4RTWA

Crystal structure of the c-src-sh3 domain e93v/q128r mutant in complex with the high affinity peptide app12
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
57
structure length
57
Chain Sequence
b'TFVALYDYVSRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene tyrosine-protein kinase Src
publication title Crystal structure of the c-Src-SH3 domain E93V/Q128R mutant in complex with the high affinity peptide APP12
rcsb
source organism Gallus gallus
molecule tags Protein binding
total genus 13
structure length 57
sequence length 57
chains with identical sequence C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4rtwA00
3I9QA 1E7OA 1PKTA 2CH4W 2J05A 2LCSA 1UG1A 1VYUA 1E6HA 2O31A 2M0YA 4AFZC 1UHCA 3UA6A 5I22A 1PRMC 1M3AA 1UJ0A 2SEMA 4RTUA 1M8MA 2EKHA 3PVLA 3VS6A 1X2KA 1NLOC 1BU1A 2RNAA 3PVQA 2EGCA 3EG3A 2HDAA 1QWFA 4D8DA 1M30A 1MUZA 2K2MA 2FPDA 2O9VA 1AWJA 1MV0B 2PNIA 2B86A 2EYXA 5GJWB 3PE0A 2O88A 1KJWA 4EIKA 2CUBA 4HXJA 2JXBA 2C0IA 1NG2A 4ORZA 1UE9A 2M51A 1B07A 1QWEA 2YUPA 2V1QA 1N5ZA 3EHQA 4ESRA 2AZSA 1SHFA 2GQIA 1K1ZA 3ULRB 2HBWA 1SRMA 2L2PA 1K76A 4DEXA 2DRMA 2YUQA 1ABQA 1U3OA 4FSSA 2VWFA 2G6FX 2L3SA 2EYWA 1WXUA 1W1FA 1KIKA 2KRSA 2JM9A 1TUCA 2A36A 1QLYA 1YP5A 2J7IA 2LZ6B 2XMFA 1ZUUA 2EGAA 1WFWA 3VS5A 1X43A 1SSHA 5EC7A 2K79A 2CH4A 1H3HA 2C0TA 2L0AA 1GRIA 1HJDA 1WXTA 1G83A 1H8KA 3VS3A 1SEMA 5HCKA 1Z9ZA 2W10A 1JU5C 1W6XA 2KRNA 4F14A 1I0CA 2PTKA 2F2XA 4J9DA 4J9HA 3VS7A 3H41A 2QDLA 1ZBJA 1Y57A 2KEAA 2A37A 2KRMA 3M0TA 1UUEA 4Y92A 2FEIA 2AKKA 1U5SA 2EYZA 3REAB 2ROTA 1UGVA 2KT1A 4R0KA 1NEGA 2DE0X 2DNUA 3I5RA 2J06A 1OPKA 4OMNA 2DL7A 1OEBA 4J9IA 1X69A 2D8JA 3M0SA 1E6GA 2DX1A 1PWTA 2PZ1A 1QKXA 2O9SA 3M0QA 1H92A 1GCQA 2DA9A 4Z89A 2RQWA 1IO6A 4J9EA 2EPDA 3M0PA 1ZUYA 1WA7A 2CUDA 3H0HA 3U23A 3ZL7C 2BZXA 2DM1A 2F2WA 4JJDA 2VVKA 1OOTA 2H8HA 3VS0A 1X2QA 1NYFA 1GCPA 3SHWA 1GL5A 1RLPC 2P4RA 2LQWA 2O2OA 1QKWA 2D0NA 2RQRA 3EG0A 3CQTA 1NYGA 2KBTA 2KGTA 4JZ3A 1WIEA 2HCKA 4AG2C 2FG0A 1I07A 2D1XA 4CC2A 1T3LA 3NPFA 4D8KA 1SHGA 3VS2A 1LCKA 4HVWA 2EBPA 2RQUA 4Z88A 2JMAA 2KROA 2AK5A 2FPEA 2EGEA 1AZGB 3QWYA 1NM7A 2MOXA 2RQTA 1QCFA 2FO0A 3THKA 3I35A 1UTIA 4RTVA 5L23A 3I5SA 2DL3A 2VKNA 1VA7A 4A63B 3QWXX 2DJQA 2W0ZA 1A0NB 1T3SA 4F16A 2ECZA 4JJCA 3M0UA 2L3PA 4RTTA 2X3WD 1NEBA 1WLPB 1Z9QA 2LMJA 2BZ8A 4JZ4A 2J6FA 4RTZA 2CDTA 4LNPA 1ZSGA 2JM8A 1AWXA 1HD3A 3VRYA 2EVRA 1ABOA 4GLMA 2DL4A 4RTYA 1FYNA 2EQIA 2KT8A 4HCKA 1ZLMA 1JO8A 2KYMA 5IHNA 2OAWA 4OMQA 1UHFA 5ECAA 2JW4A 4OMPA 1CKBA 3TVTA 4AG1C 1OV3A 1RI9A 2BTTA 4QT7A 2OJ2A 4AFSC 1KSWA 2DILA 2NWMA 2A28A 2IIMA 2OI3A 3O5ZA 2LQNA 1FMKA 1WYXA 2LNHB 5GJVB 2NUZA 3JV3A 4JPBW 1PKSA 1UFFA 3TSWA 3RNJA 1GCQC 1ZX6A 3VRZA 2DL5A 1HSQA 2FPFA 3NGPA 3M0RA 2KXDA 2X3XD 3R6NA 1BK2A 2K6DA 2GTOA 4DEYA 4K11A 4AFUC 2C0OA 1WDXA 1NLPC 2DRKA 2HEQA 4RTWA 1AEYA 1EFNA 2I0NA 3NHNA 2YSQA 4E6RA 1V1CA 2GGRA 2A08A 2K9GA 4WCIA 2YDLA 1AVZC 1JQQA 2JT4A 4CC4B 2V1RA 2RPNA 1PRLC 2DBKA 1CKAA 1K4US 2RN8A 1SRLA 3SEMA 1AOJA 2FRYA 2MIOA 3EG2A 1K0XA 2JS0A 4HVVA 1M3BA 2ENMA 1XOVA 2DBMA 3KFVA 1AZEA 1T0HA 2CT4A 1AWWA 4LUEA 1YWPA 3UF4A 2RMOA 1WX6A 1RLQC 3TSZA 2KYBA 2MCNA 2HSPA 3UATA 1TUDA 3H0IA 4GBQA 5IHIA 5IXBA 2GTJA 2JMCA 1BB9A 3EHRA 4M4ZA 4Z8AA 3LH5A 2LJ1A 2KXCA 4JJBA 2ED1A 1GBRA 1M3CA 2E5KA 2ESWA 3EG1A 4OMMA 1GBQA 4KRTA 2CSQA 2ED0A 4RUGA 5IH2A 1WI7A 1B3QA 5IXFA 2DVJA 1JXMA 2YUOA 2YT6A 4LN2A 4IIMA 5FWBA 2DF6A 2ABLA 5FW9A 1K0SA 3H0FA 4J9CA 2GBQA 1UJYA 4LE9A 2EYYA 5IHKA 2J6KA 1I1JA 1CSKA 1WXBA 4LUDA 1VYVA 4J9FA 4AFQC 4OMOA 2FRWA 1RUWA 1KFZA 1T0JA 1PNJA 1J3TA 3A98A 2LP5A 2K7AA 1JXOA 2AZVA 1MV3A 4HVUA 1G2BA 2DLPA 1X6GA 1X6BA 2KR3A 4J9BA 1S1NA 1BBZA 3NMZC 1UDLA 2RQVA 2EW3A 4OMLA 1GFCA 2DL8A 3UA7A 3GBQA 1U06A 1AD5A 2BZYA 2LJ3A 2LX7A 3FJ5A 2KE9A 1M27C 2ROLA 3IQLA 2D8HA 2GNCA 1TG0A 1YNZA 1YCSB 1GFDA 2SRCA 3VS1A 2AKLA 2J6OA 5I11A 1JEGA 4J9GA 4F17A 1YN8A 1UECA 1ZUKA 3REBB 4ZNXA 4IIOA 1K9AA 2DYBA 1PHTA 1YWOA 2JTEA 4X1VA 5FWCA 2L3QA 1Y0MA 4CC7A 1X27A 1SPKA 2JS2A 2KNBB 2YUNA 2F2VA 3EGUA 4RTXA 2K3BA 2LJ0A 1VYTA 1ARKA 2CT3A 3RBBB 1OPLA 2DMOA 1W70A 2CSIA 4CC3A 2CREA 3C0CA 2RF0A 3VS4A 1AWOA
chains in the Genus database with same CATH superfamily
1E7OA 8ATCB 1MGQA 1VQ7Q 4M77E 4PK4A 3ZEHA 5GAMj 2RJEA 1PRMC 1M3AA 1UJ0A 2SEMA 3OYGA 2WSCE 2X35A 2XD0A 4PJOB 2L3RA 2K5FA 2EGCA 3CPWP 3EG3A 1IXDA 1M30A 3G6EA 2O9VA 2QYZA 1AWJA 5HK0A 4GY5A 1MMAA 2EYXA 3M9QA 2RHYA 3TQ7P 3L2WA 2RHUA 2CUBA 4FCYA 1JRIA 4HXJA 3A8LB 2M51A 4ELYC 1B07A 1QWEA 2KK4A 2MI6A 2V8KA 1VQLT 1SHFA 2HBWA 2BE9B 3QPHA 5GMKi 4EMKA 2HBPA 1SKUB 4DEXA 3CBPA 1Q95G 3P8BB 2QGFB 1HK9A 1ABQA 1U3OA 4FSSA 3CPFA 7AT1B 3MPUB 4ZGJB 2XHCA 4DBFA 1RAGB 3L2RA 2QQRA 2A36A 1VQ8A 2AHJB 4M77B 3VS5A 1IGQA 1X43A 3QSUA 2DD5A 2VB6A 5EC7A 3V7CA 1N27A 1WJRA 3EGDA 2PQWA 2C0TA 2VGMA 2L5QA 3A8GB 3GPLA 2XICA 1B7TA 2K3YA 3VS3A 1BCOA 1Y71A 1Z9ZA 2W10A 3BW1A 5D6XA 4LDXA 4M7AF 3OQ5A 3X24B 3G4SA 4ZGDB 1I0CA 4HCZA 2PTKA 3CXCA 2CP7A 1N6AA 4J9HA 3H41A 4OP0A 5KE2A 3OS2A 2KEAA 2LRQA 3INZA 1TH7A 4DOVA 2AKKA 1U5SA 3QBYA 4ATOA 2ROTA 1KD1U 2KT1A 4R0KA 3OSSC 1UGQB 2HKQB 1TUGB 5FU6B 3E9GA 1OEBA 3BY7A 3CCMT 2K57A 3QZ5B 3OYKA 2X4WA 3OBYA 3CCUT 4HCCA 5GAN4 3NTKA 3R6OA 2PZ1A 3CCJT 1QKXA 2O9SA 1NJIC 3LWIA 4M75G 1WHMA 2DA9A 1VQPQ 5LJ5g 2D0QB 1IO6A 3CBOA 3M0PA 1K73R 1ZSZB 2JZ2A 1YHQA 3EG9A 3HTRA 2DFUA 5CO7A 4MDXA 4J6YA 5AT1B 2A7YA 1IHWA 2X4JA 2HSEB 1OOTA 2QQAA 2H8HA 3VS0A 2K2VA 1GCPA 1QW1A 4DQ2A 1WHJA 2O2OA 3CMEA 2YLCA 2RQRA 2DEQA 2DZCA 3EG0A 3X20B 3OYLA 3LH0A 2K5IA 1KC8C 1VQOA 4Q5WA 1NYGA 3Q1JA 2QEXA 1I07A 4F7UE 5A0GA 2JJ9A 2D1XA 4CC2A 3P8DA 2LX9A 1SHGA 3PNWC 4PFOA 3OYDA 3HFOA 1N8RC 2MPXC 4IURA 1QVGA 2X51A 2JMAA 1YI2T 2EGEA 2KI7A 3QWYA 1QCFA 1VOMA 3FIFA 3THKA 1VQ7A 1UTIA 3JCMc 2IVWA 3M59A 1VQNA 3I5SA 3GNFB 3CC4T 5LJ5j 1VA7A 4FU6A 1NZ9A 1IB8A 2JN0A 2EIFA 1A0NB 4M78G 5LJ3d 4F16A 2ECZA 1RL2A 4C5HA 1TOVA 4RTTA 2X3WD 3FDRA 2CKKA 2DTOA 2QQSA 3CCLQ 1NEBA 1D09B 2BZ8A 2J6FA 1P92A 4KH1B 4LNPA 1KQSP 2YWWA 2YXYA 3T9NA 1N9RA 4XU0A 2NLUA 3FJPA 2CP0A 1ACMB 1S72A 2KYMA 4C92G 1M2VA 1QMCA 1ZHIA 1M90U 3JCMe 5KYWB 4OMPA 1CKBA 2DXCA 3TVTA 5FROA 4AG1C 4BDYA 2HL5C 2M02A 4F7UB 1W2BS 