2VV5A

The open structure of mscs
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
256
structure length
256
Chain Sequence
LSYAVNIVAALAIIIVGLIIARMISNAVNRLMISRKIDATVADFLSALVRYGIIAFTLIAALGRVGVQTASVIAVLGAAGLVVGLALQGSLSNLAAGVLLVMFRPFRAGEYVDLGGVAGTVLSVQIFSTTMRTADGKIIVIPNGKIIAGNIINFSREPVRRNEFIIGVAYDSDIDQVKQILTNIIQSEDRILKDREMTVRLNELGASSINFVVRVWSNSGDLQNVYWDVLERIKREFDAAGISFPYPQMDVNFKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of an Open Form of an E. Coli Mechanosensitive Channel at 3.45 A Resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords SMALL-CONDUCTANCE MECHANOSENSITIVE CHANNEL
total genus 83
structure length 256
sequence length 256
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2008-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00924 MS_channel Mechanosensitive ion channel
A PF05552 TM_helix Conserved TM helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.60 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2vv5A02
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vv5A03
3QGPA 2GCFA 1CC8A 1TL5A 4EFAC 3KG1A 1Y9OA 2HIQA 5T7LB 5B0AA 4A4JA 2HLUA 2RILA 3VTIA 3KKFA 4A46A 1VIEA 2OP5A 1P6TA 2LQBA 2OD6A 2ROGA 4OJGA 1VQSA 1N5SA 4ZA1A 3LGNA 4FNIA 3CJKB 3I9ZA 1MWYA 1KVJA 2K1RA 4OJHA 1KVIA 2XMUA 3BGUA 1Q8BA 3BDEA 1XBWA 2ASYA 4OJ1A 5B0DA 1N5TA 1TR0A 1SI9A 1FVSA 2KT3A 1U7LA 2VV5A 3DCAA 3F44A 1P8GA 2FTRA 2OAUA 2W4DA 1W2IA 2BJDA 2AP6A 3FRYA 3QMQA 5A6PA 1YJTA 2RMLA 4YDXA 2Q3PA 2CRLA 1LQ9A 3KG0A 4F67A 1JWWA 2PD1A 4Q2MA 1GXTA 1Y3KA 2PGCA 3MCSA 4A47A 2KT2A 1S6OA 5T7LA 1TUVA 4U9RA 2KKHA 5KAKA 2KYZA 3FGVA 2JDJA 5F0UA 4OJ3A 1QUPA 2RK1A 1Y3JA 2QIFA 2GQVA 2XMKA 3CJKA 2GV1A 3IWLA 1OQ6A 1IUJA 3LO3A 2K1RB 3TRGA 3T9NA 2HQIA 2LXFA 4Q2LA 2HFOA 1Y0HA 1JK9B 2FHMA 2ROPA 4FNHA 4YEAA 2EW9A 4DPOA 1CC7A 5B0EA 2AJ1A 3TNVA 2QLWA 1FE0A 2BJEA 2XMJA 1YJRA 5B08A 1R6YA 2FB0A 1SQEA 3UDCA 1FEEA 2L3MA 3KNGA 4HH0A 1X8DA 1FD8A 1TZ0A 1RJJA 1YJUA 1URRA 2GGPB 2IYGA 3FMBA 2N7YA 3BB5A 1OSDA 3HHLA 1Q4RA 2OKQA 3SFMA 1X0PA 1X7VA 2AJ0A 2W4PA 3MZIA 2LDIA 5B0GA 2GO8A 4ZOSA 1SB6A 3GZ7A 4NPOA 4Y2IA 2RH2A 1N5QA 2XMVA 4DL0C 3HX9A 3BM7A 2HFNA 1MWZA 4HH1A 1N5VA 3HF5A 4DN9A 4A48A 2N4DA 1Q53A 4HL9A 5B0CA 5K9FA 1ULRA 2GA7A 5F0WA 1K0VA 2LQ9A 1V3ZA 1VIFA 2W4CA 3HDSA 5B0BA 2K7KA 5B0FA 1GXUA 2AW0A 2K7JA 2HLTA 1KQKA 4HI2A 5IXUA 2P4TA 1YG0A 2RU9A 2OMOA 3BR8A 3WDOA 3HHLC 2ROEA 1YJVA 2FIUA 2GGPA 1AFIA 2BBEA 2OFGX 3K7RA 1VQYA 3HHLB 1S6UA 2BYCA 4OIXA 1AFJA 1TL4A 2G9OA 1Q8LA 2OD4A 3BN7A 4Y2KA 2QLXA 5A6WA 2ZDOA 1FESA 3TOQA 1FE4A 4NL5A 2XMMA 2QYCA 4HI1A 4QOTA 2VH7A 2GFFA 2RSQA 2ZDPA 3LGMA 4Y2MA 2OFHX 1CPZA 1AW0A 2XMWA 1YRXA 3E8OA 2IFXA 2IYIA 3DXSX 1OPZA 3HHLD 2K2PA 1WD6A 1OQ3A 3BF4A 2BUNA 1APSA 2RK2A 2ACYA 3HFKA 5B09A 1FVQA 2XMTA 2N4CA 3IWXA
chains in the Genus database with same CATH superfamily
1OU9A 4FPRA 4ID8A 2RILA 2VONA 3KG4A 4M7AE 4OX9F 4H4MA 4LRCA 3KUHA 5GMEA 3CMES 4Z7YA 3W61A 2KM8C 3DLKA 3H5UA 4NA1A 1VQPT 2OUGA 2FVQA 2BZ8A 1KHVA 2MIOA 2HMIA 3HFOA 4PABA 4F36A 2Z2ZA 5J2QA 1PC0A 3NTKA 3EDRB 2QN6B 2DNPA 2HFOA 3TEGA 3M6UA 5F8GA 4MZTA 1FEEA 4X62J 2GJIA 5GAOn 3FMBA 5IHNA 3G1JA 2VASA 4K7QA 3KWMA 2E1PA 5IN1A 2J6SA 4LF6J 4DN9A 2ZE2A 2BMBA 5HJXA 1UMJA 1U1MA 1RL2A 2GGRA 4M77A 4DUYF 1E6YB 3DOLB 2OMOA 1RT1B 3DMJA 3RRGA 2MYSA 1H3ZA 2BBEA 2ZHOA 3R6OA 1HSQA 3JCMJ 1XJWB 5GAMe 1HNXF 2H5EA 2RJDA 3OMGA 1UWAA 2DTOA 4MIAA 2FHJD 2J8AA 4CO2A 2CKKA 3JQMA 4A4KA 1VYAA 4GKKJ 2VPYB 2JWNA 2CJYB 3ZTQA 3MEWA 2FL7A 4BE2A 4AYBD 4DSKA 5DZ6A 4RW8B 3N5FA 5LT5A 2R2SA 3J7A1 1LWEA 4DX7A 4CWBA 2UUBJ 4JV2A 3BV8A 1RI0A 4NLPA 1S0MA 1F60B 4OFZA 2HQGA 1RTDB 5KYUB 2HHQA 2LU2A 4RG8A 2EQMA 2JUFA 2BV3A 2L9NA 5HK0A 5BXIA 4DSEA 