2DBMA

Solution structures of the sh3 domain of human sh3-containing grb2-like protein 2
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
73
structure length
73
Chain Sequence
GSSGSSGPCCRALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLHGHSGFFPINYVEILVALPHSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SH3-containing GRB2-like protein 2
publication title Solution structures of the SH3 domain of human SH3-containing GRB2-like protein 2
rcsb
source organism Homo sapiens
molecule tags Transferase, signaling protein
total genus 5
structure length 73
sequence length 73
ec nomenclature ec 2.3.1.-:
pdb deposition date 2005-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dbmA00
4IIOA 2W10A 4J9GA 4J9IA 2OJ2A 5L23A 2GTOA 1X43A 4Z88A 3TSZA 2ESWA 1G83A 2PTKA 4EIKA 1X2KA 2EPDA 4OMOA 1I07A 2K6DA 2FRWA 1M3BA 1UHFA 1X2QA 2E5KA 1E7OA 3QWYA 2DMOA 1H92A 2KNBB 3EHRA 1NEBA 5FWCA 2RMOA 2MCNA 1QCFA 1CKBA 3PVLA 5IXFA 2JM9A 2DNUA 1AWXA 4AFQC 4AFSC 3EGUA 1JEGA 3UA6A 2YUNA 1T0HA 1WXBA 1SRLA 2DRMA 2LP5A 2O88A 4DEYA 2FPDA 1XOVA 1S1NA 1W70A 3M0SA 3FJ5A 5I22A 1GCQA 1K0XA 1GBRA 2KXCA 1UTIA 4RTZA 4RTVA 2ENMA 4LUDA 2RN8A 2CSIA 3EHQA 1UG1A 2CH4A 2RQTA 2C0OA 5ECAA 1K76A 2LJ0A 1M3AA 2KRSA 4ESRA 2RQWA 4HVUA 2C0IA 2CDTA 1IO6A 1TG0A 2F2XA 1GFDA 2P4RA 2DL3A 1NLOC 1YNZA 4RTXA 4OMQA 2K3BA 1FMKA 4CC2A 1AWWA 1EFNA 1AEYA 4F16A 3M0QA 2NWMA 1PRMC 2DL4A 3VS5A 1KIKA 1AZEA 3KFVA 3I9QA 1AVZC 1MV3A 4HVWA 5IH2A 3U23A 3VRYA 3VS0A 1TUCA 1M8MA 2BTTA 4J9EA 2DBMA 2CH4W 3EG2A 3QWXX 2YUPA 2EQIA 2FPEA 2K2MA 1Y0MA 5GJWB 1MV0B 2LJ1A 1E6GA 2AZVA 2JXBA 4J9HA 2EW3A 1H3HA 2LJ3A 1T0JA 2CT4A 1GBQA 4HVVA 3NMZC 1K4US 2LMJA 4JJBA 1J3TA 2CUBA 4OMPA 2L0AA 2L3PA 1MUZA 3IQLA 4KRTA 2KBTA 4D8KA 1JQQA 2RNAA 2AKKA 2JMAA 2EYWA 3I35A 3LH5A 2D1XA 1HD3A 1WDXA 2KGTA 2KRNA 4WCIA 1RI9A 2ED0A 4LNPA 2F2VA 2KE9A 5EC7A 2JM8A 3REAB 3EG0A 1I1JA 1SPKA 2FO0A 2YSQA 2BZXA 2BZYA 1E6HA 1K1ZA 1Z9QA 1QWEA 1KJWA 4CC7A 2DVJA 3ULRB 1GRIA 1RLQC 2A37A 1YN8A 3M0UA 1JXOA 2RF0A 1PHTA 5I11A 2KYBA 2YUOA 3NHNA 3JV3A 2DE0X 2GTJA 2RQRA 2GBQA 5FWBA 1B07A 2SRCA 3ZL7C 1W1FA 2HSPA 2JTEA 4F14A 3PE0A 1OPLA 3UF4A 1WA7A 1H8KA 2AZSA 2A28A 2VKNA 4RTTA 5IXBA 2LZ6B 3VS1A 1WXUA 2O9VA 1B3QA 4GBQA 4JZ4A 2JS2A 1N5ZA 4GLMA 4JPBW 1JU5C 1SSHA 1PNJA 2V1RA 1NEGA 1NG2A 3I5SA 4JZ3A 3SHWA 2D0NA 2EYYA 1ZSGA 4J9BA 4X1VA 1GL5A 2K7AA 1ZX6A 2ABLA 1PKSA 2EGAA 2KR3A 1WLPB 3PVQA 2DL5A 2KT8A 1M3CA 3NPFA 4J9DA 1LCKA 4AG1C 1NYGA 2O31A 1QLYA 3TVTA 1OV3A 1WX6A 3UATA 2J6FA 1QWFA 2KXDA 4E6RA 1HSQA 1W6XA 3EG3A 2HDAA 2H8HA 1K0SA 4CC3A 3CQTA 1I0CA 5GJVB 2YT6A 5IHKA 2FEIA 3H41A 1NYFA 1UJYA 1BB9A 2EGCA 1ZBJA 1UUEA 1M27C 3H0HA 1CKAA 2B86A 1WIEA 2ECZA 2EKHA 2EYZA 1PWTA 2L3SA 1ZUYA 5IHIA 1GCQC 2KEAA 2F2WA 2LX7A 2CT3A 2MIOA 1K9AA 5FW9A 1Z9ZA 2G6FX 4HCKA 4IIMA 1ZLMA 3R6NA 1RLPC 1ABQA 2DILA 2I0NA 2DRKA 2M51A 2OI3A 2LQNA 3UA7A 2DA9A 2RQUA 4F17A 2GGRA 2C0TA 3VS4A 2EVRA 1YWOA 1X6BA 1OPKA 1RUWA 1UJ0A 1U3OA 2ED1A 3GBQA 1KSWA 1AOJA 4RTWA 1UE9A 2M0YA 2XMFA 4OMLA 4A63B 2QDLA 2EYXA 4LUEA 3VS6A 1GFCA 3A98A 1FYNA 4D8DA 1QKWA 2FPFA 3C0CA 1JXMA 4RUGA 2JMCA 2L3QA 2HCKA 1CSKA 1OOTA 3TSWA 3I5RA 4Z8AA 2A36A 1WFWA 2KT1A 2SEMA 4AFUC 1YP5A 1BU1A 1A0NB 1NM7A 3REBB 2VVKA 3H0FA 4AG2C 2RPNA 1BBZA 4JJDA 5IHNA 1UDLA 4QT7A 1M30A 1SRMA 2W0ZA 2LCSA 1PKTA 1UECA 1ZUUA 1YCSB 3NGPA 1T3LA 3SEMA 1KFZA 1JO8A 2CSQA 2MOXA 1VYUA 2DL7A 4AFZC 3O5ZA 4OMMA 2HEQA 2EGEA 2J7IA 2K9GA 1NLPC 4RTYA 2BZ8A 2PZ1A 4Y92A 4J9FA 3THKA 1ABOA 4LN2A 1Y57A 2YUQA 2A08A 1UGVA 4R0KA 3VS3A 1AD5A 1QKXA 1AWOA 3RNJA 5HCKA 3RBBB 1WI7A 2D8HA 2ROLA 3M0PA 4Z89A 1AWJA 2J6OA 1SHFA 1WXTA 2AK5A 2JT4A 1UHCA 2LNHB 2D8JA 3VS2A 2DBKA 2V1QA 2X3WD 1BK2A 2O9SA 2J05A 1AZGB 1WYXA 2X3XD 2DF6A 4FSSA 4J9CA 1U5SA 4K11A 2CREA 3VS7A 1X69A 2GNCA 2K79A 1SHGA 2KYMA 4CC4B 1UFFA 1GCPA 1X27A 4ZNXA 2DX1A 4M4ZA 1U06A 3M0TA 2YDLA 2OAWA 2DYBA 4JJCA 1T3SA 2LQWA 1PRLC 3H0IA 1ZUKA 1VYVA 1SEMA 1G2BA 2PNIA 4OMNA 1ARKA 2DL8A 1TUDA 2CUDA 4LE9A 2RQVA 4RTUA 4DEXA 4ORZA 2HBWA 1VYTA 1OEBA 2DJQA 2DM1A 2DLPA 1X6GA 2ROTA 2O2OA 2KROA 2FG0A 2IIMA 1V1CA 2JW4A 3M0RA 2NUZA 1VA7A 2VWFA 1YWPA 3EG1A 2FRYA 2AKLA 4HXJA 2GQIA 2KRMA 2J06A 2EBPA 3VRZA 1HJDA 2J6KA 2L2PA 2JS0A
chains in the Genus database with same CATH superfamily
1B34B 1N8RR 4FIBA 1W4SA 4J6YA 1K8AR 1QVGS 4EIKA 2EPDA 2RJFA 1ZA2B 5I2SA 1FX7A 1FXXA 2WACA 3EHRA 4OB2B 2HD0A 2MCNA 4DOWA 3CPWA 3PVLA 2JM9A 1AWXA 2GCXA 4PJNA 4N4HA 3CCRQ 4AFQC 4MDXA 3RR6A 4M7AE 2YXYA 1WXBA 4LDYA 2LP5A 1YITT 2YHTA 1YITA 4B9XA 8AT1B 1S1NA 3OYNA 1W70A 1R77A 4WF2A 5I22A 4HT8A 2E3HA 2KXCA 3QZ9B 3CC2T 4RTVA 3CC2A 2ENMA 4LUDA 1O75A 4JDSA 2D6FA 1UG1A 2F1LA 4M7AD 2CH4A 3C95A 3OS1A 2C0OA 1KC8U 3D7SB 3FRNA 4LD6A 4BY6C 2CZ0B 3CXCA 3CC7Q 1LVKA 3EGXB 4FW2A 4N4IA 2FB7A 3I56T 3I56A 4JRIA 1GFDA 1KG1A 1YHQQ 2DL3A 1NLOC 5D6WA 4J83A 2YRDA 4KUIA 4RTXA 4C92G 3OYGA 1V76A 2YLBA 1FMKA 3QSUA 2GFUA 4LDXA 3CC4Q 2NWMA 1PRMC 1G3SA 1AZEA 1AHJB 4GY5A 4JS4A 3A8LB 2HQHA 4Y28E 3VRYA 3VS0A 1IRXA 2ZZDA 1M8MA 2BTTA 2E70A 2DBMA 5KE3A 3RKWA 2YUPA 1Q95G 3EGDA 5GAN7 1TSFA 3M59A 4OB3B 3CCVQ 2AZVA 2YWWA 4M7AF 4MZMA 2EW3A 1H3HA 2LJ3A 4F7UA 5IT9E 3NMZC 3GOXA 3FIFA 4OMPA 3PIOA 2L3PA 3IQLA 2EJFA 5CVIA 2CZ6B 2DZCA 3PNWC 2RNAA 4J7FA 4A53A 2DIGA 1WDXA 3M57A 2DTHA 1FMWA 3KBGA 2F2VA 1W2BP 3EG0A 2FO0A 2YSQA 2R5MA 3X26B 1K1ZA 1Z9QA 3BFMA 1BIBA 3FDRA 4CC7A 3MEWA 1SF9A 4EMKC 3M0UA 1JXOA 2RF0A 2ZPBB 2DEQA 2KYBA 3HKSA 4FYWB 4ZTJA 2EQUA 5HK3A 2DE0X 4II1A 2SRCA 2JTEA 2LQ8A 2FZGB 3UF4A 4E47A 2A28A 1VQ6T 1VQ6A 1KHIA 2A0FB 4RTTA 2QASA 2DTOA 2L5QA 2O9VA 4JZ4A 4BI4A 1KD1C 3JCMV 1N5ZA 2E6ZA 4JJNK 2LQKA 1JJ2A 2V1RA 5GMKi 1NEGA 1NG2A 5M9OA 1N27A 4M7DE 3QYGB 4QVCA 3S3NA 3TQ7P 2GQVA 1ZX6A 2ABLA 1U1SA 2QG9B 5AYFA 2DL5A 4PJMA 2Y90A 2A7YA 4J9DA 3OYKA 5J39A 1LCKA 4J6XA 1QLYA 2QA4T 1OV3A 2QA4A 5FRNA 1G3TA 4BE2A 1M90U 2VUBA 2K5LA 2LT1A 3CPWS 5GAOq 2KXDA 3HRSA 1W6XA 3EG3A 4V2SA 2H8HA 2DJZA 4N0AC 3HRUA 2FEIA 3PTAA 2DIQA 3H41A 4L6V5 2EGCA 2NYSA 4OGCA 1R8OB 4EMKA 3MJXA 1VQKT 2ECZA 3EH2A 2EKHA 2ZCFB 1VQKA 3OYHA 1D1AA 1Q81U 1RADB 3A8HB 2QEXT 4M78B 2QEXA 1K9AA 3LGLA 5FW9A 2JOYA 2CP2A 4O5VA 1ABQA 4JUVA 2M51A 1BI1A 5GANe 5I2MA 4WTOB 3M4GA 