2VV5A

The open structure of mscs
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
256
structure length
256
Chain Sequence
b'LSYAVNIVAALAIIIVGLIIARMISNAVNRLMISRKIDATVADFLSALVRYGIIAFTLIAALGRVGVQTASVIAVLGAAGLVVGLALQGSLSNLAAGVLLVMFRPFRAGEYVDLGGVAGTVLSVQIFSTTMRTADGKIIVIPNGKIIAGNIINFSREPVRRNEFIIGVAYDSDIDQVKQILTNIIQSEDRILKDREMTVRLNELGASSINFVVRVWSNSGDLQNVYWDVLERIKREFDAAGISFPYPQMDVNFKRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SMALL-CONDUCTANCE MECHANOSENSITIVE CHANNEL
publication title The Structure of an Open Form of an E. Coli Mechanosensitive Channel at 3.45 A Resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 83
structure length 256
sequence length 256
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2008-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00924 MS_channel Mechanosensitive ion channel
A PF05552 TM_helix Conserved TM helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.60 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2vv5A02
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vv5A03
1KVJA 3TNVA 1YJTA 2ZDPA 3BDEA 1AFIA 1CC7A 2GGPA 1FE4A 1SB6A 1X8DA 2IYGA 5F0WA 2JDJA 1TR0A 1OPZA 5B0GA 1RJJA 1CC8A 2GO8A 5B0AA 2BYCA 1Y0HA 2QLXA 5T7LA 5A6WA 2K2PA 1YJUA 3VTIA 2OMOA 4FNIA 5KAKA 2BJEA 4HL9A 4YEAA 5K9FA 2FB0A 2AJ0A 3F44A 4NPOA 3KNGA 1Y3KA 2BBEA 3LGMA 2HQIA 4OIXA 2KT3A 3CJKB 1TL5A 2HLUA 2ZDOA 1CPZA 1AW0A 4YDXA 2LDIA 2PGCA 1KQKA 3BM7A 1Q4RA 2ACYA 3LGNA 3CJKA 2L3MA 3HHLC 2OP5A 1AFJA 2N7YA 2ROGA 3I9ZA 2LQBA 3E8OA 1TZ0A 2IFXA 2XMVA 2XMKA 3MZIA 5T7LB 1OQ6A 5A6PA 3DXSX 3HHLB 3TOQA 4HI2A 2AJ1A 3LO3A 4OJ1A 1QUPA 1YJVA 2RK1A 1TUVA 1FEEA 2AW0A 1X7VA 1YG0A 2XMMA 4OJ3A 3FMBA 4HI1A 1XBWA 2XMJA 3HHLA 4ZA1A 1Y3JA 1Y9OA 1JK9B 1VIEA 3HFKA 2P4TA 3IWXA 1VIFA 2HFNA 2RILA 4HH1A 1N5VA 3FRYA 2OD4A 1SI9A 3BGUA 3BN7A 2OFHX 3FGVA 3T9NA 2RSQA 2QYCA 1R6YA 5B0BA 2AP6A 4Y2KA 5B0FA 4F67A 1Q8LA 1P6TA 2W4DA 2GFFA 2GCFA 1Q53A 2QIFA 4Y2IA 2OFGX 2Q3PA 3HX9A 2IYIA 4DN9A 2RMLA 4Q2MA 2BJDA 3KG0A 4A46A 2PD1A 1K0VA 4A48A 1S6OA 2FHMA 2ROEA 1GXTA 1V3ZA 2CRLA 4EFAC 1YJRA 2QLWA 3GZ7A 1N5SA 1Q8BA 2N4CA 4HH0A 1SQEA 2HLTA 2XMUA 5IXUA 1FESA 2OKQA 2XMTA 3TRGA 2FIUA 1MWYA 4DL0C 3HHLD 1N5TA 2W4PA 4Y2MA 4A4JA 1YRXA 5B0CA 4OJGA 1VQYA 4A47A 2RH2A 4OJHA 4ZOSA 1FE0A 2KKHA 3BF4A 1MWZA 2FTRA 1URRA 1W2IA 1TL4A 3WDOA 1APSA 1FD8A 2G9OA 1KVIA 2KYZA 1VQSA 2GV1A 2GQVA 3UDCA 2KT2A 2OAUA 1IUJA 2EW9A 2ROPA 2LXFA 2W4CA 3QMQA 2RU9A 1ULRA 4U9RA 2HFOA 1S6UA 2BUNA 5F0UA 5B09A 2OD6A 3K7RA 2XMWA 1OSDA 1FVSA 2ASYA 2VV5A 1WD6A 3KKFA 2N4DA 2GA7A 1N5QA 3BR8A 3HF5A 1X0PA 5B0DA 3QGPA 1LQ9A 3HDSA 3DCAA 3IWLA 5B0EA 1P8GA 2K1RB 2K7JA 4Q2LA 4DPOA 1JWWA 5B08A 1GXUA 2LQ9A 3MCSA 4NL5A 3BB5A 3KG1A 1OQ3A 2RK2A 1FVQA 2GGPB 1U7LA 2VH7A 4QOTA 2K1RA 2K7KA 3SFMA 2HIQA 4FNHA
chains in the Genus database with same CATH superfamily
3ZTOA 5D77A 1UVJA 4C92D 4RNMA 4Y92A 2VQEF 2F5GA 1CBKA 3C46A 4E0DA 2MMPA 4JJDA 3AD7C 3EJMA 5AXKA 2HS3A 3BH6B 1VRTB 3MM8B 3D0HE 2FPDA 2YXLA 3UW1A 4LDWA 4I6AA 2F2VA 2DMOA 3META 2AF6A 7FD1A 2OTLT 1F9HA 1S0NA 5FDLB 4P10A 3IFEA 1VQ8S 1F5BA 1U45A 4C11A 1LOJA 2DERA 1HWKA 2EVRA 1S4FA 1N8RR 2M51A 1FKPB 3HXMA 3PW7A 2DH7A 1D1BA 3NKYA 3CQTA 1TMMA 3UNYA 4CQ1A 3T6BA 2W8KA 3BYRA 2FHJD 3J80Y 1MU2B 1IRXA 1YJ9A 3H25A 1BI3A 1GXTA 3OYMA 3PACA 4C8QA 1OU9A 3J7AF 1WHHA 2HNZB 2QZ8A 4KTQA 3J81U 2DILA 4MDWA 2KZZA 2GFAA 5ECAA 5GVQA 4N0AA 4DFPA 1RWXB 4HHHA 1N4LA 4LF4J 1FTCA 5KG5A 3A13A 1Y10A 2XI2A 3DU6A 4QWBA 2FC8A 4O5VA 4CCHA 5KT6A 3VS0A 1JJHA 2K7KA 2J7IA 1KOOA 3PO5A 1TL1A 2IJNA 3KNAA 3T3FA 1UWAA 4ZGDB 2WAQD 2ECZA 2J0SD 2HQCA 1EARA 4MFBA 1WQ7A 4AFSC 4B3MF 2CVEA 4DMZA 4RW4B 2ZDOA 3SD4A 5GAMf 4U7UD 4A8YA 1XTZA 4ZIVA 1SC3B 4IH6A 2ZAEA 1R8PA 1MN9A 3LO3A 3GNGA 1IGQA 2HHSA 4EBEA 5C42A 5KFLA 1KQSR 1M2VB 3C94A 3PJ9A 4J7FA 1L3VA 1VQ5Q 2LJ1A 5CYJA 2YRDA 1SIZA 1RWOB 1BWEA 3ZZYA 2ZUAA 2CJBA 4DN9A 3G6ES 3OL7A 2ZWPA 2FZCB 2PUKB 2W2QP 3AJ2A 1QVGP 3RRKA 1MWYA 1DFDA 1FJ7A 2RF0A 3NGKA 1WDTA 4FPIA 1JEGA 4QWCA 5GMKj 1LWCA 4CM2A 4B3SJ 3C2PA 2MZRA 1ZH5A 1MV0B 4WP8A 1GAOA 3LP0A 1M90T 4DR7F 4BI8B 1S72T 2KG0A 2G4BA 4QCLA 4IO1A 5K8OA 2F4VF 1QVPA 5LJ3h 2KB2A 2OJ2A 2RHIA 4JUVA 4Q7AA 4JBCA 5IT9E 4K0KF 1FMKA 1S6PA 5HVFA 5D6XA 3A5ZB 1S72S 1WDXA 5DZ6A 2NZ4A 4CM0A 4OHWA 1TKZB 4WE1A 3EGUA 4C8QC 5CYQA 4DR1J 2CKWA 3DKMA 4DBRA 4FPRA 5KG7A 4EBCA 4UY85 1N56A 1KC8T 3MEDA 5LMUF 2GW8A 5KFDA 1HLWA 3ZL7C 3PFSA 1RUWA 5GMKe 2EYZA 5LJ3g 4N0AC 2C3PA 5KG1A 4LF5J 1VIEA 4B02A 2SEMA 1YKWA 3QWUA 1SPKA 5IOLA 5GAMe 2K9GA 4JPBW 3W64A 1NPPA 3CC4T 1QVFR 2D1XA 1I94J 1ZS6A 4TLQA 2LYVA 2HLTA 1YRXA 4C4WA 1VQ5S 1FXRA 4D6WA 1S12A 3I4PA 2KYZA 1N27A 4NI2B 3JCMe 2VBWA 3LAKA 3CC4S 2QA4A 1VQOS 1JU5C 4LSNB 1JQQA 4FM4B 3JV3A 1X6GA 3DRXA 1TUGB 2XS7A 4C92B 3FJ5A 4OZJA 4JI5F 4UW2A 3M4YA 4X9DA 3CCST 3NGDA 1JIHA 2LU1A 4F7UE 1NUEA 3KBGA 2FB0A 2IDEA 3CW2C 1IZ6A 2H3JA 3GMGA 3M32A 4R8UB 1JXMA 2DVIA 1TKDA 1SV5B 4FL6A 1RT7B 4I7FB 3DRRA 1S4EA 4OX9J 2J8SA 1SSHA 1AZSA 1K76A 2WSCE 1KHVA 2RHXA 2DX1A 3OBYA 4P52A 1SC1B 4M5DB 3V81B 3MO8A 1EETB 1SI9A 3BH7B 1XR6A 4AL7A 2FJVA 4M5KA 3I5SA 1OY6A 5I3UA 3UPUA 2IYIA 1K9MU 1P1LA 2RT3A 1TTHB 