4J9HA 2F9JA 1Y3JA 2YSQA 4LBPA 1QAJA 2EFQA 2HNIA 1CSKA 1NPRA 1PRMC 4YY3F 1HXDA 4USTA 5FW9A 3SFUA 1RAJA 2QQBA 4ZP7A 4XPCA 2YWKA 2HVHA 1JNZB 5HROA 3MEDB 2C2KB 2KTQA 1SG5A 4KH1B 2NUZA 3OW2A 5KFGA 4LRFA 2LMIA 1G6BA 1YBYA 2YHTA 1LJOA 2BX6A 3UWTA 1D9DA 3UW1A 1W70A 3S6WA 3LAKA 5HK3A 2AKKA 3VUZA 4URGA 5IH2A 3MECB 3OS5A 1ZUUA 1U8WA 4CT9A 2OI3A 2K3KA 4U8YA 2G4BA 3CJ5A 2QK0A 1RWUA 2CPHA 3RR8A 1S4EA 1MU2B 3MXHP 2I38A 4YTLA 4GC7A 3QJYA 2DEJA 4M5IA 2HWTA 1Q7YC 3MAAB 2LP5A 1FRLA 4IG3A 2JMCA 2DNUA 1V1CA 1YCYA 2QQAA 2O31A 3RR6A 1PBUA 1TR0A 4OX9J 4JYAF 1KWMA 2XY5A 3H2UB 3FVYA 4DV2J 4CTAB 5E7OB 2PA8D 1RQ0A 3QIDA 1GXTA 2EGEA 2V0NA 4KC5A 4BDYA 2DEQA 5L1KA 3MDFA 1UGQB 4R25A 4PEOA 5KT4A 1VQ7S 1NJYA 3T41A 3MR6A 1F9FA 1RWWB 2DE0X 3OVAA 1X4DA 1BQMA 4M75D 4PG4A 5KYUA 1Q86T 4GO7X 3M6XA 1PC5A 1OPIA 4USWA 1WSRA 2J05A 3LTOA 3DM2A 2IA6A 5K9FA 3GOXA 2DPJA 2EYXA 1U06A 1IRXA 2ZPHB 4AFSC 2Z2MA 4NASA 2AEMA 1ZSGA 2DR6A 4MK9A 4JDSA 2V8GA 3S3NA 4M7DF 3D5MA 3H2LA 4KT0C 4OMPA 3BN7A 4LF2A 4DV4F 2KRNA 1PBAA 2VFVA 4OYAA 3C0CA 1R43A 3C14B 3FFIB 2DY9A 2IFXA 3NRBA 5BYSA 4PPDA 3Q1JA 1FDDA 2POKA 1YSJA 4HKQA 4RNFA 4C11B 4PUOB 3W2WA 3M8WA 2GQ2A 3HJFA 2R8JA 1YJ9T 3CJKB 2FJDB 3OBIA 2AZ3A 3QIPA 1NK7A 2AP6A 2RQMA 3DRYA 1IKXA 1BWEA 3IA0A 4K59A 1N33J 4ENOA 4PJLA 2ZH8A 5GAHI 5T7LA 4CLUA 2F63A 1IR2A 1Y96B 3GCXP 4F2SA 5F8NA 1IUJA 3FJPA 2EJ9A 3H0FA 1QVGR 1BCMA 2C2ZB 4X66J 1L3VA 3AD7C 2VA2A 2RI5A 3NG8A 4JV0A 4O3NA 2XZTB 1WOSA 2IYGA 2IVWA 5B0CA 2VA3A 2UUAJ 1M1KT 1VRUB 1Z2ZA 1CJVA 2BW2A 2HKEA 3QT7A 4Y2IA 3EAEA 3BDUA 2FJWA 1PKUA 4J8OA 4AXJA 4Q43A 1LW0A 4OHXA 1OPKA 2LQ9A 4OZ5A 4CNZA 5I3QA 3M1VB 1M90C 3ME9A 1EP4B 3GYGA 2N82B 5HMWA 2EGCA 1SKWA 2R7TA 3DLMA 4C92E 3EHQA 2MK5A 4I56A 4N8NA 2L48A 2KZMA 1J2VA 1JJ2S 2EEYA 2CWKA 4MAKA 5HY6A 3MUVP 1PRLC 2OP5A 4OB0B 4OJGA 5LJ5f 2DY1A 1FWZA 4GBQA 1AVZC 5KFYA 4YHHJ 5EUHA 4XU3A 4ZGDB 3EICA 3LW5C 2E6ZA 3CCWA 1KK7A 3CCUS 2KT2A 3THVA 3CMQA 3I96A 4QW2A 2IM0A 5LJ5j 2W2NP 1VQKT 5DDQC 4ECYA 2O01E 2DVIA 1WA7A 1Q82C 2IMWP 4PXCA 1VQ5T 1HIYA 3H42A 3AHPA 3Q8VA 4PLIA 1WQ7A 4KSEB 2M70A 1SH3A 2AEFA 3QIIA 3M9MB 4F4WA 3QJJA 2Z2YB 1K0XA 2C2NA 5FLXY 1VQ7Q 1UEKA 5HN0A 3OR1B 5E33A 1U8RA 1NEGA 2V67A 3VR1A 4K0KJ 2XYGB 1JB0C 5D77A 3MP8A 1DLOA 3H59A 2ROEA 3ENVA 4OZ3A 3MEDA 1AEYA 3QG1A 3DB4A 1HNIB 3A13A 5D7UA 2GQIA 2E10A 3SQOP 3JV3A 1GXIE 3JXOA 4WKRA 1M2OA 1UFFA 2XMTA 1LW0B 1FJCA 1JB0E 3QYYA 4C3KA 5K20B 3U27A 2Q79A 1KDNA 1UL3A 3W3SA 5DLGA 2D9PA 2G0CA 4E7SA 3GR1A 2G2OA 4YB7A 1FO1A 2NS1B 4M5KA 4ANCA 4I64A 4PG5A 3QMQA 1D0EA 3KOAA 1OI1A 3IXQA 3RGIA 5FLXU 2Z2LA 3MAAA 3FGVA 4ILLA 1Q82T 3I4PA 3I32A 3PKYA 3E19A 7FDRA 2QL7B 2NR0A 3O8VA 3ZTSA 2YKMA 5FRNA 2K3YA 3CCET 2DXTA 2JM9A 4JLGA 3QRQA 3CMAT 2OEMA 4E98A 2QE5A 1HQEB 4ECQA 1HNZF 3N5BB 3D6HB 5L9NA 2VG5A 2QA4Q 1XERA 2DNHA 4A63B 2KHCA 1NZ9A 2YNFB 1VQNS 2ZC3A 1NHVA 2KDOA 3CD6T 4IH6A 2PIIA 4F4AA 2RRAA 4L76A 2JM8A 4TU9A 3D3BJ 3MCMA 4F7UA 4KHPF 4XDDA 1SBRA 3M0PA 1RT3B 1FKOA 5KT3A 2R2RA 2XCPA 2ZPFB 2HWHA 4F4YA 5DLOA 1VQMQ 4X4VA 3VV0A 4GC6A 4XTUA 2ZH5A 2J7WA 4RBVA 3F56A 2C42A 1BY9A 1NHUA 3BZQA 4KRWA 2LA6A 1NMEB 2KN4A 2DEUA 2KHDA 3CC2S 5FU6B 4ED8A 1W26A 4A8QA 3CCSQ 4PQAA 1GQEA 1ZBTA 1WGSA 1N34J 1AD5A 3QRPA 1WHJA 2DYIA 3FC9A 3S8SA 3O3LA 4K2JA 3H8YA 2AYGA 2Q43A 3CCJQ 4LNPA 3ZNJ1 1YITA 2K4YA 4I6YA 2KH9A 1DFDA 4ZPBA 5HQ8A 1HMVB 4RW6B 2J0SD 2CP2A 3REBB 2BACA 4F26A 3QIPB 3MR3A 4X65F 1MHNA 2EQKA 4OGCA 1VQ5A 5ETTA 3TJAA 3KJFB 4KV8B 3S01A 3CNQP 1JKHA 3OQ2A 3W64A 3W9HA 2BQUA 4LSZB 1FJGJ 3O6QA 3KHRA 2V8KA 1IBCB 1Y96A 4J7FA 1FKAF 2I0NA 1VIXA 3SV3A 3CD6S 5IWAF 3L2RA 3KK3A 4XU2A 2HAFA 2DA9A 1VI7A 2EK1A 3QGIA 5LSLA 2JTEA 2JTFA 1RCXB 1RTIB 2RHYA 3D1QA 2M9UA 2EKOA 1HD1A 4YR3A 1U49A 2DRMA 