2DBMA

Solution structures of the sh3 domain of human sh3-containing grb2-like protein 2
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
73
structure length
73
Chain Sequence
GSSGSSGPCCRALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLHGHSGFFPINYVEILVALPHSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SH3-containing GRB2-like protein 2
publication title Solution structures of the SH3 domain of human SH3-containing GRB2-like protein 2
rcsb
source organism Homo sapiens
molecule tags Transferase, signaling protein
total genus 5
structure length 73
sequence length 73
ec nomenclature ec 2.3.1.-:
pdb deposition date 2005-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dbmA00
1K76A 2HEQA 1T3LA 1SSHA 1X6GA 2RQTA 4AFSC 2CT3A 2EYWA 3VRZA 4OMPA 2ED0A 2FPDA 1OPKA 2L3PA 4RTWA 4GBQA 1X69A 1K0XA 4JJCA 1RI9A 3I5RA 2F2WA 1HD3A 2YUPA 1U06A 3EG2A 1KFZA 1I0CA 2A08A 4K11A 1W1FA 1AOJA 1AD5A 2GTOA 2L3QA 2L3SA 2DL7A 3A98A 1WXTA 2EKHA 3VRYA 2HDAA 4HXJA 2ESWA 3NMZC 4RTUA 4OMOA 1X43A 3U23A 3M0TA 2M0YA 1S1NA 1MUZA 5HCKA 1K9AA 2KT1A 1KJWA 1M3CA 1CKAA 2W10A 1BU1A 3H0IA 1PNJA 1ZLMA 2EGCA 2LQWA 2K3BA 1PKSA 2ABLA 4CC2A 4J9CA 1AWOA 1YN8A 2GGRA 1HSQA 3EG3A 4M4ZA 2JTEA 4FSSA 2D8JA 2KRNA 1JQQA 2F2XA 1BK2A 1PHTA 1QWEA 1GL5A 1I07A 4QT7A 2LJ1A 4JJBA 1SRLA 1AZGB 1Z9ZA 1M30A 3SHWA 1VYUA 1W6XA 2FEIA 1PRLC 2P4RA 1W70A 1GCQA 2DRKA 2EVRA 1AWWA 2L0AA 4IIOA 2K2MA 3FJ5A 4RTTA 1UDLA 1VYVA 4LN2A 5IH2A 2D8HA 2KXDA 1JXMA 4F16A 1SRMA 2MIOA 2KBTA 4CC3A 2FO0A 4D8DA 2RQVA 1YP5A 2EYXA 2DVJA 2E5KA 4LNPA 4DEYA 2JT4A 1ZUYA 3VS0A 1YWOA 2HSPA 2CUDA 2GTJA 2K7AA 1NEGA 2O2OA 2JXBA 4AFZC 2LZ6B 1UUEA 1WDXA 2DF6A 1WX6A 3QWYA 4OMLA 1UHFA 4J9HA 4IIMA 2LQNA 2LCSA 1JEGA 4J9BA 1NM7A 1NG2A 4Y92A 2ROTA 2CUBA 2W0ZA 3CQTA 3EG0A 3NHNA 2AZSA 1UJ0A 1RLQC 2GBQA 2LJ3A 3ULRB 2JMAA 1ZBJA 2OI3A 2YDLA 2FG0A 3GBQA 1G83A 3PVQA 2ED1A 1TG0A 2DL3A 1TUCA 2DMOA 1AEYA 5IXBA 3EHQA 3I35A 1X2QA 3SEMA 2NUZA 2EQIA 1YNZA 1G2BA 2RN8A 1K1ZA 4J9FA 3REBB 3VS3A 1J3TA 2NWMA 1NLOC 5FW9A 2CREA 1RUWA 1QCFA 4GLMA 2D1XA 1JO8A 1ZSGA 2YUNA 4OMQA 4LUEA 1GFCA 2YUOA 1QKXA 2JS0A 2G6FX 3THKA 4JJDA 2JMCA 2KEAA 2J06A 3M0QA 3ZL7C 1VYTA 4J9DA 3I9QA 3M0SA 1AWXA 2BZXA 2GNCA 1FMKA 1ABOA 1FYNA 2DYBA 2ENMA 1UFFA 2BTTA 2F2VA 2ROLA 1VA7A 2RMOA 2AZVA 2DA9A 1U5SA 2KR3A 1UG1A 2V1QA 5IXFA 1PWTA 1A0NB 4AFUC 2I0NA 3RBBB 2KXCA 2EW3A 3M0PA 2SRCA 2MOXA 2IIMA 4EIKA 1SHFA 1WXUA 2FRYA 3VS4A 3REAB 3TVTA 1AZEA 2RPNA 1GCQC 5L23A 2CH4W 1RLPC 3H41A 3TSZA 2J6OA 2O9VA 1KSWA 2DJQA 1Y57A 4F17A 2EYYA 2DL8A 4JZ4A 5FWCA 2DBKA 5IHKA 4CC4B 2DM1A 2CSQA 4RTZA 1H3HA 1NYFA 4HVWA 1NEBA 2J6FA 2PZ1A 5GJVB 5IHIA 1T0HA 1Y0MA 2DILA 1NYGA 2JW4A 2EYZA 4JZ3A 3I5SA 5IHNA 2JM9A 1WI7A 2O31A 4D8KA 1OV3A 2AKLA 2VKNA 1X6BA 2AKKA 3JV3A 1M8MA 2CH4A 3VS5A 1SEMA 1X27A 5GJWB 2EBPA 2C0IA 4AFQC 3UF4A 2KRSA 2DNUA 4OMMA 2BZ8A 1KIKA 2D0NA 1UECA 1PKTA 2M51A 3UATA 4JPBW 2DRMA 2LJ0A 5I11A 1GRIA 1NLPC 4OMNA 4E6RA 1WLPB 2C0OA 2CSIA 5EC7A 2FRWA 2GQIA 1Z9QA 3PVLA 2RF0A 2K79A 2O88A 2DL5A 2JM8A 2KYMA 1UHCA 1CKBA 2DX1A 1E7OA 1N5ZA 3LH5A 1H8KA 1XOVA 2BZYA 1UE9A 2HCKA 1OOTA 1OPLA 1I1JA 1V1CA 1YCSB 1ZUKA 2J7IA 3H0HA 4HVUA 2KROA 3TSWA 2C0TA 2LNHB 4AG2C 2RQUA 1K0SA 2LX7A 1GCPA 2YUQA 2J05A 4ESRA 1SHGA 2FPEA 4Z88A 2KE9A 3O5ZA 4RTXA 3R6NA 5FWBA 1ZX6A 2AK5A 4WCIA 2CDTA 2B86A 2CT4A 1UGVA 3EHRA 1JXOA 2H8HA 4Z89A 1SPKA 3M0RA 1WA7A 1MV3A 2DLPA 2RNAA 4ORZA 1ARKA 4AG1C 3IQLA 1JU5C 2A28A 3RNJA 4CC7A 3EG1A 1M3AA 3VS2A 2LMJA 1GBRA 1X2KA 3VS6A 1TUDA 3H0FA 3M0UA 5I22A 1MV0B 2V1RA 2MCNA 1ABQA 2K6DA 1HJDA 2HBWA 2A36A 2DL4A 3C0CA 2KYBA 3NGPA 2ECZA 4KRTA 1T3SA 3NPFA 1QWFA 2LP5A 2DBMA 3VS7A 5ECAA 1PRMC 1QKWA 4J9GA 1WIEA 1B07A 2KT8A 1M27C 1K4US 1UTIA 4LUDA 2JS2A 1WYXA 3UA6A 2X3WD 4A63B 1WXBA 1BB9A 1AWJA 2A37A 1M3BA 2DE0X 4RUGA 4X1VA 1GBQA 1LCKA 2SEMA 2VWFA 2PNIA 2O9SA 1GFDA 2KGTA 2XMFA 4LE9A 4DEXA 1ZUUA 2OAWA 2OJ2A 2VVKA 4RTVA 2K9GA 1AVZC 2KRMA 3VS1A 4ZNXA 2QDLA 2X3XD 1OEBA 1IO6A 2YSQA 3EGUA 1B3QA 3PE0A 1YWPA 4J9EA 2KNBB 2J6KA 4HVVA 1WFWA 1U3OA 4F14A 1EFNA 2RQWA 1BBZA 1T0JA 2EPDA 2RQRA 3UA7A 2FPFA 2EGEA 4RTYA 2EGAA 1QLYA 3KFVA 4Z8AA 2PTKA 1UJYA 1H92A 1E6GA 4HCKA 3QWXX 4J9IA 1CSKA 4R0KA 1E6HA 2L2PA 2YT6A
chains in the Genus database with same CATH superfamily
4C0DC 1BIAA 4XTVA 1OI1A 3VRZA 4M75B 1UGSB 3JB9H 2CP6A 1RAHB 4ELYC 1YIJA 1Q95G 3FDRA 5LJ3j 4M7DG 4M75C 3E2UA 1H3ZA 1IGUA 4M75F 1TH7A 4LDUA 2YUPA 1KFZA 3CCRQ 4E7SA 2OTJA 4K11A 3GF5A 2ZPEB 3I55Q 1Q81U 1IB8A 2Y90A 3HFNA 2BE9B 5I2MA 2DL7A 3A98A 4RTUA 1KQSP 1X43A 2X4JA 2M0YA 4Y91A 2YLBA 1TWBA 1MUZA 1YIJQ 2E64A 2VASA 3MO8A 5FLXE 2HKQB 3G4SQ 4M7AE 4C92B 1BI2A 5GMKm 3WVEB 1PKSA 1AWOA 3RESA 4C92C 3Q1JA 1YN8A 4C92F 3V7RA 4N0AC 3V7CA 3OYJA 4FSSA 2D8JA 1I07A 4NL2A 4RKUE 4MZTA 1VYUA 2QTVA 1W6XA 1VQMT 1LVKA 1SKUB 1S72T 2HL5C 5CIUA 5CKBA 5A2QE 3L2QA 1JJ2A 1K9MC 1M1KC 3PFSA 5FU6B 4M75E 2L0AA 5HK0A 1YI2Q 2K2MA 4RTTA 3PGGA 5GMKj 1VQOA 2V8KA 5GAN2 8AT1B 3EGXA 4QVDA 3OYYA 2KBTA 5GAOp 4O6JA 1I81A 4CC3A 2P0QA 4PFZA 4LNPA 4DEYA 1ZUYA 2CS7A 2HSPA 4X34A 1RACB 2CUDA 2O2OA 1KD1C 4C8QD 2Y4XA 1WDXA 4IUUA 2E6NA 3ZBDA 3QWYA 2KAFA 4IIMA 2LCSA 2H3EB 1JEGA 1VQ4A 4O5VA 4Y92A 3PMTA 2CUBA 3CQTA 3EG0A 1RAGB 3NHNA 1Q86R 1UJ0A 3CCSQ 2FG0A 3GBQA 1M90C 1G83A 1Q82U 3PVQA 2ED1A 2LVMA 1TUCA 3CXCA 2MMPA 5IXBA 4KH0B 1X2QA 3P8HA 2EQIA 2ZPHB 4DQ2A 3CCLT 1YNZA 1G2BA 4J9FA 2XU8A 3REBB 1C0MA 4M77G 2DPPB 1NLOC 5KYUA 2MWPA 5FW9A 1KC8C 3OYHA 3CMET 1XQHA 1QCFA 4OGEA 5KE2A 4J6YA 5LJ3f 5GAMh 2CP2A 4M7AD 1QKXA 2JS0A 1MMAA 2R58A 4M77A 3AT1B 2LNVA 2XKOC 4PJNA 1AWXA 2BZXA 4JUVA 1S72A 2P0PA 1ZBXA 1FYNA 3VUBA 2E5QA 2ROLA 1IHWA 2E4HA 1QQJA 1IHVA 4MZPA 5LJ5e 2PVDB 5IAYA 3URGA 4FL6A 2OTLT 1VUBA 3WVDB 1A0NB 3JCMP 3NFCA 2F5TX 1RAFB 2I0NA 4M75D 3EAEA 2BIVA 2GFAA 2HL3A 2CP3A 3ASKA 3HRSA 2IIMA 2JZ2A 3MEVA 2PQWA 1AZEA 4DOVA 2RPNA 1VQMQ 4BD3A 2HQEA 3QYGB 2J6OA 2AIRB 2DYIA 3QIIA 2EKOA 1RADB 4JZ4A 4CC4B 4RTZA 3EG9A 3EFOA 3MCAB 2HAXA 3A8MB 2PZ1A 5IHIA 4ATOA 1T0HA 2R57A 1ZHIA 3CCUT 3CPWA 4WF2A 2QG9B 2EYZA 4XU0A 1VQNA 5I21A 1QW1A 4D8KA 3LWIA 2VKNA 2LT4A 5GAN5 1X6BA 3OY9A 5LJ3e 4BI3A 1RAAB 1QP3A 5GJWB 2EBPA 2C0IA 2JJ9A 5D6WA 3HRUA 2KRSA 2DNUA 1UECA 