2E7VA 1D8YA 1X5TA 1V3ZA 1X9SA 1NNDA 2AD9A 5LJ3Y 5E3QA 4CNZA 2CQCA 3S3MA 2Y1RI 2BDPA 3M56A 2WW8A 2DJQA 4LDXA 1UFWA 1Q7YR 1RT5A 1HQUA 4F7UF 1D1UA 2QX0A 1D09B 3EPIA 4OMMA 4Z37A 1OSDA 2KH9A 2VWFA 1NDLA 3FB9A 2GVDA 1R27B 4U6PA 2KM8B 2CJ9A 1RHMB 2K1RA 3N5BB 2XIDA 5ETQA 3DRPB 4LE9A 2CDTA 5DLOA 3GG0A 1RWPB 1N32F 5LSRA 1VRUA 3OJSA 2VONA 1WHVA 3M53A 3B78A 1AWOA 3QYGB 2NSBA 1ZUUA 4BDPA 3CCQT 3URGA 3LP1B 2CZ1B 2GHPA 1Y07A 2DISA 3KHRA 3MZIA 2R7QA 2HHQA 4DU7A 2CQ0A 3BPSP 2M0YA 1FKOB 1G1XA 4F7VA 1FRHA 3IN5A 1HD0A 5CCMA 4H54A 4EPCA 2DRDA 3KLIB 2AKLA 2ZE2B 2ZHBA 2V6AA 2C0TA 4TU8A 4ECZA 1YHQQ 2HRUA 4PKDB 5DM7R 3KXTA 1ZSGA 2NUPB 5GAGI 2N82B 4EMDA 5CVIA 4O3SA 2HBQB 4FSXA 2KAFA 2YKOA 4K5SA 5FJ4A 2HBPA 2IVFB 3BO4A 2NXEA 3NCQA 2CG8A 2LDYA 4AL5A 4M95A 5HMYA 2KHDA 2DHHA 1OJ4A 5ETKA 1H7XA 1SF9A 3HRSA 5KG6A 2QA2A 3SFMA 1N9SA 2R8IA 1HWLA 1W7WA 4ECRA 2W9AA 1S5ZA 2MLYA 4O3RA 3VR1A 3WVDB 4WFAQ 2ZPBB 1YBTA 4PQUA 2HGLA 2BRKA 2X3XD 5HY6A 2I2LA 2OAWA 3LGMA 3RNJA 3UDLA 3UN2A 4RUBA 3QPHA 3MECA 3BS9A 3HVTB 1BQNB 1XWLA 4WWSA 3OFGA 1MUZA 3TQEA 4OHZA 1YCYA 4PFOA 1TU0B 1SEMA 4G3IA 4PJOD 4U8YA 4U67Q 2K5LA 3S6WA 4DSIA 1HFEL 8RUCA 3HK2A 1YVFA 5AJ3J 2MMYA 2N3LA 2ROLA 2R7RA 4IRKA 1TK5A 1E6YB 3C15A 3R5BA 5AE1A 4FF3A 1RADB 4FU6A 4C0FA 4DEZA 5IWAF 4C0BA 3CC2A 5IXUA 4NOYA 3SV4A 1SUQA 2VUGA 5KFYA 4FYXB 1NJIT 1LVKA 4QW9A 2FTRA 1NLOC 1JO8A 1NJZA 2CQ3A 1EX4A 3MR3A 2DCLA 5AYFA 3KKFA 3QAUA 5J3BA 4I6WA 1SL0A 4BS2A 4BY6C 2G3RA 1MWQA 5LXRA 2PIIA 3PYFA 1YNZA 2M88A 2NXCA 2JJ4D 4F50A 2ASDA 4MJKA 3MPYA 1EP4A 3AT1B 1TAQA 1RLDA 1WI6A 2H3EB 1UEUA 2RU3A 1RWUA 2EG2A 4C8QE 1RKJA 1AW0A 2LCSA 5C6SA 2DT9A 5D0HA 4OGCA 1DJ0A 2J6UA 2V34A 2V8PA 1WJRA 3T1HJ 4HT9A 5LXYA 2LCCA 2HHWA 1CSJA 1WDDA 5I42A 4M7AA 1JJ2R 3MEGA 4MAKA 3M8RA 3CCMT 4ZTFA 4USKA 2QQ9A 1RTIA 3CCUT 3VUZA 2VKZG 1TL3B 1Z9ZA 4FW1A 2LCWA 2ZPGB 1NSQA 3QZ9B 2RQCA 2VC8A 2J6TA 1WGSA 2J7KA 2Y1IA 2MIOA 2BQRA 1DAXA 1P9YA 4E8UA 2QXFA 3CUNA 4PFPA 2XULA 2ZBIA 3BDLA 3DHXA 4GY5A 4OMOA 3BR9A 5GAN3 2HAXA 5DS7A 2VG6A 2E29A 4OB0B 1VC5A 2XZDB 2JNGA 1U0HA 3RKYA 4RUHA 2DNGA 1KVJA 2KT8A 3NWRA 3U1LA 3OS5A 3J80E 4ZITA 2RMOA 1KQ1A 4ECYA 1S1VA 4LIRA 2C42A 3P3DA 2L3PA 2UXDJ 3M2UB 4MTPA 3F44A 1MHNA 4CH1A 2ZD1B 3G4SA 2V9KA 4N47A 4XU2A 4QYRA 4ZPAA 2NLUA 2YNGA 4I2QB 5JVGQ 3P49B 4ZVUB 1WC0A 1YJ9T 3X28B 2DNNA 3GLXA 1LW0B 4I69A 1YWOA 1E6VA 1R6VA 2Z57B 2HHHJ 2E66A 5I3PA 2D6FA 2NUZA 2NYIA 4YN3B 4LIWA 4Y34A 4DZDA 3M8QB 1Q53A 1LXNA 4WTOB 1UDLA 1VA7A 4DV2J 4M5NA 1KIKA 2HS4A 3FFIA 2C2ZB 2FVSA 4CLFA 4B9UA 1YN8A 2J7WA 1D8ZA 2HK2A 2B4PA 3MM5A 1HR0J 2YQ1A 4LF9F 2J9EA 2FB7A 4NZ6A 1BUXA 1D0YA 2CGHA 3H2LA 3ZZZA 4RTVA 3TZYA 3CCJS 1UWBB 2DBMA 2VASA 3JB9F 5FW9A 5U47A 3KLFB 3K5PA 4LMZA 3SDZA 5KE2A 2FRYA 3OL6A 4DWIA 1AUSL 3D67A 1V76A 3G8QA 3NAIA 1DARA 4NXMJ 3BREA 1FX7A 5HQ8A 3LWMA 3DB4A 4B3TJ 2ACMA 1Q7LB 2RRBA 5EC7A 2CQIA 1WX6A 2EGAA 4PPDA 2E9TA 5IHKA 2DXCA 3KJNB 3CDAA 4ZDNA 3PRDA 5D4LA 2PO4A 1D1CA 2JEGA 3OUYB 1XMQJ 4PJOB 1XNQJ 2J0QD 1FWKA 4HHJA 1ACMB 1P9QC 2EGCA 4Q8FA 2YUQA 1K8AU 3QKJA 1WJQA 5BR8F 4RCCA 1BI0A 2KEAA 4TVAB 2VJUA 2YKMA 3X25B 4ZPVR 1TVRB 3OTOJ 2DVEA 4HKEA 3IBFB 2UXCJ 2AP6A 2MEWA 4E7KA 5EHHA 2E41A 5DLQE 1UZDA 8ATCB 3T19A 2NQPA 4IFVA 4NA2A 5LJ3e 1UPPA 1XIQA 4WCEQ 5GANg 1VQYA 3LGFA 5KOXA 7AT1B 5CHCB 1RT3A 3SEOA 3IRXB 2CUDA 3EGDA 1HPZA 1R3NA 2W9CB 3QDFA 1Q5VA 3EICA 4HVUA 2EFVA 2LU2A 3LOUA 5L9XA 4ZN3A 5GMDA 1NSAA 3V6HA 4J9RA 3TANA 2UXBJ 3BE3A 4IYQA 3VVTA 4O0IA 1LNXA 1D9FA 1OQ3A 4LF1A 4F0MA 5DJBA 2DL4A 5AT1B 4OZLA 1WORA 3VAKA 4FKYA 5DETA 3MM7A 1LWFB 2VC0A 3AXMA 3FJ2A 2HDAA 4GO7X 2E70A 3W1YC 3QGHA 5LT5A 4ANCA 2OO4A 1G3SA 1PJ6A 1GMWD 1WC1A 1B0VA 1HNIA 2BOPA 1X4FA 1L3UA 2PU9B 1FX4A 4HVVA 2RHYA 2HEQA 2DZ9A 3BBFA 3PFOA 3QRPA 1U2FA 5GAOp 3MAAB 2B86A 3HHLA 2HPUA 2CADA 2K3BA 3R2DJ 1Y57A 2EQJA 5J2MA 1M9SA 2MPXC 1K9MR 2QA4T 2OPPA 4ZHRB 4J7IA 4LUEA 2B4VA 3CDEA 1FMVA 2ZJQQ 2QA1A 5LJ5h 4RTWA 1S6QA 2XYGB 3HI9A 5E3PA 3K59A 2YTCA 4RW9A 2RHQB 4NCAA 2HEKA 2XHWA 2BW7A 3F0NA 2OTLQ 2KT2A 1WHWA 3JQJA 4EMKC 3V8JA 1OIAA 5GAN2 2V26A 4DV7J 5GAN5 3CCRA 3K8VA 4AUKA 2OJ3A 1UVNA 4AFQC 1YI2A 3MI7X 3HFNA 1D3BA 1LOUA 3QGIA 4UY8T 5GMKl 5LJ5g 1B07A 3P8BB 4N4HA 2XB2D 2MHEA 3OLAA 1U06A 3I5RA 3HL8A 1G2EA 3REAB 3H0FA 3CMAQ 1RJJA 2H1YA 5AXMA 2GNKA 3JB9I 1VQPA 1C0TA 4OV1A 1S7IA 2X3GA 4PABA 2K3YA 3PIOQ 2Y4YA 3CXCA 1YJNT 2OLWA 4X66J 4Q5WA 4ME7A 3VAMA 1WC3A 3FUYA 2X7IA 5KT7A 4LVNP 2EJ9A 3D9BA 4DV5F 1NH7A 5FU6B 1KS2A 3KK2B 2LJ0A 2C1EB 4NLSA 2RI3A 1VQ9S 1YJNS 2BKDN 5G0RB 3KMQA 1UVIA 4LRFA 5HATA 4LT6A 1R89A 2YQ3A 1UUEA 4L5GA 1IHWA 1LEOA 4O44A 2R8GA 2GVZA 2BJ7A 4NLYA 3FZ2A 1PKTA 1NM2A 3HMJG 5THWA 4YB1P 2BZYA 3TRGA 1FDNA 4WP9A 1GFWB 2HIYA 2FVRA 4HTIA 3OSNA 2D8HA 5IQQA 1AOJA 3MFHA 1FNOA 1WJ9A 5F8JA 2EKYA 1RK8A 4QWAA 1M5HA 3CBPA 4NLVA 3OS0A 4M4ZA 3VRYA 3OJUA 4WU2A 3L09A 4C8QD 3B8HA 2HKNA 3SCIE 3A8JA 3K17A 1DLOA 1CKAA 3BY7A 3BKUA 2LT4A 3QO9A 4ZPBA 2HFZA 4I67A 2KRSA 3I56A 5LMNF 1AUDA 3GV5B 1PGZA 3N6LA 1QCNA 1NK7A 2R7UA 5KAKA 4LXCA 2XD0A 3BV8A 1MROA 2QAZA 2KT5A 5LJ5Y 4G65A 2M3DA 1WEYA 3P6YC 4X34A 4M5JA 4NYOA 3I31A 4QKUA 3AB2B 2YLCA 5GAOn 2IAJB 1A0OB 1EAYC 1SJ4P 1OULA 1ZSZB 3MD3A 1VOMA 1S1WA 