4RTTA 4JUZA 3OTDA 3TOQA 4X9CA 2VQEF 2D3ZA 1V3SA 1AZSB 1DQAA 2AV5A 1Q7YU 1U25A 1K76A 1OPZA 1WC5A 1HI8A 2EQIA 2D8HA 3VS5A 2O9VA 3MEEA 4JRIA 2XYPB 3GILA 2PI5A 2XSJB 2CT3A 2PFFB 5CAAA 2A10A 3I9ZA 2HBQB 1BI2A 3M2UB 2DCLA 4J9BA 5KG4A 2M0YA 4GVBB 5KYYB 5L1JA 2NXJA 4HYKA 2L9DA 1RT3A 2O1PA 3QLHA 3ELHA 4LBIA 4MJKA 3OLBA 4RMOA 1ZM9A 2B9YA 1JXMA 3RBBB 3ZNUA 5A0YA 2YTCA 1Q95G 4LUEA 1Q81T 4XTVA 1RA6A 2GQCA 2B4PA 1SKSA 4N4HA 3A8OB 1X7VA 2RD1A 1DHMA 2L9WA 3VGVA 4IUQA 3L95X 4PPZA 2Y0BB 5HATA 1GMWA 4HHUA 1HMVA 3PJWA 3IG1B 2WVCA 2X7IA 3QUIA 3EHRA 1WIEA 3HMJG 3P5TL 3UPUA 3TUIC 3OA6A 5ETLA 5ETVA 3G6EQ 2ILYA 1Q8LA 4OMQA 2C2EA 4ZNXA 5D15A 4F04B 2ZUAA 2W25A 1SXLA 3CCRT 4WK1A 3EGVA 2R3VA 4PK4A 2LEPA 3K5MA 1DLOB 1M5SA 2KFNA 4PQUA 1KC8T 4MFBA 4KHPJ 1HWKA 1QVPA 3W8PA 2UXBJ 1L3UA 3CMAA 1MWYA 5KFFA 4M94A 1KHIA 4I68A 3AQOA 4IO1A 2PU9B 3OS0A 4WCIA 1RWVB 4RTXA 1KS2A 3OYMA 3PYGA 3AXKA 1F5CA 1OYXA 5CAIA 1YITT 5HVHA 4A53A 2CQ1A 2LJ1A 1FT8A 3CCSS 2XMKA 2JTMA 4LIWA 2GVDA 2UP1A 2XSJA 2A08A 2DXCA 3EG3A 2XNRA 2NYHA 3RTVA 1QAXA 3JB9G 1WDXA 2CZ4A 3GFHA 4PJOF 4RWWA 4ZVEA 1TZ0A 5FLXE 2XWXA 3SEOA 2CUBA 2DEIA 2CQBA 4MMKA 4RTUA 3AFGA 2BUDA 4W98A 4F0HA 3TARA 3VGTA 2B7CB 4MZPA 4LFCF 4RX6A 3RKYA 1Y10A 2UU9F 1HBUA 2LQWA 2LQ5A 5IOLA 2YKPA 3PRDA 3A3PB 4DL7A 1QCFA 4RTWA 3V5RA 5KFOA 2ZDPA 1K73T 3UN3A 2ZM6F 4QU6A 2HAXA 4GY5A 1P9QC 2YWHA 1OPLA 3CJRA 2HL3A 1JLQA 3TR5A 1NYGA 5D4LA 4OB2B 2MY8A 1T0HA 3QPHA 1PAUB 2PA3A 2X1AA 3E3XA 1KVJA 2X4XA 4QCLA 1FKOB 1IQTA 4J9NA 2ZAEA 3B8HA 5CO7A 4ZPCA 3T1YJ 1Q82U 2CZ6B 1QE1B 2CP5A 2J5AA 2MKJA 3OB9A 2F69A 1UUEA 1UCNA 2IRYA 3TAMA 2DH7A 1Q7YR 4OMFB 3FCVA 3I0RB 4ZPAA 2YXYA 1Y0MA 2M8HA 2D41A 4XTYA 1QP3A 3QO3A 1KONA 2GCXA 2MI6A 1LWXA 3W9JA 1FXDA 4MK8A 3O1LA 1Y07A 3I5SA 4K4TA 3PMIA 2WVFA 1SC4B 2UXCF 4NOYA 5H9FJ 1VIFA 4ED2A 1N5YB 3W63A 3SQGB 2OFGX 1VQ9Q 1WXUA 1N0UA 4AFQC 5HSPA 4LQ9A 2ABLA 1UWBB 1IBKF 3BQ1A 5HP1B 2ADBA 1DURA 2NLWA 4AE5A 1VQ8S 5I42B 2H5IB 2HHTA 1GL5A 2L0AA 2YNIB 3IS9A 4MMLA 2AX0A 2DLPA 2GCFA 1S6QA 3V2UC 3JTPA 3OLAA 2CPYA 1XNIA 1NH8A 2P8IA 5ECAA 4AQYJ 4U7UD 4HCKA 4ATOA 2NXCA 4OJHA 4PJOD 3ITHA 1KVIA 4TKTA 1U26A 3OS1A 1BIBA 4PFZA 3DCAA 3OTCA 5MLCV 1JU5C 2EBPA 3K58A 5L23A 2DNMA 2Q3PA 3AODA 3V6DB 3BKFA 1KFZA 3UDVA 4WF2A 4U9RA 2O5DA 1LFWA 3V6KA 3IRXA 2MQOA 2K1RB 3KYLA 3GJTB 5L1LA 4U96A 1Y0HA 2RU3A 1NDLA 1JJHA 3EXCX 2DL4A 3BH7B 2PMHA 3Q23A 1M3BA 3CMAS 2MMPA 2VGMA 1U1QA 4P2XA 6FDRA 2VL1A 1EETB 3JTOA 1VQNT 2SRCA 4TY8A 2A0FB 2R42A 4RTYA 5LL6S 2QLFB 2W10A 4G3IA 1C0MA 3A3OB 4RBTA 3CPFA 2F40A 2OD4A 1B99A 2O66A 1ZX6A 5FU7B 4OX7A 3TZYA 1B7TA 5GAMj 4U67Q 3KK2A 5CVIA 3UR0A 1VDHA 3VAMA 3M58A 4L3KA 2EVRA 1IXDA 2ZZMA 2RF2B 2QASA 3SQGA 3CC2T 3ZBDA 2LJ3A 3PYFA 4B9XA 4M77C 3U7JA 2ENMA 1AWWA 2HGNA 4F67A 3BJYA 5KG7A 3CXCS 5I42A 1VC5A 4LJMA 1TL1A 3IO1A 1VOMA 1I81A 3CIZA 1U1KA 2YX7A 3UVJA 4CLFA 2OI2A 4I2PA 4DDFA 4DUYJ 2E7WA 2NQPA 4EBDA 1R6YA 1WG1A 3CJ4A 1WC3A 1RJJA 3QWXX 4N77A 3LWIA 3MM5A 4J5YA 4CRJA 3V6JA 4WK3A 2DJQA 2F2XA 3EG9B 1N6AA 5J1EB 2KE9A 2OPRB 3V81B 3OSVA 3SI8A 1HWLA 2VGNA 2P9GA 1BI3A 5IXUA 4B17A 2ZH3A 2EFNA 2LA4A 3G8SA 2E5LF 3HSBA 3QT6A 1YI2T 4QWDA 3SIPB 3C95A 2KK4A 2RDJA 2Y8YA 3OVBA 1FJ7A 2IMOA 3PR4A 3QAUA 1KD1T 2HSEB 5BYQA 5LSRA 1U4BA 1WTFA 2MYFA 3FB9A 4ZTFA 3KDNA 4M77G 5GAN5 2DO3A 4C3LA 4TN2A 4QKUA 5D8HB 2JLGA 1VQSA 2CT4A 2WBRA 4O44A 3IR6B 2Z4PA 3V7CA 3NFCA 4DV1J 2VV5A 3L3CA 1VHFA 2YKNA 2BIVA 1X6GA 4M78B 2RQVA 4LDUA 2GIRA 1N9SA 1YHQT 4X4UA 4WCEQ 1REVA 1N5ZA 4C8QE 4WP8A 5K8NA 2BZYA 2YWWA 2L41A 3SDEB 4CM2A 3LO3A 3UWNA 1NKEA 3MAQA 4RKUE 3KUFA 4DUZF 4C0GA 2KRBA 1K73R 2BJEA 3IP0A 4OZNA 3LX7A 1S49A 2Z0WA 1DQ8A 1K8AR 2V6AA 2YRCA 2IIMA 2NUHA 2C3YA 2RQRA 5KCOA 1TV6A 3I0RA 2DBKA 