3UATA 4FT2A 3CMEA 4JPBW 2DRMA 4E6RA 4FSXA 1TXQA 2YXYA 2K5LA 3CBMA 2FRWA 3GIBA 1Z9QA 2RF0A 2JTFA 2K79A 5GMKh 4LDWA 1Q86U 4JRKA 5LL6S 2DL5A 3CCLQ 4BDYA 1UHCA 1CKBA 3RUXA 1IREB 3HFOA 1TU0B 1UE9A 2OTLA 3H9NA 1VQLT 4LD6A 2HQHA 1V1CA 1ZSZA 5GAN4 3GP8A 1V29B 1R0CB 2C0TA 2LNHB 1K73R 2WSFE 1K8AC 4PJMA 2DETA 4JJNK 3O5ZA 1I5OB 5KYXB 1G8XA 4RTXA 4CRIA 2H8HA 2OTLQ 1SPKA 4KGXB 1MNEA 1MV3A 2RNAA 1ARKA 3NTHA 2NUPA 3IQLA 4DA4A 2FB7A 1JU5C 1D09B 3CCUA 3A5ZB 5DLOA 2EIFA 3VS2A 2A3LA 2LMJA 3G6EQ 4OVAA 1X2KA 3VS6A 4MDWA 3H0FA 3M0UA 2VGMA 3CPWS 3GNFB 5CKEA 4KT0E 1M2VB 1X6OA 2JVVA 2OAUA 2HBWA 3L2WA 1VIFA 2A7YA 4XTZA 4B6MA 4KRTA 3PIOA 4EMGA 3VS7A 2JTMA 3DB3A 4EMKB 4JRQA 2QXFA 1SF9A 1B07A 2EQKA 4EMKC 1M27C 1MNDA 4UC4A 4BY6B 4BDZA 1K4US 1NZ9A 4LUDA 1VQ8T 4L6V5 3DB4A 2X3WD 5J3BA 4BY6C 1AWJA 1M3BA 4RUGA 4HT9A 2XICA 3JCMe 3DLMA 4HA8A 2VWFA 2PNIA 2O9SA 4ME7A 2CP0A 5GAMg 4PJLA 1YJWT 1GFDA 5KE3A 1ZUUA 2OAWA 4AMCA 3J81E 2K9GA 2KRMA 4FYXB 1R77A 4ZNXA 1VQ6T 2FVUA 1OEBA 4R56A 1NPRA 2K57A 3EGUA 3M5AA 4JRIA 4J9EA 2YRVA 2KNBB 2GFUA 1Q81C 3CC4T 4BACA 9ATCB 1KG1A 1N8RR 3UA7A 3SDZA 3CCQQ 2EGEA 2M0OA 4FW1A 4EMHA 2RA2A 1QLYA 1C1AA 4II1A 3E9FA 4Z8AA 1UJYA 3QWXX 2CZ7B 1E6HA 2RHZA 2ZPBB 1U1TA 2QK0A 1VQLQ 1QVPA 2WACA 1K76A 2HQXA 3DLLA 1X6GA 2RQTA 2CT3A 4E7HA 2ED0A 1OPKA 1EIFA 4GBQA 4KULA 1X69A 4OB0B 1RI9A 4ZGEB 3I5RA 3EG2A 2ZPIB 1K73U 3HL8A 2L3RA 2FYKA 4KGZB 3I55T 5LJ5d 4MZMA 3V7SA 3P8BB 2CGHA 1WJRA 4QW2A 2EKHA 8ATCB 3PNWC 3M54A 4HXJA 4F04B 3L2UA 4YTLA 2ESWA 4MMLA 1S1NA 5KCHA 3G4ST 1W2BA 3QDFA 1PNJA 2EGCA 1VQPA 2K3BA 4J9CA 5GANd 2HSEB 2JTEA 2PUOB 1JQQA 2F2XA 1BK2A 1GL5A 3LH0A 3VV0A 1Q7YU 4JJBA 3MEUA 2FEIA 1PRLC 3HRTA 2IPOB 2EVRA 5J39A 3A8GB 3CCVT 4C8QG 1VQ6A 4J83A 2RJCA 2RI3A 3TU4K 3SD4A 5CQYA 4PLLA 1UDLA 2XK0A 4M78B 2X51A 3CC4A 2B8AA 1VQ8Q 1Q82C 5KH6A 3EGDB 1JXMA 4C5GA 1B7TA 2MIOA 4M78C 1PG5B 4M78F 3JCMJ 1UGRB 3SB2A 2FO0A 2ZGWA 4D8DA 4C8QA 2RQVA 3BDUA 2XD0A 1YBYA 1WNLA 4ZN3A 3CCET 2COWA 1YJWQ 5GAMj 2JT4A 3VS0A 1QVGA 4NL3A 2VV5A 3FB9A 3WXMB 2QDYB 2BUDA 5D7UA 4B9XA 1JB0E 4J9HA 2P84A 4IUVA 5HY6A 1OU9A 1NE8A 2ZZDA 1NM7A 3CCRA 1N9RA 3QJ6A 1D0XA 2ROTA 2FZKB 2W0ZA 2RI5A 3CCST 2LJ3A 2RHXA 3I55A 2YDLA 1QCNA 4M7AG 2Z0WA 2XDBA 3M55A 1WZOA 4OB3B 5FRMA 2L89A 1N8RU 1D1AA 1AEYA 2M1HA 3SEMA 2KY9A 2NUZA 4Z02A 1XNIA 2RN8A 1KHCA 3G4SA 4M78E 2LDMA 3M4GA 4M7AA 5KCOA 5A0LA 2CREA 1RUWA 4GLMA 5J26A 4OMQA 1W2BS 3JCMW 4M75G 4LUEA 1GFCA 3JB9D 3THKA 4JJDA 2KEAA 4ZGJB 1VYTA 4J9DA 4M7DA 2PUKB 1WHLA 5HKCA 1VQ9Q 2BTTA 1VA7A 4M75A 2RK1A 1YI2A 2CZ1B 1XTDA 1UG1A 2V1QA 5GAOm 2DD4A 3OS2A 2R5AA 4AFUC 2KXCA 1YJNT 2ZAEA 2EW3A 1TTHB 3M0PA 2MOXA 4C92G 5GAN7 2MPXC 1KK7A 3HKSA 3LGFA 1WXUA 4J7IA 3TVTA 4XTUA 2CH4W 1MMGA 2KVQG 4BB7A 2ZPFB 3CCVQ 3VJPA 2RJEA 1QVGS 1C6VX 3HTRA 4A53A 2EYYA 2RO0A 2DL8A 5FU6C 4C92A 5IHKA 3L2VA 2QA4T 3FRNA 1XJWB 4A54A 4N0AA 2CSQA 1IXDA 3NTIA 1TS9A 2ATCB 2QAZA 3OSVA 3M56A 4KUDK 3E9GA 3JCMQ 2CZ0B 3JCMd 2RK2A 3CCSA 4FT4A 3CCEQ 4JZ3A 1RABB 3I5SA 5IHNA 3MHXA 2NUTA 1VQKT 2MWOA 1OV3A 4JRPA 2AKKA 2HBPA 3FJPA 2CH4A 5GAMf 2QASA 3JCMV 2DO3A 1M4ZA 3VKIA 3RMSA 4X9CA 2BZ8A 2WSEE 1PKTA 3GPLA 2LJ0A 5I11A 1GRIA 2R5MA 4Y28E 1K9MR 1M1KR 3OS1A 4HCBA 2VYTA 4M78D 4QVZA 1QVFP 4X9DA 2E3IA 2GQIA 5KYUB 4E2FB 1B34B 3C4SA 3C94A 3S3MA 2DX1A 1HXDA 1WHHA 1N5ZA 3MKDA 5GAOn 1XOVA 1TUGB 3OB9A 4LDXA 4J5YA 1I1JA 3H0HA 1ZUKA 4PFPA 1YJNA 1KD1R 4AG2C 2RQUA 2LX7A 3CCMQ 1ACMB 2LQKA 3TEEA 3OYDA 2YUQA 2DVEA 3X25B 2J05A 1VQMA 4ESRA 1SHGA 1PCXA 2KE9A 2LCCA 4L5GA 5FWBA 1D0YA 1JJ2S 3QXEB 4F7UB 3C12A 2KK4A 1M8VA 3EHRA 3V8LA 3VYGA 3X24B 4F7UF 2DLPA 1YJNQ 3VU3C 1W4SA 5GANh 4AG1C 4XAXB 5GAMe 4N4IA 3BFMA 4OF1A 2QQSA 2JN0A 5CO7A 3OA6A 3G6ET 3QDRB 1M3AA 3M4YA 4A4KA 2QI2A 3FIFA 3EG9B 1BYMA 3CD6Q 2V8IA 1FMVA 2O4XB 4FYVB 2K6DA 1HJDA 2QA4Q 3UT1A 2RJDA 4M77E 1WQWA 2XHCA 3C0CA 3NGPA 2ECZA 2HD0A 3BDLA 1M1FA 4C5IA 1VQ7T 2MAMA 2LP5A 1BKBA 2DBMA 2QGFB 1G3SA 2QQAA 4EDUA 1VQKQ 1UTIA 2DD5A 3CCLA 4F7UE 3CXCS 2QTXA 3UWNA 1FXXA 5DY9A 4RCBA 2DERA 2GQVA 1VQ5T 4DEXA 4QKUA 2VVKA 2OJ2A 1AVZC 2GCXA 2M16A 1K73C 2E3HA 3MEAA 4RCCA 5I2SA 2XDDA 1RAIB 2QYZA 3PE0A 4B9WA 2XDPA 4MDXA 1YWPA 1YFNA 2J6KA 4J7FA 3QO3A 4RG8A 1U3OA 1KHIA 2RQWA 1K9MU 1T0JA 3CCQT 1WHKA 1D1BA 1Y7XA 2FPFA 1BI3A 4RTYA 4XU3A 5D6XA 2CYZB 2M02A 1ZSZB 2PTKA 2HKNA 2LT1A 1YJ9Q 4HKEA 1E6GA 1H92A 3OS0A 5GMKi 4J9IA 1CSKA 1UEBA 1T3LA 3LLRA 1SSHA 1IRXA 4AFSC 3AHUA 4OMPA 4D6WA 2L3PA 3PMIA 4E7KA 1G3YA 4JJCA 3G6EA 2CKKA 2F2WA 1HD3A 1QP2A 2MK5A 5CKFA 1Q7YC 1KD1U 2MYSA 5GMKl 2GF7A 5GMKe 4A4FA 2DTOA 1AOJA 2NUPB 2OX7A 1IZ6A 1WXTA 3EH2A 4PJOB 2DK3A 2HDAA 4BUGA 2ZPGB 1VQ7A 4RMOA 3U23A 3M0TA 4PJOC 4PJOF 5HCKA 1WGSA 3GLXA 4M77D 2VXEA 1K9AA 1KJWA 5GAN8 2RHUA 3CMAT 2W10A 3H0IA 2G3RA 1ZLMA 2LQWA 5KYXA 2E12A 2ABLA 4C5HA 4QQDA 3OSSC 2GGRA 1HSQA 3M57A 4M4ZA 2KMTA 5GAOq 1K8AR 3MJXA 4QT7A 1SRLA 1M30A 3SHWA 4RG2A 2P4RA 1VQ7Q 1D3BB 1HK9A 1W70A 2KI7A 1I4K1 2YRCA 1GCQA 3CC7T 4DBFA 3OQ5A 4IIOA 2LRQA 1MMNA 3PT9A 4FCYA 3FJ5A 3OW2A 4V2SA 4DBHA 1M9SA 3CPWP 1ZA2B 3QG1A 1N8RC 2D8HA 2KXDA 3CCQA 4BI8B 1SRMA 3OYAA 3CCJT 1N27A 1M2VA 5KYYA 1IGQA 3OYNA 2EYXA 4PJOE 3X28B 3I56Q 2E5KA 1VQ5Q 3VYHB 1VQLA 2X4XA 1OZ3A 1Y96A 5LJ5g 2WSCE 3JRZA 3LWHA 2K7AA 3MPUB 1NEGA 2JXBA 4AFZC 4EMKA 5EG2A 1WX6A 4OMLA 1UHFA 2LQNA 2EAYA 1TOVA 4J9BA 1NG2A 3JB9F 2FZCB 3KXTA 2AZSA 4XTXA 3TCJA 2GBQA 1ZBJA 2OI3A 3SWNB 5GANg 3N5BB 2DL3A 1JRIA 2DMOA 5CKDA 3SWNC 1Y07A 3QZ5B 3QZ9B 2DZCA 3ME9A 1K1ZA 2RH2A 3VS3A 1J3TA 2NWMA 2K5FA 3OYEA 4E7JA 7AT1B 1O9SA 5L8RE 3ZFJA 3OS5A 2YUNA 2XG8D 1JBMA 1TSFA 2DFUA 2H3JA 4PFOA 1YHQT 2ZCFB 2J06A 1F1BB 3M0QA 3T9NA 3ZL7C 2L5QA 1PSFA 2DTIA 3M0SA 1BI0A 2GNCA 1ABOA 3BW1A 1VQ9T 2EJGA 2ENMA 1YITT 4L59A 1NJIR 3G7ZA 2DA9A 3CMAQ 1KQSA 1U5SA 2V26A 1PC0A 5IXFA 2PU9B 2RI2A 1WJQA 1R8OB 1UGPB 1VQ8A 4IURA 3RBBB 4E47A 3LYIA 3OW2S 2FL7A 1P92A 4J6XA 4A4HA 3OBYA 1KQ2A 1YJWA 3REAB 3G71Q 5L23A 2XIDA 5A0DA 1KQ1A 3E1SA 3QJYA 1I8FA 3TSZA 4DBRA 2O9VA 2OTJT 3CC7Q 2DJQA 1K8AU 4PJOD 1N6AA 3V8JA 1Y57A 3QBYA 4F17A 2DZ9A 5KYWB 3OYKA 3S6WA 2DBKA 4ZGDB 1H3HA 1NYFA 4A4EA 3OMCA 1NEBA 2J6FA 4HVWA 4FYYB 5GJVB 3CEYA 5LJ3d 1Y0MA 2K4YA 4N4HA 3CCJQ 1OULA 5GAN6 4M78G 2JM9A 1WI7A 2VC8A 1EX4A 2X35A 