4RTWA

Crystal structure of the c-src-sh3 domain e93v/q128r mutant in complex with the high affinity peptide app12
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
57
structure length
57
Chain Sequence
TFVALYDYVSRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the c-Src-SH3 domain E93V/Q128R mutant in complex with the high affinity peptide APP12
rcsb
source organism Gallus gallus
molecule tags Protein binding
molecule keywords Proto-oncogene tyrosine-protein kinase Src
total genus 13
structure length 57
sequence length 57
chains with identical sequence C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4rtwA00
5FW9A 1NLPC 1UG1A 2EBPA 2FPFA 1NEGA 1MV3A 4HVUA 4CC2A 1YWPA 2SEMA 2O2OA 2KT8A 3H0HA 1AVZC 1GBQA 2KYMA 3H0FA 2DJQA 2GBQA 4LE9A 1OPLA 2HBWA 3A98A 1BB9A 4Z8AA 2JXBA 1SPKA 1SRMA 1SRLA 1VYUA 1TUCA 1WX6A 2EYWA 1ZUYA 4JPBW 3RBBB 2YDLA 1Y0MA 4JJDA 3ULRB 1W1FA 1WA7A 1YP5A 2CT3A 1T3LA 2GQIA 5IHNA 1HJDA 1PNJA 2K6DA 1SHFA 3EG0A 1E6HA 2BZ8A 2D1XA 2EVRA 1GL5A 2CREA 4RTVA 1M27C 4D8KA 1NYFA 2CSQA 4RTZA 4AFQC 5I22A 4OMLA 2LX7A 3SEMA 3M0RA 1YNZA 1UHFA 1UJ0A 4DEXA 2M51A 3C0CA 1A0NB 3H0IA 4J9EA 4OMOA 1B3QA 1OEBA 3VS6A 5IH2A 2J6OA 2KXDA 1PWTA 3U23A 1VYVA 3LH5A 2ROLA 2KRSA 2RF0A 1UTIA 1HD3A 2DBKA 2DMOA 2J7IA 4GLMA 2JMCA 2DM1A 2J6FA 4J9CA 4AFUC 1CSKA 2DL3A 2AZSA 2D8JA 2YUQA 4WCIA 1UUEA 3EG1A 1WXTA 5L23A 1AD5A 1AZEA 2RMOA 2RN8A 4J9DA 1RLPC 3QWYA 5HCKA 2LJ1A 2KYBA 2GGRA 1TG0A 1E6GA 2H8HA 1WLPB 1YCSB 2LQWA 1PRMC 1PRLC 1H8KA 2X3XD 2DRMA 2CUBA 2A36A 2YUOA 4F17A 3I5SA 1U3OA 1SSHA 1UE9A 2JS2A 2K79A 2W0ZA 1AZGB 2DA9A 2LCSA 1JQQA 2HEQA 2LJ3A 1WFWA 1X27A 4RTXA 1RLQC 2HDAA 2C0TA 2L3PA 4IIOA 3REBB 4RTUA 1AEYA 1WYXA 1BU1A 2JM9A 4OMMA 1X6GA 1H3HA 3H41A 1HSQA 1M3AA 1V1CA 2NUZA 1Z9QA 1OOTA 4ORZA 2W10A 2MIOA 1M3BA 1MUZA 1SHGA 1OPKA 4GBQA 2EGEA 3TSWA 1YWOA 2DL5A 2C0OA 2V1QA 1ABOA 4J9GA 1YN8A 2DVJA 2PNIA 2DBMA 2D8HA 3VS1A 2L0AA 1K0XA 1WIEA 2YUNA 2XMFA 3VS7A 4J9FA 1W6XA 5IHIA 1PKSA 1WDXA 2AKKA 4FSSA 2VWFA 1T0JA 2FRWA 3REAB 1UECA 2BZXA 2X3WD 2B86A 2CH4A 2RQRA 5FWBA 4OMNA 2HSPA 2KRMA 4F14A 3I35A 1GCQC 1T3SA 2OAWA 4CC7A 2O9VA 1OV3A 2V1RA 2RQVA 3VS5A 1I0CA 2RQWA 1M3CA 3GBQA 1JXOA 2KXCA 4EIKA 1W70A 2LZ6B 1KFZA 5IXBA 2FRYA 4ZNXA 2J6KA 1K76A 2A08A 1PKTA 4E6RA 1JEGA 2A28A 4RTYA 1G83A 2DF6A 2AK5A 2KNBB 4OMPA 4JZ3A 4ESRA 2DX1A 1JXMA 3NHNA 2DYBA 5IXFA 1AOJA 2C0IA 3EG3A 1J3TA 3UA6A 3M0QA 3VS2A 5GJVB 1G2BA 1RI9A 2FO0A 4Z88A 2FPEA 3PVQA 2EGCA 3EG2A 1ZSGA 2JM8A 2KBTA 1FMKA 2L3QA 2L3SA 1QCFA 2J05A 1UDLA 4J9BA 4X1VA 1RUWA 2GTJA 2DL7A 1M8MA 2ESWA 1K0SA 2KR3A 4Y92A 1S1NA 2EQIA 2F2XA 3R6NA 2JS0A 1ZX6A 3JV3A 1MV0B 3VRYA 3EHQA 2YT6A 4Z89A 1K4US 2RQTA 2SRCA 4LNPA 4RUGA 1KJWA 2YSQA 2DE0X 5ECAA 2DL8A 2OI3A 1KSWA 4J9HA 3M0PA 2DNUA 4A63B 1I07A 2KT1A 2IIMA 1ZUKA 1WXBA 1UFFA 2RPNA 1K9AA 2KEAA 2KE9A 2EYXA 2JW4A 2DILA 1X2KA 2F2VA 2EW3A 2EGAA 4QT7A 2ED1A 2EKHA 2I0NA 2K2MA 1LCKA 2CH4W 1WI7A 5I11A 3NPFA 1WXUA 4R0KA 1VYTA 2D0NA 1M30A 1AWOA 3UF4A 3M0SA 1Y57A 1GCPA 1CKBA 4HXJA 1AWJA 2BTTA 1EFNA 3ZL7C 1GFCA 3FJ5A 2GTOA 1NLOC 1BBZA 2ROTA 2P4RA 4DEYA 2ENMA 2LQNA 1K1ZA 3VS3A 2NWMA 2OJ2A 1I1JA 2O31A 2PTKA 2G6FX 5IHKA 4CC3A 3M0UA 4LN2A 1PHTA 3TVTA 4AFZC 1JO8A 1Z9ZA 2RQUA 4RTWA 3PVLA 2LNHB 1UJYA 2O9SA 4LUDA 3TSZA 2KROA 4JJBA 3VS0A 2K9GA 3RNJA 2YUPA 1GFDA 2KRNA 2RNAA 3UA7A 4KRTA 2EPDA 1NG2A 2ABLA 3VRZA 3SHWA 1GRIA 2LP5A 2LMJA 1ABQA 1KIKA 1NYGA 2L2PA 3O5ZA 1U5SA 3EGUA 3M0TA 1AWXA 2MOXA 2EYZA 3EHRA 3NGPA 5GJWB 4M4ZA 4AFSC 2E5KA 1N5ZA 1BK2A 4AG2C 1QKWA 2K7AA 2HCKA 2K3BA 2O88A 2A37A 3I9QA 1X2QA 2JMAA 2DLPA 1QLYA 5FWCA 1H92A 1UHCA 4HCKA 1ZBJA 4JJCA 2J06A 3CQTA 2GNCA 1NM7A 4HVVA 1NEBA 1UGVA 1XOVA 1T0HA 5EC7A 4RTTA 2AZVA 2QDLA 1VA7A 1IO6A 2JTEA 1X69A 4OMQA 3KFVA 3VS4A 2AKLA 1U06A 1ARKA 1ZUUA 1E7OA 4K11A 1SEMA 4F16A 2DRKA 2BZYA 2ED0A 3UATA 2EYYA 2VVKA 1B07A 3THKA 2VKNA 2MCNA 2CT4A 1QWFA 4HVWA 1GBRA 4D8DA 2LJ0A 4LUEA 4J9IA 1CKAA 3QWXX 4IIMA 1AWWA 2FG0A 1FYNA 2CUDA 1TUDA 1X6BA 1GCQA 2ECZA 4AG1C 2CSIA 2KGTA 1QKXA 2DL4A 3IQLA 3NMZC 2CDTA 1X43A 2FEIA 2JT4A 4JZ4A 2PZ1A 3PE0A 1JU5C 3I5RA 4CC4B 2FPDA 1ZLMA 2M0YA 1QWEA 2F2WA
chains in the Genus database with same CATH superfamily
4XTWA 2LT1A 1NEGA 3ZBDA 2O4XA 4X9DA 1AVZC 4OMFB 2ZPBB 3RR6A 2XDDA 2LNVA 4LDVA 2D9TA 4M77D 4Z8AA 5FU7B 3LW5E 1SRLA 4XU2A 1ZUYA 1VQPA 2P84A 2OAUA 4PJNA 1W1FA 5GAMj 1WA7A 2MPXC 2GQIA 2ATCB 1HJDA 2MWOA 1E6HA 2LX9A 2EVRA 1GL5A 3F70A 1K9MU 2MMPA 1WHGA 4D8KA 1YJWQ 4AFQC 4E2FB 2LX7A 1Q7YR 1VQLA 1V76A 2CP7A 2P4TA 1UHFA 1UJ0A 1ZA2B 2XICA 3JCMX 4M7AA 4M75F 5IH2A 1RI0A 4PFPA 2KXDA 3A8HB 1VQLT 1TH7A 5D6YA 3V7SA 3U23A 4BACA 1VYVA 4BI8B 3CCRT 2DMOA 1Q86C 1TS9A 2ZPGB 1VQLQ 3ZEHA 2FB7A 1BIAA 2YUQA 1UUEA 3EG1A 3R6OA 1BI1A 1D1AA 2RN8A 4JRIA 1NZ9A 2LJ1A 1VQ8T 2BIVA 3VJPA 2CKKA 3A8GB 2GGRA 2DD4A 1TG0A 1LPLA 2LQKA 1GXIE 1YCSB 1PRMC 1PRLC 4PJOF 4C0GA 2KMTA 1YIJT 4F17A 5CCAA 2DEQA 3CCSA 3OYBA 1VQ4Q 1JQQA 2RM4A 1WFWA 4XTYA 1ZSZC 4DOVA 2C0TA 2KDSA 3EGDA 4RTUA 1WJRA 1AEYA 1RAGB 5CQXA 3GNFB 2JM9A 2PQWA 3EGXB 3H41A 1Z9QA 3FDRA 2V8KA 4FW2A 4M7DF 2W10A 3MP8A 4N0AC 2FZGB 2MIOA 1SHGA 3QG1A 4XTZA 3CC4T 5LJ5e 4HCCA 1YWOA 2DL5A 2GQVA 3NTHA 4F7UE 2COWA 2D6FA 1YN8A 3CD6Q 4IUVA 4MDXA 2L0AA 5GAOq 3S3NA 4B9XA 4DBFA 2VWFA 3JB9J 4EMHA 3EAEA 4HA8A 3I56T 1QP3A 2FYKA 2X3WD 1QVFA 2A3LA 2KRMA 2B8AA 1RAEB 3I35A 4WTOB 2X9HA 1G3YA 1T3SA 2O9VA 2V1RA 3VS5A 2RQWA 1M3CA 2JTFA 2KAFA 2KXCA 1Q81R 3G71Q 2MWPA 3I56A 1WNLA 1VQKA 2NUTB 1HK9A 2COYA 1K76A 4M78F 3QDRB 1VQ4T 3QBYA 1G83A 2DF6A 2AK5A 2KNBB 4JZ3A 5IXFA 2VV5A 3EGXA 3EG3A 2DIGA 1J3TA 3EG9A 3VS2A 5CIUA 5GJVB 1G2BA 5FU6C 2JZ2A 3JB9I 2FPEA 4FIBA 3CC2Q 2EGCA 3EG2A 1ZSGA 2RHXA 2L3QA 1VQOT 2L3SA 4N4GA 4PNOA 1UDLA 1RUWA 1BI0A 3X26B 5CQYA 1WHLA 2ESWA 2KR3A 4Y92A 4II1A 1M4ZA 1OX8A 1ZX6A 3JV3A 1UGRB 1MV0B 3CCET 2A7YA 2RQTA 1K4US 3CC2A 3GPLA 3GNGA 2YSQA 1ZHIA 3KUFA 3SD4A 1X6OA 3M0PA 2L8DA 2DNUA 3WXMB 4C92G 1D1BA 3INZA 1G5VA 4C8QC 2QEXA 6AT1B 1WXBA 4KGZB 2C06A 4R56A 4F7UA 2ZPFB 4NL3A 1KD1C 3C12A 4IUPA 4KBMB 1VQOQ 2EAYA 2DILA 3OY9A 1YHQA 2EW3A 5GAN6 3SWNB 2ED1A 1M90U 4M77B 2K2MA 5GAN4 4PJOB 1FXXA 2X51A 3BFMA 1LCKA 1RACB 3CMAQ 4HT8A 1X75C 2D0NA 