3I55Q 1S9EB 2G6FX 1ZETA 4WE1A 3R6LB 1U2CA 4LN2A 1IREB 2K8GA 2VB6A 2DXUA 2BJ3A 1YIJS 2HHHF 3SWNC 5GMKj 2HKNA 3P45B 4XK8C 4QIVA 2DRKA 1MV0B 2LJ0A 3AD9C 3PG9A 3KLIB 2HHPA 3H8ZA 4C8ZA 2H51B 3C3LA 3TP2A 3CDUA 2OAUA 2IVYA 1W2IA 2B6AA 4TQSA 3NMAA 1NZAA 2EFOA 5LJ3g 2YNIA 1U1RA 1IBMJ 4U8VA 4LRBA 2UUWA 2ZD1B 2J6FA 1R8BA 1YVFA 3JB9k 3ILJA 3MM6A 3HHKA 4U7UK 1ZBXA 4C3MA 2A1BA 2MQPA 1WEYA 4K4SA 2EW9A 1A6LA 4TVRA 2EG1A 1V29B 2WB4A 1ZM2A 2OTLA 1NSQA 2CA9A 2DHXA 1MG7A 4N4IA 1N8RU 1AUSL 5SZTA 3Q89A 4ANEA 2ROLA 4LDVA 4N0AA 4A4GA 2EYWA 1MWZA 1PNJA 3KNAA 4JV1A 2YKQA 3CB4A 1QW1A 3CXCA 2SEMA 1E6GA 2NSCA 1NSPA 4NLOA 3W62A 4B3TJ 1HNWJ 3BR8A 4ZPDA 1K1SA 3CCEQ 3E2UA 1O9SA 1YWPA 4J9IA 5CYQB 3N6NA 1BCOA 1UGVA 4NLWA 1ACMB 2KXCA 3R2CJ 4ED1A 2HBWA 3K5LA 2X4WA 3G71Q 2E5IA 4DZDA 3HSZA 4Y65A 2DL8A 3H0IA 2KXDA 1W2BA 1SPBP 4O23A 1ARKA 5KFLA 2LQBA 1VFJA 2EXUA 1YJ9S 2LEAA 5K14B 2J6TA 3OYGA 1U8SA 2NXEA 2G0IA 2FGOA 3JCMW 1X5SA 4LFBF 3T6BA 5GAN8 2DO0A 1QTNB 3JCMQ 3KTQA 1VQLA 1GCQC 3MR2A 2KXHA 3GR0A 3GJQB 3BPSP 4RNMA 3SSQA 2CWXA 1XQHA 1HD0A 3GV5B 1K73U 2DNOA 2QMWA 3NGDA 1RZMA 3AJ2A 2ZH2A 2DRAA 1HQUA 5IC4B 5CQGA 3BW1A 4LDXA 1SUQA 1NSAA 2HRTA 1W7WA 1U6FA 4NLYA 3TNVA 4FXDA 1KQSA 2M5YA 1MUZA 2PVDB 4NA2A 4UY85 1M1GA 3KLIA 5HK4A 3LH2S 2DYBA 4QPTA 5FRMA 1URRA 3IFEA 4C0DB 1UB4A 2BTTA 2DBBA 1FKPB 2RAQA 2GO8A 5D4OA 2PE8A 2P5VA 2K79A 1JBMA 4M75A 1LEOA 1HHQA 1U3OA 1NPPA 2DR9A 1NRKA 2HURA 1S1TA 1B64A 1R27B 3GG0A 4G1PA 3WDOA 5GANe 4JUVA 2OMLA 2LCCA 4FDFA 2BYCA 3M0QA 1TL4A 3THPA 1SSHA 2YQ1A 3PFOA 1IGQA 2FUG9 5EHHA 1ZA2B 3TUPA 3OYKA 2CAJA 4I6WA 3OJUA 2HNDA 1TOVA 3J80E 1NU4A 5J1EA 2YPZA 4YMEA 4OYZA 4KFBB 5HQMA 4XDCA 3J7Z5 2JEGA 2J9DA 4PG7A 4PFPA 4G1QA 4OMLA 3C66A 5CYMB 3R1HA 2NPFA 2EYZA 2K2MA 1DQ9A 5ETOA 3UD4P 5CYQA 1SIZA 5K8MA 3F44A 3Q83A 3V8LA 1VQPS 1XMOJ 3JSMB 1MW7A 4B3OB 2HNZA 1X69A 2L5QA 1N36F 2JEJA 1XK8A 3CCVQ 4HVVA 2MGZA 2VC1A 3A8LB 4OMMA 1EB0A 3BS9A 5CR2A 1VQ5S 1KQSR 2MLYA 2V63A 3GG1A 3OL9A 1TP7A 1AB8A 4GKKF 1NJZA 2MQNA 1FYNA 2B7BB 5DLFA 3L2VA 2AJQA 3O5ZA 3NY0A 3HFNA 5E41A 3PO5A 4FXVA 2LQKA 3P49B 1BMQB 5L9XA 5EC7A 3CCRQ 3M8ZA 3X3UA 4IR1A 3JCMg 4WTYA 1WC0A 1DZ5A 1VQ6S 3J7YU 4Z8AA 3L7PA 3KLFA 2V9KA 3NGUA 1OU8A 2WONB 2Y0SD 4IH7A 4Y0FA 4PKDB 3EPIA 3ZZYA 2MZTA 5KYWB 4NE9C 2H3JA 1KG1A 2J6KA 4XK8E 3QO9A 1W4SA 4HVUA 2R8IA 4D3HA 3BSNA 3AHUA 1P1LA 1YWXA 4JI8J 1OQ3A 2RK2A 2ACYA 5I22A 5F3ZA 2RKIB 4E7HA 4R0JA 1KQGB 3JQKA 3QPIA 2KNBB 3A5ZB 2CQ3A 5KCHA 3G6ET 3VGUA 5C24A 4LD9K 2V2QA 1WNLA 3Q8SB 3QWYA 2MEWA 4A8KA 3POTA 4Y6IA 2D6FA 1N0VC 3G7ZA 2FPDA 1YJ9Q 2HVDA 3UCGA 2ZPBB 3SCJE 4ED4A 3KFVA 2JHEA 3QDRB 3NBPB 1IKYB 1KNZA 5F9LA 5ETMA 1VQPA 3I5AA 1KC8C 3JCMh 2RNAA 4Q45A 3RRHA 4LSLB 4KHMA 3PYDA 4HTIA 4QJVA 3MTKA 1PKSA 2NYSA 5K8OA 1UP1A 2E7VA 2IRXA 2OGUA 2MHNA 3LWMA 5B0FA 4QZVB 2DR7A 2CDQA 3HVAA 3CC7A 4ELUA 3UT1A 3INZA 4BD3A 5GVQA 1YI2S 1EAYC 2K3IA 4FVCA 2FZCB 3QWUA 5HQLA 3CIMA 4M78D 2EBEA 3A8HB 3MOJB 3MCNA 1CEZA 1BQNA 3OUYA 2F5TX 3SCLE 2NUTA 1EHWA 3P5BP 1WJ9A 1ZUYA 1TSFA 3DKDA 2WONA 2F9DA 4KGZB 4IOBA 4O3PA 4DX5A 1LVKA 1NK8A 1YKWA 1BKBA 1V5VA 3IC1A 1XR6A 3ISNC 4NOHA 4JP8A 4PJOE 2JVVA 2ZZTA 4YS2A 3UD3P 2V4JA 1EKSA 2IVFB 4W4MA 2W9BA 1XMOF 3ASKA 3DGPB 4JB8B 2D8JA 4B3MJ 1RYSA 4MKYA 5LMUJ 4F7UE 5K14A 3CD6Q 4NCAA 1VRTA 2ZBRA 1OY9A 1H2UX 1UTAA 5KYXA 1S1WA 1K73C 2UUAF 5LJ3j 2L3MA 1X2QA 3CCLS 2E1RA 4K4UA 5EX3A 2PN6A 5KOXA 1PD0A 4P75A 4ECTA 2MY7A 1BB9A 1RAAB 4HCZA 3B4MA 2KEAA 5GANj 4Y34A 2BANB 3ZZZA 5F3TA 2P6SA 2W4CA 1RGVA 1PSDA 2C3UA 4DQPA 2MQ8A 4NLVA 2ZE2B 3MCOA 2BKDN 1RHUB 5B7WA 4AG1C 4I1TA 3W65A 2EK6A 1T03A 2XS5A 1YBTA 4ID5B 1PJ5A 1VQ6Q 1UGPB 3QSUA 3MPVA 2KT1A 4II1A 3HHLD 1UVLA 2NPIA 1IBMF 2RUGA 3CC4S 3E2EA 5J1PA 4LR8A 4XTXA 