5LJ5j 5FROA 3VS5A 1SEMA 3J7AF 5IN1A 4M78A 2F1LA 3UF4A 4OMMA 5DM7R 1KIKA 2M51A 3EGDA 3EFSA 3UDCA 1WLPB 3C95A 5EC7A 2F69A 2LQ8A 3PVLA 5GANj 1VQOT 1QVFA 3HPWA 2LX9A 1VQ9A 4KUIA 2JM8A 2KYMA 1AHJB 3SFMA 2CP7A 3HSBA 4M7DB 1U8RA 1KQSS 2J7IA 1YCSB 3OMGA 3QYHB 2KROA 3TSWA 3F70A 2IVWA 4M7DC 4PNOA 4XTWA 3OYGA 3CCMT 4M7DF 1YHQQ 3TQ7P 4ZN1A 1GCPA 5C6SA 4KGVB 1LPLA 2D6FA 3GOXA 3JCMb 3JCMg 1VQ4T 2O01E 1BI1A 2X9HA 3BE3A 1VOMA 1YITQ 1O75A 4DOWA 4WCIA 3CCVA 3MP8A 2CDTA 2CT4A 1UGVA 3VUZA 1D1CA 3M0RA 1OX9A 3NTKA 1GXIE 4FU6A 1W2BP 1QCOA 4XTYA 1NJIU 3L2RA 2A28A 4DBQA 2EFIA 3EG1A 4BE2A 3RMQA 3CCEA 1GBRA 2PVGB 1WHGA 5FU7B 1TUDA 4JLGA 5I22A 3EGXB 3CD6T 2XI9A 2OTJQ 5FU7C 3QKJA 3KUFA 2V1RA 2MCNA 1ABQA 3M9QA 4M7DE 3RKYA 1PM3A 5KYNA 1T3SA 4LDVA 2EQJA 3D7SB 2A0FB 3X20B 2NUTB 3NPFA 1Q86C 2E1HA 2EQUA 4J9GA 1WIEA 4FM4B 4JLIA 2M9UA 2JS2A 3ER0A 1WYXA 3UA6A 2LTOA 3RKWA 4PK4A 5LJ5f 1QVGP 1M2OA 1QVFS 2DAQA 2KGTA 2RM4A 2XMFA 4LE9A 5HK3A 3PIPA 3PTAA 2QDLA 2QGGA 2JNGA 1WPYA 1PD0A 2KQWA 1IO6A 3CCMA 2YSQA 1B3QA 4A4GA 4TVRA 2LC4A 4C92E 4IUTA 2NLUA 4OP0A 4HVVA 1WFWA 4F14A 1VQOQ 1EFNA 2FZGB 1BBZA 1HYOA 2EPDA 1NPPA 4C0GA 2HMAA 2DIGA 5GANf 1YJ9T 3KFVA 4E7IA 1WQ7A 2E6ZA 3G1JA 4BE0A 1VQNT 4M77B 2YT6A 2HEQA 5CVIA 4OB2B 4M77C 3JCMX 4M77F 5LJ5h 2EYWA 2DXCA 2FPDA 3CBPA 3M58A 4RTWA 3S3NA 1K0XA 1X01A 1RI0A 4Q5WA 2E70A 5GAOr 5M9OA 1VQ4Q 1U06A 1I0CA 2A08A 1B34A 3CD6A 4QVCA 1YCYA 1W1FA 1AD5A 1VIEA 2GTOA 2X4YA 2QA4A 4R55A 2L3QA 2L3SA 1OQKA 1M90R 3VRYA 4FIBA 2VGNA 4HT8A 2LCLA 3NMZC 1H641 1Y71A 3RKXA 5A0GA 4OMOA 4F7UG 4N4GA 4M7DD 2KT1A 1M3CA 1U1SA 4FYWB 1CKAA 1BU1A 3QUIA 1MMDA 1VQKA 1KC8R 3EFOB 4CC2A 1SSFA 2CZ6B 1LNXA 4PLIA 3EG3A 4F7UA 2KRNA 1JJ2P 3R6OA 1PHTA 1QWEA 1AT1B 2LJ1A 1AZGB 1OU8A 1M1GA 1Z9ZA 1S72Q 5LJ3h 2DRKA 1EZZB 4GY5A 1AWWA 5GANe 5C0MA 4HCCA 4AT1B 3L2ZA 1VYVA 4LN2A 5IH2A 2O4XA 4F16A 4JS5A 4C92D 2VUBA 1YJ9A 1YP5A 2IG0A 2DVJA 3I56T 2BE7D 4E7LA 3A8HB 1YWOA 2DEUA 3JCMc 3JB9I 2GTJA 1BIBA 1OYXA 2LZ6B 1UUEA 3HP9A 2AHJB 2DF6A 3KBGA 4EPCA 4C5EA 3ZEHA 2DXTA 1I5LA 1M1KU 4XU1A 3OBWA 1UB4A 4JDSA 3LX7A 3CXCP 1RLQC 3ULRB 2HZYA 2JMAA 3BY7A 4ANJA 1ZSZC 3M53A 4OB1B 1VQNQ 3FC3A 1TG0A 5CR2A 2D0QB 1LOJA 2DEQA 4OGCA 3EHQA 3I35A 2QQRA 4FW2A 2NYSA 3L1AA 5CQXA 4J8OA 4J6WA 4ZTFA 1D0ZA 2L8DA 2E41A 3GNGA 5GAOl 4KH1B 2YLCA 3CMEQ 2D1XA 1JO8A 1ZSGA 3RIRA 1RAEB 3JSCA 1OX8A 4IUPA 3LGLA 4ELZC 4E7ZA 2YUOA 1PD1A 1ZQ1A 5CCAA 1UGQB 2G6FX 3JCMf 2JMCA 5CK9A 5IT9E 2EWNA 2FHDA 2DIQA 1WJSA 3I9QA 1FMWA 1G3WA 2DXBA 1FMKA 2Y4YA 2DYBA 1UFFA 2F2VA 2EJ9A 3JB9J 2RMOA 2AZVA 1M90U 3DKMA 2C06A 4PJOG 1G3TA 2KR3A 1PWTA 3RERA 3OYCA 4GLKA 3FEOA 2SRCA 4EIKA 1SHFA 1KC8U 3OYMA 2FRYA 3G71T 1R0BG 3VS4A 4PJOA 3I56A 1VQ5A 1GCQC 3A8LB 2DXUA 1RLPC 3H41A 1Q7YR 4PJJA 1KSWA 1RL2A 3JCMh 3LW5E 3RDVA 4ZTJA 4XU2A 5FWCA 4BE1A 3HHTB 2QQ9A 5KYYB 2DM1A 3INZA 3OYFA 3CC2T 1Y96B 2DILA 4PKCC 3QSUA 1LJOA 4JS4A 1NYGA 2KDSA 3A1PA 3CCUQ 2YRDA 2CP5A 2JW4A 2P0KA 1DJ7B 6AT1B 2O31A 2MI6A 1ZA1B 1VQPT 4LDYA 2AKLA 1D3BA 3JV3A 1M8MA 2QEXT 1X27A 2RJFA 4AFQC 4QQGA 4PL6A 3JAME 2D0NA 2P4TA 4IUQA 2K2VA 1NLPC 3META 2EJFA 4OMNA 1WHMA 3RR6A 2C0OA 2CSIA 3JB9G 1SG5A 1MHNA 1FWZA 3J80E 5FRNA 3OYBA 2DJZA 3MEWA 2RD1A 4WTOB 2O88A 1X75C 1WHJA 2YWWA 1NJIC 3S3OA 1E7OA 1M5Q1 4CI0C 3CMAA 1OZ2A 2D9TA 3LH5A 1H8KA 2BZYA 2HCKA 1OOTA 4NOYA 1OPLA 4HVUA 5CAIA 5AT1B 3QHSA 1MGQA 1K0SA 5LJ3g 3SWNA 3G71A 1Q81R 3EFRA 2E10A 2FPEA 4Z88A 3OYIA 3CCRT 2RHIA 3R6NA 3UPUA 1ZX6A 3CC7A 2AK5A 5GAMd 2B86A 3E19A 1JXOA 4Z89A 4OMFB 4C0ZA 3QPHA 4P5NA 5GAN3 1WA7A 4ORZA 4BI4A 4HCZA 3CC2A 2AT1B 2HNIA 2YHTA 3CCJA 2KSSA 1NBEB 2DTHA 3FLGA 3RNJA 2RHYA 1YIJT 1PSEA 4CC7A 5AYFA 1V76A 2X4WA 2MF2A 1BCOA 2VXFA 1G5VA 2V8JA 3MP6A 3X26B 4VUBA 1MV0B 4XK8E 2QEXA 4C0FA 2QQBA 2DKGA 4C8QB 2K5IA 4QQ6A 1N9SA 5D6YA 2A36A 2COYA 2DL4A 2KYBA 2EQMA 2I2LA 3CBOA 4C8QC 4C8QF 3CC2Q 1QWFA 2JUFA 3MP1A 3OW2P 5ECAA 1PRMC 2K3XA 1QKWA 1YI2T 3A8OB 3H6ZA 1BCMA 2F5KA 2KT8A 4LXCA 1VQPQ 2VB6A 4A63B 1WXBA 1BB9A 3O8VA 2A37A 2QEXQ 5CKHA 2DE0X 3P8DA 4X1VA 1GBQA 2EYQA 1LCKA 5KYWA 2SEMA 3V8KA 4RTVA 4IKFA 5DLQE 3OYLA 4MMKA 3VS1A 2BKDN 2COZA 1FX7A 3EH1A 3M59A 2X3XD 3CPFA 1YHQA 1VQ6Q 4KBMB 2E65A 2RB6A 1QMCA 2K3YA 4M7AB 3TREA 2JOYA 4NS5A 3CC4Q 1Q82R 2RQRA 1YITA 4M7AC 2EGAA 4M7AF 4C8QE 3H8ZA 3L42A 4C0DB 4HCKA 4XQ3A 2PVOB 4LD9K 4R0KA 2L2PA
chains in the Genus database with same CATH topology
1K76A 2HEQA 1T3LA 1SSHA 1X6GA 2RQTA 4AFSC 2CT3A 2EYWA 3VRZA 4OMPA 2ED0A 2FPDA 1OPKA 2L3PA 4RTWA 4GBQA 1X69A 1K0XA 4JJCA 1RI9A 3I5RA 2F2WA 1HD3A 2YUPA 1U06A 3EG2A 1KFZA 1I0CA 2A08A 4K11A 1W1FA 1AOJA 1AD5A 2GTOA 2L3QA 2L3SA 2DL7A 3A98A 1WXTA 2EKHA 3VRYA 2HDAA 4HXJA 2ESWA 3NMZC 4RTUA 4OMOA 1X43A 3U23A 3M0TA 2M0YA 1S1NA 1MUZA 5HCKA 1K9AA 2KT1A 1KJWA 1M3CA 1CKAA 2W10A 1BU1A 3H0IA 1PNJA 1ZLMA 2EGCA 2LQWA 2K3BA 1PKSA 2ABLA 4CC2A 4J9CA 1AWOA 1YN8A 2GGRA 1HSQA 3EG3A 4M4ZA 2JTEA 4FSSA 2D8JA 2KRNA 1JQQA 2F2XA 1BK2A 1PHTA 1QWEA 1GL5A 1I07A 4QT7A 2LJ1A 4JJBA 1SRLA 1AZGB 1Z9ZA 1M30A 3SHWA 1VYUA 1W6XA 2FEIA 1PRLC 2P4RA 1W70A 1GCQA 2DRKA 2EVRA 1AWWA 2L0AA 4IIOA 2K2MA 3FJ5A 4RTTA 1UDLA 1VYVA 4LN2A 5IH2A 2D8HA 2KXDA 1JXMA 4F16A 1SRMA 2MIOA 2KBTA 4CC3A 2FO0A 4D8DA 2RQVA 1YP5A 2EYXA 2DVJA 2E5KA 4LNPA 4DEYA 2JT4A 1ZUYA 3VS0A 1YWOA 2HSPA 2CUDA 2GTJA 2K7AA 1NEGA 2O2OA 2JXBA 4AFZC 2LZ6B 1UUEA 1WDXA 2DF6A 1WX6A 3QWYA 4OMLA 1UHFA 4J9HA 4IIMA 2LQNA 2LCSA 1JEGA 4J9BA 1NM7A 1NG2A 4Y92A 2ROTA 2CUBA 2W0ZA 3CQTA 3EG0A 3NHNA 2AZSA 1UJ0A 1RLQC 2GBQA 2LJ3A 3ULRB 2JMAA 1ZBJA 2OI3A 2YDLA 2FG0A 3GBQA 1G83A 3PVQA 2ED1A 1TG0A 2DL3A 1TUCA 2DMOA 1AEYA 5IXBA 3EHQA 3I35A 1X2QA 3SEMA 2NUZA 2EQIA 1YNZA 1G2BA 2RN8A 1K1ZA 4J9FA 3REBB 3VS3A 1J3TA 2NWMA 1NLOC 5FW9A 2CREA 1RUWA 1QCFA 4GLMA 2D1XA 1JO8A 1ZSGA 2YUNA 4OMQA 4LUEA 1GFCA 2YUOA 1QKXA 2JS0A 2G6FX 3THKA 4JJDA 2JMCA 2KEAA 2J06A 3M0QA 3ZL7C 1VYTA 4J9DA 3I9QA 3M0SA 1AWXA 2BZXA 2GNCA 1FMKA 1ABOA 1FYNA 2DYBA 2ENMA 1UFFA 2BTTA 2F2VA 2ROLA 1VA7A 2RMOA 2AZVA 2DA9A 1U5SA 2KR3A 1UG1A 2V1QA 5IXFA 1PWTA 1A0NB 4AFUC 2I0NA 3RBBB 2KXCA 2EW3A 3M0PA 2SRCA 2MOXA 2IIMA 4EIKA 1SHFA 1WXUA 2FRYA 3VS4A 3REAB 3TVTA 1AZEA 2RPNA 1GCQC 5L23A 2CH4W 1RLPC 3H41A 3TSZA 2J6OA 2O9VA 1KSWA 2DJQA 1Y57A 4F17A 