2DBMA

Solution structures of the sh3 domain of human sh3-containing grb2-like protein 2
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
73
structure length
73
Chain Sequence
GSSGSSGPCCRALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLHGHSGFFPINYVEILVALPHSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, signaling protein
molecule keywords SH3-containing GRB2-like protein 2
publication title Solution structures of the SH3 domain of human SH3-containing GRB2-like protein 2
rcsb
source organism Homo sapiens
total genus 5
structure length 73
sequence length 73
ec nomenclature ec 2.3.1.-:
pdb deposition date 2005-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dbmA00
1V1CA 4J9EA 2JS0A 2CT4A 1HSQA 3TSZA 1KSWA 2PTKA 4LUEA 1PRMC 3QWYA 1ZX6A 2D8HA 4E6RA 4AFQC 5L23A 3VS7A 1WYXA 1I0CA 4F14A 4D8KA 4J9FA 3SEMA 2A37A 3VS2A 2KNBB 2KXDA 1OPKA 2GBQA 2LZ6B 1E7OA 3SHWA 1PNJA 1UGVA 5GJWB 1KIKA 1T0HA 2B86A 2AKKA 3NGPA 2A28A 2LJ0A 3H0HA 2MCNA 2HCKA 1Y0MA 1YCSB 2RPNA 1RUWA 1KJWA 1UECA 2J6OA 4JZ4A 1YWPA 4RTVA 3UA6A 1PWTA 1W70A 2X3WD 1VYTA 2CDTA 1SSHA 2O9SA 2DBKA 4AG2C 2AZSA 5IXBA 2DYBA 2ED0A 2LQNA 2L0AA 4JJBA 2EW3A 1ZLMA 1UJ0A 1NM7A 3FJ5A 2AZVA 1T0JA 4J9DA 3RBBB 2W0ZA 3M0SA 1NYFA 1AWXA 1GBQA 1YN8A 4DEYA 1Z9ZA 2BZXA 1PHTA 1Y57A 2K6DA 2FPEA 1OPLA 5IHNA 1M3BA 1GL5A 2KRSA 1M3CA 5IHIA 1X6GA 2LJ3A 4JJDA 2L3SA 1K0XA 2RMOA 4OMPA 1LCKA 2JT4A 1T3SA 1M27C 2YT6A 2KRMA 2L2PA 1WA7A 2DE0X 2OJ2A 2DBMA 5HCKA 4RTYA 2YUOA 2MIOA 1TUCA 2DJQA 2KBTA 1MV0B 4HVVA 1AOJA 2CUDA 2V1QA 3I35A 1GCQA 4HCKA 2FRWA 2J6KA 2KR3A 1YNZA 4ZNXA 2X3XD 4HXJA 2JTEA 2RNAA 4OMNA 3VS6A 3PVQA 4DEXA 3EG0A 3IQLA 1AWOA 2VVKA 2LCSA 1ABOA 1NEBA 1AZGB 4F16A 1BU1A 1W1FA 2BTTA 1G2BA 2A36A 2KYBA 1X2QA 2K9GA 4RTTA 3EG1A 1E6GA 2G6FX 1BBZA 5IH2A 5IHKA 2JMCA 3TSWA 1JU5C 3ULRB 3VS3A 3R6NA 2CREA 2CSQA 1WLPB 1S1NA 2GGRA 2V1RA 1UUEA 1NYGA 2E5KA 1GCQC 3KFVA 3UA7A 2FRYA 2CH4W 4CC3A 1CSKA 2KGTA 3REBB 1GRIA 1VYUA 3QWXX 2RQWA 4LE9A 4WCIA 3M0UA 2DA9A 3UF4A 2NUZA 2JM8A 2HBWA 2SEMA 1XOVA 2ENMA 4X1VA 2J6FA 1KFZA 1K4US 1SEMA 2DNUA 1CKBA 2OI3A 1SHGA 1EFNA 2EBPA 4Y92A 2CH4A 1K9AA 2O9VA 1GFCA 3I5RA 2PNIA 1NLOC 4A63B 2ED1A 2EYXA 2BZ8A 1WDXA 2FG0A 3NMZC 1RLQC 2RF0A 1MV3A 4RTUA 2EGCA 2J7IA 2RQUA 4CC4B 1W6XA 3CQTA 2SRCA 1QWFA 1AVZC 2MOXA 3VS4A 1SRMA 2FO0A 2JW4A 2C0IA 1K0SA 2HEQA 1WXTA 2EYYA 1NEGA 2LX7A 2W10A 1FMKA 2C0TA 2YUQA 2D0NA 4RTZA 4FSSA 3NPFA 2DRMA 1NG2A 1PKTA 2EGEA 1OV3A 2M0YA 2L3QA 2GNCA 4Z88A 2LQWA 4LUDA 2H8HA 4JZ3A 2ECZA 1ZUKA 2DX1A 4AFZC 3O5ZA 2BZYA 3VRZA 4OMMA 3ZL7C 1K1ZA 1OOTA 2EPDA 2LJ1A 1QCFA 2O31A 2D8JA 3NHNA 1H92A 3I9QA 2PZ1A 1UDLA 2JM9A 1UG1A 1M3AA 1SHFA 2KT1A 2DL4A 2EYWA 2ESWA 4AG1C 1WIEA 2DMOA 2FPFA 4IIMA 4KRTA 2CSIA 2KROA 1AWWA 4GLMA 1VYVA 3EG2A 2NWMA 2C0OA 1QWEA 1WI7A 2I0NA 2L3PA 1PRLC 2GTOA 4J9GA 1I1JA 1ZUUA 1UE9A 1ZUYA 5FW9A 2K2MA 2KEAA 2M51A 1WX6A 4ORZA 1QKXA 3TVTA 1B3QA 2FPDA 3PE0A 2YUNA 1U06A 5I22A 2EQIA 3M0QA 1HD3A 4HVWA 2DL3A 4J9HA 1UHCA 1X69A 1ZSGA 5GJVB 2KYMA 1CKAA 1G83A 2JMAA 3EGUA 1J3TA 1OEBA 2DL8A 4Z8AA 3VS0A 4OMQA 3RNJA 2D1XA 1VA7A 4ESRA 5FWBA 2RN8A 4GBQA 1WFWA 1AEYA 4RTXA 3PVLA 1A0NB 2ABLA 2DM1A 1Z9QA 1MUZA 3VS5A 5IXFA 3M0PA 1H8KA 4LNPA 1GCPA 2F2VA 1H3HA 3M0TA 2JS2A 1PKSA 3VRYA 2YDLA 2J05A 1ABQA 2DL7A 4RTWA 2EYZA 2K3BA 1UJYA 1ZBJA 1FYNA 2GQIA 4K11A 1QLYA 1I07A 2FEIA 3EHRA 1UHFA 2AK5A 3C0CA 4AFUC 1X43A 3VS1A 2RQTA 3REAB 4JPBW 1SPKA 2GTJA 1X27A 4R0KA 3JV3A 1B07A 4CC7A 4F17A 3THKA 1WXBA 1X6BA 2VWFA 1T3LA 1NLPC 3GBQA 2DLPA 1E6HA 2RQRA 1RLPC 3U23A 5EC7A 2O2OA 4J9CA 1U5SA 1AWJA 2AKLA 2KE9A 2O88A 2LP5A 2CT3A 1JEGA 5FWCA 2DILA 3UATA 2YSQA 2LNHB 1N5ZA 4OMOA 2K79A 2J06A 3I5SA 2KT8A 2HDAA 1RI9A 5I11A 1X2KA 1HJDA 2DRKA 3A98A 2ROLA 1GBRA 4Z89A 4J9IA 4CC2A 2JXBA 2ROTA 4IIOA 1TG0A 2XMFA 1UTIA 1U3OA 2DVJA 2DL5A 3H0FA 2DF6A 3M0RA 2EKHA 1WXUA 4QT7A 4LN2A 4HVUA 4RUGA 1IO6A 2OAWA 1M8MA 2P4RA 2KRNA 3EHQA 2IIMA 1JXOA 1JXMA 1YP5A 1YWOA 2EVRA 4EIKA 1QKWA 2F2WA 2CUBA 4AFSC 1K76A 1M30A 1BB9A 2LMJA 1BK2A 2QDLA 1AZEA 5ECAA 3EG3A 2F2XA 1JQQA 1SRLA 4OMLA 4J9BA 1JO8A 3H0IA 2EGAA 1TUDA 3H41A 2VKNA 2A08A 2RQVA 4D8DA 1AD5A 2YUPA 2K7AA 2KXCA 4M4ZA 3LH5A 1GFDA 2HSPA 1UFFA 1ARKA 4JJCA
chains in the Genus database with same CATH superfamily
4J9EA 4MMLA 4C0GA 3OBYA 2CT4A 5GAMf 1HSQA 1KSWA 4C5HA 4IUUA 4DOVA 1WYXA 1YJNA 1H3ZA 3J80E 2GCXA 2Y90A 2LZ6B 1ZSZA 4C8QE 1UGVA 1JJ2S 3ASKA 2VYTA 5GMKh 1IZ6A 2HCKA 1YCSB 4JLGA 1RUWA 2MI6A 3MCAB 4JZ4A 5FU7C 2QEXQ 1W70A 2CDTA 2QA4Q 2DBKA 2DTIA 3OYKA 1W2BS 4M77A 2ED0A 1VQMA 1QVGP 3PIPA 3CCRQ 3KBGA 3CEYA 1NM7A 3FJ5A 1HXDA 3CBPA 1XNIA 3RBBB 3X20B 3RERA 3V7CA 4PLIA 4Z02A 3CC7T 1GBQA 3FDRA 1PHTA 1Y57A 2FPEA 5D7UA 1M3CA 3OMGA 1X6GA 3A1PA 4JJDA 3VUBA 1VQ5Q 2OTLA 4OMPA 3QZ9B 2RI2A 1T3SA 2HQXA 4JS5A 2KRMA 1Q86R 3HRSA 2DPPB 2DERA 3INZA 4BUGA 3CCQQ 5GANf 2YRCA 3CCSQ 5GAMh 4M77C 2DJQA 1MV0B 1M90R 1Q82R 1M2VB 1QP3A 3QYGB 2HKQB 3QUIA 2X4JA 4ATOA 3L2QA 1G8XA 4E7KA 1YNZA 1IGUA 2QEXT 3S6WA 2IG0A 4HXJA 2RNAA 4OMNA 5GAOp 3PVQA 3OSVA 3HFOA 1AWOA 3CMAT 2QQRA 2VVKA 3R6OA 2RO0A 4DBHA 2BE7D 3VUZA 2L8DA 5KYWB 1B34A 5CK9A 2BTTA 2HZYA 1KHIA 3QO3A 1MMAA 4RTTA 9ATCB 2YRDA 3E19A 2DETA 2DD4A 4OVAA 3SD4A 4JLIA 5IHKA 1WNLA 5GMKe 2QK0A 4M78A 1JU5C 1VQ5T 5LJ5j 4PKCC 3OYNA 3UA7A 3BDLA 2CH4W 2RI5A 1GRIA 1VYUA 1JBMA 3CCJA 2RHIA 4KGXB 5GAN7 2DXTA 2HBWA 2JM8A 1XOVA 2ATCB 3CCST 2J6FA 1KFZA 4FW2A 1K4US 4M75A 1NZ9A 2V8JA 3G6EA 5GANh 4FSXA 1K9AA 2LTOA 3JCMb 2PU9B 3HP9A 4BI8B 1I4K1 4KH0B 1VQLQ 1WQ7A 2EYXA 2XDBA 4RCBA 4DBFA 1O9SA 2RF0A 1WZOA 2EQMA 4M78C 1VQ7A 2DEUA 2EGCA 1PD1A 3BFMA 1XJWB 4LDYA 3SWNB 3CQTA 3PMIA 3QZ5B 4JRIA 1SRMA 2JW4A 1K0SA 1NEGA 5GAMe 3QJYA 3T9NA 1FMKA 1KC8U 3DLMA 3LLRA 1WHHA 2DEQA 3NPFA 3FIFA 2ZAEA 4M75C 2QGGA 1O75A 1PKTA 5I21A 2F69A 2EGEA 3PT9A 2M0YA 4NS5A 2EQJA 2GNCA 5LJ5d 4HKEA 1UGRB 2H8HA 4UC4A 4A54A 3CCLQ 2KY9A 4BDYA 1ZUKA 2DX1A 4A4KA 1VOMA 4OMMA 1K1ZA 3D7SB 3G4SQ 1UDLA 1M3AA 3OYJA 2DL4A 1WIEA 2R5AA 2FPFA 3OBWA 2L3RA 3EG2A 2NWMA 3CCET 1VQLT 4PJOA 1NJIU 5IAYA 3CCMA 3QJ6A 1UE9A 2E6NA 4DOWA 1ZUYA 5FW9A 4C92F 2GQVA 3Q1JA 1YIJQ 3M5AA 4HCCA 1WJSA 3A5ZB 1B7TA 2FHDA 2XI9A 3P8HA 2CS7A 4LD6A 2DL3A 3DKMA 3HTRA 