1I51B 2BJ8A 4G65A 1FNXH 2BW7A 3ZZUA 4RUCA 5GAOp 2UUCF 3BGUA 3VVTA 2IM1A 2V8IA 4DUTA 2EYYA 1WHXA 5BJRA 2KG0A 2RMLA 4V19J 3B82A 2BVZA 3LWLA 1OO0B 1IBLF 1CLFA 1DBDA 3DGVA 4AXIA 4BI8B 2VXEA 2FZGB 3FCWA 1YBAA 2O4XB 1T0TV 1BIAA 1WJSA 4A4FA 2ZPEB 4F4ZA 1VQ4Q 5LJ5Y 1JK9B 1HLWA 1HBOA 1JLEB 2E66A 3D6TB 2Z57B 3GE9A 3CCLT 3FIFA 2N7YA 3DOMA 5FU7C 3H2VE 2CP7A 2HMIB 1ZSZB 5J26A 4R55A 1H72C 1XR7A 2Z8QA 4HL9A 1TUDA 2W9BB 2M9KA 3H0PA 3DGPA 4ILMA 4DN0A 2FPEA 2D0QB 2I5JA 2GIQA 3PX4A 1WOOA 1RACB 1TUCA 2K57A 4IRDA 5HMYA 3U1NA 2K7AA 1YJVA 1SRLA 2UUTA 4IIOA 4DSFA 1YIJA 2YUPA 3LP1A 1O5JA 5JJBA 4CIOA 5AJ3F 3DLLA 1KD1R 3V4IA 4IDKA 2XMAA 2XWYA 1KP6A 1VQ9T 3BB5A 1G4CA 1GAOA 1SRMA 4M7AC 3FCHA 3KK1B 1YJNS 4IOAQ 5ETSA 2DTIA 2IDEA 3DMJB 2X4YA 3FEZA 4MZMA 2WB1D 1D8ZA 2ILZA 2RHXA 1LWCA 2HBYB 1ZS6A 4VUBA 4L73A 4X64F 2XZWA 3DI6B 3DLHA 4KUDK 3BBCA 3DLJA 5A8WB 4XIUA 3HPOA 2IJNA 1QKWA 3PGGA 3KLGB 2D3UA 3KXDA 4M63A 2L89A 1KRPA 2W2PP 1D1CA 3JB9I 4O0NA 1WF0A 3IQLA 2DGQA 3K0JA 2AJ1A 4IO9Q 4UTGA 3AB2B 1BUXA 4FVMA 2R5MA 2DD4A 1FRKA 4M7DB 3PV8A 4M75E 5F8LA 5LMUF 4O4RA 2UV8G 5E3QA 1KLNA 3CCTA 1X43A 4LF5J 2HLTA 5LJ5g 1RYRA 3Q8PB 4LSLA 2KBTA 1RE1B 3HHLB 3KJNB 1UE9A 1BC6A 1XIQA 2MCNA 3QBYA 1SSFA 1ZM3A 4F7VA 2XY7A 4KAIA 2ZBQA 4E7LA 5GJWB 2RQUA 3MPDA 4DHVA 2XY6A 1WOPA 4NLXA 1N32F 3FJ5A 3EVWA 1K0SA 1M90T 3RESA 4ZCMA 4M7DG 2XC9A 4ZJOA 5GANd 1T3NA 4PUOA 2GO9A 1FMKA 5GAMd 3JB9D 3VYHB 2A7YA 2X3DA 2FPFA 4KGMA 2M4MA 4EU0A 2XLIA 3EG1A 5DS7A 2B8PA 5KFJA 2RUSA 2QXFA 4BY6C 1IKXB 3BBFA 4M5GA 3TZWA 1ZPVA 3I35A 3G87A 1IM4A 1L3TA 2HVZA 1SL1A 4NL3A 2L2PA 3HULA 5D3GA 1ELOA 5KH6A 2DKGA 3P6YC 3ETOA 3KLHB 4E7IA 5A8WA 4HT5A 3UI3A 2KVQG 1VQKQ 4WU2A 5LSOA 4JI8F 1VRTB 1CJVB 3M2RA 3KHHA 1N34F 4LMZA 4ZDNA 4J37A 2QEXT 1BQMB 1S1UB 5J2NA 3RU0A 2KB2A 2DYAA 2QZ8A 2NSBA 4UOFA 4C8QG 4R8UB 4NL5A 2ZUGA 3CDEA 3MWBA 4M7DA 5HO4A 1RUSA 3RG6A 4RU9A 2QTVA 2RHUA 2JX2A 1NJXA 1MNDA 5A8RA 1M30A 1VBZA 1RT7B 2EFGA 2I0XA 2P9CA 8RUCA 4X4TA 5FDLA 3M8RA 1T3SA 4C5HA 3RERA 4DFMA 4DOWA 4X4RA 3GNFB 1HI1A 4JV5F 2DNQA 2VJUA 4PWDB 1OQKA 2LNHB 2CGHA 4PJNA 4HDHA 1OX9A 2RVJA 5E5NA 3LYIA 4PAAA 5DG8A 2CPDA 4A8MP 1Z9ZA 2MDAA 3Q24A 1BD6A 3H98A 4BI4A 1WKLA 2QLWA 2UXDJ 4Q0BA 1N32J 3HKWA 3WHIA 2DFUA 4E7KA 2XI9A 1C1CB 4KUIA 2Q1LA 1Q82R 2BA9A 5I4MA 1V5IB 4QQ6A 3ZC4A 1IB8A 3GIMA 2FVCA 3UATA 2UVWA 4FT2A 1JLAA 3PNWC 3RBZA 3HP6A 2N3OA 4KT0E 3W7BA 1M2VB 2F3JA 2CPFA 3ENWA 3CCQT 1YGYA 4Z89A 3LGHA 1XN9A 2F1FA 1M5VC 5CZVA 4ETXA 1T9UA 2WZ1A 2OFHX 5KT7A 2YLCA 3PX0A 1CKBA 3CCJT 4RW9A 2YUQA 2HKQB 4FW1A 1HNIA 2VFSA 1OSCA 4NRUA 4PJOA 2DKOB 5C42A 4BDZA 4WZQA 3KHGA 2A3LA 2MLZA 1XEZA 1SJRA 1HJDA 2KJWA 1LOUA 4ZJLA 1JLCA 2BJDA 3FRYA 2VKRA 3LPYA 4FBTA 5H9EJ 3JCMb 4B9VA 1JWWA 2C0TA 3FQKA 4C98A 5KFNA 4AUKA 1XMQJ 3N9UC 2QRRA 2FY8A 2QT7A 3UFCX 1Y5NB 4CO5A 1QSSA 5L1IA 2VG7B 4FNHA 2V68A 4OB1B 4IYQA 1FJEB 1RT1A 5DZ7A 2AGPA 2C2MB 5GANh 4ECVA 4DL5A 3UO0A 4B3SJ 1AROP 4K50A 4DR4F 2DXBA 1D8YA 2RH2A 2X9HA 3AOBA 3CD5A 2E9RX 1HHTP 4B3MF 3TO8A 3HSJA 1RT2B 3CCZA 3MPYA 4GO5X 3G4SS 2ZH4A 1ZM4A 4HXJA 2FHKA 3VZIA 4EGLA 4V19X 4CM0A 2RSQA 3M8QA 3GSDA 2CZVC 3CCJS 4LF1A 2FVUA 4OVAA 4A8YA 2Q6BA 3DLLQ 4RZRA 4PXDA 2Q66A 5HBMB 2E5JA 4DR3J 1VIEA 4HEA9 3RBEA 3FEYB 2EGAA 1X6BA 2GNCA 2CADA 3M4XA 1WACA 2F7VA 2E3IA 8ATCB 1GEHA 1FK9A 2LDMA 3JB9F 1B7YB 3D68A 3D66A 1BE4A 5F9NA 1R89A 4IH5A 4NXNF 1M3CA 3OYDA 2JZ2A 3QWPA 3PFSA 3CCST 5HJYA 4WFAQ 3A8IA 4E7JA 4X2BA 4NCBA 2ZH6A 1RK8A 5B0EA 5DM7R 3PZPA 2LCLA 1XNQJ 4QW9A 2V4RA 3EJMA 1N4LA 4JI3J 4Q8FA 3LGLA 4Z2XA 2NWMA 4ZMMA 4XU0A 4TYAA 3D2WA 4EZ9A 3ZEHA 4NEZA 4UQTA 1U1SA 1X4GA 1DRZA 2AMCB 1C1AA 2GVZB 4ZP6A 2HW3A 4Y28C 3G6XA 2BQRA 1AFIA 2J9CA 3DHWC 2RIJA 3AY0A 1RBAA 4X4PA 2PDAA 2CVIA 