2ZNYA 2LVMA 3BQ0A 1YIJQ 4OX6A 4ERDA 3GPAA 1IXKA 1S1UB 1BCMA 1V9OA 2NXNA 2VFVA 2HNYA 4Q2MA 1WG4A 2QTWA 2LA6A 4JYAJ 2R7XA 5GAOl 2GFUA 1DQ9A 2CQ1A 3AA8A 2YKQA 1FRLA 2VICA 2MGZB 2B9YA 3UN3A 2LXFA 3OR1B 4C3KA 3BO2A 4C9DA 1WXBA 1U1RA 1TFYA 4M77D 1SVDA 3HO1A 3D6FB 4B3RJ 4QT7A 5GAOr 2HMIA 3G71Q 4B6MA 1M90U 2A2DA 2FC9A 4QR0A 2Q6CA 2HVDA 4K7QA 4QPTA 5F8MA 5I2MA 3H0IA 2V67A 3A3PB 4LF6F 5CO7A 4B3OA 2RI2A 3D3CJ 1A9NB 4DL2A 2GO8A 3N01A 3SCLE 4C0ZA 3CSKA 2PNIA 3X26B 2V8IA 2GJ2A 2UUAF 3V6KA 1X5OA 4Q43A 2HRYA 4IOAQ 4DV4J 5F3ZA 2DR7A 2BJ8A 2V94A 4J9EA 2CPHA 3VZHA 1VQLA 4TY9A 2BQUA 3AQPA 1YJWQ 2F1FA 3NBPA 1KC8U 1V3SA 4DPXA 5IN1A 1Y3JA 3TAMB 4IKFA 1X75C 4M7DB 3OYGA 3MTKA 3L4BC 4KQZA 1RT4B 1O9SA 1QDUB 3CCSQ 1CQMA 2CP7A 2FZGB 1U1PA 1V6HA 1KD1C 1X4GA 4C98A 1VC6A 1PSEA 1VQKT 1AWWA 2DZCA 2GQQA 5FROA 1X5PA 3DLKA 2CUBA 4TKTA 3CCEA 4R0JA 4RW7B 3IBCB 2DXFA 2N3OA 2ROTA 1SKUB 2QASA 2C28A 3LWHA 4GLKA 3GR1A 3TQ7P 1E6HA 1GT8A 4QJVA 2ED0A 1VQKS 2GA7A 1N5QA 3MP8A 1WHXA 1IJEB 2XDDA 4QPXA 4PXDA 3D6MB 3GJSB 1Q81C 3EYZA 1QE1A 2AEMA 3Q1JA 2IY5B 1RBOB 3HHEA 3ZTRA 3CD6A 3GFZA 3TVTA 2H51B 1REVA 1S9FA 4OYPA 3A8OB 4B17A 3G71S 1IN0A 2ZBCA 5D6GA 4OQJA 4WCIA 2GMHA 5K5MA 5IT9U 3CCVA 2XM3A 3D2WA 2CJQA 3RKXA 1R8AA 4NYPA 2VODA 1FXDA 2DCUB 3E1SA 3CJKA 1FNMA 3KMSA 4KC5A 2EGEA 3PHEA 1RT2A 3OYBA 1VYTA 2QE5A 3M7VA 5HL7Q 4OYZA 4M75C 3ILOA 4E7JA 4ZA1A 1TELA 3K57A 4QVCA 2VKRA 2CDRB 2R3VA 2ZZTA 1LNQA 3HKZD 3I5BA 3MOZA 3K5LA 2QI2A 3OVAA 3OSVA 2QIFA 1W25A 3GV7B 2L8DA 1NH8A 5CYMB 2YWHA 1IBCB 3L9ZA 3HD2A 2L5QA 1YITA 2ZC3A 1YZ6A 2JM9A 2Z2MA 3IGVA 4RBTA 2M4MA 4OYMA 4DFJA 3CCQQ 4GVLA 1MN7A 3QO3A 1XTDA 2O5DA 1FF2A 4U9RA 4AYBD 5DZ7A 2EFIA 3G4ST 4KH0B 1QM9A 2OI2A 2XSFA 1FERA 1T3NA 2YX7A 2VXEA 3DLMA 3TWZA 1QJHA 3DI6B 4Q2LA 2RA2A 3OW2P 2HNDB 1RBAA 2ZCFB 3T6JA 4KGMA 2RJFA 3UN5A 1GCPA 4K4TA 2LX9A 4TXSA 3IS9A 3FRNA 2JN0A 1CPZA 2SXLA 1C0UB 2MYSA 2XY6A 3DGPB 5GJWB 4LF8J 3W60A 4Q0BA 4DDFA 2R7TA 4RUAA 1K8AR 3HM9A 1TXQA 4HT8A 2DIUA 2VBXA 5FWCA 2IA0A 5GANj 4ED5A 2HHUA 3MMAA 3MPUB 2B8QA 3UCGA 3C3LA 4P7VA 4CI0C 4OYBA 2AWZA 1IR1A 2B9WA 4M75B 3CCTA 1UG1A 4CWBA 2E1CA 3HVWA 1UMJA 4O0NA 3TZZA 1N33J 2MSSA 1AD5A 4ED1A 3HHNB 1G6BA 5HI7A 3GIIA 2JFKA 2MKJA 4KHMA 3F73A 5BYRA 1TAUA 3FRZA 3VQTA 1VQ7A 3AH6A 3UD3P 4IG0A 1PILA 1WOOA 4M77B 4LF4F 2QEXQ 3ISNC 1B7TA 2JTEA 3US5A 3NNHA 1UGSB 3SMZA 2VV5A 3G6XA 1O8BA 4PWWA 2CXEA 1RHJB 2XKOC 4EWTA 3DMJB 2HWHA 1YWPA 3BFMA 1H72C 1W2BS 1VQMS 4PZVA 4J9GA 3FNNA 1CLFA 4RZRA 3IQLA 5GANe 5GMKm 3W2WA 3G8SA 1XN9A 1Q8IA 5LJ5f 3CPWS 3NL0A 3WX8A 2LQKA 3EFOB 4WZMA 5KFBA 3TEHB 1W26A 3ZNUA 1IVZA 2UUBF 3JCMc 2K3XA 2CJKA 3DOMA 3Q0AA 4FSSA 4F7UG 2MCNA 3NCRA 2GIQA 3DOLB 2KVQE 4CLZA 4EUVA 5M2UA 1WNEA 1BI1A 1WOSA 1IBLJ 1T0HA 1U2RA 2XMMA 1RAJA 3TSZA 1JLBB 5CYQB 1VQNA 3LAMA 5CAAA 3R7BB 2JMAA 4KKOB 3THPA 2JC0A 4CI0B 1T3LA 4BE1A 3H6ZA 1SJQA 2ZITA 4A46A 1Q5YA 4B9VA 5EN1A 1NKEA 1D9DA 4RTZA 2EBPA 4FBTA 4A4JA 2XO6A 3OW2R 4B3SF 3MM6A 3IR6B 3QHSA 3J7AN 5HKCA 2P0PA 3SWNB 2K4YA 2W25A 3EG2A 3CCLA 6FD1A 4JJBA 2QQRA 1NJIU 1N0UA 4QIEA 2CWKA 2XI3A 2O4XB 1CS4B 5IFMA 2AEJA 4OMFB 5DLGA 2P0QA 2VZ9A 4PEOA 2P4RA 5KFPA 2AGQA 2HWTA 3CCMQ 4RUGA 3CCUQ 2DB1A 1T9WA 4M7DF 2JH3A 1Y96B 2JVVA 3RB6A 2GGPA 3DRSA 3CBMA 3GPLA 4KGXB 2BBEA 2NUUG 2LP4A 1WJSA 4X4OA 3MKDA 4BCAA 3D1QA 2Y0BB 3J7YI 4DR1F 2KI2A 2ACYA 2DHXA 2WACA 2V4JA 4DFKA 4CT9A 4U95A 5LJ5e 2KE9A 5F8NA 4GVBB 3Q8SB 4LF5F 3TCJA 4LRAA 4DR5J 2IMOA 3DRRB 3E9GA 5D4OA 1AZSB 2GMLA 5L23A 1XEZA 2GAGC 3QJYA 1N34F 1C4CA 3CCRT 1OX9A 3FC9A 2C2EA 1FA0A 2QRRA 1I94F 3ZNJ1 4OZNA 3KYLA 5GAOm 1SQEA 3IG1B 3CMES 3QWYA 4LUDA 1LW2A 4A8WA 4A47A 4M7AD 1SCJB 1SC6A 1C2PA 2LEPA 4CLUA 1UW4A 4JI6F 3GYGA 4F26A 3CTRA 1VQPT 3HJFA 3R1LA 2YDLA 3HSBA 1QAIA 3FEXB 3MM9B 2CQ2A 5BYSA 4EO6A 2V8HA 5J2PA 4USMA 1ZM2A 5A8KA 4KGKA 3M59A 1IKVB 3U27A 1X27A 1WI8A 5A2QY 1N52B 3RB3A 1N48A 2VFUA 4IQMA 3TQ1A 1QVFA 4GKKJ 5EGYA 3B4DA 3BJYA 4WIIA 3FQLA 1FXXA 2O9VA 3HSDA 2DF6A 4OX9F 2LP5A 1UGVA 2OP5A 3FBFA 4CC2A 3TOQA 1HW9A 4M75E 4XIUA 3D6TB 4IDKA 3QPIA 2AJFE 4OZ0A 1S1TA 1T9UA 1VIFA 1Y5IB 5KFIA 2UVVA 4WIQA 1AWJA 4U7CA 4I6YA 3GU0A 1WPYA 4O3QA 1VQ4A 2XZTB 1FJCA 3RBXA 1B34A 1R0CB 1BB9A 1LFPA 3DDNA 1KD1T 5IM0A 2BEFA 1X43A 3I56T 2KKHA 1SJ1A 3PEJA 2DK3A 2E12A 3QT8A 1CJUA 4CT8A 4JV5J 2E5QA 1M90R 3VRZA 2KDOA 2D74B 2YKNB 1XNIA 2J9DA 2WW4A 1GEHA 2QYGA 3TA0A 1QKWA 1OO0B 2ZVSA 2UV8G 1FVQA 2PE8A 2DXTA 5LL6S 4E7ZA 3OYAA 5J1EB 1Q81T 4M75F 5CKEA 2ZKTA 1UGPB 1CJTB 1TL7B 2W2MP 2WTFA 5EWEA 3EHRA 5T7LA 4TY8B 4J9KA 1X4EA 2DR5A 2BANB 2BRLA 3LGHA 4HACA 4NPOA 4Z2XA 1NYFA 2ESWA 1FCAA 2HHPA 3HHDA 2GQ2A 4YDXA 1Y71A 5IXBA 3GNFB 1OSCA 3I9V9 3J80U 3EGXB 1S48A 2CSIA 3CJ4A 4JDSA 5J39A 4PQUB 4XPCA 2LJ3A 1UHCA 1S77D 2KI7A 4I64A 2JT4A 3NGUA 4NYZA 2RILA 2J06A 3PM9A 5KT3A 3BGUA 5DO2A 1M5VC 2EFQA 2UUCJ 1JLCB 4QIWD 3POTB 3TA2A 2AJ2A 4LDUA 1JLAB 5KFOA 3KJVB 1T9TA 3K0JA 1ZUKA 3BO3A 3N5FA 1FRIA 4ZN1A 3UATA 5DRKA 4PCQA 1HD3A 3HP6A 5KT4A 3I55A 5KFAA 2PUOB 2RHSB 2V63A 4E2FB 2QDLA 1HA1A 4LQ3A 3MEKA 3FC3A 4RWWA 3RW7A 4L76A 2EVZA 2COWA 3U1MA 1JJ4A 3AA9A 1ICEB 4KBIA 1X0PA 4MYUA 3R5JB 1WXTA 1LPLA 4JI3J 4ED7A 3JTNA 2QA4Q 2CZ7B 3OPKA 1VQLT 2GIRA 1DTTB 