2MCNA

Distinct ubiquitin binding modes exhibited by sh3 domains: molecular determinants and functional implications
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
57
structure length
57
Chain Sequence
b'VDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD2-associated protein
molecule tags Cell cycle/signaling protein
source organism Mus musculus
publication title Distinct ubiquitin binding modes exhibited by SH3 domains: molecular determinants and functional implications.
pubmed doi rcsb
total genus 7
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2mcnA00
2W0ZA 1ZSGA 1CKBA 2ENMA 5I22A 2BZYA 1RI9A 1PNJA 3M0QA 2JXBA 5FW9A 2LNHB 1B07A 3TSZA 1T3SA 1EFNA 1BU1A 2DJQA 1TUDA 1UDLA 2K2MA 2EYWA 2I0NA 2A08A 2J05A 1WLPB 1T0JA 1GCQC 2DBKA 2SRCA 1NLPC 2AZVA 4AG1C 3UF4A 3UA7A 4J9GA 1M27C 1H3HA 3H0FA 1GL5A 1NM7A 2DF6A 3I9QA 2DL3A 4HXJA 1H92A 1QLYA 2J6OA 1K4US 5IXBA 2EQIA 1CKAA 1SSHA 2LX7A 3VS2A 2D1XA 1Y57A 3EG2A 2O9SA 1X6BA 4J9BA 2OI3A 1XOVA 1KSWA 1AEYA 1MV3A 4R0KA 3UA6A 2M0YA 2EKHA 3FJ5A 4AFSC 3PE0A 1S1NA 1NG2A 1UHFA 2HBWA 1AWJA 1WX6A 3I5SA 1HD3A 1SHFA 1FYNA 4Z89A 4LN2A 4JJDA 2K9GA 4QT7A 2DNUA 1WDXA 2K79A 1YCSB 2KXDA 2HCKA 2KR3A 3CQTA 4CC4B 1UE9A 2DX1A 4FSSA 2M51A 2KRSA 1X2QA 3M0SA 4LUDA 1U5SA 3I35A 2ED1A 1NLOC 1Y0MA 1SHGA 2YUPA 2E5KA 2FG0A 3M0RA 2K7AA 2DE0X 1YN8A 4RUGA 2KROA 4OMQA 5IHKA 1W1FA 2EBPA 2EGEA 3EHRA 2DRKA 2HEQA 5GJWB 1OOTA 2FPFA 1OV3A 1AWXA 2KGTA 2MOXA 2VWFA 3TSWA 2EYXA 1WYXA 1X69A 2XMFA 4LUEA 2KE9A 2FRYA 2NUZA 2DBMA 2RQUA 2X3WD 2MIOA 2O88A 1ARKA 4F17A 1AZGB 2DYBA 2G6FX 1K1ZA 2OJ2A 4Y92A 2PZ1A 4LE9A 1N5ZA 2DL4A 2C0OA 1RLQC 1T0HA 3PVQA 5GJVB 2RN8A 2K3BA 4K11A 1OPKA 2GGRA 4F14A 1X27A 4LNPA 3EG0A 1GBQA 1TG0A 1UTIA 4RTWA 3M0TA 1TUCA 3RBBB 3REBB 2HSPA 3PVLA 1GFDA 2QDLA 2H8HA 4JZ3A 1E7OA 2CH4W 2LP5A 3IQLA 4IIMA 2RF0A 1QWFA 2YDLA 1WIEA 1WXTA 2KNBB 2AK5A 2EYYA 2GQIA 3LH5A 3VS7A 4E6RA 1FMKA 1M8MA 2J6KA 2YUNA 4M4ZA 5HCKA 1PRLC 2DMOA 1YWPA 2DM1A 2LZ6B 2CDTA 1X2KA 2EGAA 1VYUA 1X43A 4AFZC 1M3AA 1SRMA 4D8KA 3UATA 3GBQA 1I0CA 2RQRA 2AZSA 2CSIA 4J9EA 2HDAA 4OMMA 2JMAA 2DA9A 5I11A 1KIKA 1ZBJA 4HCKA 1M3BA 2KYBA 2GBQA 4IIOA 2B86A 2RMOA 5ECAA 5IH2A 1BK2A 3VS5A 1NYGA 3VRYA 1K0XA 1T3LA 2EW3A 3M0UA 2VKNA 2DL7A 2CUBA 1Z9QA 1GCPA 2IIMA 1U3OA 2ROLA 3H41A 2F2WA 3C0CA 2L3QA 1ZUUA 2RQVA 4GBQA 3QWXX 2RQTA 1GFCA 4HVUA 1I07A 1UJ0A 1JEGA 2BZXA 2KT1A 1W6XA 1NEBA 2SEMA 4RTTA 1JQQA 2JT4A 2CREA 3H0IA 1ZX6A 4JZ4A 4CC7A 2KXCA 4Z88A 1RLPC 1KFZA 2KRNA 3R6NA 2J06A 2VVKA 1SPKA 1MUZA 4AFUC 2YUQA 2CH4A 2JM8A 1J3TA 2EPDA 1QWEA 2KEAA 4DEYA 1QKXA 2L0AA 3NMZC 3JV3A 1HSQA 4RTZA 2CSQA 2JW4A 3I5RA 2O2OA 1ZUYA 2ESWA 2A36A 2A37A 2JM9A 2KRMA 2ED0A 4ESRA 3U23A 1YWOA 4JPBW 3EGUA 1WXUA 2ROTA 1JO8A 3SEMA 2P4RA 2V1RA 2DRMA 2FRWA 1VYVA 2MCNA 4OMLA 1QKWA 4J9FA 1VA7A 1W70A 1X6GA 3TVTA 1OEBA 2C0IA 3EG1A 2GNCA 4OMOA 3VS3A 1JXOA 2YT6A 1YP5A 3ULRB 2RPNA 3SHWA 4CC3A 1GBRA 3KFVA 5IHNA 1PRMC 2CT4A 2D8HA 2FEIA 2DL8A 2GTOA 3QWYA 4J9DA 1Z9ZA 2BZ8A 4OMPA 2LJ3A 4DEXA 1LCKA 2O9VA 3EHQA 1WXBA 5IXFA 2JTEA 1AZEA 4JJBA 1SEMA 2ABLA 2L3PA 1E6GA 2D8JA 2EYZA 3A98A 3REAB 2CUDA 1CSKA 5FWCA 1KJWA 4EIKA 3VS0A 1UUEA 2JS0A 4RTUA 2L2PA 1AWWA 1K9AA 1M30A 1M3CA 1E6HA 1ZLMA 2GTJA 2RNAA 2FPEA 2LJ0A 2DLPA 1H8KA 1IO6A 4ZNXA 1UHCA 2EGCA 4F16A 4ORZA 1PWTA 2LCSA 1AD5A 4J9IA 1U06A 4X1VA 1UJYA 1RUWA 2YUOA 5FWBA 2W10A 4RTYA 2L3SA 2X3XD 2OAWA 1VYTA 2PNIA 2J7IA 2CT3A 2KT8A 1MV0B 1WI7A 1BB9A 2LQWA 4WCIA 1UG1A 1V1CA 4RTXA 3VRZA 1AOJA 1GRIA 3VS6A 2A28A 2YSQA 3M0PA 1HJDA 1UFFA 1G2BA 2KBTA 1B3QA 3RNJA 1ZUKA 2D0NA 4HVWA 4RTVA 2AKLA 2PTKA 4AFQC 1QCFA 3VS4A 1BBZA 2JMCA 1WA7A 2EVRA 2DL5A 1PKSA 2FO0A 1AWOA 5EC7A 1K0SA 4Z8AA 1UGVA 2ECZA 1JU5C 3NPFA 3NGPA 2BTTA 2AKKA 2LMJA 4AG2C 4D8DA 2LJ1A 2LQNA 2J6FA 2O31A 2JS2A 4JJCA 4CC2A 1PHTA 1YNZA 3VS1A 1I1JA 4A63B 4OMNA 4J9HA 4KRTA 5L23A 2C0TA 2V1QA 4GLMA 2F2VA 1K76A 3NHNA 1AVZC 3O5ZA 2NWMA 1ABQA 5IHIA 1WFWA 2K6DA 2DILA 1SRLA 1UECA 2KYMA 4J9CA 1ABOA 1GCQA 4HVVA 3ZL7C 1G83A 2F2XA 1NEGA 1JXMA 1PKTA 2RQWA 3EG3A 3H0HA 3THKA 2FPDA 1NYFA 1OPLA 2DVJA 1A0NB
chains in the Genus database with same CATH superfamily
1G3TA 2CZ1B 2W0ZA 2OX7A 2EKOA 3C94A 3TU4K 3M0QA 2BUDA 4XQ3A 2JXBA 2O01E 5FW9A 1EFNA 2DJQA 1TUDA 1LOJA 1UDLA 3BFMA 4DA4A 2EYWA 3HFOA 4XTZA 1T0JA 5GAN6 2IVWA 4HKEA 1M27C 1YIJA 2DVEA 4Y91A 4JRIA 1H3HA 5A2QE 4C92A 3P8HA 2YRDA 2DJZA 3I9QA 1RI0A 1VQ8T 3H9NA 2AIRB 4ZN3A 2EQIA 4PLLA 2DZCA 2X4JA 3EH1A 5A0GA 4C5EA 2D6FA 1M5Q1 2D1XA 2OTJA 2ZCFB 5KYYB 1XOVA 4KUDK 2P0QA 1RAAB 1MV3A 4MZTA 4R0KA 5KYXA 4E7LA 1LPLA 2PVDB 2HL5C 3PE0A 2HBWA 5I2MA 1SHFA 3PIPA 2FZKB 1M1GA 2COZA 3F70A 2E3IA 1YCSB 5LJ3h 2DX1A 1S72T 2KRSA 3V7RA 1X2QA 4LUDA 2E41A 2ED1A 1KD1U 2GF7A 2MI6A 2MPXC 2QEXA 2F5TX 3P8BB 2E5KA 1WQWA 2DE0X 1YN8A 1VIEA 4M7AG 4J83A 2DRKA 1BKBA 1RAIB 2FPFA 5DY9A 1OV3A 1Q81C 1AWXA 4EMKB 4Z02A 3M58A 1X69A 3S3OA 1M90R 4XU0A 1VIFA 5CR2A 1TTHB 2COYA 1PG5B 1LVKA 2CYZB 2RQUA 2X3WD 3A8HB 3OMGA 1WHLA 2MIOA 2O88A 1AZGB 2G6FX 1D1BA 2OJ2A 3JCMh 4J5YA 3NTKA 1RLQC 4C8QB 2RN8A 3CMAQ 3UDCA 2K3BA 4C8QA 1OPKA 1X27A 4LNPA 3NFCA 1UTIA 2A3LA 3REBB 1Q82C 3OB9A 3PIOA 3VUBA 2H8HA 5GAMg 2RD1A 2LP5A 1VQNT 2JOYA 1QWFA 2YDLA 2EYYA 3EH2A 5IN1A 3VS7A 2IPOB 3MP8A 5HCKA 1PRLC 3RUXA 1YWPA 2DM1A 1OX8A 1VYUA 1C1AA 4D8KA 2NYSA 5LJ5d 3GBQA 1I0CA 2CSIA 3CCQQ 3QYGB 1TWBA 1C0MA 1KIKA 1ZBXA 3SFMA 3RERA 2B86A 5ECAA 2LT1A 1QVGA 4EMKA 4ME7A 1Q82R 1T3LA 3M0UA 3CMEA 3CCLT 2E3HA 3G6EA 3OYIA 2P4TA 4KULA 2FZCB 5KCOA 2NUTB 1M9SA 3QUIA 4M77G 3M4YA 3C0CA 4LDWA 3A8MB 2RQVA 1GFCA 1OZ2A 2X4YA 4MZMA 2HL3A 4XAXB 4IUTA 1B34A 3QO3A 2EFIA 4RMOA 3CCJT 4FCYA 4M78D 4RTTA 1DJ7B 1ZX6A 4JZ4A 4CC7A 4M7AF 2KRNA 4MMKA 4HA8A 2J06A 5CIUA 1MUZA 1UGPB 2CH4A 3ER0A 1VQOA 4M7DB 2EPDA 3HRSA 1PSEA 2L0AA 3JV3A 2MMPA 2WSFE 1ZA2B 3EFSA 2EQUA 5GAMh 2O2OA 2A36A 2YLBA 2R5AA 2ED0A 3MEVA 4ESRA 4JPBW 3CPWS 2MWOA 1VQLQ 1WXUA 4OB0B 2RA2A 1TU0B 2P4RA 1YBYA 2V1RA 2DRMA 1VQLA 3VYHB 3PTAA 4OMLA 3OMCA 5KYYA 1K8AC 2XDPA 3M57A 2LQKA 3TVTA 1EX4A 1O9SA 3S3MA 1Y07A 2RI3A 1VQ9T 3VS3A 2YT6A 4P5NA 2B8AA 2R5MA 2BKDN 5GMKl 2RPNA 4CC3A 5CKEA 3G4ST 1ACMB 2VC8A 5IHNA 1LNXA 2CP0A 1ZSZA 2D8HA 2FEIA 2RB6A 