4RTWA

Crystal structure of the c-src-sh3 domain e93v/q128r mutant in complex with the high affinity peptide app12
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
57
structure length
57
Chain Sequence
TFVALYDYVSRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene tyrosine-protein kinase Src
publication title Crystal structure of the c-Src-SH3 domain E93V/Q128R mutant in complex with the high affinity peptide APP12
rcsb
source organism Gallus gallus
molecule tags Protein binding
total genus 13
structure length 57
sequence length 57
chains with identical sequence C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4rtwA00
4F17A 1YWPA 3SEMA 2DM1A 2JMCA 2RQVA 2PNIA 2XMFA 2CUBA 3VS5A 2C0OA 2DBKA 3EGUA 2DBMA 1ZUYA 4R0KA 2CDTA 4GBQA 5FWCA 1E7OA 2RQUA 2DNUA 2AZSA 3H0FA 2O88A 2KXCA 2EGCA 3U23A 4ESRA 4F16A 2HDAA 2HSPA 2G6FX 1QCFA 2EYYA 1K0XA 1B3QA 4Y92A 1M30A 2EQIA 3VRYA 1JEGA 1UJYA 2FEIA 4OMMA 1J3TA 2RQTA 3ZL7C 2C0TA 2F2VA 1QWFA 1QKWA 1NM7A 2AK5A 4CC2A 2EYZA 1T0JA 2B86A 2ROLA 3NHNA 2V1QA 1WXUA 5IHNA 2AZVA 5FWBA 4AG2C 2KR3A 3M0PA 1H3HA 3UA6A 2GBQA 4D8DA 4RTVA 2K7AA 1IO6A 1JXOA 1NEGA 2CT4A 2DL8A 1K0SA 2LZ6B 1RUWA 2JXBA 1MUZA 3RBBB 2L0AA 1I0CA 2JM9A 1PKTA 2KXDA 1M3CA 3GBQA 1HJDA 1K76A 4OMNA 2FPEA 1GBRA 3REBB 1PKSA 2LX7A 1WXTA 4RTZA 4LUEA 4OMOA 3O5ZA 5IXFA 4ZNXA 4AFZC 1YNZA 3M0RA 2OAWA 4RTYA 2X3WD 1BBZA 1VA7A 2J6OA 2M0YA 4JPBW 1AD5A 4KRTA 2GTJA 2IIMA 3A98A 1KJWA 1T0HA 2D8JA 3TSZA 1X43A 1X6GA 1X6BA 4ORZA 1U3OA 1ABOA 2A28A 2ECZA 3I5SA 1KIKA 5I11A 1NEBA 1UE9A 2EGEA 1GL5A 3M0TA 4OMQA 2KT8A 4CC7A 1RLPC 2BZYA 1RLQC 1SPKA 2ESWA 1KSWA 2VVKA 2LQWA 3JV3A 2L3PA 1SRLA 4IIMA 1AOJA 4J9EA 2K2MA 1BB9A 1PRLC 4FSSA 2CH4W 2DL3A 2A36A 3NMZC 2FPDA 1AWOA 1UGVA 2VWFA 2HCKA 4RUGA 2L3SA 2DRMA 2DL4A 1PWTA 1YWOA 1ZX6A 1UHFA 2RN8A 2KGTA 2YUQA 1GFCA 4JJDA 4QT7A 2O9SA 4JZ3A 4DEYA 4F14A 1AWWA 5L23A 2I0NA 2EYWA 1WIEA 1ABQA 2PZ1A 2M51A 1SSHA 1PNJA 4RTUA 4RTWA 3VS1A 5GJVB 2RQRA 1MV3A 2KBTA 1JXMA 2BZ8A 1YP5A 2L3QA 4Z8AA 3EHRA 1T3SA 1VYTA 3SHWA 3ULRB 4AG1C 2JT4A 1Z9QA 2DMOA 2HBWA 2RPNA 2YSQA 3UA7A 2CUDA 1YCSB 1Z9ZA 3CQTA 1WXBA 3H41A 2KYBA 3VS2A 2OJ2A 2DX1A 2A37A 1E6HA 2ABLA 3TVTA 1FMKA 3UF4A 2W10A 1UUEA 4DEXA 1UHCA 2KEAA 2YT6A 3PVLA 4JZ4A 2DJQA 2O9VA 1JU5C 2EBPA 1TUCA 2E5KA 3EG3A 1SEMA 5IHIA 2LJ0A 3IQLA 2JS0A 2SEMA 3M0QA 2FPFA 1AWJA 2AKKA 2AKLA 3H0IA 3EG1A 2YDLA 3PE0A 3FJ5A 1Y57A 4LNPA 1ZSGA 1M8MA 4JJBA 3EG2A 1I1JA 1LCKA 1WI7A 1UFFA 1EFNA 4GLMA 3M0UA 3LH5A 2D1XA 1SHGA 1W1FA 4AFQC 1ZBJA 3VRZA 4LN2A 1NLOC 4X1VA 2DF6A 2F2WA 1M3BA 1ZLMA 3RNJA 1CKBA 4M4ZA 2RNAA 2J7IA 3VS0A 1AZEA 1X2KA 1NYFA 1U5SA 2DL5A 2BTTA 1QWEA 2J6KA 4Z89A 2C0IA 2RMOA 1UJ0A 1K9AA 1T3LA 1WLPB 1AVZC 1X69A 2KT1A 1ARKA 1PRMC 2K79A 1ZUUA 3VS6A 1HD3A 3UATA 3REAB 2LQNA 2K3BA 3I35A 4HVWA 2LP5A 5IHKA 2KYMA 4OMPA 3C0CA 3THKA 5HCKA 2DYBA 1BU1A 2DILA 1H8KA 2VKNA 1H92A 3H0HA 1AEYA 2JW4A 2PTKA 1GFDA 1X27A 2L2PA 2CH4A 4LE9A 2V1RA 1B07A 1A0NB 2DRKA 4D8KA 1K4US 1E6GA 4J9BA 5FW9A 1UECA 2EPDA 3PVQA 2CSQA 1OOTA 4CC3A 2FO0A 1RI9A 2CREA 3M0SA 4Z88A 1SRMA 2YUPA 1AZGB 1G83A 2O31A 2W0ZA 2EVRA 4WCIA 1JO8A 3VS4A 2KRNA 2JS2A 1VYUA 4RTTA 3I9QA 2JMAA 2DA9A 1UDLA 2LJ3A 1QKXA 2ROTA 1HSQA 1GCQA 1Y0MA 2O2OA 1AWXA 1U06A 2QDLA 2EGAA 1X2QA 3QWYA 4J9CA 1GCPA 1NG2A 1OPKA 1WA7A 1XOVA 2MIOA 2LJ1A 1GRIA 1K1ZA 2JM8A 2KRMA 2A08A 2KRSA 2GNCA 2GGRA 3NGPA 2MCNA 1FYNA 1WDXA 1TUDA 2BZXA 2LMJA 1ZUKA 2ED1A 2KNBB 5ECAA 2MOXA 2EKHA 4HVVA 2FRYA 1M3AA 2D8HA 2P4RA 1TG0A 2FG0A 1YN8A 5EC7A 1NLPC 2DLPA 1I07A 2CT3A 4J9FA 2NWMA 4OMLA 4LUDA 5I22A 2K6DA 4J9DA 4AFUC 1GBQA 2DVJA 4IIOA 1S1NA 4HVUA 3EHQA 1CSKA 1JQQA 2J05A 1CKAA 3VS7A 2K9GA 4J9HA 1WX6A 4RTXA 1GCQC 1WFWA 4K11A 1OV3A 2CSIA 2DE0X 4E6RA 2F2XA 1VYVA 3QWXX 1N5ZA 5IH2A 2D0NA 2EYXA 2GTOA 2KROA 2OI3A 2JTEA 1W70A 2YUNA 2EW3A 5IXBA 1OEBA 2H8HA 4EIKA 1G2BA 3VS3A 4HXJA 1NYGA 1UG1A 4HCKA 1WYXA 2RQWA 4CC4B 2NUZA 5GJWB 2HEQA 1SHFA 2LNHB 1BK2A 2RF0A 4A63B 2ENMA 2GQIA 4J9GA 4AFSC 2FRWA 1V1CA 2LCSA 1UTIA 4J9IA 2KE9A 1M27C 2ED0A 3R6NA 1W6XA 3NPFA 1KFZA 1MV0B 1PHTA 2YUOA 3TSWA 4JJCA 1OPLA 3KFVA 2SRCA 2DL7A 2X3XD 3I5RA 2J6FA 2J06A 1QLYA 3EG0A
chains in the Genus database with same CATH superfamily
4F17A 3G7ZA 3CCQA 3BE3A 3CCMA 1VQLT 1C6VX 1N9RA 2RJFA 2RQVA 3JRZA 2L5QA 1OZ2A 2DBKA 2K5IA 3S6WA 2DBMA 2QGGA 1ZUYA 3P8DA 4R0KA 3TU4K 3DLMA 2CDTA 5FWCA 1E7OA 4JS4A 2FL7A 3M4YA 4J6WA 3JSCA 2EGCA 3U23A 2FVUA 4HCBA 3AHUA 4MDXA 1YITA 2G6FX 4BE0A 3G71Q 3JCMX 4C5HA 1QCFA 5C6SA 1K8AR 4XU1A 2EYYA 1RABB 2EQIA 3MEUA 3VRYA 4M75C 4C0ZA 1UJYA 4B6MA 2VC8A 2FEIA 3L2RA 3H9NA 3QZ5B 2C0TA 3SWNA 2F2VA 3JB9D 5LJ3e 1QKWA 1NM7A 2OTJQ 4B9XA 4IURA 2ROLA 2B86A 3NHNA 2V1QA 1ZSZB 1Q82R 4AG2C 5GANe 3UA6A 2QASA 4D8DA 2QQ9A 2CT4A 3M55A 3UT1A 2LZ6B 1FMWA 2L0AA 1PKTA 3MEAA 2FPEA 3REBB 1VQ6T 1QP2A 2QDYB 2FZKB 1IB8A 4LUEA 4OMOA 5IXFA 4ZNXA 3M0RA 4RTYA 3CPWP 1VQNT 4ANJA 1C1AA 4KRTA 2IIMA 4PJNA 2E70A 2D8JA 4ORZA 1LPLA 4ZN3A 2L3RA 3QJYA 4FYWB 4BE1A 1ACMB 2BE7D 3UDCA 2NYSA 1IZ6A 2XDPA 3CC7A 1SF9A 3QO3A 2CYZB 2MWPA 1SPKA 2ESWA 1KSWA 3JCMW 4E7SA 4QQGA 1UEBA 3C95A 4IUVA 4O6JA 3X24B 4FSSA 1BB9A 1PD1A 3MKDA 4N4IA 4XTUA 2FPDA 2VWFA 2HCKA 4J6YA 3NTKA 1PM3A 1WNLA 3ME9A 4M75F 2DRMA 4M75E 2JJ9A 1UHFA 2KGTA 2V26A 2A7YA 4HCZA 1YHQT 3CC2Q 4FYXB 4QQDA 2E3IA 1HK9A 2EWNA 2HZYA 1WHMA 4QT7A 4JZ3A 4DEYA 1N8RU 2NUPA 5KH6A 5GMKe 1QCOA 3S3MA 2XG8D 3E9FA 1WIEA 1ABQA 2PZ1A 2QQAA 3CCRT 5GJVB 5CK9A 2DIGA 1JXMA 1YP5A 2L3QA 1KQSP 3CCMQ 3FLGA 4Z8AA 1M90C 2ZPGB 1VQ9A 1T3SA 1VYTA 3SHWA 1Z9QA 3OYFA 4JRPA 1YCSB 1QVFP 3OYCA 2CP7A 3VS2A 2E3HA 2DX1A 3E9GA 3I55T 1EZZB 4N4GA 1KC8U 1U1SA 1E6HA 4BACA 3CMET 2EQJA 3GIBA 1QMCA 4NL3A 1ZSZA 2EBPA 3LW5E 5GMKh 1YJWT 2ATCB 2E5KA 2JOYA 4N0AA 2CZ0B 2WSEE 2LJ0A 3M56A 3CCUA 1N9SA 2DO3A 2SEMA 3GLXA 3RERA 2FPFA 1OYXA 1YFNA 2AKKA 3QDRB 3OW2A 3H0IA 1YIJA 3EFSA 3CBPA 3CCEA 3FJ5A 2VXFA 1M8MA 3EG2A 5CKDA 4XK8E 1I1JA 4PJLA 3KBGA 1WI7A 1UFFA 3MCAB 1VQ4A 1G8XA 2LX9A 4KBMB 1SHGA 3INZA 1NLOC 3MEVA 5M9OA 2VGNA 1M3BA 4HKEA 5KE3A 1Q7YU 4M4ZA 1WQWA 2RNAA 3V8JA 2J7IA 1AZEA 4KH0B 4QKUA 2E12A 4FL6A 2JN0A 4DOWA 5DM7R 1R77A 2FZGB 1K9AA 4F7UB 2M02A 2M1HA 1AVZC 1X69A 1QVGS 4Q5WA 3G71T 