4RTWA

Crystal structure of the c-src-sh3 domain e93v/q128r mutant in complex with the high affinity peptide app12
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
57
structure length
57
Chain Sequence
TFVALYDYVSRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the c-Src-SH3 domain E93V/Q128R mutant in complex with the high affinity peptide APP12
rcsb
source organism Gallus gallus
molecule tags Protein binding
molecule keywords Proto-oncogene tyrosine-protein kinase Src
total genus 13
structure length 57
sequence length 57
chains with identical sequence C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4rtwA00
1PWTA 1FMKA 4CC2A 5L23A 2A28A 4AFQC 2YT6A 1OPKA 2DBKA 2PTKA 3M0RA 4D8KA 2AZVA 2J06A 2LJ3A 3VS6A 3NGPA 3SHWA 3EG1A 1ARKA 3TVTA 3UATA 2RNAA 2F2WA 4M4ZA 2O2OA 3U23A 1ZBJA 4CC3A 4J9GA 3UF4A 2DE0X 1WX6A 3O5ZA 1NEGA 3M0PA 4JJDA 1JEGA 1V1CA 5IHKA 1UHCA 3UA6A 4IIOA 1WI7A 2CDTA 4JPBW 2RQVA 1YN8A 2CUBA 4WCIA 1H3HA 2RQRA 4J9BA 2NWMA 2G6FX 4AFUC 2GGRA 2KE9A 1I1JA 1BU1A 1QWFA 2EW3A 2OI3A 2K9GA 2KGTA 4OMOA 4LUDA 3NMZC 4J9CA 3VS5A 2KXDA 2NUZA 1GL5A 4DEXA 2LX7A 4Z89A 2FEIA 2KYMA 1YCSB 1W70A 2ENMA 3PVQA 2MCNA 2EYXA 2O9VA 5I11A 1X6GA 1Y0MA 1E6HA 4R0KA 4RTXA 1TUDA 2B86A 2LQWA 2DYBA 3TSWA 4Z8AA 2CH4W 1AEYA 2DRKA 4JZ4A 2KRMA 1CKAA 3I35A 1PRMC 2BZYA 3RBBB 4OMLA 1GCQC 2DA9A 2FPFA 2KRNA 5IXBA 2YUOA 2EGEA 3PVLA 2CT4A 2DMOA 4HCKA 1MV0B 2SRCA 4AG1C 4DEYA 2CSQA 2K7AA 2KNBB 5IH2A 4RTYA 2YUNA 1CKBA 2RPNA 4J9IA 1J3TA 1IO6A 1ZUKA 2L3PA 2DL5A 3EGUA 1M3AA 2LJ1A 1UJYA 1BBZA 2YSQA 1UJ0A 3KFVA 2OAWA 1AZGB 2O31A 2GBQA 1SEMA 2JMCA 2HBWA 4RTUA 2PNIA 1SPKA 4Z88A 1UG1A 2MOXA 2J6OA 1WYXA 3EG2A 2ED1A 2DL3A 2JTEA 1RLPC 1H8KA 2GTOA 1AOJA 1T3LA 2K79A 4X1VA 2PZ1A 4HVVA 4F14A 2FO0A 5IXFA 4IIMA 3C0CA 1X2QA 1GCPA 3H0FA 1SSHA 2EVRA 3EG0A 2FRYA 1RI9A 3FJ5A 3M0QA 3ULRB 1GBRA 4AFSC 2GNCA 2KR3A 3QWYA 3TSZA 2YUPA 2L3SA 2CREA 1YWOA 4EIKA 1LCKA 2J6FA 2ABLA 1KSWA 3IQLA 1NYGA 2RF0A 4GBQA 4ESRA 4LN2A 1W6XA 1B07A 2JW4A 3H0IA 2BTTA 1UGVA 1UDLA 3SEMA 1X43A 1VA7A 1E7OA 1NLOC 3ZL7C 1K4US 1QKXA 1VYUA 1RUWA 1JO8A 1T3SA 1E6GA 4Y92A 1KIKA 1EFNA 2L2PA 1YNZA 2FPDA 4HVUA 1X27A 4KRTA 2I0NA 1KFZA 2KT1A 4J9EA 3VRZA 1U06A 1N5ZA 2D0NA 2KRSA 1K0XA 1ZSGA 2C0OA 5IHNA 2ED0A 4J9DA 4LNPA 2O88A 2V1QA 2KBTA 1S1NA 2BZXA 1T0JA 1AWOA 1JXOA 2VWFA 1YWPA 2LCSA 2E5KA 2GQIA 2KEAA 1K76A 1TG0A 1GCQA 5GJVB 1X69A 1SHGA 2W0ZA 3REAB 3VS4A 1UHFA 4JJBA 2K2MA 1VYTA 2YDLA 3EHRA 4HXJA 1QWEA 3VS7A 2DL7A 2A08A 1ZLMA 3M0SA 1WIEA 4CC7A 1JU5C 1B3QA 2FRWA 1OPLA 1M27C 2IIMA 3EG3A 5IHIA 4RTZA 2DF6A 3A98A 1RLQC 1PKSA 2DILA 2L3QA 1BK2A 1AZEA 2J6KA 2AKLA 1WDXA 5HCKA 1HSQA 1VYVA 2EYWA 1U3OA 3VS2A 2J05A 4OMNA 1UE9A 2A37A 1M30A 1WXBA 3I9QA 2SEMA 1WLPB 2M51A 1H92A 5FW9A 4CC4B 2JS2A 2CH4A 3JV3A 2QDLA 3I5RA 1M3CA 2VKNA 4GLMA 1NG2A 1CSKA 1HD3A 1YP5A 1WXUA 2EPDA 5ECAA 1NLPC 1M8MA 1PHTA 1SRMA 2A36A 5EC7A 3THKA 3EHQA 2RQUA 2RMOA 4JZ3A 1Z9QA 2LNHB 2H8HA 1Y57A 2ROLA 1K0SA 2DL8A 2DLPA 2P4RA 2ROTA 1AD5A 2O9SA 1NYFA 2JXBA 2M0YA 2RQWA 1GFDA 1I07A 2RN8A 1K9AA 1U5SA 4QT7A 2RQTA 1SHFA 2EKHA 1XOVA 2OJ2A 4JJCA 2LQNA 2LP5A 4RUGA 2DRMA 1W1FA 2CUDA 2MIOA 2ECZA 2DBMA 3NPFA 2LMJA 2VVKA 3GBQA 2K6DA 2KROA 3UA7A 4K11A 2D8HA 2J7IA 1G83A 3R6NA 1Z9ZA 2CSIA 1ABQA 1NM7A 2DM1A 1AWXA 2JM9A 3M0TA 2JT4A 2DNUA 2EGCA 3REBB 1T0HA 1ZX6A 5GJWB 1UUEA 1OOTA 4FSSA 4ORZA 1JQQA 3VRYA 1HJDA 2C0TA 2EYYA 2HDAA 4AFZC 4RTWA 1TUCA 2DVJA 2FG0A 3QWXX 1OV3A 2HSPA 4J9FA 1WXTA 1PNJA 2ESWA 1UFFA 2X3XD 1MV3A 4E6RA 3NHNA 3I5SA 4OMPA 1GRIA 3RNJA 1K1ZA 5FWBA 1WA7A 4D8DA 4RTVA 1FYNA 3CQTA 5I22A 1ZUYA 3H0HA 2DL4A 2V1RA 2HEQA 4F16A 1ZUUA 3M0UA 1AWJA 2EBPA 4HVWA 2GTJA 2LJ0A 1QCFA 1G2BA 1NEBA 2F2XA 2BZ8A 2JM8A 4ZNXA 2HCKA 3VS1A 3VS0A 2XMFA 4AG2C 2AKKA 2JMAA 1GFCA 1PRLC 3H41A 2YUQA 1SRLA 1X2KA 2KYBA 2D8JA 2EGAA 1UECA 1MUZA 2KXCA 3PE0A 1X6BA 2EYZA 2L0AA 4OMQA 2AZSA 3LH5A 5FWCA 1GBQA 1QKWA 2W10A 2CT3A 1QLYA 1UTIA 1M3BA 1I0CA 1KJWA 2AK5A 4J9HA 4OMMA 1AWWA 1PKTA 4A63B 1ABOA 1BB9A 2D1XA 2KT8A 1WFWA 4LUEA 2EQIA 2FPEA 1A0NB 2K3BA 4F17A 1AVZC 2C0IA 3VS3A 1JXMA 2JS0A 2DX1A 2DJQA 2X3WD 4LE9A 1OEBA 4RTTA 2F2VA 2LZ6B
chains in the Genus database with same CATH superfamily
5I21A 4CC2A 4AFQC 1VQ8A 2YT6A 2DBKA 1M1KR 3NGPA 2QQAA 1ARKA 2QG9B 4B6MA 2RNAA 2EWNA 3LWIA 2O2OA 2RO0A 3MP1A 3CPWP 4QVDA 2VV5A 3O5ZA 4D6WA 3PIPA 1TTHB 1V1CA 5IHKA 2M1HA 2CDTA 5LJ3d 1VQ8T 2GQVA 4GY5A 3OYJA 1D09B 2XDPA 4J9BA 4N4IA 2NWMA 2OTLQ 3NTHA 2EW3A 2VXEA 2OI3A 1FMVA 2K4YA 2QTVA 2KGTA 4OMOA 4LUDA 1KC8R 3VS5A 4OB2B 3QJYA 4BD3A 1GL5A 1VQMA 4C92A 2OTLT 3X25B 2EAYA 3CD6A 4M77C 2COWA 2MCNA 3FB9A 5LJ5f 2RA2A 2O9VA 4PK4A 3CXCS 4F7UF 1Y0MA 4R0KA 3MCAB 1TUDA 2DPPB 2L8DA 1N6AA 4JRQA 3TSWA 2GFAA 1D1CA 2DJZA 4RG2A 1ZSZB 2ZPGB 3FEOA 4JZ4A 5LJ5j 1VQKA 2KRMA 1VQ9A 2D0QB 3I35A 3PGGA 1IXDA 1WZOA 4PKCC 3RBBB 2AT1B 5KYUA 2RB6A 3VJPA 5IXBA 3RMQA 1IHVA 2MWOA 2RJDA 1OYXA 1IREB 2EJGA 3WXMB 2LRQA 4XU3A 3GOXA 4FSXA 2RI2A 3P8BB 2QQRA 1V76A 3QKJA 4DQ2A 4J9IA 1J3TA 3S3MA 3NTIA 1ZUKA 2KQWA 1VQPQ 2ZGWA 3QDRB 2MMPA 2RI5A 4PJOC 4J5YA 3MO8A 1R0BG 2EKOA 2HBWA 4PFZA 1PD0A 2PNIA 4ELZC 3CCEQ 1Y71A 1HXDA 2ED1A 1RLPC 2DXUA 1QVFS 2E70A 1AOJA 3CCLT 1RAEB 2PZ1A 5D7UA 3JCMh 4F14A 3OQ5A 2FO0A 2QYZA 3R6OA 4IIMA 1MGQA 3CCLQ 1SSHA 3EG0A 2FRYA 3FJ5A 1SKUB 3QG1A 2RHIA 3TSZA 3M4YA 4C0ZA 5CVIA 4EIKA 2J6FA 3PT9A 1Q82U 5FU6C 1NYGA 4LN2A 2KMTA 1Q82R 2BTTA 1AT1B 2E5QA 4FYWB 2DIGA 1NLOC 1PG5B 3ZL7C 1C1AA 3S3OA 1UGPB 1PCXA 1VYUA 1D0ZA 1RUWA 2A3LA 1EFNA 2K3YA 3C4SA 4A4KA 1TXQA 2KT1A 2FZKB 1VQ5Q 1BKBA 4A4FA 2KRSA 1C0MA 1OZ3A 2O88A 2KBTA 1O9SA 3J81E 3CCQA 2VWFA 1YJNQ 1D1AA 4M78B 2DEUA 4E7SA 1GCQA 3OA6A 3EFSA 3SD4A 2XU8A 2LTOA 5GJVB 3EGDA 4EPCA 3CCRQ 1X69A 4LDUA 1VYTA 3WVDB 2MK5A 3VS7A 1WHLA 4C92D 2A08A 3G7ZA 3A5ZB 1KQSA 4KUDK 1SSFA 1S72Q 2DFUA 5GAMf 1VQLQ 4CC7A 1JU5C 1OPLA 1ZHIA 4XU2A 4PL6A 5IHIA 4RTZA 3AT1B 3E2UA 3PMTA 4M75G 1PD1A 3A8GB 1BK2A 4C92E 3SWNA 1YI2T 1IZ6A 1VYVA 3OYEA 1UGQB 4E7LA 1U3OA 2HL5C 3OYNA 4L6V5 3RESA 1IGUA 2KSSA 4RKUE 3OW2A 4C92C 1I4K1 4X9CA 1VQ9Q 5LJ3j 3I9QA 1RADB 2SEMA 1RAHB 1YITT 3OY9A 2V8IA 5C6SA 4JRPA 3JV3A 2EFIA 3JCMV 2RK2A 3WVEB 3JB9D 1NG2A 4ZN1A 5KYWA 4ELYC 