4XTVA 3CMAT 1BI1A 2GTOA 2PQWA 3RMQA 3QWYA 4C0DC 3MEAA 1YJ9Q 2LJ3A 4DEXA 2O9VA 2QYZA 3FRNA 4ZN1A 3QJ6A 3UWNA 1SEMA 3E1SA 5J3BA 1E6GA 1PCXA 3LH0A 1Q7YU 3A98A 1Q86U 4BY6C 3OS1A 3CCRQ 2VGMA 5FWCA 1KJWA 1KC8U 1VQ7T 1UEBA 3LYIA 3VS0A 4PJJA 4A4GA 1UUEA 2OTLT 1WPYA 5DM7R 2L2PA 1AWWA 1K9AA 3ZBDA 2FPEA 2LJ0A 5GANg 3TCJA 3RESA 3JCMV 2EQMA 4F04B 5A0DA 1PM3A 2RJFA 4J9IA 1U06A 3HRUA 4RTYA 3PT9A 4E7HA 2PNIA 1TOVA 2J7IA 3OW2A 4A54A 1NJIC 2HNIA 1OULA 2RHUA 1KD1C 3JAME 4WCIA 1VUBA 4PFOA 4RTXA 1VQMQ 1AOJA 3VS6A 2YSQA 3M0PA 5GAN4 4FYWB 4M77D 1EIFA 2GFUA 4M7AE 4FT4A 4HVWA 1KG1A 1WJRA 2CZ7B 3QZ9B 4A4HA 1VQ6A 2XU8A 4FYVB 3CCSQ 2LDMA 2JTFA 4F7UG 4C0ZA 3QYHB 4ELYC 1WA7A 2A0FB 2EVRA 3BW1A 4M7DG 1K0SA 5EC7A 2QQAA 4QW2A 1NZ9A 5GAMe 1MMNA 2CGHA 3CMAA 1SG5A 3JCMX 4E2FB 1JU5C 4PJOF 2HMAA 2BTTA 3META 3GLXA 1FMWA 1WHMA 1S72A 1JJ2S 5HK0A 2LQNA 4E7IA 4JJCA 3CCMA 3VS1A 1M2OA 5KH6A 2QQSA 4OMNA 4J9HA 5L23A 3MKDA 2HD0A 1BIBA 3QIIA 3OYAA 3NHNA 1X6OA 4IUVA 1W2BA 1FWZA 4QVZA 1SF9A 2VASA 3CEYA 2K6DA 2AHJB 1QVFP 1K73U 1OYXA 4RKUE 1YJNA 4OMFB 1D1AA 1JXMA 2RJCA 3THKA 2QEXT 3A5ZB 4M78A 2DVJA 3MPUB 3KXTA 1NE8A 5I22A 2BZYA 2JNGA 2LTOA 5FROA 1PNJA 3X28B 1VQ5A 4QVCA 2DERA 3VJPA 3OSSC 2ZGWA 3JCMW 1BU1A 2ZPFB 3HKSA 2A08A 4TVRA 4M7DA 5GAOq 2F5KA 4EMKC 1WLPB 2L8DA 2AZVA 3UF4A 2LT4A 3H0FA 2XDBA 1NM7A 1Y71A 1GL5A 5LJ5j 2DL3A 4ELZC 4M77C 1H92A 4L5GA 1QLYA 3A8OB 1YI2A 5IXBA 1VQ4A 1CKAA 2Y4YA 3VS2A 3CCUT 3L2WA 3DB3A 3N5BB 1YITT 1TXQA 3EG2A 4KUIA 2O9SA 2XK0A 1X6BA 4E7ZA 2OI3A 4C8QD 1M90C 4GY5A 1VQ7A 2RM4A 3OYGA 2L89A 2M0YA 2LC4A 1OU9A 3I5SA 3CC4A 4Z89A 3URGA 3HRTA 1D09B 2DNUA 4OF1A 3CCVT 3JCMe 1ZSZB 3CCMT 2X9HA 3V8LA 3VV0A 2M51A 3FLGA 2PVOB 1M4ZA 1U5SA 2E6NA 3V7CA 1U8RA 3CC2T 1Y0MA 5CQYA 4IUUA 2YUPA 2FG0A 2DD5A 4LXCA 4M75D 2GQVA 3M5AA 3JCMg 2WACA 1W1FA 4DOVA 1XQHA 3AT1B 5KYUA 5GJWB 2MF2A 2KY9A 3QZ5B 4LDUA 4MDWA 2KGTA 5FU6B 1BCOA 4KGZB 2VWFA 3OW2S 4JS4A 2EYXA 4NL3A 5CK9A 4FW1A 3GP8A 2KE9A 2FRYA 1N8RC 3GPLA 2X4XA 3LW5E 2COWA 2DYBA 2C0OA 2PUKB 3JCMP 1T0HA 5GJVB 3JCMc 3MEWA 2QG9B 2Y4XA 3EG0A 1Q86R 4RTWA 2I2LA 1KC8C 5EG2A 2QDLA 1VQPA 4JZ3A 3OS0A 1E7OA 4C8QF 4A4EA 3JSCA 4IIMA 5L8RE 2R57A 2HAXA 1WIEA 1B7TA 2GQIA 3LH5A 3KBGA 3C4SA 2YUNA 4M4ZA 2YRVA 1G3SA 1EZZB 2LNVA 1QVGS 5KYWA 1VQ5Q 1VQKA 2CDTA 2EGAA 2K3YA 5KYWB 2BIVA 1YITA 4AFZC 4VUBA 1SRMA 1H3ZA 2QAZA 3LX7A 2RQRA 2AZSA 3QXEB 5GMKe 3FB9A 2JMAA 2VUBA 2M02A 2DA9A 4BI8B 1S72Q 3AHUA 2KYBA 2GBQA 1M1KU 2ZAEA 1BK2A 4ZGDB 1KQ2A 1K0XA 2RI2A 2QEXQ 1BI3A 1MMAA 2YLCA 4IUQA 2FYKA 1KHCA 2NUPB 2L3QA 2KSSA 3EGDB 2ZPEB 5GMKm 1ZUUA 2KVQG 3QWXX 4M77F 3EGDA 3LWIA 2MK5A 2KMTA 1MNEA 2V8KA 4WTOB 4WF2A 5GAN2 4MZPA 2BZXA 5GAN7 4L6V5 3MO8A 3CCVQ 1PC0A 5I21A 1FMVA 3T9NA 2KXCA 1KFZA 3R6NA 1SPKA 1W4SA 2E6ZA 1N6AA 7AT1B 2WSEE 3OA6A 1HYOA 3NMZC 1D0YA 3I5RA 1YITQ 1ZUYA 2MWPA 3OYLA 2ESWA 2FHDA 2K2VA 4FYYB 2XKOC 4HT8A 3QKJA 2QGFB 3U23A 1YWOA 1D3BA 1XNIA 2CZ6B 3M56A 4N4HA 5CVIA 5GAMj 3BE3A 1M2VA 1YFNA 4XU2A 1JO8A 1MGQA 1ZA1B 3SEMA 3V7SA 5IT9E 2O4XB 1VQ4T 2FRWA 1I8FA 3NTIA 1VYVA 5GANh 4M7DD 2MCNA 3NTHA 1QKWA 1VA7A 1IRXA 1X6GA 5CAIA 4MDXA 1WZOA 5CKDA 2EJFA 3QJYA 3JCMf 1JXOA 5GAOp 4C8QE 3ULRB 4MMLA 4BB7A 1PRMC 2DL8A 4M75G 1NJIR 3G1JA 2BZ8A 3OYJA 1VQPQ 5IXFA 2WSCE 3FEOA 5GAN8 3REAB 2CUDA 4C5GA 5LJ5g 1VQKQ 1IHVA 2VYTA 2RHXA 4RTUA 3L2QA 5CO7A 2RJDA 3OSVA 1M30A 3CC7A 2GTJA 2RNAA 1IO6A 1F1BB 4JRQA 1UHCA 4B9XA 4PLIA 1C6VX 2DTHA 2P84A 3S6WA 4F16A 1PWTA 4X1VA 6AT1B 2YUOA 4DOWA 5FWBA 2W10A 1NJIU 1NPRA 2QQRA 5LJ3j 4PJMA 2QK0A 3J7AF 2CT3A 4XK8E 3M4GA 2DAQA 1MV0B 1WI7A 1B34B 1BB9A 4HCBA 1UG1A 5KE3A 5GAN3 1YIJT 1YHQT 2A28A 2M16A 1UFFA 3JB9H 1G2BA 2HQXA 2KBTA 1B3QA 1TS9A 5LJ3f 1VQ4Q 1N9RA 1QCFA 5J39A 1BBZA 1VQ6T 4QQDA 3EG9B 1WHKA 3LWHA 4EPCA 2XI9A 3G71Q 3G6EQ 1IHWA 1PKSA 2ZZDA 2EQKA 2K57A 4OGEA 4JLIA 3OY9A 2CP6A 4DBFA 2F69A 3UPUA 4Z8AA 1WHGA 3RKYA 1UGVA 4M77B 1X75C 1M1KR 1YJNT 2ZPIB 5D6YA 5GAMf 2ZPGB 4AG2C 2YRCA 2LJ1A 3G71T 4AT1B 3ZFJA 2QXFA 4CC2A 2DEQA 2LCLA 3OYCA 2JUFA 1VQ7Q 5FLXE 5LJ3g 4PJOD 2V1QA 2DXCA 4GLMA 1AHJB 3SD4A 3CCJA 4M78B 3L42A 1AVZC 3CPWP 4C92E 5IHIA 2V8IA 4IUPA 2QQ9A 4II1A 3CPWA 1YHQA 4HVVA 4D6WA 1R0BG 2GFAA 2RQWA 1K8AU 3CD6T 4AMCA 2QASA 3OYDA 1NYFA 1D1CA 2DEUA 1A0NB 2XICA 1ZSGA 2ENMA 4XTWA 4NS5A 1SSFA 1RI9A 2RHIA 3TEEA 4RCBA 5GANe 4X9DA 2LNHB 1B07A 3TSZA 1T3SA 1M1KC 2K2MA 4PL6A 1VQ8Q 2DIQA 4E47A 1QCOA 2J05A 4LD9K 2OAUA 1X01A 5FU6C 2FVUA 1R77A 1GCQC 2DBKA 3CCRT 4O6JA 1NLPC 3WVEB 3GF5A 1RL2A 1K9MC 4J9GA 3VKIA 2E4HA 4BI4A 2DF6A 3M9QA 3HTRA 1K4US 2C06A 4BD3A 2XDDA 3O8VA 3RKXA 1SSHA 2LX7A 3G4SQ 2K3XA 1Q81R 1QQJA 2RK1A 1RAGB 2JN0A 2CP3A 2EJ9A 4J9BA 5CCAA 3UA6A 3OQ5A 2JVVA 3FJ5A 4NOYA 4AFSC 1UHFA 2OTJQ 1AWJA 1WX6A 3CXCA 5CKFA 3OYHA 2HZYA 4JJDA 3RMSA 2K9GA 3L1AA 3CXCP 1IREB 2E12A 1WDXA 1WHHA 1VQMT 2DXBA 2HCKA 2KR3A 3CQTA 4CC4B 1YHQQ 2DZ9A 4FSSA 1V29B 4C0FA 3OYNA 3M0SA 4M75F 4J6XA 1NLOC 1ZQ1A 2D0QB 1KC8R 1PD1A 4UC4A 2K7AA 2VXFA 4RUGA 3CBPA 2MAMA 4OMQA 5IHKA 4XTXA 2HEQA 3TQ7P 3JB9F 2ATCB 1OOTA 1OZ3A 1I4K1 3I55Q 3X20B 4E7KA 3CC2Q 2MOXA 3TSWA 1VQOT 2DK3A 1WYXA 5FRMA 1QVFA 3L2UA 2XMFA 1R0CB 1YIJQ 1VQKT 2DPPB 4M7DC 4C5HA 4LUEA 2NUZA 3QG1A 4F7UE 2DBMA 4J6WA 2NLUA 3OYFA 5FU7B 2V8JA 4F17A 1K1ZA 1QMCA 1N5ZA 3PVQA 1HXDA 1Y96A 2GGRA 1QP2A 1IB8A 1GBQA 4FT2A 1QVGP 2YXYA 3PVLA 2DD4A 2DO3A 1GFDA 4PJOA 1MMGA 4F7UF 4BE2A 2XHCA 1I5OB 4J7IA 4PK4A 2RF0A 3JB9J 1W2BS 3OYEA 2KNBB 1U1TA 2J6KA 1YI2T 3HPWA 1QP3A 2DMOA 3EG9A 1BI2A 3H6ZA 4J6YA 3WXMB 1TSFA 1X2KA 4DBQA 4JRKA 2OTJT 5A0LA 2K5IA 3CCUA 1LJOA 4C8QC 1QCNA 3UATA 1N8RR 2VV5A 5AYFA 3E2UA 4J9EA 2HDAA 4FM4B 3HL8A 4ANJA 1TUGB 2CP5A 1KQ1A 2RMOA 3CCEA 5IH2A 4JRPA 5C0MA 8AT1B 1QW1A 2G3RA 3CPFA 2E64A 2VKNA 1Z9QA 1GCPA 4M75A 2IIMA 4NL2A 1U3OA 2ROLA 2DYIA 3CCEQ 3H41A 1G8XA 5GAOn 3GOXA 4LDYA 4A4FA 4PJOE 2R58A 4N0AC 4GBQA 3PGGA 4N4GA 1I07A 3C12A 4LD6A 3CBOA 1UJ0A 2LX9A 1RAFB 3R6OA 4C92C 1JEGA 3FJPA 1VQ9Q 1K8AR 2NUPA 4L59A 2JT4A 3H0IA 1VQ5T 4X9CA 2QTXA 3MCAB 4F7UA 4N4IA 4AFUC 2H3JA 2YUQA 4PJNA 3I56A 2JM8A 5J26A 1J3TA 1QWEA 5KE2A 2KEAA 2CSQA 1MNDA 2ZPBB 5GAOm 2LRQA 2E65A 2A37A 1XTDA 4PFPA 2JM9A 2KRMA 4FYXB 1Q95G 1UB4A 4KH1B 2KK4A 4PJOG 3EGUA 5AT1B 1YI2Q 