4RTWA

Crystal structure of the c-src-sh3 domain e93v/q128r mutant in complex with the high affinity peptide app12
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
57
structure length
57
Chain Sequence
TFVALYDYVSRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Proto-oncogene tyrosine-protein kinase Src
publication title Crystal structure of the c-Src-SH3 domain E93V/Q128R mutant in complex with the high affinity peptide APP12
rcsb
source organism Gallus gallus
total genus 13
structure length 57
sequence length 57
chains with identical sequence C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4rtwA00
1X6BA 2GNCA 3VS3A 4F16A 4Z8AA 1WX6A 5EC7A 2DX1A 1WDXA 2CH4A 1GFDA 3LH5A 2CREA 2EYWA 1EFNA 2DBKA 1NLPC 2C0IA 5FWCA 2DILA 2LQWA 2NWMA 3TSWA 1GCQC 2KROA 2MIOA 3REAB 3M0QA 2FPDA 1NLOC 4CC3A 2EKHA 2BZXA 1A0NB 3EG0A 4LNPA 4JPBW 2HCKA 4J9IA 1SSHA 4OMPA 1WFWA 1UG1A 2OJ2A 2SRCA 1KJWA 1SHFA 2F2XA 3QWYA 2DL8A 3NMZC 2EQIA 2E5KA 2LJ3A 1UJYA 3C0CA 1M3CA 2EYYA 2J6OA 2LZ6B 4ZNXA 4J9CA 4E6RA 1NEGA 2ROLA 4HVWA 1NG2A 5I11A 1G83A 2V1QA 1AOJA 2AZVA 5IHIA 1GCQA 4AFUC 1RUWA 1GRIA 2JM8A 2YSQA 2JM9A 1WIEA 2L3PA 4AG2C 3ZL7C 4J9EA 2YUNA 2DVJA 2RQUA 1UUEA 2EPDA 1X69A 1ZX6A 4HVUA 1ZSGA 5IHKA 1MUZA 4R0KA 4RTZA 2A08A 1X2QA 2F2WA 2M0YA 1JXMA 2F2VA 1UDLA 1UECA 1OOTA 2LX7A 1V1CA 2FRWA 1GFCA 2KGTA 3TVTA 1M27C 5IXBA 2FRYA 2QDLA 3FJ5A 2KYMA 2O88A 2HDAA 2J7IA 2YUOA 1PWTA 3M0PA 1WXBA 2DRKA 1NYGA 2KT1A 2CUDA 3UF4A 3NGPA 1UHFA 2XMFA 1MV3A 1WXUA 1JU5C 2KXCA 1W6XA 4J9FA 2FG0A 2CDTA 4AFQC 2DL7A 2DL4A 1ARKA 1H3HA 1CSKA 4HCKA 1HJDA 2EVRA 4DEXA 2C0OA 1X27A 4JJCA 2H8HA 3M0RA 4AFSC 1AVZC 2CH4W 1WA7A 1QCFA 1TUDA 2VWFA 3THKA 1KFZA 3IQLA 1RI9A 3VS4A 1KSWA 1K0SA 3EG2A 2JS2A 4J9HA 1HD3A 1UHCA 1QKWA 2DA9A 3A98A 2LMJA 3VS6A 4GBQA 3REBB 1G2BA 2NUZA 1PRMC 2LP5A 3H0FA 1QWFA 2RPNA 4AFZC 2DE0X 2HEQA 2RMOA 4F17A 2I0NA 5I22A 1RLQC 4OMMA 4DEYA 2JMAA 5IH2A 4WCIA 3VS7A 2CT3A 2PNIA 2RQRA 5L23A 2KRNA 1UTIA 4EIKA 1JXOA 4JZ4A 1UGVA 2LJ1A 2EYXA 3EHQA 2D8HA 2JXBA 1LCKA 1TG0A 3PVQA 1OEBA 1XOVA 1B3QA 4RTVA 1VYVA 2YT6A 2ED1A 3UA6A 3H41A 1AEYA 1ZUUA 1FMKA 2AKKA 1UFFA 1VA7A 1BBZA 1KIKA 4JZ3A 4IIMA 2LJ0A 2BZ8A 1J3TA 1W1FA 2DRMA 4A63B 3I5SA 1GBQA 4RTYA 3EG1A 1E7OA 3VRZA 2J6KA 1WLPB 5FW9A 4AG1C 2YDLA 2W10A 4LN2A 2D0NA 2GQIA 1W70A 1ZUKA 5IHNA 3VRYA 2YUQA 1VYTA 1M30A 2HSPA 1E6HA 3VS2A 1ZBJA 1SRLA 4OMOA 2C0TA 2ABLA 2CSIA 1QKXA 2KEAA 2JS0A 1JQQA 1T0JA 1VYUA 4HVVA 2W0ZA 2A28A 2MCNA 1I1JA 1U3OA 3I5RA 4RTXA 2EYZA 2KE9A 5GJWB 2DMOA 1OPKA 3M0TA 4RTWA 2KXDA 3QWXX 2FO0A 2KR3A 1AZGB 2GTJA 4LE9A 1GCPA 2K9GA 2L3QA 4RTTA 2X3XD 3KFVA 1Z9QA 1SEMA 2CUBA 3UA7A 4Z88A 2DLPA 5GJVB 2ESWA 2OAWA 5FWBA 1U5SA 1YWOA 2D8JA 4GLMA 3NPFA 2FPEA 1IO6A 2AKLA 1K76A 2VKNA 1K9AA 2DM1A 4QT7A 2JMCA 2J06A 2KYBA 1AWJA 4CC2A 3M0SA 1NM7A 2DL3A 2RN8A 3U23A 1Z9ZA 2SEMA 1PKSA 2L2PA 2OI3A 1U06A 3UATA 1SHGA 1BB9A 4X1VA 1M3AA 2O31A 1TUCA 3VS5A 1CKAA 1SPKA 2GGRA 3H0IA 2GBQA 4RUGA 3SEMA 2YUPA 4ESRA 3RBBB 2RQWA 1QLYA 1S1NA 2RQVA 4FSSA 2D1XA 2JTEA 3SHWA 3H0HA 4J9BA 4CC4B 2PTKA 2FPFA 4D8KA 4Y92A 1H92A 2O2OA 4CC7A 1K4US 1AWXA 2G6FX 2J6FA 2K3BA 1YNZA 2AK5A 1FYNA 1NEBA 3RNJA 2K7AA 3PVLA 4LUDA 1RLPC 1ZLMA 4OMQA 4KRTA 1B07A 2IIMA 1CKBA 2RF0A 1JO8A 1YCSB 2DF6A 3VS1A 2ECZA 1JEGA 1M3BA 1WI7A 2RQTA 1HSQA 1OV3A 2VVKA 3CQTA 1NYFA 1X6GA 3JV3A 3O5ZA 1T3LA 1ABOA 2KBTA 1E6GA 2V1RA 2JT4A 5IXFA 2L0AA 2LNHB 4OMLA 2ENMA 4D8DA 1ABQA 1T3SA 2EW3A 2EGCA 4J9GA 2KRMA 2KRSA 1OPLA 1K1ZA 2RNAA 1YN8A 1YP5A 2B86A 1I07A 1UE9A 4ORZA 2J05A 2O9SA 2PZ1A 2ED0A 2DBMA 1WYXA 3EG3A 1BU1A 2X3WD 2A37A 2L3SA 2BZYA 1AZEA 3R6NA 2A36A 4JJBA 2DNUA 1UJ0A 1X43A 3EGUA 1X2KA 2EGEA 2AZSA 2MOXA 1MV0B 1I0CA 2BTTA 2CT4A 1GBRA 2EGAA 4LUEA 1PKTA 2O9VA 1N5ZA 4M4ZA 4JJDA 3M0UA 2DL5A 1Y57A 2GTOA 1BK2A 1AD5A 2M51A 3PE0A 3I35A 2HBWA 1WXTA 3VS0A 1H8KA 2LQNA 3NHNA 2CSQA 5HCKA 4Z89A 4J9DA 1SRMA 4RTUA 5ECAA 1GL5A 1PHTA 2FEIA 1PRLC 3TSZA 4OMNA 3EHRA 2LCSA 4F14A 2K2MA 2DYBA 4K11A 2P4RA 3GBQA 4IIOA 2ROTA 2K79A 1ZUYA 2EBPA 2DJQA 1QWEA 2KT8A 1AWWA 3I9QA 4HXJA 1M8MA 1T0HA 1K0XA 1Y0MA 1AWOA 2K6DA 1PNJA 2KNBB 1YWPA 2JW4A 3ULRB
chains in the Genus database with same CATH superfamily
5KYWB 4MMLA 4IUUA 3L1AA 5EC7A 1JRIA 3MP8A 4DA4A 5CKBA 5LJ3h 1K73R 3LH5A 2CREA 5FWCA 4E2FB 3JCMV 5LJ5g 1W4SA 1BCOA 2KROA 2MIOA 3REAB 1RADB 3M0QA 2FPDA 1NLOC 2QTXA 2BZXA 3BFMA 3EG0A 3UPUA 1MNEA 3C4SA 2QG9B 4LNPA 4XTYA 5GAOr 4E7SA 4XQ3A 4OMPA 2DXCA 3OQ5A 1N8RC 3LGLA 1UG1A 2F2XA 3QWYA 2EQIA 5GANd 1U8RA 4JRIA 1YJ9Q 3C0CA 1X75C 2EYYA 2FHDA 2J6OA 2G3RA 1VOMA 4ZNXA 1NEGA 3CCLT 4ELYC 5I11A 1S72Q 4PJNA 4C8QG 5DY9A 1P92A 3OYBA 1WHJA 1AOJA 1GCQA 5GANh 4AFUC 1BI1A 3CCEQ 3CBMA 4WF2A 1TSFA 2YSQA 1IB8A 2JM9A 3KUFA 1UGQB 2QI2A 4NOYA 4J9EA 3X28B 2YXYA 2RQUA 4J5YA 3HKSA 3JB9I 4HVUA 1KQSS 4NL3A 1QCOA 4R0KA 4RTZA 3MP1A 3E2UA 2F2WA 2M0YA 4M77A 2F2VA 1UDLA 3V8JA 2RB6A 4JUVA 4LDWA 3HFNA 2KGTA 3L2ZA 2FRYA 2J7IA 2A3LA 3NGPA 2DPPB 5GAOq 2ZPIB 2KXCA 2EQJA 2XI9A 4MZMA 2DL7A 2QA4A 3OYHA 1I81A 1CSKA 1OQKA 2RHXA 4HCKA 3OSSC 3VV0A 3JCMQ 1TXQA 2CZ7B 4DBRA 1HJDA 2EVRA 2HZYA 2B8AA 2BUDA 4DEXA 5A0LA 5LJ5f 3JCMX 1KD1C 2OX7A 2P84A 2DIQA 1BCMA 1WA7A 1M8VA 1TU0B 4PJOC 3M57A 2DTHA 2LQ8A 1K0SA 3EG2A 1VQ9Q 1VIFA 4PFZA 2E12A 3PFSA 4M7AC 1Y07A 3PMTA 2WSFE 5DLQE 4XTZA 3FJPA 2DA9A 2RI5A 2LMJA 5GMKj 5GAN5 4GBQA 3P8HA 1VQPQ 4M77F 1C1AA 4F7UG 4KUIA 5I22A 1RLQC 4JLIA 3CCSA 2KRNA 3RDVA 2AIRB 4KGXB 1BI0A 2E70A 5J39A 1UGVA 2EYXA 2QEXT 4OGEA 1WJRA 2MK5A 2M1HA 3R6OA 4RTVA 1VYVA 1LJOA 1FMKA 2K5IA 1VA7A 2DD4A 1BBZA 2GCXA 1KIKA 2M0OA 4C92A 4M77E 1J3TA 4J7FA 1W1FA 2DRMA 5GAOn 4N4IA 1GBQA 1YIJT 2D9TA 1QMCA 4IUTA 2A7YA 2YDLA 3V8LA 3G71Q 5LJ5e 1W70A 1M1KR 4UC4A 1E6HA 3VS2A 4OMOA 1D1BA 2XKOC 1QKXA 2JS0A 1OU8A 3I55Q 2MYSA 4L6V5 3VYHB 1VQ6T 2JN0A 2W0ZA 2A28A 1N9RA 2QQRA 1U3OA 3PMIA 4XU3A 4RTWA 3OS0A 4OP0A 2FO0A 2KR3A 3CBOA 4MZPA 3SDZA 2GTJA 4LE9A 1GCPA 1HXDA 5KYUB 2L3QA 3CCJT 3CMEA 3UDCA 1KHCA 4LDXA 4RTTA 4M78G 1Z9QA 4QVCA 2YHTA 1VQMT 5FU6C 2DLPA 3ZFJA 2ESWA 2QGGA 5IN1A 2KY9A 4GLMA 4C92F 3NTHA 2AKLA 2VKNA 1B34B 3FIFA 2DEUA 2JMCA 1AWJA 3GLXA 1NJIC 2QAZA 3DB3A 3L2WA 3U23A 3L2UA 2SEMA 1B7TA 2JZ2A 2WSEE 