1HD3A 1AHJB 4OVAA 3OYMA 4M75A 4IUQA 4WTOB 1PSEA 1K73C 2RQUA 1Z9QA 3V8JA 4M7AA 2DLPA 3OS5A 4UC4A 1YITA 3HRUA 2P4RA 1WQ7A 4C5IA 4QVZA 2JXBA 3NTKA 4IUPA 1GFDA 3HTRA 5GAN8 2HNIA 2CP0A 1M5Q1 1R8OB 1ZA1B 1YJWQ 2X4YA 4QT7A 4DBRA 9ATCB 3V8LA 3L2RA 2LQNA 4HCBA 1W1FA 5I2SA 2X35A 4JS5A 1NJIC 1K8AU 4PJOD 2MIOA 3OS2A 3NPFA 2LMJA 2VVKA 1VQKQ 4ME7A 4ZGJB 4XTWA 1QVGS 2J7IA 3HFOA 1G83A 3R6NA 3MP8A 1WHGA 3URGA 3A8OB 2ZPHB 1Q81R 3REBB 1T0HA 4EMHA 1M2OA 2YXYA 2LT4A 3I56T 2MAMA 2KVQG 5GJWB 4EMKA 5HY6A 1B7TA 1JQQA 5C0MA 1QVGP 3OB9A 5KCOA 3M56A 4JDSA 5A2QE 2OTJQ 3QWXX 2HSPA 4J9FA 4C5GA 2M02A 1VQ6T 1PNJA 1UFFA 3KXTA 4JUVA 2V8KA 2K3XA 3CCRT 1W2BA 2OTJT 5FWBA 4EDUA 2WSFE 3M58A 1ZUYA 1QP3A 1M2VB 2DL4A 2V1RA 2HEQA 3VV0A 1ZUUA 3I55A 3M0UA 4QQ6A 3EG9A 2WSCE 4HVWA 1YIJT 1YIJA 1M90C 1BIBA 1G3WA 2HD0A 4IUTA 2E64A 1IGQA 2XMFA 1U8RA 4PFOA 1UGRB 1GFCA 4E47A 3MJXA 5J39A 4RG8A 2FL7A 1UECA 1VQ9T 2EIFA 2OTLA 2AZSA 3CCUA 2COYA 2CT3A 1QLYA 1UTIA 4J9HA 4M7AB 2R58A 1ABOA 1KQSS 1TH7A 1VQLA 1WFWA 4LUEA 2EQIA 4FL6A 1VIEA 3CEYA 2DJQA 1WHJA 3CC4A 4RTTA 3LYIA 2F2VA 2FYKA 4A4EA 2O01E 2L5QA 4OMFB 2A28A 1OPKA 2A7YA 3LLRA 2AZVA 4C5HA 3SHWA 1R77A 5DLOA 3JSCA 3G1JA 2F2WA 1ZQ1A 5GAOm 1QVFA 1M1GA 1JJ2P 2XIDA 2DE0X 1WGSA 4JJDA 4M7AD 5J3BA 3CCVA 1VIFA 1EIFA 3CCVT 1JEGA 2DTHA 3JCMf 3OYIA 3UPUA 3RERA 1YHQA 1FMWA 2RQVA 2XG8D 2CUBA 4WCIA 2NUTA 1VQKT 3OBWA 1H3HA 5CKFA 2RQRA 2IG0A 3CCVQ 1WNLA 1N8RU 2G6FX 2GGRA 1FWZA 4MZTA 2QGFB 2RI3A 3RIRA 1KHCA 2K9GA 4PJMA 5GAOl 1VQ4A 4PJOA 4M7AC 3ASKA 2KXDA 3C94A 1K9MU 1YCYA 3CBOA 4DEXA 4Z89A 2FEIA 2KYMA 1W70A 2E41A 4M78E 3L2ZA 3JCMW 2GF7A 2LQ8A 1X6GA 4FYYB 2B86A 3S3NA 2QQ9A 2FHDA 4II1A 3ZFJA 4Z8AA 3EFRA 3TCJA 1G3TA 2IVWA 1CKAA 8AT1B 2QDYB 3OYFA 5FU6B 4OMLA 1GCQC 2DA9A 2I2LA 1K8AC 4KUIA 2DMOA 3OYYA 4HCKA 2KK4A 2K7AA 2KNBB 4M77G 2GCXA 1YIJQ 1OU9A 2JTMA 3HHTB 5LJ3g 2YUNA 3CPWS 4HCCA 5HKCA 1X01A 1ZBXA 1IO6A 5GAOp 3V7CA 2ZCFB 2HKNA 2BUDA 1BBZA 1UJ0A 1VQ7T 5GAMh 2YWWA 4LXCA 3JB9G 2EJFA 2XDDA 5DLQE 4M78C 4C92F 1BI1A 3DKMA 4Z88A 5KYXA 2CGHA 2YHTA 4OF1A 3MHXA 2DIQA 3P8HA 2DL3A 1YJ9Q 1MHNA 4CRIA 5KE2A 4BDZA 2GTOA 1VUBA 5DM7R 3GPLA 1T3LA 1W4SA 2K79A 2YLCA 2NLUA 2RK1A 4F7UG 1KQ2A 2MWPA 4ZN3A 2DXBA 3CCMQ 5KYXB 3JB9J 3PTAA 2ZPIB 2LC4A 3X26B 3CXCA 3H0FA 1TSFA 2NUPA 2EVRA 1XNIA 1IB8A 1SF9A 3GNGA 4A54A 2O4XA 5LJ5d 1GBRA 2GNCA 4C8QA 2DK3A 2E65A 4C92G 2CREA 4OGCA 1N8RR 1U1TA 4KGXB 2L89A 1LCKA 2CS7A 2NUPB 5KYUB 1EZZB 5J26A 2MYSA 2RF0A 1BI2A 4M75F 1W6XA 1B07A 3H0IA 2BIVA 1UDLA 3SEMA 1RAIB 2HSEB 1LNXA 1VQMQ 3CMEA 1E6GA 4Y92A 3CCJA 1KIKA 1YNZA 1KK7A 4YTLA 4M7DA 4KRTA 5LJ3f 1KFZA 2HQHA 4PJOE 3PFSA 2CP7A 3AHUA 3MEWA 5LJ3h 4PJNA 2DTOA 2JOYA 5IHNA 2GFUA 2V1QA 2R5MA 2BZXA 1S72A 4L59A 1T0JA 1JXOA 4KGVB 1LJOA 3TQ7P 3CC2A 2GQIA 3E19A 2C06A 1K76A 2M16A 5LJ5g 2DYIA 4KBMB 4PLIA 2PVOB 3E1SA 1UHFA 4JJBA 2F5KA 1XQHA 3EHRA 1YJNA 4QQDA 4DA4A 3LWHA 3M0SA 1M1KU 2CZ7B 4DOVA 3EGXA 1WIEA 1B3QA 2BKDN 1MMAA 3JCMQ 2DILA 4FCYA 5GAN2 2L3QA 1AZEA 2J6KA 4XTYA 4A4GA 3QSUA 1HSQA 3OBYA 2JVVA 2QA4Q 2V26A 1TOVA 2JZ2A 2QGGA 8ATCB 1UE9A 4BI8B 1X75C 3V8KA 2KAFA 3JCMd 1WLPB 1H92A 3VKIA 5FW9A 4XTZA 4FW2A 4CC4B 2JS2A 4FW1A 4LD9K 1RABB 1OI1A 2JNGA 1CSKA 5GAN6 2QEXA 1YP5A 3CMAQ 1WXUA 3JAME 5ECAA 1QW1A 7AT1B 2DEQA 3GLXA 3EHQA 1YBYA 2X51A 4JZ3A 1Y57A 4JRKA 3OS1A 3JRZA 5GAOq 2RQWA 2QK0A 2RN8A 4M7DE 1K9AA 2FZCB 1U5SA 1QQJA 2DD4A 1Y96B 1SHFA 1XOVA 2EKHA 2CYZB 3H6ZA 5FLXE 3EGDB 3MEUA 1D3BA 2ECZA 2DBMA 4Y28E 2XI9A 3GBQA 5A0DA 1VOMA 2X4WA 2KROA 5CO7A 4ZTJA 1QVGA 4C8QD 1Z9ZA 4KH1B 5GANf 1FXXA 2OX7A 5GANh 4AT1B 1ZX6A 1XJWB 1UEBA 2COZA 4BY6C 5HK0A 1RI0A 4ORZA 4TVRA 1M9SA 5D6WA 4AFZC 3M57A 3V7RA 2CKKA 2ESWA 4ZGDB 3PNWC 1RL2A 3OYBA 2ATCB 2YRDA 4OMPA 1GRIA 4OB1B 2A0FB 3JB9H 4D8DA 4J6XA 5GAOn 1TU0B 3H0HA 1VQOA 2R5AA 1KG1A 4QVCA 4F16A 4BI3A 2DAQA 4ZTFA 5FRNA 5GAMg 2EYQA 1SG5A 1QCFA 3CCMA 2JM8A 2HCKA 3VS0A 1VQ5T 5CKEA 2CZ6B 1PRLC 1X2KA 2EGAA 3SDZA 2KXCA 4BDYA 2QQSA 1KD1C 1X6BA 1O75A 2L0AA 1BI0A 2DETA 3FIFA 3EFOB 3LH5A 1M3BA 1AWWA 3JCMP 1PKTA 1HYOA 3OYAA 3SB2A 3M54A 4N4HA 2KT8A 3I55T 1WHHA 2FPEA 3I56A 1YHQT 1JBMA 2QQBA 4PJOG 1BYMA 4V2SA 2C0IA 3OYHA 2X3WD 2LVMA 5CAIA 2RJFA 1PWTA 1YHQQ 2DZ9A 5L23A 3M0RA 4D8KA 4LDVA 2J06A 1EX4A 2LJ3A 5KYYA 3CPFA 2K5IA 3HL8A 4LD6A 3TVTA 3UATA 3BDLA 2WACA 1Q86U 4M4ZA 1ZBJA 2EQJA 5GAN5 2F5TX 1WX6A 3M0PA 3UA6A 2E1HA 4KULA 4M77F 3DB4A 4IIOA 1HK9A 1WI7A 1YITQ 4IURA 3DLMA 3A1PA 4FT4A 1YN8A 5KE3A 1KQSP 4DOWA 4E7IA 4AFUC 3JCMJ 1I1JA 1WJRA 2HZYA 3F70A 1QWFA 2P0QA 5GMKj 3NMZC 5CKBA 1RAFB 3M5AA 2RHXA 2NUZA 4B9WA 2RHUA 3MKDA 3VU3C 3CCET 2X4XA 5EG2A 3OW2S 3NFCA 3LW5E 3BE3A 5I11A 2E12A 1OX8A 1E6HA 1JJ2S 2YRCA 2QI2A 3X20B 2CH4W 1AEYA 2DRKA 2XDBA 5LL6S 3QDFA 2ZPFB 5GMKh 2BZYA 3L2QA 2G3RA 1VQ7A 2EGEA 3PVLA 2K5LA 2CT4A 2K5FA 2SRCA 1WHMA 3QHSA 2CSQA 3HP9A 3T9NA 3FJPA 4PLLA 4NL2A 2ZAEA 3L2VA 3OYGA 2ZPBB 2DL5A 2L3PA 3EGUA 2HQEA 1M3AA 3RKWA 4WF2A 2E3HA 1UJYA 3L42A 2OAWA 1N9SA 4X34A 1AZGB 5CK9A 2O31A 1RAAB 2GBQA 1SEMA 3P8DA 3N5BB 2Z0WA 3QUIA 4RTUA 1UG1A 1WHKA 5CR2A 3EG2A 3Q1JA 5GAN3 3ZEHA 1NJIR 4C0FA 1H8KA 4MMKA 2VGNA 4A53A 4X1VA 5LJ5h 3I55Q 1QVPA 2PQWA 1VQPA 4Y91A 4HVVA 1YJNT 4C0GA 4M75C 2VASA 1Q7YU 3C0CA 4M7DB 4IUUA 1GCPA 2IPOB 1D3BB 3BDUA 1NPRA 1RI9A 3EH2A 4AMCA 1ACMB 3M0QA 2LQKA 2L3RA 1KQ1A 2YUPA 4PJLA 4JJNK 4E7HA 2LCCA 1S72T 1K73U 5GAN4 2ABLA 1KSWA 1Y7XA 5KCHA 3IQLA 4ESRA 5FU7B 1YFNA 2JW4A 4NL3A 4JS4A 3LX7A 1X43A 1VA7A 1E7OA 1K4US 5A0GA 2K57A 4C8QB 1Y96A 3GF5A 5I2MA 1VQPT 2FPDA 3ER0A 4BUGA 2I0NA 4M7DD 4J9EA 2ZPEB 1U06A 1N5ZA 4M77A 2D0NA 3LGLA 3OSVA 3VYGA 1K0XA 4BACA 2C0OA 4J9DA 4LNPA 3JCMe 1NBEB 1IHWA 1F1BB 4XU1A 3J80E 3CCEA 1AWOA 3CD6Q 1YWPA 5DY9A 2E5KA 1BCOA 3SFMA 3CPWA 2KEAA 2PU9B 4OB3B 1PM3A 1TG0A 2CP6A 2V8JA 1M4ZA 1OX9A 4DBQA 1SHGA 3REAB 2K2MA 3M59A 1MNDA 1YJ9A 3OYLA 1QWEA 2KY9A 4FT2A 5IAYA 1ZLMA 4M7AE 3L1AA 1YJWA 1YJWT 2X4JA 1M27C 4C5EA 2IIMA 3PMIA 3E9GA 3EG3A 4A4HA 4FIBA 3EAEA 3META 4XTXA 5HCKA 4M77E 4M7AF 3ME9A 1N8RC 2DZCA 4M78D 3VS2A 2J05A 3EGXB 3RR6A 4OMNA 2A37A 4Z02A 1M30A 1WXBA 4OP0A 2EQKA 1JJ2A 1VQ8Q 2BE9B 2CH4A 2QDLA 3I5RA 2EQMA 4J83A 2CP3A 1Q7YC 2RM4A 1NLPC 1PHTA 1NE8A 2VGMA 4GLKA 2A36A 5EC7A 5GMKm 3KUFA 