1OQKA 3S3NA 2HNIA 2K79A 3VS6A 4HVWA 1ZSZC 4M7AB 2KYMA 2COYA 4OMPA 3C0CA 5CQYA 1RAEB 2X4JA 2K4YA 1MNDA 2CKKA 1H8KA 3A5ZB 3EH1A 3H0HA 1AEYA 3FDRA 2PTKA 2NUTA 1QVGA 5KYYB 2L2PA 2OTJT 1A0NB 4GY5A 1E6GA 3CC7Q 2RI2A 4J9BA 5GAOq 3L2UA 2CSQA 2MMPA 1OX8A 3HHTB 2CREA 3A8MB 2H3EB 3CXCS 2PUOB 2VXEA 4Z88A 5LJ3j 2YUPA 2CZ7B 1QQJA 2EVRA 2QGFB 1Q86U 1JO8A 2CGHA 1TWBA 2KRNA 2JS2A 1HYOA 4R55A 3X20B 3I9QA 1UDLA 1R0CB 2ROTA 2GF7A 3CXCA 4E7HA 1HSQA 1XQHA 2DTHA 3JCMd 1AWXA 4C8QB 3PNWC 2QDLA 4ZN1A 2RO0A 5A2QE 1K73R 1HXDA 3PGGA 3QWYA 3SD4A 4J9CA 2MIOA 4C0GA 3PIPA 2JM8A 4FT4A 3LGFA 4ELZC 2P84A 5GMKm 2AT1B 2LMJA 2JVVA 2LQ8A 1R0BG 2RB6A 1PG5B 2KNBB 2RI5A 2QXFA 3JCMf 3OBYA 5FU6B 2R57A 1TG0A 2KMTA 1OI1A 4J9FA 3CC4Q 3FIFA 2NWMA 2XKOC 3M9QA 4OMLA 1GBQA 2DVJA 4LDYA 5L8RE 3QHSA 1K9MR 1CSKA 1CKAA 3CC2T 2K9GA 3J7AF 4J9HA 2VB6A 1M1GA 4RTXA 4OF1A 2DJZA 3I56A 5GANd 1Q82C 4FCYA 1VQKQ 3HRUA 3OSVA 1NJIC 3CCEQ 2BE9B 3X25B 1VYVA 4KGVB 2DZCA 4F7UG 3CCSA 5IH2A 1S72Q 3CCMT 5GMKj 1VQ4Q 4EDUA 2YUNA 4HT9A 4M7AA 2EW3A 4EIKA 1G2BA 3VS3A 1VQPQ 1FWZA 4FW2A 2HL5C 3CD6Q 3ZFJA 2RQWA 3OMGA 2K3YA 5GANf 4BDZA 2QA4A 3ZEHA 5KYYA 5J39A 5GAN7 3HL8A 4J9GA 4QVZA 2EQUA 4XTXA 3JCMV 1UTIA 3RR6A 5FLXE 4J9IA 2EQMA 2ED0A 3VKIA 1U1TA 4XQ3A 1KFZA 2YUOA 2EQKA 1WHHA 2EJ9A 4E7ZA 1NPRA 3VJPA 8ATCB 1NPPA 2DL7A 2NLUA 2J06A 1QLYA 3EG0A 1YWPA 3SEMA 2JMCA 2V8JA 3OQ5A 2PNIA 2XMFA 3EFOB 8AT1B 3JB9J 2CUBA 4J5YA 3VS5A 4BB7A 3TEEA 4FU6A 2MI6A 4XTVA 2RJCA 2K2VA 4C0FA 4C8QA 2ZPFB 2YWWA 5AT1B 1M2VB 4M78G 4GBQA 5D6WA 2RQUA 4O5VA 4M7AC 3ER0A 3OYAA 4KGZB 2HQEA 1UGRB 3Q1JA 2BIVA 3L2ZA 4IUPA 1OU8A 2FB7A 4A4GA 2BUDA 4A4HA 1K0XA 4Y92A 5A0DA 1WJQA 3RESA 1BI2A 2XDBA 3CBOA 3CCLQ 3GOXA 2COWA 1QWFA 2AK5A 2EFIA 4CC2A 3CEYA 1T0JA 1ZA1B 3QJ6A 3M0PA 2OTLQ 3CC7T 2DERA 4AT1B 2EAYA 2KK4A 1JXOA 2LVMA 2H3JA 3RBBB 4C8QC 5EG2A 3OW2P 1K76A 4OMNA 4A4FA 5GAN5 4V2SA 5KYWB 4RTZA 2HL3A 4M75D 3O5ZA 3PTAA 2EJFA 4TVRA 4D6WA 2OAWA 1TUGB 2ZPBB 3H8ZA 4OGEA 2J6OA 2GCXA 3M54A 2CZ6B 1VQOA 3KUFA 2G3RA 3BDLA 2ECZA 4PJOG 4PK4A 5J3BA 1RADB 5I11A 3I56Q 3V8KA 3OYDA 1YI2A 5FU6C 4EMHA 1UE9A 2GFUA 2ZPIB 2LT4A 4M77G 4XTYA 2DXUA 4IUQA 1YJ9A 2MAMA 3J81E 4M7AF 1XNIA 4M7AE 1VQ7A 2LQWA 3MP6A 3E2UA 2VASA 3URGA 1M90U 4IIMA 4J9EA 3P8HA 3JCMP 2CH4W 2DL3A 2X4WA 1SSFA 3NMZC 3CC4T 2D0QB 2HKNA 2F5KA 3DB4A 3OYMA 2L3SA 4XTZA 5FRMA 2M0OA 5LJ5d 2E1HA 2RN8A 4M7DG 4OB0B 3EH2A 3RIRA 9ATCB 2JUFA 1BI0A 1BCMA 3MHXA 1JRIA 1AWWA 2EYWA 4FYVB 5A0LA 2L89A 2MPXC 1KHCA 1VQKT 3L2WA 3ASKA 3CCET 1KG1A 1IHVA 3META 1B34A 1S72T 4C8QF 2COZA 3CCVQ 4OGCA 4C8QE 2DKGA 5LJ5f 1TH7A 2X35A 3CXCP 1YJNQ 2YSQA 5FRNA 3UA7A 1VQ4T 3CQTA 1N8RR 2AHJB 3EGDB 1R8OB 3H41A 2KYBA 1VQ5A 2OJ2A 3FJPA 3JCMJ 3LX7A 4ZGEB 5GAMh 1VQPT 2JTMA 3M53A 2A37A 3CD6T 1FMKA 2KDSA 3DKMA 1UUEA 2P4TA 2YT6A 3HTRA 2C06A 4C5GA 1RAGB 1K73C 5GAN6 3EG3A 1SEMA 5IHIA 1XTDA 4CRIA 1VQMQ 1NBEB 2JS0A 4Y28E 3M0QA 5C0MA 1AWJA 2RJEA 1KC8R 2YDLA 1M1FA 4LNPA 4PFOA 3JCMc 3QBYA 5D6XA 4XTWA 1D0YA 1M2OA 2KSSA 4FT2A 5I2MA 1ZBJA 4LN2A 4J7IA 1D3BA 2PVOB 2F2WA 3E19A 2RK1A 3RNJA 3BDUA 4OVAA 3CMAQ 2MWOA 3HRTA 2DXTA 4MMLA 2BTTA 2J6KA 4Z89A 2RMOA 3JB9G 3X26B 2HQXA 1T3LA 5LL6S 4JUVA 1JJ2S 3FRNA 3QKJA 5KE2A 3OS2A 3EGXB 1MNEA 1HD3A 3UATA 3I35A 2LP5A 2FZCB 2CP6A 5HCKA 1H3ZA 1Q7YR 3MEWA 1EIFA 2RM4A 2P0KA 3BY7A 2E41A 1H92A 3CCLT 1MMDA 2JW4A 1GFDA 1X27A 1JJ2A 3A1PA 2CH4A 2QEXA 4D8KA 5GAOn 3CCJA 1QCNA 2OTLT 1UECA 2EPDA 3NFCA 4DA4A 4CC3A 2FO0A 1D0ZA 1YJ9Q 4PFPA 1RAIB 1YBYA 3M0SA 5KYXB 3L2QA 5GAN8 4LD9K 3LWHA 5IAYA 3G1JA 2W0ZA 2LC4A 3V8LA 4WCIA 3L42A 3MO8A 4RTTA 2RK2A 2DA9A 1IRXA 3G4SA 1QKXA 3QUIA 3CCQQ 1KD1U 1M4ZA 2XK0A 3A8GB 3RMQA 3TCJA 4E7LA 2ZCFB 1X2QA 2E4HA 1C0MA 1IGQA 3H6ZA 1NG2A 1VQ8A 1Q86R 1OPKA 2HKQB 2LJ1A 2RHIA 3M57A 2QAZA 4LD6A 4C92B 2KRMA 3I56T 4JDSA 3G6EA 5KCHA 2KRSA 3OW2S 4BY6B 1V29B 2GGRA 3QSUA 1X75C 1WHLA 1WDXA 1TUDA 2BZXA 1ZUKA 2ED1A 1V76A 1YITQ 2RHZA 1NJIU 5CAIA 4BD3A 2EKHA 4HVVA 1EX4A 5KYUB 2DXCA 2JZ2A 2FRYA 4YTLA 4NOYA 1M3AA 4N4HA 3NTIA 1ZQ1A 1AT1B 2V8IA 4QW2A 1YCYA 1VQLA 1I07A 1PSFA 4FIBA 2ZAEA 2YXYA 1ZBXA 2K6DA 4J9DA 4AFUC 4IIOA 1I8FA 2QK0A 1UB4A 1JQQA 2J05A 2RH2A 1OZ3A 2F5TX 3OY9A 5IN1A 4FYYB 1Q81C 4K11A 2E65A 5GAMj 3GPLA 1N6AA 3QYHB 3LWIA 4E6RA 2EIFA 3QWXX 1WGSA 2D0NA 2EYXA 2KVQG 1PCXA 3OS0A 2GTOA 2RJDA 4HT8A 3CCVT 2PVGB 1BI1A 2OI3A 4J6XA 1BKBA 1YJNT 1UGQB 3HRSA 3VYGA 5DY9A 2H8HA 4HXJA 4C5IA 1UG1A 4HCKA 2L8DA 2YLCA 1WYXA 4CC4B 2NUZA 5GJWB 2HEQA 1SHFA 2XD0A 5DLQE 2LNHB 3LYIA 4KUIA 2DEQA 4CI0C 2GQIA 4AFSC 2FRWA 1M1KU 1NE8A 2I2LA 5CKEA 3R6NA 2HQHA 2QI2A 3NPFA 4DBRA 5I2SA 1MV0B 1VQMT 2CZ1B 2QG9B 1VQ6A 2HSEB 1WJRA 2KI7A 2RA2A 2J6FA 1W4SA 4BI3A 2P0PA 3VYHB 1JBMA 2Y4XA 5GAN2 1Y07A 1FX7A 4PKCC 5GAOp 1MMAA 4OP0A 2LQKA 1NZ9A 4M78B 4RMOA 5GAOl 2DNUA 3CMAT 3H0FA 4C92G 2KXCA 1MGQA 4ESRA 2HDAA 5LJ5h 4QVCA 1XJWB 1B3QA 2RI3A 1VQ9Q 2R5AA 1M30A 5KYUA 3A8HB 1BIAA 5CCAA 3OYBA 4OMMA 3L2VA 1J3TA 2PU9B 2RQTA 2X4XA 2VV5A 1VQ8Q 1IXDA 4IKFA 1RAAB 1K8AC 4J7FA 3KXTA 1AHJB 2IG0A 2EYZA 3MP8A 2LT1A 3RKXA 3UWNA 2MF2A 3X28B 4HCCA 1WXUA 2AZVA 3HP9A 3OYGA 4MMKA 2GBQA 4M7AD 1IO6A 5LJ3d 1WHJA 2DL8A 1K0SA 1RUWA 2JXBA 1MUZA 3CCUQ 3JB9I 3A8OB 2JM9A 3CCRA 3GBQA 1HJDA 2XIDA 5D6YA 1KHIA 1GBRA 1Y7XA 1YIJQ 1Y96B 1KQ1A 2HD0A 4BUGA 4F7UA 1WHGA 4C92C 1BI3A 1MHNA 4AFZC 1YNZA 3CCQT 3QXEB 4BY6C 5CQXA 2X3WD 1OULA 4RG8A 4JPBW 2DPPB 5GAMg 3I55A 2LTOA 3A98A 5LJ3f 2QQSA 1KJWA 1U3OA 3L1AA 1ABOA 1RI0A 2A28A 4PJOB 4IUUA 2FHDA 1YJWA 3M4GA 1TSFA 1D0XA 4OMQA 2JTFA 4M77B 3OYJA 4CC7A 4C8QD 1RLQC 1YITT 1MMNA 4BE2A 1SRLA 1MMGA 1AOJA 2K2MA 5FU7B 1I81A 1FMVA 3JCMQ 1WQ7A 1AWOA 3FC3A 3QDFA 1JJ2P 1DJ7B 4GLKA 2XU8A 4Y91A 5FROA 4LDUA 4A4KA 1PWTA 1YWOA 4HA8A 1Q7YC 1ZX6A 4M7DB 3PMTA 4JJDA 1VUBA 1WZOA 3HFOA 5CKHA 4M78A 2I0NA 1X01A 3C94A 4RTWA 3G71A 3OYIA 3VS1A 2RQRA 1MV3A 2JNGA 2KBTA 2BZ8A 3OBWA 2DEUA 2DMOA 2HBWA 3VUZA 1Z9ZA 4JJNK 3M5AA 2OTJA 4DEXA 1UHCA 4P5NA 2GFAA 3PVLA 4KH1B 1JU5C 1G5VA 1TUCA 2IPOB 2V8KA 5HY6A 1JB0E 4MZPA 3WXMB 1Q86C 4DBQA 3IQLA 3DLLA 2Z0WA 1IGUA 1F1BB 3GNFB 4DBHA 3C12A 2AKLA 2X9HA 4Z02A 3EG1A 3OS1A 3SWNB 3PE0A 4WTOB 1Y57A 2K57A 3TREA 4JJBA 2DETA 4X34A 4QVDA 4M78C 1LCKA 3T9NA 4X9DA 1SG5A 2CS7A 2KAFA 1EFNA 