4LRBA 2WB4A 4WU3A 2RKIB 4J9CA 4QWDA 3OFHA 2H65B 4B9XA 4NL3A 3TX0A 1R0AA 4FXVA 4QBUA 4M5GA 3JB9G 2HHXA 2NUTA 4N5SA 2EYWA 3ASKA 2V68A 2OSQA 4I0WA 1KLMA 2AZVA 3FMBA 5AJ3F 5KFXA 3H98A 4RWXA 5DGBA 4N7TA 5K8MA 2M52A 2EYQA 4OHVA 2KFZA 1S49A 5HMZA 5JXSA 5L8RC 1M1KR 2OELA 3OA6A 2V8VA 2GCFA 3DLGB 2W7PA 4YTLA 4LD6A 4USHA 2FHMA 3BZQA 5A8RA 3JB9H 2DNZA 2JMCA 2Y90A 3GZ7A 1YFNA 1S0OA 3L2ZA 2ZH9A 3MEGB 3JCMP 3HHLD 3QIPA 2P9EA 2CYYA 2BM0A 3W62A 1UGQB 4M78C 4OJHA 1PCAA 1Y0MA 4BUGA 1GMVA 1VJWA 3CO9A 4LN2A 2FLLA 1H3HA 2PA3A 3FEOA 1H73A 2RF2B 3DLJA 2AKKA 3HF5A 1PC4A 5E5NA 5H1SV 2AQ4A 3CCVT 1NLKL 5DQIA 2CJYB 2Y3YA 1JKHB 4NCGB 3VHQA 1X2KA 2CH4A 1HMVA 2DK2A 2MLZA 4XTTA 2IYGA 4CTAB 1UECA 4XTZA 2EYYA 2KHCA 1N5YB 4ED8A 3OSSC 3BGRB 4NLDA 1SH2A 1N54B 4MK9A 4EGLA 1VQ8A 4H4KA 4DSKA 4C48A 1S9GA 3J81Y 2D69A 3BQ1A 3H5YA 3GIKA 4TVRA 1C1BB 4UQTA 3CEDA 3KFWX 5JVHQ 1HWJA 4WXWA 4W90B 1YITT 1ZAVA 2PC6A 3T1HF 1QAJA 1QQJA 4PJLA 3PR4A 1WG1A 2Q1LA 2BE2A 2YNGB 4ER8A 4C0HA 5A0YB 1T02A 1C1CB 5KYUA 4CP5A 4WP3A 2B7BB 3UA7A 4F67A 4NWBA 1S1NA 1VQ6T 3NCPA 2HGMA 5E3RA 3RRGA 5T14A 2RRAA 2Y8YA 4A8OA 3DNCA 1FEHA 2GGRA 4OJGA 2ZH7A 1RT1A 2P5VA 1W2IA 4J7CA 1VQ6S 4X62F 4M78B 2GQVA 2OI3A 1ZX6A 1WTFA 4I1TA 3FFIB 1NK6A 4PL6A 3JSMB 4DCJB 1HARA 4X4NA 2B6AA 4GO5X 3V6DB 1KWMA 1JNZB 3I32A 2JW4A 3M58A 5HP1B 3TNVA 3H40A 1QKXA 2CP2A 1FE4A 2RN8A 2CT4A 2W9BA 1NSPA 5F0WA 4DEYA 4XDDA 2YNIA 4RBVA 3TYTA 2UXDF 4OB1B 3A8LB 4UZBA 1D0ZA 2EKOA 2CQDA 4CLTA 3HKSA 2MJUA 2YLBA 5CA5A 3MGJA 2FHDA 5L1IA 4ZP6A 4P75A 1ZA1B 5J2QB 4WYLA 3PMIA 2VVKA 1I07A 1CG2A 2AGPA 5GMKa 3W9JA 4ZVSB 1RHQB 3JSBA 4G6VB 2R5MA 4IUPA 1JLEA 1G3TA 3A4TA 2L0AA 4DS4A 3G6EA 1UPMB 1Z2ZA 2JUFA 2HHHF 4A4GA 1AXQA 2EQUA 4Z8AA 1VQ7T 1F9EB 5DDQC 3NP5A 5HBMA 2IM0A 4OHXA 1DTQA 1EX8A 2IVYA 3DLEA 3QJPA 2AYMA 2OPSA 2XICA 5KFNA 1NRKA 3HRTA 1RSCA 2YKMB 5GJVB 1S1XA 1WEXA 3QWXX 2A28A 3PR5B 1IKXB 2F8HA 1UEVA 1M5OC 1NJIR 4A8SA 4JLIA 2IA6A 4H4KC 4C8YA 3CC2Q 4JRKA 2XMWA 2FLOA 1NK8A 3D68A 2XZWA 5CK9A 1HBOA 2H8HA 1KEKA 4XTVA 4P73A 2BXJA 5LL6d 1S72A 3QSUA 5D3GB 4DU8A 4HKQA 3KK1B 3D5MA 4NMLA 4V1Ak 5HSPA 4ANDA 2R7VA 1M5SA 2QJ3A 2E5KA 3JQKA 4FXDA 4CO2A 3N79A 2XCPA 4K4UA 2QSWA 3RAXA 3BSCA 4PG8A 5H9EK 1UA1A 2VB6A 1YRUA 3SYZA 3PRBA 1KQKA 1XNQF 1Q4RA 1VHFA 4ITSA 3PRVA 2L3QA 3JCMW 1U1MA 4ID5B 4R0KA 3RERA 3NXZA 2XS5A 4FT2A 2APOA 3C14B 1LK5A 2FLPA 3TU4K 4XDCA 3N28A 1VCTA 4A4KA 3CCLT 3OTOF 1DZ5A 1H8KA 2UXCF 4ZTJA 1HNIB 3H59A 5I4MA 1VQ5A 4Q44A 2DIGA 1DHMA 1TK8A 1FFWB 4EZ6A 3CC4A 1VQOA 5J2MB 3R7NB 2V8JA 3GLJA 4O4GB 4YS2A 2LRQA 1WF2A 3E2EA 1U0SA 1FD8A 3BKFA 1I5OB 2QQSA 1SPBP 1YDLA 3UDCA 5ETMA 1S6QB 3P96A 4G1IA 4DLEA 1KQSS 2HW3A 3KK3A 2W0ZA 1PRLC 4HVWA 4MZMA 1BD6A 2OEJA 1NPRA 2FHKA 3MWBA 2GS8A 4BC9A 3DXBA 4WYWA 3CIZA 2VBZA 2CS7A 4PQAA 2R42A 2KDSA 3AJ1A 1D3BB 4II1A 3FCWA 4F8RA 1BBZA 4FF1A 2YNFB 2XEXA 1DQ8A 1TV6B 2ROGA 3I9ZA 4FDFA 2PFDA 4ATNA 4UOGA 1LKZA 3CWJA 2PMWA 4RW6B 4DBHA 3GV8B 3G4SQ 1VMBA 3HTRA 2ALZA 5L8RE 4Q5VA 3ISND 2J9DE 5HVHA 3V4IA 3RYLA 4F2RA 2W4DA 3VS3A 1AT1B 4PXBA 1QCFA 4D3GA 2YUNA 2B51A 2GHWA 3EH2A 2JTMA 3SFUA 3H20A 3I96A 4UUXA 4CZCA 4K59A 2I8EA 3KLEA 2P9CA 3M4XA 3G8TA 4Y2MA 5BJRA 4M78E 2D41A 3HFOA 1HNVB 1KVIA 4KIAA 1O5JA 2ZH5A 3LYIA 2BUNA 2A7YA 3Q8VA 1RTJB 5LOQA 3GBQA 1U1SA 3P45B 2P84A 1HYSB 4N4IA 3TUPA 2A37A 4ED4A 1YJUA 4K50A 3FCVA 1VK3A 3VZIA 5GAN6 5ETSA 3B82A 2QFIA 1DLOB 3SSSA 5IC6B 2PT0A 3Q8UA 4KRWA 3R6GB 2LFVA 2LT1A 4YR0A 1VRTA 3MM8A 4JI8F 3CC7Q 1HNXF 2WONB 1FYNA 4Z7YA 3C6TB 4PK4A 2KRNA 4ZCMA 2RJDA 4M78F 5FDLA 4DQPA 1T3SA 1LWEA 1Y7XA 4B3MJ 4LFAJ 2IIHA 2ABLA 2Z2ZA 4YB5A 3J7YU 2M9KA 1TG0A 1FKPA 3TW0A 1ZM9A 4HCKA 2DH8A 3BGOP 3OT9A 2JFDA 3S6EA 2PTKA 1PIEA 4RNFA 2WBRA 5JUMA 2CP6A 2H9ZA 2COZA 1MU2A 1VR6A 2XQCA 3M55A 2F7VA 4LFBF 3ZTSA 3IMQJ 5D78A 2HNZA 2E3IA 1KR4A 1IQTA 2PI5A 2L41A 3M9MB 3M8ZA 1NK5A 3S8SA 1QVGS 2M1HA 2DD4A 4PG6A 3PY8A 4IH5A 4JV1A 4DN0A 4K4WA 2YPZA 1OS5A 4BC7A 1GRIA 2AMCB 1VLOA 3H90A 4B9WA 4IQXA 1R8CA 1IWGA 2BJ9A 2LQJA 4DR7J 3M2RB 3OXGA 2YHTA 4BE2A 3H7HB 3FVYA 2F4VJ 5HMXA 4L3KA 2UZAA 3U23A 2ATCB 4RW4A 5E3CA 2LMIA 2PSZA 4E7IA 5D4NA 5KFGA 2W8LA 3CDUA 3V7RA 3HT0A 3H8ZA 1XR7A 5HK4A 2LEBA 1X4AA 2P0KA 1KQFB 2LMJA 4BI3A 3K8WA 3ZZUA 2R2TA 3HFKA 3M4GA 1X4DA 1NJWA 1M2VA 1ZAWA 2ZBRA 1DURA 3A8HB 3ZZTA 3JSCA 3C4SA 4EI2A 3NBPB 1X6OA 4E6RA 4JYAF 1OWXA 3Q23A 2GTJA 4O6JA 1FESA 2VD3A 3NTKA 2DXUA 1X01A 1RI9A 1OYEA 1TUDA 3OVSA 3PVQA 2CPZA 4HLBA 4RX6A 1APSA 4JZ3A 5FIIA 1LK7A 2WVDA 2YPYA 5C24B 2G6FX 2CZVC 2AHJB 2LDMA 2NPIA 1FHTA 3T1YJ 4OL8A 3REBB 2CZ6B 3JXOA 2FRWA 5A0LA 4KULA 5E33A 4DV6J 5IHIA 1J3TA 2Z0GA 3JYTB 1YRTA 5KFVA 3CCRQ 2MQOA 4TQSA 1AEYA 4GC6A 3NGTA 2ASJA 2NCKL 1YI2Q 4Y91A 1UFKA 1DY3A 3T1AA 2VOPA 4M1KA 4CO5A 4Z89A 2WVCA 1Y11A 1RT6B 2HSPA 3OHAA 4V19X 3AODA 2DM1A 3PG9A 2MQ8A 4PG7A 2RQMA 4JI5J 4DHVA 1M0SA 3NRBA 3M8PA 4G1QB 4IIMA 1VQPQ 2H48B 1YG0A 5IT0A 4OHYA 5KFFA 1PYSB 2LZ6B 1TWBA 4XPEA 3SDEB 1IXDA 2VA3A 1EFNA 2E5JA 2FO0A 1S6OA 2G0IA 1Q8BA 4A53A 1AWXA 2YWWA 2Z8QA 3PTAA 1N5TA 1X69A 4BD3A 4DSEA 2MTLA 2NZCA 1WHLA 2FDNA 2Y1JA 3ET6B 1MGQA 3HSJA 4MIAA 2DGSA 3M30B 2FZKB 2E5HA 2CPJA 3E51A 4NI2A 2WOMB 2E7WA 2IDLA 1XERA 1SKSA 1VQ8T 3MUVP 