2VUBA 3MPUB 2H8HA 3A8MB 4M77D 2ROTA 1JB0E 2RHZA 3QPHA 3J7AF 1Y07A 1I07A 4N0AC 2RQTA 3OS0A 2MI6A 2RD1A 2OJ2A 3M9QA 4IKFA 4JJCA 4RUGA 3OYDA 2DRMA 5GANj 1WJSA 2JUFA 1YI2Q 2CUDA 3BW1A 1TWBA 4M78F 4PFPA 3S6WA 4C0DB 1QMCA 5LJ5e 4RCBA 5LJ3e 1KC8C 3L2WA 2DM1A 3M0TA 2JT4A 2DNUA 5CQYA 4EMKC 1UUEA 4E7ZA 4FSSA 3CCMT 2XKOC 1XTDA 2LT1A 4QKUA 4PJJA 2EYYA 2XHCA 1YI2A 1C6VX 2Y4XA 1TUCA 4RTWA 2P0PA 4PJOF 1LPLA 1G3SA 1WXTA 2LNVA 4XTVA 2FZGB 2XK0A 3EG9B 1BI3A 2OAUA 5GAN7 4HCZA 1WA7A 4RTVA 1M2VA 2F69A 5I22A 4C8QF 3H9NA 3X24B 1JRIA 4HT8A 4E2FB 2XD0A 1VQMT 2H3EB 3JB9F 1AWJA 5FU7C 2QA4A 2EBPA 4MMLA 1KD1U 2NYSA 2GTJA 2LJ0A 3QBYA 2F2XA 4ZNXA 2X9HA 1LVKA 2AKKA 3DB3A 1H3ZA 2VC8A 1WPYA 2ZZDA 3ZBDA 3QZ9B 1W2BS 2VXFA 2KYBA 2P4TA 1Q86C 1MUZA 1R0CB 3PE0A 4OMQA 3CMAA 3I56Q 4HT9A 4C8QG 5FWCA 1GBQA 3CBPA 1VQNA 1QKWA 2W10A 2AK5A 1KJWA 4OMMA 4XTUA 4A63B 2PUOB 2M0OA 1NZ9A 4EMKB 4C8QE 1K73R 1A0NB 2K3BA 1VQ6Q 1AVZC 3VS3A 2JS0A 4ANJA 4C92B 2NUTB 4LE9A 1OEBA 1G5VA 2LZ6B 1K9MR 1M1KC 4QQGA 1UGSB 2B8AA 3MP6A 4J7FA 4PJOB 2AHJB 1FMKA 1V29B 2PTKA 1VQNT 1VQ6A 4M7DG 3VS6A 3QJ6A 3LH0A 3EG1A 3OW2P 2AIRB 2VB6A 6AT1B 3DLLA 5GAMj 2QA4T 3U23A 3JB9I 4CC3A 4F7UB 4J9GA 4XK8E 4MDWA 3UF4A 1VQNQ 2YRVA 1GXIE 1NEGA 5KYYB 1M8VA 3PIOA 3QYGB 1UHCA 2H3JA 3X28B 3HRSA 1VQLT 3VYHB 4JPBW 2P84A 3OMGA 3JCMX 2HKQB 1Q82C 1ZSZC 2KE9A 1BU1A 1X6OA 4J6YA 4IUVA 5GANg 4R55A 4J9CA 3CC7T 4RCCA 1M90U 2LX7A 2R57A 4M77B 3JCMc 1BCMA 1NPPA 1YCSB 4XQ3A 2ENMA 1I81A 3PVQA 2BE7D 3MEAA 2EYXA 3HSBA 3BY7A 4RTXA 5GAMd 2LQWA 5KYNA 2DYBA 1MMNA 1KD1R 4DBHA 1TS9A 1PRMC 2QAZA 3CCRA 1U1SA 4J6WA 2DVEA 2FPFA 2KRNA 3RKYA 2K2VA 2YUOA 1MV0B 1KHIA 4AG1C 4DEYA 1KC8U 3TREA 3G4SA 2CP5A 3GP8A 5IN1A 5IH2A 2E6ZA 2PVGB 4RTYA 1Q7YR 3TU4K 1CKBA 2RPNA 2DTIA 2RH2A 2DO3A 4EMGA 1VQ5A 2LJ1A 2YSQA 3VUZA 4XU0A 4BI4A 3KFVA 3TEEA 3QXEB 3RUXA 3CC7A 4HA8A 2JMCA 3RDVA 2Y4YA 1UB4A 1SPKA 2MOXA 2J6OA 1PC0A 1WYXA 1W2BP 3UWNA 2JTEA 3LGFA 2M9UA 3INZA 1Q95G 3C12A 3BFMA 5CIUA 4BE2A 3CCJT 2E6NA 4C0DC 5IXFA 5CKHA 2LX9A 4M75D 2VYTA 1X2QA 3OYCA 4NOYA 3ULRB 3CCJQ 1I5LA 4AFSC 3G71A 2KR3A 3QWYA 3GNFB 2L3SA 2QXFA 1N27A 1YWOA 3KBGA 2DD5A 4KH0B 3RMSA 4F7UE 4GBQA 4Q5WA 1UGVA 4JLGA 3EH1A 4M7AG 3FLGA 4FYXB 4M7DF 1OQKA 1QKXA 4J8OA 1JO8A 1T3SA 1TUGB 1OULA 2L2PA 3O8VA 1RACB 4HVUA 5GAOr 1X27A 2KI7A 1BIAA 4X9DA 4M75B 3VRZA 2QEXQ 1MMGA 4LDYA 1PSFA 4O6JA 4JRIA 1ZSGA 1YJ9T 4DBFA 2ED0A 5GANe 3CC7Q 2MPXC 2FB7A 1S1NA 3CCQT 1I8FA 2LCLA 3CMET 3UDCA 2LCSA 1D0YA 1QVFP 5FROA 3FC3A 3CCSA 5KH6A 4CI0C 3CCLA 1K8AR 5FRMA 3CMEQ 3VS4A 1G3YA 2W0ZA 2YDLA 5AT1B 4B9XA 4HXJA 2WSEE 3G71Q 5HK3A 1DJ7B 2DL7A 1VQOQ 3OYKA 1G8XA 3G4SQ 2FRWA 1Q86R 1B34A 3L2UA 3CC2T 2DF6A 3G71T 3A98A 1RLQC 1PKSA 4OB0B 4R56A 3CCST 2AKLA 1WDXA 3G6EA 4LDXA 2DXTA 2EYWA 3HFNA 5CKDA 5GMKl 1B34B 2YLBA 3CC2Q 2HBPA 4L5GA 4M78A 3CCSQ 2PUKB 4F04B 2E4HA 1I5OB 2QASA 4BB7A 3M4GA 2M51A 4HKEA 1M3CA 2VKNA 4GLMA 3M53A 2RJEA 3EFOA 2EPDA 1SRMA 1M8MA 4RMOA 3H8ZA 1OU8A 4OGEA 2XICA 3THKA 5KYWB 2CZ1B 2KDSA 3VUBA 2RMOA 2LNHB 1IRXA 2ROLA 5GMKe 1K0SA 1LOJA 2DL8A 3FRNA 4C8QC 1AD5A 2O9SA 1NYFA 2M0YA 3RKXA 4ZGEB 4F7UA 2FVUA 2HL3A 3A8HB 2JTFA 2RHYA 5GMKi 1QCNA 4VUBA 5D6YA 1M1FA 2LP5A 2E3IA 3JCMg 3SWNB 3OSSC 4M7DC 1N9RA 5GANd 1D1BA 2K6DA 3UA7A 4K11A 3HKSA 2D8HA 5A0LA 1M90R 3D7SB 2OTJA 2EQUA 2HQXA 2CSIA 1ABQA 1NM7A 2Y90A 2DXCA 2JM9A 1AWXA 3FDRA 1RAGB 3QIIA 4M75E 1VQ4T 2JJ9A 2EGCA 2RJCA 1P92A 4BY6B 3G6EQ 2QEXT 4XAXB 3CMAT 3CXCP 3C95A 1Q81C 2PVDB 5CCAA 1VQ7Q 1K9MC 1OOTA 3V7SA 3VRYA 1VQ4Q 4PNOA 1NJIU 1ZA2B 2CZ0B 4JLIA 1HJDA 2C0TA 3CCQQ 2HDAA 3CBMA 3G6ET 2D6FA 5L8RE 2DVJA 2FG0A 4E7KA 1OV3A 1D0XA 1MNEA 2LDMA 4FU6A 2X3XD 1MV3A 4E6RA 2EJ9A 3NHNA 2D9TA 3I5SA 3RNJA 1K1ZA 4FYVB 2P0KA 4FM4B 1QP2A 1FYNA 3QO3A 3CQTA 4MZPA 3SWNC 5D6XA 1VQOT 1MMDA 3QYHB 4M78G 3MEVA 3OMCA 4BE1A 1Q81U 3G4ST 4KGZB 4BE0A 2JN0A 1G2BA 1NEBA 4QW2A 2BZ8A 3HPWA 3CC4T 3HRTA 2HMAA 4P5NA 3VS1A 1QCOA 4MZMA 2QTXA 5IT9E 4AG2C 2F1LA 4ATOA 2O4XB 2JMAA 4N4GA 4MDXA 3H41A 2YUQA 3JCMb 3UT1A 1SRLA 3CC4Q 2D8JA 2EYZA 4NS5A 5AYFA 1WQWA 3A8LB 1WJQA 1ZSZA 3CCUT 3CD6T 4LDWA 3M55A 3E9FA 3QZ5B 4KT0E 1I0CA 5CQXA 4O5VA 2DERA 2HAXA 2CP2A 3GIBA 1BB9A 2D1XA 2E10A 3CCUQ 1FX7A 2DKGA 2MF2A 4N0AA 4F17A 1H641 1OZ2A 5GAMe 1JXMA 2DX1A 4E7JA 5M9OA 4J7IA
chains in the Genus database with same CATH topology
1PWTA 1FMKA 4CC2A 5L23A 2A28A 4AFQC 2YT6A 1OPKA 2DBKA 2PTKA 3M0RA 4D8KA 2AZVA 2J06A 2LJ3A 3VS6A 3NGPA 3SHWA 3EG1A 1ARKA 3TVTA 3UATA 2RNAA 2F2WA 4M4ZA 2O2OA 3U23A 1ZBJA 4CC3A 4J9GA 3UF4A 2DE0X 1WX6A 3O5ZA 1NEGA 3M0PA 4JJDA 1JEGA 1V1CA 5IHKA 1UHCA 3UA6A 4IIOA 1WI7A 2CDTA 4JPBW 2RQVA 1YN8A 2CUBA 4WCIA 1H3HA 2RQRA 4J9BA 2NWMA 2G6FX 4AFUC 2GGRA 2KE9A 1I1JA 1BU1A 1QWFA 2EW3A 2OI3A 2K9GA 2KGTA 4OMOA 4LUDA 3NMZC 4J9CA 3VS5A 2KXDA 2NUZA 1GL5A 4DEXA 2LX7A 4Z89A 2FEIA 2KYMA 1YCSB 1W70A 2ENMA 3PVQA 2MCNA 2EYXA 2O9VA 5I11A 1X6GA 1Y0MA 1E6HA 4R0KA 4RTXA 1TUDA 2B86A 2LQWA 2DYBA 3TSWA 4Z8AA 2CH4W 1AEYA 2DRKA 4JZ4A 2KRMA 1CKAA 3I35A 1PRMC 2BZYA 3RBBB 4OMLA 1GCQC 2DA9A 2FPFA 2KRNA 5IXBA 2YUOA 2EGEA 3PVLA 2CT4A 2DMOA 4HCKA 1MV0B 2SRCA 4AG1C 4DEYA 2CSQA 2K7AA 2KNBB 5IH2A 4RTYA 2YUNA 1CKBA 2RPNA 4J9IA 1J3TA 1IO6A 1ZUKA 2L3PA 2DL5A 3EGUA 1M3AA 2LJ1A 1UJYA 1BBZA 2YSQA 1UJ0A 3KFVA 2OAWA 1AZGB 2O31A 2GBQA 1SEMA 2JMCA 2HBWA 4RTUA 2PNIA 1SPKA 4Z88A 1UG1A 2MOXA 2J6OA 1WYXA 3EG2A 2ED1A 2DL3A 2JTEA 1RLPC 1H8KA 2GTOA 1AOJA 1T3LA 2K79A 4X1VA 2PZ1A 4HVVA 4F14A 2FO0A 5IXFA 4IIMA 3C0CA 1X2QA 1GCPA 3H0FA 1SSHA 2EVRA 3EG0A 2FRYA 1RI9A 3FJ5A 3M0QA 3ULRB 1GBRA 4AFSC 2GNCA 2KR3A 3QWYA 3TSZA 2YUPA 2L3SA 2CREA 1YWOA 4EIKA 1LCKA 2J6FA 2ABLA 1KSWA 3IQLA 1NYGA 2RF0A 4GBQA 4ESRA 4LN2A 1W6XA 1B07A 2JW4A 3H0IA 2BTTA 1UGVA 1UDLA 3SEMA 1X43A 1VA7A 1E7OA 1NLOC 3ZL7C 1K4US 1QKXA 1VYUA 1RUWA 1JO8A 1T3SA 1E6GA 4Y92A 1KIKA 1EFNA 2L2PA 1YNZA 2FPDA 4HVUA 1X27A 4KRTA 2I0NA 1KFZA 2KT1A 4J9EA 3VRZA 1U06A 1N5ZA 2D0NA 2KRSA 1K0XA 1ZSGA 2C0OA 5IHNA 2ED0A 4J9DA 4LNPA 2O88A 2V1QA 2KBTA 1S1NA 2BZXA 1T0JA 1AWOA 1JXOA 2VWFA 1YWPA 2LCSA 2E5KA 2GQIA 2KEAA 1K76A 1TG0A 1GCQA 5GJVB 1X69A 1SHGA 2W0ZA 3REAB 3VS4A 1UHFA 4JJBA 2K2MA 1VYTA 2YDLA 3EHRA 4HXJA 1QWEA 3VS7A 2DL7A 2A08A 1ZLMA 3M0SA 1WIEA 4CC7A 