1N27A 4GLMA 3M0UA 4DOVA 3LH5A 2K3XA 4OB1B 5LJ5j 2D1XA 1W1FA 4AFQC 1PSEA 1WHKA 1OX9A 2DF6A 1ZLMA 3V7RA 1CKBA 5AYFA 3GF5A 1TOVA 4PJOA 3OYEA 2C0IA 2Y90A 4NS5A 4F7UF 1U8RA 3CBMA 1UJ0A 2YRVA 4F7UE 3VUBA 4PNOA 1ARKA 4M77A 2AIRB 2HMAA 1PRMC 3OYKA 3CCSQ 1ZUUA 1LNXA 5IHKA 1VQ9T 2DYIA 1BU1A 2R5MA 2WSCE 3OB9A 4E7JA 1VQ8T 3J80E 4FSXA 2QA4Q 2E5QA 2DAQA 1K4US 3CC2A 4M75G 5GAMe 3EFOA 4RKUE 4XU3A 5FW9A 3OYNA 3HSBA 1TXQA 1OOTA 4M7DA 1RI9A 3CCUT 4MDWA 4BI4A 1M2VA 3VU3C 2O31A 2PQWA 3TQ7P 7AT1B 1YIJT 5KYNA 4L5GA 3V7SA 4PJOC 3SDZA 3V7CA 2ZPEB 1U06A 2CP5A 1GXIE 5IT9E 4M77C 2YLBA 2EGAA 2NUPB 4M78F 4M78E 2DXBA 4AMCA 2QYZA 1GCPA 1XOVA 4IUTA 4XAXB 1K1ZA 2A08A 3HPWA 3EG9B 5FU7C 2GNCA 1Q81U 3NGPA 1FYNA 2RD1A 1KD1R 1G3WA 2Y4YA 3FB9A 2VGMA 2MOXA 3JCMh 1RL2A 4RCCA 1M8VA 5HK3A 2P4RA 4F04B 5EC7A 4M7DC 1NLPC 2IVWA 4KT0E 4II1A 4ZGDB 2DVEA 1FXXA 5CIUA 5GAN4 4EMKC 5I21A 5KYWA 5I22A 1IHWA 2K5LA 1NJIR 1IREB 2M16A 2X4YA 3VS7A 1D1BA 3EFRA 4PFZA 2ZZDA 3RUXA 3QZ9B 1WFWA 4EPCA 3DB3A 1OV3A 1KK7A 2CSIA 2DE0X 2FYKA 2VYTA 2O01E 4A54A 5LJ5g 5GAN3 2F2XA 1K9MC 1N5ZA 3JCMb 2E6NA 3SB2A 1Y71A 2KROA 1Q95G 1PD0A 1QVPA 2JTEA 2DD4A 1W70A 2XICA 1D1CA 5LJ3h 2OAUA 2E64A 4KGXB 1NYGA 4PJOF 2DZ9A 4PJOE 1VQOQ 1TU0B 5GANh 3WVEB 4EMGA 4M77F 4M77E 1YI2Q 3SWNC 1LOJA 1V1CA 2LCSA 4C0DB 3LLRA 2KE9A 4JRIA 1M27C 3OS5A 2CP0A 1W6XA 1VQ7Q 1OPLA 3KFVA 2DTOA 4JS5A 2NUTB 3I5RA 3OYYA 1O9SA 2DM1A 2LDMA 1VIFA 2YRCA 3N5BB 1QW1A 4M7DF 2C0OA 4M7DE 1M1KR 1W2BS 1K8AU 3EGUA 2F69A 2YRDA 4PLIA 2WACA 2KQWA 1G3TA 3QIIA 3EGDA 3PIOA 5GMKl 2AZSA 4DQ2A 2LCCA 2O88A 3EG9A 4F16A 1W2BA 2HSPA 4VUBA 1Q82U 3CCST 4R56A 3BFMA 3PFSA 2R58A 1JEGA 2PUKB 4J8OA 2WSFE 3CC4A 5KCOA 1G3YA 1WPYA 4X9CA 3ZL7C 1VQ5Q 2MK5A 3RKWA 3SFMA 1G3SA 2QA4T 5IHNA 5FWBA 2KR3A 2DIQA 4L6V5 1H3HA 4XU2A 1WJSA 2K7AA 4RTVA 1NEGA 4ATOA 1VQKA 1I0CA 2KXDA 2YHTA 1M3CA 4MZTA 1UGPB 3S3OA 1PKSA 1ZHIA 2LX7A 1S72A 1WXTA 2D6FA 2LNVA 1BBZA 3EGXA 1VA7A 2A0FB 2M0YA 4JRKA 1AD5A 1VQPA 2GTJA 3O8VA 3CD6A 1T0HA 3TSZA 1X43A 1X6GA 1X6BA 2ZGWA 1KIKA 3I5SA 4RCBA 1NEBA 3JB9F 2EGEA 3OYLA 1GL5A 3M0TA 3C4SA 5CVIA 2KT8A 1M5Q1 1RLPC 2BZYA 5CKFA 2VVKA 5DLOA 2X51A 3MP1A 3JV3A 2L3PA 4N0AC 5A0GA 5KYXA 5LJ5e 1PRLC 5HKCA 4C92D 2D9TA 4BI8B 2A36A 4B9WA 1UGVA 2DFUA 2XI9A 3RMSA 4RUGA 2LCLA 1VQNA 2DL4A 2ZPHB 4E47A 1LJOA 2QEXQ 3HKSA 3CCJQ 2YUQA 1GFCA 2QQBA 2O9SA 1BCOA 3BW1A 4F14A 5GAMd 5L23A 2M51A 5GANj 1B7TA 1PNJA 1SSHA 4RTUA 4C92A 3PMIA 3FEOA 6AT1B 1I5OB 3ZBDA 2CP2A 1O75A 3EHRA 3ULRB 4AG1C 3MJXA 2JT4A 3G4SQ 2RPNA 2CUDA 2MYSA 5GAOr 3NTHA 3CCLA 3UPUA 1WXBA 2QTVA 4C0DC 3OYHA 4UC4A 3MPUB 1TTHB 4A53A 5GAMf 4QQ6A 1VQOT 2ABLA 3TVTA 3UF4A 2W10A 4E7KA 2KEAA 4E2FB 1D09B 2OTLA 4JZ4A 4NL2A 2DJQA 4ZTJA 2O9VA 3G6EQ 2O4XB 1YI2T 1YHQA 4PJMA 1N8RC 1P92A 2KY9A 2QTXA 3QYGB 3CPWS 1LVKA 2HBPA 2LRQA 2XHCA 1YJ9T 5CO7A 1VQ7T 2P0QA 1KD1C 1ZSGA 4MZMA 3PT9A 1BIBA 1VQLQ 2CP3A 2VUBA 5J26A 2B8AA 4A4EA 3CPWA 1KC8C 3VRZA 4X1VA 2EYQA 5D7UA 2QQRA 3VS0A 3CMEA 1X2KA 1NYFA 1VOMA 1U5SA 2DL5A 1QWEA 1I4K1 1WLPB 2KT1A 3JCMg 3GP8A 4KUDK 2HAXA 1RAFB 2K5FA 4J83A 3REAB 2LQNA 2K3BA 2EKOA 2M9UA 4M7AG 3THKA 3WVDB 4M78D 2DYBA 2DILA 3EAEA 2VKNA 5CKBA 1VQ5T 2E6ZA 4LE9A 2V1RA 1B07A 2DRKA 4M75B 1KQSS 3PVQA 4LXCA 3GNGA 1SKUB 1SRMA 1M90R 1K73U 1I5LA 1AZGB 1UGSB 4EMKB 1G83A 1QVFS 2XDDA 1VQ6Q 3VS4A 3VV0A 4OMFB 3JAME 1VYUA 4OB2B 2DTIA 1KQSA 2JMAA 4ME7A 3CCVA 4OB3B 2LJ3A 4C5EA 1YJNA 5LJ3g 3QPHA 4JRQA 1VQNQ 3JB9H 4FM4B 1GCQA 1Y0MA 2O2OA 4C8QG 4ZGJB 3OMCA 1RACB 5GANg 1QVFA 4PL6A 3D7SB 4LDWA 1X6OA 1WA7A 4C92F 4C92E 1GRIA 4L59A 4ELYC 1M1KC 4PJJA 3M59A 5GAOm 1B34B 3LGLA 2MCNA 2BKDN 2RHUA 1W2BP 1H641 5GMKi 2O4XA 4PLLA 2GQVA 3P8BB 1M9SA 1VQMA 5ECAA 3A8LB 3F70A 1K9MU 1ZA2B 1VIEA 2D8HA 2FG0A 1YN8A 5HK0A 2DLPA 4PJOD 2CT3A 4LDXA 4WF2A 4JLIA 1Q81R 1Y96A 3M58A 4M77D 4LUDA 2A3LA 4ZTFA 1S1NA 3R6OA 4BDYA 4HVUA 1YHQQ 1D1AA 3EHQA 3HFNA 2QEXT 3CCJT 1WX6A 2RHXA 3CMAA 1BYMA 1GCQC 4JLGA 1KQ2A 4E7IA 1OU9A 2OX7A 2RHYA 3CPFA 3CCRQ 1TS9A 4LDVA 4RG2A 2EJGA 3OA6A 3QG1A 3LH0A 4M7DD 3G4ST 1D3BB 2DK3A 5IXBA 1OEBA 2PVDB 3RKYA 3I55Q 1QP3A 2E10A 3RDVA 3CMEQ 1BK2A 2DD5A 2RF0A 4A63B 2ENMA 1YJWQ 3G6ET 2F1LA 4M75A 4DBFA 3OSSC 4KULA 1RAHB 1PC0A 4FW1A 3E1SA 3AT1B 1PHTA 3TSWA 4JJCA 5CR2A 2SRCA 4EMKA 2X3XD 4XU0A 3JCMe 1QVGP
chains in the Genus database with same CATH topology
4F17A 1YWPA 3SEMA 2DM1A 2JMCA 2RQVA 2PNIA 2XMFA 2CUBA 3VS5A 2C0OA 2DBKA 3EGUA 2DBMA 1ZUYA 4R0KA 2CDTA 4GBQA 5FWCA 1E7OA 2RQUA 2DNUA 2AZSA 3H0FA 2O88A 2KXCA 2EGCA 3U23A 4ESRA 4F16A 2HDAA 2HSPA 2G6FX 1QCFA 2EYYA 1K0XA 1B3QA 4Y92A 1M30A 2EQIA 3VRYA 1JEGA 1UJYA 2FEIA 4OMMA 1J3TA 2RQTA 3ZL7C 2C0TA 2F2VA 1QWFA 1QKWA 1NM7A 2AK5A 4CC2A 2EYZA 1T0JA 2B86A 2ROLA 3NHNA 2V1QA 1WXUA 5IHNA 2AZVA 5FWBA 4AG2C 2KR3A 3M0PA 1H3HA 3UA6A 2GBQA 4D8DA 4RTVA 2K7AA 1IO6A 1JXOA 1NEGA 2CT4A 2DL8A 1K0SA 2LZ6B 1RUWA 2JXBA 1MUZA 3RBBB 2L0AA 1I0CA 2JM9A 1PKTA 2KXDA 1M3CA 3GBQA 1HJDA 1K76A 4OMNA 2FPEA 1GBRA 3REBB 1PKSA 2LX7A 1WXTA 4RTZA 4LUEA 4OMOA 3O5ZA 5IXFA 4ZNXA 4AFZC 1YNZA 3M0RA 2OAWA 4RTYA 2X3WD 1BBZA 1VA7A 2J6OA 2M0YA 4JPBW 1AD5A 4KRTA 2GTJA 2IIMA 3A98A 1KJWA 1T0HA 2D8JA 3TSZA 1X43A 1X6GA 1X6BA 4ORZA 1U3OA 1ABOA 2A28A 2ECZA 3I5SA 1KIKA 5I11A 1NEBA 1UE9A 2EGEA 1GL5A 3M0TA 4OMQA 2KT8A 4CC7A 1RLPC 2BZYA 1RLQC 1SPKA 2ESWA 1KSWA 2VVKA 2LQWA 3JV3A 2L3PA 1SRLA 4IIMA 1AOJA 4J9EA 2K2MA 1BB9A 1PRLC 4FSSA 2CH4W 2DL3A 2A36A 3NMZC 2FPDA 1AWOA 1UGVA 2VWFA 2HCKA 4RUGA 2L3SA 2DRMA 2DL4A 1PWTA 1YWOA 1ZX6A 1UHFA 2RN8A 2KGTA 2YUQA 1GFCA 4JJDA 4QT7A 2O9SA 4JZ3A 4DEYA 4F14A 1AWWA 5L23A 2I0NA 2EYWA 1WIEA 1ABQA 2PZ1A 2M51A 1SSHA 1PNJA 4RTUA 4RTWA 3VS1A 5GJVB 2RQRA 1MV3A 2KBTA 1JXMA 2BZ8A 1YP5A 2L3QA 4Z8AA 3EHRA 1T3SA 1VYTA 3SHWA 3ULRB 4AG1C 2JT4A 1Z9QA 2DMOA 2HBWA 2RPNA 2YSQA 3UA7A 2CUDA 1YCSB 1Z9ZA 3CQTA 1WXBA 3H41A 2KYBA 3VS2A 2OJ2A 2DX1A 2A37A 1E6HA 2ABLA 3TVTA 1FMKA 3UF4A 2W10A 1UUEA 4DEXA 1UHCA 2KEAA 2YT6A 3PVLA 4JZ4A 2DJQA 2O9VA 1JU5C 2EBPA 1TUCA 2E5KA 3EG3A 1SEMA 5IHIA 2LJ0A 3IQLA 2JS0A 2SEMA 3M0QA 2FPFA 1AWJA 2AKKA 2AKLA 3H0IA 3EG1A 2YDLA 3PE0A 3FJ5A 1Y57A 4LNPA 1ZSGA 1M8MA 4JJBA 3EG2A 1I1JA 1LCKA 1WI7A 1UFFA 1EFNA 4GLMA 3M0UA 3LH5A 2D1XA 1SHGA 1W1FA 4AFQC 1ZBJA 