1AWWA 4M75D 4KT0E 1M9SA 1ZSGA 1UECA 2KBTA 5LJ3j 4XTXA 2VB6A 3GPLA 3OY9A 1YNZA 3MP8A 3CCQT 1TWBA 2GFAA 1N9SA 1BI3A 1U1SA 5CR2A 2QQRA 5GMKi 1NJIU 1KQSP 1VQ5T 1B7TA 5GANe 1VQ4A 4B9XA 2ZPEB 2LJ3A 1U5SA 1IHWA 1MGQA 4OB3B 1RI0A 3CD6T 3BDUA 1OEBA 3X28B 2D0NA 4AFZC 4HVWA 2MMPA 4D8DA 3P8DA 4AFSC 2ZPHB 2Z0WA 3S3NA 1JB0E 3CCVT 1GCQC 2K5LA 3SD4A 2OTLQ 1VYUA 2O9SA 5L23A 1ZA2B 1SF9A 2CP2A 2ZPIB 1M27C 2R5AA 1AD5A 5KYWA 1BB9A 3O8VA 2D0QB 1K73R 2G6FX 3REAB 1GXIE 2OAWA 3OMCA 4OMFB 9ATCB 1K0XA 2FZCB 2V26A 4RUGA 2LP5A 5KYXB 1KG1A 4Y91A 1KQ2A 3GNGA 2CZ6B 2EGCA 2KNBB 3CQTA 4PJOF 2O9VA 2CP6A 4ELZC 2EQMA 2KVQG 2O31A 3BDLA 3RNJA 4HCBA 2KRSA 3UF4A 3FDRA 4C92D 3LX7A 3M0TA 3DLMA 1S72Q 5CK9A 3OW2A 3C0CA 3HTRA 4DBHA 4EMKB 1WXUA 2VXFA 2JUFA 2V8KA 2W10A 1JEGA 3LH5A 2RH2A 4PJOC 3G7ZA 2HQHA 1RUWA 1NLPC 5GAN7 1JJ2S 3CC7T 1VQPT 7AT1B 2B8AA 2X4YA 2K3YA 4C5EA 2JW4A 1E6GA 4JZ3A 2V8JA 2CSIA 3VS7A 5KYUB 4HXJA 4M75C 3VS4A 1NLOC 1JJ2P 2KT1A 3CPFA 4OB2B 3UATA 3M0RA 2NLUA 1RAGB 1PKSA 5GAOq 4N0AC 2KE9A 1GL5A 2FPFA 1WDXA 3KXTA 4J9CA 4K11A 1UEBA 1G83A 1ZLMA 3HRTA 1MNEA 2DD4A 4LD9K 3EGDB 2L89A 2RPNA 3VRZA 3F70A 3A8HB 2QA4T 1T0HA 2A3LA 2RB6A 4DBRA 4HVUA 3PTAA 2FZGB 3G71A 1H92A 2MF2A 2FEIA 2O88A 1I8FA 2CSQA 2KEAA 1T3SA 3EH1A 4CC7A 1YBYA 2DERA 3M57A 1QP2A 3QIIA 3FC3A 2IPOB 3VS3A 1VQPA 1TUGB 3EFSA 2DL7A 2LT4A 2CT4A 2PUOB 5FW9A 4C5IA 2OTLA 3GOXA 2YUPA 3MP6A 2M9UA 2JTMA 1X01A 1TH7A 4QW2A 1RADB 4IUUA 3TREA 1R8OB 3VS2A 4BY6C 4C0ZA 3JCMc 2DLPA 2OI3A 3VS0A 1Q7YC 1M30A 4LD6A 1QVFS 2ROLA 2EYWA 3VRYA 3PMTA 2IVWA 1UB4A 5GJVB 3BE3A 4C0DB 2ATCB 1YITA 1VQ9A 4MZPA 1KHIA 1M3BA 4JLIA 2BE9B 2CP0A 2QDLA 1K4US 4E7JA 2BZXA 3CMAT 1KD1R 3OYKA 2E70A 2OTLT 4TVRA 1NYFA 2F69A 4IUVA 1YJWA 3DLLA 1UE9A 2GTOA 2VKNA 3L2UA 3EHQA 4LDUA 2JMAA 4BB7A 1W1FA 2DE0X 2QEXA 4QQ6A 2LQ8A 2MOXA 2J06A 2P0KA 3MP1A 3JB9J 1FMKA 1QCFA 1C6VX 4A63B 2VWFA 3G6ET 4IIMA 1WZOA 4RTXA 3CMEQ 3GBQA 2RQTA 2ABLA 5IHNA 2EQIA 2LX7A 4AFQC 4C0GA 1GCPA 1K73U 3M0SA 2QK0A 4FSSA 3M4YA 1O9SA 2BZYA 5KCOA 1OPLA 1WYXA 4M77G 2L3QA 4PFPA 1BYMA 3CC2A 2KRNA 3CCLQ 5FU7B 2QEXQ 2MWOA 3J80E 4BUGA 2CS7A 1WI7A 3JV3A 1HD3A 4P5NA 4MZMA 1YJWT 4PNOA 3I5SA 3I55T 3EHRA 2RI2A 5GJWB 4ZN3A 2C0TA 1WJSA 3VS6A 4B9WA 1W6XA 4Y28E 2DMOA 3HFNA 3EG2A 3PE0A 1WJRA 3SWNC 4FL6A 1Q7YR 3OW2P 4M75E 2AZVA 3JCMJ 1K9MC 1M90R 4C92B 2LCLA 2YT6A 4C92G 4ZGDB 2M51A 1OU8A 1NJIR 1IRXA 5KE2A 4F04B 4IUTA 1OV3A 3QYGB 4M7DC 3RERA 2VYTA 5CIUA 3X26B 2E65A 2DXBA 3G4SQ 1NPPA 4XTVA 3M55A 3M4GA 4XK8E 1BK2A 2YLCA 2MYSA 1YP5A 2E6NA 2EAYA 4PK4A 3OYFA 1AEYA 2YWWA 1VQ8A 2QTVA 1YJ9T 5L8RE 2CZ7B 2DA9A 5IHKA 2XK0A 1TSFA 3VS5A 3QYHB 2RQVA 2ENMA 1M1KC 1LJOA 3HRUA 3M58A 1VQ9T 2MK5A 3JCMe 5A0LA 5HK3A 3NTIA 3VKIA 2DL8A 2XDPA 3QHSA 3JCMV 2DL4A 2QYZA 2KYBA 1AWOA 3EFOB 2M0OA 2RJDA 1RLPC 2IG0A 4N4IA 5M9OA 5GAMj 4N0AA 4BE2A 1BI2A 1D0XA 2YHTA 2KMTA 1QW1A 1M3CA 3FB9A 3CCSA 1YI2A 1U3OA 2XDDA 1FMVA 1XNIA 3OYJA 1YJ9A 1J3TA 1C0MA 2DTHA 3NTKA 3OMGA 4C92A 3CXCA 2KSSA 3MEWA 3QDRB 1SKUB 1WPYA 3JCMW 5IH2A 4M7AD 5KYYB 3C12A 2GQIA 1RACB 2EQUA 1D0ZA 3CCUQ 1EFNA 5FU6C 4M78B 2MCNA 2OAUA 2DJQA 2JS2A 1CKAA 4D6WA 1R0BG 1XJWB 5I2SA 5D6XA 2PZ1A 1K9AA 3SEMA 1RI9A 2XICA 3ER0A 3CCJA 2FB7A 2DETA 5HK0A 2P4RA 2Y4YA 1FWZA 2E10A 3MJXA 4IUPA 1Q81R 3JCMf 3G71Q 1FYNA 1G8XA 4FT4A 2CZ1B 1WHJA 4M7DB 1I1JA 4KULA 3NFCA 4A53A 3H6ZA 2QG9B 3QKJA 4RCCA 5GANd 1VQ9Q 2LRQA 1VQNQ 4RG8A 1YITQ 2MWPA 1OU9A 1YFNA 4PJOD 3CMEA 4XAXB 2JOYA 4A4GA 1KJWA 1YJ9Q 3A1PA 2HBWA 2HAXA 2AKLA 2E4HA 3LYIA 2DIGA 3BY7A 5GANf 1YHQQ 4DOWA 1K9MU 3CC2Q 2DPPB 3HP9A 1Q95G 4D8KA 2KI7A 2K5IA 1YN8A 1D09B 2E5QA 4OVAA 2A36A 3CD6A 1X27A 1M1FA 1NYGA 2KRMA 4BE0A 5KCHA 3JCMd 1Q86C 3UT1A 4C8QF 2EGAA 3MCAB 2V1RA 2JS0A 4LN2A 2RN8A 5C0MA 1ZUKA 1ZUUA 3H0FA 3LLRA 2OTJT 2FL7A 3EFRA 1VIFA 3S6WA 2PQWA 1AWJA
chains in the Genus database with same CATH topology
1VQ8T 2RJCA 3BDLA 4NOYA 4HCBA 4JUVA 1WGSA 3RMSA 3VU3C 4M75A 2EYQA 3FDRA 3A8GB 4XU2A 2DZ9A 3P8HA 4C92D 1HXDA 3M53A 1NJIC 3LX7A 4KUDK 1KC8C 3DLMA 4X34A 4YTLA 2DD5A 3G71T 2ZPGB 2P4TA 4WF2A 5CK9A 2DO3A 2DXCA 5GAN6 3E1SA 3OYLA 3OW2A 2L5QA 2E6ZA 2JZ2A 2KAFA 5LJ3g 4EMKB 3RUXA 1VQ5A 4GLKA 2QQSA 2VXFA 2KQWA 3SB2A 2LTOA 4LDWA 3JCMQ 5LJ3h 1JJ2A 2X35A 3TU4K 2EJGA 2JUFA 1YJNT 3QPHA 3UPUA 2V8KA 3RKXA 1N8RU 5GAOm 4PLLA 2RH2A 4C8QE 1Q7YU 1VUBA 2EWNA 3G7ZA 4PJOC 5GAN7 3V7CA 3WXMB 1K8AC 1JJ2S 2PUKB 2EQJA 1VQNT 2LC4A 3CC7T 2DVEA 1VQPT 2B8AA 2X4YA 2K3YA 4C5EA 2ZCFB 2XI9A 4GY5A 4OF1A 2V8JA 3L2ZA 5GAN5 1MHNA 3OYCA 4M75C 1KC8U 4M78E 3WVDB 5LJ5g 3CPFA 2BIVA 2GFUA 4OB2B 3OS5A 3CMAA 2NLUA 4E7IA 4E7HA 5GAOq 3H8ZA 4N0AC 4C8QA 1KQ1A 1Q86U 3BFMA 2ZGWA 4VUBA 3KXTA 2EQKA 4QVZA 3CXCS 1YJNA 1NZ9A 2LNVA 2RD1A 2VC8A 3RMQA 3SDZA 2LT1A 1UEBA 2VGNA 4XU3A 4PLIA 1G3SA 3KUFA 4PJOG 1BIAA 3INZA 2QQAA 3HRTA 3PFSA 4MMKA 1PSEA 2DD4A 1G3TA 4LD9K 2ZPFB 4BI3A 1U8RA 2L89A 3F70A 3A8HB 4O5VA 2V8IA 2QA4T 2A3LA 4HCZA 4JS4A 2R5MA 2RB6A 2RI3A 5DLOA 3PTAA 1QVPA 3G71A 3HSBA 2MF2A 4DOVA 4M7AE 5I21A 1I8FA 1YIJT 4Q5WA 1H641 4OGEA 1YBYA 3VYGA 2WSFE 2EJFA 3HRSA 1M5Q1 3M57A 1AHJB 1QP2A 3QIIA 4L59A 2WSEE 4A4KA 3FC3A 4JRKA 4DA4A 3JCMP 4NL3A 4L5GA 5LJ5j 1VQPA 3PIOA 4J6XA 1M90C 4PKCC 3EFSA 3L1AA 3E9FA 2LT4A 4C8QB 3HFOA 5KH6A 4C8QG 1KQSA 5IT9E 5CKDA 4E47A 2PUOB 4M78D 4C5IA 2OTLA 3M56A 5LJ5h 4J8OA 5FLXE 3GOXA 2RK2A 2FVUA 2EQMA 3MP6A 1NE8A 2M9UA 2DTOA 3OYMA 2JTMA 1G3YA 