2DBMA

Solution structures of the sh3 domain of human sh3-containing grb2-like protein 2
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
73
structure length
73
Chain Sequence
GSSGSSGPCCRALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLHGHSGFFPINYVEILVALPHSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structures of the SH3 domain of human SH3-containing GRB2-like protein 2
rcsb
source organism Homo sapiens
molecule tags Transferase, signaling protein
molecule keywords SH3-containing GRB2-like protein 2
total genus 5
structure length 73
sequence length 73
ec nomenclature ec 2.3.1.-:
pdb deposition date 2005-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dbmA00
2MOXA 2P4RA 4Y92A 4JZ4A 1JXOA 4KRTA 1AWOA 1NLPC 1K76A 1OOTA 5GJVB 3A98A 1QLYA 2EVRA 2YSQA 1VYTA 3VRYA 1W6XA 2EKHA 1IO6A 3ZL7C 4J9CA 1OEBA 1NEGA 1E6HA 1K1ZA 1AVZC 1UECA 2D0NA 2EBPA 1SHFA 3ULRB 2ROLA 3VS5A 4JPBW 2ABLA 2J7IA 2GBQA 1RI9A 1BB9A 4JJBA 4LN2A 1JXMA 2RQRA 2DRKA 2F2VA 1I0CA 2DNUA 2D8JA 2SEMA 2DL3A 1GRIA 4OMNA 2KT8A 1PHTA 2RPNA 2M0YA 2O9VA 3TVTA 1T3LA 1T0JA 2GTJA 2LQWA 2EYWA 2FEIA 4J9DA 2RNAA 1JQQA 1AWWA 1X2KA 2ROTA 4IIMA 2FRWA 2JS2A 4F16A 2KROA 1EFNA 4RTXA 1GCQC 2DM1A 1UE9A 1M27C 1NG2A 1H92A 5IHNA 1KIKA 4F17A 1UG1A 2OJ2A 4JJDA 1KJWA 1CKAA 3O5ZA 1WIEA 4HVWA 1QKWA 4AG1C 1YP5A 2CUBA 3U23A 1JU5C 1U3OA 2J05A 5L23A 2KRSA 3EG2A 4LNPA 5FWCA 4FSSA 2YUQA 1H8KA 2HEQA 2K9GA 2E5KA 4J9FA 1GFCA 1G83A 2AKKA 1UTIA 3REBB 1SHGA 4CC7A 2CT3A 4LE9A 2EQIA 1A0NB 2XMFA 4E6RA 1S1NA 2JMAA 2DA9A 4M4ZA 3JV3A 1RLPC 2B86A 2KR3A 2L3PA 4K11A 2J6OA 1CSKA 2JM9A 1M8MA 3UF4A 2DX1A 3VRZA 5FWBA 1X6BA 3EG3A 1AD5A 3H0HA 2KRMA 1H3HA 1UJ0A 3VS0A 3QWXX 2LZ6B 1I07A 1YWPA 2JM8A 2QDLA 2CREA 4AFQC 2I0NA 2HBWA 2J6FA 2BZ8A 2K2MA 3H0IA 2LP5A 1HJDA 1M3CA 1X27A 1XOVA 5IHKA 4DEYA 1TG0A 3VS4A 2K79A 2LQNA 3VS2A 1K4US 1M30A 2ED0A 2KEAA 1UJYA 2K6DA 4Z89A 2IIMA 2C0OA 1SSHA 1QCFA 1V1CA 2FG0A 2YT6A 3TSZA 1ZUUA 4OMPA 1AWJA 2AZVA 3I9QA 2MIOA 4Z8AA 5IXBA 1M3AA 1VYVA 2KXCA 2DJQA 2YDLA 3TSWA 1K0XA 1BU1A 4CC4B 3PE0A 1CKBA 2DL4A 3EG0A 3SEMA 2ESWA 4J9IA 3NPFA 4AFZC 1AZGB 2DRMA 2FRYA 3THKA 4CC2A 1FYNA 3EHQA 1PKTA 1YWOA 1GL5A 5EC7A 3VS3A 3PVQA 1BBZA 2SRCA 2A36A 4HXJA 4AG2C 2RQWA 1W70A 1WXTA 1GCQA 2LJ3A 2A28A 3M0QA 2CSIA 4ZNXA 2KYBA 4AFUC 1ABOA 1WYXA 2MCNA 2KBTA 4IIOA 1QWFA 2CDTA 2C0IA 1WX6A 3EG1A 1N5ZA 2KE9A 1VYUA 2L3SA 3IQLA 1WXBA 1HD3A 4GBQA 1LCKA 1Y0MA 5HCKA 1GFDA 1T3SA 2ECZA 3M0RA 1OV3A 3LH5A 2LMJA 3I5SA 4AFSC 2V1QA 1JO8A 3H0FA 2EYXA 4RTZA 2PTKA 4J9BA 2JXBA 1WDXA 1ZBJA 1ABQA 4OMQA 1RLQC 3EGUA 4DEXA 3PVLA 3C0CA 4WCIA 2DE0X 5ECAA 2DBKA 2AK5A 4ORZA 2O31A 2YUPA 1TUDA 2D1XA 2HDAA 1PRLC 2W10A 4HVVA 5I11A 1NM7A 1E7OA 1UUEA 4RTVA 4HCKA 2JT4A 1X6GA 3EHRA 4HVUA 1UHFA 1I1JA 3REAB 2M51A 2RN8A 4Z88A 5IHIA 3M0PA 4EIKA 3VS1A 1KFZA 2V1RA 2G6FX 4R0KA 3FJ5A 1ZSGA 2CH4A 2ENMA 1BK2A 3R6NA 4RTWA 1UDLA 1X43A 1MV0B 2CSQA 2W0ZA 2NUZA 1NEBA 2RQTA 3UA6A 1NLOC 2FPDA 3M0SA 3RBBB 2J06A 4CC3A 2L2PA 2O9SA 4J9HA 2BZYA 4F14A 1WFWA 3I35A 3NGPA 3UATA 1UGVA 1NYFA 2L0AA 2VVKA 1NYGA 2EPDA 3M0UA 2J6KA 2KYMA 1K9AA 4OMMA 2JS0A 2K3BA 1MUZA 2DMOA 2YUNA 4RTUA 2C0TA 2K7AA 2FO0A 1GCPA 1FMKA 2HCKA 2DYBA 2H8HA 2EYZA 4JJCA 4OMOA 2BZXA 2VKNA 2OAWA 2O2OA 4X1VA 1YCSB 4J9EA 1YN8A 3I5RA 1OPLA 3RNJA 1ARKA 2CH4W 2PNIA 2EGCA 1Z9ZA 1E6GA 1ZUKA 5IXFA 1JEGA 2KNBB 1PRMC 3M0TA 3VS6A 2EW3A 4D8KA 2GGRA 2FPEA 2DLPA 1W1FA 2OI3A 1U06A 1WXUA 2RF0A 1T0HA 3SHWA 1SPKA 1OPKA 2KT1A 2KRNA 4RTYA 2HSPA 3GBQA 1K0SA 2NWMA 1ZLMA 2YUOA 2KGTA 2ED1A 1RUWA 2RQUA 1MV3A 3QWYA 1GBQA 1YNZA 1PWTA 1X69A 2DL8A 1B3QA 1TUCA 4QT7A 1Y57A 2KXDA 2JTEA 2GTOA 1PKSA 1J3TA 4J9GA 2EGEA 2EYYA 5I22A 2A37A 1PNJA 5IH2A 3VS7A 1Z9QA 2O88A 2F2XA 5GJWB 1ZUYA 1ZX6A 2RMOA 1WI7A 1UFFA 3NMZC 1AZEA 4JZ3A 1SRLA 2CUDA 3UA7A 2DF6A 4GLMA 2A08A 2PZ1A 4RUGA 3KFVA 2LJ0A 4ESRA 1AWXA 4LUDA 1AEYA 2RQVA 2GQIA 2LNHB 1UHCA 1WA7A 2LX7A 2L3QA 1WLPB 2DL5A 1QWEA 2VWFA 5FW9A 1AOJA 1X2QA 4D8DA 1B07A 1SRMA 2AZSA 1U5SA 4A63B 2BTTA 2X3WD 2GNCA 4LUEA 2AKLA 1G2BA 1QKXA 1M3BA 2EGAA 2CT4A 2DL7A 2X3XD 2JW4A 3NHNA 2DVJA 4OMLA 2D8HA 2LCSA 3CQTA 2LJ1A 1GBRA 2DBMA 1HSQA 1VA7A 4RTTA 2JMCA 2FPFA 1SEMA 1KSWA 2F2WA 2DILA 3H41A
chains in the Genus database with same CATH superfamily
4HT9A 2P4RA 4Y92A 1M9SA 3M4YA 4JZ4A 2CP7A 1JXOA 4KRTA 1TTHB 1NLPC 1RAIB 2GFAA 2YLBA 1QP2A 1VQOQ 1QLYA 2F5TX 2EKHA 4ZTFA 3ZL7C 1OEBA 4C8QA 4PJOD 3CCRA 2RK1A 3CCUA 5GMKm 2DVEA 2ZPFB 2D0NA 2ZGWA 3ULRB 1YIJA 4BUGA 1VQNQ 3CPWP 2RI3A 2GBQA 1IZ6A 2A3LA 1JXMA 1NPRA 2F2VA 2RI5A 5LJ5j 1GRIA 1K73U 1PHTA 1SSFA 2RPNA 3PFSA 2JZ2A 4HCZA 2O9VA 3MHXA 1KD1C 1X2KA 3MCAB 1TS9A 1EFNA 2XDBA 3RERA 2CKKA 1RAAB 2QAZA 3L2QA 3JCMQ 3C12A 1UG1A 3DB3A 1D09B 4CI0C 2QQRA 2OTJQ 4JJDA 1KJWA 4Q5WA 3RIRA 4QQDA 1QKWA 1KQSA 1RAFB 1NZ9A 4XTZA 2IVWA 1C0MA 1LJOA 3QJ6A 3CC2T 1OYXA 3L2ZA 3U23A 1JU5C 1U3OA 2J05A 1MGQA 3TU4K 2HL3A 3CMAA 4FSSA 2GQVA 2K2VA 2YLCA 1R0BG 2VYTA 2YUQA 3RMQA 5GMKh 3M53A 2KMTA 2M9UA 4XTVA 3H9NA 5HK3A 4O6JA 1UTIA 3REBB 2KDSA 2WSEE 2CT3A 3QBYA 2EQIA 2QGFB 1A0NB 4BE1A 2HBPA 1YHQT 3QG1A 1S1NA 1TXQA 5GAOl 2DA9A 4M4ZA 2E65A 3JV3A 2NUPA 2XHCA 3BFMA 1CSKA 1D3BA 2DEQA 1M8MA 2DX1A 2EIFA 5FWBA 1AD5A 3VS0A 3CCQT 3QWXX 4L59A 2F69A 2DTHA 1B7TA 2L3RA 2CREA 2HQHA 4AFQC 2E6NA 4A4EA 1VIEA 3VKIA 1VQ9A 4ZTJA 5D6XA 4HCCA 4KGXB 2LCLA 1X27A 4DEYA 2K79A 1VQLA 3GP8A 2OAUA 1YITA 2ED0A 1UJYA 1FMVA 2IIMA 5CKBA 5GANf 3CCEA 3SWNB 3ZEHA 3X28B 1AWJA 1M2VA 4PJOG 2XG8D 5FRNA 1WJQA 5IXBA 1M3AA 3MP6A 2EKOA 1YIJQ 3LGFA 4KH0B 3F70A 1BU1A 4CC4B 3R6OA 4J8OA 2DL4A 3FB9A 4J9IA 4DOVA 4BI8B 4HCBA 2K5LA 3EHQA 4M7DF 2PVOB 1PKTA 3TEEA 2QYZA 5KYYA 3OYFA 4IKFA 4M77D 4E7IA 1KQSP 1BBZA 4LD9K 1D0ZA 2LDMA 3QZ9B 4VUBA 1WXTA 2LJ3A 3M0QA 3BDUA 3D7SB 1Y7XA 4PNOA 4PLIA 2MCNA 2DIGA 3I55A 1W4SA 4IIOA 1QWFA 3TCJA 3EG1A 2Y4XA 3V7CA 1VQPA 1M5Q1 3LX7A 5HCKA 2NLUA 3I5SA 5J39A 3EFRA 4AFSC 3G7ZA 5FRMA 3SB2A 4J9BA 3BDLA 5CIUA 1KK7A 2QQSA 1S72T 3CCRT 4F7UF 1S72Q 3C0CA 2BUDA 3CPWA 2O31A 2PVGB 2YUPA 2EJGA 3PMTA 4LDWA 4MMLA 5D6YA 1D1BA 4KH1B 1WHMA 2PUOB 4FU6A 2EQKA 4HCKA 1FX7A 2EJ9A 1X6GA 2DXUA 1YJNQ 5CKFA 2M51A 2RN8A 4C92A 3VS1A 2HNIA 4DOWA 1VQ6Q 2CP0A 5GANg 3FJ5A 