1U1SA 3HKSA 3O5ZA 1FMKA 3DKMA 1FXXA 3JV3A 2M0OA 1PKSA 3TSWA 2DL5A 2CP6A 4MZTA 2FPFA 2KXDA 3HRTA 4M75F 3R6NA 3M57A 3OSVA 4DEYA 3G1JA 3GLXA 4AFUC 4ZTJA 4EDUA 5GANh 2DIQA 2QAZA 5CR2A 2DRKA 4IUVA 5J3BA 3OYHA 4OGEA 1OZ3A 3OY9A 1YIJQ 2XDPA 2HKNA 2V8IA 3I56A 3I55T 2YDLA 1VQMT 1YITA 2OTJT 3E2UA 4RG2A 1AVZC 4CC4B 2JT4A 1MNDA 2DBKA 1K4US 1CKAA 2GFUA 2R5MA 3CD6Q 3SEMA 4M75D 4HKEA 3V7SA 3VJPA 4E7HA 2COYA 5GAMe 4HVVA 2NUPA 5CCAA 3OYIA 5EG2A 1OU8A 4QKUA 3H6ZA 1BI0A 2KDSA 3SB2A 4BI3A 3KFVA 1K73U 1AT1B 1M8VA 1BCMA 3TSZA 4C92B 3G71T 4C0GA 3H0IA 2R58A 4GBQA 3FLGA 2GTJA 2Y90A 1QVPA 5KYUA 4BI8B 2HD0A 3X26B 3EHRA 4Z8AA 2LJ1A 2RI2A 4JJBA 2ED1A 1KQ2A 4MZMA 1PSEA 4PJOC 3EG1A 1XNIA 4OB0B 2P0PA 4RUGA 5GAMd 5IXFA 1WZOA 2QXFA 5HKCA 3C94A 4LN2A 4M78F 3JB9G 1JB0E 3M55A 2DF6A 4M7DG 1K9MR 2ABLA 1D0XA 2P0KA 1K0SA 4J9CA 2DIGA 2E3IA 3TEEA 1BI1A 1UJYA 3V8JA 1VQ6A 1YJ9A 4II1A 1I1JA 3GF5A 2GCXA 4LUDA 1VYVA 1TXQA 2FRWA 3CCET 4M7AC 3DB3A 3CCVA 2VXFA 3EFRA 3L2ZA 1PNJA 1J3TA 2LP5A 3SWNB 2K7AA 1Y07A 4JJNK 4C8QG 4C92F 1KC8R 3OW2P 4M78D 4N4GA 1G2BA 1D1CA 4AMCA 5KYXB 3VYHB 2QDYB 2QG9B 3OYMA 4OMLA 1M4ZA 4M77C 3GBQA 5CKEA 1AD5A 2BZYA 2LJ3A 3N5BB 3S6WA 3IQLA 2D8HA 3CXCP 3G6ET 2EJGA 4YTLA 4KULA 3VS1A 2J6OA 2E64A 5GANg 2H3EB 2JOYA 4PFPA 4OF1A 3REBB 3CCQA 4PJLA 1K9AA 3A5ZB 4FT4A 1YWOA 4M7DB 3M53A 5CIUA 2GFAA 3OW2S 4C0ZA 4C5GA 3PTAA 2F2VA 3TU4K 2RD1A 2X4YA 2K3BA 2CT3A 2DMOA 1VQKQ 4XK8E 5FU6C 3S3NA 1QVFS 1PKTA 4N4IA 5KCHA 3RIRA 1UG1A 4PFZA 5I2MA 2O31A 2M0YA 1UHCA 3UA6A 1VQ8T 3ZFJA 4JS4A 2XI9A 1NLOC 1BU1A 2RJDA 4Y91A 3JCMg 2VC8A 3CC2A 2HDAA 1M90C 1X6OA 2X9HA 2XDBA 4D8DA 4J6WA 1OZ2A 2H3JA 2K2MA 1ZSZC 2FPDA 1VQ4Q 4QQGA 4QW2A 4X34A 3PE0A 2O88A 5GANj 3JB9F 3M4YA 3M5AA 3VKIA 1NG2A 5CKFA 4M7DF 3G4ST 1WHLA 2V1QA 1N5ZA 4ESRA 1YIJA 2NUTA 2GQIA 3ULRB 2Z0WA 1X75C 1QVGP 2DRMA 2HQEA 4PLLA 3QG1A 3JAME 5KCOA 3J81E 2CZ1B 2VWFA 4C8QF 1HXDA 5LL6S 1WXUA 5FLXE 3OYFA 3JB9D 4J7FA 4J8OA 3EAEA 4EMHA 2JM9A 4PJOA 1TUCA 2LZ6B 4EMGA 2XMFA 1K9MU 5FRNA 2E41A 1WFWA 1MNEA 3O8VA 2K79A 3M56A 2CH4A 2VGNA 2KMTA 4BE0A 3QDFA 1YHQT 4C5IA 3S3MA 1K73C 2WSEE 3URGA 3KXTA 4C8QD 1WXTA 3EFOB 3JCMP 1H8KA 4LDYA 5KH6A 1KC8U 2DD4A 4X9DA 2KRNA 1YCYA 5KE3A 4R56A 4BE1A 2E10A 5LJ5d 5D6YA 4BI4A 3CCRQ 4J9DA 3EH2A 3VS7A 3CMET 2YRVA 1ZBJA 1WHGA 1Y57A 1D0ZA 1EX4A 2A37A 4M7AE 1VQOT 4Y92A 2QEXT 2FEIA 3SD4A 2HAXA 2DNUA 2J06A 4M77A 2D8JA 2VUBA 1E6GA 2RI5A 2EQMA 4UC4A 2DX1A 1TU0B 2DETA 4BE2A 4JLIA 4V2SA 4QQ6A 1GCQA 2XK0A 2HQXA 5LJ3f 4JLGA 1VQ7T 1VQNT 2RQWA 2EPDA 1RACB 4XTWA 1ZUYA 2CUDA 2RHZA 3OMCA 3VU3C 3JCMW 1Q81R 2RHIA 3ZL7C 1LOJA 3AT1B 6AT1B 2DM1A 2F2WA 1Q86U 1Y7XA 1OYXA 4OMFB 4X9CA 3WVDB 4JRKA 1C6VX 3SHWA 3QYGB 4P5NA 1ZBXA 3META 2LQWA 2D0NA 2WSFE 5CQYA 5IT9E 4QVCA 1S72T 2D6FA 5IAYA 4M7AB 3QKJA 1O9SA 3NPFA 4D8KA 1LCKA 2R57A 3QJ6A 2RHXA 2KROA 1XTDA 4C92C 1VQKA 3OYCA 4RCCA 4B6MA 2EQKA 3L1AA 1BIAA 2PUKB 2LT4A 4JRQA 5GMKm 4RTVA 5L23A 2DL3A 1VQLQ 4A63B 3JCMb 3LW5E 3QWXX 2DJQA 3CPWS 2W0ZA 2DJZA 1PM3A 1WJQA 4R55A 1TSFA 4PJMA 1M90R 4KGXB 4KT0E 5CVIA 3RKXA 1WLPB 3I56T 2LMJA 5IN1A 3CMAA 1YITT 1R77A 4EPCA 3HRSA 1HD3A 3EGXB 4GLMA 5C6SA 4D6WA 2DL4A 1VQ4A 1I5OB 2LQ8A 5FU7B 1VIEA 2B8AA 2ATCB 1XQHA 2KT8A 1ZLMA 4XU1A 4Z02A 5C0MA 3SWNC 5J26A 2OX7A 2BUDA 5GMKh 1RI9A 1BKBA 4QT7A 2DILA 1WYXA 4E7LA 1QCNA 2NUZA 2DTHA 1UFFA 4XTUA 4DBRA 5GAOl 1YJNA 5GAMf 3UT1A 4PNOA 3M0RA 4FW1A 2X3XD 3C4SA 1BK2A 3CC7A 1WDXA 3DLMA 3ZBDA 1QCOA 1AEYA 1RABB 4XQ3A 3NHNA 1V1CA 2F1LA 2GGRA 2A08A 2DPPB 2O4XB 2ZPHB 2K9GA 3RESA 3CCMQ 4WCIA 1K9MC 3CCUQ 1VQ6T 1JQQA 3CCJQ 1YJ9T 3M58A 2RPNA 5I21A 4RKUE 3PMIA 5KYWA 3CCVT 4M7DC 4EMKB 2FZGB 1AOJA 2FRYA 2MAMA 2JNGA 3KUFA 4F7UA 2FZKB 4KUDK 2JS0A 4XTZA 1VQ9Q 5HY6A 2MF2A 1XOVA 4HT8A 2CT4A 3DB4A 1WX6A 5FRMA 1TUDA 1Q81U 4C5EA 5M9OA 5A0DA 2JMCA 2V8JA 4NL2A 1BB9A 4M4ZA 3LH5A 4WF2A 5GANe 2E5KA 2M9UA 4OMMA 3EGDB 4J83A 2ED0A 3RUXA 4FYVB 1JXMA 1RADB 2YT6A 2OTLQ 4IIMA 3HSBA 5FW9A 3MJXA 3CCQT 4LDVA 4M75B 5CKBA 2EYYA 5IHKA 2J6KA 3PIOA 1YI2Q 4M78E 2LVMA 3VUZA 4OMOA 2KVQG 2HNIA 4Y28E 2DVEA 1JJ2A 4QVDA 3JCMJ 5GAOq 5GAOm 3CC4Q 1R0CB 2MWOA 2YRCA 4DBQA 1Q86C 1LPLA 1X6BA 4AT1B 4OVAA 1UDLA 2RQVA 2EW3A 3BFMA 2DL8A 4C92E 1RI0A 5CAIA 2LX7A 1RAHB 5GAOr 3LYIA 3CC2T 2QTXA 2GNCA 3CBMA 1NPRA 1YCSB 3OB9A 2QQ9A 2AKLA 5I11A 4E7JA 4N0AC 2CS7A 1YN8A 2P84A 1VQLA 2G3RA 1ZUKA 4KH0B 4ZNXA 1PHTA 3RMQA 1SSFA 1Q7YC 3MEVA 1D3BA 4XU3A 3RDVA 3JCMd 1KQSS 3SWNA 4X1VA 1YIJT 4CC7A 2HL3A 2P0QA 5LJ3h 1WHHA 3GIBA 2KNBB 4M78B 4DOWA 4RTXA 4QQDA 5KYXA 3RBBB 3QUIA 1G5VA 3HPWA 3MEAA 2CREA 3A8MB 3VS4A 3CCSQ 3I9QA 3P8HA 2F5TX 4E2FB 1B34B 3JB9J 2CH4W 1VYUA 1E6HA 5GMKj 5I22A 4RTUA 3I55Q 2OTJQ 2EKHA 4PJJA 3PVLA 3S3OA 2RNAA 3PVQA 4BACA 1G3WA 3L2QA 2E6ZA 1QWFA 1MUZA 5LJ5f 1MV0B 3QYHB 5GJWB 1Y96A 5D7UA 4EIKA 4KGVB 2RM4A 2JXBA 2IG0A 4ORZA 1QP2A 1UE9A 1DJ7B 1MMDA 1VQPA 3G71Q 2YUPA 1VQ5Q 3FB9A 3EHQA 2AZSA 3RERA 1K1ZA 4J5YA 1K76A 4M7DE 1ZA2B 1WQWA 1M2VB 3CCJA 3JRZA 2XDDA 2PUOB 4DA4A 3MEUA 2L3SA 1QQJA 1W1FA 1KIKA 2KRSA 4FT2A 1VQ9A 1WPYA 2DK3A 2J7IA 4RMOA 5I2SA 4C8QE 1IGUA 4LD9K 1UEBA 2IPOB 1H3HA 2JTMA 4IUTA 2GF7A 1GRIA 2YRDA 1WHKA 1HJDA 1Q81C 1SEMA 4CI0C 3MP8A 4F14A 1M9SA 4F04B 2OTLA 3ASKA 3RR6A 5FU7C 3BE3A 2KRMA 3M0TA 2DKGA 3J7AF 4L6V5 2OAUA 3REAB 1NEGA 2DE0X 2YHTA 4OMNA 3D7SB 3G6EQ 3CCLA 1X69A 1F1BB 2CZ7B 1NBEB 3LX7A 4ELZC 1PWTA 2XIDA 1Q86R 5KYUB 1U8RA 1VQKT 2XKOC 1H92A 1KHIA 1AHJB 2E3HA 2HQHA 3LGLA 4Z89A 2D9TA 1WQ7A 1OI1A 5DY9A 3EFOA 4J9EA 4C8QB 3OS5A 3WXMB 3KBGA 4KBMB 2FL7A 3MP1A 3UDCA 3CXCS 3H0HA 4PLIA 5GAN7 1PG5B 4NL3A 2WACA 1PD0A 2CZ0B 4JJDA 3CMAT 1FWZA 1NYFA 4E47A 2P4RA 1VQ4T 1UGPB 1VQ8Q 2DO3A 4O6JA 3TREA 2LNVA 3OYYA 1Q7YR 2L8DA 3RKWA 2K4YA 1Q82C 4NS5A 2KBTA 4JZ3A 4EMKC 2HCKA 3HL8A 4AG2C 2A3LA 1T3LA 3SDZA 5GAN3 2EBPA 4Z88A 2M1HA 1IRXA 1KG1A 1WJSA 2PVDB 1RAIB 2AK5A 3LGFA 2FPEA 1AZGB 1YJWQ 4E7KA 1R8OB 4JUVA 3CD6A 4FYWB 3DLLA 3CCSA 1YJNT 1W2BA 1M1KR 1UB4A 3MP6A 5DM7R 3I35A 4ME7A 1D1BA 1H3ZA 3F70A 1U1TA 3CC7T 1VIFA 2FHDA 2OTJA 3GNGA 1R0BG 3CEYA 4JJCA 5A2QE 3HHTB 1OU9A 2L3PA 2CP5A 4BY6C 2LTOA 3SFMA 1JJ2P 1Z9QA 4JZ4A 4RTZA 1C0MA 1ZSGA 2CP2A 4M75C 3VRYA 2EVRA 1ABOA 2XG8D 4M7AA 2EQIA 2RK1A 5GAN8 4HCKA 4JRIA 2LDMA 