1AWOA 4B6MA 3UF4A 1GCPA 1CKBA 1WPYA 2VYTA 3FJ5A 2GTOA 4AT1B 2NWMA 1I1JA 2BE9B 2G6FX 1BYMA 3PTAA 3M0UA 9ATCB 4M7DB 2EYQA 1PHTA 4AFZC 1JO8A 3FLGA 3CCUQ 4DQ2A 4ATOA 2D0QB 3UPUA 3TREA 3PMIA 3G6EQ 3A1PA 4QVCA 3TSZA 1TWBA 1I5OB 4JJBA 2F1LA 2K9GA 1H3ZA 1GFDA 3OSSC 2KRNA 2NUPB 5CKEA 5J3BA 2ZPIB 3JCMJ 2O01E 3ZFJA 3OSVA 4O6JA 2LMJA 4F7UG 4E7HA 1NYGA 2HAXA 2RI5A 3G1JA 3O5ZA 1U5SA 4ANJA 3EFSA 4BB7A 4PJOA 1N6AA 2V8IA 3EGUA 2FHDA 4M78D 2EYZA 3CPFA 3EHRA 1W2BS 3NGPA 5GJWB 1FWZA 4BY6C 1VQ9Q 1N5ZA 3CCSQ 2JOYA 4AG2C 5KYYB 5GAOn 2QA4Q 2LVMA 1WHKA 1QKWA 1H641 4HCZA 4M78B 2E3IA 2XD0A 3M4GA 3I9QA 4KULA 3EH1A 3PGGA 1YJ9A 1YJWT 1LVKA 4J7IA 4RG8A 4M7DA 4PFZA 4A54A 2L89A 3JB9D 1OX9A 1NPPA 4L59A 2HMAA 3G4ST 2EJFA 5A0GA 3M5AA 1XTDA 2KVQG 1PD1A 4M7AE 3A8OB 2R58A 2JTEA 5A2QE 1YITT 7AT1B 3VS4A 1ARKA 1U06A 3HSBA 1ZUUA 3CXCA 4ZN1A 3QDFA 5CAIA 2QQ9A 4XK8E 2CYZB 2PU9B 1M2VA 4JUVA 2MCNA 1QWFA 1VQ8Q 3QO3A 4LUEA 4J9IA 1VQ6T 1CKAA 3LGLA 3QWXX 2FG0A 5KYWA 1FYNA 3VYGA 1X6BA 4BI4A 4EMGA 3VV0A 4AG1C 3MP1A 2E65A 1QKXA 1OU9A 2CDTA 3EFOB 1VQNQ 4J8OA 4M7AB 1OZ3A 4CC4B 2VXFA 2QYZA 1FX7A 1ZLMA 1QVFP 2RHZA 2RHYA 3OYEA 2CZ7B 2DXBA 2FPFA 4HVUA 4MZPA 5GMKm 3PFSA 4CC2A 2O2OA 3HRUA 3MKDA 4EMKB 1NBEB 2EIFA 4C0DB 1YCYA 4MZTA 3FIFA 2E6ZA 3L42A 4LE9A 2R5MA 4XU0A 3A98A 1N8RC 3JB9G 3L2UA 4BY6B 4C0FA 2JXBA 1IGQA 1SPKA 1TUCA 4FW1A 4YTLA 1Y0MA 1B34B 3GLXA 3C4SA 4KT0E 1ZSZA 2CT3A 4EPCA 3M54A 3I55A 5I21A 4NS5A 2CP6A 3G71A 2MF2A 3EG0A 4LD9K 1IB8A 2BZ8A 1MMGA 2ZGWA 3CCLQ 4PLIA 2CSQA 4RTZA 1K9MC 2XI9A 1SKUB 4OB1B 3SEMA 5DY9A 2CP3A 4QW2A 1YNZA 2V8JA 1W2BP 1C0MA 4DEXA 2M51A 3TU4K 5LL6S 4NOYA 4KUDK 1OEBA 1ACMB 2J6OA 4KGVB 5C6SA 4C8QD 1VQ7Q 2KRSA 2RF0A 1UTIA 1HD3A 2J7IA 4GLMA 2J6FA 4FYVB 4PL6A 5HY6A 3OYMA 2D8JA 2EJ9A 2QXFA 4C8QE 5GMKj 3RKXA 1EX4A 4FYWB 1RAIB 3OYJA 1AZEA 2JN0A 2RMOA 1S72T 3L2ZA 2KYBA 3CC7Q 2PUOB 3N5BB 5CVIA 1PSEA 2VASA 2ZCFB 2YUOA 2E64A 3E2UA 2EQMA 2JS2A 2K79A 2W0ZA 2XDBA 5CK9A 2DA9A 4PFOA 3M9QA 3CMAT 1WJQA 3C94A 4RTXA 5GAN3 1VQOA 4FT2A 2HDAA 5LJ3d 4IIOA 3JCMc 1OU8A 1WYXA 4A4GA 1BU1A 5D6XA 1H3HA 2NUZA 3MJXA 4M77E 1K73C 4ORZA 2VC8A 2RHIA 3RERA 1OPKA 4GBQA 1KK7A 2EGEA 3QZ5B 4X9CA 5GANd 2IG0A 2CP2A 2DVJA 2ZZDA 4FSXA 2JJ9A 4ELYC 2D8HA 2HNIA 3VS1A 3OS0A 2OTLT 3GOXA 3L1AA 1KQSP 1WIEA 3V7CA 2XMFA 4J9FA 2H3JA 2VXEA 1WDXA 5HKCA 2AKKA 2OTJT 2O4XB 5GAMf 5GAMg 2FRWA 3REAB 4M7AF 2BZXA 1MNEA 2RQRA 1VIFA 5KYNA 2VGMA 1NJIU 1R0BG 1C1AA 2QG9B 2HKNA 4CC7A 2RQVA 3GBQA 4FYYB 2PVGB 1KC8C 1W70A 1B7TA 1KFZA 1BCOA 8AT1B 3AHUA 1YIJA 2J6KA 4M75G 1PKTA 4E6RA 1JEGA 4JLGA 3QXEB 4Q5WA 3V8JA 5LJ5j 1Y96A 4ESRA 3FB9A 2DYBA 3OW2P 4PLLA 2QTVA 2C0IA 2QGGA 2EQKA 4R55A 2FO0A 4Z88A 1D0YA 1TUGB 3RESA 3PVQA 1C6VX 1S72Q 1KHIA 3CBMA 4WF2A 3M55A 4M75C 2E6NA 4J9BA 4QVDA 2GTJA 1M8MA 1AHJB 2H3EB 1FMWA 2EQIA 4Y28E 3R6NA 1LOJA 4M78G 3S6WA 3EHQA 2YT6A 1KC8R 4LNPA 5KYUB 1HXDA 3OA6A 1R0CB 2XIDA 2DE0X 2JTMA 4PKCC 1PSFA 3RMSA 5ECAA 2OI3A 3AT1B 1KSWA 3H9NA 3FEOA 3JCMP 3HFOA 1M8VA 4C92A 1ZUKA 4XTUA 2RPNA 4E7ZA 2WSFE 3HTRA 4M7DG 4RCCA 1M1KC 4O5VA 2IPOB 4A53A 2E4HA 2VUBA 2I0NA 2RK2A 3OS2A 4L5GA 3FC3A 2EQUA 3NPFA 2CS7A 4R0KA 2LC4A 3CCUT 3M0SA 1Y57A 4HXJA 4M7DC 3CC2T 4E7JA 4C92D 4A4KA 4FYXB 2LQNA 4DEYA 1K1ZA 3VS3A 1XJWB 1UEBA 2M1HA 2O31A 2PTKA 4JRKA 2YLBA 4J7FA 2XHCA 3QYHB 1JB0E 3OBWA 5AYFA 3M58A 2HQEA 3CPWP 5IAYA 3L2RA 3CPWA 1YJ9T 3CCJT 4P5NA 1VQNT 1MMNA 3PVLA 4M77C 1UJYA 4MDWA 2M16A 2BE7D 2QEXQ 3CCQT 3CCLT 4CRIA 3JCMh 2YWWA 3UA7A 4Z02A 3QKJA 4J5YA 3G6EA 3OW2A 4KRTA 1WZOA 4M75B 3LYIA 2LP5A 1ABQA 3JCMd 2L2PA 1KQ1A 3CCMT 3S3OA 2FL7A 4C5IA 1AWXA 1YI2T 4IUQA 1K73R 3G4SQ 3QZ9B 4ME7A 1VQ6A 2K7AA 2KQWA 2LCLA 1WHHA 2K3BA 5LJ3g 4DBHA 2A37A 1Q82R 5GAN8 1Y71A 1VOMA 2JMAA 2R5AA 3LLRA 3CCUA 2XU8A 3PMTA 1H92A 2K5IA 3CCQA 1K73U 1VQKT 5M9OA 2QQRA 1NEBA 1UGVA 5DLQE 2VGNA 4EMKA 4IUUA 3OS5A 5GMKh 3LGFA 5EC7A 3UT1A 3ER0A 3QIIA 1VQ5T 3J80E 2AZVA 1N27A 2JUFA 1IO6A 4L6V5 4OB2B 3KFVA 4J6XA 1E7OA 4K11A 4F16A 4LDUA 2DRKA 3RDVA 2CZ1B 2ED0A 4M75A 1B34A 1IRXA 2EYYA 4EMKC 3THKA 2VKNA 2K57A 2CT4A 2KK4A 4D8DA 2LJ0A 4C92E 4M78E 3CC4Q 3E1SA 2ECZA 4B9WA 5KYXB 3DB4A 3QJYA 3IQLA 1P92A 3NMZC 4C0ZA 3MO8A 1X43A 3P8HA 3HHTB 3PE0A 2Y90A 5KCOA 3OQ5A 1PC0A 4PJMA 1LJOA 2F2WA 3C95A 2X4WA 4J6WA 2EBPA 4BE2A 4M7DD 3P8DA 3VUBA 3OMGA 1TOVA 4M7AC 1YWPA 2SEMA 1NE8A 3MEVA 3DLLA 1YJNQ 2KT8A 1M5Q1 1GBQA 5FU7C 4ZGDB 2QGFB 3OYDA 4GY5A 3CCMQ 2X35A 4LD6A 5CR2A 3GF5A 2XKOC 1D0ZA 1VYUA 1WX6A 2EYWA 4JPBW 2M02A 2VB6A 3H8ZA 2YDLA 2OTLQ 2EWNA 1YP5A 3BW1A 1T3LA 1Q81C 5GAOl 4PJOD 3X28B 2DZCA 2E3HA 4ZTFA 1NJIR 3V7RA 1NYFA 4OMLA 1KC8U 1N9SA 1UGQB 2QI2A 3KBGA 3MEWA 2COZA 2DEUA 5GAN7 3C0CA 1N9RA 2RO0A 5J39A 3H0IA 1VQNA 4OMOA 1B3QA 1OI1A 3VS6A 1Q7YU 3UWNA 2OTJQ 3JCMW 3J7AF 1PWTA 3LH5A 2ROLA 2LCCA 4M75D 2JMCA 2DM1A 4ZGEB 3HL8A 3A8MB 1K8AU 3QYGB 4RMOA 4WCIA 1TTHB 1WXTA 1RLPC 5HCKA 3G71T 3QJ6A 5LJ3f 1E6GA 2FZKB 3JCMV 2LQWA 2X3XD 5HK3A 2A36A 4F7UB 3CC7A 4OVAA 5GAN5 2K5FA 1JRIA 2EKOA 1SSHA 1KD1R 2LCSA 4KH0B 2HEQA 3RKYA 4TVRA 4RKUE 4C8QG 1QCNA 1M9SA 1SSFA 1VQMQ 2QQBA 3M53A 5DM7R 3CCVA 4OGCA 1BCMA 1YFNA 3QPHA 3CMEQ 3A5ZB 4OMMA 1M3AA 1V1CA 2AHJB 5LJ3h 1OOTA 5GMKl 2F5KA 1M90R 1KQSS 1M3BA 1VQPQ 1WHJA 5GAN2 5A0LA 1QVGA 3WVDB 2V1QA 2C0OA 2DJZA 4PJOC 3QHSA 4J9GA 2DERA 2PNIA 2DBMA 1VQ9T 1QVFS 2K5LA 3CCST 1K0XA 2YUNA 3CCRA 3VS7A 1W6XA 5IHIA 1PKSA 1EZZB 3M56A 2FZCB 3P8BB 4FSSA 2PUKB 2NLUA 1T0JA 5GAMd 1UECA 2PVOB 3CMAA 2QTXA 2CH4A 3L2WA 5FWBA 1KQ2A 2HSPA 1TSFA 4IUTA 1GCQC 4QQDA 5IN1A 4MZMA 1I0CA 1KG1A 4EIKA 4C92B 1YI2Q 2LZ6B 4M77G 3X24B 1U8RA 4ZNXA 4N0AA 3URGA 4C5HA 1TXQA 2DYIA 1Q86U 4RTYA 4C8QA 4OMPA 2QA4A 1U1TA 1JXMA 1VQMT 1Y7XA 1YIJQ 2R57A 3TCJA 1RI9A 5KYYA 2RB6A 1UGSB 2HSEB 4M78A 4XU3A 2YLCA 2JM8A 1VQ6Q 4XAXB 3UDCA 2J05A 1I8FA 4XTXA 2V26A 2CGHA 2DL7A 3V8LA 3J81E 1IGUA 1Q95G 4A4EA 1S1NA 3CC4A 3VYHB 3PIOA 2F2XA 4JRQA 2BKDN 4FU6A 1RAHB 2JS0A 1JJ2P 1UB4A 3VRYA 3CCQQ 2RH2A 1JJ2A 4Z89A 3MPUB 4RUGA 3SB2A 5FROA 2DXCA 3RMQA 5GANh 3BE3A 3HPWA 4DA4A 3CBPA 4BUGA 4A63B 2KT1A 2E12A 2ZPHB 3CCJA 2DD5A 1Y07A 3T9NA 1K9AA 1IXDA 2L5QA 1YJ9Q 2KEAA 2EYXA 2JW4A 4FL6A 5L8RE 1AT1B 4DOWA 3CXCP 1WJSA 2EGAA 2NYSA 4QT7A 1I5LA 2JVVA 3LWIA 3M57A 1VQ4A 