1U06A 2MPXC 4DOWA 3S6WA 2HAXA 3VS5A 1CKAA 3A8HB 2GGRA 3RBBB 5GAMe 4ZGDB 2COYA 2CP5A 2E4HA 3CCVA 1QLYA 4WTOB 4C8QC 4LDVA 2QA4Q 3M56A 4C0DC 4J9BA 3CXCP 4C92E 2NUPA 1H92A 2O2OA 1ZSZB 1MHNA 1Q81U 4CC7A 3HL8A 2RJEA 2X9HA 2YLCA 2K3BA 4EMKC 2K7AA 1TUGB 3PVLA 4D6WA 4LUDA 3ZBDA 1OZ3A 2M16A 4MDWA 2XHCA 1B07A 4DQ2A 3QDRB 2DF6A 3QIIA 3VS1A 2QQSA 3ZEHA 1M3BA 1WI7A 3OYKA 1D1CA 1NYFA 1T3LA 2RA2A 4BDYA 1ABOA 2V1RA 1Q82C 2L0AA 4OMLA 1AHJB 2O4XB 4QQ6A 3G1JA 1ZSZA 4OB1B 4OF1A 2NUTB 2KVQG 1NZ9A 1YP5A 3OMCA 5FRMA 1OX9A 1UGRB 2VB6A 5A0GA 1YITT 2MWPA 3MEWA 2J05A 2PQWA 1XJWB 2DBMA 5LJ5h 3MJXA 1BU1A 2A37A 1F1BB 2QQBA 1OX8A 4BB7A 2RK1A 2DNUA 4BD3A 1VQ4Q 4PL6A 1X2KA 3EG9A 5GANj 4KGVB 3MCAB 2O4XA 1WJQA 1VQLA 1WHLA 4PJOD 1BKBA 4M4ZA 3H6ZA 2NUTA 3M0UA 1N6AA 4M7AD 5CVIA 1VQKA 2LDMA 3I35A 1WXTA 2EFIA 3CCMA 4E7ZA 1HK9A 3NHNA 1Q7YR 2CSQA 4Z89A 1N9SA 1PM3A 2LVMA 4RCCA 1PRLC 3EFOB 2HKQB 2DYBA 3C94A 4K11A 3ER0A 5GAMd 3GP8A 2BKDN 1XQHA 4E7JA 3S3OA 5KE2A 2QDYB 4IKFA 2KT8A 4HXJA 3QKJA 3TEEA 1PG5B 1AWOA 5KYXB 4BUGA 5GAN7 9ATCB 2RK2A 1G5VA 1MMAA 4AT1B 1D1AA 2QGFB 2E1HA 1YJWT 5FRNA 2KSSA 1GFDA 4QVZA 3X25B 1N8RU 2DBKA 4PJOB 3GF5A 2NWMA 4C5IA 3MEVA 3J80E 3VYGA 4M7AB 2M9UA 5J3BA 4PFOA 3CCVQ 4CC3A 5KE3A 1A0NB 4C0GA 4V2SA 2R5AA 1YI2Q 4M7DG 3PNWC 5CR2A 4M78C 3LYIA 4XTVA 3E19A 2HBPA 2K4YA 1D3BB 1KJWA 2EIFA 3V7SA 1MNDA 2DYIA 2E5KA 5FU7B 2LJ3A 4NS5A 1UJYA 4PJOA 2RJFA 4J9CA 4FW2A 3HHTB 4HVWA 2RD1A 1WHGA 3JB9F 2V1QA 3L42A 2NLUA 1VQ8Q 4KGZB 4ME7A 1QVFA 1K8AC 5CKEA 1GRIA 4A4HA 1WIEA 1N27A 2DVJA 2OTJQ 4PNOA 3JCMW 4DBQA 1UUEA 1BI2A 3HPWA 2EPDA 3OYEA 3VJPA 1MMGA 2P0QA 1UB4A 1YJ9T 5IHKA 1VQOQ 1MUZA 1M4ZA 4HCZA 2D6FA 1ZA2B 4C8QD 3BW1A 5GMKl 1OOTA 1V1CA 1KD1U 1GFCA 3EGDA 4JS4A 3JCMJ 4LD9K 1SKUB 1S72T 2O88A 1PWTA 3M0PA 1WXBA 2DRKA 1NYGA 2CUDA 3CCQQ 1M2VB 1JBMA 3CCET 4PJOF 1MV3A 1VQLQ 3GPLA 3OYFA 3OYIA 2HL3A 4PJLA 4J9FA 2FG0A 2CDTA 3GOXA 4TVRA 4QVDA 5FU6B 1VQKQ 4RKUE 4XTUA 3EGXA 3CCMQ 1OULA 1X27A 4JJCA 3SD4A 3CD6Q 2H8HA 1AVZC 1QCFA 5AT1B 2VXEA 1NBEB 1RI9A 1FXXA 1M9SA 4M75A 2VV5A 1M2OA 4J9HA 1HD3A 3CCLA 4Q5WA 1RAAB 4BI8B 2P4TA 2VXFA 3A98A 6AT1B 2V8JA 3BDUA 1MMNA 1IHWA 1M2VA 1UEBA 1G2BA 4JRPA 2HL5C 2NUZA 2QQAA 2RHZA 2JTFA 4R55A 1QWFA 1RL2A 1WNLA 8AT1B 1YJNT 4HT9A 3G6EA 4C8QB 2HEQA 5KYYB 2I0NA 1K73C 4OMMA 3V7RA 4C0DB 4C5GA 3CMAQ 2JOYA 2RQRA 5L23A 1UTIA 1JXOA 5KYWA 3JCMc 4JZ4A 3S3MA 1KG1A 2E6ZA 2LJ1A 3BY7A 3EHQA 2JXBA 4EMKB 3QJYA 1VQ9T 1OEBA 2DD5A 3QJ6A 3M53A 4J8OA 3FEOA 1B3QA 2BIVA 1AEYA 1KQ1A 4BDZA 1M90C 1VQPT 2XG8D 3CPFA 3I5SA 4M75F 4C8QA 2DXBA 4RTYA 1KC8R 3VRZA 2M02A 2J6KA 1RAEB 1WPYA 2JJ9A 1OYXA 2D0NA 3VRYA 1RI0A 2X51A 1I5LA 1QVFS 1ZHIA 3CCUA 2HSEB 1ZBJA 3TU4K 1LPLA 3OBYA 1T0JA 1HYOA 1V76A 3CC2A 1I1JA 2LRQA 3INZA 3Q1JA 2KE9A 3RUXA 1NJIU 4ZN3A 4B6MA 2KXDA 5GAOm 3QWXX 4M75E 1AZGB 4A4GA 2CP7A 2OTLA 1R0CB 4BE0A 4E7IA 3KFVA 2XK0A 1SEMA 4Z88A 2OAWA 5FWBA 2Y4XA 3G71T 3CPWP 4M7DC 7AT1B 5GAOp 3C95A 4M77G 3NPFA 4F7UB 1Q86R 2FPEA 4DOVA 3M4YA 4J7IA 1K9AA 2DM1A 4O6JA 4C8QF 3RR6A 4CC2A 1NM7A 2DL3A 5M9OA 4P5NA 4PKCC 2BE7D 3I55T 1GXIE 1OI1A 4JLGA 1PKSA 4HA8A 2OI3A 3LH0A 1BB9A 4X1VA 2O31A 1TUCA 3DB4A 4M78D 2GBQA 4RUGA 2EYQA 3RERA 2L89A 2FVUA 3LWIA 3LGFA 3T9NA 1YIJA 3X24B 3H0HA 2WSCE 1VQ5A 3LWHA 2R57A 4D8KA 3J7AF 2K3XA 2MF2A 4FT2A 3ME9A 1YHQA 5GAMj 1Q82U 4QKUA 1G3TA 2KAFA 4ZN1A 3SB2A 3RNJA 1JB0E 2CYZB 3OBWA 1RLPC 3P8BB 4N0AC 4ANJA 4KRTA 1I4K1 5FLXE 1CKBA 1RACB 1JO8A 3JSCA 2YLBA 1G3WA 2P0PA 1JEGA 3G6EQ 2RQTA 1RAHB 3CCJA 4J6XA 2VVKA 2QA4T 3MO8A 3JV3A 5A0DA 3O5ZA 2KBTA 1E6GA 5IXFA 1UGPB 1RAGB 4D8DA 1BIAA 4M78B 1OPLA 1K1ZA 2DXUA 2KI7A 4J83A 2RNAA 1YN8A 1WHKA 1K9MC 2HKNA 2FZGB 4C92G 2K57A 2AHJB 3M4GA 1QVPA 2XDPA 2X4WA 1WYXA 2AT1B 2F1LA 3EG3A 2X3WD 5GAN6 3OY9A 2EKOA 3PIPA 3X20B 2VGNA 5GAN8 3V7CA 1AZEA 1W2BP 3R6NA 3UWNA 2A36A 2E65A 1M1KC 1UJ0A 2CS7A 3OYAA 2RJDA 2ZPBB 1WHHA 1WZOA 4PLIA 2AZSA 2DZ9A 1PD1A 4A4EA 1KK7A 4OVAA 2BTTA 2A0FB 2YRDA 3M59A 2EGAA 3CC4A 1SSFA 2O9VA 1Y96B 3CCUQ 4JJDA 3QBYA 3V8KA 1Y57A 3MEUA 1BK2A 1AD5A 2M51A 5KCOA 2H3JA 1G8XA 3VS0A 5HCKA 2E3HA 1FMWA 3CC2Q 4RTUA 1O75A 3JCMf 3DLMA 5FROA 2DTOA 4OMNA 3EHRA 2FZKB 3KXTA 4FM4B 2P4RA 3GBQA 2ROTA 2Z0WA 2EBPA 4A54A 2OTLQ 1JJ2P 4KBMB 4X9DA 3H8ZA 3NTKA 5HKCA 1VQ4T 1H3ZA 1Y0MA 3CCRA 3FRNA 2RHYA 5KYUA 4II1A 5HY6A 1ZA1B 2DIGA 2JW4A 1PSFA 3TCJA 1X6BA 4XK8E 3VS3A 4F16A 4Z8AA 3HTRA 1G3YA 2KMTA 3C12A 2CZ0B 1WX6A 5CKHA 4BI4A 2DX1A 3RMQA 1B34A 2CH4A 1M1GA 2EYWA 3A8LB 4J6YA 3BE3A 4PFPA 4FIBA 5CO7A 3FC3A 1GCQC 1AT1B 5LJ3j 2E64A 2WACA 4E7HA 4OGCA 3DKMA 2EKHA 4OB2B 1VQ5Q 5L8RE 2CP2A 2EJGA 4KH1B 2DERA 3M58A 2HCKA 2LCCA 1YHQQ 1W2BA 2PUOB 5D6XA 2OJ2A 2SRCA 3CC7A 1SHFA 2LTOA 5LJ5d 3P8DA 3CCSQ 1K8AU 3TQ7P 2L3RA 5C6SA 1PSEA 1D09B 1OZ2A 1QW1A 4M77C 4E7LA 2L8DA 2JNGA 2PU9B 4FYYB 4AMCA 2ROLA 4KH0B 1G83A 3CCVT 3S3NA 4M7DD 2AZVA 5IHIA 5I2SA 2BE9B 4MDXA 4RG2A 3OS1A 2E10A 1YI2T 2JM8A 1VQNA 2EQKA 2L3PA 3ZL7C 1JJ2A 4PK4A 2YUNA 1MMDA 1X01A 3AT1B 2EQMA 1PD0A 1TWBA 2EWNA 4QQDA 4JRQA 1WGSA 1YJWA 2RM4A 1I5OB 1D0YA 2CP6A 2A08A 1X2QA 4ELZC 5KH6A 2LX7A 3CXCA 2LT1A 3TVTA 3E9GA 2QDLA 2KYMA 2KT1A 1VQ8T 3UF4A 4C5HA 4JJNK 2RI2A 1UHFA 2XMFA 2ZAEA 3VUBA 3CMEQ 1ACMB 1WXUA 1Q7YC 1JU5C 2LNVA 3CC4Q 4L59A 1RABB 4IURA 1W6XA 3PT9A 2DKGA 3M55A 4AFQC 2DL4A 2LC4A 1ARKA 4FW1A 2ZZDA 2OTJT 3META 2F69A 4M7DB 2C0OA 2YRVA 2DVEA 3M0RA 5GANf 1Q95G 3G7ZA 1K73U 3F70A 2VWFA 3THKA 1VQOT 2DZCA 3G4SA 3VS4A 1KSWA 1LNXA 2JS2A 1UHCA 2IG0A 4FU6A 1QQJA 4C92C 3EFOA 1O9SA 3HP9A 5IT9E 3JB9J 5I21A 2PVDB 3VS6A 5I2MA 3CCQT 3CCRQ 3FDRA 3H0FA 1VQLT 2RMOA 3I56A 4F17A 4DEYA 5J26A 3JB9G 2JMAA 5IH2A 4WCIA 1VQKT 5KYXA 2CT3A 2HNIA 1M90U 3CCMT 2RI3A 4JS5A 4EIKA 3CD6T 3J81E 4RG8A 1Q81R 1EZZB 1G3SA 4BI3A 1LCKA 1VQ7A 5A2QE 2CZ6B 2FYKA 1W2BS 3MEAA 4LDUA 1BI3A 1MGQA 2ED1A 3H41A 1ZUUA 1FWZA 3WVEB 4JZ3A 4M7AA 3M54A 2LJ0A 3A8GB 3RMSA 1ZBXA 3SWNC 3CC7Q 5FW9A 4AG1C 3CMAT 1TH7A 1K8AR 4LN2A 2E6NA 1ZUKA 4FYXB 5IHNA 2YUQA 1M30A 2HSPA 1D3BA 1SRLA 2C0TA 2CSIA 5GAN4 1WJSA 1JQQA 1VYUA 4HVVA 1JJ2S 3KBGA 4M7DF 4OB3B 4BY6C 2ZPEB 3BDLA 4RTXA 2EYZA 2PUKB 5GJWB 2DMOA 1V29B 3H9NA 3M0TA 3D7SB 1IREB 3A1PA 1C0MA 2K9GA 1D0ZA 1YJNA 1VQNQ 3CXCS 1LVKA 3OMGA 3UA7A 1R77A 