1JU5C 1B3QA 2FRWA 1OPLA 1M27C 2IIMA 3EG3A 5IHIA 4RTZA 2DF6A 3A98A 1RLQC 1PKSA 2DILA 2L3QA 1BK2A 1AZEA 2J6KA 2AKLA 1WDXA 5HCKA 1HSQA 1VYVA 2EYWA 1U3OA 3VS2A 2J05A 4OMNA 1UE9A 2A37A 1M30A 1WXBA 3I9QA 2SEMA 1WLPB 2M51A 1H92A 5FW9A 4CC4B 2JS2A 2CH4A 3JV3A 2QDLA 3I5RA 1M3CA 2VKNA 4GLMA 1NG2A 1CSKA 1HD3A 1YP5A 1WXUA 2EPDA 5ECAA 1NLPC 1M8MA 1PHTA 1SRMA 2A36A 5EC7A 3THKA 3EHQA 2RQUA 2RMOA 4JZ3A 1Z9QA 2LNHB 2H8HA 1Y57A 2ROLA 1K0SA 2DL8A 2DLPA 2P4RA 2ROTA 1AD5A 2O9SA 1NYFA 2JXBA 2M0YA 2RQWA 1GFDA 1I07A 2RN8A 1K9AA 1U5SA 4QT7A 2RQTA 1SHFA 2EKHA 1XOVA 2OJ2A 4JJCA 2LQNA 2LP5A 4RUGA 2DRMA 1W1FA 2CUDA 2MIOA 2ECZA 2DBMA 3NPFA 2LMJA 2VVKA 3GBQA 2K6DA 2KROA 3UA7A 4K11A 2D8HA 2J7IA 1G83A 3R6NA 1Z9ZA 2CSIA 1ABQA 1NM7A 2DM1A 1AWXA 2JM9A 3M0TA 2JT4A 2DNUA 2EGCA 3REBB 1T0HA 1ZX6A 5GJWB 1UUEA 1OOTA 4FSSA 4ORZA 1JQQA 3VRYA 1HJDA 2C0TA 2EYYA 2HDAA 4AFZC 4RTWA 1TUCA 2DVJA 2FG0A 3QWXX 1OV3A 2HSPA 4J9FA 1WXTA 1PNJA 2ESWA 1UFFA 2X3XD 1MV3A 4E6RA 3NHNA 3I5SA 4OMPA 1GRIA 3RNJA 1K1ZA 5FWBA 1WA7A 4D8DA 4RTVA 1FYNA 3CQTA 5I22A 1ZUYA 3H0HA 2DL4A 2V1RA 2HEQA 4F16A 1ZUUA 3M0UA 1AWJA 2EBPA 4HVWA 2GTJA 2LJ0A 1QCFA 1G2BA 1NEBA 2F2XA 2BZ8A 2JM8A 4ZNXA 2HCKA 3VS1A 3VS0A 2XMFA 4AG2C 2AKKA 2JMAA 1GFCA 1PRLC 3H41A 2YUQA 1SRLA 1X2KA 2KYBA 2D8JA 2EGAA 1UECA 1MUZA 2KXCA 3PE0A 1X6BA 2EYZA 2L0AA 4OMQA 2AZSA 3LH5A 5FWCA 1GBQA 1QKWA 2W10A 2CT3A 1QLYA 1UTIA 1M3BA 1I0CA 1KJWA 2AK5A 4J9HA 4OMMA 1AWWA 1PKTA 4A63B 1ABOA 1BB9A 2D1XA 2KT8A 1WFWA 4LUEA 2EQIA 2FPEA 1A0NB 2K3BA 4F17A 1AVZC 2C0IA 3VS3A 1JXMA 2JS0A 2DX1A 2DJQA 2X3WD 4LE9A 1OEBA 4RTTA 2F2VA 2LZ6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PWT A;  1FMK A;  4CC2 A;  5L23 A;  2A28 A;  4AFQ C;  2YT6 A;  1OPK A;  2DBK A;  2PTK A;  3M0R A;  4D8K A;  2AZV A;  2J06 A;  2LJ3 A;  3VS6 A;  3NGP A;  3SHW A;  3EG1 A;  1ARK A;  3TVT A;  3UAT A;  2RNA A;  2F2W A;  4M4Z A;  2O2O A;  3U23 A;  1ZBJ A;  4CC3 A;  4J9G A;  3UF4 A;  2DE0 X;  1WX6 A;  3O5Z A;  1NEG A;  3M0P A;  4JJD A;  1JEG A;  1V1C A;  5IHK A;  1UHC A;  3UA6 A;  4IIO A;  1WI7 A;  2CDT A;  4JPB W;  2RQV A;  1YN8 A;  2CUB A;  4WCI A;  1H3H A;  2RQR A;  4J9B A;  2NWM A;  2G6F X;  4AFU C;  2GGR A;  2KE9 A;  1I1J A;  1BU1 A;  1QWF A;  2EW3 A;  2OI3 A;  2K9G A;  2KGT A;  4OMO A;  4LUD A;  3NMZ C;  4J9C A;  3VS5 A;  2KXD A;  2NUZ A;  1GL5 A;  4DEX A;  2LX7 A;  4Z89 A;  2FEI A;  2KYM A;  1YCS B;  1W70 A;  2ENM A;  3PVQ A;  2MCN A;  2EYX A;  2O9V A;  5I11 A;  1X6G A;  1Y0M A;  1E6H A;  4R0K A;  4RTX A;  1TUD A;  2B86 A;  2LQW A;  2DYB A;  3TSW A;  4Z8A A;  2CH4 W;  1AEY A;  2DRK A;  4JZ4 A;  2KRM A;  1CKA A;  3I35 A;  1PRM C;  2BZY A;  3RBB B;  4OML A;  1GCQ C;  2DA9 A;  2FPF A;  2KRN A;  5IXB A;  2YUO A;  2EGE A;  3PVL A;  2CT4 A;  2DMO A;  4HCK A;  1MV0 B;  2SRC A;  4AG1 C;  4DEY A;  2CSQ A;  2K7A A;  2KNB B;  5IH2 A;  4RTY A;  2YUN A;  1CKB A;  2RPN A;  4J9I A;  1J3T A;  1IO6 A;  1ZUK A;  2L3P A;  2DL5 A;  3EGU A;  1M3A A;  2LJ1 A;  1UJY A;  1BBZ A;  2YSQ A;  1UJ0 A;  3KFV A;  2OAW A;  1AZG B;  2O31 A;  2GBQ A;  1SEM A;  2JMC A;  2HBW A;  4RTU A;  2PNI A;  1SPK A;  4Z88 A;  1UG1 A;  2MOX A;  2J6O A;  1WYX A;  3EG2 A;  2ED1 A;  2DL3 A;  2JTE A;  1RLP C;  1H8K A;  2GTO A;  1AOJ A;  1T3L A;  2K79 A;  4X1V A;  2PZ1 A;  4HVV A;  4F14 A;  2FO0 A;  5IXF A;  4IIM A;  3C0C A;  1X2Q A;  1GCP A;  3H0F A;  1SSH A;  2EVR A;  3EG0 A;  2FRY A;  1RI9 A;  3FJ5 A;  3M0Q A;  3ULR B;  1GBR A;  4AFS C;  2GNC A;  2KR3 A;  3QWY A;  3TSZ A;  2YUP A;  2L3S A;  2CRE A;  1YWO A;  4EIK A;  1LCK A;  2J6F A;  2ABL A;  1KSW A;  3IQL A;  1NYG A;  2RF0 A;  4GBQ A;  4ESR A;  4LN2 A;  1W6X A;  1B07 A;  2JW4 A;  3H0I A;  2BTT A;  1UGV A;  1UDL A;  3SEM A;  1X43 A;  1VA7 A;  1E7O A;  1NLO C;  3ZL7 C;  1K4U S;  1QKX A;  1VYU A;  1RUW A;  1JO8 A;  1T3S A;  1E6G A;  4Y92 A;  1KIK A;  1EFN A;  2L2P A;  1YNZ A;  2FPD A;  4HVU A;  1X27 A;  4KRT A;  2I0N A;  1KFZ A;  2KT1 A;  4J9E A;  3VRZ A;  1U06 A;  1N5Z A;  2D0N A;  2KRS A;  1K0X A;  1ZSG A;  2C0O A;  5IHN A;  2ED0 A;  4J9D A;  4LNP A;  2O88 A;  2V1Q A;  2KBT A;  1S1N A;  2BZX A;  1T0J A;  1AWO A;  1JXO A;  2VWF A;  1YWP A;  2LCS A;  2E5K A;  2GQI A;  2KEA A;  1K76 A;  1TG0 A;  1GCQ A;  5GJV B;  1X69 A;  1SHG A;  2W0Z A;  3REA B;  3VS4 A;  1UHF A;  4JJB A;  2K2M A;  1VYT A;  2YDL A;  3EHR A;  4HXJ A;  1QWE A;  3VS7 A;  2DL7 A;  2A08 A;  1ZLM A;  3M0S A;  1WIE A;  4CC7 A;  1JU5 C;  1B3Q A;  2FRW A;  1OPL A;  1M27 C;  2IIM A;  3EG3 A;  5IHI A;  4RTZ A;  2DF6 A;  3A98 A;  1RLQ C;  1PKS A;  2DIL A;  2L3Q A;  1BK2 A;  1AZE A;  2J6K A;  2AKL A;  1WDX A;  5HCK A;  1HSQ A;  1VYV A;  2EYW A;  1U3O A;  3VS2 A;  2J05 A;  4OMN A;  1UE9 A;  2A37 A;  1M30 A;  1WXB A;  3I9Q A;  2SEM A;  1WLP B;  2M51 A;  1H92 A;  5FW9 A;  4CC4 B;  2JS2 A;  2CH4 A;  3JV3 A;  2QDL A;  3I5R A;  1M3C A;  2VKN A;  4GLM A;  1NG2 A;  1CSK A;  1HD3 A;  1YP5 A;  1WXU A;  2EPD A;  5ECA A;  1NLP C;  1M8M A;  1PHT A;  1SRM A;  2A36 A;  5EC7 A;  3THK A;  3EHQ A;  2RQU A;  2RMO A;  4JZ3 A;  1Z9Q A;  2LNH B;  2H8H A;  1Y57 A;  2ROL A;  1K0S A;  2DL8 A;  2DLP A;  2P4R A;  2ROT A;  1AD5 A;  2O9S A;  1NYF A;  2JXB A;  2M0Y A;  2RQW A;  1GFD A;  1I07 A;  2RN8 A;  1K9A A;  1U5S A;  4QT7 A;  2RQT A;  1SHF A;  2EKH A;  1XOV A;  2OJ2 A;  4JJC A;  2LQN A;  2LP5 A;  4RUG A;  2DRM A;  1W1F A;  2CUD A;  2MIO A;  2ECZ A;  2DBM A;  3NPF A;  2LMJ A;  2VVK A;  3GBQ A;  2K6D A;  2KRO A;  3UA7 A;  4K11 A;  2D8H A;  2J7I A;  1G83 A;  3R6N A;  1Z9Z A;  2CSI A;  1ABQ A;  1NM7 A;  2DM1 A;  1AWX A;  2JM9 A;  3M0T A;  2JT4 A;  2DNU A;  2EGC A;  3REB B;  1T0H A;  1ZX6 A;  5GJW B;  1UUE A;  1OOT A;  4FSS A;  4ORZ A;  1JQQ A;  3VRY A;  1HJD A;  2C0T A;  2EYY A;  2HDA A;  4AFZ C;  4RTW A;  1TUC A;  2DVJ A;  2FG0 A;  3QWX X;  1OV3 A;  2HSP A;  4J9F A;  1WXT A;  1PNJ A;  2ESW A;  1UFF A;  2X3X D;  1MV3 A;  4E6R A;  3NHN A;  3I5S A;  4OMP A;  1GRI A;  3RNJ A;  1K1Z A;  5FWB A;  1WA7 A;  4D8D A;  4RTV A;  1FYN A;  3CQT A;  5I22 A;  1ZUY A;  3H0H A;  2DL4 A;  2V1R A;  2HEQ A;  4F16 A;  1ZUU A;  3M0U A;  1AWJ A;  2EBP A;  4HVW A;  2GTJ A;  2LJ0 A;  1QCF A;  1G2B A;  1NEB A;  2F2X A;  2BZ8 A;  2JM8 A;  4ZNX A;  2HCK A;  3VS1 A;  3VS0 A;  2XMF A;  4AG2 C;  2AKK A;  2JMA A;  1GFC A;  1PRL C;  3H41 A;  2YUQ A;  1SRL A;  1X2K A;  2KYB A;  2D8J A;  2EGA A;  1UEC A;  1MUZ A;  2KXC A;  3PE0 A;  1X6B A;  2EYZ A;  2L0A A;  4OMQ A;  2AZS A;  3LH5 A;  5FWC A;  1GBQ A;  1QKW A;  2W10 A;  2CT3 A;  1QLY A;  1UTI A;  1M3B A;  1I0C A;  1KJW A;  2AK5 A;  4J9H A;  4OMM A;  1AWW A;  1PKT A;  4A63 B;  1ABO A;  1BB9 A;  2D1X A;  2KT8 A;  1WFW A;  4LUE A;  2EQI A;  2FPE A;  1A0N B;  2K3B A;  4F17 A;  1AVZ C;  2C0I A;  3VS3 A;  1JXM A;  2JS0 A;  2DX1 A;  2DJQ A;  2X3W D;  4LE9 A;  1OEB A;  4RTT A;  2F2V A;  2LZ6 B; 