2E5QA 4F7UF 1WI7A 5I11A 3EFOA 1ZA1B 3CCJQ 1MGQA 4OGEA 1MMDA 4JJNK 4A4HA 2DTHA 2M9UA 2XG8D 1G3SA 1EFNA 1GFCA 1NLOC 1BBZA 2ROTA 2P4RA 4OB0B 2AIRB 2OJ2A 5CKBA 4ZN3A 2RK1A 3HP9A 3RUXA 3M59A 5GMKe 2MYSA 4CC3A 4E7KA 2GCXA 2RHUA 1YJNA 2QQAA 3TVTA 3DB3A 3CD6T 1Z9ZA 4GLKA 3OS1A 1VQ7T 2RQUA 2IVWA 1D3BB 4RTWA 2DKGA 2RI3A 1SF9A 4LUDA 2DVEA 5LJ5f 1ZSZB 2KROA 5LJ5g 4VUBA 3RNJA 5GANe 3OYYA 2RNAA 2WSCE 3TEEA 1N8RR 2YXYA 2EPDA 1MNDA 3LWHA 2ABLA 3VRZA 2YRDA 1GRIA 2Y4XA 3JCMg 4JRPA 1VQ5Q 2NUTA 1YITA 1ZQ1A 3HRSA 3M0TA 4XQ3A 1VQKQ 3OW2S 4PK4A 1F1BB 2AT1B 3O8VA 4C92F 1Q7YC 2E5KA 1MMAA 3X20B 1O9SA 2HKQB 5KYXA 4M75E 2HCKA 3RIRA 4J6YA 2RD1A 2DTOA 4LDYA 2DLPA 1K8AC 2PVDB 2F5TX 4A4FA 1UHCA 4HCKA 4IURA 1YHQQ 5KCHA 3CCLA 2DXUA 2DK3A 4PJJA 1NM7A 1D3BA 1XOVA 1WGSA 1T0HA 1RAFB 3PNWC 3MHXA 1RABB 5KYUA 1KHCA 1VA7A 2E41A 1X69A 3OYNA 4C8QF 4PJOE 2QQSA 2AKLA 1SEMA 2HD0A 2HQXA 1QMCA 2BZYA 2QEXT 2HL5C 3UATA 1VQ7A 1V29B 2VVKA 1B07A 3RKWA 1QVGP 3VU3C 1X01A 2YRVA 1VUBA 2DFUA 4HVWA 1GBRA 2XK0A 3EGDB 3X25B 1KD1U 1AWWA 4IIMA 2CUDA 1TUDA 3BY7A 2DIQA 2L3RA 3META 3OYGA 4JDSA 4V2SA 1R8OB 1RL2A 5GAMe 4JS5A 3G4SA 2QASA 4F04B 3CMEA 3V8KA 5IT9E 2DL4A 3CEYA 1YJWA 2KY9A 4M7DE 2JT4A 1RAAB 2X4JA 1RADB 3I5RA 1YBYA 4D6WA 1QWEA 3EH2A 5CKDA 4CI0C 4M77F 5FW9A 3LX7A 1NLPC 1UG1A 1K8AR 5EG2A 4RG2A 1MV3A 5FU6B 2LTOA 2ZPEB 2JNGA 3H0HA 2KYMA 3H0FA 2DJQA 2GBQA 1OPLA 1NPRA 4Y91A 2HBWA 1BB9A 3PIPA 1N8RU 1WHMA 2CZ0B 1SRMA 1VIEA 4QVZA 3E19A 3RBBB 3SFMA 4C92C 4JJDA 3ULRB 1LNXA 5GANg 1OYXA 5GANf 1EIFA 5IHNA 2DO3A 2NUPA 4M7AD 1PNJA 2K6DA 1SHFA 1OULA 3OB9A 2D1XA 2ZAEA 2P0KA 2CREA 4RTVA 1S72A 1M27C 1QVPA 4FM4B 1UGPB 3EG9B 5I22A 1W4SA 4QQ6A 5GMKi 3M0RA 1IREB 3TQ7P 1OZ2A 3OYIA 5DLOA 2F69A 2MI6A 3PT9A 1A0NB 4J9EA 3E9FA 2RJFA 5KE3A 2EFIA 4E7LA 4UC4A 1G8XA 5J26A 3OYAA 3OYLA 2DBKA 1PM3A 2OTJA 4J9CA 4AFUC 1CSKA 2DL3A 2AZSA 5GAOm 5L23A 1AD5A 5GAOr 2QDYB 4J9DA 3QWYA 3CCMA 8ATCB 2OTLA 3MEUA 2H8HA 1IZ6A 1WLPB 2RA2A 2HZYA 1H8KA 2A0FB 2DRMA 2CUBA 3A8LB 1M1FA 2LQ8A 3I5SA 1U3OA 5HK0A 1UE9A 3OYHA 2RJDA 1AZGB 5LJ5h 3KXTA 1D1CA 2LJ3A 1X27A 3JB9F 1RLQC 1IHVA 3OMCA 1QVGS 3E9GA 3OYFA 4M77A 1M2VB 2KI7A 2L3PA 4BE0A 3REBB 2DTIA 3WVEB 4M78C 2DAQA 4C8QB 1M1KR 5A0DA 1NJIC 1X6GA 1HSQA 4C5EA 1VQ8A 4LXCA 1MUZA 2X4YA 3MEAA 3BDUA 3TSWA 2DZ9A 4KUIA 1ABOA 4KH1B 4HT9A 1JBMA 1BI3A 1WQWA 2K4YA 1D09B 1KQSA 4C0DC 1WQ7A 3ME9A 5LJ3j 1Q86R 3CCRQ 3GP8A 2B86A 4FT4A 3G7ZA 1I81A 4OMNA 4F14A 1Q82U 1MHNA 5KE2A 5GAMh 4QKUA 1O75A 2OAWA 2K2VA 1OV3A 3OBYA 1JXOA 1VQMA 3JSCA 3MP6A 5IXBA 1K9MR 2FRYA 1QP2A 3LH0A 3CC7T 4FCYA 2A08A 5D7UA 1YI2A 3QUIA 4NL2A 2A28A 3HKSA 4BI3A 1YITQ 2DX1A 4AMCA 3NHNA 3CCVQ 1AOJA 1DJ7B 3UA6A 4KGXB 3M0QA 4XTVA 4OP0A 3OYCA 5FLXE 5CKFA 4E7SA 1PCXA 2KBTA 1FMKA 2GFUA 1QCFA 1JJ2S 5D6WA 4EDUA 4JLIA 3FRNA 4X1VA 5LJ3e 1YHQT 2HL3A 2M0OA 1Q82C 4LDXA 2HQHA 2RI2A 1K0SA 4M7AG 3QSUA 3S3MA 1ZBXA 1QCOA 3NTIA 1XNIA 2SRCA 1BI2A 1KJWA 3Q1JA 2DL8A 3JCMe 5FRNA 3FJPA 4J9HA 3BDLA 3JB9H 1I07A 2X4XA 1QW1A 2BUDA 2IIMA 1PD0A 5CKHA 1UFFA 4HKEA 4BDZA 1HYOA 4C5GA 4DBQA 4ZGJB 2GFAA 3OYKA 2KE9A 1M1GA 3CCEQ 5KYWB 1BIBA 1M1KU 1X2KA 2F2VA 2LDMA 2EKHA 2QAZA 2XDPA 2I2LA 3CCVT 2QK0A 4MMLA 2CH4W 5GANj 1D0XA 1WXUA 2E10A 1VYTA 4E7IA 1M30A 1R77A 4BE1A 1QQJA 1AWJA 2BTTA 1PG5B 3CCEA 3CPWS 3ZL7C 3CD6A 2YHTA 1G3WA 2ENMA 2CZ6B 2E70A 2P0QA 1FMVA 2GF7A 5IHKA 5GAOp 4LN2A 3MCAB 3NTKA 3DLMA 3L2QA 3DKMA 4BD3A 2LNHB 4N4HA 4IKFA 3SWNC 1M2OA 1OQKA 3VUZA 3CBOA 1Q81U 2O9SA 2EQJA 5LJ5d 3VS0A 2YUPA 2HBPA 1W2BA 4QQGA 3I56Q 2RJCA 4OB3B 1NG2A 3SHWA 4BDYA 2E1HA 2FVUA 3M4YA 4XU1A 1KIKA 2P0PA 3JCMf 3SWNA 4PJLA 4MMKA 1VQ9A 2MOXA 5I2MA 1I4K1 1Y96B 1VQ5A 3SDZA 3JCMb 4M4ZA 3H6ZA 1IHWA 2K3YA 3GIBA 4AFSC 1BK2A 2OX7A 2CP0A 3JAME 4J83A 2RJEA 1YJNT 3JCMQ 2DXTA 4HCBA 1TU0B 2DPPB 2O88A 1U1SA 3CMET 1X2QA 3G6ET 1QLYA 2LT4A 5FWCA 2YRCA 1ZBJA 4JS4A 2G3RA 4JJCA 5I2SA 2EJGA 2J06A 3CQTA 2GNCA 3HFNA 4OF1A 1BKBA 2K3XA 2WSEE 5C0MA 4HVVA 5AT1B 1G3TA 4LDWA 3HRTA 4N4IA 2LRQA 4RTTA 2DETA 3NFCA 2QDLA 2QA4T 4E47A 3I55T 4OMQA 3D7SB 4RCBA 3I55Q 3VKIA 2Z0WA 2MAMA 2KSSA 3EFRA 5KH6A 1XQHA 2CP5A 4ELZC 5CO7A 4ZTJA 1VQPT 5FRMA 3CXCS 1GCQA 2CSIA 2KGTA 1M90C 4PJOG 2WACA 3ASKA 3JRZA 2FEIA 3L2VA 4JZ4A 4DBRA 2PZ1A 2Y4YA 1JU5C 2MK5A 4X34A 2FPDA 1SG5A 2M0YA
chains in the Genus database with same CATH topology
5FW9A 1NLPC 1UG1A 2EBPA 2FPFA 1NEGA 1MV3A 4HVUA 4CC2A 1YWPA 2SEMA 2O2OA 2KT8A 3H0HA 1AVZC 1GBQA 2KYMA 3H0FA 2DJQA 2GBQA 4LE9A 1OPLA 2HBWA 3A98A 1BB9A 4Z8AA 2JXBA 1SPKA 1SRMA 1SRLA 1VYUA 1TUCA 1WX6A 2EYWA 1ZUYA 4JPBW 3RBBB 2YDLA 1Y0MA 4JJDA 3ULRB 1W1FA 1WA7A 1YP5A 2CT3A 1T3LA 2GQIA 5IHNA 1HJDA 1PNJA 2K6DA 1SHFA 3EG0A 1E6HA 2BZ8A 2D1XA 2EVRA 1GL5A 2CREA 4RTVA 1M27C 4D8KA 1NYFA 2CSQA 4RTZA 4AFQC 5I22A 4OMLA 2LX7A 3SEMA 3M0RA 1YNZA 1UHFA 1UJ0A 4DEXA 2M51A 3C0CA 1A0NB 3H0IA 4J9EA 4OMOA 1B3QA 1OEBA 3VS6A 5IH2A 2J6OA 2KXDA 1PWTA 3U23A 1VYVA 3LH5A 2ROLA 2KRSA 2RF0A 1UTIA 1HD3A 2DBKA 2DMOA 2J7IA 4GLMA 2JMCA 2DM1A 2J6FA 4J9CA 4AFUC 1CSKA 2DL3A 2AZSA 2D8JA 2YUQA 4WCIA 1UUEA 3EG1A 1WXTA 5L23A 1AD5A 1AZEA 2RMOA 2RN8A 4J9DA 1RLPC 3QWYA 5HCKA 2LJ1A 2KYBA 2GGRA 1TG0A 1E6GA 2H8HA 1WLPB 1YCSB 2LQWA 1PRMC 1PRLC 1H8KA 2X3XD 2DRMA 2CUBA 2A36A 2YUOA 4F17A 3I5SA 1U3OA 1SSHA 1UE9A 2JS2A 2K79A 2W0ZA 1AZGB 2DA9A 2LCSA 1JQQA 2HEQA 2LJ3A 1WFWA 1X27A 4RTXA 1RLQC 2HDAA 2C0TA 2L3PA 4IIOA 3REBB 4RTUA 1AEYA 1WYXA 1BU1A 2JM9A 4OMMA 1X6GA 1H3HA 3H41A 1HSQA 1M3AA 1V1CA 2NUZA 1Z9QA 1OOTA 4ORZA 2W10A 2MIOA 1M3BA 1MUZA 1SHGA 1OPKA 4GBQA 2EGEA 3TSWA 1YWOA 2DL5A 2C0OA 2V1QA 1ABOA 4J9GA 1YN8A 2DVJA 2PNIA 2DBMA 2D8HA 3VS1A 2L0AA 1K0XA 1WIEA 2YUNA 2XMFA 3VS7A 4J9FA 1W6XA 5IHIA 1PKSA 1WDXA 2AKKA 4FSSA 2VWFA 1T0JA 2FRWA 3REAB 1UECA 2BZXA 2X3WD 2B86A 2CH4A 2RQRA 5FWBA 4OMNA 2HSPA 2KRMA 4F14A 3I35A 1GCQC 1T3SA 2OAWA 4CC7A 2O9VA 1OV3A 2V1RA 2RQVA 3VS5A 1I0CA 2RQWA 1M3CA 3GBQA 1JXOA 2KXCA 4EIKA 1W70A 2LZ6B 1KFZA 5IXBA 2FRYA 4ZNXA 2J6KA 1K76A 2A08A 1PKTA 4E6RA 1JEGA 2A28A 4RTYA 1G83A 2DF6A 2AK5A 2KNBB 4OMPA 4JZ3A 4ESRA 2DX1A 1JXMA 3NHNA 2DYBA 5IXFA 1AOJA 2C0IA 3EG3A 1J3TA 3UA6A 3M0QA 3VS2A 5GJVB 1G2BA 1RI9A 2FO0A 4Z88A 2FPEA 3PVQA 2EGCA 3EG2A 1ZSGA 2JM8A 2KBTA 1FMKA 2L3QA 2L3SA 