2GF7A 1RAFB 1U5SA 1YWOA 2P0KA 3OYGA 4ZTJA 4M7AF 2X4JA 4QT7A 3MHXA 2J06A 2KYBA 4EPCA 3M0SA 2RN8A 2X35A 2YRCA 4KULA 2L5QA 1D0XA 1VQ9A 2L2PA 5D6YA 3RIRA 1M3AA 1EX4A 1PC0A 1Y7XA 4EMHA 2XICA 8ATCB 1FMVA 3SEMA 2CKKA 1VQPA 2RQWA 5CQXA 1UGSB 2HMAA 1S1NA 4KUDK 2RQVA 2D1XA 4QQGA 2JTEA 4PJOE 4M77D 4C5EA 1ZSZC 2KK4A 3OS5A 4M7AE 2PTKA 2FPFA 1BIBA 4M75G 3OYNA 2KDSA 3G4SQ 3QPHA 1AWXA 2G6FX 2ZPGB 2J6FA 1YNZA 2AK5A 4Y91A 1FYNA 3OW2P 3HSBA 3VUZA 4LXCA 4Z02A 3FB9A 2QXFA 1N8RR 1ZLMA 4OMQA 2VASA 2IIMA 1K9MU 2HD0A 2RF0A 5D7UA 1YCSB 2XIDA 2HQEA 3NTIA 3I56Q 1OV3A 4ZTFA 3OYLA 1X6GA 1SF9A 2LNHB 2ENMA 3N5BB 5KYYA 2EW3A 5KYNA 1M90R 3G71A 4J9GA 1M1KU 2KRMA 5AYFA 3HRUA 2DK3A 4R56A 1VQ7Q 1PCXA 3OS2A 3I55A 4M77B 3QHSA 3EH2A 1KC8C 4ORZA 1QVGP 2PZ1A 4EMKA 2LCLA 2E41A 2CGHA 4FL6A 2XU8A 2L3SA 2BZYA 5GMKi 4XAXB 4JJBA 1KQ2A 4FCYA 2YWWA 3G6ET 1R8OB 2DXTA 5LJ5j 1X43A 2IVWA 3EGUA 3FLGA 4ZGEB 1I0CA 3M5AA 4LUEA 4A4KA 5GAMg 2DL5A 3JAME 4C92D 3PE0A 2GTOA 2KQWA 2HBWA 1H8KA 2LQNA 2QQ9A 2QASA 1SRMA 5ECAA 1GL5A 3EFRA 1PHTA 4BE2A 1VIEA 4DBFA 2QEXA 2LCSA 4F14A 4IIOA 1KD1R 1ZUYA 2DJQA 1Q86C 1YJNQ 3OW2A 3OB9A 4ZGJB 3I9QA 1M8MA 1T0HA 2DJZA 1K0XA 4QW2A 2K6DA 4EDUA 2KNBB 2O01E 1YWPA 3JCMg 3ULRB 3ASKA 1NPRA 2GNCA 3CCUT 2MWOA 3PIOA 2Y4YA 4FYVB 4F7UA 1IRXA 1WDXA 4C8QE 4KT0E 3OYDA 3CC2T 4XTWA 1EFNA 1NLPC 2C0IA 2GQVA 2DILA 2RH2A 2LQWA 3OYYA 3TSWA 3CCLQ 1VQ6A 2LX9A 4C92B 4FT4A 3A8MB 2OTLT 2VYTA 1QVGA 2MI6A 1IHVA 2X4XA 4JPBW 3GIBA 4J9IA 3JCMb 4RMOA 5FU7C 1SSHA 1WFWA 1VQMA 2GFAA 2DL8A 3NMZC 4PJMA 1M5Q1 5CIUA 1M3CA 5CKDA 3OYJA 3QZ5B 2LZ6B 4E6RA 5GAOl 1K9MR 5KCHA 3CPWA 5GAMf 1NG2A 4F7UF 1SG5A 2F5KA 1VQ4A 2JTMA 1WHMA 4XU2A 3MPUB 4XTXA 2COZA 1VQ5T 1RUWA 3L2QA 1X6OA 2QYZA 3SWNB 1LOJA 1YHQT 4AG2C 1I8FA 2V8KA 2JVVA 2EJFA 3GNGA 2MAMA 3CCST 4M78A 3VU3C 3EAEA 1Q7YU 2NYSA 4BE1A 1X69A 4M75C 1ZX6A 1ZSGA 2K5FA 4L5GA 1VUBA 5LJ3g 4Y28E 1JXMA 1UECA 2FRWA 3PTAA 2FL7A 4F7UE 4BY6B 3MP6A 1M27C 5IXBA 3FJ5A 2HDAA 1NJIR 2YUOA 4IUQA 2C06A 5CCAA 3QZ9B 5DLOA 3LW5E 3LX7A 1NE8A 2V26A 2NUPB 3SWNA 5GAN3 1H3HA 2QK0A 1YBYA 3AHUA 2VGMA 3QYGB 1WQWA 1RAIB 3OW2S 1TOVA 1Y96A 5GMKe 4AFSC 2CH4W 1NPPA 1TUDA 1KFZA 3IQLA 1EIFA 3UT1A 4DBHA 2QEXQ 5D6WA 4ATOA 1YITA 2PVGB 3L2VA 1U1TA 4M78F 4LDYA 4E7KA 1QKWA 3RKXA 3CBPA 1ZQ1A 1BYMA 3REBB 4IUVA 3M9QA 4E47A 1PRMC 2LP5A 5GANg 2CP3A 3CMET 3HRSA 2RPNA 4AFZC 1YI2A 2DE0X 3CC4T 4FYWB 4F04B 1YIJQ 3E9FA 3QYHB 4FSXA 2DTIA 5HK3A 3VS7A 2EJ9A 1Y71A 2PNIA 2ZCFB 2PVOB 2JUFA 2ZGWA 4EMGA 1QVGS 2FB7A 5CAIA 1Q82R 2D8HA 3QXEB 1TG0A 2COWA 3PVQA 1VQ6Q 1XOVA 4M78E 3JCMe 2YT6A 3UA6A 1QCNA 3EFSA 2ZPFB 1YCYA 4CI0C 2AKKA 1UFFA 2DFUA 3A8OB 1VQ8A 5CKFA 4IIMA 3JB9D 2BZ8A 3CCRT 3EG9B 4A63B 3CCJQ 3EH1A 3EG1A 4VUBA 1E7OA 2LT4A 3CPWS 1WLPB 2K2VA 5LJ3f 1VQMQ 1FX7A 2DETA 2OTJA 2W10A 2GQIA 3CEYA 3HFOA 1VYTA 4HCCA 1VQOA 2ABLA 2KEAA 2VUBA 4HKEA 1TTHB 4B9WA 3E1SA 2MCNA 4RCBA 3I5RA 4B9XA 3OSVA 4J6WA 1KHIA 1OPKA 2EAYA 2OAUA 5C0MA 3CCQA 3RESA 2X3XD 2RHUA 4JRKA 3CC7T 5DM7R 4OMFB 2CUBA 4JDSA 4PLLA 5CK9A 3NFCA 5GJVB 1C6VX 2X4YA 4HT8A 2ZPHB 2D8JA 4PJJA 3URGA 1IO6A 1K76A 3CD6A 2XDBA 2DO3A 4GY5A 4GLKA 2DAQA 1QVFP 4A4FA 1Z9ZA 3GNFB 4MZTA 3UATA 1SHGA 2HQXA 1KQSP 3MKDA 1H641 3QUIA 1SPKA 5GMKh 3H0IA 3JB9H 5GMKm 4ESRA 2YUPA 1QP2A 2EQUA 4HCBA 2FZCB 3JCMP 4X9CA 4FSSA 1VQNT 1IZ6A 2VC8A 5EG2A 1TS9A 3SHWA 5LJ3e 2F5TX 3PGGA 4CC4B 5CQYA 5GAMh 3JRZA 4XU1A 3CMAA 4Y92A 2Y90A 3RKYA 2MMPA 2D0QB 4M7DA 1K4US 1XTDA 3RKWA 1WQ7A 4A53A 1YITQ 1NEBA 3JCMd 1YJ9A 2CZ1B 2RO0A 1XNIA 1OU9A 2R5MA 3QG1A 4N4GA 4OB0B 3OA6A 2ECZA 1S72A 1DJ7B 1KC8U 1HSQA 1IXDA 1Q81C 3L2RA 2QTVA 3CQTA 4M75D 5LL6S 2JT4A 3JCMh 3CCEA 1ABQA 1T3SA 3WVDB 2EGCA 2H3EB 4IUPA 4X34A 2XD0A 2KRSA 2GFUA 4CRIA 5IAYA 3G4ST 4PJOG 1QP3A 2B86A 3TREA 3SFMA 5GANe 4M7AG 1I07A 1IGQA 3EGDB 1UE9A 2O9SA 2ED0A 2LQKA 4MMKA 4N0AA 4NL2A 3I56T 2EGEA 5HK0A 2MOXA 1MV0B 1YFNA 4BACA 2ATCB 1KQSA 2CT4A 1GBRA 2K3YA 3EGXB 2RHIA 4N4HA 1R0BG 2E3IA 5GAN2 1Q86U 1PKTA 1N5ZA 2IPOB 1M1FA 4XU0A 3QSUA 3WXMB 3O8VA 3DLLA 1U1SA 1VQ7T 3OYCA 1YJWQ 4M75B 3LLRA 4LD6A 2V8IA 4J9DA 4C0ZA 2K5LA 2FEIA 3HRTA 2HQHA 3TSZA 3VKIA 3OYMA 2R58A 2I2LA 2K2MA 4M7DE 3A5ZB 4YTLA 2K79A 1IGUA 2RJCA 1QWEA 1AWWA 5LJ3d 3QDFA 3X26B 2XDDA 1PNJA 2DEQA 4C0FA 4O5VA 2CP0A 3QO3A 2E5QA
chains in the Genus database with same CATH topology
1X6BA 2GNCA 3VS3A 4F16A 4Z8AA 1WX6A 5EC7A 2DX1A 1WDXA 2CH4A 1GFDA 3LH5A 2CREA 2EYWA 1EFNA 2DBKA 1NLPC 2C0IA 5FWCA 2DILA 2LQWA 2NWMA 3TSWA 1GCQC 2KROA 2MIOA 3REAB 3M0QA 2FPDA 1NLOC 4CC3A 2EKHA 2BZXA 1A0NB 3EG0A 4LNPA 4JPBW 2HCKA 4J9IA 1SSHA 4OMPA 1WFWA 1UG1A 2OJ2A 2SRCA 1KJWA 1SHFA 2F2XA 3QWYA 2DL8A 3NMZC 2EQIA 2E5KA 2LJ3A 1UJYA 3C0CA 1M3CA 2EYYA 2J6OA 2LZ6B 4ZNXA 4J9CA 4E6RA 1NEGA 2ROLA 4HVWA 1NG2A 5I11A 1G83A 2V1QA 1AOJA 2AZVA 5IHIA 1GCQA 4AFUC 1RUWA 1GRIA 2JM8A 2YSQA 2JM9A 1WIEA 2L3PA 4AG2C 3ZL7C 4J9EA 2YUNA 2DVJA 2RQUA 1UUEA 2EPDA 1X69A 1ZX6A 4HVUA 1ZSGA 5IHKA 1MUZA 4R0KA 4RTZA 2A08A 1X2QA 2F2WA 2M0YA 1JXMA 2F2VA 1UDLA 1UECA 1OOTA 2LX7A 1V1CA 2FRWA 1GFCA 2KGTA 3TVTA 1M27C 5IXBA 2FRYA 2QDLA 3FJ5A 2KYMA 2O88A 2HDAA 2J7IA 2YUOA 1PWTA 3M0PA 1WXBA 2DRKA 1NYGA 2KT1A 2CUDA 3UF4A 3NGPA 1UHFA 2XMFA 1MV3A 1WXUA 1JU5C 2KXCA 1W6XA 4J9FA 2FG0A 2CDTA 4AFQC 2DL7A 2DL4A 1ARKA 1H3HA 1CSKA 4HCKA 1HJDA 2EVRA 4DEXA 2C0OA 1X27A 4JJCA 2H8HA 3M0RA 4AFSC 1AVZC 2CH4W 1WA7A 1QCFA 1TUDA 2VWFA 3THKA 1KFZA 3IQLA 1RI9A 3VS4A 1KSWA 1K0SA 3EG2A 2JS2A 4J9HA 1HD3A 1UHCA 1QKWA 2DA9A 3A98A 2LMJA 3VS6A 4GBQA 3REBB 1G2BA 2NUZA 1PRMC 2LP5A 3H0FA 1QWFA 2RPNA 4AFZC 2DE0X 2HEQA 2RMOA 4F17A 2I0NA 5I22A 1RLQC 4OMMA 4DEYA 2JMAA 5IH2A 4WCIA 3VS7A 2CT3A 2PNIA 2RQRA 5L23A 2KRNA 1UTIA 4EIKA 1JXOA 4JZ4A 1UGVA 2LJ1A 2EYXA 3EHQA 2D8HA 2JXBA 1LCKA 1TG0A 3PVQA 1OEBA 1XOVA 1B3QA 4RTVA 1VYVA 2YT6A 2ED1A 3UA6A 3H41A 1AEYA 1ZUUA 1FMKA 2AKKA 1UFFA 1VA7A 1BBZA 1KIKA 4JZ3A 4IIMA 2LJ0A 2BZ8A 1J3TA 1W1FA 2DRMA 4A63B 3I5SA 1GBQA 4RTYA 3EG1A 1E7OA 3VRZA 2J6KA 1WLPB 5FW9A 4AG1C 2YDLA 2W10A 4LN2A 2D0NA 2GQIA 1W70A 1ZUKA 5IHNA 3VRYA 2YUQA 1VYTA 1M30A 2HSPA 1E6HA 3VS2A 1ZBJA 1SRLA 4OMOA 2C0TA 2ABLA 2CSIA 1QKXA 2KEAA 2JS0A 1JQQA 1T0JA 1VYUA 4HVVA 2W0ZA 2A28A 2MCNA 1I1JA 1U3OA 3I5RA 4RTXA 2EYZA 2KE9A 