3Q1JA 3H8ZA 3QHSA 4A53A 4LDVA 1OX9A 1BI0A 4M78F 5DLOA 4EMGA 4J9FA 1IXDA 2RJEA 3MHXA 1OEBA 1KK7A 1M2VB 3SWNA 1BCMA 3DB4A 3I56T 4E7JA 3I55A 2A7YA 2HQEA 3CC7T 4J9DA 2YHTA 1KD1R 1LCKA 5HKCA 2HKNA 3CCQA 1YJWA 3EHQA 3QSUA 2FL7A 2PUOB 2JTEA 2LVMA 1JB0E 3FIFA 1AZEA 4JJBA 1BIAA 2P0KA 2ABLA 2RK2A 1UGQB 2D8JA 2EYZA 3V8JA 5GMKi 3SB2A 3CC7Q 2BE9B 2RHZA 1WJSA 4OB2B 4GLKA 2JZ2A 3CBMA 2JS0A 1H641 2QTVA 1M3CA 3JRZA 4BE1A 1E6HA 1ZLMA 2DLPA 1N27A 4ZNXA 3E19A 2X4WA 4M77A 4C5IA 1IGUA 1TH7A 2RHYA 3DLMA 4ORZA 2M0OA 1AD5A 2LCSA 1RUWA 3HHTB 4C92F 5FRNA 2L3SA 2X3XD 1VYTA 2DXUA 1GXIE 4C0DB 4DQ2A 1NBEB 2RI5A 4PFZA 4BDZA 1V1CA 2EIFA 1Q7YC 2E70A 4FL6A 3VRZA 1WHJA 1GRIA 1HJDA 1VQPT 5C6SA 2KI7A 1Y7XA 4HT9A 1ZUKA 1RAEB 4RTVA 5LJ5f 3QDFA 2EQJA 5D7UA 2AKLA 3OYBA 1UGRB 3VS4A 3S3NA 4ZTJA 1YJNQ 2MYSA 3PMIA 4QQGA 1K73C 3EGXB 1M90U 2JMCA 3LGFA 4OGCA 4RG8A 2JTMA 2CZ0B 1AWOA 1JBMA 3CCMQ 3GIBA 1RACB 5CQXA 1D0XA 3M59A 4OB1B 2LMJA 1JRIA 4OB3B 4D8DA 4J7FA 2PU9B 2O31A 3VU3C 2JS2A 4QKUA 1PHTA 4B6MA 2VXEA 3OBYA 1YNZA 3JCMd 1I1JA 4A63B 2Y90A 4JDSA 4KRTA 1K9MR 2E5QA 3O5ZA 4OVAA 3CC2A 3M54A 1ABQA 4M7DF 4LDXA 1YJWQ 1WFWA 4V2SA 1P92A 4J9CA 1ABOA 1NEGA 1PSFA 1PKTA 1M1FA 3EG3A 3JCMJ 5GMKj 1JJ2A 2GCXA 3L2VA 2FPDA 3EAEA 4M75E 4KGXB 4BE0A 1N8RU 2E10A 1CKBA 3UT1A 4QVDA 4C8QG 5KCHA 1RADB 4PJOB 2K5LA 5LJ5h 1KQSP 1WGSA 1VOMA 3A8GB 4M75C 5CKBA 4M77E 1NPPA 1U1SA 2I0NA 2EAYA 3M55A 2QA4T 1IZ6A 3MP1A 4M7AA 3EGXA 2DXTA 3EFRA 2SRCA 1VQNA 4JS5A 2OTLA 4AG1C 1ZSZC 3UA7A 1OI1A 2EYQA 4HXJA 1HK9A 1RAHB 2AT1B 2K4YA 2J6OA 1Q81U 2PVGB 3LGLA 2HKQB 2NUTA 1Y57A 4XU1A 3OS5A 1KSWA 3CCRA 3PMTA 1AEYA 1PD0A 2EKHA 3BDLA 2L3RA 2O4XA 2VB6A 3RR6A 4BI3A 1S1NA 1NG2A 1MHNA 1VQ9A 4HCCA 1HD3A 1FYNA 4FIBA 4LN2A 4QT7A 2DTOA 1VQ8A 2K79A 2KXDA 1UE9A 3L2RA 2V26A 2CKKA 5I2SA 3A8LB 3I35A 1Q86C 3CCLA 4PKCC 4IURA 2BE7D 3OS2A 3BDUA 4E7SA 1SHGA 4YTLA 3M0RA 3C95A 4PJOC 2CP2A 5KYUB 2KROA 3TREA 2EBPA 2EGEA 3EHRA 3CXCS 5GANj 5GMKh 3CCVA 3CCJQ 3HP9A 3INZA 3CMEQ 1N9SA 3DLLA 2M1HA 3FDRA 3JB9D 3WVDB 3A1PA 1ZHIA 2OTLQ 1FX7A 3FC3A 4OP0A 5D6XA 3QPHA 2Z0WA 1FXXA 4KT0E 3I55T 1ARKA 5KYXB 3CCSA 4Y92A 2L5QA 2PZ1A 4LE9A 3J80E 2DL4A 2QI2A 2QA4Q 1I81A 1VQOQ 5GAOl 4K11A 1G5VA 2M9UA 4F14A 4XTUA 2X35A 1TG0A 3M0TA 1TUCA 3OBWA 3RBBB 1YJ9T 2HSPA 4X34A 3SWNB 4XU3A 4M78G 2CH4W 1Q82U 3G6ET 2QQBA 3IQLA 2KDSA 3JCMb 4IKFA 1WXTA 4O5VA 2AK5A 4E6RA 1FMKA 1M8MA 4XTYA 4PJLA 3OYMA 5D6WA 2LZ6B 1AT1B 5GAN5 2XG8D 1X43A 3E9GA 1M3AA 1UGSB 3CC4T 1G3YA 4M7DE 4ZGJB 2XD0A 4OMMA 5GANd 2EJGA 1RABB 1YCYA 1ZBJA 5LL6S 2IG0A 4HCKA 1MMDA 3VUZA 5I11A 1YJWT 1M3BA 1OQKA 4IIOA 2RO0A 4R56A 2FZGB 4C92B 3JCMQ 3VS5A 1NYGA 2D9TA 3VRYA 3CD6Q 2EW3A 2DL7A 2CUBA 2DKGA 2F2WA 1YJ9A 5LJ3e 2RQTA 4Y28E 4HVUA 1M8VA 2HBPA 3JB9I 3HSBA 4FU6A 3GNFB 1BYMA 1NEBA 1W6XA 2KT1A 2SEMA 3CCST 1XJWB 3CCET 2HSEB 1JQQA 2CREA 4BY6B 4BACA 3SWNC 2DETA 4Z88A 1RLPC 1SKUB 4JJNK 3G7ZA 2VVKA 4EMHA 3G4SA 4DBRA 4J8OA 1VQLT 2CS7A 4DEYA 1QKXA 2P0PA 4RCCA 4RTZA 1KHIA 1HSQA 2JW4A 4M7AB 4FSXA 3CD6A 3ME9A 1G3WA 4BDYA 8ATCB 4CRIA 3D7SB 5HY6A 4KBMB 4HCZA 4M7AC 2ROTA 1VQ6Q 2JJ9A 4N0AA 9ATCB 2QDYB 3JB9G 1W70A 2H3EB 2VGNA 1QVFS 3G71A 3DKMA 3MEUA 4BUGA 2C0IA 3EG1A 3QDRB 2CP7A 1VQMA 4JLGA 2LQ8A 2GNCA 4OMOA 2YWWA 1WJQA 3P8DA 2X51A 1YP5A 1IGQA 3SHWA 1GBRA 5FU7C 1KQSA 3KFVA 1KQSS 1I5LA 2CT4A 1Y96B 5GANf 5IAYA 1D0ZA 3X26B 1Z9ZA 4OMPA 2KQWA 4F7UB 1OU8A 1V76A 1WXBA 4KH0B 1Q7YR 2DTIA 3PFSA 2QGGA 2L3PA 3M53A 5LJ3d 5HK3A 1CSKA 3CMET 3EFOA 1O75A 1WNLA 4EDUA 3EFOB 4EIKA 3OYKA 3LLRA 5KYNA 2RH2A 1H8KA 2FB7A 3CC4Q 4FW2A 2EGCA 5DLQE 4C92D 3MJXA 5CKHA 4M75B 4QQ6A 3SDZA 3GNGA 3BY7A 1UJYA 1D3BB 2OAWA 2EWNA 2XIDA 2KT8A 1W2BP 3I56Q 4ZTFA 3X24B 2QA4A 4RG2A 2ZPHB 3RKWA 3QBYA 2LQWA 4M78E 3OW2P 3VYGA 4Q5WA 3KUFA 3MP6A 5GAMd 3RNJA 4DBHA 3PNWC 2D0NA 4A4KA 2K5FA 2PTKA 3E9FA 4AFQC 4M7AD 3L2ZA 1WQ7A 1QVPA 4KGVB 1JJ2P 5LJ5e 2KAFA 4C92G 3CCUQ 4B9WA 4ATOA 2DL5A 1VQNQ 2FO0A 2DFUA 2F1LA 4R55A 3CCLQ 4ZGEB 2ECZA 3NPFA 3NGPA 3RDVA 2AKKA 4JUVA 3RIRA 2J6FA 2DIGA 4PNOA 5GAOr 4CI0C 3X25B 2C0TA 3V8KA 2F2VA 3CCQT 3ZEHA 1K76A 4M78C 3HFNA 3J81E 3OYYA 1K9MU 2NWMA 3ASKA 2DILA 1R8OB 1SRLA 1UECA 2KYMA 2HQHA 1GCQA 3ZL7C 1G83A 5M9OA 2F2XA 3H0HA 1K73R 2LCCA 1OPLA 2E1HA 4C0GA
chains in the Genus database with same CATH topology
2W0ZA 1ZSGA 1CKBA 2ENMA 5I22A 2BZYA 1RI9A 1PNJA 3M0QA 2JXBA 5FW9A 2LNHB 1B07A 3TSZA 1T3SA 1EFNA 1BU1A 2DJQA 1TUDA 1UDLA 2K2MA 2EYWA 2I0NA 2A08A 2J05A 1WLPB 1T0JA 1GCQC 2DBKA 2SRCA 1NLPC 2AZVA 4AG1C 3UF4A 3UA7A 4J9GA 1M27C 1H3HA 3H0FA 1GL5A 1NM7A 2DF6A 3I9QA 2DL3A 4HXJA 1H92A 1QLYA 2J6OA 1K4US 5IXBA 2EQIA 1CKAA 1SSHA 2LX7A 3VS2A 2D1XA 1Y57A 3EG2A 2O9SA 1X6BA 4J9BA 2OI3A 1XOVA 1KSWA 1AEYA 1MV3A 4R0KA 3UA6A 2M0YA 2EKHA 3FJ5A 4AFSC 3PE0A 1S1NA 1NG2A 1UHFA 2HBWA 1AWJA 1WX6A 3I5SA 1HD3A 1SHFA 1FYNA 4Z89A 4LN2A 4JJDA 2K9GA 4QT7A 2DNUA 1WDXA 2K79A 1YCSB 2KXDA 2HCKA 2KR3A 3CQTA 4CC4B 1UE9A 2DX1A 4FSSA 2M51A 2KRSA 1X2QA 3M0SA 4LUDA 1U5SA 3I35A 2ED1A 1NLOC 1Y0MA 1SHGA 2YUPA 2E5KA 2FG0A 3M0RA 2K7AA 2DE0X 1YN8A 4RUGA 2KROA 4OMQA 5IHKA 1W1FA 2EBPA 2EGEA 3EHRA 2DRKA 2HEQA 5GJWB 1OOTA 2FPFA 1OV3A 1AWXA 2KGTA 2MOXA 2VWFA 3TSWA 2EYXA 1WYXA 1X69A 2XMFA 4LUEA 2KE9A 2FRYA 2NUZA 2DBMA 2RQUA 2X3WD 2MIOA 2O88A 1ARKA 4F17A 1AZGB 2DYBA 2G6FX 1K1ZA 2OJ2A 4Y92A 2PZ1A 4LE9A 1N5ZA 2DL4A 2C0OA 1RLQC 1T0HA 3PVQA 5GJVB 2RN8A 2K3BA 4K11A 1OPKA 2GGRA 4F14A 1X27A 4LNPA 3EG0A 1GBQA 1TG0A 1UTIA 4RTWA 3M0TA 1TUCA 3RBBB 3REBB 2HSPA 3PVLA 1GFDA 2QDLA 2H8HA 4JZ3A 1E7OA 2CH4W 2LP5A 3IQLA 4IIMA 2RF0A 1QWFA 2YDLA 1WIEA 1WXTA 2KNBB 2AK5A 2EYYA 2GQIA 3LH5A 3VS7A 4E6RA 1FMKA 1M8MA 2J6KA 2YUNA 4M4ZA 5HCKA 1PRLC 2DMOA 1YWPA 2DM1A 2LZ6B 2CDTA 1X2KA 2EGAA 1VYUA 1X43A 4AFZC 1M3AA 1SRMA 4D8KA 3UATA 3GBQA 1I0CA 2RQRA 2AZSA 2CSIA 4J9EA 2HDAA 4OMMA 2JMAA 2DA9A 5I11A 1KIKA 1ZBJA 4HCKA 1M3BA 2KYBA 2GBQA 4IIOA 2B86A 2RMOA 5ECAA 5IH2A 1BK2A 3VS5A 1NYGA 3VRYA 1K0XA 1T3LA 2EW3A 3M0UA 2VKNA 2DL7A 2CUBA 1Z9QA 1GCPA 2IIMA 1U3OA 2ROLA 3H41A 2F2WA 3C0CA 2L3QA 1ZUUA 2RQVA 4GBQA 3QWXX 2RQTA 1GFCA 4HVUA 1I07A 1UJ0A 1JEGA 2BZXA 2KT1A 1W6XA 1NEBA 2SEMA 4RTTA 1JQQA 2JT4A 2CREA 3H0IA 1ZX6A 4JZ4A 4CC7A 2KXCA 4Z88A 1RLPC 1KFZA 2KRNA 