1QCFA 2J05A 1UDLA 4J9BA 4X1VA 1RUWA 2GTJA 2DL7A 1M8MA 2ESWA 1K0SA 2KR3A 4Y92A 1S1NA 2EQIA 2F2XA 3R6NA 2JS0A 1ZX6A 3JV3A 1MV0B 3VRYA 3EHQA 2YT6A 4Z89A 1K4US 2RQTA 2SRCA 4LNPA 4RUGA 1KJWA 2YSQA 2DE0X 5ECAA 2DL8A 2OI3A 1KSWA 4J9HA 3M0PA 2DNUA 4A63B 1I07A 2KT1A 2IIMA 1ZUKA 1WXBA 1UFFA 2RPNA 1K9AA 2KEAA 2KE9A 2EYXA 2JW4A 2DILA 1X2KA 2F2VA 2EW3A 2EGAA 4QT7A 2ED1A 2EKHA 2I0NA 2K2MA 1LCKA 2CH4W 1WI7A 5I11A 3NPFA 1WXUA 4R0KA 1VYTA 2D0NA 1M30A 1AWOA 3UF4A 3M0SA 1Y57A 1GCPA 1CKBA 4HXJA 1AWJA 2BTTA 1EFNA 3ZL7C 1GFCA 3FJ5A 2GTOA 1NLOC 1BBZA 2ROTA 2P4RA 4DEYA 2ENMA 2LQNA 1K1ZA 3VS3A 2NWMA 2OJ2A 1I1JA 2O31A 2PTKA 2G6FX 5IHKA 4CC3A 3M0UA 4LN2A 1PHTA 3TVTA 4AFZC 1JO8A 1Z9ZA 2RQUA 4RTWA 3PVLA 2LNHB 1UJYA 2O9SA 4LUDA 3TSZA 2KROA 4JJBA 3VS0A 2K9GA 3RNJA 2YUPA 1GFDA 2KRNA 2RNAA 3UA7A 4KRTA 2EPDA 1NG2A 2ABLA 3VRZA 3SHWA 1GRIA 2LP5A 2LMJA 1ABQA 1KIKA 1NYGA 2L2PA 3O5ZA 1U5SA 3EGUA 3M0TA 1AWXA 2MOXA 2EYZA 3EHRA 3NGPA 5GJWB 4M4ZA 4AFSC 2E5KA 1N5ZA 1BK2A 4AG2C 1QKWA 2K7AA 2HCKA 2K3BA 2O88A 2A37A 3I9QA 1X2QA 2JMAA 2DLPA 1QLYA 5FWCA 1H92A 1UHCA 4HCKA 1ZBJA 4JJCA 2J06A 3CQTA 2GNCA 1NM7A 4HVVA 1NEBA 1UGVA 1XOVA 1T0HA 5EC7A 4RTTA 2AZVA 2QDLA 1VA7A 1IO6A 2JTEA 1X69A 4OMQA 3KFVA 3VS4A 2AKLA 1U06A 1ARKA 1ZUUA 1E7OA 4K11A 1SEMA 4F16A 2DRKA 2BZYA 2ED0A 3UATA 2EYYA 2VVKA 1B07A 3THKA 2VKNA 2MCNA 2CT4A 1QWFA 4HVWA 1GBRA 4D8DA 2LJ0A 4LUEA 4J9IA 1CKAA 3QWXX 4IIMA 1AWWA 2FG0A 1FYNA 2CUDA 1TUDA 1X6BA 1GCQA 2ECZA 4AG1C 2CSIA 2KGTA 1QKXA 2DL4A 3IQLA 3NMZC 2CDTA 1X43A 2FEIA 2JT4A 4JZ4A 2PZ1A 3PE0A 1JU5C 3I5RA 4CC4B 2FPDA 1ZLMA 2M0YA 1QWEA 2F2WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FW9 A;  1NLP C;  1UG1 A;  2EBP A;  2FPF A;  1NEG A;  1MV3 A;  4HVU A;  4CC2 A;  1YWP A;  2SEM A;  2O2O A;  2KT8 A;  3H0H A;  1AVZ C;  1GBQ A;  2KYM A;  3H0F A;  2DJQ A;  2GBQ A;  4LE9 A;  1OPL A;  2HBW A;  3A98 A;  1BB9 A;  4Z8A A;  2JXB A;  1SPK A;  1SRM A;  1SRL A;  1VYU A;  1TUC A;  1WX6 A;  2EYW A;  1ZUY A;  4JPB W;  3RBB B;  2YDL A;  1Y0M A;  4JJD A;  3ULR B;  1W1F A;  1WA7 A;  1YP5 A;  2CT3 A;  1T3L A;  2GQI A;  5IHN A;  1HJD A;  1PNJ A;  2K6D A;  1SHF A;  3EG0 A;  1E6H A;  2BZ8 A;  2D1X A;  2EVR A;  1GL5 A;  2CRE A;  4RTV A;  1M27 C;  4D8K A;  1NYF A;  2CSQ A;  4RTZ A;  4AFQ C;  5I22 A;  4OML A;  2LX7 A;  3SEM A;  3M0R A;  1YNZ A;  1UHF A;  1UJ0 A;  4DEX A;  2M51 A;  3C0C A;  1A0N B;  3H0I A;  4J9E A;  4OMO A;  1B3Q A;  1OEB A;  3VS6 A;  5IH2 A;  2J6O A;  2KXD A;  1PWT A;  3U23 A;  1VYV A;  3LH5 A;  2ROL A;  2KRS A;  2RF0 A;  1UTI A;  1HD3 A;  2DBK A;  2DMO A;  2J7I A;  4GLM A;  2JMC A;  2DM1 A;  2J6F A;  4J9C A;  4AFU C;  1CSK A;  2DL3 A;  2AZS A;  2D8J A;  2YUQ A;  4WCI A;  1UUE A;  3EG1 A;  1WXT A;  5L23 A;  1AD5 A;  1AZE A;  2RMO A;  2RN8 A;  4J9D A;  1RLP C;  3QWY A;  5HCK A;  2LJ1 A;  2KYB A;  2GGR A;  1TG0 A;  1E6G A;  2H8H A;  1WLP B;  1YCS B;  2LQW A;  1PRM C;  1PRL C;  1H8K A;  2X3X D;  2DRM A;  2CUB A;  2A36 A;  2YUO A;  4F17 A;  3I5S A;  1U3O A;  1SSH A;  1UE9 A;  2JS2 A;  2K79 A;  2W0Z A;  1AZG B;  2DA9 A;  2LCS A;  1JQQ A;  2HEQ A;  2LJ3 A;  1WFW A;  1X27 A;  4RTX A;  1RLQ C;  2HDA A;  2C0T A;  2L3P A;  4IIO A;  3REB B;  4RTU A;  1AEY A;  1WYX A;  1BU1 A;  2JM9 A;  4OMM A;  1X6G A;  1H3H A;  3H41 A;  1HSQ A;  1M3A A;  1V1C A;  2NUZ A;  1Z9Q A;  1OOT A;  4ORZ A;  2W10 A;  2MIO A;  1M3B A;  1MUZ A;  1SHG A;  1OPK A;  4GBQ A;  2EGE A;  3TSW A;  1YWO A;  2DL5 A;  2C0O A;  2V1Q A;  1ABO A;  4J9G A;  1YN8 A;  2DVJ A;  2PNI A;  2DBM A;  2D8H A;  3VS1 A;  2L0A A;  1K0X A;  1WIE A;  2YUN A;  2XMF A;  3VS7 A;  4J9F A;  1W6X A;  5IHI A;  1PKS A;  1WDX A;  2AKK A;  4FSS A;  2VWF A;  1T0J A;  2FRW A;  3REA B;  1UEC A;  2BZX A;  2X3W D;  2B86 A;  2CH4 A;  2RQR A;  5FWB A;  4OMN A;  2HSP A;  2KRM A;  4F14 A;  3I35 A;  1GCQ C;  1T3S A;  2OAW A;  4CC7 A;  2O9V A;  1OV3 A;  2V1R A;  2RQV A;  3VS5 A;  1I0C A;  2RQW A;  1M3C A;  3GBQ A;  1JXO A;  2KXC A;  4EIK A;  1W70 A;  2LZ6 B;  1KFZ A;  5IXB A;  2FRY A;  4ZNX A;  2J6K A;  1K76 A;  2A08 A;  1PKT A;  4E6R A;  1JEG A;  2A28 A;  4RTY A;  1G83 A;  2DF6 A;  2AK5 A;  2KNB B;  4OMP A;  4JZ3 A;  4ESR A;  2DX1 A;  1JXM A;  3NHN A;  2DYB A;  5IXF A;  1AOJ A;  2C0I A;  3EG3 A;  1J3T A;  3UA6 A;  3M0Q A;  3VS2 A;  5GJV B;  1G2B A;  1RI9 A;  2FO0 A;  4Z88 A;  2FPE A;  3PVQ A;  2EGC A;  3EG2 A;  1ZSG A;  2JM8 A;  2KBT A;  1FMK A;  2L3Q A;  2L3S A;  1QCF A;  2J05 A;  1UDL A;  4J9B A;  4X1V A;  1RUW A;  2GTJ A;  2DL7 A;  1M8M A;  2ESW A;  1K0S A;  2KR3 A;  4Y92 A;  1S1N A;  2EQI A;  2F2X A;  3R6N A;  2JS0 A;  1ZX6 A;  3JV3 A;  1MV0 B;  3VRY A;  3EHQ A;  2YT6 A;  4Z89 A;  1K4U S;  2RQT A;  2SRC A;  4LNP A;  4RUG A;  1KJW A;  2YSQ A;  2DE0 X;  5ECA A;  2DL8 A;  2OI3 A;  1KSW A;  4J9H A;  3M0P A;  2DNU A;  4A63 B;  1I07 A;  2KT1 A;  2IIM A;  1ZUK A;  1WXB A;  1UFF A;  2RPN A;  1K9A A;  2KEA A;  2KE9 A;  2EYX A;  2JW4 A;  2DIL A;  1X2K A;  2F2V A;  2EW3 A;  2EGA A;  4QT7 A;  2ED1 A;  2EKH A;  2I0N A;  2K2M A;  1LCK A;  2CH4 W;  1WI7 A;  5I11 A;  3NPF A;  1WXU A;  4R0K A;  1VYT A;  2D0N A;  1M30 A;  1AWO A;  3UF4 A;  3M0S A;  1Y57 A;  1GCP A;  1CKB A;  4HXJ A;  1AWJ A;  2BTT A;  1EFN A;  3ZL7 C;  1GFC A;  3FJ5 A;  2GTO A;  1NLO C;  1BBZ A;  2ROT A;  2P4R A;  4DEY A;  2ENM A;  2LQN A;  1K1Z A;  3VS3 A;  2NWM A;  2OJ2 A;  1I1J A;  2O31 A;  2PTK A;  2G6F X;  5IHK A;  4CC3 A;  3M0U A;  4LN2 A;  1PHT A;  3TVT A;  4AFZ C;  1JO8 A;  1Z9Z A;  2RQU A;  4RTW A;  3PVL A;  2LNH B;  1UJY A;  2O9S A;  4LUD A;  3TSZ A;  2KRO A;  4JJB A;  3VS0 A;  2K9G A;  3RNJ A;  2YUP A;  1GFD A;  2KRN A;  2RNA A;  3UA7 A;  4KRT A;  2EPD A;  1NG2 A;  2ABL A;  3VRZ A;  3SHW A;  1GRI A;  2LP5 A;  2LMJ A;  1ABQ A;  1KIK A;  1NYG A;  2L2P A;  3O5Z A;  1U5S A;  3EGU A;  3M0T A;  1AWX A;  2MOX A;  2EYZ A;  3EHR A;  3NGP A;  5GJW B;  4M4Z A;  4AFS C;  2E5K A;  1N5Z A;  1BK2 A;  4AG2 C;  1QKW A;  2K7A A;  2HCK A;  2K3B A;  2O88 A;  2A37 A;  3I9Q A;  1X2Q A;  2JMA A;  2DLP A;  1QLY A;  5FWC A;  1H92 A;  1UHC A;  4HCK A;  1ZBJ A;  4JJC A;  2J06 A;  3CQT A;  2GNC A;  1NM7 A;  4HVV A;  1NEB A;  1UGV A;  1XOV A;  1T0H A;  5EC7 A;  4RTT A;  2AZV A;  2QDL A;  1VA7 A;  1IO6 A;  2JTE A;  1X69 A;  4OMQ A;  3KFV A;  3VS4 A;  2AKL A;  1U06 A;  1ARK A;  1ZUU A;  1E7O A;  4K11 A;  1SEM A;  4F16 A;  2DRK A;  2BZY A;  2ED0 A;  3UAT A;  2EYY A;  2VVK A;  1B07 A;  3THK A;  2VKN A;  2MCN A;  2CT4 A;  1QWF A;  4HVW A;  1GBR A;  4D8D A;  2LJ0 A;  4LUE A;  4J9I A;  1CKA A;  3QWX X;  4IIM A;  1AWW A;  2FG0 A;  1FYN A;  2CUD A;  1TUD A;  1X6B A;  1GCQ A;  2ECZ A;  4AG1 C;  2CSI A;  2KGT A;  1QKX A;  2DL4 A;  3IQL A;  3NMZ C;  2CDT A;  1X43 A;  2FEI A;  2JT4 A;  4JZ4 A;  2PZ1 A;  3PE0 A;  1JU5 C;  3I5R A;  4CC4 B;  2FPD A;  1ZLM A;  2M0Y A;  1QWE A;  2F2W A; 