4J9HA 2HSEB 5GANe 3EFOB 1X69A 1CKAA 1G83A 2JMAA 5KYXB 8AT1B 3EGUA 2E12A 4IUQA 4E7HA 2DL8A 5CKHA 4GY5A 5DM7R 3RNJA 2D1XA 4ESRA 4WF2A 2FZKB 3G71A 2RN8A 4ZTFA 4BE2A 1AEYA 4RTXA 3PVLA 3H8ZA 1Z9QA 4FT2A 3CCLT 2CZ1B 3CC4A 1KD1R 4PJOC 3QPHA 5FROA 2RHZA 2M16A 4DBRA 3GF5A 3LWIA 5KE3A 2CP2A 1GCPA 3M4GA 3CC2A 2HAXA 2NUPB 3G4ST 3VU3C 5LJ3g 3VJPA 2DL7A 3JCMd 1UJYA 1ZBJA 4DQ2A 1IXDA 2GQIA 4BDZA 1D0XA 3UT1A 2HL5C 2K5FA 2FEIA 2X4YA 1R8OB 2RB6A 1X43A 1YFNA 5CAIA 5HKCA 3QXEB 1X27A 1YIJT 4XK8E 3H6ZA 3GBQA 5CVIA 1RLPC 4J9CA 5CR2A 4GLKA 1YJWQ 4QQ6A 1VQPT 2YSQA 2M02A 2DTOA 1VQ8Q 2J06A 3JCMQ 2MYSA 2KT8A 4Q5WA 4XAXB 2LT1A 2ROLA 4ZGJB 5GAOr 2JXBA 1K8AU 4IIOA 1IHVA 2V8IA 3JCMV 2DL5A 3H0FA 2DF6A 1R77A 2EKHA 4AMCA 4M7AD 2OAWA 2E70A 3EHQA 3CD6A 1N8RC 4MZMA 3QG1A 5LJ3h 1TWBA 4BACA 1RAHB 5KE2A 2MWPA 4C5EA 4AFSC 4ZN1A 4KBMB 2LMJA 1AZEA 3JB9I 3CCUQ 3HL8A 2PVOB 3I55T 2F2XA 1EZZB 4FU6A 4AT1B 4OMLA 3OS1A 4C92D 3EGXB 2EGAA 4L5GA 2DZ9A 2MMPA 4BE0A 4D8DA 3OSSC 2OTJA 2K7AA 2KXCA 1YJWT 3LH5A 3EH1A 1VQ8T 1OQKA 3JB9J 2E41A 5CQYA 3TSZA 1Y96A 2KQWA 3QWYA 1WQWA 5L23A 3VS7A 1I0CA 2BUDA 2WSFE 4F14A 3SEMA 2KXDA 1OPKA 2GBQA 2VV5A 4XTZA 4M7DA 3RKYA 3HPWA 1YJNQ 1T0HA 2AKKA 2I2LA 2A28A 4A4HA 2LJ0A 1OULA 2K3YA 3V7RA 3H0HA 4E47A 3QSUA 1FWZA 4EMKB 3QIIA 3TQ7P 1VQ4A 2ZPIB 3LGFA 3DLLA 1YWPA 4RTVA 1PWTA 2HL3A 2X3WD 1R0BG 3EAEA 4KUIA 2AZSA 4L59A 4EMHA 5FU6C 2D6FA 4LXCA 4JJBA 1ZLMA 4A4EA 1VQMQ 3CCUT 2AZVA 4DA4A 2HKNA 3M0SA 1NYFA 2JOYA 4DEYA 3QBYA 4RMOA 1Z9ZA 2COYA 4M7AB 1M3BA 4M7DC 4XTWA 2RMOA 1LCKA 4BI3A 4BY6B 2OTLQ 4PNOA 4RG8A 5GMKi 1Q95G 2OJ2A 4JUVA 1K73C 3J7AF 5A0LA 4C92B 1MMGA 1GXIE 1S72A 3N5BB 3JB9H 1TUCA 3FLGA 4OGCA 1YJNT 1AOJA 4FL6A 3I35A 1QVFP 2D9TA 2KI7A 4HCKA 3CXCP 2FRWA 1N8RR 4FM4B 3PTAA 1QQJA 5DLOA 2GF7A 2L5QA 4M7AG 2X3XD 3E1SA 1QW1A 1I81A 2YHTA 1M4ZA 3QKJA 3VS6A 3CCVT 1D1AA 5J26A 2OAUA 3RMSA 2LCSA 1IB8A 1NEBA 3GNFB 1YJ9Q 4F16A 1KK7A 1VQMT 1W1FA 1SG5A 4F7UF 2A36A 2KMTA 4R55A 4J6WA 1I5OB 4C92G 3EG1A 1E6GA 2G6FX 1UGSB 2E3IA 5GAMg 4C0ZA 2V26A 2QTVA 3ULRB 2DAQA 2CREA 2VXEA 5LJ3j 1S1NA 4KH1B 1NYGA 2E5KA 1PD0A 1BYMA 2R58A 2OTLT 3REBB 1MHNA 2RQWA 4LE9A 2E5QA 3M9QA 2A7YA 2DA9A 5A0GA 3JRZA 2SEMA 3MKDA 4X1VA 3CCJQ 1VQ9A 3M59A 1SHGA 3RUXA 4Y92A 2CH4A 3EFOA 2RD1A 5A0DA 4KT0E 3G6EQ 1F1BB 2ZZDA 5KYUA 2CZ6B 2XICA 2EJFA 3QYHB 3GIBA 1NLOC 3CPWP 2PQWA 2AT1B 2FG0A 3NMZC 1RLQC 4J7FA 4II1A 4M77F 2J7IA 2RQUA 1M1FA 2PVDB 3V8LA 1QWFA 2FO0A 1YJ9T 3L2WA 2C0IA 1VQOT 4M7AE 1WHJA 4J8OA 2LX7A 1FMWA 1PG5B 2DYIA 2EJ9A 4OGEA 4RTZA 2XU8A 4QVCA 5GANg 3JSCA 5GAN5 4PJLA 2L3QA 2RJFA 1AHJB 5LJ3d 1K73R 3WXMB 4LUDA 3OW2S 4C92E 3KUFA 1Q7YU 5D6WA 3C95A 3HRUA 3O5ZA 3ZL7C 2DKGA 1OOTA 4O5VA 1MMDA 5GAN2 5J39A 1H92A 4PJMA 1RL2A 3C94A 4B6MA 2JM9A 2P4TA 1UG1A 1SHFA 2LRQA 4XQ3A 3MEAA 1X01A 2EYWA 2M1HA 3MEWA 3SFMA 1SF9A 4KRTA 2CSIA 2P84A 4GLMA 2QA4T 1Y71A 2ZPGB 2CP6A 5HK3A 3CCRT 2V8KA 1C6VX 2ZCFB 4J9GA 4PFZA 1NPRA 2KEAA 3OB9A 2HBPA 4B9WA 3CCMQ 1WX6A 1QKXA 1B3QA 2AHJB 2FPDA 2QQ9A 3PE0A 1U06A 2LC4A 3M57A 3M0QA 4HVWA 4OB0B 1JB0E 2WSCE 2KYMA 4YTLA 1J3TA 2DFUA 1QVFA 4Z8AA 3VS0A 3CXCA 1BI2A 1MGQA 4O6JA 1D0YA 1WFWA 2FVUA 3CCQT 3WVEB 3G71Q 2RHYA 3A8OB 5IXFA 3M0PA 1KC8C 4X34A 1KD1C 1H8KA 4JDSA 3WVDB 3CC4Q 2NUTA 4M75F 2JS2A 3VRYA 2YDLA 2RM4A 2J05A 2RHXA 3EGXA 4FYVB 1OX9A 2EYZA 3CC2Q 2WSEE 1Q81U 2QQSA 3I56A 5KYYB 4C0DC 1PSFA 1N27A 1HYOA 3HSBA 1KQSP 1QCNA 1YI2A 2R5MA 3EFRA 3CMAA 4ZN3A 4N4GA 5GMKj 2GTJA 3EGDA 3JV3A 1B07A 2DK3A 4CC7A 4M77D 3L42A 1WXBA 1IRXA 2VWFA 1T3LA 3EG9B 4C8QA 4QVDA 1NJIC 2KVQG 3M56A 4ANJA 1U5SA 1TXQA 3OQ5A 3J81E 4ZGDB 2XDDA 1VQ5A 2DILA 1I5LA 2LNHB 3E2UA 2CGHA 3JCMJ 3KXTA 2BKDN 3CPWA 1QVGA 4ELYC 2HDAA 2FZGB 3ZEHA 2P0PA 1RI9A 3A8GB 3FB9A 4M7AF 4FYXB 1HJDA 1GBRA 1WGSA 3CC4T 3CCSA 4CC2A 2NLUA 2XMFA 3NFCA 1U3OA 2DVJA 4F7UB 3A8MB 4PJNA 3CC2T 1H641 3S3OA 5FU7B 4QT7A 4LN2A 3RKWA 3CMEA 1D0ZA 4RUGA 4C8QC 3OS0A 4MZTA 5FRNA 2O4XB 4PJOF 1JJ2P 5GAMj 1JXOA 2IIMA 1XQHA 1TUGB 1MNDA 3G7ZA 1QKWA 3CD6Q 2CUBA 4HCBA 1BB9A 2LCLA 1BK2A 1EX4A 2KAFA 5ECAA 3JCMX 4PK4A 4X9CA 4XU0A 4IUTA 1N6AA 2KDSA 4FYYB 1JO8A 1W2BP 3NTHA 1TUDA 2ZGWA 2VKNA 3OS5A 1ZSZB 3GLXA 2YUPA 5HY6A 4F7UG 5DY9A 4M4ZA 4XU3A 1D1CA 3QDRB 1KC8R 2OTJQ 1PC0A 2DJZA 1D3BA 2JS0A 4M78D 4ELZC 2PTKA 3GOXA 5GAOn 4M77B 1ZX6A 2D8HA 3M54A 4AFQC 2Y4XA 4D8KA 5FLXE 3VS2A 4JJNK 1G3YA 3SHWA 1KIKA 5GJWB 2G3RA 3MP8A 3HKSA 4QW2A 4E7IA 5M9OA 3VYHB 2MCNA 1VQ6A 3SB2A 1Y0MA 2RPNA 1KJWA 1UECA 4MMKA 4CI0C 4M75D 3CCEA 3UA6A 1VQLA 1VQ4Q 3OYHA 4AG2C 1I8FA 5IXBA 1YHQA 3HFNA 1K8AC 5GAMd 5GANj 5D6XA 2L0AA 3AT1B 1YBYA 2EW3A 3PMTA 1T0JA 2RK2A 2W0ZA 1NJIR 4XU2A 4M77G 5IT9E 4N4IA 2BZXA 4LDWA 2K6DA 1M9SA 1GL5A 4HCZA 2KRSA 2JNGA 1G5VA 3A8HB 5IHIA 2WACA 1KQ2A 4BE1A 1K0XA 3ZFJA 4XTXA 3X26B 1HK9A 4V2SA 1RI0A 2NYSA 3CCLA 2YLBA 5D6YA 1KQSA 2DBMA 4RKUE 1QCOA 4X9DA 4F7UE 4RTYA 2MIOA 4QVZA 4ZTJA 1ZHIA 2K3XA 2KBTA 4HVVA 3G4SA 1B34B 3MP6A 1S72Q 2CUDA 1M1KU 1WJRA 4CRIA 1D1BA 2J6KA 2LVMA 2KR3A 2CYZB 3META 5EG2A 4M78B 2JTEA 1VQ4T 1M8VA 4OB3B 4DEXA 3EG0A 3IQLA 4ME7A 5GMKl 2EKOA 3BW1A 5GAN3 2FZCB 1ABOA 2JZ2A 1BIAA 2RJEA 1WHKA 5GANd 4PJOD 1M2VA 4VUBA 1PCXA 2K5LA 2D0QB 2KYBA 2FYKA 2E1HA 4OP0A 4M75B 1MMNA 3HRTA 5IH2A 2JMCA 3TSWA 4JRQA 3GP8A 3R6NA 1WLPB 1VQPA 4MDXA 3KFVA 5KYNA 1XTDA 2FRYA 4M77E 1OYXA 1CSKA 4CC3A 4DBQA 1JJ2A 4M78G 4NL2A 5KYWA 4WCIA 3M0UA 4IURA 1BCOA 2RI3A 4OF1A 3UF4A 2NUZA 2ENMA 2DNUA 4R56A 1CKBA 2OI3A 4M7DF 4E7JA 3DB4A 1C0MA 1S72T 2XDPA 1VQKA 2EBPA 1VQ9Q 1W4SA 5GAOl 1RAFB 1RADB 3I5RA 1W2BA 3V7SA 4LD9K 2CZ0B 1QVPA 3EFSA 3O8VA 2LNVA 1K8AR 4M75G 2B8AA 4A63B 4JRPA 5LJ5f 2JTFA 4RTUA 2QDYB 5GAN8 1VQNA 4CC4B 1W6XA 2RK1A 1BIBA 3RKXA 5GAOq 3UWNA 5I2SA 3I55A 2HEQA 3UPUA 2C0TA 2YUQA 4EMGA 4FSSA 3OA6A 1YJWA 1OV3A 3URGA 2FB7A 3PNWC 2YXYA 3SWNA 2LQWA 3OYFA 1K9MU 1RABB 2E4HA 4PJOB 4EPCA 2F5TX 1OX8A 4A53A 2VGMA 4AFZC 3VRZA 4IUPA 1VUBA 5CO7A 2EPDA 3NHNA 1TOVA 2MF2A 2QG9B 2CP5A 2KT1A 4LDXA 4AG1C 4M78E 2DMOA 4IIMA 1ZA2B 2XHCA 1SKUB 1AWWA 1YITA 1QWEA 3FJPA 2L3PA 3X24B 1ZUUA 4OB2B 2K4YA 2RH2A 2K2MA 5LJ5h 3SWNC 4PJOG 3OYMA 6AT1B 4M75E 2DXUA 5I22A 4FW1A 1UEBA 3JCMf 3S3MA 4LDUA 1Q86U 2MAMA 2F5KA 1OEBA 3NTIA 3LW5E 4OMQA 1VA7A 5FWBA 2QGFB 4BD3A 