2MCNA

Distinct ubiquitin binding modes exhibited by sh3 domains: molecular determinants and functional implications
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
57
structure length
57
Chain Sequence
VDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle/signaling protein
molecule keywords CD2-associated protein
publication title Distinct ubiquitin binding modes exhibited by SH3 domains: molecular determinants and functional implications.
pubmed doi rcsb
source organism Mus musculus
total genus 7
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2mcnA00
2DJQA 2EQIA 2EYZA 2D8HA 3FJ5A 2M0YA 2GBQA 3H0FA 3KFVA 1G83A 1WIEA 1WI7A 1M8MA 2F2XA 3M0SA 2AKLA 2CH4A 2KE9A 4AFZC 1NEGA 1YP5A 2KXCA 2LX7A 2RF0A 2KT8A 2QDLA 2RQTA 2DL7A 1U3OA 2KYMA 4FSSA 1GFCA 2KROA 2OI3A 2J05A 2V1QA 1NLPC 2JW4A 3PVLA 2CSIA 2VKNA 2AK5A 4ZNXA 1QKXA 2CSQA 1JXOA 1BK2A 1HSQA 2EBPA 1ZSGA 4RTZA 1VYTA 1KFZA 2RMOA 1UDLA 2K3BA 3EHQA 5I11A 4JJCA 1WLPB 1U5SA 2D0NA 4DEYA 4RTUA 2ESWA 2DF6A 1W6XA 2J06A 1XOVA 1X2KA 4GLMA 2ENMA 2JT4A 2O31A 4J9EA 2YSQA 4OMLA 2KR3A 4R0KA 4HVUA 2O9SA 1N5ZA 1K0XA 2NWMA 2FG0A 2KEAA 1I1JA 2EGEA 2FRWA 4RTWA 1AWXA 4IIMA 3M0UA 1PWTA 2W10A 3VS0A 1AZEA 2ED1A 2F2WA 3I5RA 4RTVA 2VWFA 3VS4A 1M27C 3UATA 1X43A 3IQLA 2XMFA 1QWEA 2CDTA 2EGCA 2GTJA 4IIOA 3VS7A 1SPKA 2LZ6B 4F16A 2PNIA 2GGRA 2OJ2A 2W0ZA 2F2VA 3VRZA 1SSHA 1KSWA 4CC3A 2MCNA 5FW9A 2OAWA 2ROTA 1T3SA 1W1FA 1X6BA 2EYYA 3M0TA 2GNCA 2JM8A 1NEBA 1JO8A 2DBKA 2AZSA 1UECA 1IO6A 2NUZA 2L3PA 3JV3A 4J9DA 2DL3A 3TSZA 3EGUA 2CH4W 2C0TA 4JJDA 1GBRA 1E6HA 2ROLA 2EYXA 1BB9A 2K6DA 2M51A 1RUWA 1JQQA 3NMZC 1K0SA 1WA7A 2HSPA 4GBQA 2FPDA 3LH5A 1ARKA 3I35A 3QWXX 2X3WD 1RLPC 1ZUYA 1WXTA 2JTEA 1B3QA 2LQNA 1HJDA 1HD3A 2BZYA 3O5ZA 1NM7A 3C0CA 3EG1A 4LE9A 5GJVB 1Y0MA 4EIKA 2DM1A 2C0OA 1PNJA 2PTKA 1I0CA 2L2PA 2K79A 4HXJA 3TVTA 4JZ4A 1FMKA 2C0IA 3H0IA 2EPDA 2JMCA 1SHFA 2HBWA 2EW3A 1K9AA 4J9FA 1PRMC 2DL5A 2L3SA 3ULRB 1S1NA 4RTTA 3THKA 4AFUC 2RQRA 1AEYA 1H3HA 1YWPA 2MOXA 3I5SA 1JU5C 1YWOA 2VVKA 2KYBA 2YUPA 3UA7A 1MV0B 2BZ8A 2BTTA 2PZ1A 2DE0X 4D8DA 3VS5A 2O2OA 2EKHA 2AKKA 4Z8AA 1RI9A 3VS3A 2HEQA 4AFSC 4F17A 2O9VA 1ZUKA 2J6OA 2YUOA 4HCKA 3PE0A 1TG0A 4HVVA 1JXMA 1OV3A 2DRKA 1BBZA 4QT7A 4J9CA 1NLOC 1VYVA 4AFQC 4AG2C 2HCKA 2YDLA 3UA6A 2DLPA 1AOJA 4RTXA 1TUCA 4OMPA 2AZVA 2K9GA 2CUBA 2RQUA 1WXUA 1Y57A 1BU1A 1QWFA 4DEXA 2P4RA 1M30A 1PKSA 2DL8A 2KRNA 3EG3A 4LN2A 2A36A 2CT4A 2FPEA 2HDAA 2CUDA 1GCPA 4J9IA 2DA9A 1K4US 1M3BA 2LJ0A 1K76A 2ABLA 5HCKA 4E6RA 2DBMA 3H41A 3M0PA 2DL4A 4JJBA 1H8KA 1AD5A 2DNUA 1TUDA 4D8KA 2EYWA 2FEIA 2A28A 2LCSA 4AG1C 4Z89A 2K2MA 3REBB 2KBTA 2KGTA 1ABQA 1VA7A 3TSWA 3NGPA 4HVWA 4OMMA 3CQTA 1KIKA 2DRMA 4OMOA 5EC7A 5GJWB 2D8JA 3EHRA 1UHCA 1AWWA 5ECAA 4ORZA 3QWYA 2J7IA 1UG1A 1PHTA 1WYXA 2LJ1A 3NPFA 1WDXA 3SEMA 2E5KA 2SRCA 2SEMA 1G2BA 2ED0A 1SRMA 2EGAA 2BZXA 1YNZA 3UF4A 1GL5A 1ZBJA 2LQWA 1SRLA 1ZLMA 3VS6A 5IHKA 2MIOA 2FPFA 1B07A 3VS1A 2YT6A 1AWOA 5IHIA 2IIMA 4LUEA 3NHNA 3RNJA 1UJ0A 1UE9A 4Y92A 1OPLA 5IXFA 1QKWA 4LNPA 1YN8A 4JZ3A 3R6NA 1U06A 1X2QA 2CREA 4LUDA 4JPBW 1OOTA 1UHFA 2RPNA 1X6GA 2LJ3A 2KT1A 1LCKA 1GBQA 1PKTA 3U23A 1SEMA 1ABOA 2V1RA 5L23A 2DVJA 1GFDA 2A08A 2JS2A 3EG2A 2DX1A 1KJWA 2L0AA 4CC7A 1OPKA 1JEGA 4J9HA 2KNBB 2LNHB 3PVQA 2RQVA 4RUGA 1E6GA 2I0NA 1MUZA 2LMJA 5FWBA 1A0NB 3VRYA 4WCIA 2RQWA 3ZL7C 1T3LA 2RN8A 1AVZC 1UTIA 2DILA 1W70A 1AZGB 2J6FA 3RBBB 1T0JA 2EVRA 4OMNA 1UUEA 4F14A 4RTYA 4J9GA 1X27A 1AWJA 1Z9QA 4A63B 3VS2A 2O88A 2B86A 2JM9A 1FYNA 2KRSA 3A98A 3SHWA 2FRYA 1EFNA 1ZX6A 5IH2A 1ZUUA 1NYGA 4M4ZA 4X1VA 1QLYA 1QCFA 1WX6A 2KXDA 2YUNA 1WFWA 4CC4B 1MV3A 1SHGA 2JMAA 2L3QA 2RNAA 3REAB 5IHNA 2GQIA 5FWCA 1M3CA 1J3TA 1YCSB 2D1XA 3EG0A 4J9BA 1K1ZA 1CKAA 2LP5A 1X69A 2CT3A 5IXBA 1GCQC 2K7AA 4Z88A 1I07A 1GCQA 2G6FX 1UJYA 1CSKA 1VYUA 4K11A 1T0HA 1CKBA 4CC2A 2J6KA 1PRLC 4OMQA 5I22A 3M0QA 3M0RA 1V1CA 2ECZA 1Z9ZA 1WXBA 2A37A 1UGVA 2DYBA 1GRIA 2YUQA 1UFFA 2FO0A 2X3XD 2JXBA 3GBQA 3I9QA 4ESRA 3H0HA 1NYFA 1H92A 1OEBA 1RLQC 1NG2A 2DMOA 2JS0A 2KRMA 4KRTA 1E7OA 1M3AA 2GTOA 2H8HA
chains in the Genus database with same CATH superfamily
5LJ3d 2DO3A 1BIAA 3SWNC 2D8HA 3FJ5A 1VQ6Q 1RAGB 1WI7A 1M9SA 3J7AF 3L2ZA 4PJOG 3M0SA 3CCSQ 2CH4A 2KE9A 4AFZC 5A0GA 1UEBA 2RF0A 5GANf 2KT8A 4HA8A 1K9MU 2QDLA 1EX4A 4BY6B 2LX9A 5LJ3g 3V7SA 2OI3A 3PMTA 2EYQA 2DZCA 5D7UA 3PVLA 4XTVA 2CSIA 1RABB 2KI7A 5FU6B 3GPLA 2R58A 4M75C 5DLQE 3CXCA 2RO0A 5LJ5f 2LDMA 1ZSGA 1OZ2A 5LL6S 2ZAEA 3CCJQ 6AT1B 2DIGA 1U5SA 2D0NA 2RI5A 2J06A 4GLMA 2JT4A 1S72A 2B8AA 4PLIA 2KR3A 4C5GA 4V2SA 2NWMA 1B34A 2A7YA 2RK2A 4LXCA 4IIMA 1OZ3A 3VS0A 3JAME 3LH0A 1MMGA 2GFAA 4RTVA 2Z0WA 3IQLA 4RMOA 4M7DD 3FB9A 5C0MA 1QWEA 2CDTA 2EGCA 3QZ5B 4X9DA 3V8LA 3JCMe 2L3RA 4IIOA 2K57A 3DB4A 2AIRB 1Q81R 1Q81C 1NJIR 1NJIC 3M9QA 4QVDA 3CCQT 2MCNA 2MK5A 5FW9A 3L2UA 1T3SA 1VQ9A 2EQKA 4FM4B 3QYHB 5D6YA 2GNCA 2D9TA 1NEBA 5CQXA 2AZSA 1BI3A 1UECA 3QJYA 1YI2A 4C8QA 2DL3A 4M7AC 2C0TA 4MMKA 4RCCA 5FU7C 3CCLT 2L89A 1GBRA 3JCMh 4QQDA 1YITT 1D0ZA 4HCZA 1JQQA 3FRNA 3NMZC 1WHHA 1QMCA 2HSPA 2X4YA 4FCYA 2XU8A 2FPDA 3RUXA 3LH5A 1RLPC 5LJ5d 1WXTA 2JTEA 3RR6A 5D6XA 1HD3A 1YJNQ 3O5ZA 3SWNB 2YXYA 1KG1A 3MKDA 1Y0MA 5GJVB 4ATOA 3OYEA 1OU9A 5GAN2 3OSSC 3M4GA 1ZBXA 3M57A 2PTKA 2JJ9A 2KSSA 2YWWA 3FDRA 2K79A 4BI4A 1FMKA 1JJ2S 2JMCA 1SHFA 3OYGA 1K9AA 2QGFB 3CEYA 1PRMC 3NTHA 2X4JA 5LJ5g 4FYVB 5KYXA 4HCBA 1AHJB 4JDSA 1AEYA 2QQAA 3I5SA 1YWOA 3MPUB 2YUPA 4FYWB 4XU3A 1QVPA 2DD4A 2JZ2A 3QDRB 4MDWA 4D8DA 2O2OA 4M77D 3N5BB 2ZCFB 2HEQA 2O9VA 3C4SA 1S72Q 3X20B 1ZUKA 3CPFA 3G6EA 3PE0A 4HVVA 3V7CA 3RERA 4FIBA 2DRKA 1BBZA 4QT7A 2F1LA 3VJPA 3CD6T 4A4HA 4LD9K 1N9SA 4RTXA 3MEAA 1D1CA 2O4XA 3RMSA 1M1KR 1M1KC 2RQUA 4OB1B 1M30A 3J81E 3EG3A 4LN2A 1KK7A 5CR2A 2A36A 2FPEA 2HDAA 3QO3A 1C0MA 3INZA 4D6WA 2QXFA 4XU1A 1ZHIA 4E6RA 3H41A 2DL4A 5I2SA 1VQ9Q 1MMNA 1TUDA 5FROA 4D8KA 2EYWA 3NTKA 4ELYC 1FXXA 1IRXA 2HBPA 4M77C 2MMPA 1YI2Q 4C0ZA 1KD1U 2F5KA 4C5HA 5GMKm 4DQ2A 1FMWA 2KBTA 2KGTA 2CGHA 3TSWA 4M7AB 3NGPA 5FU7B 2QA4T 1D0XA 3VKIA 3ZBDA 4C8QG 1VQ7T 3X26B 4MZMA 2DXBA 5EG2A 2DEQA 2YRCA 5EC7A 3KBGA 5GJWB 4C92D 1VQMA 3G71T 4ORZA 2J7IA 1KHCA 