2MCNA

Distinct ubiquitin binding modes exhibited by sh3 domains: molecular determinants and functional implications
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
57
structure length
57
Chain Sequence
VDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD2-associated protein
publication title Distinct ubiquitin binding modes exhibited by SH3 domains: molecular determinants and functional implications.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell cycle/signaling protein
total genus 7
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2mcnA00
2RQRA 2KE9A 1ZSGA 1VA7A 2MCNA 2F2XA 2LQNA 1ZUUA 1EFNA 4RTVA 3I5SA 2CH4W 2LJ3A 2OI3A 3M0RA 1ZUYA 4HVWA 1Y57A 2FG0A 2YUPA 4LUDA 1U3OA 1UUEA 1T0HA 2JM8A 1VYVA 3VRZA 1UTIA 2GTOA 3VS5A 1JQQA 2X3WD 3R6NA 1G2BA 4ESRA 3VS4A 2RQUA 3NPFA 1UHFA 2EW3A 1NLPC 1QKXA 3JV3A 1UE9A 3SEMA 2DILA 2DF6A 2JXBA 1E6HA 1UJ0A 1H3HA 2FPEA 4EIKA 2EGEA 4D8DA 4OMNA 3PVLA 4DEYA 4CC7A 2OJ2A 1X43A 2ESWA 1ABOA 1X2QA 1GCPA 2KT8A 3GBQA 3UF4A 2C0OA 1QWEA 2M0YA 1E6GA 2G6FX 4JJDA 1MV3A 4Y92A 3EHQA 1JEGA 1YNZA 1A0NB 2JS0A 3VS0A 4J9HA 2KGTA 2EYYA 2SRCA 4J9GA 1V1CA 2B86A 1I07A 2L3PA 3A98A 2CH4A 3VRYA 1NYGA 2M51A 2OAWA 2ED0A 1OOTA 4AFQC 3NGPA 5IH2A 2JMAA 2O31A 2F2WA 2A08A 1U5SA 4WCIA 2J6FA 2BZXA 4J9BA 1WIEA 3EG2A 2L0AA 3O5ZA 3ULRB 2AKKA 1AOJA 1K1ZA 2P4RA 3NMZC 1KIKA 1KJWA 1FMKA 4HVVA 2LMJA 3RBBB 2W10A 1W1FA 2X3XD 2VWFA 4JJBA 4E6RA 1B07A 1GRIA 4RTTA 1UHCA 1KSWA 1GFDA 4X1VA 2KROA 2C0TA 2CSIA 1RLQC 4AG2C 2O9SA 1M8MA 2KRNA 2DL8A 4AG1C 1GBQA 1UECA 2YSQA 1W70A 4D8KA 1UFFA 4JJCA 5GJVB 1N5ZA 1QWFA 1ZX6A 1AEYA 2W0ZA 1AWOA 2CREA 4AFZC 1M27C 1QCFA 5IHKA 1J3TA 1CSKA 2V1RA 2J05A 2DMOA 2DJQA 3M0SA 2DM1A 2AZSA 1SRMA 1FYNA 3C0CA 1BBZA 1JXOA 1WI7A 3M0UA 1U06A 2J7IA 2JM9A 2DRKA 2RNAA 5FWBA 1ZLMA 2EYXA 1MV0B 1YWOA 3KFVA 1JU5C 4RTYA 2AK5A 2DA9A 2E5KA 1YCSB 1E7OA 1SEMA 1NEGA 1RI9A 2KEAA 2SEMA 3PE0A 2YDLA 1UGVA 2LJ1A 3FJ5A 1X2KA 4OMMA 2DBMA 4Z89A 2KRMA 2RPNA 1TUCA 1SSHA 4J9CA 2HEQA 1SRLA 1I1JA 2FRYA 1CKBA 3VS6A 2KRSA 2YUNA 1PHTA 4J9EA 2DX1A 2RQVA 1VYTA 3CQTA 1GCQA 2FRWA 5IXBA 1OV3A 2RMOA 4DEXA 1JO8A 1TG0A 2EYZA 3EGUA 2ECZA 1PRMC 1GFCA 3THKA 2EKHA 1TUDA 2AKLA 2IIMA 3UATA 2GBQA 2A36A 4JZ4A 4A63B 1RLPC 4OMLA 1PWTA 2JMCA 3I5RA 4R0KA 4F14A 4OMPA 1I0CA 3QWXX 4JPBW 2LJ0A 2AZVA 1Y0MA 2KYBA 4LUEA 1ABQA 1YP5A 2JW4A 2DL7A 1Z9ZA 2GNCA 2GTJA 1ARKA 5L23A 2D8JA 1AVZC 1GBRA 1B3QA 1SPKA 1NG2A 1ZBJA 2ROLA 2HSPA 2KBTA 2H8HA 1KFZA 1WXUA 4IIOA 2CUBA 2LQWA 2DL3A 2O88A 4GLMA 1G83A 4ZNXA 1M30A 2VKNA 1AZEA 1BB9A 1PKSA 1AWJA 1Z9QA 4M4ZA 2L3SA 4K11A 5ECAA 3M0QA 2LP5A 1SHGA 3LH5A 1JXMA 2YUQA 1GCQC 2J6OA 1OPKA 1ZUKA 2CT4A 4LN2A 1RUWA 3H41A 2K6DA 1WXTA 1M3BA 2D8HA 4J9IA 2K79A 2MOXA 3TSWA 4QT7A 5FW9A 2D1XA 2ROTA 1H8KA 2K2MA 3PVQA 4OMQA 4Z8AA 2L2PA 2O9VA 1X6BA 3EG0A 1NLOC 2J06A 2VVKA 3U23A 3M0PA 2JTEA 1W6XA 2KNBB 2RF0A 2KYMA 2A28A 2PNIA 4CC3A 5IXFA 4HXJA 2K9GA 3UA6A 4LE9A 3REAB 4F16A 2GGRA 2K3BA 1X69A 5HCKA 1K9AA 2YUOA 3VS1A 1UJYA 1HJDA 5I11A 2DYBA 1WXBA 1HSQA 4AFUC 1AWXA 2CDTA 5I22A 4OMOA 2CSQA 3RNJA 2FO0A 4HCKA 1AZGB 1M3AA 3VS2A 1K76A 1WFWA 1H92A 2KT1A 2F2VA 2EVRA 5IHNA 2NWMA 2LX7A 5GJWB 2FEIA 3REBB 2C0IA 2JS2A 1M3CA 2EYWA 2JT4A 2DNUA 4F17A 1PKTA 1NEBA 4KRTA 3SHWA 2MIOA 2BZYA 3TVTA 3EG1A 3I35A 1PNJA 4ORZA 2GQIA 3QWYA 2K7AA 1UDLA 4HVUA 1CKAA 2LNHB 3M0TA 1VYUA 1UG1A 1LCKA 4CC2A 2ED1A 5EC7A 1K0SA 1QLYA 1OPLA 1NYFA 1WLPB 3H0IA 2I0NA 3IQLA 4CC4B 4IIMA 1WYXA 4RTUA 2FPFA 2LZ6B 1T3SA 2YT6A 5IHIA 1X6GA 2ABLA 3NHNA 1NM7A 1PRLC 2KR3A 4J9DA 3UA7A 1YWPA 4RTXA 2DLPA 2DVJA 3ZL7C 2EGAA 2KXDA 2HDAA 2RN8A 2FPDA 2DL5A 2DRMA 2HBWA 2RQWA 2EQIA 1WDXA 2O2OA 2DE0X 1OEBA 2DL4A 3VS7A 1MUZA 3I9QA 1HD3A 4RUGA 4GBQA 2XMFA 2RQTA 3EG3A 3EHRA 4J9FA 4FSSA 1T0JA 1T3LA 1SHFA 2ENMA 2PZ1A 1AD5A 2CUDA 4Z88A 1BK2A 2NUZA 1WA7A 1S1NA 2BZ8A 2QDLA 1QKWA 4JZ3A 3VS3A 1WX6A 2EGCA 2CT3A 2A37A 3TSZA 2J6KA 2D0NA 3H0FA 4AFSC 4LNPA 1K0XA 2EPDA 4RTZA 2KXCA 3H0HA 1XOVA 1BU1A 1K4US 2HCKA 1X27A 1YN8A 2EBPA 2LCSA 2BTTA 2DBKA 4RTWA 2L3QA 1IO6A 2PTKA 1AWWA 5FWCA 2V1QA 1GL5A
chains in the Genus database with same CATH superfamily
5GAN6 2BKDN 1VQNQ 2DJZA 4YTLA 1YITT 1ZUUA 3ER0A 2CH4W 2WSEE 3LYIA 2OI3A 5FU7C 1TSFA 4BY6C 1U3OA 1IHVA 1W4SA 1KQSP 4PJMA 2P4TA 2JM8A 2E3IA 3SWNA 3VRZA 1UTIA 2E41A 3WVEB 2LCCA 2QXFA 3GLXA 4M7AG 3NPFA 4ZN1A 1VQ6Q 1UHFA 2DIQA 2FZGB 5EG2A 1NLPC 1VOMA 2OAUA 4C8QB 4CI0C 1YJNA 2XDBA 1UJ0A 1VQ9T 4JJNK 4EIKA 4Y28E 3PVLA 4CC7A 2R57A 1VQPA 3QXEB 3VJPA 1ABOA 1X2QA 1GCPA 3GBQA 2QEXT 4LDVA 1RI0A 1VQ5Q 2RD1A 1WJRA 2M0YA 1N27A 4JJDA 3A8GB 3EHQA 3QJYA 4FT2A 3VYHB 4PFOA 2K5LA 4M77C 3WXMB 1M2OA 2JS0A 3G71T 2X35A 1M90R 1Q7YU 5CAIA 2EYYA 3RMQA 4BE2A 1Q81R 1V29B 2L3PA 5A0DA 3VRYA 1VQ7Q 2M51A 2OAWA 3OYJA 3M5AA 3MPUB 5GMKh 3CCLA 1RAIB 3NGPA 4HA8A 2O31A 1MMDA 2ZAEA 2MMPA 1QMCA 2LT4A 4J9BA 4GLKA 2QTVA 3O5ZA 2R5AA 2D0QB 2AT1B 1RAFB 2DKGA 4C8QC 1KIKA 1FMKA 2F69A 4QQGA 3CCMQ 2LMJA 3JB9F 2RO0A 2HMAA 3FEOA 4C5HA 1KD1R 1W1FA 3OW2P 1GFDA 1F1BB 1M9SA 1YJNT 2C0TA 1RLQC 4AG2C 4E7ZA 3OS0A 2OTLA 3CCRA 3JCMV 1G3WA 5D6XA 4D8KA 2EKOA 2IPOB 4M7DA 4M78C 3X25B 1VQNA 4PJNA 5GJVB 1AEYA 2XDPA 3MCAB 2W0ZA 1M27C 5IHKA 1KQ2A 2B8AA 3EH1A 4XK8E 4JLGA 1JXOA 2XK0A 1BI3A 4HKEA 5CR2A 2CP6A 5CVIA 3CCLT 1N9RA 5DM7R 1M2VA 3KFVA 1JU5C 2DA9A 2DERA 3DKMA 4XU1A 1YCSB 1OU8A 3PE0A 5J39A 1ZSZA 3V7CA 1BKBA 4OMMA 1JJ2A 2RPNA 4JDSA 4E2FB 2HEQA 1SRLA 4KT0E 2MK5A 2KRSA 2OTLT 1R8OB 3CCRT 2H3EB 4M78E 3CC7A 2DX1A 4JS5A 4M7AA 2HQXA 3SWNB 1YI2T 1GCQA 4FU6A 3VUZA 3OYGA 1VQNT 1S72Q 5IXBA 1OV3A 2NLUA 4J6WA 1B34A 3LW5E 5GAMd 3JAME 3P8BB 1BCOA 2DAQA 2WSCE 2EKHA 3VYGA 3HP9A 3LGLA 2Z0WA 4A63B 1VQ4Q 1RLPC 4FSXA 5I21A 3CPFA 3OYMA 1MMGA 4JPBW 3EFRA 4Q5WA 5GMKj 1YP5A 1Z9ZA 3INZA 2GTJA 1ARKA 3JCMJ 5L23A 2D8JA 1GBRA 1SPKA 2MYSA 2V8KA 1WHKA 1K9MC 3V7RA 4D6WA 1KFZA 5GAMe 1VQ5T 3QZ5B 4GLMA 3L2QA 4XTXA 3QIIA 3RESA 2VKNA 3JCMc 4XAXB 3DB3A 4KH0B 1D1AA 3M58A 2LP5A 5HK0A 3BE3A 1VQ8A 5CCAA 3LH5A 4KGVB 1JXMA 2YUQA 3LWIA 4KGZB 4PJJA 4M75C 4C92A 2JTMA 2J6OA 1OPKA 2OX7A 4MDWA 1RUWA 1WXTA 2D8HA 2BE9B 2E12A 2P0PA 4C92D 2D1XA 4GY5A 5A0GA 2ROTA 2ZGWA 3G6EQ 4M7DB 2JVVA 3GPLA 1D0YA 4OMQA 