1N9RA 3PIPA 1TUWA 1F5BA 1FMWA 4HI1A 3LW5E 1YRXA 1BI1A 4F7UF 4HT7A 2LNVA 1G2EA 2MPXC 2O9SA 1UJ4A 2OH2A 2BJ9A 4J9DA 4PYDA 2NREA 3VAIA 4ZN3A 1K47A 2NYIA 3K57A 2Q6CA 1R8PA 3HPWA 1U0SA 3O8WA 1SI9A 4ZCIA 3EGWB 1S5ZA 5E2QA 3C16A 3R97A 1QLNA 1UFLA 2XK0A 3RJMB 4J6XA 2PMZD 4BCAA 4USMA 4BLGA 3AH6A 4EYIB 5GADU 1RT6A 4CO1A 2QEXQ 2DK2A 4N56A 5B08A 4B08A 2WBMA 4FBUA 4H4OB 3CCUQ 3QATA 1HBNB 2YBVA 3P96A 5B0GA 4KPCA 3R5BA 1SHFA 3LP2A 4ZK7M 3C14A 2WSEC 1X9MA 4BE1A 3H9NA 4OHYA 4U7CA 4ES2A 3IAS9 4ITSA 4RW4A 4ECRA 2FEIA 3W2WB 4DV0J 1ZH5A 1ZA1B 2WSCC 4FSXA 1N6QB 3KLVA 4DEXA 2V50A 1MU2A 2VICA 1M0SA 1XTZA 3SSRA 3JCMV 4C2MA 1HR0J 1BQXA 3JYTA 2X1FA 1JLAB 3M2VB 3NMRA 3SMZA 2D69A 4BC7A 3HHLC 4A4HA 5GADI 2EQJA 2XS2A 1RWPB 1LW2B 3NS6A 4YB5A 4ZHRA 1RT4A 1GK8A 1PGZA 3NWRA 2XG8D 4PR6A 2HQFA 5IHKA 4WWSA 4MH8A 3IBFB 2CS7A 2GTOA 1H73A 2FDNA 4P74A 4EIKA 2JJ9A 5ETKA 1YITS 4PJOB 2DETA 1S6OA 1Q0NA 2V8HA 5F0UA 1DAXA 4C8LA 3M2UA 2AJ2A 3JB9J 2I9SA 3GJSB 2XO6A 1NB7A 4YR2A 2HK3A 3BO4A 1UHFA 2XKOC 5KFEA 3Q22A 1GMWD 1AOJA 3CPWS 4ERDA 3RAXA 1RISA 3C16B 4JI3F 2HFNA 1YJ9A 3JSCA 1JXVA 1LV5A 1IGUA 4L72B 4A8FA 1ZPWX 1R77A 3ONQA 3I56S 2VG7A 3T5JA 2AW0A 3SWNB 1PAEX 5DDRC 2H54B 1X01A 4JJCA 2P0QA 2XLKA 2K5IA 4GLMA 2YRDA 3ENQA 5ADZA 4OI1A 3PYEA 1DTTB 4HKEA 3L1AA 1RT5A 1FWKA 4DV6F 4TYBA 3OY9A 1FTCA 1WHVA 2OSRA 1Y7PA 3J7ZT 3EYZA 1RTJB 4O3OA 1S72Q 2VU5A 2EYQA 2CQGA 1WD6A 3J81j 5KG1A 1V76A 1S0OA 4M7AD 1IKVA 1P6TA 3CCVS 3PMTA 1Y00A 1TMJA 3SEMA 1UEBA 2FO0A 4C8NA 2LU1A 2F2VA 2KMTA 4DV3J 3VAFA 2XBPA 1NCLA 1JJ2P 1XC9A 1I1JA 3R3TA 1QVFR 2VPZB 4C92F 1WG5A 4N7TA 4IOCQ 3M4YA 1NUEA 3HVTB 5J3BA 1K9MT 2GJFA 1TL3B 1D9FA 3HD1A 3J81E 3FEXB 4FS1A 2GMHA 4JOUA 4TQRA 1MMNA 2DZ9A 1FE0A 1RT4B 2FB7A 1I94J 2M02A 4JI2J 2CJBA 5KAKA 2R8GA 2VOOA 4W90B 3MM9A 2WCXA 4F8RA 3OSNA 4ELTA 1KR4A 3M1VA 1U0HB 5LJ3f 4RTVA 2HG4A 3W1YC 1TKZB 2RI2A 3CCUA 2RN8A 3A12A 3FZ2A 1RHMB 1YJ7A 5BR8J 5IHIA 1U1LA 5IT9U 2AD9A 3Q86A 3RIRA 2E5KA 4QR2A 4DR1F 5GAN6 2DM1A 5LJ3d 1HARA 1NK6A 4OQJA 4IFYA 5AXNA 4URSA 5DQIA 3QDFA 2DVJA 3IBWA 2IY5B 4BY6B 4DR2J 1VQ8T 4E0DA 4LF7F 1JJ2A 4N4GA 1Q86U 4DPUA 3EH2A 5BYRA 4CP5A 3S7RA 3VWSA 1HBUB 4C8YA 1EQ0A 1X75C 2R7SA 2VFTA 2E1MC 5EWGA 1TK0A 1SL2A 1QTMA 1RUWA 3I5BA 4J9KA 3MUTP 3X1LB 1RLQC 5KT2A 3Q8QB 2BRLA 3MKDA 1WDDA 1J5EF 3K5OA 4O3SA 1UJYA 3QZ5B 2BKPA 2IBKA 1N27A 2MQQA 1QSYA 3OSPA 1T9XA 2H8HA 2QIFA 1WI6A 3CJ8A 3GQCA 4CO4A 4Z7CA 5IXFA 1Y57A 4BWMA 2XMJA 3KMQA 2HHUA 1HNWF 2X1GA 4CLTA 2GF7A 1LK5A 1YI2Q 1S77D 5FD1A 1KD1C 2CNKB 3MMBA 3L2WA 3NNAA 3M9NB 3CC4A 3QRRA 1I1GA 1S97A 1XMBA 2UV8A 2VD3A 3OMCA 2G13A 4C5EA 1EARA 3CDWA 3QSIA 4EMKA 2AGOA 2JJ4D 2P6TA 3BYPA 3DB3A 4OYMA 1R8HA 2ACMA 4JJDA 2M51A 2VG6B 3LPEA 4NI2A 2XMMA 4ZIWA 4A4EA 2LVWA 2QMUB 4I4BA 1K9MU 1UEUA 4JI1J 2ZVIA 1U0HA 3US5A 3MF5A 1N5YA 2PO4A 4ZVQB 3DOLA 4O4GA 2MSSA 1TK8A 3V7SA 3OTOJ 4DMZA 2LDYA 2B5JA 4ED5A 1FFGB 1DARA 2YWFA 1DTQA 2JL9A 1XBWA 1N54B 4IFYB 4MDWA 5KT5A 2V94A 5A6PA 2HPUA 5LL6d 4LF8J 2CRLA 1YLXA 1MROB 2MOXA 1C2PA 1KTVA 4P2SA 1QVFP 2CNLB 4OI0A 2R5AA 1F2HA 1M8VA 4YQWA 1S0NA 1UPMB 4ZHRB 3ULHA 3M4GA 2UUBF 4C0BA 1G1XA 3GFYA 1A0OB 2KXNB 4DLEA 1SJ3P 2VC0A 1X5OA 2PI4A 3IRWP 4LF4F 4OP0A 3SZ2A 5IT0A 2U2FA 3E51A 5CKHA 1AHJB 4QIEA 2AEJA 3R8YA 2XNQA 2YVSA 3MPUB 4M77F 3CC4Q 3GIIA 1UZDA 4K8RA 1GT8A 2VBXA 3MEAA 2DH8A 2YY3A 4DXLA 1S7IA 1CVJA 3ZZOA 3OHAA 2ZH9A 4RBUA 4M7AB 4LSNA 2WSFE 1OY8A 1AWOA 3NS7B 1HR0F 2IM2A 1YI2A 3DLBA 1OV3A 2ZOMA 4OZ0A 2ZJRQ 3RB4A 2FYKA 2FHJA 4WXOA 5C2CA 2HFSA 1RLDA 4B9SA 2AZ1A 3M53A 2RD5C 5A2QY 1T3OA 1GTHA 4WTOB 4X4NA 4QR1A 4EPCA 1PJ7A 3N0VA 4FYXB 1RT5B 3DDKA 2XMUA 3BDEA 5LJ5h 2OHDA 5KG3A 1J3TA 4C8QC 2DGOA 4RW6A 2VG6A 4NI2B 4Q44A 1H3DA 5LJ3e 2BABA 3A8KA 2W8LA 