3NPFA 3OYHA 2SEMA 4RG2A 4XTYA 3QXEB 3A1PA 3CCRQ 4QVZA 4M7DB 3UF4A 1N27A 5GAN3 3VS6A 1I4K1 3EGDA 1EZZB 2FPFA 1B07A 1VQPA 4KH0B 2YT6A 1AWOA 4C0GA 3HHTB 3X28B 3C95A 5DY9A 3OBWA 3JRZA 3P8DA 3EG9A 1IXDA 3RKYA 3OMGA 4LNPA 1YN8A 4JZ3A 4DBQA 3M56A 1Q82U 4KGVB 1SF9A 4PJOC 1UHFA 1WZOA 1LCKA 1GBQA 1SEMA 1W2BA 2DIQA 3S3MA 1MMAA 2PVDB 2A3LA 2JS2A 4FYXB 2DX1A 5IN1A 3CXCS 3HFOA 4FYYB 2YLBA 2RQVA 3G6EQ 1E6GA 2DKGA 2I0NA 1D1AA 4IUTA 4M75G 3ZL7C 2YRDA 3SFMA 1AVZC 4LDVA 3ER0A 1VQ4A 4PJLA 1R0CB 4F14A 2RJEA 1X27A 1M4ZA 2PVOB 1N8RU 4ELZC 2EQJA 4MZTA 1QCOA 5GAMh 1VQNA 2KRSA 3A98A 1YJWA 3M55A 2DD5A 2LT4A 1KQSS 2VUBA 2R5MA 3MP6A 1W4SA 4M77B 2QEXT 1WX6A 3OQ5A 2KXDA 4ME7A 3RKXA 2JMAA 1PM3A 5IHNA 2EAYA 3DB3A 2D1XA 4J6WA 2LP5A 5KE2A 2DXCA 3FC3A 1QP2A 1VQMQ 4M78F 2E10A 1LJOA 3CCVA 4O6JA 1TSFA 1GCQA 5GAOr 1VQKT 2RJCA 1VQ8A 4IKFA 1XTDA 1Y71A 4ZN1A 5KH6A 2PQWA 4OMQA 3M4YA 2V26A 2ECZA 4IURA 2A37A 1VQPQ 5A2QE 1GRIA 2DXUA 4NS5A 1WHGA 2FO0A 1FWZA 4N0AC 1NYFA 2JUFA 1YJ9T 2COWA 3HKSA 2CZ0B 3CPWP 2K3XA 5LJ3h 2KRMA 4KH1B 2DJQA 4QQ6A 1H641 4EMKB 4N4GA 9ATCB 3KFVA 1G83A 1WIEA 4NOYA 3T9NA 3TCJA 3QKJA 3R6OA 3QZ9B 1NEGA 2KXCA 2LX7A 1G3TA 3JB9G 2DL7A 1FMVA 2KROA 3EFRA 4QW2A 2J05A 3CMAT 3PMIA 1YITA 5CAIA 4BE1A 1VQ4Q 3I55A 4C8QD 4XTUA 1JXOA 1RAIB 1NE8A 1BK2A 1HSQA 2K3BA 3QIIA 3Q1JA 1WLPB 3OW2A 2ESWA 3EH2A 3OYYA 5GAOm 3L2WA 1YHQA 3CMEA 2ENMA 2O31A 1VQNQ 2YSQA 4OMLA 1YJWQ 5L8RE 3RESA 2LCCA 3P8HA 5M9OA 2RHZA 4HVUA 1PC0A 2L8DA 1N5ZA 2O9SA 5GAMd 2Y4XA 4E7IA 4C5EA 4RTWA 1AWXA 3M0UA 1AZEA 2W10A 2ED1A 4C0FA 2MI6A 2VWFA 4KUIA 4XU2A 1X43A 3UATA 2XMFA 4O5VA 2LC4A 2GTJA 3OMCA 2BKDN 3JCMb 3VS7A 5HY6A 5LJ3j 4HKEA 2PNIA 1LPLA 2BIVA 5CKEA 2NUPA 3J80E 2F2VA 1BKBA 3OS1A 5GAMg 5GMKh 3CCVQ 2VGNA 4F7UG 1W1FA 3M0TA 4PKCC 4C8QC 1VQ8Q 3BFMA 5I2MA 1V76A 2DBKA 3G4ST 2JN0A 3VU3C 3CCMT 2L3PA 4M7DF 3TSZA 3EGUA 2CH4W 3GNGA 3M54A 3CCET 3DLLA 3CD6A 4JJDA 5CVIA 2M1HA 1KD1R 3GOXA 1KD1C 4BB7A 4M75D 4R56A 2EYXA 1BB9A 2M51A 2EJFA 1WJSA 1QVFA 2DTIA 1K0SA 1WA7A 5LJ5h 4J6XA 1RAAB 4C5IA 4IUQA 4N0AA 1QVGS 1B3QA 1PD1A 3C94A 1QP3A 1HJDA 2EQMA 3C0CA 2DM1A 2VGMA 4MMLA 4M78C 1M1GA 2VXEA 4JZ4A 1W2BS 2HBWA 5GAN7 2EW3A 2WACA 1VQOT 2DL5A 4UC4A 2COZA 1S1NA 4RTTA 2RI3A 2X4XA 3QSUA 1Q7YR 1Q7YC 2QA4A 5FRNA 1Q95G 1UGQB 1YITQ 4KGXB 1YWPA 5HK3A 1XJWB 2VVKA 2KYBA 3I55Q 3UA7A 1MV0B 2IVWA 1Q82R 3WVEB 1Q82C 5GAOp 3CC7T 2EKHA 2AKKA 1Q86U 4Z8AA 1G3WA 4BDYA 3OS5A 5FRMA 2PU9B 1BIBA 5GMKj 4PFZA 4F17A 4OGCA 1YHQQ 3CMEQ 4ZGJB 2VB6A 4ZTJA 1MGQA 2QDYB 4M7AD 2E3HA 4HCKA 4A53A 1JXMA 5I21A 1B34B 4BACA 1RACB 1VQLA 1VQ5Q 4GLKA 2HCKA 4JLGA 1U1TA 2FVUA 3A8GB 3UA6A 2DLPA 2GCXA 1TOVA 4OMPA 3CCUA 4LDXA 2CUBA 3SD4A 1Y57A 2R57A 1IGUA 2JNGA 2E64A 2CUDA 1F1BB 5LJ5j 4J9IA 1K4US 2CZ1B 2E12A 2ABLA 5HCKA 2DBMA 3M0PA 1N8RR 2C06A 1N8RC 1H8KA 1IGQA 2DNUA 1JBMA 4M7DE 2NUTB 3LYIA 4C8QB 4AG1C 1M1FA 3OYFA 1I8FA 2LNVA 4Z89A 2K2MA 4ANJA 4JLIA 4RKUE 1KQ2A 3CD6Q 3L2RA 1ABQA 1ZA1B 5KYWA 2QAZA 4J5YA 1D1BA 5GANd 3JB9D 4XK8E 3PIOA 1KIKA 1O75A 3OW2P 3LW5E 5ECAA 3QWYA 4J83A 2OTLA 1UG1A 2LJ1A 1WDXA 2E5KA 1G2BA 4DOVA 2I2LA 1GL5A 1K8AU 2XHCA 5KCHA 5GANg 1SRLA 1RL2A 2QI2A 3JCMQ 2P0PA 1B7TA 3EFOA 2IIMA 4C92F 3L42A 2QEXA 3JB9I 4P5NA 2RM4A 4Y92A 4M78A 4HT9A 3OA6A 3A5ZB 2QA4Q 3UPUA 3D7SB 3CCJT 4Y28E 2OAUA 2HD0A 2EKOA 1X6GA 4XQ3A 2LJ3A 2FZCB 2KT1A 4E7SA 3O8VA 1BI0A 4AT1B 2XDBA 2KK4A 4M75B 2DVJA 2L5QA 2A08A 3M59A 1KJWA 2L0AA 1Y96A 1OPKA 3SB2A 4BI8B 4FT4A 2KNBB 1IHVA 4PJMA 4FW1A 4RUGA 1MUZA 3OYMA 1VQLQ 1QVFP 1K73R 3VRYA 1K73C 2CP6A 1A0NB 4WCIA 3JCMf 2RQWA 4AMCA 2QYZA 1X75C 2KQWA 2J6FA 1PD0A 3CCUQ 4XTZA 3RBBB 1T0JA 2EVRA 3E9GA 1M2VA 1QW1A 2RJFA 2QQBA 4Q5WA 1UUEA 4LDUA 1M5Q1 3A8OB 4Y91A 2EJ9A 3KUFA 4A63B 3JCMP 1WHLA 4DOWA 2D6FA 2JM9A 4E7HA 3CPWA 3SHWA 4X9CA 1ZX6A 3OYLA 2BE9B 1QCFA 2FZKB 3HL8A 2YUNA 1WFWA 4CC4B 4PJOD 2L3QA 3CMAA 5GAOq 5FWCA 3EG0A 1K1ZA 1CKAA 2QQ9A 3PTAA 3BE3A 5IXBA 1YJNT 5KYUB 3M53A 2H3EB 2OTLQ 1GCQC 4WF2A 5IT9E 4NL3A 2MWOA 2VXFA 1D09B 3GIBA 1VIFA 1QVFS 2G6FX 2V8JA 1UJYA 3LGLA 4NL2A 3UWNA 1G5VA 3V8KA 4C92E 1T0HA 3EGDB 4GY5A 2J6KA 2MYSA 5KYYA 5I22A 3M0QA 3M0RA 3E9FA 3CC4A 1IHWA 1G3YA 3L2VA 2DYBA 2P84A 2F69A 2YUQA 3QYGB 1R77A 1MHNA 2X3XD 2QEXQ 1WHKA 4A4GA 3AT1B 4ESRA 4JUVA 1H92A 2DMOA 1RAHB 1E7OA 2DK3A 2EQIA 1YIJT 2YRVA 4M78G 5CCAA 2M0YA 3G7ZA 4M7DA 3HRSA 4IUVA 2LRQA 2X35A 3LWIA 4PFPA 1M8MA 2F2XA 5HKCA 4EMGA 3G4SA 1TUGB 2EFIA 1PCXA 2KMTA 3CCMA 2NLUA 3E19A 1U3OA 5GAMe 4FSSA 2BE7D 3URGA 2V1QA 1R0BG 1NLPC 2JW4A 4N4IA 1K9MR 2VKNA 1K9MC 3VYGA 4A4EA 2VC8A 4ZNXA 1QKXA 2CSQA 3BDUA 3KXTA 3JB9J 2XICA 4HT8A 5J3BA 1N9RA 3VV0A 2EBPA 2QTXA 1VQ9T 1Y07A 5CKFA 3HFNA 1KFZA 2RMOA 1UDLA 2M02A 2RI2A 4E47A 4RTUA 3FLGA 2DF6A 1Q86R 1Q86C 1XOVA 1X2KA 2YLCA 4J9EA 1X01A 2K5LA 1OU8A 4L5GA 2BUDA 1K0XA 3HP9A 2FG0A 1I1JA 2EGEA 2FRWA 4R55A 2FZGB 2F2WA 1YFNA 1Q81U 3I5RA 1NJIU 4OMFB 2ZPIB 4L6V5 4F7UB 2GF7A 2XDPA 2MF2A 4J7FA 4FL6A 3CCRT 3LGFA 1SKUB 2ZGWA 2OJ2A 2W0ZA 3QPHA 2VASA 2OAWA 2ROTA 1X6BA 2EYYA 2XI9A 2P0KA 5LJ3e 3OYAA 4JRPA 5D6WA 1IO6A 2NUZA 2X9HA 2IG0A 3JV3A 4FSXA 3CC4Q 3QJ6A 4J9DA 3E1SA 1MMDA 1OYXA 2ROLA 4A54A 4LD6A 4E7JA 4GBQA 1XNIA 1ARKA 1OX8A 3QWXX 2X3WD 2OTJT 1KC8U 4L59A 1RAFB 3HSBA 4J8OA 1R8OB 2BZYA 4PJOB 3CCQA 1PNJA 1I0CA 8AT1B 4M75F 3G4SQ 3P8BB 4HXJA 2HSEB 1K8AR 1K8AC 4KT0E 4M7DG 1YBYA 5GAMj 2EPDA 4EPCA 4J9FA 1M2OA 2L3SA 3ULRB 3OS0A 2X4WA 3TQ7P 3H8ZA 4AFUC 3PGGA 1V29B 2CP3A 3ZEHA 2MOXA 3CCLA 5DLOA 2CKKA 4ZGDB 2BZ8A 1ZSZA 2BTTA 2PZ1A 1I5LA 2MWPA 1WNLA 1KHIA 3VS5A 3OY9A 5KCOA 1X6OA 2A0FB 4C92A 1IREB 2QK0A 3RMQA 1YCYA 1LVKA 5KYNA 2YUOA 1TG0A 1OV3A 5J26A 3OB9A 5GMKe 1OQKA 1NLOC 2QASA 1VIEA 2HQXA 5FU6C 3CPWS 1AOJA 1TUCA 4E7KA 2LQKA 2XDDA 1VQMT 3S3NA 1WXUA 4DEXA 1PKSA 1WHMA 2KRNA 3CBOA 3OYKA 2CT4A 2V8KA 1GCPA 2NUPB 4KULA 1M3BA 5KE3A 2LJ0A 1K76A 4M7AF 3ME9A 3OYIA 4JJBA 4M78D 2JOYA 3HTRA 5LJ5e 2A28A 2LCSA 3M58A 4X34A 2DTHA 7AT1B 3LWHA 1C6VX 1U8RA 1D3BA 5GANh 1MNDA 1VA7A 2EIFA 4HVWA 1BCMA 1RAEB 2DXTA 1UGRB 3A8HB 1HK9A 3EHRA 1UHCA 1D0YA 3TU4K 3LLRA 3VUZA 4A4FA 1PHTA 1WYXA 1FX7A 4LDWA 3OYCA 3GP8A 3OYDA 1UB4A 2ED0A 4M75E 2HZYA 2Y4YA 2EGAA 2BZXA 1YNZA 3CCQQ 4MZPA 1HXDA 1ZQ1A 2K5FA 3EGXA 3VS1A 3FEOA 