#chains in the Genus database with same CATH topology
 5I21 A;  4CC2 A;  4AFQ C;  1VQ8 A;  2YT6 A;  2DBK A;  1M1K R;  3NGP A;  2QQA A;  1ARK A;  2QG9 B;  4B6M A;  2RNA A;  2EWN A;  3LWI A;  2O2O A;  2RO0 A;  3MP1 A;  3CPW P;  4QVD A;  2VV5 A;  3O5Z A;  4D6W A;  3PIP A;  1TTH B;  1V1C A;  5IHK A;  2M1H A;  2CDT A;  5LJ3 d;  1VQ8 T;  2GQV A;  4GY5 A;  3OYJ A;  1D09 B;  2XDP A;  4J9B A;  4N4I A;  2NWM A;  2OTL Q;  3NTH A;  2EW3 A;  2VXE A;  2OI3 A;  1FMV A;  2K4Y A;  2QTV A;  2KGT A;  4OMO A;  4LUD A;  1KC8 R;  3VS5 A;  4OB2 B;  3QJY A;  4BD3 A;  1GL5 A;  1VQM A;  4C92 A;  2OTL T;  3X25 B;  2EAY A;  3CD6 A;  4M77 C;  2COW A;  2MCN A;  3FB9 A;  5LJ5 f;  2RA2 A;  2O9V A;  4PK4 A;  3CXC S;  4F7U F;  1Y0M A;  4R0K A;  3MCA B;  1TUD A;  2DPP B;  2L8D A;  1N6A A;  4JRQ A;  3TSW A;  2GFA A;  1D1C A;  2DJZ A;  4RG2 A;  1ZSZ B;  2ZPG B;  3FEO A;  4JZ4 A;  5LJ5 j;  1VQK A;  2KRM A;  1VQ9 A;  2D0Q B;  3I35 A;  3PGG A;  1IXD A;  1WZO A;  4PKC C;  3RBB B;  2AT1 B;  5KYU A;  2RB6 A;  3VJP A;  5IXB A;  3RMQ A;  1IHV A;  2MWO A;  2RJD A;  1OYX A;  1IRE B;  2EJG A;  3WXM B;  2LRQ A;  4XU3 A;  3GOX A;  4FSX A;  2RI2 A;  3P8B B;  2QQR A;  1V76 A;  3QKJ A;  4DQ2 A;  4J9I A;  1J3T A;  3S3M A;  3NTI A;  1ZUK A;  2KQW A;  1VQP Q;  2ZGW A;  3QDR B;  2MMP A;  2RI5 A;  4PJO C;  4J5Y A;  3MO8 A;  1R0B G;  2EKO A;  2HBW A;  4PFZ A;  1PD0 A;  2PNI A;  4ELZ C;  3CCE Q;  1Y71 A;  1HXD A;  2ED1 A;  1RLP C;  2DXU A;  1QVF S;  2E70 A;  1AOJ A;  3CCL T;  1RAE B;  2PZ1 A;  5D7U A;  3JCM h;  4F14 A;  3OQ5 A;  2FO0 A;  2QYZ A;  3R6O A;  4IIM A;  1MGQ A;  3CCL Q;  1SSH A;  3EG0 A;  2FRY A;  3FJ5 A;  1SKU B;  3QG1 A;  2RHI A;  3TSZ A;  3M4Y A;  4C0Z A;  5CVI A;  4EIK A;  2J6F A;  3PT9 A;  1Q82 U;  5FU6 C;  1NYG A;  4LN2 A;  2KMT A;  1Q82 R;  2BTT A;  1AT1 B;  2E5Q A;  4FYW B;  2DIG A;  1NLO C;  1PG5 B;  3ZL7 C;  1C1A A;  3S3O A;  1UGP B;  1PCX A;  1VYU A;  1D0Z A;  1RUW A;  2A3L A;  1EFN A;  2K3Y A;  3C4S A;  4A4K A;  1TXQ A;  2KT1 A;  2FZK B;  1VQ5 Q;  1BKB A;  4A4F A;  2KRS A;  1C0M A;  1OZ3 A;  2O88 A;  2KBT A;  1O9S A;  3J81 E;  3CCQ A;  2VWF A;  1YJN Q;  1D1A A;  4M78 B;  2DEU A;  4E7S A;  1GCQ A;  3OA6 A;  3EFS A;  3SD4 A;  2XU8 A;  2LTO A;  5GJV B;  3EGD A;  4EPC A;  3CCR Q;  1X69 A;  4LDU A;  1VYT A;  3WVD B;  2MK5 A;  3VS7 A;  1WHL A;  4C92 D;  2A08 A;  3G7Z A;  3A5Z B;  1KQS A;  4KUD K;  1SSF A;  1S72 Q;  2DFU A;  5GAM f;  1VQL Q;  4CC7 A;  1JU5 C;  1OPL A;  1ZHI A;  4XU2 A;  4PL6 A;  5IHI A;  4RTZ A;  3AT1 B;  3E2U A;  3PMT A;  4M75 G;  1PD1 A;  3A8G B;  1BK2 A;  4C92 E;  3SWN A;  1YI2 T;  1IZ6 A;  1VYV A;  3OYE A;  1UGQ B;  4E7L A;  1U3O A;  2HL5 C;  3OYN A;  4L6V 5;  3RES A;  1IGU A;  2KSS A;  4RKU E;  3OW2 A;  4C92 C;  1I4K 1;  4X9C A;  1VQ9 Q;  5LJ3 j;  3I9Q A;  1RAD B;  2SEM A;  1RAH B;  1YIT T;  3OY9 A;  2V8I A;  5C6S A;  4JRP A;  3JV3 A;  2EFI A;  3JCM V;  2RK2 A;  3WVE B;  3JB9 D;  1NG2 A;  4ZN1 A;  5KYW A;  4ELY C;  1HD3 A;  1AHJ B;  4OVA A;  3OYM A;  4M75 A;  4IUQ A;  4WTO B;  1PSE A;  1K73 C;  2RQU A;  1Z9Q A;  3V8J A;  4M7A A;  2DLP A;  3OS5 A;  4UC4 A;  1YIT A;  3HRU A;  2P4R A;  1WQ7 A;  4C5I A;  4QVZ A;  2JXB A;  3NTK A;  4IUP A;  1GFD A;  3HTR A;  5GAN 8;  2HNI A;  2CP0 A;  1M5Q 1;  1R8O B;  1ZA1 B;  1YJW Q;  2X4Y A;  4QT7 A;  4DBR A;  9ATC B;  3V8L A;  3L2R A;  2LQN A;  4HCB A;  1W1F A;  5I2S A;  2X35 A;  4JS5 A;  1NJI C;  1K8A U;  4PJO D;  2MIO A;  3OS2 A;  3NPF A;  2LMJ A;  2VVK A;  1VQK Q;  4ME7 A;  4ZGJ B;  4XTW A;  1QVG S;  2J7I A;  3HFO A;  1G83 A;  3R6N A;  3MP8 A;  1WHG A;  3URG A;  3A8O B;  2ZPH B;  1Q81 R;  3REB B;  1T0H A;  4EMH A;  1M2O A;  2YXY A;  2LT4 A;  3I56 T;  2MAM A;  2KVQ G;  5GJW B;  4EMK A;  5HY6 A;  1B7T A;  1JQQ A;  5C0M A;  1QVG P;  3OB9 A;  5KCO A;  3M56 A;  4JDS A;  5A2Q E;  2OTJ Q;  3QWX X;  2HSP A;  4J9F A;  4C5G A;  2M02 A;  1VQ6 T;  1PNJ A;  1UFF A;  3KXT A;  4JUV A;  2V8K A;  2K3X A;  3CCR T;  1W2B A;  2OTJ T;  5FWB A;  4EDU A;  2WSF E;  3M58 A;  1ZUY A;  1QP3 A;  1M2V B;  2DL4 A;  2V1R A;  2HEQ A;  3VV0 A;  1ZUU A;  3I55 A;  3M0U A;  4QQ6 A;  3EG9 A;  2WSC E;  4HVW A;  1YIJ T;  1YIJ A;  1M90 C;  1BIB A;  1G3W A;  2HD0 A;  4IUT A;  2E64 A;  1IGQ A;  2XMF A;  1U8R A;  4PFO A;  1UGR B;  1GFC A;  4E47 A;  3MJX A;  5J39 A;  4RG8 A;  2FL7 A;  1UEC A;  1VQ9 T;  2EIF A;  2OTL A;  2AZS A;  3CCU A;  2COY A;  2CT3 A;  1QLY A;  1UTI A;  4J9H A;  4M7A B;  2R58 A;  1ABO A;  1KQS S;  1TH7 A;  1VQL A;  1WFW A;  4LUE A;  2EQI A;  4FL6 A;  1VIE A;  3CEY A;  2DJQ A;  1WHJ A;  3CC4 A;  4RTT A;  3LYI A;  2F2V A;  2FYK A;  4A4E A;  2O01 E;  2L5Q A;  4OMF B;  2A28 A;  1OPK A;  2A7Y A;  3LLR A;  2AZV A;  4C5H A;  3SHW A;  1R77 A;  5DLO A;  3JSC A;  3G1J A;  2F2W A;  1ZQ1 A;  5GAO m;  1QVF A;  1M1G A;  1JJ2 P;  2XID A;  2DE0 X;  1WGS A;  4JJD A;  4M7A D;  5J3B A;  3CCV A;  1VIF A;  1EIF A;  3CCV T;  1JEG A;  2DTH A;  3JCM f;  3OYI A;  3UPU A;  3RER A;  1YHQ A;  1FMW A;  2RQV A;  2XG8 D;  2CUB A;  4WCI A;  2NUT A;  1VQK T;  3OBW A;  1H3H A;  5CKF A;  2RQR A;  2IG0 A;  3CCV Q;  1WNL A;  1N8R U;  2G6F X;  2GGR A;  1FWZ A;  4MZT A;  2QGF B;  2RI3 A;  3RIR A;  1KHC A;  2K9G A;  4PJM A;  5GAO l;  1VQ4 A;  4PJO A;  4M7A C;  3ASK A;  2KXD A;  3C94 A;  1K9M U;  1YCY A;  3CBO A;  4DEX A;  4Z89 A;  2FEI A;  2KYM A;  1W70 A;  2E41 A;  4M78 E;  3L2Z A;  3JCM W;  2GF7 A;  2LQ8 A;  1X6G