2ZCFB 1ZSGA 3M56A 2YHTA 4WF2A 2YRDA 1TSFA 3EG9B 1Y96B 4OB3B 1NPPA 1X43A 3I55Q 1EX4A 1NE8A 3CMAT 1QVFS 3E1SA 3JCMb 2NUZA 4C92C 2O4XA 1NEBA 2FPDA 3G6EQ 2J06A 5CAIA 3RR6A 4J9HA 1SKUB 2IG0A 1M90C 1VOMA 4C0ZA 2BZYA 2VVKA 2EPDA 2J6KA 1JJ2A 2H3EB 4MDXA 1Q81C 1K8AU 5A0GA 4OMMA 2JS0A 4LDVA 2C0TA 2QI2A 2V8KA 4JRIA 2FO0A 1YJWQ 1U8RA 1UB4A 2V8IA 3JCMX 4PK4A 4JRPA 1I5LA 2RH2A 2O2OA 5KYUA 5LJ3d 5KYYB 5KYXA 5DLOA 5HY6A 2FZCB 4C8QC 5IXFA 2X35A 1NJIR 2D6FA 1S72A 2KNBB 5FLXE 3M58A 3GNGA 3DKMA 5DY9A 2RF0A 1SPKA 3FRNA 4M77C 2KT1A 4M78G 4LDYA 2KRNA 1K0SA 2YUOA 1JJ2S 5CQXA 5GAN3 2MYSA 2RQUA 3QWYA 4FYVB 1JB0E 1VQLT 5GAMe 1VQ8A 1U1SA 3JRZA 2HQXA 3WVEB 1FXXA 2DL8A 1B3QA 1N6AA 2FL7A 3CMEA 4YTLA 2QEXQ 3G71Q 3G71T 3ME9A 1PSEA 1MMNA 4N4IA 1BI2A 2A37A 3J80E 1Z9QA 3QYGB 2O88A 2F2XA 4ELZC 3NMZC 1AZEA 2MAMA 2CYZB 6AT1B 1SRLA 4EMGA 3RUXA 1VQ4Q 3KFVA 4ESRA 1AWXA 4M78E 2GQIA 4FW2A 3CC2A 4EMHA 4DBFA 3JB9I 1U5SA 2QK0A 2JVVA 3EGXA 2R5MA 2AKLA 3GNFB 1QKXA 2P0KA 1Q81R 3JCMc 2XKOC 4UC4A 3L42A 2ZPGB 1Y71A 4QKUA 2DVJA 4OMLA 1YJ9T 5GAN8 4M7AD 5FU7B 1QCNA 5EG2A 3M5AA 4M7DA 1SEMA 2F2WA 3H41A 1U1TA 3G71A 2XD0A 3J81E 5LJ3f 2DEUA 1FWZA 5GAOm 1VQOT 1D0YA 1G5VA 1W6XA 4C92E 1IGQA 1IO6A 5GAN2 5KE2A 1E6HA 1AVZC 3OBWA 4M78D 3CMEQ 2COYA 4ZN3A 2GFUA 3VUBA 5LJ3e 2EBPA 4PJOA 1SHFA 1Q7YR 3FDRA 1X01A 1YBYA 4EMKA 5LL6S 1RI9A 4XTYA 4C92B 4LN2A 2LC4A 2RQRA 2DRKA 3OSVA 3PGGA 2DO3A 1I0CA 2DNUA 2SEMA 2M02A 2DL3A 4C5GA 4E7SA 2M16A 4OMNA 2L89A 1VQ9Q 4EDUA 1OX8A 3TVTA 2GTJA 1T0JA 1Y96A 3V7RA 3LWHA 4A54A 3SD4A 4ZGEB 3CCUT 4V2SA 4MZMA 2O4XB 1AWWA 2JS2A 3FJPA 4OGCA 4BB7A 3JCMe 3A8OB 1B34A 1GCQC 3FIFA 4B9WA 3OYYA 4M75F 3E2UA 1H92A 2MF2A 4PJLA 5IHNA 1KIKA 3BW1A 1IRXA 1BYMA 1CKAA 4HVWA 1M1KR 1OZ2A 2R5AA 2E41A 4AG1C 2LT4A 2MPXC 1PSFA 2CUBA 1F1BB 1N8RC 1WZOA 3CC7Q 2LNVA 1OU9A 5CR2A 3OYGA 1YJ9Q 1YI2Q 3EG2A 4PJOF 4E7JA 4M78B 4D6WA 1VUBA 2HEQA 3JAME 2E5KA 4HKEA 4DBHA 4CC7A 4LE9A 2RHZA 2YRVA 3LLRA 1QW1A 4BI3A 2WACA 2D9TA 2B86A 4M75C 4K11A 4M77E 1VQ8T 2OTLQ 4M77B 4FYWB 3UF4A 3EH2A 3VRZA 3EG3A 3OYBA 3CCQQ 1KD1U 3JCMP 1UGQB 2LZ6B 4LDUA 1AT1B 2QDLA 5CVIA 2MMPA 1Q86R 1KQ2A 1OULA 1IHWA 3O8VA 3MP1A 2E4HA 2E12A 3C95A 4KBMB 1K4US 2QG9B 5D7UA 4MZPA 1V29B 3WVDB 5GAOr 2C0OA 3OS0A 4PJOB 4X34A 1V1CA 3N5BB 1NJIU 2YT6A 3TSZA 1GXIE 4JS5A 3QIIA 3OY9A 1Q81U 3I9QA 4Z8AA 1VQ5A 3EH1A 4OMFB 4JUVA 2KXCA 2RJEA 1VQ6A 4BE2A 3TSWA 2EQMA 1CKBA 3PE0A 1VQKA 3SEMA 2O01E 2RHIA 4BI4A 1Q7YU 1AZGB 2FRYA 4MDWA 1YWOA 4KULA 5LJ5h 4ATOA 1GL5A 3S3OA 5EC7A 2OTLA 3G6EA 3HSBA 3VJPA 3CCJQ 1VQMA 2DXTA 4DQ2A 4HXJA 1V76A 2K3XA 1GCQA 2E1HA 4ZNXA 4JJNK 4FL6A 3CC7A 2BIVA 2C0IA 4KUIA 1QVGS 1IXDA 1TUGB 2EQJA 2KE9A 5FU6B 2L3SA 4PLLA 1WXBA 1HD3A 3QO3A 1GFDA 5J26A 1W2BA 2KAFA 1T3SA 3JSCA 3M4GA 3M0RA 4OF1A 3LH5A 1UGRB 3JCMd 1OU8A 4QVCA 3NTHA 2P0QA 5A0LA 2JXBA 1WDXA 1ZBJA 1ABQA 1PCXA 4OMQA 1VQ5Q 4DEXA 5GANe 3PVLA 1KHIA 3BY7A 3G4SQ 1VQPT 3JCMW 2VB6A 2DE0X 2DBKA 2AK5A 3VYGA 3PTAA 3A8LB 3CXCP 1I8FA 3UPUA 1QQJA 3OYHA 5I11A 1NM7A 2DK3A 2JT4A 5LJ3j 1XNIA 2QXFA 2ZZDA 2RO0A 1VQ6T 4XTWA 2XU8A 2PVDB 4IURA 1R8OB 3EFOB 5KE3A 2QEXA 2KSSA 1BK2A 1Q82C 2FYKA 4RCCA 4NL2A 2EFIA 3OYMA 5CCAA 1HXDA 1G3WA 3CXCA 1ZHIA 2CP2A 3OB9A 4FT2A 3UWNA 3CMET 2XDDA 1M2OA 1BI0A 3LW5E 3NGPA 3CD6Q 3OYJA 2RD1A 1UGVA 2L0AA 1NYGA 3M0UA 1K9AA 4R56A 1K73R 2K3BA 4NS5A 2ZPIB 2YXYA 4FT4A 2K7AA 1KG1A 3S3MA 1FMKA 1W2BP 4BDZA 4E7KA 4OMOA 2BZXA 2OAWA 4C0DB 1YCSB 4J9EA 3S6WA 3ZBDA 3I5RA 1ARKA 4XTUA 1TU0B 2CH4W 1K8AC 2DPPB 1JEGA 4EPCA 1VQ7Q 4MMKA 4FSXA 5AT1B 4D8KA 2LT1A 1BCOA 2GGRA 3X20B 5KCOA 2FPEA 1M4ZA 2XI9A 1ZSZA 1ZSZB 4QQ6A 3KBGA 2HSPA 2NWMA 3MEVA 1D3BB 2G3RA 2ED1A 5KH6A 4A4HA 1RUWA 1MV3A 1WPYA 1YNZA 4QQGA 4M7DD 1WHGA 3MKDA 2XK0A 3SDZA 4OB2B 3CD6T 2ZPEB 2RJCA 1TUCA 2RK2A 2RJFA 1EZZB 2KXDA 1BI1A 2GTOA 2AIRB 4J9GA 4RCBA 5I22A 1PNJA 3E19A 1ZX6A 1D1AA 1WI7A 1UFFA 5L8RE 5GAOn 3QDFA 2PZ1A 1Q82R 2LJ0A 1AEYA 2OX7A 2DD4A 1YHQA 4DBRA 1Q86U 2HZYA 2CZ0B 1NJIC 3PIOA 1QWEA 2VWFA 1AOJA 4D8DA 2X51A 2DZCA 1SRMA 1Y07A 1OQKA 4GLKA 4M75A 4NOYA 2BTTA 3GF5A 2X3WD 2GNCA 1G2BA 1K9MR 1KHCA 1N9RA 2EGAA 1RACB 2YRCA 2OTJA 1NBEB 2CP6A 3NHNA 4PJNA 2P84A 4J7IA 1O75A 2D8HA 2LCSA 2VXEA 2LJ1A 2VGMA 2DBMA 4ME7A 1GBRA 3OYKA 3DB4A 4RTTA 2JMCA 3EFOA 4J7FA 3CCQA 3UDCA 3ASKA 1YITT 2LTOA 2MOXA 3CCMT 5C0MA 5FU6C 5GANd 2E70A 2B8AA 1OOTA 5GJVB 4C8QD 3HTRA 1VYTA 3VRYA 2E3IA 4J9CA 1YI2A 4C5HA 4QVDA 3V8LA 1VQLQ 3OYCA 2HL5C 2RHXA 2DYIA 4J6XA 2J7IA 4BDYA 1BB9A 2R57A 1XQHA 4JJBA 3C94A 2D8JA 1PM3A 2KT8A 2WSFE 3OYDA 2FB7A 1T3LA 2CP5A 2LQWA 2EYWA 5IAYA 2FZKB 2FEIA 4J9DA 1MNEA 1QCOA 4IIMA 2FRWA 4F16A 2DKGA 2HMAA 1KQSS 2RA2A 1YFNA 4RTXA 1H3ZA 5LJ3g 3URGA 4J83A 3CC4Q 2DM1A 1MHNA 1NG2A 4M7AG 1WHJA 3EGDA 4F17A 2KI7A 2Y4YA 2ZAEA 3RESA 4XK8E 1MNDA 1YCYA 3G4ST 1VQPQ 3O5ZA 3CCLT 3A5ZB 4PFPA 1KC8R 2DERA 1HK9A 3CCEQ 2BE9B 3QSUA 4M7DG 3A8GB 2KRSA 4LNPA 4C0DC 3CBOA 4KT0E 2V26A 1IGUA 4XU2A 4EMKB 1H8KA 4ZN1A 2AKKA 3CEYA 1R0CB 1SHGA 4M7AC 4IUVA 3GOXA 1RAEB 2DZ9A 5LJ5g 1YHQQ 2Z0WA 3MJXA 4E6RA 1M1GA 7AT1B 3RKWA 5D6WA 1RLPC 2KR3A 3WXMB 3QPHA 2JM9A 1X6BA 1BCMA 3H0HA 1PG5B 1H3HA 3PNWC 3RDVA 2PUKB 1YWPA 2I0NA 2HBWA 3M9QA 2QDYB 4F04B 4A4KA 2BZ8A 2K2MA 1Q82U 4M7AF 2RB6A 1VQOA 2HAXA 4LDXA 3H0IA 2LP5A 2CZ7B 1QVFP 1M3CA 1XOVA 2NUTA 4XU3A 4BACA 3OW2A 2LQNA 3VS2A 1M30A 4GY5A 1M1KC 3CXCS 3CC4A 2K6DA 4JDSA 1HYOA 1OX9A 1UGPB 2JN0A 4Z89A 5KYUB 1B34B 1SSHA 2H3JA 1P92A 3NFCA 1N8RR 1G8XA 4KGVB 5CQYA 5KCHA 3PIPA 1I5OB 1WJSA 2JNGA 2MIOA 1VYVA 4ELYC 3OW2P 2DJQA 1JBMA 4PL6A 1QVFA 3OQ5A 1K0XA 4IUPA 4DA4A 3JCMJ 3EG0A 2ESWA 3NPFA 4X9CA 2KY9A 3X24B 3THKA 3H6ZA 2Y90A 2QTVA 3VS3A 2RHUA 2MWOA 3A8MB 4C0FA 2A36A 4OVAA 2RQWA 1W70A 3VV0A 2A28A 1MMDA 2KYBA 2MI6A 3KUFA 4BY6B 1ABOA 1JRIA 2VGNA 1W2BS 2CDTA 2DTOA 3META 3P8HA 1N5ZA 2DJZA 1ZQ1A 2X4WA 1LCKA 3QKJA 3VUZA 2DD5A 2M0OA 1OV3A 2EWNA 2QQ9A 5GMKj 3RKYA 3OMCA 2X9HA 4E7ZA 2KK4A 1RLQC 2RM4A 3EAEA 5ECAA 1D0XA 1QMCA 2JTMA 4C5IA 1SF9A 1TUDA 2D1XA 3CC7T 1LPLA 3CCET 1G3YA 3L2WA 1E7OA 3HPWA 2VUBA 2K57A 3EHRA 5CKEA 2QA4Q 4HVUA 3REAB 2BKDN 3M0PA 5HK0A 1SG5A 1KFZA 2G6FX 3UT1A 2VASA 1LVKA 4C92D 2CH4A 4CRIA 1QP3A 5DLQE 5LJ3h 1UDLA 3EG9A 3EGXB 2L8DA 3VYHB 1NLOC 3M0SA 2YWWA 1PD0A 