1Y07A 1RAGB 1M90U 1A0NB 1Q82U 4PFOA 2ABLA 1MUZA 4IUVA 3VS5A 5CCAA 2RJCA 1LOJA 4HT8A 4LNPA 4C5IA 4E7SA 2DIQA 2Y4YA 2F2VA 1H3HA 2EIFA 3M0TA 2IVWA 2VB6A 2QI2A 1AT1B 1LNXA 8ATCB 5KYXA 3GPLA 1ABQA 1K9MR 1FYNA 4K11A 1QLYA 1I07A 4KGZB 2QXFA 1Q7YC 4M7DD 2LX9A 1UHFA 4PL6A 3I56Q 3C0CA 1U1SA 2H3JA 4E7ZA 4AFUC 1VQ7Q 1KQ1A 2LT4A 4A4FA 3VS1A 3CCVA 3REAB 4J83A 2Z0WA 1YI2Q 2NUPA 4R0KA 3JCMW 2PVGB 4WTOB 3CMAQ 2EQUA 3OY9A 4F17A 3OMCA 2ZPHB 1NLPC 2DLPA 2H3EB 2RQRA 5CIUA 3U23A 2X4XA 2O2OA 1BI0A 3X28B 3PFSA 1AWJA 2AKLA 2LP5A 1EIFA 2CT3A 4PJOE 1JEGA 3JCMh 5FWCA 4N0AA 3UATA 1N5ZA 1ZSZC 2K79A 3I5SA 3CCJT 5I11A 5LJ5e 3C12A 2XK0A 4Z89A 4J9IA 3OYBA 2ROTA 1TG0A 3MEVA 3G6ET 1V29B 1IREB 1WXUA 4XTUA 1M8MA 2P4RA 2JTMA 3I56T 3JAME 5FU6B 3CMEQ 1TTHB 2C06A 1JXMA 1YP5A 1YWOA 4QKUA 1VQ7T 2EVRA 1ZBXA 1G3SA 1M30A 3G1JA 4N0AC 2QDLA 3CC7A 2A0FB 1YI2T 3EG3A 4BI4A 1Y96B 1RAEB 1YJ9A 1VQOA 2X51A 1Q81C 4NL3A 2K57A 3P8BB 4J9BA 4M78F 5CKFA 4M7DB 2A08A 2RQVA 4B9XA 1AD5A 1WPYA 3SDZA 1C1AA 1LJOA 2CP7A 1JRIA 3E9FA 5FRMA 1GFDA 1UB4A 1RAAB 3RIRA 2JVVA 2KK4A 4JJCA 1PSEA 1V1CA 1LPLA 4QQDA 3TEEA 3E9GA 3JB9F 2LQ8A 4LUEA 1PRMC 2CKKA 4E6RA 4E2FB 2A3LA 4FT4A 4J9FA 2A37A 3H9NA 2KNBB 4FYWB 3V8KA 1E7OA 1PNJA 5KH6A 2B86A 2QASA 1Q7YR 3NGPA 4D6WA 2QEXA 3JCMc 4KGVB 7AT1B 2GFAA 4Y28E 2MWOA 3PIOA 4EDUA 2J6OA 2QA4A 4M7DG 4KUDK 1VQ6Q 3JCMe 1VYTA 1V76A 1SSHA 3CMET 2O9SA 3CCRA 3CCMT 3CCEQ 2DYBA 2QQBA 3ER0A 2X9HA 2LQNA 1U8RA 4F04B 1UJ0A 1YHQQ 4J9DA 1M1GA 1AWXA 2QYZA 3MJXA 1YN8A 2QTXA 3MP1A 4L6V5 5A2QE 2JJ9A 3ZBDA 4C8QF 4EMKA 1N9SA 1OPLA 1YCYA 5IHNA 2LDMA 5KCHA 5KCOA 1P92A 2LJ3A 1KD1U 3RDVA 2L3SA 2JT4A 3G71T 1M27C 2YT6A 2L2PA 3NTKA 3CCQA 1WA7A 2DE0X 2E10A 5GMKm 1VIEA 1D09B 5HCKA 1UGQB 2YUOA 4OB1B 4M7AA 2VGNA 3TCJA 1QP2A 2V1QA 2E65A 3OYDA 1GCQA 2YRVA 2MPXC 1Y7XA 3OYIA 3MHXA 3OYLA 4ZGEB 2EJGA 4ZNXA 4EMKC 1SSFA 1VQ6T 2BE9B 1WHMA 5GAN4 2EQKA 3L2ZA 3M55A 1Q81R 1U1TA 4C92A 5DLQE 3M53A 2HMAA 5AT1B 3MEUA 2IPOB 1YHQT 1AZGB 4C0FA 2DZCA 1BU1A 4M7DE 1G2BA 1PM3A 2CP3A 1X2QA 2K9GA 1LVKA 1OU9A 2LCCA 3LYIA 4XTVA 5LL6S 1BBZA 5GAOm 1WHLA 1RACB 4M7AC 3VS3A 2CSQA 1R0CB 4J7IA 2GGRA 2V1RA 1UUEA 3VYGA 5CKDA 3EH2A 1GCQC 4A4GA 5KYUB 3VV0A 3M4YA 2KGTA 3S3NA 4BY6C 1VQPQ 3L2VA 1KG1A 4QQGA 3QWXX 1QVFS 3CXCS 2DVEA 2EWNA 3ME9A 1SEMA 4C92C 3RMQA 2DO3A 2RJDA 2EFIA 3OW2P 1EFNA 3JB9D 2O9VA 1GFCA 4J5YA 4IKFA 3JCMP 1VQKQ 2DTHA 4LDVA 3TU4K 2PNIA 3MPUB 4HA8A 1WJQA 3CD6T 5LJ3f 5AYFA 2ED1A 2O01E 2BZ8A 1WDXA 2E3HA 3LGLA 2EAYA 2VASA 4MZPA 5HK0A 1MV3A 2E64A 4PFPA 2SRCA 1M1KC 3OYGA 1AVZC 2MOXA 2QAZA 3VS4A 1VQNQ 1ACMB 1WXTA 2EYYA 3CPFA 2DXCA 2ZPBB 3LH0A 2W10A 1VIFA 3I55Q 2D0NA 3F70A 2HNIA 1FXXA 3TREA 2COWA 2DRMA 5L8RE 5C6SA 2OTJT 1NG2A 4E7LA 3VKIA 2P0KA 4C8QD 4KULA 4Z88A 3BDUA 4JZ3A 2LQKA 1BI1A 3QHSA 2ECZA 2JN0A 2BZYA 4N4HA 3FRNA 2DD5A 3OYCA 1FMVA 1QCFA 1TU0B 2LJ1A 3CPWS 4MDWA 5CKEA 2O31A 1QVGS 2D8JA 3CBOA 3I9QA 2HD0A 5IN1A 2PZ1A 2FL7A 2CZ7B 1NE8A 3OS2A 4C0DB 2ESWA 1VQKT 2KROA 1VYVA 5CKBA 2C0OA 1OZ2A 1N9RA 1WI7A 2I0NA 2VC8A 3A8LB 4BB7A 1PRLC 4RG2A 2GTOA 1YITQ 1RAIB 3L1AA 1I1JA 2XIDA 4JRKA 1YIJA 3CBMA 4NOYA 3RR6A 2KSSA 2M51A 5GAN6 4PLLA 4ORZA 1VQNT 3TVTA 1WHGA 2X35A 2YUNA 2EQIA 1HD3A 2NUTB 4FCYA 1UHCA 1ZSGA 2YLCA 5GJVB 1FX7A 3PGGA 2CP0A 3BY7A 3OYAA 1OZ3A 2L89A 2HQHA 4C5GA 4GBQA 4OMFB 5J3BA 4XTYA 2DM1A 2EYQA 4Y91A 1MNEA 2PUKB 4P5NA 2XD0A 3RESA 1N8RU 1DJ7B 1G3TA 4RCCA 1OI1A 2RHUA 3EGDB 1QMCA 1TH7A 1KHCA 1TS9A 1PKSA 3OYEA 2E6ZA 1M2OA 5LJ5g 3FC3A 3JB9G 4RTWA 2K3BA 3LWHA 1K9MC 4C8QB 3BE3A 3EHRA 2AIRB 5CQXA 3L2UA 2AK5A 3DB3A 1G3WA 3L2RA 4HT9A 1M1KR 3X25B 1YITT 1UGPB 2RQTA 1NBEB 2K2VA 4JPBW 1BKBA 1SPKA 3GNGA 3CCVQ 2X4WA 2COZA 4JS4A 3THKA 1OU8A 1X6BA 5KYYA 1E6HA 3V8JA 3OW2A 5EC7A 1M5Q1 2BIVA 2XG8D 2KE9A 2O88A 2VXFA 1VQ8A 4C8QG 4OMOA 2HQEA 2VUBA 1X75C 2OX7A 2R57A 3AHUA 1X2KA 5LJ3e 1X6OA 2DRKA 3A98A 4PJJA 1Q86C 2DIGA 5C0MA 2ZPEB 3EG9A 1VQ9T 1BCMA 4J6XA 2P0QA 1UTIA 4XU1A 1KQSS 1ZA1B 1IGQA 1ZQ1A 3UDCA 3M0RA 1M90C 1NPPA 2MK5A 1Q82C 4HVUA 2ZPFB 1IO6A 2RA2A 2M0OA 2KRNA 2K5IA 3M58A 2DXBA 3C4SA 3CCUA 4EIKA 2F2WA 3MO8A 1K76A 3JCMg 4TVRA 1D3BB 2GFUA 2JUFA 2XKOC 1BI3A 1JQQA 3P8DA 4F7UA 3QDFA 1SRLA 3OYYA 3CC7Q 2QQAA 3LX7A 1VQOQ 3H0IA 1K73U 3H41A 3FEOA 2F1LA 3HHTB 2YWWA 2O4XA 5I2MA 1TSFA 2PUOB 4FIBA 2M9UA 2HSPA 1IHWA 1UFFA 4J6YA 1ARKA
chains in the Genus database with same CATH topology
1V1CA 4J9EA 2JS0A 2CT4A 1HSQA 3TSZA 1KSWA 2PTKA 4LUEA 1PRMC 3QWYA 1ZX6A 2D8HA 4E6RA 4AFQC 5L23A 3VS7A 1WYXA 1I0CA 4F14A 4D8KA 4J9FA 3SEMA 2A37A 3VS2A 2KNBB 2KXDA 1OPKA 2GBQA 2LZ6B 1E7OA 3SHWA 1PNJA 1UGVA 5GJWB 1KIKA 1T0HA 2B86A 2AKKA 3NGPA 2A28A 2LJ0A 3H0HA 2MCNA 2HCKA 1Y0MA 1YCSB 2RPNA 1RUWA 1KJWA 1UECA 2J6OA 4JZ4A 1YWPA 4RTVA 3UA6A 1PWTA 1W70A 2X3WD 1VYTA 2CDTA 1SSHA 2O9SA 2DBKA 4AG2C 2AZSA 5IXBA 2DYBA 2ED0A 2LQNA 2L0AA 4JJBA 2EW3A 1ZLMA 1UJ0A 1NM7A 3FJ5A 2AZVA 1T0JA 4J9DA 3RBBB 2W0ZA 3M0SA 1NYFA 1AWXA 1GBQA 1YN8A 4DEYA 1Z9ZA 2BZXA 1PHTA 1Y57A 2K6DA 2FPEA 1OPLA 5IHNA 1M3BA 1GL5A 2KRSA 1M3CA 5IHIA 1X6GA 2LJ3A 4JJDA 2L3SA 1K0XA 2RMOA 4OMPA 1LCKA 2JT4A 1T3SA 1M27C 2YT6A 2KRMA 2L2PA 1WA7A 2DE0X 2OJ2A 2DBMA 5HCKA 4RTYA 2YUOA 2MIOA 1TUCA 2DJQA 2KBTA 1MV0B 4HVVA 1AOJA 2CUDA 2V1QA 3I35A 1GCQA 4HCKA 2FRWA 2J6KA 2KR3A 1YNZA 4ZNXA 2X3XD 4HXJA 2JTEA 2RNAA 4OMNA 3VS6A 3PVQA 4DEXA 3EG0A 3IQLA 1AWOA 2VVKA 2LCSA 1ABOA 1NEBA 1AZGB 4F16A 1BU1A 1W1FA 2BTTA 1G2BA 2A36A 2KYBA 1X2QA 2K9GA 4RTTA 3EG1A 1E6GA 2G6FX 1BBZA 5IH2A 5IHKA 2JMCA 3TSWA 1JU5C 3ULRB 3VS3A 3R6NA 2CREA 2CSQA 1WLPB 1S1NA 2GGRA 2V1RA 1UUEA 1NYGA 2E5KA 1GCQC 3KFVA 3UA7A 2FRYA 2CH4W 4CC3A 1CSKA 2KGTA 3REBB 1GRIA 1VYUA 3QWXX 2RQWA 4LE9A 4WCIA 3M0UA 2DA9A 3UF4A 2NUZA 2JM8A 2HBWA 2SEMA 1XOVA 2ENMA 4X1VA 2J6FA 1KFZA 1K4US 1SEMA 2DNUA 1CKBA 2OI3A 1SHGA 1EFNA 2EBPA 4Y92A 2CH4A 1K9AA 2O9VA 1GFCA 3I5RA 2PNIA 1NLOC 4A63B 2ED1A 2EYXA 2BZ8A 1WDXA 2FG0A 3NMZC 1RLQC 2RF0A 1MV3A 4RTUA 2EGCA 2J7IA 2RQUA 4CC4B 1W6XA 3CQTA 2SRCA 1QWFA 1AVZC 2MOXA 3VS4A 1SRMA 2FO0A 2JW4A 2C0IA 1K0SA 2HEQA 1WXTA 2EYYA 1NEGA 2LX7A 2W10A 1FMKA 2C0TA 2YUQA 2D0NA 4RTZA 4FSSA 3NPFA 2DRMA 1NG2A 1PKTA 2EGEA 1OV3A 2M0YA 2L3QA 2GNCA 4Z88A 2LQWA 4LUDA 2H8HA 4JZ3A 2ECZA 1ZUKA 2DX1A 4AFZC 