A;  4FYY B;  2B86 A;  3S3N A;  2QQ9 A;  2FHD A;  4II1 A;  3ZFJ A;  4Z8A A;  3EFR A;  3TCJ A;  1G3T A;  2IVW A;  1CKA A;  8AT1 B;  2QDY B;  3OYF A;  5FU6 B;  4OML A;  1GCQ C;  2DA9 A;  2I2L A;  1K8A C;  4KUI A;  2DMO A;  3OYY A;  4HCK A;  2KK4 A;  2K7A A;  2KNB B;  4M77 G;  2GCX A;  1YIJ Q;  1OU9 A;  2JTM A;  3HHT B;  5LJ3 g;  2YUN A;  3CPW S;  4HCC A;  5HKC A;  1X01 A;  1ZBX A;  1IO6 A;  5GAO p;  3V7C A;  2ZCF B;  2HKN A;  2BUD A;  1BBZ A;  1UJ0 A;  1VQ7 T;  5GAM h;  2YWW A;  4LXC A;  3JB9 G;  2EJF A;  2XDD A;  5DLQ E;  4M78 C;  4C92 F;  1BI1 A;  3DKM A;  4Z88 A;  5KYX A;  2CGH A;  2YHT A;  4OF1 A;  3MHX A;  2DIQ A;  3P8H A;  2DL3 A;  1YJ9 Q;  1MHN A;  4CRI A;  5KE2 A;  4BDZ A;  2GTO A;  1VUB A;  5DM7 R;  3GPL A;  1T3L A;  1W4S A;  2K79 A;  2YLC A;  2NLU A;  2RK1 A;  4F7U G;  1KQ2 A;  2MWP A;  4ZN3 A;  2DXB A;  3CCM Q;  5KYX B;  3JB9 J;  3PTA A;  2ZPI B;  2LC4 A;  3X26 B;  3CXC A;  3H0F A;  1TSF A;  2NUP A;  2EVR A;  1XNI A;  1IB8 A;  1SF9 A;  3GNG A;  4A54 A;  2O4X A;  5LJ5 d;  1GBR A;  2GNC A;  4C8Q A;  2DK3 A;  2E65 A;  4C92 G;  2CRE A;  4OGC A;  1N8R R;  1U1T A;  4KGX B;  2L89 A;  1LCK A;  2CS7 A;  2NUP B;  5KYU B;  1EZZ B;  5J26 A;  2MYS A;  2RF0 A;  1BI2 A;  4M75 F;  1W6X A;  1B07 A;  3H0I A;  2BIV A;  1UDL A;  3SEM A;  1RAI B;  2HSE B;  1LNX A;  1VQM Q;  3CME A;  1E6G A;  4Y92 A;  3CCJ A;  1KIK A;  1YNZ A;  1KK7 A;  4YTL A;  4M7D A;  4KRT A;  5LJ3 f;  1KFZ A;  2HQH A;  4PJO E;  3PFS A;  2CP7 A;  3AHU A;  3MEW A;  5LJ3 h;  4PJN A;  2DTO A;  2JOY A;  5IHN A;  2GFU A;  2V1Q A;  2R5M A;  2BZX A;  1S72 A;  4L59 A;  1T0J A;  1JXO A;  4KGV B;  1LJO A;  3TQ7 P;  3CC2 A;  2GQI A;  3E19 A;  2C06 A;  1K76 A;  2M16 A;  5LJ5 g;  2DYI A;  4KBM B;  4PLI A;  2PVO B;  3E1S A;  1UHF A;  4JJB A;  2F5K A;  1XQH A;  3EHR A;  1YJN A;  4QQD A;  4DA4 A;  3LWH A;  3M0S A;  1M1K U;  2CZ7 B;  4DOV A;  3EGX A;  1WIE A;  1B3Q A;  2BKD N;  1MMA A;  3JCM Q;  2DIL A;  4FCY A;  5GAN 2;  2L3Q A;  1AZE A;  2J6K A;  4XTY A;  4A4G A;  3QSU A;  1HSQ A;  3OBY A;  2JVV A;  2QA4 Q;  2V26 A;  1TOV A;  2JZ2 A;  2QGG A;  8ATC B;  1UE9 A;  4BI8 B;  1X75 C;  3V8K A;  2KAF A;  3JCM d;  1WLP B;  1H92 A;  3VKI A;  5FW9 A;  4XTZ A;  4FW2 A;  4CC4 B;  2JS2 A;  4FW1 A;  4LD9 K;  1RAB B;  1OI1 A;  2JNG A;  1CSK A;  5GAN 6;  2QEX A;  1YP5 A;  3CMA Q;  1WXU A;  3JAM E;  5ECA A;  1QW1 A;  7AT1 B;  2DEQ A;  3GLX A;  3EHQ A;  1YBY A;  2X51 A;  4JZ3 A;  1Y57 A;  4JRK A;  3OS1 A;  3JRZ A;  5GAO q;  2RQW A;  2QK0 A;  2RN8 A;  4M7D E;  1K9A A;  2FZC B;  1U5S A;  1QQJ A;  2DD4 A;  1Y96 B;  1SHF A;  1XOV A;  2EKH A;  2CYZ B;  3H6Z A;  5FLX E;  3EGD B;  3MEU A;  1D3B A;  2ECZ A;  2DBM A;  4Y28 E;  2XI9 A;  3GBQ A;  5A0D A;  1VOM A;  2X4W A;  2KRO A;  5CO7 A;  4ZTJ A;  1QVG A;  4C8Q D;  1Z9Z A;  4KH1 B;  5GAN f;  1FXX A;  2OX7 A;  5GAN h;  4AT1 B;  1ZX6 A;  1XJW B;  1UEB A;  2COZ A;  4BY6 C;  5HK0 A;  1RI0 A;  4ORZ A;  4TVR A;  1M9S A;  5D6W A;  4AFZ C;  3M57 A;  3V7R A;  2CKK A;  2ESW A;  4ZGD B;  3PNW C;  1RL2 A;  3OYB A;  2ATC B;  2YRD A;  4OMP A;  1GRI A;  4OB1 B;  2A0F B;  3JB9 H;  4D8D A;  4J6X A;  5GAO n;  1TU0 B;  3H0H A;  1VQO A;  2R5A A;  1KG1 A;  4QVC A;  4F16 A;  4BI3 A;  2DAQ A;  4ZTF A;  5FRN A;  5GAM g;  2EYQ A;  1SG5 A;  1QCF A;  3CCM A;  2JM8 A;  2HCK A;  3VS0 A;  1VQ5 T;  5CKE A;  2CZ6 B;  1PRL C;  1X2K A;  2EGA A;  3SDZ A;  2KXC A;  4BDY A;  2QQS A;  1KD1 C;  1X6B A;  1O75 A;  2L0A A;  1BI0 A;  2DET A;  3FIF A;  3EFO B;  3LH5 A;  1M3B A;  1AWW A;  3JCM P;  1PKT A;  1HYO A;  3OYA A;  3SB2 A;  3M54 A;  4N4H A;  2KT8 A;  3I55 T;  1WHH A;  2FPE A;  3I56 A;  1YHQ T;  1JBM A;  2QQB A;  4PJO G;  1BYM A;  4V2S A;  2C0I A;  3OYH A;  2X3W D;  2LVM A;  5CAI A;  2RJF A;  1PWT A;  1YHQ Q;  2DZ9 A;  5L23 A;  3M0R A;  4D8K A;  4LDV A;  2J06 A;  1EX4 A;  2LJ3 A;  5KYY A;  3CPF A;  2K5I A;  3HL8 A;  4LD6 A;  3TVT A;  3UAT A;  3BDL A;  2WAC A;  1Q86 U;  4M4Z A;  1ZBJ A;  2EQJ A;  5GAN 5;  2F5T X;  1WX6 A;  3M0P A;  3UA6 A;  2E1H A;  4KUL A;  4M77 F;  3DB4 A;  4IIO A;  1HK9 A;  1WI7 A;  1YIT Q;  4IUR A;  3DLM A;  3A1P A;  4FT4 A;  1YN8 A;  5KE3 A;  1KQS P;  4DOW A;  4E7I A;  4AFU C;  3JCM J;  1I1J A;  1WJR A;  2HZY A;  3F70 A;  1QWF A;  2P0Q A;  5GMK j;  3NMZ C;  5CKB A;  1RAF B;  3M5A A;  2RHX A;  2NUZ A;  4B9W A;  2RHU A;  3MKD A;  3VU3 C;  3CCE T;  2X4X A;  5EG2 A;  3OW2 S;  3NFC A;  3LW5 E;  3BE3 A;  5I11 A;  2E12 A;  1OX8 A;  1E6H A;  1JJ2 S;  2YRC A;  2QI2 A;  3X20 B;  2CH4 W;  1AEY A;  2DRK A;  2XDB A;  5LL6 S;  3QDF A;  2ZPF B;  5GMK h;  2BZY A;  3L2Q A;  2G3R A;  1VQ7 A;  2EGE A;  3PVL A;  2K5L A;  2CT4 A;  2K5F A;  2SRC A;  1WHM A;  3QHS A;  2CSQ A;  3HP9 A;  3T9N A;  3FJP A;  4PLL A;  4NL2 A;  2ZAE A;  3L2V A;  3OYG A;  2ZPB B;  2DL5 A;  2L3P A;  3EGU A;  2HQE A;  1M3A A;  3RKW A;  4WF2 A;  2E3H A;  1UJY A;  3L42 A;  2OAW A;  1N9S A;  4X34 A;  1AZG B;  5CK9 A;  2O31 A;  1RAA B;  2GBQ A;  1SEM A;  3P8D A;  3N5B B;  2Z0W A;  3QUI A;  4RTU A;  1UG1 A;  1WHK A;  5CR2 A;  3EG2 A;  3Q1J A;  5GAN 3;  3ZEH A;  1NJI R;  4C0F A;  1H8K A;  4MMK A;  2VGN A;  4A53 A;  4X1V A;  5LJ5 h;  3I55 Q;  1QVP A;  2PQW A;  1VQP A;  4Y91 A;  4HVV A;  1YJN T;  4C0G A;  4M75 C;  2VAS A;  1Q7Y U;  3C0C A;  4M7D B;  4IUU A;  1GCP A;  2IPO B;  1D3B B;  3BDU A;  1NPR A;  1RI9 A;  3EH2 A;  4AMC A;  1ACM B;  3M0Q A;  2LQK A;  2L3R A;  1KQ1 A;  2YUP A;  4PJL A;  4JJN K;  4E7H A;  2LCC A;  1S72 T;  1K73 U;  5GAN 4;  2ABL A;  1KSW A;  1Y7X A;  5KCH A;  3IQL A;  4ESR A;  5FU7 B;  1YFN A;  2JW4 A;  4NL3 A;  4JS4 A;  3LX7 A;  1X43 A;  1VA7 A;  1E7O A;  1K4U S;  5A0G A;  2K57 A;  4C8Q B;  1Y96 A;  3GF5 A;  5I2M A;  1VQP T;  2FPD A;  3ER0 A;  4BUG A;  2I0N A;  4M7D D;  4J9E A;  2ZPE B;  1U06 A;  1N5Z A;  4M77 A;  2D0N A;  3LGL A;  3OSV A;  3VYG A;  1K0X A;  4BAC A;  2C0O A;  4J9D A;  4LNP A;  3JCM e;  1NBE B;  1IHW A;  1F1B B;  4XU1 A;  3J80 E;  3CCE A;  1AWO A;  3CD6 Q;  1YWP A;  5DY9 A;  2E5K A;  1BCO A;  3SFM A;  3CPW A;  2KEA A;  2PU9 B;  4OB3 B;  1PM3 A;  1TG0 A;  2CP6 A;  2V8J A;  1M4Z A;  1OX9 A;  