5IHIA 4LUEA 3NHNA 1SG5A 2KVQG 1OPLA 5CO7A 1RADB 5IXFA 2P0QA 3FIFA 3OYNA 1U06A 2CREA 2DZ9A 4LUDA 3CCLQ 3CC2T 4E7ZA 4JPBW 4II1A 3META 2RHIA 1SSFA 1YJNA 1VQ7A 3U23A 1BI1A 2K5IA 3HRUA 1VQNT 3JCMJ 2V1RA 3QDFA 2LQ8A 1YJWT 5L23A 2R5AA 3G71A 3EG2A 4QVCA 1OX9A 3MEWA 4CC7A 1NZ9A 2QQSA 4FT2A 5CKDA 4PL6A 1OULA 4OB0B 3EFSA 2LMJA 5FWBA 4C92G 4MDXA 1NPRA 4OB3B 1T3LA 2RN8A 1UTIA 3ASKA 5GANj 2HKQB 5AYFA 2DILA 3MO8A 2HQHA 1I81A 4M7AE 4OMNA 1UGSB 1VUBA 4PJJA 2IPOB 4F04B 3CCVT 4M77F 2H3JA 4KUDK 2CS7A 1G8XA 1AWJA 2CP7A 4F7UF 1YIJA 2DPPB 1VQ8T 4OB2B 3I56T 3TREA 4JJNK 2O88A 2B86A 4QKUA 1FYNA 3TEEA 3QBYA 1WQ7A 2HMAA 1IB8A 5GAN8 2DFUA 5IH2A 1PSEA 1ZUUA 1NYGA 4M4ZA 2RK1A 4X1VA 1WGSA 2P4TA 5KYWB 1M8VA 1TU0B 1JJ2P 1SHGA 1ACMB 2RNAA 2HAXA 2LTOA 1J3TA 1YCSB 2WSFE 1KQSA 4BDZA 4J9BA 4BE2A 2FL7A 4EDUA 8ATCB 1VQ6T 4CI0C 1XQHA 4BUGA 4XTWA 2DJZA 2NYSA 2F5TX 1I07A 2QG9B 5GAN4 1UGPB 1CSKA 2NUTA 1VYUA 4ZN3A 4PNOA 1WPYA 3CCST 3OYJA 1O9SA 4PJOF 1PRLC 1V1CA 3A8LB 3EFOB 1Z9ZA 1WXBA 2FHDA 5GAOn 2M9UA 2QTVA 2VYTA 1QQJA 5C6SA 1ZA2B 4EMHA 3LX7A 2GQVA 3OS2A 3I55T 4M78B 2DYIA 3I9QA 3PT9A 5KYXB 4DBRA 1GXIE 3JCMV 1WJRA 1NG2A 5CKHA 4KRTA 4IUUA 5FLXE 2GTOA 4M7DC 2EYZA 1VQ7Q 3CCRA 1YHQT 3CMET 1PG5B 1AT1B 2GBQA 3H0FA 1KC8R 4YTLA 1KC8C 3G71Q 3SWNA 1Y96B 3VUBA 1VQ5T 2LVMA 2XD0A 1M90U 2AKLA 1VQKA 2HL5C 4E7LA 5CIUA 2AHJB 1YP5A 3V8JA 4KBMB 3PNWC 2RQTA 2KYMA 2E6ZA 2GFUA 1PSFA 4BD3A 1C1AA 2E5QA 1GFCA 1QCNA 4M77E 3OW2S 1U1SA 3MJXA 3NFCA 1NBEB 1M2VB 1LNXA 4F7UE 2O4XB 4A4KA 3QUIA 2AK5A 2ATCB 3EAEA 4PJNA 4XAXB 1YJ9A 4DBHA 2CP2A 2E1HA 1BI2A 2HL3A 1VYTA 4RTZA 5AT1B 5GMKi 5I11A 3EHQA 4M75A 2OTJA 1YIJQ 4JJCA 3OBYA 4DEYA 1W6XA 3RIRA 5J39A 3S3OA 2E3IA 2XKOC 4R0KA 3BY7A 2YHTA 3RDVA 2KEAA 2QGGA 1OI1A 1PWTA 4OP0A 3DLMA 3VS4A 3JB9H 2OX7A 1M27C 1VOMA 2DTOA 2HKNA 2EWNA 1SPKA 2LZ6B 1N6AA 4F16A 2Y90A 2GGRA 3JCMc 3VRZA 1I5OB 1SSHA 1KSWA 4CC3A 4PJOE 1TWBA 2RHUA 4IUPA 1JRIA 2ZZDA 2DEUA 2JM8A 5KYYB 1JO8A 2V8IA 1KQ1A 5GMKl 5CKBA 4B9WA 4XTXA 3G1JA 3WVDB 3CBPA 3CXCP 2XG8D 1E6HA 2DVEA 2K6DA 4M7AA 3VYHB 1RUWA 3EG9B 3JCMd 5CK9A 5KYUA 2PUOB 2RH2A 2RA2A 2AT1B 3I35A 4FW2A 1ZUYA 2LQNA 2COYA 1NM7A 3EG1A 4LE9A 3MHXA 2VV5A 2PUKB 2O01E 4EIKA 1S72T 2C0OA 3MEUA 1VQLT 4JS5A 1H3ZA 2L2PA 2ZPGB 3NTIA 1Q7YU 3MEVA 3JCMg 4J7IA 3TVTA 1VQKQ 2C0IA 2ZPHB 1QVGA 3H0IA 3CCUT 1KQSP 4OVAA 4VUBA 3S6WA 4B6MA 3EH1A 2HNIA 1RI0A 4KGZB 3THKA 2RQRA 1ZSZC 4EMKC 1H3HA 3CCEA 3M5AA 1JU5C 2M0OA 1WQWA 1WJQA 4ZGEB 4J6YA 4TVRA 1YJ9Q 2DE0X 1JB0E 2PVGB 2E65A 2RHXA 3C12A 4C92C 2OTJQ 4CRIA 2JTFA 1RI9A 2M16A 3VS3A 3MP1A 4PK4A 4AFSC 1TXQA 1YI2T 2J6OA 3L2QA 4QQGA 4JRQA 4LDYA 4AFQC 4J9CA 1VYVA 4AG2C 2E4HA 2MAMA 3HRTA 2YDLA 4ZTFA 1BYMA 4C0DC 2DERA 1G3SA 4E2FB 4DBFA 2AZVA 2K9GA 4C8QF 1VQOA 1BU1A 1QWFA 2JVVA 2OTLT 2P4RA 3CC2A 2DL8A 3AHUA 4JS4A 2ZPBB 3CMAQ 4WTOB 3UT1A 2DA9A 4PLLA 2WSCE 1MNEA 1AD5A 5GAN6 3CC7A 2RJDA 2FEIA 3BDLA 1LOJA 5DM7R 2FB7A 3RKWA 3REBB 1DJ7B 4M77A 3X24B 3JCMX 3FJPA 4OMMA 4F7UA 2QQRA 3CQTA 2ZPEB 2DRMA 4OMOA 3F70A 2CZ6B 2KDSA 2D8JA 1AWWA 4PFOA 4M7AG 3SEMA 2SRCA 4N4HA 3I56A 4OF1A 1SRMA 5CQYA 3WXMB 1TS9A 5A0DA 1ZBJA 4DA4A 5GAMf 2LQWA 2XIDA 1ZLMA 3G6ET 5IAYA 4HCCA 5IHKA 2MIOA 2E70A 3QG1A 2XK0A 4B9XA 3RNJA 1UJ0A 3OSVA 3CCMQ 1UE9A 4JRKA 3HPWA 2CP5A 3QHSA 1QKWA 3X25B 3R6NA 1X2QA 2LT1A 3CCEQ 2EJGA 1ZSZB 3BW1A 1OOTA 1HYOA 2RPNA 1PKTA 1ABOA 1VQ6A 4PJOA 4EMKA 1JJ2A 4C92B 1GFDA 3H6ZA 3E2UA 1K73U 1JEGA 2RHYA 1BCOA 4J9HA 3CCSA 2LNHB 3PVQA 2JTMA 2FYKA 4BY6C 1M90R 1Y7XA 1M90C 4C8QE 3CBMA 4RCBA 1M1KU 2K4YA 1NPPA 1W70A 2CP0A 1AZGB 3ZFJA 4C0DB 1WHJA 1VQOQ 4JRIA 3CC2Q 2E6NA 4Z02A 5GANe 4RTYA 4J9GA 5LJ3f 4OGEA 5GAOl 3CCJA 1Z9QA 3MCAB 3GLXA 3VS2A 2K2VA 1QVGP 2G3RA 5HK0A 3CC4T 3CC7Q 2FRYA 1EFNA 1VQ5A 2X51A 3H9NA 3SDZA 1VQPT 1D3BB 2DAQA 3PFSA 1QLYA 5GAN5 2EQUA 4M78E 4BI3A 1W2BP 1MV3A 2E41A 3UDCA 3JCMW 3REAB 5A0LA 2GQIA 4RG8A 1M3CA 3DKMA 2WSEE 1TH7A 2RB6A 1IZ6A 1X69A 3GNFB 2CT3A 4M77G 2RD1A 2LCLA 2K7AA 3GF5A 4Z88A 3I56Q 2ZPFB 4XU0A 2K3YA 4K11A 2MPXC 1CKBA 3EGXB 4CC2A 1EIFA 3JSCA 1TTHB 2KAFA 1UGVA 2DETA 3JB9F 1UFFA 3OYBA 3PIPA 2KY9A 4BE0A 2D0QB 2JXBA 3GBQA 3L1AA 4FU6A 3V7RA 3H0HA 1VQ4T 1OEBA 1RLQC 2HQEA 1P92A 3A8MB 2CYZB 2JS0A 1M3AA 2CZ7B 3MP8A 2H8HA
chains in the Genus database with same CATH topology
2DJQA 2EQIA 2EYZA 2D8HA 3FJ5A 2M0YA 2GBQA 3H0FA 3KFVA 1G83A 1WIEA 1WI7A 1M8MA 2F2XA 3M0SA 2AKLA 2CH4A 2KE9A 4AFZC 1NEGA 1YP5A 2KXCA 2LX7A 2RF0A 2KT8A 2QDLA 2RQTA 2DL7A 1U3OA 2KYMA 4FSSA 1GFCA 2KROA 2OI3A 2J05A 2V1QA 1NLPC 2JW4A 3PVLA 2CSIA 2VKNA 2AK5A 4ZNXA 1QKXA 2CSQA 1JXOA 1BK2A 1HSQA 2EBPA 1ZSGA 4RTZA 1VYTA 1KFZA 2RMOA 1UDLA 2K3BA 3EHQA 5I11A 4JJCA 1WLPB 1U5SA 2D0NA 4DEYA 4RTUA 2ESWA 2DF6A 1W6XA 2J06A 1XOVA 1X2KA 4GLMA 2ENMA 2JT4A 2O31A 4J9EA 2YSQA 4OMLA 2KR3A 4R0KA 4HVUA 2O9SA 1N5ZA 1K0XA 2NWMA 2FG0A 2KEAA 1I1JA 2EGEA 2FRWA 4RTWA 1AWXA 4IIMA 3M0UA 1PWTA 2W10A 3VS0A 1AZEA 2ED1A 2F2WA 3I5RA 4RTVA 2VWFA 3VS4A 1M27C 3UATA 1X43A 3IQLA 2XMFA 1QWEA 2CDTA 2EGCA 2GTJA 4IIOA 3VS7A 1SPKA 2LZ6B 4F16A 2PNIA 2GGRA 2OJ2A 2W0ZA 2F2VA 3VRZA 1SSHA 1KSWA 4CC3A 2MCNA 5FW9A 2OAWA 2ROTA 1T3SA 1W1FA 1X6BA 2EYYA 3M0TA 2GNCA 2JM8A 1NEBA 1JO8A 2DBKA 2AZSA 1UECA 1IO6A 2NUZA 2L3PA 3JV3A 4J9DA 2DL3A 3TSZA 3EGUA 2CH4W 2C0TA 4JJDA 1GBRA 1E6HA 2ROLA 2EYXA 1BB9A 2K6DA 2M51A 1RUWA 1JQQA 3NMZC 1K0SA 1WA7A 2HSPA 4GBQA 2FPDA 3LH5A 1ARKA 3I35A 3QWXX 2X3WD 1RLPC 1ZUYA 1WXTA 2JTEA 1B3QA 2LQNA 1HJDA 1HD3A 2BZYA 3O5ZA 1NM7A 3C0CA 3EG1A 4LE9A 5GJVB 1Y0MA 4EIKA 2DM1A 2C0OA 1PNJA 2PTKA 1I0CA 2L2PA 2K79A 4HXJA 3TVTA 4JZ4A 1FMKA 2C0IA 3H0IA 2EPDA 2JMCA 1SHFA 2HBWA 2EW3A 1K9AA 4J9FA 1PRMC 2DL5A 2L3SA 3ULRB 1S1NA 4RTTA 3THKA 4AFUC 2RQRA 1AEYA 1H3HA 1YWPA 2MOXA 3I5SA 1JU5C 1YWOA 2VVKA 2KYBA 2YUPA 3UA7A 1MV0B 2BZ8A 2BTTA 2PZ1A 2DE0X 4D8DA 3VS5A 2O2OA 2EKHA 2AKKA 4Z8AA 1RI9A 3VS3A 2HEQA 4AFSC 4F17A 2O9VA 1ZUKA 2J6OA 2YUOA 4HCKA 3PE0A 1TG0A 4HVVA 1JXMA 1OV3A 2DRKA 1BBZA 4QT7A 4J9CA 1NLOC 1VYVA 4AFQC 4AG2C 2HCKA 2YDLA 3UA6A 2DLPA 1AOJA 4RTXA 1TUCA 4OMPA 2AZVA 2K9GA 2CUBA 2RQUA 1WXUA 1Y57A 1BU1A 1QWFA 4DEXA 2P4RA 1M30A 1PKSA 2DL8A 2KRNA 3EG3A 4LN2A 2A36A 2CT4A 2FPEA 2HDAA 2CUDA 1GCPA 4J9IA 2DA9A 1K4US 1M3BA 2LJ0A 