3MEAA 2XHCA 1NLOC 1QCOA 2J06A 4A4GA 5GAOn 2VVKA 2EQKA 2DIGA 2JTEA 1W6XA 4M77G 2K5IA 1Q86U 3HRSA 2A28A 1I81A 3RKYA 5LJ3j 3REAB 2YHTA 2X4XA 1O9SA 4OB1B 1M2VB 3CMEQ 3M9QA 1XJWB 5HCKA 2EJFA 2QTXA 1UJYA 1ZSZB 3OS2A 2ZPBB 5I2SA 3OYAA 1BI2A 1VQ4A 2DYBA 4M75E 4AFUC 1NJIC 3OMGA 5KH6A 1WPYA 4C8QG 3KBGA 1VUBA 2MAMA 4BB7A 3R6OA 1AZGB 1H92A 5IHNA 5LJ5h 4LD9K 5GJWB 1N8RR 4M7AB 2FEIA 2DPPB 4ELYC 3QG1A 1B34B 3CBPA 4M78G 3FDRA 4BI3A 1UEBA 4IUVA 1U1TA 2BZYA 4PLIA 3TVTA 3EG1A 4J6XA 3I35A 1FXXA 3X20B 3M4YA 4XU2A 3M55A 4ORZA 3VKIA 1OI1A 3GNFB 1MNEA 5HY6A 2COZA 1S72T 5GANe 4OB2B 1LOJA 3I55Q 2ED1A 5EC7A 1QLYA 1OPLA 1YFNA 1M90U 2COWA 1WLPB 3M4GA 2VXEA 4CC4B 3E19A 1WYXA 1YJWQ 1Q81U 2FPFA 1VQ4T 1PC0A 5IHIA 2DTHA 1OZ3A 1NM7A 1QVPA 2RHZA 4J9DA 1V76A 5KCOA 2RQWA 1WDXA 2O2OA 2O4XA 5DLQE 3VS7A 2XMFA 2RQTA 4EDUA 2EQMA 3RIRA 1KD1U 4J9FA 2DD5A 1T0JA 1UGSB 3QUIA 4C92B 4JUVA 2NUZA 1WA7A 2ZPEB 2Y90A 1S1NA 1QP3A 2M0OA 1QKWA 2PQWA 2BIVA 2RM4A 5J3BA 2PVGB 1DJ7B 4M7DF 4KBMB 4AFSC 4LNPA 1IZ6A 3JB9H 2EPDA 5GAOr 3CCJQ 4ATOA 4QVZA 1AT1B 2HCKA 4N4IA 1KQSS 1WQ7A 2LCSA 1IO6A 3JCMb 2Y4XA 4BE1A 4XTVA 2RQRA 4MZPA 1ZSGA 4JS4A 1VA7A 3EH2A 4A4KA 2DK3A 4RTVA 4B9WA 5LJ5j 1Y57A 2ZPFB 1IB8A 2F5TX 4C92C 1H641 1M1KC 1UUEA 1VYVA 2GTOA 2HSEB 1XQHA 2VB6A 3I55A 3VS5A 3GP8A 1G2BA 3VS4A 2RQUA 2HAXA 3CMET 4M75G 3HRTA 2ZZDA 3SB2A 3TQ7P 3SEMA 1YJWA 2DILA 5IAYA 2KSSA 2DF6A 5M9OA 4M7AF 1H3HA 2DXTA 1RAAB 4M78A 5KYNA 2XD0A 3ZBDA 4OMNA 4XTYA 4DEYA 4AMCA 5D6YA 4A4HA 1QWEA 2HBPA 2X4JA 2G6FX 4Y92A 4PKCC 4M78D 3URGA 1AHJB 1JEGA 1TTHB 1YNZA 1IRXA 3FIFA 2CKKA 3P8DA 2LNVA 3CCEQ 4J9HA 2RHUA 1V1CA 1XNIA 3CC4A 1I07A 1Q95G 3A98A 1NYGA 4DBQA 4P5NA 3L2UA 2JTFA 4B9XA 3D7SB 1OOTA 4B6MA 3OW2S 4QKUA 5GAN3 4JRKA 5KYWA 2E6NA 4A4FA 1WJQA 2BZXA 4E7KA 1K8AC 4ZGDB 3UT1A 1WIEA 3JSCA 3EG2A 2DEUA 2AKKA 3I55T 1G3SA 5AYFA 1K1ZA 4HCZA 2P4RA 3X24B 3NMZC 1KJWA 4PJOC 3RKXA 2LT1A 1KHCA 3RBBB 2W10A 5FU7B 2X3XD 1YJWT 1QQJA 1VIFA 2WACA 3OYFA 1GRIA 4BY6B 1UHCA 2O4XB 1KSWA 3RDVA 4X1VA 2KROA 2CSIA 2XIDA 2KRNA 2ATCB 1GBQA 2YSQA 2EQJA 1C1AA 1VQ9A 1N5ZA 1QWFA 1ZX6A 4XU3A 2CREA 1OX9A 1QCFA 1CSKA 4O5VA 2V1RA 2DMOA 2AZSA 2ZPGB 1K9MR 3M0UA 1RAHB 1ZHIA 3G71A 2J7IA 1Y7XA 2K3YA 2CZ6B 2EYXA 2V8JA 3E1SA 5HK3A 1YBYA 4RTYA 2RI5A 1NEGA 3HRUA 2SEMA 3HSBA 1PM3A 2KY9A 4PJOE 3N5BB 3X26B 2PU9B 4E7HA 2LC4A 4EMKC 4Z89A 2RA2A 1M4ZA 1TUCA 5CKFA 1SSHA 3F70A 4KUDK 1JB0E 4LDXA 2CZ1B 2YUNA 3CCEA 4J9EA 2RQVA 3JRZA 3LLRA 3FB9A 2HQHA 4UC4A 1GXIE 1M1FA 4M75A 1YHQA 3HFOA 1N9SA 5KYUA 1MMNA 4ZN3A 1JO8A 4XTWA 3PT9A 1TG0A 2EYZA 4LXCA 3MP8A 2DTOA 2ECZA 4DOVA 1N8RU 5GAOm 4M75D 2O01E 2KK4A 1TUDA 2IIMA 2GBQA 2A36A 3PIOA 4M78B 2DXCA 3MJXA 1PWTA 2JMCA 1I0CA 3GNGA 3NTKA 2LJ0A 4FW1A 2AZVA 2M1HA 4LUEA 1ABQA 2JW4A 4FW2A 2CGHA 4BDYA 4JRQA 1B3QA 1ZBJA 1NG2A 2ROLA 2HSPA 2KBTA 2H8HA 4Y91A 4OMFB 1LNXA 1N6AA 2X4WA 2DL3A 1M8VA 3CD6A 5KE3A 1G83A 2MPXC 2FYKA 1I4K1 2GQVA 1AZEA 2FHDA 5KYWB 1IHWA 2NUTA 4ZTJA 3CCET 3V8JA 1MHNA 4FYYB 3PMIA 1BIAA 1X75C 4C92G 1YHQT 1LPLA 4BE0A 2QG9B 3QPHA 2JZ2A 1YI2A 1M5Q1 4JRPA 2K6DA 3AT1B 4E7JA 2MOXA 8ATCB 3UPUA 3META 1H8KA 2K2MA 3PVQA 3P8HA 2C06A 2QQRA 5GAMg 4J7IA 3DLLA 1VQ6A 4DBFA 2RF0A 4FIBA 5LJ5f 1R77A 2QQSA 2CP2A 1YJ9Q 2VV5A 5IXFA 2XICA 4FYXB 4HXJA 3CD6T 2K9GA 4M77F 3PTAA 2GGRA 1X69A 1VQ5A 1D1CA 1QVGS 1LJOA 5I11A 3PNWC 3CBOA 1EX4A 3EAEA 3BDLA 1WXBA 1HSQA 2CDTA 1C6VX 2P0QA 1OULA 3JCMd 4PJOG 3VS2A 1VQ7A 3CBMA 1WQWA 5LL6S 3A8HB 2K5FA 4C8QF 4QVDA 2EVRA 3CC2Q 2NWMA 2LX7A 1G3YA 1M3CA 4M75B 1RADB 5I2MA 2OTJQ 2RK1A 2JT4A 4F17A 5KYUB 5A0LA 1NEBA 1TOVA 3SHWA 1KQSA 3C12A 3X28B 5CO7A 1VQ6T 4R55A 4PJLA 3CCMA 4M78F 3J81E 3JCMe 2LNHB 2CZ0B 3M0TA 1VYUA 1UG1A 1K0SA 3KUFA 1WJSA 3H0IA 2I0NA 2LZ6B 1JBMA 3PMTA 1X6GA 3CXCP 4LDYA 1D3BA 3CMAQ 1PRLC 3UA7A 1M1KR 3CCVQ 4RTXA 2DLPA 2EJGA 3PFSA 2EGAA 1Y07A 3BDUA 2HDAA 3WVDB 2FPDA 3Q1JA 1VQ7T 4HCBA 2NUTB 2DE0X 1VQOQ 3I9QA 1YJ9A 3OQ5A 2ZCFB 2KMTA 1TWBA 1RAEB 3EG3A 3EHRA 1T3LA 3H9NA 4C0GA 5C0MA 1KG1A 1AD5A 4Z88A 3G4SQ 4ZGJB 5GANg 4J5YA 3CCMT 4X34A 4EPCA 2EJ9A 1C0MA 4JLIA 3VS3A 4QQ6A 4IKFA 7AT1B 3OW2A 2QQAA 2BE7D 2FVUA 2CZ7B 5KE2A 4KH1B 2YXYA 5KYYA 4FCYA 4V2SA 5FRNA 1S72A 4RTZA 4LDWA 1K9MU 3TCJA 1K4US 2QASA 1X27A 3CC2A 3MO8A 4A53A 1VQMQ 1YI2Q 2E65A 2PTKA 1AWWA 5AT1B 2OTJA 2X9HA 5FWCA 1K8AR 2LVMA 2HZYA 2F1LA 3AHUA 1U1SA 4BD3A 2F2XA 2LQNA 1EFNA 2D6FA 3I5SA 2RK2A 2LJ3A 1IXDA 5GAOp 3M0RA 1KK7A 3OY9A 1ZUYA 4JRIA 5GANd 2YUPA 1UGPB 2RJEA 1YJ9T 1WHHA 4PJOA 2L3RA 4C0FA 1VQKQ 2XDDA 1QVGP 3R6NA 4ESRA 6AT1B 1PSEA 2RH2A 3JV3A 4PJOD 1UE9A 2FZKB 2L89A 3M57A 1Q82C 2JXBA 2KI7A 2FPEA 4D8DA 3HFNA 3QKJA 3CCVA 1X43A 2GFAA 2NUPA 3UF4A 2C0OA 2LTOA 1D09B 1A0NB 2X51A 1D0XA 2JJ9A 3CC2T 3VS0A 3V8LA 4X9DA 2E70A 2KGTA 1B7TA 2OTJT 1OYXA 1O75A 2SRCA 1VIEA 3CCUQ 1WGSA 2VUBA 3G6EA 1QVFS 4AT1B 5IH2A 4Z02A 4KUIA 1ZBXA 2A08A 2HL3A 2AHJB 1NJIU 4KGXB 2DD4A 1D3BB 2PVOB 2QDYB 2L0AA 4EMKA 3HHTB 4HVVA 1EZZB 4F7UE 4OF1A 5FRMA 2VWFA 1NPPA 4OGEA 1B07A 4RTTA 4ZTFA 3MP6A 4M7DE 3JB9D 1WHMA 3CMEA 3RR6A 3CMAT 2EQUA 2QA4Q 2DL8A 1I5LA 1YIJQ 3CCVT 5GMKe 2RB6A 1TS9A 1UFFA 4JJCA 5FROA 1PSFA 1X6OA 2ZPIB 3I56Q 3DLMA 4LD6A 4DBRA 1VQOT 1J3TA 1RAGB 1BI0A 2J05A 2PVDB 2DJQA 3M0SA 1NZ9A 2DM1A 1FYNA 3C0CA 4IUTA 1BBZA 1VQKA 1U06A 3V8KA 1TXQA 1NBEB 2JM9A 3G6ET 5KYYB 2DRKA 2RNAA 4PL6A 2E5KA 1E7OA 2KEAA 3JCMP 2A0FB 1UGVA 2CYZB 4E47A 5C6SA 3FJ5A 1X2KA 5LJ3d 2DBMA 2LCLA 1EIFA 4J9CA 3M54A 1UB4A 2KDSA 4M7AE 1P92A 3PGGA 1OX8A 1WZOA 2CP5A 1ZA1B 3CCUA 4PJOB 3JCMh 1OQKA 2MF2A 1D0ZA 2CP3A 2RMOA 4PNOA 4ANJA 4DEXA 1KC8C 3EGUA 5GAMh 1GFCA 1JRIA 3THKA 1I5OB 4R56A 5CKHA 4DOWA 1MNDA 1K73C 4N0AA 5LJ3e 5GAN4 4OMLA 3OYLA 1VQKT 2DZ9A 4OMPA 3EGXA 2NUPB 3OYDA 1QVGA 1Y0MA 3OS1A 5CKDA 8AT1B 1AVZC 5GMKl 3SD4A 2QA4A 4RMOA 1WXUA 4IIOA 3JCMQ 2YRVA 2CUBA 1YIJA 4E7IA 4NOYA 2QGFB 2E64A 4ZNXA 5FLXE 2P0KA 3I56A 1PKSA 3C4SA 1Z9QA 4M4ZA 2L3SA 1M1KU 4K11A 1WHLA 2DETA 3CCJA 5ECAA 3M0QA 4TVRA 2Y4YA 1QVFP 3QJ6A 1I8FA 1VQPQ 2AIRB 3CCUT 1SHGA 4EMKB 4IURA 5GAOq 3JB9I 4C92F 5GAN5 3H41A 3OSSC 2HKQB 2LQKA 3TSWA 3CEYA 4QT7A 5FW9A 5L8RE 4F7UG 1NPRA 1QW1A 1W2BS 3QHSA 3S6WA 1X6BA 3EG0A 3LX7A 4BDZA 4DQ2A 3CCQQ 2RJFA 2LQ8A 2KQWA 4IUUA 3M0PA 