3V8KA 2MWPA 4PJOG 1QVGS 3OYBA 1VQ5A 5IHNA 5ECAA 2JW4A 1UGRB 2HZYA 2BTTA 1KSWA 1I4K1 2OI3A 1QP3A 2IIMA 2EKOA 1I8FA 1N9SA 1JBMA 4JPBW 1KQ1A 4N4HA 3H9NA 2FYKA 1ZX6A 3VYGA 3QZ9B 1HSQA 1X01A 1TTHB 2DYIA 2GTOA 3CMEQ 1NPPA 1LNXA 5DLOA 2C0OA 1VQOQ 3MCAB 2QEXQ 2HEQA 2QGGA 2P4TA 2YSQA 3OBWA 2ZZDA 1RAFB 1LVKA 1O75A 2YLBA 2V1RA 4HA8A 2LQKA 2JTFA 2RN8A 1SRLA 4M77G 3A1PA 2QA4Q 5CQXA 2AT1B 5KYYB 3L42A 4MZPA 1K0XA 4M78C 4ZTFA 1VQNQ 2M16A 1M3BA 3A8HB 2ENMA 4E7IA 5GMKe 2QI2A 5LJ5h 2DBMA 1T0HA 1AWWA 4ANJA 1YWPA 4DBHA 4IUPA 2RMOA 3PT9A 3UF4A 1RLQC 2KYBA 2MCNA 3UATA 4B9XA 5KYNA 5IHIA 1ZQ1A 2ZPIB 3BDUA 4FL6A 2EWNA 1FMVA 1YBYA 2QK0A 2ESWA 4L59A 3JCMQ 1GBQA 4KRTA 1G8XA 2MYSA 5IH2A 2PU9B 2O4XA 1Q7YU 1ZSZA 4A4GA 1S72Q 2DVJA 2COZA 3OYJA 2YUOA 2E65A 3JCMf 1PC0A 1NE8A 5FWBA 2FB7A 1M1GA 2VXEA 4XU2A 4VUBA 2GBQA 4LE9A 1VUBA 1PD1A 4J9FA 1RUWA 1KFZA 4A4HA 3JB9I 4O5VA 1M1KU 1XJWB 4PJOF 2AZVA 4E7ZA 1Q82R 1MV3A 3OW2A 2DLPA 1FX7A 2KY9A 2DXBA 1X6GA 1MHNA 2CP3A 2KR3A 4A4FA 1OX9A 4J9BA 1BBZA 1M2OA 1W4SA 3NMZC 2HMAA 1GFCA 3I56Q 4MDWA 1YITQ 1U06A 1QVFA 1M5Q1 2LT1A 4KUIA 1M27C 1YJWA 2RB6A 3OMGA 4ZN3A 1TG0A 4CRIA 4RCBA 3OS0A 4PJOD 2SRCA 4M75A 2ZGWA 2DZ9A 4J9GA 1K8AR 4IUUA 4L5GA 1VQPT 2O01E 1I81A 3OYNA 4M75E 5L8RE 2EAYA 2EFIA 1X27A 2YUNA 4M77F 3RMSA 4M7AD 2EQJA 3EFSA 1VYTA 1W70A 3C0CA 2RF0A 1AWOA 1H641 2J05A 3A8OB 4E7SA 2LCSA 1VQ9T 3HRUA 3CCRA 5CK9A 4AFZC 1OQKA 2DXTA 1M8MA 2RK2A 2Y4YA 4XTVA 3VS6A 3L2VA 1BI2A 1X2KA 2ZAEA 1YJ9Q 1VQ6Q 2RO0A 2CZ6B 3OA6A 4GLKA 4M77D 3UWNA 3CCVQ 2X4XA 4C8QC 4JRPA 2PNIA 2L89A 4WTOB 2B86A 5CKDA 1KJWA 3J80E 4F7UG 2C0IA 3EH1A 1HYOA 2E1HA 2I2LA 3FEOA 4M78A 2E4HA 5LJ3e 4KGZB 2OTLT 4BY6B 1KHCA 1SRMA 2L2PA 2YUQA 1B34A 1LJOA 2LCLA 3NTIA 3AHUA 1UGSB 1W2BP 2QA4A 2G6FX 3CCLT 2EYWA 5GANd 4C0DC 4PJNA 4C92A 1QLYA 1YP5A 4BDZA 3C95A 3CCQQ 1ZUUA 2VV5A 2JVVA 2EGAA 3OYEA 2V26A 2FZCB 2ZPBB 3ER0A 1SSHA 4LDWA 1I5LA 2EQUA 2L0AA 2K3XA 8AT1B 1SF9A 3G7ZA 4LDUA 1G83A 5HCKA 4XTXA 1Q82U 3QXEB 1G3SA 1JU5C 1W6XA 1TWBA 3EG9B 2AIRB 2F2XA 3QHSA 2NYSA 4J6XA 2DTIA 2QDLA 5GAOn 4JS5A 1UUEA 4B9WA 2E12A 2EYZA 3VV0A 4IKFA 1UGVA 3CC2Q 3I5RA 2RI3A 2ZPGB 1OPKA 2DL7A 5GAOp 4J9IA 3M0SA 5DLQE 5CKHA 3L2UA 2RJCA 3M0QA 5GAN6 1K8AU 3CD6T 2RH2A 4HT9A 3CCST 3NTHA 1M1KC 2KQWA 3QIIA 1SG5A 3PFSA 1VQMQ 1WA7A 1G3YA 2COWA 5J39A 2BIVA 3U23A 2BZXA 3BDLA 3CPWA 1EZZB 2VVKA 1X2QA 2E6NA 4F7UF 3HP9A 1GL5A 1M1FA 1RLPC 3MO8A 1QKWA 3LWHA 3PMTA 3JB9H 3CQTA 4M7DA 3QO3A 5GAN2 4J7IA 2KGTA 1WIEA 1TS9A 2FG0A 3TCJA 1VQ5T 1RAEB 3LLRA 1OULA 3VS2A 3E19A 3CCMA 4ZGEB 4A54A 4HVWA 3JCMh 1RAAB 2RQUA 3WVEB 3CCUA 1NJIR 1KD1C 1NM7A 2MOXA 4C8QA 2RQTA 2FO0A 4RG8A 3JCMV 2XU8A 1WGSA 3MKDA 3OYAA 3C12A 4NOYA 2CYZB 3E1SA 2VKNA 3FRNA 1KK7A 4QVZA 2CGHA 3JCMX 1T3SA 3GOXA 1BYMA 3M0UA 3QJYA 3CCEQ 2F69A 4A4EA 3PGGA 2CDTA 1D3BB 4FM4B 2JM8A 1AWXA 1PSFA 3VUBA 5A0LA 4RTYA 3H8ZA 2ZCFB 1FYNA 4FSXA 4PKCC 1JO8A 1BI3A 3M54A 2OAWA 2BKDN 4OMQA 1UHFA 4A53A 1IZ6A 5GAMh 1N8RR 2VASA 1OV3A 1QVFP 2E70A 4AFSC 2OJ2A 1BIBA 2NWMA 2A28A 5LJ3g 2NUPB 2LQNA 1D0YA 2LNHB 1YI2A 5GJVB 2DXUA 1ZA1B 1D1AA 3RNJA 1GCQC 3VRZA 4C92D 3NGPA 2ZPEB 2DEUA 2EYQA 2K6DA 4K11A 3CC4A 2RA2A 3MEWA 9ATCB 2E5QA 3UPUA 1NLPC 4RTWA 1EFNA 2I0NA 2EJ9A 1Y96B 4N0AA 2K5LA 1V76A 4E6RA 2R5AA 3MHXA 1G3TA 4JDSA 4C0FA 3FC3A 1C1AA 2MK5A 1IREB 2KAFA 1PRLC 4MMLA 2GQVA 4LXCA 1EIFA 1GXIE 2MIOA 3EG2A 3NFCA 2DAQA 3M4GA 1AZEA 2KSSA 4LUEA 2HSPA 2F5KA 1V29B 1IHVA 1WNLA 5LJ3j 3V8LA 5IXBA 4FW2A 3CMAQ 2MMPA 4C0DB 4XTYA 2KXCA 1GBRA 1M3CA 4HCBA 2PVGB 2DERA 2CSQA 4BB7A 1YJWT 4OB3B 1WI7A 3G4SQ 1B3QA 3PIPA 1PCXA 1MMGA 2Y4XA 2LCCA 4FIBA 2PVOB 2LC4A 3H0FA 2C06A 3I55A 1VQMA 1K8AC 5KYYA 1NJIU 4OB2B 1CSKA 4OB1B 1WXBA 3ME9A 4AFQC 3GP8A 3QDRB 1YJNQ 2JUFA 1T0JA 3A98A 4FYXB 4PL6A 5LJ5e 4BUGA 4M7DD 1KQSA 2QASA 2EJFA 1JXOA 3CC7Q 2BE7D 2ZPFB 5HK3A 4XAXB 3V7RA 4HVUA 3X28B 5GAMg 2A0FB 1FMWA 3X25B 1S1NA 3G71A 4MMKA 3CCRT 1MMNA 4PJOE 3UA7A 1YHQQ 1KD1R 1YFNA 1OX8A 3FJ5A 2QTVA 2KE9A 4OGCA 3E9FA 2ROLA 4TVRA 5GMKl 3OS1A 1YNZA 1GFDA 1JEGA 4BD3A 4F17A 4M7AG 1UECA 4IIOA 4IUQA 4ZN1A 2DYBA 1N8RU 5D6WA 1JJ2S 3JSCA 5AYFA 4LD6A 2JTEA 3EGXA 5FWCA 2L3QA 1Y0MA 5GAN5 3CCEA 1SPKA 2JS2A 3HFNA 3EGUA 5GANf 2LJ0A 3RKYA 1ARKA 1OPLA 2NUTB 2VYTA 2CSIA 2FVUA 4CC3A 2QQBA 2RJFA 4A4KA 2QA4T 4FYYB
chains in the Genus database with same CATH topology
3I9QA 1E7OA 1PKTA 2CH4W 2J05A 2LCSA 1UG1A 1VYUA 1E6HA 2O31A 2M0YA 4AFZC 1UHCA 3UA6A 5I22A 1PRMC 1M3AA 1UJ0A 2SEMA 4RTUA 1M8MA 2EKHA 3PVLA 3VS6A 1X2KA 1NLOC 1BU1A 2RNAA 3PVQA 2EGCA 3EG3A 2HDAA 1QWFA 4D8DA 1M30A 1MUZA 2K2MA 2FPDA 2O9VA 1AWJA 1MV0B 2PNIA 2B86A 2EYXA 5GJWB 3PE0A 2O88A 1KJWA 4EIKA 2CUBA 4HXJA 2JXBA 2C0IA 1NG2A 4ORZA 1UE9A 2M51A 1B07A 1QWEA 2YUPA 2V1QA 1N5ZA 3EHQA 4ESRA 2AZSA 1SHFA 2GQIA 1K1ZA 3ULRB 2HBWA 1SRMA 2L2PA 1K76A 4DEXA 2DRMA 2YUQA 1ABQA 1U3OA 4FSSA 2VWFA 2G6FX 2L3SA 2EYWA 1WXUA 1W1FA 1KIKA 2KRSA 2JM9A 1TUCA 2A36A 1QLYA 1YP5A 2J7IA 2LZ6B 2XMFA 1ZUUA 2EGAA 1WFWA 3VS5A 1X43A 1SSHA 5EC7A 2K79A 2CH4A 1H3HA 2C0TA 2L0AA 1GRIA 1HJDA 1WXTA 1G83A 1H8KA 3VS3A 1SEMA 5HCKA 1Z9ZA 2W10A 1JU5C 1W6XA 2KRNA 4F14A 1I0CA 2PTKA 2F2XA 4J9DA 4J9HA 3VS7A 3H41A 2QDLA 1ZBJA 1Y57A 2KEAA 2A37A 2KRMA 3M0TA 1UUEA 4Y92A 2FEIA 2AKKA 1U5SA 2EYZA 3REAB 2ROTA 1UGVA 2KT1A 4R0KA 1NEGA 2DE0X 2DNUA 3I5RA 2J06A 1OPKA 4OMNA 2DL7A 1OEBA 4J9IA 1X69A 2D8JA 3M0SA 1E6GA 2DX1A 1PWTA 2PZ1A 1QKXA 2O9SA 3M0QA 1H92A 1GCQA 2DA9A 4Z89A 2RQWA 1IO6A 4J9EA 2EPDA 3M0PA 1ZUYA 1WA7A 2CUDA 3H0HA 3U23A 3ZL7C 2BZXA 2DM1A 2F2WA 4JJDA 2VVKA 1OOTA 2H8HA 3VS0A 1X2QA 1NYFA 1GCPA 3SHWA 1GL5A 1RLPC 2P4RA 2LQWA 2O2OA 1QKWA 2D0NA 2RQRA 3EG0A 3CQTA 1NYGA 2KBTA 2KGTA 4JZ3A 1WIEA 2HCKA 4AG2C 2FG0A 1I07A 2D1XA 4CC2A 1T3LA 3NPFA 4D8KA 1SHGA 3VS2A 1LCKA 4HVWA 2EBPA 2RQUA 4Z88A 2JMAA 2KROA 2AK5A 2FPEA 2EGEA 1AZGB 3QWYA 1NM7A 2MOXA 2RQTA 1QCFA 2FO0A 3THKA 3I35A 1UTIA 4RTVA 5L23A 3I5SA 2DL3A 2VKNA 1VA7A 4A63B 3QWXX 2DJQA 2W0ZA 1A0NB 1T3SA 4F16A 2ECZA 4JJCA 3M0UA 2L3PA 4RTTA 2X3WD 1NEBA 1WLPB 1Z9QA 2LMJA 2BZ8A 4JZ4A 2J6FA 4RTZA 2CDTA 4LNPA 1ZSGA 2JM8A 1AWXA 1HD3A 3VRYA 2EVRA 1ABOA 4GLMA 2DL4A 4RTYA 1FYNA 2EQIA 2KT8A 4HCKA 1ZLMA 1JO8A 2KYMA 5IHNA 2OAWA 4OMQA 1UHFA 5ECAA 2JW4A 