1K76A 2ABLA 5HCKA 4E6RA 2DBMA 3H41A 3M0PA 2DL4A 4JJBA 1H8KA 1AD5A 2DNUA 1TUDA 4D8KA 2EYWA 2FEIA 2A28A 2LCSA 4AG1C 4Z89A 2K2MA 3REBB 2KBTA 2KGTA 1ABQA 1VA7A 3TSWA 3NGPA 4HVWA 4OMMA 3CQTA 1KIKA 2DRMA 4OMOA 5EC7A 5GJWB 2D8JA 3EHRA 1UHCA 1AWWA 5ECAA 4ORZA 3QWYA 2J7IA 1UG1A 1PHTA 1WYXA 2LJ1A 3NPFA 1WDXA 3SEMA 2E5KA 2SRCA 2SEMA 1G2BA 2ED0A 1SRMA 2EGAA 2BZXA 1YNZA 3UF4A 1GL5A 1ZBJA 2LQWA 1SRLA 1ZLMA 3VS6A 5IHKA 2MIOA 2FPFA 1B07A 3VS1A 2YT6A 1AWOA 5IHIA 2IIMA 4LUEA 3NHNA 3RNJA 1UJ0A 1UE9A 4Y92A 1OPLA 5IXFA 1QKWA 4LNPA 1YN8A 4JZ3A 3R6NA 1U06A 1X2QA 2CREA 4LUDA 4JPBW 1OOTA 1UHFA 2RPNA 1X6GA 2LJ3A 2KT1A 1LCKA 1GBQA 1PKTA 3U23A 1SEMA 1ABOA 2V1RA 5L23A 2DVJA 1GFDA 2A08A 2JS2A 3EG2A 2DX1A 1KJWA 2L0AA 4CC7A 1OPKA 1JEGA 4J9HA 2KNBB 2LNHB 3PVQA 2RQVA 4RUGA 1E6GA 2I0NA 1MUZA 2LMJA 5FWBA 1A0NB 3VRYA 4WCIA 2RQWA 3ZL7C 1T3LA 2RN8A 1AVZC 1UTIA 2DILA 1W70A 1AZGB 2J6FA 3RBBB 1T0JA 2EVRA 4OMNA 1UUEA 4F14A 4RTYA 4J9GA 1X27A 1AWJA 1Z9QA 4A63B 3VS2A 2O88A 2B86A 2JM9A 1FYNA 2KRSA 3A98A 3SHWA 2FRYA 1EFNA 1ZX6A 5IH2A 1ZUUA 1NYGA 4M4ZA 4X1VA 1QLYA 1QCFA 1WX6A 2KXDA 2YUNA 1WFWA 4CC4B 1MV3A 1SHGA 2JMAA 2L3QA 2RNAA 3REAB 5IHNA 2GQIA 5FWCA 1M3CA 1J3TA 1YCSB 2D1XA 3EG0A 4J9BA 1K1ZA 1CKAA 2LP5A 1X69A 2CT3A 5IXBA 1GCQC 2K7AA 4Z88A 1I07A 1GCQA 2G6FX 1UJYA 1CSKA 1VYUA 4K11A 1T0HA 1CKBA 4CC2A 2J6KA 1PRLC 4OMQA 5I22A 3M0QA 3M0RA 1V1CA 2ECZA 1Z9ZA 1WXBA 2A37A 1UGVA 2DYBA 1GRIA 2YUQA 1UFFA 2FO0A 2X3XD 2JXBA 3GBQA 3I9QA 4ESRA 3H0HA 1NYFA 1H92A 1OEBA 1RLQC 1NG2A 2DMOA 2JS0A 2KRMA 4KRTA 1E7OA 1M3AA 2GTOA 2H8HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DJQ A;  2EQI A;  2EYZ A;  2D8H A;  3FJ5 A;  2M0Y A;  2GBQ A;  3H0F A;  3KFV A;  1G83 A;  1WIE A;  1WI7 A;  1M8M A;  2F2X A;  3M0S A;  2AKL A;  2CH4 A;  2KE9 A;  4AFZ C;  1NEG A;  1YP5 A;  2KXC A;  2LX7 A;  2RF0 A;  2KT8 A;  2QDL A;  2RQT A;  2DL7 A;  1U3O A;  2KYM A;  4FSS A;  1GFC A;  2KRO A;  2OI3 A;  2J05 A;  2V1Q A;  1NLP C;  2JW4 A;  3PVL A;  2CSI A;  2VKN A;  2AK5 A;  4ZNX A;  1QKX A;  2CSQ A;  1JXO A;  1BK2 A;  1HSQ A;  2EBP A;  1ZSG A;  4RTZ A;  1VYT A;  1KFZ A;  2RMO A;  1UDL A;  2K3B A;  3EHQ A;  5I11 A;  4JJC A;  1WLP B;  1U5S A;  2D0N A;  4DEY A;  4RTU A;  2ESW A;  2DF6 A;  1W6X A;  2J06 A;  1XOV A;  1X2K A;  4GLM A;  2ENM A;  2JT4 A;  2O31 A;  4J9E A;  2YSQ A;  4OML A;  2KR3 A;  4R0K A;  4HVU A;  2O9S A;  1N5Z A;  1K0X A;  2NWM A;  2FG0 A;  2KEA A;  1I1J A;  2EGE A;  2FRW A;  4RTW A;  1AWX A;  4IIM A;  3M0U A;  1PWT A;  2W10 A;  3VS0 A;  1AZE A;  2ED1 A;  2F2W A;  3I5R A;  4RTV A;  2VWF A;  3VS4 A;  1M27 C;  3UAT A;  1X43 A;  3IQL A;  2XMF A;  1QWE A;  2CDT A;  2EGC A;  2GTJ A;  4IIO A;  3VS7 A;  1SPK A;  2LZ6 B;  4F16 A;  2PNI A;  2GGR A;  2OJ2 A;  2W0Z A;  2F2V A;  3VRZ A;  1SSH A;  1KSW A;  4CC3 A;  2MCN A;  5FW9 A;  2OAW A;  2ROT A;  1T3S A;  1W1F A;  1X6B A;  2EYY A;  3M0T A;  2GNC A;  2JM8 A;  1NEB A;  1JO8 A;  2DBK A;  2AZS A;  1UEC A;  1IO6 A;  2NUZ A;  2L3P A;  3JV3 A;  4J9D A;  2DL3 A;  3TSZ A;  3EGU A;  2CH4 W;  2C0T A;  4JJD A;  1GBR A;  1E6H A;  2ROL A;  2EYX A;  1BB9 A;  2K6D A;  2M51 A;  1RUW A;  1JQQ A;  3NMZ C;  1K0S A;  1WA7 A;  2HSP A;  4GBQ A;  2FPD A;  3LH5 A;  1ARK A;  3I35 A;  3QWX X;  2X3W D;  1RLP C;  1ZUY A;  1WXT A;  2JTE A;  1B3Q A;  2LQN A;  1HJD A;  1HD3 A;  2BZY A;  3O5Z A;  1NM7 A;  3C0C A;  3EG1 A;  4LE9 A;  5GJV B;  1Y0M A;  4EIK A;  2DM1 A;  2C0O A;  1PNJ A;  2PTK A;  1I0C A;  2L2P A;  2K79 A;  4HXJ A;  3TVT A;  4JZ4 A;  1FMK A;  2C0I A;  3H0I A;  2EPD A;  2JMC A;  1SHF A;  2HBW A;  2EW3 A;  1K9A A;  4J9F A;  1PRM C;  2DL5 A;  2L3S A;  3ULR B;  1S1N A;  4RTT A;  3THK A;  4AFU C;  2RQR A;  1AEY A;  1H3H A;  1YWP A;  2MOX A;  3I5S A;  1JU5 C;  1YWO A;  2VVK A;  2KYB A;  2YUP A;  3UA7 A;  1MV0 B;  2BZ8 A;  2BTT A;  2PZ1 A;  2DE0 X;  4D8D A;  3VS5 A;  2O2O A;  2EKH A;  2AKK A;  4Z8A A;  1RI9 A;  3VS3 A;  2HEQ A;  4AFS C;  4F17 A;  2O9V A;  1ZUK A;  2J6O A;  2YUO A;  4HCK A;  3PE0 A;  1TG0 A;  4HVV A;  1JXM A;  1OV3 A;  2DRK A;  1BBZ A;  4QT7 A;  4J9C A;  1NLO C;  1VYV A;  4AFQ C;  4AG2 C;  2HCK A;  2YDL A;  3UA6 A;  2DLP A;  1AOJ A;  4RTX A;  1TUC A;  4OMP A;  2AZV A;  2K9G A;  2CUB A;  2RQU A;  1WXU A;  1Y57 A;  1BU1 A;  1QWF A;  4DEX A;  2P4R A;  1M30 A;  1PKS A;  2DL8 A;  2KRN A;  3EG3 A;  4LN2 A;  2A36 A;  2CT4 A;  2FPE A;  2HDA A;  2CUD A;  1GCP A;  4J9I A;  2DA9 A;  1K4U S;  1M3B A;  2LJ0 A;  1K76 A;  2ABL A;  5HCK A;  4E6R A;  2DBM A;  3H41 A;  3M0P A;  2DL4 A;  4JJB A;  1H8K A;  1AD5 A;  2DNU A;  1TUD A;  4D8K A;  2EYW A;  2FEI A;  2A28 A;  2LCS A;  4AG1 C;  4Z89 A;  2K2M A;  3REB B;  2KBT A;  2KGT A;  1ABQ A;  1VA7 A;  3TSW A;  3NGP A;  4HVW A;  4OMM A;  3CQT A;  1KIK A;  2DRM A;  4OMO A;  5EC7 A;  5GJW B;  2D8J A;  3EHR A;  1UHC A;  1AWW A;  5ECA A;  4ORZ A;  3QWY A;  2J7I A;  1UG1 A;  1PHT A;  1WYX A;  2LJ1 A;  3NPF A;  1WDX A;  3SEM A;  2E5K A;  2SRC A;  2SEM A;  1G2B A;  2ED0 A;  1SRM A;  2EGA A;  2BZX A;  1YNZ A;  3UF4 A;  1GL5 A;  1ZBJ A;  2LQW A;  1SRL A;  1ZLM A;  3VS6 A;  5IHK A;  2MIO A;  2FPF A;  1B07 A;  3VS1 A;  2YT6 A;  1AWO A;  5IHI A;  2IIM A;  4LUE A;  3NHN A;  3RNJ A;  1UJ0 A;  1UE9 A;  4Y92 A;  1OPL A;  5IXF A;  1QKW A;  4LNP A;  1YN8 A;  4JZ3 A;  3R6N A;  1U06 A;  1X2Q A;  2CRE A;  4LUD A;  4JPB W;  1OOT A;  1UHF A;  2RPN A;  1X6G A;  2LJ3 A;  2KT1 A;  1LCK A;  1GBQ A;  1PKT A;  3U23 A;  1SEM A;  1ABO A;  2V1R A;  5L23 A;  2DVJ A;  1GFD A;  2A08 A;  2JS2 A;  3EG2 A;  2DX1 A;  1KJW A;  2L0A A;  4CC7 A;  1OPK A;  1JEG A;  4J9H A;  2KNB B;  2LNH B;  3PVQ A;  2RQV A;  4RUG A;  1E6G A;  2I0N A;  1MUZ A;  2LMJ A;  5FWB A;  1A0N B;  3VRY A;  4WCI A;  2RQW A;  3ZL7 C;  1T3L A;  2RN8 A;  1AVZ C;  1UTI A;  2DIL A;  1W70 A;  1AZG B;  2J6F A;  3RBB B;  1T0J A;  2EVR A;  4OMN A;  1UUE A;  4F14 A;  4RTY A;  4J9G A;  1X27 A;  1AWJ A;  1Z9Q A;  4A63 B;  3VS2 A;  2O88 A;  2B86 A;  2JM9 A;  1FYN A;  2KRS A;  3A98 A;  3SHW A;  2FRY A;  1EFN A;  1ZX6 A;  5IH2 A;  1ZUU A;  1NYG A;  4M4Z A;  4X1V A;  1QLY A;  1QCF A;  1WX6 A;  2KXD A;  2YUN A;  1WFW A;  4CC4 B;  1MV3 A;  1SHG A;  2JMA A;  2L3Q A;  2RNA A;  3REA B;  5IHN A;  2GQI A;  5FWC A;  1M3C A;  1J3T A;  1YCS B;  2D1X A;  3EG0 A;  4J9B A;  1K1Z A;  1CKA A;  2LP5 A;  1X69 A;  2CT3 A;  5IXB A;  1GCQ C;  2K7A A;  4Z88 A;  1I07 A;  1GCQ A;  2G6F X;  1UJY A;  1CSK A;  1VYU A;  4K11 A;  1T0H A;  1CKB A;  4CC2 A;  2J6K A;  1PRL C;  4OMQ A;  5I22 A;  3M0Q A;  3M0R A;  1V1C A;  2ECZ A;  1Z9Z A;  1WXB A;  2A37 A;  1UGV A;  2DYB A;  1GRI A;  2YUQ A;  1UFF A;  2FO0 A;  2X3X D;  2JXB A;  3GBQ A;  3I9Q A;  4ESR A;  3H0H A;  1NYF A;  1H92 A;  1OEB A;  1RLQ C;  1NG2 A;  2DMO A;  2JS0 A;  2KRM A;  4KRT A;  1E7O A;  1M3A A;  2GTO A;  2H8H A; 