4LSNA 2JTFA 3RW6A 2RRNA 2DRMA 3J7Z5 3S3NA 1XMOF 2XG8A 2UV8A 3VUBA 3SV3A 4RUCA 4C92A 4LR7A 1WELA 2QQAA 5CAIA 2HHTA 5M9OA 3S7RA 2OMOA 3HKWA 2N7CA 2DEUA 2JLFA 4OI3A 1Z9QA 2DIVA 4R5PB 4AL6A 2HLUA 1QP2A 4M5LA 3GFXA 2FPEA 4C8OA 1X4CA 3I56Q 4O4RA 3PYDA 4R8UA 1PAUB 3NTHA 1R31A 1SV5A 1G2BA 1RT7A 4I7FA 2XY5A 4A8XA 2J7UA 2M8DB 1YJVA 2DGUA 3IS9B 3UT1A 2KVQG 2MY8A 1UVMA 2IIMA 2MI6A 1RACB 5GMKi 4M7DG 1UP1A 2EK6A 3QLHB 3V81A 1R7IA 1EETA 1T9VA 2FHJA 1YLXA 3OR2B 1WC6A 1WZOA 4PXEA 3CCJA 3JRZA 3C66A 3NPFA 1UEKA 4CC4B 4OLOA 2RNAA 2DEJA 2YUPA 1NO8A 1S9EB 3QSIA 2OTJQ 4ZGEB 3PGGA 1KD1U 4YB7A 2BM1A 3CVKA 3ETOA 3DYAB 2K2MA 3OTDA 4ZPTR 4BHQA 3MEUA 3WHIA 4I56A 4NLGA 5B0DA 3GCXP 1JJ2S 2EC0A 1MLAA 2EPDA 3IR7B 2VFSA 5K20B 2IG0A 2BMBA 2L48A 3P8DA 2VXFA 1BLUA 4ELZC 2WK4A 3IP0A 1C1AA 5A76A 2C2OB 3PKYA 3PNIA 2C2KB 2BQ3A 4FN5A 2C2DA 1X9WA 3DM2B 1HBNB 1WLPB 3G6ET 2VFRA 3N5BA 2DD8S 2QLXA 3I9QA 2XC9A 4CO0A 3DRPA 1Q81U 4DX6A 1Y00A 2V0NA 4CO1A 2W01A 2A08A 4C5IA 3QZ8A 3JCMJ 3F70A 3W8PA 3DRYA 3CD7A 5CKBA 1Q86C 4YB6A 3HVRA 1W70A 2C3UA 3NS7B 2YWKA 1F9FA 1FWZA 3CNQP 4U8VA 2RE1A 4LBIA 4QIGA 3AHUA 3N6NA 2MK5A 1ARKA 1S59A 2IHR1 4J9PA 3DOMB 2EI5A 4HH1A 4R56A 1WEZA 1FKOA 4F16A 3CJTA 4LUBA 4J6XA 1VBYA 1V29B 1WTBA 2MQQA 2RQUA 2Q3PA 4ZNXA 2JEJA 1QTMA 3L2VA 2RS8A 2D9TA 1ZAXA 5GAMj 3EVOA 3TX8A 2RJCA 3UA6A 5K14B 3PEHA 4C92C 1JLQB 2B5JA 3KJQB 1UZHA 1WKLA 3SFGA 2ZOFA 4CO4A 3M9OB 5GAN7 4KUIA 2Z2LA 3CJQA 1H2UX 2ZHAA 2XDBA 2K57A 4XQ3A 4OYXA 4DR3J 3OY9A 5D6WA 2VIHA 1KSPA 2NUPA 4EIKA 1UTIA 5IWAJ 2G0JA 1TUCA 3CCEQ 3KOAA 3M9QA 3LQVA 4KV8B 4F4AA 4DF8A 4DUZF 3DLBA 2R2SA 1GXUA 1ZYQA 1AVZC 4DJBA 2A0FB 4IG3B 2H4WB 1W2BP 4EZ9A 2HGNA 2BX6A 3RMSA 1WIEA 1U49A 4G1PA 4QU7A 5LSLA 4FYYB 3CPWP 2BJEA 4YEAA 2IBKA 2CG4A 3CO0P 4ELTA 3CD6Q 1VQ5T 3HZEA 3JS9A 3EZUA 1QY7A 1RKIA 3UVJA 1BQNA 2K2VA 3EHQA 3QJJA 4QR2A 1NDCA 1VQOT 1YSJA 1IBLF 1JLFA 4HEA9 1V3RA 2XMAA 2AW0A 3V5RA 2QSFA 1IHVA 4M75G 3OQ5A 3I82A 2CT3A 3K5MA 3QYHB 3JCMV 2KXHA 4OZ1A 4NS5A 3NGSA 4N8OA 3E19A 2KM8C 4B9SA 2XMTA 3M0TA 1RXOB 5A8WA 2FVCA 3ITHA 4MKVA 4DSFA 2C22A 3OVBA 1XQIA 2JWNA 3GR0A 1L5UA 3JAMY 1NSKL 1YITQ 1YWXA 1WHGA 3FBBA 1LW2B 3LH5A 3V8KA 2LQ9A 3T5JA 3A8MB 1M4ZA 1SJRA 2VF3A 3G82B 5KG3A 3LW5C 2JVOA 4BACA 4KJIA 4RNNA 1FRJA 4ES1A 1QVGR 5T41A 4FYVB 3SCJE 5KYYB 2AZ1A 3CMQA 2R5AA 4DX7A 3EAEA 4QYZJ 4ZVHA 4P6QA 1VQ9A 1YJNA 2X4JA 1OMSA 4NLRA 6FDRA 4B9NA 2HQHA 2ZHOA 4IFYB 2AJ4A 3MCMA 2K8GA 1NKBA 4F17A 1IKYB 3W9IA 1KRPA 3MPDA 4DCPB 3V2UC 4AXJA 2FL7A 1A7GE 1B4SA 1ZTWA 2O31A 4CLPA 4DPTA 1V5VA 2XI9A 2J8AA 4ZIWA 1TL3A 4I4BA 4KPCA 3R8YA 3KWMA 1U26A 3EG0A 2VQFF 1R8OB 3SQGA 4EMHA 3SBMA 1I1JA 2BV3A 2HS0A 3QDRB 1CJKB 2VG5B 3ELHA 3HSZA 5ETLA 3FSIA 3VAIA 1IGUA 2Z4PA 1IKWA 1RYRA 2KO1A 2O2OA 1ZM3A 1ROFA 5L38A 3BGFA 1FMWA 2A6OA 2DFUA 3DDIA 4IRCA 2RUSA 2W1BA 1VQ7Q 2MKSA 4MMLA 4DL4A 4LF9J 2VH7A 3U1NA 3ULHA 1TFWA 2Y4XA 2KYBA 2GO9A 2B8AA 1CC7A 2EKNA 3PVXA 2DL8A 4J9SA 3TJ9A 3JB9J 4CLKA 2QMXA 4GKKF 4WF9Q 4DF4A 2E6ZA 3MJXA 3LGLA 2BZ8A 3CXCP 2XY7A 3M2UA 5FD1A 4L6V3 1U24A 2VG7B 1W6XA 4I2QA 3M6WA 5T7LB 3A3NB 4PLIA 4DQSA 1YGYA 4OJ1A 2ERRA 1LW0A 2ZOMA 1JK9B 5GAHI 5D0EA 2EBGA 2RHZA 4XTWA 2WCXA 1SRLA 1IBMJ 1QW1A 3EGNA 2V8KA 3UO0A 4AQYF 1HL6A 1FRXA 2ZUGA 4Y3CA 4J37A 4Y00A 3OMGA 4FS1A 2BZXA 2RMLA 1FDAA 4ZCIA 4IRDA 2YUOA 1VQNQ 4BI4A 2DYBA 4NL2A 1PHTA 4DQIA 2OPRB 4IR1A 4I2PB 4YHHJ 3SSRA 1RAAB 1WI7A 3VAGA 4UC4A 2H5EA 4PG5A 4DOZA 3ADAC 2HBRB 1VC0A 1HBUB 2HQXA 3M8YA 4H4OB 4JV5F 3LH0A 1UWBA 2O66A 3E01B 4ZMMA 2JJ9A 4CH0S 2ZVIA 4USIA 2DTIA 1NDKA 3CJ8A 3KLFA 5ETVA 3OXFA 3CCLQ 1UW9A 1M30A 3OYHA 3OYJA 4O3NA 3W2VB 1IR2A 2DE0X 3QQCD 1RA6A 4PFZA 2QL9B 4ZLNA 2JM8A 3FMWA 2IRUA 4A8FA 3V7CA 1H98A 3LA0A 1YTYA 1B64A 1UCNA 2W2OP 2Z2YB 3T5KA 4PWDA 3CDWA 5GANd 2E7XA 2H5IB 2YWGA 5DDOC 4O3OA 2KVIA 1NM7A 1Y4ZB 3OUYA 1K1QA 1VISA 1RHUB 2KTQA 1ZUYA 2XS2A 2XTJP 2Z58B 5HJYA 2X1FA 4HI1A 2L9WA 3KHHA 1J5OA 1YHQT 3IXQA 2D3OR 4R55A 5J2NB 3OYDA 3IR5B 2UUCF 2JEFA 3VS5A 2PDAA 4WPAA 2RHUA 3C8YA 2O88A 4M94A 2MAMA 1TVRA 2C0IA 1MG7A 4EFAC 2V1RA 4C92E 3L2UA 1PNJA 1YHQS 8AT1B 4ECVA 4ZGJB 1VQKA 4GKJF 4LFCJ 3T41A 2CSQA 1FJEB 3GP8A 3GTYX 3M6XA 3QFHA 2R2RA 4IUFA 2MB0B 1SQGA 5E2QA 4F02A 1G7CB 2QL7B 3IRXA 3R6LB 2KXCA 2EXUA 2U1AA 3QIPB 2DY9A 4ZKAA 5GMKh 3CXCR 2A2CA 1KQGB 4JI3F 4DR2J 3QT6A 5D0GA 3QUIA 4DR6J 4IIOA 3G71A 2XNRA 1X31C 2KYXA 1KHIA 1RWWB 1LWXA 2COYA 4DL7A 2X1BA 4HXJA 2UP1A 1PBAA 4DXLA 3OHBA 1LWFA 3JSYA 4RW8A 1R8HA 4WJBA 4ZK7M 4P72A 5HLFB 4KFBB 3DOKB 4C92F 3JQMA 3PV8A 1Q86T 1X7VA 2BR0A 3EXYA 2B8PA 3TUZC 1EKSA 1S9GB 3LUYA 1YJWA 2H5JB 3RBEA 3MAAA 3THTA 5CXTA 3GSDA 4W98A 3TAQA 2ZBQA 3EUNA 1H38A 1J5EJ 2L08A 2NXUA 4RU9A 4YMEA 1PJ7A 2AIRB 1CULB 2V2VA 4LSLA 1YX2A 4PUOB 4X84A 2FJWA 1BI2A 2MKHA 2C2RA 4USJC 1KD1R 3M1VB 1B3TA 1FKAF 2MJNA 1VQ4Q 2BE7D 3QMQA 1U1QA 4F4YA 2HHVA 5H9EJ 3PW0A 1U1NA 4A8MP 2QK0A 1MMDA 1Z2LA 2UU9J 2EFGA 4K4YA 1RT1B 4PJOC 1LQ9A 1CJVB 2ZZDA 4JJNK 3N0VA 2MLXA 4DX8H 3MEAA 2DJZA 2QLJB 1BIAA 3LW5E 3AHPA 1ZLMA 1Q81R 4K4SA 5MAOA 4ED6A 3EWGA 4IUUA 4ZLJA 2JLEA 2B9XA 3O8WA 3BSOA 2LQ8A 4EO8A 3FEYB 2X4WA 4MYTA 3MMCB 3KHLA 4L6V5 1VK8A 4Z88A 3TZXA 4LRCA 1N36F 3M05A 3TARA 2LCLA 1NZ9A 4PNOA 