2DBMA

Solution structures of the sh3 domain of human sh3-containing grb2-like protein 2
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
73
structure length
73
Chain Sequence
b'GSSGSSGPCCRALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLHGHSGFFPINYVEILVALPHSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SH3-containing GRB2-like protein 2
publication title Solution structures of the SH3 domain of human SH3-containing GRB2-like protein 2
rcsb
source organism Homo sapiens
molecule tags Transferase, signaling protein
total genus 5
structure length 73
sequence length 73
ec nomenclature ec 2.3.1.-:
pdb deposition date 2005-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dbmA00
1RLQC 3PVLA 3VS0A 2DE0X 4X1VA 2KROA 4AFUC 3VRYA 1QKXA 1X2KA 3H0HA 3VRZA 5I11A 1ARKA 4FSSA 1BBZA 2FRYA 1GL5A 2HBWA 2RPNA 2GBQA 3IQLA 2J06A 4JZ3A 4RTZA 1MUZA 1AWWA 2GGRA 1UTIA 2FRWA 2J7IA 1TG0A 1WFWA 1SHFA 1T3LA 1VYTA 3M0TA 4RTWA 2CH4W 2BZ8A 2LP5A 2LJ0A 2OAWA 3THKA 2JMAA 1SEMA 3EG2A 2K9GA 1YWPA 2K79A 2AKLA 3I5RA 1K9AA 1MV3A 1EFNA 2KXDA 3KFVA 1JXMA 2KRSA 1WXUA 4J9HA 2A28A 2FPEA 2W10A 2RMOA 1SRLA 1WYXA 3O5ZA 2KXCA 2CUDA 5FWBA 4OMPA 5GJWB 4J9GA 5IXBA 1VYVA 2EVRA 3UF4A 4OMNA 4D8KA 4DEXA 2X3XD 4Z89A 4J9FA 2AZSA 1ZX6A 1ZUKA 2HEQA 2RQUA 3UA7A 1NEBA 3VS7A 1KIKA 1MV0B 2EBPA 1Y57A 2EW3A 2KYMA 2AK5A 2DL7A 2D8HA 1ABQA 3NMZC 1K76A 4ZNXA 2JS0A 3NHNA 2EYZA 2DYBA 2RNAA 5I22A 3M0SA 3EHRA 1E6HA 1YN8A 2XMFA 2GTOA 2FG0A 2AKKA 2P4RA 2SEMA 4GBQA 1LCKA 3I35A 5ECAA 1RI9A 1X6BA 2DLPA 4IIMA 1XOVA 1WA7A 4GLMA 1GBQA 3VS5A 1T0HA 4JJCA 1UUEA 3UA6A 1X6GA 2V1RA 2JS2A 1PRMC 3PE0A 2DA9A 3M0UA 2EQIA 4IIOA 1VYUA 3GBQA 2DJQA 1Z9ZA 2RQRA 1IO6A 2LQWA 2D0NA 1GFCA 4RTTA 4HVVA 2EYXA 1ABOA 2GQIA 2KGTA 1QLYA 2ESWA 2V1QA 1PKSA 1YP5A 2IIMA 2PTKA 3A98A 1TUDA 4EIKA 2CUBA 4Z8AA 2MCNA 2QDLA 3RBBB 1SRMA 2FEIA 2JM8A 2C0OA 2DNUA 2JT4A 1AWJA 3UATA 2KT8A 5IHIA 4D8DA 1YCSB 2L3QA 4CC2A 1NYFA 2EGEA 4F14A 1H92A 1G2BA 2KE9A 2FO0A 4Y92A 2CT3A 2DBKA 1CKBA 3H0IA 4M4ZA 4RUGA 5L23A 1BB9A 4HXJA 1OPKA 1UHCA 4RTUA 1AWOA 2F2WA 1B3QA 2L3SA 3LH5A 2KNBB 1RUWA 2DL8A 2KRMA 2NWMA 2OI3A 2HCKA 1SSHA 5GJVB 4OMLA 2DF6A 2ED0A 2BZYA 2CSIA 1JO8A 1QKWA 2L3PA 2KEAA 1PRLC 1W70A 2RQWA 1HSQA 1ZUUA 1PWTA 1UECA 1CSKA 1HJDA 3REAB 1AD5A 3QWXX 1G83A 3NGPA 4JJBA 4RTYA 3EG1A 2NUZA 2O9VA 1A0NB 4CC7A 1K0XA 4F17A 1TUCA 2YUNA 3FJ5A 2VVKA 1H8KA 1WX6A 2PZ1A 2G6FX 1WXTA 3NPFA 2JXBA 1E7OA 1YWOA 3I5SA 1AEYA 2LNHB 2J05A 2GNCA 2J6OA 2KT1A 1NG2A 4LN2A 2EYWA 1U3OA 2SRCA 2EGCA 1YNZA 1KJWA 2KBTA 2LMJA 2B86A 1JEGA 1UGVA 1U5SA 1ZUYA 4J9DA 1B07A 4K11A 2VKNA 2E5KA 3VS4A 3VS2A 1GFDA 2JW4A 3VS6A 1WDXA 1X27A 2O9SA 1M30A 1KSWA 3EHQA 2L2PA 2GTJA 1UDLA 1PKTA 1K0SA 1AWXA 2DL3A 2DVJA 2M51A 3RNJA 1M27C 2DX1A 2RQVA 4DEYA 2DMOA 1I1JA 3M0PA 2D1XA 1NEGA 2BZXA 3TSZA 2CSQA 4ORZA 1UE9A 2I0NA 4AFQC 2YT6A 2A37A 4HVWA 1GCQA 1V1CA 1AZGB 1GBRA 1BK2A 4JPBW 1NLOC 1I07A 3VS1A 1FYNA 4E6RA 2K2MA 1SHGA 3REBB 4RTXA 1QCFA 2DL5A 2JM9A 2RN8A 3H41A 2EYYA 5EC7A 1VA7A 2YDLA 1OEBA 4KRTA 1M3BA 3H0FA 4AG1C 1M8MA 2W0ZA 4J9IA 4ESRA 5IXFA 2F2XA 2KR3A 3ZL7C 2CDTA 1T3SA 4JZ4A 2LCSA 2EGAA 2KRNA 1GCQC 4HCKA 1UG1A 2A08A 1Y0MA 2JMCA 3CQTA 2LX7A 1HD3A 4CC3A 2RF0A 1JU5C 5HCKA 2O88A 1ZSGA 1FMKA 2YUOA 4J9BA 1UJYA 4Z88A 1J3TA 2H8HA 4R0KA 1E6GA 2K3BA 1K4US 2C0IA 3ULRB 4CC4B 4J9EA 1S1NA 5FWCA 2AZVA 2HSPA 1OV3A 1UFFA 1OOTA 1PHTA 1M3CA 1H3HA 4JJDA 1ZLMA 2HDAA 3JV3A 2F2VA 4AFZC 4OMQA 2O2OA 2LJ3A 2X3WD 1OPLA 2VWFA 2J6KA 1WLPB 4LE9A 2K6DA 4J9CA 1NM7A 3R6NA 5IHKA 1GCPA 1I0CA 1W1FA 2RQTA 1JXOA 2OJ2A 1ZBJA 2LZ6B 2FPDA 2A36A 2CREA 2D8JA 2ROTA 5IHNA 3VS3A 2M0YA 1PNJA 2ROLA 1AZEA 2JTEA 2J6FA 5IH2A 2DRMA 4LUEA 3TSWA 1QWEA 3QWYA 2YSQA 1W6XA 2CT4A 3C0CA 4AG2C 2C0TA 1CKAA 1JQQA 1WXBA 4AFSC 2DM1A 3EGUA 3M0RA 1M3AA 1X69A 1WI7A 4OMMA 3SHWA 1N5ZA 2O31A 1K1ZA 4WCIA 2DRKA 2PNIA 3EG3A 4QT7A 1QWFA 3I9QA 2CH4A 2L0AA 2ENMA 4RTVA 1Z9QA 3SEMA 1SPKA 1X43A 2MOXA 2LJ1A 1GRIA 2EKHA 2BTTA 4LNPA 3U23A 2ECZA 2ED1A 2MIOA 1RLPC 1BU1A 1UJ0A 4F16A 2YUPA 1U06A 2FPFA 1WIEA 3M0QA 1X2QA 2YUQA 2KYBA 1AVZC 2EPDA 1NYGA 1T0JA 2ABLA 2K7AA 4HVUA 4LUDA 1KFZA 3PVQA 4OMOA 4A63B 3EG0A 2DILA 2LQNA 1AOJA 3TVTA 1NLPC 2DBMA 2DL4A 5FW9A 1UHFA
chains in the Genus database with same CATH superfamily
1RLQC 3PVLA 4X1VA 3FEOA 2KROA 3JCMW 1VQ9Q 1QKXA 2VXFA 4E7LA 2QTVA 3H0HA 2RPNA 3IQLA 3QZ5B 4RTZA 3CMEQ 1UTIA 5GAN3 5FROA 2Y4YA 3E9FA 2QQSA 1KC8C 1WFWA 4F7UF 1SHFA 2PVGB 2XK0A 1SEMA 3EFSA 3CCSQ 1VQ7Q 5GANd 2K79A 2AKLA 2EFIA 1K9AA 1G3WA 3HFNA 4PJMA 2CP5A 1JXMA 3OBYA 1D0YA 3D7SB 5D6WA 3VYGA 4M78B 2FPEA 3LLRA 3O5ZA 3CCMQ 4OMPA 5IXBA 1VYVA 1VQLQ 4OGCA 3CMAQ 2DEQA 4M7DE 2RHXA 5KYNA 3OYKA 4C0DC 1YJ9Q 1K8AC 2HEQA 4NOYA 3UT1A 3HKSA 1R77A 2K57A 4B9WA 1QQJA 1MV0B 2EBPA 2OTJT 2EW3A 4M75D 2AK5A 2VGNA 3RMQA 1ABQA 1MMAA 1K76A 4XAXB 2NUTB 5I22A 5D6XA 3QUIA 4CRIA 4IKFA 1YN8A 4J5YA 4NL3A 1RAAB 2MI6A 5GAMd 3QG1A 3I35A 3X26B 5ECAA 3LX7A 3HSBA 1KK7A 2DJZA 1X6BA 1Y96A 2DLPA 1QP2A 3QHSA 5FU6B 1D3BA 4GLMA 3MP1A 2OTLA 4PFZA 3CBMA 4TVRA 1BCMA 1BI2A 3QKJA 5DY9A 3J80E 4Q5WA 2V1RA 3M5AA 3PE0A 3MHXA 4M78F 2EQIA 2EJFA 4IIOA 4E2FB 1VYUA 4PK4A 1QVFA 1H3ZA 1N9RA 2D0NA 1BIBA 4ME7A 5FLXE 2EYXA 2XIDA 2PVOB 3SWNA 2GQIA 2ESWA 2V1QA 2Y4XA 1TS9A 3JCMQ 2VC8A 1W4SA 2COZA 5CK9A 4E7KA 4XTUA 2LCCA 3JB9D 1YJNQ 2M9UA 4BI3A 4M7AA 2L3QA 2P0PA 4CC2A 1G2BA 4Y92A 2P0QA 3RDVA 3E19A 3CCUQ 3AHUA 4C0GA 1KHIA 1AWOA 3A5ZB 2M0OA 2F2WA 4UC4A 2L3SA 3RR6A 3LH5A 1WPYA 2KNBB 1M9SA 2KRMA 2NWMA 3OMGA 1R0BG 4C0FA 2PUKB 3LW5E 3JCMf 3S6WA 1W70A 5GMKj 4PLIA 1ZUUA 4ELZC 1UECA 5DLQE 2E6ZA 3S3MA 2DERA 1H641 4PJNA 4M77A 3JAME 1Q86U 3VU3C 3J81E 4CC7A 3EH2A 4PJOE 4F17A 3NTKA 1IB8A 2VVKA 1Q86R 4OVAA 5A0LA 1YWOA 5HKCA 3GIBA 2OTLT 1BYMA 1HXDA 4KGZB 3VJPA 4QVZA 3EFOA 4M7AG 3OYBA 1XJWB 2VGMA 1YCYA 5CQXA 2KBTA 3E1SA 2B86A 2L8DA 5I2MA 1JEGA 5GANj 1U5SA 3CC2T 4J9DA 4C8QD 3DLLA 2F1LA 4DOWA 4XTVA 5GAN2 1D3BB 4K11A 4QKUA 1VQOQ 2E5KA 4J7FA 4DBFA 2ZAEA 4HT8A 3NFCA 4C5IA 1VQ8A 2K5FA 3VS6A 2EIFA 3CCRQ 1JRIA 1IHWA 1VQPQ 3AT1B 3MP6A 4FCYA 1NJIU 1UDLA 5LL6S 2FHDA 1F1BB 3SWNB 4PNOA 1MGQA 2V8KA 2RQVA 1HYOA 1QCOA 2F5KA 3JB9J 4L5GA 3I56A 2BZXA 3TSZA 1PD1A 2R5AA 4M77G 