#chains in the Genus database with same CATH topology
 5LJ3 d;  2DO3 A;  1BIA A;  3SWN C;  2D8H A;  3FJ5 A;  1VQ6 Q;  1RAG B;  1WI7 A;  1M9S A;  3J7A F;  3L2Z A;  4PJO G;  3M0S A;  3CCS Q;  2CH4 A;  2KE9 A;  4AFZ C;  5A0G A;  1UEB A;  2RF0 A;  5GAN f;  2KT8 A;  4HA8 A;  1K9M U;  2QDL A;  1EX4 A;  4BY6 B;  2LX9 A;  5LJ3 g;  3V7S A;  2OI3 A;  3PMT A;  2EYQ A;  2DZC A;  5D7U A;  3PVL A;  4XTV A;  2CSI A;  1RAB B;  2KI7 A;  5FU6 B;  3GPL A;  2R58 A;  4M75 C;  5DLQ E;  3CXC A;  2RO0 A;  5LJ5 f;  2LDM A;  1ZSG A;  1OZ2 A;  5LL6 S;  2ZAE A;  3CCJ Q;  6AT1 B;  2DIG A;  1U5S A;  2D0N A;  2RI5 A;  2J06 A;  4GLM A;  2JT4 A;  1S72 A;  2B8A A;  4PLI A;  2KR3 A;  4C5G A;  4V2S A;  2NWM A;  1B34 A;  2A7Y A;  2RK2 A;  4LXC A;  4IIM A;  1OZ3 A;  3VS0 A;  3JAM E;  3LH0 A;  1MMG A;  2GFA A;  4RTV A;  2Z0W A;  3IQL A;  4RMO A;  4M7D D;  3FB9 A;  5C0M A;  1QWE A;  2CDT A;  2EGC A;  3QZ5 B;  4X9D A;  3V8L A;  3JCM e;  2L3R A;  4IIO A;  2K57 A;  3DB4 A;  2AIR B;  1Q81 R;  1Q81 C;  1NJI R;  1NJI C;  3M9Q A;  4QVD A;  3CCQ T;  2MCN A;  2MK5 A;  5FW9 A;  3L2U A;  1T3S A;  1VQ9 A;  2EQK A;  4FM4 B;  3QYH B;  5D6Y A;  2GNC A;  2D9T A;  1NEB A;  5CQX A;  2AZS A;  1BI3 A;  1UEC A;  3QJY A;  1YI2 A;  4C8Q A;  2DL3 A;  4M7A C;  2C0T A;  4MMK A;  4RCC A;  5FU7 C;  3CCL T;  2L89 A;  1GBR A;  3JCM h;  4QQD A;  1YIT T;  1D0Z A;  4HCZ A;  1JQQ A;  3FRN A;  3NMZ C;  1WHH A;  1QMC A;  2HSP A;  2X4Y A;  4FCY A;  2XU8 A;  2FPD A;  3RUX A;  3LH5 A;  1RLP C;  5LJ5 d;  1WXT A;  2JTE A;  3RR6 A;  5D6X A;  1HD3 A;  1YJN Q;  3O5Z A;  3SWN B;  2YXY A;  1KG1 A;  3MKD A;  1Y0M A;  5GJV B;  4ATO A;  3OYE A;  1OU9 A;  5GAN 2;  3OSS C;  3M4G A;  1ZBX A;  3M57 A;  2PTK A;  2JJ9 A;  2KSS A;  2YWW A;  3FDR A;  2K79 A;  4BI4 A;  1FMK A;  1JJ2 S;  2JMC A;  1SHF A;  3OYG A;  1K9A A;  2QGF B;  3CEY A;  1PRM C;  3NTH A;  2X4J A;  5LJ5 g;  4FYV B;  5KYX A;  4HCB A;  1AHJ B;  4JDS A;  1AEY A;  2QQA A;  3I5S A;  1YWO A;  3MPU B;  2YUP A;  4FYW B;  4XU3 A;  1QVP A;  2DD4 A;  2JZ2 A;  3QDR B;  4MDW A;  4D8D A;  2O2O A;  4M77 D;  3N5B B;  2ZCF B;  2HEQ A;  2O9V A;  3C4S A;  1S72 Q;  3X20 B;  1ZUK A;  3CPF A;  3G6E A;  3PE0 A;  4HVV A;  3V7C A;  3RER A;  4FIB A;  2DRK A;  1BBZ A;  4QT7 A;  2F1L A;  3VJP A;  3CD6 T;  4A4H A;  4LD9 K;  1N9S A;  4RTX A;  3MEA A;  1D1C A;  2O4X A;  3RMS A;  1M1K R;  1M1K C;  2RQU A;  4OB1 B;  1M30 A;  3J81 E;  3EG3 A;  4LN2 A;  1KK7 A;  5CR2 A;  2A36 A;  2FPE A;  2HDA A;  3QO3 A;  1C0M A;  3INZ A;  4D6W A;  2QXF A;  4XU1 A;  1ZHI A;  4E6R A;  3H41 A;  2DL4 A;  5I2S A;  1VQ9 Q;  1MMN A;  1TUD A;  5FRO A;  4D8K A;  2EYW A;  3NTK A;  4ELY C;  1FXX A;  1IRX A;  2HBP A;  4M77 C;  2MMP A;  1YI2 Q;  4C0Z A;  1KD1 U;  2F5K A;  4C5H A;  5GMK m;  4DQ2 A;  1FMW A;  2KBT A;  2KGT A;  2CGH A;  3TSW A;  4M7A B;  3NGP A;  5FU7 B;  2QA4 T;  1D0X A;  3VKI A;  3ZBD A;  4C8Q G;  1VQ7 T;  3X26 B;  4MZM A;  2DXB A;  5EG2 A;  2DEQ A;  2YRC A;  5EC7 A;  3KBG A;  5GJW B;  4C92 D;  1VQM A;  3G71 T;  4ORZ A;  2J7I A;  1KHC A;  3NPF A;  3OYH A;  2SEM A;  4RG2 A;  4XTY A;  3QXE B;  3A1P A;  3CCR Q;  4QVZ A;  4M7D B;  3UF4 A;  1N27 A;  5GAN 3;  3VS6 A;  1I4K 1;  3EGD A;  1EZZ B;  2FPF A;  1B07 A;  1VQP A;  4KH0 B;  2YT6 A;  1AWO A;  4C0G A;  3HHT B;  3X28 B;  3C95 A;  5DY9 A;  3OBW A;  3JRZ A;  3P8D A;  3EG9 A;  1IXD A;  3RKY A;  3OMG A;  4LNP A;  1YN8 A;  4JZ3 A;  4DBQ A;  3M56 A;  1Q82 U;  4KGV B;  1SF9 A;  4PJO C;  1UHF A;  1WZO A;  1LCK A;  1GBQ A;  1SEM A;  1W2B A;  2DIQ A;  3S3M A;  1MMA A;  2PVD B;  2A3L A;  2JS2 A;  4FYX B;  2DX1 A;  5IN1 A;  3CXC S;  3HFO A;  4FYY B;  2YLB A;  2RQV A;  3G6E Q;  1E6G A;  2DKG A;  2I0N A;  1D1A A;  4IUT A;  4M75 G;  3ZL7 C;  2YRD A;  3SFM A;  1AVZ C;  4LDV A;  3ER0 A;  1VQ4 A;  4PJL A;  1R0C B;  4F14 A;  2RJE A;  1X27 A;  1M4Z A;  2PVO B;  1N8R U;  4ELZ C;  2EQJ A;  4MZT A;  1QCO A;  5GAM h;  1VQN A;  2KRS A;  3A98 A;  1YJW A;  3M55 A;  2DD5 A;  2LT4 A;  1KQS S;  2VUB A;  2R5M A;  3MP6 A;  1W4S A;  4M77 B;  2QEX T;  1WX6 A;  3OQ5 A;  2KXD A;  4ME7 A;  3RKX A;  2JMA A;  1PM3 A;  5IHN A;  2EAY A;  3DB3 A;  2D1X A;  4J6W A;  2LP5 A;  5KE2 A;  2DXC A;  3FC3 A;  1QP2 A;  1VQM Q;  4M78 F;  2E10 A;  1LJO A;  3CCV A;  4O6J A;  1TSF A;  1GCQ A;  5GAO r;  1VQK T;  2RJC A;  1VQ8 A;  4IKF A;  1XTD A;  1Y71 A;  4ZN1 A;  5KH6 A;  2PQW A;  4OMQ A;  3M4Y A;  2V26 A;  2ECZ A;  4IUR A;  2A37 A;  1VQP Q;  5A2Q E;  1GRI A;  2DXU A;  4NS5 A;  1WHG A;  2FO0 A;  1FWZ A;  4N0A C;  1NYF A;  2JUF A;  1YJ9 T;  2COW A;  3HKS A;  2CZ0 B;  3CPW P;  2K3X A;  5LJ3 h;  2KRM A;  4KH1 B;  2DJQ A;  4QQ6 A;  1H64 1;  4EMK B;  4N4G A;  9ATC B;  3KFV A;  1G83 A;  1WIE A;  4NOY A;  3T9N A;  3TCJ A;  3QKJ A;  3R6O A;  3QZ9 B;  1NEG A;  2KXC A;  2LX7 A;  1G3T A;  3JB9 G;  2DL7 A;  1FMV A;  2KRO A;  3EFR A;  4QW2 A;  2J05 A;  3CMA T;  3PMI A;  1YIT A;  5CAI A;  4BE1 A;  1VQ4 Q;  3I55 A;  4C8Q D;  4XTU A;  1JXO A;  1RAI B;  1NE8 A;  1BK2 A;  1HSQ A;  2K3B A;  3QII A;  3Q1J A;  1WLP B;  3OW2 A;  2ESW A;  3EH2 A;  3OYY A;  5GAO m;  3L2W A;  1YHQ A;  3CME A;  2ENM A;  2O31 A;  1VQN Q;  2YSQ A;  4OML A;  1YJW Q;  5L8R E;  3RES A;  2LCC A;  3P8H A;  5M9O A;  2RHZ A;  4HVU A;  1PC0 A;  2L8D A;  1N5Z A;  2O9S A;  5GAM d;  2Y4X A;  4E7I A;  4C5E A;  4RTW A;  1AWX A;  3M0U A;  1AZE A;  2W10 A;  2ED1 A;  4C0F A;  2MI6 A;  2VWF A;  4KUI A;  4XU2 A;  1X43 A;  3UAT