2QA4T 4BUGA 3PIPA 1JJ2P 4XTZA 1YIJT 1IGUA 2RHXA 1Q7YC 3HPWA 2DTIA 4LE9A 4F16A 3NTHA 3ME9A 3FC3A 4MMLA 4C5GA 3I56T 4IUPA 2K3BA 2OTLQ 3QZ9B 1K8AU 3CCJT 2CP0A 2YUOA 3MEVA 4XQ3A 3VS1A 4WTOB 2IG0A 1HJDA 5GMKi 4J8OA 3FRNA 5DY9A 3TREA 4A54A 3VU3C 2CSQA 2H3JA 3OB9A 2E3HA 3RNJA 5GAMj 2FO0A 5GANh 5LJ5d 2F2VA 2DYIA 4PJOF 3REBB 2EYWA 3LWHA 3VV0A 1PKTA 4KRTA 4PK4A 4DBHA 2JN0A 3CXCS 2GQIA 2MWPA 3L42A 2K7AA 5D7UA 3QYGB 4C0DB 1UDLA 4HVUA 4FT4A 1R0BG 3RERA 3QSUA 1OU9A 3L2RA 3RMSA 3EGXB 3ASKA 4CC2A 1LCKA 2DFUA 2V8IA 1KQ1A 1NYFA 5LJ5e 1U8RA 3CC7Q 1NJIR 4RTUA 2YT6A 3J80E 3L2WA 1RL2A 1Y71A 2KR3A 1YWPA 1G8XA 4BACA 2DVJA 3OMCA 2FZCB 2QYZA 2K2VA 2RN8A 2NYSA 3CCQA 2DRMA 2I2LA 3HTRA 4ZGEB 3QDRB 1BCMA 1OEBA 2DL4A 3GOXA 1Q82R 1WNLA 4OVAA 3A1PA 4QVCA 2E6ZA 2HKNA 2JNGA 1SHFA 2L8DA 2PZ1A 3J7AF 1IREB 3JCMg 2QGGA 4N0AC 3OSVA 4X9CA 4C0DC 5DLOA 2QDLA 4F7UA 2RHIA 4CRIA 4JZ3A 4L5GA 5GAN2 1VQPT 1QVFA 2A37A 2YWWA 4M77E 3DB4A 2XG8D 2F5KA 3UDCA 3H0FA 2BUDA 2K3XA 4M7DD 3T9NA 2A3LA 1W2BP 1XOVA 1BU1A 1VQ8Q 2FB7A 3LGFA 2EBPA 5CK9A 2DZCA 2L3QA 2QI2A 4N4HA 3H6ZA 2LX9A 1GL5A 4PFPA 2V26A 2KE9A 5GAN7 3CCQT 2MCNA 1HYOA 2VC8A 5GANj 3BY7A 4C8QE 2YLBA 1YCYA 1VQLQ 3OA6A 2X4YA 3QBYA 2RHYA 3MEWA 3EFSA 3G7ZA 4HVWA 4LUDA 2FG0A 5LJ3h 1T0HA 4XU0A 1PD0A 3QYHB 2DO3A 4PFZA 1JQQA 2X3WD 2LRQA 2HNIA 3M56A 2EW3A 1QKXA 2DXUA 1WHJA 2MWOA 3OYEA 2XU8A 3CPWS 4A4EA 1E6HA 2E4HA 3OYNA 5CQYA 3A8OB 2HL5C 2EGEA 3OBWA 4MMKA 2LDMA 1SSFA 2OJ2A 4M7AD 2ESWA 2EWNA 2KT8A 3ZFJA 4C5IA 1E6GA 2PUKB 1MV3A 1MMAA 2RJCA 1PCXA 5A2QE 1SF9A 1BIBA 5GAN8 2K57A 4J9GA 2DXBA 1Y96A 3S3OA 2B86A 1Q86C 2CH4A 1FMWA 3RUXA 2ED0A 1HXDA 4AFQC 2JMAA 4QW2A 2VYTA 2F2WA 3SDZA 1XTDA 2P84A 1U5SA 4WCIA 2J6FA 2E5QA 3JB9G 4NL3A 4HT9A 3ULRB 1AOJA 1ZQ1A 4J7FA 3SWNC 1KC8R 3CC7T 3TU4K 4JJBA 4E6RA 1NE8A 5J26A 5GMKm 2MI6A 3NTIA 2O9SA 1M8MA 3KXTA 4AG1C 1BYMA 1UECA 4ELZC 1W70A 2COYA 1UGQB 1K73R 4L6V5 2RI2A 3CCSQ 4FYWB 3FLGA 1AWOA 1VQLA 4AFZC 1G5VA 4FM4B 4F7UB 2JOYA 4MZMA 1SRMA 1WI7A 1TH7A 3JCMf 3A8LB 3L1AA 5FWBA 1ZLMA 1MV0B 5GAMf 1YWOA 1WHGA 3S3MA 2AK5A 3OYKA 3BW1A 1M90C 1SEMA 1RI9A 2YDLA 1H3ZA 1Q81C 1QP2A 2LJ1A 1M1GA 4RCBA 3RKWA 4NL2A 2PUOB 3M53A 4HCCA 2KRMA 2VXFA 5GAOl 9ATCB 1VQ8T 3E9GA 1I1JA 2FRYA 5IT9E 1W2BA 1CKBA 3VS6A 3NFCA 2EYQA 1PHTA 4NS5A 1VYTA 2EIFA 3OYBA 2KVQG 3CQTA 5D6WA 2FRWA 1R0CB 2DEQA 4M75F 4OGCA 2EFIA 3CMAA 1KD1C 4M7DC 1VQLT 1PRMC 4F04B 2AKLA 5IN1A 3UATA 4JZ4A 1HK9A 4J6YA 2CS7A 4HT8A 3UWNA 3E9FA 2EAYA 3I5RA 4R0KA 4F14A 1ZA2B 1VQOA 3L2VA 3CPWP 3QWXX 2DVEA 2KAFA 2KYBA 2YRDA 1Q7YR 2DL7A 2GNCA 2QK0A 2FL7A 4L59A 2M9UA 5KYXA 3G4SA 4C5EA 1D1BA 3GF5A 1Y96B 1ZSZC 2LQWA 2A7YA 2O88A 2XI9A 3CCSA 3HKSA 3BFMA 1M30A 3M59A 3A8MB 1BB9A 1AWJA 2D9TA 1PG5B 1FMVA 3EFOA 2E1HA 3EGDA 3SFMA 3TEEA 1FWZA 4II1A 1VQMA 3OS5A 4M7AC 2YLCA 4LDUA 1GCQC 3L2ZA 5LJ3g 3CXCA 4FYVB 1Q82U 1ZUKA 5CKBA 3O8VA 2CT4A 4LN2A 4N4GA 2XKOC 1KHIA 2GF7A 1M3BA 3OYHA 1JJ2S 2JUFA 2K79A 4J9IA 3MP1A 3CC4Q 4VUBA 2IVWA 4RG8A 3LH0A 3QO3A 3EG9A 3VUBA 3MEUA 1BI1A 3HL8A 4Z8AA 2L2PA 2O9VA 3JCMW 3E2UA 4RKUE 4F7UF 3U23A 5GANf 1YITQ 3G4ST 2KNBB 1PD1A 2KYMA 3OYYA 1RABB 4O6JA 2PNIA 4CC3A 1RACB 4M77A 3UA6A 3CCST 3OYIA 4BI4A 2M02A 4ME7A 4MZTA 1K9AA 4M77D 4IUQA 4J83A 4MDXA 2RI3A 1VQ9Q 1AWXA 5I22A 1VQMT 1ACMB 4OMOA 2QEXQ 5CIUA 4C0ZA 4FL6A 4HCKA 1M3AA 1K76A 4C8QA 4BI8B 1WFWA 2KT1A 2GFUA 4EMHA 3H8ZA 3A5ZB 3G71Q 3C94A 1SKUB 2C0IA 2JS2A 3C95A 1QCNA 4C8QD 2K4YA 2DNUA 4QQDA 2MIOA 2QAZA 3GIBA 1PNJA 4EMGA 3S3NA 4OP0A 3FJPA 3QWYA 4RG2A 4OB0B 2VGNA 2R58A 4XTUA 3V7SA 1CKAA 1G3TA 2YRCA 1TU0B 3MKDA 1IGQA 3ZEHA 2QQBA 5CKEA 3G1JA 3IQLA 3OBYA 4IIMA 5KYXB 2ZPHB 1SG5A 2G3RA 4PLLA 1T3SA 1UGRB 1YHQQ 1YJNQ 2ABLA 3NHNA 1MGQA 5FU6B 2L5QA 3CPWA 4RCCA 4C92E 1FX7A 3QDFA 3ZL7C 4E7SA 2KXDA 2RJDA 2WSFE 2DL5A 2HBWA 2VGMA 1YITA 4OB3B 2EQIA 2VASA 2HQEA 4WF2A 5CQXA 1MUZA 3EFOB 3MHXA 3EGDB 3JCMX 1HD3A 4RUGA 4GBQA 1KC8U 2E10A 1LVKA 4FSSA 2QQ9A 5KCHA 1X01A 4E7LA 2GCXA 2R5MA 2ENMA 4KULA 2CUDA 1BK2A 3CCLQ 2HD0A 4M7DG 2BZ8A 1K73U 1N8RC 5LJ5g 1WX6A 5HKCA 3JB9J 3CD6Q 2EGCA 5LJ3f 2CT3A 3TSZA 2CP7A 3EG9B 2J6KA 1OZ2A 3OYCA 2D0NA 2QEXA 1Q86R 1K0XA 4DA4A 2KXCA 3H0HA 5FU6C 1YN8A 3CC4T 2BTTA 2DBKA 4RTWA 3CCRQ 2M16A 1TUGB 2V1QA 4M77B
chains in the Genus database with same CATH topology
2RQRA 2KE9A 1ZSGA 1VA7A 2MCNA 2F2XA 2LQNA 1ZUUA 1EFNA 4RTVA 3I5SA 2CH4W 2LJ3A 2OI3A 3M0RA 1ZUYA 4HVWA 1Y57A 2FG0A 2YUPA 4LUDA 1U3OA 1UUEA 1T0HA 2JM8A 1VYVA 3VRZA 1UTIA 2GTOA 3VS5A 1JQQA 2X3WD 3R6NA 1G2BA 4ESRA 3VS4A 2RQUA 3NPFA 1UHFA 2EW3A 1NLPC 1QKXA 3JV3A 1UE9A 3SEMA 2DILA 2DF6A 2JXBA 1E6HA 1UJ0A 1H3HA 2FPEA 4EIKA 2EGEA 4D8DA 4OMNA 3PVLA 4DEYA 4CC7A 2OJ2A 1X43A 2ESWA 1ABOA 1X2QA 1GCPA 2KT8A 3GBQA 3UF4A 2C0OA 1QWEA 2M0YA 1E6GA 2G6FX 4JJDA 1MV3A 4Y92A 3EHQA 1JEGA 1YNZA 1A0NB 2JS0A 3VS0A 4J9HA 2KGTA 2EYYA 2SRCA 4J9GA 1V1CA 2B86A 1I07A 2L3PA 3A98A 2CH4A 3VRYA 1NYGA 2M51A 2OAWA 2ED0A 1OOTA 4AFQC 3NGPA 5IH2A 2JMAA 2O31A 2F2WA 2A08A 1U5SA 4WCIA 2J6FA 2BZXA 4J9BA 1WIEA 3EG2A 2L0AA 3O5ZA 3ULRB 2AKKA 1AOJA 1K1ZA 2P4RA 3NMZC 1KIKA 1KJWA 1FMKA 4HVVA 2LMJA 3RBBB 2W10A 1W1FA 2X3XD 2VWFA 4JJBA 4E6RA 1B07A 1GRIA 4RTTA 1UHCA 1KSWA 1GFDA 4X1VA 2KROA 2C0TA 2CSIA 1RLQC 4AG2C 2O9SA 1M8MA 2KRNA 2DL8A 4AG1C 1GBQA 1UECA 2YSQA 1W70A 4D8KA 1UFFA 4JJCA 5GJVB 1N5ZA 1QWFA 1ZX6A 1AEYA 2W0ZA 1AWOA 2CREA 4AFZC 1M27C 1QCFA 5IHKA 1J3TA 1CSKA 2V1RA 2J05A 2DMOA 2DJQA 3M0SA 2DM1A 2AZSA 1SRMA 1FYNA 3C0CA 1BBZA 1JXOA 1WI7A 3M0UA 1U06A 2J7IA 2JM9A 2DRKA 2RNAA 5FWBA 1ZLMA 2EYXA 1MV0B 1YWOA 3KFVA 1JU5C 4RTYA 2AK5A 2DA9A 2E5KA 1YCSB 1E7OA 1SEMA 1NEGA 1RI9A 2KEAA 2SEMA 3PE0A 2YDLA 1UGVA 2LJ1A 3FJ5A 1X2KA 4OMMA 2DBMA 4Z89A 2KRMA 2RPNA 1TUCA 1SSHA 4J9CA 2HEQA 1SRLA 1I1JA 2FRYA 1CKBA 3VS6A 2KRSA 2YUNA 1PHTA 4J9EA 2DX1A 2RQVA 1VYTA 3CQTA 1GCQA 2FRWA 5IXBA 1OV3A 2RMOA 4DEXA 1JO8A 1TG0A 2EYZA 3EGUA 2ECZA 1PRMC 1GFCA 3THKA 2EKHA 1TUDA 2AKLA 2IIMA 3UATA 2GBQA 2A36A 4JZ4A 4A63B 1RLPC 4OMLA 1PWTA 2JMCA 3I5RA 4R0KA 4F14A 4OMPA 1I0CA 3QWXX 4JPBW 2LJ0A 2AZVA 1Y0MA 2KYBA 4LUEA 1ABQA 1YP5A 2JW4A 2DL7A 1Z9ZA 2GNCA 2GTJA 1ARKA 5L23A 2D8JA 1AVZC 1GBRA 1B3QA 1SPKA 1NG2A 1ZBJA 2ROLA 2HSPA 2KBTA 2H8HA 1KFZA 1WXUA 4IIOA 2CUBA 