2RK1A 1RUWA 1B7TA 3E19A 1UE9A 2M0YA 2XHCA 3RMQA 1VQPQ 1Q7YU 4OMLA 4KULA 4QVZA 2RA2A 2QDLA 2RB6A 4HKEA 4C5GA 1GFCA 1BI0A 1QCNA 4YTLA 3A98A 2MWPA 2CP7A 1OU9A 4X34A 1VQOT 1VQOA 3EFOA 4M75B 3M5AA 2HCKA 2CP6A 3I5RA 2RI5A 2A36A 2SEMA 1I8FA 4NOYA 1BU1A 2X9HA 1VQ8T 1VQ8A 3REBB 1BIAA 2VVKA 3SWNB 1BBZA 4JJDA 4E7LA 2Y4YA 5LJ5f 3LW5E 2ATCB 2LCSA 1KD1R 1ZUUA 2VV5A 1YCSB 5DM7R 3QZ5B 1WPYA 3A8MB 4OMMA 2GF7A 1NLPC 3GNFB 2JZ2A 4RTYA 2PZ1A 1YIJT 5FU7B 1YIJA 4J9FA 1VQLQ 3FJPA 5C0MA 3M54A 1WGSA 1H3ZA 1Y57A 2OTLT 2EKOA 4R0KA 2OTLA 4PLIA 3G7ZA 2M1HA 3UPUA 4Z89A 1SHFA 1R0CB 2D8JA 2V1QA 2I2LA 4QQDA 2X3WD 5FU6B 1Y7XA 2F5TX 1PM3A 1WYXA 3OW2P 2X3XD 2DF6A 1M1GA 4FSSA 1M1KU 4LXCA 1TWBA 2XDDA 1X69A 1K73C 1D0ZA 2GNCA 2K79A 2XKOC 2HZYA 4C92C 3L2RA 2KK4A 4M4ZA 1U06A 3JB9H 2L8DA 4QQGA 4BUGA 2V26A 4JJCA 1TH7A 1T3SA 2K3XA 5LJ5d 7AT1B 2VXEA 1JJ2S 3H0IA 3NFCA 4RCCA 3V8KA 2LX9A 2JUFA 4ELYC 1Y96B 2WSEE 1TUDA 2CUDA 3PMTA 4LE9A 2RQVA 4DEXA 3QKJA 1R0BG 2HBWA 2DTIA 3PFSA 1X6GA 2O2OA 4PJOC 2IIMA 4CI0C 3CCQQ 5CR2A 1IHWA 4XK8E 4M7DA 1VQMT 1VQMA 1YBYA 1RI0A 2PQWA 2FRYA 2GQIA 3J7AF 2EJ9A 3VRZA 1MNEA 2QXFA 3ZFJA 3H9NA 1YJ9T 3QDRB 2L89A 1YJ9A 2W10A 1OX8A 3VU3C 4XU0A 3OSSC 5L23A 2GTOA 1X43A 4Z88A 5FLXE 4E7SA 2OTJQ 1G3YA 4JRPA 2LVMA 5GAOm 1UB4A 2ZAEA 1I5LA 3EGDB 2EQMA 3OYFA 2FRWA 3H6ZA 2MF2A 5CKDA 1UHFA 2JTMA 2BKDN 2E5KA 1WHJA 4DQ2A 4FYYB 4M7AG 3VYHB 2RMOA 1EX4A 4MZPA 1WJRA 3MHXA 1IZ6A 2DNUA 5J3BA 3CD6Q 2NUPA 2X4JA 4AFSC 2YUNA 4C92A 1T0HA 1VQ7Q 2DRMA 4PNOA 4DEYA 3V8JA 5LJ3g 1GCQA 2DZ9A 3G4ST 3G4SA 3GF5A 1C0MA 4OB0B 4RTZA 3J81E 4AT1B 2E41A 3JCMJ 2RN8A 2CSIA 3EHQA 2D0QB 3G6EQ 5ECAA 5DY9A 1M3AA 3RKYA 4PJOA 3FEOA 1Q86U 4JLIA 2DVEA 3LYIA 4FU6A 3JB9I 5GAOl 4DOVA 5LJ5j 4B6MA 2LDMA 4PL6A 1BCOA 3DB4A 1VQ4Q 4M77E 4CC2A 1AWWA 1EFNA 4F16A 1K73R 4DBRA 3EH1A 2JJ9A 3X28B 3GLXA 1KIKA 5A0LA 1ZHIA 3INZA 5KCOA 3PT9A 4XU1A 3OBWA 4RCBA 3Q1JA 1IGUA 2KI7A 2CH4W 2MYSA 4ZN3A 3SD4A 3CCST 3QWXX 3CCSA 4AMCA 2DFUA 2EQIA 2FPEA 3JCMg 1Y0MA 3MEVA 5GJWB 2FYKA 2AHJB 2LJ1A 3I55Q 1E6GA 3JCMc 3FB9A 4OP0A 4J9HA 3M56A 2O4XA 2CT4A 1GBQA 2X4WA 4X9CA 1K4US 1YJWQ 1J3TA 2CUBA 1WNLA 2DD4A 2L0AA 3C94A 1MUZA 4F7UF 4LD9K 2KBTA 3DLMA 2AKKA 2JMAA 5CKHA 1W2BA 2DPPB 3I35A 4A4EA 3JCMP 1QQJA 5KYXB 2QQRA 2IG0A 5EC7A 2JM8A 3REAB 2P84A 3FC3A 2RJEA 1I1JA 3VV0A 1VIEA 2BZXA 2B8AA 2BZYA 2DXTA 2JTFA 3JCMb 4M7AB 5KYWA 1E6HA 2EJGA 1KJWA 3LWHA 1OYXA 2BIVA 3HL8A 4ELZC 1LJOA 2RI3A 2XU8A 1YN8A 1Y07A 1RABB 4EMGA 2MMPA 1NPPA 3NHNA 5IN1A 2RQRA 3DB3A 3R6OA 5FWBA 3PIPA 2DXCA 4FT2A 3ZL7C 3PE0A 1X6OA 1H8KA 2AZSA 3OYAA 1VQNT 1VQNA 5IXBA 2RH2A 2KMTA 1WXUA 1B3QA 3JB9F 2JS2A 4GLMA 3LX7A 2CKKA 1WJQA 1PNJA 3MEAA 4PFOA 3RKXA 3OYMA 4HT9A 1K9MC 3UT1A 1ZSGA 4X1VA 2WSCE 3OMCA 2EGAA 2RM4A 3M55A 3ZBDA 3HFNA 4C8QC 3HTRA 4DBHA 3NPFA 1XNIA 1BI2A 2RHYA 4M77C 3CCLT 4IUVA 4JS5A 3CCLA 2E12A 2EAYA 2MK5A 2J6FA 1PSFA 3EG9B 2VXFA 1XTDA 5GAMg 4J5YA 3TREA 1K0SA 3NTKA 2DETA 4L5GA 2YT6A 1N8RU 2F69A 1YJNT 5LJ3h 1YJNA 1ZBJA 1M27C 1K8AU 3H0HA 1RAFB 1OU8A 3BDLA 5CIUA 1CKAA 3L2ZA 3CMEQ 4N4GA 1ZUYA 5D6XA 2NUTA 1JB0E 4XAXB 5GAN8 1Q82C 2BE7D 1D1CA 2LX7A 2MPXC 4E7JA 1ZSZB 2CT3A 2MIOA 1VIFA 2G6FX 4HCKA 3QYHB 4HCZA 3ME9A 4M78G 1ZLMA 1UEBA 3R6NA 2CP0A 3A8OB 3HFOA 3CBMA 2DILA 2I0NA 2DRKA 2DA9A 4XTWA 1MMDA 2BUDA 2C0TA 3BW1A 3VS4A 1YWOA 1OPKA 1U3OA 2ED1A 2PU9B 1AOJA 1S72Q 4BDYA 1NPRA 2VYTA 4HCBA 4C8QA 5GANh 2FL7A 4A63B 3CCET 3CCEA 3S6WA 3CCUT 4M77A 3E1SA 3CCUA 4FCYA 2COZA 2QQBA 4PJJA 1N9RA 3C12A 3JCMh 2QQ9A 3C0CA 3BDUA 2XD0A 2DXBA 2JMCA 2L3QA 3MP8A 4RG2A 1CSKA 1OOTA 4C0DB 1DJ7B 4M7DB 3CCJQ 1OX9A 5A0DA 1YP5A 1A0NB 1HYOA 4M75G 1YI2Q 1NM7A 2XI9A 1VQ5T 3QO3A 1I4K1 2CZ1B 1VQ5A 2KQWA 3MCAB 1SRMA 2H3EB 4PFPA 3CMAQ 1QW1A 1UGPB 1VYUA 3QIIA 1W2BS 2HEQA 1K9MR 2EGEA 2J7IA 3M53A 3X24B 2BZ8A 2K2VA 3EAEA 1ABOA 4LN2A 3BY7A 2RK2A 3RNJA 1NZ9A 3RBBB 1WI7A 3VUBA 4ANJA 3SB2A 3TU4K 1AT1B 3M0PA 5LJ3e 4M7DD 1NJIC 1WXTA 1EIFA 2RO0A 2ZGWA 2AK5A 2LNHB 5GANj 3OW2A 4JRKA 5CKBA 2RHIA 4J9CA 4X9DA 3L2WA 1X75C 2KYMA 4CC4B 4BI8B 5FROA 4ZNXA 3TEEA 4C92E 3M0TA 2R57A 2OAWA 1RAHB 2FZCB 3CCRT 2LQWA 2HL3A 3CPFA 3CCRA 1VQ9Q 4FYXB 1ZUKA 1SEMA 1G2BA 2PNIA 4OMNA 1Q82R 1ARKA 1M2VB 4KH1B 3V7RA 2MAMA 2RD1A 4RTUA 3CEYA 4D6WA 4C92D 2ROTA 2GFAA 2HMAA 1V1CA 1GXIE 1VA7A 2VWFA 4PJOE 3DLLA 5GAN3 2ZPGB 4M7DF 4HXJA 2KRMA 3JCMe 5GAMh 3OMGA 2EBPA 3J80E 2LNVA 3CC7T 5KCHA 2QYZA 3CC7A 5KYUA 1G8XA 1M1KR 2VB6A 4Y91A 4DBQA 1NE8A 2FVUA 4PJOD 3T9NA 3TSZA 2ESWA 2PTKA 1QVPA 1X2KA 3GPLA 3WVDB 4OMOA 4HCCA 1M3BA 2COWA 3RIRA 3CC4T 3CC4A 1E7OA 2DMOA 3QJYA 5FWCA 2OAUA 1CKBA 3NTHA 4N0AA 5IXFA 3E2UA 3EGXA 2RHUA 3EGUA 4F7UG 3UA6A 1SRLA 2KSSA 5CQYA 1TXQA 4C92F 1XOVA 4IUUA 3M0SA 1F1BB 1UGQB 2V8KA 3LGFA 1I5OB 3CCVT 1K0XA 3E9GA 3CCVA 4JLGA 3OA6A 4IKFA 5GAOn 3CCMQ 1KQ1A 4KUDK 2LJ0A 5KE2A 2RJCA 2KRSA 2HAXA 1OQKA 1KQSP 2RQWA 2C0IA 4BDZA 4Z02A 1NJIR 1V29B 4PJOF 1TG0A 2P4RA 4MZTA 3VKIA 1KK7A 2V8JA 4FSXA 1YNZA 4OVAA 3P8HA 1PCXA 4VUBA 4OMQA 4XTVA 5GMKe 1AEYA 4C0GA 3VS5A 4BE1A 1YCYA 3JB9G 2HKNA 4ZGDB 4MMKA 3WVEB 4F04B 3V8LA 1AVZC 5IH2A 1QCOA 2AIRB 3U23A 2LT4A 4KGVB 3OSVA 1TUCA 4QW2A 4J9EA 2E6NA 3RESA 1YITQ 3EG2A 4BI3A 5GAMe 1N9SA 2CZ7B 2XG8D 5CKEA 2JXBA 3CC2Q 2YRVA 1BCMA 3QHSA 1M9SA 1Q86R 1T0JA 4HVVA 4PFZA 3RDVA 1M5Q1 3JAME 2DK3A 1IHVA 2R5AA 4OMFB 3OW2S 4D8KA 1JQQA 3MKDA 4LDVA 4DA4A 3LH5A 3OS5A 1HD3A 1KD1U 4M78C 1RAAB 1MGQA 2ED0A 4LNPA 1LNXA 2KE9A 2ZPEB 2QQAA 2D9TA 3I56Q 2LC4A 2X4YA 3X20B 2NLUA 2DO3A 3X25B 2K57A 2PVOB 3A1PA 1SKUB 2DVJA 1WHMA 1RLQC 2QI2A 4F7UB 1PHTA 2YUOA 8ATCB 2HSEB 3LWIA 4MMLA 2M16A 4ZGEB 1D0XA 1B07A 5GAOp 1W1FA 4C0ZA 2DKGA 2HSPA 1YJNQ 2CP5A 2P4TA 1Y71A 5CO7A 2E4HA 2COYA 4GLKA 1WA7A 2P0KA 2VKNA 3RERA 1BYMA 4FW1A 3SDZA 4A4GA 2LZ6B 4BY6B 3AT1B 4M75C 2XIDA 4JPBW 3OYYA 3MP6A 1SSHA 3LH0A 2G3RA 4QKUA 1D3BA 3I5SA 4JZ3A 3SHWA 3OQ5A 2EYYA 3SWNC 4M77B 3N5BB 3QUIA 4C5HA 5GAN2 2KR3A 1WLPB 2PVGB 4RG8A 3PVQA 2KT8A 2M9UA 1PD1A 1M3CA 4C8QE 4IURA 3HP9A 4EMHA 1NYGA 2O31A 3A8GB 2DXUA 5FU7C 2IPOB 2E64A 1VQPT 1VQPA 5L8RE 2VC8A 2PUOB 2E1HA 2XDPA 1TS9A 2HDAA 1RL2A 2YLCA 3UWNA 3CQTA 4CC3A 5GJVB 2X51A 4C8QD 5IHKA 3OB9A 1UJYA 3L2VA 2KY9A 3OYIA 1BB9A 1QVGP 1UUEA 4M77D 4OF1A 5FU6C 1VOMA 2B86A 