3R6NA 2J06A 2VVKA 1SPKA 1MUZA 4AFUC 2YUQA 2CH4A 2JM8A 1J3TA 2EPDA 1QWEA 2KEAA 4DEYA 1QKXA 2L0AA 3NMZC 3JV3A 1HSQA 4RTZA 2CSQA 2JW4A 3I5RA 2O2OA 1ZUYA 2ESWA 2A36A 2A37A 2JM9A 2KRMA 2ED0A 4ESRA 3U23A 1YWOA 4JPBW 3EGUA 1WXUA 2ROTA 1JO8A 3SEMA 2P4RA 2V1RA 2DRMA 2FRWA 1VYVA 2MCNA 4OMLA 1QKWA 4J9FA 1VA7A 1W70A 1X6GA 3TVTA 1OEBA 2C0IA 3EG1A 2GNCA 4OMOA 3VS3A 1JXOA 2YT6A 1YP5A 3ULRB 2RPNA 3SHWA 4CC3A 1GBRA 3KFVA 5IHNA 1PRMC 2CT4A 2D8HA 2FEIA 2DL8A 2GTOA 3QWYA 4J9DA 1Z9ZA 2BZ8A 4OMPA 2LJ3A 4DEXA 1LCKA 2O9VA 3EHQA 1WXBA 5IXFA 2JTEA 1AZEA 4JJBA 1SEMA 2ABLA 2L3PA 1E6GA 2D8JA 2EYZA 3A98A 3REAB 2CUDA 1CSKA 5FWCA 1KJWA 4EIKA 3VS0A 1UUEA 2JS0A 4RTUA 2L2PA 1AWWA 1K9AA 1M30A 1M3CA 1E6HA 1ZLMA 2GTJA 2RNAA 2FPEA 2LJ0A 2DLPA 1H8KA 1IO6A 4ZNXA 1UHCA 2EGCA 4F16A 4ORZA 1PWTA 2LCSA 1AD5A 4J9IA 1U06A 4X1VA 1UJYA 1RUWA 2YUOA 5FWBA 2W10A 4RTYA 2L3SA 2X3XD 2OAWA 1VYTA 2PNIA 2J7IA 2CT3A 2KT8A 1MV0B 1WI7A 1BB9A 2LQWA 4WCIA 1UG1A 1V1CA 4RTXA 3VRZA 1AOJA 1GRIA 3VS6A 2A28A 2YSQA 3M0PA 1HJDA 1UFFA 1G2BA 2KBTA 1B3QA 3RNJA 1ZUKA 2D0NA 4HVWA 4RTVA 2AKLA 2PTKA 4AFQC 1QCFA 3VS4A 1BBZA 2JMCA 1WA7A 2EVRA 2DL5A 1PKSA 2FO0A 1AWOA 5EC7A 1K0SA 4Z8AA 1UGVA 2ECZA 1JU5C 3NPFA 3NGPA 2BTTA 2AKKA 2LMJA 4AG2C 4D8DA 2LJ1A 2LQNA 2J6FA 2O31A 2JS2A 4JJCA 4CC2A 1PHTA 1YNZA 3VS1A 1I1JA 4A63B 4OMNA 4J9HA 4KRTA 5L23A 2C0TA 2V1QA 4GLMA 2F2VA 1K76A 3NHNA 1AVZC 3O5ZA 2NWMA 1ABQA 5IHIA 1WFWA 2K6DA 2DILA 1SRLA 1UECA 2KYMA 4J9CA 1ABOA 1GCQA 4HVVA 3ZL7C 1G83A 2F2XA 1NEGA 1JXMA 1PKTA 2RQWA 3EG3A 3H0HA 3THKA 2FPDA 1NYFA 1OPLA 2DVJA 1A0NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W0Z A;  1ZSG A;  1CKB A;  2ENM A;  5I22 A;  2BZY A;  1RI9 A;  1PNJ A;  3M0Q A;  2JXB A;  5FW9 A;  2LNH B;  1B07 A;  3TSZ A;  1T3S A;  1EFN A;  1BU1 A;  2DJQ A;  1TUD A;  1UDL A;  2K2M A;  2EYW A;  2I0N A;  2A08 A;  2J05 A;  1WLP B;  1T0J A;  1GCQ C;  2DBK A;  2SRC A;  1NLP C;  2AZV A;  4AG1 C;  3UF4 A;  3UA7 A;  4J9G A;  1M27 C;  1H3H A;  3H0F A;  1GL5 A;  1NM7 A;  2DF6 A;  3I9Q A;  2DL3 A;  4HXJ A;  1H92 A;  1QLY A;  2J6O A;  1K4U S;  5IXB A;  2EQI A;  1CKA A;  1SSH A;  2LX7 A;  3VS2 A;  2D1X A;  1Y57 A;  3EG2 A;  2O9S A;  1X6B A;  4J9B A;  2OI3 A;  1XOV A;  1KSW A;  1AEY A;  1MV3 A;  4R0K A;  3UA6 A;  2M0Y A;  2EKH A;  3FJ5 A;  4AFS C;  3PE0 A;  1S1N A;  1NG2 A;  1UHF A;  2HBW A;  1AWJ A;  1WX6 A;  3I5S A;  1HD3 A;  1SHF A;  1FYN A;  4Z89 A;  4LN2 A;  4JJD A;  2K9G A;  4QT7 A;  2DNU A;  1WDX A;  2K79 A;  1YCS B;  2KXD A;  2HCK A;  2KR3 A;  3CQT A;  4CC4 B;  1UE9 A;  2DX1 A;  4FSS A;  2M51 A;  2KRS A;  1X2Q A;  3M0S A;  4LUD A;  1U5S A;  3I35 A;  2ED1 A;  1NLO C;  1Y0M A;  1SHG A;  2YUP A;  2E5K A;  2FG0 A;  3M0R A;  2K7A A;  2DE0 X;  1YN8 A;  4RUG A;  2KRO A;  4OMQ A;  5IHK A;  1W1F A;  2EBP A;  2EGE A;  3EHR A;  2DRK A;  2HEQ A;  5GJW B;  1OOT A;  2FPF A;  1OV3 A;  1AWX A;  2KGT A;  2MOX A;  2VWF A;  3TSW A;  2EYX A;  1WYX A;  1X69 A;  2XMF A;  4LUE A;  2KE9 A;  2FRY A;  2NUZ A;  2DBM A;  2RQU A;  2X3W D;  2MIO A;  2O88 A;  1ARK A;  4F17 A;  1AZG B;  2DYB A;  2G6F X;  1K1Z A;  2OJ2 A;  4Y92 A;  2PZ1 A;  4LE9 A;  1N5Z A;  2DL4 A;  2C0O A;  1RLQ C;  1T0H A;  3PVQ A;  5GJV B;  2RN8 A;  2K3B A;  4K11 A;  1OPK A;  2GGR A;  4F14 A;  1X27 A;  4LNP A;  3EG0 A;  1GBQ A;  1TG0 A;  1UTI A;  4RTW A;  3M0T A;  1TUC A;  3RBB B;  3REB B;  2HSP A;  3PVL A;  1GFD A;  2QDL A;  2H8H A;  4JZ3 A;  1E7O A;  2CH4 W;  2LP5 A;  3IQL A;  4IIM A;  2RF0 A;  1QWF A;  2YDL A;  1WIE A;  1WXT A;  2KNB B;  2AK5 A;  2EYY A;  2GQI A;  3LH5 A;  3VS7 A;  4E6R A;  1FMK A;  1M8M A;  2J6K A;  2YUN A;  4M4Z A;  5HCK A;  1PRL C;  2DMO A;  1YWP A;  2DM1 A;  2LZ6 B;  2CDT A;  1X2K A;  2EGA A;  1VYU A;  1X43 A;  4AFZ C;  1M3A A;  1SRM A;  4D8K A;  3UAT A;  3GBQ A;  1I0C A;  2RQR A;  2AZS A;  2CSI A;  4J9E A;  2HDA A;  4OMM A;  2JMA A;  2DA9 A;  5I11 A;  1KIK A;  1ZBJ A;  4HCK A;  1M3B A;  2KYB A;  2GBQ A;  4IIO A;  2B86 A;  2RMO A;  5ECA A;  5IH2 A;  1BK2 A;  3VS5 A;  1NYG A;  3VRY A;  1K0X A;  1T3L A;  2EW3 A;  3M0U A;  2VKN A;  2DL7 A;  2CUB A;  1Z9Q A;  1GCP A;  2IIM A;  1U3O A;  2ROL A;  3H41 A;  2F2W A;  3C0C A;  2L3Q A;  1ZUU A;  2RQV A;  4GBQ A;  3QWX X;  2RQT A;  1GFC A;  4HVU A;  1I07 A;  1UJ0 A;  1JEG A;  2BZX A;  2KT1 A;  1W6X A;  1NEB A;  2SEM A;  4RTT A;  1JQQ A;  2JT4 A;  2CRE A;  3H0I A;  1ZX6 A;  4JZ4 A;  4CC7 A;  2KXC A;  4Z88 A;  1RLP C;  1KFZ A;  2KRN A;  3R6N A;  2J06 A;  2VVK A;  1SPK A;  1MUZ A;  4AFU C;  2YUQ A;  2CH4 A;  2JM8 A;  1J3T A;  2EPD A;  1QWE A;  2KEA A;  4DEY A;  1QKX A;  2L0A A;  3NMZ C;  3JV3 A;  1HSQ A;  4RTZ A;  2CSQ A;  2JW4 A;  3I5R A;  2O2O A;  1ZUY A;  2ESW A;  2A36 A;  2A37 A;  2JM9 A;  2KRM A;  2ED0 A;  4ESR A;  3U23 A;  1YWO A;  4JPB W;  3EGU A;  1WXU A;  2ROT A;  1JO8 A;  3SEM A;  2P4R A;  2V1R A;  2DRM A;  2FRW A;  1VYV A;  2MCN A;  4OML A;  1QKW A;  4J9F A;  1VA7 A;  1W70 A;  1X6G A;  3TVT A;  1OEB A;  2C0I A;  3EG1 A;  2GNC A;  4OMO A;  3VS3 A;  1JXO A;  2YT6 A;  1YP5 A;  3ULR B;  2RPN A;  3SHW A;  4CC3 A;  1GBR A;  3KFV A;  5IHN A;  1PRM C;  2CT4 A;  2D8H A;  2FEI A;  2DL8 A;  2GTO A;  3QWY A;  4J9D A;  1Z9Z A;  2BZ8 A;  4OMP A;  2LJ3 A;  4DEX A;  1LCK A;  2O9V A;  3EHQ A;  1WXB A;  5IXF A;  2JTE A;  1AZE A;  4JJB A;  1SEM A;  2ABL A;  2L3P A;  1E6G A;  2D8J A;  2EYZ A;  3A98 A;  3REA B;  2CUD A;  1CSK A;  5FWC A;  1KJW A;  4EIK A;  3VS0 A;  1UUE A;  2JS0 A;  4RTU A;  2L2P A;  1AWW A;  1K9A A;  1M30 A;  1M3C A;  1E6H A;  1ZLM A;  2GTJ A;  2RNA A;  2FPE A;  2LJ0 A;  2DLP A;  1H8K A;  1IO6 A;  4ZNX A;  1UHC A;  2EGC A;  4F16 A;  4ORZ A;  1PWT A;  2LCS A;  1AD5 A;  4J9I A;  1U06 A;  4X1V A;  1UJY A;  1RUW A;  2YUO A;  5FWB A;  2W10 A;  4RTY A;  2L3S A;  2X3X D;  2OAW A;  1VYT A;  2PNI A;  2J7I A;  2CT3 A;  2KT8 A;  1MV0 B;  1WI7 A;  1BB9 A;  2LQW A;  4WCI A;  1UG1 A;  1V1C A;  4RTX A;  3VRZ A;  1AOJ A;  1GRI A;  3VS6 A;  2A28 A;  2YSQ A;  3M0P A;  1HJD A;  1UFF A;  1G2B A;  2KBT A;  1B3Q A;  3RNJ A;  1ZUK A;  2D0N A;  4HVW A;  4RTV A;  2AKL A;  2PTK A;  4AFQ C;  1QCF A;  3VS4 A;  1BBZ A;  2JMC A;  1WA7 A;  2EVR A;  2DL5 A;  1PKS A;  2FO0 A;  1AWO A;  5EC7 A;  1K0S A;  4Z8A A;  1UGV A;  2ECZ A;  1JU5 C;  3NPF A;  3NGP A;  2BTT A;  2AKK A;  2LMJ A;  4AG2 C;  4D8D A;  2LJ1 A;  2LQN A;  2J6F A;  2O31 A;  2JS2 A;  4JJC A;  4CC2 A;  1PHT A;  1YNZ A;  3VS1 A;  1I1J A;  4A63 B;  4OMN A;  4J9H A;  4KRT A;  5L23 A;  2C0T A;  2V1Q A;  4GLM A;  2F2V A;  1K76 A;  3NHN A;  1AVZ C;  3O5Z A;  2NWM A;  1ABQ A;  5IHI A;  1WFW A;  2K6D A;  2DIL A;  1SRL A;  1UEC A;  2KYM A;  4J9C A;  1ABO A;  1GCQ A;  4HVV A;  3ZL7 C;  1G83 A;  2F2X A;  1NEG A;  1JXM A;  1PKT A;  2RQW A;  3EG3 A;  3H0H A;  3THK A;  2FPD A;  1NYF A;  1OPL A;  2DVJ A;  1A0N B; 