1P92A 1X01A 3CCEA 1TH7A 1KD1U 1H3ZA 3M59A 2F5KA 3C95A 4IUQA 4QW2A 5J3BA 3OYEA 4IUUA 3TREA 1R8OB 1BI0A 5LJ5e 4QQGA 4BY6C 4C0ZA 4J6YA 5GMKh 4MDXA 5KE3A 3JCMc 4J6WA 3JB9D 2FHDA 1VQ6A 4EMKA 1Q7YC 1I81A 3OYDA 2DXTA 2HNIA 1UGQB 4RKUE 4RG2A 3OYHA 4M77A 1QP3A 4LD6A 1QVFS 4V2SA 3GIBA 1M90U 4CI0C 3PMTA 2IVWA 1UB4A 1Q82C 4JLGA 4C0DB 4PJOE 2HBPA 3HPWA 4BACA 1LNXA 1YITA 5CO7A 1VQ9A 4MZPA 1KHIA 2R57A 3J81E 2QXFA 2DEQA 4JLIA 3JAME 3CCUT 4M75F 3PT9A 1M4ZA 2A7YA 3A5ZB 2DKGA 2LVMA 2QQ9A 1KHCA 1ZHIA 3JB9I 3CCMT 4E7JA 3CMAT 2EJ9A 3OYKA 2E70A 2OTLT 1RL2A 4TVRA 4EMHA 4EMKC 3HL8A 2F69A 4IUVA 1YJWA 3DLLA 2PVGB 3OBYA 3L2UA 1B34B 5IAYA 1XQHA 1OZ2A 2RM4A 3CEYA 4JDSA 4LDUA 4BB7A 3OYGA 4JRPA 5CQYA 2QEXA 1M8VA 3AHUA 4QQ6A 4X9CA 3OW2S 4PJOB 1IZ6A 2LQ8A 4OB1B 5D6WA 1FXXA 5GAN2 5C6SA 3URGA 4F7UG 4F7UA 4RCBA 3CCRT 3KBGA 4C5GA 2P0KA 3MP1A 3JB9J 1S72A 4HT8A 4BI4A 2QA4A 4MDWA 4NS5A 1IREB 3G6ET 4LDVA 2GCXA 3CBPA 3ZEHA 2VV5A 1N9RA 1EIFA 3S3OA 4IURA 1VQKT 2OTJA 5I2MA 3JCMX 2AHJB 3CCET 4JRQA 5A2QE 4A4FA 2YRVA 4EPCA 2E1HA 2L8DA 2RK1A 2Y90A 1WJQA 1Y96A 2VXEA 3QZ9B 2X4XA 1ZBXA 5CKHA 4ZTJA 2PVDB 1OYXA 4J5YA 3QG1A 4M78A 5GMKj 3CC2T 2HD0A 1K73C 3PGGA 4C0GA 2M1HA 5FRNA 2LDMA 5CKEA 1ZQ1A 1K73U 4F7UB 2XHCA 2EFIA 3C4SA 5GANg 3DB3A 4M7DA 5CKFA 1VIEA 3G6EA 3M4YA 1O9SA 3RKYA 3TEEA 5KCOA 4M77G 1U1TA 4M75G 1VQMT 1BYMA 5GAMh 3CCLT 4KBMB 3CC2A 5FU7B 2M16A 1YHQA 4C92E 2MWOA 4M7AF 3ME9A 4C8QC 3OA6A 3J80E 4BUGA 2K4YA 2BUDA 2CS7A 2RHYA 2XKOC 4BE2A 4HT9A 5D6YA 2CYZB 1N6AA 4P5NA 1YIJA 1YITT 4CRIA 1Q81U 4QQDA 1G3WA 4MZMA 3J7AF 1YJWT 4PNOA 1N8RC 1UGPB 3E19A 4F7UE 3CCRA 3CCUA 2O4XA 4R56A 3SWNA 2CZ0B 1VQOT 1S72T 3I55T 4BDZA 2RI2A 2DK3A 2VGMA 4EMGA 4ZN3A 5GANj 3VV0A 2RHXA 5FU7C 4FT2A 4QVCA 2DZCA 3Q1JA 5DY9A 4F7UF 4NL2A 1YHQT 1BIBA 3EAEA 1N27A 1WJSA 4XTUA 3UWNA 5GMKm 4B9WA 3LWHA 4A4EA 1VQ4T 4Y28E 4XTWA 2DJZA 2VUBA 4FSXA 3HFNA 2K2VA 1BI1A 2WACA 2K57A 1XTDA 3OS2A 5LL6S 1WJRA 3A8OB 3NTHA 3SWNC 1VQ6T 4FM4B 3WVEB 3X25B 3L2QA 3JCMg 2I2LA 2CGHA 2FYKA 2MAMA 3M54A 4FL6A 2HQXA 4M77D 1SSFA 1V29B 3BW1A 4XU0A 4M7AC 2E41A 3QBYA 5GMKl 3OSVA 2D6FA 4M75E 3JCMJ 1K9MC 4EDUA 3OS0A 3CCLA 4C92B 4XTZA 2LCLA 4C92G 3MEAA 1OZ3A 3V7RA 2BKDN 1NPRA 2GQVA 4ZGDB 5CQXA 4L6V5 3SFMA 5KE2A 3CBOA 5DM7R 4E7KA 5FRMA 4ATOA 4XQ3A 1M1GA 2RHUA 4M75B 4ZTFA 3CCST 4IUTA 3FIFA 3QYGB 1WQ7A 3GF5A 2RA2A 4M7DC 5GAOl 3M5AA 3DB4A 3RERA 2VYTA 5CIUA 4XTYA 3X26B 1JBMA 2LCCA 3OYNA 2H3JA 2E65A 2DXBA 4N4HA 4M7AB 1NPPA 4XTVA 4M7AG 2ZPBB 3ASKA 3M55A 3I55A 1BKBA 3M4GA 3QXEB 2XG8D 4XK8E 2O01E 3PMIA 2ZZDA 3JSCA 5CAIA 1I4K1 1UGRB 2YLCA 3OYAA 2QEXT 4PL6A 2XD0A 2E12A 2E6NA 2E64A 2EAYA 2PVOB 5GMKe 3OYFA 1W2BS 3JB9H 2K5FA 3L2VA 1XOVA 5GAMg 1VQ8A 1YJ9T 5L8RE 2EKOA 3JCMh 3N5BB 2CZ7B 3JRZA 3V8LA 2XK0A 1VQ7T 4HCCA 3FLGA 2QDYB 3FJPA 5GAMd 2RHIA 4M7DG 5HKCA 3QYHB 4N4GA 5GANh 1DJ7B 4Z02A 1M1KC 3OYYA 1LJOA 3HRUA 2F5TX 3M58A 3I56A 1B34A 3OB9A 1VQ9T 3ZFJA 4BD3A 5GAMe 3JCMe 3QZ5B 2L3RA 1Y07A 3PNWC 4UC4A 5CKBA 2R58A 5J39A 1QVGS 5A0LA 5HK3A 5GAN4 1KD1C 3NTIA 3VKIA 2XDPA 4M77B 1Y71A 2DTIA 3E9GA 3QHSA 2LX9A 3QUIA 3CCMA 1YI2T 4M78G 3RKWA 3CCJT 4IKFA 2EIFA 3CMET 4MMLA 4FIBA 3JCMV 1YCYA 5LJ3e 2JNGA 4ELYC 1OI1A 3P8BB 4J7FA 4A4HA 5DLQE 2M0OA 3PIPA 2RJDA 2IG0A 5GAOp 3RESA 2XU8A 4M77E 4N4IA 4KUIA 4N0AA 1BI2A 5GAMf 5IN1A 5M9OA 5GAMj 3OYIA 3S3MA 2YHTA 4M7AA 2RI5A 3L42A 2KMTA 1QW1A 4C92F 3L2WA 3FB9A 3CCSA 1YI2A 1VQMA 3C94A 3QJYA 2JVVA 3A8MB 1WQWA 5FROA 5A0GA 4LDYA 4M77F 2KDSA 4II1A 2XDDA 4MZTA 1XNIA 4OGCA 3T9NA 3UDCA 3OYJA 4ZGEB 3RIRA 3X20B 2QI2A 3G4ST 1YJ9A 4E7LA 1X6OA 4C0DC 2DTHA 3NTKA 4XU1A 2WSCE 5CCAA 3OMGA 4FU6A 4M78F 1M1KU 3VJPA 4M77C 3MO8A 4C92A 3V8KA 4BI8B 3CXCA 2DXUA 1W4SA 3TCJA 2KSSA 4M7DD 3DKMA 3I56T 3MEWA 3QDRB 3V7SA 3LGLA 1WPYA 3JCMW 4R55A 3CC4T 4M7AD 3VUBA 3C12A 1VQOA 2D9TA 2LQKA 2Y4XA 3QJ6A 2YLBA 2JN0A 2EQUA 2QTXA 2XIDA 5J26A 1Y96B 4M7DE 1VQ7A 3R6OA 5FU6C 4M78B 5GAN3 1JRIA 2JTFA 2OAUA 4ZGJB 1Q81C 3X24B 4OP0A 3JB9G 3M9QA 1O75A 4C8QD 4D6WA 5AYFA 3CCQA 1VQLA 3G4SA 3JCMb 3LWIA 5HY6A 5I2SA 1I5LA 2KY9A 5D6XA 1D3BA 1K8AU 3HHTB 3HKSA 3L2RA 2XICA 3ER0A 3MHXA 2FB7A 2RO0A 4DQ2A 5HK0A 3CCJA 2Y4YA 4X9DA 1FWZA 2E10A 4C92C 3QSUA 4IUPA 4M75D 4KT0E 1M9SA 4O6JA 3JCMf 3LGFA 4JJNK 4A54A 1G5VA 1Y7XA 4LDXA 4FT4A 2CZ1B 3VYHB 1HK9A 4JRIA 4M7DB 4J7IA 2O4XB 5LJ3j 4XTXA 3GPLA 3OY9A 4KULA 5EG2A 3MP8A 3SWNB 3CCQT 2RJEA 5LJ5d 3NFCA 2GFAA 1N9SA 1BI3A 1U1SA 1WNLA 4A53A 3H6ZA 5CR2A 2QQRA 3QKJA 4RCCA 5GMKi 1PSFA 2C06A 5GANd 3MEVA 3CCVA 2PU9B 2LRQA 1NJIU 4RG8A 3JB9F 4OB0B 4HKEA 2MWPA 4C5HA 1VQ5T 3OBWA 4PJOD 2PQWA 3MEUA 5FU6B 3CMEA 4XAXB 4BE1A 2RJFA 5GANe 4M7DF 2JOYA 4A4GA 2DIQA 1VQ4A 1D3BB 1VQLT 4B9XA 2HAXA 5LJ3f 2ZPEB 2G3RA 5LJ3d 3CPWS 3LYIA 2P0QA 1VQNA 1MGQA 1LOJA 3LH0A 4OB3B 1RI0A 3CD6T 2MI6A 5GAOr 3BDUA 3X28B 5GAOn 3OYBA 2QQBA 3VUZA 3CC4A 2MMPA 3FEOA 3FRNA 1KQSS 3P8DA 2X4JA 2ZPHB 4ME7A 2DIGA 2K3XA 3S3NA 4M78C 3BY7A 1JB0E 3CCVT 5GANf 4PJOA 1UGSB 2K5LA 3SD4A 4RMOA 3GLXA 3A8LB 4C0FA 4DOWA 4JS5A 1QVFA 1K9MU 3LW5E 4HA8A 5LJ5f 1FX7A 3V8JA 2XDBA 2DPPB 3HP9A 1X75C 3OS1A 2K5IA 3ZBDA 3GP8A 2E5QA 4ZN1A 2RHZA 4BY6B 4OVAA 1W2BA 2ZPIB 1QVGA 3OSSC 4BDYA 3CD6A 2R5AA 3QO3A 1M1FA 3CC7A 4BE0A 1Q86C 5KCHA 3JCMd 5GAN8 3UT1A 4C8QF 1Q82U 3MCAB 3O8VA 2D0QB 3OQ5A 2KK4A 1GXIE 2DAQA 3OMCA 3META 3CPWA 4OMFB 5C0MA 2HQEA 1KG1A 4Y91A 3LLRA 5A0DA 1VQKA 4QVDA 1KQ2A 3GNFB 3GNGA 