2DBMA

Solution structures of the sh3 domain of human sh3-containing grb2-like protein 2
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
73
structure length
73
Chain Sequence
GSSGSSGPCCRALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLHGHSGFFPINYVEILVALPHSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structures of the SH3 domain of human SH3-containing GRB2-like protein 2
rcsb
source organism Homo sapiens
molecule tags Transferase, signaling protein
molecule keywords SH3-containing GRB2-like protein 2
total genus 5
structure length 73
sequence length 73
ec nomenclature ec 2.3.1.-:
pdb deposition date 2005-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dbmA00
2F2VA 1T0JA 4RTWA 1TG0A 2LJ0A 1G2BA 4M4ZA 3TSZA 4JZ4A 1NM7A 1E6GA 2AZVA 2DRMA 2EPDA 1SEMA 1M27C 2FRYA 2KROA 2CSIA 1T3LA 2FG0A 4AFQC 1ZUYA 3UA6A 2LNHB 4F16A 1QWEA 1AVZC 2SEMA 3VS0A 1AZEA 2AKKA 2HBWA 2GBQA 2KGTA 1I07A 2FO0A 1M30A 2J06A 3I5SA 2AZSA 2ESWA 4Z8AA 3M0SA 4LNPA 2KT8A 3REAB 4Z89A 2JXBA 3TSWA 4J9HA 4A63B 2KRSA 1WLPB 2RQWA 3VS4A 5IH2A 3RBBB 2K3BA 2RNAA 2VVKA 1X2KA 1Y0MA 2DVJA 2M51A 4GBQA 1WFWA 1UE9A 2RMOA 2EYXA 1G83A 2X3XD 3CQTA 1U06A 3ZL7C 4J9FA 2LP5A 1X69A 4AG1C 2DJQA 3EHRA 2DL4A 1GCPA 2YSQA 3EGUA 3VRYA 2C0IA 3NHNA 3NPFA 3H41A 2RQUA 2D1XA 4J9EA 1KSWA 2O9VA 3VS7A 1AEYA 3PE0A 1SSHA 5I22A 3VRZA 3I5RA 1AD5A 1WA7A 2PTKA 2FEIA 1MV3A 1UTIA 1VA7A 2DBMA 1UHFA 4CC3A 1X6BA 3IQLA 2DL5A 1H8KA 4J9CA 1H3HA 1W6XA 2W10A 2KXDA 4R0KA 1ZUUA 1GFCA 2J6KA 4Z88A 2JM9A 2DE0X 1RLPC 2OJ2A 2F2XA 1WYXA 3TVTA 3PVQA 2CT3A 4AFZC 1K9AA 2YDLA 2PZ1A 2JT4A 2O9SA 1UHCA 4AG2C 2JMAA 4QT7A 3VS1A 4RTUA 1ZLMA 1T3SA 4LN2A 3O5ZA 3QWYA 2ECZA 4ESRA 1Z9QA 3M0PA 1K76A 2DL3A 1SHFA 1AWWA 2HDAA 2BZ8A 1GL5A 2LQNA 2J05A 2DNUA 1GFDA 4HXJA 1K1ZA 1LCKA 1EFNA 2D8JA 4LUEA 1M3BA 1PNJA 4OMLA 1PWTA 5IXFA 1NLPC 4CC4B 4F14A 2JS2A 1NEGA 2V1RA 4OMPA 2LJ1A 2KRNA 4IIOA 2DILA 2J7IA 2KE9A 2KNBB 5ECAA 2PNIA 1ZBJA 1WI7A 1V1CA 1OV3A 2CUDA 2V1QA 2CT4A 1UUEA 1T0HA 1M8MA 1GCQA 2ED0A 3U23A 1YWOA 2CSQA 2LJ3A 4RTVA 1BK2A 3FJ5A 2K9GA 3REBB 3JV3A 1W1FA 3M0TA 1ARKA 1X2QA 5GJWB 3VS6A 2GGRA 3UF4A 2E5KA 1NLOC 2ABLA 4WCIA 4HVVA 2C0OA 4Y92A 2OI3A 2EGCA 1WDXA 2MOXA 2O2OA 4D8KA 2X3WD 2K6DA 2JW4A 2DL8A 2FPFA 2B86A 1QKWA 2NUZA 2ED1A 1VYUA 4FSSA 1NEBA 4JJCA 3H0FA 1WXTA 2DX1A 1HJDA 3H0HA 4J9DA 1X43A 1WIEA 1JO8A 1UJ0A 2I0NA 3GBQA 3LH5A 1X27A 1UGVA 1IO6A 2L2PA 3EHQA 2RN8A 1WX6A 1RI9A 3C0CA 3VS2A 1UJYA 1X6GA 2D8HA 2RQVA 2KR3A 2CUBA 2A08A 2DRKA 2BZXA 1CKBA 2DL7A 1FMKA 3RNJA 2RQTA 4HCKA 1ABQA 1WXUA 2RF0A 4RTXA 3QWXX 4JJDA 4RTYA 1E6HA 4KRTA 1KJWA 1BB9A 2LX7A 1S1NA 1A0NB 1KIKA 1NYGA 4DEYA 2L3QA 4AFSC 2CH4W 3M0UA 1PKTA 4JJBA 4K11A 2W0ZA 2MCNA 1YN8A 2YUPA 2P4RA 4DEXA 1YP5A 1AWXA 1PRLC 4OMMA 1JQQA 1VYVA 2OAWA 3EG1A 1AWOA 2DLPA 2RPNA 2DM1A 5EC7A 1YCSB 4JPBW 2HCKA 5IHKA 4X1VA 2SRCA 3I9QA 1YWPA 2LZ6B 4AFUC 1SPKA 5GJVB 5FWCA 2A37A 2M0YA 2EBPA 1WXBA 2KEAA 1AOJA 1GCQC 4F17A 1OPLA 1ZUKA 4GLMA 1SHGA 5IHNA 2GNCA 2HSPA 2KYMA 2H8HA 2XMFA 2YT6A 1I0CA 3UATA 2VKNA 2EW3A 4J9BA 1UG1A 2EYWA 2K7AA 1MV0B 2DBKA 3H0IA 2CREA 1BBZA 2FPDA 4J9GA 2KRMA 2L3SA 5IHIA 2BTTA 1HSQA 2FRWA 2L3PA 3EG2A 1CKAA 3M0RA 2JMCA 2A28A 4LE9A 2DA9A 2BZYA 3SEMA 2EVRA 1J3TA 2CH4A 2LQWA 2O31A 5I11A 1Z9ZA 2F2WA 1U5SA 4OMQA 1JEGA 4RTZA 2VWFA 1MUZA 4E6RA 5L23A 1TUDA 1PRMC 4OMOA 2GTOA 2C0TA 1UDLA 1AZGB 2YUQA 1SRMA 4IIMA 4ORZA 3SHWA 2EKHA 4J9IA 1JXOA 3UA7A 1UECA 1W70A 2K79A 3I35A 2EGAA 4RUGA 1K0SA 2EQIA 4CC7A 1NYFA 1RUWA 1OEBA 3PVLA 2D0NA 2AKLA 1PHTA 2ROTA 1M3CA 3NGPA 1ZSGA 1JXMA 1QWFA 1KFZA 1AWJA 2HEQA 1PKSA 1FYNA 1B07A 4ZNXA 1TUCA 2KXCA 1QKXA 2JTEA 1B3QA 2EGEA 2KYBA 1XOVA 2DMOA 4EIKA 1ABOA 1QLYA 2L0AA 2IIMA 2MIOA 3EG3A 2JS0A 2YUOA 1M3AA 1E7OA 4HVWA 2EYZA 1H92A 1HD3A 2RQRA 2DYBA 2GTJA 2KT1A 3THKA 4RTTA 2EYYA 4HVUA 2LCSA 2DF6A 3ULRB 2G6FX 1GBRA 1K4US 4LUDA 3KFVA 3M0QA 2NWMA 3EG0A 1GBQA 4JZ3A 1VYTA 1UFFA 1OPKA 1OOTA 5HCKA 1NG2A 2J6OA 1K0XA 2YUNA 4CC2A 2J6FA 2JM8A 2K2MA 2ROLA 2ENMA 4OMNA 2CDTA 3VS5A 3A98A 2O88A 1U3OA 1YNZA 3VS3A 1Y57A 1JU5C 2A36A 2AK5A 5FWBA 1I1JA 1CSKA 1SRLA 3R6NA 1GRIA 1ZX6A 5IXBA 4D8DA 2LMJA 5FW9A 1QCFA 2FPEA 2QDLA 2GQIA 1BU1A 1RLQC 3NMZC 1N5ZA 2KBTA
chains in the Genus database with same CATH superfamily
3CC4A 2F2VA 3TSZA 2BIVA 3GP8A 3CC4T 2EPDA 3L42A 1WHKA 4O6JA 2FRYA 2FG0A 3A8OB 4LXCA 4LD9K 2RHIA 3OA6A 2DERA 1AVZC 2DZ9A 3VS0A 1XJWB 1M1FA 2KGTA 3OYJA 1I07A 1EIFA 1M30A 4F7UE 2QTXA 4M77B 2AZSA 2ESWA 1S72T 1NJIR 3G6EA 5FRMA 4LNPA 3META 1YJWA 4M77E 2A7YA 3TSWA 4J9HA 4A63B 1WLPB 3VS4A 1RADB 1OZ2A 5GAN5 2K3BA 3T9NA 1Y0MA 2DVJA 5CQXA 2IG0A 3OMGA 5KYXB 2NLUA 1Q81U 2LP5A 3FEOA 1VQPT 2OX7A 2EJGA 3RMQA 4RMOA 3C95A 4LD6A 3A8MB 4OVAA 2KMTA 3EGUA 1D1AA 5AYFA 2R5MA 1N9RA 2D1XA 3M53A 2LT4A 3NTHA 4B9WA 3ZEHA 3CBPA 5I22A 4D6WA 3VRZA 2LC4A 3NTIA 3I5RA 1G5VA 3OYHA 1AD5A 2PTKA 3CBOA 3M58A 2HMAA 3I55Q 1Q7YU 1QVFA 3JRZA 5GAN6 1UGRB 1VUBA 4HCCA 2OAUA 1UHFA 1JRIA 1VQ6Q 1H3HA 2W10A 4XQ3A 4KGVB 2KXDA 2BKDN 3E19A 3QBYA 1ZUUA 1D0YA 3M5AA 3H8ZA 2VYTA 1GFCA 3QPHA 2F1LA 4Z88A 3QZ5B 3CMAQ 5FU6C 3RKXA 2OJ2A 2F2XA 5IN1A 3CD6T 2LNVA 4XTUA 4DOWA 4AT1B 1JJ2S 4AFZC 2FB7A 1IB8A 2AHJB 3HFNA 4AG2C 1BKBA 5GAOq 1PSFA 4FL6A 2RI3A 1M4ZA 2VUBA 3UPUA 4XTVA 2XHCA 2QEXA 2XG8D 3JCMc 3M0PA 2C06A 3GPLA 1NJIU 4M7AG 4PKCC 2MK5A 1AWWA 2HDAA 5A0DA 1TXQA 4ELYC 5IT9E 4KH1B 2MMPA 2J05A 2KQWA 1Y96A 3CPFA 4HXJA 1ACMB 2CP7A 2DD4A 1Q86C 3CCUQ 3MEVA 1R0BG 2JS2A 1I5OB 1NEGA 4M75C 3CPWA 1Q7YC 1KD1C 1KQSP 1ZBJA 2JVVA 2XDDA 1OV3A 2CUDA 4HCBA 3CCSA 4OB1B 2HKQB 1Q82R 1UUEA 4JDSA 3U23A 2ED0A 3EFSA 1YWOA 1WJQA 4RTVA 4A4HA 3FJ5A 1BI0A 2K9GA 2Z0WA 3JV3A 3M0TA 1X2QA 1NPRA 3PFSA 4J6XA 3UF4A 5J3BA 2P0QA 3JCMV 2QYZA 2OTLA 2ABLA 4WCIA 3E1SA 2C0OA 4Y92A 2OI3A 2EGCA 2E4HA 3L1AA 2MOXA 4KGZB 1UGQB 2K6DA 4M7AB 2FPFA 2B86A 2NUZA 2COYA 2WSFE 2RM4A 1VQNA 2V8JA 4OB2B 1JO8A 1UJ0A 2I0NA 1W4SA 3LH5A 2NUTA 1UGVA 3G71A 3VS2A 3C0CA 2LTOA 1VQ5T 2CUBA 4M78B 2BZXA 2CP5A 1EZZB 1OYXA 2LX9A 2X4WA 3JCMg 3CCMQ 1ABQA 2ATCB 2RF0A 5FU7B 4WF2A 5KYUA 5KE3A 1E6HA 2DAQA 1WHHA 4J6WA 3FRNA 4M77D 1GXIE 2CH4W 4XTXA 4K11A 2W0ZA 3OYAA 2YUPA 3JAME 2LCCA 4DEXA 1YP5A 5GAN4 4OMMA 1KD1U 1JQQA 