#chains in the Genus database with same CATH topology
 1G3T A;  2CZ1 B;  2W0Z A;  2OX7 A;  2EKO A;  3C94 A;  3TU4 K;  3M0Q A;  2BUD A;  4XQ3 A;  2JXB A;  2O01 E;  5FW9 A;  1EFN A;  2DJQ A;  1TUD A;  1LOJ A;  1UDL A;  3BFM A;  4DA4 A;  2EYW A;  3HFO A;  4XTZ A;  1T0J A;  5GAN 6;  2IVW A;  4HKE A;  1M27 C;  1YIJ A;  2DVE A;  4Y91 A;  4JRI A;  1H3H A;  5A2Q E;  4C92 A;  3P8H A;  2YRD A;  2DJZ A;  3I9Q A;  1RI0 A;  1VQ8 T;  3H9N A;  2AIR B;  4ZN3 A;  2EQI A;  4PLL A;  2DZC A;  2X4J A;  3EH1 A;  5A0G A;  4C5E A;  2D6F A;  1M5Q 1;  2D1X A;  2OTJ A;  2ZCF B;  5KYY B;  1XOV A;  4KUD K;  2P0Q A;  1RAA B;  1MV3 A;  4MZT A;  4R0K A;  5KYX A;  4E7L A;  1LPL A;  2PVD B;  2HL5 C;  3PE0 A;  2HBW A;  5I2M A;  1SHF A;  3PIP A;  2FZK B;  1M1G A;  2COZ A;  3F70 A;  2E3I A;  1YCS B;  5LJ3 h;  2DX1 A;  1S72 T;  2KRS A;  3V7R A;  1X2Q A;  4LUD A;  2E41 A;  2ED1 A;  1KD1 U;  2GF7 A;  2MI6 A;  2MPX C;  2QEX A;  2F5T X;  3P8B B;  2E5K A;  1WQW A;  2DE0 X;  1YN8 A;  1VIE A;  4M7A G;  4J83 A;  2DRK A;  1BKB A;  1RAI B;  2FPF A;  5DY9 A;  1OV3 A;  1Q81 C;  1AWX A;  4EMK B;  4Z02 A;  3M58 A;  1X69 A;  3S3O A;  1M90 R;  4XU0 A;  1VIF A;  5CR2 A;  1TTH B;  2COY A;  1PG5 B;  1LVK A;  2CYZ B;  2RQU A;  2X3W D;  3A8H B;  3OMG A;  1WHL A;  2MIO A;  2O88 A;  1AZG B;  2G6F X;  1D1B A;  2OJ2 A;  3JCM h;  4J5Y A;  3NTK A;  1RLQ C;  4C8Q B;  2RN8 A;  3CMA Q;  3UDC A;  2K3B A;  4C8Q A;  1OPK A;  1X27 A;  4LNP A;  3NFC A;  1UTI A;  2A3L A;  3REB B;  1Q82 C;  3OB9 A;  3PIO A;  3VUB A;  2H8H A;  5GAM g;  2RD1 A;  2LP5 A;  1VQN T;  2JOY A;  1QWF A;  2YDL A;  2EYY A;  3EH2 A;  5IN1 A;  3VS7 A;  2IPO B;  3MP8 A;  5HCK A;  1PRL C;  3RUX A;  1YWP A;  2DM1 A;  1OX8 A;  1VYU A;  1C1A A;  4D8K A;  2NYS A;  5LJ5 d;  3GBQ A;  1I0C A;  2CSI A;  3CCQ Q;  3QYG B;  1TWB A;  1C0M A;  1KIK A;  1ZBX A;  3SFM A;  3RER A;  2B86 A;  5ECA A;  2LT1 A;  1QVG A;  4EMK A;  4ME7 A;  1Q82 R;  1T3L A;  3M0U A;  3CME A;  3CCL T;  2E3H A;  3G6E A;  3OYI A;  2P4T A;  4KUL A;  2FZC B;  5KCO A;  2NUT B;  1M9S A;  3QUI A;  4M77 G;  3M4Y A;  3C0C A;  4LDW A;  3A8M B;  2RQV A;  1GFC A;  1OZ2 A;  2X4Y A;  4MZM A;  2HL3 A;  4XAX B;  4IUT A;  1B34 A;  3QO3 A;  2EFI A;  4RMO A;  3CCJ T;  4FCY A;  4M78 D;  4RTT A;  1DJ7 B;  1ZX6 A;  4JZ4 A;  4CC7 A;  4M7A F;  2KRN A;  4MMK A;  4HA8 A;  2J06 A;  5CIU A;  1MUZ A;  1UGP B;  2CH4 A;  3ER0 A;  1VQO A;  4M7D B;  2EPD A;  3HRS A;  1PSE A;  2L0A A;  3JV3 A;  2MMP A;  2WSF E;  1ZA2 B;  3EFS A;  2EQU A;  5GAM h;  2O2O A;  2A36 A;  2YLB A;  2R5A A;  2ED0 A;  3MEV A;  4ESR A;  4JPB W;  3CPW S;  2MWO A;  1VQL Q;  1WXU A;  4OB0 B;  2RA2 A;  1TU0 B;  2P4R A;  1YBY A;  2V1R A;  2DRM A;  1VQL A;  3VYH B;  3PTA A;  4OML A;  3OMC A;  5KYY A;  1K8A C;  2XDP A;  3M57 A;  2LQK A;  3TVT A;  1EX4 A;  1O9S A;  3S3M A;  1Y07 A;  2RI3 A;  1VQ9 T;  3VS3 A;  2YT6 A;  4P5N A;  2B8A A;  2R5M A;  2BKD N;  5GMK l;  2RPN A;  4CC3 A;  5CKE A;  3G4S T;  1ACM B;  2VC8 A;  5IHN A;  1LNX A;  2CP0 A;  1ZSZ A;  2D8H A;  2FEI A;  2RB6 A;  4XTV A;  3CMA T;  1BI1 A;  2GTO A;  2PQW A;  3RMQ A;  3QWY A;  4C0D C;  3MEA A;  1YJ9 Q;  2LJ3 A;  4DEX A;  2O9V A;  2QYZ A;  3FRN A;  4ZN1 A;  3QJ6 A;  3UWN A;  1SEM A;  3E1S A;  5J3B A;  1E6G A;  1PCX A;  3LH0 A;  1Q7Y U;  3A98 A;  1Q86 U;  4BY6 C;  3OS1 A;  3CCR Q;  2VGM A;  5FWC A;  1KJW A;  1KC8 U;  1VQ7 T;  1UEB A;  3LYI A;  3VS0 A;  4PJJ A;  4A4G A;  1UUE A;  2OTL T;  1WPY A;  5DM7 R;  2L2P A;  1AWW A;  1K9A A;  3ZBD A;  2FPE A;  2LJ0 A;  5GAN g;  3TCJ A;  3RES A;  3JCM V;  2EQM A;  4F04 B;  5A0D A;  1PM3 A;  2RJF A;  4J9I A;  1U06 A;  3HRU A;  4RTY A;  3PT9 A;  4E7H A;  2PNI A;  1TOV A;  2J7I A;  3OW2 A;  4A54 A;  1NJI C;  2HNI A;  1OUL A;  2RHU A;  1KD1 C;  3JAM E;  4WCI A;  1VUB A;  4PFO A;  4RTX A;  1VQM Q;  1AOJ A;  3VS6 A;  2YSQ A;  3M0P A;  5GAN 4;  4FYW B;  4M77 D;  1EIF A;  2GFU A;  4M7A E;  4FT4 A;  4HVW A;  1KG1 A;  1WJR A;  2CZ7 B;  3QZ9 B;  4A4H A;  1VQ6 A;  2XU8 A;  4FYV B;  3CCS Q;  2LDM A;  2JTF A;  4F7U G;  4C0Z A;  3QYH B;  4ELY C;  1WA7 A;  2A0F B;  2EVR A;  3BW1 A;  4M7D G;  1K0S A;  5EC7 A;  2QQA A;  4QW2 A;  1NZ9 A;  5GAM e;  1MMN A;  2CGH A;  3CMA A;  1SG5 A;  3JCM X;  4E2F B;  1JU5 C;  4PJO F;  2HMA A;  2BTT A;  3MET A;  3GLX A;  1FMW A;  1WHM A;  1S72 A;  1JJ2 S;  5HK0 A;  2LQN A;  4E7I A;  4JJC A;  3CCM A;  3VS1 A;  1M2O A;  5KH6 A;  2QQS A;  4OMN A;  4J9H A;  5L23 A;  3MKD A;  2HD0 A;  1BIB A;  3QII A;  3OYA A;  3NHN A;  1X6O A;  4IUV A;  1W2B A;  1FWZ A;  4QVZ A;  1SF9 A;  2VAS A;  3CEY A;  2K6D A;  2AHJ B;  1QVF P;  1K73 U;  1OYX A;  4RKU E;  1YJN A;  4OMF B;  1D1A A;  1JXM A;  2RJC A;  3THK A;  2QEX T;  3A5Z B;  4M78 A;  2DVJ A;  3MPU B;  3KXT A;  1NE8 A;  5I22 A;  2BZY A;  2JNG A;  2LTO A;  5FRO A;  1PNJ A;  3X28 B;  1VQ5 A;  4QVC A;  2DER A;  3VJP A;  3OSS C;  2ZGW A;  3JCM W;  1BU1 A;  2ZPF B;  3HKS A;  2A08 A;  4TVR A;  4M7D A;  5GAO q;  2F5K A;  4EMK C;  1WLP B;  2L8D A;  2AZV A;  3UF4 A;  2LT4 A;  3H0F A;  2XDB A;  1NM7 A;  1Y71 A;  1GL5 A;  5LJ5 j;  2DL3 A;  4ELZ C;  4M77 C;  1H92 A;  4L5G A;  1QLY A;  3A8O B;  1YI2 A;  5IXB A;  1VQ4 A;  1CKA A;  2Y4Y A;  3VS2 A;  3CCU T;  3L2W A;  3DB3 A;  3N5B B;  1YIT T;  1TXQ A;  3EG2 A;  4KUI A;  2O9S A;  2XK0 A;  1X6B A;  4E7Z A;  2OI3 A;  4C8Q D;  1M90 C;  4GY5 A;  1VQ7 A;  2RM4 A;  3OYG A;  2L89 A;  2M0Y A;  2LC4 A;  1OU9 A;  3I5S A;  3CC4 