A;  2XMF A;  4O5V A;  2LC4 A;  2GTJ A;  3OMC A;  2BKD N;  3JCM b;  3VS7 A;  5HY6 A;  5LJ3 j;  4HKE A;  2PNI A;  1LPL A;  2BIV A;  5CKE A;  2NUP A;  3J80 E;  2F2V A;  1BKB A;  3OS1 A;  5GAM g;  5GMK h;  3CCV Q;  2VGN A;  4F7U G;  1W1F A;  3M0T A;  4PKC C;  4C8Q C;  1VQ8 Q;  3BFM A;  5I2M A;  1V76 A;  2DBK A;  3G4S T;  2JN0 A;  3VU3 C;  3CCM T;  2L3P A;  4M7D F;  3TSZ A;  3EGU A;  2CH4 W;  3GNG A;  3M54 A;  3CCE T;  3DLL A;  3CD6 A;  4JJD A;  5CVI A;  2M1H A;  1KD1 R;  3GOX A;  1KD1 C;  4BB7 A;  4M75 D;  4R56 A;  2EYX A;  1BB9 A;  2M51 A;  2EJF A;  1WJS A;  1QVF A;  2DTI A;  1K0S A;  1WA7 A;  5LJ5 h;  4J6X A;  1RAA B;  4C5I A;  4IUQ A;  4N0A A;  1QVG S;  1B3Q A;  1PD1 A;  3C94 A;  1QP3 A;  1HJD A;  2EQM A;  3C0C A;  2DM1 A;  2VGM A;  4MML A;  4M78 C;  1M1G A;  2VXE A;  4JZ4 A;  1W2B S;  2HBW A;  5GAN 7;  2EW3 A;  2WAC A;  1VQO T;  2DL5 A;  4UC4 A;  2COZ A;  1S1N A;  4RTT A;  2RI3 A;  2X4X A;  3QSU A;  1Q7Y R;  1Q7Y C;  2QA4 A;  5FRN A;  1Q95 G;  1UGQ B;  1YIT Q;  4KGX B;  1YWP A;  5HK3 A;  1XJW B;  2VVK A;  2KYB A;  3I55 Q;  3UA7 A;  1MV0 B;  2IVW A;  1Q82 R;  3WVE B;  1Q82 C;  5GAO p;  3CC7 T;  2EKH A;  2AKK A;  1Q86 U;  4Z8A A;  1G3W A;  4BDY A;  3OS5 A;  5FRM A;  2PU9 B;  1BIB A;  5GMK j;  4PFZ A;  4F17 A;  4OGC A;  1YHQ Q;  3CME Q;  4ZGJ B;  2VB6 A;  4ZTJ A;  1MGQ A;  2QDY B;  4M7A D;  2E3H A;  4HCK A;  4A53 A;  1JXM A;  5I21 A;  1B34 B;  4BAC A;  1RAC B;  1VQL A;  1VQ5 Q;  4GLK A;  2HCK A;  4JLG A;  1U1T A;  2FVU A;  3A8G B;  3UA6 A;  2DLP A;  2GCX A;  1TOV A;  4OMP A;  3CCU A;  4LDX A;  2CUB A;  3SD4 A;  1Y57 A;  2R57 A;  1IGU A;  2JNG A;  2E64 A;  2CUD A;  1F1B B;  5LJ5 j;  4J9I A;  1K4U S;  2CZ1 B;  2E12 A;  2ABL A;  5HCK A;  2DBM A;  3M0P A;  1N8R R;  2C06 A;  1N8R C;  1H8K A;  1IGQ A;  2DNU A;  1JBM A;  4M7D E;  2NUT B;  3LYI A;  4C8Q B;  4AG1 C;  1M1F A;  3OYF A;  1I8F A;  2LNV A;  4Z89 A;  2K2M A;  4ANJ A;  4JLI A;  4RKU E;  1KQ2 A;  3CD6 Q;  3L2R A;  1ABQ A;  1ZA1 B;  5KYW A;  2QAZ A;  4J5Y A;  1D1B A;  5GAN d;  3JB9 D;  4XK8 E;  3PIO A;  1KIK A;  1O75 A;  3OW2 P;  3LW5 E;  5ECA A;  3QWY A;  4J83 A;  2OTL A;  1UG1 A;  2LJ1 A;  1WDX A;  2E5K A;  1G2B A;  4DOV A;  2I2L A;  1GL5 A;  1K8A U;  2XHC A;  5KCH A;  5GAN g;  1SRL A;  1RL2 A;  2QI2 A;  3JCM Q;  2P0P A;  1B7T A;  3EFO A;  2IIM A;  4C92 F;  3L42 A;  2QEX A;  3JB9 I;  4P5N A;  2RM4 A;  4Y92 A;  4M78 A;  4HT9 A;  3OA6 A;  3A5Z B;  2QA4 Q;  3UPU A;  3D7S B;  3CCJ T;  4Y28 E;  2OAU A;  2HD0 A;  2EKO A;  1X6G A;  4XQ3 A;  2LJ3 A;  2FZC B;  2KT1 A;  4E7S A;  3O8V A;  1BI0 A;  4AT1 B;  2XDB A;  2KK4 A;  4M75 B;  2DVJ A;  2L5Q A;  2A08 A;  3M59 A;  1KJW A;  2L0A A;  1Y96 A;  1OPK A;  3SB2 A;  4BI8 B;  4FT4 A;  2KNB B;  1IHV A;  4PJM A;  4FW1 A;  4RUG A;  1MUZ A;  3OYM A;  1VQL Q;  1QVF P;  1K73 R;  3VRY A;  1K73 C;  2CP6 A;  1A0N B;  4WCI A;  3JCM f;  2RQW A;  4AMC A;  2QYZ A;  1X75 C;  2KQW A;  2J6F A;  1PD0 A;  3CCU Q;  4XTZ A;  3RBB B;  1T0J A;  2EVR A;  3E9G A;  1M2V A;  1QW1 A;  2RJF A;  2QQB A;  4Q5W A;  1UUE A;  4LDU A;  1M5Q 1;  3A8O B;  4Y91 A;  2EJ9 A;  3KUF A;  4A63 B;  3JCM P;  1WHL A;  4DOW A;  2D6F A;  2JM9 A;  4E7H A;  3CPW A;  3SHW A;  4X9C A;  1ZX6 A;  3OYL A;  2BE9 B;  1QCF A;  2FZK B;  3HL8 A;  2YUN A;  1WFW A;  4CC4 B;  4PJO D;  2L3Q A;  3CMA A;  5GAO q;  5FWC A;  3EG0 A;  1K1Z A;  1CKA A;  2QQ9 A;  3PTA A;  3BE3 A;  5IXB A;  1YJN T;  5KYU B;  3M53 A;  2H3E B;  2OTL Q;  1GCQ C;  4WF2 A;  5IT9 E;  4NL3 A;  2MWO A;  2VXF A;  1D09 B;  3GIB A;  1VIF A;  1QVF S;  2G6F X;  2V8J A;  1UJY A;  3LGL A;  4NL2 A;  3UWN A;  1G5V A;  3V8K A;  4C92 E;  1T0H A;  3EGD B;  4GY5 A;  2J6K A;  2MYS A;  5KYY A;  5I22 A;  3M0Q A;  3M0R A;  3E9F A;  3CC4 A;  1IHW A;  1G3Y A;  3L2V A;  2DYB A;  2P84 A;  2F69 A;  2YUQ A;  3QYG B;  1R77 A;  1MHN A;  2X3X D;  2QEX Q;  1WHK A;  4A4G A;  3AT1 B;  4ESR A;  4JUV A;  1H92 A;  2DMO A;  1RAH B;  1E7O A;  2DK3 A;  2EQI A;  1YIJ T;  2YRV A;  4M78 G;  5CCA A;  2M0Y A;  3G7Z A;  4M7D A;  3HRS A;  4IUV A;  2LRQ A;  2X35 A;  3LWI A;  4PFP A;  1M8M A;  2F2X A;  5HKC A;  4EMG A;  3G4S A;  1TUG B;  2EFI A;  1PCX A;  2KMT A;  3CCM A;  2NLU A;  3E19 A;  1U3O A;  5GAM e;  4FSS A;  2BE7 D;  3URG A;  2V1Q A;  1R0B G;  1NLP C;  2JW4 A;  4N4I A;  1K9M R;  2VKN A;  1K9M C;  3VYG A;  4A4E A;  2VC8 A;  4ZNX A;  1QKX A;  2CSQ A;  3BDU A;  3KXT A;  3JB9 J;  2XIC A;  4HT8 A;  5J3B A;  1N9R A;  3VV0 A;  2EBP A;  2QTX A;  1VQ9 T;  1Y07 A;  5CKF A;  3HFN A;  1KFZ A;  2RMO A;  1UDL A;  2M02 A;  2RI2 A;  4E47 A;  4RTU A;  3FLG A;  2DF6 A;  1Q86 R;  1Q86 C;  1XOV A;  1X2K A;  2YLC A;  4J9E A;  1X01 A;  2K5L A;  1OU8 A;  4L5G A;  2BUD A;  1K0X A;  3HP9 A;  2FG0 A;  1I1J A;  2EGE A;  2FRW A;  4R55 A;  2FZG B;  2F2W A;  1YFN A;  1Q81 U;  3I5R A;  1NJI U;  4OMF B;  2ZPI B;  4L6V 5;  4F7U B;  2GF7 A;  2XDP A;  2MF2 A;  4J7F A;  4FL6 A;  3CCR T;  3LGF A;  1SKU B;  2ZGW A;  2OJ2 A;  2W0Z A;  3QPH A;  2VAS A;  2OAW A;  2ROT A;  1X6B A;  2EYY A;  2XI9 A;  2P0K A;  5LJ3 e;  3OYA A;  4JRP A;  5D6W A;  1IO6 A;  2NUZ A;  2X9H A;  2IG0 A;  3JV3 A;  4FSX A;  3CC4 Q;  3QJ6 A;  4J9D A;  3E1S A;  1MMD A;  1OYX A;  2ROL A;  4A54 A;  4LD6 A;  4E7J A;  4GBQ A;  1XNI A;  1ARK A;  1OX8 A;  3QWX X;  2X3W D;  2OTJ T;  1KC8 U;  4L59 A;  1RAF B;  3HSB A;  4J8O A;  1R8O B;  2BZY A;  4PJO B;  3CCQ A;  1PNJ A;  1I0C A;  8AT1 B;  4M75 F;  3G4S Q;  3P8B B;  4HXJ A;  2HSE B;  1K8A R;  1K8A C;  4KT0 E;  4M7D G;  1YBY A;  5GAM j;  2EPD A;  4EPC A;  4J9F A;  1M2O A;  2L3S A;  3ULR B;  3OS0 A;  2X4W A;  3TQ7 P;  3H8Z A;  4AFU C;  3PGG A;  1V29 B;  2CP3 A;  3ZEH A;  2MOX A;  3CCL A;  5DLO A;  2CKK A;  4ZGD B;  2BZ8 A;  1ZSZ A;  2BTT A;  2PZ1 A;  1I5L A;  2MWP A;  1WNL A;  1KHI A;  3VS5 A;  3OY9 A;  5KCO A;  1X6O A;  2A0F B;  4C92 A;  1IRE B;  2QK0 A;  3RMQ A;  1YCY A;  1LVK A;  5KYN A;  2YUO A;  1TG0 A;  1OV3 A;  5J26 A;  3OB9 A;  5GMK e;  1OQK A;  1NLO C;  2QAS A;  1VIE A;  2HQX A;  5FU6 C;  3CPW S;  1AOJ A;  1TUC A;  4E7K A;  2LQK A;  2XDD A;  1VQM T;  3S3N A;  1WXU A;  4DEX A;  1PKS