3EG1A 4N0AC 4M77G 2DXBA 1W2BS 2DM1A 4JPBW 2EIFA 2EWNA 3OYDA 4X1VA 2IVWA 3I9QA 4AFUC 4DBFA 3TU4K 2F5KA 3JCMf 3L2RA 2XKOC 2L3RA 2A37A 2EBPA 2M0YA 2KEAA 1OPLA 4ZN1A 1ZUKA 4IUVA 4IUTA 1VQ5Q 5I2SA 3FB9A 4J9BA 2EYWA 2K7AA 1KQSS 3G6EQ 2FPDA 1G3WA 1Q95G 2YLCA 3RUXA 1YITQ 4QVCA 1HSQA 3OW2P 2QK0A 3PIOA 2DEUA 1B7TA 2JMCA 2YRVA 2EVRA 1LPLA 2QASA 2LQWA 2O31A 3M4YA 3P8BB 4TVRA 3I56A 1TTHB 2R58A 1U5SA 4F7UF 1G3YA 4RTZA 2HAXA 2BUDA 2VWFA 4E6RA 1B34A 1TUDA 3A1PA 4NS5A 1OU9A 2YRCA 2HL5C 2GTOA 1VQ9A 4E7JA 4IIMA 1SRMA 1WHLA 3UA7A 5CCAA 1VQKT 4M7DA 1V29B 1W70A 3CMAA 2RHYA 4RUGA 1K9MC 1K0SA 4Y91A 2CZ1B 3KXTA 3E9GA 2CP3A 4C8QE 3CXCS 3PVLA 2D0NA 1Q86R 1XNIA 2AKLA 3AHUA 2ROTA 2KK4A 3I56Q 1QQJA 2O4XB 5CKHA 2V8IA 1QWFA 3CCET 1LOJA 1Q81C 1PKSA 2MAMA 1ZHIA 4M75B 4ZNXA 4EMKC 2DVEA 4MDWA 3MKDA 2KXCA 5FROA 1IHVA 2DMOA 1RAAB 4EIKA 1ABOA 4EMKA 3TEEA 1BIBA 2IIMA 2MIOA 1M3AA 4M7AD 2GCXA 4HVWA 4MZPA 1G3SA 1H92A 3QDRB 4RTTA 2MWOA 2CP6A 3M0QA 4FT2A 2RJCA 2E3IA 4M7AC 4JZ3A 1VYTA 1YIJA 1OOTA 4M78D 1NG2A 1AHJB 1G8XA 5KE2A 1K0XA 2JM8A 3DLMA 2VC8A 2O88A 4HKEA 1U3OA 4ATOA 1YNZA 1IZ6A 3VS3A 3PGGA 3FIFA 3VU3C 3EGXA 2X4XA 1CSKA 2K5LA 3MP1A 2K2VA 4X9CA 4X9DA 5FW9A 1QCFA 5FU7C 3JB9G 5DLQE 4KGXB 3NMZC 4RTWA 4AMCA 2JNGA 4JZ4A 2DZCA 4DBQA 1Y71A 3WVEB 1M27C 2VGMA 2CSIA 3LGLA 3JB9D 5GAMd 4C5GA 5GMKj 5CKDA 1ZUYA 3UA6A 2VASA 2LNHB 2CP2A 1QWEA 4DQ2A 2HBWA 4PJOA 2FO0A 2PVGB 2VB6A 1MHNA 3M54A 3V8JA 2DTIA 4XTZA 2KSSA 2RNAA 2DIQA 2VVKA 1X2KA 1QVPA 2EQJA 2M51A 4P5NA 4F7UG 4GBQA 2XICA 2HZYA 4M78G 4A54A 2O01E 2CP0A 1M2VB 4II1A 3KBGA 1YJNT 4BE2A 3DB3A 1X69A 1HXDA 5I21A 3EHRA 2X4YA 4M75F 3PT9A 1VQKA 2OTJT 5CVIA 2YSQA 5J26A 4FT4A 5FLXE 3EFRA 5CKBA 4EPCA 3M57A 3HHTB 2YRDA 2LVMA 4GLKA 3VS7A 1AEYA 3V7SA 2HD0A 2E65A 3PE0A 3QDFA 4CRIA 2BE7D 1R77A 3CCEA 1UTIA 1YITA 3CCVT 2ZPGB 5GAOl 2DL5A 1H8KA 1W6XA 1BYMA 3JCMX 3L2UA 4L59A 4M75D 1KQSA 1K8AR 4XU1A 4HT8A 2J6KA 2JM9A 2GF7A 3RR6A 3G7ZA 5KCOA 4PJNA 1RLPC 2ZPEB 1RAHB 1OQKA 5GAOm 3CCLT 3PVQA 2FL7A 3E2UA 4HCZA 6AT1B 1XTDA 3SDZA 2YDLA 4EDUA 3PIPA 2QEXQ 2JT4A 3RERA 1RAFB 1M5Q1 4N4HA 1ZA2B 3GOXA 4HT9A 3QWYA 3C12A 4FIBA 4M75G 1K76A 4HA8A 2FZCB 1SHFA 1PC0A 2BZ8A 1OU8A 2CS7A 1S72Q 5GAOr 1K8AU 1QCNA 1GFDA 2DTHA 1EFNA 4LUEA 1M3BA 1X75C 1PNJA 2LCLA 5CKEA 1VQ4T 1K73R 3NFCA 1NLPC 3JB9F 1ZQ1A 2V1RA 5LJ5f 2HQXA 3CCQT 1YHQQ 2EJ9A 1K73C 2DJZA 3G71Q 2CZ0B 2CT4A 3X24B 3PMTA 4ZTJA 2CSQA 1BIAA 4FW1A 5GAN8 3FC3A 3OYKA 4NL2A 1D3BB 4N4GA 3TCJA 3VS6A 3MJXA 2GGRA 2JZ2A 3URGA 2O4XA 1VIEA 3CCEQ 2PU9B 1OX8A 1BCMA 1WNLA 2O2OA 3ER0A 3RDVA 3S3NA 2X3WD 4BUGA 1RAGB 2ED1A 1X6OA 2M16A 5C6SA 1M1GA 1MMNA 3OYYA 1X43A 1YJWT 4ELZC 3GBQA 1X27A 3BFMA 3CCRQ 2L2PA 3EHQA 1D1BA 2LQ8A 4JLGA 2DTOA 4PFPA 1W2BA 1MMGA 1X6GA 1VQMT 2X35A 3JB9I 2E70A 2HQEA 2DRKA 3D7SB 3SWNA 1WQWA 3M4GA 2M02A 2RI2A 1VQ6T 1WQ7A 2RQTA 3HTRA 4C5IA 3LYIA 4M77C 1FMWA 2QAZA 5LJ3h 4R55A 1QP3A 4OGEA 4BY6C 1N8RU 5KH6A 2Y4XA 1WZOA 2LX7A 2FZGB 1A0NB 1N9SA 2DPPB 1S72A 4QVDA 1TS9A 1AWXA 1PRLC 3MP8A 4FYVB 1VYVA 5EC7A 2LT1A 5CK9A 5IHKA 2HCKA 3N5BB 2WSCE 2R57A 2RA2A 2SRCA 4E47A 4DBHA 2LZ6B 2HQHA 4F04B 1YI2Q 5GJVB 3CCUA 2QQRA 4C0ZA 2KAFA 3QZ9B 1WXBA 1GCQC 4KUDK 2I2LA 4GLMA 2FYKA 1SKUB 1R8OB 1SHGA 5IHNA 2GNCA 2HSPA 4KT0E 4A4GA 1YHQT 2HBPA 2XMFA 4PLIA 2DK3A 5L8RE 1I0CA 2OTJA 1YJ9Q 1TOVA 2EW3A 2RK1A 2DBKA 1YIJQ 1N6AA 4PFOA 4JRQA 5DLOA 3OW2S 2A3LA 4XTWA 2L3PA 1K9MU 1CKAA 3M0RA 2MF2A 2Y4YA 2A28A 4LE9A 3QJ6A 4LDYA 2E64A 4M7AF 1M8VA 4WTOB 4FW2A 3VJPA 2JUFA 3QSUA 3VYHB 1HYOA 4KUIA 2E41A 2E6NA 3BE3A 1UDLA 3SHWA 1LNXA 1UECA 3LLRA 2JJ9A 4MMLA 3VUZA 4ZGJB 4DBRA 2EQIA 3FJPA 1OEBA 3R6OA 1X01A 1BI3A 5IAYA 2AT1B 4LDXA 1M1KU 2RD1A 4DOVA 1UGPB 5GAN2 1FYNA 4QVZA 4C8QG 1TUCA 5GANg 3OB9A 1VQPQ 5GMKl 2JTEA 2EGEA 2KYBA 1VQLT 3CPWP 2AIRB 5GANd 3M9QA 3CXCP 1VQNT 2YUOA 1E7OA 1WJSA 2EYZA 1D3BA 1D1CA 1PG5B 3QUIA 2CKKA 1HD3A 2DYBA 2GTJA 3THKA 4HVUA 3Q1JA 2LCSA 1GBRA 3KFVA 1VQ4Q 3GIBA 2YWWA 1K73U 2CGHA 3CBMA 1GBQA 2DXUA 1UFFA 1OPKA 4C0DB 5GAMh 5HCKA 4CC2A 2J6FA 4E7IA 1WHMA 1OZ3A 2XDBA 2ENMA 2CDTA 3A98A 3OYLA 4BI8B 1LVKA 4MDXA 4FYWB 1Y57A 1JU5C 5AT1B 2AK5A 4RCBA 4C8QB 2E12A 4ZGDB 3GNFB 4ANJA 2M9UA 3L2QA 2FPEA 4C8QF 2QGFB 2GQIA 4BY6B 7AT1B 5GANh 4KH0B 3G71T 3JB9J 4M7DD 3A8LB 2H3JA 2XIDA 4C0DC 5LJ5j 4M4ZA 2XD0A 1NM7A 1E6GA 2AZVA 2DRMA 1KG1A 3V7RA 3G4SA 2KROA 1YHQA 4C92F 2ZZDA 4IKFA 2GQVA 3OW2A 1JBMA 1H641 2CZ6B 4PJLA 3HSBA 1TH7A 1AZEA 5A0LA 4X34A 3X28B 2J06A 1KK7A 4FSXA 4Z8AA 4M7DG 3RKWA 1C0MA 1JJ2P 1NBEB 4M77A 2EYQA 2KT8A 3REAB 3CC7Q 1Y07A 2KRSA 5IH2A 4F7UA 3RBBB 2E5QA 2E1HA 1VQ5A 1O75A 3MPUB 5KYXA 5C0MA 4J5YA 3MEAA 4IUQA 1QVGP 1UE9A 2RMOA 2VV5A 1I5LA 4PJOG 3L2ZA 4AG1C 2DJQA 3PTAA 3UWNA 2A0FB 1RABB 1GCPA 3QO3A 5LJ5g 2F5TX 3NHNA 4PL6A 1YFNA 3H41A 2RB6A 3FLGA 3OYCA 2RHXA 1KSWA 3O8VA 3A8GB 2RJEA 1VOMA 3ME9A 4F7UB 3OS2A 2FEIA 2LRQA 3VV0A 3LWHA 1U1SA 2EJFA 2DBMA 3PMIA 1I8FA 4OF1A 1UEBA 4PK4A 4J9CA 2JTMA 5GMKe 1VQ9T 2KI7A 1K9MR 4M77F 2QTVA 1PD1A 2LDMA 2JN0A 3SD4A 4N0AA 2K3YA 3CD6A 1WYXA 5LJ5h 2CT3A 3RMSA 1KC8R 1K9AA 4C5HA 1VQ8T 1UHCA 4EMKB 5HKCA 4QT7A 3VS1A 1DJ7B 2RO0A 4JS4A 1T3SA 3O5ZA 1Z9QA 3I55A 2K5IA 3HRTA 1G3TA 4C0GA 3JCMQ 1K1ZA 3OSSC 2QA4A 2D8JA 4OMLA 2MYSA 1PWTA 4CC4B 3HFOA 4OMPA 1IREB 2KRNA 3CCLA 5M9OA 1BI1A 1RAIB 2J7IA 3UDCA 2KE9A 2KNBB 5ECAA 5GANe 5HK3A 2PNIA 4M7DF 1WI7A 1V1CA 2EFIA 4PNOA 5KYNA 2V1QA 4C8QD 1M90R 1M8MA 3OYBA 1VQMQ 2LJ3A 1BK2A 1YI2A 2VXEA 4QQDA 4JRKA 5CIUA 3X20B 4JUVA 2K5FA 2OTLT 5GMKi 2P0KA 4VUBA 4C8QC 1W2BP 1WHJA 4B9XA 4D8KA 3JCMb 1SSFA 2JW4A 3JCMJ 1BI2A 4JS5A 1NEBA 2DEQA 3BDLA 4JJCA 1HJDA 3H0HA 5D7UA 4J9DA 1IRXA 2DXTA 4BE0A 3P8DA 1RL2A 1WX6A 1IGUA 4ZGEB 1UJYA 1OX9A 3CPWS 2D8HA 3FDRA 1LJOA 5GAMg 4RCCA 3CCUT 2A08A 1VQ6A 1UB4A 3EFOB 2P4TA 1PCXA 3RNJA 2XU8A 4M78E 2E3HA 4HCKA 3QYHB 4XU0A 3CCRA 3EH1A 1WXUA 1QP2A 1QVGS 4RTXA 2VGNA 2X4JA 4RTYA 4C92D 4BB7A 4KRTA 5DM7R 1KJWA 1BB9A 1S1NA 4DA4A 5J39A 1VQ7T 1KIKA 1NYGA 2CYZB 1PKTA 3SB2A 4PJJA 3G1JA 2D6FA 5GAMf 2DXCA 2OAWA 2GFUA 1QMCA 4NL3A 2DLPA 2DIGA 3BY7A 1YCYA 3QIIA 3OYNA 4C92G 1TWBA 1YWPA 2Y90A 1SPKA 3MO8A 3CCVA 1AOJA 3CCJT 4F17A 5EG2A 3JCMW 3CCJA 3CCRT 2QG9B 2H8HA 2YT6A 3UATA 2VKNA 3JCMP 1U8RA 1IHWA 3GLXA 1UG1A 