2CSQA 4ORZA 4AMCA 2JUFA 3CEYA 2YT6A 1GCQA 1VQNA 2E6NA 4C92D 1TUGB 2RK1A 1BK2A 4RMOA 3O8VA 5GMKm 3F70A 3QXEB 1YJWA 5GAMj 1Q81U 2DL5A 1B7TA 5KH6A 2YRVA 3JCMc 1Q81R 1KG1A 4ZN3A 1YIJQ 2XKOC 2W0ZA 5IXFA 2HMAA 4FM4B 2CDTA 2YLBA 2LCSA 5M9OA 3RESA 1UG1A 1VQ6Q 1Y0MA 2LX7A 3OYAA 2MF2A 2RF0A 4NS5A 1LPLA 3N5BB 4KGVB 5GANe 2QEXQ 4M77B 1FMKA 3RUXA 2YUOA 4J9BA 1UJYA 4R56A 4Z88A 4RCBA 4F7UE 1C1AA 1E6GA 1WHKA 3JB9I 2XHCA 3CCQA 1K4US 3ASKA 2E10A 2AZVA 1KC8U 1VQ8T 3EFOB 4PL6A 4A4GA 5CCAA 4JJDA 5CKHA 3QYHB 1KC8R 2JN0A 2WACA 5I21A 3UDCA 3PIOA 2KQWA 1NM7A 3R6NA 1EX4A 3BW1A 1VQ5A 3I56T 2CP3A 2KI7A 2D0QB 8AT1B 3OYEA 1ZBJA 5EG2A 3VS3A 2CREA 2ROLA 2ZPHB 4JUVA 2J6FA 3CCJT 2DRMA 3TSWA 3QWYA 2LNVA 5GAMe 1YJWT 2OAUA 2C0TA 3QIIA 5I2SA 1K8AU 4RCCA 3UPUA 3EGUA 1R8OB 1M3AA 1X69A 1Q82C 1K8AR 2LX9A 3DB3A 1OULA 4OMMA 2DTIA 4M77F 2XDBA 3OBWA 4BDZA 3SEMA 1SPKA 3DKMA 1NPRA 1PC0A 2FVUA 4LNPA 3U23A 2MIOA 1RLPC 3I55A 4EMKC 1UJ0A 4F16A 2EQJA 4B6MA 3M0QA 1X2QA 2DD4A 4P5NA 2HQHA 4EMHA 1OU9A 3L1AA 1NYGA 2RA2A 5CIUA 4OMOA 3CCVA 5CKBA 1VQMA 2AIRB 3CCQT 1IREB 4M75A 2RHZA 3E2UA 4HCBA 1BI1A 3CC7A 4FSXA 1UGQB 1SSFA 4A4HA 5LJ3g 1WGSA 3NTHA 3VRYA 2YWWA 3OYNA 2EJ9A 5I11A 4FSSA 3OW2A 1BBZA 4IURA 2HBWA 2DK3A 2ZCFB 4HKEA 2EQKA 2YLCA 1FMVA 2GGRA 1W2BS 2J7IA 3INZA 1QVGP 3RIRA 4C0DB 1T3LA 4M7DC 3M0TA 1VQ5T 4RTWA 3THKA 2BZ8A 3HRSA 4BB7A 3G6EA 3JB9H 3OYMA 3EG2A 1SF9A 1M1GA 1YWPA 2K9GA 3ME9A 3MEWA 3I5RA 2ZPEB 4MDXA 1EFNA 3MO8A 1S72T 2W10A 4MMKA 2RMOA 3QJ6A 2DXBA 2KXCA 3M53A 3M55A 2CUDA 2P4TA 4LD9K 4FU6A 2X4YA 3MEVA 3OB9A 4KUDK 3JCMb 8ATCB 3JSCA 7AT1B 1UB4A 1WJRA 1ZX6A 1ZUKA 1NJIC 4M75G 4BE1A 1RI0A 2QA4A 4PJOD 3WVDB 3CCEA 2K4YA 2KAFA 2PQWA 1QMCA 2D8HA 5D7UA 3PIPA 1W2BP 3G71A 1TTHB 5IT9E 1BKBA 3EHRA 1E6HA 4FL6A 2XMFA 2RM4A 2GTOA 3WXMB 1WHLA 2FG0A 2RO0A 5GMKi 5GAOl 1U8RA 2P4RA 1VQMT 1D1AA 3GPLA 2JZ2A 5FRNA 1G5VA 3ZEHA 2RHYA 4E7ZA 3KUFA 1WA7A 3X20B 3FIFA 2RHUA 2JS2A 3LGLA 1PRMC 1SKUB 3M0UA 1WZOA 1ZQ1A 3CPWA 1JBMA 4JRPA 4DBRA 2LQWA 4M75B 4M78G 3G6ET 5GAN5 2KGTA 1X6OA 4HT9A 1YP5A 4DOVA 1JJ2S 2IIMA 3JB9G 2K3XA 1TUDA 4Z8AA 2MCNA 2JJ9A 1M4ZA 1UGRB 2QDLA 3VV0A 2C0OA 1YITT 3UATA 3JCMJ 4IUPA 3Q1JA 4PJLA 4C8QA 5GAN6 1MMGA 2FO0A 2DBKA 3CCLQ 3H0IA 4M4ZA 5L23A 4HXJA 4MZTA 1XNIA 2DYIA 2CP7A 5GAOr 4RTUA 4PJOC 1BIAA 3CXCS 2RJDA 1VQ4A 2FB7A 4LD6A 1YHQT 2ED0A 4XU3A 3CC2Q 2O01E 2CZ6B 2L3PA 1ZSZA 1PRLC 1GXIE 2E70A 3GNFB 3L42A 3G71T 1HJDA 3REAB 3QWXX 3CD6A 3V8JA 1G3TA 4C92A 3TU4K 2DTHA 5HK0A 2K2VA 1EIFA 2MAMA 3EG1A 2O9VA 4M75F 1JJ2P 2YUNA 3WVEB 1Y71A 1WX6A 2PZ1A 2G6FX 4A4KA 4BY6C 3TEEA 2QTXA 2JXBA 1E7OA 3I5SA 4N4IA 1AEYA 2AT1B 2LNHB 2GNCA 4M7AE 2EYWA 1U3OA 4C8QG 2MMPA 1YNZA 2GFUA 2HNIA 3EGXA 4ATOA 1FWZA 3NTIA 1UGVA 1PD0A 1ZUYA 2MWOA 2JTMA 1B07A 2QQRA 5KYWB 4AT1B 1NE8A 3CXCP 4X34A 2JVVA 5FU7C 4O6JA 1WJQA 2L5QA 2G3RA 2BIVA 1X27A 3EHQA 2L2PA 4JLGA 1RL2A 2NYSA 4EMKA 4Z02A 4OGEA 2DL3A 1VQ9A 3UWNA 4DEYA 1ZA1B 4A54A 2D1XA 4C92G 3JCMP 3CMEA 4M77E 3JB9F 3HFOA 4FYYB 1VQ4T 2GCXA 1Q82U 4C8QB 2A0FB 2L3RA 1AZGB 4JRIA 4IUTA 1I07A 3VS1A 3JCMg 1R0CB 1Q82R 3CCSA 1VQ7A 4FYWB 1QCFA 3HL8A 5GANg 2Z0WA 1N27A 1OEBA 1VQ8Q 3CD6T 4AG1C 1M8MA 3CCMA 2KR3A 3PGGA 1T3SA 1VQLA 3FB9A 4WF2A 2LQ8A 2E3HA 1ZSZB 1NZ9A 2RJCA 2K5LA 3OS0A 3L2WA 6AT1B 1HD3A 1YJ9A 3QJYA 1JU5C 4C92B 1Q7YU 2O88A 4RG8A 3CBPA 5GANf 3GNGA 3CCJQ 2R5MA 4N0AC 2H8HA 4R0KA 4L6V5 3PMIA 4J6YA 1YBYA 2QG9B 2EJGA 3PT9A 5FWCA 1C6VX 2HSPA 2MK5A 1OOTA 1M3CA 3C94A 1H3HA 1KD1C 3EGXB 5GAMg 4C8QF 2KK4A 4AFZC 2FYKA 4OMQA 1QVPA 3QZ9B 2X3WD 2VWFA 1WLPB 4JJNK 3OSVA 4LE9A 1KQ1A 2K6DA 1GCPA 1I0CA 1FXXA 1W1FA 2KMTA 4ZGDB 1WJSA 3C95A 3A8GB 1AZEA 5IHNA 2M0YA 2Y90A 2JTEA 4JS5A 3M58A 4IUUA 4XU0A 4EMKB 2QGGA 2L89A 4AG2C 1KQSS 5GAMf 2X51A 1K9MC 3CCQQ 3G4SQ 1JQQA 4AFSC 1LVKA 2DM1A 4V2SA 3RERA 1YJNA 1NJIR 4C92F 3SHWA 2F5TX 2O31A 4PFOA 2ZZDA 1MMDA 2A3LA 1U1TA 2GF7A 2QI2A 2PNIA 5LJ3h 3CCMT 4YTLA 3I9QA 2B8AA 4IUVA 2ENMA 1C0MA 3CCUA 4BI4A 2GFAA 1X43A 2D9TA 2EKHA 2ED1A 3A8OB 4HCZA 2E4HA 2FPFA 2X4WA 2XDDA 1YI2A 4C5HA 3OYGA 1N8RC 2K5IA 4PLLA 2EPDA 2ABLA 3OW2S 4LUDA 3H9NA 3OS1A 2CP0A 5LJ5h 1VIFA 1S72Q 5KCHA 2LRQA 1NLPC 4PJJA 2DETA 2V26A 2FL7A 3VS0A 2DE0X 4AFUC 1KQSP 1ARKA 3MPUB 1O9SA 2XU8A 1GL5A 2GBQA 4JZ3A 4BI8B 1MUZA 5J26A 5GAN8 4D6WA 2E5QA 2FRWA 1VYTA 3V8KA 2CH4W 2LP5A 2OAWA 2M02A 2JMAA 3X24B 3RKXA 3MEAA 1M1KU 3FC3A 3OYCA 3OMCA 1MV3A 1VQOA 5C6SA 2KRSA 1WXUA 2OX7A 3LYIA 2A28A 2DPPB 2NLUA 1VQMQ 1SRLA 1WYXA 3CCRA 5J39A 3A8MB 4MZPA 1VQPA 2RI5A 3OW2P 5LJ3d 3UF4A 3HHTB 4OMNA 4D8KA 4FW2A 2MWPA 4J9FA 3CCUT 3SDZA 3DB4A 4A53A 4M75E 2P0KA 1WNLA 3UA7A 3P8HA 4N4HA 2VXEA 4ZGJB 4J8OA 1KIKA 4M7DD 1VQNT 4XK8E 4BACA 3G6EQ 2XDPA 2DL7A 3CPFA 3NMZC 4ZNXA 2JS0A 1YI2T 3NHNA 2EYZA 2DYBA 2HL3A 2RNAA 1YFNA 4M7AD 3M0SA 2EQUA 3KXTA 1QP3A 5LJ5d 1YITQ 2LC4A 2AKKA 4ZTFA 4GBQA 4KT0E 2DIGA 1LCKA 4XTXA 2QQBA 3V7SA 1YIJA 1XOVA 2DIQA 1GBQA 2RHIA 2WSFE 5A0GA 3VS5A 4JJCA 3HPWA 1ZHIA 1UUEA 5D6YA 2DZ9A 3OSSC 3X28B 1X6GA 2IPOB 3EGDA 2DXUA 2DA9A 1IGQA 2QXFA 4PJOB 4BDYA 2DJQA 1Z9ZA 2ZPGB 2RQRA 3A8HB 4C5GA 4DBHA 4CI0C 2DD5A 1X01A 4RTTA 4M78E 4HVVA 1YHQQ 2BE9B 1ABOA 1EZZB 5CKFA 1PKSA 2CZ7B 2BKDN 3V7RA 4EIKA 1I8FA 2R57A 3GOXA 3RBBB 2FEIA 2DNUA 2XICA 1AWJA 1Q7YC 2KT8A 5IHIA 1VQOT 4D8DA 3LGFA 2COYA 2FZGB 2EYQA 5GAOq 2EGEA 4F14A 2KE9A 1OI1A 1LNXA 2CT3A 3C4SA 1OZ3A 4RUGA 1DJ7B 4C0ZA 2FZKB 3SWNC 4FW1A 1LJOA 4JLIA 3VYHB 3R6OA 3EG9A 3M57A 2KSSA 2OTJQ 3M59A 4QVDA 4B9XA 3EH1A 4OMFB 3CC4A 2LVMA 1RADB 2HCKA 2OI3A 4OB0B 5GJVB 2DO3A 4M7AC 5KCOA 5KE2A 2ZGWA 1D1BA 2E65A 2KEAA 1HSQA 1PWTA 2VYTA 1CSKA 2EAYA 2QQ9A 2CZ0B 4LDXA 1G83A 3OA6A 1M2VA 4J7IA 4PJOF 4RTYA 3TQ7P 1M90U 2LT1A 2NUZA 2RJEA 2D6FA 1PG5B 3ZBDA 1H8KA 1OYXA 2MPXC 1ZA2B 5AYFA 2LQKA 3FLGA 3SB2A 1MHNA 2J6OA 2KT1A 2ZPIB 4C8QE 4O5VA 2EGCA 3DLMA 3I55T 4BE0A 1KJWA 1RABB 2E64A 1VQ4Q 5GAN4 2QDYB 4FYXB 1G3YA 1KD1U 4PFPA 4M77C 3HRUA 2CP2A 4BUGA 5CKDA 3JCMh 2VKNA 1KD1R 4WTOB 5KE3A 3CCVT 3VUBA 3VS2A 1M5Q1 1OU8A 1QVFS 2JNGA 5KYWA 3EGDB 1M30A 5LJ3j 3CC7T 4RKUE 1KSWA 2CZ1B 3CD6Q 4JRQA 2GTJA 4FT2A 1U1SA 3OYYA 1AWXA 4ANJA 1BCOA 2DVJA 5A0DA 2A7YA 3MEUA 3RNJA 3ZFJA 2DX1A 2E3IA 2KVQG 4LXCA 3PTAA 4J83A 1UGSB 5IN1A 4C92E 4IUQA 1K9MU 2M1HA 