2CZ6B 2CKKA 4J83A 2OTJT 2FL7A 3EFRA 4PJOF 1VIFA 2X4WA 5CVIA 3CBMA 4ELZC 2P0PA 3S6WA 2GF7A 2KVQG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GIB A;  4XTW A;  4M7D E;  2DJZ A;  2YLB A;  2JN0 A;  2QTX A;  3HFN A;  4JUV A;  4NOY A;  1Y96 B;  3VU3 C;  4M75 A;  4PJO E;  2K57 A;  1LNX A;  4XU2 A;  4M78 B;  2DZ9 A;  4C92 D;  5GAN 3;  1JRI A;  1HXD A;  3JB9 G;  4OP0 A;  3SWN C;  2DEQ A;  4C8Q D;  4JLI A;  4M75 F;  3JCM g;  2I2L A;  2CGH A;  2FYK A;  4M77 D;  3JCM b;  2DKG A;  4WF2 A;  5GAN 6;  3JB9 I;  3BW1 A;  4XU0 A;  1I5L A;  2E41 A;  4M7A C;  1D3B A;  5GMK l;  2EJ9 A;  4M75 E;  3JCM J;  5LJ3 g;  2FB7 A;  4XTZ A;  3RUX A;  4C92 B;  4C92 G;  4DQ2 A;  4X9D A;  4EMH A;  2E10 A;  2VXF A;  3SB2 A;  3V7R A;  4C92 C;  4M75 D;  4EMK C;  3JCM Q;  3QSU A;  5LJ3 h;  3JCM f;  4A54 A;  1B34 B;  2EJG A;  2RM4 A;  1M8V A;  4XQ3 A;  3RKX A;  5GAO m;  1HK9 A;  3AHU A;  4JRI A;  4M75 B;  4C8Q E;  4M7D B;  4PJO C;  2EWN A;  4X9C A;  3FIF A;  4XTX A;  5LJ3 j;  1WQ7 A;  5GAN 7;  3V7C A;  5GAN 2;  2RA2 A;  4M7D C;  4PJO B;  5GAO l;  4F7U A;  4F7U G;  2DVE A;  4RCB A;  3SWN B;  3RER A;  5LJ5 d;  4XTY A;  3JB9 J;  1JBM A;  1N9S A;  2E65 A;  4M7A B;  1U1S A;  4EMK B;  1WNL A;  4XTV A;  3L2Z A;  4A53 A;  5GAN 5;  4M7A G;  4M75 C;  4M78 E;  3M4G A;  4RCC A;  5GMK i;  5LJ5 g;  5CAI A;  5GAN d;  1I4K 1;  2YLC A;  5GAO q;  4N0A C;  4C8Q A;  1KQ1 A;  1N9R A;  2E64 A;  2EAY A;  2ZGW A;  3BFM A;  3JB9 F;  5GMK e;  4PJO D;  3JCM X;  3JB9 H;  5GAN e;  4M7D F;  5GAM g;  2E1H A;  2Y90 A;  2VXE A;  1Y96 A;  2RD1 A;  2VC8 A;  1D3B B;  5LJ3 f;  3JCM h;  3V8L A;  4J5Y A;  4M78 A;  5GMK j;  5GAM d;  4M7D G;  3FJP A;  5LJ3 d;  3PGG A;  4XU3 A;  4PJO G;  5GAN h;  1MGQ A;  1LOJ A;  1BIA A;  3INZ A;  4MMK A;  4F7U B;  5GAO r;  1LJO A;  3BDU A;  1B34 A;  5GAO n;  5GAM e;  3JCM e;  5GAN g;  4HT8 A;  3HSB A;  2RB6 A;  4M7D A;  5GAN 4;  4M7A D;  3RKY A;  4M78 C;  3BY7 A;  5GAN f;  4PJO A;  4M7A E;  4M77 B;  2DTI A;  1U1T A;  3QHS A;  3QUI A;  4M75 G;  4M77 G;  1I8F A;  4M78 G;  5I21 A;  1H64 1;  3RKW A;  5GAM h;  4MML A;  3JCM V;  3V7S A;  1YCY A;  2EJF A;  1M5Q 1;  5LJ3 e;  4HA8 A;  5LJ5 f;  3JCM P;  4JRK A;  4C92 E;  3V8J A;  4NL3 A;  5LJ5 j;  4J6X A;  4M7A F;  4C8Q C;  5GAO p;  3EFS A;  3L1A A;  3RES A;  4M77 E;  5GAM j;  4HT9 A;  4N0A A;  4C8Q B;  3HFO A;  5GAM f;  4C8Q G;  2YHT A;  4M7A A;  4M78 D;  4C92 F;  3FB9 A;  3QO3 A;  5LJ5 h;  3JCM d;  5GAN 8;  4C8Q F;  4PNO A;  2DTO A;  1WQW A;  4F7U E;  4M77 F;  1X01 A;  1TH7 A;  3SWN A;  3RIR A;  5GAN j;  4EMG A;  5LJ5 e;  4J6Y A;  5GMK h;  4QVC A;  2DTH A;  4XU1 A;  2DZC A;  5DY9 A;  3JCM c;  4J6W A;  4M78 F;  4NL2 A;  4Y91 A;  4F7U F;  4QVD A;  3JB9 D;  1KQ2 A;  1BIB A;  4M77 C;  3EFR A;  4C92 A;  4PJO F;  4EMK A;  1I81 A;  4XTU A;  3V8K A;  2DXU A;  5GMK m;  4M7D D;  2DXT A;  2HNI A;  1WPY A;  3JCM W;  4M77 A;  4V2S A; 
#chains in the Genus database with same CATH topology
 4NOY A;  1WGS A;  3VU3 C;  2EYQ A;  2LCS A;  2DZ9 A;  2LMJ A;  3P8H A;  1HXD A;  4JJC A;  1WIE A;  1KC8 C;  3SHW A;  1PM3 A;  2ED0 A;  4YTL A;  4E7Z A;  3E1S A;  3OYL A;  2DNU A;  2GNC A;  1YJW Q;  3CC7 Q;  2L5Q A;  2E6Z A;  1ZX6 A;  4GLK A;  4LDW A;  3TU4 K;  1JXO A;  1YJN T;  3QPH A;  3UPU A;  1N8R U;  4OMN A;  2K6D A;  3H0H A;  4C8Q E;  3V7C A;  2EVR A;  1K8A C;  2EQJ A;  2LC4 A;  2KT8 A;  1QQJ A;  3I56 Q;  2GFU A;  2X9H A;  1SRL A;  4JJD A;  4E7I A;  3H8Z A;  4C8Q A;  3QDF A;  3BFM A;  4VUB A;  2OX7 A;  4QVZ A;  3CXC S;  2PTK A;  4QKU A;  1NZ9 A;  3RMQ A;  2LT1 A;  1G2B A;  2M0Y A;  2DF6 A;  3KUF A;  1BIA A;  2A0F B;  2ZPF B;  1U8R A;  1MMA A;  2R5M A;  5I22 A;  5DLO A;  1SEM A;  1ABQ A;  1OX9 A;  1BCO A;  2HEQ A;  4Q5W A;  2EYZ A;  3CCJ Q;  3V7S A;  1AHJ B;  1ABO A;  2WSE E;  1M90 C;  2AKK A;  1BBZ A;  4C8Q G;  5IT9 E;  3D7S B;  2FVU A;  1I0C A;  3OYM A;  4IUQ A;  2L3P A;  5GMK h;  1Y0M A;  4J6W A;  1KK7 A;  3JB9 D;  4JZ4 A;  2M02 A;  4EMK A;  5AT1 B;  2RQU A;  2DL5 A;  1UGQ B;  4PJL A;  4RG2 A;  3OYH A;  2RMO A;  1PRM C;  1M90 U;  4BAC A;  2AT1 B;  1BU1 A;  3UA7 A;  3J81 E;  2R57 A;  3CCS Q;  8AT1 B;  2DEQ A;  3CCU T;  4M75 F;  2B86 A;  3PT9 A;  4AFU C;  1W2B P;  1M4Z A;  3A5Z B;  2LVM A;  1K8A R;  2EJ9 A;  1RL2 A;  1UG1 A;  2KYM A;  3HL8 A;  3CPW P;  3EGU A;  2DBK A;  5IAY A;  3VS1 A;  3AHU A;  3CXC P;  3OW2 S;  1GBR A;  1IZ6 A;  5GAN 2;  3URG A;  4F7U A;  2IIM A;  5KYW B;  4C5G A;  4NS5 A;  2LZ6 B;  1IRE B;  4LDV A;  1IGU A;  3CBP A;  4OMP A;  1N9R A;  1UDL A;  1LPL A;  5I2M A;  4JRQ A;  4A4F A;  2YRV A;  4EPC A;  2E1H A;  2L8D A;  2Y90 A;  2VXE A;  1Y96 A;  2X3X D;  4ZTJ A;  2PVD B;  4J5Y A;  5FRN A;  2M1H A;  4F7U B;  1PHT A;  2EFI A;  4OML A;  3C4S A;  5GAN g;  3EGX B;  3G6E A;  3TEE A;  1VQP Q;  1U1T A;  2ROT A;  1VQM T;  1OOT A;  1SRM A;  4FCY A;  2M16 A;  1YHQ A;  2FO0 A;  1IXD A;  4OMQ A;  4E2F B;  2K4Y A;  2BUD A;  2XKO C;  3AT1 B;  2DVJ A;  1X6G A;  1YIJ A;  1TG0 A;  3J7A F;  1U06 A;  1PRL C;  4R56 A;  1VQO T;  1S72 T;  2ED1 A;  1VYV A;  4RTW A;  4EIK A;  1MV0 B;  4F7U F;  1YHQ T;  1BIB A;  1GFD A;  1WHL A;  5GMK m;  2V1Q A;  2W0Z A;  2C0I A;  2L2P A;  4PFZ A;  1OX8 A;  1BCM A;  1XTD A;  2K57 A;  5LL6 S;  1RAA B;  3A8O B;  1VQM Q;  3R6N A;  2NWM A;  3X25 B;  2I2L A;  2CGH A;  