3O5ZA 2BZYA 3VRZA 4OMMA 3ZL7C 1K1ZA 1OOTA 2EPDA 2LJ1A 1QCFA 2O31A 2D8JA 3NHNA 1H92A 3I9QA 2PZ1A 1UDLA 2JM9A 1UG1A 1M3AA 1SHFA 2KT1A 2DL4A 2EYWA 2ESWA 4AG1C 1WIEA 2DMOA 2FPFA 4IIMA 4KRTA 2CSIA 2KROA 1AWWA 4GLMA 1VYVA 3EG2A 2NWMA 2C0OA 1QWEA 1WI7A 2I0NA 2L3PA 1PRLC 2GTOA 4J9GA 1I1JA 1ZUUA 1UE9A 1ZUYA 5FW9A 2K2MA 2KEAA 2M51A 1WX6A 4ORZA 1QKXA 3TVTA 1B3QA 2FPDA 3PE0A 2YUNA 1U06A 5I22A 2EQIA 3M0QA 1HD3A 4HVWA 2DL3A 4J9HA 1UHCA 1X69A 1ZSGA 5GJVB 2KYMA 1CKAA 1G83A 2JMAA 3EGUA 1J3TA 1OEBA 2DL8A 4Z8AA 3VS0A 4OMQA 3RNJA 2D1XA 1VA7A 4ESRA 5FWBA 2RN8A 4GBQA 1WFWA 1AEYA 4RTXA 3PVLA 1A0NB 2ABLA 2DM1A 1Z9QA 1MUZA 3VS5A 5IXFA 3M0PA 1H8KA 4LNPA 1GCPA 2F2VA 1H3HA 3M0TA 2JS2A 1PKSA 3VRYA 2YDLA 2J05A 1ABQA 2DL7A 4RTWA 2EYZA 2K3BA 1UJYA 1ZBJA 1FYNA 2GQIA 4K11A 1QLYA 1I07A 2FEIA 3EHRA 1UHFA 2AK5A 3C0CA 4AFUC 1X43A 3VS1A 2RQTA 3REAB 4JPBW 1SPKA 2GTJA 1X27A 4R0KA 3JV3A 1B07A 4CC7A 4F17A 3THKA 1WXBA 1X6BA 2VWFA 1T3LA 1NLPC 3GBQA 2DLPA 1E6HA 2RQRA 1RLPC 3U23A 5EC7A 2O2OA 4J9CA 1U5SA 1AWJA 2AKLA 2KE9A 2O88A 2LP5A 2CT3A 1JEGA 5FWCA 2DILA 3UATA 2YSQA 2LNHB 1N5ZA 4OMOA 2K79A 2J06A 3I5SA 2KT8A 2HDAA 1RI9A 5I11A 1X2KA 1HJDA 2DRKA 3A98A 2ROLA 1GBRA 4Z89A 4J9IA 4CC2A 2JXBA 2ROTA 4IIOA 1TG0A 2XMFA 1UTIA 1U3OA 2DVJA 2DL5A 3H0FA 2DF6A 3M0RA 2EKHA 1WXUA 4QT7A 4LN2A 4HVUA 4RUGA 1IO6A 2OAWA 1M8MA 2P4RA 2KRNA 3EHQA 2IIMA 1JXOA 1JXMA 1YP5A 1YWOA 2EVRA 4EIKA 1QKWA 2F2WA 2CUBA 4AFSC 1K76A 1M30A 1BB9A 2LMJA 1BK2A 2QDLA 1AZEA 5ECAA 3EG3A 2F2XA 1JQQA 1SRLA 4OMLA 4J9BA 1JO8A 3H0IA 2EGAA 1TUDA 3H41A 2VKNA 2A08A 2RQVA 4D8DA 1AD5A 2YUPA 2K7AA 2KXCA 4M4ZA 3LH5A 1GFDA 2HSPA 1UFFA 1ARKA 4JJCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V1C A;  4J9E A;  2JS0 A;  2CT4 A;  1HSQ A;  3TSZ A;  1KSW A;  2PTK A;  4LUE A;  1PRM C;  3QWY A;  1ZX6 A;  2D8H A;  4E6R A;  4AFQ C;  5L23 A;  3VS7 A;  1WYX A;  1I0C A;  4F14 A;  4D8K A;  4J9F A;  3SEM A;  2A37 A;  3VS2 A;  2KNB B;  2KXD A;  1OPK A;  2GBQ A;  2LZ6 B;  1E7O A;  3SHW A;  1PNJ A;  1UGV A;  5GJW B;  1KIK A;  1T0H A;  2B86 A;  2AKK A;  3NGP A;  2A28 A;  2LJ0 A;  3H0H A;  2MCN A;  2HCK A;  1Y0M A;  1YCS B;  2RPN A;  1RUW A;  1KJW A;  1UEC A;  2J6O A;  4JZ4 A;  1YWP A;  4RTV A;  3UA6 A;  1PWT A;  1W70 A;  2X3W D;  1VYT A;  2CDT A;  1SSH A;  2O9S A;  2DBK A;  4AG2 C;  2AZS A;  5IXB A;  2DYB A;  2ED0 A;  2LQN A;  2L0A A;  4JJB A;  2EW3 A;  1ZLM A;  1UJ0 A;  1NM7 A;  3FJ5 A;  2AZV A;  1T0J A;  4J9D A;  3RBB B;  2W0Z A;  3M0S A;  1NYF A;  1AWX A;  1GBQ A;  1YN8 A;  4DEY A;  1Z9Z A;  2BZX A;  1PHT A;  1Y57 A;  2K6D A;  2FPE A;  1OPL A;  5IHN A;  1M3B A;  1GL5 A;  2KRS A;  1M3C A;  5IHI A;  1X6G A;  2LJ3 A;  4JJD A;  2L3S A;  1K0X A;  2RMO A;  4OMP A;  1LCK A;  2JT4 A;  1T3S A;  1M27 C;  2YT6 A;  2KRM A;  2L2P A;  1WA7 A;  2DE0 X;  2OJ2 A;  2DBM A;  5HCK A;  4RTY A;  2YUO A;  2MIO A;  1TUC A;  2DJQ A;  2KBT A;  1MV0 B;  4HVV A;  1AOJ A;  2CUD A;  2V1Q A;  3I35 A;  1GCQ A;  4HCK A;  2FRW A;  2J6K A;  2KR3 A;  1YNZ A;  4ZNX A;  2X3X D;  4HXJ A;  2JTE A;  2RNA A;  4OMN A;  3VS6 A;  3PVQ A;  4DEX A;  3EG0 A;  3IQL A;  1AWO A;  2VVK A;  2LCS A;  1ABO A;  1NEB A;  1AZG B;  4F16 A;  1BU1 A;  1W1F A;  2BTT A;  1G2B A;  2A36 A;  2KYB A;  1X2Q A;  2K9G A;  4RTT A;  3EG1 A;  1E6G A;  2G6F X;  1BBZ A;  5IH2 A;  5IHK A;  2JMC A;  3TSW A;  1JU5 C;  3ULR B;  3VS3 A;  3R6N A;  2CRE A;  2CSQ A;  1WLP B;  1S1N A;  2GGR A;  2V1R A;  1UUE A;  1NYG A;  2E5K A;  1GCQ C;  3KFV A;  3UA7 A;  2FRY A;  2CH4 W;  4CC3 A;  1CSK A;  2KGT A;  3REB B;  1GRI A;  1VYU A;  3QWX X;  2RQW A;  4LE9 A;  4WCI A;  3M0U A;  2DA9 A;  3UF4 A;  2NUZ A;  2JM8 A;  2HBW A;  2SEM A;  1XOV A;  2ENM A;  4X1V A;  2J6F A;  1KFZ A;  1K4U S;  1SEM A;  2DNU A;  1CKB A;  2OI3 A;  1SHG A;  1EFN A;  2EBP A;  4Y92 A;  2CH4 A;  1K9A A;  2O9V A;  1GFC A;  3I5R A;  2PNI A;  1NLO C;  4A63 B;  2ED1 A;  2EYX A;  2BZ8 A;  1WDX A;  2FG0 A;  3NMZ C;  1RLQ C;  2RF0 A;  1MV3 A;  4RTU A;  2EGC A;  2J7I A;  2RQU A;  4CC4 B;  1W6X A;  3CQT A;  2SRC A;  1QWF A;  1AVZ C;  2MOX A;  3VS4 A;  1SRM A;  2FO0 A;  2JW4 A;  2C0I A;  1K0S A;  2HEQ A;  1WXT A;  2EYY A;  1NEG A;  2LX7 A;  2W10 A;  1FMK A;  2C0T A;  2YUQ A;  2D0N A;  4RTZ A;  4FSS A;  3NPF A;  2DRM A;  1NG2 A;  1PKT A;  2EGE A;  1OV3 A;  2M0Y A;  2L3Q A;  2GNC A;  4Z88 A;  2LQW A;  4LUD A;  2H8H A;  4JZ3 A;  2ECZ A;  1ZUK A;  2DX1 A;  4AFZ C;  3O5Z A;  2BZY A;  3VRZ A;  4OMM A;  3ZL7 C;  1K1Z A;  1OOT A;  2EPD A;  2LJ1 A;  1QCF A;  2O31 A;  2D8J A;  3NHN A;  1H92 A;  3I9Q A;  2PZ1 A;  1UDL A;  2JM9 A;  1UG1 A;  1M3A A;  1SHF A;  2KT1 A;  2DL4 A;  2EYW A;  2ESW A;  4AG1 C;  1WIE A;  2DMO A;  2FPF A;  4IIM A;  4KRT A;  2CSI A;  2KRO A;  1AWW A;  4GLM A;  1VYV A;  3EG2 A;  2NWM A;  2C0O A;  1QWE A;  1WI7 A;  2I0N A;  2L3P A;  1PRL C;  2GTO A;  4J9G A;  1I1J A;  1ZUU A;  1UE9 A;  1ZUY A;  5FW9 A;  2K2M A;  2KEA A;  2M51 A;  1WX6 A;  4ORZ A;  1QKX A;  3TVT A;  1B3Q A;  2FPD A;  3PE0 A;  2YUN A;  1U06 A;  5I22 A;  2EQI A;  3M0Q A;  1HD3 A;  4HVW A;  2DL3 A;  4J9H A;  1UHC A;  1X69 A;  1ZSG A;  5GJV B;  2KYM A;  1CKA A;  1G83 A;  2JMA A;  3EGU A;  1J3T A;  1OEB A;  2DL8 A;  4Z8A A;  3VS0 A;  4OMQ A;  3RNJ A;  2D1X A;  1VA7 A;  4ESR A;  5FWB A;  2RN8 A;  4GBQ A;  1WFW A;  1AEY A;  4RTX A;  3PVL A;  1A0N B;  2ABL A;  2DM1 A;  1Z9Q A;  1MUZ A;  3VS5 A;  5IXF A;  3M0P A;  1H8K A;  4LNP A;  1GCP A;  2F2V A;  1H3H A;  3M0T A;  2JS2 A;  1PKS A;  3VRY A;  2YDL A;  2J05 A;  1ABQ A;  2DL7 A;  4RTW A;  2EYZ A;  2K3B A;  1UJY A;  1ZBJ A;  1FYN A;  2GQI A;  4K11 A;  1QLY A;  1I07 A;  2FEI A;  3EHR A;  1UHF A;  2AK5 A;  3C0C A;  4AFU C;  1X43 A;  3VS1 A;  2RQT A;  3REA B;  4JPB W;  1SPK A;  2GTJ A;  1X27 A;  4R0K A;  3JV3 A;  1B07 A;  4CC7 A;  4F17 A;  3THK A;  1WXB A;  1X6B A;  2VWF A;  1T3L A;  1NLP C;  3GBQ A;  2DLP A;  1E6H A;  2RQR A;  1RLP C;  3U23 A;  5EC7 A;  2O2O A;  4J9C A;  1U5S A;  1AWJ A;  2AKL A;  2KE9 A;  2O88 A;  2LP5 A;  2CT3 A;  1JEG A;  5FWC A;  2DIL A;  3UAT A;  2YSQ A;  2LNH B;  1N5Z A;  4OMO A;  2K79 A;  2J06 A;  3I5S A;  2KT8 A;  2HDA A;  1RI9 A;  5I11 A;  1X2K A;  1HJD A;  2DRK A;  3A98 A;  2ROL A;  1GBR A;  4Z89 A;  4J9I A;  4CC2 A;  2JXB A;  2ROT A;  4IIO A;  1TG0 A;  2XMF A;  1UTI A;  1U3O A;  2DVJ A;  2DL5 A;  3H0F A;  2DF6 A;  3M0R A;  2EKH A;  1WXU A;  4QT7 A;  4LN2 A;  4HVU A;  4RUG A;  1IO6 A;  2OAW A;  1M8M A;  2P4R A;  2KRN A;  3EHQ A;  2IIM A;  1JXO A;  1JXM A;  1YP5 A;  1YWO A;  2EVR A;  4EIK A;  1QKW A;  2F2W A;  2CUB A;  4AFS C;  1K76 A;  1M30 A;  1BB9 A;  2LMJ A;  1BK2 A;  2QDL A;  1AZE A;  5ECA A;  3EG3 A;  2F2X A;  1JQQ A;  1SRL A;  4OML A;  4J9B A;  1JO8 A;  3H0I A;  2EGA A;  1TUD A;  3H41 A;  2VKN A;  2A08 A;  2RQV A;  4D8D A;  1AD5 A;  2YUP A;  2K7A A;  2KXC A;  4M4Z A;  3LH5 A;  1GFD A;  2HSP A;  1UFF A;  1ARK A;  4JJC A; 