2IVWA 2YXYA 4QW2A 2H3EB 3H8ZA 3CC4T 2I0NA 4AFQC 1NPPA 1K9MR 2A37A 4HVWA 1NBEB 1V1CA 1M8VA 5LJ5j 3LWHA 2HQXA 3E9GA 1IRXA 1QVGA 1IZ6A 1KHCA 4RTXA 2EWNA 2RN8A 3L2UA 3H41A 1I81A 2EYYA 1M1KC 2YDLA 5DLOA 2YRDA 3EG9B 4OB2B 2WSEE 4KRTA 2FZCB 2HBPA 3H0FA 3OQ5A 1OZ2A 2F2XA 3CBOA 2OTLQ 2DVEA 3HP9A 3QO3A 4OB1B 2EGAA 1XQHA 2KRNA 3BFMA 1GCQC 1QVFP 1N8RU 1V76A 3OYHA 1N8RR 3CQTA 5CKEA 2QA4T 1TH7A 4QQ6A 4CC3A 3CCET 1WHHA 5HCKA 1M2VB 1WHJA 2GQVA 1J3TA 1IHVA 1K73C 1SG5A 3JCMd 2I2LA 2K3BA 3S3OA 2C0IA 2HKQB 3ULRB 1M2OA 4J9EA 4XQ3A 2BUDA 3EAEA 4Y91A 3QBYA 2DEUA 1OV3A 5LJ3e 1W2BA 1PHTA 1V29B 1D0ZA 1ZLMA 2HDAA 3M4YA 4ZN1A 2DXCA 2COWA 5KYUB 2LJ3A 1OPLA 1WQ7A 2J6KA 3PFSA 4PKCC 1TXQA 2CKKA 3OYLA 5IHKA 2MYSA 4E7JA 2QGFB 1PSEA 3FDRA 2LTOA 1JXOA 2OJ2A 2C06A 5FRMA 2LZ6B 1GFDA 2A36A 2D8JA 3RKYA 5IH2A 5GAOm 5LJ5e 1TWBA 2YSQA 1VQKA 4KULA 2QYZA 3G1JA 2QAZA 1CKAA 4N4GA 2RD1A 1WXBA 2E1HA 2LDMA 1IXDA 1PSFA 2DAQA 1VIEA 4KH1B 1WI7A 1N5ZA 2RB6A 4WCIA 2DRKA 3EG3A 3CCLA 2LCLA 4FIBA 1B34A 4A4FA 1Z9QA 3FJPA 1D1CA 5CVIA 3JCMX 2MOXA 2LJ1A 5CAIA 1UEBA 1PCXA 2BTTA 3L2QA 4LDWA 4J6XA 1IGUA 3GLXA 1U06A 2P84A 1WIEA 3S3NA 5AT1B 2YUQA 4X9DA 4XU1A 2IG0A 3CC2A 1T0JA 2K7AA 4A63B 4M7DA 3EG0A 2DILA 2EQMA 3H6ZA 1AOJA 5GMKl 2V8JA 2DL4A 4M78D 1UHFA 3M9QA 3SD4A 2EKOA 4QQDA 3CMAA 1RACB 1X2KA 4E47A 3VRZA 2FRYA 2J06A 1M90C 3I56Q 1AWWA 1JJ2A 2E41A 1TG0A 2DTOA 1WHMA 2RK2A 4JRKA 1AT1B 1FX7A 2O4XA 1VQNQ 1UGPB 2LJ0A 1Q7YR 3P8BB 1OQKA 4M75C 2X4XA 4LDYA 1I5LA 1YJWQ 4HCCA 4QQGA 2NUPA 1YI2Q 4XTWA 2KXDA 2X4JA 3KFVA 2VV5A 1VQKT 5KYYA 3BE3A 4J9HA 3MP8A 3G7ZA 4GY5A 3OYJA 2LT4A 4KH0B 3CXCA 5FWBA 5GJWB 4J9GA 4KBMB 1P92A 1BI3A 1VQ9T 4LDUA 2EVRA 1WHGA 3QPHA 4ZTJA 4DEXA 3CCLT 2X3XD 4M7DG 2ZPFB 4Z89A 2AZSA 3CMET 3M4GA 5CQYA 2RQUA 1NEBA 3VS7A 4II1A 1JB0E 1ZBXA 1Y57A 2VB6A 1TOVA 3QYGB 2KYMA 3LH0A 1I4K1 1MNEA 5KYXA 3CCST 1VQ7T 3A1PA 3L2ZA 3M56A 2QQAA 1QW1A 2DFUA 5HK3A 4M78C 1B34B 1Y96B 4DA4A 3FRNA 3L2RA 3OS5A 2SEMA 1OX9A 2CGHA 1RI9A 4BD3A 4IIMA 1D09B 1VQLT 3CMAT 2HQEA 1T0HA 2JTFA 1TSFA 4BE2A 3UA6A 5HY6A 1VQ5Q 1YJ9T 4J6WA 3V7CA 4M7DB 3T9NA 4E7IA 3GBQA 1RAIB 1IO6A 4Y28E 2RI3A 1GFCA 1RAGB 1QLYA 2F69A 4JDSA 4PJOA 2PTKA 3A98A 4M7AB 2CUBA 3CCJA 3PNWC 4F04B 1SRMA 2JM8A 5GAOp 1KQ2A 2JT4A 4DQ2A 1YCSB 5GMKe 1N9SA 1AHJB 5FU6C 3V8LA 2QK0A 1NYFA 1H92A 1RAHB 2BE7D 2O4XB 3PMTA 1CKBA 3BDLA 1BB9A 1Y07A 1HK9A 4OF1A 1OPKA 1UHCA 2NUPB 1B3QA 2CS7A 1LOJA 1RUWA 2DL8A 3I55Q 4LDVA 5KYYB 1G8XA 1SSHA 4OMLA 2DF6A 1VUBA 1BI0A 2BZYA 2CSIA 1VOMA 3ER0A 3JCMe 4C8QC 1M1KR 1JO8A 1QKWA 2HD0A 3META 2CYZB 2DXTA 4E7HA 2RQWA 4EDUA 3OYIA 3CCVQ 4R55A 2HKNA 3HRTA 3OYFA 1AD5A 2RJFA 3NGPA 1YJNT 2DKGA 3BY7A 4M7DF 4JJBA 1QCNA 3G4SA 3CC7Q 3A8LB 1Q95G 1A0NB 1K0XA 4PJOG 1TUCA 3FJ5A 4EPCA 2K3YA 2AHJB 1WXTA 3NPFA 5KYXB 4M7AF 1K73U 2J05A 1ZSZC 1G3SA 1NG2A 4LN2A 2HL5C 2CP6A 4OB3B 3MKDA 2KDSA 2SRCA 1K73R 2LMJA 3CC4Q 5CR2A 4C92C 3SFMA 1Y7XA 2YHTA 4MZMA 2WSCE 3C12A 1I5OB 2PUOB 3VS4A 3QDRB 5DM7R 3CPWS 2JW4A 2E12A 3L2VA 1O75A 1WDXA 2O9SA 2PVDB 3KBGA 5GAOn 1S72A 1N6AA 1PM3A 1RAEB 1PKTA 1K0SA 2M51A 4XU2A 1VQ6A 1M27C 1QVGS 2HZYA 2DMOA 1I1JA 3M0PA 4F7UA 1NEGA 4ZGEB 4C5EA 2QA4Q 1KQSA 1UE9A 3CCEQ 2QEXA 5J3BA 2XD0A 4OP0A 4M77D 1GBRA 4JPBW 1NLOC 3G71Q 1FYNA 4E6RA 2K2MA 1SHGA 3REBB 2JM9A 2V8IA 1XTDA 3VKIA 3CCRT 2R58A 5EC7A 3JCMV 3URGA 1VA7A 1VQPT 4JS4A 1M3BA 4J9IA 3G4ST 4ESRA 1MMNA 3ZL7C 4N0AA 4KUIA 4JZ4A 4BY6B 3CPWP 1FMWA 4HCKA 2A08A 4KGXB 2JMCA 5CO7A 1Q86C 3J7AF 2XI9A 2RH2A 2HSEB 1ZSGA 3BDUA 4XTYA 4E7SA 3MJXA 4NL2A 5FU7B 4F7UG 5L8RE 3X25B 3JRZA 4CC4B 3OS2A 2PU9B 5GMKh 1S1NA 1X75C 1YITA 3QSUA 1YIJT 5LJ5g 1M90R 1UFFA 5LJ3f 3JV3A 2F2VA 4FT4A 2O2OA 3TREA 3LWIA 1VQ6T 3GP8A 4A4EA 4J9CA 4M78A 3QDFA 3OY9A 2DZCA 4HA8A 5KYUA 2RQTA 4L59A 1WQWA 3OYDA 2FPDA 2ROTA 2QEXT 9ATCB 1PNJA 1YHQA 3MCAB 5GANh 3HTRA 4LUEA 1QWEA 3P8DA 3RMSA 1W6XA 2CT4A 5LJ5f 3C0CA 5IAYA 4X9CA 2M16A 2X9HA 4F7UB 3GF5A 2ZPBB 3M0RA 4ELYC 2YRCA 5A2QE 4GLKA 1K1ZA 1MNDA 3RKWA 4QT7A 5GAN7 2NUTA 1QWFA 4MMLA 2CH4A 2L0AA 4FYVB 1RAFB 4RTVA 3VUZA 2KY9A 1Q81C 1ACMB 4DBQA 3EFRA 1GRIA 2XG8D 2VASA 3TCJA 4VUBA 2ECZA 1D0XA 2OTJA 2H3JA 1BU1A 1TU0B 2VUBA 4MDWA 2YUPA 5C0MA 4RG2A 2HAXA 2KYBA 1AVZC 2JOYA 4HVUA 4XTZA 1KFZA 3PVQA 4QVCA 2X35A 2ATCB 2LQNA 2QASA 1VQKQ 3TVTA 4EMGA 5GAMh 2DBMA 5FW9A 1OX8A 2RI2A 3M54A 1M1FA
chains in the Genus database with same CATH topology
1RLQC 3PVLA 3VS0A 2DE0X 4X1VA 2KROA 4AFUC 3VRYA 1QKXA 1X2KA 3H0HA 3VRZA 5I11A 1ARKA 4FSSA 1BBZA 2FRYA 1GL5A 2HBWA 2RPNA 2GBQA 3IQLA 2J06A 4JZ3A 4RTZA 1MUZA 1AWWA 2GGRA 1UTIA 2FRWA 2J7IA 1TG0A 1WFWA 1SHFA 1T3LA 1VYTA 3M0TA 4RTWA 2CH4W 2BZ8A 2LP5A 2LJ0A 2OAWA 3THKA 2JMAA 1SEMA 3EG2A 2K9GA 1YWPA 2K79A 2AKLA 3I5RA 1K9AA 1MV3A 1EFNA 2KXDA 3KFVA 1JXMA 2KRSA 1WXUA 4J9HA 2A28A 2FPEA 2W10A 2RMOA 1SRLA 1WYXA 3O5ZA 2KXCA 2CUDA 5FWBA 4OMPA 5GJWB 4J9GA 5IXBA 1VYVA 2EVRA 3UF4A 4OMNA 4D8KA 4DEXA 2X3XD 4Z89A 4J9FA 2AZSA 1ZX6A 1ZUKA 2HEQA 2RQUA 3UA7A 1NEBA 3VS7A 1KIKA 1MV0B 2EBPA 1Y57A 2EW3A 2KYMA 2AK5A 2DL7A 2D8HA 1ABQA 3NMZC 1K76A 4ZNXA 2JS0A 3NHNA 2EYZA 2DYBA 2RNAA 5I22A 3M0SA 3EHRA 1E6HA 1YN8A 2XMFA 2GTOA 2FG0A 2AKKA 2P4RA 2SEMA 4GBQA 1LCKA 3I35A 5ECAA 1RI9A 1X6BA 2DLPA 4IIMA 1XOVA 1WA7A 4GLMA 1GBQA 3VS5A 1T0HA 4JJCA 1UUEA 3UA6A 1X6GA 2V1RA 2JS2A 1PRMC 3PE0A 2DA9A 3M0UA 2EQIA 4IIOA 1VYUA 3GBQA 2DJQA 1Z9ZA 2RQRA 1IO6A 2LQWA 2D0NA 1GFCA 4RTTA 4HVVA 2EYXA 1ABOA 2GQIA 2KGTA 1QLYA 2ESWA 2V1QA 1PKSA 1YP5A 2IIMA 2PTKA 3A98A 1TUDA 4EIKA 2CUBA 4Z8AA 2MCNA 2QDLA 3RBBB 1SRMA 2FEIA 2JM8A 2C0OA 2DNUA 2JT4A 1AWJA 3UATA 2KT8A 5IHIA 4D8DA 1YCSB 2L3QA 4CC2A 1NYFA 2EGEA 4F14A 1H92A 1G2BA 2KE9A 2FO0A 4Y92A 2CT3A 2DBKA 1CKBA 3H0IA 4M4ZA 4RUGA 5L23A 1BB9A 4HXJA 1OPKA 1UHCA 4RTUA 1AWOA 2F2WA 1B3QA 2L3SA 3LH5A 2KNBB 1RUWA 2DL8A 2KRMA 2NWMA 2OI3A 2HCKA 1SSHA 5GJVB 4OMLA 2DF6A 2ED0A 2BZYA 2CSIA 1JO8A 1QKWA 2L3PA 2KEAA 1PRLC 1W70A 2RQWA 1HSQA 1ZUUA 1PWTA 1UECA 1CSKA 1HJDA 3REAB 1AD5A 3QWXX 1G83A 3NGPA 4JJBA 4RTYA 3EG1A 2NUZA 2O9VA 1A0NB 4CC7A 1K0XA 4F17A 1TUCA 2YUNA 3FJ5A 2VVKA 1H8KA 1WX6A 2PZ1A 2G6FX 1WXTA 3NPFA 2JXBA 1E7OA 1YWOA 3I5SA 1AEYA 2LNHB 2J05A 2GNCA 2J6OA 2KT1A 1NG2A 4LN2A 2EYWA 1U3OA 2SRCA 2EGCA 1YNZA 1KJWA 