5GJWB 2DMOA 1OPKA 3M0TA 4RTWA 2KXDA 3QWXX 2FO0A 2KR3A 1AZGB 2GTJA 4LE9A 1GCPA 2K9GA 2L3QA 4RTTA 2X3XD 3KFVA 1Z9QA 1SEMA 2CUBA 3UA7A 4Z88A 2DLPA 5GJVB 2ESWA 2OAWA 5FWBA 1U5SA 1YWOA 2D8JA 4GLMA 3NPFA 2FPEA 1IO6A 2AKLA 1K76A 2VKNA 1K9AA 2DM1A 4QT7A 2JMCA 2J06A 2KYBA 1AWJA 4CC2A 3M0SA 1NM7A 2DL3A 2RN8A 3U23A 1Z9ZA 2SEMA 1PKSA 2L2PA 2OI3A 1U06A 3UATA 1SHGA 1BB9A 4X1VA 1M3AA 2O31A 1TUCA 3VS5A 1CKAA 1SPKA 2GGRA 3H0IA 2GBQA 4RUGA 3SEMA 2YUPA 4ESRA 3RBBB 2RQWA 1QLYA 1S1NA 2RQVA 4FSSA 2D1XA 2JTEA 3SHWA 3H0HA 4J9BA 4CC4B 2PTKA 2FPFA 4D8KA 4Y92A 1H92A 2O2OA 4CC7A 1K4US 1AWXA 2G6FX 2J6FA 2K3BA 1YNZA 2AK5A 1FYNA 1NEBA 3RNJA 2K7AA 3PVLA 4LUDA 1RLPC 1ZLMA 4OMQA 4KRTA 1B07A 2IIMA 1CKBA 2RF0A 1JO8A 1YCSB 2DF6A 3VS1A 2ECZA 1JEGA 1M3BA 1WI7A 2RQTA 1HSQA 1OV3A 2VVKA 3CQTA 1NYFA 1X6GA 3JV3A 3O5ZA 1T3LA 1ABOA 2KBTA 1E6GA 2V1RA 2JT4A 5IXFA 2L0AA 2LNHB 4OMLA 2ENMA 4D8DA 1ABQA 1T3SA 2EW3A 2EGCA 4J9GA 2KRMA 2KRSA 1OPLA 1K1ZA 2RNAA 1YN8A 1YP5A 2B86A 1I07A 1UE9A 4ORZA 2J05A 2O9SA 2PZ1A 2ED0A 2DBMA 1WYXA 3EG3A 1BU1A 2X3WD 2A37A 2L3SA 2BZYA 1AZEA 3R6NA 2A36A 4JJBA 2DNUA 1UJ0A 1X43A 3EGUA 1X2KA 2EGEA 2AZSA 2MOXA 1MV0B 1I0CA 2BTTA 2CT4A 1GBRA 2EGAA 4LUEA 1PKTA 2O9VA 1N5ZA 4M4ZA 4JJDA 3M0UA 2DL5A 1Y57A 2GTOA 1BK2A 1AD5A 2M51A 3PE0A 3I35A 2HBWA 1WXTA 3VS0A 1H8KA 2LQNA 3NHNA 2CSQA 5HCKA 4Z89A 4J9DA 1SRMA 4RTUA 5ECAA 1GL5A 1PHTA 2FEIA 1PRLC 3TSZA 4OMNA 3EHRA 2LCSA 4F14A 2K2MA 2DYBA 4K11A 2P4RA 3GBQA 4IIOA 2ROTA 2K79A 1ZUYA 2EBPA 2DJQA 1QWEA 2KT8A 1AWWA 3I9QA 4HXJA 1M8MA 1T0HA 1K0XA 1Y0MA 1AWOA 2K6DA 1PNJA 2KNBB 1YWPA 2JW4A 3ULRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X6B A;  2GNC A;  3VS3 A;  4F16 A;  4Z8A A;  1WX6 A;  5EC7 A;  2DX1 A;  1WDX A;  2CH4 A;  1GFD A;  3LH5 A;  2CRE A;  2EYW A;  1EFN A;  2DBK A;  1NLP C;  2C0I A;  5FWC A;  2DIL A;  2LQW A;  2NWM A;  3TSW A;  1GCQ C;  2KRO A;  2MIO A;  3REA B;  3M0Q A;  2FPD A;  1NLO C;  4CC3 A;  2EKH A;  2BZX A;  1A0N B;  3EG0 A;  4LNP A;  4JPB W;  2HCK A;  4J9I A;  1SSH A;  4OMP A;  1WFW A;  1UG1 A;  2OJ2 A;  2SRC A;  1KJW A;  1SHF A;  2F2X A;  3QWY A;  2DL8 A;  3NMZ C;  2EQI A;  2E5K A;  2LJ3 A;  1UJY A;  3C0C A;  1M3C A;  2EYY A;  2J6O A;  2LZ6 B;  4ZNX A;  4J9C A;  4E6R A;  1NEG A;  2ROL A;  4HVW A;  1NG2 A;  5I11 A;  1G83 A;  2V1Q A;  1AOJ A;  2AZV A;  5IHI A;  1GCQ A;  4AFU C;  1RUW A;  1GRI A;  2JM8 A;  2YSQ A;  2JM9 A;  1WIE A;  2L3P A;  4AG2 C;  3ZL7 C;  4J9E A;  2YUN A;  2DVJ A;  2RQU A;  1UUE A;  2EPD A;  1X69 A;  1ZX6 A;  4HVU A;  1ZSG A;  5IHK A;  1MUZ A;  4R0K A;  4RTZ A;  2A08 A;  1X2Q A;  2F2W A;  2M0Y A;  1JXM A;  2F2V A;  1UDL A;  1UEC A;  1OOT A;  2LX7 A;  1V1C A;  2FRW A;  1GFC A;  2KGT A;  3TVT A;  1M27 C;  5IXB A;  2FRY A;  2QDL A;  3FJ5 A;  2KYM A;  2O88 A;  2HDA A;  2J7I A;  2YUO A;  1PWT A;  3M0P A;  1WXB A;  2DRK A;  1NYG A;  2KT1 A;  2CUD A;  3UF4 A;  3NGP A;  1UHF A;  2XMF A;  1MV3 A;  1WXU A;  1JU5 C;  2KXC A;  1W6X A;  4J9F A;  2FG0 A;  2CDT A;  4AFQ C;  2DL7 A;  2DL4 A;  1ARK A;  1H3H A;  1CSK A;  4HCK A;  1HJD A;  2EVR A;  4DEX A;  2C0O A;  1X27 A;  4JJC A;  2H8H A;  3M0R A;  4AFS C;  1AVZ C;  2CH4 W;  1WA7 A;  1QCF A;  1TUD A;  2VWF A;  3THK A;  1KFZ A;  3IQL A;  1RI9 A;  3VS4 A;  1KSW A;  1K0S A;  3EG2 A;  2JS2 A;  4J9H A;  1HD3 A;  1UHC A;  1QKW A;  2DA9 A;  3A98 A;  2LMJ A;  3VS6 A;  4GBQ A;  3REB B;  1G2B A;  2NUZ A;  1PRM C;  2LP5 A;  3H0F A;  1QWF A;  2RPN A;  4AFZ C;  2DE0 X;  2HEQ A;  2RMO A;  4F17 A;  2I0N A;  5I22 A;  1RLQ C;  4OMM A;  4DEY A;  2JMA A;  5IH2 A;  4WCI A;  3VS7 A;  2CT3 A;  2PNI A;  2RQR A;  5L23 A;  2KRN A;  1UTI A;  4EIK A;  1JXO A;  4JZ4 A;  1UGV A;  2LJ1 A;  2EYX A;  3EHQ A;  2D8H A;  2JXB A;  1LCK A;  1TG0 A;  3PVQ A;  1OEB A;  1XOV A;  1B3Q A;  4RTV A;  1VYV A;  2YT6 A;  2ED1 A;  3UA6 A;  3H41 A;  1AEY A;  1ZUU A;  1FMK A;  2AKK A;  1UFF A;  1VA7 A;  1BBZ A;  1KIK A;  4JZ3 A;  4IIM A;  2LJ0 A;  2BZ8 A;  1J3T A;  1W1F A;  2DRM A;  4A63 B;  3I5S A;  1GBQ A;  4RTY A;  3EG1 A;  1E7O A;  3VRZ A;  2J6K A;  1WLP B;  5FW9 A;  4AG1 C;  2YDL A;  2W10 A;  4LN2 A;  2D0N A;  2GQI A;  1W70 A;  1ZUK A;  5IHN A;  3VRY A;  2YUQ A;  1VYT A;  1M30 A;  2HSP A;  1E6H A;  3VS2 A;  1ZBJ A;  1SRL A;  4OMO A;  2C0T A;  2ABL A;  2CSI A;  1QKX A;  2KEA A;  2JS0 A;  1JQQ A;  1T0J A;  1VYU A;  4HVV A;  2W0Z A;  2A28 A;  2MCN A;  1I1J A;  1U3O A;  3I5R A;  4RTX A;  2EYZ A;  2KE9 A;  5GJW B;  2DMO A;  1OPK A;  3M0T A;  4RTW A;  2KXD A;  3QWX X;  2FO0 A;  2KR3 A;  1AZG B;  2GTJ A;  4LE9 A;  1GCP A;  2K9G A;  2L3Q A;  4RTT A;  2X3X D;  3KFV A;  1Z9Q A;  1SEM A;  2CUB A;  3UA7 A;  4Z88 A;  2DLP A;  5GJV B;  2ESW A;  2OAW A;  5FWB A;  1U5S A;  1YWO A;  2D8J A;  4GLM A;  3NPF A;  2FPE A;  1IO6 A;  2AKL A;  1K76 A;  2VKN A;  1K9A A;  2DM1 A;  4QT7 A;  2JMC A;  2J06 A;  2KYB A;  1AWJ A;  4CC2 A;  3M0S A;  1NM7 A;  2DL3 A;  2RN8 A;  3U23 A;  1Z9Z A;  2SEM A;  1PKS A;  2L2P A;  2OI3 A;  1U06 A;  3UAT A;  1SHG A;  1BB9 A;  4X1V A;  1M3A A;  2O31 A;  1TUC A;  3VS5 A;  1CKA A;  1SPK A;  2GGR A;  3H0I A;  2GBQ A;  4RUG A;  3SEM A;  2YUP A;  4ESR A;  3RBB B;  2RQW A;  1QLY A;  1S1N A;  2RQV A;  4FSS A;  2D1X A;  2JTE A;  3SHW A;  3H0H A;  4J9B A;  4CC4 B;  2PTK A;  2FPF A;  4D8K A;  4Y92 A;  1H92 A;  2O2O A;  4CC7 A;  1K4U S;  1AWX A;  2G6F X;  2J6F A;  2K3B A;  1YNZ A;  2AK5 A;  1FYN A;  1NEB A;  3RNJ A;  2K7A A;  3PVL A;  4LUD A;  1RLP C;  1ZLM A;  4OMQ A;  4KRT A;  1B07 A;  2IIM A;  1CKB A;  2RF0 A;  1JO8 A;  1YCS B;  2DF6 A;  3VS1 A;  2ECZ A;  1JEG A;  1M3B A;  1WI7 A;  2RQT A;  1HSQ A;  1OV3 A;  2VVK A;  3CQT A;  1NYF A;  1X6G A;  3JV3 A;  3O5Z A;  1T3L A;  1ABO A;  2KBT A;  1E6G A;  2V1R A;  2JT4 A;  5IXF A;  2L0A A;  2LNH B;  4OML A;  2ENM A;  4D8D A;  1ABQ A;  1T3S A;  2EW3 A;  2EGC A;  4J9G A;  2KRM A;  2KRS A;  1OPL A;  1K1Z A;  2RNA A;  1YN8 A;  1YP5 A;  2B86 A;  1I07 A;  1UE9 A;  4ORZ A;  2J05 A;  2O9S A;  2PZ1 A;  2ED0 A;  2DBM A;  1WYX A;  3EG3 A;  1BU1 A;  2X3W D;  2A37 A;  2L3S A;  2BZY A;  1AZE A;  3R6N A;  2A36 A;  4JJB A;  2DNU A;  1UJ0 A;  1X43 A;  3EGU A;  1X2K A;  2EGE A;  2AZS A;  2MOX A;  1MV0 B;  1I0C A;  2BTT A;  2CT4 A;  1GBR A;  2EGA A;  4LUE A;  1PKT A;  2O9V A;  1N5Z A;  4M4Z A;  4JJD A;  3M0U A;  2DL5 A;  1Y57 A;  2GTO A;  1BK2 A;  1AD5 A;  2M51 A;  3PE0 A;  3I35 A;  2HBW A;  1WXT A;  3VS0 A;  1H8K A;  2LQN A;  3NHN A;  2CSQ A;  5HCK A;  4Z89 A;  4J9D A;  1SRM A;  4RTU A;  5ECA A;  1GL5 A;  1PHT A;  2FEI A;  1PRL C;  3TSZ A;  4OMN A;  3EHR A;  2LCS A;  4F14 A;  2K2M A;  2DYB A;  4K11 A;  2P4R A;  3GBQ A;  4IIO A;  2ROT A;  2K79 A;  1ZUY A;  2EBP A;  2DJQ A;  1QWE A;  2KT8 A;  1AWW A;  3I9Q A;  4HXJ A;  1M8M A;  1T0H A;  1K0X A;  1Y0M A;  1AWO A;  2K6D A;  1PNJ A;  2KNB B;  1YWP A;  2JW4 A;  3ULR B; 