2EYYA 2DL8A 4JZ4A 5FWCA 2DBKA 5IHKA 4CC4B 2DM1A 2CSQA 4RTZA 1H3HA 1NYFA 4HVWA 1NEBA 2J6FA 2PZ1A 5GJVB 5IHIA 1T0HA 1Y0MA 2DILA 1NYGA 2JW4A 2EYZA 4JZ3A 3I5SA 5IHNA 2JM9A 1WI7A 2O31A 4D8KA 1OV3A 2AKLA 2VKNA 1X6BA 2AKKA 3JV3A 1M8MA 2CH4A 3VS5A 1SEMA 1X27A 5GJWB 2EBPA 2C0IA 4AFQC 3UF4A 2KRSA 2DNUA 4OMMA 2BZ8A 1KIKA 2D0NA 1UECA 1PKTA 2M51A 3UATA 4JPBW 2DRMA 2LJ0A 5I11A 1GRIA 1NLPC 4OMNA 4E6RA 1WLPB 2C0OA 2CSIA 5EC7A 2FRWA 2GQIA 1Z9QA 3PVLA 2RF0A 2K79A 2O88A 2DL5A 2JM8A 2KYMA 1UHCA 1CKBA 2DX1A 1E7OA 1N5ZA 3LH5A 1H8KA 1XOVA 2BZYA 1UE9A 2HCKA 1OOTA 1OPLA 1I1JA 1V1CA 1YCSB 1ZUKA 2J7IA 3H0HA 4HVUA 2KROA 3TSWA 2C0TA 2LNHB 4AG2C 2RQUA 1K0SA 2LX7A 1GCPA 2YUQA 2J05A 4ESRA 1SHGA 2FPEA 4Z88A 2KE9A 3O5ZA 4RTXA 3R6NA 5FWBA 1ZX6A 2AK5A 4WCIA 2CDTA 2B86A 2CT4A 1UGVA 3EHRA 1JXOA 2H8HA 4Z89A 1SPKA 3M0RA 1WA7A 1MV3A 2DLPA 2RNAA 4ORZA 1ARKA 4AG1C 3IQLA 1JU5C 2A28A 3RNJA 4CC7A 3EG1A 1M3AA 3VS2A 2LMJA 1GBRA 1X2KA 3VS6A 1TUDA 3H0FA 3M0UA 5I22A 1MV0B 2V1RA 2MCNA 1ABQA 2K6DA 1HJDA 2HBWA 2A36A 2DL4A 3C0CA 2KYBA 3NGPA 2ECZA 4KRTA 1T3SA 3NPFA 1QWFA 2LP5A 2DBMA 3VS7A 5ECAA 1PRMC 1QKWA 4J9GA 1WIEA 1B07A 2KT8A 1M27C 1K4US 1UTIA 4LUDA 2JS2A 1WYXA 3UA6A 2X3WD 4A63B 1WXBA 1BB9A 1AWJA 2A37A 1M3BA 2DE0X 4RUGA 4X1VA 1GBQA 1LCKA 2SEMA 2VWFA 2PNIA 2O9SA 1GFDA 2KGTA 2XMFA 4LE9A 4DEXA 1ZUUA 2OAWA 2OJ2A 2VVKA 4RTVA 2K9GA 1AVZC 2KRMA 3VS1A 4ZNXA 2QDLA 2X3XD 1OEBA 1IO6A 2YSQA 3EGUA 1B3QA 3PE0A 1YWPA 4J9EA 2KNBB 2J6KA 4HVVA 1WFWA 1U3OA 4F14A 1EFNA 2RQWA 1BBZA 1T0JA 2EPDA 2RQRA 3UA7A 2FPFA 2EGEA 4RTYA 2EGAA 1QLYA 3KFVA 4Z8AA 2PTKA 1UJYA 1H92A 1E6GA 4HCKA 3QWXX 4J9IA 1CSKA 4R0KA 1E6HA 2L2PA 2YT6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K76 A;  2HEQ A;  1T3L A;  1SSH A;  1X6G A;  2RQT A;  4AFS C;  2CT3 A;  2EYW A;  3VRZ A;  4OMP A;  2ED0 A;  2FPD A;  1OPK A;  2L3P A;  4RTW A;  4GBQ A;  1X69 A;  1K0X A;  4JJC A;  1RI9 A;  3I5R A;  2F2W A;  1HD3 A;  2YUP A;  1U06 A;  3EG2 A;  1KFZ A;  1I0C A;  2A08 A;  4K11 A;  1W1F A;  1AOJ A;  1AD5 A;  2GTO A;  2L3Q A;  2L3S A;  2DL7 A;  3A98 A;  1WXT A;  2EKH A;  3VRY A;  2HDA A;  4HXJ A;  2ESW A;  3NMZ C;  4RTU A;  4OMO A;  1X43 A;  3U23 A;  3M0T A;  2M0Y A;  1S1N A;  1MUZ A;  5HCK A;  1K9A A;  2KT1 A;  1KJW A;  1M3C A;  1CKA A;  2W10 A;  1BU1 A;  3H0I A;  1PNJ A;  1ZLM A;  2EGC A;  2LQW A;  2K3B A;  1PKS A;  2ABL A;  4CC2 A;  4J9C A;  1AWO A;  1YN8 A;  2GGR A;  1HSQ A;  3EG3 A;  4M4Z A;  2JTE A;  4FSS A;  2D8J A;  2KRN A;  1JQQ A;  2F2X A;  1BK2 A;  1PHT A;  1QWE A;  1GL5 A;  1I07 A;  4QT7 A;  2LJ1 A;  4JJB A;  1SRL A;  1AZG B;  1Z9Z A;  1M30 A;  3SHW A;  1VYU A;  1W6X A;  2FEI A;  1PRL C;  2P4R A;  1W70 A;  1GCQ A;  2DRK A;  2EVR A;  1AWW A;  2L0A A;  4IIO A;  2K2M A;  3FJ5 A;  4RTT A;  1UDL A;  1VYV A;  4LN2 A;  5IH2 A;  2D8H A;  2KXD A;  1JXM A;  4F16 A;  1SRM A;  2MIO A;  2KBT A;  4CC3 A;  2FO0 A;  4D8D A;  2RQV A;  1YP5 A;  2EYX A;  2DVJ A;  2E5K A;  4LNP A;  4DEY A;  2JT4 A;  1ZUY A;  3VS0 A;  1YWO A;  2HSP A;  2CUD A;  2GTJ A;  2K7A A;  1NEG A;  2O2O A;  2JXB A;  4AFZ C;  2LZ6 B;  1UUE A;  1WDX A;  2DF6 A;  1WX6 A;  3QWY A;  4OML A;  1UHF A;  4J9H A;  4IIM A;  2LQN A;  2LCS A;  1JEG A;  4J9B A;  1NM7 A;  1NG2 A;  4Y92 A;  2ROT A;  2CUB A;  2W0Z A;  3CQT A;  3EG0 A;  3NHN A;  2AZS A;  1UJ0 A;  1RLQ C;  2GBQ A;  2LJ3 A;  3ULR B;  2JMA A;  1ZBJ A;  2OI3 A;  2YDL A;  2FG0 A;  3GBQ A;  1G83 A;  3PVQ A;  2ED1 A;  1TG0 A;  2DL3 A;  1TUC A;  2DMO A;  1AEY A;  5IXB A;  3EHQ A;  3I35 A;  1X2Q A;  3SEM A;  2NUZ A;  2EQI A;  1YNZ A;  1G2B A;  2RN8 A;  1K1Z A;  4J9F A;  3REB B;  3VS3 A;  1J3T A;  2NWM A;  1NLO C;  5FW9 A;  2CRE A;  1RUW A;  1QCF A;  4GLM A;  2D1X A;  1JO8 A;  1ZSG A;  2YUN A;  4OMQ A;  4LUE A;  1GFC A;  2YUO A;  1QKX A;  2JS0 A;  2G6F X;  3THK A;  4JJD A;  2JMC A;  2KEA A;  2J06 A;  3M0Q A;  3ZL7 C;  1VYT A;  4J9D A;  3I9Q A;  3M0S A;  1AWX A;  2BZX A;  2GNC A;  1FMK A;  1ABO A;  1FYN A;  2DYB A;  2ENM A;  1UFF A;  2BTT A;  2F2V A;  2ROL A;  1VA7 A;  2RMO A;  2AZV A;  2DA9 A;  1U5S A;  2KR3 A;  1UG1 A;  2V1Q A;  5IXF A;  1PWT A;  1A0N B;  4AFU C;  2I0N A;  3RBB B;  2KXC A;  2EW3 A;  3M0P A;  2SRC A;  2MOX A;  2IIM A;  4EIK A;  1SHF A;  1WXU A;  2FRY A;  3VS4 A;  3REA B;  3TVT A;  1AZE A;  2RPN A;  1GCQ C;  5L23 A;  2CH4 W;  1RLP C;  3H41 A;  3TSZ A;  2J6O A;  2O9V A;  1KSW A;  2DJQ A;  1Y57 A;  4F17 A;  2EYY A;  2DL8 A;  4JZ4 A;  5FWC A;  2DBK A;  5IHK A;  4CC4 B;  2DM1 A;  2CSQ A;  4RTZ A;  1H3H A;  1NYF A;  4HVW A;  1NEB A;  2J6F A;  2PZ1 A;  5GJV B;  5IHI A;  1T0H A;  1Y0M A;  2DIL A;  1NYG A;  2JW4 A;  2EYZ A;  4JZ3 A;  3I5S A;  5IHN A;  2JM9 A;  1WI7 A;  2O31 A;  4D8K A;  1OV3 A;  2AKL A;  2VKN A;  1X6B A;  2AKK A;  3JV3 A;  1M8M A;  2CH4 A;  3VS5 A;  1SEM A;  1X27 A;  5GJW B;  2EBP A;  2C0I A;  4AFQ C;  3UF4 A;  2KRS A;  2DNU A;  4OMM A;  2BZ8 A;  1KIK A;  2D0N A;  1UEC A;  1PKT A;  2M51 A;  3UAT A;  4JPB W;  2DRM A;  2LJ0 A;  5I11 A;  1GRI A;  1NLP C;  4OMN A;  4E6R A;  1WLP B;  2C0O A;  2CSI A;  5EC7 A;  2FRW A;  2GQI A;  1Z9Q A;  3PVL A;  2RF0 A;  2K79 A;  2O88 A;  2DL5 A;  2JM8 A;  2KYM A;  1UHC A;  1CKB A;  2DX1 A;  1E7O A;  1N5Z A;  3LH5 A;  1H8K A;  1XOV A;  2BZY A;  1UE9 A;  2HCK A;  1OOT A;  1OPL A;  1I1J A;  1V1C A;  1YCS B;  1ZUK A;  2J7I A;  3H0H A;  4HVU A;  2KRO A;  3TSW A;  2C0T A;  2LNH B;  4AG2 C;  2RQU A;  1K0S A;  2LX7 A;  1GCP A;  2YUQ A;  2J05 A;  4ESR A;  1SHG A;  2FPE A;  4Z88 A;  2KE9 A;  3O5Z A;  4RTX A;  3R6N A;  5FWB A;  1ZX6 A;  2AK5 A;  4WCI A;  2CDT A;  2B86 A;  2CT4 A;  1UGV A;  3EHR A;  1JXO A;  2H8H A;  4Z89 A;  1SPK A;  3M0R A;  1WA7 A;  1MV3 A;  2DLP A;  2RNA A;  4ORZ A;  1ARK A;  4AG1 C;  3IQL A;  1JU5 C;  2A28 A;  3RNJ A;  4CC7 A;  3EG1 A;  1M3A A;  3VS2 A;  2LMJ A;  1GBR A;  1X2K A;  3VS6 A;  1TUD A;  3H0F A;  3M0U A;  5I22 A;  1MV0 B;  2V1R A;  2MCN A;  1ABQ A;  2K6D A;  1HJD A;  2HBW A;  2A36 A;  2DL4 A;  3C0C A;  2KYB A;  3NGP A;  2ECZ A;  4KRT A;  1T3S A;  3NPF A;  1QWF A;  2LP5 A;  2DBM A;  3VS7 A;  5ECA A;  1PRM C;  1QKW A;  4J9G A;  1WIE A;  1B07 A;  2KT8 A;  1M27 C;  1K4U S;  1UTI A;  4LUD A;  2JS2 A;  1WYX A;  3UA6 A;  2X3W D;  4A63 B;  1WXB A;  1BB9 A;  1AWJ A;  2A37 A;  1M3B A;  2DE0 X;  4RUG A;  4X1V A;  1GBQ A;  1LCK A;  2SEM A;  2VWF A;  2PNI A;  2O9S A;  1GFD A;  2KGT A;  2XMF A;  4LE9 A;  4DEX A;  1ZUU A;  2OAW A;  2OJ2 A;  2VVK A;  4RTV A;  2K9G A;  1AVZ C;  2KRM A;  3VS1 A;  4ZNX A;  2QDL A;  2X3X D;  1OEB A;  1IO6 A;  2YSQ A;  3EGU A;  1B3Q A;  3PE0 A;  1YWP A;  4J9E A;  2KNB B;  2J6K A;  4HVV A;  1WFW A;  1U3O A;  4F14 A;  1EFN A;  2RQW A;  1BBZ A;  1T0J A;  2EPD A;  2RQR A;  3UA7 A;  2FPF A;  2EGE A;  4RTY A;  2EGA A;  1QLY A;  3KFV A;  4Z8A A;  2PTK A;  1UJY A;  1H92 A;  1E6G A;  4HCK A;  3QWX X;  4J9I A;  1CSK A;  4R0K A;  1E6H A;  2L2P A;  2YT6 A; 