4OMPA 1CKBA 3TVTA 4AG1C 1OV3A 1RI9A 2BTTA 4QT7A 2OJ2A 4AFSC 1KSWA 2DILA 2NWMA 2A28A 2IIMA 2OI3A 3O5ZA 2LQNA 1FMKA 1WYXA 2LNHB 5GJVB 2NUZA 3JV3A 4JPBW 1PKSA 1UFFA 3TSWA 3RNJA 1GCQC 1ZX6A 3VRZA 2DL5A 1HSQA 2FPFA 3NGPA 3M0RA 2KXDA 2X3XD 3R6NA 1BK2A 2K6DA 2GTOA 4DEYA 4K11A 4AFUC 2C0OA 1WDXA 1NLPC 2DRKA 2HEQA 4RTWA 1AEYA 1EFNA 2I0NA 3NHNA 2YSQA 4E6RA 1V1CA 2GGRA 2A08A 2K9GA 4WCIA 2YDLA 1AVZC 1JQQA 2JT4A 4CC4B 2V1RA 2RPNA 1PRLC 2DBKA 1CKAA 1K4US 2RN8A 1SRLA 3SEMA 1AOJA 2FRYA 2MIOA 3EG2A 1K0XA 2JS0A 4HVVA 1M3BA 2ENMA 1XOVA 2DBMA 3KFVA 1AZEA 1T0HA 2CT4A 1AWWA 4LUEA 1YWPA 3UF4A 2RMOA 1WX6A 1RLQC 3TSZA 2KYBA 2MCNA 2HSPA 3UATA 1TUDA 3H0IA 4GBQA 5IHIA 5IXBA 2GTJA 2JMCA 1BB9A 3EHRA 4M4ZA 4Z8AA 3LH5A 2LJ1A 2KXCA 4JJBA 2ED1A 1GBRA 1M3CA 2E5KA 2ESWA 3EG1A 4OMMA 1GBQA 4KRTA 2CSQA 2ED0A 4RUGA 5IH2A 1WI7A 1B3QA 5IXFA 2DVJA 1JXMA 2YUOA 2YT6A 4LN2A 4IIMA 5FWBA 2DF6A 2ABLA 5FW9A 1K0SA 3H0FA 4J9CA 2GBQA 1UJYA 4LE9A 2EYYA 5IHKA 2J6KA 1I1JA 1CSKA 1WXBA 4LUDA 1VYVA 4J9FA 4AFQC 4OMOA 2FRWA 1RUWA 1KFZA 1T0JA 1PNJA 1J3TA 3A98A 2LP5A 2K7AA 1JXOA 2AZVA 1MV3A 4HVUA 1G2BA 2DLPA 1X6GA 1X6BA 2KR3A 4J9BA 1S1NA 1BBZA 3NMZC 1UDLA 2RQVA 2EW3A 4OMLA 1GFCA 2DL8A 3UA7A 3GBQA 1U06A 1AD5A 2BZYA 2LJ3A 2LX7A 3FJ5A 2KE9A 1M27C 2ROLA 3IQLA 2D8HA 2GNCA 1TG0A 1YNZA 1YCSB 1GFDA 2SRCA 3VS1A 2AKLA 2J6OA 5I11A 1JEGA 4J9GA 4F17A 1YN8A 1UECA 1ZUKA 3REBB 4ZNXA 4IIOA 1K9AA 2DYBA 1PHTA 1YWOA 2JTEA 4X1VA 5FWCA 2L3QA 1Y0MA 4CC7A 1X27A 1SPKA 2JS2A 2KNBB 2YUNA 2F2VA 3EGUA 4RTXA 2K3BA 2LJ0A 1VYTA 1ARKA 2CT3A 3RBBB 1OPLA 2DMOA 1W70A 2CSIA 4CC3A 2CREA 3C0CA 2RF0A 3VS4A 1AWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I9Q A;  1E7O A;  1PKT A;  2CH4 W;  2J05 A;  2LCS A;  1UG1 A;  1VYU A;  1E6H A;  2O31 A;  2M0Y A;  4AFZ C;  1UHC A;  3UA6 A;  5I22 A;  1PRM C;  1M3A A;  1UJ0 A;  2SEM A;  4RTU A;  1M8M A;  2EKH A;  3PVL A;  3VS6 A;  1X2K A;  1NLO C;  1BU1 A;  2RNA A;  3PVQ A;  2EGC A;  3EG3 A;  2HDA A;  1QWF A;  4D8D A;  1M30 A;  1MUZ A;  2K2M A;  2FPD A;  2O9V A;  1AWJ A;  1MV0 B;  2PNI A;  2B86 A;  2EYX A;  5GJW B;  3PE0 A;  2O88 A;  1KJW A;  4EIK A;  2CUB A;  4HXJ A;  2JXB A;  2C0I A;  1NG2 A;  4ORZ A;  1UE9 A;  2M51 A;  1B07 A;  1QWE A;  2YUP A;  2V1Q A;  1N5Z A;  3EHQ A;  4ESR A;  2AZS A;  1SHF A;  2GQI A;  1K1Z A;  3ULR B;  2HBW A;  1SRM A;  2L2P A;  1K76 A;  4DEX A;  2DRM A;  2YUQ A;  1ABQ A;  1U3O A;  4FSS A;  2VWF A;  2G6F X;  2L3S A;  2EYW A;  1WXU A;  1W1F A;  1KIK A;  2KRS A;  2JM9 A;  1TUC A;  2A36 A;  1QLY A;  1YP5 A;  2J7I A;  2LZ6 B;  2XMF A;  1ZUU A;  2EGA A;  1WFW A;  3VS5 A;  1X43 A;  1SSH A;  5EC7 A;  2K79 A;  2CH4 A;  1H3H A;  2C0T A;  2L0A A;  1GRI A;  1HJD A;  1WXT A;  1G83 A;  1H8K A;  3VS3 A;  1SEM A;  5HCK A;  1Z9Z A;  2W10 A;  1JU5 C;  1W6X A;  2KRN A;  4F14 A;  1I0C A;  2PTK A;  2F2X A;  4J9D A;  4J9H A;  3VS7 A;  3H41 A;  2QDL A;  1ZBJ A;  1Y57 A;  2KEA A;  2A37 A;  2KRM A;  3M0T A;  1UUE A;  4Y92 A;  2FEI A;  2AKK A;  1U5S A;  2EYZ A;  3REA B;  2ROT A;  1UGV A;  2KT1 A;  4R0K A;  1NEG A;  2DE0 X;  2DNU A;  3I5R A;  2J06 A;  1OPK A;  4OMN A;  2DL7 A;  1OEB A;  4J9I A;  1X69 A;  2D8J A;  3M0S A;  1E6G A;  2DX1 A;  1PWT A;  2PZ1 A;  1QKX A;  2O9S A;  3M0Q A;  1H92 A;  1GCQ A;  2DA9 A;  4Z89 A;  2RQW A;  1IO6 A;  4J9E A;  2EPD A;  3M0P A;  1ZUY A;  1WA7 A;  2CUD A;  3H0H A;  3U23 A;  3ZL7 C;  2BZX A;  2DM1 A;  2F2W A;  4JJD A;  2VVK A;  1OOT A;  2H8H A;  3VS0 A;  1X2Q A;  1NYF A;  1GCP A;  3SHW A;  1GL5 A;  1RLP C;  2P4R A;  2LQW A;  2O2O A;  1QKW A;  2D0N A;  2RQR A;  3EG0 A;  3CQT A;  1NYG A;  2KBT A;  2KGT A;  4JZ3 A;  1WIE A;  2HCK A;  4AG2 C;  2FG0 A;  1I07 A;  2D1X A;  4CC2 A;  1T3L A;  3NPF A;  4D8K A;  1SHG A;  3VS2 A;  1LCK A;  4HVW A;  2EBP A;  2RQU A;  4Z88 A;  2JMA A;  2KRO A;  2AK5 A;  2FPE A;  2EGE A;  1AZG B;  3QWY A;  1NM7 A;  2MOX A;  2RQT A;  1QCF A;  2FO0 A;  3THK A;  3I35 A;  1UTI A;  4RTV A;  5L23 A;  3I5S A;  2DL3 A;  2VKN A;  1VA7 A;  4A63 B;  3QWX X;  2DJQ A;  2W0Z A;  1A0N B;  1T3S A;  4F16 A;  2ECZ A;  4JJC A;  3M0U A;  2L3P A;  4RTT A;  2X3W D;  1NEB A;  1WLP B;  1Z9Q A;  2LMJ A;  2BZ8 A;  4JZ4 A;  2J6F A;  4RTZ A;  2CDT A;  4LNP A;  1ZSG A;  2JM8 A;  1AWX A;  1HD3 A;  3VRY A;  2EVR A;  1ABO A;  4GLM A;  2DL4 A;  4RTY A;  1FYN A;  2EQI A;  2KT8 A;  4HCK A;  1ZLM A;  1JO8 A;  2KYM A;  5IHN A;  2OAW A;  4OMQ A;  1UHF A;  5ECA A;  2JW4 A;  4OMP A;  1CKB A;  3TVT A;  4AG1 C;  1OV3 A;  1RI9 A;  2BTT A;  4QT7 A;  2OJ2 A;  4AFS C;  1KSW A;  2DIL A;  2NWM A;  2A28 A;  2IIM A;  2OI3 A;  3O5Z A;  2LQN A;  1FMK A;  1WYX A;  2LNH B;  5GJV B;  2NUZ A;  3JV3 A;  4JPB W;  1PKS A;  1UFF A;  3TSW A;  3RNJ A;  1GCQ C;  1ZX6 A;  3VRZ A;  2DL5 A;  1HSQ A;  2FPF A;  3NGP A;  3M0R A;  2KXD A;  2X3X D;  3R6N A;  1BK2 A;  2K6D A;  2GTO A;  4DEY A;  4K11 A;  4AFU C;  2C0O A;  1WDX A;  1NLP C;  2DRK A;  2HEQ A;  4RTW A;  1AEY A;  1EFN A;  2I0N A;  3NHN A;  2YSQ A;  4E6R A;  1V1C A;  2GGR A;  2A08 A;  2K9G A;  4WCI A;  2YDL A;  1AVZ C;  1JQQ A;  2JT4 A;  4CC4 B;  2V1R A;  2RPN A;  1PRL C;  2DBK A;  1CKA A;  1K4U S;  2RN8 A;  1SRL A;  3SEM A;  1AOJ A;  2FRY A;  2MIO A;  3EG2 A;  1K0X A;  2JS0 A;  4HVV A;  1M3B A;  2ENM A;  1XOV A;  2DBM A;  3KFV A;  1AZE A;  1T0H A;  2CT4 A;  1AWW A;  4LUE A;  1YWP A;  3UF4 A;  2RMO A;  1WX6 A;  1RLQ C;  3TSZ A;  2KYB A;  2MCN A;  2HSP A;  3UAT A;  1TUD A;  3H0I A;  4GBQ A;  5IHI A;  5IXB A;  2GTJ A;  2JMC A;  1BB9 A;  3EHR A;  4M4Z A;  4Z8A A;  3LH5 A;  2LJ1 A;  2KXC A;  4JJB A;  2ED1 A;  1GBR A;  1M3C A;  2E5K A;  2ESW A;  3EG1 A;  4OMM A;  1GBQ A;  4KRT A;  2CSQ A;  2ED0 A;  4RUG A;  5IH2 A;  1WI7 A;  1B3Q A;  5IXF A;  2DVJ A;  1JXM A;  2YUO A;  2YT6 A;  4LN2 A;  4IIM A;  5FWB A;  2DF6 A;  2ABL A;  5FW9 A;  1K0S A;  3H0F A;  4J9C A;  2GBQ A;  1UJY A;  4LE9 A;  2EYY A;  5IHK A;  2J6K A;  1I1J A;  1CSK A;  1WXB A;  4LUD A;  1VYV A;  4J9F A;  4AFQ C;  4OMO A;  2FRW A;  1RUW A;  1KFZ A;  1T0J A;  1PNJ A;  1J3T A;  3A98 A;  2LP5 A;  2K7A A;  1JXO A;  2AZV A;  1MV3 A;  4HVU A;  1G2B A;  2DLP A;  1X6G A;  1X6B A;  2KR3 A;  4J9B A;  1S1N A;  1BBZ A;  3NMZ C;  1UDL A;  2RQV A;  2EW3 A;  4OML A;  1GFC A;  2DL8 A;  3UA7 A;  3GBQ A;  1U06 A;  1AD5 A;  2BZY A;  2LJ3 A;  2LX7 A;  3FJ5 A;  2KE9 A;  1M27 C;  2ROL A;  3IQL A;  2D8H A;  2GNC A;  1TG0 A;  1YNZ A;  1YCS B;  1GFD A;  2SRC A;  3VS1 A;  2AKL A;  2J6O A;  5I11 A;  1JEG A;  4J9G A;  4F17 A;  1YN8 A;  1UEC A;  1ZUK A;  3REB B;  4ZNX A;  4IIO A;  1K9A A;  2DYB A;  1PHT A;  1YWO A;  2JTE A;  4X1V A;  5FWC A;  2L3Q A;  1Y0M A;  4CC7 A;  1X27 A;  1SPK A;  2JS2 A;  2KNB B;  2YUN A;  2F2V A;  3EGU A;  4RTX A;  2K3B A;  2LJ0 A;  1VYT A;  1ARK A;  2CT3 A;  3RBB B;  1OPL A;  2DMO A;  1W70 A;  2CSI A;  4CC3 A;  2CRE A;  3C0C A;  2RF0 A;  3VS4 A;  1AWO A; 