2EYQA 5EG2A 1WIEA 3RMSA 2DERA 2EYZA 1PWTA 1VQ6Q 3OYBA 1KC8R 4RMOA 4KGZB 2XDBA 5IHIA 3OYDA 2KEAA 5CCAA 2H3JA 4MDWA 9ATCB 3HRTA 1UGRB 1Z9ZA 3OBYA 5LJ3f 2QQSA 4IIMA 2O01E 6AT1B 2A3LA 4XU2A 2FHDA 1VQLT 2KVQG 2OI3A 3OYCA 1M90C 4M75A 1VQLA 3UA7A 1H641 2RQUA 4IUTA 4EMKB 1X6BA 1MMAA 1I81A 1HK9A 4E7HA 2E65A 3SWNA 1KSWA 1ZBXA 2KAFA 2LRQA 3M4YA 4RTWA 2QA4Q 1IGQA 1U1TA 3URGA 5DLQE 1G5VA 1RAIB 1G3WA 2XMFA 2DAQA 4C8QF 2EYXA 2R58A 4C5EA 1FYNA 1Q81C 4M77F 1QKWA 1JXMA 4PKCC 3G71T 4RUGA 3G71A 3DKMA 4XTXA 3TSWA 4Z8AA 1VQKQ 3M58A 5GANf 4M7DG 5J26A 4AG2C 5LJ3d 1K73U 1M30A 1P92A 5KYUB 1QP2A 1PKTA 2QEXQ 1UECA 3JCMf 5GAN6 2DD5A 3MP1A 2MI6A 3L42A 1JO8A 2CSQA 2MOXA 2DL7A 3O5ZA 3OYEA 2C06A 3CCQT 3CCQA 3MPUB 3EFRA 4KGXB 1TOVA 1D1BA 4FT4A 1Q7YC 3META 3EFOB 3CBPA 1AWOA 4LDWA 4C5IA 1ZA1B 3BE3A 4ZN1A 1AWJA 1OI1A 2J6OA 2K5FA 1UHCA 2QAZA 2RHXA 4Q5WA 3VS2A 1Y96A 2DBKA 4PLLA 1QVFP 1BK2A 4CRIA 3ER0A 2OTJT 2J05A 2RJDA 1AZGB 2OTJA 4IUPA 1U5SA 4K11A 3QDFA 5DLOA 1VQOQ 5GANd 2YRCA 3C4SA 4E7IA 1TTHB 2E10A 2YDLA 3S3MA 3SFMA 5FRMA 3CD6T 4BE0A 1M4ZA 3CD6A 1VQ8Q 1PRLC 4ZGJB 3JCMd 2E3IA 1VQ7T 1VQ7A 4C0FA 3OS0A 2EFIA 3MO8A 2CGHA 4EPCA 4PJOG 1OEBA 5HK0A 3EFSA 2FG0A 2MWOA 3M0RA 2HQXA 1YIJQ 1YWPA 3FLGA 1M90R 3G6ET 2OTLQ 3G6EA 2K4YA 1QVFS 1C6VX 1M1KC 1HJDA 1LOJA 1TUGB 2HNIA 4IIOA 1X01A 4J9GA 1KHCA 5CKFA 2EIFA 4J9IA 5CK9A 2OJ2A 3G1JA 5CQXA 2PUKB 1G83A 2QK0A 5LJ3j 1VQ4T 1VQ4A 1I07A 3VYGA 2K6DA 4FL6A 2WSFE 1X2QA 1Q81R 3KXTA 5GAMf 3QWYA 1H92A 2KNBB 1NEBA 4XTUA 1QCFA 1MMNA 2IVWA 5KYYA 1PSEA 4M7AC 1EZZB 4J6WA 3QBYA 3CPWP 1JEGA 3OYLA 2O88A 2E5QA 2FPDA 3QG1A 3UDCA 5HKCA 3FJ5A 2RI2A 1GBRA 3I55T 1XJWB 3I55A 1UTIA 2QGFB 4P5NA 2QTXA 1VQMQ 1YJWT 1Q7YR 1YJWA 2RQTA 1KQSA 3QJ6A 2LCLA 2VASA 1K76A 3JCMQ 4ESRA 4XTZA 4FM4B 4KBMB 2L3RA 2NUPB 4HVUA 2CDTA 4ME7A 3WXMB 1YJ9Q 1IO6A 4C92B 3CXCP 2F2XA 2V8IA 5I21A 4XU3A 5GAMd 5GAOr 1OZ3A 2K3BA 2M0OA 4JRQA 1M1FA 3M0QA 5GMKm 2DL4A 2PVDB 3VUZA 2XICA 3KFVA 3AHUA 4EDUA 1B34A 1D3BB 3I9QA 3JCMX 1MV3A 5AT1B 4HVWA 4PJOB 5GMKh 5KYXA 3A5ZB 4KT0E 4A4FA 4ZTFA 3JB9J 2JVVA 4NS5A 5KH6A 5LJ5g 3L2UA 2K2MA 4M7AA 1Q86C 1MV0B 3G4SQ 4PK4A 2CP3A 1LPLA 5KYNA 4OGEA 1VUBA 3JSCA 5HY6A 5A0GA 2LMJA 4JJBA 4KH0B 1RACB 4KRTA 2VGNA 3CXCS 4E7KA 2EYWA 2D1XA 1ZSZC 2KGTA 2KRNA 4WCIA 1RI9A 1YHQT 3HPWA 4M78E 1YHQA 1IREB 4A4HA 1K9MU 1SPKA 1MHNA 1OZ2A 5GMKl 3GIBA 2Y4XA 1QWEA 3ULRB 1GRIA 4R55A 1JRIA 2A37A 2O4XB 5I11A 3JV3A 4M78D 2GTJA 2K3YA 2GBQA 2OX7A 5GMKj 2LTOA 4A4KA 4F14A 2EQJA 1OPLA 1QMCA 3GP8A 3V7CA 3JCMW 4QVDA 3CCSQ 3CMET 3P8DA 3CMEA 1WHKA 4XTYA 4FYVB 1FWZA 3VS1A 4GBQA 5KYWB 3EG9A 5D7UA 3L1AA 4UC4A 1JU5C 2HKQB 3JRZA 4C0DC 4M7DC 3F70A 4M75E 3OY9A 4OB1B 5GAMj 3OYJA 1JJ2P 4TVRA 2D0NA 1M2OA 4RKUE 4J9BA 1RAEB 4C8QG 5GAN4 1GL5A 2K7AA 1Q82U 1PKSA 4M77G 3ASKA 2ZPFB 3MEUA 1IB8A 2DEUA 4M75D 4AG1C 1S72T 3TVTA 1S72A 2EWNA 1WX6A 2VGMA 4HA8A 3UATA 1WHLA 1ZSZA 2HQEA 3TCJA 2DYIA 1QWFA 2K5IA 1MNDA 4E6RA 1HSQA 4M78F 4DBFA 1QVGA 1I0CA 1KQ2A 1HXDA 1NYFA 2HBPA 4A54A 2CS7A 3RUXA 3O8VA 1UGSB 4B9WA 3S3OA 3G71Q 3CCJT 3CCJA 3HHTB 2F5KA 1KC8C 1YI2T 1VQNQ 3QXEB 1YI2A 2L3SA 1GCQC 3QPHA 2F2WA 1KQSS 3CBOA 2BE9B 4QQ6A 3CMAT 3CMAA 2X4XA 3E9FA 5A2QE 1RLPC 1SG5A 1TU0B 2LQNA 4J7IA 4IUQA 2EQKA 1FMVA 4F17A 2GGRA 4BACA 4M75F 2EVRA 1UJ0A 3P8BB 3GBQA 2HL5C 1N8RC 1MMGA 3CCLQ 1QP3A 2JN0A 2NUTB 2P0PA 1WQWA 1BI3A 4NL2A 5IAYA 1K8AC 1WZOA 4BB7A 3V7SA 4ATOA 4LUEA 2LCCA 2ZPIB 3VS6A 5LJ5h 1JBMA 1NJIU 4D8DA 5GAN5 2FPFA 2QTVA 2KT1A 1WFWA 4AFUC 4XQ3A 2CYZB 4PJLA 1VQ9T 1YFNA 1VQ9A 3H0FA 2RPNA 5IHNA 1IXDA 1UDLA 2FZKB 4QT7A 2W0ZA 1D0YA 4R56A 1U8RA 4C8QB 3NGPA 1T3LA 3SEMA 1KFZA 4AFZC 5D6YA 1NBEB 4F7UE 2M02A 2K9GA 2KDSA 4Y92A 1RAGB 3THKA 2YUQA 2A08A 1UGVA 3VS3A 1AD5A 1QKXA 3PGGA 1OULA 5HCKA 2D8HA 2ROLA 2JT4A 1QVFA 5LL6S 5KYYB 4M78A 1M2VA 3KUFA 1WHHA 2O9SA 4J8OA 3CCEQ 2JNGA 3H8ZA 3CCUQ 1D09B 1C1AA 1M8VA 2CREA 3VS7A 1WHGA 1SHGA 5CAIA 1PD0A 1O9SA 3M9QA 1UFFA 1GCPA 1X27A 2DX1A 2QGGA 4E7ZA 3LLRA 2XK0A 2DYBA 1WJSA 3PMIA 2ZPHB 5C6SA 4NL3A 1VQ5Q 1ACMB 1PC0A 1VYVA 4L59A 3L2QA 5GANg 1ZQ1A 2DL8A 2P0QA 1SSFA 3GNGA 2RHZA 4ORZA 1VYTA 3HSBA 2DJQA 4LDUA 2DM1A 2DLPA 2KROA 2Z0WA 1PG5B 2JW4A 1XQHA 2NUZA 2AT1B 3VJPA 4E2FB 3CCMT 4O6JA 3CCMA 2X35A 3EG1A 1N6AA 1BKBA 2AKLA 4BD3A 3JB9D 5LJ5e 1WQ7A 3ZEHA 2QDYB 3OS2A 2J06A 3NTIA 2J6KA 2L2PA 2JS0A
chains in the Genus database with same CATH topology
4IIOA 2W10A 4J9GA 4J9IA 2OJ2A 5L23A 2GTOA 1X43A 4Z88A 3TSZA 2ESWA 1G83A 2PTKA 4EIKA 1X2KA 2EPDA 4OMOA 1I07A 2K6DA 2FRWA 1M3BA 1UHFA 1X2QA 2E5KA 1E7OA 3QWYA 2DMOA 1H92A 2KNBB 3EHRA 1NEBA 5FWCA 2RMOA 2MCNA 1QCFA 1CKBA 3PVLA 5IXFA 2JM9A 2DNUA 1AWXA 4AFQC 4AFSC 3EGUA 1JEGA 3UA6A 2YUNA 1T0HA 1WXBA 1SRLA 2DRMA 2LP5A 2O88A 4DEYA 2FPDA 1XOVA 1S1NA 1W70A 3M0SA 3FJ5A 5I22A 1GCQA 1K0XA 1GBRA 2KXCA 1UTIA 4RTZA 4RTVA 2ENMA 4LUDA 2RN8A 2CSIA 3EHQA 1UG1A 2CH4A 2RQTA 2C0OA 5ECAA 1K76A 2LJ0A 1M3AA 2KRSA 4ESRA 2RQWA 4HVUA 2C0IA 2CDTA 1IO6A 1TG0A 2F2XA 1GFDA 2P4RA 2DL3A 1NLOC 1YNZA 4RTXA 4OMQA 2K3BA 1FMKA 4CC2A 1AWWA 1EFNA 1AEYA 4F16A 3M0QA 2NWMA 1PRMC 2DL4A 3VS5A 1KIKA 1AZEA 3KFVA 3I9QA 1AVZC 1MV3A 4HVWA 5IH2A 3U23A 3VRYA 3VS0A 1TUCA 1M8MA 2BTTA 4J9EA 2DBMA 2CH4W 3EG2A 3QWXX 2YUPA 2EQIA 2FPEA 2K2MA 1Y0MA 5GJWB 1MV0B 2LJ1A 1E6GA 2AZVA 2JXBA 4J9HA 2EW3A 1H3HA 2LJ3A 1T0JA 2CT4A 1GBQA 4HVVA 3NMZC 1K4US 2LMJA 4JJBA 1J3TA 2CUBA 4OMPA 2L0AA 2L3PA 1MUZA 3IQLA 4KRTA 2KBTA 4D8KA 1JQQA 2RNAA 2AKKA 2JMAA 2EYWA 3I35A 3LH5A 2D1XA 1HD3A 1WDXA 2KGTA 2KRNA 4WCIA 1RI9A 2ED0A 4LNPA 2F2VA 2KE9A 5EC7A 2JM8A 3REAB 3EG0A 1I1JA 1SPKA 2FO0A 2YSQA 2BZXA 2BZYA 1E6HA 1K1ZA 1Z9QA 1QWEA 1KJWA 4CC7A 2DVJA 3ULRB 1GRIA 1RLQC 2A37A 1YN8A 3M0UA 1JXOA 2RF0A 1PHTA 5I11A 2KYBA 2YUOA 3NHNA 3JV3A 2DE0X 2GTJA 2RQRA 2GBQA 5FWBA 1B07A 2SRCA 3ZL7C 1W1FA 2HSPA 2JTEA 4F14A 3PE0A 1OPLA 3UF4A 1WA7A 1H8KA 2AZSA 2A28A 2VKNA 4RTTA 5IXBA 2LZ6B 3VS1A 1WXUA 2O9VA 1B3QA 4GBQA 4JZ4A 2JS2A 1N5ZA 4GLMA 4JPBW 1JU5C 1SSHA 1PNJA 2V1RA 1NEGA 1NG2A 3I5SA 4JZ3A 3SHWA 2D0NA 2EYYA 1ZSGA 4J9BA 4X1VA 1GL5A 2K7AA 1ZX6A 2ABLA 1PKSA 2EGAA 2KR3A 1WLPB 3PVQA 2DL5A 2KT8A 1M3CA 3NPFA 4J9DA 1LCKA 4AG1C 1NYGA 2O31A 1QLYA 3TVTA 1OV3A 1WX6A 3UATA 2J6FA 1QWFA 2KXDA 4E6RA 1HSQA 