2LQWA 2DL3A 2O88A 4GLMA 1G83A 4ZNXA 1M30A 2VKNA 1AZEA 1BB9A 1PKSA 1AWJA 1Z9QA 4M4ZA 2L3SA 4K11A 5ECAA 3M0QA 2LP5A 1SHGA 3LH5A 1JXMA 2YUQA 1GCQC 2J6OA 1OPKA 1ZUKA 2CT4A 4LN2A 1RUWA 3H41A 2K6DA 1WXTA 1M3BA 2D8HA 4J9IA 2K79A 2MOXA 3TSWA 4QT7A 5FW9A 2D1XA 2ROTA 1H8KA 2K2MA 3PVQA 4OMQA 4Z8AA 2L2PA 2O9VA 1X6BA 3EG0A 1NLOC 2J06A 2VVKA 3U23A 3M0PA 2JTEA 1W6XA 2KNBB 2RF0A 2KYMA 2A28A 2PNIA 4CC3A 5IXFA 4HXJA 2K9GA 3UA6A 4LE9A 3REAB 4F16A 2GGRA 2K3BA 1X69A 5HCKA 1K9AA 2YUOA 3VS1A 1UJYA 1HJDA 5I11A 2DYBA 1WXBA 1HSQA 4AFUC 1AWXA 2CDTA 5I22A 4OMOA 2CSQA 3RNJA 2FO0A 4HCKA 1AZGB 1M3AA 3VS2A 1K76A 1WFWA 1H92A 2KT1A 2F2VA 2EVRA 5IHNA 2NWMA 2LX7A 5GJWB 2FEIA 3REBB 2C0IA 2JS2A 1M3CA 2EYWA 2JT4A 2DNUA 4F17A 1PKTA 1NEBA 4KRTA 3SHWA 2MIOA 2BZYA 3TVTA 3EG1A 3I35A 1PNJA 4ORZA 2GQIA 3QWYA 2K7AA 1UDLA 4HVUA 1CKAA 2LNHB 3M0TA 1VYUA 1UG1A 1LCKA 4CC2A 2ED1A 5EC7A 1K0SA 1QLYA 1OPLA 1NYFA 1WLPB 3H0IA 2I0NA 3IQLA 4CC4B 4IIMA 1WYXA 4RTUA 2FPFA 2LZ6B 1T3SA 2YT6A 5IHIA 1X6GA 2ABLA 3NHNA 1NM7A 1PRLC 2KR3A 4J9DA 3UA7A 1YWPA 4RTXA 2DLPA 2DVJA 3ZL7C 2EGAA 2KXDA 2HDAA 2RN8A 2FPDA 2DL5A 2DRMA 2HBWA 2RQWA 2EQIA 1WDXA 2O2OA 2DE0X 1OEBA 2DL4A 3VS7A 1MUZA 3I9QA 1HD3A 4RUGA 4GBQA 2XMFA 2RQTA 3EG3A 3EHRA 4J9FA 4FSSA 1T0JA 1T3LA 1SHFA 2ENMA 2PZ1A 1AD5A 2CUDA 4Z88A 1BK2A 2NUZA 1WA7A 1S1NA 2BZ8A 2QDLA 1QKWA 4JZ3A 3VS3A 1WX6A 2EGCA 2CT3A 2A37A 3TSZA 2J6KA 2D0NA 3H0FA 4AFSC 4LNPA 1K0XA 2EPDA 4RTZA 2KXCA 3H0HA 1XOVA 1BU1A 1K4US 2HCKA 1X27A 1YN8A 2EBPA 2LCSA 2BTTA 2DBKA 4RTWA 2L3QA 1IO6A 2PTKA 1AWWA 5FWCA 2V1QA 1GL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RQR A;  2KE9 A;  1ZSG A;  1VA7 A;  2MCN A;  2F2X A;  2LQN A;  1ZUU A;  1EFN A;  4RTV A;  3I5S A;  2CH4 W;  2LJ3 A;  2OI3 A;  3M0R A;  1ZUY A;  4HVW A;  1Y57 A;  2FG0 A;  2YUP A;  4LUD A;  1U3O A;  1UUE A;  1T0H A;  2JM8 A;  1VYV A;  3VRZ A;  1UTI A;  2GTO A;  3VS5 A;  1JQQ A;  2X3W D;  3R6N A;  1G2B A;  4ESR A;  3VS4 A;  2RQU A;  3NPF A;  1UHF A;  2EW3 A;  1NLP C;  1QKX A;  3JV3 A;  1UE9 A;  3SEM A;  2DIL A;  2DF6 A;  2JXB A;  1E6H A;  1UJ0 A;  1H3H A;  2FPE A;  4EIK A;  2EGE A;  4D8D A;  4OMN A;  3PVL A;  4DEY A;  4CC7 A;  2OJ2 A;  1X43 A;  2ESW A;  1ABO A;  1X2Q A;  1GCP A;  2KT8 A;  3GBQ A;  3UF4 A;  2C0O A;  1QWE A;  2M0Y A;  1E6G A;  2G6F X;  4JJD A;  1MV3 A;  4Y92 A;  3EHQ A;  1JEG A;  1YNZ A;  1A0N B;  2JS0 A;  3VS0 A;  4J9H A;  2KGT A;  2EYY A;  2SRC A;  4J9G A;  1V1C A;  2B86 A;  1I07 A;  2L3P A;  3A98 A;  2CH4 A;  3VRY A;  1NYG A;  2M51 A;  2OAW A;  2ED0 A;  1OOT A;  4AFQ C;  3NGP A;  5IH2 A;  2JMA A;  2O31 A;  2F2W A;  2A08 A;  1U5S A;  4WCI A;  2J6F A;  2BZX A;  4J9B A;  1WIE A;  3EG2 A;  2L0A A;  3O5Z A;  3ULR B;  2AKK A;  1AOJ A;  1K1Z A;  2P4R A;  3NMZ C;  1KIK A;  1KJW A;  1FMK A;  4HVV A;  2LMJ A;  3RBB B;  2W10 A;  1W1F A;  2X3X D;  2VWF A;  4JJB A;  4E6R A;  1B07 A;  1GRI A;  4RTT A;  1UHC A;  1KSW A;  1GFD A;  4X1V A;  2KRO A;  2C0T A;  2CSI A;  1RLQ C;  4AG2 C;  2O9S A;  1M8M A;  2KRN A;  2DL8 A;  4AG1 C;  1GBQ A;  1UEC A;  2YSQ A;  1W70 A;  4D8K A;  1UFF A;  4JJC A;  5GJV B;  1N5Z A;  1QWF A;  1ZX6 A;  1AEY A;  2W0Z A;  1AWO A;  2CRE A;  4AFZ C;  1M27 C;  1QCF A;  5IHK A;  1J3T A;  1CSK A;  2V1R A;  2J05 A;  2DMO A;  2DJQ A;  3M0S A;  2DM1 A;  2AZS A;  1SRM A;  1FYN A;  3C0C A;  1BBZ A;  1JXO A;  1WI7 A;  3M0U A;  1U06 A;  2J7I A;  2JM9 A;  2DRK A;  2RNA A;  5FWB A;  1ZLM A;  2EYX A;  1MV0 B;  1YWO A;  3KFV A;  1JU5 C;  4RTY A;  2AK5 A;  2DA9 A;  2E5K A;  1YCS B;  1E7O A;  1SEM A;  1NEG A;  1RI9 A;  2KEA A;  2SEM A;  3PE0 A;  2YDL A;  1UGV A;  2LJ1 A;  3FJ5 A;  1X2K A;  4OMM A;  2DBM A;  4Z89 A;  2KRM A;  2RPN A;  1TUC A;  1SSH A;  4J9C A;  2HEQ A;  1SRL A;  1I1J A;  2FRY A;  1CKB A;  3VS6 A;  2KRS A;  2YUN A;  1PHT A;  4J9E A;  2DX1 A;  2RQV A;  1VYT A;  3CQT A;  1GCQ A;  2FRW A;  5IXB A;  1OV3 A;  2RMO A;  4DEX A;  1JO8 A;  1TG0 A;  2EYZ A;  3EGU A;  2ECZ A;  1PRM C;  1GFC A;  3THK A;  2EKH A;  1TUD A;  2AKL A;  2IIM A;  3UAT A;  2GBQ A;  2A36 A;  4JZ4 A;  4A63 B;  1RLP C;  4OML A;  1PWT A;  2JMC A;  3I5R A;  4R0K A;  4F14 A;  4OMP A;  1I0C A;  3QWX X;  4JPB W;  2LJ0 A;  2AZV A;  1Y0M A;  2KYB A;  4LUE A;  1ABQ A;  1YP5 A;  2JW4 A;  2DL7 A;  1Z9Z A;  2GNC A;  2GTJ A;  1ARK A;  5L23 A;  2D8J A;  1AVZ C;  1GBR A;  1B3Q A;  1SPK A;  1NG2 A;  1ZBJ A;  2ROL A;  2HSP A;  2KBT A;  2H8H A;  1KFZ A;  1WXU A;  4IIO A;  2CUB A;  2LQW A;  2DL3 A;  2O88 A;  4GLM A;  1G83 A;  4ZNX A;  1M30 A;  2VKN A;  1AZE A;  1BB9 A;  1PKS A;  1AWJ A;  1Z9Q A;  4M4Z A;  2L3S A;  4K11 A;  5ECA A;  3M0Q A;  2LP5 A;  1SHG A;  3LH5 A;  1JXM A;  2YUQ A;  1GCQ C;  2J6O A;  1OPK A;  1ZUK A;  2CT4 A;  4LN2 A;  1RUW A;  3H41 A;  2K6D A;  1WXT A;  1M3B A;  2D8H A;  4J9I A;  2K79 A;  2MOX A;  3TSW A;  4QT7 A;  5FW9 A;  2D1X A;  2ROT A;  1H8K A;  2K2M A;  3PVQ A;  4OMQ A;  4Z8A A;  2L2P A;  2O9V A;  1X6B A;  3EG0 A;  1NLO C;  2J06 A;  2VVK A;  3U23 A;  3M0P A;  2JTE A;  1W6X A;  2KNB B;  2RF0 A;  2KYM A;  2A28 A;  2PNI A;  4CC3 A;  5IXF A;  4HXJ A;  2K9G A;  3UA6 A;  4LE9 A;  3REA B;  4F16 A;  2GGR A;  2K3B A;  1X69 A;  5HCK A;  1K9A A;  2YUO A;  3VS1 A;  1UJY A;  1HJD A;  5I11 A;  2DYB A;  1WXB A;  1HSQ A;  4AFU C;  1AWX A;  2CDT A;  5I22 A;  4OMO A;  2CSQ A;  3RNJ A;  2FO0 A;  4HCK A;  1AZG B;  1M3A A;  3VS2 A;  1K76 A;  1WFW A;  1H92 A;  2KT1 A;  2F2V A;  2EVR A;  5IHN A;  2NWM A;  2LX7 A;  5GJW B;  2FEI A;  3REB B;  2C0I A;  2JS2 A;  1M3C A;  2EYW A;  2JT4 A;  2DNU A;  4F17 A;  1PKT A;  1NEB A;  4KRT A;  3SHW A;  2MIO A;  2BZY A;  3TVT A;  3EG1 A;  3I35 A;  1PNJ A;  4ORZ A;  2GQI A;  3QWY A;  2K7A A;  1UDL A;  4HVU A;  1CKA A;  2LNH B;  3M0T A;  1VYU A;  1UG1 A;  1LCK A;  4CC2 A;  2ED1 A;  5EC7 A;  1K0S A;  1QLY A;  1OPL A;  1NYF A;  1WLP B;  3H0I A;  2I0N A;  3IQL A;  4CC4 B;  4IIM A;  1WYX A;  4RTU A;  2FPF A;  2LZ6 B;  1T3S A;  2YT6 A;  5IHI A;  1X6G A;  2ABL A;  3NHN A;  1NM7 A;  1PRL C;  2KR3 A;  4J9D A;  3UA7 A;  1YWP A;  4RTX A;  2DLP A;  2DVJ A;  3ZL7 C;  2EGA A;  2KXD A;  2HDA A;  2RN8 A;  2FPD A;  2DL5 A;  2DRM A;  2HBW A;  2RQW A;  2EQI A;  1WDX A;  2O2O A;  2DE0 X;  1OEB A;  2DL4 A;  3VS7 A;  1MUZ A;  3I9Q A;  1HD3 A;  4RUG A;  4GBQ A;  2XMF A;  2RQT A;  3EG3 A;  3EHR A;  4J9F A;  4FSS A;  1T0J A;  1T3L A;  1SHF A;  2ENM A;  2PZ1 A;  1AD5 A;  2CUD A;  4Z88 A;  1BK2 A;  2NUZ A;  1WA7 A;  1S1N A;  2BZ8 A;  2QDL A;  1QKW A;  4JZ3 A;  3VS3 A;  1WX6 A;  2EGC A;  2CT3 A;  2A37 A;  3TSZ A;  2J6K A;  2D0N A;  3H0F A;  4AFS C;  4LNP A;  1K0X A;  2EPD A;  4RTZ A;  2KXC A;  3H0H A;  1XOV A;  1BU1 A;  1K4U S;  2HCK A;  1X27 A;  1YN8 A;  2EBP A;  2LCS A;  2BTT A;  2DBK A;  4RTW A;  2L3Q A;  1IO6 A;  2PTK A;  1AWW A;  5FWC A;  2V1Q A;  1GL5 A; 
#chains in the Genus database with same CATH topology
 5GAN 6;  2BKD N;  1VQN Q;  2DJZ A;  4YTL A;  1YIT T;  1ZUU A;  3ER0 A;  2CH4 W;  2WSE E;  3LYI A;  2OI3 A;  5FU7 C;  1TSF A;  4BY6 C;  1U3O A;  1IHV A;  1W4S A;  1KQS P;  4PJM A;  2P4T A;  2JM8 A;  2E3I A;  3SWN A;  3VRZ A;  1UTI A;  2E41 A;  3WVE B;  2LCC A;  2QXF A;  3GLX A;  4M7A G;  3NPF A;  4ZN1 A;  1VQ6 Q;  1UHF A;  2DIQ A;  2FZG B;  5EG2 A;  1NLP C;  1VOM A;  2OAU A;  4C8Q B;  4CI0 C;  1YJN A;  2XDB A;  1UJ0 A;  1VQ9 T;  4JJN K;  4EIK A;  4Y28 E;  3PVL A;  4CC7 A;  2R57 A;  1VQP A;  3QXE B;  3VJP A;  1ABO A;  1X2Q A;  1GCP A;  3GBQ A;  2QEX T;  4LDV A;  1RI0 A;  1VQ5 Q;  2RD1 A;  1WJR A;  2M0Y A;  1N27 A;  4JJD A;  3A8G B;  3EHQ A;  3QJY A;  4FT2 A;  3VYH B;  4PFO A;  2K5L A;  4M77 C;  3WXM B;  1M2O A;  2JS0 A;  3G71 T;  2X35 A;  1M90 R;  1Q7Y U;  5CAI A;  2EYY A;  3RMQ A;  4BE2 A;  1Q81 R;  1V29 B;  2L3P A;  5A0D A;  3VRY A;  1VQ7 Q;  2M51 A;  2OAW A;  3OYJ A;  3M5A A;  3MPU B;  5GMK h;  3CCL A;  1RAI B;  3NGP A;  4HA8 A;  2O31 A;  1MMD A;  2ZAE A;  2MMP A;  1QMC A;  2LT4 A;  4J9B A;  4GLK A;  2QTV A;  3O5Z A;  2R5A A;  2D0Q B;  2AT1 B;  1RAF B;  2DKG A;  4C8Q C;  1KIK A;  1FMK A;  2F69 A;  4QQG A;  3CCM Q;  2LMJ A;  3JB9 F;  2RO0 A;  2HMA A;  3FEO A;  4C5H A;  1KD1 R;  1W1F A;  3OW2 P;  1GFD A;  1F1B B;  1M9S A;  1YJN T;  2C0T A;  1RLQ C;  4AG2 C;  4E7Z A;  3OS0 A;  2OTL A;  3CCR A;  3JCM V;  1G3W A;  5D6X A;  4D8K A;  2EKO A;  2IPO B;  4M7D A;  4M78 C;  3X25 B;  1VQN A;  4PJN A;  5GJV B;  1AEY A;  2XDP A;  3MCA B;  2W0Z A;  1M27 C;  5IHK A;  1KQ2 A;  2B8A A;  3EH1 A;  4XK8 E;  4JLG A;  1JXO A;  2XK0 A;  1BI3 A;  4HKE A;  5CR2 A;  2CP6 A;  5CVI A;  3CCL T;  1N9R A;  5DM7 R;  1M2V A;  3KFV A;  1JU5 C;  2DA9 A;  2DER A;  3DKM A;  4XU1 A;  1YCS B;  1OU8 A;  3PE0 A;  5J39 A;  1ZSZ A;  3V7C A;  1BKB A;  4OMM A;  1JJ2 A;  2RPN A;  4JDS A;  4E2F B;  2HEQ A;  1SRL A;  4KT0 E;  2MK5 A;  2KRS A;  2OTL T;  1R8O B;  3CCR T;  2H3E B;  4M78 E;  3CC7 A;  2DX1 A;  4JS5 A;  4M7A A;  2HQX A;  3SWN B;  1YI2 T;  1GCQ A;  4FU6 A;  3VUZ A;  3OYG A;  1VQN T;  1S72 Q;  5IXB A;  1OV3 A;  2NLU A;  4J6W A;  1B34 A;  3LW5 E;  5GAM d;  3JAM E;  3P8B B;  1BCO A;  2DAQ A;  2WSC E;  2EKH A;  3VYG A;  3HP9 A;  3LGL A;  2Z0W A;  4A63 B;  1VQ4 Q;  1RLP C;  4FSX A;  5I21 A;  3CPF A;  3OYM A;  1MMG A;  4JPB W;  3EFR A;  4Q5W A;  5GMK j;  1YP5 A;  1Z9Z A;  3INZ A;  2GTJ A;  1ARK A;  3JCM J;  5L23 A;  2D8J A;  1GBR A;  1SPK A;  2MYS A;  2V8K A;  1WHK A;  1K9M C;  3V7R A;  4D6W A;  1KFZ A;  5GAM e;  1VQ5 T;  3QZ5 B;  4GLM A;  3L2Q A;  4XTX A;  3QII A;  3RES A;  2VKN A;  3JCM c;  4XAX B;  3DB3 A;  4KH0 B;  1D1A A;  3M58 A;  2LP5 A;  5HK0 A;  3BE3 A;  1VQ8 A;  5CCA A;  3LH5 A;  4KGV B;  1JXM A;  2YUQ A;  3LWI A;  4KGZ B;  4PJJ A;  4M75 C;  4C92 A;  2JTM A;  2J6O A;  1OPK A;  2OX7 A;  4MDW A;  1RUW A;  1WXT A;  2D8H A;  2BE9 B;  2E12 A;  2P0P A;  4C92 D;  2D1X A;  4GY5 A;  5A0G A;  2ROT A;  2ZGW A;  3G6E Q;  4M7D B;  2JVV A;  3GPL A;  1D0Y A;  4OMQ A;  3MEA A;  2XHC A;  1NLO C;  1QCO A;  2J06 A;  4A4G A;  5GAO n;  2VVK A;  2EQK A;  2DIG A;  2JTE A;  1W6X A;  4M77 G;  2K5I A;  1Q86 U;  3HRS A;  2A28 A;  1I81 A;  3RKY A;  5LJ3 j;  3REA B;  2YHT A;  2X4X A;  1O9S A;  4OB1 B;  1M2V B;  3CME Q;  3M9Q A;  1XJW B;  5HCK A;  2EJF A;  2QTX A;  1UJY A;  1ZSZ B;  3OS2 A;  2ZPB B;  5I2S A;  3OYA A;  1BI2 A;  1VQ4 A;  2DYB A;  4M75 E;  4AFU C;  1NJI C;  3OMG A;  5KH6 A;  1WPY A;  4C8Q G;  3KBG A;  1VUB A;  2MAM A;  4BB7 A;  3R6O A;  1AZG B;  1H92 A;  5IHN A;  5LJ5 h;  4LD9 K;  5GJW B;  1N8R R;  4M7A B;  2FEI A;  2DPP B;  4ELY C;  3QG1 A;  1B34 B;  3CBP A;  4M78 G;  3FDR A;  4BI3 A;  1UEB A;  4IUV A;  1U1T A;  2BZY A;  4PLI A;  3TVT A;  3EG1 A;  4J6X A;  3I35 A;  1FXX A;  3X20 B;  3M4Y A;  4XU2 A;  3M55 A;  4ORZ A;  3VKI A;  1OI1 A;  3GNF B;  1MNE A;  5HY6 A;  2COZ A;  1S72 T;  5GAN e;  4OB2 B;  1LOJ A;  3I55 Q;  2ED1 A;  5EC7 A;  1QLY A;  1OPL A;  1YFN A;  1M90 U;  2COW A;  1WLP B;  3M4G A;  2VXE A;  4CC4 B;  3E19 A;  1WYX A;  1YJW Q;  1Q81 U;  2FPF A;  1VQ4 T;  1PC0 A;  5IHI A;  2DTH A;  1OZ3 A;  1NM7 A;  1QVP A;  2RHZ A;  4J9D A;  1V76 A;  5KCO A;  2RQW A;  1WDX A;  2O2O A;  2O4X A;  5DLQ E;  3VS7 A;  2XMF A;  2RQT A;  4EDU A;  2EQM A;  3RIR A;  1KD1 U;  4J9F A;  2DD5 A;  1T0J A;  1UGS B;  3QUI A;  4C92 B;  4JUV A;  2NUZ A;  1WA7 A;  2ZPE B;  2Y90 A;  1S1N A;  1QP3 A;  2M0O A;  1QKW A;  2PQW A;  2BIV A;  2RM4 A;  5J3B A;  2PVG B;  1DJ7 B;  4M7D F;  4KBM B;  4AFS C;  4LNP A;  1IZ6 A;  3JB9 H;  2EPD A;  5GAO r;  3CCJ Q;  4ATO A;  4QVZ A;  1AT1 B;  2HCK A;  4N4I A;  1KQS S;  1WQ7 A;  2LCS A;  1IO6 A;  3JCM b;  2Y4X A;  4BE1 A;  4XTV A;  2RQR A;  4MZP A;  1ZSG A;  4JS4 A;  1VA7 A;  3EH2 A;  4A4K A;  2DK3 A;  4RTV A;  4B9W A;  5LJ5 j;  1Y57 A;  2ZPF B;  1IB8 A;  2F5T X;  4C92 C;  1H64 1;  1M1K C;  1UUE A;  1VYV A;  2GTO A;  2HSE B;  1XQH A;  2VB6 A;  3I55 A;  3VS5 A;  3GP8 A;  1G2B A;  3VS4 A;  2RQU A;  2HAX A;  3CME T;  4M75 G;  3HRT A;  2ZZD A;  3SB2 A;  3TQ7 P;  3SEM A;  1YJW A;  2DIL A;  5IAY A;  2KSS A;  2DF6 A;  5M9O A;  4M7A F;  1H3H A;  2DXT A;  1RAA B;  4M78 A;  5KYN A;  2XD0 A;  3ZBD A;  4OMN A;  4XTY A;  4DEY A;  4AMC A;  5D6Y A;  4A4H A;  1QWE A;  2HBP A;  2X4J A;  2G6F X;  4Y92 A;  4PKC C;  4M78 D;  3URG A;  1AHJ B;  1JEG A;  1TTH B;  1YNZ A;  1IRX A;  3FIF A;  2CKK A;  