3H0IA 3HRUA 5HK0A 3OY9A 2L3SA 3V8KA 5IHIA 2E10A 2FRWA 3EG2A 2QA4Q 1ZBXA 3LW5E 1VQ8Q 1QCOA 3HP9A 2DA9A 3OQ5A 3SEMA 4QKUA 5LL6S 2CH4A 2QEXT 4LDWA 3MEUA 2EQUA 3CEYA 4CI0C 3L2WA 4PJOD 2F2WA 3A5ZB 4M75E 2L8DA 2RH2A 4M78F 1FXXA 4OMQA 2PVDB 1YITT 5LJ3g 3WVDB 1MUZA 5L23A 1PRMC 2F69A 1FWZA 2WSEE 4OB0B 4JLIA 1M9SA 3HPWA 1AZGB 1AT1B 2NUTB 2YUQA 4C92C 5A0GA 1JXOA 3F70A 1OULA 2KDSA 3OBWA 2K79A 3I35A 4XU2A 4M7AA 2FZKB 4J7IA 1RUWA 3DKMA 2PUKB 3AT1B 3KUFA 4XTYA 5FU6B 1PHTA 3LX7A 1NZ9A 4XAXB 3UT1A 3BDUA 2RJFA 4BACA 1M1KR 1M3CA 2GFAA 3WXMB 3NGPA 4R56A 4N4IA 3EFOA 1KC8C 2COWA 1AWJA 2HEQA 1M2OA 1YIJT 4M7DC 2QA4T 3MCAB 2PQWA 3CCMT 1VQLA 1QKXA 3EGDB 1B3QA 4ZTFA 1XOVA 2WACA 2HNIA 4FCYA 3INZA 3CMEQ 3EG3A 3M59A 4QW2A 1MMAA 1N27A 1YJWQ 2YHTA 5KYYB 1KQ1A 1C6VX 3S6WA 4MZMA 4OP0A 3GNGA 2ZPBB 4PJOC 3ULRB 2KVQG 4LUDA 3RKYA 3RIRA 3EG0A 2L5QA 1RI0A 2DETA 8AT1B 3CC2T 4FYXB 3ZBDA 4JRIA 3CC7A 2QI2A 2ZAEA 4FU6A 2CZ7B 4OMNA 3VS5A 1PSEA 2H3EB 3S3OA 5GAOn 3BW1A 3G6ET 1SG5A 4QQ6A 1I4K1 2XDPA 4A53A 5FWBA 1I1JA 3R6NA 2K57A 5LJ3e 1M1KC 4E7HA 1ZX6A 4UC4A 1YJ9A 3V8LA 2QDLA 3CMET 5LJ5e 5KYWB 1BU1A 4Y28E 3OS1A 1RLQC 2KBTA 1T0JA 1WHGA 1YI2T 1TG0A 2LJ0A 1G2BA 4YTLA 2X9HA 2K4YA 3EG9A 3CCVQ 5GMKm 2NUPA 4C92A 1SEMA 2DFUA 1QVFS 4LDUA 1JB0E 1T3LA 4AFQC 3G4ST 3NTKA 4RKUE 4F16A 1I81A 3ZFJA 2SEMA 1VQLQ 2AKKA 2GBQA 1M90U 1U1TA 3J81E 3I5SA 4E7SA 4C8QA 1P92A 3M0SA 2V26A 5LJ5d 4OMFB 3X26B 4Z89A 2JXBA 1IGQA 2RQWA 3QKJA 2HKNA 3CCSQ 3MEWA 3CD6Q 1VQMA 2XI9A 2QQSA 1WFWA 3OMCA 4J8OA 2EYXA 1G83A 2X3XD 3EG9B 3QHSA 3CQTA 1U06A 3ZL7C 4J9FA 3JCMe 1MGQA 1YJNA 2JOYA 1D0ZA 1WJRA 4IURA 3J80E 2DL4A 3J7AF 2MWPA 3JCMd 2DD5A 4A4KA 3VRYA 3LH0A 2C0IA 2YXYA 3NPFA 4A4FA 4OB3B 1ZA1B 2RQUA 1V76A 3L2VA 4J9EA 2O9VA 3VYGA 2ZPHB 1SSHA 1Y7XA 2EKOA 1WA7A 3OSVA 3OS5A 2MPXC 2IPOB 5GAMe 1QW1A 1MV3A 2NUPB 4C92B 2VXFA 3CCLQ 3V7CA 2QQ9A 1NE8A 1VA7A 1MNDA 1Q7YR 4M75A 4IUPA 4CC3A 1NPPA 1X6BA 3IQLA 4ME7A 4R0KA 3EGDA 5CAIA 3RESA 5GANf 2YLBA 2DE0X 1N8RC 4BDYA 3TVTA 1KC8U 4M7AE 1VQNQ 2DYIA 1VQ8A 4JJNK 1VQ9Q 5GANj 2PZ1A 4M7DB 2O9SA 2JMAA 4RTUA 2L89A 3M56A 1D09B 4LN2A 1ZLMA 4GY5A 1O9SA 2FHDA 5CKFA 2ECZA 4ESRA 3DB4A 2DL3A 4B6MA 3EGXB 1F1BB 3CC2Q 2EAYA 1OI1A 1GL5A 2LQNA 2DNUA 4E7KA 1VQOA 1LCKA 2HSEB 5KYYA 3CXCA 4EMGA 2COZA 4RG8A 5IXFA 5GAMj 4F14A 1VQ4A 4XU3A 2LJ1A 4IIOA 2DILA 4ZN3A 2JTFA 3H6ZA 5FRNA 3CCQA 2PVOB 1M90C 5GAN3 1T0HA 3CMEA 3EH2A 4PLLA 1GCQA 2RJDA 4C92E 1FMVA 2QDYB 3REBB 2P0PA 4L6V5 1Q82U 1W1FA 2R5AA 5LJ3d 3CC2A 1ARKA 5GJWB 5CO7A 2V8KA 5GAOp 2ZGWA 3S3MA 1WPYA 2E5KA 1NLOC 4M78C 4IUUA 4E2FB 4HVVA 1JJ2A 2QGGA 3P8HA 1WDXA 3OYGA 8ATCB 3SFMA 4Q5WA 2DL8A 4FSSA 1QKWA 1VYUA 3OYMA 1KHIA 1Q81R 1TU0B 3H0FA 1WXTA 2DX1A 1WIEA 5D6XA 4M7DE 3CCQQ 5KYWA 1Q86U 2BE9B 4KULA 1YJ9T 1IO6A 4LDVA 4A4EA 2LQKA 2M1HA 2RN8A 1N5ZA 4FM4B 1C1AA 1RI9A 2RHUA 3C4SA 3C94A 5KYUB 2RQVA 2KR3A 4XK8E 3JCMh 1MNEA 3EAEA 1CKBA 2DL7A 4PJMA 1FMKA 9ATCB 1NJIC 4BI4A 1KQ2A 2MI6A 1ZSZA 3QWXX 4O5VA 4JJDA 2DO3A 4EMHA 3GF5A 5I2MA 1VQOQ 4PJOE 2DKGA 2NYSA 4DEYA 2L3QA 1B34B 4AFSC 4KBMB 3M0UA 4E7LA 1VQ7A 4JJBA 3VUBA 2MCNA 1YN8A 2P4RA 3DLLA 1AWOA 5LJ3f 3PNWC 5KCHA 4QQGA 5D6WA 2RPNA 1BCOA 4L5GA 1YCSB 4BDZA 1QVGA 4BD3A 3I56T 2M0OA 2P84A 1KHCA 5FWCA 4MMKA 4E7ZA 3OYFA 2D0QB 3OYIA 4C5EA 1UGSB 2KYMA 2HL3A 1PM3A 1MV0B 2CREA 1BBZA 4J9GA 2KRMA 2BTTA 4PJOF 2BZYA 3VKIA 2OTLQ 3QYGB 1SF9A 1J3TA 2G3RA 1ZSZB 5I11A 3JB9H 5D6YA 1Z9ZA 1TSFA 2QQAA 3X25B 5A2QE 3I55T 5DY9A 4BE1A 3JSCA 4OGCA 2E6ZA 1JEGA 1YJNQ 3CC4Q 3M55A 4OMOA 2PUOB 1H3ZA 2C0TA 1VQPA 5LJ3j 4ORZA 2D9TA 2EKHA 4J9IA 2RI5A 4FYYB 3CMAT 1N8RR 1WGSA 1VIFA 2EGAA 5HY6A 3OS0A 2FVUA 4CC7A 4V2SA 1ZSZC 4M78A 1NYFA 3CCJQ 4MZTA 5GAN7 3LWIA 1YBYA 3HL8A 1R0CB 1PD0A 4Z02A 1FX7A 3A8HB 1ZSGA 1JXMA 1KFZA 2ZCFB 1D0XA 1B07A 2RK2A 3CCMA 2XK0A 2QQBA 3TREA 1VQOT 1K8AC 3OBYA 1VQ7Q 1QLYA 2L0AA 3QG1A 2B8AA 4C0FA 1VQKQ 2OTJQ 3H9NA 2JS0A 5GMKh 3MP6A 3TQ7P 3MHXA 4BI3A 2ZPIB 1RACB 3SWNC 3E9FA 1Q82C 2EQKA 2RQRA 2KT1A 4PFZA 2EYYA 2K3XA 2DF6A 1K4US 2G6FX 4RG2A 2NWMA 1XQHA 1KD1R 1M2VA 3CC7T 1EX4A 3OYEA 3LGFA 3G4SQ 2J6OA 4J6YA 2YUNA 3ASKA 3QXEB 2K2MA 2EQMA 2RHZA 4J7FA 2ROLA 4JRPA 1HK9A 2X51A 1MMDA 1IXDA 5CQYA 2A36A 3SWNB 1TUGB 2ZPFB 5CR2A 2QXFA 1SRLA 3HRSA 4PJOB 1RAEB 4J83A 1GRIA 3QJYA 4NOYA 5IXBA 4D8DA 3CCST 2LMJA 2KY9A 1QVFP 1Y96B 3HKSA
chains in the Genus database with same CATH topology
2F2VA 1T0JA 4RTWA 1TG0A 2LJ0A 1G2BA 4M4ZA 3TSZA 4JZ4A 1NM7A 1E6GA 2AZVA 2DRMA 2EPDA 1SEMA 1M27C 2FRYA 2KROA 2CSIA 1T3LA 2FG0A 4AFQC 1ZUYA 3UA6A 2LNHB 4F16A 1QWEA 1AVZC 2SEMA 3VS0A 1AZEA 2AKKA 2HBWA 2GBQA 2KGTA 1I07A 2FO0A 1M30A 2J06A 3I5SA 2AZSA 2ESWA 4Z8AA 3M0SA 4LNPA 2KT8A 3REAB 4Z89A 2JXBA 3TSWA 4J9HA 4A63B 2KRSA 1WLPB 2RQWA 3VS4A 5IH2A 3RBBB 2K3BA 2RNAA 2VVKA 1X2KA 1Y0MA 2DVJA 2M51A 4GBQA 1WFWA 1UE9A 2RMOA 2EYXA 1G83A 2X3XD 3CQTA 1U06A 3ZL7C 4J9FA 2LP5A 1X69A 4AG1C 2DJQA 3EHRA 2DL4A 1GCPA 2YSQA 3EGUA 3VRYA 2C0IA 3NHNA 3NPFA 3H41A 2RQUA 2D1XA 4J9EA 1KSWA 2O9VA 3VS7A 1AEYA 3PE0A 1SSHA 5I22A 3VRZA 3I5RA 1AD5A 1WA7A 2PTKA 2FEIA 1MV3A 1UTIA 1VA7A 2DBMA 1UHFA 4CC3A 1X6BA 3IQLA 2DL5A 1H8KA 4J9CA 1H3HA 1W6XA 2W10A 2KXDA 4R0KA 1ZUUA 1GFCA 2J6KA 4Z88A 2JM9A 2DE0X 1RLPC 2OJ2A 2F2XA 1WYXA 3TVTA 3PVQA 2CT3A 4AFZC 1K9AA 2YDLA 2PZ1A 2JT4A 2O9SA 1UHCA 4AG2C 2JMAA 4QT7A 3VS1A 4RTUA 1ZLMA 1T3SA 4LN2A 3O5ZA 3QWYA 2ECZA 4ESRA 1Z9QA 3M0PA 1K76A 2DL3A 1SHFA 1AWWA 2HDAA 2BZ8A 1GL5A 2LQNA 2J05A 2DNUA 1GFDA 4HXJA 1K1ZA 1LCKA 1EFNA 2D8JA 4LUEA 1M3BA 1PNJA 4OMLA 1PWTA 5IXFA 1NLPC 4CC4B 4F14A 2JS2A 1NEGA 2V1RA 4OMPA 2LJ1A 2KRNA 4IIOA 2DILA 2J7IA 2KE9A 2KNBB 5ECAA 2PNIA 1ZBJA 1WI7A 1V1CA 1OV3A 2CUDA 2V1QA 2CT4A 1UUEA 1T0HA 1M8MA 1GCQA 2ED0A 3U23A 1YWOA 2CSQA 2LJ3A 4RTVA 1BK2A 3FJ5A 2K9GA 3REBB 3JV3A 1W1FA 3M0TA 1ARKA 1X2QA 5GJWB 3VS6A 2GGRA 3UF4A 2E5KA 1NLOC 2ABLA 4WCIA 4HVVA 2C0OA 4Y92A 2OI3A 2EGCA 1WDXA 2MOXA 2O2OA 4D8KA 2X3WD 2K6DA 2JW4A 2DL8A 2FPFA 2B86A 1QKWA 2NUZA 2ED1A 1VYUA 4FSSA 1NEBA 4JJCA 3H0FA 1WXTA 2DX1A 1HJDA 3H0HA 4J9DA 1X43A 1WIEA 1JO8A 1UJ0A 2I0NA 3GBQA 3LH5A 1X27A 1UGVA 1IO6A 2L2PA 3EHQA 2RN8A 1WX6A 1RI9A 3C0CA 3VS2A 1UJYA 1X6GA 2D8HA 2RQVA 2KR3A 2CUBA 2A08A 2DRKA 2BZXA 1CKBA 2DL7A 1FMKA 3RNJA 