4OV1A 2W2OP 2QO3A 3HD2A 4KKOA 1NKBA 2YUNA 4LXCA 2ASDA 2QA4T 1IKVB 5A76A 1SV5B 1IO6A 1PKTA 1M1FA 2R58A 1OQ6A 5LXRA 3ZZRA 3N6LA 1UVMA 2FGCA 1RTIA 1VYTA 5DY9A 3TX8A 2MJNA 1X8DA 2F8MA 1YNZA 2R7RA 2W4PA 2PUKB 2OPPB 4J9LA 3MM8B 1MMDA 3BM7A 4PWUA 3VCDA 1MROA 4FYYB 3RB3A 4NXMJ 1TL3A 1EKRA 5F0WA 3DYAB 3JQJA 2ALZA 1GXUA 2AGQA 2XICA 4MKAA 2Y90A 2J06A 3BGRA 1NPKA 4X4QA 1RHRB 1O75A 1NKCA 2RF0A 4OZJA 4URQU 3LQVA 1U6ZA 4K4ZA 3E8OA 4C0HA 2EFIA 2OTJT 4BBYA 4J9FA 3QQCD 4FW2A 2CIMA 4GVBA 1I8FA 3F0NA 1BGXT 4J9OA 3ISZA 3UNYA 1HWUA 3EMTA 5HMXA 2IHR1 1VA7A 3BGOP 2AZSA 4MKVA 1BU1A 3RBXA 1C4CA 1U7LA 1RHJB 5IC6B 4N5SA 4J7IA 2ZOGA 5CZXA 4OF1A 2DL7A 2DJWA 3TREA 2EW3A 5GMDA 4YB6A 1WHMA 4CLLA 3CJKA 1VIOA 3FSXA 3PM9A 3H40A 1M9SA 2B9EA 4J6YA 1ZAWA 1CJUB 5GJVB 4JRQA 1HQ2A 2ZNYA 3MM6B 1S9FA 2HK2A 2QG9B 3OV7A 2JT4A 4IRKA 1IJEB 2NXNA 1SJ4P 2H9ZA 1N56A 1XOVA 1IHWA 1YHQA 3NHNA 5AT1B 2VDIA 4PL6A 1GX6A 1I5OB 3DDIA 2CUDA 3CQTA 3SDZA 4LRDA 2H65B 4ELZC 1KBRA 4MFBB 3ZZPA 2DBMA 4P71A 2PC6A 3I5RA 1T9TA 3DKMA 3ZO7A 4OIXA 4Y2CA 2IBOA 3ET6A 2KI2A 2EPDA 3GU0A 2LCSA 5ETRA 1K44A 4Y92A 3MMCB 2CSQA 1HA1A 3UN5A 5LOQA 1U48A 2E7XA 3NCQA 4FPIA 4BWJA 1KEKA 3ZFJA 2ZZNA 1RAHB 1D0YA 2VOPA 4J9RA 1EJ7L 5DM7Q 3G6VA 1QE1A 1VYUA 3TANA 3GIRA 1V6HA 1OYEA 2V1RA 4WBFA 3G6ES 5CKFA 1VQKA 2IAJB 1D1UA 3FLGA 3FBEA 2DXFA 1S12A 4GMKA 1PCAA 2FLNA 4ZCKA 3N6MA 4PRFA 1TK5A 3NGKA 1S6PB 2Y3YA 3PJXA 4RTZA 2FHDA 1YJTA 2QX0A 4CH7A 1Q81C 2XIDA 2V2KA 2XCAA 2VBWA 1WEZA 2HVIA 4ECXA 5AE2A 4UZBA 5D0EA 2J6UA 5L46A 4OLPA 1VQKS 5LMNF 2B9XA 2UVVA 3MI7X 2COYA 3PO4A 3SXLA 5F8JA 4PWWA 2P84A 4NLGA 2QAZA 2GHPA 4CYUA 1N8RR 2DK3A 4NLRA 1B3TA 4HH0A 5GANg 1FD8A 1U2FA 2EKYA 2DL5A 1S7HA 4L59A 1WG4A 3QGGA 3ILIA 2DIVA 1Y71A 1E6VB 4I7FB 5FIIA 3VQTA 2AKLA 5KFZA 4M78G 4ETZA 1C1BB 1S76D 2GBQA 4NXMF 2Z30B 4ZITA 5A8KA 4CC7A 2JXBA 1S57A 2R9LA 2QGFB 5CKBA 3ITHB 2E6NA 2K3XA 1JLQB 1FMVA 3DN9A 2QMXA 1QM9A 3AA8A 3LGMA 3PRVA 2HZVA 3PW2A 4J9PA 1QKXA 1KIKA 1YP5A 1M1KC 1I4K1 2P0PA 3PW0A 3NP5A 2GAGC 3BKTA 1HKAA 1Y11A 3PIOA 4EK2A 2B4UA 3DHXA 4KFBA 4OV6A 4KH0B 4UOHA 2XQCA 1GX5A 2HQEA 2WVDA 4E2FB 3C6TB 2PVGB 3CPWP 1FDAA 1UJ5A 2GQQA 4N47A 2O2OA 5DQGA 4YHHF 4CH1A 1NXIA 4I0WA 2XB2D 1UAWA 4D8KA 5F41A 1NG2A 1P9YA 3DXBA 1JO8A 1SJQA 4IQMA 3QJLA 1VISA 3JSMA 4YN3B 2CQ4A 2H1YA 4QWBA 3TRGA 3RNJA 2LXFA 3OFGA 2RQTA 3NOCA 4HA8A 1TWBA 2AZVA 1RLPC 3M55A 1KQ1A 2WSEE 1UWBA 4WIIA 3X24B 3KFWX 3PTAA 3OTOF 3HT3A 5LM7E 3N01A 1TS9A 4NWBA 4MDXA 1RCOB 4E47A 5AJ3J 1GBQA 2CZ0B 5IT9E 2LQ8A 2BXJA 1VQ4A 3R27A 2KI7A 1YZ6A 2IA0A 3CCQS 5CQXA 4LVOP 2RF2A 2F5GA 3BREA 5EDWA 1X5PA 2MTLA 4USUA 3PE0A 5GMKe 2GIFA 4IRCA 5J2MA 3OSSC 4M75B 2E9TA 5A0DA 1G3TA 4OMOA 2YNFA 3A8EA 4DCPB 1TUGB 1P27B 1B3QA 1IKWB 3H0HA 5D0RA 1J5OB 2N4CA 1I07A 2GAHC 3CPWA 4KGVB 4F7UB 2DISA 3K5PA 4J9SA 3G86A 4N0AC 1WI8A 3PEHA 1FNMA 5LJ3h 5GANf 4FXWA 5K5MA 3SD4A 1RXOB 3M6WA 1VQ6A 2VJVA 2E41A 2HGMA 2J8SA 1NZ8A 2QQ9A 3OPKA 2HHHJ 2R7OA 1LNQA 1KQ2A 2BQ3A 4DG1B 4PJMA 2HQDA 1Z9QA 2RHQB 2R7UA 1EETA 3E01A 1LK7A 2Z0GA 3L2UA 1RWKB 3J80Y 2JSXA 3HK2A 5GMKh 4C92G 3PIOQ 1D1BA 1U45A 2HWIA 4DA4A 4Y3CA 4OX6A 1RWOB 2MHEA 4KJIA 4MTPA 2HZYA 3HVRA 3QSYB 1JLBA 3SV4A 1R6VA 3RUBL 5D78A 2HZCA 1XQIA 4NCGA 2HFZA 3CC7T 1ZUKA 3B6BA 3CMAQ 2RE1A 3C6UA 3TVZA 5D4NA 4QOTA 2BZ2A 2GFFA 2VFRA 3HJVA 4DQIA 3M8PB 2HQHA 3VRZA 2EFPA 2M2BA 3H6ZA 5DDPC 3KUGA 4M7DC 1HK9A 2E70A 3JAME 1YTYA 1CC8A 1K9MR 2CG8A 3EG2A 5B0AA 2F4FA 3AAWB 4A4JA 2Y4YA 3GP9A 3ET6B 5FJ4A 3H25A 1BQNB 2EPIA 4JZ4A 3NEKA 3OXGA 2BEFA 2VUGA 4OJ1A 4ED3A 2PMWA 3R6NA 2C2OB 1TFWA 2BRKA 1CQNA 1FVSA 3ETMA 2BKOA 1O8BA 5J2MB 5GAN2 2ZNZA 2HSPA 2W0ZA 3F73A 2Y1IA 5GAN7 2M1HA 2CXEA 3LP0B 2EJFA 2B51A 4UY8T 3V81A 5KG6A 1Q79A 3I31A 