3VRZA 4LN2A 1NLOC 4X1VA 2DF6A 2F2WA 1M3BA 1ZLMA 3RNJA 1CKBA 4M4ZA 2RNAA 2J7IA 3VS0A 1AZEA 1X2KA 1NYFA 1U5SA 2DL5A 2BTTA 1QWEA 2J6KA 4Z89A 2C0IA 2RMOA 1UJ0A 1K9AA 1T3LA 1WLPB 1AVZC 1X69A 2KT1A 1ARKA 1PRMC 2K79A 1ZUUA 3VS6A 1HD3A 3UATA 3REAB 2LQNA 2K3BA 3I35A 4HVWA 2LP5A 5IHKA 2KYMA 4OMPA 3C0CA 3THKA 5HCKA 2DYBA 1BU1A 2DILA 1H8KA 2VKNA 1H92A 3H0HA 1AEYA 2JW4A 2PTKA 1GFDA 1X27A 2L2PA 2CH4A 4LE9A 2V1RA 1B07A 1A0NB 2DRKA 4D8KA 1K4US 1E6GA 4J9BA 5FW9A 1UECA 2EPDA 3PVQA 2CSQA 1OOTA 4CC3A 2FO0A 1RI9A 2CREA 3M0SA 4Z88A 1SRMA 2YUPA 1AZGB 1G83A 2O31A 2W0ZA 2EVRA 4WCIA 1JO8A 3VS4A 2KRNA 2JS2A 1VYUA 4RTTA 3I9QA 2JMAA 2DA9A 1UDLA 2LJ3A 1QKXA 2ROTA 1HSQA 1GCQA 1Y0MA 2O2OA 1AWXA 1U06A 2QDLA 2EGAA 1X2QA 3QWYA 4J9CA 1GCPA 1NG2A 1OPKA 1WA7A 1XOVA 2MIOA 2LJ1A 1GRIA 1K1ZA 2JM8A 2KRMA 2A08A 2KRSA 2GNCA 2GGRA 3NGPA 2MCNA 1FYNA 1WDXA 1TUDA 2BZXA 2LMJA 1ZUKA 2ED1A 2KNBB 5ECAA 2MOXA 2EKHA 4HVVA 2FRYA 1M3AA 2D8HA 2P4RA 1TG0A 2FG0A 1YN8A 5EC7A 1NLPC 2DLPA 1I07A 2CT3A 4J9FA 2NWMA 4OMLA 4LUDA 5I22A 2K6DA 4J9DA 4AFUC 1GBQA 2DVJA 4IIOA 1S1NA 4HVUA 3EHQA 1CSKA 1JQQA 2J05A 1CKAA 3VS7A 2K9GA 4J9HA 1WX6A 4RTXA 1GCQC 1WFWA 4K11A 1OV3A 2CSIA 2DE0X 4E6RA 2F2XA 1VYVA 3QWXX 1N5ZA 5IH2A 2D0NA 2EYXA 2GTOA 2KROA 2OI3A 2JTEA 1W70A 2YUNA 2EW3A 5IXBA 1OEBA 2H8HA 4EIKA 1G2BA 3VS3A 4HXJA 1NYGA 1UG1A 4HCKA 1WYXA 2RQWA 4CC4B 2NUZA 5GJWB 2HEQA 1SHFA 2LNHB 1BK2A 2RF0A 4A63B 2ENMA 2GQIA 4J9GA 4AFSC 2FRWA 1V1CA 2LCSA 1UTIA 4J9IA 2KE9A 1M27C 2ED0A 3R6NA 1W6XA 3NPFA 1KFZA 1MV0B 1PHTA 2YUOA 3TSWA 4JJCA 1OPLA 3KFVA 2SRCA 2DL7A 2X3XD 3I5RA 2J6FA 2J06A 1QLYA 3EG0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F17 A;  1YWP A;  3SEM A;  2DM1 A;  2JMC A;  2RQV A;  2PNI A;  2XMF A;  2CUB A;  3VS5 A;  2C0O A;  2DBK A;  3EGU A;  2DBM A;  1ZUY A;  4R0K A;  2CDT A;  4GBQ A;  5FWC A;  1E7O A;  2RQU A;  2DNU A;  2AZS A;  3H0F A;  2O88 A;  2KXC A;  2EGC A;  3U23 A;  4ESR A;  4F16 A;  2HDA A;  2HSP A;  2G6F X;  1QCF A;  2EYY A;  1K0X A;  1B3Q A;  4Y92 A;  1M30 A;  2EQI A;  3VRY A;  1JEG A;  1UJY A;  2FEI A;  4OMM A;  1J3T A;  2RQT A;  3ZL7 C;  2C0T A;  2F2V A;  1QWF A;  1QKW A;  1NM7 A;  2AK5 A;  4CC2 A;  2EYZ A;  1T0J A;  2B86 A;  2ROL A;  3NHN A;  2V1Q A;  1WXU A;  5IHN A;  2AZV A;  5FWB A;  4AG2 C;  2KR3 A;  3M0P A;  1H3H A;  3UA6 A;  2GBQ A;  4D8D A;  4RTV A;  2K7A A;  1IO6 A;  1JXO A;  1NEG A;  2CT4 A;  2DL8 A;  1K0S A;  2LZ6 B;  1RUW A;  2JXB A;  1MUZ A;  3RBB B;  2L0A A;  1I0C A;  2JM9 A;  1PKT A;  2KXD A;  1M3C A;  3GBQ A;  1HJD A;  1K76 A;  4OMN A;  2FPE A;  1GBR A;  3REB B;  1PKS A;  2LX7 A;  1WXT A;  4RTZ A;  4LUE A;  4OMO A;  3O5Z A;  5IXF A;  4ZNX A;  4AFZ C;  1YNZ A;  3M0R A;  2OAW A;  4RTY A;  2X3W D;  1BBZ A;  1VA7 A;  2J6O A;  2M0Y A;  4JPB W;  1AD5 A;  4KRT A;  2GTJ A;  2IIM A;  3A98 A;  1KJW A;  1T0H A;  2D8J A;  3TSZ A;  1X43 A;  1X6G A;  1X6B A;  4ORZ A;  1U3O A;  1ABO A;  2A28 A;  2ECZ A;  3I5S A;  1KIK A;  5I11 A;  1NEB A;  1UE9 A;  2EGE A;  1GL5 A;  3M0T A;  4OMQ A;  2KT8 A;  4CC7 A;  1RLP C;  2BZY A;  1RLQ C;  1SPK A;  2ESW A;  1KSW A;  2VVK A;  2LQW A;  3JV3 A;  2L3P A;  1SRL A;  4IIM A;  1AOJ A;  4J9E A;  2K2M A;  1BB9 A;  1PRL C;  4FSS A;  2CH4 W;  2DL3 A;  2A36 A;  3NMZ C;  2FPD A;  1AWO A;  1UGV A;  2VWF A;  2HCK A;  4RUG A;  2L3S A;  2DRM A;  2DL4 A;  1PWT A;  1YWO A;  1ZX6 A;  1UHF A;  2RN8 A;  2KGT A;  2YUQ A;  1GFC A;  4JJD A;  4QT7 A;  2O9S A;  4JZ3 A;  4DEY A;  4F14 A;  1AWW A;  5L23 A;  2I0N A;  2EYW A;  1WIE A;  1ABQ A;  2PZ1 A;  2M51 A;  1SSH A;  1PNJ A;  4RTU A;  4RTW A;  3VS1 A;  5GJV B;  2RQR A;  1MV3 A;  2KBT A;  1JXM A;  2BZ8 A;  1YP5 A;  2L3Q A;  4Z8A A;  3EHR A;  1T3S A;  1VYT A;  3SHW A;  3ULR B;  4AG1 C;  2JT4 A;  1Z9Q A;  2DMO A;  2HBW A;  2RPN A;  2YSQ A;  3UA7 A;  2CUD A;  1YCS B;  1Z9Z A;  3CQT A;  1WXB A;  3H41 A;  2KYB A;  3VS2 A;  2OJ2 A;  2DX1 A;  2A37 A;  1E6H A;  2ABL A;  3TVT A;  1FMK A;  3UF4 A;  2W10 A;  1UUE A;  4DEX A;  1UHC A;  2KEA A;  2YT6 A;  3PVL A;  4JZ4 A;  2DJQ A;  2O9V A;  1JU5 C;  2EBP A;  1TUC A;  2E5K A;  3EG3 A;  1SEM A;  5IHI A;  2LJ0 A;  3IQL A;  2JS0 A;  2SEM A;  3M0Q A;  2FPF A;  1AWJ A;  2AKK A;  2AKL A;  3H0I A;  3EG1 A;  2YDL A;  3PE0 A;  3FJ5 A;  1Y57 A;  4LNP A;  1ZSG A;  1M8M A;  4JJB A;  3EG2 A;  1I1J A;  1LCK A;  1WI7 A;  1UFF A;  1EFN A;  4GLM A;  3M0U A;  3LH5 A;  2D1X A;  1SHG A;  1W1F A;  4AFQ C;  1ZBJ A;  3VRZ A;  4LN2 A;  1NLO C;  4X1V A;  2DF6 A;  2F2W A;  1M3B A;  1ZLM A;  3RNJ A;  1CKB A;  4M4Z A;  2RNA A;  2J7I A;  3VS0 A;  1AZE A;  1X2K A;  1NYF A;  1U5S A;  2DL5 A;  2BTT A;  1QWE A;  2J6K A;  4Z89 A;  2C0I A;  2RMO A;  1UJ0 A;  1K9A A;  1T3L A;  1WLP B;  1AVZ C;  1X69 A;  2KT1 A;  1ARK A;  1PRM C;  2K79 A;  1ZUU A;  3VS6 A;  1HD3 A;  3UAT A;  3REA B;  2LQN A;  2K3B A;  3I35 A;  4HVW A;  2LP5 A;  5IHK A;  2KYM A;  4OMP A;  3C0C A;  3THK A;  5HCK A;  2DYB A;  1BU1 A;  2DIL A;  1H8K A;  2VKN A;  1H92 A;  3H0H A;  1AEY A;  2JW4 A;  2PTK A;  1GFD A;  1X27 A;  2L2P A;  2CH4 A;  4LE9 A;  2V1R A;  1B07 A;  1A0N B;  2DRK A;  4D8K A;  1K4U S;  1E6G A;  4J9B A;  5FW9 A;  1UEC A;  2EPD A;  3PVQ A;  2CSQ A;  1OOT A;  4CC3 A;  2FO0 A;  1RI9 A;  2CRE A;  3M0S A;  4Z88 A;  1SRM A;  2YUP A;  1AZG B;  1G83 A;  2O31 A;  2W0Z A;  2EVR A;  4WCI A;  1JO8 A;  3VS4 A;  2KRN A;  2JS2 A;  1VYU A;  4RTT A;  3I9Q A;  2JMA A;  2DA9 A;  1UDL A;  2LJ3 A;  1QKX A;  2ROT A;  1HSQ A;  1GCQ A;  1Y0M A;  2O2O A;  1AWX A;  1U06 A;  2QDL A;  2EGA A;  1X2Q A;  3QWY A;  4J9C A;  1GCP A;  1NG2 A;  1OPK A;  1WA7 A;  1XOV A;  2MIO A;  2LJ1 A;  1GRI A;  1K1Z A;  2JM8 A;  2KRM A;  2A08 A;  2KRS A;  2GNC A;  2GGR A;  3NGP A;  2MCN A;  1FYN A;  1WDX A;  1TUD A;  2BZX A;  2LMJ A;  1ZUK A;  2ED1 A;  2KNB B;  5ECA A;  2MOX A;  2EKH A;  4HVV A;  2FRY A;  1M3A A;  2D8H A;  2P4R A;  1TG0 A;  2FG0 A;  1YN8 A;  5EC7 A;  1NLP C;  2DLP A;  1I07 A;  2CT3 A;  4J9F A;  2NWM A;  4OML A;  4LUD A;  5I22 A;  2K6D A;  4J9D A;  4AFU C;  1GBQ A;  2DVJ A;  4IIO A;  1S1N A;  4HVU A;  3EHQ A;  1CSK A;  1JQQ A;  2J05 A;  1CKA A;  3VS7 A;  2K9G A;  4J9H A;  1WX6 A;  4RTX A;  1GCQ C;  1WFW A;  4K11 A;  1OV3 A;  2CSI A;  2DE0 X;  4E6R A;  2F2X A;  1VYV A;  3QWX X;  1N5Z A;  5IH2 A;  2D0N A;  2EYX A;  2GTO A;  2KRO A;  2OI3 A;  2JTE A;  1W70 A;  2YUN A;  2EW3 A;  5IXB A;  1OEB A;  2H8H A;  4EIK A;  1G2B A;  3VS3 A;  4HXJ A;  1NYG A;  1UG1 A;  4HCK A;  1WYX A;  2RQW A;  4CC4 B;  2NUZ A;  5GJW B;  2HEQ A;  1SHF A;  2LNH B;  1BK2 A;  2RF0 A;  4A63 B;  2ENM A;  2GQI A;  4J9G A;  4AFS C;  2FRW A;  1V1C A;  2LCS A;  1UTI A;  4J9I A;  2KE9 A;  1M27 C;  2ED0 A;  3R6N A;  1W6X A;  3NPF A;  1KFZ A;  1MV0 B;  1PHT A;  2YUO A;  3TSW A;  4JJC A;  1OPL A;  3KFV A;  2SRC A;  2DL7 A;  2X3X D;  3I5R A;  2J6F A;  2J06 A;  1QLY A;  3EG0 A; 