1W6XA 3EG3A 2HDAA 2H8HA 1K0SA 4CC3A 3CQTA 1I0CA 5GJVB 2YT6A 5IHKA 2FEIA 3H41A 1NYFA 1UJYA 1BB9A 2EGCA 1ZBJA 1UUEA 1M27C 3H0HA 1CKAA 2B86A 1WIEA 2ECZA 2EKHA 2EYZA 1PWTA 2L3SA 1ZUYA 5IHIA 1GCQC 2KEAA 2F2WA 2LX7A 2CT3A 2MIOA 1K9AA 5FW9A 1Z9ZA 2G6FX 4HCKA 4IIMA 1ZLMA 3R6NA 1RLPC 1ABQA 2DILA 2I0NA 2DRKA 2M51A 2OI3A 2LQNA 3UA7A 2DA9A 2RQUA 4F17A 2GGRA 2C0TA 3VS4A 2EVRA 1YWOA 1X6BA 1OPKA 1RUWA 1UJ0A 1U3OA 2ED1A 3GBQA 1KSWA 1AOJA 4RTWA 1UE9A 2M0YA 2XMFA 4OMLA 4A63B 2QDLA 2EYXA 4LUEA 3VS6A 1GFCA 3A98A 1FYNA 4D8DA 1QKWA 2FPFA 3C0CA 1JXMA 4RUGA 2JMCA 2L3QA 2HCKA 1CSKA 1OOTA 3TSWA 3I5RA 4Z8AA 2A36A 1WFWA 2KT1A 2SEMA 4AFUC 1YP5A 1BU1A 1A0NB 1NM7A 3REBB 2VVKA 3H0FA 4AG2C 2RPNA 1BBZA 4JJDA 5IHNA 1UDLA 4QT7A 1M30A 1SRMA 2W0ZA 2LCSA 1PKTA 1UECA 1ZUUA 1YCSB 3NGPA 1T3LA 3SEMA 1KFZA 1JO8A 2CSQA 2MOXA 1VYUA 2DL7A 4AFZC 3O5ZA 4OMMA 2HEQA 2EGEA 2J7IA 2K9GA 1NLPC 4RTYA 2BZ8A 2PZ1A 4Y92A 4J9FA 3THKA 1ABOA 4LN2A 1Y57A 2YUQA 2A08A 1UGVA 4R0KA 3VS3A 1AD5A 1QKXA 1AWOA 3RNJA 5HCKA 3RBBB 1WI7A 2D8HA 2ROLA 3M0PA 4Z89A 1AWJA 2J6OA 1SHFA 1WXTA 2AK5A 2JT4A 1UHCA 2LNHB 2D8JA 3VS2A 2DBKA 2V1QA 2X3WD 1BK2A 2O9SA 2J05A 1AZGB 1WYXA 2X3XD 2DF6A 4FSSA 4J9CA 1U5SA 4K11A 2CREA 3VS7A 1X69A 2GNCA 2K79A 1SHGA 2KYMA 4CC4B 1UFFA 1GCPA 1X27A 4ZNXA 2DX1A 4M4ZA 1U06A 3M0TA 2YDLA 2OAWA 2DYBA 4JJCA 1T3SA 2LQWA 1PRLC 3H0IA 1ZUKA 1VYVA 1SEMA 1G2BA 2PNIA 4OMNA 1ARKA 2DL8A 1TUDA 2CUDA 4LE9A 2RQVA 4RTUA 4DEXA 4ORZA 2HBWA 1VYTA 1OEBA 2DJQA 2DM1A 2DLPA 1X6GA 2ROTA 2O2OA 2KROA 2FG0A 2IIMA 1V1CA 2JW4A 3M0RA 2NUZA 1VA7A 2VWFA 1YWPA 3EG1A 2FRYA 2AKLA 4HXJA 2GQIA 2KRMA 2J06A 2EBPA 3VRZA 1HJDA 2J6KA 2L2PA 2JS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IIO A;  2W10 A;  4J9G A;  4J9I A;  2OJ2 A;  5L23 A;  2GTO A;  1X43 A;  4Z88 A;  3TSZ A;  2ESW A;  1G83 A;  2PTK A;  4EIK A;  1X2K A;  2EPD A;  4OMO A;  1I07 A;  2K6D A;  2FRW A;  1M3B A;  1UHF A;  1X2Q A;  2E5K A;  1E7O A;  3QWY A;  2DMO A;  1H92 A;  2KNB B;  3EHR A;  1NEB A;  5FWC A;  2RMO A;  2MCN A;  1QCF A;  1CKB A;  3PVL A;  5IXF A;  2JM9 A;  2DNU A;  1AWX A;  4AFQ C;  4AFS C;  3EGU A;  1JEG A;  3UA6 A;  2YUN A;  1T0H A;  1WXB A;  1SRL A;  2DRM A;  2LP5 A;  2O88 A;  4DEY A;  2FPD A;  1XOV A;  1S1N A;  1W70 A;  3M0S A;  3FJ5 A;  5I22 A;  1GCQ A;  1K0X A;  1GBR A;  2KXC A;  1UTI A;  4RTZ A;  4RTV A;  2ENM A;  4LUD A;  2RN8 A;  2CSI A;  3EHQ A;  1UG1 A;  2CH4 A;  2RQT A;  2C0O A;  5ECA A;  1K76 A;  2LJ0 A;  1M3A A;  2KRS A;  4ESR A;  2RQW A;  4HVU A;  2C0I A;  2CDT A;  1IO6 A;  1TG0 A;  2F2X A;  1GFD A;  2P4R A;  2DL3 A;  1NLO C;  1YNZ A;  4RTX A;  4OMQ A;  2K3B A;  1FMK A;  4CC2 A;  1AWW A;  1EFN A;  1AEY A;  4F16 A;  3M0Q A;  2NWM A;  1PRM C;  2DL4 A;  3VS5 A;  1KIK A;  1AZE A;  3KFV A;  3I9Q A;  1AVZ C;  1MV3 A;  4HVW A;  5IH2 A;  3U23 A;  3VRY A;  3VS0 A;  1TUC A;  1M8M A;  2BTT A;  4J9E A;  2DBM A;  2CH4 W;  3EG2 A;  3QWX X;  2YUP A;  2EQI A;  2FPE A;  2K2M A;  1Y0M A;  5GJW B;  1MV0 B;  2LJ1 A;  1E6G A;  2AZV A;  2JXB A;  4J9H A;  2EW3 A;  1H3H A;  2LJ3 A;  1T0J A;  2CT4 A;  1GBQ A;  4HVV A;  3NMZ C;  1K4U S;  2LMJ A;  4JJB A;  1J3T A;  2CUB A;  4OMP A;  2L0A A;  2L3P A;  1MUZ A;  3IQL A;  4KRT A;  2KBT A;  4D8K A;  1JQQ A;  2RNA A;  2AKK A;  2JMA A;  2EYW A;  3I35 A;  3LH5 A;  2D1X A;  1HD3 A;  1WDX A;  2KGT A;  2KRN A;  4WCI A;  1RI9 A;  2ED0 A;  4LNP A;  2F2V A;  2KE9 A;  5EC7 A;  2JM8 A;  3REA B;  3EG0 A;  1I1J A;  1SPK A;  2FO0 A;  2YSQ A;  2BZX A;  2BZY A;  1E6H A;  1K1Z A;  1Z9Q A;  1QWE A;  1KJW A;  4CC7 A;  2DVJ A;  3ULR B;  1GRI A;  1RLQ C;  2A37 A;  1YN8 A;  3M0U A;  1JXO A;  2RF0 A;  1PHT A;  5I11 A;  2KYB A;  2YUO A;  3NHN A;  3JV3 A;  2DE0 X;  2GTJ A;  2RQR A;  2GBQ A;  5FWB A;  1B07 A;  2SRC A;  3ZL7 C;  1W1F A;  2HSP A;  2JTE A;  4F14 A;  3PE0 A;  1OPL A;  3UF4 A;  1WA7 A;  1H8K A;  2AZS A;  2A28 A;  2VKN A;  4RTT A;  5IXB A;  2LZ6 B;  3VS1 A;  1WXU A;  2O9V A;  1B3Q A;  4GBQ A;  4JZ4 A;  2JS2 A;  1N5Z A;  4GLM A;  4JPB W;  1JU5 C;  1SSH A;  1PNJ A;  2V1R A;  1NEG A;  1NG2 A;  3I5S A;  4JZ3 A;  3SHW A;  2D0N A;  2EYY A;  1ZSG A;  4J9B A;  4X1V A;  1GL5 A;  2K7A A;  1ZX6 A;  2ABL A;  1PKS A;  2EGA A;  2KR3 A;  1WLP B;  3PVQ A;  2DL5 A;  2KT8 A;  1M3C A;  3NPF A;  4J9D A;  1LCK A;  4AG1 C;  1NYG A;  2O31 A;  1QLY A;  3TVT A;  1OV3 A;  1WX6 A;  3UAT A;  2J6F A;  1QWF A;  2KXD A;  4E6R A;  1HSQ A;  1W6X A;  3EG3 A;  2HDA A;  2H8H A;  1K0S A;  4CC3 A;  3CQT A;  1I0C A;  5GJV B;  2YT6 A;  5IHK A;  2FEI A;  3H41 A;  1NYF A;  1UJY A;  1BB9 A;  2EGC A;  1ZBJ A;  1UUE A;  1M27 C;  3H0H A;  1CKA A;  2B86 A;  1WIE A;  2ECZ A;  2EKH A;  2EYZ A;  1PWT A;  2L3S A;  1ZUY A;  5IHI A;  1GCQ C;  2KEA A;  2F2W A;  2LX7 A;  2CT3 A;  2MIO A;  1K9A A;  5FW9 A;  1Z9Z A;  2G6F X;  4HCK A;  4IIM A;  1ZLM A;  3R6N A;  1RLP C;  1ABQ A;  2DIL A;  2I0N A;  2DRK A;  2M51 A;  2OI3 A;  2LQN A;  3UA7 A;  2DA9 A;  2RQU A;  4F17 A;  2GGR A;  2C0T A;  3VS4 A;  2EVR A;  1YWO A;  1X6B A;  1OPK A;  1RUW A;  1UJ0 A;  1U3O A;  2ED1 A;  3GBQ A;  1KSW A;  1AOJ A;  4RTW A;  1UE9 A;  2M0Y A;  2XMF A;  4OML A;  4A63 B;  2QDL A;  2EYX A;  4LUE A;  3VS6 A;  1GFC A;  3A98 A;  1FYN A;  4D8D A;  1QKW A;  2FPF A;  3C0C A;  1JXM A;  4RUG A;  2JMC A;  2L3Q A;  2HCK A;  1CSK A;  1OOT A;  3TSW A;  3I5R A;  4Z8A A;  2A36 A;  1WFW A;  2KT1 A;  2SEM A;  4AFU C;  1YP5 A;  1BU1 A;  1A0N B;  1NM7 A;  3REB B;  2VVK A;  3H0F A;  4AG2 C;  2RPN A;  1BBZ A;  4JJD A;  5IHN A;  1UDL A;  4QT7 A;  1M30 A;  1SRM A;  2W0Z A;  2LCS A;  1PKT A;  1UEC A;  1ZUU A;  1YCS B;  3NGP A;  1T3L A;  3SEM A;  1KFZ A;  1JO8 A;  2CSQ A;  2MOX A;  1VYU A;  2DL7 A;  4AFZ C;  3O5Z A;  4OMM A;  2HEQ A;  2EGE A;  2J7I A;  2K9G A;  1NLP C;  4RTY A;  2BZ8 A;  2PZ1 A;  4Y92 A;  4J9F A;  3THK A;  1ABO A;  4LN2 A;  1Y57 A;  2YUQ A;  2A08 A;  1UGV A;  4R0K A;  3VS3 A;  1AD5 A;  1QKX A;  1AWO A;  3RNJ A;  5HCK A;  3RBB B;  1WI7 A;  2D8H A;  2ROL A;  3M0P A;  4Z89 A;  1AWJ A;  2J6O A;  1SHF A;  1WXT A;  2AK5 A;  2JT4 A;  1UHC A;  2LNH B;  2D8J A;  3VS2 A;  2DBK A;  2V1Q A;  2X3W D;  1BK2 A;  2O9S A;  2J05 A;  1AZG B;  1WYX A;  2X3X D;  2DF6 A;  4FSS A;  4J9C A;  1U5S A;  4K11 A;  2CRE A;  3VS7 A;  1X69 A;  2GNC A;  2K79 A;  1SHG A;  2KYM A;  4CC4 B;  1UFF A;  1GCP A;  1X27 A;  4ZNX A;  2DX1 A;  4M4Z A;  1U06 A;  3M0T A;  2YDL A;  2OAW A;  2DYB A;  4JJC A;  1T3S A;  2LQW A;  1PRL C;  3H0I A;  1ZUK A;  1VYV A;  1SEM A;  1G2B A;  2PNI A;  4OMN A;  1ARK A;  2DL8 A;  1TUD A;  2CUD A;  4LE9 A;  2RQV A;  4RTU A;  4DEX A;  4ORZ A;  2HBW A;  1VYT A;  1OEB A;  2DJQ A;  2DM1 A;  2DLP A;  1X6G A;  2ROT A;  2O2O A;  2KRO A;  2FG0 A;  2IIM A;  1V1C A;  2JW4 A;  3M0R A;  2NUZ A;  1VA7 A;  2VWF A;  1YWP A;  3EG1 A;  2FRY A;  2AKL A;  4HXJ A;  2GQI A;  2KRM A;  2J06 A;  2EBP A;  3VRZ A;  1HJD A;  2J6K A;  2L2P A;  2JS0 A; 