3CCJT 1BMQB 5LMNJ 5KYWB 1GFDA 4HI2A 2F5TX 4MKBA 3TZWA 2BTTA 1HKAA 4BDZA 1RTHB 1T3OA 5C25B 3S3OA 3KLGB 3KK2A 5G0RA 1WYXA 2K79A 2LNHB 3V8LA 3GSIA 2FJEB 5HJXA 4DQRA 1T95A 4PPZA 3UDVA 4GBQA 2NYHA 3WIUA 3J7ZT 3M2VB 2BE9B 3UR3C 5LJ3j 4DV0J 1W2BA 1VQMA 2RNEA 2VHGA 2MKYA 2BABA 1HBMB 3Q2TC 1SC4B 4C3MA 3I55Q 3CPWA 1FK9B 2J6OA 1GCQC 2OH2A 3L2WA 3C16B 4URSA 4EMKA 2AYGA 3CIMA 1R43A 2D1CA 1RAOA 1TKXB 1NYGA 3TSWA 5KYNA 3TP2A 4Z7CA 2PI4A 2D8JA 3VVUA 1RTDB 4PLLA 2K2PA 2RQ4A 1YQHA 1K1ZA 3EGVA 3NLCA 4ETZA 2ZPFB 4C0DB 3BM7A 4LREA 4L73A 2E9ZA 2CQPA 3KFVA 5E0OA 4JLGA 1N6QB 3EFSA 2HKEA 5DG9A 2YX4A 2JZ5A 5LSOA 4A4FA 1PWTA 2E5LJ 1KFDA 2RK1A 3H4BA 2WSFC 2DXDA 4J9IA 2B56A 1CKBA 3LPYA 1T11A 2RD1A 2GMJA 3BYPA 2DRBA 1GL5A 2RQRA 1ZSZA 2DL5A 3E9FA 3QIDA 5DQHA 4QVZA 4FS2A 3LPEA 3BN4A 1H2VZ 2V4RA 3MMBA 4HDHA 1K73C 2XCAA 1G3OA 3BEGB 1M1KC 4KYZA 4DPYA 2GQIA 1S0MA 3HCXA 4P74A 3MDFA 3RIRA 4M78G 2HFOA 2MGZA 3VS4A 1FNXH 4MH8A 1IJFB 3D3BJ 2UUTA 2DBBA 2YY3A 4NE9C 4KUDK 2ZNZA 4KO0B 2DAQA 3KUEA 4J9BA 3NNAA 2EFPA 3ENQA 3QRRA 4DV3J 1U4BA 3D54A 3KK3B 5FU6C 5EWGA 2CP0A 1AYEA 2MF2A 1FI4A 1XNRJ 5ETTA 2IM1A 3NWGA 4YOEA 4OI0A 2LDIA 4EDUA 1Y7PA 2L2PA 1GMWA 1HD1A 3EG9B 3R9LA 3JAME 1WUUA 1VUBA 3DXSX 3QWPA 4OYAA 2IRXA 3DN9A 2EPIA 1M5Q1 2IVMA 5KE3A 4ECUA 1WHMA 3CF5Q 4NEZA 2K5IA 3CMEA 3TAMA 2HYIB 4M7DA 1BIBA 5FLXY 5B0FA 4L59A 1HWUA 4LQ9A 4DG1B 5KFWA 2MHNA 3IM8A 1I5LA 3VS6A 4JRIA 1RT4A 2NS1B 4ZS6A 2DNPA 1UVKA 2CAJA 2DNQA 3HSGA 3KUGA 2A6MA 4URQU 3GYNA 2EIFA 3PX6A 1RLQC 3I0RB 2DTJA 4NRUA 4H4MB 3BF4A 4D8DA 3ZZ0A 1GNKA 4IR9A 4ELYC 1RBLA 2C3MA 1JXOA 4RW7A 4C0GA 2OAUA 4J8OA 4DSJA 4ZVOB 4JI2J 1WHYA 1S57A 2YRCA 3HJVA 2MSTA 4O23A 1I8FA 1UJ4A 3R2CJ 4AFZC 5AXLA 4JI4F 1QLYA 1OX8A 2L9DA 5D4PA 4TNOA 4DPOA 4PAAA 2DTHA 1VQ9T 1JLGB 1SSFA 5FRNA 3ISZA 2LTOA 1KSWA 3EVWA 3HVAA 2YH0A 5DDPC 1RI0A 2K06A 2M7SA 1ZSZC 1YBUA 5A6WA 3BDPA 5HROB 1NJYA 3OW2S 3GF5A 4OF1A 4QQGA 2HURA 3G6YA 2DETA 4IOBA 2DPPB 3W63A 1T8EA 1NMEB 1SHGA 2ADBA 2XG8D 1BQMB 4XK8C 2MKKA 2IFXA 2ZH6A 4USVA 2LNVA 5GAN4 2HL3A 3NEKA 1T05A 3HHKA 2HBZB 1L3KA 2YNHB 1U1KA 5L46A 3NFCA 3GYXB 3AAWB 2RAQA 4F7UB 2ZJPQ 3M0UA 1T7PA 2ZC4A 1X0FA 4DX5A 2Z0WA 4ICLB 3FQKA 3PTWA 3G6EQ 4QVDA 4OMNA 1LWEB 5HMWA 4PJNA 2I0NA 4USTA 3TEGA 3OMCA 5CYMA 1KHCA 4LR9A 2XMFA 1MWZA 4YR3A 4UT4A 2OTLS 2HFSA 1VRQC 4OI4A 3W8GA 1NKCA 4J83A 5HVGA 2I5JB 2LKZA 4UOFA 3CMAT 2E9RX 5L39A 1M1FA 2XYPB 1S0VA 2EK1A 4LNPA 4PJOE 4M5HA 3F41A 1NJIC 3QFWA 2C2MB 4MKAA 5A0DA 2F63A 3DCAA 1Q82C 4DS5A 5ADZA 4TU7A 5KYXB 1BC6A 3DI6A 4TU9A 4F3OA 1H2TZ 3MCNA 2CJAA 5CQYA 4HDGA 2HNDA 3PX4A 3CMAS 2F2WA 4DSLA 2JDJA 2ZZMA 3UNGC 2P2CB 4M7DC 4F3QA 1HNZJ 1N9RA 1S72Q 1QVFP 4USUA 4WFXA 2HVIA 3SIPB 1YBYA 2P6SA 1NE8A 3JCMX 1C0UA 3DHWC 1TZ0A 3DGPA 4DR4F 3RB0A 2AJ1A 4RJVA 2R4FA 1U8RA 4RCBA 3C6UB 4LFAF 3MR2A 2UUBJ 4MIWA 3BN7A 1W4SA 3CPFA 2VYTA 4M75A 2YBVA 1QD1A 2RDIA 4PJOF 2EW3A 2JX2A 4YY3J 3JB9D 5AE3A 3M0RA 2BA9A 5KFJA 1HQEB 2QLWA 1N5SA 3H2UB 3ZTPA 1F3VA 4C8LA 4KPYA 1PKUA 3EZOA 3CJ3A 1ITPA 4BLGA 3UI3A 3OTCA 2LQWA 3JCMf 5C0MA 3NY0A 1KG1A 3ETMA 1SL1A 2XSJB 4BWMA 2A1BA 2F4FA 3CC4Q 3MP6A 1VQOQ 4M77A 4FVCA 2FJBB 2HWIA 3K5OA 1P92A 3MR7A 5H9FK 3LTOA 3HDSA 3T5HA 1XQHA 3PKMA 5I11A 2D3O1 3D4JA 1OI1A 4NLPA 3DMJA 4CC7A 1EZZB 3NMAA 1Q78A 1RAHB 4B9LA 1FFGB 3EFOA 4WFNQ 1TOVA 1YIJT 3MP1A 4HCCA 1RQ0A 2XO7A 4JI1J 3DOLA 4QQ6A 4DUYJ 2WSFE 4N56A 2HQEA 2EWNA 1HXDA 4JZ4A 2EQIA 3QJLA 1YIJS 5F8IA 3AJDA 1JLBA 3FGVA 3MCAB 3M8PB 2QTVA 3W5YA 4KKOA 4DOVA 1AZEA 1D0EA 2DLPA 5KFQA 2GF7A 1M8VA 4DQQA 2JSXA 5EG2A 3IO1A 5GAHU 4E7SA 1KVKA 3G71T 1GX6A 4OZ2A 4P71A 4EMGA 5GMEA 2CNOB 4NXNJ 1IM6A 1XK8A 3NS5A 1N34J 3SWNA 2L3SA 4JS5A 5B09A 2GCXA 4RU2A 3T1YF 2K3IA 2POKA 3PYEA 2O4XA 2UUWA 4HVZA 1CS4A 1HNWF 4FP9A 3MAHA 2MWPA 4DV6F 5FRMA 1DRZA 3EPGA 1GFCA 2XGPA 1VYAA 1PKSA 2ALYB 2YWEA 1VDHA 4HCBA 1VBZA 1NCLA 4X4QA 1HHSA 2GAHC 4JI6J 5B0GA 2HQGA 2UVWA 4QW2A 2RI5A 1BXNA 4J9UE 1Y96A 1YJWT 4K4ZA 1EIFA 2RB7A 1FJGJ 4KHPJ 1OPLA 2MZ1A 4OIXA 2OPQA 2DXEA 2IM3A 1CSKA 1VBXA 3NOGA 1U8SA 1SIWB 5MLCV 2HG4A 4C11B 1HIYA 4RG8A 3H41A 1YJWS 3VU3C 2XBPA 2W24A 2LVWA 1WC4A 3S1TA 4KR0B 5GAOq 4LF2A 4M77C 4GVBA 4ORZA 5DLFA 3CCWA 3SI8A 3HFVA 3OYLA 2V2QA 2ZH4A 1U1LA 3CCSS 3DLLQ 2XHCA 4C8QB 4D3HA 2W7OA 3S01A 3O6QA 4TQRA 2AT1B 1VQ6A 4CLYA 3OB9A 5HCKA 1H3ZA 4F04B 3CBOA 3BSAA 1F5CA 2RS2A 1KK7A 4ZLLA 2UVRA 4J9NA 4C5HA 2VU5A 2V1QA 4PG4A 3IG1A 5CABA 1K73T 3THVA 3TEEA 2PVOB 3JSRA 1M1KT 2CA9A 4XAKA 2XNQA 1TSFA 2DY1A 4KT0C 4WFBQ 3WC0A 2G13A 2MZTA 1C6VX 1RUSA 2LA4A 2CKKA 1T03A 3I4HX 4B08A 2DNHA 3MEEA 4W92B 4WK1A 3MM9A 1TL1B 1PC0A 3Q8YA 5KFKA 2V50A 1WHKA 3BBBA 5L1LA 3D7SB 2BKOA 1IKVA 4MFBB 4J9FA 4IKAA 1WG5A 1G4CA 1OU8A 4X9CA 4JS4A 1TP7A 4X65J 1PSFA 1FO1A 1ZZNA 2A3LA 3OYEA 3CD0A 4OZ5A 1RWNB 4XK8E 2CWXA 5C42B 3PDNA 4WKYA 2NYSA 2AJQA 4GMKA 5KFSA 3RZAA 3TVZA 4URGA 1A6LA 3SWNC 1ELOA 1NXIA 1Q0NA 1MMNA 1VQMT 1QAYA 3EE3A 1K0VA 2KRRA 4DPUA 2ZH2A 3JCMQ 1YCSB 5F9NA 2N4CA 2OEMA 2BUDA 1LWCB 3VQSA 1BWVA 4IUQA 1TMJA 2BIVA 3KG4A 2MQPA 3KLHA 4CC3A 3CCQS 4VUBA 3M5AA 1QWEA 2KNBB 2J6KA 3LP0B 2XLJA 1RWKB 2QGGA 2ROPA 3ZO7A 4JI7J 2RU9A 1ULRA 4LF7J 4F0HA 1WKKA 3VAFA 2E5IA 3P5TL 2B5JB 2L89A 