4DBQ A;  1SHG A;  3REA B;  2K2M A;  3M59 A;  1MND A;  1YJ9 A;  3OYL A;  1QWE A;  2KY9 A;  4FT2 A;  5IAY A;  1ZLM A;  4M7A E;  3L1A A;  1YJW A;  1YJW T;  2X4J A;  1M27 C;  4C5E A;  2IIM A;  3PMI A;  3E9G A;  3EG3 A;  4A4H A;  4FIB A;  3EAE A;  3MET A;  4XTX A;  5HCK A;  4M77 E;  4M7A F;  3ME9 A;  1N8R C;  2DZC A;  4M78 D;  3VS2 A;  2J05 A;  3EGX B;  3RR6 A;  4OMN A;  2A37 A;  4Z02 A;  1M30 A;  1WXB A;  4OP0 A;  2EQK A;  1JJ2 A;  1VQ8 Q;  2BE9 B;  2CH4 A;  2QDL A;  3I5R A;  2EQM A;  4J83 A;  2CP3 A;  1Q7Y C;  2RM4 A;  1NLP C;  1PHT A;  1NE8 A;  2VGM A;  4GLK A;  2A36 A;  5EC7 A;  5GMK m;  3KUF A;  2VUB A;  3MPU B;  2H8H A;  3A8M B;  4M77 D;  2ROT A;  1JB0 E;  2RHZ A;  3QPH A;  3J7A F;  1Y07 A;  1I07 A;  4N0A C;  2RQT A;  3OS0 A;  2MI6 A;  2RD1 A;  2OJ2 A;  3M9Q A;  4IKF A;  4JJC A;  4RUG A;  3OYD A;  2DRM A;  5GAN j;  1WJS A;  2JUF A;  1YI2 Q;  2CUD A;  3BW1 A;  1TWB A;  4M78 F;  4PFP A;  3S6W A;  4C0D B;  1QMC A;  5LJ5 e;  4RCB A;  5LJ3 e;  1KC8 C;  3L2W A;  2DM1 A;  3M0T A;  2JT4 A;  2DNU A;  5CQY A;  4EMK C;  1UUE A;  4E7Z A;  4FSS A;  3CCM T;  2XKO C;  1XTD A;  2LT1 A;  4QKU A;  4PJJ A;  2EYY A;  2XHC A;  1YI2 A;  1C6V X;  2Y4X A;  1TUC A;  4RTW A;  2P0P A;  4PJO F;  1LPL A;  1G3S A;  1WXT A;  2LNV A;  4XTV A;  2FZG B;  2XK0 A;  3EG9 B;  1BI3 A;  2OAU A;  5GAN 7;  4HCZ A;  1WA7 A;  4RTV A;  1M2V A;  2F69 A;  5I22 A;  4C8Q F;  3H9N A;  3X24 B;  1JRI A;  4HT8 A;  4E2F B;  2XD0 A;  1VQM T;  2H3E B;  3JB9 F;  1AWJ A;  5FU7 C;  2QA4 A;  2EBP A;  4MML A;  1KD1 U;  2NYS A;  2GTJ A;  2LJ0 A;  3QBY A;  2F2X A;  4ZNX A;  2X9H A;  1LVK A;  2AKK A;  3DB3 A;  1H3Z A;  2VC8 A;  1WPY A;  2ZZD A;  3ZBD A;  3QZ9 B;  1W2B S;  2VXF A;  2KYB A;  2P4T A;  1Q86 C;  1MUZ A;  1R0C B;  3PE0 A;  4OMQ A;  3CMA A;  3I56 Q;  4HT9 A;  4C8Q G;  5FWC A;  1GBQ A;  3CBP A;  1VQN A;  1QKW A;  2W10 A;  2AK5 A;  1KJW A;  4OMM A;  4XTU A;  4A63 B;  2PUO B;  2M0O A;  1NZ9 A;  4EMK B;  4C8Q E;  1K73 R;  1A0N B;  2K3B A;  1VQ6 Q;  1AVZ C;  3VS3 A;  2JS0 A;  4ANJ A;  4C92 B;  2NUT B;  4LE9 A;  1OEB A;  1G5V A;  2LZ6 B;  1K9M R;  1M1K C;  4QQG A;  1UGS B;  2B8A A;  3MP6 A;  4J7F A;  4PJO B;  2AHJ B;  1FMK A;  1V29 B;  2PTK A;  1VQN T;  1VQ6 A;  4M7D G;  3VS6 A;  3QJ6 A;  3LH0 A;  3EG1 A;  3OW2 P;  2AIR B;  2VB6 A;  6AT1 B;  3DLL A;  5GAM j;  2QA4 T;  3U23 A;  3JB9 I;  4CC3 A;  4F7U B;  4J9G A;  4XK8 E;  4MDW A;  3UF4 A;  1VQN Q;  2YRV A;  1GXI E;  1NEG A;  5KYY B;  1M8V A;  3PIO A;  3QYG B;  1UHC A;  2H3J A;  3X28 B;  3HRS A;  1VQL T;  3VYH B;  4JPB W;  2P84 A;  3OMG A;  3JCM X;  2HKQ B;  1Q82 C;  1ZSZ C;  2KE9 A;  1BU1 A;  1X6O A;  4J6Y A;  4IUV A;  5GAN g;  4R55 A;  4J9C A;  3CC7 T;  4RCC A;  1M90 U;  2LX7 A;  2R57 A;  4M77 B;  3JCM c;  1BCM A;  1NPP A;  1YCS B;  4XQ3 A;  2ENM A;  1I81 A;  3PVQ A;  2BE7 D;  3MEA A;  2EYX A;  3HSB A;  3BY7 A;  4RTX A;  5GAM d;  2LQW A;  5KYN A;  2DYB A;  1MMN A;  1KD1 R;  4DBH A;  1TS9 A;  1PRM C;  2QAZ A;  3CCR A;  1U1S A;  4J6W A;  2DVE A;  2FPF A;  2KRN A;  3RKY A;  2K2V A;  2YUO A;  1MV0 B;  1KHI A;  4AG1 C;  4DEY A;  1KC8 U;  3TRE A;  3G4S A;  2CP5 A;  3GP8 A;  5IN1 A;  5IH2 A;  2E6Z A;  2PVG B;  4RTY A;  1Q7Y R;  3TU4 K;  1CKB A;  2RPN A;  2DTI A;  2RH2 A;  2DO3 A;  4EMG A;  1VQ5 A;  2LJ1 A;  2YSQ A;  3VUZ A;  4XU0 A;  4BI4 A;  3KFV A;  3TEE A;  3QXE B;  3RUX A;  3CC7 A;  4HA8 A;  2JMC A;  3RDV A;  2Y4Y A;  1UB4 A;  1SPK A;  2MOX A;  2J6O A;  1PC0 A;  1WYX A;  1W2B P;  3UWN A;  2JTE A;  3LGF A;  2M9U A;  3INZ A;  1Q95 G;  3C12 A;  3BFM A;  5CIU A;  4BE2 A;  3CCJ T;  2E6N A;  4C0D C;  5IXF A;  5CKH A;  2LX9 A;  4M75 D;  2VYT A;  1X2Q A;  3OYC A;  4NOY A;  3ULR B;  3CCJ Q;  1I5L A;  4AFS C;  3G71 A;  2KR3 A;  3QWY A;  3GNF B;  2L3S A;  2QXF A;  1N27 A;  1YWO A;  3KBG A;  2DD5 A;  4KH0 B;  3RMS A;  4F7U E;  4GBQ A;  4Q5W A;  1UGV A;  4JLG A;  3EH1 A;  4M7A G;  3FLG A;  4FYX B;  4M7D F;  1OQK A;  1QKX A;  4J8O A;  1JO8 A;  1T3S A;  1TUG B;  1OUL A;  2L2P A;  3O8V A;  1RAC B;  4HVU A;  5GAO r;  1X27 A;  2KI7 A;  1BIA A;  4X9D A;  4M75 B;  3VRZ A;  2QEX Q;  1MMG A;  4LDY A;  1PSF A;  4O6J A;  4JRI A;  1ZSG A;  1YJ9 T;  4DBF A;  2ED0 A;  5GAN e;  3CC7 Q;  2MPX C;  2FB7 A;  1S1N A;  3CCQ T;  1I8F A;  2LCL A;  3CME T;  3UDC A;  2LCS A;  1D0Y A;  1QVF P;  5FRO A;  3FC3 A;  3CCS A;  5KH6 A;  4CI0 C;  3CCL A;  1K8A R;  5FRM A;  3CME Q;  3VS4 A;  1G3Y A;  2W0Z A;  2YDL A;  5AT1 B;  4B9X A;  4HXJ A;  2WSE E;  3G71 Q;  5HK3 A;  1DJ7 B;  2DL7 A;  1VQO Q;  3OYK A;  1G8X A;  3G4S Q;  2FRW A;  1Q86 R;  1B34 A;  3L2U A;  3CC2 T;  2DF6 A;  3G71 T;  3A98 A;  1RLQ C;  1PKS A;  4OB0 B;  4R56 A;  3CCS T;  2AKL A;  1WDX A;  3G6E A;  4LDX A;  2DXT A;  2EYW A;  3HFN A;  5CKD A;  5GMK l;  1B34 B;  2YLB A;  3CC2 Q;  2HBP A;  4L5G A;  4M78 A;  3CCS Q;  2PUK B;  4F04 B;  2E4H A;  1I5O B;  2QAS A;  4BB7 A;  3M4G A;  2M51 A;  4HKE A;  1M3C A;  2VKN A;  4GLM A;  3M53 A;  2RJE A;  3EFO A;  2EPD A;  1SRM A;  1M8M A;  4RMO A;  3H8Z A;  1OU8 A;  4OGE A;  2XIC A;  3THK A;  5KYW B;  2CZ1 B;  2KDS A;  3VUB A;  2RMO A;  2LNH B;  1IRX A;  2ROL A;  5GMK e;  1K0S A;  1LOJ A;  2DL8 A;  3FRN A;  4C8Q C;  1AD5 A;  2O9S A;  1NYF A;  2M0Y A;  3RKX A;  4ZGE B;  4F7U A;  2FVU A;  2HL3 A;  3A8H B;  2JTF A;  2RHY A;  5GMK i;  1QCN A;  4VUB A;  5D6Y A;  1M1F A;  2LP5 A;  2E3I A;  3JCM g;  3SWN B;  3OSS C;  4M7D C;  1N9R A;  5GAN d;  1D1B A;  2K6D A;  3UA7 A;  4K11 A;  3HKS A;  2D8H A;  5A0L A;  1M90 R;  3D7S B;  2OTJ A;  2EQU A;  2HQX A;  2CSI A;  1ABQ A;  1NM7 A;  2Y90 A;  2DXC A;  2JM9 A;  1AWX A;  3FDR A;  1RAG B;  3QII A;  4M75 E;  1VQ4 T;  2JJ9 A;  2EGC A;  2RJC A;  1P92 A;  4BY6 B;  3G6E Q;  2QEX T;  4XAX B;  3CMA T;  3CXC P;  3C95 A;  1Q81 C;  2PVD B;  5CCA A;  1VQ7 Q;  1K9M C;  1OOT A;  3V7S A;  3VRY A;  1VQ4 Q;  4PNO A;  1NJI U;  1ZA2 B;  2CZ0 B;  4JLI A;  1HJD A;  2C0T A;  3CCQ Q;  2HDA A;  3CBM A;  3G6E T;  2D6F A;  5L8R E;  2DVJ A;  2FG0 A;  4E7K A;  1OV3 A;  1D0X A;  1MNE A;  2LDM A;  4FU6 A;  2X3X D;  1MV3 A;  4E6R A;  2EJ9 A;  3NHN A;  2D9T A;  3I5S A;  3RNJ A;  1K1Z A;  4FYV B;  2P0K A;  4FM4 B;  1QP2 A;  1FYN A;  3QO3 A;  3CQT A;  4MZP A;  3SWN C;  5D6X A;  1VQO T;  1MMD A;  3QYH B;  4M78 G;  3MEV A;  3OMC A;  4BE1 A;  1Q81 U;  3G4S T;  4KGZ B;  4BE0 A;  2JN0 A;  1G2B A;  1NEB A;  4QW2 A;  2BZ8 A;  3HPW A;  3CC4 T;  3HRT A;  2HMA A;  4P5N A;  3VS1 A;  1QCO A;  4MZM A;  2QTX A;  5IT9 E;  4AG2 C;  2F1L A;  4ATO A;  2O4X B;  2JMA A;  4N4G A;  4MDX A;  3H41 A;  2YUQ A;  3JCM b;  3UT1 A;  1SRL A;  3CC4 Q;  2D8J A;  2EYZ A;  4NS5 A;  5AYF A;  1WQW A;  3A8L B;  1WJQ A;  1ZSZ A;  3CCU T;  3CD6 T;  4LDW A;  3M55 A;  3E9F A;  3QZ5 B;  4KT0 E;  1I0C A;  5CQX A;  4O5V A;  2DER A;  2HAX A;  2CP2 A;  3GIB A;  1BB9 A;  2D1X A;  2E10 A;  3CCU Q;  1FX7 A;  2DKG A;  2MF2 A;  4N0A A;  4F17 A;  1H64 1;  1OZ2 A;  5GAM e;  1JXM A;  2DX1 A;  4E7J A;  5M9O A;  4J7I A; 