#chains in the Genus database with same CATH topology
 4XTW A;  2LT1 A;  1NEG A;  3ZBD A;  2O4X A;  4X9D A;  1AVZ C;  4OMF B;  2ZPB B;  3RR6 A;  2XDD A;  2LNV A;  4LDV A;  2D9T A;  4M77 D;  4Z8A A;  5FU7 B;  3LW5 E;  1SRL A;  4XU2 A;  1ZUY A;  1VQP A;  2P84 A;  2OAU A;  4PJN A;  1W1F A;  5GAM j;  1WA7 A;  2MPX C;  2GQI A;  2ATC B;  1HJD A;  2MWO A;  1E6H A;  2LX9 A;  2EVR A;  1GL5 A;  3F70 A;  1K9M U;  2MMP A;  1WHG A;  4D8K A;  1YJW Q;  4AFQ C;  4E2F B;  2LX7 A;  1Q7Y R;  1VQL A;  1V76 A;  2CP7 A;  2P4T A;  1UHF A;  1UJ0 A;  1ZA2 B;  2XIC A;  3JCM X;  4M7A A;  4M75 F;  5IH2 A;  1RI0 A;  4PFP A;  2KXD A;  3A8H B;  1VQL T;  1TH7 A;  5D6Y A;  3V7S A;  3U23 A;  4BAC A;  1VYV A;  4BI8 B;  3CCR T;  2DMO A;  1Q86 C;  1TS9 A;  2ZPG B;  1VQL Q;  3ZEH A;  2FB7 A;  1BIA A;  2YUQ A;  1UUE A;  3EG1 A;  3R6O A;  1BI1 A;  1D1A A;  2RN8 A;  4JRI A;  1NZ9 A;  2LJ1 A;  1VQ8 T;  2BIV A;  3VJP A;  2CKK A;  3A8G B;  2GGR A;  2DD4 A;  1TG0 A;  1LPL A;  2LQK A;  1GXI E;  1YCS B;  1PRM C;  1PRL C;  4PJO F;  4C0G A;  2KMT A;  1YIJ T;  4F17 A;  5CCA A;  2DEQ A;  3CCS A;  3OYB A;  1VQ4 Q;  1JQQ A;  2RM4 A;  1WFW A;  4XTY A;  1ZSZ C;  4DOV A;  2C0T A;  2KDS A;  3EGD A;  4RTU A;  1WJR A;  1AEY A;  1RAG B;  5CQX A;  3GNF B;  2JM9 A;  2PQW A;  3EGX B;  3H41 A;  1Z9Q A;  3FDR A;  2V8K A;  4FW2 A;  4M7D F;  2W10 A;  3MP8 A;  4N0A C;  2FZG B;  2MIO A;  1SHG A;  3QG1 A;  4XTZ A;  3CC4 T;  5LJ5 e;  4HCC A;  1YWO A;  2DL5 A;  2GQV A;  3NTH A;  4F7U E;  2COW A;  2D6F A;  1YN8 A;  3CD6 Q;  4IUV A;  4MDX A;  2L0A A;  5GAO q;  3S3N A;  4B9X A;  4DBF A;  2VWF A;  3JB9 J;  4EMH A;  3EAE A;  4HA8 A;  3I56 T;  1QP3 A;  2FYK A;  2X3W D;  1QVF A;  2A3L A;  2KRM A;  2B8A A;  1RAE B;  3I35 A;  4WTO B;  2X9H A;  1G3Y A;  1T3S A;  2O9V A;  2V1R A;  3VS5 A;  2RQW A;  1M3C A;  2JTF A;  2KAF A;  2KXC A;  1Q81 R;  3G71 Q;  2MWP A;  3I56 A;  1WNL A;  1VQK A;  2NUT B;  1HK9 A;  2COY A;  1K76 A;  4M78 F;  3QDR B;  1VQ4 T;  3QBY A;  1G83 A;  2DF6 A;  2AK5 A;  2KNB B;  4JZ3 A;  5IXF A;  2VV5 A;  3EGX A;  3EG3 A;  2DIG A;  1J3T A;  3EG9 A;  3VS2 A;  5CIU A;  5GJV B;  1G2B A;  5FU6 C;  2JZ2 A;  3JB9 I;  2FPE A;  4FIB A;  3CC2 Q;  2EGC A;  3EG2 A;  1ZSG A;  2RHX A;  2L3Q A;  1VQO T;  2L3S A;  4N4G A;  4PNO A;  1UDL A;  1RUW A;  1BI0 A;  3X26 B;  5CQY A;  1WHL A;  2ESW A;  2KR3 A;  4Y92 A;  4II1 A;  1M4Z A;  1OX8 A;  1ZX6 A;  3JV3 A;  1UGR B;  1MV0 B;  3CCE T;  2A7Y A;  2RQT A;  1K4U S;  3CC2 A;  3GPL A;  3GNG A;  2YSQ A;  1ZHI A;  3KUF A;  3SD4 A;  1X6O A;  3M0P A;  2L8D A;  2DNU A;  3WXM B;  4C92 G;  1D1B A;  3INZ A;  1G5V A;  4C8Q C;  2QEX A;  6AT1 B;  1WXB A;  4KGZ B;  2C06 A;  4R56 A;  4F7U A;  2ZPF B;  4NL3 A;  1KD1 C;  3C12 A;  4IUP A;  4KBM B;  1VQO Q;  2EAY A;  2DIL A;  3OY9 A;  1YHQ A;  2EW3 A;  5GAN 6;  3SWN B;  2ED1 A;  1M90 U;  4M77 B;  2K2M A;  5GAN 4;  4PJO B;  1FXX A;  2X51 A;  3BFM A;  1LCK A;  1RAC B;  3CMA Q;  4HT8 A;  1X75 C;  2D0N A;  1AWO A;  4B6M A;  3UF4 A;  1GCP A;  1CKB A;  1WPY A;  2VYT A;  3FJ5 A;  2GTO A;  4AT1 B;  2NWM A;  1I1J A;  2BE9 B;  2G6F X;  1BYM A;  3PTA A;  3M0U A;  9ATC B;  4M7D B;  2EYQ A;  1PHT A;  4AFZ C;  1JO8 A;  3FLG A;  3CCU Q;  4DQ2 A;  4ATO A;  2D0Q B;  3UPU A;  3TRE A;  3PMI A;  3G6E Q;  3A1P A;  4QVC A;  3TSZ A;  1TWB A;  1I5O B;  4JJB A;  2F1L A;  2K9G A;  1H3Z A;  1GFD A;  3OSS C;  2KRN A;  2NUP B;  5CKE A;  5J3B A;  2ZPI B;  3JCM J;  2O01 E;  3ZFJ A;  3OSV A;  4O6J A;  2LMJ A;  4F7U G;  4E7H A;  1NYG A;  2HAX A;  2RI5 A;  3G1J A;  3O5Z A;  1U5S A;  4ANJ A;  3EFS A;  4BB7 A;  4PJO A;  1N6A A;  2V8I A;  3EGU A;  2FHD A;  4M78 D;  2EYZ A;  3CPF A;  3EHR A;  1W2B S;  3NGP A;  5GJW B;  1FWZ A;  4BY6 C;  1VQ9 Q;  1N5Z A;  3CCS Q;  2JOY A;  4AG2 C;  5KYY B;  5GAO n;  2QA4 Q;  2LVM A;  1WHK A;  1QKW A;  1H64 1;  4HCZ A;  4M78 B;  2E3I A;  2XD0 A;  3M4G A;  3I9Q A;  4KUL A;  3EH1 A;  3PGG A;  1YJ9 A;  1YJW T;  1LVK A;  4J7I A;  4RG8 A;  4M7D A;  4PFZ A;  4A54 A;  2L89 A;  3JB9 D;  1OX9 A;  1NPP A;  4L59 A;  2HMA A;  3G4S T;  2EJF A;  5A0G A;  3M5A A;  1XTD A;  2KVQ G;  1PD1 A;  4M7A E;  3A8O B;  2R58 A;  2JTE A;  5A2Q E;  1YIT T;  7AT1 B;  3VS4 A;  1ARK A;  1U06 A;  3HSB A;  1ZUU A;  3CXC A;  4ZN1 A;  3QDF A;  5CAI A;  2QQ9 A;  4XK8 E;  2CYZ B;  2PU9 B;  1M2V A;  4JUV A;  2MCN A;  1QWF A;  1VQ8 Q;  3QO3 A;  4LUE A;  4J9I A;  1VQ6 T;  1CKA A;  3LGL A;  3QWX X;  2FG0 A;  5KYW A;  1FYN A;  3VYG A;  1X6B A;  4BI4 A;  4EMG A;  3VV0 A;  4AG1 C;  3MP1 A;  2E65 A;  1QKX A;  1OU9 A;  2CDT A;  3EFO B;  1VQN Q;  4J8O A;  4M7A B;  1OZ3 A;  4CC4 B;  2VXF A;  2QYZ A;  1FX7 A;  1ZLM A;  1QVF P;  2RHZ A;  2RHY A;  3OYE A;  2CZ7 B;  2DXB A;  2FPF A;  4HVU A;  4MZP A;  5GMK m;  3PFS A;  4CC2 A;  2O2O A;  3HRU A;  3MKD A;  4EMK B;  1NBE B;  2EIF A;  4C0D B;  1YCY A;  4MZT A;  3FIF A;  2E6Z A;  3L42 A;  4LE9 A;  2R5M A;  4XU0 A;  3A98 A;  1N8R C;  3JB9 G;  3L2U A;  4BY6 B;  4C0F A;  2JXB A;  1IGQ A;  1SPK A;  1TUC A;  4FW1 A;  4YTL A;  1Y0M A;  1B34 B;  3GLX A;  3C4S A;  4KT0 E;  1ZSZ A;  2CT3 A;  4EPC A;  3M54 A;  3I55 A;  5I21 A;  4NS5 A;  2CP6 A;  3G71 A;  2MF2 A;  3EG0 A;  4LD9 K;  1IB8 A;  2BZ8 A;  1MMG A;  2ZGW A;  3CCL Q;  4PLI A;  2CSQ A;  4RTZ A;  1K9M C;  2XI9 A;  1SKU B;  4OB1 B;  3SEM A;  5DY9 A;  2CP3 A;  4QW2 A;  1YNZ A;  2V8J A;  1W2B P;  1C0M A;  4DEX A;  2M51 A;  3TU4 K;  5LL6 S;  4NOY