#chains in the Genus database with same CATH topology
 4C0D C;  1BIA A;  4XTV A;  1OI1 A;  3VRZ A;  4M75 B;  1UGS B;  3JB9 H;  2CP6 A;  1RAH B;  4ELY C;  1YIJ A;  1Q95 G;  3FDR A;  5LJ3 j;  4M7D G;  4M75 C;  3E2U A;  1H3Z A;  1IGU A;  4M75 F;  1TH7 A;  4LDU A;  2YUP A;  1KFZ A;  3CCR Q;  4E7S A;  2OTJ A;  4K11 A;  3GF5 A;  2ZPE B;  3I55 Q;  1Q81 U;  1IB8 A;  2Y90 A;  3HFN A;  2BE9 B;  5I2M A;  2DL7 A;  3A98 A;  4RTU A;  1KQS P;  1X43 A;  2X4J A;  2M0Y A;  4Y91 A;  2YLB A;  1TWB A;  1MUZ A;  1YIJ Q;  2E64 A;  2VAS A;  3MO8 A;  5FLX E;  2HKQ B;  3G4S Q;  4M7A E;  4C92 B;  1BI2 A;  5GMK m;  3WVE B;  1PKS A;  1AWO A;  3RES A;  4C92 C;  3Q1J A;  1YN8 A;  4C92 F;  3V7R A;  4N0A C;  3V7C A;  3OYJ A;  4FSS A;  2D8J A;  1I07 A;  4NL2 A;  4RKU E;  4MZT A;  1VYU A;  2QTV A;  1W6X A;  1VQM T;  1LVK A;  1SKU B;  1S72 T;  2HL5 C;  5CIU A;  5CKB A;  5A2Q E;  3L2Q A;  1JJ2 A;  1K9M C;  1M1K C;  3PFS A;  5FU6 B;  4M75 E;  2L0A A;  5HK0 A;  1YI2 Q;  2K2M A;  4RTT A;  3PGG A;  5GMK j;  1VQO A;  2V8K A;  5GAN 2;  8AT1 B;  3EGX A;  4QVD A;  3OYY A;  2KBT A;  5GAO p;  4O6J A;  1I81 A;  4CC3 A;  2P0Q A;  4PFZ A;  4LNP A;  4DEY A;  1ZUY A;  2CS7 A;  2HSP A;  4X34 A;  1RAC B;  2CUD A;  2O2O A;  1KD1 C;  4C8Q D;  2Y4X A;  1WDX A;  4IUU A;  2E6N A;  3ZBD A;  3QWY A;  2KAF A;  4IIM A;  2LCS A;  2H3E B;  1JEG A;  1VQ4 A;  4O5V A;  4Y92 A;  3PMT A;  2CUB A;  3CQT A;  3EG0 A;  1RAG B;  3NHN A;  1Q86 R;  1UJ0 A;  3CCS Q;  2FG0 A;  3GBQ A;  1M90 C;  1G83 A;  1Q82 U;  3PVQ A;  2ED1 A;  2LVM A;  1TUC A;  3CXC A;  2MMP A;  5IXB A;  4KH0 B;  1X2Q A;  3P8H A;  2EQI A;  2ZPH B;  4DQ2 A;  3CCL T;  1YNZ A;  1G2B A;  4J9F A;  2XU8 A;  3REB B;  1C0M A;  4M77 G;  2DPP B;  1NLO C;  5KYU A;  2MWP A;  5FW9 A;  1KC8 C;  3OYH A;  3CME T;  1XQH A;  1QCF A;  4OGE A;  5KE2 A;  4J6Y A;  5LJ3 f;  5GAM h;  2CP2 A;  4M7A D;  1QKX A;  2JS0 A;  1MMA A;  2R58 A;  4M77 A;  3AT1 B;  2LNV A;  2XKO C;  4PJN A;  1AWX A;  2BZX A;  4JUV A;  1S72 A;  2P0P A;  1ZBX A;  1FYN A;  3VUB A;  2E5Q A;  2ROL A;  1IHW A;  2E4H A;  1QQJ A;  1IHV A;  4MZP A;  5LJ5 e;  2PVD B;  5IAY A;  3URG A;  4FL6 A;  2OTL T;  1VUB A;  3WVD B;  1A0N B;  3JCM P;  3NFC A;  2F5T X;  1RAF B;  2I0N A;  4M75 D;  3EAE A;  2BIV A;  2GFA A;  2HL3 A;  2CP3 A;  3ASK A;  3HRS A;  2IIM A;  2JZ2 A;  3MEV A;  2PQW A;  1AZE A;  4DOV A;  2RPN A;  1VQM Q;  4BD3 A;  2HQE A;  3QYG B;  2J6O A;  2AIR B;  2DYI A;  3QII A;  2EKO A;  1RAD B;  4JZ4 A;  4CC4 B;  4RTZ A;  3EG9 A;  3EFO A;  3MCA B;  2HAX A;  3A8M B;  2PZ1 A;  5IHI A;  4ATO A;  1T0H A;  2R57 A;  1ZHI A;  3CCU T;  3CPW A;  4WF2 A;  2QG9 B;  2EYZ A;  4XU0 A;  1VQN A;  5I21 A;  1QW1 A;  4D8K A;  3LWI A;  2VKN A;  2LT4 A;  5GAN 5;  1X6B A;  3OY9 A;  5LJ3 e;  4BI3 A;  1RAA B;  1QP3 A;  5GJW B;  2EBP A;  2C0I A;  2JJ9 A;  5D6W A;  3HRU A;  2KRS A;  2DNU A;  1UEC A;  3UAT A;  4FT2 A;  3CME A;  4JPB W;  2DRM A;  4E6R A;  4FSX A;  1TXQ A;  2YXY A;  2K5L A;  3CBM A;  2FRW A;  3GIB A;  1Z9Q A;  2RF0 A;  2JTF A;  2K79 A;  5GMK h;  4LDW A;  1Q86 U;  4JRK A;  5LL6 S;  2DL5 A;  3CCL Q;  4BDY A;  1UHC A;  1CKB A;  3RUX A;  1IRE B;  3HFO A;  1TU0 B;  1UE9 A;  2OTL A;  3H9N A;  1VQL T;  4LD6 A;  2HQH A;  1V1C A;  1ZSZ A;  5GAN 4;  3GP8 A;  1V29 B;  1R0C B;  2C0T A;  2LNH B;  1K73 R;  2WSF E;  1K8A C;  4PJM A;  2DET A;  4JJN K;  3O5Z A;  1I5O B;  5KYX B;  1G8X A;  4RTX A;  4CRI A;  2H8H A;  2OTL Q;  1SPK A;  4KGX B;  1MNE A;  1MV3 A;  2RNA A;  1ARK A;  3NTH A;  2NUP A;  3IQL A;  4DA4 A;  2FB7 A;  1JU5 C;  1D09 B;  3CCU A;  3A5Z B;  5DLO A;  2EIF A;  3VS2 A;  2A3L A;  2LMJ A;  3G6E Q;  4OVA A;  1X2K A;  3VS6 A;  4MDW A;  3H0F A;  3M0U A;  2VGM A;  3CPW S;  3GNF B;  5CKE A;  4KT0 E;  1M2V B;  1X6O A;  2JVV A;  2OAU A;  2HBW A;  3L2W A;  1VIF A;  2A7Y A;  4XTZ A;  4B6M A;  4KRT A;  3PIO A;  4EMG A;  3VS7 A;  2JTM A;  3DB3 A;  4EMK B;  4JRQ A;  2QXF A;  1SF9 A;  1B07 A;  2EQK A;  4EMK C;  1M27 C;  1MND A;  4UC4 A;  4BY6 B;  4BDZ A;  1K4U S;  1NZ9 A;  4LUD A;  1VQ8 T;  4L6V 5;  3DB4 A;  2X3W D;  5J3B A;  4BY6 C;  1AWJ A;  1M3B A;  4RUG A;  4HT9 A;  2XIC A;  3JCM e;  3DLM A;  4HA8 A;  2VWF A;  2PNI A;  2O9S A;  4ME7 A;  2CP0 A;  5GAM g;  4PJL A;  1YJW T;  1GFD A;  5KE3 A;  1ZUU A;  2OAW A;  4AMC A;  3J81 E;  2K9G A;  2KRM A;  4FYX B;  1R77 A;  4ZNX A;  1VQ6 T;  2FVU A;  1OEB A;  4R56 A;  1NPR A;  2K57 A;  3EGU A;  3M5A A;  4JRI A;  4J9E A;  2YRV A;  2KNB B;  2GFU A;  1Q81 C;  3CC4 T;  4BAC A;  9ATC B;  1KG1 A;  1N8R R;  3UA7 A;  3SDZ A;  3CCQ Q;  2EGE A;  2M0O A;  4FW1 A;  4EMH A;  2RA2 A;  1QLY A;  1C1A A;  4II1 A;  3E9F A;  4Z8A A;  1UJY A;  3QWX X;  2CZ7 B;  1E6H A;  2RHZ A;  2ZPB B;  1U1T A;  2QK0 A;  1VQL Q;  1QVP A;  2WAC A;  1K76 A;  2HQX A;  3DLL A;  1X6G A;  2RQT A;  2CT3 A;  4E7H A;  2ED0 A;  1OPK A;  1EIF A;  4GBQ A;  4KUL A;  1X69 A;  4OB0 B;  1RI9 A;  4ZGE B;  3I5R A;  3EG2 A;  2ZPI B;  1K73 U;  3HL8 A;  2L3R A;  2FYK A;  4KGZ B;  3I55 T;  5LJ5 d;  4MZM A;  3V7S A;  3P8B B;  2CGH A;  1WJR A;  4QW2 A;  2EKH A;  8ATC B;  3PNW C;  3M54 A;  4HXJ A;  4F04 B;  3L2U A;  4YTL A;  2ESW A;  4MML A;  1S1N A;  5KCH A;  3G4S T;  1W2B A;  3QDF A;  1PNJ A;  2EGC A;  1VQP A;  2K3B A;  4J9C A;  5GAN d;  2HSE B;  2JTE A;  2PUO B;  1JQQ A;  2F2X A;  1BK2 A;  1GL5 A;  3LH0 A;  3VV0 A;  1Q7Y U;  4JJB A;  3MEU A;  2FEI A;  1PRL