#chains in the Genus database with same CATH homology
 1PWT A;  1FMK A;  4CC2 A;  5L23 A;  2A28 A;  4AFQ C;  2YT6 A;  1OPK A;  2DBK A;  2PTK A;  3M0R A;  4D8K A;  2AZV A;  2J06 A;  2LJ3 A;  3VS6 A;  3NGP A;  3SHW A;  3EG1 A;  1ARK A;  3TVT A;  3UAT A;  2RNA A;  2F2W A;  4M4Z A;  2O2O A;  3U23 A;  1ZBJ A;  4CC3 A;  4J9G A;  3UF4 A;  2DE0 X;  1WX6 A;  3O5Z A;  1NEG A;  3M0P A;  4JJD A;  1JEG A;  1V1C A;  5IHK A;  1UHC A;  3UA6 A;  4IIO A;  1WI7 A;  2CDT A;  4JPB W;  2RQV A;  1YN8 A;  2CUB A;  4WCI A;  1H3H A;  2RQR A;  4J9B A;  2NWM A;  2G6F X;  4AFU C;  2GGR A;  2KE9 A;  1I1J A;  1BU1 A;  1QWF A;  2EW3 A;  2OI3 A;  2K9G A;  2KGT A;  4OMO A;  4LUD A;  3NMZ C;  4J9C A;  3VS5 A;  2KXD A;  2NUZ A;  1GL5 A;  4DEX A;  2LX7 A;  4Z89 A;  2FEI A;  2KYM A;  1YCS B;  1W70 A;  2ENM A;  3PVQ A;  2MCN A;  2EYX A;  2O9V A;  5I11 A;  1X6G A;  1Y0M A;  1E6H A;  4R0K A;  4RTX A;  1TUD A;  2B86 A;  2LQW A;  2DYB A;  3TSW A;  4Z8A A;  2CH4 W;  1AEY A;  2DRK A;  4JZ4 A;  2KRM A;  1CKA A;  3I35 A;  1PRM C;  2BZY A;  3RBB B;  4OML A;  1GCQ C;  2DA9 A;  2FPF A;  2KRN A;  5IXB A;  2YUO A;  2EGE A;  3PVL A;  2CT4 A;  2DMO A;  4HCK A;  1MV0 B;  2SRC A;  4AG1 C;  4DEY A;  2CSQ A;  2K7A A;  2KNB B;  5IH2 A;  4RTY A;  2YUN A;  1CKB A;  2RPN A;  4J9I A;  1J3T A;  1IO6 A;  1ZUK A;  2L3P A;  2DL5 A;  3EGU A;  1M3A A;  2LJ1 A;  1UJY A;  1BBZ A;  2YSQ A;  1UJ0 A;  3KFV A;  2OAW A;  1AZG B;  2O31 A;  2GBQ A;  1SEM A;  2JMC A;  2HBW A;  4RTU A;  2PNI A;  1SPK A;  4Z88 A;  1UG1 A;  2MOX A;  2J6O A;  1WYX A;  3EG2 A;  2ED1 A;  2DL3 A;  2JTE A;  1RLP C;  1H8K A;  2GTO A;  1AOJ A;  1T3L A;  2K79 A;  4X1V A;  2PZ1 A;  4HVV A;  4F14 A;  2FO0 A;  5IXF A;  4IIM A;  3C0C A;  1X2Q A;  1GCP A;  3H0F A;  1SSH A;  2EVR A;  3EG0 A;  2FRY A;  1RI9 A;  3FJ5 A;  3M0Q A;  3ULR B;  1GBR A;  4AFS C;  2GNC A;  2KR3 A;  3QWY A;  3TSZ A;  2YUP A;  2L3S A;  2CRE A;  1YWO A;  4EIK A;  1LCK A;  2J6F A;  2ABL A;  1KSW A;  3IQL A;  1NYG A;  2RF0 A;  4GBQ A;  4ESR A;  4LN2 A;  1W6X A;  1B07 A;  2JW4 A;  3H0I A;  2BTT A;  1UGV A;  1UDL A;  3SEM A;  1X43 A;  1VA7 A;  1E7O A;  1NLO C;  3ZL7 C;  1K4U S;  1QKX A;  1VYU A;  1RUW A;  1JO8 A;  1T3S A;  1E6G A;  4Y92 A;  1KIK A;  1EFN A;  2L2P A;  1YNZ A;  2FPD A;  4HVU A;  1X27 A;  4KRT A;  2I0N A;  1KFZ A;  2KT1 A;  4J9E A;  3VRZ A;  1U06 A;  1N5Z A;  2D0N A;  2KRS A;  1K0X A;  1ZSG A;  2C0O A;  5IHN A;  2ED0 A;  4J9D A;  4LNP A;  2O88 A;  2V1Q A;  2KBT A;  1S1N A;  2BZX A;  1T0J A;  1AWO A;  1JXO A;  2VWF A;  1YWP A;  2LCS A;  2E5K A;  2GQI A;  2KEA A;  1K76 A;  1TG0 A;  1GCQ A;  5GJV B;  1X69 A;  1SHG A;  2W0Z A;  3REA B;  3VS4 A;  1UHF A;  4JJB A;  2K2M A;  1VYT A;  2YDL A;  3EHR A;  4HXJ A;  1QWE A;  3VS7 A;  2DL7 A;  2A08 A;  1ZLM A;  3M0S A;  1WIE A;  4CC7 A;  1JU5 C;  1B3Q A;  2FRW A;  1OPL A;  1M27 C;  2IIM A;  3EG3 A;  5IHI A;  4RTZ A;  2DF6 A;  3A98 A;  1RLQ C;  1PKS A;  2DIL A;  2L3Q A;  1BK2 A;  1AZE A;  2J6K A;  2AKL A;  1WDX A;  5HCK A;  1HSQ A;  1VYV A;  2EYW A;  1U3O A;  3VS2 A;  2J05 A;  4OMN A;  1UE9 A;  2A37 A;  1M30 A;  1WXB A;  3I9Q A;  2SEM A;  1WLP B;  2M51 A;  1H92 A;  5FW9 A;  4CC4 B;  2JS2 A;  2CH4 A;  3JV3 A;  2QDL A;  3I5R A;  1M3C A;  2VKN A;  4GLM A;  1NG2 A;  1CSK A;  1HD3 A;  1YP5 A;  1WXU A;  2EPD A;  5ECA A;  1NLP C;  1M8M A;  1PHT A;  1SRM A;  2A36 A;  5EC7 A;  3THK A;  3EHQ A;  2RQU A;  2RMO A;  4JZ3 A;  1Z9Q A;  2LNH B;  2H8H A;  1Y57 A;  2ROL A;  1K0S A;  2DL8 A;  2DLP A;  2P4R A;  2ROT A;  1AD5 A;  2O9S A;  1NYF A;  2JXB A;  2M0Y A;  2RQW A;  1GFD A;  1I07 A;  2RN8 A;  1K9A A;  1U5S A;  4QT7 A;  2RQT A;  1SHF A;  2EKH A;  1XOV A;  2OJ2 A;  4JJC A;  2LQN A;  2LP5 A;  4RUG A;  2DRM A;  1W1F A;  2CUD A;  2MIO A;  2ECZ A;  2DBM A;  3NPF A;  2LMJ A;  2VVK A;  3GBQ A;  2K6D A;  2KRO A;  3UA7 A;  4K11 A;  2D8H A;  2J7I A;  1G83 A;  3R6N A;  1Z9Z A;  2CSI A;  1ABQ A;  1NM7 A;  2DM1 A;  1AWX A;  2JM9 A;  3M0T A;  2JT4 A;  2DNU A;  2EGC A;  3REB B;  1T0H A;  1ZX6 A;  5GJW B;  1UUE A;  1OOT A;  4FSS A;  4ORZ A;  1JQQ A;  3VRY A;  1HJD A;  2C0T A;  2EYY A;  2HDA A;  4AFZ C;  4RTW A;  1TUC A;  2DVJ A;  2FG0 A;  3QWX X;  1OV3 A;  2HSP A;  4J9F A;  1WXT A;  1PNJ A;  2ESW A;  1UFF A;  2X3X D;  1MV3 A;  4E6R A;  3NHN A;  3I5S A;  4OMP A;  1GRI A;  3RNJ A;  1K1Z A;  5FWB A;  1WA7 A;  4D8D A;  4RTV A;  1FYN A;  3CQT A;  5I22 A;  1ZUY A;  3H0H A;  2DL4 A;  2V1R A;  2HEQ A;  4F16 A;  1ZUU A;  3M0U A;  1AWJ A;  2EBP A;  4HVW A;  2GTJ A;  2LJ0 A;  1QCF A;  1G2B A;  1NEB A;  2F2X A;  2BZ8 A;  2JM8 A;  4ZNX A;  2HCK A;  3VS1 A;  3VS0 A;  2XMF A;  4AG2 C;  2AKK A;  2JMA A;  1GFC A;  1PRL C;  3H41 A;  2YUQ A;  1SRL A;  1X2K A;  2KYB A;  2D8J A;  2EGA A;  1UEC A;  1MUZ A;  2KXC A;  3PE0 A;  1X6B A;  2EYZ A;  2L0A A;  4OMQ A;  2AZS A;  3LH5 A;  5FWC A;  1GBQ A;  1QKW A;  2W10 A;  2CT3 A;  1QLY A;  1UTI A;  1M3B A;  1I0C A;  1KJW A;  2AK5 A;  4J9H A;  4OMM A;  1AWW A;  1PKT A;  4A63 B;  1ABO A;  1BB9 A;  2D1X A;  2KT8 A;  1WFW A;  4LUE A;  2EQI A;  2FPE A;  1A0N B;  2K3B A;  4F17 A;  1AVZ C;  2C0I A;  3VS3 A;  1JXM A;  2JS0 A;  2DX1 A;  2DJQ A;  2X3W D;  4LE9 A;  1OEB A;  4RTT A;  2F2V A;  2LZ6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...