2KBTA 2LMJA 2B86A 1JEGA 1UGVA 1U5SA 1ZUYA 4J9DA 1B07A 4K11A 2VKNA 2E5KA 3VS4A 3VS2A 1GFDA 2JW4A 3VS6A 1WDXA 1X27A 2O9SA 1M30A 1KSWA 3EHQA 2L2PA 2GTJA 1UDLA 1PKTA 1K0SA 1AWXA 2DL3A 2DVJA 2M51A 3RNJA 1M27C 2DX1A 2RQVA 4DEYA 2DMOA 1I1JA 3M0PA 2D1XA 1NEGA 2BZXA 3TSZA 2CSQA 4ORZA 1UE9A 2I0NA 4AFQC 2YT6A 2A37A 4HVWA 1GCQA 1V1CA 1AZGB 1GBRA 1BK2A 4JPBW 1NLOC 1I07A 3VS1A 1FYNA 4E6RA 2K2MA 1SHGA 3REBB 4RTXA 1QCFA 2DL5A 2JM9A 2RN8A 3H41A 2EYYA 5EC7A 1VA7A 2YDLA 1OEBA 4KRTA 1M3BA 3H0FA 4AG1C 1M8MA 2W0ZA 4J9IA 4ESRA 5IXFA 2F2XA 2KR3A 3ZL7C 2CDTA 1T3SA 4JZ4A 2LCSA 2EGAA 2KRNA 1GCQC 4HCKA 1UG1A 2A08A 1Y0MA 2JMCA 3CQTA 2LX7A 1HD3A 4CC3A 2RF0A 1JU5C 5HCKA 2O88A 1ZSGA 1FMKA 2YUOA 4J9BA 1UJYA 4Z88A 1J3TA 2H8HA 4R0KA 1E6GA 2K3BA 1K4US 2C0IA 3ULRB 4CC4B 4J9EA 1S1NA 5FWCA 2AZVA 2HSPA 1OV3A 1UFFA 1OOTA 1PHTA 1M3CA 1H3HA 4JJDA 1ZLMA 2HDAA 3JV3A 2F2VA 4AFZC 4OMQA 2O2OA 2LJ3A 2X3WD 1OPLA 2VWFA 2J6KA 1WLPB 4LE9A 2K6DA 4J9CA 1NM7A 3R6NA 5IHKA 1GCPA 1I0CA 1W1FA 2RQTA 1JXOA 2OJ2A 1ZBJA 2LZ6B 2FPDA 2A36A 2CREA 2D8JA 2ROTA 5IHNA 3VS3A 2M0YA 1PNJA 2ROLA 1AZEA 2JTEA 2J6FA 5IH2A 2DRMA 4LUEA 3TSWA 1QWEA 3QWYA 2YSQA 1W6XA 2CT4A 3C0CA 4AG2C 2C0TA 1CKAA 1JQQA 1WXBA 4AFSC 2DM1A 3EGUA 3M0RA 1M3AA 1X69A 1WI7A 4OMMA 3SHWA 1N5ZA 2O31A 1K1ZA 4WCIA 2DRKA 2PNIA 3EG3A 4QT7A 1QWFA 3I9QA 2CH4A 2L0AA 2ENMA 4RTVA 1Z9QA 3SEMA 1SPKA 1X43A 2MOXA 2LJ1A 1GRIA 2EKHA 2BTTA 4LNPA 3U23A 2ECZA 2ED1A 2MIOA 1RLPC 1BU1A 1UJ0A 4F16A 2YUPA 1U06A 2FPFA 1WIEA 3M0QA 1X2QA 2YUQA 2KYBA 1AVZC 2EPDA 1NYGA 1T0JA 2ABLA 2K7AA 4HVUA 4LUDA 1KFZA 3PVQA 4OMOA 4A63B 3EG0A 2DILA 2LQNA 1AOJA 3TVTA 1NLPC 2DBMA 2DL4A 5FW9A 1UHFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RLQ C;  3PVL A;  3VS0 A;  2DE0 X;  4X1V A;  2KRO A;  4AFU C;  3VRY A;  1QKX A;  1X2K A;  3H0H A;  3VRZ A;  5I11 A;  1ARK A;  4FSS A;  1BBZ A;  2FRY A;  1GL5 A;  2HBW A;  2RPN A;  2GBQ A;  3IQL A;  2J06 A;  4JZ3 A;  4RTZ A;  1MUZ A;  1AWW A;  2GGR A;  1UTI A;  2FRW A;  2J7I A;  1TG0 A;  1WFW A;  1SHF A;  1T3L A;  1VYT A;  3M0T A;  4RTW A;  2CH4 W;  2BZ8 A;  2LP5 A;  2LJ0 A;  2OAW A;  3THK A;  2JMA A;  1SEM A;  3EG2 A;  2K9G A;  1YWP A;  2K79 A;  2AKL A;  3I5R A;  1K9A A;  1MV3 A;  1EFN A;  2KXD A;  3KFV A;  1JXM A;  2KRS A;  1WXU A;  4J9H A;  2A28 A;  2FPE A;  2W10 A;  2RMO A;  1SRL A;  1WYX A;  3O5Z A;  2KXC A;  2CUD A;  5FWB A;  4OMP A;  5GJW B;  4J9G A;  5IXB A;  1VYV A;  2EVR A;  3UF4 A;  4OMN A;  4D8K A;  4DEX A;  2X3X D;  4Z89 A;  4J9F A;  2AZS A;  1ZX6 A;  1ZUK A;  2HEQ A;  2RQU A;  3UA7 A;  1NEB A;  3VS7 A;  1KIK A;  1MV0 B;  2EBP A;  1Y57 A;  2EW3 A;  2KYM A;  2AK5 A;  2DL7 A;  2D8H A;  1ABQ A;  3NMZ C;  1K76 A;  4ZNX A;  2JS0 A;  3NHN A;  2EYZ A;  2DYB A;  2RNA A;  5I22 A;  3M0S A;  3EHR A;  1E6H A;  1YN8 A;  2XMF A;  2GTO A;  2FG0 A;  2AKK A;  2P4R A;  2SEM A;  4GBQ A;  1LCK A;  3I35 A;  5ECA A;  1RI9 A;  1X6B A;  2DLP A;  4IIM A;  1XOV A;  1WA7 A;  4GLM A;  1GBQ A;  3VS5 A;  1T0H A;  4JJC A;  1UUE A;  3UA6 A;  1X6G A;  2V1R A;  2JS2 A;  1PRM C;  3PE0 A;  2DA9 A;  3M0U A;  2EQI A;  4IIO A;  1VYU A;  3GBQ A;  2DJQ A;  1Z9Z A;  2RQR A;  1IO6 A;  2LQW A;  2D0N A;  1GFC A;  4RTT A;  4HVV A;  2EYX A;  1ABO A;  2GQI A;  2KGT A;  1QLY A;  2ESW A;  2V1Q A;  1PKS A;  1YP5 A;  2IIM A;  2PTK A;  3A98 A;  1TUD A;  4EIK A;  2CUB A;  4Z8A A;  2MCN A;  2QDL A;  3RBB B;  1SRM A;  2FEI A;  2JM8 A;  2C0O A;  2DNU A;  2JT4 A;  1AWJ A;  3UAT A;  2KT8 A;  5IHI A;  4D8D A;  1YCS B;  2L3Q A;  4CC2 A;  1NYF A;  2EGE A;  4F14 A;  1H92 A;  1G2B A;  2KE9 A;  2FO0 A;  4Y92 A;  2CT3 A;  2DBK A;  1CKB A;  3H0I A;  4M4Z A;  4RUG A;  5L23 A;  1BB9 A;  4HXJ A;  1OPK A;  1UHC A;  4RTU A;  1AWO A;  2F2W A;  1B3Q A;  2L3S A;  3LH5 A;  2KNB B;  1RUW A;  2DL8 A;  2KRM A;  2NWM A;  2OI3 A;  2HCK A;  1SSH A;  5GJV B;  4OML A;  2DF6 A;  2ED0 A;  2BZY A;  2CSI A;  1JO8 A;  1QKW A;  2L3P A;  2KEA A;  1PRL C;  1W70 A;  2RQW A;  1HSQ A;  1ZUU A;  1PWT A;  1UEC A;  1CSK A;  1HJD A;  3REA B;  1AD5 A;  3QWX X;  1G83 A;  3NGP A;  4JJB A;  4RTY A;  3EG1 A;  2NUZ A;  2O9V A;  1A0N B;  4CC7 A;  1K0X A;  4F17 A;  1TUC A;  2YUN A;  3FJ5 A;  2VVK A;  1H8K A;  1WX6 A;  2PZ1 A;  2G6F X;  1WXT A;  3NPF A;  2JXB A;  1E7O A;  1YWO A;  3I5S A;  1AEY A;  2LNH B;  2J05 A;  2GNC A;  2J6O A;  2KT1 A;  1NG2 A;  4LN2 A;  2EYW A;  1U3O A;  2SRC A;  2EGC A;  1YNZ A;  1KJW A;  2KBT A;  2LMJ A;  2B86 A;  1JEG A;  1UGV A;  1U5S A;  1ZUY A;  4J9D A;  1B07 A;  4K11 A;  2VKN A;  2E5K A;  3VS4 A;  3VS2 A;  1GFD A;  2JW4 A;  3VS6 A;  1WDX A;  1X27 A;  2O9S A;  1M30 A;  1KSW A;  3EHQ A;  2L2P A;  2GTJ A;  1UDL A;  1PKT A;  1K0S A;  1AWX A;  2DL3 A;  2DVJ A;  2M51 A;  3RNJ A;  1M27 C;  2DX1 A;  2RQV A;  4DEY A;  2DMO A;  1I1J A;  3M0P A;  2D1X A;  1NEG A;  2BZX A;  3TSZ A;  2CSQ A;  4ORZ A;  1UE9 A;  2I0N A;  4AFQ C;  2YT6 A;  2A37 A;  4HVW A;  1GCQ A;  1V1C A;  1AZG B;  1GBR A;  1BK2 A;  4JPB W;  1NLO C;  1I07 A;  3VS1 A;  1FYN A;  4E6R A;  2K2M A;  1SHG A;  3REB B;  4RTX A;  1QCF A;  2DL5 A;  2JM9 A;  2RN8 A;  3H41 A;  2EYY A;  5EC7 A;  1VA7 A;  2YDL A;  1OEB A;  4KRT A;  1M3B A;  3H0F A;  4AG1 C;  1M8M A;  2W0Z A;  4J9I A;  4ESR A;  5IXF A;  2F2X A;  2KR3 A;  3ZL7 C;  2CDT A;  1T3S A;  4JZ4 A;  2LCS A;  2EGA A;  2KRN A;  1GCQ C;  4HCK A;  1UG1 A;  2A08 A;  1Y0M A;  2JMC A;  3CQT A;  2LX7 A;  1HD3 A;  4CC3 A;  2RF0 A;  1JU5 C;  5HCK A;  2O88 A;  1ZSG A;  1FMK A;  2YUO A;  4J9B A;  1UJY A;  4Z88 A;  1J3T A;  2H8H A;  4R0K A;  1E6G A;  2K3B A;  1K4U S;  2C0I A;  3ULR B;  4CC4 B;  4J9E A;  1S1N A;  5FWC A;  2AZV A;  2HSP A;  1OV3 A;  1UFF A;  1OOT A;  1PHT A;  1M3C A;  1H3H A;  4JJD A;  1ZLM A;  2HDA A;  3JV3 A;  2F2V A;  4AFZ C;  4OMQ A;  2O2O A;  2LJ3 A;  2X3W D;  1OPL A;  2VWF A;  2J6K A;  1WLP B;  4LE9 A;  2K6D A;  4J9C A;  1NM7 A;  3R6N A;  5IHK A;  1GCP A;  1I0C A;  1W1F A;  2RQT A;  1JXO A;  2OJ2 A;  1ZBJ A;  2LZ6 B;  2FPD A;  2A36 A;  2CRE A;  2D8J A;  2ROT A;  5IHN A;  3VS3 A;  2M0Y A;  1PNJ A;  2ROL A;  1AZE A;  2JTE A;  2J6F A;  5IH2 A;  2DRM A;  4LUE A;  3TSW A;  1QWE A;  3QWY A;  2YSQ A;  1W6X A;  2CT4 A;  3C0C A;  4AG2 C;  2C0T A;  1CKA A;  1JQQ A;  1WXB A;  4AFS C;  2DM1 A;  3EGU A;  3M0R A;  1M3A A;  1X69 A;  1WI7 A;  4OMM A;  3SHW A;  1N5Z A;  2O31 A;  1K1Z A;  4WCI A;  2DRK A;  2PNI A;  3EG3 A;  4QT7 A;  1QWF A;  3I9Q A;  2CH4 A;  2L0A A;  2ENM A;  4RTV A;  1Z9Q A;  3SEM A;  1SPK A;  1X43 A;  2MOX A;  2LJ1 A;  1GRI A;  2EKH A;  2BTT A;  4LNP A;  3U23 A;  2ECZ A;  2ED1 A;  2MIO A;  1RLP C;  1BU1 A;  1UJ0 A;  4F16 A;  2YUP A;  1U06 A;  2FPF A;  1WIE A;  3M0Q A;  1X2Q A;  2YUQ A;  2KYB A;  1AVZ C;  2EPD A;  1NYG A;  1T0J A;  2ABL A;  2K7A A;  4HVU A;  4LUD A;  1KFZ A;  3PVQ A;  4OMO A;  4A63 B;  3EG0 A;  2DIL A;  2LQN A;  1AOJ A;  3TVT A;  1NLP C;  2DBM A;  2DL4 A;  5FW9 A;  1UHF A; 