#chains in the Genus database with same CATH topology
 4F17 A;  3G7Z A;  3CCQ A;  3BE3 A;  3CCM A;  1VQL T;  1C6V X;  1N9R A;  2RJF A;  2RQV A;  3JRZ A;  2L5Q A;  1OZ2 A;  2DBK A;  2K5I A;  3S6W A;  2DBM A;  2QGG A;  1ZUY A;  3P8D A;  4R0K A;  3TU4 K;  3DLM A;  2CDT A;  5FWC A;  1E7O A;  4JS4 A;  2FL7 A;  3M4Y A;  4J6W A;  3JSC A;  2EGC A;  3U23 A;  2FVU A;  4HCB A;  3AHU A;  4MDX A;  1YIT A;  2G6F X;  4BE0 A;  3G71 Q;  3JCM X;  4C5H A;  1QCF A;  5C6S A;  1K8A R;  4XU1 A;  2EYY A;  1RAB B;  2EQI A;  3MEU A;  3VRY A;  4M75 C;  4C0Z A;  1UJY A;  4B6M A;  2VC8 A;  2FEI A;  3L2R A;  3H9N A;  3QZ5 B;  2C0T A;  3SWN A;  2F2V A;  3JB9 D;  5LJ3 e;  1QKW A;  1NM7 A;  2OTJ Q;  4B9X A;  4IUR A;  2ROL A;  2B86 A;  3NHN A;  2V1Q A;  1ZSZ B;  1Q82 R;  4AG2 C;  5GAN e;  3UA6 A;  2QAS A;  4D8D A;  2QQ9 A;  2CT4 A;  3M55 A;  3UT1 A;  2LZ6 B;  1FMW A;  2L0A A;  1PKT A;  3MEA A;  2FPE A;  3REB B;  1VQ6 T;  1QP2 A;  2QDY B;  2FZK B;  1IB8 A;  4LUE A;  4OMO A;  5IXF A;  4ZNX A;  3M0R A;  4RTY A;  3CPW P;  1VQN T;  4ANJ A;  1C1A A;  4KRT A;  2IIM A;  4PJN A;  2E70 A;  2D8J A;  4ORZ A;  1LPL A;  4ZN3 A;  2L3R A;  3QJY A;  4FYW B;  4BE1 A;  1ACM B;  2BE7 D;  3UDC A;  2NYS A;  1IZ6 A;  2XDP A;  3CC7 A;  1SF9 A;  3QO3 A;  2CYZ B;  2MWP A;  1SPK A;  2ESW A;  1KSW A;  3JCM W;  4E7S A;  4QQG A;  1UEB A;  3C95 A;  4IUV A;  4O6J A;  3X24 B;  4FSS A;  1BB9 A;  1PD1 A;  3MKD A;  4N4I A;  4XTU A;  2FPD A;  2VWF A;  2HCK A;  4J6Y A;  3NTK A;  1PM3 A;  1WNL A;  3ME9 A;  4M75 F;  2DRM A;  4M75 E;  2JJ9 A;  1UHF A;  2KGT A;  2V26 A;  2A7Y A;  4HCZ A;  1YHQ T;  3CC2 Q;  4FYX B;  4QQD A;  2E3I A;  1HK9 A;  2EWN A;  2HZY A;  1WHM A;  4QT7 A;  4JZ3 A;  4DEY A;  1N8R U;  2NUP A;  5KH6 A;  5GMK e;  1QCO A;  3S3M A;  2XG8 D;  3E9F A;  1WIE A;  1ABQ A;  2PZ1 A;  2QQA A;  3CCR T;  5GJV B;  5CK9 A;  2DIG A;  1JXM A;  1YP5 A;  2L3Q A;  1KQS P;  3CCM Q;  3FLG A;  4Z8A A;  1M90 C;  2ZPG B;  1VQ9 A;  1T3S A;  1VYT A;  3SHW A;  1Z9Q A;  3OYF A;  4JRP A;  1YCS B;  1QVF P;  3OYC A;  2CP7 A;  3VS2 A;  2E3H A;  2DX1 A;  3E9G A;  3I55 T;  1EZZ B;  4N4G A;  1KC8 U;  1U1S A;  1E6H A;  4BAC A;  3CME T;  2EQJ A;  3GIB A;  1QMC A;  4NL3 A;  1ZSZ A;  2EBP A;  3LW5 E;  5GMK h;  1YJW T;  2ATC B;  2E5K A;  2JOY A;  4N0A A;  2CZ0 B;  2WSE E;  2LJ0 A;  3M56 A;  3CCU A;  1N9S A;  2DO3 A;  2SEM A;  3GLX A;  3RER A;  2FPF A;  1OYX A;  1YFN A;  2AKK A;  3QDR B;  3OW2 A;  3H0I A;  1YIJ A;  3EFS A;  3CBP A;  3CCE A;  3FJ5 A;  2VXF A;  1M8M A;  3EG2 A;  5CKD A;  4XK8 E;  1I1J A;  4PJL A;  3KBG A;  1WI7 A;  1UFF A;  3MCA B;  1VQ4 A;  1G8X A;  2LX9 A;  4KBM B;  1SHG A;  3INZ A;  1NLO C;  3MEV A;  5M9O A;  2VGN A;  1M3B A;  4HKE A;  5KE3 A;  1Q7Y U;  4M4Z A;  1WQW A;  2RNA A;  3V8J A;  2J7I A;  1AZE A;  4KH0 B;  4QKU A;  2E12 A;  4FL6 A;  2JN0 A;  4DOW A;  5DM7 R;  1R77 A;  2FZG B;  1K9A A;  4F7U B;  2M02 A;  2M1H A;  1AVZ C;  1X69 A;  1QVG S;  4Q5W A;  3G71 T;  1OQK A;  3S3N A;  2HNI A;  2K79 A;  3VS6 A;  4HVW A;  1ZSZ C;  4M7A B;  2KYM A;  2COY A;  4OMP A;  3C0C A;  5CQY A;  1RAE B;  2X4J A;  2K4Y A;  1MND A;  2CKK A;  1H8K A;  3A5Z B;  3EH1 A;  3H0H A;  1AEY A;  3FDR A;  2PTK A;  2NUT A;  1QVG A;  5KYY B;  2L2P A;  2OTJ T;  1A0N B;  4GY5 A;  1E6G A;  3CC7 Q;  2RI2 A;  4J9B A;  5GAO q;  3L2U A;  2CSQ A;  2MMP A;  1OX8 A;  3HHT B;  2CRE A;  3A8M B;  2H3E B;  3CXC S;  2PUO B;  2VXE A;  4Z88 A;  5LJ3 j;  2YUP A;  2CZ7 B;  1QQJ A;  2EVR A;  2QGF B;  1Q86 U;  1JO8 A;  2CGH A;  1TWB A;  2KRN A;  2JS2 A;  1HYO A;  4R55 A;  3X20 B;  3I9Q A;  1UDL A;  1R0C B;  2ROT A;  2GF7 A;  3CXC A;  4E7H A;  1HSQ A;  1XQH A;  2DTH A;  3JCM d;  1AWX A;  4C8Q B;  3PNW C;  2QDL A;  4ZN1 A;  2RO0 A;  5A2Q E;  1K73 R;  1HXD A;  3PGG A;  3QWY A;  3SD4 A;  4J9C A;  2MIO A;  4C0G A;  3PIP A;  2JM8 A;  4FT4 A;  3LGF A;  4ELZ C;  2P84 A;  5GMK m;  2AT1 B;  2LMJ A;  2JVV A;  2LQ8 A;  1R0B G;  2RB6 A;  1PG5 B;  2KNB B;  2RI5 A;  2QXF A;  3JCM f;  3OBY A;  5FU6 B;  2R57 A;  1TG0 A;  2KMT A;  1OI1 A;  4J9F A;  3CC4 Q;  3FIF A;  2NWM A;  2XKO C;  3M9Q A;  4OML A;  1GBQ A;  2DVJ A;  4LDY A;  5L8R E;  3QHS A;  1K9M R;  1CSK A;  1CKA A;  3CC2 T;  2K9G A;  3J7A F;  4J9H A;  2VB6 A;  1M1G A;  4RTX A;  4OF1 A;  2DJZ A;  3I56 A;  5GAN d;  1Q82 C;  4FCY A;  1VQK Q;  3HRU A;  3OSV A;  1NJI C;  3CCE Q;  2BE9 B;  3X25 B;  1VYV A;  4KGV B;  2DZC A;  4F7U G;  3CCS A;  5IH2 A;  1S72 Q;  3CCM T;  5GMK j;  1VQ4 Q;  4EDU A;  2YUN A;  4HT9 A;  4M7A A;  2EW3 A;  4EIK A;  1G2B A;  3VS3 A;  1VQP Q;  1FWZ A;  4FW2 A;  2HL5 C;  3CD6 Q;  3ZFJ A;  2RQW A;  3OMG A;  2K3Y A;  5GAN f;  4BDZ A;  2QA4 A;  3ZEH A;  5KYY A;  5J39 A;  5GAN 7;  3HL8 A;  4J9G A;  4QVZ A;  2EQU A;  4XTX A;  3JCM V;  1UTI A;  3RR6 A;  5FLX E;  4J9I A;  2EQM A;  2ED0 A;  3VKI A;  1U1T A;  4XQ3 A;  1KFZ A;  2YUO A;  2EQK A;  1WHH A;  2EJ9 A;  4E7Z A;  1NPR A;  3VJP A;  8ATC B;  1NPP A;  2DL7 A;  2NLU A;  2J06 A;  1QLY A;  3EG0 A;  1YWP A;  3SEM A;  2JMC A;  2V8J A;  3OQ5 A;  2PNI A;  2XMF A;  3EFO B;  8AT1 B;  3JB9 J;  2CUB A;  4J5Y A;  3VS5 A;  4BB7 A;  3TEE A;  4FU6 A;  2MI6 A;  4XTV A;  2RJC A;  2K2V A;  4C0F A;  4C8Q A;  2ZPF B;  2YWW A;  5AT1 B;  1M2V B;  4M78 G;  4GBQ A;  5D6W A;  2RQU A;  4O5V A;  4M7A C;  3ER0 A;  3OYA A;  4KGZ B;  2HQE A;  1UGR B;  3Q1J A;  2BIV A;  3L2Z A;  4IUP A;  1OU8 A;  2FB7 A;  4A4G A;  2BUD A;  