4PJOE 4M7AB 2C06A 1RL2A 4M7AE 4F14A 1WFWA 1WGSA 4C92F 4F7UA 4PFZA 3UATA 3V8JA 1NYFA 3OYNA 3AHUA 1O9SA 2X4YA 2KYMA 3JB9J 4RTUA 2NUTB 1GCPA 1KC8C 1AHJB 2HCKA 2DYBA 2H8HA 4JJCA 2VKNA 4M77F 1Q95G 2LX9A 2DAQA 5KYWA 3OYLA 5KYWB 4JS4A 3MEAA 1Z9ZA 1ZUKA 2VXFA 3L1AA 1BIBA 1N27A 4IUTA 1PD1A 1PRMC 3M0TA 3JCMV 3VS6A 2K3YA 2CZ6B 4PJOC 2LRQA 1W1FA 2QTXA 3P8DA 4M75E 1WXUA 1T0HA 3SHWA 3E9GA 1OPKA 2DFUA 4RTYA 3GBQA 1YJNA 3G6ET 2DTIA 4X9DA 5GAOq 1WQ7A 8AT1B 1GBQA 4KUDK 3CBMA 1Q7YC 4ANJA 3I56T 3L2UA 2JOYA 1ZA2B 4Z02A 4ZGJB 1J3TA 4N4GA 2AHJB 2EGEA 2EYYA 3CCSQ 4RG8A 2E64A 4RG2A 5IH2A 3VS7A 3I55T 4RMOA 1R77A 1ZUYA 2P0PA 3PT9A 5DM7R 2RMOA 3X26B 3QUIA 2LCCA 3CCUQ 3UA7A 5GAOp 2QA4A 4M77G 4GLMA 4OB1B 2A08A 3G4SA 1XTDA 1LNXA 2DXCA 2EQUA 4ZGDB 1UHCA 2LX7A 2L3QA 2P4TA 1WLPB 1VQ7T 4C8QE 4B6MA 3C4SA 3EGDB 1B07A 3Q1JA 4N4HA 3SWNC 4A63B 4A53A 1VQ9T 1DJ7B 4LUEA 1MMGA 2GCXA 4J6YA 4FM4B 2FZGB 2CT4A 3HL8A 1BKBA 4IUUA 4M7AA 1ZSZC 2E3HA 1G3SA 3CQTA 5C6SA 5GAN7 3QHSA 2F1LA 2FPFA 3OYIA 1KSWA 3CCMQ 1YITQ 1YIJT 2E5QA 2V8JA 3HFNA 1EIFA 1XJWB 1AWOA 2HKQB 3CCLQ 1K76A 4IUQA 3A98A 2EVRA 2YSQA 5I2MA 4II1A 2DIQA 1NEGA 5CO7A 3NTIA 1K1ZA 4OB0B 1YJWA 1UECA 2ROLA 3VS5A 3LGLA 4JPBW 2ABLA 4TVRA 4E2FB 2XDPA 3MO8A 4L5GA 2EJFA 1RAHB 2LVMA 4M75B 2M0YA 1G3TA 4F7UE 2BE7D 1WQWA 5LJ5d 3V8KA 2NUPB 2RNAA 1JQQA 2ROTA 1K9MC 2KROA 1JJ2P 1K73C 1RABB 1UE9A 2WSCE 1M2VB 1M27C 3RKXA 5IN1A 3H8ZA 1I81A 5FU7C 4C8QG 2OJ2A 3MP8A 2RJDA 5IT9E 3CBPA 3OW2S 4M75D 2K5FA 1QVGP 3QJYA 4P5NA 1WIEA 4B9XA 1YP5A 1MMAA 5I2SA 3OS5A 2JJ9A 3OSSC 2ZPBB 2COWA 3E9FA 3TREA 2FVUA 4NL3A 5L23A 5FWCA 1YI2T 4M78A 4A4GA 4HA8A 4Y91A 3INZA 2QQBA 5FROA 2K9GA 3CCVQ 4J9FA 3I56Q 1GFCA 1G83A 1WNLA 1I4K1 4KGZB 5GAMh 1VQMQ 4L6V5 3RMSA 4J6WA 2HD0A 2XMFA 2JMAA 2EAYA 2GF7A 4M78F 2L3PA 2J6OA 1N9SA 5GMKi 3HRTA 4DBQA 4PFOA 2KRMA 3TQ7P 1UJ0A 3CPWS 1TOVA 3A8HB 4XTXA 1I07A 2JM8A 4FW1A 1WJRA 3DLMA 4E7HA 2J6FA 4N0AA 4XQ3A 3HKSA 4HT8A 2HQEA 2QGGA 3HHTB 4C5EA 1HJDA 2XICA 2MK5A 1OI1A 5IHKA 4JRQA 2OTJT 2QASA 3QZ5B 3OA6A 1TG0A 3VS4A 1RAGB 3CCMA 4LD6A 2KEAA 1IHVA 4M77A 1KC8U 1M90R 3GIBA 1QCFA 5GAMj 2FG0A 3X25B 2QA4T 1ZUUA 1X6OA 5CK9A 4OMPA 1YJ9A 4M7DB 5AYFA 2AZVA 3CCVT 3J7AF 1KQ1A 4M78C 1VQMT 2YDLA 4XU0A 1H641 4OGEA 3A1PA 5J3BA 3M55A 4AFZC 5GAMd 2RI2A 2K5IA 2DRMA 4CC2A 1FYNA 2VV5A 2A0FB 1VQ7A 1C1AA 5GMKl 1M1FA 3OBYA 4PKCC 5HKCA 3PVQA 3AT1B 3QXEB 3JB9F 4RKUE 2SRCA 4F7UB 1TH7A 4AG2C 3OS1A 4R55A 5I21A 2CSIA 4AFUC 4C8QF 1BIAA 1WYXA 2KBTA 3OYAA 3NTKA 2LQ8A 1WX6A 2DXBA 2PU9B 2A7YA 3FLGA 3HRSA 4Y28E 1VYUA 3JB9D 3IQLA 1X75C 4GBQA 1RADB 1Y0MA 3CD6A 2K4YA 2CGHA 3SWNA 1OZ3A 1D1CA 2JUFA 5LJ5f 2ECZA 4QW2A 3CCSA 2LMJA 1K8AR 1N8RU 2V1QA 1JO8A 3H0FA 2EYXA 4LXCA 4RTZA 2PTKA 3M54A 1TWBA 3EGUA 1YJWT 3OMGA 5LJ5e 4WCIA 4J5YA 4F7UG 1IREB 3I56A 2QQAA 1QVPA 4C8QB 4ORZA 4PJMA 3CC2Q 2HDAA 5M9OA 5A2QE 3G1JA 1PRLC 2W10A 3HP9A 4HVVA 1UUEA 4RTVA 4BD3A 1UHFA 1I1JA 4JLGA 2X4JA 1YJNT 4Z88A 5IHIA 4EIKA 2HSEB 2L5QA 2V1RA 3CCJT 1VQ4A 3JB9H 4R0KA 2CP3A 2LQKA 4FYYB 1VQKQ 2XIDA 2ENMA 3LWIA 5CKHA 3ER0A 5GAMf 3R6NA 3CCST 4RTWA 2I2LA 4AMCA 1MV0B 2CSQA 2W0ZA 4EMKC 4XU1A 1UEBA 2RQTA 1LOJA 3UA6A 1ACMB 3RBBB 4CC3A 2L2PA 3KXTA 2O9SA 5CKDA 1VQ8Q 2OTLT 3I35A 3EFSA 3MEUA 3BE3A 2QEXT 3JB9G 5GAN4 4FIBA 2IPOB 2R58A 4AT1B 1BI3A 1MUZA 2DMOA 2E10A 2YUNA 4O5VA 3CCRQ 3M57A 1KD1R 1VIFA 4A4FA 2ZPHB 1UGSB 1WHKA 2EYZA 5KYNA 3L2RA 4X1VA 1YN8A 1OPLA 2CS7A 3RNJA 3M59A 4C92G 3CCJA 1VQ4T 4WTOB 2PNIA 2EGCA 1FMWA 1E6GA 3CC4T 2DETA 1C6VX 1WHHA 1VQNA 4JRKA 1M8VA 3V7SA 5GANj 2KQWA 1VQ5T 2EW3A 1M1KU 2DLPA 4N0AC 2OI3A 1U06A 1K9MU 3QDRB 4C0GA 1RI0A 4M7DC 2M1HA 1IB8A 5GMKe 2PQWA 1ZLMA 4FYXB 2KGTA 3GPLA 4OP0A 3PMIA 3OYEA 2X4XA 2EYQA 3JCMg 5A0DA 2KVQG 5GAMg 1PWTA 1VQNT 3HRUA 1X69A 3DLLA 4QT7A 2F5KA 1Y57A 2HKNA 2JTEA 3CPFA 3GLXA 1PKSA 2JTFA 3JCMh 4PJJA 1WHLA 9ATCB 3CCLA 1QVGA 3MEWA 1ZBXA 2FHDA 2D0QB 5GJWB 3CMAQ 1Q86C 4FCYA 4M7DE 4JZ3A 2CUDA 1PC0A 2DF6A 5KYXB 3LYIA 4E7LA 2MWPA 4RUGA 4BY6C 2CZ1B 4LUDA 3ZFJA 4M75G 2ATCB 2E6ZA 2RQVA 2LNHB 2COZA 1WA7A 3T9NA 3P8BB 4JLIA 4MZTA 3HFOA 4XAXB 2DL5A 5FW9A 1X2QA 3SFMA 3CCVA 3LH0A 2AZSA 3JCMf 3FC3A 1M3BA 1ZA1B 2DL7A 1M90U 2X3XD 2JW4A 3MPUB 5GAN6 2RHYA 4E47A 5GANh 5GAN5 2VC8A 3L2VA 1HSQA 1VA7A 3QYHB 3S3NA 2AT1B 2NYSA 3FEOA 3VU3C 3OS2A 4BE0A 4QVZA 2DILA 8ATCB 1VQKT
chains in the Genus database with same CATH topology
2MOXA 2P4RA 4Y92A 4JZ4A 1JXOA 4KRTA 1AWOA 1NLPC 1K76A 1OOTA 5GJVB 3A98A 1QLYA 2EVRA 2YSQA 1VYTA 3VRYA 1W6XA 2EKHA 1IO6A 3ZL7C 4J9CA 1OEBA 1NEGA 1E6HA 1K1ZA 1AVZC 1UECA 2D0NA 2EBPA 1SHFA 3ULRB 2ROLA 3VS5A 4JPBW 2ABLA 2J7IA 2GBQA 1RI9A 1BB9A 4JJBA 4LN2A 1JXMA 2RQRA 2DRKA 2F2VA 1I0CA 2DNUA 2D8JA 2SEMA 2DL3A 1GRIA 4OMNA 2KT8A 1PHTA 2RPNA 2M0YA 2O9VA 3TVTA 1T3LA 1T0JA 2GTJA 2LQWA 2EYWA 2FEIA 4J9DA 2RNAA 1JQQA 1AWWA 1X2KA 2ROTA 4IIMA 2FRWA 2JS2A 4F16A 2KROA 1EFNA 4RTXA 1GCQC 2DM1A 1UE9A 1M27C 1NG2A 1H92A 5IHNA 1KIKA 4F17A 1UG1A 2OJ2A 4JJDA 1KJWA 1CKAA 3O5ZA 1WIEA 4HVWA 1QKWA 4AG1C 1YP5A 2CUBA 3U23A 1JU5C 1U3OA 2J05A 5L23A 2KRSA 3EG2A 4LNPA 5FWCA 4FSSA 2YUQA 1H8KA 2HEQA 2K9GA 2E5KA 4J9FA 1GFCA 1G83A 2AKKA 1UTIA 3REBB 1SHGA 4CC7A 2CT3A 4LE9A 2EQIA 1A0NB 2XMFA 4E6RA 1S1NA 2JMAA 2DA9A 4M4ZA 3JV3A 1RLPC 2B86A 2KR3A 2L3PA 4K11A 2J6OA 1CSKA 2JM9A 1M8MA 3UF4A 2DX1A 3VRZA 5FWBA 1X6BA 3EG3A 1AD5A 3H0HA 2KRMA 1H3HA 1UJ0A 3VS0A 3QWXX 2LZ6B 1I07A 1YWPA 2JM8A 2QDLA 2CREA 4AFQC 2I0NA 2HBWA 2J6FA 2BZ8A 2K2MA 3H0IA 2LP5A 1HJDA 1M3CA 1X27A 1XOVA 5IHKA 4DEYA 1TG0A 3VS4A 2K79A 2LQNA 3VS2A 1K4US 1M30A 2ED0A 2KEAA 1UJYA 2K6DA 4Z89A 2IIMA 2C0OA 1SSHA 1QCFA 1V1CA 2FG0A 2YT6A 3TSZA 1ZUUA 4OMPA 1AWJA 2AZVA 3I9QA 2MIOA 4Z8AA 5IXBA 1M3AA 1VYVA 2KXCA 2DJQA 2YDLA 3TSWA 1K0XA 1BU1A 4CC4B 3PE0A 1CKBA 2DL4A 3EG0A 3SEMA 2ESWA 4J9IA 3NPFA 4AFZC 1AZGB 2DRMA 2FRYA 3THKA 4CC2A 1FYNA 3EHQA 1PKTA 1YWOA 1GL5A 5EC7A 3VS3A 3PVQA 1BBZA 2SRCA 2A36A 4HXJA 4AG2C 2RQWA 1W70A 1WXTA 1GCQA 2LJ3A 2A28A 3M0QA 2CSIA 4ZNXA 2KYBA 4AFUC 1ABOA 1WYXA 2MCNA 2KBTA 4IIOA 1QWFA 2CDTA 2C0IA 1WX6A 3EG1A 1N5ZA 2KE9A 1VYUA 2L3SA 3IQLA 1WXBA 1HD3A 4GBQA 1LCKA 1Y0MA 5HCKA 1GFDA 1T3SA 2ECZA 3M0RA 1OV3A 3LH5A 2LMJA 3I5SA 4AFSC 2V1QA 1JO8A 3H0FA 2EYXA 4RTZA 2PTKA 