#chains in the Genus database with same CATH topology
 1E7O A;  8ATC B;  1MGQ A;  1VQ7 Q;  4M77 E;  4PK4 A;  3ZEH A;  5GAM j;  2RJE A;  1PRM C;  1M3A A;  1UJ0 A;  2SEM A;  3OYG A;  2WSC E;  2X35 A;  2XD0 A;  4PJO B;  2L3R A;  2K5F A;  2EGC A;  3CPW P;  3EG3 A;  1IXD A;  1M30 A;  3G6E A;  2O9V A;  2QYZ A;  1AWJ A;  5HK0 A;  4GY5 A;  1MMA A;  2EYX A;  3M9Q A;  2RHY A;  3TQ7 P;  3L2W A;  2RHU A;  2CUB A;  4FCY A;  1JRI A;  4HXJ A;  3A8L B;  2M51 A;  4ELY C;  1B07 A;  1QWE A;  2KK4 A;  2MI6 A;  2V8K A;  1VQL T;  1SHF A;  2HBW A;  2BE9 B;  3QPH A;  5GMK i;  4EMK A;  2HBP A;  1SKU B;  4DEX A;  3CBP A;  1Q95 G;  3P8B B;  2QGF B;  1HK9 A;  1ABQ A;  1U3O A;  4FSS A;  3CPF A;  7AT1 B;  3MPU B;  4ZGJ B;  2XHC A;  4DBF A;  1RAG B;  3L2R A;  2QQR A;  2A36 A;  1VQ8 A;  2AHJ B;  4M77 B;  3VS5 A;  1IGQ A;  1X43 A;  3QSU A;  2DD5 A;  2VB6 A;  5EC7 A;  3V7C A;  1N27 A;  1WJR A;  3EGD A;  2PQW A;  2C0T A;  2VGM A;  2L5Q A;  3A8G B;  3GPL A;  2XIC A;  1B7T A;  2K3Y A;  3VS3 A;  1BCO A;  1Y71 A;  1Z9Z A;  2W10 A;  3BW1 A;  5D6X A;  4LDX A;  4M7A F;  3OQ5 A;  3X24 B;  3G4S A;  4ZGD B;  1I0C A;  4HCZ A;  2PTK A;  3CXC A;  2CP7 A;  1N6A A;  4J9H A;  3H41 A;  4OP0 A;  5KE2 A;  3OS2 A;  2KEA A;  2LRQ A;  3INZ A;  1TH7 A;  4DOV A;  2AKK A;  1U5S A;  3QBY A;  4ATO A;  2ROT A;  1KD1 U;  2KT1 A;  4R0K A;  3OSS C;  1UGQ B;  2HKQ B;  1TUG B;  5FU6 B;  3E9G A;  1OEB A;  3BY7 A;  3CCM T;  2K57 A;  3QZ5 B;  3OYK A;  2X4W A;  3OBY A;  3CCU T;  4HCC A;  5GAN 4;  3NTK A;  3R6O A;  2PZ1 A;  3CCJ T;  1QKX A;  2O9S A;  1NJI C;  3LWI A;  4M75 G;  1WHM A;  2DA9 A;  1VQP Q;  5LJ5 g;  2D0Q B;  1IO6 A;  3CBO A;  3M0P A;  1K73 R;  1ZSZ B;  2JZ2 A;  1YHQ A;  3EG9 A;  3HTR A;  2DFU A;  5CO7 A;  4MDX A;  4J6Y A;  5AT1 B;  2A7Y A;  1IHW A;  2X4J A;  2HSE B;  1OOT A;  2QQA A;  2H8H A;  3VS0 A;  2K2V A;  1GCP A;  1QW1 A;  4DQ2 A;  1WHJ A;  2O2O A;  3CME A;  2YLC A;  2RQR A;  2DEQ A;  2DZC A;  3EG0 A;  3X20 B;  3OYL A;  3LH0 A;  2K5I A;  1KC8 C;  1VQO A;  4Q5W A;  1NYG A;  3Q1J A;  2QEX A;  1I07 A;  4F7U E;  5A0G A;  2JJ9 A;  2D1X A;  4CC2 A;  3P8D A;  2LX9 A;  1SHG A;  3PNW C;  4PFO A;  3OYD A;  3HFO A;  1N8R C;  2MPX C;  4IUR A;  1QVG A;  2X51 A;  2JMA A;  1YI2 T;  2EGE A;  2KI7 A;  3QWY A;  1QCF A;  1VOM A;  3FIF A;  3THK A;  1VQ7 A;  1UTI A;  3JCM c;  2IVW A;  3M59 A;  1VQN A;  3I5S A;  3GNF B;  3CC4 T;  5LJ5 j;  1VA7 A;  4FU6 A;  1NZ9 A;  1IB8 A;  2JN0 A;  2EIF A;  1A0N B;  4M78 G;  5LJ3 d;  4F16 A;  2ECZ A;  1RL2 A;  4C5H A;  1TOV A;  4RTT A;  2X3W D;  3FDR A;  2CKK A;  2DTO A;  2QQS A;  3CCL Q;  1NEB A;  1D09 B;  2BZ8 A;  2J6F A;  1P92 A;  4KH1 B;  4LNP A;  1KQS P;  2YWW A;  2YXY A;  3T9N A;  1N9R A;  4XU0 A;  2NLU A;  3FJP A;  2CP0 A;  1ACM B;  1S72 A;  2KYM A;  4C92 G;  1M2V A;  1QMC A;  1ZHI A;  1M90 U;  3JCM e;  5KYW B;  4OMP A;  1CKB A;  2DXC A;  3TVT A;  5FRO A;  4AG1 C;  4BDY A;  2HL5 C;  2M02 A;  4F7U B;  1W2B S;  1U1S A;  3HKS A;  3O5Z A;  1FMK A;  3DKM A;  1FXX A;  3JV3 A;  2M0O A;  1PKS A;  3TSW A;  2DL5 A;  2CP6 A;  4MZT A;  2FPF A;  2KXD A;  3HRT A;  4M75 F;  3R6N A;  3M57 A;  3OSV A;  4DEY A;  3G1J A;  3GLX A;  4AFU C;  4ZTJ A;  4EDU A;  5GAN h;  2DIQ A;  2QAZ A;  5CR2 A;  2DRK A;  4IUV A;  5J3B A;  3OYH A;  4OGE A;  1OZ3 A;  3OY9 A;  1YIJ Q;  2XDP A;  2HKN A;  2V8I A;  3I56 A;  3I55 T;  2YDL A;  1VQM T;  1YIT A;  2OTJ T;  3E2U A;  4RG2 A;  1AVZ C;  4CC4 B;  2JT4 A;  1MND A;  2DBK A;  1K4U S;  1CKA A;  2GFU A;  2R5M A;  3CD6 Q;  3SEM A;  4M75 D;  4HKE A;  3V7S A;  3VJP A;  4E7H A;  2COY A;  5GAM e;  4HVV A;  2NUP A;  5CCA A;  3OYI A;  5EG2 A;  1OU8 A;  4QKU A;  3H6Z A;  1BI0 A;  2KDS A;  3SB2 A;  4BI3 A;  3KFV A;  1K73 U;  1AT1 B;  1M8V A;  1BCM A;  3TSZ A;  4C92 B;  3G71 T;  4C0G A;  3H0I A;  2R58 A;  4GBQ A;  3FLG A;  2GTJ A;  2Y90 A;  1QVP A;  5KYU A;  4BI8 B;  2HD0 A;  3X26 B;  3EHR A;  4Z8A A;  2LJ1 A;  2RI2 A;  4JJB A;  2ED1 A;  1KQ2 A;  4MZM A;  1PSE A;  4PJO C;  3EG1 A;  1XNI A;  4OB0 B;  2P0P A;  4RUG A;  5GAM d;  5IXF A;  1WZO A;  2QXF A;  5HKC A;  3C94 A;  4LN2 A;  4M78 F;  3JB9 G;  1JB0 E;  3M55 A;  2DF6 A;  4M7D G;  1K9M R;  2ABL A;  1D0X A;  2P0K A;  1K0S A;  4J9C A;  2DIG A;  2E3I A;  3TEE A;  1BI1 A;  1UJY A;  3V8J A;  1VQ6 A;  1YJ9 A;  4II1 A;  1I1J A;  3GF5 A;  2GCX A;  4LUD A;  1VYV A;  1TXQ A;  2FRW A;  3CCE T;  4M7A C;  3DB3 A;  3CCV A;  2VXF A;  3EFR A;  3L2Z A;  1PNJ A;  1J3T A;  2LP5 A;  3SWN B;  2K7A A;  1Y07 A;  4JJN K;  4C8Q G;  4C92 F;  1KC8 R;  3OW2 P;  4M78 D;  4N4G A;  1G2B A;  1D1C A;  4AMC A;  5KYX B;  3VYH B;  2QDY B;  2QG9 B;  3OYM A;  4OML A;  1M4Z A;  4M77 C;  3GBQ A;  5CKE A;  1AD5 A;  2BZY A;  2LJ3 A;  3N5B B;  3S6W A;  3IQL A;  2D8H A;  3CXC P;  3G6E T;  2EJG A;  4YTL A;  4KUL A;  3VS1 A;  2J6O A;  2E64 A;  5GAN g;  2H3E B;  2JOY A;  4PFP A;  4OF1 A;  3REB B;  3CCQ A;  4PJL A;  1K9A A;  3A5Z B;  4FT4 A;  1YWO A;  4M7D B;  3M53 A;  5CIU A;  2GFA A;  3OW2 S;  4C0Z A;  4C5G A;  3PTA A;  2F2V A;  3TU4 K;  2RD1 A;  2X4Y A;  2K3B A;  2CT3 A;  2DMO A;  1VQK Q;  4XK8 E;  5FU6 C;  3S3N A;  1QVF S;  1PKT A;  4N4I A;  5KCH A;  3RIR A;  1UG1 A;  4PFZ A;  5I2M A;  2O31 A;  2M0Y A;  1UHC A;  3UA6 A;  1VQ8 T;  3ZFJ A;  4JS4 A;  2XI9 A;  1NLO C;  1BU1 A;  2RJD A;  4Y91 A;  3JCM g;  2VC8 A;  3CC2 A;  2HDA A;  1M90 C;  1X6O A;  2X9H A;  2XDB A;  4D8D A;  4J6W A;  1OZ2 A;  