3M54 A;  2MIO A;  3BW1 A;  2E41 A;  2CRE A;  5GMK l;  1MMG A;  1YCS B;  3CCL A;  3MEA A;  1OZ3 A;  2KXD A;  1VA7 A;  2HSP A;  3SFM A;  4E7K A;  5DM7 R;  4ATO A;  1YWO A;  3FIF A;  1Q82 R;  3I55 A;  3QXE B;  3PMI A;  2ZZD A;  2QEX T;  4PL6 A;  2E64 A;  2PVO B;  1W2B S;  2K5F A;  3L2V A;  1XOV A;  3N5B B;  1UHF A;  1VQ7 T;  3V8L A;  4HCC A;  4M7D G;  2QDY B;  3FJP A;  2RHI A;  1H8K A;  2COY A;  5GAN h;  1YI2 Q;  1M2V B;  5EC7 A;  4J9E A;  1B34 A;  1IGQ A;  2X3W D;  2L3S A;  2L3R A;  1Y07 A;  2A08 A;  4UC4 A;  2R58 A;  1QVG S;  5GAN 4;  1OQK A;  4M77 B;  1Y71 A;  2LX9 A;  1YI2 T;  3CME T;  4MML A;  3NHN A;  5LJ3 e;  2K79 A;  2LJ0 A;  2DFU A;  2SRC A;  3I9Q A;  4J7F A;  4A4H A;  5DLQ E;  1AWX A;  3PIP A;  5GAO p;  2XU8 A;  4F17 A;  5GAM f;  1W70 A;  4KRT A;  1MND A;  5FRO A;  3A8M B;  5A0G A;  2KDS A;  3T9N A;  3UDC A;  1D1C A;  3REB B;  1TOV A;  3X20 B;  1VQ4 Q;  4E7L A;  2VVK A;  2WSC E;  3MO8 A;  1W4S A;  3TCJ A;  3PVQ A;  3LGL A;  3CC4 T;  2LQK A;  2JN0 A;  3CCE Q;  3R6O A;  1JRI A;  2JTF A;  4ZGJ B;  3X24 B;  3JB9 G;  1VQL A;  3JCM b;  4LUE A;  1I5L A;  2KY9 A;  1D3B A;  2DYB A;  2RO0 A;  4X9D A;  3EFO A;  2AZS A;  2JJ9 A;  4O6J A;  1G5V A;  2RF0 A;  1HK9 A;  2O4X B;  1QVG P;  2DRM A;  5EG2 A;  3SWN B;  5KYX A;  1D0Y A;  1VQO Q;  1PSF A;  3MEV A;  1FMW A;  4HKE A;  4C5H A;  4B6M A;  3MEU A;  4BE1 A;  2QAZ A;  1YJN Q;  2DEU A;  1VQL T;  1KFZ A;  1UHC A;  3TVT A;  4E6R A;  3CCR Q;  2P0Q A;  3THK A;  2F2W A;  1LOJ A;  2MI6 A;  5GAO r;  3OYB A;  2QQB A;  3CC4 A;  2X4J A;  4ME7 A;  1WHM A;  2K3X A;  1TS9 A;  1UGS B;  3TQ7 P;  3NGP A;  1QMC A;  5IHI A;  4C0F A;  2DYI A;  3V8J A;  3CCM Q;  2XDB A;  2KXC A;  3OS1 A;  4ZN1 A;  2RHZ A;  3OSS C;  4J9F A;  1K1Z A;  4IIO A;  3CC7 A;  1Q82 U;  2YUQ A;  3EGD A;  3OQ5 A;  2DAQ A;  4RTZ A;  3MET A;  3CPW A;  4AG1 C;  2FZK B;  5A0D A;  2YDL A;  1EZZ B;  1VQK A;  3GNF B;  4J83 A;  2HSE B;  4GBQ A;  3EGX A;  1JXM A;  2X4W A;  5CVI A;  2P0P A;  1PC0 A;  1VQ8 T;  4J9D A;  3RMS A;  2FRY A;  4XU2 A;  1WLP B;  4FYX B;  1NJI C;  4X34 A;  2DD5 A;  2ZPG B;  2P4T A;  2DRK A;  5GAN 6;  2JZ2 A;  2KAF A;  2EKH A;  2LTO A;  3JCM Q;  2EYX A;  2P84 A;  1SPK A;  3RKX A;  1Q7Y U;  1ZBJ A;  3WXM B;  1VQN T;  5IXB A;  1AZE A;  4GY5 A;  5GAN 5;  3L2Z A;  1MHN A;  1KC8 U;  1UJ0 A;  4M78 E;  1RAE B;  2BIV A;  3CMA A;  1ZSZ A;  1M3A A;  4E7H A;  2ZGW A;  3ZL7 C;  2A37 A;  2EQK A;  1TUD A;  1YJN A;  2RD1 A;  4FW2 A;  1VQK Q;  1G3S A;  4PJO G;  3I35 A;  3INZ A;  4MMK A;  1PSE A;  1G3T A;  4BI3 A;  1A0N B;  2V8I A;  3HSB A;  2D8H A;  1UUE A;  2ESW A;  4DOV A;  4KH0 B;  4HVV A;  1D1A A;  2WSF E;  2EJF A;  2K3B A;  1QCN A;  4A4K A;  2GBQ A;  3EG9 B;  4NL3 A;  3PIO A;  1RLQ C;  3IQL A;  4PKC C;  3L1A A;  3E9F A;  3HFO A;  1KQS A;  4M78 D;  2YUO A;  4Z89 A;  3M56 A;  4J8O A;  5FLX E;  2OJ2 A;  2DTO A;  1G3Y A;  1VQ7 Q;  2F5K A;  3H0I A;  1BI0 A;  4J6Y A;  4MDX A;  1OUL A;  5KE3 A;  1VQ6 A;  1RAI B;  1V1C A;  1I81 A;  2DXT A;  2HNI A;  4RKU E;  1ZA1 B;  2MPX C;  4ANJ A;  4F16 A;  4KGZ B;  2QA4 Q;  3GIB A;  4PJO E;  2HBP A;  3HPW A;  4WTO B;  1LCK A;  5CO7 A;  2QXF A;  1PD0 A;  2ZAE A;  2A7Y A;  4Z88 A;  2DKG A;  2QQ9 A;  1KHC A;  1ZHI A;  1HYO A;  3CCM T;  1GFC A;  2HDA A;  4EMH A;  1NEB A;  1QWE A;  1OZ2 A;  2AK5 A;  2RM4 A;  2X51 A;  4JDS A;  3OYG A;  4JRP A;  1GCQ A;  3A98 A;  5D6W A;  1FXX A;  5C6S A;  3CCR T;  3KBG A;  1VQL Q;  2QA4 A;  2YSQ A;  1F1B B;  2NUT A;  1JQQ A;  3ZEH A;  2VV5 A;  3MPU B;  2OTJ A;  3JCM X;  2BE7 D;  2J6F A;  1MMN A;  2AIR B;  2RK1 A;  1WJQ A;  3QZ9 B;  1OYX A;  4M78 A;  5GMK j;  3CC2 T;  1JO8 A;  3PGG A;  1ZQ1 A;  2XHC A;  4FW1 A;  3QWY A;  4RTV A;  2PNI A;  3TSW A;  3U23 A;  1WA7 A;  2RNA A;  1VIE A;  4M7D A;  3RKY A;  4OMO A;  4KGV B;  2RQW A;  2NUZ A;  4KGX B;  1GRI A;  1K9M R;  2CH4 A;  4C92 E;  2DBM A;  3OA6 A;  2RHY A;  4HT9 A;  1ZSZ C;  4OMM A;  1NBE B;  2LNH B;  2HKQ B;  2HCK A;  1Q81 U;  1YIT T;  4CRI A;  1X2K A;  2GGR A;  4QQD A;  1G3W A;  1UGP B;  3E19 A;  4F7U E;  2FRW A;  3SWN A;  2CZ0 B;  1IO6 A;  3CC4 Q;  2DK3 A;  4CC3 A;  4FT2 A;  4QVC A;  2C0O A;  3Q1J A;  1N27 A;  3UWN A;  1Z9Z A;  2K9G A;  3CCV Q;  3LWH A;  4A4E A;  1VQ4 T;  2COZ A;  4RTT A;  4XTW A;  3TSZ A;  2VUB A;  2K2V A;  2WAC A;  1S1N A;  1QVF P;  3OS2 A;  3NTH A;  4FM4 B;  1LVK A;  3WVE B;  3L2Q A;  3JCM g;  4M77 D;  2MAM A;  1AT1 B;  3H9N A;  2K7A A;  3EG0 A;  2EPD A;  3M0Q A;  1SSF A;  4RTY A;  1RAB B;  4XU0 A;  5ECA A;  3QBY A;  3OSV A;  2D6F A;  1VQ5 Q;  1WHH A;  1VYT A;  2YRD A;  1NPR A;  2GQV A;  4L6V 5;  5FRM A;  2COW A;  2E3H A;  2J7I A;  3CCQ Q;  1M1G A;  2RHU A;  4M75 B;  1AOJ A;  4ZTF A;  3CCS T;  1NG2 A;  2E3I A;  3GF5 A;  4Y92 A;  5GAO l;  3DB4 A;  1Q86 R;  2H3J A;  4M7A B;  4N4H A;  3ASK A;  1BKB A;  2O01 E;  5FWB A;  3JSC A;  5CAI A;  1I4K 1;  3OYA A;  2XD0 A;  2JTE A;  2HL5 C;  5GMK e;  1M2O A;  1E6H A;  3JRZ A;  2DM1 A;  3FLG A;  5GAM d;  1PKT A;  2HL3 A;  1DJ7 B;  4Z02 A;  4PJM A;  3OYY A;  4KUD K;  3CMA Q;  3OB9 A;  3ZFJ A;  5GAM e;  2CUD A;  3PNW C;  1KD1 C;  3CCM A;  3QUI A;  1QLY A;  3RKW A;  3CCJ T;  4IKF A;  4FIB A;  5KYN A;  1WXT A;  4ELY C;  1OI1 A;  3RES A;  4KUI A;  2JMC A;  1EX4 A;  2VAS A;  4M7A A;  2RI5 A;  3RDV A;  3L2W A;  1VQM