A;  4KUD K;  1OEB A;  1ACM B;  2J6O A;  4KGV B;  5C6S A;  4C8Q D;  1VQ7 Q;  2KRS A;  2RF0 A;  1UTI A;  1HD3 A;  2J7I A;  4GLM A;  2J6F A;  4FYV B;  4PL6 A;  5HY6 A;  3OYM A;  2D8J A;  2EJ9 A;  2QXF A;  4C8Q E;  5GMK j;  3RKX A;  1EX4 A;  4FYW B;  1RAI B;  3OYJ A;  1AZE A;  2JN0 A;  2RMO A;  1S72 T;  3L2Z A;  2KYB A;  3CC7 Q;  2PUO B;  3N5B B;  5CVI A;  1PSE A;  2VAS A;  2ZCF B;  2YUO A;  2E64 A;  3E2U A;  2EQM A;  2JS2 A;  2K79 A;  2W0Z A;  2XDB A;  5CK9 A;  2DA9 A;  4PFO A;  3M9Q A;  3CMA T;  1WJQ A;  3C94 A;  4RTX A;  5GAN 3;  1VQO A;  4FT2 A;  2HDA A;  5LJ3 d;  4IIO A;  3JCM c;  1OU8 A;  1WYX A;  4A4G A;  1BU1 A;  5D6X A;  1H3H A;  2NUZ A;  3MJX A;  4M77 E;  1K73 C;  4ORZ A;  2VC8 A;  2RHI A;  3RER A;  1OPK A;  4GBQ A;  1KK7 A;  2EGE A;  3QZ5 B;  4X9C A;  5GAN d;  2IG0 A;  2CP2 A;  2DVJ A;  2ZZD A;  4FSX A;  2JJ9 A;  4ELY C;  2D8H A;  2HNI A;  3VS1 A;  3OS0 A;  2OTL T;  3GOX A;  3L1A A;  1KQS P;  1WIE A;  3V7C A;  2XMF A;  4J9F A;  2H3J A;  2VXE A;  1WDX A;  5HKC A;  2AKK A;  2OTJ T;  2O4X B;  5GAM f;  5GAM g;  2FRW A;  3REA B;  4M7A F;  2BZX A;  1MNE A;  2RQR A;  1VIF A;  5KYN A;  2VGM A;  1NJI U;  1R0B G;  1C1A A;  2QG9 B;  2HKN A;  4CC7 A;  2RQV A;  3GBQ A;  4FYY B;  2PVG B;  1KC8 C;  1W70 A;  1B7T A;  1KFZ A;  1BCO A;  8AT1 B;  3AHU A;  1YIJ A;  2J6K A;  4M75 G;  1PKT A;  4E6R A;  1JEG A;  4JLG A;  3QXE B;  4Q5W A;  3V8J A;  5LJ5 j;  1Y96 A;  4ESR A;  3FB9 A;  2DYB A;  3OW2 P;  4PLL A;  2QTV A;  2C0I A;  2QGG A;  2EQK A;  4R55 A;  2FO0 A;  4Z88 A;  1D0Y A;  1TUG B;  3RES A;  3PVQ A;  1C6V X;  1S72 Q;  1KHI A;  3CBM A;  4WF2 A;  3M55 A;  4M75 C;  2E6N A;  4J9B A;  4QVD A;  2GTJ A;  1M8M A;  1AHJ B;  2H3E B;  1FMW A;  2EQI A;  4Y28 E;  3R6N A;  1LOJ A;  4M78 G;  3S6W A;  3EHQ A;  2YT6 A;  1KC8 R;  4LNP A;  5KYU B;  1HXD A;  3OA6 A;  1R0C B;  2XID A;  2DE0 X;  2JTM A;  4PKC C;  1PSF A;  3RMS A;  5ECA A;  2OI3 A;  3AT1 B;  1KSW A;  3H9N A;  3FEO A;  3JCM P;  3HFO A;  1M8V A;  4C92 A;  1ZUK A;  4XTU A;  2RPN A;  4E7Z A;  2WSF E;  3HTR A;  4M7D G;  4RCC A;  1M1K C;  4O5V A;  2IPO B;  4A53 A;  2E4H A;  2VUB A;  2I0N A;  2RK2 A;  3OS2 A;  4L5G A;  3FC3 A;  2EQU A;  3NPF A;  2CS7 A;  4R0K A;  2LC4 A;  3CCU T;  3M0S A;  1Y57 A;  4HXJ A;  4M7D C;  3CC2 T;  4E7J A;  4C92 D;  4A4K A;  4FYX B;  2LQN A;  4DEY A;  1K1Z A;  3VS3 A;  1XJW B;  1UEB A;  2M1H A;  2O31 A;  2PTK A;  4JRK A;  2YLB A;  4J7F A;  2XHC A;  3QYH B;  1JB0 E;  3OBW A;  5AYF A;  3M58 A;  2HQE A;  3CPW P;  5IAY A;  3L2R A;  3CPW A;  1YJ9 T;  3CCJ T;  4P5N A;  1VQN T;  1MMN A;  3PVL A;  4M77 C;  1UJY A;  4MDW A;  2M16 A;  2BE7 D;  2QEX Q;  3CCQ T;  3CCL T;  4CRI A;  3JCM h;  2YWW A;  3UA7 A;  4Z02 A;  3QKJ A;  4J5Y A;  3G6E A;  3OW2 A;  4KRT A;  1WZO A;  4M75 B;  3LYI A;  2LP5 A;  1ABQ A;  3JCM d;  2L2P A;  1KQ1 A;  3CCM T;  3S3O A;  2FL7 A;  4C5I A;  1AWX A;  1YI2 T;  4IUQ A;  1K73 R;  3G4S Q;  3QZ9 B;  4ME7 A;  1VQ6 A;  2K7A A;  2KQW A;  2LCL A;  1WHH A;  2K3B A;  5LJ3 g;  4DBH A;  2A37 A;  1Q82 R;  5GAN 8;  1Y71 A;  1VOM A;  2JMA A;  2R5A A;  3LLR A;  3CCU A;  2XU8 A;  3PMT A;  1H92 A;  2K5I A;  3CCQ A;  1K73 U;  1VQK T;  5M9O A;  2QQR A;  1NEB A;  1UGV A;  5DLQ E;  2VGN A;  4EMK A;  4IUU A;  3OS5 A;  5GMK h;  3LGF A;  5EC7 A;  3UT1 A;  3ER0 A;  3QII A;  1VQ5 T;  3J80 E;  2AZV A;  1N27 A;  2JUF A;  1IO6 A;  4L6V 5;  4OB2 B;  3KFV A;  4J6X A;  1E7O A;  4K11 A;  4F16 A;  4LDU A;  2DRK A;  3RDV A;  2CZ1 B;  2ED0 A;  4M75 A;  1B34 A;  1IRX A;  2EYY A;  4EMK C;  3THK A;  2VKN A;  2K57 A;  2CT4 A;  2KK4 A;  4D8D A;  2LJ0 A;  4C92 E;  4M78 E;  3CC4 Q;  3E1S A;  2ECZ A;  4B9W A;  5KYX B;  3DB4 A;  3QJY A;  3IQL A;  1P92 A;  3NMZ C;  4C0Z A;  3MO8 A;  1X43 A;  3P8H A;  3HHT B;  3PE0 A;  2Y90 A;  5KCO A;  3OQ5 A;  1PC0 A;  4PJM A;  1LJO A;  2F2W A;  3C95 A;  2X4W A;  4J6W A;  2EBP A;  4BE2 A;  4M7D D;  3P8D A;  3VUB A;  3OMG A;  1TOV A;  4M7A C;  1YWP A;  2SEM A;  1NE8 A;  3MEV A;  3DLL A;  1YJN Q;  2KT8 A;  1M5Q 1;  1GBQ A;  5FU7 C;  4ZGD B;  2QGF B;  3OYD A;  4GY5 A;  3CCM Q;  2X35 A;  4LD6 A;  5CR2 A;  3GF5 A;  2XKO C;  1D0Z A;  1VYU A;  1WX6 A;  2EYW A;  4JPB W;  2M02 A;  2VB6 A;  3H8Z A;  2YDL A;  2OTL Q;  2EWN A;  1YP5 A;  3BW1 A;  1T3L A;  1Q81 C;  5GAO l;  4PJO D;  3X28 B;  2DZC A;  2E3H A;  4ZTF A;  1NJI R;  3V7R A;  1NYF A;  4OML A;  1KC8 U;  1N9S A;  1UGQ B;  2QI2 A;  3KBG A;  3MEW A;  2COZ A;  2DEU A;  5GAN 7;  3C0C A;  1N9R A;  2RO0 A;  5J39 A;  3H0I A;  1VQN A;  4OMO A;  1B3Q A;  1OI1 A;  3VS6 A;  1Q7Y U;  3UWN A;  2OTJ Q;  3JCM W;  3J7A F;  1PWT A;  3LH5 A;  2ROL A;  2LCC A;  4M75 D;  2JMC A;  2DM1 A;  4ZGE B;  3HL8 A;  3A8M B;  1K8A U;  3QYG B;  4RMO A;  4WCI A;  1TTH B;  1WXT A;  1RLP C;  5HCK A;  3G71 T;  3QJ6 A;  5LJ3 f;  1E6G A;  2FZK B;  3JCM V;  2LQW A;  2X3X D;  5HK3 A;  2A36 A;  4F7U B;  3CC7 A;  4OVA A;  5GAN 5;  2K5F A;  1JRI A;  2EKO A;  1SSH A;  1KD1 R;  2LCS A;  4KH0 B;  2HEQ A;  3RKY A;  4TVR A;  4RKU E;  4C8Q G;  1QCN A;  1M9S A;  1SSF A;  1VQM Q;  2QQB A;  3M53 A;  5DM7 R;  3CCV A;  4OGC A;  1BCM A;  1YFN A;  3QPH A;  3CME Q;  3A5Z B;  4OMM A;  1M3A A;  1V1C A;  2AHJ B;  5LJ3 h;  1OOT A;  5GMK l;  2F5K A;  1M90 R;  1KQS S;  1M3B A;  1VQP Q;  1WHJ A;  5GAN 2;  5A0L A;  1QVG A;  3WVD B;  2V1Q A;  2C0O A;  2DJZ A;  4PJO C;  3QHS A;  4J9G A;  2DER A;  2PNI A;  2DBM A;  1VQ9 T;  1QVF S;  2K5L A;  3CCS T;  1K0X A;  2YUN A;  3CCR A;  3VS7 A;  1W6X A;  5IHI A;  1PKS A;  1EZZ B;  3M56 A;  2FZC B;  3P8B B;  4FSS A;  2PUK B;  2NLU A;  1T0J A;  5GAM d;  1UEC A;  2PVO B;  3CMA A;  2QTX A;  2CH4 A;  3L2W A;  5FWB A;  1KQ2 A;  2HSP A;  1TSF A;  4IUT A;  1GCQ C;  4QQD A;  5IN1 A;  4MZM A;  1I0C A;  1KG1 A;  4EIK A;  4C92 B;  1YI2 Q;  2LZ6 B;  4M77 G;  3X24 B;  1U8R A;  4ZNX A;  4N0A A;  3URG A;  4C5H A;  1TXQ A;  2DYI A;  1Q86 U;  4RTY A;  4C8Q A;  4OMP A;  2QA4 A;  1U1T A;  1JXM A;  1VQM T;  1Y7X A;  1YIJ Q;  2R57 A;  3TCJ A;  1RI9 A;  5KYY A;  2RB6 A;  1UGS B;  2HSE B;  4M78 A;  4XU3 A;  2YLC A;  2JM8 A;  1VQ6 Q;  4XAX B;  3UDC A;  2J05 A;  1I8F A;  