#chains in the Genus database with same CATH topology
 5KYW B;  4MML A;  4IUU A;  3L1A A;  5EC7 A;  1JRI A;  3MP8 A;  4DA4 A;  5CKB A;  5LJ3 h;  1K73 R;  3LH5 A;  2CRE A;  5FWC A;  4E2F B;  3JCM V;  5LJ5 g;  1W4S A;  1BCO A;  2KRO A;  2MIO A;  3REA B;  1RAD B;  3M0Q A;  2FPD A;  1NLO C;  2QTX A;  2BZX A;  3BFM A;  3EG0 A;  3UPU A;  1MNE A;  3C4S A;  2QG9 B;  4LNP A;  4XTY A;  5GAO r;  4E7S A;  4XQ3 A;  4OMP A;  2DXC A;  3OQ5 A;  1N8R C;  3LGL A;  1UG1 A;  2F2X A;  3QWY A;  2EQI A;  5GAN d;  1U8R A;  4JRI A;  1YJ9 Q;  3C0C A;  1X75 C;  2EYY A;  2FHD A;  2J6O A;  2G3R A;  1VOM A;  4ZNX A;  1NEG A;  3CCL T;  4ELY C;  5I11 A;  1S72 Q;  4PJN A;  4C8Q G;  5DY9 A;  1P92 A;  3OYB A;  1WHJ A;  1AOJ A;  1GCQ A;  5GAN h;  4AFU C;  1BI1 A;  3CCE Q;  3CBM A;  4WF2 A;  1TSF A;  2YSQ A;  1IB8 A;  2JM9 A;  3KUF A;  1UGQ B;  2QI2 A;  4NOY A;  4J9E A;  3X28 B;  2YXY A;  2RQU A;  4J5Y A;  3HKS A;  3JB9 I;  4HVU A;  1KQS S;  4NL3 A;  1QCO A;  4R0K A;  4RTZ A;  3MP1 A;  3E2U A;  2F2W A;  2M0Y A;  4M77 A;  2F2V A;  1UDL A;  3V8J A;  2RB6 A;  4JUV A;  4LDW A;  3HFN A;  2KGT A;  3L2Z A;  2FRY A;  2J7I A;  2A3L A;  3NGP A;  2DPP B;  5GAO q;  2ZPI B;  2KXC A;  2EQJ A;  2XI9 A;  4MZM A;  2DL7 A;  2QA4 A;  3OYH A;  1I81 A;  1CSK A;  1OQK A;  2RHX A;  4HCK A;  3OSS C;  3VV0 A;  3JCM Q;  1TXQ A;  2CZ7 B;  4DBR A;  1HJD A;  2EVR A;  2HZY A;  2B8A A;  2BUD A;  4DEX A;  5A0L A;  5LJ5 f;  3JCM X;  1KD1 C;  2OX7 A;  2P84 A;  2DIQ A;  1BCM A;  1WA7 A;  1M8V A;  1TU0 B;  4PJO C;  3M57 A;  2DTH A;  2LQ8 A;  1K0S A;  3EG2 A;  1VQ9 Q;  1VIF A;  4PFZ A;  2E12 A;  3PFS A;  4M7A C;  1Y07 A;  3PMT A;  2WSF E;  5DLQ E;  4XTZ A;  3FJP A;  2DA9 A;  2RI5 A;  2LMJ A;  5GMK j;  5GAN 5;  4GBQ A;  3P8H A;  1VQP Q;  4M77 F;  1C1A A;  4F7U G;  4KUI A;  5I22 A;  1RLQ C;  4JLI A;  3CCS A;  2KRN A;  3RDV A;  2AIR B;  4KGX B;  1BI0 A;  2E70 A;  5J39 A;  1UGV A;  2EYX A;  2QEX T;  4OGE A;  1WJR A;  2MK5 A;  2M1H A;  3R6O A;  4RTV A;  1VYV A;  1LJO A;  1FMK A;  2K5I A;  1VA7 A;  2DD4 A;  1BBZ A;  2GCX A;  1KIK A;  2M0O A;  4C92 A;  4M77 E;  1J3T A;  4J7F A;  1W1F A;  2DRM A;  5GAO n;  4N4I A;  1GBQ A;  1YIJ T;  2D9T A;  1QMC A;  4IUT A;  2A7Y A;  2YDL A;  3V8L A;  3G71 Q;  5LJ5 e;  1W70 A;  1M1K R;  4UC4 A;  1E6H A;  3VS2 A;  4OMO A;  1D1B A;  2XKO C;  1QKX A;  2JS0 A;  1OU8 A;  3I55 Q;  2MYS A;  4L6V 5;  3VYH B;  1VQ6 T;  2JN0 A;  2W0Z A;  2A28 A;  1N9R A;  2QQR A;  1U3O A;  3PMI A;  4XU3 A;  4RTW A;  3OS0 A;  4OP0 A;  2FO0 A;  2KR3 A;  3CBO A;  4MZP A;  3SDZ A;  2GTJ A;  4LE9 A;  1GCP A;  1HXD A;  5KYU B;  2L3Q A;  3CCJ T;  3CME A;  3UDC A;  1KHC A;  4LDX A;  4RTT A;  4M78 G;  1Z9Q A;  4QVC A;  2YHT A;  1VQM T;  5FU6 C;  2DLP A;  3ZFJ A;  2ESW A;  2QGG A;  5IN1 A;  2KY9 A;  4GLM A;  4C92 F;  3NTH A;  2AKL A;  2VKN A;  1B34 B;  3FIF A;  2DEU A;  2JMC A;  1AWJ A;  3GLX A;  1NJI C;  2QAZ A;  3DB3 A;  3L2W A;  3U23 A;  3L2U A;  2SEM A;  1B7T A;  2JZ2 A;  2WSE E;  1U06 A;  2MPX C;  4DOW A;  3S6W A;  2HAX A;  3VS5 A;  1CKA A;  3A8H B;  2GGR A;  3RBB B;  5GAM e;  4ZGD B;  2COY A;  2CP5 A;  2E4H A;  3CCV A;  1QLY A;  4WTO B;  4C8Q C;  4LDV A;  2QA4 Q;  3M56 A;  4C0D C;  4J9B A;  3CXC P;  4C92 E;  2NUP A;  1H92 A;  2O2O A;  1ZSZ B;  1MHN A;  1Q81 U;  4CC7 A;  3HL8 A;  2RJE A;  2X9H A;  2YLC A;  2K3B A;  4EMK C;  2K7A A;  1TUG B;  3PVL A;  4D6W A;  4LUD A;  3ZBD A;  1OZ3 A;  2M16 A;  4MDW A;  2XHC A;  1B07 A;  4DQ2 A;  3QDR B;  2DF6 A;  3QII A;  3VS1 A;  2QQS A;  3ZEH A;  1M3B A;  1WI7 A;  3OYK A;  1D1C A;  1NYF A;  1T3L A;  2RA2 A;  4BDY A;  1ABO A;  2V1R A;  1Q82 C;  2L0A A;  4OML A;  1AHJ B;  2O4X B;  4QQ6 A;  3G1J A;  1ZSZ A;  4OB1 B;  4OF1 A;  2NUT B;  2KVQ G;  1NZ9 A;  1YP5 A;  3OMC A;  5FRM A;  1OX9 A;  1UGR B;  2VB6 A;  5A0G A;  1YIT T;  2MWP A;  3MEW A;  2J05 A;  2PQW A;  1XJW B;  2DBM A;  5LJ5 h;  3MJX A;  1BU1 A;  2A37 A;  1F1B B;  2QQB A;  1OX8 A;  4BB7 A;  2RK1 A;  2DNU A;  4BD3 A;  1VQ4 Q;  4PL6 A;  1X2K A;  3EG9 A;  5GAN j;  4KGV B;  3MCA B;  2O4X A;  1WJQ A;  1VQL A;  1WHL A;  4PJO D;  1BKB A;  4M4Z A;  3H6Z A;  2NUT A;  3M0U A;  1N6A A;  4M7A D;  5CVI A;  1VQK A;  2LDM A;  3I35 A;  1WXT A;  2EFI A;  3CCM A;  4E7Z A;  1HK9 A;  3NHN A;  1Q7Y R;  2CSQ A;  4Z89 A;  1N9S A;  1PM3 A;  2LVM A;  4RCC A;  1PRL C;  3EFO B;  2HKQ B;  2DYB A;  3C94 A;  4K11 A;  3ER0 A;  5GAM d;  3GP8 A;  2BKD N;  1XQH A;  4E7J A;  3S3O A;  5KE2 A;  2QDY B;  4IKF A;  2KT8 A;  4HXJ A;  3QKJ A;  3TEE A;  1PG5 B;  1AWO A;  5KYX B;  4BUG A;  5GAN 7;  9ATC B;  2RK2 A;  1G5V A;  1MMA A;  4AT1 B;  1D1A A;  2QGF B;  2E1H A;  1YJW T;  5FRN A;  2KSS A;  1GFD A;  4QVZ A;  3X25 B;  1N8R U;  2DBK A;  4PJO B;  3GF5 A;  2NWM A;  4C5I A;  3MEV A;  3J80 E;  3VYG A;  4M7A B;  2M9U A;  5J3B A;  4PFO A;  3CCV Q;  4CC3 A;  5KE3 A;  1A0N B;  4C0G A;  4V2S A;  2R5A A;  1YI2 Q;  4M7D G;  3PNW C;  5CR2 A;  4M78 C;  3LYI A;  4XTV A;  3E19 A;  2HBP A;  2K4Y A;  1D3B B;  1KJW A;  2EIF A;  3V7S A;  1MND A;  2DYI A;  2E5K A;  5FU7 B;  2LJ3 A;  4NS5 A;  1UJY A;  4PJO A;  2RJF A;  4J9C A;  4FW2 A;  3HHT B;  4HVW A;  2RD1 A;  1WHG A;  3JB9 F;  2V1Q A;  3L42 A;  2NLU A;  1VQ8 Q;  4KGZ B;  4ME7 A;  1QVF A;  1K8A C;  5CKE A;  1GRI A;  4A4H A;  1WIE A;  1N27 A;  2DVJ A;  2OTJ Q;  4PNO A;  3JCM W;  4DBQ A;  1UUE A;  1BI2 A;  3HPW A;  2EPD A;  3OYE A;  3VJP A;  1MMG A;  2P0Q A;  1UB4 