2H3J A;  2K2M A;  1ZSZ C;  2FPD A;  1VQ4 Q;  4QQG A;  4QW2 A;  4X34 A;  3PE0 A;  2O88 A;  5GAN j;  3JB9 F;  3M4Y A;  3M5A A;  3VKI A;  1NG2 A;  5CKF A;  4M7D F;  3G4S T;  1WHL A;  2V1Q A;  1N5Z A;  4ESR A;  1YIJ A;  2NUT A;  2GQI A;  3ULR B;  2Z0W A;  1X75 C;  1QVG P;  2DRM A;  2HQE A;  4PLL A;  3QG1 A;  3JAM E;  5KCO A;  3J81 E;  2CZ1 B;  2VWF A;  4C8Q F;  1HXD A;  5LL6 S;  1WXU A;  5FLX E;  3OYF A;  3JB9 D;  4J7F A;  4J8O A;  3EAE A;  4EMH A;  2JM9 A;  4PJO A;  1TUC A;  2LZ6 B;  4EMG A;  2XMF A;  1K9M U;  5FRN A;  2E41 A;  1WFW A;  1MNE A;  3O8V A;  2K79 A;  3M56 A;  2CH4 A;  2VGN A;  2KMT A;  4BE0 A;  3QDF A;  1YHQ T;  4C5I A;  3S3M A;  1K73 C;  2WSE E;  3URG A;  3KXT A;  4C8Q D;  1WXT A;  3EFO B;  3JCM P;  1H8K A;  4LDY A;  5KH6 A;  1KC8 U;  2DD4 A;  4X9D A;  2KRN A;  1YCY A;  5KE3 A;  4R56 A;  4BE1 A;  2E10 A;  5LJ5 d;  5D6Y A;  4BI4 A;  3CCR Q;  4J9D A;  3EH2 A;  3VS7 A;  3CME T;  2YRV A;  1ZBJ A;  1WHG A;  1Y57 A;  1D0Z A;  1EX4 A;  2A37 A;  4M7A E;  1VQO T;  4Y92 A;  2QEX T;  2FEI A;  3SD4 A;  2HAX A;  2DNU A;  2J06 A;  4M77 A;  2D8J A;  2VUB A;  1E6G A;  2RI5 A;  2EQM A;  4UC4 A;  2DX1 A;  1TU0 B;  2DET A;  4BE2 A;  4JLI A;  4V2S A;  4QQ6 A;  1GCQ A;  2XK0 A;  2HQX A;  5LJ3 f;  4JLG A;  1VQ7 T;  1VQN T;  2RQW A;  2EPD A;  1RAC B;  4XTW A;  1ZUY A;  2CUD A;  2RHZ A;  3OMC A;  3VU3 C;  3JCM W;  1Q81 R;  2RHI A;  3ZL7 C;  1LOJ A;  3AT1 B;  6AT1 B;  2DM1 A;  2F2W A;  1Q86 U;  1Y7X A;  1OYX A;  4OMF B;  4X9C A;  3WVD B;  4JRK A;  1C6V X;  3SHW A;  3QYG B;  4P5N A;  1ZBX A;  3MET A;  2LQW A;  2D0N A;  2WSF E;  5CQY A;  5IT9 E;  4QVC A;  1S72 T;  2D6F A;  5IAY A;  4M7A B;  3QKJ A;  1O9S A;  3NPF A;  4D8K A;  1LCK A;  2R57 A;  3QJ6 A;  2RHX A;  2KRO A;  1XTD A;  4C92 C;  1VQK A;  3OYC A;  4RCC A;  4B6M A;  2EQK A;  3L1A A;  1BIA A;  2PUK B;  2LT4 A;  4JRQ A;  5GMK m;  4RTV A;  5L23 A;  2DL3 A;  1VQL Q;  4A63 B;  3JCM b;  3LW5 E;  3QWX X;  2DJQ A;  3CPW S;  2W0Z A;  2DJZ A;  1PM3 A;  1WJQ A;  4R55 A;  1TSF A;  4PJM A;  1M90 R;  4KGX B;  4KT0 E;  5CVI A;  3RKX A;  1WLP B;  3I56 T;  2LMJ A;  5IN1 A;  3CMA A;  1YIT T;  1R77 A;  4EPC A;  3HRS A;  1HD3 A;  3EGX B;  4GLM A;  5C6S A;  4D6W A;  2DL4 A;  1VQ4 A;  1I5O B;  2LQ8 A;  5FU7 B;  1VIE A;  2B8A A;  2ATC B;  1XQH A;  2KT8 A;  1ZLM A;  4XU1 A;  4Z02 A;  5C0M A;  3SWN C;  5J26 A;  2OX7 A;  2BUD A;  5GMK h;  1RI9 A;  1BKB A;  4QT7 A;  2DIL A;  1WYX A;  4E7L A;  1QCN A;  2NUZ A;  2DTH A;  1UFF A;  4XTU A;  4DBR A;  5GAO l;  1YJN A;  5GAM f;  3UT1 A;  4PNO A;  3M0R A;  4FW1 A;  2X3X D;  3C4S A;  1BK2 A;  3CC7 A;  1WDX A;  3DLM A;  3ZBD A;  1QCO A;  1AEY A;  1RAB B;  4XQ3 A;  3NHN A;  1V1C A;  2F1L A;  2GGR A;  2A08 A;  2DPP B;  2O4X B;  2ZPH B;  2K9G A;  3RES A;  3CCM Q;  4WCI A;  1K9M C;  3CCU Q;  1VQ6 T;  1JQQ A;  3CCJ Q;  1YJ9 T;  3M58 A;  2RPN A;  5I21 A;  4RKU E;  3PMI A;  5KYW A;  3CCV T;  4M7D C;  4EMK B;  2FZG B;  1AOJ A;  2FRY A;  2MAM A;  2JNG A;  3KUF A;  4F7U A;  2FZK B;  4KUD K;  2JS0 A;  4XTZ A;  1VQ9 Q;  5HY6 A;  2MF2 A;  1XOV A;  4HT8 A;  2CT4 A;  3DB4 A;  1WX6 A;  5FRM A;  1TUD A;  1Q81 U;  4C5E A;  5M9O A;  5A0D A;  2JMC A;  2V8J A;  4NL2 A;  1BB9 A;  4M4Z A;  3LH5 A;  4WF2 A;  5GAN e;  2E5K A;  2M9U A;  4OMM A;  3EGD B;  4J83 A;  2ED0 A;  3RUX A;  4FYV B;  1JXM A;  1RAD B;  2YT6 A;  2OTL Q;  4IIM A;  3HSB A;  5FW9 A;  3MJX A;  3CCQ T;  4LDV A;  4M75 B;  5CKB A;  2EYY A;  5IHK A;  2J6K A;  3PIO A;  1YI2 Q;  4M78 E;  2LVM A;  3VUZ A;  4OMO A;  2KVQ G;  2HNI A;  4Y28 E;  2DVE A;  1JJ2 A;  4QVD A;  3JCM J;  5GAO q;  5GAO m;  3CC4 Q;  1R0C B;  2MWO A;  2YRC A;  4DBQ A;  1Q86 C;  1LPL A;  1X6B A;  4AT1 B;  4OVA A;  1UDL A;  2RQV A;  2EW3 A;  3BFM A;  2DL8 A;  4C92 E;  1RI0 A;  5CAI A;  2LX7 A;  1RAH B;  5GAO r;  3LYI A;  3CC2 T;  2QTX A;  2GNC A;  3CBM A;  1NPR A;  1YCS B;  3OB9 A;  2QQ9 A;  2AKL A;  5I11 A;  4E7J A;  4N0A C;  2CS7 A;  1YN8 A;  2P84 A;  1VQL A;  2G3R A;  1ZUK A;  4KH0 B;  4ZNX A;  1PHT A;  3RMQ A;  1SSF A;  1Q7Y C;  3MEV A;  1D3B A;  4XU3 A;  3RDV A;  3JCM d;  1KQS S;  3SWN A;  4X1V A;  1YIJ T;  4CC7 A;  2HL3 A;  2P0Q A;  5LJ3 h;  1WHH A;  3GIB A;  2KNB B;  4M78 B;  4DOW A;  4RTX A;  4QQD A;  5KYX A;  3RBB B;  3QUI A;  1G5V A;  3HPW A;  3MEA A;  2CRE A;  3A8M B;  3VS4 A;  3CCS Q;  3I9Q A;  3P8H A;  2F5T X;  4E2F B;  1B34 B;  3JB9 J;  2CH4 W;  1VYU A;  1E6H A;  5GMK j;  5I22 A;  4RTU A;  3I55 Q;  2OTJ Q;  2EKH A;  4PJJ A;  3PVL A;  3S3O A;  2RNA A;  3PVQ A;  4BAC A;  1G3W A;  3L2Q A;  2E6Z A;  1QWF A;  1MUZ A;  5LJ5 f;  1MV0 B;  3QYH B;  5GJW B;  1Y96 A;  5D7U A;  4EIK A;  4KGV B;  2RM4 A;  2JXB A;  2IG0 A;  4ORZ A;  1QP2 A;  1UE9 A;  1DJ7 B;  1MMD A;  1VQP A;  3G71 Q;  2YUP A;  1VQ5 Q;  3FB9 A;  3EHQ A;  2AZS A;  3RER A;  1K1Z A;  4J5Y A;  1K76 A;  4M7D E;  1ZA2 B;  1WQW A;  1M2V B;  3CCJ A;  3JRZ A;  2XDD A;  2PUO B;  4DA4 A;  3MEU A;  2L3S A;  1QQJ A;  1W1F A;  1KIK A;  2KRS A;  4FT2 A;  1VQ9 A;  1WPY A;  2DK3 A;  2J7I A;  4RMO A;  5I2S A;  4C8Q E;  1IGU A;  4LD9 K;  1UEB A;  2IPO B;  1H3H A;  2JTM A;  4IUT A;  2GF7 A;  1GRI A;  2YRD A;  1WHK A;  1HJD A;  1Q81 C;  1SEM A;  4CI0 C;  3MP8 A;  4F14 A;  1M9S A;  4F04 B;  2OTL A;  3ASK A;  3RR6 A;  5FU7 C;  3BE3 A;  2KRM A;  3M0T A;  2DKG A;  3J7A F;  4L6V 5;  2OAU A;  3REA B;  1NEG A;  2DE0 X;  2YHT A;  4OMN A;  3D7S B;  3G6E Q;  3CCL A;  1X69 A;  1F1B B;  2CZ7 B;  1NBE B;  3LX7 A;  4ELZ C;  1PWT A;  2XID A;  1Q86 R;  5KYU B;  1U8R A;  1VQK T;  2XKO C;  1H92 A;  1KHI A;  1AHJ B;  2E3H A;  2HQH A;  3LGL A;  4Z89 A;  2D9T A;  1WQ7 A;  1OI1 A;  5DY9 A;  3EFO A;  4J9E A;  4C8Q B;  3OS5 A;  3WXM B;  3KBG A;  4KBM B;  2FL7 A;  3MP1 A;  3UDC A;  3CXC S;  3H0H A;  4PLI A;  5GAN 7;  1PG5 B;  4NL3 A;  2WAC A;  1PD0 A;  2CZ0 B;  4JJD A;  3CMA T;  1FWZ A;  1NYF A;  4E47 A;  2P4R A;  1VQ4 T;  1UGP B;  1VQ8 Q;  2DO3 A;  4O6J A;  3TRE A;  2LNV A;  3OYY A;  1Q7Y R;  2L8D A;  3RKW A;  2K4Y A;  1Q82 C;  4NS5 A;  2KBT A;  4JZ3 A;  4EMK C;  2HCK A;  3HL8 A;  4AG2 C;  2A3L A;  1T3L A;  3SDZ A;  5GAN 3;  2EBP A;  4Z88 A;  