2RQTA 4HCKA 1ABQA 1WXUA 2RF0A 4RTXA 3QWXX 4JJDA 4RTYA 1E6HA 4KRTA 1KJWA 1BB9A 2LX7A 1S1NA 1A0NB 1KIKA 1NYGA 4DEYA 2L3QA 4AFSC 2CH4W 3M0UA 1PKTA 4JJBA 4K11A 2W0ZA 2MCNA 1YN8A 2YUPA 2P4RA 4DEXA 1YP5A 1AWXA 1PRLC 4OMMA 1JQQA 1VYVA 2OAWA 3EG1A 1AWOA 2DLPA 2RPNA 2DM1A 5EC7A 1YCSB 4JPBW 2HCKA 5IHKA 4X1VA 2SRCA 3I9QA 1YWPA 2LZ6B 4AFUC 1SPKA 5GJVB 5FWCA 2A37A 2M0YA 2EBPA 1WXBA 2KEAA 1AOJA 1GCQC 4F17A 1OPLA 1ZUKA 4GLMA 1SHGA 5IHNA 2GNCA 2HSPA 2KYMA 2H8HA 2XMFA 2YT6A 1I0CA 3UATA 2VKNA 2EW3A 4J9BA 1UG1A 2EYWA 2K7AA 1MV0B 2DBKA 3H0IA 2CREA 1BBZA 2FPDA 4J9GA 2KRMA 2L3SA 5IHIA 2BTTA 1HSQA 2FRWA 2L3PA 3EG2A 1CKAA 3M0RA 2JMCA 2A28A 4LE9A 2DA9A 2BZYA 3SEMA 2EVRA 1J3TA 2CH4A 2LQWA 2O31A 5I11A 1Z9ZA 2F2WA 1U5SA 4OMQA 1JEGA 4RTZA 2VWFA 1MUZA 4E6RA 5L23A 1TUDA 1PRMC 4OMOA 2GTOA 2C0TA 1UDLA 1AZGB 2YUQA 1SRMA 4IIMA 4ORZA 3SHWA 2EKHA 4J9IA 1JXOA 3UA7A 1UECA 1W70A 2K79A 3I35A 2EGAA 4RUGA 1K0SA 2EQIA 4CC7A 1NYFA 1RUWA 1OEBA 3PVLA 2D0NA 2AKLA 1PHTA 2ROTA 1M3CA 3NGPA 1ZSGA 1JXMA 1QWFA 1KFZA 1AWJA 2HEQA 1PKSA 1FYNA 1B07A 4ZNXA 1TUCA 2KXCA 1QKXA 2JTEA 1B3QA 2EGEA 2KYBA 1XOVA 2DMOA 4EIKA 1ABOA 1QLYA 2L0AA 2IIMA 2MIOA 3EG3A 2JS0A 2YUOA 1M3AA 1E7OA 4HVWA 2EYZA 1H92A 1HD3A 2RQRA 2DYBA 2GTJA 2KT1A 3THKA 4RTTA 2EYYA 4HVUA 2LCSA 2DF6A 3ULRB 2G6FX 1GBRA 1K4US 4LUDA 3KFVA 3M0QA 2NWMA 3EG0A 1GBQA 4JZ3A 1VYTA 1UFFA 1OPKA 1OOTA 5HCKA 1NG2A 2J6OA 1K0XA 2YUNA 4CC2A 2J6FA 2JM8A 2K2MA 2ROLA 2ENMA 4OMNA 2CDTA 3VS5A 3A98A 2O88A 1U3OA 1YNZA 3VS3A 1Y57A 1JU5C 2A36A 2AK5A 5FWBA 1I1JA 1CSKA 1SRLA 3R6NA 1GRIA 1ZX6A 5IXBA 4D8DA 2LMJA 5FW9A 1QCFA 2FPEA 2QDLA 2GQIA 1BU1A 1RLQC 3NMZC 1N5ZA 2KBTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F2V A;  1T0J A;  4RTW A;  1TG0 A;  2LJ0 A;  1G2B A;  4M4Z A;  3TSZ A;  4JZ4 A;  1NM7 A;  1E6G A;  2AZV A;  2DRM A;  2EPD A;  1SEM A;  1M27 C;  2FRY A;  2KRO A;  2CSI A;  1T3L A;  2FG0 A;  4AFQ C;  1ZUY A;  3UA6 A;  2LNH B;  4F16 A;  1QWE A;  1AVZ C;  2SEM A;  3VS0 A;  1AZE A;  2AKK A;  2HBW A;  2GBQ A;  2KGT A;  1I07 A;  2FO0 A;  1M30 A;  2J06 A;  3I5S A;  2AZS A;  2ESW A;  4Z8A A;  3M0S A;  4LNP A;  2KT8 A;  3REA B;  4Z89 A;  2JXB A;  3TSW A;  4J9H A;  4A63 B;  2KRS A;  1WLP B;  2RQW A;  3VS4 A;  5IH2 A;  3RBB B;  2K3B A;  2RNA A;  2VVK A;  1X2K A;  1Y0M A;  2DVJ A;  2M51 A;  4GBQ A;  1WFW A;  1UE9 A;  2RMO A;  2EYX A;  1G83 A;  2X3X D;  3CQT A;  1U06 A;  3ZL7 C;  4J9F A;  2LP5 A;  1X69 A;  4AG1 C;  2DJQ A;  3EHR A;  2DL4 A;  1GCP A;  2YSQ A;  3EGU A;  3VRY A;  2C0I A;  3NHN A;  3NPF A;  3H41 A;  2RQU A;  2D1X A;  4J9E A;  1KSW A;  2O9V A;  3VS7 A;  1AEY A;  3PE0 A;  1SSH A;  5I22 A;  3VRZ A;  3I5R A;  1AD5 A;  1WA7 A;  2PTK A;  2FEI A;  1MV3 A;  1UTI A;  1VA7 A;  2DBM A;  1UHF A;  4CC3 A;  1X6B A;  3IQL A;  2DL5 A;  1H8K A;  4J9C A;  1H3H A;  1W6X A;  2W10 A;  2KXD A;  4R0K A;  1ZUU A;  1GFC A;  2J6K A;  4Z88 A;  2JM9 A;  2DE0 X;  1RLP C;  2OJ2 A;  2F2X A;  1WYX A;  3TVT A;  3PVQ A;  2CT3 A;  4AFZ C;  1K9A A;  2YDL A;  2PZ1 A;  2JT4 A;  2O9S A;  1UHC A;  4AG2 C;  2JMA A;  4QT7 A;  3VS1 A;  4RTU A;  1ZLM A;  1T3S A;  4LN2 A;  3O5Z A;  3QWY A;  2ECZ A;  4ESR A;  1Z9Q A;  3M0P A;  1K76 A;  2DL3 A;  1SHF A;  1AWW A;  2HDA A;  2BZ8 A;  1GL5 A;  2LQN A;  2J05 A;  2DNU A;  1GFD A;  4HXJ A;  1K1Z A;  1LCK A;  1EFN A;  2D8J A;  4LUE A;  1M3B A;  1PNJ A;  4OML A;  1PWT A;  5IXF A;  1NLP C;  4CC4 B;  4F14 A;  2JS2 A;  1NEG A;  2V1R A;  4OMP A;  2LJ1 A;  2KRN A;  4IIO A;  2DIL A;  2J7I A;  2KE9 A;  2KNB B;  5ECA A;  2PNI A;  1ZBJ A;  1WI7 A;  1V1C A;  1OV3 A;  2CUD A;  2V1Q A;  2CT4 A;  1UUE A;  1T0H A;  1M8M A;  1GCQ A;  2ED0 A;  3U23 A;  1YWO A;  2CSQ A;  2LJ3 A;  4RTV A;  1BK2 A;  3FJ5 A;  2K9G A;  3REB B;  3JV3 A;  1W1F A;  3M0T A;  1ARK A;  1X2Q A;  5GJW B;  3VS6 A;  2GGR A;  3UF4 A;  2E5K A;  1NLO C;  2ABL A;  4WCI A;  4HVV A;  2C0O A;  4Y92 A;  2OI3 A;  2EGC A;  1WDX A;  2MOX A;  2O2O A;  4D8K A;  2X3W D;  2K6D A;  2JW4 A;  2DL8 A;  2FPF A;  2B86 A;  1QKW A;  2NUZ A;  2ED1 A;  1VYU A;  4FSS A;  1NEB A;  4JJC A;  3H0F A;  1WXT A;  2DX1 A;  1HJD A;  3H0H A;  4J9D A;  1X43 A;  1WIE A;  1JO8 A;  1UJ0 A;  2I0N A;  3GBQ A;  3LH5 A;  1X27 A;  1UGV A;  1IO6 A;  2L2P A;  3EHQ A;  2RN8 A;  1WX6 A;  1RI9 A;  3C0C A;  3VS2 A;  1UJY A;  1X6G A;  2D8H A;  2RQV A;  2KR3 A;  2CUB A;  2A08 A;  2DRK A;  2BZX A;  1CKB A;  2DL7 A;  1FMK A;  3RNJ A;  2RQT A;  4HCK A;  1ABQ A;  1WXU A;  2RF0 A;  4RTX A;  3QWX X;  4JJD A;  4RTY A;  1E6H A;  4KRT A;  1KJW A;  1BB9 A;  2LX7 A;  1S1N A;  1A0N B;  1KIK A;  1NYG A;  4DEY A;  2L3Q A;  4AFS C;  2CH4 W;  3M0U A;  1PKT A;  4JJB A;  4K11 A;  2W0Z A;  2MCN A;  1YN8 A;  2YUP A;  2P4R A;  4DEX A;  1YP5 A;  1AWX A;  1PRL C;  4OMM A;  1JQQ A;  1VYV A;  2OAW A;  3EG1 A;  1AWO A;  2DLP A;  2RPN A;  2DM1 A;  5EC7 A;  1YCS B;  4JPB W;  2HCK A;  5IHK A;  4X1V A;  2SRC A;  3I9Q A;  1YWP A;  2LZ6 B;  4AFU C;  1SPK A;  5GJV B;  5FWC A;  2A37 A;  2M0Y A;  2EBP A;  1WXB A;  2KEA A;  1AOJ A;  1GCQ C;  4F17 A;  1OPL A;  1ZUK A;  4GLM A;  1SHG A;  5IHN A;  2GNC A;  2HSP A;  2KYM A;  2H8H A;  2XMF A;  2YT6 A;  1I0C A;  3UAT A;  2VKN A;  2EW3 A;  4J9B A;  1UG1 A;  2EYW A;  2K7A A;  1MV0 B;  2DBK A;  3H0I A;  2CRE A;  1BBZ A;  2FPD A;  4J9G A;  2KRM A;  2L3S A;  5IHI A;  2BTT A;  1HSQ A;  2FRW A;  2L3P A;  3EG2 A;  1CKA A;  3M0R A;  2JMC A;  2A28 A;  4LE9 A;  2DA9 A;  2BZY A;  3SEM A;  2EVR A;  1J3T A;  2CH4 A;  2LQW A;  2O31 A;  5I11 A;  1Z9Z A;  2F2W A;  1U5S A;  4OMQ A;  1JEG A;  4RTZ A;  2VWF A;  1MUZ A;  4E6R A;  5L23 A;  1TUD A;  1PRM C;  4OMO A;  2GTO A;  2C0T A;  1UDL A;  1AZG B;  2YUQ A;  1SRM A;  4IIM A;  4ORZ A;  3SHW A;  2EKH A;  4J9I A;  1JXO A;  3UA7 A;  1UEC A;  1W70 A;  2K79 A;  3I35 A;  2EGA A;  4RUG A;  1K0S A;  2EQI A;  4CC7 A;  1NYF A;  1RUW A;  1OEB A;  3PVL A;  2D0N A;  2AKL A;  1PHT A;  2ROT A;  1M3C A;  3NGP A;  1ZSG A;  1JXM A;  1QWF A;  1KFZ A;  1AWJ A;  2HEQ A;  1PKS A;  1FYN A;  1B07 A;  4ZNX A;  1TUC A;  2KXC A;  1QKX A;  2JTE A;  1B3Q A;  2EGE A;  2KYB A;  1XOV A;  2DMO A;  4EIK A;  1ABO A;  1QLY A;  2L0A A;  2IIM A;  2MIO A;  3EG3 A;  2JS0 A;  2YUO A;  1M3A A;  1E7O A;  4HVW A;  2EYZ A;  1H92 A;  1HD3 A;  2RQR A;  2DYB A;  2GTJ A;  2KT1 A;  3THK A;  4RTT A;  2EYY A;  4HVU A;  2LCS A;  2DF6 A;  3ULR B;  2G6F X;  1GBR A;  1K4U S;  4LUD A;  3KFV A;  3M0Q A;  2NWM A;  3EG0 A;  1GBQ A;  4JZ3 A;  1VYT A;  1UFF A;  1OPK A;  1OOT A;  5HCK A;  1NG2 A;  2J6O A;  1K0X A;  2YUN A;  4CC2 A;  2J6F A;  2JM8 A;  2K2M A;  2ROL A;  2ENM A;  4OMN A;  2CDT A;  3VS5 A;  3A98 A;  2O88 A;  1U3O A;  1YNZ A;  3VS3 A;  1Y57 A;  1JU5 C;  2A36 A;  2AK5 A;  5FWB A;  1I1J A;  1CSK A;  1SRL A;  3R6N A;  1GRI A;  1ZX6 A;  5IXB A;  4D8D A;  2LMJ A;  5FW9 A;  1QCF A;  2FPE A;  2QDL A;  2GQI A;  1BU1 A;  1RLQ C;  3NMZ C;  1N5Z A;  2KBT A; 