A;  1YJ9 T;  5IHK A;  1VQO Q;  1MUZ A;  1M4Z A;  4HCZ A;  2D6F A;  1ZA2 B;  4C8Q D;  3BW1 A;  5GMK l;  1OOT A;  1V1C A;  1KD1 U;  1GFC A;  3EGD A;  4JS4 A;  3JCM J;  4LD9 K;  1SKU B;  1S72 T;  2O88 A;  1PWT A;  3M0P A;  1WXB A;  2DRK A;  1NYG A;  2CUD A;  3CCQ Q;  1M2V B;  1JBM A;  3CCE T;  4PJO F;  1MV3 A;  1VQL Q;  3GPL A;  3OYF A;  3OYI A;  2HL3 A;  4PJL A;  4J9F A;  2FG0 A;  2CDT A;  3GOX A;  4TVR A;  4QVD A;  5FU6 B;  1VQK Q;  4RKU E;  4XTU A;  3EGX A;  3CCM Q;  1OUL A;  1X27 A;  4JJC A;  3SD4 A;  3CD6 Q;  2H8H A;  1AVZ C;  1QCF A;  5AT1 B;  2VXE A;  1NBE B;  1RI9 A;  1FXX A;  1M9S A;  4M75 A;  2VV5 A;  1M2O A;  4J9H A;  1HD3 A;  3CCL A;  4Q5W A;  1RAA B;  4BI8 B;  2P4T A;  2VXF A;  3A98 A;  6AT1 B;  2V8J A;  3BDU A;  1MMN A;  1IHW A;  1M2V A;  1UEB A;  1G2B A;  4JRP A;  2HL5 C;  2NUZ A;  2QQA A;  2RHZ A;  2JTF A;  4R55 A;  1QWF A;  1RL2 A;  1WNL A;  8AT1 B;  1YJN T;  4HT9 A;  3G6E A;  4C8Q B;  2HEQ A;  5KYY B;  2I0N A;  1K73 C;  4OMM A;  3V7R A;  4C0D B;  4C5G A;  3CMA Q;  2JOY A;  2RQR A;  5L23 A;  1UTI A;  1JXO A;  5KYW A;  3JCM c;  4JZ4 A;  3S3M A;  1KG1 A;  2E6Z A;  2LJ1 A;  3BY7 A;  3EHQ A;  2JXB A;  4EMK B;  3QJY A;  1VQ9 T;  1OEB A;  2DD5 A;  3QJ6 A;  3M53 A;  4J8O A;  3FEO A;  1B3Q A;  2BIV A;  1AEY A;  1KQ1 A;  4BDZ A;  1M90 C;  1VQP T;  2XG8 D;  3CPF A;  3I5S A;  4M75 F;  4C8Q A;  2DXB A;  4RTY A;  1KC8 R;  3VRZ A;  2M02 A;  2J6K A;  1RAE B;  1WPY A;  2JJ9 A;  1OYX A;  2D0N A;  3VRY A;  1RI0 A;  2X51 A;  1I5L A;  1QVF S;  1ZHI A;  3CCU A;  2HSE B;  1ZBJ A;  3TU4 K;  1LPL A;  3OBY A;  1T0J A;  1HYO A;  1V76 A;  3CC2 A;  1I1J A;  2LRQ A;  3INZ A;  3Q1J A;  2KE9 A;  3RUX A;  1NJI U;  4ZN3 A;  4B6M A;  2KXD A;  5GAO m;  3QWX X;  4M75 E;  1AZG B;  4A4G A;  2CP7 A;  2OTL A;  1R0C B;  4BE0 A;  4E7I A;  3KFV A;  2XK0 A;  1SEM A;  4Z88 A;  2OAW A;  5FWB A;  2Y4X A;  3G71 T;  3CPW P;  4M7D C;  7AT1 B;  5GAO p;  3C95 A;  4M77 G;  3NPF A;  4F7U B;  1Q86 R;  2FPE A;  4DOV A;  3M4Y A;  4J7I A;  1K9A A;  2DM1 A;  4O6J A;  4C8Q F;  3RR6 A;  4CC2 A;  1NM7 A;  2DL3 A;  5M9O A;  4P5N A;  4PKC C;  2BE7 D;  3I55 T;  1GXI E;  1OI1 A;  4JLG A;  1PKS A;  4HA8 A;  2OI3 A;  3LH0 A;  1BB9 A;  4X1V A;  2O31 A;  1TUC A;  3DB4 A;  4M78 D;  2GBQ A;  4RUG A;  2EYQ A;  3RER A;  2L89 A;  2FVU A;  3LWI A;  3LGF A;  3T9N A;  1YIJ A;  3X24 B;  3H0H A;  2WSC E;  1VQ5 A;  3LWH A;  2R57 A;  4D8K A;  3J7A F;  2K3X A;  2MF2 A;  4FT2 A;  3ME9 A;  1YHQ A;  5GAM j;  1Q82 U;  4QKU A;  1G3T A;  2KAF A;  4ZN1 A;  3SB2 A;  3RNJ A;  1JB0 E;  2CYZ B;  3OBW A;  1RLP C;  3P8B B;  4N0A C;  4ANJ A;  4KRT A;  1I4K 1;  5FLX E;  1CKB A;  1RAC B;  1JO8 A;  3JSC A;  2YLB A;  1G3W A;  2P0P A;  1JEG A;  3G6E Q;  2RQT A;  1RAH B;  3CCJ A;  4J6X A;  2VVK A;  2QA4 T;  3MO8 A;  3JV3 A;  5A0D A;  3O5Z A;  2KBT A;  1E6G A;  5IXF A;  1UGP B;  1RAG B;  4D8D A;  1BIA A;  4M78 B;  1OPL A;  1K1Z A;  2DXU A;  2KI7 A;  4J83 A;  2RNA A;  1YN8 A;  1WHK A;  1K9M C;  2HKN A;  2FZG B;  4C92 G;  2K57 A;  2AHJ B;  3M4G A;  1QVP A;  2XDP A;  2X4W A;  1WYX A;  2AT1 B;  2F1L A;  3EG3 A;  2X3W D;  5GAN 6;  3OY9 A;  2EKO A;  3PIP A;  3X20 B;  2VGN A;  5GAN 8;  3V7C A;  1AZE A;  1W2B P;  3R6N A;  3UWN A;  2A36 A;  2E65 A;  1M1K C;  1UJ0 A;  2CS7 A;  3OYA A;  2RJD A;  2ZPB B;  1WHH A;  1WZO A;  4PLI A;  2AZS A;  2DZ9 A;  1PD1 A;  4A4E A;  1KK7 A;  4OVA A;  2BTT A;  2A0F B;  2YRD A;  3M59 A;  2EGA A;  3CC4 A;  1SSF A;  2O9V A;  1Y96 B;  3CCU Q;  4JJD A;  3QBY A;  3V8K A;  1Y57 A;  3MEU A;  1BK2 A;  1AD5 A;  2M51 A;  5KCO A;  2H3J A;  1G8X A;  3VS0 A;  5HCK A;  2E3H A;  1FMW A;  3CC2 Q;  4RTU A;  1O75 A;  3JCM f;  3DLM A;  5FRO A;  2DTO A;  4OMN A;  3EHR A;  2FZK B;  3KXT A;  4FM4 B;  2P4R A;  3GBQ A;  2ROT A;  2Z0W A;  2EBP A;  4A54 A;  2OTL Q;  1JJ2 P;  4KBM B;  4X9D A;  3H8Z A;  3NTK A;  5HKC A;  1VQ4 T;  1H3Z A;  1Y0M A;  3CCR A;  3FRN A;  2RHY A;  5KYU A;  4II1 A;  5HY6 A;  1ZA1 B;  2DIG A;  2JW4 A;  1PSF A;  3TCJ A;  1X6B A;  4XK8 E;  3VS3 A;  4F16 A;  4Z8A A;  3HTR A;  1G3Y A;  2KMT A;  3C12 A;  2CZ0 B;  1WX6 A;  5CKH A;  4BI4 A;  2DX1 A;  3RMQ A;  1B34 A;  2CH4 A;  1M1G A;  2EYW A;  3A8L B;  4J6Y A;  3BE3 A;  4PFP A;  4FIB A;  5CO7 A;  3FC3 A;  1GCQ C;  1AT1 B;  5LJ3 j;  2E64 A;  2WAC A;  4E7H A;  4OGC A;  3DKM A;  2EKH A;  4OB2 B;  1VQ5 Q;  5L8R E;  2CP2 A;  2EJG A;  4KH1 B;  2DER A;  3M58 A;  2HCK A;  2LCC A;  1YHQ Q;  1W2B A;  2PUO B;  5D6X A;  2OJ2 A;  2SRC A;  3CC7 A;  1SHF A;  2LTO A;  5LJ5 d;  3P8D A;  3CCS Q;  1K8A U;  3TQ7 P;  2L3R A;  5C6S A;  1PSE A;  1D09 B;  1OZ2 A;  1QW1 A;  4M77 C;  4E7L A;  2L8D A;  2JNG A;  2PU9 B;  4FYY B;  4AMC A;  2ROL A;  4KH0 B;  1G83 A;  3CCV T;  3S3N A;  4M7D D;  2AZV A;  5IHI A;  5I2S A;  2BE9 B;  4MDX A;  4RG2 A;  3OS1 A;  2E10 A;  1YI2 T;  2JM8 A;  1VQN A;  2EQK A;  2L3P A;  3ZL7 C;  1JJ2 A;  4PK4 A;  2YUN A;  1MMD A;  1X01 A;  3AT1 B;  2EQM A;  1PD0 A;  1TWB A;  2EWN A;  4QQD A;  4JRQ A;  1WGS A;  1YJW A;  2RM4 A;  1I5O B;  1D0Y A;  2CP6 A;  2A08 A;  1X2Q A;  4ELZ C;  5KH6 A;  2LX7 A;  3CXC A;  2LT1 A;  3TVT A;  3E9G A;  2QDL A;  2KYM A;  2KT1 A;  1VQ8 T;  3UF4 A;  4C5H A;  4JJN K;  2RI2 A;  1UHF A;  2XMF A;  2ZAE A;  3VUB A;  3CME Q;  1ACM B;  1WXU A;  1Q7Y C;  1JU5 C;  2LNV A;  3CC4 Q;  4L59 A;  1RAB B;  4IUR A;  1W6X A;  3PT9 A;  2DKG A;  3M55 A;  4AFQ C;  2DL4 A;  2LC4 A;  1ARK A;  4FW1 A;  2ZZD A;  2OTJ T;  3MET A;  2F69 A;  4M7D B;  2C0O A;  2YRV A;  2DVE A;  3M0R A;  5GAN f;  1Q95 G;  3G7Z A;  1K73 U;  3F70 A;  2VWF A;  3THK A;  1VQO T;  2DZC A;  3G4S A;  3VS4 A;  1KSW A;  1LNX A;  2JS2 A;  1UHC A;  2IG0 A;  4FU6 A;  1QQJ A;  4C92 C;  3EFO A;  1O9S A;  3HP9 A;  5IT9 E;  3JB9 J;  5I21 A;  2PVD B;  3VS6 A;  5I2M A;  3CCQ T;  3CCR Q;  3FDR A;  3H0F A;  1VQL T;  2RMO A;  3I56 A;  4F17 A;  4DEY A;  5J26 A;  3JB9 G;  2JMA A;  5IH2 A;  4WCI A;  1VQK T;  5KYX A;  2CT3 A;  2HNI A;  1M90 U;  3CCM T;  2RI3 A;  4JS5 A;  4EIK A;  3CD6 T;  3J81 E;  4RG8 A;  1Q81 R;  1EZZ B;  1G3S A;  4BI3 A;  1LCK A;  1VQ7 A;  5A2Q E;  2CZ6 B;  2FYK A;  1W2B S;  3MEA