A;  1WHM A;  2KRN A;  3CBO A;  3OYK A;  2CT4 A;  2V8K A;  1GCP A;  2NUP B;  4KUL A;  1M3B A;  5KE3 A;  2LJ0 A;  1K76 A;  4M7A F;  3ME9 A;  3OYI A;  4JJB A;  4M78 D;  2JOY A;  3HTR A;  5LJ5 e;  2A28 A;  2LCS A;  3M58 A;  4X34 A;  2DTH A;  7AT1 B;  3LWH A;  1C6V X;  1U8R A;  1D3B A;  5GAN h;  1MND A;  1VA7 A;  2EIF A;  4HVW A;  1BCM A;  1RAE B;  2DXT A;  1UGR B;  3A8H B;  1HK9 A;  3EHR A;  1UHC A;  1D0Y A;  3TU4 K;  3LLR A;  3VUZ A;  4A4F A;  1PHT A;  1WYX A;  1FX7 A;  4LDW A;  3OYC A;  3GP8 A;  3OYD A;  1UB4 A;  2ED0 A;  4M75 E;  2HZY A;  2Y4Y A;  2EGA A;  2BZX A;  1YNZ A;  3CCQ Q;  4MZP A;  1HXD A;  1ZQ1 A;  2K5F A;  3EGX A;  3VS1 A;  3FEO A;  5IHI A;  4LUE A;  3NHN A;  1SG5 A;  2KVQ G;  1OPL A;  5CO7 A;  1RAD B;  5IXF A;  2P0Q A;  3FIF A;  3OYN A;  1U06 A;  2CRE A;  2DZ9 A;  4LUD A;  3CCL Q;  3CC2 T;  4E7Z A;  4JPB W;  4II1 A;  3MET A;  2RHI A;  1SSF A;  1YJN A;  1VQ7 A;  3U23 A;  1BI1 A;  2K5I A;  3HRU A;  1VQN T;  3JCM J;  2V1R A;  3QDF A;  2LQ8 A;  1YJW T;  5L23 A;  2R5A A;  3G71 A;  3EG2 A;  4QVC A;  1OX9 A;  3MEW A;  4CC7 A;  1NZ9 A;  2QQS A;  4FT2 A;  5CKD A;  4PL6 A;  1OUL A;  4OB0 B;  3EFS A;  2LMJ A;  5FWB A;  4C92 G;  4MDX A;  1NPR A;  4OB3 B;  1T3L A;  2RN8 A;  1UTI A;  3ASK A;  5GAN j;  2HKQ B;  5AYF A;  2DIL A;  3MO8 A;  2HQH A;  1I81 A;  4M7A E;  4OMN A;  1UGS B;  1VUB A;  4PJJ A;  2IPO B;  4F04 B;  3CCV T;  4M77 F;  2H3J A;  4KUD K;  2CS7 A;  1G8X A;  1AWJ A;  2CP7 A;  4F7U F;  1YIJ A;  2DPP B;  1VQ8 T;  4OB2 B;  3I56 T;  3TRE A;  4JJN K;  2O88 A;  2B86 A;  4QKU A;  1FYN A;  3TEE A;  3QBY A;  1WQ7 A;  2HMA A;  1IB8 A;  5GAN 8;  2DFU A;  5IH2 A;  1PSE A;  1ZUU A;  1NYG A;  4M4Z A;  2RK1 A;  4X1V A;  1WGS A;  2P4T A;  5KYW B;  1M8V A;  1TU0 B;  1JJ2 P;  1SHG A;  1ACM B;  2RNA A;  2HAX A;  2LTO A;  1J3T A;  1YCS B;  2WSF E;  1KQS A;  4BDZ A;  4J9B A;  4BE2 A;  2FL7 A;  4EDU A;  8ATC B;  1VQ6 T;  4CI0 C;  1XQH A;  4BUG A;  4XTW A;  2DJZ A;  2NYS A;  2F5T X;  1I07 A;  2QG9 B;  5GAN 4;  1UGP B;  1CSK A;  2NUT A;  1VYU A;  4ZN3 A;  4PNO A;  1WPY A;  3CCS T;  3OYJ A;  1O9S A;  4PJO F;  1PRL C;  1V1C A;  3A8L B;  3EFO B;  1Z9Z A;  1WXB A;  2FHD A;  5GAO n;  2M9U A;  2QTV A;  2VYT A;  1QQJ A;  5C6S A;  1ZA2 B;  4EMH A;  3LX7 A;  2GQV A;  3OS2 A;  3I55 T;  4M78 B;  2DYI A;  3I9Q A;  3PT9 A;  5KYX B;  4DBR A;  1GXI E;  3JCM V;  1WJR A;  1NG2 A;  5CKH A;  4KRT A;  4IUU A;  5FLX E;  2GTO A;  4M7D C;  2EYZ A;  1VQ7 Q;  3CCR A;  1YHQ T;  3CME T;  1PG5 B;  1AT1 B;  2GBQ A;  3H0F A;  1KC8 R;  4YTL A;  1KC8 C;  3G71 Q;  3SWN A;  1Y96 B;  3VUB A;  1VQ5 T;  2LVM A;  2XD0 A;  1M90 U;  2AKL A;  1VQK A;  2HL5 C;  4E7L A;  5CIU A;  2AHJ B;  1YP5 A;  3V8J A;  4KBM B;  3PNW C;  2RQT A;  2KYM A;  2E6Z A;  2GFU A;  1PSF A;  4BD3 A;  1C1A A;  2E5Q A;  1GFC A;  1QCN A;  4M77 E;  3OW2 S;  1U1S A;  3MJX A;  3NFC A;  1NBE B;  1M2V B;  1LNX A;  4F7U E;  2O4X B;  4A4K A;  3QUI A;  2AK5 A;  2ATC B;  3EAE A;  4PJN A;  4XAX B;  1YJ9 A;  4DBH A;  2CP2 A;  2E1H A;  1BI2 A;  2HL3 A;  1VYT A;  4RTZ A;  5AT1 B;  5GMK i;  5I11 A;  3EHQ A;  4M75 A;  2OTJ A;  1YIJ Q;  4JJC A;  3OBY A;  4DEY A;  1W6X A;  3RIR A;  5J39 A;  3S3O A;  2E3I A;  2XKO C;  4R0K A;  3BY7 A;  2YHT A;  3RDV A;  2KEA A;  2QGG A;  1OI1 A;  1PWT A;  4OP0 A;  3DLM A;  3VS4 A;  3JB9 H;  2OX7 A;  1M27 C;  1VOM A;  2DTO A;  2HKN A;  2EWN A;  1SPK A;  2LZ6 B;  1N6A A;  4F16 A;  2Y90 A;  2GGR A;  3JCM c;  3VRZ A;  1I5O B;  1SSH A;  1KSW A;  4CC3 A;  4PJO E;  1TWB A;  2RHU A;  4IUP A;  1JRI A;  2ZZD A;  2DEU A;  2JM8 A;  5KYY B;  1JO8 A;  2V8I A;  1KQ1 A;  5GMK l;  5CKB A;  4B9W A;  4XTX A;  3G1J A;  3WVD B;  3CBP A;  3CXC P;  2XG8 D;  1E6H A;  2DVE A;  2K6D A;  4M7A A;  3VYH B;  1RUW A;  3EG9 B;  3JCM d;  5CK9 A;  5KYU A;  2PUO B;  2RH2 A;  2RA2 A;  2AT1 B;  3I35 A;  4FW2 A;  1ZUY A;  2LQN A;  2COY A;  1NM7 A;  3EG1 A;  4LE9 A;  3MHX A;  2VV5 A;  2PUK B;  2O01 E;  4EIK A;  1S72 T;  2C0O A;  3MEU A;  1VQL T;  4JS5 A;  1H3Z A;  2L2P A;  2ZPG B;  3NTI A;  1Q7Y U;  3MEV A;  3JCM g;  4J7I A;  3TVT A;  1VQK Q;  2C0I A;  2ZPH B;  1QVG A;  3H0I A;  3CCU T;  1KQS P;  4OVA A;  4VUB A;  3S6W A;  4B6M A;  3EH1 A;  2HNI A;  1RI0 A;  4KGZ B;  3THK A;  2RQR A;  1ZSZ C;  4EMK C;  1H3H A;  3CCE A;  3M5A A;  1JU5 C;  2M0O A;  1WQW A;  1WJQ A;  4ZGE B;  4J6Y A;  4TVR A;  1YJ9 Q;  2DE0 X;  1JB0 E;  2PVG B;  2E65 A;  2RHX A;  3C12 A;  4C92 C;  2OTJ Q;  4CRI A;  2JTF A;  1RI9 A;  2M16 A;  3VS3 A;  3MP1 A;  4PK4 A;  4AFS C;  1TXQ A;  1YI2 T;  2J6O A;  3L2Q A;  4QQG A;  4JRQ A;  4LDY A;  4AFQ C;  4J9C A;  1VYV A;  4AG2 C;  2E4H A;  2MAM A;  3HRT A;  2YDL A;  4ZTF A;  1BYM A;  4C0D C;  2DER A;  1G3S A;  4E2F B;  4DBF A;  2AZV A;  2K9G A;  4C8Q F;  1VQO A;  1BU1 A;  1QWF A;  2JVV A;  2OTL T;  2P4R A;  3CC2 A;  2DL8 A;  3AHU A;  4JS4 A;  2ZPB B;  3CMA Q;  4WTO B;  3UT1 A;  2DA9 A;  4PLL A;  2WSC E;  1MNE A;  1AD5 A;  5GAN 6;  3CC7 A;  2RJD A;  2FEI A;  3BDL A;  1LOJ A;  5DM7 R;  2FB7 A;  3RKW A;  3REB B;  1DJ7 B;  4M77 A;  3X24 B;  3JCM X;  3FJP A;  4OMM A;  4F7U A;  2QQR A;  3CQT A;  2ZPE B;  2DRM A;  4OMO A;  3F70 A;  2CZ6 B;  2KDS A;  2D8J A;  1AWW A;  4PFO A;  4M7A G;  3SEM A;  2SRC A;  4N4H A;  3I56 A;  4OF1 A;  1SRM A;  5CQY A;  3WXM B;  1TS9 A;  5A0D A;  1ZBJ A;  4DA4 A;  5GAM f;  2LQW A;  2XID A;  1ZLM A;  3G6E T;  5IAY A;  4HCC A;  5IHK A;  2MIO A;  2E70 A;  3QG1 A;  2XK0 A;  4B9X A;  3RNJ A;  1UJ0 A;  3OSV A;  3CCM Q;  1UE9 A;  4JRK A;  3HPW A;  2CP5 A;  3QHS A;  1QKW A;  3X25 B;  3R6N A;  1X2Q A;  2LT1 A;  3CCE Q;  2EJG A;  1ZSZ B;  3BW1 A;  1OOT A;  1HYO A;  2RPN A;  1PKT A;  1ABO A;  1VQ6 A;  4PJO A;  4EMK A;  1JJ2 A;  4C92 B;  1GFD A;  3H6Z A;  3E2U A;  1K73 U;  1JEG A;  2RHY A;  1BCO A;  4J9H A;  3CCS A;  2LNH B;  3PVQ A;  2JTM A;  2FYK A;  4BY6 C;  1M90 R;  1Y7X A;  1M90 C;  4C8Q E;  3CBM A;  4RCB A;  1M1K U;  2K4Y A;  1NPP A;  1W70 A;  2CP0 A;  1AZG B;  3ZFJ A;  4C0D B;  1WHJ A;  1VQO Q;  4JRI A;  3CC2 Q;  2E6N A;  4Z02 A;  5GAN e;  4RTY A;  4J9G A;  5LJ3 f;  4OGE A;  5GAO l;  3CCJ A;  1Z9Q A;  3MCA B;  3GLX A;  3VS2 A;  2K2V A;  1QVG P;  2G3R A;  5HK0 A;  3CC4 T;  3CC7 Q;  2FRY A;  1EFN A;  1VQ5 A;  2X51 A;  3H9N A;  3SDZ A;  1VQP T;  1D3B B;  2DAQ A;  3PFS A;  1QLY A;  5GAN 5;  2EQU A;  4M78 E;  4BI3 A;  1W2B P;  1MV3 A;  2E41 A;  3UDC A;  3JCM W;  3REA B;  5A0L A;  2GQI A;  4RG8 A;  1M3C A;  3DKM A;  2WSE E;  1TH7 A;  2RB6 A;  1IZ6 A;  1X69 A;  3GNF B;  2CT3 A;  4M77 G;  2RD1 A;  2LCL A;  2K7A A;  3GF5 A;  4Z88 A;  3I56 Q;  2ZPF B;  4XU0 A;  2K3Y A;  4K11 A;  2MPX C;  1CKB A;  3EGX B;  4CC2 A;  1EIF A;  3JSC A;  1TTH B;  2KAF A;  1UGV A;  2DET A;  3JB9 F;  1UFF A;  3OYB A;  3PIP A;  2KY9 A;  4BE0 A;  2D0Q B;  2JXB A;  3GBQ A;  3L1A A;  4FU6 A;  3V7R A;  3H0H A;  1VQ4 T;  1OEB A;  1RLQ C;  2HQE A;  1P92 A;  3A8M B;  2CYZ B;  2JS0 A;  1M3A A;  2CZ7 B;  3MP8 A;  2H8H A; 