C;  3HRT A;  2IPO B;  2EVR A;  5J39 A;  3A8G B;  3CCV T;  4C8Q G;  1VQ6 A;  4J83 A;  2RJC A;  2RI3 A;  3TU4 K;  3SD4 A;  5CQY A;  4PLL A;  1UDL A;  2XK0 A;  4M78 B;  2X51 A;  3CC4 A;  2B8A A;  1VQ8 Q;  1Q82 C;  5KH6 A;  3EGD B;  1JXM A;  4C5G A;  1B7T A;  2MIO A;  4M78 C;  1PG5 B;  4M78 F;  3JCM J;  1UGR B;  3SB2 A;  2FO0 A;  2ZGW A;  4D8D A;  4C8Q A;  2RQV A;  3BDU A;  2XD0 A;  1YBY A;  1WNL A;  4ZN3 A;  3CCE T;  2COW A;  1YJW Q;  5GAM j;  2JT4 A;  3VS0 A;  1QVG A;  4NL3 A;  2VV5 A;  3FB9 A;  3WXM B;  2QDY B;  2BUD A;  5D7U A;  4B9X A;  1JB0 E;  4J9H A;  2P84 A;  4IUV A;  5HY6 A;  1OU9 A;  1NE8 A;  2ZZD A;  1NM7 A;  3CCR A;  1N9R A;  3QJ6 A;  1D0X A;  2ROT A;  2FZK B;  2W0Z A;  2RI5 A;  3CCS T;  2LJ3 A;  2RHX A;  3I55 A;  2YDL A;  1QCN A;  4M7A G;  2Z0W A;  2XDB A;  3M55 A;  1WZO A;  4OB3 B;  5FRM A;  2L89 A;  1N8R U;  1D1A A;  1AEY A;  2M1H A;  3SEM A;  2KY9 A;  2NUZ A;  4Z02 A;  1XNI A;  2RN8 A;  1KHC A;  3G4S A;  4M78 E;  2LDM A;  3M4G A;  4M7A A;  5KCO A;  5A0L A;  2CRE A;  1RUW A;  4GLM A;  5J26 A;  4OMQ A;  1W2B S;  3JCM W;  4M75 G;  4LUE A;  1GFC A;  3JB9 D;  3THK A;  4JJD A;  2KEA A;  4ZGJ B;  1VYT A;  4J9D A;  4M7D A;  2PUK B;  1WHL A;  5HKC A;  1VQ9 Q;  2BTT A;  1VA7 A;  4M75 A;  2RK1 A;  1YI2 A;  2CZ1 B;  1XTD A;  1UG1 A;  2V1Q A;  5GAO m;  2DD4 A;  3OS2 A;  2R5A A;  4AFU C;  2KXC A;  1YJN T;  2ZAE A;  2EW3 A;  1TTH B;  3M0P A;  2MOX A;  4C92 G;  5GAN 7;  2MPX C;  1KK7 A;  3HKS A;  3LGF A;  1WXU A;  4J7I A;  3TVT A;  4XTU A;  2CH4 W;  1MMG A;  2KVQ G;  4BB7 A;  2ZPF B;  3CCV Q;  3VJP A;  2RJE A;  1QVG S;  1C6V X;  3HTR A;  4A53 A;  2EYY A;  2RO0 A;  2DL8 A;  5FU6 C;  4C92 A;  5IHK A;  3L2V A;  2QA4 T;  3FRN A;  1XJW B;  4A54 A;  4N0A A;  2CSQ A;  1IXD A;  3NTI A;  1TS9 A;  2ATC B;  2QAZ A;  3OSV A;  3M56 A;  4KUD K;  3E9G A;  3JCM Q;  2CZ0 B;  3JCM d;  2RK2 A;  3CCS A;  4FT4 A;  3CCE Q;  4JZ3 A;  1RAB B;  3I5S A;  5IHN A;  3MHX A;  2NUT A;  1VQK T;  2MWO A;  1OV3 A;  4JRP A;  2AKK A;  2HBP A;  3FJP A;  2CH4 A;  5GAM f;  2QAS A;  3JCM V;  2DO3 A;  1M4Z A;  3VKI A;  3RMS A;  4X9C A;  2BZ8 A;  2WSE E;  1PKT A;  3GPL A;  2LJ0 A;  5I11 A;  1GRI A;  2R5M A;  4Y28 E;  1K9M R;  1M1K R;  3OS1 A;  4HCB A;  2VYT A;  4M78 D;  4QVZ A;  1QVF P;  4X9D A;  2E3I A;  2GQI A;  5KYU B;  4E2F B;  1B34 B;  3C4S A;  3C94 A;  3S3M A;  2DX1 A;  1HXD A;  1WHH A;  1N5Z A;  3MKD A;  5GAO n;  1XOV A;  1TUG B;  3OB9 A;  4LDX A;  4J5Y A;  1I1J A;  3H0H A;  1ZUK A;  4PFP A;  1YJN A;  1KD1 R;  4AG2 C;  2RQU A;  2LX7 A;  3CCM Q;  1ACM B;  2LQK A;  3TEE A;  3OYD A;  2YUQ A;  2DVE A;  3X25 B;  2J05 A;  1VQM A;  4ESR A;  1SHG A;  1PCX A;  2KE9 A;  2LCC A;  4L5G A;  5FWB A;  1D0Y A;  1JJ2 S;  3QXE B;  4F7U B;  3C12 A;  2KK4 A;  1M8V A;  3EHR A;  3V8L A;  3VYG A;  3X24 B;  4F7U F;  2DLP A;  1YJN Q;  3VU3 C;  1W4S A;  5GAN h;  4AG1 C;  4XAX B;  5GAM e;  4N4I A;  3BFM A;  4OF1 A;  2QQS A;  2JN0 A;  5CO7 A;  3OA6 A;  3G6E T;  3QDR B;  1M3A A;  3M4Y A;  4A4K A;  2QI2 A;  3FIF A;  3EG9 B;  1BYM A;  3CD6 Q;  2V8I A;  1FMV A;  2O4X B;  4FYV B;  2K6D A;  1HJD A;  2QA4 Q;  3UT1 A;  2RJD A;  4M77 E;  1WQW A;  2XHC A;  3C0C A;  3NGP A;  2ECZ A;  2HD0 A;  3BDL A;  1M1F A;  4C5I A;  1VQ7 T;  2MAM A;  2LP5 A;  1BKB A;  2DBM A;  2QGF B;  1G3S A;  2QQA A;  4EDU A;  1VQK Q;  1UTI A;  2DD5 A;  3CCL A;  4F7U E;  3CXC S;  2QTX A;  3UWN A;  1FXX A;  5DY9 A;  4RCB A;  2DER A;  2GQV A;  1VQ5 T;  4DEX A;  4QKU A;  2VVK A;  2OJ2 A;  1AVZ C;  2GCX A;  2M16 A;  1K73 C;  2E3H A;  3MEA A;  4RCC A;  5I2S A;  2XDD A;  1RAI B;  2QYZ A;  3PE0 A;  4B9W A;  2XDP A;  4MDX A;  1YWP A;  1YFN A;  2J6K A;  4J7F A;  3QO3 A;  4RG8 A;  1U3O A;  1KHI A;  2RQW A;  1K9M U;  1T0J A;  3CCQ T;  1WHK A;  1D1B A;  1Y7X A;  2FPF A;  1BI3 A;  4RTY A;  4XU3 A;  5D6X A;  2CYZ B;  2M02 A;  1ZSZ B;  2PTK A;  2HKN A;  2LT1 A;  1YJ9 Q;  4HKE A;  1E6G A;  1H92 A;  3OS0 A;  5GMK i;  4J9I A;  1CSK A;  1UEB A;  1T3L A;  3LLR A;  1SSH A;  1IRX A;  4AFS C;  3AHU A;  4OMP A;  4D6W A;  2L3P A;  3PMI A;  4E7K A;  1G3Y A;  4JJC A;  3G6E A;  2CKK A;  2F2W A;  1HD3 A;  1QP2 A;  2MK5 A;  5CKF A;  1Q7Y C;  1KD1 U;  2MYS A;  5GMK l;  2GF7 A;  5GMK e;  4A4F A;  2DTO A;  1AOJ A;  2NUP B;  2OX7 A;  1IZ6 A;  1WXT A;  3EH2 A;  4PJO B;  2DK3 A;  2HDA A;  4BUG A;  2ZPG B;  1VQ7 A;  4RMO A;  3U23 A;  3M0T A;  4PJO C;  4PJO F;  5HCK A;  1WGS A;  3GLX A;  4M77 D;  2VXE A;  1K9A A;  1KJW A;  5GAN 8;  2RHU A;  3CMA T;  2W10 A;  3H0I A;  2G3R A;  1ZLM A;  2LQW A;  5KYX A;  2E12 A;  2ABL A;  4C5H A;  4QQD A;  3OSS C;  2GGR A;  1HSQ A;  3M57 A;  4M4Z A;  2KMT A;  5GAO q;  1K8A R;  3MJX A;  4QT7 A;  1SRL A;  1M30 A;  3SHW A;  4RG2 A;  2P4R A;  1VQ7 Q;  1D3B B;  1HK9 A;  1W70 A;  2KI7 A;  1I4K 1;  2YRC A;  1GCQ A;  3CC7 T;  4DBF A;  3OQ5 A;  4IIO A;  2LRQ A;  1MMN A;  3PT9 A;  4FCY A;  3FJ5 A;  3OW2 A;  4V2S A;  4DBH A;  1M9S A;  3CPW P;  1ZA2 B;  3QG1 A;  1N8R C;  2D8H A;  2KXD A;  3CCQ A;  4BI8 B;  1SRM A;  3OYA A;  3CCJ T;  1N27 A;  1M2V A;  5KYY A;  1IGQ A;  3OYN A;  2EYX A;  4PJO E;  3X28 B;  3I56 Q;  2E5K A;  1VQ5 Q;  3VYH B;  1VQL A;  2X4X A;  1OZ3 A;  1Y96 A;  5LJ5 g;  2WSC E;  3JRZ A;  3LWH A;  2K7A A;  3MPU B;  1NEG A;  2JXB A;  4AFZ C;  4EMK A;  5EG2 A;  1WX6 A;  4OML A;  1UHF A;  2LQN A;  2EAY A;  1TOV A;  4J9B A;  1NG2 A;  3JB9 F;  2FZC B;  3KXT A;  2AZS A;  4XTX A;  3TCJ A;  2GBQ A;  1ZBJ A;  2OI3 A;  3SWN B;  5GAN g;  3N5B B;  2DL3 A;  1JRI A;  2DMO A;  5CKD A;  3SWN C;  1Y07 A;  3QZ5 B;  3QZ9 B;  2DZC A;  3ME9 A;  1K1Z A;  2RH2 A;  3VS3 A;  1J3T A;  2NWM A;  2K5F A;  3OYE A;  4E7J A;  7AT1 B;  1O9S A;  5L8R E;  3ZFJ A;  3OS5 A;  2YUN A;  2XG8 D;  1JBM A;  1TSF A;  2DFU A;  2H3J A;  4PFO A;  1YHQ T;  2ZCF B;  2J06 A;  1F1B B;  3M0Q A;  3T9N A;  3ZL7 C;  2L5Q A;  1PSF A;  2DTI A;  3M0S A;  1BI0 A;  2GNC A;  1ABO A;  3BW1 A;  1VQ9 T;  2EJG A;  2ENM A;  1YIT T;  4L59 A;  1NJI R;  3G7Z A;  2DA9 A;  3CMA Q;  1KQS A;  1U5S A;  2V26 A;  1PC0 A;  5IXF A;  2PU9 B;  2RI2 A;  1WJQ A;  1R8O B;  1UGP B;  1VQ8 A;  4IUR A;  3RBB B;  4E47 A;  