A;  4Z89 A;  3URG A;  3HRT A;  1D09 B;  2DNU A;  4OF1 A;  3CCV T;  3JCM e;  1ZSZ B;  3CCM T;  2X9H A;  3V8L A;  3VV0 A;  2M51 A;  3FLG A;  2PVO B;  1M4Z A;  1U5S A;  2E6N A;  3V7C A;  1U8R A;  3CC2 T;  1Y0M A;  5CQY A;  4IUU A;  2YUP A;  2FG0 A;  2DD5 A;  4LXC A;  4M75 D;  2GQV A;  3M5A A;  3JCM g;  2WAC A;  1W1F A;  4DOV A;  1XQH A;  3AT1 B;  5KYU A;  5GJW B;  2MF2 A;  2KY9 A;  3QZ5 B;  4LDU A;  4MDW A;  2KGT A;  5FU6 B;  1BCO A;  4KGZ B;  2VWF A;  3OW2 S;  4JS4 A;  2EYX A;  4NL3 A;  5CK9 A;  4FW1 A;  3GP8 A;  2KE9 A;  2FRY A;  1N8R C;  3GPL A;  2X4X A;  3LW5 E;  2COW A;  2DYB A;  2C0O A;  2PUK B;  3JCM P;  1T0H A;  5GJV B;  3JCM c;  3MEW A;  2QG9 B;  2Y4X A;  3EG0 A;  1Q86 R;  4RTW A;  2I2L A;  1KC8 C;  5EG2 A;  2QDL A;  1VQP A;  4JZ3 A;  3OS0 A;  1E7O A;  4C8Q F;  4A4E A;  3JSC A;  4IIM A;  5L8R E;  2R57 A;  2HAX A;  1WIE A;  1B7T A;  2GQI A;  3LH5 A;  3KBG A;  3C4S A;  2YUN A;  4M4Z A;  2YRV A;  1G3S A;  1EZZ B;  2LNV A;  1QVG S;  5KYW A;  1VQ5 Q;  1VQK A;  2CDT A;  2EGA A;  2K3Y A;  5KYW B;  2BIV A;  1YIT A;  4AFZ C;  4VUB A;  1SRM A;  1H3Z A;  2QAZ A;  3LX7 A;  2RQR A;  2AZS A;  3QXE B;  5GMK e;  3FB9 A;  2JMA A;  2VUB A;  2M02 A;  2DA9 A;  4BI8 B;  1S72 Q;  3AHU A;  2KYB A;  2GBQ A;  1M1K U;  2ZAE A;  1BK2 A;  4ZGD B;  1KQ2 A;  1K0X A;  2RI2 A;  2QEX Q;  1BI3 A;  1MMA A;  2YLC A;  4IUQ A;  2FYK A;  1KHC A;  2NUP B;  2L3Q A;  2KSS A;  3EGD B;  2ZPE B;  5GMK m;  1ZUU A;  2KVQ G;  3QWX X;  4M77 F;  3EGD A;  3LWI A;  2MK5 A;  2KMT A;  1MNE A;  2V8K A;  4WTO B;  4WF2 A;  5GAN 2;  4MZP A;  2BZX A;  5GAN 7;  4L6V 5;  3MO8 A;  3CCV Q;  1PC0 A;  5I21 A;  1FMV A;  3T9N A;  2KXC A;  1KFZ A;  3R6N A;  1SPK A;  1W4S A;  2E6Z A;  1N6A A;  7AT1 B;  2WSE E;  3OA6 A;  1HYO A;  3NMZ C;  1D0Y A;  3I5R A;  1YIT Q;  1ZUY A;  2MWP A;  3OYL A;  2ESW A;  2FHD A;  2K2V A;  4FYY B;  2XKO C;  4HT8 A;  3QKJ A;  2QGF B;  3U23 A;  1YWO A;  1D3B A;  1XNI A;  2CZ6 B;  3M56 A;  4N4H A;  5CVI A;  5GAM j;  3BE3 A;  1M2V A;  1YFN A;  4XU2 A;  1JO8 A;  1MGQ A;  1ZA1 B;  3SEM A;  3V7S A;  5IT9 E;  2O4X B;  1VQ4 T;  2FRW A;  1I8F A;  3NTI A;  1VYV A;  5GAN h;  4M7D D;  2MCN A;  3NTH A;  1QKW A;  1VA7 A;  1IRX A;  1X6G A;  5CAI A;  4MDX A;  1WZO A;  5CKD A;  2EJF A;  3QJY A;  3JCM f;  1JXO A;  5GAO p;  4C8Q E;  3ULR B;  4MML A;  4BB7 A;  1PRM C;  2DL8 A;  4M75 G;  1NJI R;  3G1J A;  2BZ8 A;  3OYJ A;  1VQP Q;  5IXF A;  2WSC E;  3FEO A;  5GAN 8;  3REA B;  2CUD A;  4C5G A;  5LJ5 g;  1VQK Q;  1IHV A;  2VYT A;  2RHX A;  4RTU A;  3L2Q A;  5CO7 A;  2RJD A;  3OSV A;  1M30 A;  3CC7 A;  2GTJ A;  2RNA A;  1IO6 A;  1F1B B;  4JRQ A;  1UHC A;  4B9X A;  4PLI A;  1C6V X;  2DTH A;  2P84 A;  3S6W A;  4F16 A;  1PWT A;  4X1V A;  6AT1 B;  2YUO A;  4DOW A;  5FWB A;  2W10 A;  1NJI U;  1NPR A;  2QQR A;  5LJ3 j;  4PJM A;  2QK0 A;  3J7A F;  2CT3 A;  4XK8 E;  3M4G A;  2DAQ A;  1MV0 B;  1WI7 A;  1B34 B;  1BB9 A;  4HCB A;  1UG1 A;  5KE3 A;  5GAN 3;  1YIJ T;  1YHQ T;  2A28 A;  2M16 A;  1UFF A;  3JB9 H;  1G2B A;  2HQX A;  2KBT A;  1B3Q A;  1TS9 A;  5LJ3 f;  1VQ4 Q;  1N9R A;  1QCF A;  5J39 A;  1BBZ A;  1VQ6 T;  4QQD A;  3EG9 B;  1WHK A;  3LWH A;  4EPC A;  2XI9 A;  3G71 Q;  3G6E Q;  1IHW A;  1PKS A;  2ZZD A;  2EQK A;  2K57 A;  4OGE A;  4JLI A;  3OY9 A;  2CP6 A;  4DBF A;  2F69 A;  3UPU A;  4Z8A A;  1WHG A;  3RKY A;  1UGV A;  4M77 B;  1X75 C;  1M1K R;  1YJN T;  2ZPI B;  5D6Y A;  5GAM f;  2ZPG B;  4AG2 C;  2YRC A;  2LJ1 A;  3G71 T;  4AT1 B;  3ZFJ A;  2QXF A;  4CC2 A;  2DEQ A;  2LCL A;  3OYC A;  2JUF A;  1VQ7 Q;  5FLX E;  5LJ3 g;  4PJO D;  2V1Q A;  2DXC A;  4GLM A;  1AHJ B;  3SD4 A;  3CCJ A;  4M78 B;  3L42 A;  1AVZ C;  3CPW P;  4C92 E;  5IHI A;  2V8I A;  4IUP A;  2QQ9 A;  4II1 A;  3CPW A;  1YHQ A;  4HVV A;  4D6W A;  1R0B G;  2GFA A;  2RQW A;  1K8A U;  3CD6 T;  4AMC A;  2QAS A;  3OYD A;  1NYF A;  1D1C A;  2DEU A;  1A0N B;  2XIC A;  1ZSG A;  2ENM A;  4XTW A;  4NS5 A;  1SSF A;  1RI9 A;  2RHI A;  3TEE A;  4RCB A;  5GAN e;  4X9D A;  2LNH B;  1B07 A;  3TSZ A;  1T3S A;  1M1K C;  2K2M A;  4PL6 A;  1VQ8 Q;  2DIQ A;  4E47 A;  1QCO A;  2J05 A;  4LD9 K;  2OAU A;  1X01 A;  5FU6 C;  2FVU A;  1R77 A;  1GCQ C;  2DBK A;  3CCR T;  4O6J A;  1NLP C;  3WVE B;  3GF5 A;  1RL2 A;  1K9M C;  4J9G A;  3VKI A;  2E4H A;  4BI4 A;  2DF6 A;  3M9Q A;  3HTR A;  1K4U S;  2C06 A;  4BD3 A;  2XDD A;  3O8V A;  3RKX A;  1SSH A;  2LX7 A;  3G4S Q;  2K3X A;  1Q81 R;  1QQJ A;  2RK1 A;  1RAG B;  2JN0 A;  2CP3 A;  2EJ9 A;  4J9B A;  5CCA A;  3UA6 A;  3OQ5 A;  2JVV A;  3FJ5 A;  4NOY A;  4AFS C;  1UHF A;  2OTJ Q;  1AWJ A;  1WX6 A;  3CXC A;  5CKF A;  3OYH A;  2HZY A;  4JJD A;  3RMS A;  2K9G A;  3L1A A;  3CXC P;  1IRE B;  2E12 A;  1WDX A;  1WHH A;  1VQM T;  2DXB A;  2HCK A;  2KR3 A;  3CQT A;  4CC4 B;  1YHQ Q;  2DZ9 A;  4FSS A;  1V29 B;  4C0F A;  3OYN A;  3M0S A;  4M75 F;  4J6X A;  1NLO C;  1ZQ1 A;  2D0Q B;  1KC8 R;  1PD1 A;  4UC4 A;  2K7A A;  2VXF A;  4RUG A;  3CBP A;  2MAM A;  4OMQ A;  5IHK A;  4XTX A;  2HEQ A;  3TQ7 P;  3JB9 F;  2ATC B;  1OOT A;  1OZ3 A;  1I4K 1;  3I55 Q;  3X20 B;  4E7K A;  3CC2 Q;  2MOX A;  3TSW A;  1VQO T;  2DK3 A;  1WYX A;  5FRM A;  1QVF A;  3L2U A;  2XMF A;  1R0C B;  1YIJ Q;  1VQK T;  2DPP B;  4M7D C;  4C5H A;  4LUE A;  2NUZ A;  3QG1 A;  4F7U E;  2DBM A;  4J6W A;  2NLU A;  3OYF A;  5FU7 B;  2V8J A;  4F17 A;  1K1Z A;  1QMC A;  1N5Z A;  3PVQ A;  1HXD A;  1Y96 A;  2GGR A;  1QP2 A;  1IB8 A;  1GBQ A;  4FT2 A;  1QVG P;  2YXY A;  3PVL A;  2DD4 A;  2DO3 A;  1GFD A;  4PJO A;  1MMG A;  4F7U F;  4BE2 A;  2XHC A;  1I5O B;  4J7I A;  4PK4 A;  2RF0 A;  3JB9 J;  1W2B S;  3OYE A;  2KNB B;  1U1T A;  2J6K A;  1YI2 T;  3HPW A;  1QP3 A;  2DMO A;  3EG9 A;  1BI2 A;  3H6Z A;  4J6Y A;  3WXM B;  1TSF A;  1X2K A;  4DBQ A;  4JRK A;  2OTJ T;  5A0L A;  2K5I A;  3CCU A;  1LJO A;  4C8Q C;  1QCN A;  3UAT A;  1N8R R;  2VV5 A;  5AYF A;  3E2U A;  4J9E A;  2HDA A;  4FM4 B;  3HL8 A;  4ANJ A;  1TUG B;  2CP5 A;  1KQ1 A;  2RMO A;  3CCE A;  5IH2 A;  4JRP A;  5C0M A;  8AT1 B;  1QW1 A;  2G3R A;  3CPF A;  2E64 A;  2VKN A;  1Z9Q A;  1GCP A;  4M75 A;  2IIM