#chains in the Genus database with same CATH topology
 4J9E A;  4MML A;  4C0G A;  3OBY A;  2CT4 A;  5GAM f;  1HSQ A;  1KSW A;  4C5H A;  4IUU A;  4DOV A;  1WYX A;  1YJN A;  1H3Z A;  3J80 E;  2GCX A;  2Y90 A;  2LZ6 B;  1ZSZ A;  4C8Q E;  1UGV A;  1JJ2 S;  3ASK A;  2VYT A;  5GMK h;  1IZ6 A;  2HCK A;  1YCS B;  4JLG A;  1RUW A;  2MI6 A;  3MCA B;  4JZ4 A;  5FU7 C;  2QEX Q;  1W70 A;  2CDT A;  2QA4 Q;  2DBK A;  2DTI A;  3OYK A;  1W2B S;  4M77 A;  2ED0 A;  1VQM A;  1QVG P;  3PIP A;  3CCR Q;  3KBG A;  3CEY A;  1NM7 A;  3FJ5 A;  1HXD A;  3CBP A;  1XNI A;  3RBB B;  3X20 B;  3RER A;  3V7C A;  4PLI A;  4Z02 A;  3CC7 T;  1GBQ A;  3FDR A;  1PHT A;  1Y57 A;  2FPE A;  5D7U A;  1M3C A;  3OMG A;  1X6G A;  3A1P A;  4JJD A;  3VUB A;  1VQ5 Q;  2OTL A;  4OMP A;  3QZ9 B;  2RI2 A;  1T3S A;  2HQX A;  4JS5 A;  2KRM A;  1Q86 R;  3HRS A;  2DPP B;  2DER A;  3INZ A;  4BUG A;  3CCQ Q;  5GAN f;  2YRC A;  3CCS Q;  5GAM h;  4M77 C;  2DJQ A;  1MV0 B;  1M90 R;  1Q82 R;  1M2V B;  1QP3 A;  3QYG B;  2HKQ B;  3QUI A;  2X4J A;  4ATO A;  3L2Q A;  1G8X A;  4E7K A;  1YNZ A;  1IGU A;  2QEX T;  3S6W A;  2IG0 A;  4HXJ A;  2RNA A;  4OMN A;  5GAO p;  3PVQ A;  3OSV A;  3HFO A;  1AWO A;  3CMA T;  2QQR A;  2VVK A;  3R6O A;  2RO0 A;  4DBH A;  2BE7 D;  3VUZ A;  2L8D A;  5KYW B;  1B34 A;  5CK9 A;  2BTT A;  2HZY A;  1KHI A;  3QO3 A;  1MMA A;  4RTT A;  9ATC B;  2YRD A;  3E19 A;  2DET A;  2DD4 A;  4OVA A;  3SD4 A;  4JLI A;  5IHK A;  1WNL A;  5GMK e;  2QK0 A;  4M78 A;  1JU5 C;  1VQ5 T;  5LJ5 j;  4PKC C;  3OYN A;  3UA7 A;  3BDL A;  2CH4 W;  2RI5 A;  1GRI A;  1VYU A;  1JBM A;  3CCJ A;  2RHI A;  4KGX B;  5GAN 7;  2DXT A;  2HBW A;  2JM8 A;  1XOV A;  2ATC B;  3CCS T;  2J6F A;  1KFZ A;  4FW2 A;  1K4U S;  4M75 A;  1NZ9 A;  2V8J A;  3G6E A;  5GAN h;  4FSX A;  1K9A A;  2LTO A;  3JCM b;  2PU9 B;  3HP9 A;  4BI8 B;  1I4K 1;  4KH0 B;  1VQL Q;  1WQ7 A;  2EYX A;  2XDB A;  4RCB A;  4DBF A;  1O9S A;  2RF0 A;  1WZO A;  2EQM A;  4M78 C;  1VQ7 A;  2DEU A;  2EGC A;  1PD1 A;  3BFM A;  1XJW B;  4LDY A;  3SWN B;  3CQT A;  3PMI A;  3QZ5 B;  4JRI A;  1SRM A;  2JW4 A;  1K0S A;  1NEG A;  5GAM e;  3QJY A;  3T9N A;  1FMK A;  1KC8 U;  3DLM A;  3LLR A;  1WHH A;  2DEQ A;  3NPF A;  3FIF A;  2ZAE A;  4M75 C;  2QGG A;  1O75 A;  1PKT A;  5I21 A;  2F69 A;  2EGE A;  3PT9 A;  2M0Y A;  4NS5 A;  2EQJ A;  2GNC A;  5LJ5 d;  4HKE A;  1UGR B;  2H8H A;  4UC4 A;  4A54 A;  3CCL Q;  2KY9 A;  4BDY A;  1ZUK A;  2DX1 A;  4A4K A;  1VOM A;  4OMM A;  1K1Z A;  3D7S B;  3G4S Q;  1UDL A;  1M3A A;  3OYJ A;  2DL4 A;  1WIE A;  2R5A A;  2FPF A;  3OBW A;  2L3R A;  3EG2 A;  2NWM A;  3CCE T;  1VQL T;  4PJO A;  1NJI U;  5IAY A;  3CCM A;  3QJ6 A;  1UE9 A;  2E6N A;  4DOW A;  1ZUY A;  5FW9 A;  4C92 F;  2GQV A;  3Q1J A;  1YIJ Q;  3M5A A;  4HCC A;  1WJS A;  3A5Z B;  1B7T A;  2FHD A;  2XI9 A;  3P8H A;  2CS7 A;  4LD6 A;  2DL3 A;  3DKM A;  3HTR A;  4J9H A;  2HSE B;  5GAN e;  3EFO B;  1X69 A;  1CKA A;  1G83 A;  2JMA A;  5KYX B;  8AT1 B;  3EGU A;  2E12 A;  4IUQ A;  4E7H A;  2DL8 A;  5CKH A;  4GY5 A;  5DM7 R;  3RNJ A;  2D1X A;  4ESR A;  4WF2 A;  2FZK B;  3G71 A;  2RN8 A;  4ZTF A;  4BE2 A;  1AEY A;  4RTX A;  3PVL A;  3H8Z A;  1Z9Q A;  4FT2 A;  3CCL T;  2CZ1 B;  3CC4 A;  1KD1 R;  4PJO C;  3QPH A;  5FRO A;  2RHZ A;  2M16 A;  4DBR A;  3GF5 A;  3LWI A;  5KE3 A;  2CP2 A;  1GCP A;  3M4G A;  3CC2 A;  2HAX A;  2NUP B;  3G4S T;  3VU3 C;  5LJ3 g;  3VJP A;  2DL7 A;  3JCM d;  1UJY A;  1ZBJ A;  4DQ2 A;  1IXD A;  2GQI A;  4BDZ A;  1D0X A;  3UT1 A;  2HL5 C;  2K5F A;  2FEI A;  2X4Y A;  1R8O B;  2RB6 A;  1X43 A;  1YFN A;  5CAI A;  5HKC A;  3QXE B;  1X27 A;  1YIJ T;  4XK8 E;  3H6Z A;  3GBQ A;  5CVI A;  1RLP C;  4J9C A;  5CR2 A;  4GLK A;  1YJW Q;  4QQ6 A;  1VQP T;  2YSQ A;  2M02 A;  2DTO A;  1VQ8 Q;  2J06 A;  3JCM Q;  2MYS A;  2KT8 A;  4Q5W A;  4XAX B;  2LT1 A;  2ROL A;  4ZGJ B;  5GAO r;  2JXB A;  1K8A U;  4IIO A;  1IHV A;  2V8I A;  3JCM V;  2DL5 A;  3H0F A;  2DF6 A;  1R77 A;  2EKH A;  4AMC A;  4M7A D;  2OAW A;  2E70 A;  3EHQ A;  3CD6 A;  1N8R C;  4MZM A;  3QG1 A;  5LJ3 h;  1TWB A;  4BAC A;  1RAH B;  5KE2 A;  2MWP A;  4C5E A;  4AFS C;  4ZN1 A;  4KBM B;  2LMJ A;  1AZE A;  3JB9 I;  3CCU Q;  3HL8 A;  2PVO B;  3I55 T;  2F2X A;  1EZZ B;  4FU6 A;  4AT1 B;  4OML A;  3OS1 A;  4C92 D;  3EGX B;  2EGA A;  4L5G A;  2DZ9 A;  2MMP A;  4BE0 A;  4D8D A;  3OSS C;  2OTJ A;  2K7A A;  2KXC A;  1YJW T;  3LH5 A;  3EH1 A;  1VQ8 T;  1OQK A;  3JB9 J;  2E41 A;  5CQY A;  3TSZ A;  1Y96 A;  2KQW A;  3QWY A;  1WQW A;  5L23 A;  3VS7 A;  1I0C A;  2BUD A;  2WSF E;  4F14 A;  3SEM A;  2KXD A;  1OPK A;  2GBQ A;  2VV5 A;  4XTZ A;  4M7D A;  3RKY A;  3HPW A;  1YJN Q;  1T0H A;  2AKK A;  2I2L A;  2A28 A;  4A4H A;  2LJ0 A;  1OUL A;  2K3Y A;  3V7R A;  3H0H A;  4E47 A;  3QSU A;  1FWZ A;  4EMK B;  3QII A;  3TQ7 P;  1VQ4 A;  2ZPI B;  3LGF A;  3DLL A;  1YWP A;  4RTV A;  1PWT A;  2HL3 A;  2X3W D;  1R0B G;  3EAE A;  4KUI A;  2AZS A;  4L59 A;  4EMH A;  5FU6 C;  2D6F A;  4LXC A;  4JJB A;  1ZLM A;  4A4E A;  1VQM Q;  3CCU T;  2AZV A;  4DA4 A;  2HKN A;  3M0S A;  1NYF A;  2JOY A;  4DEY A;  3QBY A;  4RMO A;  1Z9Z A;  2COY A;  4M7A B;  1M3B A;  4M7D C;  4XTW A;  2RMO A;  1LCK A;  4BI3 A;  4BY6 B;  2OTL Q;  4PNO A;  4RG8 A;  5GMK i;  1Q95 G;  2OJ2 A;  4JUV A;  1K73 C;  3J7A F;  5A0L A;  4C92 B;  1MMG A;  1GXI E;  1S72 A;  3N5B B;  3JB9 H;  1TUC A;  3FLG