#chains in the Genus database with same CATH topology
 1B34 B;  1N8R R;  4FIB A;  1W4S A;  4J6Y A;  1K8A R;  1QVG S;  4EIK A;  2EPD A;  2RJF A;  1ZA2 B;  5I2S A;  1FX7 A;  1FXX A;  2WAC A;  3EHR A;  4OB2 B;  2HD0 A;  2MCN A;  4DOW A;  3CPW A;  3PVL A;  2JM9 A;  1AWX A;  2GCX A;  4PJN A;  4N4H A;  3CCR Q;  4AFQ C;  4MDX A;  3RR6 A;  4M7A E;  2YXY A;  1WXB A;  4LDY A;  2LP5 A;  1YIT T;  2YHT A;  1YIT A;  4B9X A;  8AT1 B;  1S1N A;  3OYN A;  1W70 A;  1R77 A;  4WF2 A;  5I22 A;  4HT8 A;  2E3H A;  2KXC A;  3QZ9 B;  3CC2 T;  4RTV A;  3CC2 A;  2ENM A;  4LUD A;  1O75 A;  4JDS A;  2D6F A;  1UG1 A;  2F1L A;  4M7A D;  2CH4 A;  3C95 A;  3OS1 A;  2C0O A;  1KC8 U;  3D7S B;  3FRN A;  4LD6 A;  4BY6 C;  2CZ0 B;  3CXC A;  3CC7 Q;  1LVK A;  3EGX B;  4FW2 A;  4N4I A;  2FB7 A;  3I56 T;  3I56 A;  4JRI A;  1GFD A;  1KG1 A;  1YHQ Q;  2DL3 A;  1NLO C;  5D6W A;  4J83 A;  2YRD A;  4KUI A;  4RTX A;  4C92 G;  3OYG A;  1V76 A;  2YLB A;  1FMK A;  3QSU A;  2GFU A;  4LDX A;  3CC4 Q;  2NWM A;  1PRM C;  1G3S A;  1AZE A;  1AHJ B;  4GY5 A;  4JS4 A;  3A8L B;  2HQH A;  4Y28 E;  3VRY A;  3VS0 A;  1IRX A;  2ZZD A;  1M8M A;  2BTT A;  2E70 A;  2DBM A;  5KE3 A;  3RKW A;  2YUP A;  1Q95 G;  3EGD A;  5GAN 7;  1TSF A;  3M59 A;  4OB3 B;  3CCV Q;  2AZV A;  2YWW A;  4M7A F;  4MZM A;  2EW3 A;  1H3H A;  2LJ3 A;  4F7U A;  5IT9 E;  3NMZ C;  3GOX A;  3FIF A;  4OMP A;  3PIO A;  2L3P A;  3IQL A;  2EJF A;  5CVI A;  2CZ6 B;  2DZC A;  3PNW C;  2RNA A;  4J7F A;  4A53 A;  2DIG A;  1WDX A;  3M57 A;  2DTH A;  1FMW A;  3KBG A;  2F2V A;  1W2B P;  3EG0 A;  2FO0 A;  2YSQ A;  2R5M A;  3X26 B;  1K1Z A;  1Z9Q A;  3BFM A;  1BIB A;  3FDR A;  4CC7 A;  3MEW A;  1SF9 A;  4EMK C;  3M0U A;  1JXO A;  2RF0 A;  2ZPB B;  2DEQ A;  2KYB A;  3HKS A;  4FYW B;  4ZTJ A;  2EQU A;  5HK3 A;  2DE0 X;  4II1 A;  2SRC A;  2JTE A;  2LQ8 A;  2FZG B;  3UF4 A;  4E47 A;  2A28 A;  1VQ6 T;  1VQ6 A;  1KHI A;  2A0F B;  4RTT A;  2QAS A;  2DTO A;  2L5Q A;  2O9V A;  4JZ4 A;  4BI4 A;  1KD1 C;  3JCM V;  1N5Z A;  2E6Z A;  4JJN K;  2LQK A;  1JJ2 A;  2V1R A;  5GMK i;  1NEG A;  1NG2 A;  5M9O A;  1N27 A;  4M7D E;  3QYG B;  4QVC A;  3S3N A;  3TQ7 P;  2GQV A;  1ZX6 A;  2ABL A;  1U1S A;  2QG9 B;  5AYF A;  2DL5 A;  4PJM A;  2Y90 A;  2A7Y A;  4J9D A;  3OYK A;  5J39 A;  1LCK A;  4J6X A;  1QLY A;  2QA4 T;  1OV3 A;  2QA4 A;  5FRN A;  1G3T A;  4BE2 A;  1M90 U;  2VUB A;  2K5L A;  2LT1 A;  3CPW S;  5GAO q;  2KXD A;  3HRS A;  1W6X A;  3EG3 A;  4V2S A;  2H8H A;  2DJZ A;  4N0A C;  3HRU A;  2FEI A;  3PTA A;  2DIQ A;  3H41 A;  4L6V 5;  2EGC A;  2NYS A;  4OGC A;  1R8O B;  4EMK A;  3MJX A;  1VQK T;  2ECZ A;  3EH2 A;  2EKH A;  2ZCF B;  1VQK A;  3OYH A;  1D1A A;  1Q81 U;  1RAD B;  3A8H B;  2QEX T;  4M78 B;  2QEX A;  1K9A A;  3LGL A;  5FW9 A;  2JOY A;  2CP2 A;  4O5V A;  1ABQ A;  4JUV A;  2M51 A;  1BI1 A;  5GAN e;  5I2M A;  4WTO B;  3M4G A;  2RK1 A;  1RUW A;  1B7T A;  3E19 A;  1UE9 A;  2M0Y A;  2XHC A;  3RMQ A;  1VQP Q;  1Q7Y U;  4OML A;  4KUL A;  4QVZ A;  2RA2 A;  2QDL A;  2RB6 A;  4HKE A;  4C5G A;  1GFC A;  1BI0 A;  1QCN A;  4YTL A;  3A98 A;  2MWP A;  2CP7 A;  1OU9 A;  4X34 A;  1VQO T;  1VQO A;  3EFO A;  4M75 B;  3M5A A;  2HCK A;  2CP6 A;  3I5R A;  2RI5 A;  2A36 A;  2SEM A;  1I8F A;  4NOY A;  1BU1 A;  2X9H A;  1VQ8 T;  1VQ8 A;  3REB B;  1BIA A;  2VVK A;  3SWN B;  1BBZ A;  4JJD A;  4E7L A;  2Y4Y A;  5LJ5 f;  3LW5 E;  2ATC B;  2LCS A;  1KD1 R;  1ZUU A;  2VV5 A;  1YCS B;  5DM7 R;  3QZ5 B;  1WPY A;  3A8M B;  4OMM A;  2GF7 A;  1NLP C;  3GNF B;  2JZ2 A;  4RTY A;  2PZ1 A;  1YIJ T;  5FU7 B;  1YIJ A;  4J9F A;  1VQL Q;  3FJP A;  5C0M A;  3M54 A;  1WGS A;  1H3Z A;  1Y57 A;  2OTL T;  2EKO A;  4R0K A;  2OTL A;  4PLI A;  3G7Z A;  2M1H A;  3UPU A;  4Z89 A;  1SHF A;  1R0C B;  2D8J A;  2V1Q A;  2I2L A;  4QQD A;  2X3W D;  5FU6 B;  1Y7X A;  2F5T X;  1PM3 A;  1WYX A;  3OW2 P;  2X3X D;  2DF6 A;  1M1G A;  4FSS A;  1M1K U;  4LXC A;  1TWB A;  2XDD A;  1X69 A;  1K73 C;  1D0Z A;  2GNC A;  2K79 A;  2XKO C;  2HZY A;  4C92 C;  3L2R A;  2KK4 A;  4M4Z A;  1U06 A;  3JB9 H;  2L8D A;  4QQG A;  4BUG A;  2V26 A;  4JJC A;  1TH7 A;  1T3S A;  2K3X A;  5LJ5 d;  7AT1 B;  2VXE A;  1JJ2 S;  3H0I A;  3NFC A;  4RCC A;  3V8K A;  2LX9 A;  2JUF A;  4ELY C;  1Y96 B;  2WSE E;  1TUD A;  2CUD A;  3PMT A;  4LE9 A;  2RQV A;  4DEX A;  3QKJ A;  1R0B G;  2HBW A;  2DTI A;  3PFS A;  1X6G A;  2O2O A;  4PJO C;  2IIM A;  4CI0 C;  3CCQ Q;  5CR2 A;  1IHW A;  4XK8 E;  4M7D A;  1VQM T;  1VQM A;  1YBY A;  1RI0 A;  2PQW A;  2FRY A;  2GQI A;  3J7A F;  2EJ9 A;  3VRZ A;  1MNE A;  2QXF A;  3ZFJ A;  3H9N A;  1YJ9 T;  3QDR B;  2L89 A;  1YJ9 A;  2W10 A;  1OX8 A;  3VU3 C;  4XU0 A;  3OSS C;  5L23 A;  2GTO A;  1X43 A;  4Z88 A;  5FLX E;  4E7S A;  2OTJ Q;  1G3Y A;  4JRP A;  2LVM A;  5GAO m;  1UB4 A;  2ZAE A;  1I5L A;  3EGD B;  2EQM A;  3OYF A;  2FRW A;  3H6Z A;  2MF2 A;  5CKD A;  1UHF A;  2JTM A;  2BKD N;  2E5K A;  1WHJ A;  4DQ2 A;  4FYY B;  4M7A G;  3VYH B;  2RMO A;  1EX4 A;  4MZP A;  1WJR A;  3MHX A;  1IZ6 A;  2DNU A;  5J3B A;  3CD6 Q;  2NUP A;  2X4J A;  4AFS C;  2YUN A;  4C92 A;  1T0H A;  1VQ7 Q;  2DRM A;  4PNO A;  4DEY A;  3V8J A;  5LJ3 g;  1GCQ A;  2DZ9 A;  3G4S T;  3G4S A;  3GF5 A;  1C0M A;  4OB0 B;  4RTZ A;  3J81 E;  4AT1 B;  2E41 A;  3JCM J;  2RN8 A;  2CSI A;  3EHQ A;  2D0Q B;  3G6E Q;  5ECA A;  5DY9 A;  1M3A A;  3RKY A;  4PJO A;  3FEO A;  1Q86 