#chains in the Genus database with same CATH topology
 1RLQ C;  3PVL A;  4X1V A;  3FEO A;  2KRO A;  3JCM W;  1VQ9 Q;  1QKX A;  2VXF A;  4E7L A;  2QTV A;  3H0H A;  2RPN A;  3IQL A;  3QZ5 B;  4RTZ A;  3CME Q;  1UTI A;  5GAN 3;  5FRO A;  2Y4Y A;  3E9F A;  2QQS A;  1KC8 C;  1WFW A;  4F7U F;  1SHF A;  2PVG B;  2XK0 A;  1SEM A;  3EFS A;  3CCS Q;  1VQ7 Q;  5GAN d;  2K79 A;  2AKL A;  2EFI A;  1K9A A;  1G3W A;  3HFN A;  4PJM A;  2CP5 A;  1JXM A;  3OBY A;  1D0Y A;  3D7S B;  5D6W A;  3VYG A;  4M78 B;  2FPE A;  3LLR A;  3O5Z A;  3CCM Q;  4OMP A;  5IXB A;  1VYV A;  1VQL Q;  4OGC A;  3CMA Q;  2DEQ A;  4M7D E;  2RHX A;  5KYN A;  3OYK A;  4C0D C;  1YJ9 Q;  1K8A C;  2HEQ A;  4NOY A;  3UT1 A;  3HKS A;  1R77 A;  2K57 A;  4B9W A;  1QQJ A;  1MV0 B;  2EBP A;  2OTJ T;  2EW3 A;  4M75 D;  2AK5 A;  2VGN A;  3RMQ A;  1ABQ A;  1MMA A;  1K76 A;  4XAX B;  2NUT B;  5I22 A;  5D6X A;  3QUI A;  4CRI A;  4IKF A;  1YN8 A;  4J5Y A;  4NL3 A;  1RAA B;  2MI6 A;  5GAM d;  3QG1 A;  3I35 A;  3X26 B;  5ECA A;  3LX7 A;  3HSB A;  1KK7 A;  2DJZ A;  1X6B A;  1Y96 A;  2DLP A;  1QP2 A;  3QHS A;  5FU6 B;  1D3B A;  4GLM A;  3MP1 A;  2OTL A;  4PFZ A;  3CBM A;  4TVR A;  1BCM A;  1BI2 A;  3QKJ A;  5DY9 A;  3J80 E;  4Q5W A;  2V1R A;  3M5A A;  3PE0 A;  3MHX A;  4M78 F;  2EQI A;  2EJF A;  4IIO A;  4E2F B;  1VYU A;  4PK4 A;  1QVF A;  1H3Z A;  1N9R A;  2D0N A;  1BIB A;  4ME7 A;  5FLX E;  2EYX A;  2XID A;  2PVO B;  3SWN A;  2GQI A;  2ESW A;  2V1Q A;  2Y4X A;  1TS9 A;  3JCM Q;  2VC8 A;  1W4S A;  2COZ A;  5CK9 A;  4E7K A;  4XTU A;  2LCC A;  3JB9 D;  1YJN Q;  2M9U A;  4BI3 A;  4M7A A;  2L3Q A;  2P0P A;  4CC2 A;  1G2B A;  4Y92 A;  2P0Q A;  3RDV A;  3E19 A;  3CCU Q;  3AHU A;  4C0G A;  1KHI A;  1AWO A;  3A5Z B;  2M0O A;  2F2W A;  4UC4 A;  2L3S A;  3RR6 A;  3LH5 A;  1WPY A;  2KNB B;  1M9S A;  2KRM A;  2NWM A;  3OMG A;  1R0B G;  4C0F A;  2PUK B;  3LW5 E;  3JCM f;  3S6W A;  1W70 A;  5GMK j;  4PLI A;  1ZUU A;  4ELZ C;  1UEC A;  5DLQ E;  2E6Z A;  3S3M A;  2DER A;  1H64 1;  4PJN A;  4M77 A;  3JAM E;  1Q86 U;  3VU3 C;  3J81 E;  4CC7 A;  3EH2 A;  4PJO E;  4F17 A;  3NTK A;  1IB8 A;  2VVK A;  1Q86 R;  4OVA A;  5A0L A;  1YWO A;  5HKC A;  3GIB A;  2OTL T;  1BYM A;  1HXD A;  4KGZ B;  3VJP A;  4QVZ A;  3EFO A;  4M7A G;  3OYB A;  1XJW B;  2VGM A;  1YCY A;  5CQX A;  2KBT A;  3E1S A;  2B86 A;  2L8D A;  5I2M A;  1JEG A;  5GAN j;  1U5S A;  3CC2 T;  4J9D A;  4C8Q D;  3DLL A;  2F1L A;  4DOW A;  4XTV A;  5GAN 2;  1D3B B;  4K11 A;  4QKU A;  1VQO Q;  2E5K A;  4J7F A;  4DBF A;  2ZAE A;  4HT8 A;  3NFC A;  4C5I A;  1VQ8 A;  2K5F A;  3VS6 A;  2EIF A;  3CCR Q;  1JRI A;  1IHW A;  1VQP Q;  3AT1 B;  3MP6 A;  4FCY A;  1NJI U;  1UDL A;  5LL6 S;  2FHD A;  1F1B B;  3SWN B;  4PNO A;  1MGQ A;  2V8K A;  2RQV A;  1HYO A;  1QCO A;  2F5K A;  3JB9 J;  4L5G A;  3I56 A;  2BZX A;  3TSZ A;  1PD1 A;  2R5A A;  4M77 G;  2CSQ A;  4ORZ A;  4AMC A;  2JUF A;  3CEY A;  2YT6 A;  1GCQ A;  1VQN A;  2E6N A;  4C92 D;  1TUG B;  2RK1 A;  1BK2 A;  4RMO A;  3O8V A;  5GMK m;  3F70 A;  3QXE B;  1YJW A;  5GAM j;  1Q81 U;  2DL5 A;  1B7T A;  5KH6 A;  2YRV A;  3JCM c;  1Q81 R;  1KG1 A;  4ZN3 A;  1YIJ Q;  2XKO C;  2W0Z A;  5IXF A;  2HMA A;  4FM4 B;  2CDT A;  2YLB A;  2LCS A;  5M9O A;  3RES A;  1UG1 A;  1VQ6 Q;  1Y0M A;  2LX7 A;  3OYA A;  2MF2 A;  2RF0 A;  4NS5 A;  1LPL A;  3N5B B;  4KGV B;  5GAN e;  2QEX Q;  4M77 B;  1FMK A;  3RUX A;  2YUO A;  4J9B A;  1UJY A;  4R56 A;  4Z88 A;  4RCB A;  4F7U E;  1C1A A;  1E6G A;  1WHK A;  3JB9 I;  2XHC A;  3CCQ A;  1K4U S;  3ASK A;  2E10 A;  2AZV A;  1KC8 U;  1VQ8 T;  3EFO B;  4PL6 A;  4A4G A;  5CCA A;  4JJD A;  5CKH A;  3QYH B;  1KC8 R;  2JN0 A;  2WAC A;  5I21 A;  3UDC A;  3PIO A;  2KQW A;  1NM7 A;  3R6N A;  1EX4 A;  3BW1 A;  1VQ5 A;  3I56 T;  2CP3 A;  2KI7 A;  2D0Q B;  8AT1 B;  3OYE A;  1ZBJ A;  5EG2 A;  3VS3 A;  2CRE A;  2ROL A;  2ZPH B;  4JUV A;  2J6F A;  3CCJ T;  2DRM A;  3TSW A;  3QWY A;  2LNV A;  5GAM e;  1YJW T;  2OAU A;  2C0T A;  3QII A;  5I2S A;  1K8A U;  4RCC A;  3UPU A;  3EGU A;  1R8O B;  1M3A A;  1X69 A;  1Q82 C;  1K8A R;  2LX9 A;  3DB3 A;  1OUL A;  4OMM A;  2DTI A;  4M77 F;  2XDB A;  3OBW A;  4BDZ A;  3SEM A;  1SPK A;  3DKM A;  1NPR A;  1PC0 A;  2FVU A;  4LNP A;  3U23 A;  2MIO A;  1RLP C;  3I55 A;  4EMK C;  1UJ0 A;  4F16 A;  2EQJ A;  4B6M A;  3M0Q A;  1X2Q A;  2DD4 A;  4P5N A;  2HQH A;  4EMH A;  1OU9 A;  3L1A A;  1NYG A;  2RA2 A;  5CIU A;  4OMO A;  3CCV A;  5CKB A;  1VQM A;  2AIR B;  3CCQ T;  1IRE B;  4M75 A;  2RHZ A;  3E2U A;  4HCB A;  1BI1 A;  3CC7 A;  4FSX A;  1UGQ B;  1SSF A;  4A4H A;  5LJ3 g;  1WGS A;  3NTH A;  3VRY A;  2YWW A;  3OYN A;  2EJ9 A;  5I11 A;  4FSS A;  3OW2 A;  1BBZ A;  4IUR A;  2HBW A;  2DK3 A;  2ZCF B;  4HKE A;  2EQK A;  2YLC A;  1FMV A;  2GGR A;  1W2B S;  2J7I A;  3INZ A;  1QVG P;  3RIR A;  4C0D B;  1T3L A;  4M7D C;  3M0T A;  1VQ5 T;  4RTW A;  3THK A;  2BZ8 A;  3HRS A;  4BB7 A;  3G6E A;  3JB9 H;  3OYM A;  3EG2 A;  1SF9 A;  1M1G A;  1YWP A;  2K9G A;  3ME9 A;  3MEW A;  3I5R A;  2ZPE B;  4MDX A;  1EFN A;  3MO8 A;  1S72 T;  2W10 A;  4MMK A;  2RMO A;  3QJ6 A;  2DXB A;  2KXC A;  3M53 A;  3M55 A;  2CUD A;  2P4T A;  4LD9 K;  4FU6 A;  2X4Y A;  3MEV A;  3OB9 A;  4KUD K;  3JCM b;  8ATC B;  3JSC A;  7AT1 B;  1UB4 A;  1WJR A;  1ZX6 A;  1ZUK A;  1NJI C;  4M75 G;  4BE1 A;  1RI0 A;  2QA4 A;  4PJO D;  3WVD B;  3CCE A;  2K4Y