#chains in the Genus database with same CATH homology
 2DJQ A;  2EQI A;  2EYZ A;  2D8H A;  3FJ5 A;  2M0Y A;  2GBQ A;  3H0F A;  3KFV A;  1G83 A;  1WIE A;  1WI7 A;  1M8M A;  2F2X A;  3M0S A;  2AKL A;  2CH4 A;  2KE9 A;  4AFZ C;  1NEG A;  1YP5 A;  2KXC A;  2LX7 A;  2RF0 A;  2KT8 A;  2QDL A;  2RQT A;  2DL7 A;  1U3O A;  2KYM A;  4FSS A;  1GFC A;  2KRO A;  2OI3 A;  2J05 A;  2V1Q A;  1NLP C;  2JW4 A;  3PVL A;  2CSI A;  2VKN A;  2AK5 A;  4ZNX A;  1QKX A;  2CSQ A;  1JXO A;  1BK2 A;  1HSQ A;  2EBP A;  1ZSG A;  4RTZ A;  1VYT A;  1KFZ A;  2RMO A;  1UDL A;  2K3B A;  3EHQ A;  5I11 A;  4JJC A;  1WLP B;  1U5S A;  2D0N A;  4DEY A;  4RTU A;  2ESW A;  2DF6 A;  1W6X A;  2J06 A;  1XOV A;  1X2K A;  4GLM A;  2ENM A;  2JT4 A;  2O31 A;  4J9E A;  2YSQ A;  4OML A;  2KR3 A;  4R0K A;  4HVU A;  2O9S A;  1N5Z A;  1K0X A;  2NWM A;  2FG0 A;  2KEA A;  1I1J A;  2EGE A;  2FRW A;  4RTW A;  1AWX A;  4IIM A;  3M0U A;  1PWT A;  2W10 A;  3VS0 A;  1AZE A;  2ED1 A;  2F2W A;  3I5R A;  4RTV A;  2VWF A;  3VS4 A;  1M27 C;  3UAT A;  1X43 A;  3IQL A;  2XMF A;  1QWE A;  2CDT A;  2EGC A;  2GTJ A;  4IIO A;  3VS7 A;  1SPK A;  2LZ6 B;  4F16 A;  2PNI A;  2GGR A;  2OJ2 A;  2W0Z A;  2F2V A;  3VRZ A;  1SSH A;  1KSW A;  4CC3 A;  2MCN A;  5FW9 A;  2OAW A;  2ROT A;  1T3S A;  1W1F A;  1X6B A;  2EYY A;  3M0T A;  2GNC A;  2JM8 A;  1NEB A;  1JO8 A;  2DBK A;  2AZS A;  1UEC A;  1IO6 A;  2NUZ A;  2L3P A;  3JV3 A;  4J9D A;  2DL3 A;  3TSZ A;  3EGU A;  2CH4 W;  2C0T A;  4JJD A;  1GBR A;  1E6H A;  2ROL A;  2EYX A;  1BB9 A;  2K6D A;  2M51 A;  1RUW A;  1JQQ A;  3NMZ C;  1K0S A;  1WA7 A;  2HSP A;  4GBQ A;  2FPD A;  3LH5 A;  1ARK A;  3I35 A;  3QWX X;  2X3W D;  1RLP C;  1ZUY A;  1WXT A;  2JTE A;  1B3Q A;  2LQN A;  1HJD A;  1HD3 A;  2BZY A;  3O5Z A;  1NM7 A;  3C0C A;  3EG1 A;  4LE9 A;  5GJV B;  1Y0M A;  4EIK A;  2DM1 A;  2C0O A;  1PNJ A;  2PTK A;  1I0C A;  2L2P A;  2K79 A;  4HXJ A;  3TVT A;  4JZ4 A;  1FMK A;  2C0I A;  3H0I A;  2EPD A;  2JMC A;  1SHF A;  2HBW A;  2EW3 A;  1K9A A;  4J9F A;  1PRM C;  2DL5 A;  2L3S A;  3ULR B;  1S1N A;  4RTT A;  3THK A;  4AFU C;  2RQR A;  1AEY A;  1H3H A;  1YWP A;  2MOX A;  3I5S A;  1JU5 C;  1YWO A;  2VVK A;  2KYB A;  2YUP A;  3UA7 A;  1MV0 B;  2BZ8 A;  2BTT A;  2PZ1 A;  2DE0 X;  4D8D A;  3VS5 A;  2O2O A;  2EKH A;  2AKK A;  4Z8A A;  1RI9 A;  3VS3 A;  2HEQ A;  4AFS C;  4F17 A;  2O9V A;  1ZUK A;  2J6O A;  2YUO A;  4HCK A;  3PE0 A;  1TG0 A;  4HVV A;  1JXM A;  1OV3 A;  2DRK A;  1BBZ A;  4QT7 A;  4J9C A;  1NLO C;  1VYV A;  4AFQ C;  4AG2 C;  2HCK A;  2YDL A;  3UA6 A;  2DLP A;  1AOJ A;  4RTX A;  1TUC A;  4OMP A;  2AZV A;  2K9G A;  2CUB A;  2RQU A;  1WXU A;  1Y57 A;  1BU1 A;  1QWF A;  4DEX A;  2P4R A;  1M30 A;  1PKS A;  2DL8 A;  2KRN A;  3EG3 A;  4LN2 A;  2A36 A;  2CT4 A;  2FPE A;  2HDA A;  2CUD A;  1GCP A;  4J9I A;  2DA9 A;  1K4U S;  1M3B A;  2LJ0 A;  1K76 A;  2ABL A;  5HCK A;  4E6R A;  2DBM A;  3H41 A;  3M0P A;  2DL4 A;  4JJB A;  1H8K A;  1AD5 A;  2DNU A;  1TUD A;  4D8K A;  2EYW A;  2FEI A;  2A28 A;  2LCS A;  4AG1 C;  4Z89 A;  2K2M A;  3REB B;  2KBT A;  2KGT A;  1ABQ A;  1VA7 A;  3TSW A;  3NGP A;  4HVW A;  4OMM A;  3CQT A;  1KIK A;  2DRM A;  4OMO A;  5EC7 A;  5GJW B;  2D8J A;  3EHR A;  1UHC A;  1AWW A;  5ECA A;  4ORZ A;  3QWY A;  2J7I A;  1UG1 A;  1PHT A;  1WYX A;  2LJ1 A;  3NPF A;  1WDX A;  3SEM A;  2E5K A;  2SRC A;  2SEM A;  1G2B A;  2ED0 A;  1SRM A;  2EGA A;  2BZX A;  1YNZ A;  3UF4 A;  1GL5 A;  1ZBJ A;  2LQW A;  1SRL A;  1ZLM A;  3VS6 A;  5IHK A;  2MIO A;  2FPF A;  1B07 A;  3VS1 A;  2YT6 A;  1AWO A;  5IHI A;  2IIM A;  4LUE A;  3NHN A;  3RNJ A;  1UJ0 A;  1UE9 A;  4Y92 A;  1OPL A;  5IXF A;  1QKW A;  4LNP A;  1YN8 A;  4JZ3 A;  3R6N A;  1U06 A;  1X2Q A;  2CRE A;  4LUD A;  4JPB W;  1OOT A;  1UHF A;  2RPN A;  1X6G A;  2LJ3 A;  2KT1 A;  1LCK A;  1GBQ A;  1PKT A;  3U23 A;  1SEM A;  1ABO A;  2V1R A;  5L23 A;  2DVJ A;  1GFD A;  2A08 A;  2JS2 A;  3EG2 A;  2DX1 A;  1KJW A;  2L0A A;  4CC7 A;  1OPK A;  1JEG A;  4J9H A;  2KNB B;  2LNH B;  3PVQ A;  2RQV A;  4RUG A;  1E6G A;  2I0N A;  1MUZ A;  2LMJ A;  5FWB A;  1A0N B;  3VRY A;  4WCI A;  2RQW A;  3ZL7 C;  1T3L A;  2RN8 A;  1AVZ C;  1UTI A;  2DIL A;  1W70 A;  1AZG B;  2J6F A;  3RBB B;  1T0J A;  2EVR A;  4OMN A;  1UUE A;  4F14 A;  4RTY A;  4J9G A;  1X27 A;  1AWJ A;  1Z9Q A;  4A63 B;  3VS2 A;  2O88 A;  2B86 A;  2JM9 A;  1FYN A;  2KRS A;  3A98 A;  3SHW A;  2FRY A;  1EFN A;  1ZX6 A;  5IH2 A;  1ZUU A;  1NYG A;  4M4Z A;  4X1V A;  1QLY A;  1QCF A;  1WX6 A;  2KXD A;  2YUN A;  1WFW A;  4CC4 B;  1MV3 A;  1SHG A;  2JMA A;  2L3Q A;  2RNA A;  3REA B;  5IHN A;  2GQI A;  5FWC A;  1M3C A;  1J3T A;  1YCS B;  2D1X A;  3EG0 A;  4J9B A;  1K1Z A;  1CKA A;  2LP5 A;  1X69 A;  2CT3 A;  5IXB A;  1GCQ C;  2K7A A;  4Z88 A;  1I07 A;  1GCQ A;  2G6F X;  1UJY A;  1CSK A;  1VYU A;  4K11 A;  1T0H A;  1CKB A;  4CC2 A;  2J6K A;  1PRL C;  4OMQ A;  5I22 A;  3M0Q A;  3M0R A;  1V1C A;  2ECZ A;  1Z9Z A;  1WXB A;  2A37 A;  1UGV A;  2DYB A;  1GRI A;  2YUQ A;  1UFF A;  2FO0 A;  2X3X D;  2JXB A;  3GBQ A;  3I9Q A;  4ESR A;  3H0H A;  1NYF A;  1H92 A;  1OEB A;  1RLQ C;  1NG2 A;  2DMO A;  2JS0 A;  2KRM A;  4KRT A;  1E7O A;  1M3A A;  2GTO A;  2H8H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...