4A4H A;  1K0X A;  4Y92 A;  5A0D A;  1WJQ A;  3RES A;  1BI2 A;  2XDB A;  3CBO A;  3CCL Q;  3GOX A;  2COW A;  1QWF A;  2AK5 A;  2EFI A;  4CC2 A;  3CEY A;  1T0J A;  1ZA1 B;  3QJ6 A;  3M0P A;  2OTL Q;  3CC7 T;  2DER A;  4AT1 B;  2EAY A;  2KK4 A;  1JXO A;  2LVM A;  2H3J A;  3RBB B;  4C8Q C;  5EG2 A;  3OW2 P;  1K76 A;  4OMN A;  4A4F A;  5GAN 5;  4V2S A;  5KYW B;  4RTZ A;  2HL3 A;  4M75 D;  3O5Z A;  3PTA A;  2EJF A;  4TVR A;  4D6W A;  2OAW A;  1TUG B;  2ZPB B;  3H8Z A;  4OGE A;  2J6O A;  2GCX A;  3M54 A;  2CZ6 B;  1VQO A;  3KUF A;  2G3R A;  3BDL A;  2ECZ A;  4PJO G;  4PK4 A;  5J3B A;  1RAD B;  5I11 A;  3I56 Q;  3V8K A;  3OYD A;  1YI2 A;  5FU6 C;  4EMH A;  1UE9 A;  2GFU A;  2ZPI B;  2LT4 A;  4M77 G;  4XTY A;  2DXU A;  4IUQ A;  1YJ9 A;  2MAM A;  3J81 E;  4M7A F;  1XNI A;  4M7A E;  1VQ7 A;  2LQW A;  3MP6 A;  3E2U A;  2VAS A;  3URG A;  1M90 U;  4IIM A;  4J9E A;  3P8H A;  3JCM P;  2CH4 W;  2DL3 A;  2X4W A;  1SSF A;  3NMZ C;  3CC4 T;  2D0Q B;  2HKN A;  2F5K A;  3DB4 A;  3OYM A;  2L3S A;  4XTZ A;  5FRM A;  2M0O A;  5LJ5 d;  2E1H A;  2RN8 A;  4M7D G;  4OB0 B;  3EH2 A;  3RIR A;  9ATC B;  2JUF A;  1BI0 A;  1BCM A;  3MHX A;  1JRI A;  1AWW A;  2EYW A;  4FYV B;  5A0L A;  2L89 A;  2MPX C;  1KHC A;  1VQK T;  3L2W A;  3ASK A;  3CCE T;  1KG1 A;  1IHV A;  3MET A;  1B34 A;  1S72 T;  4C8Q F;  2COZ A;  3CCV Q;  4OGC A;  4C8Q E;  2DKG A;  5LJ5 f;  1TH7 A;  2X35 A;  3CXC P;  1YJN Q;  2YSQ A;  5FRN A;  3UA7 A;  1VQ4 T;  3CQT A;  1N8R R;  2AHJ B;  3EGD B;  1R8O B;  3H41 A;  2KYB A;  1VQ5 A;  2OJ2 A;  3FJP A;  3JCM J;  3LX7 A;  4ZGE B;  5GAM h;  1VQP T;  2JTM A;  3M53 A;  2A37 A;  3CD6 T;  1FMK A;  2KDS A;  3DKM A;  1UUE A;  2P4T A;  2YT6 A;  3HTR A;  2C06 A;  4C5G A;  1RAG B;  1K73 C;  5GAN 6;  3EG3 A;  1SEM A;  5IHI A;  1XTD A;  4CRI A;  1VQM Q;  1NBE B;  2JS0 A;  4Y28 E;  3M0Q A;  5C0M A;  1AWJ A;  2RJE A;  1KC8 R;  2YDL A;  1M1F A;  4LNP A;  4PFO A;  3JCM c;  3QBY A;  5D6X A;  4XTW A;  1D0Y A;  1M2O A;  2KSS A;  4FT2 A;  5I2M A;  1ZBJ A;  4LN2 A;  4J7I A;  1D3B A;  2PVO B;  2F2W A;  3E19 A;  2RK1 A;  3RNJ A;  3BDU A;  4OVA A;  3CMA Q;  2MWO A;  3HRT A;  2DXT A;  4MML A;  2BTT A;  2J6K A;  4Z89 A;  2RMO A;  3JB9 G;  3X26 B;  2HQX A;  1T3L A;  5LL6 S;  4JUV A;  1JJ2 S;  3FRN A;  3QKJ A;  5KE2 A;  3OS2 A;  3EGX B;  1MNE A;  1HD3 A;  3UAT A;  3I35 A;  2LP5 A;  2FZC B;  2CP6 A;  5HCK A;  1H3Z A;  1Q7Y R;  3MEW A;  1EIF A;  2RM4 A;  2P0K A;  3BY7 A;  2E41 A;  1H92 A;  3CCL T;  1MMD A;  2JW4 A;  1GFD A;  1X27 A;  1JJ2 A;  3A1P A;  2CH4 A;  2QEX A;  4D8K A;  5GAO n;  3CCJ A;  1QCN A;  2OTL T;  1UEC A;  2EPD A;  3NFC A;  4DA4 A;  4CC3 A;  2FO0 A;  1D0Z A;  1YJ9 Q;  4PFP A;  1RAI B;  1YBY A;  3M0S A;  5KYX B;  3L2Q A;  5GAN 8;  4LD9 K;  3LWH A;  5IAY A;  3G1J A;  2W0Z A;  2LC4 A;  3V8L A;  4WCI A;  3L42 A;  3MO8 A;  4RTT A;  2RK2 A;  2DA9 A;  1IRX A;  3G4S A;  1QKX A;  3QUI A;  3CCQ Q;  1KD1 U;  1M4Z A;  2XK0 A;  3A8G B;  3RMQ A;  3TCJ A;  4E7L A;  2ZCF B;  1X2Q A;  2E4H A;  1C0M A;  1IGQ A;  3H6Z A;  1NG2 A;  1VQ8 A;  1Q86 R;  1OPK A;  2HKQ B;  2LJ1 A;  2RHI A;  3M57 A;  2QAZ A;  4LD6 A;  4C92 B;  2KRM A;  3I56 T;  4JDS A;  3G6E A;  5KCH A;  2KRS A;  3OW2 S;  4BY6 B;  1V29 B;  2GGR A;  3QSU A;  1X75 C;  1WHL A;  1WDX A;  1TUD A;  2BZX A;  1ZUK A;  2ED1 A;  1V76 A;  1YIT Q;  2RHZ A;  1NJI U;  5CAI A;  4BD3 A;  2EKH A;  4HVV A;  1EX4 A;  5KYU B;  2DXC A;  2JZ2 A;  2FRY A;  4YTL A;  4NOY A;  1M3A A;  4N4H A;  3NTI A;  1ZQ1 A;  1AT1 B;  2V8I A;  4QW2 A;  1YCY A;  1VQL A;  1I07 A;  1PSF A;  4FIB A;  2ZAE A;  2YXY A;  1ZBX A;  2K6D A;  4J9D A;  4AFU C;  4IIO A;  1I8F A;  2QK0 A;  1UB4 A;  1JQQ A;  2J05 A;  2RH2 A;  1OZ3 A;  2F5T X;  3OY9 A;  5IN1 A;  4FYY B;  1Q81 C;  4K11 A;  2E65 A;  5GAM j;  3GPL A;  1N6A A;  3QYH B;  3LWI A;  4E6R A;  2EIF A;  3QWX X;  1WGS A;  2D0N A;  2EYX A;  2KVQ G;  1PCX A;  3OS0 A;  2GTO A;  2RJD A;  4HT8 A;  3CCV T;  2PVG B;  1BI1 A;  2OI3 A;  4J6X A;  1BKB A;  1YJN T;  1UGQ B;  3HRS A;  3VYG A;  5DY9 A;  2H8H A;  4HXJ A;  4C5I A;  1UG1 A;  4HCK A;  2L8D A;  2YLC A;  1WYX A;  4CC4 B;  2NUZ A;  5GJW B;  2HEQ A;  1SHF A;  2XD0 A;  5DLQ E;  2LNH B;  3LYI A;  4KUI A;  2DEQ A;  4CI0 C;  2GQI A;  4AFS C;  2FRW A;  1M1K U;  1NE8 A;  2I2L A;  5CKE A;  3R6N A;  2HQH A;  2QI2 A;  3NPF A;  4DBR A;  5I2S A;  1MV0 B;  1VQM T;  2CZ1 B;  2QG9 B;  1VQ6 A;  2HSE B;  1WJR A;  2KI7 A;  2RA2 A;  2J6F A;  1W4S A;  4BI3 A;  2P0P A;  3VYH B;  1JBM A;  2Y4X A;  5GAN 2;  1Y07 A;  1FX7 A;  4PKC C;  5GAO p;  1MMA A;  4OP0 A;  2LQK A;  1NZ9 A;  4M78 B;  4RMO A;  5GAO l;  2DNU A;  3CMA T;  3H0F A;  4C92 G;  2KXC A;  1MGQ A;  4ESR A;  2HDA A;  5LJ5 h;  4QVC A;  1XJW B;  1B3Q A;  2RI3 A;  1VQ9 Q;  2R5A A;  1M30 A;  5KYU A;  3A8H B;  1BIA A;  5CCA A;  3OYB A;  4OMM A;  3L2V A;  1J3T A;  2PU9 B;  2RQT A;  2X4X A;  2VV5 A;  1VQ8 Q;  1IXD A;  4IKF A;  1RAA B;  1K8A C;  4J7F A;  3KXT A;  1AHJ B;  2IG0 A;  2EYZ A;  3MP8 A;  2LT1 A;  3RKX A;  3UWN A;  2MF2 A;  3X28 B;  4HCC A;  1WXU A;  2AZV A;  3HP9 A;  3OYG A;  4MMK A;  2GBQ A;  4M7A D;  1IO6 A;  5LJ3 d;  1WHJ A;  2DL8 A;  1K0S A;  1RUW A;  2JXB A;  1MUZ A;  3CCU Q;  3JB9 I;  3A8O B;  2JM9 A;  3CCR A;  3GBQ A;  1HJD A;  2XID A;  5D6Y A;  1KHI A;  1GBR A;  1Y7X A;  1YIJ Q;  1Y96 B;  1KQ1 A;  2HD0 A;  4BUG A;  4F7U A;  1WHG A;  4C92 C;  1BI3 A;  1MHN A;  4AFZ C;  1YNZ A;  3CCQ T;  3QXE B;  4BY6 C;  5CQX A;  2X3W D;  1OUL A;  4RG8 A;  4JPB W;  2DPP B;  5GAM g;  3I55 A;  2LTO A;  3A98 A;  5LJ3 f;  2QQS A;  1KJW A;  1U3O A;  3L1A A;  1ABO A;  1RI0 A;  2A28 A;  4PJO B;  4IUU A;  2FHD A;  1YJW A;  3M4G A;  1TSF A;  1D0X A;  4OMQ A;  2JTF A;  4M77 B;  3OYJ A;  4CC7 A;  4C8Q D;  1RLQ C;  1YIT T;  1MMN A;  4BE2 A;  1SRL A;  1MMG A;  1AOJ A;  2K2M A;  5FU7 B;  1I81 A;  1FMV A;  3JCM Q;  1WQ7 A;  1AWO A;  3FC3 A;  3QDF A;  1JJ2 P;  1DJ7 B;  4GLK A;  2XU8 A;  4Y91 A;  5FRO A;  4LDU A;  4A4K A;  1PWT A;  1YWO A;  4HA8 A;  1Q7Y C;  1ZX6 A;  4M7D B;  3PMT A;  4JJD A;  1VUB A;  1WZO A;  3HFO A;  5CKH A;  4M78 A;  2I0N A;  1X01 A;  3C94 A;  