U;  4JLI A;  2DVE A;  3LYI A;  4FU6 A;  3JB9 I;  5GAO l;  4DOV A;  5LJ5 j;  4B6M A;  2LDM A;  4PL6 A;  1BCO A;  3DB4 A;  1VQ4 Q;  4M77 E;  4CC2 A;  1AWW A;  1EFN A;  4F16 A;  1K73 R;  4DBR A;  3EH1 A;  2JJ9 A;  3X28 B;  3GLX A;  1KIK A;  5A0L A;  1ZHI A;  3INZ A;  5KCO A;  3PT9 A;  4XU1 A;  3OBW A;  4RCB A;  3Q1J A;  1IGU A;  2KI7 A;  2CH4 W;  2MYS A;  4ZN3 A;  3SD4 A;  3CCS T;  3QWX X;  3CCS A;  4AMC A;  2DFU A;  2EQI A;  2FPE A;  3JCM g;  1Y0M A;  3MEV A;  5GJW B;  2FYK A;  2AHJ B;  2LJ1 A;  3I55 Q;  1E6G A;  3JCM c;  3FB9 A;  4OP0 A;  4J9H A;  3M56 A;  2O4X A;  2CT4 A;  1GBQ A;  2X4W A;  4X9C A;  1K4U S;  1YJW Q;  1J3T A;  2CUB A;  1WNL A;  2DD4 A;  2L0A A;  3C94 A;  1MUZ A;  4F7U F;  4LD9 K;  2KBT A;  3DLM A;  2AKK A;  2JMA A;  5CKH A;  1W2B A;  2DPP B;  3I35 A;  4A4E A;  3JCM P;  1QQJ A;  5KYX B;  2QQR A;  2IG0 A;  5EC7 A;  2JM8 A;  3REA B;  2P84 A;  3FC3 A;  2RJE A;  1I1J A;  3VV0 A;  1VIE A;  2BZX A;  2B8A A;  2BZY A;  2DXT A;  2JTF A;  3JCM b;  4M7A B;  5KYW A;  1E6H A;  2EJG A;  1KJW A;  3LWH A;  1OYX A;  2BIV A;  3HL8 A;  4ELZ C;  1LJO A;  2RI3 A;  2XU8 A;  1YN8 A;  1Y07 A;  1RAB B;  4EMG A;  2MMP A;  1NPP A;  3NHN A;  5IN1 A;  2RQR A;  3DB3 A;  3R6O A;  5FWB A;  3PIP A;  2DXC A;  4FT2 A;  3ZL7 C;  3PE0 A;  1X6O A;  1H8K A;  2AZS A;  3OYA A;  1VQN T;  1VQN A;  5IXB A;  2RH2 A;  2KMT A;  1WXU A;  1B3Q A;  3JB9 F;  2JS2 A;  4GLM A;  3LX7 A;  2CKK A;  1WJQ A;  1PNJ A;  3MEA A;  4PFO A;  3RKX A;  3OYM A;  4HT9 A;  1K9M C;  3UT1 A;  1ZSG A;  4X1V A;  2WSC E;  3OMC A;  2EGA A;  2RM4 A;  3M55 A;  3ZBD A;  3HFN A;  4C8Q C;  3HTR A;  4DBH A;  3NPF A;  1XNI A;  1BI2 A;  2RHY A;  4M77 C;  3CCL T;  4IUV A;  4JS5 A;  3CCL A;  2E12 A;  2EAY A;  2MK5 A;  2J6F A;  1PSF A;  3EG9 B;  2VXF A;  1XTD A;  5GAM g;  4J5Y A;  3TRE A;  1K0S A;  3NTK A;  2DET A;  4L5G A;  2YT6 A;  1N8R U;  2F69 A;  1YJN T;  5LJ3 h;  1YJN A;  1ZBJ A;  1M27 C;  1K8A U;  3H0H A;  1RAF B;  1OU8 A;  3BDL A;  5CIU A;  1CKA A;  3L2Z A;  3CME Q;  4N4G A;  1ZUY A;  5D6X A;  2NUT A;  1JB0 E;  4XAX B;  5GAN 8;  1Q82 C;  2BE7 D;  1D1C A;  2LX7 A;  2MPX C;  4E7J A;  1ZSZ B;  2CT3 A;  2MIO A;  1VIF A;  2G6F X;  4HCK A;  3QYH B;  4HCZ A;  3ME9 A;  4M78 G;  1ZLM A;  1UEB A;  3R6N A;  2CP0 A;  3A8O B;  3HFO A;  3CBM A;  2DIL A;  2I0N A;  2DRK A;  2DA9 A;  4XTW A;  1MMD A;  2BUD A;  2C0T A;  3BW1 A;  3VS4 A;  1YWO A;  1OPK A;  1U3O A;  2ED1 A;  2PU9 B;  1AOJ A;  1S72 Q;  4BDY A;  1NPR A;  2VYT A;  4HCB A;  4C8Q A;  5GAN h;  2FL7 A;  4A63 B;  3CCE T;  3CCE A;  3S6W A;  3CCU T;  4M77 A;  3E1S A;  3CCU A;  4FCY A;  2COZ A;  2QQB A;  4PJJ A;  1N9R A;  3C12 A;  3JCM h;  2QQ9 A;  3C0C A;  3BDU A;  2XD0 A;  2DXB A;  2JMC A;  2L3Q A;  3MP8 A;  4RG2 A;  1CSK A;  1OOT A;  4C0D B;  1DJ7 B;  4M7D B;  3CCJ Q;  1OX9 A;  5A0D A;  1YP5 A;  1A0N B;  1HYO A;  4M75 G;  1YI2 Q;  1NM7 A;  2XI9 A;  1VQ5 T;  3QO3 A;  1I4K 1;  2CZ1 B;  1VQ5 A;  2KQW A;  3MCA B;  1SRM A;  2H3E B;  4PFP A;  3CMA Q;  1QW1 A;  1UGP B;  1VYU A;  3QII A;  1W2B S;  2HEQ A;  1K9M R;  2EGE A;  2J7I A;  3M53 A;  3X24 B;  2BZ8 A;  2K2V A;  3EAE A;  1ABO A;  4LN2 A;  3BY7 A;  2RK2 A;  3RNJ A;  1NZ9 A;  3RBB B;  1WI7 A;  3VUB A;  4ANJ A;  3SB2 A;  3TU4 K;  1AT1 B;  3M0P A;  5LJ3 e;  4M7D D;  1NJI C;  1WXT A;  1EIF A;  2RO0 A;  2ZGW A;  2AK5 A;  2LNH B;  5GAN j;  3OW2 A;  4JRK A;  5CKB A;  2RHI A;  4J9C A;  4X9D A;  3L2W A;  1X75 C;  2KYM A;  4CC4 B;  4BI8 B;  5FRO A;  4ZNX A;  3TEE A;  4C92 E;  3M0T A;  2R57 A;  2OAW A;  1RAH B;  2FZC B;  3CCR T;  2LQW A;  2HL3 A;  3CPF A;  3CCR A;  1VQ9 Q;  4FYX B;  1ZUK A;  1SEM A;  1G2B A;  2PNI A;  4OMN A;  1Q82 R;  1ARK A;  1M2V B;  4KH1 B;  3V7R A;  2MAM A;  2RD1 A;  4RTU A;  3CEY A;  4D6W A;  4C92 D;  2ROT A;  2GFA A;  2HMA A;  1V1C A;  1GXI E;  1VA7 A;  2VWF A;  4PJO E;  3DLL A;  5GAN 3;  2ZPG B;  4M7D F;  4HXJ A;  2KRM A;  3JCM e;  5GAM h;  3OMG A;  2EBP A;  3J80 E;  2LNV A;  3CC7 T;  5KCH A;  2QYZ A;  3CC7 A;  5KYU A;  1G8X A;  1M1K R;  2VB6 A;  4Y91 A;  4DBQ A;  1NE8 A;  2FVU A;  4PJO D;  3T9N A;  3TSZ A;  2ESW A;  2PTK A;  1QVP A;  1X2K A;  3GPL A;  3WVD B;  4OMO A;  4HCC A;  1M3B A;  2COW A;  3RIR A;  3CC4 T;  3CC4 A;  1E7O A;  2DMO A;  3QJY A;  5FWC A;  2OAU A;  1CKB A;  3NTH A;  4N0A A;  5IXF A;  3E2U A;  3EGX A;  2RHU A;  3EGU A;  4F7U G;  3UA6 A;  1SRL A;  2KSS A;  5CQY A;  1TXQ A;  4C92 F;  1XOV A;  4IUU A;  3M0S A;  1F1B B;  1UGQ B;  2V8K A;  3LGF A;  1I5O B;  3CCV T;  1K0X A;  3E9G A;  3CCV A;  4JLG A;  3OA6 A;  4IKF A;  5GAO n;  3CCM Q;  1KQ1 A;  4KUD K;  2LJ0 A;  5KE2 A;  2RJC A;  2KRS A;  2HAX A;  1OQK A;  1KQS P;  2RQW A;  2C0I A;  4BDZ A;  4Z02 A;  1NJI R;  1V29 B;  4PJO F;  1TG0 A;  2P4R A;  4MZT A;  3VKI A;  1KK7 A;  2V8J A;  4FSX A;  1YNZ A;  4OVA A;  3P8H A;  1PCX A;  4VUB A;  4OMQ A;  4XTV A;  5GMK e;  1AEY A;  4C0G A;  3VS5 A;  4BE1 A;  1YCY A;  3JB9 G;  2HKN A;  4ZGD B;  4MMK A;  3WVE B;  4F04 B;  3V8L A;  1AVZ C;  5IH2 A;  1QCO A;  2AIR B;  3U23 A;  2LT4 A;  4KGV B;  3OSV A;  1TUC A;  4QW2 A;  4J9E A;  2E6N A;  3RES A;  1YIT Q;  3EG2 A;  4BI3 A;  5GAM e;  1N9S A;  2CZ7 B;  2XG8 D;  5CKE A;  2JXB A;  3CC2 Q;  2YRV A;  1BCM A;  3QHS A;  1M9S A;  1Q86 R;  1T0J A;  4HVV A;  4PFZ A;  3RDV A;  1M5Q 1;  3JAM E;  2DK3 A;  1IHV A;  2R5A A;  4OMF B;  3OW2 S;  4D8K A;  1JQQ A;  3MKD A;  4LDV A;  4DA4 A;  3LH5 A;  3OS5 A;  1HD3 A;  1KD1 U;  4M78 C;  1RAA B;  1MGQ A;  2ED0 A;  4LNP A;  1LNX A;  2KE9 A;  2ZPE B;  2QQA A;  2D9T A;  3I56 Q;  2LC4 A;  2X4Y A;  3X20 B;  2NLU A;  2DO3 A;  3X25 B;  2K57 A;  2PVO B;  3A1P A;  1SKU B;  2DVJ A;  1WHM A;  1RLQ C;  2QI2 A;  4F7U B;  1PHT A;  2YUO A;  8ATC B;  2HSE B;  3LWI A;  4MML A;  2M16 A;  4ZGE B;  1D0X A;  1B07 A;  5GAO p;  1W1F A;  4C0Z A;  2DKG A;  2HSP A;  1YJN Q;  2CP5 A;  2P4T A;  1Y71 A;  5CO7 A;  2E4H A;  2COY A;  4GLK A;  1WA7 A;  2P0K A;  2VKN A;  3RER A;  1BYM A;  4FW1 A;  3SDZ A;  4A4G A;  2LZ6 B;  4BY6 B;  3AT1 B;  4M75 C;  2XID A;  4JPB W;  3OYY A;  3MP6 A;  1SSH A;  3LH0 A;  2G3R A;  4QKU A;  1D3B A;  3I5S A;  4JZ3 A;  