#chains in the Genus database with same CATH topology
 3CC4 A;  2F2V A;  3TSZ A;  2BIV A;  3GP8 A;  3CC4 T;  2EPD A;  3L42 A;  1WHK A;  4O6J A;  2FRY A;  2FG0 A;  3A8O B;  4LXC A;  4LD9 K;  2RHI A;  3OA6 A;  2DER A;  1AVZ C;  2DZ9 A;  3VS0 A;  1XJW B;  1M1F A;  2KGT A;  3OYJ A;  1I07 A;  1EIF A;  1M30 A;  4F7U E;  2QTX A;  4M77 B;  2AZS A;  2ESW A;  1S72 T;  1NJI R;  3G6E A;  5FRM A;  4LNP A;  3MET A;  1YJW A;  4M77 E;  2A7Y A;  3TSW A;  4J9H A;  4A63 B;  1WLP B;  3VS4 A;  1RAD B;  1OZ2 A;  5GAN 5;  2K3B A;  3T9N A;  1Y0M A;  2DVJ A;  5CQX A;  2IG0 A;  3OMG A;  5KYX B;  2NLU A;  1Q81 U;  2LP5 A;  3FEO A;  1VQP T;  2OX7 A;  2EJG A;  3RMQ A;  4RMO A;  3C95 A;  4LD6 A;  3A8M B;  4OVA A;  2KMT A;  3EGU A;  1D1A A;  5AYF A;  2R5M A;  1N9R A;  2D1X A;  3M53 A;  2LT4 A;  3NTH A;  4B9W A;  3ZEH A;  3CBP A;  5I22 A;  4D6W A;  3VRZ A;  2LC4 A;  3NTI A;  3I5R A;  1G5V A;  3OYH A;  1AD5 A;  2PTK A;  3CBO A;  3M58 A;  2HMA A;  3I55 Q;  1Q7Y U;  1QVF A;  3JRZ A;  5GAN 6;  1UGR B;  1VUB A;  4HCC A;  2OAU A;  1UHF A;  1JRI A;  1VQ6 Q;  1H3H A;  2W10 A;  4XQ3 A;  4KGV B;  2KXD A;  2BKD N;  3E19 A;  3QBY A;  1ZUU A;  1D0Y A;  3M5A A;  3H8Z A;  2VYT A;  1GFC A;  3QPH A;  2F1L A;  4Z88 A;  3QZ5 B;  3CMA Q;  5FU6 C;  3RKX A;  2OJ2 A;  2F2X A;  5IN1 A;  3CD6 T;  2LNV A;  4XTU A;  4DOW A;  4AT1 B;  1JJ2 S;  4AFZ C;  2FB7 A;  1IB8 A;  2AHJ B;  3HFN A;  4AG2 C;  1BKB A;  5GAO q;  1PSF A;  4FL6 A;  2RI3 A;  1M4Z A;  2VUB A;  3UPU A;  4XTV A;  2XHC A;  2QEX A;  2XG8 D;  3JCM c;  3M0P A;  2C06 A;  3GPL A;  1NJI U;  4M7A G;  4PKC C;  2MK5 A;  1AWW A;  2HDA A;  5A0D A;  1TXQ A;  4ELY C;  5IT9 E;  4KH1 B;  2MMP A;  2J05 A;  2KQW A;  1Y96 A;  3CPF A;  4HXJ A;  1ACM B;  2CP7 A;  2DD4 A;  1Q86 C;  3CCU Q;  3MEV A;  1R0B G;  2JS2 A;  1I5O B;  1NEG A;  4M75 C;  3CPW A;  1Q7Y C;  1KD1 C;  1KQS P;  1ZBJ A;  2JVV A;  2XDD A;  1OV3 A;  2CUD A;  4HCB A;  3CCS A;  4OB1 B;  2HKQ B;  1Q82 R;  1UUE A;  4JDS A;  3U23 A;  2ED0 A;  3EFS A;  1YWO A;  1WJQ A;  4RTV A;  4A4H A;  3FJ5 A;  1BI0 A;  2K9G A;  2Z0W A;  3JV3 A;  3M0T A;  1X2Q A;  1NPR A;  3PFS A;  4J6X A;  3UF4 A;  5J3B A;  2P0Q A;  3JCM V;  2QYZ A;  2OTL A;  2ABL A;  4WCI A;  3E1S A;  2C0O A;  4Y92 A;  2OI3 A;  2EGC A;  2E4H A;  3L1A A;  2MOX A;  4KGZ B;  1UGQ B;  2K6D A;  4M7A B;  2FPF A;  2B86 A;  2NUZ A;  2COY A;  2WSF E;  2RM4 A;  1VQN A;  2V8J A;  4OB2 B;  1JO8 A;  1UJ0 A;  2I0N A;  1W4S A;  3LH5 A;  2NUT A;  1UGV A;  3G71 A;  3VS2 A;  3C0C A;  2LTO A;  1VQ5 T;  2CUB A;  4M78 B;  2BZX A;  2CP5 A;  1EZZ B;  1OYX A;  2LX9 A;  2X4W A;  3JCM g;  3CCM Q;  1ABQ A;  2ATC B;  2RF0 A;  5FU7 B;  4WF2 A;  5KYU A;  5KE3 A;  1E6H A;  2DAQ A;  1WHH A;  4J6W A;  3FRN A;  4M77 D;  1GXI E;  2CH4 W;  4XTX A;  4K11 A;  2W0Z A;  3OYA A;  2YUP A;  3JAM E;  2LCC A;  4DEX A;  1YP5 A;  5GAN 4;  4OMM A;  1KD1 U;  1JQQ A;  3EG1 A;  4N0A C;  4M77 G;  2DXB A;  1W2B S;  2DM1 A;  4JPB W;  2EIF A;  2EWN A;  3OYD A;  4X1V A;  2IVW A;  3I9Q A;  4AFU C;  4DBF A;  3TU4 K;  2F5K A;  3JCM f;  3L2R A;  2XKO C;  2L3R A;  2A37 A;  2EBP A;  2M0Y A;  2KEA A;  1OPL A;  4ZN1 A;  1ZUK A;  4IUV A;  4IUT A;  1VQ5 Q;  5I2S A;  3FB9 A;  4J9B A;  2EYW A;  2K7A A;  1KQS S;  3G6E Q;  2FPD A;  1G3W A;  1Q95 G;  2YLC A;  3RUX A;  1YIT Q;  4QVC A;  1HSQ A;  3OW2 P;  2QK0 A;  3PIO A;  2DEU A;  1B7T A;  2JMC A;  2YRV A;  2EVR A;  1LPL A;  2QAS A;  2LQW A;  2O31 A;  3M4Y A;  3P8B B;  4TVR A;  3I56 A;  1TTH B;  2R58 A;  1U5S A;  4F7U F;  1G3Y A;  4RTZ A;  2HAX A;  2BUD A;  2VWF A;  4E6R A;  1B34 A;  1TUD A;  3A1P A;  4NS5 A;  1OU9 A;  2YRC A;  2HL5 C;  2GTO A;  1VQ9 A;  4E7J A;  4IIM A;  1SRM A;  1WHL A;  3UA7 A;  5CCA A;  1VQK T;  4M7D A;  1V29 B;  1W70 A;  3CMA A;  2RHY A;  4RUG A;  1K9M C;  1K0S A;  4Y91 A;  2CZ1 B;  3KXT A;  3E9G A;  2CP3 A;  4C8Q E;  3CXC S;  3PVL A;  2D0N A;  1Q86 R;  1XNI A;  2AKL A;  3AHU A;  2ROT A;  2KK4 A;  3I56 Q;  1QQJ A;  2O4X B;  5CKH A;  2V8I A;  1QWF A;  3CCE T;  1LOJ A;  1Q81 C;  1PKS A;  2MAM A;  1ZHI A;  4M75 B;  4ZNX A;  4EMK C;  2DVE A;  4MDW A;  3MKD A;  2KXC A;  5FRO A;  1IHV A;  2DMO A;  1RAA B;  4EIK A;  1ABO A;  4EMK A;  3TEE A;  1BIB A;  2IIM A;  2MIO A;  1M3A A;  4M7A D;  2GCX A;  4HVW A;  4MZP A;  1G3S A;  1H92 A;  3QDR B;  4RTT A;  2MWO A;  2CP6 A;  3M0Q A;  4FT2 A;  2RJC A;  2E3I A;  4M7A C;  4JZ3 A;  1VYT A;  1YIJ A;  1OOT A;  4M78 D;  1NG2 A;  1AHJ B;  1G8X A;  5KE2 A;  1K0X A;  2JM8 A;  3DLM A;  2VC8 A;  2O88 A;  4HKE A;  1U3O A;  4ATO A;  1YNZ A;  1IZ6 A;  3VS3 A;  3PGG A;  3FIF A;  3VU3 C;  3EGX A;  2X4X A;  1CSK A;  2K5L A;  3MP1 A;  2K2V A;  4X9C A;  4X9D A;  5FW9 A;  1QCF A;  5FU7 C;  3JB9 G;  5DLQ E;  4KGX B;  3NMZ C;  4RTW A;  4AMC A;  2JNG A;  4JZ4 A;  2DZC A;  4DBQ A;  1Y71 A;  3WVE B;  1M27 C;  2VGM A;  2CSI A;  3LGL A;  3JB9 D;  5GAM d;  4C5G A;  5GMK j;  5CKD A;  1ZUY A;  3UA6 A;  2VAS A;  2LNH B;  2CP2 A;  1QWE A;  4DQ2 A;  2HBW A;  4PJO A;  2FO0 A;  2PVG B;  2VB6 A;  1MHN A;  3M54 A;  3V8J A;  2DTI A;  4XTZ A;  2KSS A;  2RNA A;  2DIQ A;  2VVK A;  1X2K A;  1QVP A;  2EQJ A;  2M51 A;  4P5N A;  4F7U G;  4GBQ A;  2XIC A;  2HZY A;  4M78 G;  4A54 A;  2O01 E;  2CP0 A;  1M2V B;  4II1 A;  3KBG A;  1YJN T;  4BE2 A;  3DB3 A;  1X69 A;  1HXD A;  5I21 A;  3EHR A;  2X4Y A;  4M75 F;  3PT9 A;  1VQK A;  2OTJ T;  5CVI A;  2YSQ A;  5J26 A;  