3BW1A 4XU0A 2EFNA 3RR6A 1FX2A 3R6OA 2YKNA 1S6PB 1LV5A 1JJ2P 4P5NA 3HULA 4L74A 2I2YA 2R7OA 3HPOA 4M7DE 5J1EA 2KT1A 4ZPDA 4WE1B 3G86A 2YT6A 1CJTA 1TL7A 2PVGB 1F60B 2RQVA 2KSSA 4TY8A 1FDDA 2BANA 1Q95G 3MEDB 1RHRB 1EIYB 1AFJA 5E7OB 2Q6BA 4YFUA 4V2SA 5IZHA 3EGXA 1FRMA 1FWLA 4NZ0A 3DU5A 1H74A 5DDRC 3FJPA 5LJ5j 2QQBA 2FLNA 5CQXA 3BPDA 4J9MA 3IGNA 3MXHP 3ONQA 5C2GA 3UVJB 1SBRA 4WFZA 4E7HA 1T9YA 3LX7A 4FKXA 2GFFA 1JLFB 4NLTA 3WZ0A 1M3AA 2QEXT 3D1HA 1JLCA 1KHWA 3POTA 3TO8A 2GC8A 2BKNA 4Y28C 1JLAA 1UAWA 3KJVA 2E65A 4JUZA 2XMUA 4IOCQ 1KQSA 1QP3A 3G9CA 3L7UA 4RBUA 2K3KA 2QEXS 4DR3F 4QQBA 2VC1A 1PRMC 1GQEA 1NHUA 3RUXA 1VHIA 3O5TB 4A8KA 1WA7A 4J9OA 4V19J 2LEAA 3B54A 5A8WB 3ITHB 4FF4A 1S7HA 1KP6A 5CD4A 3MFIA 3GIMA 1N0VC 2HIQA 1Q82T 3VV2B 5FLXE 1OY8A 1PSDA 2B7CB 3WQPA 4MK7A 3CEYA 3IWNC 4ZLPA 1XOVA 1A0NB 3UDEA 1DTTA 3M32B 3VF0B 3TJ8A 4F4XA 2MPUA 4YP3A 2GNCA 2RKIA 3CMET 2CZ4A 1IM4A 1PC5A 3IAM9 1OQKA 5DM6Q 1VJQA 1EHWA 3JTOA 4ILRA 3CGIA 1N8RC 2FVPA 2VL1A 5A6PA 4PWUA 2X35A 4NASA 4LBPA 2ZEJA 3ZC4A 1Y5NB 3IWXA 3PIPA 1VYVA 5HK3A 1Q86U 3K58A 5I3UB 1X4BA 2KL8A 3GJTB 1YJ9Q 1B7YB 3MAQA 2G0CA 3AD9C 2XK0A 3GFYA 3OBIA 2IRYA 2JNJA 2WRMA 3DLGA 2CH4W 4L72B 2FQQB 2E10A 4RTUA 2FIUA 1RT5B 2PQWA 1HQUB 2DRAA 1VYUA 3PX0A 1GXIE 2R2UA 3RBDA 1ABOA 4MDXA 2FPHX 2KRBA 4F4WA 2B4UA 3K89A 2FJAB 3IC1A 3CCJQ 4WF2A 4C3LA 2N4DA 2JL9A 2QO3A 2GVDB 2NSCA 3BR8A 3SQGB 4Y2CA 2RF2A 1O75A 5BYQA 3NMRA 1TKTA 4DL5A 2K1RB 3CCMS 1JWWA 3RAQA 2KU7A 3CCUS 1NZAA 3T9ZA 3VGSA 3GONA 1IKWB 2EG1A 4RPFA 1VRUB 1VI7A 4X62J 1FT8A 2I0XA 1JKHA 3L2QA 4NCGA 1L3TA 5B0AA 4FNIA 4DOWA 4C8QF 4CTAA 2ZH1A 4F0KA 1N5YA 1DQAA 2QLFB 3ILIA 1TL5A 3PJXA 2JS0A 2CPXA 3BGRA 4QZVB 4EEYA 4GRSA 3LP2A 2DYIA 3BBCA 2CQ4A 4BY6B 3E3XA 3FSYA 3L2RA 2E3HA 1MNEA 3HD1A 2MQNA 2ZFHA 1C1BA 3OFEA 1WQWA 5CKFA 3Q89A 4WKRA 4ECXA 2G1HA 4KGVB 4M77E 4JB8B 2EJFA 3FRYA 3M0SA 2Z56B 5A0YA 1C1CA 2KYMA 1BE4A 2HAIA 2XWXA 3RTVA 2G2OA 2AZSA 4QIVA 5LJ3f 1QVGA 4LDVA 4ZCLA 4X4SA 1NK4A 4ZOSA 3MUMP 3TA1A 1YJ9S 4C92G 4KT0E 3ZFJA 5KCOA 1M27C 4M78A 3I35A 4OX7A 3W61A 2CPFA 4PYAA 3JSMA 1SRMA 5KFEA 1UFFA 5CZXA 5L1JA 3PW5A 1U3OA 3QG1A 2O01C 4ZJLA 4ES2A 2IJRA 3V6DA 1BGXT 1KC8R 1RA7A 1FDBA 5HP1A 1JXVA 4M77F 1BCOA 2BW2A 5K9FA 3ULRB 3PT9A 3MECB 4CDIA 5C7PA 3D0GE 3WC2A 4C8MA 2KXDA 3VYGA 1HHQA 1V1CA 4M7AC 5J2QA 4X1VA 1RCOB 3L95X 3CC7A 4OMLA 4QW8A 4PWDB 3C12A 2HL5C 2P4TA 2QL5B 3UPFA 4ANJA 3EZ5A 1IBMF 3C15B 1HYOA 2J6FA 4LSZB 4JV0A 1R8BA 4F2SA 2GTOA 2NLWA 5GANh 4KBMB 5IXFA 2E44A 2HBWA 2KRMA 2P8IA 1J5OB 1SUQB 2CVIA 2AZ3A 3V4MA 4IURA 2P6TA 4YHHF 1FRKA 3R1HA 4UOCA 4BB7A 1RE1B 1IBKJ 2ZWOA 5D8HB 2WZ1A 1IKXA 1BU1A 2RDDA 2KFYA 2W4CA 3TR5A 2QFJA 2VBYA 1KBRA 5KFMA 2PFFB 4OI2A 2HFVA 4ZP8A 3R97A 1KDNA 4AD6A 4JOUA 4OLPA 4F4KA 4ZVPB 2BVZA 1MMGA 4S0MA 4EK2A 1LFWA 1UKUA 2RK2A 1EP4B 5D3GA 2CQHA 3AOAA 3KK1A 4RTTA 4U7UK 2MDAA 2AKWB 4X4UA 2QV6A 4Y6IA 2DKGA 3Q86A 2J76E 1FTRA 1KJWA 4LRDA 2HQIA 4ZJQA 4B9TA 3KUFA 2E1RA 2EQMA 3BSNA 1U1TA 2G2ZA 2I6WA 2J0WA 4YUDA 3TAPA 4K5RA 3X3UA 3D1OA 4P2MA 4WFYA 4JI0J 2FVQA 4ID5A 1OYDA 2DPIA 3VS2A 5I42B 4M7AB 4OJ3A 2CUYA 1KNZA 3C14A 3D6HB 4RW8B 4F4ZA 5CR2A 1RTIB 5ETOA 2X1GA 5GAMd 2IBOA 2RJZA 2QLBB 4ED2A 1VQ9Q 1T0JA 1YJNQ 3QBCA 4JRPA 4KY3A 3O8VA 4A8QA 4FIBA 3PFEA 1QMCA 4K2JA 4AG1C 3QATA 4Y28E 4J9DA 1Q7YC 2EFOA 1UHFA 3M6UA 2OKQA 5I2SA 4KE5A 5DG8A 3THKA 2VFTA 4LFCF 1CVJA 4C0OC 1SKRA 3JCMd 3WDOA 4P7TA 3CJ0A 2M0GB 4O4GA 4AFFA 4M7DD 3H5UA 2WHOA 1Z4UA 4LSLB 2JVRA 2VG6B 1UFLA 3H5SA 1H92A 2AU0A 1KKHA 4KH1B 4DR2F 1U0HB 3HFZB 2HVEA 4AG2C 4DR6F 1C0MA 2QA4S 1B99A 3EG1A 2RH3A 9ATCB 4FW2A 1S1VB 5KFCA 1YJ7A 3A98A 1IQZA 1YJTA 3PMTA 3AQOA 1PBUA 2WVFA 4IUVA 2F8MA 3H9NA 1VLYA 4X4RA 4WK3A 2DKOB 3SB2A 3GP9A 2HD0A 2DR8A 2W7AA 3R5DA 4UZCA 2V4QA 1NZ8A 5K8NA 3DDKA 2ADCA 4A4EA 2D3ZA 1E6VB 1SXLA 1G8XA 2YNFA 1TV6A 3VJPA 2ILZA 2RDJA 2HQ3A 1GTHA 4PJJA 5F8HA 2DXBA 3MR5A 1XBWA 1ZM4A 4EBDA 3DB3A 4RW6A 3FIFA 1NJXA 3G87A 1P1TA 1RB0A 1EQMA 5DG7A 1PD1A 4J91A 1J5EF 3JAMU 4JI8J 3SCKE 2C3YA 1HNXJ 3A8KA 1F2GA 3I0SA 3AXKA 3JTPA 2DHSA 3KLVA 4DV1J 3BGLA 1U5SA 4FZVA 3MM5B 2MKIA 3X1LB 1JX4A 3ICLA 2RIJA 1JJ2A 4J6WA 4CO3A 3HLUA 3A8EA 4C5GA 5ITHA 4E47A 1HNVA 2FYKA 2DHGA 1UA0A 3K7RA 2JHEA 2FJXA 2V8GA 5KT2A 4XU3A 2UU9F 2DGTA 1Q1KA 3R3TA 1RTJA 3V7SA 3TJAA 3FBCA 4LFBJ 4CYUA 3M6VA 2DGWA 2KJVA 3HZGA 1AA1B 2R58A 2EBEA 4P9SA 1RYSA 1NBEB 2EEYA 5KG2A 2ZJRQ 3AB4B 4DCOB 1SHFA 3EDQB 5F9LA 3HRUA 1S79A 4WBFA 1HYSA 1OEBA 3HPWA 1F1BB 1NDPA 2M02A 4EMKB 3P5BP 4I68A 2DITA 2YH1A 4LBHA 5E41A 3NS6A 2QN6B 2YSQA 1P27B 4CRJA 4IUTA 1NB2A 4PRFA 3HHLC 4UOHA 2MWOA 2DA9A 4DV2F 4ED3A 3LWLA 2WONA 3C6TA 3CJ2A 3OYKA 3FSXA 1N8RT 4AE5A 3MTJA 3LWIA 1HR0F 2A3JA 2KBTA 4USWA 1B0TA 4NX9A 2MQMA 2VA2A 4ID8A 2MKCA 3OLBA 4IFVB 1UTAA 2JLGA 3W5XA 5SUHA 3I5AA 1RT3B 2FD2A 1RISA 4WZQA 4NXMF 3EGDB 4EU0A 1HPZB 2ZM6J 4MK8A 4DV0F 3LANA 4B3TF 1K0XA 2IC3A 4M75D 3MMBB 1S99A 1SQFA 2OTJA 2QG9B 3OS2A 1VQKQ 5HANA 1JJCB 4NA3A 2DNKA 2ZPIB 4L75A 2VUBA 2DNMA 1BKBA 1XMQF 2F69A 4EYIB 2O01E 2YX1A 3BB5A 2ZKUA 4DFMA 3MM7B 4X64J 4K4VA 4OFZA 1XJWB 2JOYA 2L3RA 3LALA 2L9NA 3HP9A 3OL9A 1B0PA 2Y9HA 1KQ2A 1LCKA 1S10A 2CNKB 3M2RA 4OB2B 2MZQA 1GXLA 3A1PA 