A;  4OGC A;  1YJN T;  1AOJ A;  4FL6 A;  3I35 A;  1QVF P;  2D9T A;  2KI7 A;  4HCK A;  3CXC P;  2FRW A;  1N8R R;  4FM4 B;  3PTA A;  1QQJ A;  5DLO A;  2GF7 A;  2L5Q A;  4M7A G;  2X3X D;  3E1S A;  1QW1 A;  1I81 A;  2YHT A;  1M4Z A;  3QKJ A;  3VS6 A;  3CCV T;  1D1A A;  5J26 A;  2OAU A;  3RMS A;  2LCS A;  1IB8 A;  1NEB A;  3GNF B;  1YJ9 Q;  4F16 A;  1KK7 A;  1VQM T;  1W1F A;  1SG5 A;  4F7U F;  2A36 A;  2KMT A;  4R55 A;  4J6W A;  1I5O B;  4C92 G;  3EG1 A;  1E6G A;  2G6F X;  1UGS B;  2E3I A;  5GAM g;  4C0Z A;  2V26 A;  2QTV A;  3ULR B;  2DAQ A;  2CRE A;  2VXE A;  5LJ3 j;  1S1N A;  4KH1 B;  1NYG A;  2E5K A;  1PD0 A;  1BYM A;  2R58 A;  2OTL T;  3REB B;  1MHN A;  2RQW A;  4LE9 A;  2E5Q A;  3M9Q A;  2A7Y A;  2DA9 A;  5A0G A;  3JRZ A;  2SEM A;  3MKD A;  4X1V A;  3CCJ Q;  1VQ9 A;  3M59 A;  1SHG A;  3RUX A;  4Y92 A;  2CH4 A;  3EFO A;  2RD1 A;  5A0D A;  4KT0 E;  3G6E Q;  1F1B B;  2ZZD A;  5KYU A;  2CZ6 B;  2XIC A;  2EJF A;  3QYH B;  3GIB A;  1NLO C;  3CPW P;  2PQW A;  2AT1 B;  2FG0 A;  3NMZ C;  1RLQ C;  4J7F A;  4II1 A;  4M77 F;  2J7I A;  2RQU A;  1M1F A;  2PVD B;  3V8L A;  1QWF A;  2FO0 A;  1YJ9 T;  3L2W A;  2C0I A;  1VQO T;  4M7A E;  1WHJ A;  4J8O A;  2LX7 A;  1FMW A;  1PG5 B;  2DYI A;  2EJ9 A;  4OGE A;  4RTZ A;  2XU8 A;  4QVC A;  5GAN g;  3JSC A;  5GAN 5;  4PJL A;  2L3Q A;  2RJF A;  1AHJ B;  5LJ3 d;  1K73 R;  3WXM B;  4LUD A;  3OW2 S;  4C92 E;  3KUF A;  1Q7Y U;  5D6W A;  3C95 A;  3HRU A;  3O5Z A;  3ZL7 C;  2DKG A;  1OOT A;  4O5V A;  1MMD A;  5GAN 2;  5J39 A;  1H92 A;  4PJM A;  1RL2 A;  3C94 A;  4B6M A;  2JM9 A;  2P4T A;  1UG1 A;  1SHF A;  2LRQ A;  4XQ3 A;  3MEA A;  1X01 A;  2EYW A;  2M1H A;  3MEW A;  3SFM A;  1SF9 A;  4KRT A;  2CSI A;  2P84 A;  4GLM A;  2QA4 T;  1Y71 A;  2ZPG B;  2CP6 A;  5HK3 A;  3CCR T;  2V8K A;  1C6V X;  2ZCF B;  4J9G A;  4PFZ A;  1NPR A;  2KEA A;  3OB9 A;  2HBP A;  4B9W A;  3CCM Q;  1WX6 A;  1QKX A;  1B3Q A;  2AHJ B;  2FPD A;  2QQ9 A;  3PE0 A;  1U06 A;  2LC4 A;  3M57 A;  3M0Q A;  4HVW A;  4OB0 B;  1JB0 E;  2WSC E;  2KYM A;  4YTL A;  1J3T A;  2DFU A;  1QVF A;  4Z8A A;  3VS0 A;  3CXC A;  1BI2 A;  1MGQ A;  4O6J A;  1D0Y A;  1WFW A;  2FVU A;  3CCQ T;  3WVE B;  3G71 Q;  2RHY A;  3A8O B;  5IXF A;  3M0P A;  1KC8 C;  4X34 A;  1KD1 C;  1H8K A;  4JDS A;  3WVD B;  3CC4 Q;  2NUT A;  4M75 F;  2JS2 A;  3VRY A;  2YDL A;  2RM4 A;  2J05 A;  2RHX A;  3EGX A;  4FYV B;  1OX9 A;  2EYZ A;  3CC2 Q;  2WSE E;  1Q81 U;  2QQS A;  3I56 A;  5KYY B;  4C0D C;  1PSF A;  1N27 A;  1HYO A;  3HSB A;  1KQS P;  1QCN A;  1YI2 A;  2R5M A;  3EFR A;  3CMA A;  4ZN3 A;  4N4G A;  5GMK j;  2GTJ A;  3EGD A;  3JV3 A;  1B07 A;  2DK3 A;  4CC7 A;  4M77 D;  3L42 A;  1WXB A;  1IRX A;  2VWF A;  1T3L A;  3EG9 B;  4C8Q A;  4QVD A;  1NJI C;  2KVQ G;  3M56 A;  4ANJ A;  1U5S A;  1TXQ A;  3OQ5 A;  3J81 E;  4ZGD B;  2XDD A;  1VQ5 A;  2DIL A;  1I5L A;  2LNH B;  3E2U A;  2CGH A;  3JCM J;  3KXT A;  2BKD N;  3CPW A;  1QVG A;  4ELY C;  2HDA A;  2FZG B;  3ZEH A;  2P0P A;  1RI9 A;  3A8G B;  3FB9 A;  4M7A F;  4FYX B;  1HJD A;  1GBR A;  1WGS A;  3CC4 T;  3CCS A;  4CC2 A;  2NLU A;  2XMF A;  3NFC A;  1U3O A;  2DVJ A;  4F7U B;  3A8M B;  4PJN A;  3CC2 T;  1H64 1;  3S3O A;  5FU7 B;  4QT7 A;  4LN2 A;  3RKW A;  3CME A;  1D0Z A;  4RUG A;  4C8Q C;  3OS0 A;  4MZT A;  5FRN A;  2O4X B;  4PJO F;  1JJ2 P;  5GAM j;  1JXO A;  2IIM A;  1XQH A;  1TUG B;  1MND A;  3G7Z A;  1QKW A;  3CD6 Q;  2CUB A;  4HCB A;  1BB9 A;  2LCL A;  1BK2 A;  1EX4 A;  2KAF A;  5ECA A;  3JCM X;  4PK4 A;  4X9C A;  4XU0 A;  4IUT A;  1N6A A;  2KDS A;  4FYY B;  1JO8 A;  1W2B P;  3NTH A;  1TUD A;  2ZGW A;  2VKN A;  3OS5 A;  1ZSZ B;  3GLX A;  2YUP A;  5HY6 A;  4F7U G;  5DY9 A;  4M4Z A;  4XU3 A;  1D1C A;  3QDR B;  1KC8 R;  2OTJ Q;  1PC0 A;  2DJZ A;  1D3B A;  2JS0 A;  4M78 D;  4ELZ C;  2PTK A;  3GOX A;  5GAO n;  4M77 B;  1ZX6 A;  2D8H A;  3M54 A;  4AFQ C;  2Y4X A;  4D8K A;  5FLX E;  3VS2 A;  4JJN K;  1G3Y A;  3SHW A;  1KIK A;  5GJW B;  2G3R A;  3MP8 A;  3HKS A;  4QW2 A;  4E7I A;  5M9O A;  3VYH B;  2MCN A;  1VQ6 A;  3SB2 A;  1Y0M A;  2RPN A;  1KJW A;  1UEC A;  4MMK A;  4CI0 C;  4M75 D;  3CCE A;  3UA6 A;  1VQL A;  1VQ4 Q;  3OYH A;  4AG2 C;  1I8F A;  5IXB A;  1YHQ A;  3HFN A;  1K8A C;  5GAM d;  5GAN j;  5D6X A;  2L0A A;  3AT1 B;  1YBY A;  2EW3 A;  3PMT A;  1T0J A;  2RK2 A;  2W0Z A;  1NJI R;  4XU2 A;  4M77 G;  5IT9 E;  4N4I A;  2BZX A;  4LDW A;  2K6D A;  1M9S A;  1GL5 A;  4HCZ A;  2KRS A;  2JNG A;  1G5V A;  3A8H B;  5IHI A;  2WAC A;  1KQ2 A;  4BE1 A;  1K0X A;  3ZFJ A;  4XTX A;  3X26 B;  1HK9 A;  4V2S A;  1RI0 A;  2NYS A;  3CCL A;  2YLB A;  5D6Y A;  1KQS A;  2DBM A;  4RKU E;  1QCO A;  4X9D A;  4F7U E;  4RTY A;  2MIO A;  4QVZ A;  4ZTJ A;  1ZHI A;  2K3X A;  2KBT A;  4HVV A;  3G4S A;  1B34 B;  3MP6 A;  1S72 Q;  2CUD A;  1M1K U;  1WJR A;  4CRI A;  1D1B A;  2J6K A;  2LVM A;  2KR3 A;  2CYZ B;  3MET A;  5EG2 A;  4M78 B;  2JTE A;  1VQ4 T;  1M8V A;  4OB3 B;  4DEX A;  3EG0 A;  3IQL A;  4ME7 A;  5GMK l;  2EKO A;  3BW1 A;  5GAN 3;  2FZC B;  1ABO A;  2JZ2 A;  1BIA A;  2RJE A;  1WHK A;  5GAN d;  4PJO D;  1M2V A;  4VUB A;  1PCX A;  2K5L A;  2D0Q B;  2KYB A;  2FYK A;  2E1H A;  4OP0 A;  4M75 B;  1MMN A;  3HRT A;  5IH2 A;  2JMC A;  3TSW A;  4JRQ A;  3GP8 A;  3R6N A;  1WLP B;  1VQP A;  4MDX A;  3KFV A;  5KYN A;  1XTD A;  2FRY A;  4M77 E;  1OYX A;  1CSK A;  4CC3 A;  4DBQ A;  1JJ2 A;  4M78 G;  4NL2 A;  5KYW A;  4WCI A;  3M0U A;  4IUR A;  1BCO A;  2RI3 A;  4OF1 A;  3UF4 A;  2NUZ A;  2ENM A;  2DNU A;  4R56 A;  1CKB A;  2OI3 A;  4M7D F;  4E7J A;  3DB4 A;  1C0M A;  1S72 T;  2XDP A;  1VQK A;  2EBP A;  1VQ9 Q;  1W4S A;  5GAO l;  1RAF B;  1RAD B;  3I5R A;  1W2B A;  3V7S A;  4LD9 K;  2CZ0 B;  1QVP A;  3EFS A;  3O8V A;  2LNV A;  1K8A R;  4M75 G;  2B8A A;  4A63 B;  4JRP A;  5LJ5 f;  2JTF A;  4RTU A;  2QDY B;  5GAN 8;  1VQN A;  4CC4 B;  1W6X A;  2RK1 A;  1BIB A;  3RKX A;  5GAO q;  3UWN A;  5I2S A;  3I55 A;  2HEQ A;  3UPU A;  2C0T A;  2YUQ A;  4EMG A;  4FSS A;  3OA6 A;  1YJW A;  1OV3 A;  3URG A;  2FB7 A;  3PNW C;  2YXY A;  3SWN A;  2LQW A;  3OYF A;  1K9M U;  1RAB B;  2E4H A;  4PJO