3LYI A;  3OW2 S;  2FL7 A;  1P92 A;  4J6X A;  4A4H A;  3OBY A;  1KQ2 A;  1YJW A;  3REA B;  3G71 Q;  5L23 A;  2XID A;  5A0D A;  1KQ1 A;  3E1S A;  3QJY A;  1I8F A;  3TSZ A;  4DBR A;  2O9V A;  2OTJ T;  3CC7 Q;  2DJQ A;  1K8A U;  4PJO D;  1N6A A;  3V8J A;  1Y57 A;  3QBY A;  4F17 A;  2DZ9 A;  5KYW B;  3OYK A;  3S6W A;  2DBK A;  4ZGD B;  1H3H A;  1NYF A;  4A4E A;  3OMC A;  1NEB A;  2J6F A;  4HVW A;  4FYY B;  5GJV B;  3CEY A;  5LJ3 d;  1Y0M A;  2K4Y A;  4N4H A;  3CCJ Q;  1OUL A;  5GAN 6;  4M78 G;  2JM9 A;  1WI7 A;  2VC8 A;  1EX4 A;  2X35 A;  5LJ5 j;  5FRO A;  3VS5 A;  1SEM A;  3J7A F;  5IN1 A;  4M78 A;  2F1L A;  3UF4 A;  4OMM A;  5DM7 R;  1KIK A;  2M51 A;  3EGD A;  3EFS A;  3UDC A;  1WLP B;  3C95 A;  5EC7 A;  2F69 A;  2LQ8 A;  3PVL A;  5GAN j;  1VQO T;  1QVF A;  3HPW A;  2LX9 A;  1VQ9 A;  4KUI A;  2JM8 A;  2KYM A;  1AHJ B;  3SFM A;  2CP7 A;  3HSB A;  4M7D B;  1U8R A;  1KQS S;  2J7I A;  1YCS B;  3OMG A;  3QYH B;  2KRO A;  3TSW A;  3F70 A;  2IVW A;  4M7D C;  4PNO A;  4XTW A;  3OYG A;  3CCM T;  4M7D F;  1YHQ Q;  3TQ7 P;  4ZN1 A;  1GCP A;  5C6S A;  4KGV B;  1LPL A;  2D6F A;  3GOX A;  3JCM b;  3JCM g;  1VQ4 T;  2O01 E;  1BI1 A;  2X9H A;  3BE3 A;  1VOM A;  1YIT Q;  1O75 A;  4DOW A;  4WCI A;  3CCV A;  3MP8 A;  2CDT A;  2CT4 A;  1UGV A;  3VUZ A;  1D1C A;  3M0R A;  1OX9 A;  3NTK A;  1GXI E;  4FU6 A;  1W2B P;  1QCO A;  4XTY A;  1NJI U;  3L2R A;  2A28 A;  4DBQ A;  2EFI A;  3EG1 A;  4BE2 A;  3RMQ A;  3CCE A;  1GBR A;  2PVG B;  1WHG A;  5FU7 B;  1TUD A;  4JLG A;  5I22 A;  3EGX B;  3CD6 T;  2XI9 A;  2OTJ Q;  5FU7 C;  3QKJ A;  3KUF A;  2V1R A;  2MCN A;  1ABQ A;  3M9Q A;  4M7D E;  3RKY A;  1PM3 A;  5KYN A;  1T3S A;  4LDV A;  2EQJ A;  3D7S B;  2A0F B;  3X20 B;  2NUT B;  3NPF A;  1Q86 C;  2E1H A;  2EQU A;  4J9G A;  1WIE A;  4FM4 B;  4JLI A;  2M9U A;  2JS2 A;  3ER0 A;  1WYX A;  3UA6 A;  2LTO A;  3RKW A;  4PK4 A;  5LJ5 f;  1QVG P;  1M2O A;  1QVF S;  2DAQ A;  2KGT A;  2RM4 A;  2XMF A;  4LE9 A;  5HK3 A;  3PIP A;  3PTA A;  2QDL A;  2QGG A;  2JNG A;  1WPY A;  1PD0 A;  2KQW A;  1IO6 A;  3CCM A;  2YSQ A;  1B3Q A;  4A4G A;  4TVR A;  2LC4 A;  4C92 E;  4IUT A;  2NLU A;  4OP0 A;  4HVV A;  1WFW A;  4F14 A;  1VQO Q;  1EFN A;  2FZG B;  1BBZ A;  1HYO A;  2EPD A;  1NPP A;  4C0G A;  2HMA A;  2DIG A;  5GAN f;  1YJ9 T;  3KFV A;  4E7I A;  1WQ7 A;  2E6Z A;  3G1J A;  4BE0 A;  1VQN T;  4M77 B;  2YT6 A;  2HEQ A;  5CVI A;  4OB2 B;  4M77 C;  3JCM X;  4M77 F;  5LJ5 h;  2EYW A;  2DXC A;  2FPD A;  3CBP A;  3M58 A;  4RTW A;  3S3N A;  1K0X A;  1X01 A;  1RI0 A;  4Q5W A;  2E70 A;  5GAO r;  5M9O A;  1VQ4 Q;  1U06 A;  1I0C A;  2A08 A;  1B34 A;  3CD6 A;  4QVC A;  1YCY A;  1W1F A;  1AD5 A;  1VIE A;  2GTO A;  2X4Y A;  2QA4 A;  4R55 A;  2L3Q A;  2L3S A;  1OQK A;  1M90 R;  3VRY A;  4FIB A;  2VGN A;  4HT8 A;  2LCL A;  3NMZ C;  1H64 1;  1Y71 A;  3RKX A;  5A0G A;  4OMO A;  4F7U G;  4N4G A;  4M7D D;  2KT1 A;  1M3C A;  1U1S A;  4FYW B;  1CKA A;  1BU1 A;  3QUI A;  1MMD A;  1VQK A;  1KC8 R;  3EFO B;  4CC2 A;  1SSF A;  2CZ6 B;  1LNX A;  4PLI A;  3EG3 A;  4F7U A;  2KRN A;  1JJ2 P;  3R6O A;  1PHT A;  1QWE A;  1AT1 B;  2LJ1 A;  1AZG B;  1OU8 A;  1M1G A;  1Z9Z A;  1S72 Q;  5LJ3 h;  2DRK A;  1EZZ B;  4GY5 A;  1AWW A;  5GAN e;  5C0M A;  4HCC A;  4AT1 B;  3L2Z A;  1VYV A;  4LN2 A;  5IH2 A;  2O4X A;  4F16 A;  4JS5 A;  4C92 D;  2VUB A;  1YJ9 A;  1YP5 A;  2IG0 A;  2DVJ A;  3I56 T;  2BE7 D;  4E7L A;  3A8H B;  1YWO A;  2DEU A;  3JCM c;  3JB9 I;  2GTJ A;  1BIB A;  1OYX A;  2LZ6 B;  1UUE A;  3HP9 A;  2AHJ B;  2DF6 A;  3KBG A;  4EPC A;  4C5E A;  3ZEH A;  2DXT A;  1I5L A;  1M1K U;  4XU1 A;  3OBW A;  1UB4 A;  4JDS A;  3LX7 A;  3CXC P;  1RLQ C;  3ULR B;  2HZY A;  2JMA A;  3BY7 A;  4ANJ A;  1ZSZ C;  3M53 A;  4OB1 B;  1VQN Q;  3FC3 A;  1TG0 A;  5CR2 A;  2D0Q B;  1LOJ A;  2DEQ A;  4OGC A;  3EHQ A;  3I35 A;  2QQR A;  4FW2 A;  2NYS A;  3L1A A;  5CQX A;  4J8O A;  4J6W A;  4ZTF A;  1D0Z A;  2L8D A;  2E41 A;  3GNG A;  5GAO l;  4KH1 B;  2YLC A;  3CME Q;  2D1X A;  1JO8 A;  1ZSG A;  3RIR A;  1RAE B;  3JSC A;  1OX8 A;  4IUP A;  3LGL A;  4ELZ C;  4E7Z A;  2YUO A;  1PD1 A;  1ZQ1 A;  5CCA A;  1UGQ B;  2G6F X;  3JCM f;  2JMC A;  5CK9 A;  5IT9 E;  2EWN A;  2FHD A;  2DIQ A;  1WJS A;  3I9Q A;  1FMW A;  1G3W A;  2DXB A;  1FMK A;  2Y4Y A;  2DYB A;  1UFF A;  2F2V A;  2EJ9 A;  3JB9 J;  2RMO A;  2AZV A;  1M90 U;  3DKM A;  2C06 A;  4PJO G;  1G3T A;  2KR3 A;  1PWT A;  3RER A;  3OYC A;  4GLK A;  3FEO A;  2SRC A;  4EIK A;  1SHF A;  1KC8 U;  3OYM A;  2FRY A;  3G71 T;  1R0B G;  3VS4 A;  4PJO A;  3I56 A;  1VQ5 A;  1GCQ C;  3A8L B;  2DXU A;  1RLP C;  3H41 A;  1Q7Y R;  4PJJ A;  1KSW A;  1RL2 A;  3JCM h;  3LW5 E;  3RDV A;  4ZTJ A;  4XU2 A;  5FWC A;  4BE1 A;  3HHT B;  2QQ9 A;  5KYY B;  2DM1 A;  3INZ A;  3OYF A;  3CC2 T;  1Y96 B;  2DIL A;  4PKC C;  3QSU A;  1LJO A;  4JS4 A;  1NYG A;  2KDS A;  3A1P A;  3CCU Q;  2YRD A;  2CP5 A;  2JW4 A;  2P0K A;  1DJ7 B;  6AT1 B;  2O31 A;  2MI6 A;  1ZA1 B;  1VQP T;  4LDY A;  2AKL A;  1D3B A;  3JV3 A;  1M8M A;  2QEX T;  1X27 A;  2RJF A;  4AFQ C;  4QQG A;  4PL6 A;  3JAM E;  2D0N A;  2P4T A;  4IUQ A;  2K2V A;  1NLP C;  3MET A;  2EJF A;  4OMN A;  1WHM A;  3RR6 A;  2C0O A;  2CSI A;  3JB9 G;  1SG5 A;  1MHN A;  1FWZ A;  3J80 E;  5FRN A;  3OYB A;  2DJZ A;  3MEW A;  2RD1 A;  4WTO B;  2O88 A;  1X75 C;  1WHJ A;  2YWW A;  1NJI C;  3S3O A;  1E7O A;  1M5Q 1;  4CI0 C;  3CMA A;  1OZ2 A;  2D9T A;  3LH5 A;  1H8K A;  2BZY A;  2HCK A;  1OOT A;  4NOY A;  1OPL A;  4HVU A;  5CAI A;  5AT1 B;  3QHS A;  1MGQ A;  1K0S A;  5LJ3 g;  3SWN A;  3G71 A;  1Q81 R;  3EFR A;  2E10 A;  2FPE A;  4Z88 A;  3OYI A;  3CCR T;  2RHI A;  3R6N A;  3UPU A;  1ZX6 A;  3CC7 A;  2AK5 A;  5GAM d;  2B86 A;  3E19 A;  1JXO A;  4Z89 A;  4OMF B;  4C0Z A;  3QPH A;  4P5N A;  5GAN 3;  1WA7 A;  4ORZ A;  4BI4 A;  4HCZ A;  3CC2 A;  2AT1 B;  2HNI A;  2YHT A;  3CCJ A;  2KSS A;  1NBE B;  2DTH A;  3FLG A;  3RNJ A;  2RHY A;  1YIJ T;  1PSE A;  4CC7 A;  5AYF A;  1V76 A;  2X4W A;  2MF2 A;  1BCO A;  2VXF A;  1G5V A;  2V8J A;  3MP6 A;  3X26 B;  4VUB A;  1MV0 B;  4XK8 E;  2QEX A;  4C0F A;  2QQB A;  2DKG A;  4C8Q B;  2K5I A;  4QQ6 A;  1N9S A;  5D6Y A;  2A36 A;  2COY A;  2DL4 A;  2KYB A;  2EQM A;  2I2L A;  3CBO A;  4C8Q C;  4C8Q F;  3CC2 Q;  1QWF A;  2JUF A;  3MP1 A;  3OW2 P;  5ECA A;  1PRM C;  2K3X A;  1QKW A;  1YI2 T;  3A8O B;  3H6Z A;  1BCM A;  2F5K A;  2KT8 A;  4LXC A;  1VQP Q;  2VB6 A;  4A63 B;  1WXB A;  1BB9 A;  3O8V A;  2A37 A;  2QEX Q;  5CKH A;  2DE0 X;  3P8D A;  4X1V A;  1GBQ A;  2EYQ A;  1LCK A;  5KYW A;  2SEM A;  3V8K A;  4RTV A;  4IKF A;  5DLQ E;  3OYL A;  4MMK A;  3VS1 A;  2BKD N;  2COZ A;  1FX7 A;  3EH1 A;  3M59 A;  2X3X D;  3CPF A;  1YHQ A;  1VQ6 Q;  4KBM B;  2E65 A;  2RB6 A;  1QMC A;  2K3Y A;  4M7A B;  3TRE A;  2JOY A;  4NS5 A;  3CC4 Q;  1Q82 R;  2RQR A;  1YIT A;  4M7A C;  2EGA A;  4M7A F;  4C8Q E;  3H8Z A;  3L42 A;  4C0D B;  4HCK A;  4XQ3 A;  2PVO B;  4LD9 K;  4R0K A;  2L2P A; 