4J9BA 2JXBA 1WDXA 1ZBJA 1ABQA 4OMQA 1RLQC 3EGUA 4DEXA 3PVLA 3C0CA 4WCIA 2DE0X 5ECAA 2DBKA 2AK5A 4ORZA 2O31A 2YUPA 1TUDA 2D1XA 2HDAA 1PRLC 2W10A 4HVVA 5I11A 1NM7A 1E7OA 1UUEA 4RTVA 4HCKA 2JT4A 1X6GA 3EHRA 4HVUA 1UHFA 1I1JA 3REAB 2M51A 2RN8A 4Z88A 5IHIA 3M0PA 4EIKA 3VS1A 1KFZA 2V1RA 2G6FX 4R0KA 3FJ5A 1ZSGA 2CH4A 2ENMA 1BK2A 3R6NA 4RTWA 1UDLA 1X43A 1MV0B 2CSQA 2W0ZA 2NUZA 1NEBA 2RQTA 3UA6A 1NLOC 2FPDA 3M0SA 3RBBB 2J06A 4CC3A 2L2PA 2O9SA 4J9HA 2BZYA 4F14A 1WFWA 3I35A 3NGPA 3UATA 1UGVA 1NYFA 2L0AA 2VVKA 1NYGA 2EPDA 3M0UA 2J6KA 2KYMA 1K9AA 4OMMA 2JS0A 2K3BA 1MUZA 2DMOA 2YUNA 4RTUA 2C0TA 2K7AA 2FO0A 1GCPA 1FMKA 2HCKA 2DYBA 2H8HA 2EYZA 4JJCA 4OMOA 2BZXA 2VKNA 2OAWA 2O2OA 4X1VA 1YCSB 4J9EA 1YN8A 3I5RA 1OPLA 3RNJA 1ARKA 2CH4W 2PNIA 2EGCA 1Z9ZA 1E6GA 1ZUKA 5IXFA 1JEGA 2KNBB 1PRMC 3M0TA 3VS6A 2EW3A 4D8KA 2GGRA 2FPEA 2DLPA 1W1FA 2OI3A 1U06A 1WXUA 2RF0A 1T0HA 3SHWA 1SPKA 1OPKA 2KT1A 2KRNA 4RTYA 2HSPA 3GBQA 1K0SA 2NWMA 1ZLMA 2YUOA 2KGTA 2ED1A 1RUWA 2RQUA 1MV3A 3QWYA 1GBQA 1YNZA 1PWTA 1X69A 2DL8A 1B3QA 1TUCA 4QT7A 1Y57A 2KXDA 2JTEA 2GTOA 1PKSA 1J3TA 4J9GA 2EGEA 2EYYA 5I22A 2A37A 1PNJA 5IH2A 3VS7A 1Z9QA 2O88A 2F2XA 5GJWB 1ZUYA 1ZX6A 2RMOA 1WI7A 1UFFA 3NMZC 1AZEA 4JZ3A 1SRLA 2CUDA 3UA7A 2DF6A 4GLMA 2A08A 2PZ1A 4RUGA 3KFVA 2LJ0A 4ESRA 1AWXA 4LUDA 1AEYA 2RQVA 2GQIA 2LNHB 1UHCA 1WA7A 2LX7A 2L3QA 1WLPB 2DL5A 1QWEA 2VWFA 5FW9A 1AOJA 1X2QA 4D8DA 1B07A 1SRMA 2AZSA 1U5SA 4A63B 2BTTA 2X3WD 2GNCA 4LUEA 2AKLA 1G2BA 1QKXA 1M3BA 2EGAA 2CT4A 2DL7A 2X3XD 2JW4A 3NHNA 2DVJA 4OMLA 2D8HA 2LCSA 3CQTA 2LJ1A 1GBRA 2DBMA 1HSQA 1VA7A 4RTTA 2JMCA 2FPFA 1SEMA 1KSWA 2F2WA 2DILA 3H41A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MOX A;  2P4R A;  4Y92 A;  4JZ4 A;  1JXO A;  4KRT A;  1AWO A;  1NLP C;  1K76 A;  1OOT A;  5GJV B;  3A98 A;  1QLY A;  2EVR A;  2YSQ A;  1VYT A;  3VRY A;  1W6X A;  2EKH A;  1IO6 A;  3ZL7 C;  4J9C A;  1OEB A;  1NEG A;  1E6H A;  1K1Z A;  1AVZ C;  1UEC A;  2D0N A;  2EBP A;  1SHF A;  3ULR B;  2ROL A;  3VS5 A;  4JPB W;  2ABL A;  2J7I A;  2GBQ A;  1RI9 A;  1BB9 A;  4JJB A;  4LN2 A;  1JXM A;  2RQR A;  2DRK A;  2F2V A;  1I0C A;  2DNU A;  2D8J A;  2SEM A;  2DL3 A;  1GRI A;  4OMN A;  2KT8 A;  1PHT A;  2RPN A;  2M0Y A;  2O9V A;  3TVT A;  1T3L A;  1T0J A;  2GTJ A;  2LQW A;  2EYW A;  2FEI A;  4J9D A;  2RNA A;  1JQQ A;  1AWW A;  1X2K A;  2ROT A;  4IIM A;  2FRW A;  2JS2 A;  4F16 A;  2KRO A;  1EFN A;  4RTX A;  1GCQ C;  2DM1 A;  1UE9 A;  1M27 C;  1NG2 A;  1H92 A;  5IHN A;  1KIK A;  4F17 A;  1UG1 A;  2OJ2 A;  4JJD A;  1KJW A;  1CKA A;  3O5Z A;  1WIE A;  4HVW A;  1QKW A;  4AG1 C;  1YP5 A;  2CUB A;  3U23 A;  1JU5 C;  1U3O A;  2J05 A;  5L23 A;  2KRS A;  3EG2 A;  4LNP A;  5FWC A;  4FSS A;  2YUQ A;  1H8K A;  2HEQ A;  2K9G A;  2E5K A;  4J9F A;  1GFC A;  1G83 A;  2AKK A;  1UTI A;  3REB B;  1SHG A;  4CC7 A;  2CT3 A;  4LE9 A;  2EQI A;  1A0N B;  2XMF A;  4E6R A;  1S1N A;  2JMA A;  2DA9 A;  4M4Z A;  3JV3 A;  1RLP C;  2B86 A;  2KR3 A;  2L3P A;  4K11 A;  2J6O A;  1CSK A;  2JM9 A;  1M8M A;  3UF4 A;  2DX1 A;  3VRZ A;  5FWB A;  1X6B A;  3EG3 A;  1AD5 A;  3H0H A;  2KRM A;  1H3H A;  1UJ0 A;  3VS0 A;  3QWX X;  2LZ6 B;  1I07 A;  1YWP A;  2JM8 A;  2QDL A;  2CRE A;  4AFQ C;  2I0N A;  2HBW A;  2J6F A;  2BZ8 A;  2K2M A;  3H0I A;  2LP5 A;  1HJD A;  1M3C A;  1X27 A;  1XOV A;  5IHK A;  4DEY A;  1TG0 A;  3VS4 A;  2K79 A;  2LQN A;  3VS2 A;  1K4U S;  1M30 A;  2ED0 A;  2KEA A;  1UJY A;  2K6D A;  4Z89 A;  2IIM A;  2C0O A;  1SSH A;  1QCF A;  1V1C A;  2FG0 A;  2YT6 A;  3TSZ A;  1ZUU A;  4OMP A;  1AWJ A;  2AZV A;  3I9Q A;  2MIO A;  4Z8A A;  5IXB A;  1M3A A;  1VYV A;  2KXC A;  2DJQ A;  2YDL A;  3TSW A;  1K0X A;  1BU1 A;  4CC4 B;  3PE0 A;  1CKB A;  2DL4 A;  3EG0 A;  3SEM A;  2ESW A;  4J9I A;  3NPF A;  4AFZ C;  1AZG B;  2DRM A;  2FRY A;  3THK A;  4CC2 A;  1FYN A;  3EHQ A;  1PKT A;  1YWO A;  1GL5 A;  5EC7 A;  3VS3 A;  3PVQ A;  1BBZ A;  2SRC A;  2A36 A;  4HXJ A;  4AG2 C;  2RQW A;  1W70 A;  1WXT A;  1GCQ A;  2LJ3 A;  2A28 A;  3M0Q A;  2CSI A;  4ZNX A;  2KYB A;  4AFU C;  1ABO A;  1WYX A;  2MCN A;  2KBT A;  4IIO A;  1QWF A;  2CDT A;  2C0I A;  1WX6 A;  3EG1 A;  1N5Z A;  2KE9 A;  1VYU A;  2L3S A;  3IQL A;  1WXB A;  1HD3 A;  4GBQ A;  1LCK A;  1Y0M A;  5HCK A;  1GFD A;  1T3S A;  2ECZ A;  3M0R A;  1OV3 A;  3LH5 A;  2LMJ A;  3I5S A;  4AFS C;  2V1Q A;  1JO8 A;  3H0F A;  2EYX A;  4RTZ A;  2PTK A;  4J9B A;  2JXB A;  1WDX A;  1ZBJ A;  1ABQ A;  4OMQ A;  1RLQ C;  3EGU A;  4DEX A;  3PVL A;  3C0C A;  4WCI A;  2DE0 X;  5ECA A;  2DBK A;  2AK5 A;  4ORZ A;  2O31 A;  2YUP A;  1TUD A;  2D1X A;  2HDA A;  1PRL C;  2W10 A;  4HVV A;  5I11 A;  1NM7 A;  1E7O A;  1UUE A;  4RTV A;  4HCK A;  2JT4 A;  1X6G A;  3EHR A;  4HVU A;  1UHF A;  1I1J A;  3REA B;  2M51 A;  2RN8 A;  4Z88 A;  5IHI A;  3M0P A;  4EIK A;  3VS1 A;  1KFZ A;  2V1R A;  2G6F X;  4R0K A;  3FJ5 A;  1ZSG A;  2CH4 A;  2ENM A;  1BK2 A;  3R6N A;  4RTW A;  1UDL A;  1X43 A;  1MV0 B;  2CSQ A;  2W0Z A;  2NUZ A;  1NEB A;  2RQT A;  3UA6 A;  1NLO C;  2FPD A;  3M0S A;  3RBB B;  2J06 A;  4CC3 A;  2L2P A;  2O9S A;  4J9H A;  2BZY A;  4F14 A;  1WFW A;  3I35 A;  3NGP A;  3UAT A;  1UGV A;  1NYF A;  2L0A A;  2VVK A;  1NYG A;  2EPD A;  3M0U A;  2J6K A;  2KYM A;  1K9A A;  4OMM A;  2JS0 A;  2K3B A;  1MUZ A;  2DMO A;  2YUN A;  4RTU A;  2C0T A;  2K7A A;  2FO0 A;  1GCP A;  1FMK A;  2HCK A;  2DYB A;  2H8H A;  2EYZ A;  4JJC A;  4OMO A;  2BZX A;  2VKN A;  2OAW A;  2O2O A;  4X1V A;  1YCS B;  4J9E A;  1YN8 A;  3I5R A;  1OPL A;  3RNJ A;  1ARK A;  2CH4 W;  2PNI A;  2EGC A;  1Z9Z A;  1E6G A;  1ZUK A;  5IXF A;  1JEG A;  2KNB B;  1PRM C;  3M0T A;  3VS6 A;  2EW3 A;  4D8K A;  2GGR A;  2FPE A;  2DLP A;  1W1F A;  2OI3 A;  1U06 A;  1WXU A;  2RF0 A;  1T0H A;  3SHW A;  1SPK A;  1OPK A;  2KT1 A;  2KRN A;  4RTY A;  2HSP A;  3GBQ A;  1K0S A;  2NWM A;  1ZLM A;  2YUO A;  2KGT A;  2ED1 A;  1RUW A;  2RQU A;  1MV3 A;  3QWY A;  1GBQ A;  1YNZ A;  1PWT A;  1X69 A;  2DL8 A;  1B3Q A;  1TUC A;  4QT7 A;  1Y57 A;  2KXD A;  2JTE A;  2GTO A;  1PKS A;  1J3T A;  4J9G A;  2EGE A;  2EYY A;  5I22 A;  2A37 A;  1PNJ A;  5IH2 A;  3VS7 A;  1Z9Q A;  2O88 A;  2F2X A;  5GJW B;  1ZUY A;  1ZX6 A;  2RMO A;  1WI7 A;  1UFF A;  3NMZ C;  1AZE A;  4JZ3 A;  1SRL A;  2CUD A;  3UA7 A;  2DF6 A;  4GLM A;  2A08 A;  2PZ1 A;  4RUG A;  3KFV A;  2LJ0 A;  4ESR A;  1AWX A;  4LUD A;  1AEY A;  2RQV A;  2GQI A;  2LNH B;  1UHC A;  1WA7 A;  2LX7 A;  2L3Q A;  1WLP B;  2DL5 A;  1QWE A;  2VWF A;  5FW9 A;  1AOJ A;  1X2Q A;  4D8D A;  1B07 A;  1SRM A;  2AZS A;  1U5S A;  4A63 B;  2BTT A;  2X3W D;  2GNC A;  4LUE A;  2AKL A;  1G2B A;  1QKX A;  1M3B A;  2EGA A;  2CT4 A;  2DL7 A;  2X3X D;  2JW4 A;  3NHN A;  2DVJ A;  4OML A;  2D8H A;  2LCS A;  3CQT A;  2LJ1 A;  1GBR A;  2DBM A;  1HSQ A;  1VA7 A;  4RTT A;  2JMC A;  2FPF A;  1SEM A;  1KSW A;  2F2W A;  2DIL A;  3H41 A; 