A;  4LDU A;  1BI3 A;  1MGQ A;  2ED1 A;  3H41 A;  1ZUU A;  1FWZ A;  3WVE B;  4JZ3 A;  4M7A A;  3M54 A;  2LJ0 A;  3A8G B;  3RMS A;  1ZBX A;  3SWN C;  3CC7 Q;  5FW9 A;  4AG1 C;  3CMA T;  1TH7 A;  1K8A R;  4LN2 A;  2E6N A;  1ZUK A;  4FYX B;  5IHN A;  2YUQ A;  1M30 A;  2HSP A;  1D3B A;  1SRL A;  2C0T A;  2CSI A;  5GAN 4;  1WJS A;  1JQQ A;  1VYU A;  4HVV A;  1JJ2 S;  3KBG A;  4M7D F;  4OB3 B;  4BY6 C;  2ZPE B;  3BDL A;  4RTX A;  2EYZ A;  2PUK B;  5GJW B;  2DMO A;  1V29 B;  3H9N A;  3M0T A;  3D7S B;  1IRE B;  3A1P A;  1C0M A;  2K9G A;  1D0Z A;  1YJN A;  1VQN Q;  3CXC S;  1LVK A;  3OMG A;  3UA7 A;  1R77 A;  2GF7 A;  1RAF B;  1U5S A;  1YWO A;  2P0K A;  3OYG A;  4ZTJ A;  4M7A F;  2X4J A;  4QT7 A;  3MHX A;  2J06 A;  2KYB A;  4EPC A;  3M0S A;  2RN8 A;  2X35 A;  2YRC A;  4KUL A;  2L5Q A;  1D0X A;  1VQ9 A;  2L2P A;  5D6Y A;  3RIR A;  1M3A A;  1EX4 A;  1PC0 A;  1Y7X A;  4EMH A;  2XIC A;  8ATC B;  1FMV A;  3SEM A;  2CKK A;  1VQP A;  2RQW A;  5CQX A;  1UGS B;  2HMA A;  1S1N A;  4KUD K;  2RQV A;  2D1X A;  4QQG A;  2JTE A;  4PJO E;  4M77 D;  4C5E A;  1ZSZ C;  2KK4 A;  3OS5 A;  4M7A E;  2PTK A;  2FPF A;  1BIB A;  4M75 G;  3OYN A;  2KDS A;  3G4S Q;  3QPH A;  1AWX A;  2G6F X;  2ZPG B;  2J6F A;  1YNZ A;  2AK5 A;  4Y91 A;  1FYN A;  3OW2 P;  3HSB A;  3VUZ A;  4LXC A;  4Z02 A;  3FB9 A;  2QXF A;  1N8R R;  1ZLM A;  4OMQ A;  2VAS A;  2IIM A;  1K9M U;  2HD0 A;  2RF0 A;  5D7U A;  1YCS B;  2XID A;  2HQE A;  3NTI A;  3I56 Q;  1OV3 A;  4ZTF A;  3OYL A;  1X6G A;  1SF9 A;  2LNH B;  2ENM A;  3N5B B;  5KYY A;  2EW3 A;  5KYN A;  1M90 R;  3G71 A;  4J9G A;  1M1K U;  2KRM A;  5AYF A;  3HRU A;  2DK3 A;  4R56 A;  1VQ7 Q;  1PCX A;  3OS2 A;  3I55 A;  4M77 B;  3QHS A;  3EH2 A;  1KC8 C;  4ORZ A;  1QVG P;  2PZ1 A;  4EMK A;  2LCL A;  2E41 A;  2CGH A;  4FL6 A;  2XU8 A;  2L3S A;  2BZY A;  5GMK i;  4XAX B;  4JJB A;  1KQ2 A;  4FCY A;  2YWW A;  3G6E T;  1R8O B;  2DXT A;  5LJ5 j;  1X43 A;  2IVW A;  3EGU A;  3FLG A;  4ZGE B;  1I0C A;  3M5A A;  4LUE A;  4A4K A;  5GAM g;  2DL5 A;  3JAM E;  4C92 D;  3PE0 A;  2GTO A;  2KQW A;  2HBW A;  1H8K A;  2LQN A;  2QQ9 A;  2QAS A;  1SRM A;  5ECA A;  1GL5 A;  3EFR A;  1PHT A;  4BE2 A;  1VIE A;  4DBF A;  2QEX A;  2LCS A;  4F14 A;  4IIO A;  1KD1 R;  1ZUY A;  2DJQ A;  1Q86 C;  1YJN Q;  3OW2 A;  3OB9 A;  4ZGJ B;  3I9Q A;  1M8M A;  1T0H A;  2DJZ A;  1K0X A;  4QW2 A;  2K6D A;  4EDU A;  2KNB B;  2O01 E;  1YWP A;  3JCM g;  3ULR B;  3ASK A;  1NPR A;  2GNC A;  3CCU T;  2MWO A;  3PIO A;  2Y4Y A;  4FYV B;  4F7U A;  1IRX A;  1WDX A;  4C8Q E;  4KT0 E;  3OYD A;  3CC2 T;  4XTW A;  1EFN A;  1NLP C;  2C0I A;  2GQV A;  2DIL A;  2RH2 A;  2LQW A;  3OYY A;  3TSW A;  3CCL Q;  1VQ6 A;  2LX9 A;  4C92 B;  4FT4 A;  3A8M B;  2OTL T;  2VYT A;  1QVG A;  2MI6 A;  1IHV A;  2X4X A;  4JPB W;  3GIB A;  4J9I A;  3JCM b;  4RMO A;  5FU7 C;  1SSH A;  1WFW A;  1VQM A;  2GFA A;  2DL8 A;  3NMZ C;  4PJM A;  1M5Q 1;  5CIU A;  1M3C A;  5CKD A;  3OYJ A;  3QZ5 B;  2LZ6 B;  4E6R A;  5GAO l;  1K9M R;  5KCH A;  3CPW A;  5GAM f;  1NG2 A;  4F7U F;  1SG5 A;  2F5K A;  1VQ4 A;  2JTM A;  1WHM A;  4XU2 A;  3MPU B;  4XTX A;  2COZ A;  1VQ5 T;  1RUW A;  3L2Q A;  1X6O A;  2QYZ A;  3SWN B;  1LOJ A;  1YHQ T;  4AG2 C;  1I8F A;  2V8K A;  2JVV A;  2EJF A;  3GNG A;  2MAM A;  3CCS T;  4M78 A;  3VU3 C;  3EAE A;  1Q7Y U;  2NYS A;  4BE1 A;  1X69 A;  4M75 C;  1ZX6 A;  1ZSG A;  2K5F A;  4L5G A;  1VUB A;  5LJ3 g;  4Y28 E;  1JXM A;  1UEC A;  2FRW A;  3PTA A;  2FL7 A;  4F7U E;  4BY6 B;  3MP6 A;  1M27 C;  5IXB A;  3FJ5 A;  2HDA A;  1NJI R;  2YUO A;  4IUQ A;  2C06 A;  5CCA A;  3QZ9 B;  5DLO A;  3LW5 E;  3LX7 A;  1NE8 A;  2V26 A;  2NUP B;  3SWN A;  5GAN 3;  1H3H A;  2QK0 A;  1YBY A;  3AHU A;  2VGM A;  3QYG B;  1WQW A;  1RAI B;  3OW2 S;  1TOV A;  1Y96 A;  5GMK e;  4AFS C;  2CH4 W;  1NPP A;  1TUD A;  1KFZ A;  3IQL A;  1EIF A;  3UT1 A;  4DBH A;  2QEX Q;  5D6W A;  4ATO A;  1YIT A;  2PVG B;  3L2V A;  1U1T A;  4M78 F;  4LDY A;  4E7K A;  1QKW A;  3RKX A;  3CBP A;  1ZQ1 A;  1BYM A;  3REB B;  4IUV A;  3M9Q A;  4E47 A;  1PRM C;  2LP5 A;  5GAN g;  2CP3 A;  3CME T;  3HRS A;  2RPN A;  4AFZ C;  1YI2 A;  2DE0 X;  3CC4 T;  4FYW B;  4F04 B;  1YIJ Q;  3E9F A;  3QYH B;  4FSX A;  2DTI A;  5HK3 A;  3VS7 A;  2EJ9 A;  1Y71 A;  2PNI A;  2ZCF B;  2PVO B;  2JUF A;  2ZGW A;  4EMG A;  1QVG S;  2FB7 A;  5CAI A;  1Q82 R;  2D8H A;  3QXE B;  1TG0 A;  2COW A;  3PVQ A;  1VQ6 Q;  1XOV A;  4M78 E;  3JCM e;  2YT6 A;  3UA6 A;  1QCN A;  3EFS A;  2ZPF B;  1YCY A;  4CI0 C;  2AKK A;  1UFF A;  2DFU A;  3A8O B;  1VQ8 A;  5CKF A;  4IIM A;  3JB9 D;  2BZ8 A;  3CCR T;  3EG9 B;  4A63 B;  3CCJ Q;  3EH1 A;  3EG1 A;  4VUB A;  1E7O A;  2LT4 A;  3CPW S;  1WLP B;  2K2V A;  5LJ3 f;  1VQM Q;  1FX7 A;  2DET A;  2OTJ A;  2W10 A;  2GQI A;  3CEY A;  3HFO A;  1VYT A;  4HCC A;  1VQO A;  2ABL A;  2KEA A;  2VUB A;  4HKE A;  1TTH B;  4B9W A;  3E1S A;  2MCN A;  4RCB A;  3I5R A;  4B9X A;  3OSV A;  4J6W A;  1KHI A;  1OPK A;  2EAY A;  2OAU A;  5C0M A;  3CCQ A;  3RES A;  2X3X D;  2RHU A;  4JRK A;  3CC7 T;  5DM7 R;  4OMF B;  2CUB A;  4JDS A;  4PLL A;  5CK9 A;  3NFC A;  5GJV B;  1C6V X;  2X4Y A;  4HT8 A;  2ZPH B;  2D8J A;  4PJJ A;  3URG A;  1IO6 A;  1K76 A;  3CD6 A;  2XDB A;  2DO3 A;  4GY5 A;  4GLK A;  2DAQ A;  1QVF P;  4A4F A;  1Z9Z A;  3GNF B;  4MZT A;  3UAT A;  1SHG A;  2HQX A;  1KQS P;  3MKD A;  1H64 1;  3QUI A;  1SPK A;  5GMK h;  3H0I A;  3JB9 H;  5GMK m;  4ESR A;  2YUP A;  1QP2 A;  2EQU A;  4HCB A;  2FZC B;  3JCM P;  4X9C A;  4FSS A;  1VQN T;  1IZ6 A;  2VC8 A;  5EG2 A;  1TS9 A;  3SHW A;  5LJ3 e;  2F5T X;  3PGG A;  4CC4 B;  5CQY A;  5GAM h;  3JRZ A;  4XU1 A;  3CMA A;  4Y92 A;  2Y90 A;  3RKY A;  2MMP A;  2D0Q B;  4M7D A;  1K4U S;  1XTD A;  3RKW A;  1WQ7 A;  4A53 A;  1YIT Q;  1NEB A;  3JCM d;  1YJ9 A;  2CZ1 B;  2RO0 A;  1XNI A;  1OU9 A;  2R5M A;  3QG1 A;  4N4G A;  4OB0 B;  3OA6 A;  2ECZ A;  1S72 A;  1DJ7 B;  1KC8 U;  1HSQ A;  1IXD A;  1Q81 C;  3L2R A;  2QTV A;  3CQT A;  4M75 D;  5LL6 S;  2JT4 A;  3JCM h;  3CCE A;  1ABQ A;  1T3S A;  3WVD B;  2EGC A;  2H3E B;  4IUP A;  4X34 A;  2XD0 A;  2KRS A;  2GFU A;  4CRI A;  5IAY A;  3G4S T;  4PJO G;  1QP3 A;  2B86 A;  3TRE A;  3SFM A;  5GAN e;  4M7A G;  1I07 A;  1IGQ A;  3EGD B;  1UE9 A;  2O9S A;  2ED0 A;  2LQK A;  4MMK A;  4N0A A;  4NL2 A;  3I56 T;  2EGE A;  5HK0 A;  2MOX A;  1MV0 B;  1YFN A;  4BAC A;  2ATC B;  1KQS A;  2CT4 A;  1GBR A;  2K3Y A;  3EGX B;  2RHI A;  4N4H A;  1R0B G;  2E3I A;  5GAN 2;  1Q86 U;  1PKT A;  1N5Z A;  2IPO B;  1M1F A;  4XU0 A;  3QSU A;  3WXM B;  3O8V A;  3DLL A;  1U1S A;  1VQ7 T;  3OYC A;  1YJW Q;  4M75 B;  3LLR A;  4LD6 A;  2V8I A;  4J9D A;  4C0Z A;  2K5L A;  2FEI A;  3HRT A;  2HQH A;  3TSZ A;  3VKI A;  3OYM A;  2R58 A;  2I2L A;  2K2M A;  4M7D E;  3A5Z B;  4YTL A;  2K79 A;  1IGU A;  2RJC A;  1QWE A;  1AWW A;  5LJ3 d;  3QDF A;  3X26 B;  2XDD A;  1PNJ A;  2DEQ A;  4C0F A;  4O5V A;  2CP0 A;  3QO3 A;  2E5Q A; 