A;  3C94 A;  6AT1 B;  2JVV A;  1PG5 B;  4MZT A;  4OGC A;  1RAF B;  3G4S T;  1NM7 A;  4C0D C;  5CCA A;  3H41 A;  1M1K U;  4FU6 A;  2DXU A;  1IB8 A;  3DKM A;  3I56 T;  4DBF A;  1KIK A;  3VUB A;  2D9T A;  2KGT A;  3QJ6 A;  2QTX A;  1Y96 B;  1VQ7 A;  4M4Z A;  8ATC B;  2EYY A;  4DEY A;  1Z9Q A;  5HY6 A;  4FYY B;  1K8A U;  3HHT B;  3HKS A;  3L2R A;  3NPF A;  3MHX A;  2QGF B;  4DQ2 A;  3QSU A;  3NMZ C;  2DIL A;  3LGF A;  4JJN K;  4A54 A;  1Y7X A;  4LDX A;  3VYH B;  4JRI A;  4CC2 A;  4J7I A;  2DX1 A;  2F2X A;  1K76 A;  2RJE A;  5LJ5 d;  1WNL A;  1M8M A;  2JT4 A;  4PJN A;  2C06 A;  1ZUY A;  3CCV A;  2PU9 B;  2CP7 A;  3PVL A;  3JB9 F;  4OB0 B;  3OBW A;  5FU6 B;  2RJF A;  4M7D F;  1QWF A;  2J6O A;  1D1B A;  4AMC A;  2DIQ A;  2RQR A;  1D3B B;  1AVZ C;  5LJ3 f;  1UGV A;  2K2M A;  1VQ6 Q;  2G3R A;  1K0S A;  5LJ3 d;  1VQN A;  3LH0 A;  1KC8 R;  5GAO n;  3VUZ A;  3FEO A;  3FRN A;  1KQS S;  4M78 C;  4PJO A;  1JU5 C;  4RMO A;  3GLX A;  3A8L B;  4JS5 A;  1QVF A;  1PD1 A;  3LW5 E;  4HA8 A;  5LJ5 f;  1FX7 A;  1HSQ A;  1X75 C;  3ZBD A;  3GP8 A;  4BY6 B;  1W2B A;  4LUD A;  1QVG A;  4BDY A;  3QO3 A;  2EBP A;  5GAN 8;  3G6E Q;  4HCK A;  2KK4 A;  2H3E B;  1X6B A;  4GLM A;  2HQE A;  4QVD A;  2CKK A;  1WHK A;  1PNJ A;  1TXQ A;  3CBM A;  2GF7 A;  2RJC A;  4JUV A;  4M75 A;  3A8G B;  1E7O A;  3M53 A;  4R0K A;  3G71 T;  4WF2 A;  2DO3 A;  2DXC A;  4JPB W;  1V76 A;  2EW3 A;  3CD6 Q;  5LJ3 g;  3RUX A;  1VQ5 A;  2QQS A;  3SB2 A;  2KQW A;  5LJ3 h;  1JJ2 A;  2X35 A;  1SHG A;  2EJG A;  1I07 A;  1HJD A;  5GAO m;  4PLL A;  2F2V A;  1VUB A;  2EWN A;  2PUK B;  2CUB A;  2DVE A;  4J9B A;  3E2U A;  2ZCF B;  4DEX A;  2XI9 A;  4J9H A;  4OF1 A;  1T0J A;  3OYC A;  3WVD B;  5LJ5 g;  3OS5 A;  2SEM A;  1R77 A;  3EG3 A;  1KQ1 A;  1Q86 U;  1NEG A;  1CKB A;  3ULR B;  1TU0 B;  1VQ8 Q;  2LNV A;  2VC8 A;  3SDZ A;  4ZNX A;  2VGN A;  2FG0 A;  5HCK A;  4XU3 A;  4PLI A;  2QQA A;  3PFS A;  3QWX X;  1MMD A;  4O5V A;  4JS4 A;  4HT8 A;  4HCZ A;  2RI3 A;  1X2Q A;  1RAH B;  1QVP A;  4RTU A;  1M1K R;  4M7A E;  4JJB A;  5I21 A;  2XMF A;  1YIJ T;  1H64 1;  2CDT A;  4OGE A;  2YRC A;  2NUP B;  4PJJ A;  3VYG A;  3HRS A;  1M5Q 1;  4L59 A;  4DA4 A;  3JCM P;  4JRK A;  4L5G A;  5LJ5 j;  4J6X A;  1ZSZ B;  3KFV A;  2FPE A;  2KR3 A;  4C8Q B;  5KH6 A;  1N8R R;  1B07 A;  4QT7 A;  5CKD A;  2YUN A;  4E47 A;  5LJ5 h;  1PCX A;  4CC4 B;  2RK2 A;  2LQW A;  1NE8 A;  1P92 A;  2HKN A;  3CCE A;  1H3Z A;  1KD1 U;  3M59 A;  3UA6 A;  3C95 A;  4ORZ A;  2ECZ A;  5J3B A;  3OYE A;  4LE9 A;  5LJ5 e;  4QQG A;  4WCI A;  2NUT B;  2FHD A;  2OTJ Q;  1T3L A;  4ESR A;  3M0P A;  3OYD A;  4M77 A;  1QP3 A;  4V2S A;  1QKX A;  4CI0 C;  1Q82 C;  4JLG A;  1LNX A;  1WXB A;  3JAM E;  3MKD A;  3JB9 I;  4EMK C;  2HMA A;  2PVG B;  1ACM B;  3OBY A;  1UTI A;  1B34 B;  1XQH A;  2NUP A;  3CEY A;  1M8V A;  4PFO A;  5CQY A;  4X9C A;  4PJO B;  4OB1 B;  4F7U G;  4RCB A;  1S72 A;  4BI4 A;  4MDW A;  1I5O B;  2A28 A;  2GCX A;  4AT1 B;  1EIF A;  3S3O A;  4IUR A;  1VQK T;  2AHJ B;  3CCE T;  1KSW A;  5A2Q E;  4J9I A;  5CKH A;  2JM9 A;  2H8H A;  1QKW A;  1ZBX A;  2X4X A;  3QG1 A;  2HD0 A;  1K73 C;  2LDM A;  5CKE A;  1CSK A;  3O5Z A;  2LQN A;  3DB3 A;  2QAS A;  5CKF A;  4M75 G;  5GAM h;  3CCL T;  4KBM B;  2E5K A;  1N5Z A;  2CP3 A;  1UJY A;  5KYU A;  4M7A F;  3ME9 A;  2CP5 A;  4C8Q C;  3I5R A;  2J6K A;  3RR6 A;  5D6Y A;  1QCO A;  5FWC A;  2CYZ B;  2D8J A;  1N6A A;  2KRO A;  2QGG A;  1X69 A;  1TTH B;  1N8R C;  3CCR A;  3CCU A;  2O4X A;  4DBQ A;  2L0A A;  4BDZ A;  2VGM A;  5GAN j;  4X1V A;  4EMG A;  2JXB A;  3VV0 A;  2RHX A;  5FU7 C;  1MUZ A;  2DZC A;  5DY9 A;  4NL2 A;  3EAE A;  4XTU A;  1GBQ A;  1Y57 A;  3EH2 A;  1X43 A;  2DJZ A;  4FSX A;  1BI1 A;  4AG2 C;  1WX6 A;  5D7U A;  2DL3 A;  3RBB B;  1VQ6 T;  2JM8 A;  3G1J A;  2FYK A;  2HQX A;  1MV3 A;  1V29 B;  4E7S A;  1ARK A;  4M7A C;  4LXC A;  2CH4 W;  4FYV B;  4EDU A;  3OS0 A;  4XTZ A;  1OPK A;  3V7R A;  2BKD N;  2CT3 A;  1M2V A;  1IHV A;  5CQX A;  3CBO A;  4KH1 B;  1SSH A;  5IXF A;  4XQ3 A;  4Z8A A;  3EG1 A;  1UFF A;  1WQ7 A;  2BTT A;  2RA2 A;  3M5A A;  3FJ5 A;  3OYN A;  4XTY A;  3CPW S;  1JBM A;  2LCC A;  4M7A G;  1AZG B;  2ZPB B;  1B3Q A;  2XG8 D;  1SG5 A;  4LNP A;  1C1A A;  1UGR B;  2E12 A;  1WHG A;  3JB9 H;  5I11 A;  2J05 A;  2D1X A;  5GAM g;  2EKO A;  3JCM h;  5KYY A;  5HKC A;  4N4G A;  2F5T X;  3I56 A;  4BD3 A;  3QZ5 B;  1WFW A;  5CKB A;  5J39 A;  1VOM A;  3E9G A;  2DTI A;  2I0N A;  4M78 G;  1R0C B;  2EIF A;  1TUC A;  1YCY A;  2HZY A;  2JNG A;  4J9G A;  3P8B B;  4FYW B;  4M77 E;  3OYI A;  5IN1 A;  3S3M A;  2NYS A;  2F1L A;  2BZ8 A;  3L42 A;  4C92 F;  3QJY A;  1WQW A;  2LJ1 A;  4LDY A;  4M77 F;  4II1 A;  4ZGE B;  3RIR A;  2QI2 A;  1SHF A;  1X6O A;  4XU1 A;  2O2O A;  4M78 F;  3VJP A;  4M77 C;  3V8K A;  4BI8 B;  2FPD A;  4M7D D;  3M0U A;  4R55 A;  3I55 Q;  2GTJ A;  1VQO A;  2Y4X A;  4M7D E;  2YLB A;  2XID A;  5J26 A;  5GAN 3;  3EG9 A;  1YIJ Q;  1Q81 C;  4OP0 A;  3M9Q A;  1O75 A;  4C8Q D;  5AYF A;  3CCQ A;  1PWT A;  3G4S A;  4F14 A;  1H3H A;  3LWI A;  1YWP A;  2EGE A;  4C92 C;  2YXY A;  1AWW A;  4M75 D;  4KT0 E;  1M9S A;  1ZSG A;  1UEC A;  2KBT A;  5LJ3 j;  4XTX A;  2VB6 A;  3GPL A;  3OY9 A;  1YNZ A;  3MP8 A;  3CCQ T;  1TWB A;  2GFA A;  1N9S A;  1BI3 A;  