#chains in the Genus database with same CATH topology
 4HT9 A;  2P4R A;  4Y92 A;  1M9S A;  3M4Y A;  4JZ4 A;  2CP7 A;  1JXO A;  4KRT A;  1TTH B;  1NLP C;  1RAI B;  2GFA A;  2YLB A;  1QP2 A;  1VQO Q;  1QLY A;  2F5T X;  2EKH A;  4ZTF A;  3ZL7 C;  1OEB A;  4C8Q A;  4PJO D;  3CCR A;  2RK1 A;  3CCU A;  5GMK m;  2DVE A;  2ZPF B;  2D0N A;  2ZGW A;  3ULR B;  1YIJ A;  4BUG A;  1VQN Q;  3CPW P;  2RI3 A;  2GBQ A;  1IZ6 A;  2A3L A;  1JXM A;  1NPR A;  2F2V A;  2RI5 A;  5LJ5 j;  1GRI A;  1K73 U;  1PHT A;  1SSF A;  2RPN A;  3PFS A;  2JZ2 A;  4HCZ A;  2O9V A;  3MHX A;  1KD1 C;  1X2K A;  3MCA B;  1TS9 A;  1EFN A;  2XDB A;  3RER A;  2CKK A;  1RAA B;  2QAZ A;  3L2Q A;  3JCM Q;  3C12 A;  1UG1 A;  3DB3 A;  1D09 B;  4CI0 C;  2QQR A;  2OTJ Q;  4JJD A;  1KJW A;  4Q5W A;  3RIR A;  4QQD A;  1QKW A;  1KQS A;  1RAF B;  1NZ9 A;  4XTZ A;  2IVW A;  1C0M A;  1LJO A;  3QJ6 A;  3CC2 T;  1OYX A;  3L2Z A;  3U23 A;  1JU5 C;  1U3O A;  2J05 A;  1MGQ A;  3TU4 K;  2HL3 A;  3CMA A;  4FSS A;  2GQV A;  2K2V A;  2YLC A;  1R0B G;  2VYT A;  2YUQ A;  3RMQ A;  5GMK h;  3M53 A;  2KMT A;  2M9U A;  4XTV A;  3H9N A;  5HK3 A;  4O6J A;  1UTI A;  3REB B;  2KDS A;  2WSE E;  2CT3 A;  3QBY A;  2EQI A;  2QGF B;  1A0N B;  4BE1 A;  2HBP A;  1YHQ T;  3QG1 A;  1S1N A;  1TXQ A;  5GAO l;  2DA9 A;  4M4Z A;  2E65 A;  3JV3 A;  2NUP A;  2XHC A;  3BFM A;  1CSK A;  1D3B A;  2DEQ A;  1M8M A;  2DX1 A;  2EIF A;  5FWB A;  1AD5 A;  3VS0 A;  3CCQ T;  3QWX X;  4L59 A;  2F69 A;  2DTH A;  1B7T A;  2L3R A;  2CRE A;  2HQH A;  4AFQ C;  2E6N A;  4A4E A;  1VIE A;  3VKI A;  1VQ9 A;  4ZTJ A;  5D6X A;  4HCC A;  4KGX B;  2LCL A;  1X27 A;  4DEY A;  2K79 A;  1VQL A;  3GP8 A;  2OAU A;  1YIT A;  2ED0 A;  1UJY A;  1FMV A;  2IIM A;  5CKB A;  5GAN f;  3CCE A;  3SWN B;  3ZEH A;  3X28 B;  1AWJ A;  1M2V A;  4PJO G;  2XG8 D;  5FRN A;  1WJQ A;  5IXB A;  1M3A A;  3MP6 A;  2EKO A;  1YIJ Q;  3LGF A;  4KH0 B;  3F70 A;  1BU1 A;  4CC4 B;  3R6O A;  4J8O A;  2DL4 A;  3FB9 A;  4J9I A;  4DOV A;  4BI8 B;  4HCB A;  2K5L A;  3EHQ A;  4M7D F;  2PVO B;  1PKT A;  3TEE A;  2QYZ A;  5KYY A;  3OYF A;  4IKF A;  4M77 D;  4E7I A;  1KQS P;  1BBZ A;  4LD9 K;  1D0Z A;  2LDM A;  3QZ9 B;  4VUB A;  1WXT A;  2LJ3 A;  3M0Q A;  3BDU A;  3D7S B;  1Y7X A;  4PNO A;  4PLI A;  2MCN A;  2DIG A;  3I55 A;  1W4S A;  4IIO A;  1QWF A;  3TCJ A;  3EG1 A;  2Y4X A;  3V7C A;  1VQP A;  1M5Q 1;  3LX7 A;  5HCK A;  2NLU A;  3I5S A;  5J39 A;  3EFR A;  4AFS C;  3G7Z A;  5FRM A;  3SB2 A;  4J9B A;  3BDL A;  5CIU A;  1KK7 A;  2QQS A;  1S72 T;  3CCR T;  4F7U F;  1S72 Q;  3C0C A;  2BUD A;  3CPW A;  2O31 A;  2PVG B;  2YUP A;  2EJG A;  3PMT A;  4LDW A;  4MML A;  5D6Y A;  1D1B A;  4KH1 B;  1WHM A;  2PUO B;  4FU6 A;  2EQK A;  4HCK A;  1FX7 A;  2EJ9 A;  1X6G A;  2DXU A;  1YJN Q;  5CKF A;  2M51 A;  2RN8 A;  4C92 A;  3VS1 A;  2HNI A;  4DOW A;  1VQ6 Q;  2CP0 A;  5GAN g;  3FJ5 A;  2ZCF B;  1ZSG A;  3M56 A;  2YHT A;  4WF2 A;  2YRD A;  1TSF A;  3EG9 B;  1Y96 B;  4OB3 B;  1NPP A;  1X43 A;  3I55 Q;  1EX4 A;  1NE8 A;  3CMA T;  1QVF S;  3E1S A;  3JCM b;  2NUZ A;  4C92 C;  2O4X A;  1NEB A;  2FPD A;  3G6E Q;  2J06 A;  5CAI A;  3RR6 A;  4J9H A;  1SKU B;  2IG0 A;  1M90 C;  1VOM A;  4C0Z A;  2BZY A;  2VVK A;  2EPD A;  2J6K A;  1JJ2 A;  2H3E B;  4MDX A;  1Q81 C;  1K8A U;  5A0G A;  4OMM A;  2JS0 A;  4LDV A;  2C0T A;  2QI2 A;  2V8K A;  4JRI A;  2FO0 A;  1YJW Q;  1U8R A;  1UB4 A;  2V8I A;  3JCM X;  4PK4 A;  4JRP A;  1I5L A;  2RH2 A;  2O2O A;  5KYU A;  5LJ3 d;  5KYY B;  5KYX A;  5DLO A;  5HY6 A;  2FZC B;  4C8Q C;  5IXF A;  2X35 A;  1NJI R;  2D6F A;  1S72 A;  2KNB B;  5FLX E;  3M58 A;  3GNG A;  3DKM A;  5DY9 A;  2RF0 A;  1SPK A;  3FRN A;  4M77 C;  2KT1 A;  4M78 G;  4LDY A;  2KRN A;  1K0S A;  2YUO A;  1JJ2 S;  5CQX A;  5GAN 3;  2MYS A;  2RQU A;  3QWY A;  4FYV B;  1JB0 E;  1VQL T;  5GAM e;  1VQ8 A;  1U1S A;  3JRZ A;  2HQX A;  3WVE B;  1FXX A;  2DL8 A;  1B3Q A;  1N6A A;  2FL7 A;  3CME A;  4YTL A;  2QEX Q;  3G71 Q;  3G71 T;  3ME9 A;  1PSE A;  1MMN A;  4N4I A;  1BI2 A;  2A37 A;  3J80 E;  1Z9Q A;  3QYG B;  2O88 A;  2F2X A;  4ELZ C;  3NMZ C;  1AZE A;  2MAM A;  2CYZ B;  6AT1 B;  1SRL A;  4EMG A;  3RUX A;  1VQ4 Q;  3KFV A;  4ESR A;  1AWX A;  4M78 E;  2GQI A;  4FW2 A;  3CC2 A;  4EMH A;  4DBF A;  3JB9 I;  1U5S A;  2QK0 A;  2JVV A;  3EGX A;  2R5M A;  2AKL A;  3GNF B;  1QKX A;  2P0K A;  1Q81 R;  3JCM c;  2XKO C;  4UC4 A;  3L42 A;  2ZPG B;  1Y71 A;  4QKU A;  2DVJ A;  4OML A;  1YJ9 T;  5GAN 8;  4M7A D;  5FU7 B;  1QCN A;  5EG2 A;  3M5A A;  4M7D A;  1SEM A;  2F2W A;  3H41 A;  1U1T A;  3G71 A;  2XD0 A;  3J81 E;  5LJ3 f;  2DEU A;  1FWZ A;  5GAO m;  1VQO T;  1D0Y A;  1G5V A;  1W6X A;  4C92 E;  1IGQ A;  1IO6 A;  5GAN 2;  5KE2 A;  1E6H A;  1AVZ C;  3OBW A;  4M78 D;  3CME Q;  2COY A;  4ZN3 A;  2GFU A;  3VUB A;  5LJ3 e;  2EBP A;  4PJO A;  1SHF A;  1Q7Y R;  3FDR A;  1X01 A;  1YBY A;  4EMK A;  5LL6 S;  1RI9 A;  4XTY A;  4C92 B;  4LN2 A;  2LC4 A;  2RQR A;  2DRK A;  3OSV A;  3PGG A;  2DO3 A;  1I0C A;  2DNU A;  2SEM A;  2M02 A;  2DL3 A;  4C5G A;  4E7S A;  2M16 A;  4OMN A;  2L89 A;  1VQ9 Q;  4EDU A;  1OX8 A;  3TVT A;  2GTJ A;  1T0J A;  1Y96 A;  3V7R A;  3LWH A;  4A54 A;  3SD4 A;  4ZGE B;  3CCU T;  4V2S A;  4MZM A;  2O4X B;  1AWW A;  2JS2 A;  3FJP A;  4OGC A;  4BB7 A;  3JCM e;  3A8O B;  1B34 A;  1GCQ C;  3FIF A;  4B9W A;  3OYY A;  4M75 F;  3E2U A;  1H92 A;  