3P8D A;  2LNV A;  3CCE Q;  4J9H A;  2RHU A;  1V1C A;  1XNI A;  3CC4 A;  1I07 A;  1Q95 G;  3A98 A;  1NYG A;  4DBQ A;  4P5N A;  3L2U A;  2JTF A;  4B9X A;  3D7S B;  1OOT A;  4B6M A;  3OW2 S;  4QKU A;  5GAN 3;  4JRK A;  5KYW A;  2E6N A;  4A4F A;  1WJQ A;  2BZX A;  4E7K A;  1K8A C;  4ZGD B;  3UT1 A;  1WIE A;  3JSC A;  3EG2 A;  2DEU A;  2AKK A;  3I55 T;  1G3S A;  5AYF A;  1K1Z A;  4HCZ A;  2P4R A;  3X24 B;  3NMZ C;  1KJW A;  4PJO C;  3RKX A;  2LT1 A;  1KHC A;  3RBB B;  2W10 A;  5FU7 B;  2X3X D;  1YJW T;  1QQJ A;  1VIF A;  2WAC A;  3OYF A;  1GRI A;  4BY6 B;  1UHC A;  2O4X B;  1KSW A;  3RDV A;  4X1V A;  2KRO A;  2CSI A;  2XID A;  2KRN A;  2ATC B;  1GBQ A;  2YSQ A;  2EQJ A;  1C1A A;  1VQ9 A;  1N5Z A;  1QWF A;  1ZX6 A;  4XU3 A;  2CRE A;  1OX9 A;  1QCF A;  1CSK A;  4O5V A;  2V1R A;  2DMO A;  2AZS A;  2ZPG B;  1K9M R;  3M0U A;  1RAH B;  1ZHI A;  3G71 A;  2J7I A;  1Y7X A;  2K3Y A;  2CZ6 B;  2EYX A;  2V8J A;  3E1S A;  5HK3 A;  1YBY A;  4RTY A;  2RI5 A;  1NEG A;  3HRU A;  2SEM A;  3HSB A;  1PM3 A;  2KY9 A;  4PJO E;  3N5B B;  3X26 B;  2PU9 B;  4E7H A;  2LC4 A;  4EMK C;  4Z89 A;  2RA2 A;  1M4Z A;  1TUC A;  5CKF A;  1SSH A;  3F70 A;  4KUD K;  1JB0 E;  4LDX A;  2CZ1 B;  2YUN A;  3CCE A;  4J9E A;  2RQV A;  3JRZ A;  3LLR A;  3FB9 A;  2HQH A;  4UC4 A;  1GXI E;  1M1F A;  4M75 A;  1YHQ A;  3HFO A;  1N9S A;  5KYU A;  1MMN A;  4ZN3 A;  1JO8 A;  4XTW A;  3PT9 A;  1TG0 A;  2EYZ A;  4LXC A;  3MP8 A;  2DTO A;  2ECZ A;  4DOV A;  1N8R U;  5GAO m;  4M75 D;  2O01 E;  2KK4 A;  1TUD A;  2IIM A;  2GBQ A;  2A36 A;  3PIO A;  4M78 B;  2DXC A;  3MJX A;  1PWT A;  2JMC A;  1I0C A;  3GNG A;  3NTK A;  2LJ0 A;  4FW1 A;  2AZV A;  2M1H A;  4LUE A;  1ABQ A;  2JW4 A;  4FW2 A;  2CGH A;  4BDY A;  4JRQ A;  1B3Q A;  1ZBJ A;  1NG2 A;  2ROL A;  2HSP A;  2KBT A;  2H8H A;  4Y91 A;  4OMF B;  1LNX A;  1N6A A;  2X4W A;  2DL3 A;  1M8V A;  3CD6 A;  5KE3 A;  1G83 A;  2MPX C;  2FYK A;  1I4K 1;  2GQV A;  1AZE A;  2FHD A;  5KYW B;  1IHW A;  2NUT A;  4ZTJ A;  3CCE T;  3V8J A;  1MHN A;  4FYY B;  3PMI A;  1BIA A;  1X75 C;  4C92 G;  1YHQ T;  1LPL A;  4BE0 A;  2QG9 B;  3QPH A;  2JZ2 A;  1YI2 A;  1M5Q 1;  4JRP A;  2K6D A;  3AT1 B;  4E7J A;  2MOX A;  8ATC B;  3UPU A;  3MET A;  1H8K A;  2K2M A;  3PVQ A;  3P8H A;  2C06 A;  2QQR A;  5GAM g;  4J7I A;  3DLL A;  1VQ6 A;  4DBF A;  2RF0 A;  4FIB A;  5LJ5 f;  1R77 A;  2QQS A;  2CP2 A;  1YJ9 Q;  2VV5 A;  5IXF A;  2XIC A;  4FYX B;  4HXJ A;  3CD6 T;  2K9G A;  4M77 F;  3PTA A;  2GGR A;  1X69 A;  1VQ5 A;  1D1C A;  1QVG S;  1LJO A;  5I11 A;  3PNW C;  3CBO A;  1EX4 A;  3EAE A;  3BDL A;  1WXB A;  1HSQ A;  2CDT A;  1C6V X;  2P0Q A;  1OUL A;  3JCM d;  4PJO G;  3VS2 A;  1VQ7 A;  3CBM A;  1WQW A;  5LL6 S;  3A8H B;  2K5F A;  4C8Q F;  4QVD A;  2EVR A;  3CC2 Q;  2NWM A;  2LX7 A;  1G3Y A;  1M3C A;  4M75 B;  1RAD B;  5I2M A;  2OTJ Q;  2RK1 A;  2JT4 A;  4F17 A;  5KYU B;  5A0L A;  1NEB A;  1TOV A;  3SHW A;  1KQS A;  3C12 A;  3X28 B;  5CO7 A;  1VQ6 T;  4R55 A;  4PJL A;  3CCM A;  4M78 F;  3J81 E;  3JCM e;  2LNH B;  2CZ0 B;  3M0T A;  1VYU A;  1UG1 A;  1K0S A;  3KUF A;  1WJS A;  3H0I A;  2I0N A;  2LZ6 B;  1JBM A;  3PMT A;  1X6G A;  3CXC P;  4LDY A;  1D3B A;  3CMA Q;  1PRL C;  3UA7 A;  1M1K R;  3CCV Q;  4RTX A;  2DLP A;  2EJG A;  3PFS A;  2EGA A;  1Y07 A;  3BDU A;  2HDA A;  3WVD B;  2FPD A;  3Q1J A;  1VQ7 T;  4HCB A;  2NUT B;  2DE0 X;  1VQO Q;  3I9Q A;  1YJ9 A;  3OQ5 A;  2ZCF B;  2KMT A;  1TWB A;  1RAE B;  3EG3 A;  3EHR A;  1T3L A;  3H9N A;  4C0G A;  5C0M A;  1KG1 A;  1AD5 A;  4Z88 A;  3G4S Q;  4ZGJ B;  5GAN g;  4J5Y A;  3CCM T;  4X34 A;  4EPC A;  2EJ9 A;  1C0M A;  4JLI A;  3VS3 A;  4QQ6 A;  4IKF A;  7AT1 B;  3OW2 A;  2QQA A;  2BE7 D;  2FVU A;  2CZ7 B;  5KE2 A;  4KH1 B;  2YXY A;  5KYY A;  4FCY A;  4V2S A;  5FRN A;  1S72 A;  4RTZ A;  4LDW A;  1K9M U;  3TCJ A;  1K4U S;  2QAS A;  1X27 A;  3CC2 A;  3MO8 A;  4A53 A;  1VQM Q;  1YI2 Q;  2E65 A;  2PTK A;  1AWW A;  5AT1 B;  2OTJ A;  2X9H A;  5FWC A;  1K8A R;  2LVM A;  2HZY A;  2F1L A;  3AHU A;  1U1S A;  4BD3 A;  2F2X A;  2LQN A;  1EFN A;  2D6F A;  3I5S A;  2RK2 A;  2LJ3 A;  1IXD A;  5GAO p;  3M0R A;  1KK7 A;  3OY9 A;  1ZUY A;  4JRI A;  5GAN d;  2YUP A;  1UGP B;  2RJE A;  1YJ9 T;  1WHH A;  4PJO A;  2L3R A;  4C0F A;  1VQK Q;  2XDD A;  1QVG P;  3R6N A;  4ESR A;  6AT1 B;  1PSE A;  2RH2 A;  3JV3 A;  4PJO D;  1UE9 A;  2FZK B;  2L89 A;  3M57 A;  1Q82 C;  2JXB A;  2KI7 A;  2FPE A;  4D8D A;  3HFN A;  3QKJ A;  3CCV A;  1X43 A;  2GFA A;  2NUP A;  3UF4 A;  2C0O A;  2LTO A;  1D09 B;  1A0N B;  2X51 A;  1D0X A;  2JJ9 A;  3CC2 T;  3VS0 A;  3V8L A;  4X9D A;  2E70 A;  2KGT A;  1B7T A;  2OTJ T;  1OYX A;  1O75 A;  2SRC A;  1VIE A;  3CCU Q;  1WGS A;  2VUB A;  3G6E A;  1QVF S;  4AT1 B;  5IH2 A;  4Z02 A;  4KUI A;  1ZBX A;  2A08 A;  2HL3 A;  2AHJ B;  1NJI U;  4KGX B;  2DD4 A;  1D3B B;  2PVO B;  2QDY B;  2L0A A;  4EMK A;  3HHT B;  4HVV A;  1EZZ B;  4F7U E;  4OF1 A;  5FRM A;  2VWF A;  1NPP A;  4OGE A;  1B07 A;  4RTT A;  4ZTF A;  3MP6 A;  4M7D E;  3JB9 D;  1WHM A;  3CME A;  3RR6 A;  3CMA T;  2EQU A;  2QA4 Q;  2DL8 A;  1I5L A;  1YIJ Q;  3CCV T;  5GMK e;  2RB6 A;  1TS9 A;  1UFF A;  4JJC A;  5FRO A;  1PSF A;  1X6O A;  2ZPI B;  3I56 Q;  3DLM A;  4LD6 A;  4DBR A;  1VQO T;  1J3T A;  1RAG B;  1BI0 A;  2J05 A;  2PVD B;  2DJQ A;  3M0S A;  1NZ9 A;  2DM1 A;  1FYN A;  3C0C A;  4IUT A;  1BBZ A;  1VQK A;  1U06 A;  3V8K A;  1TXQ A;  1NBE B;  2JM9 A;  3G6E T;  5KYY B;  2DRK A;  2RNA A;  4PL6 A;  2E5K A;  1E7O A;  2KEA A;  3JCM P;  2A0F B;  1UGV A;  2CYZ B;  4E47 A;  5C6S A;  3FJ5 A;  1X2K A;  5LJ3 d;  2DBM A;  2LCL A;  1EIF A;  4J9C A;  3M54 A;  1UB4 A;  2KDS A;  4M7A E;  1P92 A;  3PGG A;  1OX8 A;  1WZO A;  2CP5 A;  1ZA1 B;  3CCU A;  4PJO B;  3JCM h;  1OQK A;  2MF2 A;  1D0Z A;  2CP3 A;  2RMO A;  4PNO A;  4ANJ A;  4DEX A;  1KC8 C;  3EGU A;  5GAM h;  1GFC A;  1JRI A;  3THK A;  1I5O B;  4R56 A;  5CKH A;  4DOW A;  1MND A;  1K73 C;  4N0A A;  5LJ3 e;  5GAN 4;  4OML A;  3OYL A;  1VQK T;  2DZ9 A;  4OMP A;  3EGX A;  2NUP B;  3OYD A;  1QVG A;  1Y0M A;  3OS1 A;  5CKD A;  8AT1 B;  