1U1S A;  5CR2 A;  2QQR A;  5GMK i;  1NJI U;  1KQS P;  1VQ5 T;  1B7T A;  5GAN e;  1VQ4 A;  4B9X A;  2ZPE B;  2LJ3 A;  1U5S A;  1IHW A;  1MGQ A;  4OB3 B;  1RI0 A;  3CD6 T;  3BDU A;  1OEB A;  3X28 B;  2D0N A;  4AFZ C;  4HVW A;  2MMP A;  4D8D A;  3P8D A;  4AFS C;  2ZPH B;  2Z0W A;  3S3N A;  1JB0 E;  3CCV T;  1GCQ C;  2K5L A;  3SD4 A;  2OTL Q;  1VYU A;  2O9S A;  5L23 A;  1ZA2 B;  1SF9 A;  2CP2 A;  2ZPI B;  1M27 C;  2R5A A;  1AD5 A;  5KYW A;  1BB9 A;  3O8V A;  2D0Q B;  1K73 R;  2G6F X;  3REA B;  1GXI E;  2OAW A;  3OMC A;  4OMF B;  9ATC B;  1K0X A;  2FZC B;  2V26 A;  4RUG A;  2LP5 A;  5KYX B;  1KG1 A;  4Y91 A;  1KQ2 A;  3GNG A;  2CZ6 B;  2EGC A;  2KNB B;  3CQT A;  4PJO F;  2O9V A;  2CP6 A;  4ELZ C;  2EQM A;  2KVQ G;  2O31 A;  3BDL A;  3RNJ A;  4HCB A;  2KRS A;  3UF4 A;  3FDR A;  4C92 D;  3LX7 A;  3M0T A;  3DLM A;  1S72 Q;  5CK9 A;  3OW2 A;  3C0C A;  3HTR A;  4DBH A;  4EMK B;  1WXU A;  2VXF A;  2JUF A;  2V8K A;  2W10 A;  1JEG A;  3LH5 A;  2RH2 A;  4PJO C;  3G7Z A;  2HQH A;  1RUW A;  1NLP C;  5GAN 7;  1JJ2 S;  3CC7 T;  1VQP T;  7AT1 B;  2B8A A;  2X4Y A;  2K3Y A;  4C5E A;  2JW4 A;  1E6G A;  4JZ3 A;  2V8J A;  2CSI A;  3VS7 A;  5KYU B;  4HXJ A;  4M75 C;  3VS4 A;  1NLO C;  1JJ2 P;  2KT1 A;  3CPF A;  4OB2 B;  3UAT A;  3M0R A;  2NLU A;  1RAG B;  1PKS A;  5GAO q;  4N0A C;  2KE9 A;  1GL5 A;  2FPF A;  1WDX A;  3KXT A;  4J9C A;  4K11 A;  1UEB A;  1G83 A;  1ZLM A;  3HRT A;  1MNE A;  2DD4 A;  4LD9 K;  3EGD B;  2L89 A;  2RPN A;  3VRZ A;  3F70 A;  3A8H B;  2QA4 T;  1T0H A;  2A3L A;  2RB6 A;  4DBR A;  4HVU A;  3PTA A;  2FZG B;  3G71 A;  1H92 A;  2MF2 A;  2FEI A;  2O88 A;  1I8F A;  2CSQ A;  2KEA A;  1T3S A;  3EH1 A;  4CC7 A;  1YBY A;  2DER A;  3M57 A;  1QP2 A;  3QII A;  3FC3 A;  2IPO B;  3VS3 A;  1VQP A;  1TUG B;  3EFS A;  2DL7 A;  2LT4 A;  2CT4 A;  2PUO B;  5FW9 A;  4C5I A;  2OTL A;  3GOX A;  2YUP A;  3MP6 A;  2M9U A;  2JTM A;  1X01 A;  1TH7 A;  4QW2 A;  1RAD B;  4IUU A;  3TRE A;  1R8O B;  3VS2 A;  4BY6 C;  4C0Z A;  3JCM c;  2DLP A;  2OI3 A;  3VS0 A;  1Q7Y C;  1M30 A;  4LD6 A;  1QVF S;  2ROL A;  2EYW A;  3VRY A;  3PMT A;  2IVW A;  1UB4 A;  5GJV B;  3BE3 A;  4C0D B;  2ATC B;  1YIT A;  1VQ9 A;  4MZP A;  1KHI A;  1M3B A;  4JLI A;  2BE9 B;  2CP0 A;  2QDL A;  1K4U S;  4E7J A;  2BZX A;  3CMA T;  1KD1 R;  3OYK A;  2E70 A;  2OTL T;  4TVR A;  1NYF A;  2F69 A;  4IUV A;  1YJW A;  3DLL A;  1UE9 A;  2GTO A;  2VKN A;  3L2U A;  3EHQ A;  4LDU A;  2JMA A;  4BB7 A;  1W1F A;  2DE0 X;  2QEX A;  4QQ6 A;  2LQ8 A;  2MOX A;  2J06 A;  2P0K A;  3MP1 A;  3JB9 J;  1FMK A;  1QCF A;  1C6V X;  4A63 B;  2VWF A;  3G6E T;  4IIM A;  1WZO A;  4RTX A;  3CME Q;  3GBQ A;  2RQT A;  2ABL A;  5IHN A;  2EQI A;  2LX7 A;  4AFQ C;  4C0G A;  1GCP A;  1K73 U;  3M0S A;  2QK0 A;  4FSS A;  3M4Y A;  1O9S A;  2BZY A;  5KCO A;  1OPL A;  1WYX A;  4M77 G;  2L3Q A;  4PFP A;  1BYM A;  3CC2 A;  2KRN A;  3CCL Q;  5FU7 B;  2QEX Q;  2MWO A;  3J80 E;  4BUG A;  2CS7 A;  1WI7 A;  3JV3 A;  1HD3 A;  4P5N A;  4MZM A;  1YJW T;  4PNO A;  3I5S A;  3I55 T;  3EHR A;  2RI2 A;  5GJW B;  4ZN3 A;  2C0T A;  1WJS A;  3VS6 A;  4B9W A;  1W6X A;  4Y28 E;  2DMO A;  3HFN A;  3EG2 A;  3PE0 A;  1WJR A;  3SWN C;  4FL6 A;  1Q7Y R;  3OW2 P;  4M75 E;  2AZV A;  3JCM J;  1K9M C;  1M90 R;  4C92 B;  2LCL A;  2YT6 A;  4C92 G;  4ZGD B;  2M51 A;  1OU8 A;  1NJI R;  1IRX A;  5KE2 A;  4F04 B;  4IUT A;  1OV3 A;  3QYG B;  4M7D C;  3RER A;  2VYT A;  5CIU A;  3X26 B;  2E65 A;  2DXB A;  3G4S Q;  1NPP A;  4XTV A;  3M55 A;  3M4G A;  4XK8 E;  1BK2 A;  2YLC A;  2MYS A;  1YP5 A;  2E6N A;  2EAY A;  4PK4 A;  3OYF A;  1AEY A;  2YWW A;  1VQ8 A;  2QTV A;  1YJ9 T;  5L8R E;  2CZ7 B;  2DA9 A;  5IHK A;  2XK0 A;  1TSF A;  3VS5 A;  3QYH B;  2RQV A;  2ENM A;  1M1K C;  1LJO A;  3HRU A;  3M58 A;  1VQ9 T;  2MK5 A;  3JCM e;  5A0L A;  5HK3 A;  3NTI A;  3VKI A;  2DL8 A;  2XDP A;  3QHS A;  3JCM V;  2DL4 A;  2QYZ A;  2KYB A;  1AWO A;  3EFO B;  2M0O A;  2RJD A;  1RLP C;  2IG0 A;  4N4I A;  5M9O A;  5GAM j;  4N0A A;  4BE2 A;  1BI2 A;  1D0X A;  2YHT A;  2KMT A;  1QW1 A;  1M3C A;  3FB9 A;  3CCS A;  1YI2 A;  1U3O A;  2XDD A;  1FMV A;  1XNI A;  3OYJ A;  1YJ9 A;  1J3T A;  1C0M A;  2DTH A;  3NTK A;  3OMG A;  4C92 A;  3CXC A;  2KSS A;  3MEW A;  3QDR B;  1SKU B;  1WPY A;  3JCM W;  5IH2 A;  4M7A D;  5KYY B;  3C12 A;  2GQI A;  1RAC B;  2EQU A;  1D0Z A;  3CCU Q;  1EFN A;  5FU6 C;  4M78 B;  2MCN A;  2OAU A;  2DJQ A;  2JS2 A;  1CKA A;  4D6W A;  1R0B G;  1XJW B;  5I2S A;  5D6X A;  2PZ1 A;  1K9A A;  3SEM A;  1RI9 A;  2XIC A;  3ER0 A;  3CCJ A;  2FB7 A;  2DET A;  5HK0 A;  2P4R A;  2Y4Y A;  1FWZ A;  2E10 A;  3MJX A;  4IUP A;  1Q81 R;  3JCM f;  3G71 Q;  1FYN A;  1G8X A;  4FT4 A;  2CZ1 B;  1WHJ A;  4M7D B;  1I1J A;  4KUL A;  3NFC A;  4A53 A;  3H6Z A;  2QG9 B;  3QKJ A;  4RCC A;  5GAN d;  1VQ9 Q;  2LRQ A;  1VQN Q;  4RG8 A;  1YIT Q;  2MWP A;  1OU9 A;  1YFN A;  4PJO D;  3CME A;  4XAX B;  2JOY A;  4A4G A;  1KJW A;  1YJ9 Q;  3A1P A;  2HBW A;  2HAX A;  2AKL A;  2E4H A;  3LYI A;  2DIG A;  3BY7 A;  5GAN f;  1YHQ Q;  4DOW A;  1K9M U;  3CC2 Q;  2DPP B;  3HP9 A;  1Q95 G;  4D8K A;  2KI7 A;  2K5I A;  1YN8 A;  1D09 B;  2E5Q A;  4OVA A;  2A36 A;  3CD6 A;  1X27 A;  1M1F A;  1NYG A;  2KRM A;  4BE0 A;  5KCH A;  3JCM d;  1Q86 C;  3UT1 A;  4C8Q F;  2EGA A;  3MCA B;  2V1R A;  2JS0 A;  4LN2 A;  2RN8 A;  5C0M A;  1ZUK A;  1ZUU A;  3H0F A;  3LLR A;  2OTJ T;  2FL7 A;  3EFR A;  1VIF A;  3S6W A;  2PQW A;  1AWJ A; 