B;  4EPC A;  2F5T X;  1OX8 A;  4A53 A;  2VGM A;  4AFZ C;  3VRZ A;  4IUP A;  1VUB A;  5CO7 A;  2EPD A;  3NHN A;  1TOV A;  2MF2 A;  2QG9 B;  2CP5 A;  2KT1 A;  4LDX A;  4AG1 C;  4M78 E;  2DMO A;  4IIM A;  1ZA2 B;  2XHC A;  1SKU B;  1AWW A;  1YIT A;  1QWE A;  3FJP A;  2L3P A;  3X24 B;  1ZUU A;  4OB2 B;  2K4Y A;  2RH2 A;  2K2M A;  5LJ5 h;  3SWN C;  4PJO G;  3OYM A;  6AT1 B;  4M75 E;  2DXU A;  5I22 A;  4FW1 A;  1UEB A;  3JCM f;  3S3M A;  4LDU A;  1Q86 U;  2MAM A;  2F5K A;  1OEB A;  3NTI A;  3LW5 E;  4OMQ A;  1VA7 A;  5FWB A;  2QGF B;  4BD3 A;  1Y07 A;  1RAG B;  1M90 U;  1A0N B;  1Q82 U;  4PFO A;  2ABL A;  1MUZ A;  4IUV A;  3VS5 A;  5CCA A;  2RJC A;  1LOJ A;  4HT8 A;  4LNP A;  4C5I A;  4E7S A;  2DIQ A;  2Y4Y A;  2F2V A;  1H3H A;  2EIF A;  3M0T A;  2IVW A;  2VB6 A;  2QI2 A;  1AT1 B;  1LNX A;  8ATC B;  5KYX A;  3GPL A;  1ABQ A;  1K9M R;  1FYN A;  4K11 A;  1QLY A;  1I07 A;  4KGZ B;  2QXF A;  1Q7Y C;  4M7D D;  2LX9 A;  1UHF A;  4PL6 A;  3I56 Q;  3C0C A;  1U1S A;  2H3J A;  4E7Z A;  4AFU C;  1VQ7 Q;  1KQ1 A;  2LT4 A;  4A4F A;  3VS1 A;  3CCV A;  3REA B;  4J83 A;  2Z0W A;  1YI2 Q;  2NUP A;  4R0K A;  3JCM W;  2PVG B;  4WTO B;  3CMA Q;  2EQU A;  3OY9 A;  4F17 A;  3OMC A;  2ZPH B;  1NLP C;  2DLP A;  2H3E B;  2RQR A;  5CIU A;  3U23 A;  2X4X A;  2O2O A;  1BI0 A;  3X28 B;  3PFS A;  1AWJ A;  2AKL A;  2LP5 A;  1EIF A;  2CT3 A;  4PJO E;  1JEG A;  3JCM h;  5FWC A;  4N0A A;  3UAT A;  1N5Z A;  1ZSZ C;  2K79 A;  3I5S A;  3CCJ T;  5I11 A;  5LJ5 e;  3C12 A;  2XK0 A;  4Z89 A;  4J9I A;  3OYB A;  2ROT A;  1TG0 A;  3MEV A;  3G6E T;  1V29 B;  1IRE B;  1WXU A;  4XTU A;  1M8M A;  2P4R A;  2JTM A;  3I56 T;  3JAM E;  5FU6 B;  3CME Q;  1TTH B;  2C06 A;  1JXM A;  1YP5 A;  1YWO A;  4QKU A;  1VQ7 T;  2EVR A;  1ZBX A;  1G3S A;  1M30 A;  3G1J A;  4N0A C;  2QDL A;  3CC7 A;  2A0F B;  1YI2 T;  3EG3 A;  4BI4 A;  1Y96 B;  1RAE B;  1YJ9 A;  1VQO A;  2X51 A;  1Q81 C;  4NL3 A;  2K57 A;  3P8B B;  4J9B A;  4M78 F;  5CKF A;  4M7D B;  2A08 A;  2RQV A;  4B9X A;  1AD5 A;  1WPY A;  3SDZ A;  1C1A A;  1LJO A;  2CP7 A;  1JRI A;  3E9F A;  5FRM A;  1GFD A;  1UB4 A;  1RAA B;  3RIR A;  2JVV A;  2KK4 A;  4JJC A;  1PSE A;  1V1C A;  1LPL A;  4QQD A;  3TEE A;  3E9G A;  3JB9 F;  2LQ8 A;  4LUE A;  1PRM C;  2CKK A;  4E6R A;  4E2F B;  2A3L A;  4FT4 A;  4J9F A;  2A37 A;  3H9N A;  2KNB B;  4FYW B;  3V8K A;  1E7O A;  1PNJ A;  5KH6 A;  2B86 A;  2QAS A;  1Q7Y R;  3NGP A;  4D6W A;  2QEX A;  3JCM c;  4KGV B;  7AT1 B;  2GFA A;  4Y28 E;  2MWO A;  3PIO A;  4EDU A;  2J6O A;  2QA4 A;  4M7D G;  4KUD K;  1VQ6 Q;  3JCM e;  1VYT A;  1V76 A;  1SSH A;  3CME T;  2O9S A;  3CCR A;  3CCM T;  3CCE Q;  2DYB A;  2QQB A;  3ER0 A;  2X9H A;  2LQN A;  1U8R A;  4F04 B;  1UJ0 A;  1YHQ Q;  4J9D A;  1M1G A;  1AWX A;  2QYZ A;  3MJX A;  1YN8 A;  2QTX A;  3MP1 A;  4L6V 5;  5A2Q E;  2JJ9 A;  3ZBD A;  4C8Q F;  4EMK A;  1N9S A;  1OPL A;  1YCY A;  5IHN A;  2LDM A;  5KCH A;  5KCO A;  1P92 A;  2LJ3 A;  1KD1 U;  3RDV A;  2L3S A;  2JT4 A;  3G71 T;  1M27 C;  2YT6 A;  2L2P A;  3NTK A;  3CCQ A;  1WA7 A;  2DE0 X;  2E10 A;  5GMK m;  1VIE A;  1D09 B;  5HCK A;  1UGQ B;  2YUO A;  4OB1 B;  4M7A A;  2VGN A;  3TCJ A;  1QP2 A;  2V1Q A;  2E65 A;  3OYD A;  1GCQ A;  2YRV A;  2MPX C;  1Y7X A;  3OYI A;  3MHX A;  3OYL A;  4ZGE B;  2EJG A;  4ZNX A;  4EMK C;  1SSF A;  1VQ6 T;  2BE9 B;  1WHM A;  5GAN 4;  2EQK A;  3L2Z A;  3M55 A;  1Q81 R;  1U1T A;  4C92 A;  5DLQ E;  3M53 A;  2HMA A;  5AT1 B;  3MEU A;  2IPO B;  1YHQ T;  1AZG B;  4C0F A;  2DZC A;  1BU1 A;  4M7D E;  1G2B A;  1PM3 A;  2CP3 A;  1X2Q A;  2K9G A;  1LVK A;  1OU9 A;  2LCC A;  3LYI A;  4XTV A;  5LL6 S;  1BBZ A;  5GAO m;  1WHL A;  1RAC B;  4M7A C;  3VS3 A;  2CSQ A;  1R0C B;  4J7I A;  2GGR A;  2V1R A;  1UUE A;  3VYG A;  5CKD A;  3EH2 A;  1GCQ C;  4A4G A;  5KYU B;  3VV0 A;  3M4Y A;  2KGT A;  3S3N A;  4BY6 C;  1VQP Q;  3L2V A;  1KG1 A;  4QQG A;  3QWX X;  1QVF S;  3CXC S;  2DVE A;  2EWN A;  3ME9 A;  1SEM A;  4C92 C;  3RMQ A;  2DO3 A;  2RJD A;  2EFI A;  3OW2 P;  1EFN A;  3JB9 D;  2O9V A;  1GFC A;  4J5Y A;  4IKF A;  3JCM P;  1VQK Q;  2DTH A;  4LDV A;  3TU4 K;  2PNI A;  3MPU B;  4HA8 A;  1WJQ A;  3CD6 T;  5LJ3 f;  5AYF A;  2ED1 A;  2O01 E;  2BZ8 A;  1WDX A;  2E3H A;  3LGL A;  2EAY A;  2VAS A;  4MZP A;  5HK0 A;  1MV3 A;  2E64 A;  4PFP A;  2SRC A;  1M1K C;  3OYG A;  1AVZ C;  2MOX A;  2QAZ A;  3VS4 A;  1VQN Q;  1ACM B;  1WXT A;  2EYY A;  3CPF A;  2DXC A;  2ZPB B;  3LH0 A;  2W10 A;  1VIF A;  3I55 Q;  2D0N A;  3F70 A;  2HNI A;  1FXX A;  3TRE A;  2COW A;  2DRM A;  5L8R E;  5C6S A;  2OTJ T;  1NG2 A;  4E7L A;  3VKI A;  2P0K A;  4C8Q D;  4KUL A;  4Z88 A;  3BDU A;  4JZ3 A;  2LQK A;  1BI1 A;  3QHS A;  2ECZ A;  2JN0 A;  2BZY A;  4N4H A;  3FRN A;  2DD5 A;  3OYC A;  1FMV A;  1QCF A;  1TU0 B;  2LJ1 A;  3CPW S;  4MDW A;  5CKE A;  2O31 A;  1QVG S;  2D8J A;  3CBO A;  3I9Q A;  2HD0 A;  5IN1 A;  2PZ1 A;  2FL7 A;  2CZ7 B;  1NE8 A;  3OS2 A;  4C0D B;  2ESW A;  1VQK T;  2KRO A;  1VYV A;  5CKB A;  2C0O A;  1OZ2 A;  1N9R A;  1WI7 A;  2I0N A;  2VC8 A;  3A8L B;  4BB7 A;  1PRL C;  4RG2 A;  2GTO A;  1YIT Q;  1RAI B;  3L1A A;  1I1J A;  2XID A;  4JRK A;  1YIJ A;  3CBM A;  4NOY A;  3RR6 A;  2KSS A;  2M51 A;  5GAN 6;  4PLL A;  4ORZ A;  1VQN T;  3TVT A;  1WHG A;  2X35 A;  2YUN A;  2EQI A;  1HD3 A;  2NUT B;  4FCY A;  1UHC A;  1ZSG A;  2YLC A;  5GJV B;  1FX7 A;  3PGG A;  2CP0 A;  3BY7 A;  3OYA A;  1OZ3 A;  2L89 A;  2HQH A;  4C5G A;  4GBQ A;  4OMF B;  5J3B A;  4XTY A;  2DM1 A;  2EYQ A;  4Y91 A;  1MNE A;  2PUK B;  4P5N A;  2XD0 A;  3RES A;  1N8R U;  1DJ7 B;  1G3T A;  4RCC A;  1OI1 A;  2RHU A;  3EGD B;  1QMC A;  1TH7 A;  1KHC A;  1TS9 A;  1PKS A;  3OYE A;  2E6Z A;  1M2O A;  5LJ5 g;  3FC3 A;  3JB9 G;  4RTW A;  2K3B A;  3LWH A;  1K9M C;  4C8Q B;  3BE3 A;  3EHR A;  2AIR B;  5CQX A;  3L2U A;  2AK5 A;  3DB3 A;  1G3W A;  3L2R A;  4HT9 A;  1M1K R;  3X25 B;  1YIT T;  1UGP B;  2RQT A;  1NBE B;  2K2V A;  4JPB W;  1BKB A;  1SPK A;  3GNG A;  3CCV Q;  2X4W A;  2COZ A;  4JS4 A;  3THK A;  1OU8 A;  1X6B A;  5KYY A;  1E6H A;  3V8J A;  3OW2 A;  5EC7 A;  1M5Q 1;  2BIV A;  2XG8 D;  2KE9 A;  2O88 A;  2VXF A;  1VQ8 A;  4C8Q G;  4OMO A;  2HQE A;  2VUB A;  1X75 C;  2OX7 A;  2R57 A;  3AHU A;  1X2K A;  5LJ3 e;  1X6O A;  2DRK A;  3A98 A;  4PJJ A;  1Q86 C;  2DIG A;  5C0M A;  2ZPE B;  3EG9 A;  1VQ9 T;  1BCM A;  4J6X A;  2P0Q A;  1UTI A;  4XU1 A;  1KQS S;  1ZA1 B;  1IGQ A;  1ZQ1 A;  3UDC A;  3M0R A;  1M90 C;  1NPP A;  2MK5 A;  1Q82 C;  4HVU A;  2ZPF B;  1IO6 A;  2RA2 A;  2M0O A;  2KRN A;  2K5I A;  3M58 A;  2DXB A;  3C4S A;  3CCU A;  4EIK A;  2F2W A;  3MO8 A;  1K76 A;  3JCM g;  4TVR A;  1D3B B;  2GFU A;  2JUF A;  2XKO C;  1BI3 A;  1JQQ A;  3P8D A;  4F7U A;  3QDF A;  1SRL A;  3OYY A;  3CC7 Q;  2QQA A;  3LX7 A;  1VQO Q;  3H0I A;  1K73 U;  3H41 A;  3FEO A;  2F1L A;  3HHT B;  2YWW A;  2O4X A;  5I2M A;  1TSF A;  2PUO B;  4FIB A;  2M9U A;  2HSP A;  1IHW A;  1UFF A;  4J6Y A;  1ARK A; 