2MF2 A;  4PJL A;  5IHN A;  1KIK A;  3BW1 A;  1IRX A;  1BYM A;  1CKA A;  4HVW A;  1M1K R;  1OZ2 A;  2R5A A;  2E41 A;  4AG1 C;  2LT4 A;  2MPX C;  1PSF A;  2CUB A;  1F1B B;  1N8R C;  1WZO A;  3CC7 Q;  2LNV A;  1OU9 A;  5CR2 A;  3OYG A;  1YJ9 Q;  1YI2 Q;  3EG2 A;  4PJO F;  4E7J A;  4M78 B;  4D6W A;  1VUB A;  2HEQ A;  3JAM E;  2E5K A;  4HKE A;  4DBH A;  4CC7 A;  4LE9 A;  2RHZ A;  2YRV A;  3LLR A;  1QW1 A;  4BI3 A;  2WAC A;  2D9T A;  2B86 A;  4M75 C;  4K11 A;  4M77 E;  1VQ8 T;  2OTL Q;  4M77 B;  4FYW B;  3UF4 A;  3EH2 A;  3VRZ A;  3EG3 A;  3OYB A;  3CCQ Q;  1KD1 U;  3JCM P;  1UGQ B;  2LZ6 B;  4LDU A;  1AT1 B;  2QDL A;  5CVI A;  2MMP A;  1Q86 R;  1KQ2 A;  1OUL A;  1IHW A;  3O8V A;  3MP1 A;  2E4H A;  2E12 A;  3C95 A;  4KBM B;  1K4U S;  2QG9 B;  5D7U A;  4MZP A;  1V29 B;  3WVD B;  5GAO r;  2C0O A;  3OS0 A;  4PJO B;  4X34 A;  1V1C A;  3N5B B;  1NJI U;  2YT6 A;  3TSZ A;  1GXI E;  4JS5 A;  3QII A;  3OY9 A;  1Q81 U;  3I9Q A;  4Z8A A;  1VQ5 A;  3EH1 A;  4OMF B;  4JUV A;  2KXC A;  2RJE A;  1VQ6 A;  4BE2 A;  3TSW A;  2EQM A;  1CKB A;  3PE0 A;  1VQK A;  3SEM A;  2O01 E;  2RHI A;  4BI4 A;  1Q7Y U;  1AZG B;  2FRY A;  4MDW A;  1YWO A;  4KUL A;  5LJ5 h;  4ATO A;  1GL5 A;  3S3O A;  5EC7 A;  2OTL A;  3G6E A;  3HSB A;  3VJP A;  3CCJ Q;  1VQM A;  2DXT A;  4DQ2 A;  4HXJ A;  1V76 A;  2K3X A;  1GCQ A;  2E1H A;  4ZNX A;  4JJN K;  4FL6 A;  3CC7 A;  2BIV A;  2C0I A;  4KUI A;  1QVG S;  1IXD A;  1TUG B;  2EQJ A;  2KE9 A;  5FU6 B;  2L3S A;  4PLL A;  1WXB A;  1HD3 A;  3QO3 A;  1GFD A;  5J26 A;  1W2B A;  2KAF A;  1T3S A;  3JSC A;  3M4G A;  3M0R A;  4OF1 A;  3LH5 A;  1UGR B;  3JCM d;  1OU8 A;  4QVC A;  3NTH A;  2P0Q A;  5A0L A;  2JXB A;  1WDX A;  1ZBJ A;  1ABQ A;  1PCX A;  4OMQ A;  1VQ5 Q;  4DEX A;  5GAN e;  3PVL A;  1KHI A;  3BY7 A;  3G4S Q;  1VQP T;  3JCM W;  2VB6 A;  2DE0 X;  2DBK A;  2AK5 A;  3VYG A;  3PTA A;  3A8L B;  3CXC P;  1I8F A;  3UPU A;  1QQJ A;  3OYH A;  5I11 A;  1NM7 A;  2DK3 A;  2JT4 A;  5LJ3 j;  1XNI A;  2QXF A;  2ZZD A;  2RO0 A;  1VQ6 T;  4XTW A;  2XU8 A;  2PVD B;  4IUR A;  1R8O B;  3EFO B;  5KE3 A;  2QEX A;  2KSS A;  1BK2 A;  1Q82 C;  2FYK A;  4RCC A;  4NL2 A;  2EFI A;  3OYM A;  5CCA A;  1HXD A;  1G3W A;  3CXC A;  1ZHI A;  2CP2 A;  3OB9 A;  4FT2 A;  3UWN A;  3CME T;  2XDD A;  1M2O A;  1BI0 A;  3LW5 E;  3NGP A;  3CD6 Q;  3OYJ A;  2RD1 A;  1UGV A;  2L0A A;  1NYG A;  3M0U A;  1K9A A;  4R56 A;  1K73 R;  2K3B A;  4NS5 A;  2ZPI B;  2YXY A;  4FT4 A;  2K7A A;  1KG1 A;  3S3M A;  1FMK A;  1W2B P;  4BDZ A;  4E7K A;  4OMO A;  2BZX A;  2OAW A;  4C0D B;  1YCS B;  4J9E A;  3S6W A;  3ZBD A;  3I5R A;  1ARK A;  4XTU A;  1TU0 B;  2CH4 W;  1K8A C;  2DPP B;  1JEG A;  4EPC A;  1VQ7 Q;  4MMK A;  4FSX A;  5AT1 B;  4D8K A;  2LT1 A;  1BCO A;  2GGR A;  3X20 B;  5KCO A;  2FPE A;  1M4Z A;  2XI9 A;  1ZSZ A;  1ZSZ B;  4QQ6 A;  3KBG A;  2HSP A;  2NWM A;  3MEV A;  1D3B B;  2G3R A;  2ED1 A;  5KH6 A;  4A4H A;  1RUW A;  1MV3 A;  1WPY A;  1YNZ A;  4QQG A;  4M7D D;  1WHG A;  3MKD A;  2XK0 A;  3SDZ A;  4OB2 B;  3CD6 T;  2ZPE B;  2RJC A;  1TUC A;  2RK2 A;  2RJF A;  1EZZ B;  2KXD A;  1BI1 A;  2GTO A;  2AIR B;  4J9G A;  4RCB A;  5I22 A;  1PNJ A;  3E19 A;  1ZX6 A;  1D1A A;  1WI7 A;  1UFF A;  5L8R E;  5GAO n;  3QDF A;  2PZ1 A;  1Q82 R;  2LJ0 A;  1AEY A;  2OX7 A;  2DD4 A;  1YHQ A;  4DBR A;  1Q86 U;  2HZY A;  2CZ0 B;  1NJI C;  3PIO A;  1QWE A;  2VWF A;  1AOJ A;  4D8D A;  2X51 A;  2DZC A;  1SRM A;  1Y07 A;  1OQK A;  4GLK A;  4M75 A;  4NOY A;  2BTT A;  3GF5 A;  2X3W D;  2GNC A;  1G2B A;  1K9M R;  1KHC A;  1N9R A;  2EGA A;  1RAC B;  2YRC A;  2OTJ A;  1NBE B;  2CP6 A;  3NHN A;  4PJN A;  2P84 A;  4J7I A;  1O75 A;  2D8H A;  2LCS A;  2VXE A;  2LJ1 A;  2VGM A;  2DBM A;  4ME7 A;  1GBR A;  3OYK A;  3DB4 A;  4RTT A;  2JMC A;  3EFO A;  4J7F A;  3CCQ A;  3UDC A;  3ASK A;  1YIT T;  2LTO A;  2MOX A;  3CCM T;  5C0M A;  5FU6 C;  5GAN d;  2E70 A;  2B8A A;  1OOT A;  5GJV B;  4C8Q D;  3HTR A;  1VYT A;  3VRY A;  2E3I A;  4J9C A;  1YI2 A;  4C5H A;  4QVD A;  3V8L A;  1VQL Q;  3OYC A;  2HL5 C;  2RHX A;  2DYI A;  4J6X A;  2J7I A;  4BDY A;  1BB9 A;  2R57 A;  1XQH A;  4JJB A;  3C94 A;  2D8J A;  1PM3 A;  2KT8 A;  2WSF E;  3OYD A;  2FB7 A;  1T3L A;  2CP5 A;  2LQW A;  2EYW A;  5IAY A;  2FZK B;  2FEI A;  4J9D A;  1MNE A;  1QCO A;  4IIM A;  2FRW A;  4F16 A;  2DKG A;  2HMA A;  1KQS S;  2RA2 A;  1YFN A;  4RTX A;  1H3Z A;  5LJ3 g;  3URG A;  4J83 A;  3CC4 Q;  2DM1 A;  1MHN A;  1NG2 A;  4M7A G;  1WHJ A;  3EGD A;  4F17 A;  2KI7 A;  2Y4Y A;  2ZAE A;  3RES A;  4XK8 E;  1MND A;  1YCY A;  3G4S T;  1VQP Q;  3O5Z A;  3CCL T;  3A5Z B;  4PFP A;  1KC8 R;  2DER A;  1HK9 A;  3CCE Q;  2BE9 B;  3QSU A;  4M7D G;  3A8G B;  2KRS A;  4LNP A;  4C0D C;  3CBO A;  4KT0 E;  2V26 A;  1IGU A;  4XU2 A;  4EMK B;  1H8K A;  4ZN1 A;  2AKK A;  3CEY A;  1R0C B;  1SHG A;  4M7A C;  4IUV A;  3GOX A;  1RAE B;  2DZ9 A;  5LJ5 g;  1YHQ Q;  2Z0W A;  3MJX A;  4E6R A;  1M1G A;  7AT1 B;  3RKW A;  5D6W A;  1RLP C;  2KR3 A;  3WXM B;  3QPH A;  2JM9 A;  1X6B A;  1BCM A;  3H0H A;  1PG5 B;  1H3H A;  3PNW C;  3RDV A;  2PUK B;  1YWP A;  2I0N A;  2HBW A;  3M9Q A;  2QDY B;  4F04 B;  4A4K A;  2BZ8 A;  2K2M A;  1Q82 U;  4M7A F;  2RB6 A;  1VQO A;  2HAX A;  4LDX A;  3H0I A;  2LP5 A;  2CZ7 B;  1QVF P;  1M3C A;  1XOV A;  2NUT A;  4XU3 A;  4BAC A;  3OW2 A;  2LQN A;  3VS2 A;  1M30 A;  4GY5 A;  1M1K C;  3CXC S;  3CC4 A;  2K6D A;  4JDS A;  1HYO A;  1OX9 A;  1UGP B;  2JN0 A;  4Z89 A;  5KYU B;  1B34 B;  1SSH A;  2H3J A;  1P92 A;  3NFC A;  1N8R R;  1G8X A;  4KGV B;  5CQY A;  5KCH A;  3PIP A;  1I5O B;  1WJS A;  2JNG A;  2MIO A;  1VYV A;  4ELY C;  3OW2 P;  2DJQ A;  1JBM A;  4PL6 A;  1QVF A;  3OQ5 A;  1K0X A;  4IUP A;  4DA4 A;  3JCM J;  3EG0 A;  2ESW A;  3NPF A;  4X9C A;  2KY9 A;  3X24 B;  3THK A;  3H6Z A;  2Y90 A;  2QTV A;  3VS3 A;  2RHU A;  2MWO A;  3A8M B;  4C0F A;  2A36 A;  4OVA A;  2RQW A;  1W70 A;  3VV0 A;  2A28 A;  1MMD A;  2KYB A;  2MI6 A;  3KUF A;  4BY6 B;  1ABO A;  1JRI A;  2VGN A;  1W2B S;  2CDT A;  2DTO A;  3MET A;  3P8H A;  1N5Z A;  2DJZ A;  1ZQ1 A;  2X4W A;  1LCK A;  3QKJ A;  3VUZ A;  2DD5 A;  2M0O A;  1OV3 A;  2EWN A;  2QQ9 A;  5GMK j;  3RKY A;  3OMC A;  2X9H A;  4E7Z A;  2KK4 A;  1RLQ C;  2RM4 A;  3EAE A;  5ECA A;  1D0X A;  1QMC A;  2JTM A;  4C5I A;  1SF9 A;  1TUD A;  2D1X A;  3CC7 T;  1LPL A;  3CCE T;  1G3Y A;  3L2W A;  1E7O A;  3HPW A;  2VUB A;  2K57 A;  3EHR A;  5CKE A;  2QA4 Q;  4HVU A;  3REA B;  2BKD N;  3M0P A;  5HK0 A;  1SG5 A;  1KFZ A;  2G6F X;  3UT1 A;  2VAS A;  1LVK A;  4C92 D;  2CH4 A;  4CRI A;  1QP3 A;  5DLQ E;  5LJ3 h;  1UDL A;  3EG9 A;  3EGX B;  2L8D A;  3VYH B;  1NLO C;  3M0S A;  2YWW A;  1PD0 A;  4PJO E;  4M7A B;  2C06 A;  1RL2 A;  4M7A E;  4F14 A;  1WFW A;  1WGS A;  4C92 F;  4F7U A;  4PFZ A;  3UAT A;  3V8J A;  1NYF A;  3OYN A;  3AHU A;  1O9S A;  2X4Y A;  2KYM A;  3JB9 J;  4RTU A;  2NUT B;  1GCP A;  1KC8 C;  1AHJ B;  2HCK A;  2DYB A;  2H8H A;  4JJC A;  2VKN A;  4M77 F;  1Q95 G;  2LX9 A;  2DAQ A;  5KYW A;  3OYL A;  5KYW B;  4JS4 A;  3MEA A;  1Z9Z A;  1ZUK A;  2VXF A;  3L1A A;  1BIB A;  1N27 A;  4IUT A;  1PD1 A;  1PRM C;  3M0T A;  3JCM V;  3VS6 A;  2K3Y A;  2CZ6 B;  4PJO C;  2LRQ A;  1W1F A;  2QTX A;  3P8D A;  4M75 E;  1WXU A;  1T0H A;  3SHW A;  3E9G A;  1OPK A;  2DFU A;  4RTY A;  3GBQ A;  1YJN A;  3G6E T;  2DTI A;  4X9D A;  5GAO q;  1WQ7 A;  8AT1 B;  1GBQ A;  4KUD K;  3CBM A;  1Q7Y C;  4ANJ A;  3I56 T;  3L2U A;  2JOY A;  1ZA2 B;  4Z02 A;  4ZGJ B;  1J3T A;  4N4G A;  2AHJ B;  2EGE A;  2EYY A;  3CCS Q;  4RG8 A;  2E64 A;  4RG2 A;  5IH2 A;  3VS7 A;  3I55 T;  4RMO A;  1R77 A;  1ZUY A;  2P0P A;  3PT9 A;  5DM7 R;  2RMO A;  3X26 B;  3QUI A;  2LCC A;  3CCU Q;  3UA7 A;  5GAO p;  2QA4 A;  4M77 G;  4GLM A;  4OB1 B;  2A08 A;  3G4S A;  1XTD A;  1LNX A;  2DXC A;  2EQU A;  4ZGD B;  1UHC A;  2LX7 A;  2L3Q A;  2P4T A;  1WLP B;  1VQ7 T;  4C8Q E;  4B6M A;  3C4S A;  3EGD B;  1B07 A;  3Q1J A;  4N4H A;  3SWN C;  4A63 B;  4A53 A;  1VQ9 T;  1DJ7 B;  4LUE A;  1MMG A;  2GCX A;  4J6Y A;  4FM4 B;  2FZG B;  2CT4 A;  3HL8 A;  1BKB A;  4IUU A;  4M7A A;  1ZSZ C;  2E3H A;  1G3S A;  3CQT A;  5C6S A;  5GAN 7;  3QHS A;  2F1L A;  2FPF A;  3OYI A;  1KSW A;  3CCM Q;  1YIT Q;  1YIJ T;  2E5Q A;  2V8J A;  3HFN A;  1EIF A;  1XJW B;  1AWO A;  2HKQ B;  3CCL Q;  1K76 A;  4IUQ A;  3A98 A;  2EVR A;  2YSQ A;  5I2M A;  4II1 A;  2DIQ A;  1NEG A;  5CO7 A;  3NTI A;  1K1Z A;  4OB0 B;  1YJW A;  1UEC A;  2ROL A;  3VS5 A;  3LGL A;  4JPB W;  2ABL A;  4TVR A;  4E2F B;  2XDP A;  3MO8 A;  4L5G A;  2EJF A;  1RAH B;  2LVM A;  4M75 B;  2M0Y A;  1G3T A;  4F7U E;  2BE7 D;  1WQW A;  5LJ5 d;  3V8K A;  2NUP B;  2RNA A;  1JQQ A;  2ROT A;  1K9M C;  2KRO A;  1JJ2 P;  1K73 C;  1RAB B;  1UE9 A;  2WSC E;  1M2V B;  1M27 C;  3RKX A;  5IN1 A;  3H8Z A;  1I81 A;  5FU7 C;  4C8Q G;  2OJ2 A;  3MP8 A;  2RJD A;  5IT9 E;  3CBP A;  3OW2 S;  4M75 D;  2K5F A;  1QVG P;  3QJY A;  4P5N A;  1WIE A;  4B9X A;  1YP5 A;  1MMA A;  5I2S A;  3OS5 A;  2JJ9 A;  3OSS C;  2ZPB B;  2COW A;  3E9F A;  3TRE A;  2FVU A;  4NL3 A;  5L23 A;  5FWC A;  1YI2 T;  4M78 A;  4A4G A;  4HA8 A;  4Y91 A;  3INZ A;  2QQB A;  5FRO A;  2K9G A;  3CCV Q;  4J9F A;  3I56 Q;  1GFC A;  1G83 A;  1WNL A;  1I4K 1;  4KGZ B;  5GAM h;  1VQM Q;  4L6V 5;  3RMS A;  4J6W A;  2HD0 A;  2XMF A;  2JMA A;  2EAY A;  2GF7 A;  4M78 F;  2L3P A;  2J6O A;  1N9S A;  5GMK i;  3HRT A;  4DBQ A;  4PFO A;  2KRM A;  3TQ7 P;  1UJ0 A;  3CPW S;  1TOV A;  3A8H B;  4XTX A;  1I07 A;  2JM8 A;  4FW1 A;  1WJR A;  3DLM A;  4E7H A;  2J6F A;  4N0A A;  4XQ3 A;  3HKS A;  4HT8 A;  2HQE A;  2QGG A;  3HHT B;  4C5E A;  1HJD A;  2XIC A;  2MK5 A;  1OI1 A;  5IHK A;  4JRQ A;  2OTJ T;  2QAS A;  3QZ5 B;  3OA6 A;  1TG0 A;  3VS4 A;  1RAG B;  3CCM A;  4LD6 A;  2KEA A;  1IHV A;  4M77 A;  1KC8 U;  1M90 R;  3GIB A;  1QCF A;  5GAM j;  2FG0 A;  3X25 B;  2QA4 T;  1ZUU A;  1X6O A;  5CK9 A;  4OMP A;  1YJ9 A;  4M7D B;  5AYF A;  2AZV A;  3CCV T;  3J7A F;  1KQ1 A;  4M78 C;  1VQM T;  2YDL A;  4XU0 A;  1H64 1;  4OGE A;  3A1P A;  5J3B A;  3M55 A;  4AFZ C;  5GAM d;  2RI2 A;  2K5I A;  2DRM A;  4CC2 A;  1FYN A;  2VV5 A;  2A0F B;  1VQ7 A;  1C1A A;  5GMK l;  1M1F A;  3OBY A;  4PKC C;  5HKC A;  3PVQ A;  3AT1 B;  3QXE B;  3JB9 F;  4RKU E;  2SRC A;  4F7U B;  1TH7 A;  4AG2 C;  3OS1 A;  4R55 A;  5I21 A;  2CSI A;  4AFU C;  4C8Q F;  1BIA A;  1WYX A;  2KBT A;  3OYA A;  3NTK A;  2LQ8 A;  1WX6 A;  2DXB A;  2PU9 B;  2A7Y A;  3FLG A;  3HRS A;  4Y28 E;  1VYU A;  3JB9 D;  3IQL A;  1X75 C;  4GBQ A;  1RAD B;  1Y0M A;  3CD6 A;  2K4Y A;  2CGH A;  3SWN A;  1OZ3 A;  1D1C A;  2JUF A;  5LJ5 f;  2ECZ A;  4QW2 A;  3CCS A;  2LMJ A;  1K8A R;  1N8R U;  2V1Q A;  1JO8 A;  3H0F A;  2EYX A;  4LXC A;  4RTZ A;  2PTK A;  3M54 A;  1TWB A;  3EGU A;  1YJW T;  3OMG A;  5LJ5 e;  4WCI A;  4J5Y A;  4F7U G;  1IRE B;  3I56 A;  2QQA A;  1QVP A;  4C8Q B;  4ORZ A;  4PJM A;  3CC2 Q;  2HDA A;  5M9O A;  5A2Q E;  3G1J A;  1PRL C;  2W10 A;  3HP9 A;  4HVV A;  1UUE A;  4RTV A;  4BD3 A;  1UHF A;  1I1J A;  4JLG A;  2X4J A;  1YJN T;  4Z88 A;  5IHI A;  4EIK A;  2HSE B;  2L5Q A;  2V1R A;  3CCJ T;  1VQ4 A;  3JB9 H;  4R0K A;  2CP3 A;  2LQK A;  4FYY B;  1VQK Q;  2XID A;  2ENM A;  3LWI A;  5CKH A;  3ER0 A;  5GAM f;  3R6N A;  3CCS T;  4RTW A;  2I2L A;  4AMC A;  1MV0 B;  2CSQ A;  2W0Z A;  4EMK C;  4XU1 A;  1UEB A;  2RQT A;  1LOJ A;  3UA6 A;  1ACM B;  3RBB B;  4CC3 A;  2L2P A;  3KXT A;  2O9S A;  5CKD A;  1VQ8 Q;  2OTL T;  3I35 A;  3EFS A;  3MEU A;  3BE3 A;  2QEX T;  3JB9 G;  5GAN 4;  4FIB A;  2IPO B;  2R58 A;  4AT1 B;  1BI3 A;  1MUZ A;  2DMO A;  2E10 A;  2YUN A;  4O5V A;  3CCR Q;  3M57 A;  1KD1 R;  1VIF A;  4A4F A;  2ZPH B;  1UGS B;  1WHK A;  2EYZ A;  5KYN A;  3L2R A;  4X1V A;  1YN8 A;  1OPL A;  2CS7 A;  3RNJ A;  3M59 A;  4C92 G;  3CCJ A;  1VQ4 T;  4WTO B;  2PNI A;  2EGC A;  1FMW A;  1E6G A;  3CC4 T;  2DET A;  1C6V X;  1WHH A;  1VQN A;  4JRK A;  1M8V A;  3V7S A;  5GAN j;  2KQW A;  1VQ5 T;  2EW3 A;  1M1K U;  2DLP A;  4N0A C;  2OI3 A;  1U06 A;  1K9M U;  3QDR B;  4C0G A;  1RI0 A;  4M7D C;  2M1H A;  1IB8 A;  5GMK e;  2PQW A;  1ZLM A;  4FYX B;  2KGT A;  3GPL A;  4OP0 A;  3PMI A;  3OYE A;  2X4X A;  2EYQ A;  3JCM g;  5A0D A;  2KVQ G;  5GAM g;  1PWT A;  1VQN T;  3HRU A;  1X69 A;  3DLL A;  4QT7 A;  2F5K A;  1Y57 A;  2HKN A;  2JTE A;  3CPF A;  3GLX A;  1PKS A;  2JTF A;  3JCM h;  4PJJ A;  1WHL A;  9ATC B;  3CCL A;  1QVG A;  3MEW A;  1ZBX A;  2FHD A;  2D0Q B;  5GJW B;  3CMA Q;  1Q86 C;  4FCY A;  4M7D E;  4JZ3 A;  2CUD A;  1PC0 A;  2DF6 A;  5KYX B;  3LYI A;  4E7L A;  2MWP A;  4RUG A;  4BY6 C;  2CZ1 B;  4LUD A;  3ZFJ A;  4M75 G;  2ATC B;  2E6Z A;  2RQV A;  2LNH B;  2COZ A;  1WA7 A;  3T9N A;  3P8B B;  4JLI A;  4MZT A;  3HFO A;  4XAX B;  2DL5 A;  5FW9 A;  1X2Q A;  3SFM A;  3CCV A;  3LH0 A;  2AZS A;  3JCM f;  3FC3 A;  1M3B A;  1ZA1 B;  2DL7 A;  1M90 U;  2X3X D;  2JW4 A;  3MPU B;  5GAN 6;  2RHY A;  4E47 A;  5GAN h;  5GAN 5;  2VC8 A;  3L2V A;  1HSQ A;  1VA7 A;  3QYH B;  3S3N A;  2AT1 B;  2NYS A;  3FEO A;  3VU3 C;  3OS2 A;  4BE0 A;  4QVZ A;  2DIL A;  8ATC B;  1VQK T; 