#chains in the Genus database with same CATH homology
 1VQ8 T;  2RJC A;  3BDL A;  4NOY A;  4HCB A;  4JUV A;  1WGS A;  3RMS A;  3VU3 C;  4M75 A;  2EYQ A;  3FDR A;  3A8G B;  4XU2 A;  2DZ9 A;  3P8H A;  4C92 D;  1HXD A;  3M53 A;  1NJI C;  3LX7 A;  4KUD K;  1KC8 C;  3DLM A;  4X34 A;  4YTL A;  2DD5 A;  3G71 T;  2ZPG B;  2P4T A;  4WF2 A;  5CK9 A;  2DO3 A;  2DXC A;  5GAN 6;  3E1S A;  3OYL A;  3OW2 A;  2L5Q A;  2E6Z A;  2JZ2 A;  2KAF A;  5LJ3 g;  4EMK B;  3RUX A;  1VQ5 A;  4GLK A;  2QQS A;  2VXF A;  2KQW A;  3SB2 A;  2LTO A;  4LDW A;  3JCM Q;  5LJ3 h;  1JJ2 A;  2X35 A;  3TU4 K;  2EJG A;  2JUF A;  1YJN T;  3QPH A;  3UPU A;  2V8K A;  3RKX A;  1N8R U;  5GAO m;  4PLL A;  2RH2 A;  4C8Q E;  1Q7Y U;  1VUB A;  2EWN A;  3G7Z A;  4PJO C;  5GAN 7;  3V7C A;  3WXM B;  1K8A C;  1JJ2 S;  2PUK B;  2EQJ A;  1VQN T;  2LC4 A;  3CC7 T;  2DVE A;  1VQP T;  2B8A A;  2X4Y A;  2K3Y A;  4C5E A;  2ZCF B;  2XI9 A;  4GY5 A;  4OF1 A;  2V8J A;  3L2Z A;  5GAN 5;  1MHN A;  3OYC A;  4M75 C;  1KC8 U;  4M78 E;  3WVD B;  5LJ5 g;  3CPF A;  2BIV A;  2GFU A;  4OB2 B;  3OS5 A;  3CMA A;  2NLU A;  4E7I A;  4E7H A;  5GAO q;  3H8Z A;  4N0A C;  4C8Q A;  1KQ1 A;  1Q86 U;  3BFM A;  2ZGW A;  4VUB A;  3KXT A;  2EQK A;  4QVZ A;  3CXC S;  1YJN A;  1NZ9 A;  2LNV A;  2RD1 A;  2VC8 A;  3RMQ A;  3SDZ A;  2LT1 A;  1UEB A;  2VGN A;  4XU3 A;  4PLI A;  1G3S A;  3KUF A;  4PJO G;  1BIA A;  3INZ A;  2QQA A;  3HRT A;  3PFS A;  4MMK A;  1PSE A;  2DD4 A;  1G3T A;  4LD9 K;  2ZPF B;  4BI3 A;  1U8R A;  2L89 A;  3F70 A;  3A8H B;  4O5V A;  2V8I A;  2QA4 T;  2A3L A;  4HCZ A;  4JS4 A;  2R5M A;  2RB6 A;  2RI3 A;  5DLO A;  3PTA A;  1QVP A;  3G71 A;  3HSB A;  2MF2 A;  4DOV A;  4M7A E;  5I21 A;  1I8F A;  1YIJ T;  4Q5W A;  1H64 1;  4OGE A;  1YBY A;  3VYG A;  2WSF E;  2EJF A;  3HRS A;  1M5Q 1;  3M57 A;  1AHJ B;  1QP2 A;  3QII A;  4L59 A;  2WSE E;  4A4K A;  3FC3 A;  4JRK A;  4DA4 A;  3JCM P;  4NL3 A;  4L5G A;  5LJ5 j;  1VQP A;  3PIO A;  4J6X A;  1M90 C;  4PKC C;  3EFS A;  3L1A A;  3E9F A;  2LT4 A;  4C8Q B;  3HFO A;  5KH6 A;  4C8Q G;  1KQS A;  5IT9 E;  5CKD A;  4E47 A;  2PUO B;  4M78 D;  4C5I A;  2OTL A;  3M56 A;  5LJ5 h;  4J8O A;  5FLX E;  3GOX A;  2RK2 A;  2FVU A;  2EQM A;  3MP6 A;  1NE8 A;  2M9U A;  2DTO A;  3OYM A;  2JTM A;  1G3Y A;  1P92 A;  1X01 A;  3CCE A;  1TH7 A;  1KD1 U;  1H3Z A;  3M59 A;  2F5K A;  3C95 A;  4IUQ A;  4QW2 A;  5J3B A;  3OYE A;  4IUU A;  3TRE A;  1R8O B;  1BI0 A;  5LJ5 e;  4QQG A;  4BY6 C;  4C0Z A;  4J6Y A;  5GMK h;  4MDX A;  5KE3 A;  3JCM c;  4J6W A;  3JB9 D;  2FHD A;  1VQ6 A;  4EMK A;  1Q7Y C;  1I81 A;  3OYD A;  2DXT A;  2HNI A;  1UGQ B;  4RKU E;  4RG2 A;  3OYH A;  4M77 A;  1QP3 A;  4LD6 A;  1QVF S;  4V2S A;  3GIB A;  1M90 U;  4CI0 C;  3PMT A;  2IVW A;  1UB4 A;  1Q82 C;  4JLG A;  4C0D B;  4PJO E;  2HBP A;  3HPW A;  4BAC A;  1LNX A;  1YIT A;  5CO7 A;  1VQ9 A;  4MZP A;  1KHI A;  2R57 A;  3J81 E;  2QXF A;  2DEQ A;  4JLI A;  3JAM E;  3CCU T;  4M75 F;  3PT9 A;  1M4Z A;  2A7Y A;  3A5Z B;  2DKG A;  2LVM A;  2QQ9 A;  1KHC A;  1ZHI A;  3JB9 I;  3CCM T;  4E7J A;  3CMA T;  2EJ9 A;  3OYK A;  2E70 A;  2OTL T;  1RL2 A;  4TVR A;  4EMH A;  4EMK C;  3HL8 A;  2F69 A;  4IUV A;  1YJW A;  3DLL A;  2PVG B;  3OBY A;  3L2U A;  1B34 B;  5IAY A;  1XQH A;  1OZ2 A;  2RM4 A;  3CEY A;  4JDS A;  4LDU A;  4BB7 A;  3OYG A;  4JRP A;  5CQY A;  2QEX A;  1M8V A;  3AHU A;  4QQ6 A;  4X9C A;  3OW2 S;  4PJO B;  1IZ6 A;  2LQ8 A;  4OB1 B;  5D6W A;  1FXX A;  5GAN 2;  5C6S A;  3URG A;  4F7U G;  4F7U A;  4RCB A;  3CCR T;  3KBG A;  4C5G A;  2P0K A;  3MP1 A;  3JB9 J;  1S72 A;  4HT8 A;  4BI4 A;  2QA4 A;  4MDW A;  4NS5 A;  1IRE B;  3G6E T;  4LDV A;  2GCX A;  3CBP A;  3ZEH A;  2VV5 A;  1N9R A;  1EIF A;  3S3O A;  4IUR A;  1VQK T;  2OTJ A;  5I2M A;  3JCM X;  2AHJ B;  3CCE T;  4JRQ A;  5A2Q E;  4A4F A;  2YRV A;  4EPC A;  2E1H A;  2L8D A;  2RK1 A;  2Y90 A;  1WJQ A;  1Y96 A;  2VXE A;  3QZ9 B;  2X4X A;  1ZBX A;  5CKH A;  4ZTJ A;  2PVD B;  1OYX A;  4J5Y A;  3QG1 A;  4M78 A;  5GMK j;  3CC2 T;  2HD0 A;  1K73 C;  3PGG A;  4C0G A;  2M1H A;  5FRN A;  2LDM A;  5CKE A;  1ZQ1 A;  1K73 U;  4F7U B;  2XHC A;  2EFI A;  3C4S A;  5GAN g;  3DB3 A;  4M7D A;  5CKF A;  1VIE A;  3G6E A;  3M4Y A;  1O9S A;  3RKY A;  3TEE A;  5KCO A;  4M77 G;  1U1T A;  4M75 G;  1VQM T;  1BYM A;  5GAM h;  3CCL T;  4KBM B;  3CC2 A;  5FU7 B;  2M16 A;  1YHQ A;  4C92 E;  2MWO A;  4M7A F;  3ME9 A;  4C8Q C;  3OA6 A;  3J80 E;  4BUG A;  2K4Y A;  2BUD A;  2CS7 A;  2RHY A;  2XKO C;  4BE2 A;  4HT9 A;  5D6Y A;  2CYZ B;  1N6A A;  4P5N A;  1YIJ A;  1YIT T;  4CRI A;  1Q81 U;  4QQD A;  1G3W A;  4MZM A;  3J7A F;  1YJW T;  4PNO A;  1N8R C;  1UGP B;  3E19 A;  4F7U E;  3CCR A;  3CCU A;  2O4X A;  4R56 A;  3SWN A;  2CZ0 B;  1VQO T;  1S72 T;  3I55 T;  4BDZ A;  2RI2 A;  2DK3 A;  2VGM A;  4EMG A;  4ZN3 A;  5GAN j;  3VV0 A;  2RHX A;  5FU7 C;  4FT2 A;  4QVC A;  2DZC A;  3Q1J A;  5DY9 A;  4F7U F;  4NL2 A;  1YHQ T;  1BIB A;  3EAE A;  1N27 A;  1WJS A;  4XTU A;  3UWN A;  5GMK m;  4B9W A;  3LWH A;  4A4E A;  1VQ4 T;  4Y28 E;  4XTW A;  2DJZ A;  2VUB A;  4FSX A;  3HFN A;  2K2V A;  1BI1 A;  2WAC A;  2K57 A;  1XTD A;  3OS2 