1AVZ C;  5GMK l;  3SD4 A;  2QA4 A;  4RMO A;  1WXU A;  4IIO A;  3JCM Q;  2YRV A;  2CUB A;  1YIJ A;  4E7I A;  4NOY A;  2QGF B;  2E64 A;  4ZNX A;  5FLX E;  2P0K A;  3I56 A;  1PKS A;  3C4S A;  1Z9Q A;  4M4Z A;  2L3S A;  1M1K U;  4K11 A;  1WHL A;  2DET A;  3CCJ A;  5ECA A;  3M0Q A;  4TVR A;  2Y4Y A;  1QVF P;  3QJ6 A;  1I8F A;  1VQP Q;  2AIR B;  3CCU T;  1SHG A;  4EMK B;  4IUR A;  5GAO q;  3JB9 I;  4C92 F;  5GAN 5;  3H41 A;  3OSS C;  2HKQ B;  2LQK A;  3TSW A;  3CEY A;  4QT7 A;  5FW9 A;  5L8R E;  4F7U G;  1NPR A;  1QW1 A;  1W2B S;  3QHS A;  3S6W A;  1X6B A;  3EG0 A;  3LX7 A;  4BDZ A;  4DQ2 A;  3CCQ Q;  2RJF A;  2LQ8 A;  2KQW A;  4IUU A;  3M0P A;  2QA4 T;  4BUG A;  3PIP A;  1JJ2 P;  4XTZ A;  1YIJ T;  1IGU A;  2RHX A;  1Q7Y C;  3HPW A;  2DTI A;  4LE9 A;  4F16 A;  3NTH A;  3ME9 A;  3FC3 A;  4MML A;  4C5G A;  3I56 T;  4IUP A;  2K3B A;  2OTL Q;  3QZ9 B;  1K8A U;  3CCJ T;  2CP0 A;  2YUO A;  3MEV A;  4XQ3 A;  3VS1 A;  4WTO B;  2IG0 A;  1HJD A;  5GMK i;  4J8O A;  3FRN A;  5DY9 A;  3TRE A;  4A54 A;  3VU3 C;  2CSQ A;  2H3J A;  3OB9 A;  2E3H A;  3RNJ A;  5GAM j;  2FO0 A;  5GAN h;  5LJ5 d;  2F2V A;  2DYI A;  4PJO F;  3REB B;  2EYW A;  3LWH A;  3VV0 A;  1PKT A;  4KRT A;  4PK4 A;  4DBH A;  2JN0 A;  3CXC S;  2GQI A;  2MWP A;  3L42 A;  2K7A A;  5D7U A;  3QYG B;  4C0D B;  1UDL A;  4HVU A;  4FT4 A;  1R0B G;  3RER A;  3QSU A;  1OU9 A;  3L2R A;  3RMS A;  3EGX B;  3ASK A;  4CC2 A;  1LCK A;  2DFU A;  2V8I A;  1KQ1 A;  1NYF A;  5LJ5 e;  1U8R A;  3CC7 Q;  1NJI R;  4RTU A;  2YT6 A;  3J80 E;  3L2W A;  1RL2 A;  1Y71 A;  2KR3 A;  1YWP A;  1G8X A;  4BAC A;  2DVJ A;  3OMC A;  2FZC B;  2QYZ A;  2K2V A;  2RN8 A;  2NYS A;  3CCQ A;  2DRM A;  2I2L A;  3HTR A;  4ZGE B;  3QDR B;  1BCM A;  1OEB A;  2DL4 A;  3GOX A;  1Q82 R;  1WNL A;  4OVA A;  3A1P A;  4QVC A;  2E6Z A;  2HKN A;  2JNG A;  1SHF A;  2L8D A;  2PZ1 A;  3J7A F;  1IRE B;  3JCM g;  2QGG A;  4N0A C;  3OSV A;  4X9C A;  4C0D C;  5DLO A;  2QDL A;  4F7U A;  2RHI A;  4CRI A;  4JZ3 A;  4L5G A;  5GAN 2;  1VQP T;  1QVF A;  2A37 A;  2YWW A;  4M77 E;  3DB4 A;  2XG8 D;  2F5K A;  3UDC A;  3H0F A;  2BUD A;  2K3X A;  4M7D D;  3T9N A;  2A3L A;  1W2B P;  1XOV A;  1BU1 A;  1VQ8 Q;  2FB7 A;  3LGF A;  2EBP A;  5CK9 A;  2DZC A;  2L3Q A;  2QI2 A;  4N4H A;  3H6Z A;  2LX9 A;  1GL5 A;  4PFP A;  2V26 A;  2KE9 A;  5GAN 7;  3CCQ T;  2MCN A;  1HYO A;  2VC8 A;  5GAN j;  3BY7 A;  4C8Q E;  2YLB A;  1YCY A;  1VQL Q;  3OA6 A;  2X4Y A;  3QBY A;  2RHY A;  3MEW A;  3EFS A;  3G7Z A;  4HVW A;  4LUD A;  2FG0 A;  5LJ3 h;  1T0H A;  4XU0 A;  1PD0 A;  3QYH B;  2DO3 A;  4PFZ A;  1JQQ A;  2X3W D;  2LRQ A;  2HNI A;  3M56 A;  2EW3 A;  1QKX A;  2DXU A;  1WHJ A;  2MWO A;  3OYE A;  2XU8 A;  3CPW S;  4A4E A;  1E6H A;  2E4H A;  3OYN A;  5CQY A;  3A8O B;  2HL5 C;  2EGE A;  3OBW A;  4MMK A;  2LDM A;  1SSF A;  2OJ2 A;  4M7A D;  2ESW A;  2EWN A;  2KT8 A;  3ZFJ A;  4C5I A;  1E6G A;  2PUK B;  1MV3 A;  1MMA A;  2RJC A;  1PCX A;  5A2Q E;  1SF9 A;  1BIB A;  5GAN 8;  2K57 A;  4J9G A;  2DXB A;  1Y96 A;  3S3O A;  2B86 A;  1Q86 C;  2CH4 A;  1FMW A;  3RUX A;  2ED0 A;  1HXD A;  4AFQ C;  2JMA A;  4QW2 A;  2VYT A;  2F2W A;  3SDZ A;  1XTD A;  2P84 A;  1U5S A;  4WCI A;  2J6F A;  2E5Q A;  3JB9 G;  4NL3 A;  4HT9 A;  3ULR B;  1AOJ A;  1ZQ1 A;  4J7F A;  3SWN C;  1KC8 R;  3CC7 T;  3TU4 K;  4JJB A;  4E6R A;  1NE8 A;  5J26 A;  5GMK m;  2MI6 A;  3NTI A;  2O9S A;  1M8M A;  3KXT A;  4AG1 C;  1BYM A;  1UEC A;  4ELZ C;  1W70 A;  2COY A;  1UGQ B;  1K73 R;  4L6V 5;  2RI2 A;  3CCS Q;  4FYW B;  3FLG A;  1AWO A;  1VQL A;  4AFZ C;  1G5V A;  4FM4 B;  4F7U B;  2JOY A;  4MZM A;  1SRM A;  1WI7 A;  1TH7 A;  3JCM f;  3A8L B;  3L1A A;  5FWB A;  1ZLM A;  1MV0 B;  5GAM f;  1YWO A;  1WHG A;  3S3M A;  2AK5 A;  3OYK A;  3BW1 A;  1M90 C;  1SEM A;  1RI9 A;  2YDL A;  1H3Z A;  1Q81 C;  1QP2 A;  2LJ1 A;  1M1G A;  4RCB A;  3RKW A;  4NL2 A;  2PUO B;  3M53 A;  4HCC A;  2KRM A;  2VXF A;  5GAO l;  9ATC B;  1VQ8 T;  3E9G A;  1I1J A;  2FRY A;  5IT9 E;  1W2B A;  1CKB A;  3VS6 A;  3NFC A;  2EYQ A;  1PHT A;  4NS5 A;  1VYT A;  2EIF A;  3OYB A;  2KVQ G;  3CQT A;  5D6W A;  2FRW A;  1R0C B;  2DEQ A;  4M75 F;  4OGC A;  2EFI A;  3CMA A;  1KD1 C;  4M7D C;  1VQL T;  1PRM C;  4F04 B;  2AKL A;  5IN1 A;  3UAT A;  4JZ4 A;  1HK9 A;  4J6Y A;  2CS7 A;  4HT8 A;  3UWN A;  3E9F A;  2EAY A;  3I5R A;  4R0K A;  4F14 A;  1ZA2 B;  1VQO A;  3L2V A;  3CPW P;  3QWX X;  2DVE A;  2KAF A;  2KYB A;  2YRD A;  1Q7Y R;  2DL7 A;  2GNC A;  2QK0 A;  2FL7 A;  4L59 A;  2M9U A;  5KYX A;  3G4S A;  4C5E A;  1D1B A;  3GF5 A;  1Y96 B;  1ZSZ C;  2LQW A;  2A7Y A;  2O88 A;  2XI9 A;  3CCS A;  3HKS A;  3BFM A;  1M30 A;  3M59 A;  3A8M B;  1BB9 A;  1AWJ A;  2D9T A;  1PG5 B;  1FMV A;  3EFO A;  2E1H A;  3EGD A;  3SFM A;  3TEE A;  1FWZ A;  4II1 A;  1VQM A;  3OS5 A;  4M7A C;  2YLC A;  4LDU A;  1GCQ C;  3L2Z A;  5LJ3 g;  3CXC A;  4FYV B;  1Q82 U;  1ZUK A;  5CKB A;  3O8V A;  2CT4 A;  4LN2 A;  4N4G A;  2XKO C;  1KHI A;  2GF7 A;  1M3B A;  3OYH A;  1JJ2 S;  2JUF A;  2K79 A;  4J9I A;  3MP1 A;  3CC4 Q;  4VUB A;  2IVW A;  4RG8 A;  3LH0 A;  3QO3 A;  3EG9 A;  3VUB A;  3MEU A;  1BI1 A;  3HL8 A;  4Z8A A;  2L2P A;  2O9V A;  3JCM W;  3E2U A;  4RKU E;  4F7U F;  3U23 A;  5GAN f;  1YIT Q;  3G4S T;  2KNB B;  1PD1 A;  2KYM A;  3OYY A;  1RAB B;  4O6J A;  2PNI A;  4CC3 A;  1RAC B;  4M77 A;  3UA6 A;  3CCS T;  3OYI A;  4BI4 A;  2M02 A;  4ME7 A;  4MZT A;  1K9A A;  4M77 D;  4IUQ A;  4J83 A;  4MDX A;  2RI3 A;  1VQ9 Q;  1AWX A;  5I22 A;  1VQM T;  1ACM B;  4OMO A;  2QEX Q;  5CIU A;  4C0Z A;  4FL6 A;  4HCK A;  1M3A A;  1K76 A;  4C8Q A;  4BI8 B;  1WFW A;  2KT1 A;  2GFU A;  4EMH A;  3H8Z A;  3A5Z B;  3G71 Q;  3C94 A;  1SKU B;  2C0I A;  2JS2 A;  3C95 A;  1QCN A;  4C8Q D;  2K4Y A;  2DNU A;  4QQD A;  2MIO A;  2QAZ A;  3GIB A;  1PNJ A;  4EMG A;  3S3N A;  4OP0 A;  3FJP A;  3QWY A;  4RG2 A;  4OB0 B;  2VGN A;  2R58 A;  4XTU A;  3V7S A;  1CKA A;  1G3T A;  2YRC A;  1TU0 B;  3MKD A;  1IGQ A;  3ZEH A;  2QQB A;  5CKE A;  3G1J A;  3IQL A;  3OBY A;  4IIM A;  5KYX B;  2ZPH B;  1SG5 A;  2G3R A;  4PLL A;  1T3S A;  1UGR B;  1YHQ Q;  1YJN Q;  2ABL A;  3NHN A;  1MGQ A;  5FU6 B;  2L5Q A;  3CPW A;  4RCC A;  4C92 E;  1FX7 A;  3QDF A;  3ZL7 C;  4E7S A;  2KXD A;  2RJD A;  2WSF E;  2DL5 A;  2HBW A;  2VGM A;  1YIT A;  4OB3 B;  2EQI A;  2VAS A;  2HQE A;  4WF2 A;  5CQX A;  1MUZ A;  3EFO B;  3MHX A;  3EGD B;  3JCM X;  1HD3 A;  4RUG A;  4GBQ A;  1KC8 U;  2E10 A;  1LVK A;  4FSS A;  2QQ9 A;  5KCH A;  1X01 A;  4E7L A;  2GCX A;  2R5M A;  2ENM A;  4KUL A;  2CUD A;  1BK2 A;  3CCL Q;  2HD0 A;  4M7D G;  2BZ8 A;  1K73 U;  1N8R C;  5LJ5 g;  1WX6 A;  5HKC A;  3JB9 J;  3CD6 Q;  2EGC A;  5LJ3 f;  2CT3 A;  3TSZ A;  2CP7 A;  3EG9 B;  2J6K A;  1OZ2 A;  3OYC A;  2D0N A;  2QEX A;  1Q86 R;  1K0X A;  4DA4 A;  2KXC A;  3H0H A;  5FU6 C;  1YN8 A;  3CC4 T;  2BTT A;  2DBK A;  4RTW A;  3CCR Q;  2M16 A;  1TUG B;  2V1Q A;  4M77 B; 