4FT4 A;  5FLX E;  3EFR A;  5CKB A;  4EPC A;  3M57 A;  3HHT B;  2YRD A;  2LVM A;  4GLK A;  3VS7 A;  1AEY A;  3V7S A;  2HD0 A;  2E65 A;  3PE0 A;  3QDF A;  4CRI A;  2BE7 D;  1R77 A;  3CCE A;  1UTI A;  1YIT A;  3CCV T;  2ZPG B;  5GAO l;  2DL5 A;  1H8K A;  1W6X A;  1BYM A;  3JCM X;  3L2U A;  4L59 A;  4M75 D;  1KQS A;  1K8A R;  4XU1 A;  4HT8 A;  2J6K A;  2JM9 A;  2GF7 A;  3RR6 A;  3G7Z A;  5KCO A;  4PJN A;  1RLP C;  2ZPE B;  1RAH B;  1OQK A;  5GAO m;  3CCL T;  3PVQ A;  2FL7 A;  3E2U A;  4HCZ A;  6AT1 B;  1XTD A;  3SDZ A;  2YDL A;  4EDU A;  3PIP A;  2QEX Q;  2JT4 A;  3RER A;  1RAF B;  1M5Q 1;  4N4H A;  1ZA2 B;  3GOX A;  4HT9 A;  3QWY A;  3C12 A;  4FIB A;  4M75 G;  1K76 A;  4HA8 A;  2FZC B;  1SHF A;  1PC0 A;  2BZ8 A;  1OU8 A;  2CS7 A;  1S72 Q;  5GAO r;  1K8A U;  1QCN A;  1GFD A;  2DTH A;  1EFN A;  4LUE A;  1M3B A;  1X75 C;  1PNJ A;  2LCL A;  5CKE A;  1VQ4 T;  1K73 R;  3NFC A;  1NLP C;  3JB9 F;  1ZQ1 A;  2V1R A;  5LJ5 f;  2HQX A;  3CCQ T;  1YHQ Q;  2EJ9 A;  1K73 C;  2DJZ A;  3G71 Q;  2CZ0 B;  2CT4 A;  3X24 B;  3PMT A;  4ZTJ A;  2CSQ A;  1BIA A;  4FW1 A;  5GAN 8;  3FC3 A;  3OYK A;  4NL2 A;  1D3B B;  4N4G A;  3TCJ A;  3VS6 A;  3MJX A;  2GGR A;  2JZ2 A;  3URG A;  2O4X A;  1VIE A;  3CCE Q;  2PU9 B;  1OX8 A;  1BCM A;  1WNL A;  2O2O A;  3ER0 A;  3RDV A;  3S3N A;  2X3W D;  4BUG A;  1RAG B;  2ED1 A;  1X6O A;  2M16 A;  5C6S A;  1M1G A;  1MMN A;  3OYY A;  1X43 A;  1YJW T;  4ELZ C;  3GBQ A;  1X27 A;  3BFM A;  3CCR Q;  2L2P A;  3EHQ A;  1D1B A;  2LQ8 A;  4JLG A;  2DTO A;  4PFP A;  1W2B A;  1MMG A;  1X6G A;  1VQM T;  2X35 A;  3JB9 I;  2E70 A;  2HQE A;  2DRK A;  3D7S B;  3SWN A;  1WQW A;  3M4G A;  2M02 A;  2RI2 A;  1VQ6 T;  1WQ7 A;  2RQT A;  3HTR A;  4C5I A;  3LYI A;  4M77 C;  1FMW A;  2QAZ A;  5LJ3 h;  4R55 A;  1QP3 A;  4OGE A;  4BY6 C;  1N8R U;  5KH6 A;  2Y4X A;  1WZO A;  2LX7 A;  2FZG B;  1A0N B;  1N9S A;  2DPP B;  1S72 A;  4QVD A;  1TS9 A;  1AWX A;  1PRL C;  3MP8 A;  4FYV B;  1VYV A;  5EC7 A;  2LT1 A;  5CK9 A;  5IHK A;  2HCK A;  3N5B B;  2WSC E;  2R57 A;  2RA2 A;  2SRC A;  4E47 A;  4DBH A;  2LZ6 B;  2HQH A;  4F04 B;  1YI2 Q;  5GJV B;  3CCU A;  2QQR A;  4C0Z A;  2KAF A;  3QZ9 B;  1WXB A;  1GCQ C;  4KUD K;  2I2L A;  4GLM A;  2FYK A;  1SKU B;  1R8O B;  1SHG A;  5IHN A;  2GNC A;  2HSP A;  4KT0 E;  4A4G A;  1YHQ T;  2HBP A;  2XMF A;  4PLI A;  2DK3 A;  5L8R E;  1I0C A;  2OTJ A;  1YJ9 Q;  1TOV A;  2EW3 A;  2RK1 A;  2DBK A;  1YIJ Q;  1N6A A;  4PFO A;  4JRQ A;  5DLO A;  3OW2 S;  2A3L A;  4XTW A;  2L3P A;  1K9M U;  1CKA A;  3M0R A;  2MF2 A;  2Y4Y A;  2A28 A;  4LE9 A;  3QJ6 A;  4LDY A;  2E64 A;  4M7A F;  1M8V A;  4WTO B;  4FW2 A;  3VJP A;  2JUF A;  3QSU A;  3VYH B;  1HYO A;  4KUI A;  2E41 A;  2E6N A;  3BE3 A;  1UDL A;  3SHW A;  1LNX A;  1UEC A;  3LLR A;  2JJ9 A;  4MML A;  3VUZ A;  4ZGJ B;  4DBR A;  2EQI A;  3FJP A;  1OEB A;  3R6O A;  1X01 A;  1BI3 A;  5IAY A;  2AT1 B;  4LDX A;  1M1K U;  2RD1 A;  4DOV A;  1UGP B;  5GAN 2;  1FYN A;  4QVZ A;  4C8Q G;  1TUC A;  5GAN g;  3OB9 A;  1VQP Q;  5GMK l;  2JTE A;  2EGE A;  2KYB A;  1VQL T;  3CPW P;  2AIR B;  5GAN d;  3M9Q A;  3CXC P;  1VQN T;  2YUO A;  1E7O A;  1WJS A;  2EYZ A;  1D3B A;  1D1C A;  1PG5 B;  3QUI A;  2CKK A;  1HD3 A;  2DYB A;  2GTJ A;  3THK A;  4HVU A;  3Q1J A;  2LCS A;  1GBR A;  3KFV A;  1VQ4 Q;  3GIB A;  2YWW A;  1K73 U;  2CGH A;  3CBM A;  1GBQ A;  2DXU A;  1UFF A;  1OPK A;  4C0D B;  5GAM h;  5HCK A;  4CC2 A;  2J6F A;  4E7I A;  1WHM A;  1OZ3 A;  2XDB A;  2ENM A;  2CDT A;  3A98 A;  3OYL A;  4BI8 B;  1LVK A;  4MDX A;  4FYW B;  1Y57 A;  1JU5 C;  5AT1 B;  2AK5 A;  4RCB A;  4C8Q B;  2E12 A;  4ZGD B;  3GNF B;  4ANJ A;  2M9U A;  3L2Q A;  2FPE A;  4C8Q F;  2QGF B;  2GQI A;  4BY6 B;  7AT1 B;  5GAN h;  4KH0 B;  3G71 T;  3JB9 J;  4M7D D;  3A8L B;  2H3J A;  2XID A;  4C0D C;  5LJ5 j;  4M4Z A;  2XD0 A;  1NM7 A;  1E6G A;  2AZV A;  2DRM A;  1KG1 A;  3V7R A;  3G4S A;  2KRO A;  1YHQ A;  4C92 F;  2ZZD A;  4IKF A;  2GQV A;  3OW2 A;  1JBM A;  1H64 1;  2CZ6 B;  4PJL A;  3HSB A;  1TH7 A;  1AZE A;  5A0L A;  4X34 A;  3X28 B;  2J06 A;  1KK7 A;  4FSX A;  4Z8A A;  4M7D G;  3RKW A;  1C0M A;  1JJ2 P;  1NBE B;  4M77 A;  2EYQ A;  2KT8 A;  3REA B;  3CC7 Q;  1Y07 A;  2KRS A;  5IH2 A;  4F7U A;  3RBB B;  2E5Q A;  2E1H A;  1VQ5 A;  1O75 A;  3MPU B;  5KYX A;  5C0M A;  4J5Y A;  3MEA A;  4IUQ A;  1QVG P;  1UE9 A;  2RMO A;  2VV5 A;  1I5L A;  4PJO G;  3L2Z A;  4AG1 C;  2DJQ A;  3PTA A;  3UWN A;  2A0F B;  1RAB B;  1GCP A;  3QO3 A;  5LJ5 g;  2F5T X;  3NHN A;  4PL6 A;  1YFN A;  3H41 A;  2RB6 A;  3FLG A;  3OYC A;  2RHX A;  1KSW A;  3O8V A;  3A8G B;  2RJE A;  1VOM A;  3ME9 A;  4F7U B;  3OS2 A;  2FEI A;  2LRQ A;  3VV0 A;  3LWH A;  1U1S A;  2EJF A;  2DBM A;  3PMI A;  1I8F A;  4OF1 A;  1UEB A;  4PK4 A;  4J9C A;  2JTM A;  5GMK e;  1VQ9 T;  2KI7 A;  1K9M R;  4M77 F;  2QTV A;  1PD1 A;  2LDM A;  2JN0 A;  3SD4 A;  4N0A A;  2K3Y A;  3CD6 A;  1WYX A;  5LJ5 h;  2CT3 A;  3RMS A;  1KC8 R;  1K9A A;  4C5H A;  1VQ8 T;  1UHC A;  4EMK B;  5HKC A;  4QT7 A;  3VS1 A;  1DJ7 B;  2RO0 A;  4JS4 A;  1T3S A;  3O5Z A;  1Z9Q A;  3I55 A;  2K5I A;  3HRT A;  1G3T A;  4C0G A;  3JCM Q;  1K1Z A;  3OSS C;  2QA4 A;  2D8J A;  4OML A;  2MYS A;  1PWT A;  4CC4 B;  3HFO A;  4OMP A;  1IRE B;  2KRN A;  3CCL A;  5M9O A;  1BI1 A;  1RAI B;  2J7I A;  3UDC A;  2KE9 A;  2KNB B;  5ECA A;  5GAN e;  5HK3 A;  2PNI A;  4M7D F;  1WI7 A;  1V1C A;  2EFI A;  4PNO A;  5KYN A;  2V1Q A;  4C8Q D;  1M90 R;  1M8M A;  3OYB A;  1VQM Q;  2LJ3 A;  1BK2 A;  1YI2 A;  2VXE A;  4QQD A;  4JRK A;  5CIU A;  3X20 B;  4JUV A;  2K5F A;  2OTL T;  5GMK i;  2P0K A;  4VUB A;  4C8Q C;  1W2B P;  1WHJ A;  4B9X A;  4D8K A;  3JCM b;  1SSF A;  2JW4 A;  3JCM J;  1BI2 A;  4JS5 A;  1NEB A;  2DEQ A;  3BDL A;  4JJC A;  1HJD A;  3H0H A;  5D7U A;  4J9D A;  1IRX A;  2DXT A;  4BE0 A;  3P8D A;  1RL2 A;  1WX6 A;  1IGU A;  4ZGE B;  1UJY A;  1OX9 A;  3CPW S;  2D8H A;  3FDR A;  1LJO A;  5GAM g;  4RCC A;  3CCU T;  2A08 A;  1VQ6 A;  1UB4 A;  3EFO B;  2P4T A;  1PCX A;  3RNJ A;  2XU8 A;  4M78 E;  2E3H A;  4HCK A;  3QYH B;  4XU0 A;  3CCR A;  3EH1 A;  1WXU