4XTX A;  2V26 A;  2CGH A;  2DL7 A;  3V8L A;  3J81 E;  1IGU A;  1Q95 G;  4A4E A;  1S1N A;  3CC4 A;  3VYH B;  3PIO A;  2F2X A;  4JRQ A;  2BKD N;  4FU6 A;  1RAH B;  2JS0 A;  1JJ2 P;  1UB4 A;  3VRY A;  3CCQ Q;  2RH2 A;  1JJ2 A;  4Z89 A;  3MPU B;  4RUG A;  3SB2 A;  5FRO A;  2DXC A;  3RMQ A;  5GAN h;  3BE3 A;  3HPW A;  4DA4 A;  3CBP A;  4BUG A;  4A63 B;  2KT1 A;  2E12 A;  2ZPH B;  3CCJ A;  2DD5 A;  1Y07 A;  3T9N A;  1K9A A;  1IXD A;  2L5Q A;  1YJ9 Q;  2KEA A;  2EYX A;  2JW4 A;  4FL6 A;  5L8R E;  1AT1 B;  4DOW A;  3CXC P;  1WJS A;  2EGA A;  2NYS A;  4QT7 A;  1I5L A;  2JVV A;  3LWI A;  3M57 A;  1VQ4 A;  2E5Q A;  4F7U F;  1WI7 A;  5I11 A;  3EFO A;  1ZA1 B;  3CCJ Q;  1MGQ A;  4OGE A;  1MMD A;  4JJN K;  4A4H A;  2DTH A;  2M9U A;  2XG8 D;  1G3S A;  1EFN A;  1GFC A;  1NLO C;  1BBZ A;  2ROT A;  2P4R A;  4OB0 B;  2AIR B;  2OJ2 A;  5CKB A;  4ZN3 A;  2RK1 A;  3HP9 A;  3RUX A;  3M59 A;  5GMK e;  2MYS A;  4CC3 A;  4E7K A;  2GCX A;  2RHU A;  1YJN A;  2QQA A;  3TVT A;  3DB3 A;  3CD6 T;  1Z9Z A;  4GLK A;  3OS1 A;  1VQ7 T;  2RQU A;  2IVW A;  1D3B B;  4RTW A;  2DKG A;  2RI3 A;  1SF9 A;  4LUD A;  2DVE A;  5LJ5 f;  1ZSZ B;  2KRO A;  5LJ5 g;  4VUB A;  3RNJ A;  5GAN e;  3OYY A;  2RNA A;  2WSC E;  3TEE A;  1N8R R;  2YXY A;  2EPD A;  1MND A;  3LWH A;  2ABL A;  3VRZ A;  2YRD A;  1GRI A;  2Y4X A;  3JCM g;  4JRP A;  1VQ5 Q;  2NUT A;  1YIT A;  1ZQ1 A;  3HRS A;  3M0T A;  4XQ3 A;  1VQK Q;  3OW2 S;  4PK4 A;  1F1B B;  2AT1 B;  3O8V A;  4C92 F;  1Q7Y C;  2E5K A;  1MMA A;  3X20 B;  1O9S A;  2HKQ B;  5KYX A;  4M75 E;  2HCK A;  3RIR A;  4J6Y A;  2RD1 A;  2DTO A;  4LDY A;  2DLP A;  1K8A C;  2PVD B;  2F5T X;  4A4F A;  1UHC A;  4HCK A;  4IUR A;  1YHQ Q;  5KCH A;  3CCL A;  2DXU A;  2DK3 A;  4PJJ A;  1NM7 A;  1D3B A;  1XOV A;  1WGS A;  1T0H A;  1RAF B;  3PNW C;  3MHX A;  1RAB B;  5KYU A;  1KHC A;  1VA7 A;  2E41 A;  1X69 A;  3OYN A;  4C8Q F;  4PJO E;  2QQS A;  2AKL A;  1SEM A;  2HD0 A;  2HQX A;  1QMC A;  2BZY A;  2QEX T;  2HL5 C;  3UAT A;  1VQ7 A;  1V29 B;  2VVK A;  1B07 A;  3RKW A;  1QVG P;  3VU3 C;  1X01 A;  2YRV A;  1VUB A;  2DFU A;  4HVW A;  1GBR A;  2XK0 A;  3EGD B;  3X25 B;  1KD1 U;  1AWW A;  4IIM A;  2CUD A;  1TUD A;  3BY7 A;  2DIQ A;  2L3R A;  3MET A;  3OYG A;  4JDS A;  4V2S A;  1R8O B;  1RL2 A;  5GAM e;  4JS5 A;  3G4S A;  2QAS A;  4F04 B;  3CME A;  3V8K A;  5IT9 E;  2DL4 A;  3CEY A;  1YJW A;  2KY9 A;  4M7D E;  2JT4 A;  1RAA B;  2X4J A;  1RAD B;  3I5R A;  1YBY A;  4D6W A;  1QWE A;  3EH2 A;  5CKD A;  4CI0 C;  4M77 F;  5FW9 A;  3LX7 A;  1NLP C;  1UG1 A;  1K8A R;  5EG2 A;  4RG2 A;  1MV3 A;  5FU6 B;  2LTO A;  2ZPE B;  2JNG A;  3H0H A;  2KYM A;  3H0F A;  2DJQ A;  2GBQ A;  1OPL A;  1NPR A;  4Y91 A;  2HBW A;  1BB9 A;  3PIP A;  1N8R U;  1WHM A;  2CZ0 B;  1SRM A;  1VIE A;  4QVZ A;  3E19 A;  3RBB B;  3SFM A;  4C92 C;  4JJD A;  3ULR B;  1LNX A;  5GAN g;  1OYX A;  5GAN f;  1EIF A;  5IHN A;  2DO3 A;  2NUP A;  4M7A D;  1PNJ A;  2K6D A;  1SHF A;  1OUL A;  3OB9 A;  2D1X A;  2ZAE A;  2P0K A;  2CRE A;  4RTV A;  1S72 A;  1M27 C;  1QVP A;  4FM4 B;  1UGP B;  3EG9 B;  5I22 A;  1W4S A;  4QQ6 A;  5GMK i;  3M0R A;  1IRE B;  3TQ7 P;  1OZ2 A;  3OYI A;  5DLO A;  2F69 A;  2MI6 A;  3PT9 A;  1A0N B;  4J9E A;  3E9F A;  2RJF A;  5KE3 A;  2EFI A;  4E7L A;  4UC4 A;  1G8X A;  5J26 A;  3OYA A;  3OYL A;  2DBK A;  1PM3 A;  2OTJ A;  4J9C A;  4AFU C;  1CSK A;  2DL3 A;  2AZS A;  5GAO m;  5L23 A;  1AD5 A;  5GAO r;  2QDY B;  4J9D A;  3QWY A;  3CCM A;  8ATC B;  2OTL A;  3MEU A;  2H8H A;  1IZ6 A;  1WLP B;  2RA2 A;  2HZY A;  1H8K A;  2A0F B;  2DRM A;  2CUB A;  3A8L B;  1M1F A;  2LQ8 A;  3I5S A;  1U3O A;  5HK0 A;  1UE9 A;  3OYH A;  2RJD A;  1AZG B;  5LJ5 h;  3KXT A;  1D1C A;  2LJ3 A;  1X27 A;  3JB9 F;  1RLQ C;  1IHV A;  3OMC A;  1QVG S;  3E9G A;  3OYF A;  4M77 A;  1M2V B;  2KI7 A;  2L3P A;  4BE0 A;  3REB B;  2DTI A;  3WVE B;  4M78 C;  2DAQ A;  4C8Q B;  1M1K R;  5A0D A;  1NJI C;  1X6G A;  1HSQ A;  4C5E A;  1VQ8 A;  4LXC A;  1MUZ A;  2X4Y A;  3MEA A;  3BDU A;  3TSW A;  2DZ9 A;  4KUI A;  1ABO A;  4KH1 B;  4HT9 A;  1JBM A;  1BI3 A;  1WQW A;  2K4Y A;  1D09 B;  1KQS A;  4C0D C;  1WQ7 A;  3ME9 A;  5LJ3 j;  1Q86 R;  3CCR Q;  3GP8 A;  2B86 A;  4FT4 A;  3G7Z A;  1I81 A;  4OMN A;  4F14 A;  1Q82 U;  1MHN A;  5KE2 A;  5GAM h;  4QKU A;  1O75 A;  2OAW A;  2K2V A;  1OV3 A;  3OBY A;  1JXO A;  1VQM A;  3JSC A;  3MP6 A;  5IXB A;  1K9M R;  2FRY A;  1QP2 A;  3LH0 A;  3CC7 T;  4FCY A;  2A08 A;  5D7U A;  1YI2 A;  3QUI A;  4NL2 A;  2A28 A;  3HKS A;  4BI3 A;  1YIT Q;  2DX1 A;  4AMC A;  3NHN A;  3CCV Q;  1AOJ A;  1DJ7 B;  3UA6 A;  4KGX B;  3M0Q A;  4XTV A;  4OP0 A;  3OYC A;  5FLX E;  5CKF A;  4E7S A;  1PCX A;  2KBT A;  1FMK A;  2GFU A;  1QCF A;  1JJ2 S;  5D6W A;  4EDU A;  4JLI A;  3FRN A;  4X1V A;  5LJ3 e;  1YHQ T;  2HL3 A;  2M0O A;  1Q82 C;  4LDX A;  2HQH A;  2RI2 A;  1K0S A;  4M7A G;  3QSU A;  3S3M A;  1ZBX A;  1QCO A;  3NTI A;  1XNI A;  2SRC A;  1BI2 A;  1KJW A;  3Q1J A;  2DL8 A;  3JCM e;  5FRN A;  3FJP A;  4J9H A;  3BDL A;  3JB9 H;  1I07 A;  2X4X A;  1QW1 A;  2BUD A;  2IIM A;  1PD0 A;  5CKH A;  1UFF A;  4HKE A;  4BDZ A;  1HYO A;  4C5G A;  4DBQ A;  4ZGJ B;  2GFA A;  3OYK A;  2KE9 A;  1M1G A;  3CCE Q;  5KYW B;  1BIB A;  1M1K U;  1X2K A;  2F2V A;  2LDM A;  2EKH A;  2QAZ A;  2XDP A;  2I2L A;  3CCV T;  2QK0 A;  4MML A;  2CH4 W;  5GAN j;  1D0X A;  1WXU A;  2E10 A;  1VYT A;  4E7I A;  1M30 A;  1R77 A;  4BE1 A;  1QQJ A;  1AWJ A;  2BTT A;  1PG5 B;  3CCE A;  3CPW S;  3ZL7 C;  3CD6 A;  2YHT A;  1G3W A;  2ENM A;  2CZ6 B;  2E70 A;  2P0Q A;  1FMV A;  2GF7 A;  5IHK A;  5GAO p;  4LN2 A;  3MCA B;  3NTK A;  3DLM A;  3L2Q A;  3DKM A;  4BD3 A;  2LNH B;  4N4H A;  4IKF A;  3SWN C;  1M2O A;  1OQK A;  3VUZ A;  3CBO A;  1Q81 U;  2O9S A;  2EQJ A;  5LJ5 d;  3VS0 A;  2YUP A;  2HBP A;  1W2B A;  4QQG A;  3I56 Q;  2RJC A;  4OB3 B;  1NG2 A;  3SHW A;  4BDY A;  2E1H A;  2FVU A;  3M4Y A;  4XU1 A;  1KIK A;  2P0P A;  3JCM f;  3SWN A;  4PJL A;  4MMK A;  1VQ9 A;  2MOX A;  5I2M A;  1I4K 1;  1Y96 B;  1VQ5 A;  3SDZ A;  3JCM b;  4M4Z A;  3H6Z A;  1IHW A;  2K3Y A;  3GIB A;  4AFS C;  1BK2 A;  2OX7 A;  2CP0 A;  3JAM E;  4J83 A;  2RJE A;  1YJN T;  3JCM Q;  2DXT A;  4HCB A;  1TU0 B;  2DPP B;  2O88 A;  1U1S A;  3CME T;  1X2Q A;  3G6E T;  1QLY A;  2LT4 A;  5FWC A;  2YRC A;  1ZBJ A;  4JS4 A;  2G3R A;  4JJC A;  5I2S A;  2EJG A;  2J06 A;  3CQT A;  2GNC A;  3HFN A;  4OF1 A;  1BKB A;  2K3X A;  2WSE E;  5C0M A;  4HVV A;  5AT1 B;  1G3T A;  4LDW A;  3HRT A;  4N4I A;  2LRQ A;  4RTT A;  2DET A;  3NFC A;  2QDL A;  2QA4 T;  4E47 A;  3I55 T;  4OMQ A;  3D7S B;  4RCB A;  3I55 Q;  3VKI A;  2Z0W A;  2MAM A;  2KSS A;  3EFR A;  5KH6 A;  1XQH A;  2CP5 A;  4ELZ C;  5CO7 A;  4ZTJ A;  1VQP T;  5FRM A;  3CXC S;  1GCQ A;  2CSI A;  2KGT A;  1M90 C;  4PJO G;  2WAC A;  3ASK A;  3JRZ A;  2FEI A;  3L2V A;  4JZ4 A;  4DBR A;  2PZ1 A;  2Y4Y A;  1JU5 C;  2MK5 A;  4X34 A;  2FPD A;  1SG5 A;  2M0Y A; 