A;  4NL2 A;  1U3O A;  2ROL A;  2DYI A;  3CCE Q;  3H41 A;  1G8X A;  5GAO n;  3GOX A;  4LDY A;  4A4F A;  4PJO E;  2R58 A;  4N0A C;  4GBQ A;  3PGG A;  4N4G A;  1I07 A;  3C12 A;  4LD6 A;  3CBO A;  1UJ0 A;  2LX9 A;  1RAF B;  3R6O A;  4C92 C;  1JEG A;  3FJP A;  1VQ9 Q;  1K8A R;  2NUP A;  4L59 A;  2JT4 A;  3H0I A;  1VQ5 T;  4X9C A;  2QTX A;  3MCA B;  4F7U A;  4N4I A;  4AFU C;  2H3J A;  2YUQ A;  4PJN A;  3I56 A;  2JM8 A;  5J26 A;  1J3T A;  1QWE A;  5KE2 A;  2KEA A;  2CSQ A;  1MND A;  2ZPB B;  5GAO m;  2LRQ A;  2E65 A;  2A37 A;  1XTD A;  4PFP A;  2JM9 A;  2KRM A;  4FYX B;  1Q95 G;  1UB4 A;  4KH1 B;  2KK4 A;  4PJO G;  3EGU A;  5AT1 B;  1YI2 Q;  3Q1J A;  3H8Z A;  3QHS A;  4A53 A;  4LDV A;  1OX9 A;  1BI0 A;  4M78 F;  5DLO A;  4EMG A;  4J9F A;  1IXD A;  2RJE A;  3MHX A;  1OEB A;  1KK7 A;  1M2V B;  3SWN A;  1BCM A;  3DB4 A;  3I56 T;  4E7J A;  3I55 A;  2A7Y A;  2HQE A;  3CC7 T;  4J9D A;  2YHT A;  1KD1 R;  1LCK A;  5HKC A;  2HKN A;  3CCQ A;  1YJW A;  3EHQ A;  3QSU A;  2FL7 A;  2PUO B;  2JTE A;  2LVM A;  1JB0 E;  3FIF A;  1AZE A;  4JJB A;  1BIA A;  2P0K A;  2ABL A;  2RK2 A;  1UGQ B;  2D8J A;  2EYZ A;  3V8J A;  5GMK i;  3SB2 A;  3CC7 Q;  2BE9 B;  2RHZ A;  1WJS A;  4OB2 B;  4GLK A;  2JZ2 A;  3CBM A;  2JS0 A;  1H64 1;  2QTV A;  1M3C A;  3JRZ A;  4BE1 A;  1E6H A;  1ZLM A;  2DLP A;  1N27 A;  4ZNX A;  3E19 A;  2X4W A;  4M77 A;  4C5I A;  1IGU A;  1TH7 A;  2RHY A;  3DLM A;  4ORZ A;  2M0O A;  1AD5 A;  2LCS A;  1RUW A;  3HHT B;  4C92 F;  5FRN A;  2L3S A;  2X3X D;  1VYT A;  2DXU A;  1GXI E;  4C0D B;  4DQ2 A;  1NBE B;  2RI5 A;  4PFZ A;  4BDZ A;  1V1C A;  2EIF A;  1Q7Y C;  2E70 A;  4FL6 A;  3VRZ A;  1WHJ A;  1GRI A;  1HJD A;  1VQP T;  5C6S A;  2KI7 A;  1Y7X A;  4HT9 A;  1ZUK A;  1RAE B;  4RTV A;  5LJ5 f;  3QDF A;  2EQJ A;  5D7U A;  2AKL A;  3OYB A;  1UGR B;  3VS4 A;  3S3N A;  4ZTJ A;  1YJN Q;  2MYS A;  3PMI A;  4QQG A;  1K73 C;  3EGX B;  1M90 U;  2JMC A;  3LGF A;  4OGC A;  4RG8 A;  2JTM A;  2CZ0 B;  1AWO A;  1JBM A;  3CCM Q;  3GIB A;  1RAC B;  5CQX A;  1D0X A;  3M59 A;  4OB1 B;  2LMJ A;  1JRI A;  4OB3 B;  4D8D A;  4J7F A;  2PU9 B;  2O31 A;  3VU3 C;  2JS2 A;  4QKU A;  1PHT A;  4B6M A;  2VXE A;  3OBY A;  1YNZ A;  3JCM d;  1I1J A;  4A63 B;  2Y90 A;  4JDS A;  4KRT A;  1K9M R;  2E5Q A;  3O5Z A;  4OVA A;  3CC2 A;  3M54 A;  1ABQ A;  4M7D F;  4LDX A;  1YJW Q;  1WFW A;  4V2S A;  1P92 A;  4J9C A;  1ABO A;  1NEG A;  1PSF A;  1PKT A;  1M1F A;  3EG3 A;  3JCM J;  5GMK j;  1JJ2 A;  2GCX A;  3L2V A;  2FPD A;  3EAE A;  4M75 E;  4KGX B;  4BE0 A;  1N8R U;  2E10 A;  1CKB A;  3UT1 A;  4QVD A;  4C8Q G;  5KCH A;  1RAD B;  4PJO B;  2K5L A;  5LJ5 h;  1KQS P;  1WGS A;  1VOM A;  3A8G B;  4M75 C;  5CKB A;  4M77 E;  1NPP A;  1U1S A;  2I0N A;  2EAY A;  3M55 A;  2QA4 T;  1IZ6 A;  3MP1 A;  4M7A A;  3EGX A;  2DXT A;  3EFR A;  2SRC A;  1VQN A;  4JS5 A;  2OTL A;  4AG1 C;  1ZSZ C;  3UA7 A;  1OI1 A;  2EYQ A;  4HXJ A;  1HK9 A;  1RAH B;  2AT1 B;  2K4Y A;  2J6O A;  1Q81 U;  2PVG B;  3LGL A;  2HKQ B;  2NUT A;  1Y57 A;  4XU1 A;  3OS5 A;  1KSW A;  3CCR A;  3PMT A;  1AEY A;  1PD0 A;  2EKH A;  3BDL A;  2L3R A;  2O4X A;  2VB6 A;  3RR6 A;  4BI3 A;  1S1N A;  1NG2 A;  1MHN A;  1VQ9 A;  4HCC A;  1HD3 A;  1FYN A;  4FIB A;  4LN2 A;  4QT7 A;  2DTO A;  1VQ8 A;  2K79 A;  2KXD A;  1UE9 A;  3L2R A;  2V26 A;  2CKK A;  5I2S A;  3A8L B;  3I35 A;  1Q86 C;  3CCL A;  4PKC C;  4IUR A;  2BE7 D;  3OS2 A;  3BDU A;  4E7S A;  1SHG A;  4YTL A;  3M0R A;  3C95 A;  4PJO C;  2CP2 A;  5KYU B;  2KRO A;  3TRE A;  2EBP A;  2EGE A;  3EHR A;  3CXC S;  5GAN j;  5GMK h;  3CCV A;  3CCJ Q;  3HP9 A;  3INZ A;  3CME Q;  1N9S A;  3DLL A;  2M1H A;  3FDR A;  3JB9 D;  3WVD B;  3A1P A;  1ZHI A;  2OTL Q;  1FX7 A;  3FC3 A;  4OP0 A;  5D6X A;  3QPH A;  2Z0W A;  1FXX A;  4KT0 E;  3I55 T;  1ARK A;  5KYX B;  3CCS A;  4Y92 A;  2L5Q A;  2PZ1 A;  4LE9 A;  3J80 E;  2DL4 A;  2QI2 A;  2QA4 Q;  1I81 A;  1VQO Q;  5GAO l;  4K11 A;  1G5V A;  2M9U A;  4F14 A;  4XTU A;  2X35 A;  1TG0 A;  3M0T A;  1TUC A;  3OBW A;  3RBB B;  1YJ9 T;  2HSP A;  4X34 A;  3SWN B;  4XU3 A;  4M78 G;  2CH4 W;  1Q82 U;  3G6E T;  2QQB A;  3IQL A;  2KDS A;  3JCM b;  4IKF A;  1WXT A;  4O5V A;  2AK5 A;  4E6R A;  1FMK A;  1M8M A;  4XTY A;  4PJL A;  3OYM A;  5D6W A;  2LZ6 B;  1AT1 B;  5GAN 5;  2XG8 D;  1X43 A;  3E9G A;  1M3A A;  1UGS B;  3CC4 T;  1G3Y A;  4M7D E;  4ZGJ B;  2XD0 A;  4OMM A;  5GAN d;  2EJG A;  1RAB B;  1YCY A;  1ZBJ A;  5LL6 S;  2IG0 A;  4HCK A;  1MMD A;  3VUZ A;  5I11 A;  1YJW T;  1M3B A;  1OQK A;  4IIO A;  2RO0 A;  4R56 A;  2FZG B;  4C92 B;  3JCM Q;  3VS5 A;  1NYG A;  2D9T A;  3VRY A;  3CD6 Q;  2EW3 A;  2DL7 A;  2CUB A;  2DKG A;  2F2W A;  1YJ9 A;  5LJ3 e;  2RQT A;  4Y28 E;  4HVU A;  1M8V A;  2HBP A;  3JB9 I;  3HSB A;  4FU6 A;  3GNF B;  1BYM A;  1NEB A;  1W6X A;  2KT1 A;  2SEM A;  3CCS T;  1XJW B;  3CCE T;  2HSE B;  1JQQ A;  2CRE A;  4BY6 B;  4BAC A;  3SWN C;  2DET A;  4Z88 A;  1RLP C;  1SKU B;  4JJN K;  3G7Z A;  2VVK A;  4EMH A;  3G4S A;  4DBR A;  4J8O A;  1VQL T;  2CS7 A;  4DEY A;  1QKX A;  2P0P A;  4RCC A;  4RTZ A;  1KHI A;  1HSQ A;  2JW4 A;  4M7A B;  4FSX A;  3CD6 A;  3ME9 A;  1G3W A;  4BDY A;  8ATC B;  4CRI A;  3D7S B;  5HY6 A;  4KBM B;  4HCZ A;  4M7A C;  2ROT A;  1VQ6 Q;  2JJ9 A;  4N0A A;  9ATC B;  2QDY B;  3JB9 G;  1W70 A;  2H3E B;  2VGN A;  1QVF S;  3G71 A;  3DKM A;  3MEU A;  4BUG A;  2C0I A;  3EG1 A;  3QDR B;  2CP7 A;  1VQM A;  4JLG A;  2LQ8 A;  2GNC A;  4OMO A;  2YWW A;  1WJQ A;  3P8D A;  2X51 A;  1YP5 A;  1IGQ A;  3SHW A;  1GBR A;  5FU7 C;  1KQS A;  3KFV A;  1KQS S;  1I5L A;  2CT4 A;  1Y96 B;  5GAN f;  5IAY A;  1D0Z A;  3X26 B;  1Z9Z A;  4OMP A;  2KQW A;  4F7U B;  1OU8 A;  1V76 A;  1WXB A;  4KH0 B;  1Q7Y R;  2DTI A;  3PFS A;  2QGG A;  2L3P A;  3M53 A;  5LJ3 d;  5HK3 A;  1CSK A;  3CME T;  3EFO A;  1O75 A;  1WNL A;  4EDU A;  3EFO B;  4EIK A;  3OYK A;  3LLR A;  5KYN A;  2RH2 A;  1H8K A;  2FB7 A;  3CC4 Q;  4FW2 A;  2EGC A;  5DLQ E;  4C92 D;  3MJX A;  5CKH A;  4M75 B;  4QQ6 A;  3SDZ A;  3GNG A;  3BY7 A;  1UJY A;  1D3B B;  2OAW A;  2EWN A;  2XID A;  2KT8 A;  1W2B P;  3I56 Q;  4ZTF A;  3X24 B;  2QA4 A;  4RG2 A;  2ZPH B;  3RKW A;  3QBY A;  2LQW A;  4M78 E;  3OW2 P;  3VYG A;  4Q5W A;  3KUF A;  3MP6 A;  5GAM d;  3RNJ A;  4DBH A;  3PNW C;  2D0N A;  4A4K A;  2K5F A;  2PTK A;  3E9F A;  4AFQ C;  4M7A D;  3L2Z A;  1WQ7 A;  1QVP A;  4KGV B;  1JJ2 P;  5LJ5 e;  2KAF A;  4C92 G;  3CCU Q;  4B9W A;  4ATO A;  2DL5 A;  1VQN Q;  2FO0 A;  2DFU A;  2F1L A;  4R55 A;  3CCL Q;  4ZGE B;  2ECZ A;  3NPF A;  3NGP A;  3RDV A;  2AKK A;  4JUV A;  3RIR A;  2J6F A;  2DIG A;  4PNO A;  5GAO r;  4CI0 C;  3X25 B;  2C0T A;  3V8K A;  2F2V A;  3CCQ T;  3ZEH A;  1K76 A;  4M78 C;  3HFN A;  3J81 E;  3OYY A;  1K9M U;  2NWM A;  3ASK A;  2DIL A;  1R8O B;  1SRL A;  1UEC A;  2KYM A;  2HQH A;  1GCQ A;  3ZL7 C;  1G83 A;  5M9O A;  2F2X A;  3H0H A;  1K73 R;  2LCC A;  1OPL A;  2E1H A;  4C0G A; 