A;  1QP2 A;  1QVG S;  4RTX A;  2VGN A;  2X4J A;  4RTY A;  4C92 D;  4BB7 A;  4KRT A;  5DM7 R;  1KJW A;  1BB9 A;  1S1N A;  4DA4 A;  5J39 A;  1VQ7 T;  1KIK A;  1NYG A;  2CYZ B;  1PKT A;  3SB2 A;  4PJJ A;  3G1J A;  2D6F A;  5GAM f;  2DXC A;  2OAW A;  2GFU A;  1QMC A;  4NL3 A;  2DLP A;  2DIG A;  3BY7 A;  1YCY A;  3QII A;  3OYN A;  4C92 G;  1TWB A;  1YWP A;  2Y90 A;  1SPK A;  3MO8 A;  3CCV A;  1AOJ A;  3CCJ T;  4F17 A;  5EG2 A;  3JCM W;  3CCJ A;  3CCR T;  2QG9 B;  2H8H A;  2YT6 A;  3UAT A;  2VKN A;  3JCM P;  1U8R A;  1IHW A;  3GLX A;  1UG1 A;  3H0I A;  3HRU A;  5HK0 A;  3OY9 A;  2L3S A;  3V8K A;  5IHI A;  2E10 A;  2FRW A;  3EG2 A;  2QA4 Q;  1ZBX A;  3LW5 E;  1VQ8 Q;  1QCO A;  3HP9 A;  2DA9 A;  3OQ5 A;  3SEM A;  4QKU A;  5LL6 S;  2CH4 A;  2QEX T;  4LDW A;  3MEU A;  2EQU A;  3CEY A;  4CI0 C;  3L2W A;  4PJO D;  2F2W A;  3A5Z B;  4M75 E;  2L8D A;  2RH2 A;  4M78 F;  1FXX A;  4OMQ A;  2PVD B;  1YIT T;  5LJ3 g;  3WVD B;  1MUZ A;  5L23 A;  1PRM C;  2F69 A;  1FWZ A;  2WSE E;  4OB0 B;  4JLI A;  1M9S A;  3HPW A;  1AZG B;  1AT1 B;  2NUT B;  2YUQ A;  4C92 C;  5A0G A;  1JXO A;  3F70 A;  1OUL A;  2KDS A;  3OBW A;  2K79 A;  3I35 A;  4XU2 A;  4M7A A;  2FZK B;  4J7I A;  1RUW A;  3DKM A;  2PUK B;  3AT1 B;  3KUF A;  4XTY A;  5FU6 B;  1PHT A;  3LX7 A;  1NZ9 A;  4XAX B;  3UT1 A;  3BDU A;  2RJF A;  4BAC A;  1M1K R;  1M3C A;  2GFA A;  3WXM B;  3NGP A;  4R56 A;  4N4I A;  3EFO A;  1KC8 C;  2COW A;  1AWJ A;  2HEQ A;  1M2O A;  1YIJ T;  4M7D C;  2QA4 T;  3MCA B;  2PQW A;  3CCM T;  1VQL A;  1QKX A;  3EGD B;  1B3Q A;  4ZTF A;  1XOV A;  2WAC A;  2HNI A;  4FCY A;  3INZ A;  3CME Q;  3EG3 A;  3M59 A;  4QW2 A;  1MMA A;  1N27 A;  1YJW Q;  2YHT A;  5KYY B;  1KQ1 A;  1C6V X;  3S6W A;  4MZM A;  4OP0 A;  3GNG A;  2ZPB B;  4PJO C;  3ULR B;  2KVQ G;  4LUD A;  3RKY A;  3RIR A;  3EG0 A;  2L5Q A;  1RI0 A;  2DET A;  8AT1 B;  3CC2 T;  4FYX B;  3ZBD A;  4JRI A;  3CC7 A;  2QI2 A;  2ZAE A;  4FU6 A;  2CZ7 B;  4OMN A;  3VS5 A;  1PSE A;  2H3E B;  3S3O A;  5GAO n;  3BW1 A;  3G6E T;  1SG5 A;  4QQ6 A;  1I4K 1;  2XDP A;  4A53 A;  5FWB A;  1I1J A;  3R6N A;  2K57 A;  5LJ3 e;  1M1K C;  4E7H A;  1ZX6 A;  4UC4 A;  1YJ9 A;  3V8L A;  2QDL A;  3CME T;  5LJ5 e;  5KYW B;  1BU1 A;  4Y28 E;  3OS1 A;  1RLQ C;  2KBT A;  1T0J A;  1WHG A;  1YI2 T;  1TG0 A;  2LJ0 A;  1G2B A;  4YTL A;  2X9H A;  2K4Y A;  3EG9 A;  3CCV Q;  5GMK m;  2NUP A;  4C92 A;  1SEM A;  2DFU A;  1QVF S;  4LDU A;  1JB0 E;  1T3L A;  4AFQ C;  3G4S T;  3NTK A;  4RKU E;  4F16 A;  1I81 A;  3ZFJ A;  2SEM A;  1VQL Q;  2AKK A;  2GBQ A;  1M90 U;  1U1T A;  3J81 E;  3I5S A;  4E7S A;  4C8Q A;  1P92 A;  3M0S A;  2V26 A;  5LJ5 d;  4OMF B;  3X26 B;  4Z89 A;  2JXB A;  1IGQ A;  2RQW A;  3QKJ A;  2HKN A;  3CCS Q;  3MEW A;  3CD6 Q;  1VQM A;  2XI9 A;  2QQS A;  1WFW A;  3OMC A;  4J8O A;  2EYX A;  1G83 A;  2X3X D;  3EG9 B;  3QHS A;  3CQT A;  1U06 A;  3ZL7 C;  4J9F A;  3JCM e;  1MGQ A;  1YJN A;  2JOY A;  1D0Z A;  1WJR A;  4IUR A;  3J80 E;  2DL4 A;  3J7A F;  2MWP A;  3JCM d;  2DD5 A;  4A4K A;  3VRY A;  3LH0 A;  2C0I A;  2YXY A;  3NPF A;  4A4F A;  4OB3 B;  1ZA1 B;  2RQU A;  1V76 A;  3L2V A;  4J9E A;  2O9V A;  3VYG A;  2ZPH B;  1SSH A;  1Y7X A;  2EKO A;  1WA7 A;  3OSV A;  3OS5 A;  2MPX C;  2IPO B;  5GAM e;  1QW1 A;  1MV3 A;  2NUP B;  4C92 B;  2VXF A;  3CCL Q;  3V7C A;  2QQ9 A;  1NE8 A;  1VA7 A;  1MND A;  1Q7Y R;  4M75 A;  4IUP A;  4CC3 A;  1NPP A;  1X6B A;  3IQL A;  4ME7 A;  4R0K A;  3EGD A;  5CAI A;  3RES A;  5GAN f;  2YLB A;  2DE0 X;  1N8R C;  4BDY A;  3TVT A;  1KC8 U;  4M7A E;  1VQN Q;  2DYI A;  1VQ8 A;  4JJN K;  1VQ9 Q;  5GAN j;  2PZ1 A;  4M7D B;  2O9S A;  2JMA A;  4RTU A;  2L89 A;  3M56 A;  1D09 B;  4LN2 A;  1ZLM A;  4GY5 A;  1O9S A;  2FHD A;  5CKF A;  2ECZ A;  4ESR A;  3DB4 A;  2DL3 A;  4B6M A;  3EGX B;  1F1B B;  3CC2 Q;  2EAY A;  1OI1 A;  1GL5 A;  2LQN A;  2DNU A;  4E7K A;  1VQO A;  1LCK A;  2HSE B;  5KYY A;  3CXC A;  4EMG A;  2COZ A;  4RG8 A;  5IXF A;  5GAM j;  4F14 A;  1VQ4 A;  4XU3 A;  2LJ1 A;  4IIO A;  2DIL A;  4ZN3 A;  2JTF A;  3H6Z A;  5FRN A;  3CCQ A;  2PVO B;  1M90 C;  5GAN 3;  1T0H A;  3CME A;  3EH2 A;  4PLL A;  1GCQ A;  2RJD A;  4C92 E;  1FMV A;  2QDY B;  3REB B;  2P0P A;  4L6V 5;  1Q82 U;  1W1F A;  2R5A A;  5LJ3 d;  3CC2 A;  1ARK A;  5GJW B;  5CO7 A;  2V8K A;  5GAO p;  2ZGW A;  3S3M A;  1WPY A;  2E5K A;  1NLO C;  4M78 C;  4IUU A;  4E2F B;  4HVV A;  1JJ2 A;  2QGG A;  3P8H A;  1WDX A;  3OYG A;  8ATC B;  3SFM A;  4Q5W A;  2DL8 A;  4FSS A;  1QKW A;  1VYU A;  3OYM A;  1KHI A;  1Q81 R;  1TU0 B;  3H0F A;  1WXT A;  2DX1 A;  1WIE A;  5D6X A;  4M7D E;  3CCQ Q;  5KYW A;  1Q86 U;  2BE9 B;  4KUL A;  1YJ9 T;  1IO6 A;  4LDV A;  4A4E A;  2LQK A;  2M1H A;  2RN8 A;  1N5Z A;  4FM4 B;  1C1A A;  1RI9 A;  2RHU A;  3C4S A;  3C94 A;  5KYU B;  2RQV A;  2KR3 A;  4XK8 E;  3JCM h;  1MNE A;  3EAE A;  1CKB A;  2DL7 A;  4PJM A;  1FMK A;  9ATC B;  1NJI C;  4BI4 A;  1KQ2 A;  2MI6 A;  1ZSZ A;  3QWX X;  4O5V A;  4JJD A;  2DO3 A;  4EMH A;  3GF5 A;  5I2M A;  1VQO Q;  4PJO E;  2DKG A;  2NYS A;  4DEY A;  2L3Q A;  1B34 B;  4AFS C;  4KBM B;  3M0U A;  4E7L A;  1VQ7 A;  4JJB A;  3VUB A;  2MCN A;  1YN8 A;  2P4R A;  3DLL A;  1AWO A;  5LJ3 f;  3PNW C;  5KCH A;  4QQG A;  5D6W A;  2RPN A;  1BCO A;  4L5G A;  1YCS B;  4BDZ A;  1QVG A;  4BD3 A;  3I56 T;  2M0O A;  2P84 A;  1KHC A;  5FWC A;  4MMK A;  4E7Z A;  3OYF A;  2D0Q B;  3OYI A;  4C5E A;  1UGS B;  2KYM A;  2HL3 A;  1PM3 A;  1MV0 B;  2CRE A;  1BBZ A;  4J9G A;  2KRM A;  2BTT A;  4PJO F;  2BZY A;  3VKI A;  2OTL Q;  3QYG B;  1SF9 A;  1J3T A;  2G3R A;  1ZSZ B;  5I11 A;  3JB9 H;  5D6Y A;  1Z9Z A;  1TSF A;  2QQA A;  3X25 B;  5A2Q E;  3I55 T;  5DY9 A;  4BE1 A;  3JSC A;  4OGC A;  2E6Z A;  1JEG A;  1YJN Q;  3CC4 Q;  3M55 A;  4OMO A;  2PUO B;  1H3Z A;  2C0T A;  1VQP A;  5LJ3 j;  4ORZ A;  2D9T A;  2EKH A;  4J9I A;  2RI5 A;  4FYY B;  3CMA T;  1N8R R;  1WGS A;  1VIF A;  2EGA A;  5HY6 A;  3OS0 A;  2FVU A;  4CC7 A;  4V2S A;  1ZSZ C;  4M78 A;  1NYF A;  3CCJ Q;  4MZT A;  5GAN 7;  3LWI A;  1YBY A;  3HL8 A;  1R0C B;  1PD0 A;  4Z02 A;  1FX7 A;  3A8H B;  1ZSG A;  1JXM A;  1KFZ A;  2ZCF B;  1D0X A;  1B07 A;  2RK2 A;  3CCM A;  2XK0 A;  2QQB A;  3TRE A;  1VQO T;  1K8A C;  3OBY A;  1VQ7 Q;  1QLY A;  2L0A A;  3QG1 A;  2B8A A;  4C0F A;  1VQK Q;  2OTJ Q;  3H9N A;  2JS0 A;  5GMK h;  3MP6 A;  3TQ7 P;  3MHX A;  4BI3 A;  2ZPI B;  1RAC B;  3SWN C;  3E9F A;  1Q82 C;  2EQK A;  2RQR A;  2KT1 A;  4PFZ A;  2EYY A;  2K3X A;  2DF6 A;  1K4U S;  2G6F X;  4RG2 A;  2NWM A;  1XQH A;  1KD1 R;  1M2V A;  3CC7 T;  1EX4 A;  3OYE A;  3LGF A;  3G4S Q;  2J6O A;  4J6Y A;  2YUN A;  3ASK A;  3QXE B;  2K2M A;  2EQM A;  2RHZ A;  4J7F A;  2ROL A;  4JRP A;  1HK9 A;  2X51 A;  1MMD A;  1IXD A;  5CQY A;  2A36 A;  3SWN B;  1TUG B;  2ZPF B;  5CR2 A;  2QXF A;  1SRL A;  3HRS A;  4PJO B;  1RAE B;  4J83 A;  1GRI A;  3QJY A;  4NOY A;  5IXB A;  4D8D A;  3CCS T;  2LMJ A;  2KY9 A;  1QVF P;  1Y96 B;  3HKS A; 