#chains in the Genus database with same CATH homology
 2MOX A;  2P4R A;  4Y92 A;  4JZ4 A;  1JXO A;  4KRT A;  1AWO A;  1NLP C;  1K76 A;  1OOT A;  5GJV B;  3A98 A;  1QLY A;  2EVR A;  2YSQ A;  1VYT A;  3VRY A;  1W6X A;  2EKH A;  1IO6 A;  3ZL7 C;  4J9C A;  1OEB A;  1NEG A;  1E6H A;  1K1Z A;  1AVZ C;  1UEC A;  2D0N A;  2EBP A;  1SHF A;  3ULR B;  2ROL A;  3VS5 A;  4JPB W;  2ABL A;  2J7I A;  2GBQ A;  1RI9 A;  1BB9 A;  4JJB A;  4LN2 A;  1JXM A;  2RQR A;  2DRK A;  2F2V A;  1I0C A;  2DNU A;  2D8J A;  2SEM A;  2DL3 A;  1GRI A;  4OMN A;  2KT8 A;  1PHT A;  2RPN A;  2M0Y A;  2O9V A;  3TVT A;  1T3L A;  1T0J A;  2GTJ A;  2LQW A;  2EYW A;  2FEI A;  4J9D A;  2RNA A;  1JQQ A;  1AWW A;  1X2K A;  2ROT A;  4IIM A;  2FRW A;  2JS2 A;  4F16 A;  2KRO A;  1EFN A;  4RTX A;  1GCQ C;  2DM1 A;  1UE9 A;  1M27 C;  1NG2 A;  1H92 A;  5IHN A;  1KIK A;  4F17 A;  1UG1 A;  2OJ2 A;  4JJD A;  1KJW A;  1CKA A;  3O5Z A;  1WIE A;  4HVW A;  1QKW A;  4AG1 C;  1YP5 A;  2CUB A;  3U23 A;  1JU5 C;  1U3O A;  2J05 A;  5L23 A;  2KRS A;  3EG2 A;  4LNP A;  5FWC A;  4FSS A;  2YUQ A;  1H8K A;  2HEQ A;  2K9G A;  2E5K A;  4J9F A;  1GFC A;  1G83 A;  2AKK A;  1UTI A;  3REB B;  1SHG A;  4CC7 A;  2CT3 A;  4LE9 A;  2EQI A;  1A0N B;  2XMF A;  4E6R A;  1S1N A;  2JMA A;  2DA9 A;  4M4Z A;  3JV3 A;  1RLP C;  2B86 A;  2KR3 A;  2L3P A;  4K11 A;  2J6O A;  1CSK A;  2JM9 A;  1M8M A;  3UF4 A;  2DX1 A;  3VRZ A;  5FWB A;  1X6B A;  3EG3 A;  1AD5 A;  3H0H A;  2KRM A;  1H3H A;  1UJ0 A;  3VS0 A;  3QWX X;  2LZ6 B;  1I07 A;  1YWP A;  2JM8 A;  2QDL A;  2CRE A;  4AFQ C;  2I0N A;  2HBW A;  2J6F A;  2BZ8 A;  2K2M A;  3H0I A;  2LP5 A;  1HJD A;  1M3C A;  1X27 A;  1XOV A;  5IHK A;  4DEY A;  1TG0 A;  3VS4 A;  2K79 A;  2LQN A;  3VS2 A;  1K4U S;  1M30 A;  2ED0 A;  2KEA A;  1UJY A;  2K6D A;  4Z89 A;  2IIM A;  2C0O A;  1SSH A;  1QCF A;  1V1C A;  2FG0 A;  2YT6 A;  3TSZ A;  1ZUU A;  4OMP A;  1AWJ A;  2AZV A;  3I9Q A;  2MIO A;  4Z8A A;  5IXB A;  1M3A A;  1VYV A;  2KXC A;  2DJQ A;  2YDL A;  3TSW A;  1K0X A;  1BU1 A;  4CC4 B;  3PE0 A;  1CKB A;  2DL4 A;  3EG0 A;  3SEM A;  2ESW A;  4J9I A;  3NPF A;  4AFZ C;  1AZG B;  2DRM A;  2FRY A;  3THK A;  4CC2 A;  1FYN A;  3EHQ A;  1PKT A;  1YWO A;  1GL5 A;  5EC7 A;  3VS3 A;  3PVQ A;  1BBZ A;  2SRC A;  2A36 A;  4HXJ A;  4AG2 C;  2RQW A;  1W70 A;  1WXT A;  1GCQ A;  2LJ3 A;  2A28 A;  3M0Q A;  2CSI A;  4ZNX A;  2KYB A;  4AFU C;  1ABO A;  1WYX A;  2MCN A;  2KBT A;  4IIO A;  1QWF A;  2CDT A;  2C0I A;  1WX6 A;  3EG1 A;  1N5Z A;  2KE9 A;  1VYU A;  2L3S A;  3IQL A;  1WXB A;  1HD3 A;  4GBQ A;  1LCK A;  1Y0M A;  5HCK A;  1GFD A;  1T3S A;  2ECZ A;  3M0R A;  1OV3 A;  3LH5 A;  2LMJ A;  3I5S A;  4AFS C;  2V1Q A;  1JO8 A;  3H0F A;  2EYX A;  4RTZ A;  2PTK A;  4J9B A;  2JXB A;  1WDX A;  1ZBJ A;  1ABQ A;  4OMQ A;  1RLQ C;  3EGU A;  4DEX A;  3PVL A;  3C0C A;  4WCI A;  2DE0 X;  5ECA A;  2DBK A;  2AK5 A;  4ORZ A;  2O31 A;  2YUP A;  1TUD A;  2D1X A;  2HDA A;  1PRL C;  2W10 A;  4HVV A;  5I11 A;  1NM7 A;  1E7O A;  1UUE A;  4RTV A;  4HCK A;  2JT4 A;  1X6G A;  3EHR A;  4HVU A;  1UHF A;  1I1J A;  3REA B;  2M51 A;  2RN8 A;  4Z88 A;  5IHI A;  3M0P A;  4EIK A;  3VS1 A;  1KFZ A;  2V1R A;  2G6F X;  4R0K A;  3FJ5 A;  1ZSG A;  2CH4 A;  2ENM A;  1BK2 A;  3R6N A;  4RTW A;  1UDL A;  1X43 A;  1MV0 B;  2CSQ A;  2W0Z A;  2NUZ A;  1NEB A;  2RQT A;  3UA6 A;  1NLO C;  2FPD A;  3M0S A;  3RBB B;  2J06 A;  4CC3 A;  2L2P A;  2O9S A;  4J9H A;  2BZY A;  4F14 A;  1WFW A;  3I35 A;  3NGP A;  3UAT A;  1UGV A;  1NYF A;  2L0A A;  2VVK A;  1NYG A;  2EPD A;  3M0U A;  2J6K A;  2KYM A;  1K9A A;  4OMM A;  2JS0 A;  2K3B A;  1MUZ A;  2DMO A;  2YUN A;  4RTU A;  2C0T A;  2K7A A;  2FO0 A;  1GCP A;  1FMK A;  2HCK A;  2DYB A;  2H8H A;  2EYZ A;  4JJC A;  4OMO A;  2BZX A;  2VKN A;  2OAW A;  2O2O A;  4X1V A;  1YCS B;  4J9E A;  1YN8 A;  3I5R A;  1OPL A;  3RNJ A;  1ARK A;  2CH4 W;  2PNI A;  2EGC A;  1Z9Z A;  1E6G A;  1ZUK A;  5IXF A;  1JEG A;  2KNB B;  1PRM C;  3M0T A;  3VS6 A;  2EW3 A;  4D8K A;  2GGR A;  2FPE A;  2DLP A;  1W1F A;  2OI3 A;  1U06 A;  1WXU A;  2RF0 A;  1T0H A;  3SHW A;  1SPK A;  1OPK A;  2KT1 A;  2KRN A;  4RTY A;  2HSP A;  3GBQ A;  1K0S A;  2NWM A;  1ZLM A;  2YUO A;  2KGT A;  2ED1 A;  1RUW A;  2RQU A;  1MV3 A;  3QWY A;  1GBQ A;  1YNZ A;  1PWT A;  1X69 A;  2DL8 A;  1B3Q A;  1TUC A;  4QT7 A;  1Y57 A;  2KXD A;  2JTE A;  2GTO A;  1PKS A;  1J3T A;  4J9G A;  2EGE A;  2EYY A;  5I22 A;  2A37 A;  1PNJ A;  5IH2 A;  3VS7 A;  1Z9Q A;  2O88 A;  2F2X A;  5GJW B;  1ZUY A;  1ZX6 A;  2RMO A;  1WI7 A;  1UFF A;  3NMZ C;  1AZE A;  4JZ3 A;  1SRL A;  2CUD A;  3UA7 A;  2DF6 A;  4GLM A;  2A08 A;  2PZ1 A;  4RUG A;  3KFV A;  2LJ0 A;  4ESR A;  1AWX A;  4LUD A;  1AEY A;  2RQV A;  2GQI A;  2LNH B;  1UHC A;  1WA7 A;  2LX7 A;  2L3Q A;  1WLP B;  2DL5 A;  1QWE A;  2VWF A;  5FW9 A;  1AOJ A;  1X2Q A;  4D8D A;  1B07 A;  1SRM A;  2AZS A;  1U5S A;  4A63 B;  2BTT A;  2X3W D;  2GNC A;  4LUE A;  2AKL A;  1G2B A;  1QKX A;  1M3B A;  2EGA A;  2CT4 A;  2DL7 A;  2X3X D;  2JW4 A;  3NHN A;  2DVJ A;  4OML A;  2D8H A;  2LCS A;  3CQT A;  2LJ1 A;  1GBR A;  2DBM A;  1HSQ A;  1VA7 A;  4RTT A;  2JMC A;  2FPF A;  1SEM A;  1KSW A;  2F2W A;  2DIL A;  3H41 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...