#chains in the Genus database with same CATH homology
 1V1C A;  4J9E A;  2JS0 A;  2CT4 A;  1HSQ A;  3TSZ A;  1KSW A;  2PTK A;  4LUE A;  1PRM C;  3QWY A;  1ZX6 A;  2D8H A;  4E6R A;  4AFQ C;  5L23 A;  3VS7 A;  1WYX A;  1I0C A;  4F14 A;  4D8K A;  4J9F A;  3SEM A;  2A37 A;  3VS2 A;  2KNB B;  2KXD A;  1OPK A;  2GBQ A;  2LZ6 B;  1E7O A;  3SHW A;  1PNJ A;  1UGV A;  5GJW B;  1KIK A;  1T0H A;  2B86 A;  2AKK A;  3NGP A;  2A28 A;  2LJ0 A;  3H0H A;  2MCN A;  2HCK A;  1Y0M A;  1YCS B;  2RPN A;  1RUW A;  1KJW A;  1UEC A;  2J6O A;  4JZ4 A;  1YWP A;  4RTV A;  3UA6 A;  1PWT A;  1W70 A;  2X3W D;  1VYT A;  2CDT A;  1SSH A;  2O9S A;  2DBK A;  4AG2 C;  2AZS A;  5IXB A;  2DYB A;  2ED0 A;  2LQN A;  2L0A A;  4JJB A;  2EW3 A;  1ZLM A;  1UJ0 A;  1NM7 A;  3FJ5 A;  2AZV A;  1T0J A;  4J9D A;  3RBB B;  2W0Z A;  3M0S A;  1NYF A;  1AWX A;  1GBQ A;  1YN8 A;  4DEY A;  1Z9Z A;  2BZX A;  1PHT A;  1Y57 A;  2K6D A;  2FPE A;  1OPL A;  5IHN A;  1M3B A;  1GL5 A;  2KRS A;  1M3C A;  5IHI A;  1X6G A;  2LJ3 A;  4JJD A;  2L3S A;  1K0X A;  2RMO A;  4OMP A;  1LCK A;  2JT4 A;  1T3S A;  1M27 C;  2YT6 A;  2KRM A;  2L2P A;  1WA7 A;  2DE0 X;  2OJ2 A;  2DBM A;  5HCK A;  4RTY A;  2YUO A;  2MIO A;  1TUC A;  2DJQ A;  2KBT A;  1MV0 B;  4HVV A;  1AOJ A;  2CUD A;  2V1Q A;  3I35 A;  1GCQ A;  4HCK A;  2FRW A;  2J6K A;  2KR3 A;  1YNZ A;  4ZNX A;  2X3X D;  4HXJ A;  2JTE A;  2RNA A;  4OMN A;  3VS6 A;  3PVQ A;  4DEX A;  3EG0 A;  3IQL A;  1AWO A;  2VVK A;  2LCS A;  1ABO A;  1NEB A;  1AZG B;  4F16 A;  1BU1 A;  1W1F A;  2BTT A;  1G2B A;  2A36 A;  2KYB A;  1X2Q A;  2K9G A;  4RTT A;  3EG1 A;  1E6G A;  2G6F X;  1BBZ A;  5IH2 A;  5IHK A;  2JMC A;  3TSW A;  1JU5 C;  3ULR B;  3VS3 A;  3R6N A;  2CRE A;  2CSQ A;  1WLP B;  1S1N A;  2GGR A;  2V1R A;  1UUE A;  1NYG A;  2E5K A;  1GCQ C;  3KFV A;  3UA7 A;  2FRY A;  2CH4 W;  4CC3 A;  1CSK A;  2KGT A;  3REB B;  1GRI A;  1VYU A;  3QWX X;  2RQW A;  4LE9 A;  4WCI A;  3M0U A;  2DA9 A;  3UF4 A;  2NUZ A;  2JM8 A;  2HBW A;  2SEM A;  1XOV A;  2ENM A;  4X1V A;  2J6F A;  1KFZ A;  1K4U S;  1SEM A;  2DNU A;  1CKB A;  2OI3 A;  1SHG A;  1EFN A;  2EBP A;  4Y92 A;  2CH4 A;  1K9A A;  2O9V A;  1GFC A;  3I5R A;  2PNI A;  1NLO C;  4A63 B;  2ED1 A;  2EYX A;  2BZ8 A;  1WDX A;  2FG0 A;  3NMZ C;  1RLQ C;  2RF0 A;  1MV3 A;  4RTU A;  2EGC A;  2J7I A;  2RQU A;  4CC4 B;  1W6X A;  3CQT A;  2SRC A;  1QWF A;  1AVZ C;  2MOX A;  3VS4 A;  1SRM A;  2FO0 A;  2JW4 A;  2C0I A;  1K0S A;  2HEQ A;  1WXT A;  2EYY A;  1NEG A;  2LX7 A;  2W10 A;  1FMK A;  2C0T A;  2YUQ A;  2D0N A;  4RTZ A;  4FSS A;  3NPF A;  2DRM A;  1NG2 A;  1PKT A;  2EGE A;  1OV3 A;  2M0Y A;  2L3Q A;  2GNC A;  4Z88 A;  2LQW A;  4LUD A;  2H8H A;  4JZ3 A;  2ECZ A;  1ZUK A;  2DX1 A;  4AFZ C;  3O5Z A;  2BZY A;  3VRZ A;  4OMM A;  3ZL7 C;  1K1Z A;  1OOT A;  2EPD A;  2LJ1 A;  1QCF A;  2O31 A;  2D8J A;  3NHN A;  1H92 A;  3I9Q A;  2PZ1 A;  1UDL A;  2JM9 A;  1UG1 A;  1M3A A;  1SHF A;  2KT1 A;  2DL4 A;  2EYW A;  2ESW A;  4AG1 C;  1WIE A;  2DMO A;  2FPF A;  4IIM A;  4KRT A;  2CSI A;  2KRO A;  1AWW A;  4GLM A;  1VYV A;  3EG2 A;  2NWM A;  2C0O A;  1QWE A;  1WI7 A;  2I0N A;  2L3P A;  1PRL C;  2GTO A;  4J9G A;  1I1J A;  1ZUU A;  1UE9 A;  1ZUY A;  5FW9 A;  2K2M A;  2KEA A;  2M51 A;  1WX6 A;  4ORZ A;  1QKX A;  3TVT A;  1B3Q A;  2FPD A;  3PE0 A;  2YUN A;  1U06 A;  5I22 A;  2EQI A;  3M0Q A;  1HD3 A;  4HVW A;  2DL3 A;  4J9H A;  1UHC A;  1X69 A;  1ZSG A;  5GJV B;  2KYM A;  1CKA A;  1G83 A;  2JMA A;  3EGU A;  1J3T A;  1OEB A;  2DL8 A;  4Z8A A;  3VS0 A;  4OMQ A;  3RNJ A;  2D1X A;  1VA7 A;  4ESR A;  5FWB A;  2RN8 A;  4GBQ A;  1WFW A;  1AEY A;  4RTX A;  3PVL A;  1A0N B;  2ABL A;  2DM1 A;  1Z9Q A;  1MUZ A;  3VS5 A;  5IXF A;  3M0P A;  1H8K A;  4LNP A;  1GCP A;  2F2V A;  1H3H A;  3M0T A;  2JS2 A;  1PKS A;  3VRY A;  2YDL A;  2J05 A;  1ABQ A;  2DL7 A;  4RTW A;  2EYZ A;  2K3B A;  1UJY A;  1ZBJ A;  1FYN A;  2GQI A;  4K11 A;  1QLY A;  1I07 A;  2FEI A;  3EHR A;  1UHF A;  2AK5 A;  3C0C A;  4AFU C;  1X43 A;  3VS1 A;  2RQT A;  3REA B;  4JPB W;  1SPK A;  2GTJ A;  1X27 A;  4R0K A;  3JV3 A;  1B07 A;  4CC7 A;  4F17 A;  3THK A;  1WXB A;  1X6B A;  2VWF A;  1T3L A;  1NLP C;  3GBQ A;  2DLP A;  1E6H A;  2RQR A;  1RLP C;  3U23 A;  5EC7 A;  2O2O A;  4J9C A;  1U5S A;  1AWJ A;  2AKL A;  2KE9 A;  2O88 A;  2LP5 A;  2CT3 A;  1JEG A;  5FWC A;  2DIL A;  3UAT A;  2YSQ A;  2LNH B;  1N5Z A;  4OMO A;  2K79 A;  2J06 A;  3I5S A;  2KT8 A;  2HDA A;  1RI9 A;  5I11 A;  1X2K A;  1HJD A;  2DRK A;  3A98 A;  2ROL A;  1GBR A;  4Z89 A;  4J9I A;  4CC2 A;  2JXB A;  2ROT A;  4IIO A;  1TG0 A;  2XMF A;  1UTI A;  1U3O A;  2DVJ A;  2DL5 A;  3H0F A;  2DF6 A;  3M0R A;  2EKH A;  1WXU A;  4QT7 A;  4LN2 A;  4HVU A;  4RUG A;  1IO6 A;  2OAW A;  1M8M A;  2P4R A;  2KRN A;  3EHQ A;  2IIM A;  1JXO A;  1JXM A;  1YP5 A;  1YWO A;  2EVR A;  4EIK A;  1QKW A;  2F2W A;  2CUB A;  4AFS C;  1K76 A;  1M30 A;  1BB9 A;  2LMJ A;  1BK2 A;  2QDL A;  1AZE A;  5ECA A;  3EG3 A;  2F2X A;  1JQQ A;  1SRL A;  4OML A;  4J9B A;  1JO8 A;  3H0I A;  2EGA A;  1TUD A;  3H41 A;  2VKN A;  2A08 A;  2RQV A;  4D8D A;  1AD5 A;  2YUP A;  2K7A A;  2KXC A;  4M4Z A;  3LH5 A;  1GFD A;  2HSP A;  1UFF A;  1ARK A;  4JJC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...