3SHW A;  3OQ5 A;  2EYY A;  3SWN C;  4M77 B;  3N5B B;  3QUI A;  4C5H A;  5GAN 2;  2KR3 A;  1WLP B;  2PVG B;  4RG8 A;  3PVQ A;  2KT8 A;  2M9U A;  1PD1 A;  1M3C A;  4C8Q E;  4IUR A;  3HP9 A;  4EMH A;  1NYG A;  2O31 A;  3A8G B;  2DXU A;  5FU7 C;  2IPO B;  2E64 A;  1VQP T;  1VQP A;  5L8R E;  2VC8 A;  2PUO B;  2E1H A;  2XDP A;  1TS9 A;  2HDA A;  1RL2 A;  2YLC A;  3UWN A;  3CQT A;  4CC3 A;  5GJV B;  2X51 A;  4C8Q D;  5IHK A;  3OB9 A;  1UJY A;  3L2V A;  2KY9 A;  3OYI A;  1BB9 A;  1QVG P;  1UUE A;  4M77 D;  4OF1 A;  5FU6 C;  1VOM A;  2B86 A;  2EYQ A;  5EG2 A;  1WIE A;  3RMS A;  2DER A;  2EYZ A;  1PWT A;  1VQ6 Q;  3OYB A;  1KC8 R;  4RMO A;  4KGZ B;  2XDB A;  5IHI A;  3OYD A;  2KEA A;  5CCA A;  2H3J A;  4MDW A;  9ATC B;  3HRT A;  1UGR B;  1Z9Z A;  3OBY A;  5LJ3 f;  2QQS A;  4IIM A;  2O01 E;  6AT1 B;  2A3L A;  4XU2 A;  2FHD A;  1VQL T;  2KVQ G;  2OI3 A;  3OYC A;  1M90 C;  4M75 A;  1VQL A;  3UA7 A;  1H64 1;  2RQU A;  4IUT A;  4EMK B;  1X6B A;  1MMA A;  1I81 A;  1HK9 A;  4E7H A;  2E65 A;  3SWN A;  1KSW A;  1ZBX A;  2KAF A;  2LRQ A;  3M4Y A;  4RTW A;  2QA4 Q;  1IGQ A;  1U1T A;  3URG A;  5DLQ E;  1G5V A;  1RAI B;  1G3W A;  2XMF A;  2DAQ A;  4C8Q F;  2EYX A;  2R58 A;  4C5E A;  1FYN A;  1Q81 C;  4M77 F;  1QKW A;  1JXM A;  4PKC C;  3G71 T;  4RUG A;  3G71 A;  3DKM A;  4XTX A;  3TSW A;  4Z8A A;  1VQK Q;  3M58 A;  5GAN f;  4M7D G;  5J26 A;  4AG2 C;  5LJ3 d;  1K73 U;  1M30 A;  1P92 A;  5KYU B;  1QP2 A;  1PKT A;  2QEX Q;  1UEC A;  3JCM f;  5GAN 6;  2DD5 A;  3MP1 A;  2MI6 A;  3L42 A;  1JO8 A;  2CSQ A;  2MOX A;  2DL7 A;  3O5Z A;  3OYE A;  2C06 A;  3CCQ T;  3CCQ A;  3MPU B;  3EFR A;  4KGX B;  1TOV A;  1D1B A;  4FT4 A;  1Q7Y C;  3MET A;  3EFO B;  3CBP A;  1AWO A;  4LDW A;  4C5I A;  1ZA1 B;  3BE3 A;  4ZN1 A;  1AWJ A;  1OI1 A;  2J6O A;  2K5F A;  1UHC A;  2QAZ A;  2RHX A;  4Q5W A;  3VS2 A;  1Y96 A;  2DBK A;  4PLL A;  1QVF P;  1BK2 A;  4CRI A;  3ER0 A;  2OTJ T;  2J05 A;  2RJD A;  1AZG B;  2OTJ A;  4IUP A;  1U5S A;  4K11 A;  3QDF A;  5DLO A;  1VQO Q;  5GAN d;  2YRC A;  3C4S A;  4E7I A;  1TTH B;  2E10 A;  2YDL A;  3S3M A;  3SFM A;  5FRM A;  3CD6 T;  4BE0 A;  1M4Z A;  3CD6 A;  1VQ8 Q;  1PRL C;  4ZGJ B;  3JCM d;  2E3I A;  1VQ7 T;  1VQ7 A;  4C0F A;  3OS0 A;  2EFI A;  3MO8 A;  2CGH A;  4EPC A;  4PJO G;  1OEB A;  5HK0 A;  3EFS A;  2FG0 A;  2MWO A;  3M0R A;  2HQX A;  1YIJ Q;  1YWP A;  3FLG A;  1M90 R;  3G6E T;  2OTL Q;  3G6E A;  2K4Y A;  1QVF S;  1C6V X;  1M1K C;  1HJD A;  1LOJ A;  1TUG B;  2HNI A;  4IIO A;  1X01 A;  4J9G A;  1KHC A;  5CKF A;  2EIF A;  4J9I A;  5CK9 A;  2OJ2 A;  3G1J A;  5CQX A;  2PUK B;  1G83 A;  2QK0 A;  5LJ3 j;  1VQ4 T;  1VQ4 A;  1I07 A;  3VYG A;  2K6D A;  4FL6 A;  2WSF E;  1X2Q A;  1Q81 R;  3KXT A;  5GAM f;  3QWY A;  1H92 A;  2KNB B;  1NEB A;  4XTU A;  1QCF A;  1MMN A;  2IVW A;  5KYY A;  1PSE A;  4M7A C;  1EZZ B;  4J6W A;  3QBY A;  3CPW P;  1JEG A;  3OYL A;  2O88 A;  2E5Q A;  2FPD A;  3QG1 A;  3UDC A;  5HKC A;  3FJ5 A;  2RI2 A;  1GBR A;  3I55 T;  1XJW B;  3I55 A;  1UTI A;  2QGF B;  4P5N A;  2QTX A;  1VQM Q;  1YJW T;  1Q7Y R;  1YJW A;  2RQT A;  1KQS A;  3QJ6 A;  2LCL A;  2VAS A;  1K76 A;  3JCM Q;  4ESR A;  4XTZ A;  4FM4 B;  4KBM B;  2L3R A;  2NUP B;  4HVU A;  2CDT A;  4ME7 A;  3WXM B;  1YJ9 Q;  1IO6 A;  4C92 B;  3CXC P;  2F2X A;  2V8I A;  5I21 A;  4XU3 A;  5GAM d;  5GAO r;  1OZ3 A;  2K3B A;  2M0O A;  4JRQ A;  1M1F A;  3M0Q A;  5GMK m;  2DL4 A;  2PVD B;  3VUZ A;  2XIC A;  3KFV A;  3AHU A;  4EDU A;  1B34 A;  1D3B B;  3I9Q A;  3JCM X;  1MV3 A;  5AT1 B;  4HVW A;  4PJO B;  5GMK h;  5KYX A;  3A5Z B;  4KT0 E;  4A4F A;  4ZTF A;  3JB9 J;  2JVV A;  4NS5 A;  5KH6 A;  5LJ5 g;  3L2U A;  2K2M A;  4M7A A;  1Q86 C;  1MV0 B;  3G4S Q;  4PK4 A;  2CP3 A;  1LPL A;  5KYN A;  4OGE A;  1VUB A;  3JSC A;  5HY6 A;  5A0G A;  2LMJ A;  4JJB A;  4KH0 B;  1RAC B;  4KRT A;  2VGN A;  3CXC S;  4E7K A;  2EYW A;  2D1X A;  1ZSZ C;  2KGT A;  2KRN A;  4WCI A;  1RI9 A;  1YHQ T;  3HPW A;  4M78 E;  1YHQ A;  1IRE B;  4A4H A;  1K9M U;  1SPK A;  1MHN A;  1OZ2 A;  5GMK l;  3GIB A;  2Y4X A;  1QWE A;  3ULR B;  1GRI A;  4R55 A;  1JRI A;  2A37 A;  2O4X B;  5I11 A;  3JV3 A;  4M78 D;  2GTJ A;  2K3Y A;  2GBQ A;  2OX7 A;  5GMK j;  2LTO A;  4A4K A;  4F14 A;  2EQJ A;  1OPL A;  1QMC A;  3GP8 A;  3V7C A;  3JCM W;  4QVD A;  3CCS Q;  3CME T;  3P8D A;  3CME A;  1WHK A;  4XTY A;  4FYV B;  1FWZ A;  3VS1 A;  4GBQ A;  5KYW B;  3EG9 A;  5D7U A;  3L1A A;  4UC4 A;  1JU5 C;  2HKQ B;  3JRZ A;  4C0D C;  4M7D C;  3F70 A;  4M75 E;  3OY9 A;  4OB1 B;  5GAM j;  3OYJ A;  1JJ2 P;  4TVR A;  2D0N A;  1M2O A;  4RKU E;  4J9B A;  1RAE B;  4C8Q G;  5GAN 4;  1GL5 A;  2K7A A;  1Q82 U;  1PKS A;  4M77 G;  3ASK A;  2ZPF B;  3MEU A;  1IB8 A;  2DEU A;  4M75 D;  4AG1 C;  1S72 T;  3TVT A;  1S72 A;  2EWN A;  1WX6 A;  2VGM A;  4HA8 A;  3UAT A;  1WHL A;  1ZSZ A;  2HQE A;  3TCJ A;  2DYI A;  1QWF A;  2K5I A;  1MND A;  4E6R A;  1HSQ A;  4M78 F;  4DBF A;  1QVG A;  1I0C A;  1KQ2 A;  1HXD A;  1NYF A;  2HBP A;  4A54 A;  2CS7 A;  3RUX A;  3O8V A;  1UGS B;  4B9W A;  3S3O A;  3G71 Q;  3CCJ T;  3CCJ A;  3HHT B;  2F5K A;  1KC8 C;  1YI2 T;  1VQN Q;  3QXE B;  1YI2 A;  2L3S A;  1GCQ C;  3QPH A;  2F2W A;  1KQS S;  3CBO A;  2BE9 B;  4QQ6 A;  3CMA T;  3CMA A;  2X4X A;  3E9F A;  5A2Q E;  1RLP C;  1SG5 A;  1TU0 B;  2LQN A;  4J7I A;  4IUQ A;  2EQK A;  1FMV A;  4F17 A;  2GGR A;  4BAC A;  4M75 F;  2EVR A;  1UJ0 A;  3P8B B;  3GBQ A;  2HL5 C;  1N8R C;  1MMG A;  3CCL Q;  1QP3 A;  2JN0 A;  2NUT B;  2P0P A;  1WQW A;  1BI3 A;  4NL2 A;  5IAY A;  1K8A C;  1WZO A;  4BB7 A;  3V7S A;  4ATO A;  4LUE A;  2LCC A;  2ZPI B;  3VS6 A;  5LJ5 h;  1JBM A;  1NJI U;  4D8D A;  5GAN 5;  2FPF A;  2QTV A;  2KT1 A;  1WFW A;  4AFU C;  4XQ3 A;  2CYZ B;  4PJL A;  1VQ9 T;  1YFN A;  1VQ9 A;  3H0F A;  2RPN A;  5IHN A;  1IXD A;  1UDL A;  2FZK B;  4QT7 A;  2W0Z A;  1D0Y A;  4R56 A;  1U8R A;  4C8Q B;  3NGP A;  1T3L A;  3SEM A;  1KFZ A;  4AFZ C;  5D6Y A;  1NBE B;  4F7U E;  2M02 A;  2K9G A;  2KDS A;  4Y92 A;  1RAG B;  3THK A;  2YUQ A;  2A08 A;  1UGV A;  3VS3 A;  1AD5 A;  1QKX A;  3PGG A;  1OUL A;  5HCK A;  2D8H A;  2ROL A;  2JT4 A;  1QVF A;  5LL6 S;  5KYY B;  4M78 A;  1M2V A;  3KUF A;  1WHH A;  2O9S A;  4J8O A;  3CCE Q;  2JNG A;  3H8Z A;  3CCU Q;  1D09 B;  1C1A A;  1M8V A;  2CRE A;  3VS7 A;  1WHG A;  1SHG A;  5CAI A;  1PD0 A;  1O9S A;  3M9Q A;  1UFF A;  1GCP A;  1X27 A;  2DX1 A;  2QGG A;  4E7Z A;  3LLR A;  2XK0 A;  2DYB A;  1WJS A;  3PMI A;  2ZPH B;  5C6S A;  4NL3 A;  1VQ5 Q;  1ACM B;  1PC0 A;  1VYV A;  4L59 A;  3L2Q A;  5GAN g;  1ZQ1 A;  2DL8 A;  2P0Q A;  1SSF A;  3GNG A;  2RHZ A;  4ORZ A;  1VYT A;  3HSB A;  2DJQ A;  4LDU A;  2DM1 A;  2DLP A;  2KRO A;  2Z0W A;  1PG5 B;  2JW4 A;  1XQH A;  2NUZ A;  2AT1 B;  3VJP A;  4E2F B;  3CCM T;  4O6J A;  3CCM A;  2X35 A;  3EG1 A;  1N6A A;  1BKB A;  2AKL A;  4BD3 A;  3JB9 D;  5LJ5 e;  1WQ7 A;  3ZEH A;  2QDY B;  3OS2 A;  2J06 A;  3NTI A;  2J6K A;  2L2P A;  2JS0 A; 