#chains in the Genus database with same CATH homology
 2RQR A;  2KE9 A;  1ZSG A;  1VA7 A;  2MCN A;  2F2X A;  2LQN A;  1ZUU A;  1EFN A;  4RTV A;  3I5S A;  2CH4 W;  2LJ3 A;  2OI3 A;  3M0R A;  1ZUY A;  4HVW A;  1Y57 A;  2FG0 A;  2YUP A;  4LUD A;  1U3O A;  1UUE A;  1T0H A;  2JM8 A;  1VYV A;  3VRZ A;  1UTI A;  2GTO A;  3VS5 A;  1JQQ A;  2X3W D;  3R6N A;  1G2B A;  4ESR A;  3VS4 A;  2RQU A;  3NPF A;  1UHF A;  2EW3 A;  1NLP C;  1QKX A;  3JV3 A;  1UE9 A;  3SEM A;  2DIL A;  2DF6 A;  2JXB A;  1E6H A;  1UJ0 A;  1H3H A;  2FPE A;  4EIK A;  2EGE A;  4D8D A;  4OMN A;  3PVL A;  4DEY A;  4CC7 A;  2OJ2 A;  1X43 A;  2ESW A;  1ABO A;  1X2Q A;  1GCP A;  2KT8 A;  3GBQ A;  3UF4 A;  2C0O A;  1QWE A;  2M0Y A;  1E6G A;  2G6F X;  4JJD A;  1MV3 A;  4Y92 A;  3EHQ A;  1JEG A;  1YNZ A;  1A0N B;  2JS0 A;  3VS0 A;  4J9H A;  2KGT A;  2EYY A;  2SRC A;  4J9G A;  1V1C A;  2B86 A;  1I07 A;  2L3P A;  3A98 A;  2CH4 A;  3VRY A;  1NYG A;  2M51 A;  2OAW A;  2ED0 A;  1OOT A;  4AFQ C;  3NGP A;  5IH2 A;  2JMA A;  2O31 A;  2F2W A;  2A08 A;  1U5S A;  4WCI A;  2J6F A;  2BZX A;  4J9B A;  1WIE A;  3EG2 A;  2L0A A;  3O5Z A;  3ULR B;  2AKK A;  1AOJ A;  1K1Z A;  2P4R A;  3NMZ C;  1KIK A;  1KJW A;  1FMK A;  4HVV A;  2LMJ A;  3RBB B;  2W10 A;  1W1F A;  2X3X D;  2VWF A;  4JJB A;  4E6R A;  1B07 A;  1GRI A;  4RTT A;  1UHC A;  1KSW A;  1GFD A;  4X1V A;  2KRO A;  2C0T A;  2CSI A;  1RLQ C;  4AG2 C;  2O9S A;  1M8M A;  2KRN A;  2DL8 A;  4AG1 C;  1GBQ A;  1UEC A;  2YSQ A;  1W70 A;  4D8K A;  1UFF A;  4JJC A;  5GJV B;  1N5Z A;  1QWF A;  1ZX6 A;  1AEY A;  2W0Z A;  1AWO A;  2CRE A;  4AFZ C;  1M27 C;  1QCF A;  5IHK A;  1J3T A;  1CSK A;  2V1R A;  2J05 A;  2DMO A;  2DJQ A;  3M0S A;  2DM1 A;  2AZS A;  1SRM A;  1FYN A;  3C0C A;  1BBZ A;  1JXO A;  1WI7 A;  3M0U A;  1U06 A;  2J7I A;  2JM9 A;  2DRK A;  2RNA A;  5FWB A;  1ZLM A;  2EYX A;  1MV0 B;  1YWO A;  3KFV A;  1JU5 C;  4RTY A;  2AK5 A;  2DA9 A;  2E5K A;  1YCS B;  1E7O A;  1SEM A;  1NEG A;  1RI9 A;  2KEA A;  2SEM A;  3PE0 A;  2YDL A;  1UGV A;  2LJ1 A;  3FJ5 A;  1X2K A;  4OMM A;  2DBM A;  4Z89 A;  2KRM A;  2RPN A;  1TUC A;  1SSH A;  4J9C A;  2HEQ A;  1SRL A;  1I1J A;  2FRY A;  1CKB A;  3VS6 A;  2KRS A;  2YUN A;  1PHT A;  4J9E A;  2DX1 A;  2RQV A;  1VYT A;  3CQT A;  1GCQ A;  2FRW A;  5IXB A;  1OV3 A;  2RMO A;  4DEX A;  1JO8 A;  1TG0 A;  2EYZ A;  3EGU A;  2ECZ A;  1PRM C;  1GFC A;  3THK A;  2EKH A;  1TUD A;  2AKL A;  2IIM A;  3UAT A;  2GBQ A;  2A36 A;  4JZ4 A;  4A63 B;  1RLP C;  4OML A;  1PWT A;  2JMC A;  3I5R A;  4R0K A;  4F14 A;  4OMP A;  1I0C A;  3QWX X;  4JPB W;  2LJ0 A;  2AZV A;  1Y0M A;  2KYB A;  4LUE A;  1ABQ A;  1YP5 A;  2JW4 A;  2DL7 A;  1Z9Z A;  2GNC A;  2GTJ A;  1ARK A;  5L23 A;  2D8J A;  1AVZ C;  1GBR A;  1B3Q A;  1SPK A;  1NG2 A;  1ZBJ A;  2ROL A;  2HSP A;  2KBT A;  2H8H A;  1KFZ A;  1WXU A;  4IIO A;  2CUB A;  2LQW A;  2DL3 A;  2O88 A;  4GLM A;  1G83 A;  4ZNX A;  1M30 A;  2VKN A;  1AZE A;  1BB9 A;  1PKS A;  1AWJ A;  1Z9Q A;  4M4Z A;  2L3S A;  4K11 A;  5ECA A;  3M0Q A;  2LP5 A;  1SHG A;  3LH5 A;  1JXM A;  2YUQ A;  1GCQ C;  2J6O A;  1OPK A;  1ZUK A;  2CT4 A;  4LN2 A;  1RUW A;  3H41 A;  2K6D A;  1WXT A;  1M3B A;  2D8H A;  4J9I A;  2K79 A;  2MOX A;  3TSW A;  4QT7 A;  5FW9 A;  2D1X A;  2ROT A;  1H8K A;  2K2M A;  3PVQ A;  4OMQ A;  4Z8A A;  2L2P A;  2O9V A;  1X6B A;  3EG0 A;  1NLO C;  2J06 A;  2VVK A;  3U23 A;  3M0P A;  2JTE A;  1W6X A;  2KNB B;  2RF0 A;  2KYM A;  2A28 A;  2PNI A;  4CC3 A;  5IXF A;  4HXJ A;  2K9G A;  3UA6 A;  4LE9 A;  3REA B;  4F16 A;  2GGR A;  2K3B A;  1X69 A;  5HCK A;  1K9A A;  2YUO A;  3VS1 A;  1UJY A;  1HJD A;  5I11 A;  2DYB A;  1WXB A;  1HSQ A;  4AFU C;  1AWX A;  2CDT A;  5I22 A;  4OMO A;  2CSQ A;  3RNJ A;  2FO0 A;  4HCK A;  1AZG B;  1M3A A;  3VS2 A;  1K76 A;  1WFW A;  1H92 A;  2KT1 A;  2F2V A;  2EVR A;  5IHN A;  2NWM A;  2LX7 A;  5GJW B;  2FEI A;  3REB B;  2C0I A;  2JS2 A;  1M3C A;  2EYW A;  2JT4 A;  2DNU A;  4F17 A;  1PKT A;  1NEB A;  4KRT A;  3SHW A;  2MIO A;  2BZY A;  3TVT A;  3EG1 A;  3I35 A;  1PNJ A;  4ORZ A;  2GQI A;  3QWY A;  2K7A A;  1UDL A;  4HVU A;  1CKA A;  2LNH B;  3M0T A;  1VYU A;  1UG1 A;  1LCK A;  4CC2 A;  2ED1 A;  5EC7 A;  1K0S A;  1QLY A;  1OPL A;  1NYF A;  1WLP B;  3H0I A;  2I0N A;  3IQL A;  4CC4 B;  4IIM A;  1WYX A;  4RTU A;  2FPF A;  2LZ6 B;  1T3S A;  2YT6 A;  5IHI A;  1X6G A;  2ABL A;  3NHN A;  1NM7 A;  1PRL C;  2KR3 A;  4J9D A;  3UA7 A;  1YWP A;  4RTX A;  2DLP A;  2DVJ A;  3ZL7 C;  2EGA A;  2KXD A;  2HDA A;  2RN8 A;  2FPD A;  2DL5 A;  2DRM A;  2HBW A;  2RQW A;  2EQI A;  1WDX A;  2O2O A;  2DE0 X;  1OEB A;  2DL4 A;  3VS7 A;  1MUZ A;  3I9Q A;  1HD3 A;  4RUG A;  4GBQ A;  2XMF A;  2RQT A;  3EG3 A;  3EHR A;  4J9F A;  4FSS A;  1T0J A;  1T3L A;  1SHF A;  2ENM A;  2PZ1 A;  1AD5 A;  2CUD A;  4Z88 A;  1BK2 A;  2NUZ A;  1WA7 A;  1S1N A;  2BZ8 A;  2QDL A;  1QKW A;  4JZ3 A;  3VS3 A;  1WX6 A;  2EGC A;  2CT3 A;  2A37 A;  3TSZ A;  2J6K A;  2D0N A;  3H0F A;  4AFS C;  4LNP A;  1K0X A;  2EPD A;  4RTZ A;  2KXC A;  3H0H A;  1XOV A;  1BU1 A;  1K4U S;  2HCK A;  1X27 A;  1YN8 A;  2EBP A;  2LCS A;  2BTT A;  2DBK A;  4RTW A;  2L3Q A;  1IO6 A;  2PTK A;  1AWW A;  5FWC A;  2V1Q A;  1GL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...