2M1H A;  1IRX A;  1KG1 A;  1WJS A;  2PVD B;  1RAI B;  2AK5 A;  3LGF A;  2FPE A;  1AZG B;  1YJW Q;  4E7K A;  1R8O B;  4JUV A;  3CD6 A;  4FYW B;  3DLL A;  3CCS A;  1YJN T;  1W2B A;  1M1K R;  1UB4 A;  3MP6 A;  5DM7 R;  3I35 A;  4ME7 A;  1D1B A;  1H3Z A;  3F70 A;  1U1T A;  3CC7 T;  1VIF A;  2FHD A;  2OTJ A;  3GNG A;  1R0B G;  3CEY A;  4JJC A;  5A2Q E;  3HHT B;  1OU9 A;  2L3P A;  2CP5 A;  4BY6 C;  2LTO A;  3SFM A;  1JJ2 P;  1Z9Q A;  4JZ4 A;  4RTZ A;  1C0M A;  1ZSG A;  2CP2 A;  4M75 C;  3VRY A;  2EVR A;  1ABO A;  2XG8 D;  4M7A A;  2EQI A;  2RK1 A;  5GAN 8;  4HCK A;  4JRI A;  2LDM A;  3V8K A;  2MWP A;  4PJO G;  1QVG S;  3OYB A;  1VQ5 A;  5IHN A;  5ECA A;  2JW4 A;  1UGR B;  2HZY A;  2BTT A;  1KSW A;  1I4K 1;  2OI3 A;  1QP3 A;  2IIM A;  2EKO A;  1I8F A;  1N9S A;  1JBM A;  4JPB W;  1KQ1 A;  4N4H A;  3H9N A;  2FYK A;  1ZX6 A;  3VYG A;  3QZ9 B;  1HSQ A;  1X01 A;  1TTH B;  2DYI A;  2GTO A;  3CME Q;  1NPP A;  1LNX A;  5DLO A;  2C0O A;  1VQO Q;  3MCA B;  2QEX Q;  2HEQ A;  2QGG A;  2P4T A;  2YSQ A;  3OBW A;  2ZZD A;  1RAF B;  1LVK A;  1O75 A;  2YLB A;  2V1R A;  4HA8 A;  2LQK A;  2JTF A;  2RN8 A;  1SRL A;  4M77 G;  3A1P A;  2QA4 Q;  5CQX A;  2AT1 B;  5KYY B;  3L42 A;  4MZP A;  1K0X A;  4M78 C;  4ZTF A;  1VQN Q;  2M16 A;  1M3B A;  3A8H B;  2ENM A;  4E7I A;  5GMK e;  2QI2 A;  5LJ5 h;  2DBM A;  1T0H A;  1AWW A;  4ANJ A;  1YWP A;  4DBH A;  4IUP A;  2RMO A;  3PT9 A;  3UF4 A;  1RLQ C;  2KYB A;  2MCN A;  3UAT A;  4B9X A;  5KYN A;  5IHI A;  1ZQ1 A;  2ZPI B;  3BDU A;  4FL6 A;  2EWN A;  1FMV A;  1YBY A;  2QK0 A;  2ESW A;  4L59 A;  3JCM Q;  1GBQ A;  4KRT A;  1G8X A;  2MYS A;  5IH2 A;  2PU9 B;  2O4X A;  1Q7Y U;  1ZSZ A;  4A4G A;  1S72 Q;  2DVJ A;  2COZ A;  3OYJ A;  2YUO A;  2E65 A;  3JCM f;  1PC0 A;  1NE8 A;  5FWB A;  2FB7 A;  1M1G A;  2VXE A;  4XU2 A;  4VUB A;  2GBQ A;  4LE9 A;  1VUB A;  1PD1 A;  4J9F A;  1RUW A;  1KFZ A;  4A4H A;  3JB9 I;  4O5V A;  1M1K U;  1XJW B;  4PJO F;  2AZV A;  4E7Z A;  1Q82 R;  1MV3 A;  3OW2 A;  2DLP A;  1FX7 A;  2KY9 A;  2DXB A;  1X6G A;  1MHN A;  2CP3 A;  2KR3 A;  4A4F A;  1OX9 A;  4J9B A;  1BBZ A;  1M2O A;  1W4S A;  3NMZ C;  2HMA A;  1GFC A;  3I56 Q;  4MDW A;  1YIT Q;  1U06 A;  1QVF A;  1M5Q 1;  2LT1 A;  4KUI A;  1M27 C;  1YJW A;  2RB6 A;  3OMG A;  4ZN3 A;  1TG0 A;  4CRI A;  4RCB A;  3OS0 A;  4PJO D;  2SRC A;  4M75 A;  2ZGW A;  2DZ9 A;  4J9G A;  1K8A R;  4IUU A;  4L5G A;  1VQP T;  2O01 E;  1I81 A;  3OYN A;  4M75 E;  5L8R E;  2EAY A;  2EFI A;  1X27 A;  2YUN A;  4M77 F;  3RMS A;  4M7A D;  2EQJ A;  3EFS A;  1VYT A;  1W70 A;  3C0C A;  2RF0 A;  1AWO A;  1H64 1;  2J05 A;  3A8O B;  4E7S A;  2LCS A;  1VQ9 T;  3HRU A;  3CCR A;  5CK9 A;  4AFZ C;  1OQK A;  2DXT A;  1M8M A;  2RK2 A;  2Y4Y A;  4XTV A;  3VS6 A;  3L2V A;  1BI2 A;  1X2K A;  2ZAE A;  1YJ9 Q;  1VQ6 Q;  2RO0 A;  2CZ6 B;  3OA6 A;  4GLK A;  4M77 D;  3UWN A;  3CCV Q;  2X4X A;  4C8Q C;  4JRP A;  2PNI A;  2L89 A;  4WTO B;  2B86 A;  5CKD A;  1KJW A;  3J80 E;  4F7U G;  2C0I A;  3EH1 A;  1HYO A;  2E1H A;  2I2L A;  3FEO A;  4M78 A;  2E4H A;  5LJ3 e;  4KGZ B;  2OTL T;  4BY6 B;  1KHC A;  1SRM A;  2L2P A;  2YUQ A;  1B34 A;  1LJO A;  2LCL A;  3NTI A;  3AHU A;  1UGS B;  1W2B P;  2QA4 A;  2G6F X;  3CCL T;  2EYW A;  5GAN d;  4C0D C;  4PJN A;  4C92 A;  1QLY A;  1YP5 A;  4BDZ A;  3C95 A;  3CCQ Q;  1ZUU A;  2VV5 A;  2JVV A;  2EGA A;  3OYE A;  2V26 A;  2FZC B;  2ZPB B;  3ER0 A;  1SSH A;  4LDW A;  1I5L A;  2EQU A;  2L0A A;  2K3X A;  8AT1 B;  1SF9 A;  3G7Z A;  4LDU A;  1G83 A;  5HCK A;  4XTX A;  1Q82 U;  3QXE B;  1G3S A;  1JU5 C;  1W6X A;  1TWB A;  3EG9 B;  2AIR B;  2F2X A;  3QHS A;  2NYS A;  4J6X A;  2DTI A;  2QDL A;  5GAO n;  4JS5 A;  1UUE A;  4B9W A;  2E12 A;  2EYZ A;  3VV0 A;  4IKF A;  1UGV A;  3CC2 Q;  3I5R A;  2RI3 A;  2ZPG B;  1OPK A;  2DL7 A;  5GAO p;  4J9I A;  3M0S A;  5DLQ E;  5CKH A;  3L2U A;  2RJC A;  3M0Q A;  5GAN 6;  1K8A U;  3CD6 T;  2RH2 A;  4HT9 A;  3CCS T;  3NTH A;  1M1K C;  2KQW A;  3QII A;  1SG5 A;  3PFS A;  1VQM Q;  1WA7 A;  1G3Y A;  2COW A;  5J39 A;  2BIV A;  3U23 A;  2BZX A;  3BDL A;  3CPW A;  1EZZ B;  2VVK A;  1X2Q A;  2E6N A;  4F7U F;  3HP9 A;  1GL5 A;  1M1F A;  1RLP C;  3MO8 A;  1QKW A;  3LWH A;  3PMT A;  3JB9 H;  3CQT A;  4M7D A;  3QO3 A;  5GAN 2;  4J7I A;  2KGT A;  1WIE A;  1TS9 A;  2FG0 A;  3TCJ A;  1VQ5 T;  1RAE B;  3LLR A;  1OUL A;  3VS2 A;  3E19 A;  3CCM A;  4ZGE B;  4A54 A;  4HVW A;  3JCM h;  1RAA B;  2RQU A;  3WVE B;  3CCU A;  1NJI R;  1KD1 C;  1NM7 A;  2MOX A;  4C8Q A;  2RQT A;  2FO0 A;  4RG8 A;  3JCM V;  2XU8 A;  1WGS A;  3MKD A;  3OYA A;  3C12 A;  4NOY A;  2CYZ B;  3E1S A;  2VKN A;  3FRN A;  1KK7 A;  4QVZ A;  2CGH A;  3JCM X;  1T3S A;  3GOX A;  1BYM A;  3M0U A;  3QJY A;  3CCE Q;  2F69 A;  4A4E A;  3PGG A;  2CDT A;  1D3B B;  4FM4 B;  2JM8 A;  1AWX A;  1PSF A;  3VUB A;  5A0L A;  4RTY A;  3H8Z A;  2ZCF B;  1FYN A;  4FSX A;  4PKC C;  1JO8 A;  1BI3 A;  3M54 A;  2OAW A;  2BKD N;  4OMQ A;  1UHF A;  4A53 A;  1IZ6 A;  5GAM h;  1N8R R;  2VAS A;  1OV3 A;  1QVF P;  2E70 A;  4AFS C;  2OJ2 A;  1BIB A;  2NWM A;  2A28 A;  5LJ3 g;  2NUP B;  2LQN A;  1D0Y A;  2LNH B;  1YI2 A;  5GJV B;  2DXU A;  1ZA1 B;  1D1A A;  3RNJ A;  1GCQ C;  3VRZ A;  4C92 D;  3NGP A;  2ZPE B;  2DEU A;  2EYQ A;  2K6D A;  4K11 A;  3CC4 A;  2RA2 A;  3MEW A;  9ATC B;  2E5Q A;  3UPU A;  1NLP C;  4RTW A;  1EFN A;  2I0N A;  2EJ9 A;  1Y96 B;  4N0A A;  2K5L A;  1V76 A;  4E6R A;  2R5A A;  3MHX A;  1G3T A;  4JDS A;  4C0F A;  3FC3 A;  1C1A A;  2MK5 A;  1IRE B;  2KAF A;  1PRL C;  4MML A;  2GQV A;  4LXC A;  1EIF A;  1GXI E;  2MIO A;  3EG2 A;  3NFC A;  2DAQ A;  3M4G A;  1AZE A;  2KSS A;  4LUE A;  2HSP A;  2F5K A;  1V29 B;  1IHV A;  1WNL A;  5LJ3 j;  3V8L A;  5IXB A;  4FW2 A;  3CMA Q;  2MMP A;  4C0D B;  4XTY A;  2KXC A;  1GBR A;  1M3C A;  4HCB A;  2PVG B;  2DER A;  2CSQ A;  4BB7 A;  1YJW T;  4OB3 B;  1WI7 A;  3G4S Q;  1B3Q A;  3PIP A;  1PCX A;  1MMG A;  2Y4X A;  2LCC A;  4FIB A;  2PVO B;  2LC4 A;  3H0F A;  2C06 A;  3I55 A;  1VQM A;  1K8A C;  5KYY A;  1NJI U;  4OB2 B;  1CSK A;  4OB1 B;  1WXB A;  3ME9 A;  4AFQ C;  3GP8 A;  3QDR B;  1YJN Q;  2JUF A;  1T0J A;  3A98 A;  4FYX B;  4PL6 A;  5LJ5 e;  4BUG A;  4M7D D;  1KQS A;  2QAS A;  2EJF A;  1JXO A;  3CC7 Q;  2BE7 D;  2ZPF B;  5HK3 A;  4XAX B;  3V7R A;  4HVU A;  3X28 B;  5GAM g;  2A0F B;  1FMW A;  3X25 B;  1S1N A;  3G71 A;  4MMK A;  3CCR T;  1MMN A;  4PJO E;  3UA7 A;  1YHQ Q;  1KD1 R;  1YFN A;  1OX8 A;  3FJ5 A;  2QTV A;  2KE9 A;  4OGC A;  3E9F A;  2ROL A;  4TVR A;  5GMK l;  3OS1 A;  1YNZ A;  1GFD A;  1JEG A;  4BD3 A;  4F17 A;  4M7A G;  1UEC A;  4IIO A;  4IUQ A;  4ZN1 A;  2DYB A;  1N8R U;  5D6W A;  1JJ2 S;  3JSC A;  5AYF A;  4LD6 A;  2JTE A;  3EGX A;  5FWC A;  2L3Q A;  1Y0M A;  5GAN 5;  3CCE A;  1SPK A;  2JS2 A;  3HFN A;  3EGU A;  5GAN f;  2LJ0 A;  3RKY A;  1ARK A;  1OPL A;  2NUT B;  2VYT A;  2CSI A;  2FVU A;  4CC3 A;  2QQB A;  2RJF A;  4A4K A;  2QA4 T;  4FYY B; 