#chains in the Genus database with same CATH homology
 2F2V A;  1T0J A;  4RTW A;  1TG0 A;  2LJ0 A;  1G2B A;  4M4Z A;  3TSZ A;  4JZ4 A;  1NM7 A;  1E6G A;  2AZV A;  2DRM A;  2EPD A;  1SEM A;  1M27 C;  2FRY A;  2KRO A;  2CSI A;  1T3L A;  2FG0 A;  4AFQ C;  1ZUY A;  3UA6 A;  2LNH B;  4F16 A;  1QWE A;  1AVZ C;  2SEM A;  3VS0 A;  1AZE A;  2AKK A;  2HBW A;  2GBQ A;  2KGT A;  1I07 A;  2FO0 A;  1M30 A;  2J06 A;  3I5S A;  2AZS A;  2ESW A;  4Z8A A;  3M0S A;  4LNP A;  2KT8 A;  3REA B;  4Z89 A;  2JXB A;  3TSW A;  4J9H A;  4A63 B;  2KRS A;  1WLP B;  2RQW A;  3VS4 A;  5IH2 A;  3RBB B;  2K3B A;  2RNA A;  2VVK A;  1X2K A;  1Y0M A;  2DVJ A;  2M51 A;  4GBQ A;  1WFW A;  1UE9 A;  2RMO A;  2EYX A;  1G83 A;  2X3X D;  3CQT A;  1U06 A;  3ZL7 C;  4J9F A;  2LP5 A;  1X69 A;  4AG1 C;  2DJQ A;  3EHR A;  2DL4 A;  1GCP A;  2YSQ A;  3EGU A;  3VRY A;  2C0I A;  3NHN A;  3NPF A;  3H41 A;  2RQU A;  2D1X A;  4J9E A;  1KSW A;  2O9V A;  3VS7 A;  1AEY A;  3PE0 A;  1SSH A;  5I22 A;  3VRZ A;  3I5R A;  1AD5 A;  1WA7 A;  2PTK A;  2FEI A;  1MV3 A;  1UTI A;  1VA7 A;  2DBM A;  1UHF A;  4CC3 A;  1X6B A;  3IQL A;  2DL5 A;  1H8K A;  4J9C A;  1H3H A;  1W6X A;  2W10 A;  2KXD A;  4R0K A;  1ZUU A;  1GFC A;  2J6K A;  4Z88 A;  2JM9 A;  2DE0 X;  1RLP C;  2OJ2 A;  2F2X A;  1WYX A;  3TVT A;  3PVQ A;  2CT3 A;  4AFZ C;  1K9A A;  2YDL A;  2PZ1 A;  2JT4 A;  2O9S A;  1UHC A;  4AG2 C;  2JMA A;  4QT7 A;  3VS1 A;  4RTU A;  1ZLM A;  1T3S A;  4LN2 A;  3O5Z A;  3QWY A;  2ECZ A;  4ESR A;  1Z9Q A;  3M0P A;  1K76 A;  2DL3 A;  1SHF A;  1AWW A;  2HDA A;  2BZ8 A;  1GL5 A;  2LQN A;  2J05 A;  2DNU A;  1GFD A;  4HXJ A;  1K1Z A;  1LCK A;  1EFN A;  2D8J A;  4LUE A;  1M3B A;  1PNJ A;  4OML A;  1PWT A;  5IXF A;  1NLP C;  4CC4 B;  4F14 A;  2JS2 A;  1NEG A;  2V1R A;  4OMP A;  2LJ1 A;  2KRN A;  4IIO A;  2DIL A;  2J7I A;  2KE9 A;  2KNB B;  5ECA A;  2PNI A;  1ZBJ A;  1WI7 A;  1V1C A;  1OV3 A;  2CUD A;  2V1Q A;  2CT4 A;  1UUE A;  1T0H A;  1M8M A;  1GCQ A;  2ED0 A;  3U23 A;  1YWO A;  2CSQ A;  2LJ3 A;  4RTV A;  1BK2 A;  3FJ5 A;  2K9G A;  3REB B;  3JV3 A;  1W1F A;  3M0T A;  1ARK A;  1X2Q A;  5GJW B;  3VS6 A;  2GGR A;  3UF4 A;  2E5K A;  1NLO C;  2ABL A;  4WCI A;  4HVV A;  2C0O A;  4Y92 A;  2OI3 A;  2EGC A;  1WDX A;  2MOX A;  2O2O A;  4D8K A;  2X3W D;  2K6D A;  2JW4 A;  2DL8 A;  2FPF A;  2B86 A;  1QKW A;  2NUZ A;  2ED1 A;  1VYU A;  4FSS A;  1NEB A;  4JJC A;  3H0F A;  1WXT A;  2DX1 A;  1HJD A;  3H0H A;  4J9D A;  1X43 A;  1WIE A;  1JO8 A;  1UJ0 A;  2I0N A;  3GBQ A;  3LH5 A;  1X27 A;  1UGV A;  1IO6 A;  2L2P A;  3EHQ A;  2RN8 A;  1WX6 A;  1RI9 A;  3C0C A;  3VS2 A;  1UJY A;  1X6G A;  2D8H A;  2RQV A;  2KR3 A;  2CUB A;  2A08 A;  2DRK A;  2BZX A;  1CKB A;  2DL7 A;  1FMK A;  3RNJ A;  2RQT A;  4HCK A;  1ABQ A;  1WXU A;  2RF0 A;  4RTX A;  3QWX X;  4JJD A;  4RTY A;  1E6H A;  4KRT A;  1KJW A;  1BB9 A;  2LX7 A;  1S1N A;  1A0N B;  1KIK A;  1NYG A;  4DEY A;  2L3Q A;  4AFS C;  2CH4 W;  3M0U A;  1PKT A;  4JJB A;  4K11 A;  2W0Z A;  2MCN A;  1YN8 A;  2YUP A;  2P4R A;  4DEX A;  1YP5 A;  1AWX A;  1PRL C;  4OMM A;  1JQQ A;  1VYV A;  2OAW A;  3EG1 A;  1AWO A;  2DLP A;  2RPN A;  2DM1 A;  5EC7 A;  1YCS B;  4JPB W;  2HCK A;  5IHK A;  4X1V A;  2SRC A;  3I9Q A;  1YWP A;  2LZ6 B;  4AFU C;  1SPK A;  5GJV B;  5FWC A;  2A37 A;  2M0Y A;  2EBP A;  1WXB A;  2KEA A;  1AOJ A;  1GCQ C;  4F17 A;  1OPL A;  1ZUK A;  4GLM A;  1SHG A;  5IHN A;  2GNC A;  2HSP A;  2KYM A;  2H8H A;  2XMF A;  2YT6 A;  1I0C A;  3UAT A;  2VKN A;  2EW3 A;  4J9B A;  1UG1 A;  2EYW A;  2K7A A;  1MV0 B;  2DBK A;  3H0I A;  2CRE A;  1BBZ A;  2FPD A;  4J9G A;  2KRM A;  2L3S A;  5IHI A;  2BTT A;  1HSQ A;  2FRW A;  2L3P A;  3EG2 A;  1CKA A;  3M0R A;  2JMC A;  2A28 A;  4LE9 A;  2DA9 A;  2BZY A;  3SEM A;  2EVR A;  1J3T A;  2CH4 A;  2LQW A;  2O31 A;  5I11 A;  1Z9Z A;  2F2W A;  1U5S A;  4OMQ A;  1JEG A;  4RTZ A;  2VWF A;  1MUZ A;  4E6R A;  5L23 A;  1TUD A;  1PRM C;  4OMO A;  2GTO A;  2C0T A;  1UDL A;  1AZG B;  2YUQ A;  1SRM A;  4IIM A;  4ORZ A;  3SHW A;  2EKH A;  4J9I A;  1JXO A;  3UA7 A;  1UEC A;  1W70 A;  2K79 A;  3I35 A;  2EGA A;  4RUG A;  1K0S A;  2EQI A;  4CC7 A;  1NYF A;  1RUW A;  1OEB A;  3PVL A;  2D0N A;  2AKL A;  1PHT A;  2ROT A;  1M3C A;  3NGP A;  1ZSG A;  1JXM A;  1QWF A;  1KFZ A;  1AWJ A;  2HEQ A;  1PKS A;  1FYN A;  1B07 A;  4ZNX A;  1TUC A;  2KXC A;  1QKX A;  2JTE A;  1B3Q A;  2EGE A;  2KYB A;  1XOV A;  2DMO A;  4EIK A;  1ABO A;  1QLY A;  2L0A A;  2IIM A;  2MIO A;  3EG3 A;  2JS0 A;  2YUO A;  1M3A A;  1E7O A;  4HVW A;  2EYZ A;  1H92 A;  1HD3 A;  2RQR A;  2DYB A;  2GTJ A;  2KT1 A;  3THK A;  4RTT A;  2EYY A;  4HVU A;  2LCS A;  2DF6 A;  3ULR B;  2G6F X;  1GBR A;  1K4U S;  4LUD A;  3KFV A;  3M0Q A;  2NWM A;  3EG0 A;  1GBQ A;  4JZ3 A;  1VYT A;  1UFF A;  1OPK A;  1OOT A;  5HCK A;  1NG2 A;  2J6O A;  1K0X A;  2YUN A;  4CC2 A;  2J6F A;  2JM8 A;  2K2M A;  2ROL A;  2ENM A;  4OMN A;  2CDT A;  3VS5 A;  3A98 A;  2O88 A;  1U3O A;  1YNZ A;  3VS3 A;  1Y57 A;  1JU5 C;  2A36 A;  2AK5 A;  5FWB A;  1I1J A;  1CSK A;  1SRL A;  3R6N A;  1GRI A;  1ZX6 A;  5IXB A;  4D8D A;  2LMJ A;  5FW9 A;  1QCF A;  2FPE A;  2QDL A;  2GQI A;  1BU1 A;  1RLQ C;  3NMZ C;  1N5Z A;  2KBT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...