#chains in the Genus database with same CATH homology
 5FW9 A;  1NLP C;  1UG1 A;  2EBP A;  2FPF A;  1NEG A;  1MV3 A;  4HVU A;  4CC2 A;  1YWP A;  2SEM A;  2O2O A;  2KT8 A;  3H0H A;  1AVZ C;  1GBQ A;  2KYM A;  3H0F A;  2DJQ A;  2GBQ A;  4LE9 A;  1OPL A;  2HBW A;  3A98 A;  1BB9 A;  4Z8A A;  2JXB A;  1SPK A;  1SRM A;  1SRL A;  1VYU A;  1TUC A;  1WX6 A;  2EYW A;  1ZUY A;  4JPB W;  3RBB B;  2YDL A;  1Y0M A;  4JJD A;  3ULR B;  1W1F A;  1WA7 A;  1YP5 A;  2CT3 A;  1T3L A;  2GQI A;  5IHN A;  1HJD A;  1PNJ A;  2K6D A;  1SHF A;  3EG0 A;  1E6H A;  2BZ8 A;  2D1X A;  2EVR A;  1GL5 A;  2CRE A;  4RTV A;  1M27 C;  4D8K A;  1NYF A;  2CSQ A;  4RTZ A;  4AFQ C;  5I22 A;  4OML A;  2LX7 A;  3SEM A;  3M0R A;  1YNZ A;  1UHF A;  1UJ0 A;  4DEX A;  2M51 A;  3C0C A;  1A0N B;  3H0I A;  4J9E A;  4OMO A;  1B3Q A;  1OEB A;  3VS6 A;  5IH2 A;  2J6O A;  2KXD A;  1PWT A;  3U23 A;  1VYV A;  3LH5 A;  2ROL A;  2KRS A;  2RF0 A;  1UTI A;  1HD3 A;  2DBK A;  2DMO A;  2J7I A;  4GLM A;  2JMC A;  2DM1 A;  2J6F A;  4J9C A;  4AFU C;  1CSK A;  2DL3 A;  2AZS A;  2D8J A;  2YUQ A;  4WCI A;  1UUE A;  3EG1 A;  1WXT A;  5L23 A;  1AD5 A;  1AZE A;  2RMO A;  2RN8 A;  4J9D A;  1RLP C;  3QWY A;  5HCK A;  2LJ1 A;  2KYB A;  2GGR A;  1TG0 A;  1E6G A;  2H8H A;  1WLP B;  1YCS B;  2LQW A;  1PRM C;  1PRL C;  1H8K A;  2X3X D;  2DRM A;  2CUB A;  2A36 A;  2YUO A;  4F17 A;  3I5S A;  1U3O A;  1SSH A;  1UE9 A;  2JS2 A;  2K79 A;  2W0Z A;  1AZG B;  2DA9 A;  2LCS A;  1JQQ A;  2HEQ A;  2LJ3 A;  1WFW A;  1X27 A;  4RTX A;  1RLQ C;  2HDA A;  2C0T A;  2L3P A;  4IIO A;  3REB B;  4RTU A;  1AEY A;  1WYX A;  1BU1 A;  2JM9 A;  4OMM A;  1X6G A;  1H3H A;  3H41 A;  1HSQ A;  1M3A A;  1V1C A;  2NUZ A;  1Z9Q A;  1OOT A;  4ORZ A;  2W10 A;  2MIO A;  1M3B A;  1MUZ A;  1SHG A;  1OPK A;  4GBQ A;  2EGE A;  3TSW A;  1YWO A;  2DL5 A;  2C0O A;  2V1Q A;  1ABO A;  4J9G A;  1YN8 A;  2DVJ A;  2PNI A;  2DBM A;  2D8H A;  3VS1 A;  2L0A A;  1K0X A;  1WIE A;  2YUN A;  2XMF A;  3VS7 A;  4J9F A;  1W6X A;  5IHI A;  1PKS A;  1WDX A;  2AKK A;  4FSS A;  2VWF A;  1T0J A;  2FRW A;  3REA B;  1UEC A;  2BZX A;  2X3W D;  2B86 A;  2CH4 A;  2RQR A;  5FWB A;  4OMN A;  2HSP A;  2KRM A;  4F14 A;  3I35 A;  1GCQ C;  1T3S A;  2OAW A;  4CC7 A;  2O9V A;  1OV3 A;  2V1R A;  2RQV A;  3VS5 A;  1I0C A;  2RQW A;  1M3C A;  3GBQ A;  1JXO A;  2KXC A;  4EIK A;  1W70 A;  2LZ6 B;  1KFZ A;  5IXB A;  2FRY A;  4ZNX A;  2J6K A;  1K76 A;  2A08 A;  1PKT A;  4E6R A;  1JEG A;  2A28 A;  4RTY A;  1G83 A;  2DF6 A;  2AK5 A;  2KNB B;  4OMP A;  4JZ3 A;  4ESR A;  2DX1 A;  1JXM A;  3NHN A;  2DYB A;  5IXF A;  1AOJ A;  2C0I A;  3EG3 A;  1J3T A;  3UA6 A;  3M0Q A;  3VS2 A;  5GJV B;  1G2B A;  1RI9 A;  2FO0 A;  4Z88 A;  2FPE A;  3PVQ A;  2EGC A;  3EG2 A;  1ZSG A;  2JM8 A;  2KBT A;  1FMK A;  2L3Q A;  2L3S A;  1QCF A;  2J05 A;  1UDL A;  4J9B A;  4X1V A;  1RUW A;  2GTJ A;  2DL7 A;  1M8M A;  2ESW A;  1K0S A;  2KR3 A;  4Y92 A;  1S1N A;  2EQI A;  2F2X A;  3R6N A;  2JS0 A;  1ZX6 A;  3JV3 A;  1MV0 B;  3VRY A;  3EHQ A;  2YT6 A;  4Z89 A;  1K4U S;  2RQT A;  2SRC A;  4LNP A;  4RUG A;  1KJW A;  2YSQ A;  2DE0 X;  5ECA A;  2DL8 A;  2OI3 A;  1KSW A;  4J9H A;  3M0P A;  2DNU A;  4A63 B;  1I07 A;  2KT1 A;  2IIM A;  1ZUK A;  1WXB A;  1UFF A;  2RPN A;  1K9A A;  2KEA A;  2KE9 A;  2EYX A;  2JW4 A;  2DIL A;  1X2K A;  2F2V A;  2EW3 A;  2EGA A;  4QT7 A;  2ED1 A;  2EKH A;  2I0N A;  2K2M A;  1LCK A;  2CH4 W;  1WI7 A;  5I11 A;  3NPF A;  1WXU A;  4R0K A;  1VYT A;  2D0N A;  1M30 A;  1AWO A;  3UF4 A;  3M0S A;  1Y57 A;  1GCP A;  1CKB A;  4HXJ A;  1AWJ A;  2BTT A;  1EFN A;  3ZL7 C;  1GFC A;  3FJ5 A;  2GTO A;  1NLO C;  1BBZ A;  2ROT A;  2P4R A;  4DEY A;  2ENM A;  2LQN A;  1K1Z A;  3VS3 A;  2NWM A;  2OJ2 A;  1I1J A;  2O31 A;  2PTK A;  2G6F X;  5IHK A;  4CC3 A;  3M0U A;  4LN2 A;  1PHT A;  3TVT A;  4AFZ C;  1JO8 A;  1Z9Z A;  2RQU A;  4RTW A;  3PVL A;  2LNH B;  1UJY A;  2O9S A;  4LUD A;  3TSZ A;  2KRO A;  4JJB A;  3VS0 A;  2K9G A;  3RNJ A;  2YUP A;  1GFD A;  2KRN A;  2RNA A;  3UA7 A;  4KRT A;  2EPD A;  1NG2 A;  2ABL A;  3VRZ A;  3SHW A;  1GRI A;  2LP5 A;  2LMJ A;  1ABQ A;  1KIK A;  1NYG A;  2L2P A;  3O5Z A;  1U5S A;  3EGU A;  3M0T A;  1AWX A;  2MOX A;  2EYZ A;  3EHR A;  3NGP A;  5GJW B;  4M4Z A;  4AFS C;  2E5K A;  1N5Z A;  1BK2 A;  4AG2 C;  1QKW A;  2K7A A;  2HCK A;  2K3B A;  2O88 A;  2A37 A;  3I9Q A;  1X2Q A;  2JMA A;  2DLP A;  1QLY A;  5FWC A;  1H92 A;  1UHC A;  4HCK A;  1ZBJ A;  4JJC A;  2J06 A;  3CQT A;  2GNC A;  1NM7 A;  4HVV A;  1NEB A;  1UGV A;  1XOV A;  1T0H A;  5EC7 A;  4RTT A;  2AZV A;  2QDL A;  1VA7 A;  1IO6 A;  2JTE A;  1X69 A;  4OMQ A;  3KFV A;  3VS4 A;  2AKL A;  1U06 A;  1ARK A;  1ZUU A;  1E7O A;  4K11 A;  1SEM A;  4F16 A;  2DRK A;  2BZY A;  2ED0 A;  3UAT A;  2EYY A;  2VVK A;  1B07 A;  3THK A;  2VKN A;  2MCN A;  2CT4 A;  1QWF A;  4HVW A;  1GBR A;  4D8D A;  2LJ0 A;  4LUE A;  4J9I A;  1CKA A;  3QWX X;  4IIM A;  1AWW A;  2FG0 A;  1FYN A;  2CUD A;  1TUD A;  1X6B A;  1GCQ A;  2ECZ A;  4AG1 C;  2CSI A;  2KGT A;  1QKX A;  2DL4 A;  3IQL A;  3NMZ C;  2CDT A;  1X43 A;  2FEI A;  2JT4 A;  4JZ4 A;  2PZ1 A;  3PE0 A;  1JU5 C;  3I5R A;  4CC4 B;  2FPD A;  1ZLM A;  2M0Y A;  1QWE A;  2F2W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...