A;  5LL6 S;  1WJR A;  3A8O B;  3NTH A;  3SWN C;  1VQ6 T;  4FM4 B;  3WVE B;  3X25 B;  3L2Q A;  3JCM g;  2I2L A;  2CGH A;  2FYK A;  2MAM A;  3M54 A;  4FL6 A;  2HQX A;  4M77 D;  1SSF A;  1V29 B;  3BW1 A;  4XU0 A;  4M7A C;  2E41 A;  3QBY A;  5GMK l;  3OSV A;  2D6F A;  4M75 E;  3JCM J;  1K9M C;  4EDU A;  3OS0 A;  3CCL A;  4C92 B;  4XTZ A;  2LCL A;  4C92 G;  3MEA A;  1OZ3 A;  3V7R A;  2BKD N;  1NPR A;  2GQV A;  4ZGD B;  5CQX A;  4L6V 5;  3SFM A;  5KE2 A;  3CBO A;  5DM7 R;  4E7K A;  5FRM A;  4ATO A;  4XQ3 A;  1M1G A;  2RHU A;  4M75 B;  4ZTF A;  3CCS T;  4IUT A;  3FIF A;  3QYG B;  1WQ7 A;  3GF5 A;  2RA2 A;  4M7D C;  5GAO l;  3M5A A;  3DB4 A;  3RER A;  2VYT A;  5CIU A;  4XTY A;  3X26 B;  1JBM A;  2LCC A;  3OYN A;  2H3J A;  2E65 A;  2DXB A;  4N4H A;  4M7A B;  1NPP A;  4XTV A;  4M7A G;  2ZPB B;  3ASK A;  3M55 A;  3I55 A;  1BKB A;  3M4G A;  3QXE B;  2XG8 D;  4XK8 E;  2O01 E;  3PMI A;  2ZZD A;  3JSC A;  5CAI A;  1I4K 1;  1UGR B;  2YLC A;  3OYA A;  2QEX T;  4PL6 A;  2XD0 A;  2E12 A;  2E6N A;  2E64 A;  2EAY A;  2PVO B;  5GMK e;  3OYF A;  1W2B S;  3JB9 H;  2K5F A;  3L2V A;  1XOV A;  5GAM g;  1VQ8 A;  1YJ9 T;  5L8R E;  2EKO A;  3JCM h;  3N5B B;  2CZ7 B;  3JRZ A;  3V8L A;  2XK0 A;  1VQ7 T;  4HCC A;  3FLG A;  2QDY B;  3FJP A;  5GAM d;  2RHI A;  4M7D G;  5HKC A;  3QYH B;  4N4G A;  5GAN h;  1DJ7 B;  4Z02 A;  1M1K C;  3OYY A;  1LJO A;  3HRU A;  2F5T X;  3M58 A;  3I56 A;  1B34 A;  3OB9 A;  1VQ9 T;  3ZFJ A;  4BD3 A;  5GAM e;  3JCM e;  3QZ5 B;  2L3R A;  1Y07 A;  3PNW C;  4UC4 A;  5CKB A;  2R58 A;  5J39 A;  1QVG S;  5A0L A;  5HK3 A;  5GAN 4;  1KD1 C;  3NTI A;  3VKI A;  2XDP A;  4M77 B;  1Y71 A;  2DTI A;  3E9G A;  3QHS A;  2LX9 A;  3QUI A;  3CCM A;  1YI2 T;  4M78 G;  3RKW A;  3CCJ T;  4IKF A;  2EIF A;  3CME T;  4MML A;  4FIB A;  3JCM V;  1YCY A;  5LJ3 e;  2JNG A;  4ELY C;  1OI1 A;  3P8B B;  4J7F A;  4A4H A;  5DLQ E;  2M0O A;  3PIP A;  2RJD A;  2IG0 A;  5GAO p;  3RES A;  2XU8 A;  4M77 E;  4N4I A;  4KUI A;  4N0A A;  1BI2 A;  5GAM f;  5IN1 A;  5M9O A;  5GAM j;  3OYI A;  3S3M A;  2YHT A;  4M7A A;  2RI5 A;  3L42 A;  2KMT A;  1QW1 A;  4C92 F;  3L2W A;  3FB9 A;  3CCS A;  1YI2 A;  1VQM A;  3C94 A;  3QJY A;  2JVV A;  3A8M B;  1WQW A;  5FRO A;  5A0G A;  4LDY A;  4M77 F;  2KDS A;  4II1 A;  2XDD A;  4MZT A;  1XNI A;  4OGC A;  3T9N A;  3UDC A;  3OYJ A;  4ZGE B;  3RIR A;  3X20 B;  2QI2 A;  3G4S T;  1YJ9 A;  4E7L A;  1X6O A;  4C0D C;  2DTH A;  3NTK A;  4XU1 A;  2WSC E;  5CCA A;  3OMG A;  4FU6 A;  4M78 F;  1M1K U;  3VJP A;  4M77 C;  3MO8 A;  4C92 A;  3V8K A;  4BI8 B;  3CXC A;  2DXU A;  1W4S A;  3TCJ A;  2KSS A;  4M7D D;  3DKM A;  3I56 T;  3MEW A;  3QDR B;  3V7S A;  3LGL A;  1WPY A;  3JCM W;  4R55 A;  3CC4 T;  4M7A D;  3VUB A;  3C12 A;  1VQO A;  2D9T A;  2LQK A;  2Y4X A;  3QJ6 A;  2YLB A;  2JN0 A;  2EQU A;  2QTX A;  2XID A;  5J26 A;  1Y96 B;  4M7D E;  1VQ7 A;  3R6O A;  5FU6 C;  4M78 B;  5GAN 3;  1JRI A;  2JTF A;  2OAU A;  4ZGJ B;  1Q81 C;  3X24 B;  4OP0 A;  3JB9 G;  3M9Q A;  1O75 A;  4C8Q D;  4D6W A;  5AYF A;  3CCQ A;  1VQL A;  3G4S A;  3JCM b;  3LWI A;  5HY6 A;  5I2S A;  1I5L A;  2KY9 A;  5D6X A;  1D3B A;  1K8A U;  3HHT B;  3HKS A;  3L2R A;  2XIC A;  3ER0 A;  3MHX A;  2FB7 A;  2RO0 A;  4DQ2 A;  5HK0 A;  3CCJ A;  2Y4Y A;  4X9D A;  1FWZ A;  2E10 A;  4C92 C;  3QSU A;  4IUP A;  4M75 D;  4KT0 E;  1M9S A;  4O6J A;  3JCM f;  3LGF A;  4JJN K;  4A54 A;  1G5V A;  1Y7X A;  4LDX A;  4FT4 A;  2CZ1 B;  3VYH B;  1HK9 A;  4JRI A;  4M7D B;  4J7I A;  2O4X B;  5LJ3 j;  4XTX A;  3GPL A;  3OY9 A;  4KUL A;  5EG2 A;  3MP8 A;  3SWN B;  3CCQ T;  2RJE A;  5LJ5 d;  3NFC A;  2GFA A;  1N9S A;  1BI3 A;  1U1S A;  1WNL A;  4A53 A;  3H6Z A;  5CR2 A;  2QQR A;  3QKJ A;  4RCC A;  5GMK i;  1PSF A;  2C06 A;  5GAN d;  3MEV A;  3CCV A;  2PU9 B;  2LRQ A;  1NJI U;  4RG8 A;  3JB9 F;  4OB0 B;  4HKE A;  2MWP A;  4C5H A;  1VQ5 T;  3OBW A;  4PJO D;  2PQW A;  3MEU A;  5FU6 B;  3CME A;  4XAX B;  4BE1 A;  2RJF A;  5GAN e;  4M7D F;  2JOY A;  4A4G A;  2DIQ A;  1VQ4 A;  1D3B B;  1VQL T;  4B9X A;  2HAX A;  5LJ3 f;  2ZPE B;  2G3R A;  5LJ3 d;  3CPW S;  3LYI A;  2P0Q A;  1VQN A;  1MGQ A;  1LOJ A;  3LH0 A;  4OB3 B;  1RI0 A;  3CD6 T;  2MI6 A;  5GAO r;  3BDU A;  3X28 B;  5GAO n;  3OYB A;  2QQB A;  3VUZ A;  3CC4 A;  2MMP A;  3FEO A;  3FRN A;  1KQS S;  3P8D A;  2X4J A;  2ZPH B;  4ME7 A;  2DIG A;  2K3X A;  3S3N A;  4M78 C;  3BY7 A;  1JB0 E;  3CCV T;  5GAN f;  4PJO A;  1UGS B;  2K5L A;  3SD4 A;  4RMO A;  3GLX A;  3A8L B;  4C0F A;  4DOW A;  4JS5 A;  1QVF A;  1K9M U;  3LW5 E;  4HA8 A;  5LJ5 f;  1FX7 A;  3V8J A;  2XDB A;  2DPP B;  3HP9 A;  1X75 C;  3OS1 A;  2K5I A;  3ZBD A;  3GP8 A;  2E5Q A;  4ZN1 A;  2RHZ A;  4BY6 B;  4OVA A;  1W2B A;  2ZPI B;  1QVG A;  3OSS C;  4BDY A;  3CD6 A;  2R5A A;  3QO3 A;  1M1F A;  3CC7 A;  4BE0 A;  1Q86 C;  5KCH A;  3JCM d;  5GAN 8;  3UT1 A;  4C8Q F;  1Q82 U;  3MCA B;  3O8V A;  2D0Q B;  3OQ5 A;  2KK4 A;  1GXI E;  2DAQ A;  3OMC A;  3MET A;  3CPW A;  4OMF B;  5C0M A;  2HQE A;  1KG1 A;  4Y91 A;  3LLR A;  5A0D A;  1VQK A;  4QVD A;  1KQ2 A;  3GNF B;  3GNG A;  2CZ6 B;  2CKK A;  4J83 A;  2OTJ T;  2FL7 A;  3EFR A;  4PJO F;  1VIF A;  2X4W A;  5CVI A;  3CBM A;  4ELZ C;  2P0P A;  3S6W A;  2GF7 A;  2KVQ G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...