#chains in the Genus database with same CATH homology
 1X6B A;  2GNC A;  3VS3 A;  4F16 A;  4Z8A A;  1WX6 A;  5EC7 A;  2DX1 A;  1WDX A;  2CH4 A;  1GFD A;  3LH5 A;  2CRE A;  2EYW A;  1EFN A;  2DBK A;  1NLP C;  2C0I A;  5FWC A;  2DIL A;  2LQW A;  2NWM A;  3TSW A;  1GCQ C;  2KRO A;  2MIO A;  3REA B;  3M0Q A;  2FPD A;  1NLO C;  4CC3 A;  2EKH A;  2BZX A;  1A0N B;  3EG0 A;  4LNP A;  4JPB W;  2HCK A;  4J9I A;  1SSH A;  4OMP A;  1WFW A;  1UG1 A;  2OJ2 A;  2SRC A;  1KJW A;  1SHF A;  2F2X A;  3QWY A;  2DL8 A;  3NMZ C;  2EQI A;  2E5K A;  2LJ3 A;  1UJY A;  3C0C A;  1M3C A;  2EYY A;  2J6O A;  2LZ6 B;  4ZNX A;  4J9C A;  4E6R A;  1NEG A;  2ROL A;  4HVW A;  1NG2 A;  5I11 A;  1G83 A;  2V1Q A;  1AOJ A;  2AZV A;  5IHI A;  1GCQ A;  4AFU C;  1RUW A;  1GRI A;  2JM8 A;  2YSQ A;  2JM9 A;  1WIE A;  2L3P A;  4AG2 C;  3ZL7 C;  4J9E A;  2YUN A;  2DVJ A;  2RQU A;  1UUE A;  2EPD A;  1X69 A;  1ZX6 A;  4HVU A;  1ZSG A;  5IHK A;  1MUZ A;  4R0K A;  4RTZ A;  2A08 A;  1X2Q A;  2F2W A;  2M0Y A;  1JXM A;  2F2V A;  1UDL A;  1UEC A;  1OOT A;  2LX7 A;  1V1C A;  2FRW A;  1GFC A;  2KGT A;  3TVT A;  1M27 C;  5IXB A;  2FRY A;  2QDL A;  3FJ5 A;  2KYM A;  2O88 A;  2HDA A;  2J7I A;  2YUO A;  1PWT A;  3M0P A;  1WXB A;  2DRK A;  1NYG A;  2KT1 A;  2CUD A;  3UF4 A;  3NGP A;  1UHF A;  2XMF A;  1MV3 A;  1WXU A;  1JU5 C;  2KXC A;  1W6X A;  4J9F A;  2FG0 A;  2CDT A;  4AFQ C;  2DL7 A;  2DL4 A;  1ARK A;  1H3H A;  1CSK A;  4HCK A;  1HJD A;  2EVR A;  4DEX A;  2C0O A;  1X27 A;  4JJC A;  2H8H A;  3M0R A;  4AFS C;  1AVZ C;  2CH4 W;  1WA7 A;  1QCF A;  1TUD A;  2VWF A;  3THK A;  1KFZ A;  3IQL A;  1RI9 A;  3VS4 A;  1KSW A;  1K0S A;  3EG2 A;  2JS2 A;  4J9H A;  1HD3 A;  1UHC A;  1QKW A;  2DA9 A;  3A98 A;  2LMJ A;  3VS6 A;  4GBQ A;  3REB B;  1G2B A;  2NUZ A;  1PRM C;  2LP5 A;  3H0F A;  1QWF A;  2RPN A;  4AFZ C;  2DE0 X;  2HEQ A;  2RMO A;  4F17 A;  2I0N A;  5I22 A;  1RLQ C;  4OMM A;  4DEY A;  2JMA A;  5IH2 A;  4WCI A;  3VS7 A;  2CT3 A;  2PNI A;  2RQR A;  5L23 A;  2KRN A;  1UTI A;  4EIK A;  1JXO A;  4JZ4 A;  1UGV A;  2LJ1 A;  2EYX A;  3EHQ A;  2D8H A;  2JXB A;  1LCK A;  1TG0 A;  3PVQ A;  1OEB A;  1XOV A;  1B3Q A;  4RTV A;  1VYV A;  2YT6 A;  2ED1 A;  3UA6 A;  3H41 A;  1AEY A;  1ZUU A;  1FMK A;  2AKK A;  1UFF A;  1VA7 A;  1BBZ A;  1KIK A;  4JZ3 A;  4IIM A;  2LJ0 A;  2BZ8 A;  1J3T A;  1W1F A;  2DRM A;  4A63 B;  3I5S A;  1GBQ A;  4RTY A;  3EG1 A;  1E7O A;  3VRZ A;  2J6K A;  1WLP B;  5FW9 A;  4AG1 C;  2YDL A;  2W10 A;  4LN2 A;  2D0N A;  2GQI A;  1W70 A;  1ZUK A;  5IHN A;  3VRY A;  2YUQ A;  1VYT A;  1M30 A;  2HSP A;  1E6H A;  3VS2 A;  1ZBJ A;  1SRL A;  4OMO A;  2C0T A;  2ABL A;  2CSI A;  1QKX A;  2KEA A;  2JS0 A;  1JQQ A;  1T0J A;  1VYU A;  4HVV A;  2W0Z A;  2A28 A;  2MCN A;  1I1J A;  1U3O A;  3I5R A;  4RTX A;  2EYZ A;  2KE9 A;  5GJW B;  2DMO A;  1OPK A;  3M0T A;  4RTW A;  2KXD A;  3QWX X;  2FO0 A;  2KR3 A;  1AZG B;  2GTJ A;  4LE9 A;  1GCP A;  2K9G A;  2L3Q A;  4RTT A;  2X3X D;  3KFV A;  1Z9Q A;  1SEM A;  2CUB A;  3UA7 A;  4Z88 A;  2DLP A;  5GJV B;  2ESW A;  2OAW A;  5FWB A;  1U5S A;  1YWO A;  2D8J A;  4GLM A;  3NPF A;  2FPE A;  1IO6 A;  2AKL A;  1K76 A;  2VKN A;  1K9A A;  2DM1 A;  4QT7 A;  2JMC A;  2J06 A;  2KYB A;  1AWJ A;  4CC2 A;  3M0S A;  1NM7 A;  2DL3 A;  2RN8 A;  3U23 A;  1Z9Z A;  2SEM A;  1PKS A;  2L2P A;  2OI3 A;  1U06 A;  3UAT A;  1SHG A;  1BB9 A;  4X1V A;  1M3A A;  2O31 A;  1TUC A;  3VS5 A;  1CKA A;  1SPK A;  2GGR A;  3H0I A;  2GBQ A;  4RUG A;  3SEM A;  2YUP A;  4ESR A;  3RBB B;  2RQW A;  1QLY A;  1S1N A;  2RQV A;  4FSS A;  2D1X A;  2JTE A;  3SHW A;  3H0H A;  4J9B A;  4CC4 B;  2PTK A;  2FPF A;  4D8K A;  4Y92 A;  1H92 A;  2O2O A;  4CC7 A;  1K4U S;  1AWX A;  2G6F X;  2J6F A;  2K3B A;  1YNZ A;  2AK5 A;  1FYN A;  1NEB A;  3RNJ A;  2K7A A;  3PVL A;  4LUD A;  1RLP C;  1ZLM A;  4OMQ A;  4KRT A;  1B07 A;  2IIM A;  1CKB A;  2RF0 A;  1JO8 A;  1YCS B;  2DF6 A;  3VS1 A;  2ECZ A;  1JEG A;  1M3B A;  1WI7 A;  2RQT A;  1HSQ A;  1OV3 A;  2VVK A;  3CQT A;  1NYF A;  1X6G A;  3JV3 A;  3O5Z A;  1T3L A;  1ABO A;  2KBT A;  1E6G A;  2V1R A;  2JT4 A;  5IXF A;  2L0A A;  2LNH B;  4OML A;  2ENM A;  4D8D A;  1ABQ A;  1T3S A;  2EW3 A;  2EGC A;  4J9G A;  2KRM A;  2KRS A;  1OPL A;  1K1Z A;  2RNA A;  1YN8 A;  1YP5 A;  2B86 A;  1I07 A;  1UE9 A;  4ORZ A;  2J05 A;  2O9S A;  2PZ1 A;  2ED0 A;  2DBM A;  1WYX A;  3EG3 A;  1BU1 A;  2X3W D;  2A37 A;  2L3S A;  2BZY A;  1AZE A;  3R6N A;  2A36 A;  4JJB A;  2DNU A;  1UJ0 A;  1X43 A;  3EGU A;  1X2K A;  2EGE A;  2AZS A;  2MOX A;  1MV0 B;  1I0C A;  2BTT A;  2CT4 A;  1GBR A;  2EGA A;  4LUE A;  1PKT A;  2O9V A;  1N5Z A;  4M4Z A;  4JJD A;  3M0U A;  2DL5 A;  1Y57 A;  2GTO A;  1BK2 A;  1AD5 A;  2M51 A;  3PE0 A;  3I35 A;  2HBW A;  1WXT A;  3VS0 A;  1H8K A;  2LQN A;  3NHN A;  2CSQ A;  5HCK A;  4Z89 A;  4J9D A;  1SRM A;  4RTU A;  5ECA A;  1GL5 A;  1PHT A;  2FEI A;  1PRL C;  3TSZ A;  4OMN A;  3EHR A;  2LCS A;  4F14 A;  2K2M A;  2DYB A;  4K11 A;  2P4R A;  3GBQ A;  4IIO A;  2ROT A;  2K79 A;  1ZUY A;  2EBP A;  2DJQ A;  1QWE A;  2KT8 A;  1AWW A;  3I9Q A;  4HXJ A;  1M8M A;  1T0H A;  1K0X A;  1Y0M A;  1AWO A;  2K6D A;  1PNJ A;  2KNB B;  1YWP A;  2JW4 A;  3ULR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...