A;  2KAF A;  2PQW A;  1QMC A;  2D8H A;  5D7U A;  3PIP A;  1W2B P;  3G71 A;  1TTH B;  5IT9 E;  1BKB A;  3EHR A;  1E6H A;  4FL6 A;  2XMF A;  2RM4 A;  2GTO A;  3WXM B;  1WHL A;  2FG0 A;  2RO0 A;  5GMK i;  5GAO l;  1U8R A;  2P4R A;  1VQM T;  1D1A A;  3GPL A;  2JZ2 A;  5FRN A;  1G5V A;  3ZEH A;  2RHY A;  4E7Z A;  3KUF A;  1WA7 A;  3X20 B;  3FIF A;  2RHU A;  2JS2 A;  3LGL A;  1PRM C;  1SKU B;  3M0U A;  1WZO A;  1ZQ1 A;  3CPW A;  1JBM A;  4JRP A;  4DBR A;  2LQW A;  4M75 B;  4M78 G;  3G6E T;  5GAN 5;  2KGT A;  1X6O A;  4HT9 A;  1YP5 A;  4DOV A;  1JJ2 S;  2IIM A;  3JB9 G;  2K3X A;  1TUD A;  4Z8A A;  2MCN A;  2JJ9 A;  1M4Z A;  1UGR B;  2QDL A;  3VV0 A;  2C0O A;  1YIT T;  3UAT A;  3JCM J;  4IUP A;  3Q1J A;  4PJL A;  4C8Q A;  5GAN 6;  1MMG A;  2FO0 A;  2DBK A;  3CCL Q;  3H0I A;  4M4Z A;  5L23 A;  4HXJ A;  4MZT A;  1XNI A;  2DYI A;  2CP7 A;  5GAO r;  4RTU A;  4PJO C;  1BIA A;  3CXC S;  2RJD A;  1VQ4 A;  2FB7 A;  4LD6 A;  1YHQ T;  2ED0 A;  4XU3 A;  3CC2 Q;  2O01 E;  2CZ6 B;  2L3P A;  1ZSZ A;  1PRL C;  1GXI E;  2E70 A;  3GNF B;  3L42 A;  3G71 T;  1HJD A;  3REA B;  3QWX X;  3CD6 A;  3V8J A;  1G3T A;  4C92 A;  3TU4 K;  2DTH A;  5HK0 A;  2K2V A;  1EIF A;  2MAM A;  3EG1 A;  2O9V A;  4M75 F;  1JJ2 P;  2YUN A;  3WVE B;  1Y71 A;  1WX6 A;  2PZ1 A;  2G6F X;  4A4K A;  4BY6 C;  3TEE A;  2QTX A;  2JXB A;  1E7O A;  3I5S A;  4N4I A;  1AEY A;  2AT1 B;  2LNH B;  2GNC A;  4M7A E;  2EYW A;  1U3O A;  4C8Q G;  2MMP A;  1YNZ A;  2GFU A;  2HNI A;  3EGX A;  4ATO A;  1FWZ A;  3NTI A;  1UGV A;  1PD0 A;  1ZUY A;  2MWO A;  2JTM A;  1B07 A;  2QQR A;  5KYW B;  4AT1 B;  1NE8 A;  3CXC P;  4X34 A;  2JVV A;  5FU7 C;  4O6J A;  1WJQ A;  2L5Q A;  2G3R A;  2BIV A;  1X27 A;  3EHQ A;  2L2P A;  4JLG A;  1RL2 A;  2NYS A;  4EMK A;  4Z02 A;  4OGE A;  2DL3 A;  1VQ9 A;  3UWN A;  4DEY A;  1ZA1 B;  4A54 A;  2D1X A;  4C92 G;  3JCM P;  3CME A;  4M77 E;  3JB9 F;  3HFO A;  4FYY B;  1VQ4 T;  2GCX A;  1Q82 U;  4C8Q B;  2A0F B;  2L3R A;  1AZG B;  4JRI A;  4IUT A;  1I07 A;  3VS1 A;  3JCM g;  1R0C B;  1Q82 R;  3CCS A;  1VQ7 A;  4FYW B;  1QCF A;  3HL8 A;  5GAN g;  2Z0W A;  1N27 A;  1OEB A;  1VQ8 Q;  3CD6 T;  4AG1 C;  1M8M A;  3CCM A;  2KR3 A;  3PGG A;  1T3S A;  1VQL A;  3FB9 A;  4WF2 A;  2LQ8 A;  2E3H A;  1ZSZ B;  1NZ9 A;  2RJC A;  2K5L A;  3OS0 A;  3L2W A;  6AT1 B;  1HD3 A;  1YJ9 A;  3QJY A;  1JU5 C;  4C92 B;  1Q7Y U;  2O88 A;  4RG8 A;  3CBP A;  5GAN f;  3GNG A;  3CCJ Q;  2R5M A;  4N0A C;  2H8H A;  4R0K A;  4L6V 5;  3PMI A;  4J6Y A;  1YBY A;  2QG9 B;  2EJG A;  3PT9 A;  5FWC A;  1C6V X;  2HSP A;  2MK5 A;  1OOT A;  1M3C A;  3C94 A;  1H3H A;  1KD1 C;  3EGX B;  5GAM g;  4C8Q F;  2KK4 A;  4AFZ C;  2FYK A;  4OMQ A;  1QVP A;  3QZ9 B;  2X3W D;  2VWF A;  1WLP B;  4JJN K;  3OSV A;  4LE9 A;  1KQ1 A;  2K6D A;  1GCP A;  1I0C A;  1FXX A;  1W1F A;  2KMT A;  4ZGD B;  1WJS A;  3C95 A;  3A8G B;  1AZE A;  5IHN A;  2M0Y A;  2Y90 A;  2JTE A;  4JS5 A;  3M58 A;  4IUU A;  4XU0 A;  4EMK B;  2QGG A;  2L89 A;  4AG2 C;  1KQS S;  5GAM f;  2X51 A;  1K9M C;  3CCQ Q;  3G4S Q;  1JQQ A;  4AFS C;  1LVK A;  2DM1 A;  4V2S A;  3RER A;  1YJN A;  1NJI R;  4C92 F;  3SHW A;  2F5T X;  2O31 A;  4PFO A;  2ZZD A;  1MMD A;  2A3L A;  1U1T A;  2GF7 A;  2QI2 A;  2PNI A;  5LJ3 h;  3CCM T;  4YTL A;  3I9Q A;  2B8A A;  4IUV A;  2ENM A;  1C0M A;  3CCU A;  4BI4 A;  2GFA A;  1X43 A;  2D9T A;  2EKH A;  2ED1 A;  3A8O B;  4HCZ A;  2E4H A;  2FPF A;  2X4W A;  2XDD A;  1YI2 A;  4C5H A;  3OYG A;  1N8R C;  2K5I A;  4PLL A;  2EPD A;  2ABL A;  3OW2 S;  4LUD A;  3H9N A;  3OS1 A;  2CP0 A;  5LJ5 h;  1VIF A;  1S72 Q;  5KCH A;  2LRQ A;  1NLP C;  4PJJ A;  2DET A;  2V26 A;  2FL7 A;  3VS0 A;  2DE0 X;  4AFU C;  1KQS P;  1ARK A;  3MPU B;  1O9S A;  2XU8 A;  1GL5 A;  2GBQ A;  4JZ3 A;  4BI8 B;  1MUZ A;  5J26 A;  5GAN 8;  4D6W A;  2E5Q A;  2FRW A;  1VYT A;  3V8K A;  2CH4 W;  2LP5 A;  2OAW A;  2M02 A;  2JMA A;  3X24 B;  3RKX A;  3MEA A;  1M1K U;  3FC3 A;  3OYC A;  3OMC A;  1MV3 A;  1VQO A;  5C6S A;  2KRS A;  1WXU A;  2OX7 A;  3LYI A;  2A28 A;  2DPP B;  2NLU A;  1VQM Q;  1SRL A;  1WYX A;  3CCR A;  5J39 A;  3A8M B;  4MZP A;  1VQP A;  2RI5 A;  3OW2 P;  5LJ3 d;  3UF4 A;  3HHT B;  4OMN A;  4D8K A;  4FW2 A;  2MWP A;  4J9F A;  3CCU T;  3SDZ A;  3DB4 A;  4A53 A;  4M75 E;  2P0K A;  1WNL A;  3UA7 A;  3P8H A;  4N4H A;  2VXE A;  4ZGJ B;  4J8O A;  1KIK A;  4M7D D;  1VQN T;  4XK8 E;  4BAC A;  3G6E Q;  2XDP A;  2DL7 A;  3CPF A;  3NMZ C;  4ZNX A;  2JS0 A;  1YI2 T;  3NHN A;  2EYZ A;  2DYB A;  2HL3 A;  2RNA A;  1YFN A;  4M7A D;  3M0S A;  2EQU A;  3KXT A;  1QP3 A;  5LJ5 d;  1YIT Q;  2LC4 A;  2AKK A;  4ZTF A;  4GBQ A;  4KT0 E;  2DIG A;  1LCK A;  4XTX A;  2QQB A;  3V7S A;  1YIJ A;  1XOV A;  2DIQ A;  1GBQ A;  2RHI A;  2WSF E;  5A0G A;  3VS5 A;  4JJC A;  3HPW A;  1ZHI A;  1UUE A;  5D6Y A;  2DZ9 A;  3OSS C;  3X28 B;  1X6G A;  2IPO B;  3EGD A;  2DXU A;  2DA9 A;  1IGQ A;  2QXF A;  4PJO B;  4BDY A;  2DJQ A;  1Z9Z A;  2ZPG B;  2RQR A;  3A8H B;  4C5G A;  4DBH A;  4CI0 C;  2DD5 A;  1X01 A;  4RTT A;  4M78 E;  4HVV A;  1YHQ Q;  2BE9 B;  1ABO A;  1EZZ B;  5CKF A;  1PKS A;  2CZ7 B;  2BKD N;  3V7R A;  4EIK A;  1I8F A;  2R57 A;  3GOX A;  3RBB B;  2FEI A;  2DNU A;  2XIC A;  1AWJ A;  1Q7Y C;  2KT8 A;  5IHI A;  1VQO T;  4D8D A;  3LGF A;  2COY A;  2FZG B;  2EYQ A;  5GAO q;  2EGE A;  4F14 A;  2KE9 A;  1OI1 A;  1LNX A;  2CT3 A;  3C4S A;  1OZ3 A;  4RUG A;  1DJ7 B;  4C0Z A;  2FZK B;  3SWN C;  4FW1 A;  1LJO A;  4JLI A;  3VYH B;  3R6O A;  3EG9 A;  3M57 A;  2KSS A;  2OTJ Q;  3M59 A;  4QVD A;  4B9X A;  3EH1 A;  4OMF B;  3CC4 A;  2LVM A;  1RAD B;  2HCK A;  2OI3 A;  4OB0 B;  5GJV B;  2DO3 A;  4M7A C;  5KCO A;  5KE2 A;  2ZGW A;  1D1B A;  2E65 A;  2KEA A;  1HSQ A;  1PWT A;  2VYT A;  1CSK A;  2EAY A;  2QQ9 A;  2CZ0 B;  4LDX A;  1G83 A;  3OA6 A;  1M2V A;  4J7I A;  4PJO F;  4RTY A;  3TQ7 P;  1M90 U;  2LT1 A;  2NUZ A;  2RJE A;  2D6F A;  1PG5 B;  3ZBD A;  1H8K A;  1OYX A;  2MPX C;  1ZA2 B;  5AYF A;  2LQK A;  3FLG A;  3SB2 A;  1MHN A;  2J6O A;  2KT1 A;  2ZPI B;  4C8Q E;  4O5V A;  2EGC A;  3DLM A;  3I55 T;  4BE0 A;  1KJW A;  1RAB B;  