#chains in the Genus database with same CATH homology
 3I9Q A;  1E7O A;  1PKT A;  2CH4 W;  2J05 A;  2LCS A;  1UG1 A;  1VYU A;  1E6H A;  2O31 A;  2M0Y A;  4AFZ C;  1UHC A;  3UA6 A;  5I22 A;  1PRM C;  1M3A A;  1UJ0 A;  2SEM A;  4RTU A;  1M8M A;  2EKH A;  3PVL A;  3VS6 A;  1X2K A;  1NLO C;  1BU1 A;  2RNA A;  3PVQ A;  2EGC A;  3EG3 A;  2HDA A;  1QWF A;  4D8D A;  1M30 A;  1MUZ A;  2K2M A;  2FPD A;  2O9V A;  1AWJ A;  1MV0 B;  2PNI A;  2B86 A;  2EYX A;  5GJW B;  3PE0 A;  2O88 A;  1KJW A;  4EIK A;  2CUB A;  4HXJ A;  2JXB A;  2C0I A;  1NG2 A;  4ORZ A;  1UE9 A;  2M51 A;  1B07 A;  1QWE A;  2YUP A;  2V1Q A;  1N5Z A;  3EHQ A;  4ESR A;  2AZS A;  1SHF A;  2GQI A;  1K1Z A;  3ULR B;  2HBW A;  1SRM A;  2L2P A;  1K76 A;  4DEX A;  2DRM A;  2YUQ A;  1ABQ A;  1U3O A;  4FSS A;  2VWF A;  2G6F X;  2L3S A;  2EYW A;  1WXU A;  1W1F A;  1KIK A;  2KRS A;  2JM9 A;  1TUC A;  2A36 A;  1QLY A;  1YP5 A;  2J7I A;  2LZ6 B;  2XMF A;  1ZUU A;  2EGA A;  1WFW A;  3VS5 A;  1X43 A;  1SSH A;  5EC7 A;  2K79 A;  2CH4 A;  1H3H A;  2C0T A;  2L0A A;  1GRI A;  1HJD A;  1WXT A;  1G83 A;  1H8K A;  3VS3 A;  1SEM A;  5HCK A;  1Z9Z A;  2W10 A;  1JU5 C;  1W6X A;  2KRN A;  4F14 A;  1I0C A;  2PTK A;  2F2X A;  4J9D A;  4J9H A;  3VS7 A;  3H41 A;  2QDL A;  1ZBJ A;  1Y57 A;  2KEA A;  2A37 A;  2KRM A;  3M0T A;  1UUE A;  4Y92 A;  2FEI A;  2AKK A;  1U5S A;  2EYZ A;  3REA B;  2ROT A;  1UGV A;  2KT1 A;  4R0K A;  1NEG A;  2DE0 X;  2DNU A;  3I5R A;  2J06 A;  1OPK A;  4OMN A;  2DL7 A;  1OEB A;  4J9I A;  1X69 A;  2D8J A;  3M0S A;  1E6G A;  2DX1 A;  1PWT A;  2PZ1 A;  1QKX A;  2O9S A;  3M0Q A;  1H92 A;  1GCQ A;  2DA9 A;  4Z89 A;  2RQW A;  1IO6 A;  4J9E A;  2EPD A;  3M0P A;  1ZUY A;  1WA7 A;  2CUD A;  3H0H A;  3U23 A;  3ZL7 C;  2BZX A;  2DM1 A;  2F2W A;  4JJD A;  2VVK A;  1OOT A;  2H8H A;  3VS0 A;  1X2Q A;  1NYF A;  1GCP A;  3SHW A;  1GL5 A;  1RLP C;  2P4R A;  2LQW A;  2O2O A;  1QKW A;  2D0N A;  2RQR A;  3EG0 A;  3CQT A;  1NYG A;  2KBT A;  2KGT A;  4JZ3 A;  1WIE A;  2HCK A;  4AG2 C;  2FG0 A;  1I07 A;  2D1X A;  4CC2 A;  1T3L A;  3NPF A;  4D8K A;  1SHG A;  3VS2 A;  1LCK A;  4HVW A;  2EBP A;  2RQU A;  4Z88 A;  2JMA A;  2KRO A;  2AK5 A;  2FPE A;  2EGE A;  1AZG B;  3QWY A;  1NM7 A;  2MOX A;  2RQT A;  1QCF A;  2FO0 A;  3THK A;  3I35 A;  1UTI A;  4RTV A;  5L23 A;  3I5S A;  2DL3 A;  2VKN A;  1VA7 A;  4A63 B;  3QWX X;  2DJQ A;  2W0Z A;  1A0N B;  1T3S A;  4F16 A;  2ECZ A;  4JJC A;  3M0U A;  2L3P A;  4RTT A;  2X3W D;  1NEB A;  1WLP B;  1Z9Q A;  2LMJ A;  2BZ8 A;  4JZ4 A;  2J6F A;  4RTZ A;  2CDT A;  4LNP A;  1ZSG A;  2JM8 A;  1AWX A;  1HD3 A;  3VRY A;  2EVR A;  1ABO A;  4GLM A;  2DL4 A;  4RTY A;  1FYN A;  2EQI A;  2KT8 A;  4HCK A;  1ZLM A;  1JO8 A;  2KYM A;  5IHN A;  2OAW A;  4OMQ A;  1UHF A;  5ECA A;  2JW4 A;  4OMP A;  1CKB A;  3TVT A;  4AG1 C;  1OV3 A;  1RI9 A;  2BTT A;  4QT7 A;  2OJ2 A;  4AFS C;  1KSW A;  2DIL A;  2NWM A;  2A28 A;  2IIM A;  2OI3 A;  3O5Z A;  2LQN A;  1FMK A;  1WYX A;  2LNH B;  5GJV B;  2NUZ A;  3JV3 A;  4JPB W;  1PKS A;  1UFF A;  3TSW A;  3RNJ A;  1GCQ C;  1ZX6 A;  3VRZ A;  2DL5 A;  1HSQ A;  2FPF A;  3NGP A;  3M0R A;  2KXD A;  2X3X D;  3R6N A;  1BK2 A;  2K6D A;  2GTO A;  4DEY A;  4K11 A;  4AFU C;  2C0O A;  1WDX A;  1NLP C;  2DRK A;  2HEQ A;  4RTW A;  1AEY A;  1EFN A;  2I0N A;  3NHN A;  2YSQ A;  4E6R A;  1V1C A;  2GGR A;  2A08 A;  2K9G A;  4WCI A;  2YDL A;  1AVZ C;  1JQQ A;  2JT4 A;  4CC4 B;  2V1R A;  2RPN A;  1PRL C;  2DBK A;  1CKA A;  1K4U S;  2RN8 A;  1SRL A;  3SEM A;  1AOJ A;  2FRY A;  2MIO A;  3EG2 A;  1K0X A;  2JS0 A;  4HVV A;  1M3B A;  2ENM A;  1XOV A;  2DBM A;  3KFV A;  1AZE A;  1T0H A;  2CT4 A;  1AWW A;  4LUE A;  1YWP A;  3UF4 A;  2RMO A;  1WX6 A;  1RLQ C;  3TSZ A;  2KYB A;  2MCN A;  2HSP A;  3UAT A;  1TUD A;  3H0I A;  4GBQ A;  5IHI A;  5IXB A;  2GTJ A;  2JMC A;  1BB9 A;  3EHR A;  4M4Z A;  4Z8A A;  3LH5 A;  2LJ1 A;  2KXC A;  4JJB A;  2ED1 A;  1GBR A;  1M3C A;  2E5K A;  2ESW A;  3EG1 A;  4OMM A;  1GBQ A;  4KRT A;  2CSQ A;  2ED0 A;  4RUG A;  5IH2 A;  1WI7 A;  1B3Q A;  5IXF A;  2DVJ A;  1JXM A;  2YUO A;  2YT6 A;  4LN2 A;  4IIM A;  5FWB A;  2DF6 A;  2ABL A;  5FW9 A;  1K0S A;  3H0F A;  4J9C A;  2GBQ A;  1UJY A;  4LE9 A;  2EYY A;  5IHK A;  2J6K A;  1I1J A;  1CSK A;  1WXB A;  4LUD A;  1VYV A;  4J9F A;  4AFQ C;  4OMO A;  2FRW A;  1RUW A;  1KFZ A;  1T0J A;  1PNJ A;  1J3T A;  3A98 A;  2LP5 A;  2K7A A;  1JXO A;  2AZV A;  1MV3 A;  4HVU A;  1G2B A;  2DLP A;  1X6G A;  1X6B A;  2KR3 A;  4J9B A;  1S1N A;  1BBZ A;  3NMZ C;  1UDL A;  2RQV A;  2EW3 A;  4OML A;  1GFC A;  2DL8 A;  3UA7 A;  3GBQ A;  1U06 A;  1AD5 A;  2BZY A;  2LJ3 A;  2LX7 A;  3FJ5 A;  2KE9 A;  1M27 C;  2ROL A;  3IQL A;  2D8H A;  2GNC A;  1TG0 A;  1YNZ A;  1YCS B;  1GFD A;  2SRC A;  3VS1 A;  2AKL A;  2J6O A;  5I11 A;  1JEG A;  4J9G A;  4F17 A;  1YN8 A;  1UEC A;  1ZUK A;  3REB B;  4ZNX A;  4IIO A;  1K9A A;  2DYB A;  1PHT A;  1YWO A;  2JTE A;  4X1V A;  5FWC A;  2L3Q A;  1Y0M A;  4CC7 A;  1X27 A;  1SPK A;  2JS2 A;  2KNB B;  2YUN A;  2F2V A;  3EGU A;  4RTX A;  2K3B A;  2LJ0 A;  1VYT A;  1ARK A;  2CT3 A;  3RBB B;  1OPL A;  2DMO A;  1W70 A;  2CSI A;  4CC3 A;  2CRE A;  3C0C A;  2RF0 A;  3VS4 A;  1AWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...