#chains in the Genus database with same CATH homology
 2W0Z A;  1ZSG A;  1CKB A;  2ENM A;  5I22 A;  2BZY A;  1RI9 A;  1PNJ A;  3M0Q A;  2JXB A;  5FW9 A;  2LNH B;  1B07 A;  3TSZ A;  1T3S A;  1EFN A;  1BU1 A;  2DJQ A;  1TUD A;  1UDL A;  2K2M A;  2EYW A;  2I0N A;  2A08 A;  2J05 A;  1WLP B;  1T0J A;  1GCQ C;  2DBK A;  2SRC A;  1NLP C;  2AZV A;  4AG1 C;  3UF4 A;  3UA7 A;  4J9G A;  1M27 C;  1H3H A;  3H0F A;  1GL5 A;  1NM7 A;  2DF6 A;  3I9Q A;  2DL3 A;  4HXJ A;  1H92 A;  1QLY A;  2J6O A;  1K4U S;  5IXB A;  2EQI A;  1CKA A;  1SSH A;  2LX7 A;  3VS2 A;  2D1X A;  1Y57 A;  3EG2 A;  2O9S A;  1X6B A;  4J9B A;  2OI3 A;  1XOV A;  1KSW A;  1AEY A;  1MV3 A;  4R0K A;  3UA6 A;  2M0Y A;  2EKH A;  3FJ5 A;  4AFS C;  3PE0 A;  1S1N A;  1NG2 A;  1UHF A;  2HBW A;  1AWJ A;  1WX6 A;  3I5S A;  1HD3 A;  1SHF A;  1FYN A;  4Z89 A;  4LN2 A;  4JJD A;  2K9G A;  4QT7 A;  2DNU A;  1WDX A;  2K79 A;  1YCS B;  2KXD A;  2HCK A;  2KR3 A;  3CQT A;  4CC4 B;  1UE9 A;  2DX1 A;  4FSS A;  2M51 A;  2KRS A;  1X2Q A;  3M0S A;  4LUD A;  1U5S A;  3I35 A;  2ED1 A;  1NLO C;  1Y0M A;  1SHG A;  2YUP A;  2E5K A;  2FG0 A;  3M0R A;  2K7A A;  2DE0 X;  1YN8 A;  4RUG A;  2KRO A;  4OMQ A;  5IHK A;  1W1F A;  2EBP A;  2EGE A;  3EHR A;  2DRK A;  2HEQ A;  5GJW B;  1OOT A;  2FPF A;  1OV3 A;  1AWX A;  2KGT A;  2MOX A;  2VWF A;  3TSW A;  2EYX A;  1WYX A;  1X69 A;  2XMF A;  4LUE A;  2KE9 A;  2FRY A;  2NUZ A;  2DBM A;  2RQU A;  2X3W D;  2MIO A;  2O88 A;  1ARK A;  4F17 A;  1AZG B;  2DYB A;  2G6F X;  1K1Z A;  2OJ2 A;  4Y92 A;  2PZ1 A;  4LE9 A;  1N5Z A;  2DL4 A;  2C0O A;  1RLQ C;  1T0H A;  3PVQ A;  5GJV B;  2RN8 A;  2K3B A;  4K11 A;  1OPK A;  2GGR A;  4F14 A;  1X27 A;  4LNP A;  3EG0 A;  1GBQ A;  1TG0 A;  1UTI A;  4RTW A;  3M0T A;  1TUC A;  3RBB B;  3REB B;  2HSP A;  3PVL A;  1GFD A;  2QDL A;  2H8H A;  4JZ3 A;  1E7O A;  2CH4 W;  2LP5 A;  3IQL A;  4IIM A;  2RF0 A;  1QWF A;  2YDL A;  1WIE A;  1WXT A;  2KNB B;  2AK5 A;  2EYY A;  2GQI A;  3LH5 A;  3VS7 A;  4E6R A;  1FMK A;  1M8M A;  2J6K A;  2YUN A;  4M4Z A;  5HCK A;  1PRL C;  2DMO A;  1YWP A;  2DM1 A;  2LZ6 B;  2CDT A;  1X2K A;  2EGA A;  1VYU A;  1X43 A;  4AFZ C;  1M3A A;  1SRM A;  4D8K A;  3UAT A;  3GBQ A;  1I0C A;  2RQR A;  2AZS A;  2CSI A;  4J9E A;  2HDA A;  4OMM A;  2JMA A;  2DA9 A;  5I11 A;  1KIK A;  1ZBJ A;  4HCK A;  1M3B A;  2KYB A;  2GBQ A;  4IIO A;  2B86 A;  2RMO A;  5ECA A;  5IH2 A;  1BK2 A;  3VS5 A;  1NYG A;  3VRY A;  1K0X A;  1T3L A;  2EW3 A;  3M0U A;  2VKN A;  2DL7 A;  2CUB A;  1Z9Q A;  1GCP A;  2IIM A;  1U3O A;  2ROL A;  3H41 A;  2F2W A;  3C0C A;  2L3Q A;  1ZUU A;  2RQV A;  4GBQ A;  3QWX X;  2RQT A;  1GFC A;  4HVU A;  1I07 A;  1UJ0 A;  1JEG A;  2BZX A;  2KT1 A;  1W6X A;  1NEB A;  2SEM A;  4RTT A;  1JQQ A;  2JT4 A;  2CRE A;  3H0I A;  1ZX6 A;  4JZ4 A;  4CC7 A;  2KXC A;  4Z88 A;  1RLP C;  1KFZ A;  2KRN A;  3R6N A;  2J06 A;  2VVK A;  1SPK A;  1MUZ A;  4AFU C;  2YUQ A;  2CH4 A;  2JM8 A;  1J3T A;  2EPD A;  1QWE A;  2KEA A;  4DEY A;  1QKX A;  2L0A A;  3NMZ C;  3JV3 A;  1HSQ A;  4RTZ A;  2CSQ A;  2JW4 A;  3I5R A;  2O2O A;  1ZUY A;  2ESW A;  2A36 A;  2A37 A;  2JM9 A;  2KRM A;  2ED0 A;  4ESR A;  3U23 A;  1YWO A;  4JPB W;  3EGU A;  1WXU A;  2ROT A;  1JO8 A;  3SEM A;  2P4R A;  2V1R A;  2DRM A;  2FRW A;  1VYV A;  2MCN A;  4OML A;  1QKW A;  4J9F A;  1VA7 A;  1W70 A;  1X6G A;  3TVT A;  1OEB A;  2C0I A;  3EG1 A;  2GNC A;  4OMO A;  3VS3 A;  1JXO A;  2YT6 A;  1YP5 A;  3ULR B;  2RPN A;  3SHW A;  4CC3 A;  1GBR A;  3KFV A;  5IHN A;  1PRM C;  2CT4 A;  2D8H A;  2FEI A;  2DL8 A;  2GTO A;  3QWY A;  4J9D A;  1Z9Z A;  2BZ8 A;  4OMP A;  2LJ3 A;  4DEX A;  1LCK A;  2O9V A;  3EHQ A;  1WXB A;  5IXF A;  2JTE A;  1AZE A;  4JJB A;  1SEM A;  2ABL A;  2L3P A;  1E6G A;  2D8J A;  2EYZ A;  3A98 A;  3REA B;  2CUD A;  1CSK A;  5FWC A;  1KJW A;  4EIK A;  3VS0 A;  1UUE A;  2JS0 A;  4RTU A;  2L2P A;  1AWW A;  1K9A A;  1M30 A;  1M3C A;  1E6H A;  1ZLM A;  2GTJ A;  2RNA A;  2FPE A;  2LJ0 A;  2DLP A;  1H8K A;  1IO6 A;  4ZNX A;  1UHC A;  2EGC A;  4F16 A;  4ORZ A;  1PWT A;  2LCS A;  1AD5 A;  4J9I A;  1U06 A;  4X1V A;  1UJY A;  1RUW A;  2YUO A;  5FWB A;  2W10 A;  4RTY A;  2L3S A;  2X3X D;  2OAW A;  1VYT A;  2PNI A;  2J7I A;  2CT3 A;  2KT8 A;  1MV0 B;  1WI7 A;  1BB9 A;  2LQW A;  4WCI A;  1UG1 A;  1V1C A;  4RTX A;  3VRZ A;  1AOJ A;  1GRI A;  3VS6 A;  2A28 A;  2YSQ A;  3M0P A;  1HJD A;  1UFF A;  1G2B A;  2KBT A;  1B3Q A;  3RNJ A;  1ZUK A;  2D0N A;  4HVW A;  4RTV A;  2AKL A;  2PTK A;  4AFQ C;  1QCF A;  3VS4 A;  1BBZ A;  2JMC A;  1WA7 A;  2EVR A;  2DL5 A;  1PKS A;  2FO0 A;  1AWO A;  5EC7 A;  1K0S A;  4Z8A A;  1UGV A;  2ECZ A;  1JU5 C;  3NPF A;  3NGP A;  2BTT A;  2AKK A;  2LMJ A;  4AG2 C;  4D8D A;  2LJ1 A;  2LQN A;  2J6F A;  2O31 A;  2JS2 A;  4JJC A;  4CC2 A;  1PHT A;  1YNZ A;  3VS1 A;  1I1J A;  4A63 B;  4OMN A;  4J9H A;  4KRT A;  5L23 A;  2C0T A;  2V1Q A;  4GLM A;  2F2V A;  1K76 A;  3NHN A;  1AVZ C;  3O5Z A;  2NWM A;  1ABQ A;  5IHI A;  1WFW A;  2K6D A;  2DIL A;  1SRL A;  1UEC A;  2KYM A;  4J9C A;  1ABO A;  1GCQ A;  4HVV A;  3ZL7 C;  1G83 A;  2F2X A;  1NEG A;  1JXM A;  1PKT A;  2RQW A;  3EG3 A;  3H0H A;  3THK A;  2FPD A;  1NYF A;  1OPL A;  2DVJ A;  1A0N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...