2E64 A;  1VQ4 Q;  5GAN 4;  2QDY B;  4FYX B;  1G3Y A;  1KD1 U;  4PFP A;  4M77 C;  3HRU A;  2CP2 A;  4BUG A;  5CKD A;  3JCM h;  2VKN A;  1KD1 R;  4WTO B;  5KE3 A;  3CCV T;  3VUB A;  3VS2 A;  1M5Q 1;  1OU8 A;  1QVF S;  2JNG A;  5KYW A;  3EGD B;  1M30 A;  5LJ3 j;  3CC7 T;  4RKU E;  1KSW A;  2CZ1 B;  3CD6 Q;  4JRQ A;  2GTJ A;  4FT2 A;  1U1S A;  3OYY A;  1AWX A;  4ANJ A;  1BCO A;  2DVJ A;  5A0D A;  2A7Y A;  3MEU A;  3RNJ A;  3ZFJ A;  2DX1 A;  2E3I A;  2KVQ G;  4LXC A;  3PTA A;  4J83 A;  1UGS B;  5IN1 A;  4C92 E;  4IUQ A;  1K9M U;  2M1H A;  2IVW A;  2YXY A;  4QW2 A;  2H3E B;  3H8Z A;  3CC4 T;  2I0N A;  4AFQ C;  1NPP A;  1K9M R;  2A37 A;  4HVW A;  1NBE B;  1V1C A;  1M8V A;  5LJ5 j;  3LWH A;  2HQX A;  3E9G A;  1IRX A;  1QVG A;  1IZ6 A;  1KHC A;  4RTX A;  2EWN A;  2RN8 A;  3L2U A;  3H41 A;  1I81 A;  2EYY A;  1M1K C;  2YDL A;  5DLO A;  2YRD A;  3EG9 B;  4OB2 B;  2WSE E;  4KRT A;  2FZC B;  2HBP A;  3H0F A;  3OQ5 A;  1OZ2 A;  2F2X A;  3CBO A;  2OTL Q;  2DVE A;  3HP9 A;  3QO3 A;  4OB1 B;  2EGA A;  1XQH A;  2KRN A;  3BFM A;  1GCQ C;  1QVF P;  1N8R U;  1V76 A;  3OYH A;  1N8R R;  3CQT A;  5CKE A;  2QA4 T;  1TH7 A;  4QQ6 A;  4CC3 A;  3CCE T;  1WHH A;  5HCK A;  1M2V B;  1WHJ A;  2GQV A;  1J3T A;  1IHV A;  1K73 C;  1SG5 A;  3JCM d;  2I2L A;  2K3B A;  3S3O A;  2C0I A;  2HKQ B;  3ULR B;  1M2O A;  4J9E A;  4XQ3 A;  2BUD A;  3EAE A;  4Y91 A;  3QBY A;  2DEU A;  1OV3 A;  5LJ3 e;  1W2B A;  1PHT A;  1V29 B;  1D0Z A;  1ZLM A;  2HDA A;  3M4Y A;  4ZN1 A;  2DXC A;  2COW A;  5KYU B;  2LJ3 A;  1OPL A;  1WQ7 A;  2J6K A;  3PFS A;  4PKC C;  1TXQ A;  2CKK A;  3OYL A;  5IHK A;  2MYS A;  4E7J A;  2QGF B;  1PSE A;  3FDR A;  2LTO A;  1JXO A;  2OJ2 A;  2C06 A;  5FRM A;  2LZ6 B;  1GFD A;  2A36 A;  2D8J A;  3RKY A;  5IH2 A;  5GAO m;  5LJ5 e;  1TWB A;  2YSQ A;  1VQK A;  4KUL A;  2QYZ A;  3G1J A;  2QAZ A;  1CKA A;  4N4G A;  2RD1 A;  1WXB A;  2E1H A;  2LDM A;  1IXD A;  1PSF A;  2DAQ A;  1VIE A;  4KH1 B;  1WI7 A;  1N5Z A;  2RB6 A;  4WCI A;  2DRK A;  3EG3 A;  3CCL A;  2LCL A;  4FIB A;  1B34 A;  4A4F A;  1Z9Q A;  3FJP A;  1D1C A;  5CVI A;  3JCM X;  2MOX A;  2LJ1 A;  5CAI A;  1UEB A;  1PCX A;  2BTT A;  3L2Q A;  4LDW A;  4J6X A;  1IGU A;  3GLX A;  1U06 A;  2P84 A;  1WIE A;  3S3N A;  5AT1 B;  2YUQ A;  4X9D A;  4XU1 A;  2IG0 A;  3CC2 A;  1T0J A;  2K7A A;  4A63 B;  4M7D A;  3EG0 A;  2DIL A;  2EQM A;  3H6Z A;  1AOJ A;  5GMK l;  2V8J A;  2DL4 A;  4M78 D;  1UHF A;  3M9Q A;  3SD4 A;  2EKO A;  4QQD A;  3CMA A;  1RAC B;  1X2K A;  4E47 A;  3VRZ A;  2FRY A;  2J06 A;  1M90 C;  3I56 Q;  1AWW A;  1JJ2 A;  2E41 A;  1TG0 A;  2DTO A;  1WHM A;  2RK2 A;  4JRK A;  1AT1 B;  1FX7 A;  2O4X A;  1VQN Q;  1UGP B;  2LJ0 A;  1Q7Y R;  3P8B B;  1OQK A;  4M75 C;  2X4X A;  4LDY A;  1I5L A;  1YJW Q;  4HCC A;  4QQG A;  2NUP A;  1YI2 Q;  4XTW A;  2KXD A;  2X4J A;  3KFV A;  2VV5 A;  1VQK T;  5KYY A;  3BE3 A;  4J9H A;  3MP8 A;  3G7Z A;  4GY5 A;  3OYJ A;  2LT4 A;  4KH0 B;  3CXC A;  5FWB A;  5GJW B;  4J9G A;  4KBM B;  1P92 A;  1BI3 A;  1VQ9 T;  4LDU A;  2EVR A;  1WHG A;  3QPH A;  4ZTJ A;  4DEX A;  3CCL T;  2X3X D;  4M7D G;  2ZPF B;  4Z89 A;  2AZS A;  3CME T;  3M4G A;  5CQY A;  2RQU A;  1NEB A;  3VS7 A;  4II1 A;  1JB0 E;  1ZBX A;  1Y57 A;  2VB6 A;  1TOV A;  3QYG B;  2KYM A;  3LH0 A;  1I4K 1;  1MNE A;  5KYX A;  3CCS T;  1VQ7 T;  3A1P A;  3L2Z A;  3M56 A;  2QQA A;  1QW1 A;  2DFU A;  5HK3 A;  4M78 C;  1B34 B;  1Y96 B;  4DA4 A;  3FRN A;  3L2R A;  3OS5 A;  2SEM A;  1OX9 A;  2CGH A;  1RI9 A;  4BD3 A;  4IIM A;  1D09 B;  1VQL T;  3CMA T;  2HQE A;  1T0H A;  2JTF A;  1TSF A;  4BE2 A;  3UA6 A;  5HY6 A;  1VQ5 Q;  1YJ9 T;  4J6W A;  3V7C A;  4M7D B;  3T9N A;  4E7I A;  3GBQ A;  1RAI B;  1IO6 A;  4Y28 E;  2RI3 A;  1GFC A;  1RAG B;  1QLY A;  2F69 A;  4JDS A;  4PJO A;  2PTK A;  3A98 A;  4M7A B;  2CUB A;  3CCJ A;  3PNW C;  4F04 B;  1SRM A;  2JM8 A;  5GAO p;  1KQ2 A;  2JT4 A;  4DQ2 A;  1YCS B;  5GMK e;  1N9S A;  1AHJ B;  5FU6 C;  3V8L A;  2QK0 A;  1NYF A;  1H92 A;  1RAH B;  2BE7 D;  2O4X B;  3PMT A;  1CKB A;  3BDL A;  1BB9 A;  1Y07 A;  1HK9 A;  4OF1 A;  1OPK A;  1UHC A;  2NUP B;  1B3Q A;  2CS7 A;  1LOJ A;  1RUW A;  2DL8 A;  3I55 Q;  4LDV A;  5KYY B;  1G8X A;  1SSH A;  4OML A;  2DF6 A;  1VUB A;  1BI0 A;  2BZY A;  2CSI A;  1VOM A;  3ER0 A;  3JCM e;  4C8Q C;  1M1K R;  1JO8 A;  1QKW A;  2HD0 A;  3MET A;  2CYZ B;  2DXT A;  4E7H A;  2RQW A;  4EDU A;  3OYI A;  3CCV Q;  4R55 A;  2HKN A;  3HRT A;  3OYF A;  1AD5 A;  2RJF A;  3NGP A;  1YJN T;  2DKG A;  3BY7 A;  4M7D F;  4JJB A;  1QCN A;  3G4S A;  3CC7 Q;  3A8L B;  1Q95 G;  1A0N B;  1K0X A;  4PJO G;  1TUC A;  3FJ5 A;  4EPC A;  2K3Y A;  2AHJ B;  1WXT A;  3NPF A;  5KYX B;  4M7A F;  1K73 U;  2J05 A;  1ZSZ C;  1G3S A;  1NG2 A;  4LN2 A;  2HL5 C;  2CP6 A;  4OB3 B;  3MKD A;  2KDS A;  2SRC A;  1K73 R;  2LMJ A;  3CC4 Q;  5CR2 A;  4C92 C;  3SFM A;  1Y7X A;  2YHT A;  4MZM A;  2WSC E;  3C12 A;  1I5O B;  2PUO B;  3VS4 A;  3QDR B;  5DM7 R;  3CPW S;  2JW4 A;  2E12 A;  3L2V A;  1O75 A;  1WDX A;  2O9S A;  2PVD B;  3KBG A;  5GAO n;  1S72 A;  1N6A A;  1PM3 A;  1RAE B;  1PKT A;  1K0S A;  2M51 A;  4XU2 A;  1VQ6 A;  1M27 C;  1QVG S;  2HZY A;  2DMO A;  1I1J A;  3M0P A;  4F7U A;  1NEG A;  4ZGE B;  4C5E A;  2QA4 Q;  1KQS A;  1UE9 A;  3CCE Q;  2QEX A;  5J3B A;  2XD0 A;  4OP0 A;  4M77 D;  1GBR A;  4JPB W;  1NLO C;  3G71 Q;  1FYN A;  4E6R A;  2K2M A;  1SHG A;  3REB B;  2JM9 A;  2V8I A;  1XTD A;  3VKI A;  3CCR T;  2R58 A;  5EC7 A;  3JCM V;  3URG A;  1VA7 A;  1VQP T;  4JS4 A;  1M3B A;  4J9I A;  3G4S T;  4ESR A;  1MMN A;  3ZL7 C;  4N0A A;  4KUI A;  4JZ4 A;  4BY6 B;  3CPW P;  1FMW A;  4HCK A;  2A08 A;  4KGX B;  2JMC A;  5CO7 A;  1Q86 C;  3J7A F;  2XI9 A;  2RH2 A;  2HSE B;  1ZSG A;  3BDU A;  4XTY A;  4E7S A;  3MJX A;  4NL2 A;  5FU7 B;  4F7U G;  5L8R E;  3X25 B;  3JRZ A;  4CC4 B;  3OS2 A;  2PU9 B;  5GMK h;  1S1N A;  1X75 C;  1YIT A;  3QSU A;  1YIJ T;  5LJ5 g;  1M90 R;  1UFF A;  5LJ3 f;  3JV3 A;  2F2V A;  4FT4 A;  2O2O A;  3TRE A;  3LWI A;  1VQ6 T;  3GP8 A;  4A4E A;  4J9C A;  4M78 A;  3QDF A;  3OY9 A;  2DZC A;  4HA8 A;  5KYU A;  2RQT A;  4L59 A;  1WQW A;  3OYD A;  2FPD A;  2ROT A;  2QEX T;  9ATC B;  1PNJ A;  1YHQ A;  3MCA B;  5GAN h;  3HTR A;  4LUE A;  1QWE A;  3P8D A;  3RMS A;  1W6X A;  2CT4 A;  5LJ5 f;  3C0C A;  5IAY A;  4X9C A;  2M16 A;  2X9H A;  4F7U B;  3GF5 A;  2ZPB B;  3M0R A;  4ELY C;  2YRC A;  5A2Q E;  4GLK A;  1K1Z A;  1MND A;  3RKW A;  4QT7 A;  5GAN 7;  2NUT A;  1QWF A;  4MML A;  2CH4 A;  2L0A A;  4FYV B;  1RAF B;  4RTV A;  3VUZ A;  2KY9 A;  1Q81 C;  1ACM B;  4DBQ A;  3EFR A;  1GRI A;  2XG8 D;  2VAS A;  3TCJ A;  4VUB A;  2ECZ A;  1D0X A;  2OTJ A;  2H3J A;  1BU1 A;  1TU0 B;  2VUB A;  4MDW A;  2YUP A;  5C0M A;  4RG2 A;  2HAX A;  2KYB A;  1AVZ C;  2JOY A;  4HVU A;  4XTZ A;  1KFZ A;  3PVQ A;  4QVC A;  2X35 A;  2ATC B;  2LQN A;  2QAS A;  1VQK Q;  3TVT A;  4EMG A;  5GAM h;  2DBM A;  5FW9 A;  1OX8 A;  2RI2 A;  3M54 A;  1M1F A; 