#chains in the Genus database with same CATH homology
 4IIO A;  2W10 A;  4J9G A;  4J9I A;  2OJ2 A;  5L23 A;  2GTO A;  1X43 A;  4Z88 A;  3TSZ A;  2ESW A;  1G83 A;  2PTK A;  4EIK A;  1X2K A;  2EPD A;  4OMO A;  1I07 A;  2K6D A;  2FRW A;  1M3B A;  1UHF A;  1X2Q A;  2E5K A;  1E7O A;  3QWY A;  2DMO A;  1H92 A;  2KNB B;  3EHR A;  1NEB A;  5FWC A;  2RMO A;  2MCN A;  1QCF A;  1CKB A;  3PVL A;  5IXF A;  2JM9 A;  2DNU A;  1AWX A;  4AFQ C;  4AFS C;  3EGU A;  1JEG A;  3UA6 A;  2YUN A;  1T0H A;  1WXB A;  1SRL A;  2DRM A;  2LP5 A;  2O88 A;  4DEY A;  2FPD A;  1XOV A;  1S1N A;  1W70 A;  3M0S A;  3FJ5 A;  5I22 A;  1GCQ A;  1K0X A;  1GBR A;  2KXC A;  1UTI A;  4RTZ A;  4RTV A;  2ENM A;  4LUD A;  2RN8 A;  2CSI A;  3EHQ A;  1UG1 A;  2CH4 A;  2RQT A;  2C0O A;  5ECA A;  1K76 A;  2LJ0 A;  1M3A A;  2KRS A;  4ESR A;  2RQW A;  4HVU A;  2C0I A;  2CDT A;  1IO6 A;  1TG0 A;  2F2X A;  1GFD A;  2P4R A;  2DL3 A;  1NLO C;  1YNZ A;  4RTX A;  4OMQ A;  2K3B A;  1FMK A;  4CC2 A;  1AWW A;  1EFN A;  1AEY A;  4F16 A;  3M0Q A;  2NWM A;  1PRM C;  2DL4 A;  3VS5 A;  1KIK A;  1AZE A;  3KFV A;  3I9Q A;  1AVZ C;  1MV3 A;  4HVW A;  5IH2 A;  3U23 A;  3VRY A;  3VS0 A;  1TUC A;  1M8M A;  2BTT A;  4J9E A;  2DBM A;  2CH4 W;  3EG2 A;  3QWX X;  2YUP A;  2EQI A;  2FPE A;  2K2M A;  1Y0M A;  5GJW B;  1MV0 B;  2LJ1 A;  1E6G A;  2AZV A;  2JXB A;  4J9H A;  2EW3 A;  1H3H A;  2LJ3 A;  1T0J A;  2CT4 A;  1GBQ A;  4HVV A;  3NMZ C;  1K4U S;  2LMJ A;  4JJB A;  1J3T A;  2CUB A;  4OMP A;  2L0A A;  2L3P A;  1MUZ A;  3IQL A;  4KRT A;  2KBT A;  4D8K A;  1JQQ A;  2RNA A;  2AKK A;  2JMA A;  2EYW A;  3I35 A;  3LH5 A;  2D1X A;  1HD3 A;  1WDX A;  2KGT A;  2KRN A;  4WCI A;  1RI9 A;  2ED0 A;  4LNP A;  2F2V A;  2KE9 A;  5EC7 A;  2JM8 A;  3REA B;  3EG0 A;  1I1J A;  1SPK A;  2FO0 A;  2YSQ A;  2BZX A;  2BZY A;  1E6H A;  1K1Z A;  1Z9Q A;  1QWE A;  1KJW A;  4CC7 A;  2DVJ A;  3ULR B;  1GRI A;  1RLQ C;  2A37 A;  1YN8 A;  3M0U A;  1JXO A;  2RF0 A;  1PHT A;  5I11 A;  2KYB A;  2YUO A;  3NHN A;  3JV3 A;  2DE0 X;  2GTJ A;  2RQR A;  2GBQ A;  5FWB A;  1B07 A;  2SRC A;  3ZL7 C;  1W1F A;  2HSP A;  2JTE A;  4F14 A;  3PE0 A;  1OPL A;  3UF4 A;  1WA7 A;  1H8K A;  2AZS A;  2A28 A;  2VKN A;  4RTT A;  5IXB A;  2LZ6 B;  3VS1 A;  1WXU A;  2O9V A;  1B3Q A;  4GBQ A;  4JZ4 A;  2JS2 A;  1N5Z A;  4GLM A;  4JPB W;  1JU5 C;  1SSH A;  1PNJ A;  2V1R A;  1NEG A;  1NG2 A;  3I5S A;  4JZ3 A;  3SHW A;  2D0N A;  2EYY A;  1ZSG A;  4J9B A;  4X1V A;  1GL5 A;  2K7A A;  1ZX6 A;  2ABL A;  1PKS A;  2EGA A;  2KR3 A;  1WLP B;  3PVQ A;  2DL5 A;  2KT8 A;  1M3C A;  3NPF A;  4J9D A;  1LCK A;  4AG1 C;  1NYG A;  2O31 A;  1QLY A;  3TVT A;  1OV3 A;  1WX6 A;  3UAT A;  2J6F A;  1QWF A;  2KXD A;  4E6R A;  1HSQ A;  1W6X A;  3EG3 A;  2HDA A;  2H8H A;  1K0S A;  4CC3 A;  3CQT A;  1I0C A;  5GJV B;  2YT6 A;  5IHK A;  2FEI A;  3H41 A;  1NYF A;  1UJY A;  1BB9 A;  2EGC A;  1ZBJ A;  1UUE A;  1M27 C;  3H0H A;  1CKA A;  2B86 A;  1WIE A;  2ECZ A;  2EKH A;  2EYZ A;  1PWT A;  2L3S A;  1ZUY A;  5IHI A;  1GCQ C;  2KEA A;  2F2W A;  2LX7 A;  2CT3 A;  2MIO A;  1K9A A;  5FW9 A;  1Z9Z A;  2G6F X;  4HCK A;  4IIM A;  1ZLM A;  3R6N A;  1RLP C;  1ABQ A;  2DIL A;  2I0N A;  2DRK A;  2M51 A;  2OI3 A;  2LQN A;  3UA7 A;  2DA9 A;  2RQU A;  4F17 A;  2GGR A;  2C0T A;  3VS4 A;  2EVR A;  1YWO A;  1X6B A;  1OPK A;  1RUW A;  1UJ0 A;  1U3O A;  2ED1 A;  3GBQ A;  1KSW A;  1AOJ A;  4RTW A;  1UE9 A;  2M0Y A;  2XMF A;  4OML A;  4A63 B;  2QDL A;  2EYX A;  4LUE A;  3VS6 A;  1GFC A;  3A98 A;  1FYN A;  4D8D A;  1QKW A;  2FPF A;  3C0C A;  1JXM A;  4RUG A;  2JMC A;  2L3Q A;  2HCK A;  1CSK A;  1OOT A;  3TSW A;  3I5R A;  4Z8A A;  2A36 A;  1WFW A;  2KT1 A;  2SEM A;  4AFU C;  1YP5 A;  1BU1 A;  1A0N B;  1NM7 A;  3REB B;  2VVK A;  3H0F A;  4AG2 C;  2RPN A;  1BBZ A;  4JJD A;  5IHN A;  1UDL A;  4QT7 A;  1M30 A;  1SRM A;  2W0Z A;  2LCS A;  1PKT A;  1UEC A;  1ZUU A;  1YCS B;  3NGP A;  1T3L A;  3SEM A;  1KFZ A;  1JO8 A;  2CSQ A;  2MOX A;  1VYU A;  2DL7 A;  4AFZ C;  3O5Z A;  4OMM A;  2HEQ A;  2EGE A;  2J7I A;  2K9G A;  1NLP C;  4RTY A;  2BZ8 A;  2PZ1 A;  4Y92 A;  4J9F A;  3THK A;  1ABO A;  4LN2 A;  1Y57 A;  2YUQ A;  2A08 A;  1UGV A;  4R0K A;  3VS3 A;  1AD5 A;  1QKX A;  1AWO A;  3RNJ A;  5HCK A;  3RBB B;  1WI7 A;  2D8H A;  2ROL A;  3M0P A;  4Z89 A;  1AWJ A;  2J6O A;  1SHF A;  1WXT A;  2AK5 A;  2JT4 A;  1UHC A;  2LNH B;  2D8J A;  3VS2 A;  2DBK A;  2V1Q A;  2X3W D;  1BK2 A;  2O9S A;  2J05 A;  1AZG B;  1WYX A;  2X3X D;  2DF6 A;  4FSS A;  4J9C A;  1U5S A;  4K11 A;  2CRE A;  3VS7 A;  1X69 A;  2GNC A;  2K79 A;  1SHG A;  2KYM A;  4CC4 B;  1UFF A;  1GCP A;  1X27 A;  4ZNX A;  2DX1 A;  4M4Z A;  1U06 A;  3M0T A;  2YDL A;  2OAW A;  2DYB A;  4JJC A;  1T3S A;  2LQW A;  1PRL C;  3H0I A;  1ZUK A;  1VYV A;  1SEM A;  1G2B A;  2PNI A;  4OMN A;  1ARK A;  2DL8 A;  1TUD A;  2CUD A;  4LE9 A;  2RQV A;  4RTU A;  4DEX A;  4ORZ A;  2HBW A;  1VYT A;  1OEB A;  2DJQ A;  2DM1 A;  2DLP A;  1X6G A;  2ROT A;  2O2O A;  2KRO A;  2FG0 A;  2IIM A;  1V1C A;  2JW4 A;  3M0R A;  2NUZ A;  1VA7 A;  2VWF A;  1YWP A;  3EG1 A;  2FRY A;  2AKL A;  4HXJ A;  2GQI A;  2KRM A;  2J06 A;  2EBP A;  3VRZ A;  1HJD A;  2J6K A;  2L2P A;  2JS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...