4RTW A;  3G71 A;  3OYI A;  3VS1 A;  2RQR A;  1MV3 A;  2JNG A;  2KBT A;  2BZ8 A;  3OBW A;  2DEU A;  2DMO A;  2HBW A;  3VUZ A;  1Z9Z A;  4JJN K;  3M5A A;  2OTJ A;  4DEX A;  1UHC A;  4P5N A;  2GFA A;  3PVL A;  4KH1 B;  1JU5 C;  1G5V A;  1TUC A;  2IPO B;  2V8K A;  5HY6 A;  1JB0 E;  4MZP A;  3WXM B;  1Q86 C;  4DBQ A;  3IQL A;  3DLL A;  2Z0W A;  1IGU A;  1F1B B;  3GNF B;  4DBH A;  3C12 A;  2AKL A;  2X9H A;  4Z02 A;  3EG1 A;  3OS1 A;  3SWN B;  3PE0 A;  4WTO B;  1Y57 A;  2K57 A;  3TRE A;  4JJB A;  2DET A;  4X34 A;  4QVD A;  4M78 C;  1LCK A;  3T9N A;  4X9D A;  1SG5 A;  2CS7 A;  2KAF A;  1EFN A;  1N27 A;  4GLM A;  3M0U A;  4DOV A;  3LH5 A;  2K3X A;  4OB1 B;  5LJ5 j;  2D1X A;  1W1F A;  4AFQ C;  1PSE A;  1WHK A;  1OX9 A;  2DF6 A;  1ZLM A;  3V7R A;  1CKB A;  5AYF A;  3GF5 A;  1TOV A;  4PJO A;  3OYE A;  2C0I A;  2Y90 A;  4NS5 A;  4F7U F;  1U8R A;  3CBM A;  1UJ0 A;  2YRV A;  4F7U E;  3VUB A;  4PNO A;  1ARK A;  4M77 A;  2AIR B;  2HMA A;  1PRM C;  3OYK A;  3CCS Q;  1ZUU A;  1LNX A;  5IHK A;  1VQ9 T;  2DYI A;  1BU1 A;  2R5M A;  2WSC E;  3OB9 A;  4E7J A;  1VQ8 T;  3J80 E;  4FSX A;  2QA4 Q;  2E5Q A;  2DAQ A;  1K4U S;  3CC2 A;  4M75 G;  5GAM e;  3EFO A;  4RKU E;  4XU3 A;  5FW9 A;  3OYN A;  3HSB A;  1TXQ A;  1OOT A;  4M7D A;  1RI9 A;  3CCU T;  4MDW A;  4BI4 A;  1M2V A;  3VU3 C;  2O31 A;  2PQW A;  3TQ7 P;  7AT1 B;  1YIJ T;  5KYN A;  4L5G A;  3V7S A;  4PJO C;  3SDZ A;  3V7C A;  2ZPE B;  1U06 A;  2CP5 A;  1GXI E;  5IT9 E;  4M77 C;  2YLB A;  2EGA A;  2NUP B;  4M78 F;  4M78 E;  2DXB A;  4AMC A;  2QYZ A;  1GCP A;  1XOV A;  4IUT A;  4XAX B;  1K1Z A;  2A08 A;  3HPW A;  3EG9 B;  5FU7 C;  2GNC A;  1Q81 U;  3NGP A;  1FYN A;  2RD1 A;  1KD1 R;  1G3W A;  2Y4Y A;  3FB9 A;  2VGM A;  2MOX A;  3JCM h;  1RL2 A;  4RCC A;  1M8V A;  5HK3 A;  2P4R A;  4F04 B;  5EC7 A;  4M7D C;  1NLP C;  2IVW A;  4KT0 E;  4II1 A;  4ZGD B;  2DVE A;  1FXX A;  5CIU A;  5GAN 4;  4EMK C;  5I21 A;  5KYW A;  5I22 A;  1IHW A;  2K5L A;  1NJI R;  1IRE B;  2M16 A;  2X4Y A;  3VS7 A;  1D1B A;  3EFR A;  4PFZ A;  2ZZD A;  3RUX A;  3QZ9 B;  1WFW A;  4EPC A;  3DB3 A;  1OV3 A;  1KK7 A;  2CSI A;  2DE0 X;  2FYK A;  2VYT A;  2O01 E;  4A54 A;  5LJ5 g;  5GAN 3;  2F2X A;  1K9M C;  1N5Z A;  3JCM b;  2E6N A;  3SB2 A;  1Y71 A;  2KRO A;  1Q95 G;  1PD0 A;  1QVP A;  2JTE A;  2DD4 A;  1W70 A;  2XIC A;  1D1C A;  5LJ3 h;  2OAU A;  2E64 A;  4KGX B;  1NYG A;  4PJO F;  2DZ9 A;  4PJO E;  1VQO Q;  1TU0 B;  5GAN h;  3WVE B;  4EMG A;  4M77 F;  4M77 E;  1YI2 Q;  3SWN C;  1LOJ A;  1V1C A;  2LCS A;  4C0D B;  3LLR A;  2KE9 A;  4JRI A;  1M27 C;  3OS5 A;  2CP0 A;  1W6X A;  1VQ7 Q;  1OPL A;  3KFV A;  2DTO A;  4JS5 A;  2NUT B;  3I5R A;  3OYY A;  1O9S A;  2DM1 A;  2LDM A;  1VIF A;  2YRC A;  3N5B B;  1QW1 A;  4M7D F;  2C0O A;  4M7D E;  1M1K R;  1W2B S;  1K8A U;  3EGU A;  2F69 A;  2YRD A;  4PLI A;  2WAC A;  2KQW A;  1G3T A;  3QII A;  3EGD A;  3PIO A;  5GMK l;  2AZS A;  4DQ2 A;  2LCC A;  2O88 A;  3EG9 A;  4F16 A;  1W2B A;  2HSP A;  4VUB A;  1Q82 U;  3CCS T;  4R56 A;  3BFM A;  3PFS A;  2R58 A;  1JEG A;  2PUK B;  4J8O A;  2WSF E;  3CC4 A;  5KCO A;  1G3Y A;  1WPY A;  4X9C A;  3ZL7 C;  1VQ5 Q;  2MK5 A;  3RKW A;  3SFM A;  1G3S A;  2QA4 T;  5IHN A;  5FWB A;  2KR3 A;  2DIQ A;  4L6V 5;  1H3H A;  4XU2 A;  1WJS A;  2K7A A;  4RTV A;  1NEG A;  4ATO A;  1VQK A;  1I0C A;  2KXD A;  2YHT A;  1M3C A;  4MZT A;  1UGP B;  3S3O A;  1PKS A;  1ZHI A;  2LX7 A;  1S72 A;  1WXT A;  2D6F A;  2LNV A;  1BBZ A;  3EGX A;  1VA7 A;  2A0F B;  2M0Y A;  4JRK A;  1AD5 A;  1VQP A;  2GTJ A;  3O8V A;  3CD6 A;  1T0H A;  3TSZ A;  1X43 A;  1X6G A;  1X6B A;  2ZGW A;  1KIK A;  3I5S A;  4RCB A;  1NEB A;  3JB9 F;  2EGE A;  3OYL A;  1GL5 A;  3M0T A;  3C4S A;  5CVI A;  2KT8 A;  1M5Q 1;  1RLP C;  2BZY A;  5CKF A;  2VVK A;  5DLO A;  2X51 A;  3MP1 A;  3JV3 A;  2L3P A;  4N0A C;  5A0G A;  5KYX A;  5LJ5 e;  1PRL C;  5HKC A;  4C92 D;  2D9T A;  4BI8 B;  2A36 A;  4B9W A;  1UGV A;  2DFU A;  2XI9 A;  3RMS A;  4RUG A;  2LCL A;  1VQN A;  2DL4 A;  2ZPH B;  4E47 A;  1LJO A;  2QEX Q;  3HKS A;  3CCJ Q;  2YUQ A;  1GFC A;  2QQB A;  2O9S A;  1BCO A;  3BW1 A;  4F14 A;  5GAM d;  5L23 A;  2M51 A;  5GAN j;  1B7T A;  1PNJ A;  1SSH A;  4RTU A;  4C92 A;  3PMI A;  3FEO A;  6AT1 B;  1I5O B;  3ZBD A;  2CP2 A;  1O75 A;  3EHR A;  3ULR B;  4AG1 C;  3MJX A;  2JT4 A;  3G4S Q;  2RPN A;  2CUD A;  2MYS A;  5GAO r;  3NTH A;  3CCL A;  3UPU A;  1WXB A;  2QTV A;  4C0D C;  3OYH A;  4UC4 A;  3MPU B;  1TTH B;  4A53 A;  5GAM f;  4QQ6 A;  1VQO T;  2ABL A;  3TVT A;  3UF4 A;  2W10 A;  4E7K A;  2KEA A;  4E2F B;  1D09 B;  2OTL A;  4JZ4 A;  4NL2 A;  2DJQ A;  4ZTJ A;  2O9V A;  3G6E Q;  2O4X B;  1YI2 T;  1YHQ A;  4PJM A;  1N8R C;  1P92 A;  2KY9 A;  2QTX A;  3QYG B;  3CPW S;  1LVK A;  2HBP A;  2LRQ A;  2XHC A;  1YJ9 T;  5CO7 A;  1VQ7 T;  2P0Q A;  1KD1 C;  1ZSG A;  4MZM A;  3PT9 A;  1BIB A;  1VQL Q;  2CP3 A;  2VUB A;  5J26 A;  2B8A A;  4A4E A;  3CPW A;  1KC8 C;  3VRZ A;  4X1V A;  2EYQ A;  5D7U A;  2QQR A;  3VS0 A;  3CME A;  1X2K A;  1NYF A;  1VOM A;  1U5S A;  2DL5 A;  1QWE A;  1I4K 1;  1WLP B;  2KT1 A;  3JCM g;  3GP8 A;  4KUD K;  2HAX A;  1RAF B;  2K5F A;  4J83 A;  3REA B;  2LQN A;  2K3B A;  2EKO A;  2M9U A;  4M7A G;  3THK A;  3WVD B;  4M78 D;  2DYB A;  2DIL A;  3EAE A;  2VKN A;  5CKB A;  1VQ5 T;  2E6Z A;  4LE9 A;  2V1R A;  1B07 A;  2DRK A;  4M75 B;  1KQS S;  3PVQ A;  4LXC A;  3GNG A;  1SKU B;  1SRM A;  1M90 R;  1K73 U;  1I5L A;  1AZG B;  1UGS B;  4EMK B;  1G83 A;  1QVF S;  2XDD A;  1VQ6 Q;  3VS4 A;  3VV0 A;  4OMF B;  3JAM E;  1VYU A;  4OB2 B;  2DTI A;  1KQS A;  2JMA A;  4ME7 A;  3CCV A;  4OB3 B;  2LJ3 A;  4C5E A;  1YJN A;  5LJ3 g;  3QPH A;  4JRQ A;  1VQN Q;  3JB9 H;  4FM4 B;  1GCQ A;  1Y0M A;  2O2O A;  4C8Q G;  4ZGJ B;  3OMC A;  1RAC B;  5GAN g;  1QVF A;  4PL6 A;  3D7S B;  4LDW A;  1X6O A;  1WA7 A;  4C92 F;  4C92 E;  1GRI A;  4L59 A;  4ELY C;  1M1K C;  4PJJ A;  3M59 A;  5GAO m;  1B34 B;  3LGL A;  2MCN A;  2BKD N;  2RHU A;  1W2B P;  1H64 1;  5GMK i;  2O4X A;  4PLL A;  2GQV A;  3P8B B;  1M9S A;  1VQM A;  5ECA A;  3A8L B;  3F70 A;  1K9M U;  1ZA2 B;  1VIE A;  2D8H A;  2FG0 A;  1YN8 A;  5HK0 A;  2DLP A;  4PJO D;  2CT3 A;  4LDX A;  4WF2 A;  4JLI A;  1Q81 R;  1Y96 A;  3M58 A;  4M77 D;  4LUD A;  2A3L A;  4ZTF A;  1S1N A;  3R6O A;  4BDY A;  4HVU A;  1YHQ Q;  1D1A A;  3EHQ A;  3HFN A;  2QEX T;  3CCJ T;  1WX6 A;  2RHX A;  3CMA A;  1BYM A;  1GCQ C;  4JLG A;  1KQ2 A;  4E7I A;  1OU9 A;  2OX7 A;  2RHY A;  3CPF A;  3CCR Q;  1TS9 A;  4LDV A;  4RG2 A;  2EJG A;  3OA6 A;  3QG1 A;  3LH0 A;  4M7D D;  3G4S T;  1D3B B;  2DK3 A;  5IXB A;  1OEB A;  2PVD B;  3RKY A;  3I55 Q;  1QP3 A;  2E10 A;  3RDV A;  3CME Q;  1BK2 A;  2DD5 A;  2RF0 A;  4A63 B;  2ENM A;  1YJW Q;  3G6E T;  2F1L A;  4M75 A;  4DBF A;  3OSS C;  4KUL A;  1RAH B;  1PC0 A;  4FW1 A;  3E1S A;  3AT1 B;  1PHT A;  3TSW A;  4JJC A;  5CR2 A;  2SRC A;  4EMK A;  2X3X D;  4XU0 A;  3JCM e;  1QVG P; 