#chains in the Genus database with same CATH homology
 1RLQ C;  3PVL A;  3VS0 A;  2DE0 X;  4X1V A;  2KRO A;  4AFU C;  3VRY A;  1QKX A;  1X2K A;  3H0H A;  3VRZ A;  5I11 A;  1ARK A;  4FSS A;  1BBZ A;  2FRY A;  1GL5 A;  2HBW A;  2RPN A;  2GBQ A;  3IQL A;  2J06 A;  4JZ3 A;  4RTZ A;  1MUZ A;  1AWW A;  2GGR A;  1UTI A;  2FRW A;  2J7I A;  1TG0 A;  1WFW A;  1SHF A;  1T3L A;  1VYT A;  3M0T A;  4RTW A;  2CH4 W;  2BZ8 A;  2LP5 A;  2LJ0 A;  2OAW A;  3THK A;  2JMA A;  1SEM A;  3EG2 A;  2K9G A;  1YWP A;  2K79 A;  2AKL A;  3I5R A;  1K9A A;  1MV3 A;  1EFN A;  2KXD A;  3KFV A;  1JXM A;  2KRS A;  1WXU A;  4J9H A;  2A28 A;  2FPE A;  2W10 A;  2RMO A;  1SRL A;  1WYX A;  3O5Z A;  2KXC A;  2CUD A;  5FWB A;  4OMP A;  5GJW B;  4J9G A;  5IXB A;  1VYV A;  2EVR A;  3UF4 A;  4OMN A;  4D8K A;  4DEX A;  2X3X D;  4Z89 A;  4J9F A;  2AZS A;  1ZX6 A;  1ZUK A;  2HEQ A;  2RQU A;  3UA7 A;  1NEB A;  3VS7 A;  1KIK A;  1MV0 B;  2EBP A;  1Y57 A;  2EW3 A;  2KYM A;  2AK5 A;  2DL7 A;  2D8H A;  1ABQ A;  3NMZ C;  1K76 A;  4ZNX A;  2JS0 A;  3NHN A;  2EYZ A;  2DYB A;  2RNA A;  5I22 A;  3M0S A;  3EHR A;  1E6H A;  1YN8 A;  2XMF A;  2GTO A;  2FG0 A;  2AKK A;  2P4R A;  2SEM A;  4GBQ A;  1LCK A;  3I35 A;  5ECA A;  1RI9 A;  1X6B A;  2DLP A;  4IIM A;  1XOV A;  1WA7 A;  4GLM A;  1GBQ A;  3VS5 A;  1T0H A;  4JJC A;  1UUE A;  3UA6 A;  1X6G A;  2V1R A;  2JS2 A;  1PRM C;  3PE0 A;  2DA9 A;  3M0U A;  2EQI A;  4IIO A;  1VYU A;  3GBQ A;  2DJQ A;  1Z9Z A;  2RQR A;  1IO6 A;  2LQW A;  2D0N A;  1GFC A;  4RTT A;  4HVV A;  2EYX A;  1ABO A;  2GQI A;  2KGT A;  1QLY A;  2ESW A;  2V1Q A;  1PKS A;  1YP5 A;  2IIM A;  2PTK A;  3A98 A;  1TUD A;  4EIK A;  2CUB A;  4Z8A A;  2MCN A;  2QDL A;  3RBB B;  1SRM A;  2FEI A;  2JM8 A;  2C0O A;  2DNU A;  2JT4 A;  1AWJ A;  3UAT A;  2KT8 A;  5IHI A;  4D8D A;  1YCS B;  2L3Q A;  4CC2 A;  1NYF A;  2EGE A;  4F14 A;  1H92 A;  1G2B A;  2KE9 A;  2FO0 A;  4Y92 A;  2CT3 A;  2DBK A;  1CKB A;  3H0I A;  4M4Z A;  4RUG A;  5L23 A;  1BB9 A;  4HXJ A;  1OPK A;  1UHC A;  4RTU A;  1AWO A;  2F2W A;  1B3Q A;  2L3S A;  3LH5 A;  2KNB B;  1RUW A;  2DL8 A;  2KRM A;  2NWM A;  2OI3 A;  2HCK A;  1SSH A;  5GJV B;  4OML A;  2DF6 A;  2ED0 A;  2BZY A;  2CSI A;  1JO8 A;  1QKW A;  2L3P A;  2KEA A;  1PRL C;  1W70 A;  2RQW A;  1HSQ A;  1ZUU A;  1PWT A;  1UEC A;  1CSK A;  1HJD A;  3REA B;  1AD5 A;  3QWX X;  1G83 A;  3NGP A;  4JJB A;  4RTY A;  3EG1 A;  2NUZ A;  2O9V A;  1A0N B;  4CC7 A;  1K0X A;  4F17 A;  1TUC A;  2YUN A;  3FJ5 A;  2VVK A;  1H8K A;  1WX6 A;  2PZ1 A;  2G6F X;  1WXT A;  3NPF A;  2JXB A;  1E7O A;  1YWO A;  3I5S A;  1AEY A;  2LNH B;  2J05 A;  2GNC A;  2J6O A;  2KT1 A;  1NG2 A;  4LN2 A;  2EYW A;  1U3O A;  2SRC A;  2EGC A;  1YNZ A;  1KJW A;  2KBT A;  2LMJ A;  2B86 A;  1JEG A;  1UGV A;  1U5S A;  1ZUY A;  4J9D A;  1B07 A;  4K11 A;  2VKN A;  2E5K A;  3VS4 A;  3VS2 A;  1GFD A;  2JW4 A;  3VS6 A;  1WDX A;  1X27 A;  2O9S A;  1M30 A;  1KSW A;  3EHQ A;  2L2P A;  2GTJ A;  1UDL A;  1PKT A;  1K0S A;  1AWX A;  2DL3 A;  2DVJ A;  2M51 A;  3RNJ A;  1M27 C;  2DX1 A;  2RQV A;  4DEY A;  2DMO A;  1I1J A;  3M0P A;  2D1X A;  1NEG A;  2BZX A;  3TSZ A;  2CSQ A;  4ORZ A;  1UE9 A;  2I0N A;  4AFQ C;  2YT6 A;  2A37 A;  4HVW A;  1GCQ A;  1V1C A;  1AZG B;  1GBR A;  1BK2 A;  4JPB W;  1NLO C;  1I07 A;  3VS1 A;  1FYN A;  4E6R A;  2K2M A;  1SHG A;  3REB B;  4RTX A;  1QCF A;  2DL5 A;  2JM9 A;  2RN8 A;  3H41 A;  2EYY A;  5EC7 A;  1VA7 A;  2YDL A;  1OEB A;  4KRT A;  1M3B A;  3H0F A;  4AG1 C;  1M8M A;  2W0Z A;  4J9I A;  4ESR A;  5IXF A;  2F2X A;  2KR3 A;  3ZL7 C;  2CDT A;  1T3S A;  4JZ4 A;  2LCS A;  2EGA A;  2KRN A;  1GCQ C;  4HCK A;  1UG1 A;  2A08 A;  1Y0M A;  2JMC A;  3CQT A;  2LX7 A;  1HD3 A;  4CC3 A;  2RF0 A;  1JU5 C;  5HCK A;  2O88 A;  1ZSG A;  1FMK A;  2YUO A;  4J9B A;  1UJY A;  4Z88 A;  1J3T A;  2H8H A;  4R0K A;  1E6G A;  2K3B A;  1K4U S;  2C0I A;  3ULR B;  4CC4 B;  4J9E A;  1S1N A;  5FWC A;  2AZV A;  2HSP A;  1OV3 A;  1UFF A;  1OOT A;  1PHT A;  1M3C A;  1H3H A;  4JJD A;  1ZLM A;  2HDA A;  3JV3 A;  2F2V A;  4AFZ C;  4OMQ A;  2O2O A;  2LJ3 A;  2X3W D;  1OPL A;  2VWF A;  2J6K A;  1WLP B;  4LE9 A;  2K6D A;  4J9C A;  1NM7 A;  3R6N A;  5IHK A;  1GCP A;  1I0C A;  1W1F A;  2RQT A;  1JXO A;  2OJ2 A;  1ZBJ A;  2LZ6 B;  2FPD A;  2A36 A;  2CRE A;  2D8J A;  2ROT A;  5IHN A;  3VS3 A;  2M0Y A;  1PNJ A;  2ROL A;  1AZE A;  2JTE A;  2J6F A;  5IH2 A;  2DRM A;  4LUE A;  3TSW A;  1QWE A;  3QWY A;  2YSQ A;  1W6X A;  2CT4 A;  3C0C A;  4AG2 C;  2C0T A;  1CKA A;  1JQQ A;  1WXB A;  4AFS C;  2DM1 A;  3EGU A;  3M0R A;  1M3A A;  1X69 A;  1WI7 A;  4OMM A;  3SHW A;  1N5Z A;  2O31 A;  1K1Z A;  4WCI A;  2DRK A;  2PNI A;  3EG3 A;  4QT7 A;  1QWF A;  3I9Q A;  2CH4 A;  2L0A A;  2ENM A;  4RTV A;  1Z9Q A;  3SEM A;  1SPK A;  1X43 A;  2MOX A;  2LJ1 A;  1GRI A;  2EKH A;  2BTT A;  4LNP A;  3U23 A;  2ECZ A;  2ED1 A;  2MIO A;  1RLP C;  1BU1 A;  1UJ0 A;  4F16 A;  2YUP A;  1U06 A;  2FPF A;  1WIE A;  3M0Q A;  1X2Q A;  2YUQ A;  2KYB A;  1AVZ C;  2EPD A;  1NYG A;  1T0J A;  2ABL A;  2K7A A;  4HVU A;  4LUD A;  1KFZ A;  3PVQ A;  4OMO A;  4A63 B;  3EG0 A;  2DIL A;  2LQN A;  1AOJ A;  3TVT A;  1NLP C;  2DBM A;  2DL4 A;  5FW9 A;  1UHF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...