3LGNA 3QXEB 2BZ2A 3VYHB 3C19A 4M7AE 4C6AA 1PYOB 3MD1A 3H42A 3HHLB 2E5LF 2RQTA 1QUPA 1Q86R 2NR0A 3TI0A 2HSEB 3EH1A 2B3TB 2OPPB 4XTUA 4CLWA 3G2XA 4CH7A 2YKPA 2GJIA 3F56A 1RLPC 3P4UB 2I1RA 1B7FA 1KTVA 3CC2T 2ROEA 1WHJA 4JV2A 2OMLA 2UXBF 1EKRA 4RW9B 1JB0C 2OGUA 2PMHA 1WXUA 2CQGA 1IWAA 2H54B 5B0CA 3EGWB 2KXFA 1PM3A 1FFSB 3D0IE 4NLUA 3CC2S 1H0HB 2F9DA 3HT3A 5C24A 1D3WA 3OFFA 3VCDA 1T94A 4M7AF 4A54A 3OTEA 4ECSA 2FG0A 1X9MA 4PJOG 2HNIA 1K47A 4ZVGA 4DV3F 1C0TB 1RAFB 2AX1A 2IMWP 2VQEJ 3JYTA 3MEWA 1XNRF 1UE9A 2FJDB 3JCMb 2V2ZA 5DGAA 2MYFA 3ZZRA 2QTXA 3AY0A 1MNDA 1X5SA 3RB4A 2GQCA 1HWIA 1XMOJ 1RT6A 2CP5A 5GAGU 2KZMA 4ZP7A 2FEIA 3KJFB 4Y0FA 5GAN8 3J7A1 4FYDA 5A2QE 1YZ7A 4G1QA 1UJ6A 2BJ3A 3H2VE 1V5IB 2HFNA 2QYZA 3D66A 2DGVA 2QYCA 3ENVA 2ATLA 2XGQA 2EWHA 4O44B 2GVZB 2WSEC 1ZPVA 4NLQA 1S76D 4DV7F 3SDEA 3MF5A 2AHOB 1T05B 5H9FJ 1YJRA 2RPNA 2YWFA 4IH7A 1ZBTA 1GH8A 2KROA 1I6JA 1Q8KA 3FLGA 4NLWA 3RESA 2R7WA 1K73U 4JI2F 1B3QA 4C8KA 1M1KU 3ET6A 1I0CA 4ENOA 2CDQA 1NHVA 1NK0A 3VGUA 3M30A 2DNOA 2FY8A 2X4YA 2WOMA 3V6JA 1U48A 3UE2A 3QO9B 2RM4A 4QIFA 1GMUA 1SJFA 1NB7A 2X4XA 3NTIA 5GANf 1VQMQ 4X66F 3QRQA 1ZBJA 3B4MA 1G5VA 2QT7A 2FGOA 3RR7A 2SRCA 1SB6A 3UF4A 1OPZA 2DNRA 2ENMA 4Q8EA 5CQGA 1Y0HA 3NHNA 2K5FA 4ECWA 4RNHA 1MROB 3OYYA 2JZ2A 4OGEA 4M5IA 3GIJA 2KT3A 2K6DA 4DI6A 4E7LA 4R5PA 4KSEB 1QTNB 4ZVFA 2EAYA 4DL6A 3W3SA 2MZSA 3G4SS 5HAOA 4J9HA 1S1WB 5E3AA 1XC9A 3J81j 4AXIA 1TH7A 1E7OA 3C95A 3OS1A 3W9HA 5HQMA 1XR5A 2OFHX 2HNYB 1HQ2A 3ZEHA 3I87A 5KH6A 1G83A 3QLHA 3C0CA 2QMUB 1HHTP 4YR2A 3OR2A 3PW2A 4OMQA 1E6GA 3EM1A 1OY9A 3NG8A 1K44A 4AT1B 3A3OB 5GAEI 2RH2A 1Q7YT 1FE0A 5F8LA 1FXLA 3GG1A 4KHRA 3SQOP 1M3BA 2LQ5A 1RZMA 1XMBA 4NOHA 4RKUC 4Q45A 5M2PA 5F0UA 1S9EA 5C2CA 1UL3A 1U25A 1WD6A 4BWJA 1EQ0A 2HMIB 3R5AA 5KTQA 3UR0A 6AT1B 5KT5A 3A1YG 3DYAA 4JP8A 2D9OA 2CJXB 3LH2S 5B0EA 1P8GA 1SH3A 5BXIA 2RVJA 4K8RA 1U7LA 4B3OB 2COLA 2B9EA 3CC7T 1L3SA 2F1LA 4K0KJ 3BDEA 5FU7C 3HHTB 1AFIA 3G1JA 2E6NA 3QT5A 1T0TV 1HK9A 1HNZF 2DH9A 2W10A 2NXJA 3DM2A 1HBNA 5CCAA 3O2IA 1AHJB 5K8PA 4RO0A 1GBRA 4DUZJ 2PGCA 2J6SA 3CC7S 5EX0A 1HI1A 3G7ZA 3NGRA 3G96A 2VPYB 3H4DA 4TYAA 5LMUJ 2KQWA 3MUTP 3R5CA 1TUVA 5JJBA 1K9MC 1RU2A 4GLMA 3OV7A 2XWYA 3L1AA 2CPDA 2LC4A 2ED1A 1ZTTA 1YHQA 3QGGA 3X24B 1P6TA 2HZCA 1UGRB 2GBQA 4C5EA 2HBYB 4YY3F 3RKWA 3NMZC 2DL7A 2X3DA 2CRLA 5LJ3d 3QIIA 3DLKB 2CNLB 4B3RF 4RR5A 3CMEQ 4JRQA 4Y2AA 5K14A 3CT9A 1JLQA 4PYDA 3VGVA 2M16A 3VAHA 4C2MA 1K9AA 1REGX 1PAEX 3TVKA 2QDYB 1OV3A 2HMAA 5HN0A 1QE1B 5DQGA 1GTEA 1RP5A 3SXLA 1REVB 1TKZA 3OTBA 4DV4F 3UCZP 9RUBA 4X4VA 4KV8A 3AOCA 5GADI 4N77A 2R9LA 4IG3A 2BYCA 5FU7B 1Q82U 2W2NP 1UVLA 1Y3KA 3NOCA 3CJKB 4ECTA 1N6AA 2AYBA 2CIMA 1RT2B 3M54A 1G3WA 4JI1F 4DUYF 1ZQ1A 2DGXA 1OOTA 5KCHA 1IB8A 5EWFA 2LXIA 3Q24A 2OPQB 4PJMA 1Y9OA 1F3FA 2DNLA 3AOBA 2CZ9A 2WVBA 3J81E 3R27A 4ZVRB 4Y2KA 2M70A 2DD5A 3G6VA 3SHWA 1JMTA 1VGYA 3WVEB 1JB0E 4M63A 2D0QB 1ZPWX 2HQDA 3FK4A 4MMOA 1IR0A 3KTQA 2A10A 5CIUA 2DNYA 4DPWA 4QR1A 2GJFA 4PKCC 3INZA 2X9HA 4Z02A 4NXNF 2D3UA 1Z1ZA 1BK2A 3TUIC 5D7UA 2IJFA 4FF2A 2HZAA 3U7JA 1KFSA 3GJRB 2LX7A 1YI2T 4OX8A 4MZPA 2VJVA 5HK0A 3IWLA 2WB1D 2VQFJ 2B0GA 3ZXWA 2Z30B 5B7WA 1H641 2CQBA 1G3YA 1VBKA 4LDYA 5CH7B 3CCRS 1HSQA 1ZBXA 2NWMA 1VS3A 3OSPA 1T03B 1CC8A 5KFHA 2XDPA 1N32J 3G82A 1YI2S 2NPFA 4TN2A 4KHPF 1FJGF 1NG2A 3MEEB 4KB7A 4CRIA 4CLSA 4ALZA 1ZA2B 3CD5A 4QU6A 2DPJA 3CCZA 3PW4A 4Q0BB 5FLXU 4NZ7A 4M5DA 2L3MA 1SG5A 2M0OA 5KYYA 3MMAB 1VQPS 2LQBA 2XMKA 5LM7E 3MOJB 4HA8A 2FYXA 3CXCS 4ZP9A 1EJ7L 2HVZA 3W5ZA 4IFYA 2EQKA 2RO0A 3EX7B 3RAMA 1R6YA 5D0RA 2WSEE 4XTYA 1IKYA 3HX9A 4YDDB 3A12A 2PZ1A 1O51A 1ZETA 4DA4A 5F41A 3GQCA 1M5KC 4CIOA 3CDBA 3IBWA 3ENAA 2PA8D 3BQ2A 2PEBA 4IG0B 1J2VA 4HYKA 1WFWA 1CJKA 2VG5A 3KUHA 3UD4P 4AQYJ 5SZTA 3BDUA 4IO9Q 1OYXA 3OL8A 1ZZFA 1NEGA 3EVMA 2R8KA 1RABB 3KLHB 1BQXA 1TQLA 4J5YA 3W2WB 5B08A 3M0QA 4HCZA 4PXCA 4LF8F 2Y8WA 1U47A 2QGFB 3LP1A 1I1GA 4LVOP 4M78D 4X65F 2H4YB 3QYYA 3I56S 3AD8C 3FKBA 3GILA 3SSQA 2FUG9 1N33F 1VQLQ 5I3QA 3JB9k 1MV3A 3E8OA 2XMVA 4FVMA 3MHYA 3KLIA 4ILMA 2VG7A 2ZE2A 1HJDA 2ILYA 5HO4A 1NHKL 3GIBA 4OI1A 2R8HA 2XLKA 1N88A 2KGTA 2OTJT 3I5CA 4OYOA 2OFGX 1F0XA 1JRIA 2F2XA 4J9VA 4C8QG 4FCYA 3GOXA 1X60A 3MM6B 4DZ6A 5CCLA 4A4HA 1QAXA 1SH0A 4J6YA 2ASLA 4ELVA 2OTJS 3ZBDA 2OPRA 5HQLA 4I2PA 4C8NA 1VQSA 4KRTA 4JI7F 4RKUE 4LF7F 1RAIB 4TYBA 2J0XA 2W2PP 2OD6A 3UCUP 4ECQA 4QYZK 4A63B 2OEKA 2O1PA 1MMAA 4ZVEA 1HBUA 1D1AA 3AFGA 4H4OA 1RU1A 3E01A 1OZ2A 4GKJJ 2RQWA 3OQ2A 2GGPB 3DRSB 4QOTA 2RUGA 2LECA 2MOXA 4F14A 3HVTA 2DVJA 5KFZA 2DEQA 3W2VA 5KFUA 5IHNA 4M5MA 2JC1A 3MR6A 3VTIA 1K1SA 3CCVQ 1CEZA 5CZVA 4HHUA 5IS2A 2V4JB 2V9WA 3MEVA 1GX5A 1U6BA 2RD5C 2YKAA 4K4XA 1M5PC 1O0PA 4K11A 2E1PA 1LJOA 1E6YA 3CB4A 3RBBB 3FDRA 2KFNA 2KR3A 2RB6A 2DR9A 5IT4A 4HTJA 4W4MA 4L3NA 1M3CA 1N5VA 3RRHA 3CJSA 3Q83A 1PD0A 1VQLS 2IM2A 5J2NA 3H8YA 1BHNA 1VIOA 4M77G 2GHVC 4R0EA 4UF4A 2EJGA 3E2UA 4OP0A 4MMKA 3CCET 1PG5B 1BYMA 3QAEA 1QSYA 1GK8A 2ZPHB 1K73R 2F5KA 3ER0A 3GWCA 4M8LA 4F36A 1VQ6Q 3PHTA 1W1FA 1M1HA 4KAIA 3CCES 3PE0A 2D7SA 5J2PB 3A8IA 2Q79A 3M8WA 5A8KB 1KOHA 1OPIA 5AE2A 3CD6T 3UFCX 3OW2A 4F3MA 1RTZA 1YP5A 1X4HA