#chains in the Genus database with same CATH homology
 4F17 A;  1YWP A;  3SEM A;  2DM1 A;  2JMC A;  2RQV A;  2PNI A;  2XMF A;  2CUB A;  3VS5 A;  2C0O A;  2DBK A;  3EGU A;  2DBM A;  1ZUY A;  4R0K A;  2CDT A;  4GBQ A;  5FWC A;  1E7O A;  2RQU A;  2DNU A;  2AZS A;  3H0F A;  2O88 A;  2KXC A;  2EGC A;  3U23 A;  4ESR A;  4F16 A;  2HDA A;  2HSP A;  2G6F X;  1QCF A;  2EYY A;  1K0X A;  1B3Q A;  4Y92 A;  1M30 A;  2EQI A;  3VRY A;  1JEG A;  1UJY A;  2FEI A;  4OMM A;  1J3T A;  2RQT A;  3ZL7 C;  2C0T A;  2F2V A;  1QWF A;  1QKW A;  1NM7 A;  2AK5 A;  4CC2 A;  2EYZ A;  1T0J A;  2B86 A;  2ROL A;  3NHN A;  2V1Q A;  1WXU A;  5IHN A;  2AZV A;  5FWB A;  4AG2 C;  2KR3 A;  3M0P A;  1H3H A;  3UA6 A;  2GBQ A;  4D8D A;  4RTV A;  2K7A A;  1IO6 A;  1JXO A;  1NEG A;  2CT4 A;  2DL8 A;  1K0S A;  2LZ6 B;  1RUW A;  2JXB A;  1MUZ A;  3RBB B;  2L0A A;  1I0C A;  2JM9 A;  1PKT A;  2KXD A;  1M3C A;  3GBQ A;  1HJD A;  1K76 A;  4OMN A;  2FPE A;  1GBR A;  3REB B;  1PKS A;  2LX7 A;  1WXT A;  4RTZ A;  4LUE A;  4OMO A;  3O5Z A;  5IXF A;  4ZNX A;  4AFZ C;  1YNZ A;  3M0R A;  2OAW A;  4RTY A;  2X3W D;  1BBZ A;  1VA7 A;  2J6O A;  2M0Y A;  4JPB W;  1AD5 A;  4KRT A;  2GTJ A;  2IIM A;  3A98 A;  1KJW A;  1T0H A;  2D8J A;  3TSZ A;  1X43 A;  1X6G A;  1X6B A;  4ORZ A;  1U3O A;  1ABO A;  2A28 A;  2ECZ A;  3I5S A;  1KIK A;  5I11 A;  1NEB A;  1UE9 A;  2EGE A;  1GL5 A;  3M0T A;  4OMQ A;  2KT8 A;  4CC7 A;  1RLP C;  2BZY A;  1RLQ C;  1SPK A;  2ESW A;  1KSW A;  2VVK A;  2LQW A;  3JV3 A;  2L3P A;  1SRL A;  4IIM A;  1AOJ A;  4J9E A;  2K2M A;  1BB9 A;  1PRL C;  4FSS A;  2CH4 W;  2DL3 A;  2A36 A;  3NMZ C;  2FPD A;  1AWO A;  1UGV A;  2VWF A;  2HCK A;  4RUG A;  2L3S A;  2DRM A;  2DL4 A;  1PWT A;  1YWO A;  1ZX6 A;  1UHF A;  2RN8 A;  2KGT A;  2YUQ A;  1GFC A;  4JJD A;  4QT7 A;  2O9S A;  4JZ3 A;  4DEY A;  4F14 A;  1AWW A;  5L23 A;  2I0N A;  2EYW A;  1WIE A;  1ABQ A;  2PZ1 A;  2M51 A;  1SSH A;  1PNJ A;  4RTU A;  4RTW A;  3VS1 A;  5GJV B;  2RQR A;  1MV3 A;  2KBT A;  1JXM A;  2BZ8 A;  1YP5 A;  2L3Q A;  4Z8A A;  3EHR A;  1T3S A;  1VYT A;  3SHW A;  3ULR B;  4AG1 C;  2JT4 A;  1Z9Q A;  2DMO A;  2HBW A;  2RPN A;  2YSQ A;  3UA7 A;  2CUD A;  1YCS B;  1Z9Z A;  3CQT A;  1WXB A;  3H41 A;  2KYB A;  3VS2 A;  2OJ2 A;  2DX1 A;  2A37 A;  1E6H A;  2ABL A;  3TVT A;  1FMK A;  3UF4 A;  2W10 A;  1UUE A;  4DEX A;  1UHC A;  2KEA A;  2YT6 A;  3PVL A;  4JZ4 A;  2DJQ A;  2O9V A;  1JU5 C;  2EBP A;  1TUC A;  2E5K A;  3EG3 A;  1SEM A;  5IHI A;  2LJ0 A;  3IQL A;  2JS0 A;  2SEM A;  3M0Q A;  2FPF A;  1AWJ A;  2AKK A;  2AKL A;  3H0I A;  3EG1 A;  2YDL A;  3PE0 A;  3FJ5 A;  1Y57 A;  4LNP A;  1ZSG A;  1M8M A;  4JJB A;  3EG2 A;  1I1J A;  1LCK A;  1WI7 A;  1UFF A;  1EFN A;  4GLM A;  3M0U A;  3LH5 A;  2D1X A;  1SHG A;  1W1F A;  4AFQ C;  1ZBJ A;  3VRZ A;  4LN2 A;  1NLO C;  4X1V A;  2DF6 A;  2F2W A;  1M3B A;  1ZLM A;  3RNJ A;  1CKB A;  4M4Z A;  2RNA A;  2J7I A;  3VS0 A;  1AZE A;  1X2K A;  1NYF A;  1U5S A;  2DL5 A;  2BTT A;  1QWE A;  2J6K A;  4Z89 A;  2C0I A;  2RMO A;  1UJ0 A;  1K9A A;  1T3L A;  1WLP B;  1AVZ C;  1X69 A;  2KT1 A;  1ARK A;  1PRM C;  2K79 A;  1ZUU A;  3VS6 A;  1HD3 A;  3UAT A;  3REA B;  2LQN A;  2K3B A;  3I35 A;  4HVW A;  2LP5 A;  5IHK A;  2KYM A;  4OMP A;  3C0C A;  3THK A;  5HCK A;  2DYB A;  1BU1 A;  2DIL A;  1H8K A;  2VKN A;  1H92 A;  3H0H A;  1AEY A;  2JW4 A;  2PTK A;  1GFD A;  1X27 A;  2L2P A;  2CH4 A;  4LE9 A;  2V1R A;  1B07 A;  1A0N B;  2DRK A;  4D8K A;  1K4U S;  1E6G A;  4J9B A;  5FW9 A;  1UEC A;  2EPD A;  3PVQ A;  2CSQ A;  1OOT A;  4CC3 A;  2FO0 A;  1RI9 A;  2CRE A;  3M0S A;  4Z88 A;  1SRM A;  2YUP A;  1AZG B;  1G83 A;  2O31 A;  2W0Z A;  2EVR A;  4WCI A;  1JO8 A;  3VS4 A;  2KRN A;  2JS2 A;  1VYU A;  4RTT A;  3I9Q A;  2JMA A;  2DA9 A;  1UDL A;  2LJ3 A;  1QKX A;  2ROT A;  1HSQ A;  1GCQ A;  1Y0M A;  2O2O A;  1AWX A;  1U06 A;  2QDL A;  2EGA A;  1X2Q A;  3QWY A;  4J9C A;  1GCP A;  1NG2 A;  1OPK A;  1WA7 A;  1XOV A;  2MIO A;  2LJ1 A;  1GRI A;  1K1Z A;  2JM8 A;  2KRM A;  2A08 A;  2KRS A;  2GNC A;  2GGR A;  3NGP A;  2MCN A;  1FYN A;  1WDX A;  1TUD A;  2BZX A;  2LMJ A;  1ZUK A;  2ED1 A;  2KNB B;  5ECA A;  2MOX A;  2EKH A;  4HVV A;  2FRY A;  1M3A A;  2D8H A;  2P4R A;  1TG0 A;  2FG0 A;  1YN8 A;  5EC7 A;  1NLP C;  2DLP A;  1I07 A;  2CT3 A;  4J9F A;  2NWM A;  4OML A;  4LUD A;  5I22 A;  2K6D A;  4J9D A;  4AFU C;  1GBQ A;  2DVJ A;  4IIO A;  1S1N A;  4HVU A;  3EHQ A;  1CSK A;  1JQQ A;  2J05 A;  1CKA A;  3VS7 A;  2K9G A;  4J9H A;  1WX6 A;  4RTX A;  1GCQ C;  1WFW A;  4K11 A;  1OV3 A;  2CSI A;  2DE0 X;  4E6R A;  2F2X A;  1VYV A;  3QWX X;  1N5Z A;  5IH2 A;  2D0N A;  2EYX A;  2GTO A;  2KRO A;  2OI3 A;  2JTE A;  1W70 A;  2YUN A;  2EW3 A;  5IXB A;  1OEB A;  2H8H A;  4EIK A;  1G2B A;  3VS3 A;  4HXJ A;  1NYG A;  1UG1 A;  4HCK A;  1WYX A;  2RQW A;  4CC4 B;  2NUZ A;  5GJW B;  2HEQ A;  1SHF A;  2LNH B;  1BK2 A;  2RF0 A;  4A63 B;  2ENM A;  2GQI A;  4J9G A;  4AFS C;  2FRW A;  1V1C A;  2LCS A;  1UTI A;  4J9I A;  2KE9 A;  1M27 C;  2ED0 A;  3R6N A;  1W6X A;  3NPF A;  1KFZ A;  1MV0 B;  1PHT A;  2YUO A;  3TSW A;  4JJC A;  1OPL A;  3KFV A;  2SRC A;  2DL7 A;  2X3X D;  3I5R A;  2J6F A;  2J06 A;  1QLY A;  3EG0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...