#chains in the Genus database with same CATH homology
 1K76 A;  2HEQ A;  1T3L A;  1SSH A;  1X6G A;  2RQT A;  4AFS C;  2CT3 A;  2EYW A;  3VRZ A;  4OMP A;  2ED0 A;  2FPD A;  1OPK A;  2L3P A;  4RTW A;  4GBQ A;  1X69 A;  1K0X A;  4JJC A;  1RI9 A;  3I5R A;  2F2W A;  1HD3 A;  2YUP A;  1U06 A;  3EG2 A;  1KFZ A;  1I0C A;  2A08 A;  4K11 A;  1W1F A;  1AOJ A;  1AD5 A;  2GTO A;  2L3Q A;  2L3S A;  2DL7 A;  3A98 A;  1WXT A;  2EKH A;  3VRY A;  2HDA A;  4HXJ A;  2ESW A;  3NMZ C;  4RTU A;  4OMO A;  1X43 A;  3U23 A;  3M0T A;  2M0Y A;  1S1N A;  1MUZ A;  5HCK A;  1K9A A;  2KT1 A;  1KJW A;  1M3C A;  1CKA A;  2W10 A;  1BU1 A;  3H0I A;  1PNJ A;  1ZLM A;  2EGC A;  2LQW A;  2K3B A;  1PKS A;  2ABL A;  4CC2 A;  4J9C A;  1AWO A;  1YN8 A;  2GGR A;  1HSQ A;  3EG3 A;  4M4Z A;  2JTE A;  4FSS A;  2D8J A;  2KRN A;  1JQQ A;  2F2X A;  1BK2 A;  1PHT A;  1QWE A;  1GL5 A;  1I07 A;  4QT7 A;  2LJ1 A;  4JJB A;  1SRL A;  1AZG B;  1Z9Z A;  1M30 A;  3SHW A;  1VYU A;  1W6X A;  2FEI A;  1PRL C;  2P4R A;  1W70 A;  1GCQ A;  2DRK A;  2EVR A;  1AWW A;  2L0A A;  4IIO A;  2K2M A;  3FJ5 A;  4RTT A;  1UDL A;  1VYV A;  4LN2 A;  5IH2 A;  2D8H A;  2KXD A;  1JXM A;  4F16 A;  1SRM A;  2MIO A;  2KBT A;  4CC3 A;  2FO0 A;  4D8D A;  2RQV A;  1YP5 A;  2EYX A;  2DVJ A;  2E5K A;  4LNP A;  4DEY A;  2JT4 A;  1ZUY A;  3VS0 A;  1YWO A;  2HSP A;  2CUD A;  2GTJ A;  2K7A A;  1NEG A;  2O2O A;  2JXB A;  4AFZ C;  2LZ6 B;  1UUE A;  1WDX A;  2DF6 A;  1WX6 A;  3QWY A;  4OML A;  1UHF A;  4J9H A;  4IIM A;  2LQN A;  2LCS A;  1JEG A;  4J9B A;  1NM7 A;  1NG2 A;  4Y92 A;  2ROT A;  2CUB A;  2W0Z A;  3CQT A;  3EG0 A;  3NHN A;  2AZS A;  1UJ0 A;  1RLQ C;  2GBQ A;  2LJ3 A;  3ULR B;  2JMA A;  1ZBJ A;  2OI3 A;  2YDL A;  2FG0 A;  3GBQ A;  1G83 A;  3PVQ A;  2ED1 A;  1TG0 A;  2DL3 A;  1TUC A;  2DMO A;  1AEY A;  5IXB A;  3EHQ A;  3I35 A;  1X2Q A;  3SEM A;  2NUZ A;  2EQI A;  1YNZ A;  1G2B A;  2RN8 A;  1K1Z A;  4J9F A;  3REB B;  3VS3 A;  1J3T A;  2NWM A;  1NLO C;  5FW9 A;  2CRE A;  1RUW A;  1QCF A;  4GLM A;  2D1X A;  1JO8 A;  1ZSG A;  2YUN A;  4OMQ A;  4LUE A;  1GFC A;  2YUO A;  1QKX A;  2JS0 A;  2G6F X;  3THK A;  4JJD A;  2JMC A;  2KEA A;  2J06 A;  3M0Q A;  3ZL7 C;  1VYT A;  4J9D A;  3I9Q A;  3M0S A;  1AWX A;  2BZX A;  2GNC A;  1FMK A;  1ABO A;  1FYN A;  2DYB A;  2ENM A;  1UFF A;  2BTT A;  2F2V A;  2ROL A;  1VA7 A;  2RMO A;  2AZV A;  2DA9 A;  1U5S A;  2KR3 A;  1UG1 A;  2V1Q A;  5IXF A;  1PWT A;  1A0N B;  4AFU C;  2I0N A;  3RBB B;  2KXC A;  2EW3 A;  3M0P A;  2SRC A;  2MOX A;  2IIM A;  4EIK A;  1SHF A;  1WXU A;  2FRY A;  3VS4 A;  3REA B;  3TVT A;  1AZE A;  2RPN A;  1GCQ C;  5L23 A;  2CH4 W;  1RLP C;  3H41 A;  3TSZ A;  2J6O A;  2O9V A;  1KSW A;  2DJQ A;  1Y57 A;  4F17 A;  2EYY A;  2DL8 A;  4JZ4 A;  5FWC A;  2DBK A;  5IHK A;  4CC4 B;  2DM1 A;  2CSQ A;  4RTZ A;  1H3H A;  1NYF A;  4HVW A;  1NEB A;  2J6F A;  2PZ1 A;  5GJV B;  5IHI A;  1T0H A;  1Y0M A;  2DIL A;  1NYG A;  2JW4 A;  2EYZ A;  4JZ3 A;  3I5S A;  5IHN A;  2JM9 A;  1WI7 A;  2O31 A;  4D8K A;  1OV3 A;  2AKL A;  2VKN A;  1X6B A;  2AKK A;  3JV3 A;  1M8M A;  2CH4 A;  3VS5 A;  1SEM A;  1X27 A;  5GJW B;  2EBP A;  2C0I A;  4AFQ C;  3UF4 A;  2KRS A;  2DNU A;  4OMM A;  2BZ8 A;  1KIK A;  2D0N A;  1UEC A;  1PKT A;  2M51 A;  3UAT A;  4JPB W;  2DRM A;  2LJ0 A;  5I11 A;  1GRI A;  1NLP C;  4OMN A;  4E6R A;  1WLP B;  2C0O A;  2CSI A;  5EC7 A;  2FRW A;  2GQI A;  1Z9Q A;  3PVL A;  2RF0 A;  2K79 A;  2O88 A;  2DL5 A;  2JM8 A;  2KYM A;  1UHC A;  1CKB A;  2DX1 A;  1E7O A;  1N5Z A;  3LH5 A;  1H8K A;  1XOV A;  2BZY A;  1UE9 A;  2HCK A;  1OOT A;  1OPL A;  1I1J A;  1V1C A;  1YCS B;  1ZUK A;  2J7I A;  3H0H A;  4HVU A;  2KRO A;  3TSW A;  2C0T A;  2LNH B;  4AG2 C;  2RQU A;  1K0S A;  2LX7 A;  1GCP A;  2YUQ A;  2J05 A;  4ESR A;  1SHG A;  2FPE A;  4Z88 A;  2KE9 A;  3O5Z A;  4RTX A;  3R6N A;  5FWB A;  1ZX6 A;  2AK5 A;  4WCI A;  2CDT A;  2B86 A;  2CT4 A;  1UGV A;  3EHR A;  1JXO A;  2H8H A;  4Z89 A;  1SPK A;  3M0R A;  1WA7 A;  1MV3 A;  2DLP A;  2RNA A;  4ORZ A;  1ARK A;  4AG1 C;  3IQL A;  1JU5 C;  2A28 A;  3RNJ A;  4CC7 A;  3EG1 A;  1M3A A;  3VS2 A;  2LMJ A;  1GBR A;  1X2K A;  3VS6 A;  1TUD A;  3H0F A;  3M0U A;  5I22 A;  1MV0 B;  2V1R A;  2MCN A;  1ABQ A;  2K6D A;  1HJD A;  2HBW A;  2A36 A;  2DL4 A;  3C0C A;  2KYB A;  3NGP A;  2ECZ A;  4KRT A;  1T3S A;  3NPF A;  1QWF A;  2LP5 A;  2DBM A;  3VS7 A;  5ECA A;  1PRM C;  1QKW A;  4J9G A;  1WIE A;  1B07 A;  2KT8 A;  1M27 C;  1K4U S;  1UTI A;  4LUD A;  2JS2 A;  1WYX A;  3UA6 A;  2X3W D;  4A63 B;  1WXB A;  1BB9 A;  1AWJ A;  2A37 A;  1M3B A;  2DE0 X;  4RUG A;  4X1V A;  1GBQ A;  1LCK A;  2SEM A;  2VWF A;  2PNI A;  2O9S A;  1GFD A;  2KGT A;  2XMF A;  4LE9 A;  4DEX A;  1ZUU A;  2OAW A;  2OJ2 A;  2VVK A;  4RTV A;  2K9G A;  1AVZ C;  2KRM A;  3VS1 A;  4ZNX A;  2QDL A;  2X3X D;  1OEB A;  1IO6 A;  2YSQ A;  3EGU A;  1B3Q A;  3PE0 A;  1YWP A;  4J9E A;  2KNB B;  2J6K A;  4HVV A;  1WFW A;  1U3O A;  4F14 A;  1EFN A;  2RQW A;  1BBZ A;  1T0J A;  2EPD A;  2RQR A;  3UA7 A;  2FPF A;  2EGE A;  4RTY A;  2EGA A;  1QLY A;  3KFV A;  4Z8A A;  2PTK A;  1UJY A;  1H92 A;  1E6G A;  4HCK A;  3QWX X;  4J9I A;  1CSK A;  4R0K A;  1E6H A;  2L2P A;  2YT6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...