4DBQA 3A4TA 2CYZB 3MM5B 2DR8A 4K0KF 1IWGA 1NNDA 1TXQA 2MSTA 2HAIA 3EZUA 1CSJA 3ADAC 2O88A 4C7QA 2VKZG 3OVSA 3EG9A 1CULB 3RW6A 3T19A 3CD7A 4PXBA 5I21A 2F1LA 4HH1A 1G7CB 6AT1B 3HLUA 1PJ6A 1IKYA 4UT4A 4OYOA 2FJAB 4LFBJ 2QA4G 1JEGA 1U1TA 4PJJA 3BE3A 2FC9A 1KVKA 3THKA 2V2ZA 2HNYB 3GBQA 1XNQF 1RTZA 1X4FA 2GW8A 3NGPA 1CJTA 3CMEQ 3AXMA 2B43A 4TY9A 1U09A 2IRUA 2L3PA 3OYYA 3EG0A 2D7SA 4F3QA 3M56A 2IYIA 5KFBA 1REVB 3A8GB 2HIYA 2LFVA 3MMAA 4C97A 3CC7Q 2XMFA 4O44B 1N8RT 1S72A 4QR0A 4C92B 3FKBA 1YHQQ 4ALZA 1WHWA 2AHJB 4C8MA 4NCGB 4DBRA 2YH1A 1WLPB 3M32B 3C6UB 3GSIA 4DPWA 3EFOB 5CKDA 4XTZA 2LT4A 4CNYA 4C4WA 3KLEA 2GS8A 4K4YA 1JLGB 5LMNJ 1CQMA 3RB0A 3ISND 2KKHA 3EXYA 1WHLA 1VQ7T 3C6TA 2OO4A 2D1XA 1ZTTA 3HSGA 2OTLS 1N48A 2RRNA 3TUJC 4LBHA 1S59A 2CQCA 4CLYA 5GMKm 2QDLA 3GP8A 1FRJA 3IN5A 1HBMA 2AYBA 1C4AA 1WNEA 3PACA 2FLPA 1F9HA 4RR5A 2EG2A 1X27A 1H0HB 1RLCL 2CP0A 1K0VA 3NMZC 5DDOC 2DHSA 4YY3J 1PD1A 1NLOC 3R7SB 3I0SA 1IBLJ 2MQLA 2VQFF 3B78A 3RBDA 2KYXA 2DXDA 4JI6F 4MYTA 1BXNA 4M75G 4TVAB 2AJ4A 5HL7Q 2Y9HA 2ZDOA 2QA2A 4QIWD 2PZ1A 4P10A 5CKEA 5AXMA 3VAKA 3DXSX 2K2VA 4LFCJ 4V2SA 1VQ9S 2Y4XA 3G4SA 5L8RE 3G8QA 2OELA 4DOVA 2YDLA 4FYDA 5KG0A 4ZA1A 2KZZA 2HNYA 1SC1B 3QAEA 4NLUA 5M2PA 1K1QA 1UTIA 2W9CA 3EGDA 3D28A 3TU4K 3T1HF 1LWCB 4PZVA 3UCUP 1J5OA 1B0VA 3OYAA 2N7CA 3K8WA 2ZH7A 4DR4J 1Y5LB 1TVRB 2QA1A 4OZ2A 3QZ9B 3EVMA 2D3OR 1FFWB 1R8AA 5L39A 3QYGB 1UGSB 3H41A 2W7OA 4C9DA 1VRQC 3VRYA 2VF3A 5ETNA 1NEBA 1Q4RA 1SQFA 1RADB 2QLBB 3DOKA 4FYVB 4Q7AA 2LTOA 1KC8U 4QYRA 3OXFA 1ZHIA 3A3NB 1SCJB 3O44A 4M75C 1VQ6T 1V3ZA 2ZEJA 4C92D 1JXOA 1T95A 1CKAA 3R5GA 2DHAA 1DY3A 1S72T 4ANJA 1IVZA 3I87A 3H5YA 4OMNA 2DAQA 4YFUA 4WIQA 2MLXA 4JI7F 3M0UA 4J9QA 1XR5A 1FE4A 3SHWA 2FLOA 1H74A 4OYBA 1HD3A 1LXNA 3M05A 2X4JA 1WHYA 3VU3C 3W2VA 1CBKA 3MFHA 2ROGA 5C2GA 2H4YB 2DRBA 1R0AB 2ZVSA 4ZKAA 3FSYA 3PIPQ 3LP1B 1Y4ZB 2CDRB 1IBKJ 5HP1A 2L3QA 1I94F 2J0XA 3TAQA 4IKAA 1K8AT 1RAOA 3MFIA 1FKPA 3D9BA 4USVA 2FJBB 2PGCA 1LFPA 4J9CA 4B3RF 1RHKB 3TI0A 3NCPA 1PWTA 3CCEA 1QVGP 1M5Q1 4W92B 4CT8A 2JEFA 4N41A 1NJIU 5H9FK 2A28A 2W24A 1LXJA 2DIQA 1IR0A 2GGPB 3GYXB 2HNDB 2FJVA 2ZITA 3M5AA 2G2ZA 1RWXB 1UKUA 2K7KA 2WW4A 3J7YI 2G3RA 1HYSB 2FVRA 2B3TB 4USIA 1RB0A 4RUGA 2R7QA 1M4ZA 4J6WA 2IPOB 4NZ0A 3TUZC 3OYJA 3JCMc 1S1UA 5J2NB 1RSCA 3MURP 2EBGA 4Y2MA 2OPSB 2E4HA 3Q2TC 4JS5A 3T9ZA 2HNZB 1A7GE 3M6VA 4DX8H 4QPXA 2EIFA 2UXBF 2HQXA 4PJOC 3OW2S 2JZ5A 3BKUA 2JW4A 1REGX 2DGVA 1UGRB 3S3OA 1RKJA 4X84A 3NTIA 5KFUA 2YX4A 3Q2SC 2P0KA 2RDDA 4P73A 3H4BA 4P9SA 2XEXA 4ZPVR 2E1CA 3S6EA 1OZ3A 5HROB 4OHWA 1IM6A 2MWOA 1YK9A 3HHEA 3MP1A 1TG0A 2NXUA 1U24A 3JTNA 3MEGA 2FC8A 2BDPA 2CQ2A 3EZOA 1OY6A 4J9EA 4ED7A 1S9GB 5MAOA 4RW7A 5A0LA 3KLEB 3OT9A 4DFKA 2AJ0A 2MB0B 3UF4A 2WW8A 1JJCB 2JRSA 4Q0BB 1UETA 1H38A 2CZ9A 3AB4B 4KE5A 4NZ7A 3UVJB 3SSSA 3BO2A 2OEJA 2KT8A 4M78E 2IDLA 4ED0A 3NGRA 4KTQA 5KFXA 3AOCA 2NUTB 2NUPB 3MO8A 1RP5A 3CC7S 4WYWA 2J9DE 3OFHA 4DCOB 1FD2A 2E9ZA 2YXLA 3GMGA 3WIVA 1NJWA 4UC4A 3DLEA 1WUUA 3H5SA 1B0TA 2LRQA 3JCMe 2ESWA 4F25A 2JEIA 4X4SA 5AE1A 5SUHA 3W9IA 3GPLA 4DR2F 2Y1JA 3CF5Q 3QGPA 4UW2A 2C0OA 1TL5A 3I55A 4QVDA 4J91A 4IG0A 4PLLA 2QC3A 1TKXB 1TKTA 4WFZA 4ZLLA 4J9MA 4DJBA 4IUPA 2MF2A 4R8UA 1B34B 3DC2A 5IV3A 3CEYA 4DF8A 1T94A 2YNGB 5HVGA 1QQJA 2ZZDA 5A8RB 2XDBA 2OJ2A 1JLCB 4DQRA 2HHXA 5DLQE 3DM2B 2WOMA 4F02A 2FG0A 4BC9A 1QUVA 3QHSA 2EKHA 3QBCA 4TLRA 4NLQA 1QDUB 2WK4A 2W9CB 3G4SQ 1ZZFA 1G3OA 5THWA 2UXDF 3JRZA 1P1TA 2HDAA 3BFMA 2KVQE 4A48A 3DU6A 3EGXA 1MN9A 3HDSA 3ER0A 2HMAA 4F0KA 4RLEA 1YG0A 3C4SA 3NAIA 3FQLA 4IQXA 3G4ST 4KIAA 4C11A 5GAEU 3BEGB 2MZ1A 2ZBIA 4D6WA 1F2GA 2AJFE 2DNZA 2KGTA 1ZYQA 1C1CA 4H54A 2CPJA 2YWGA 1KQSP 4DPYA 3PKMA 5I3PA 2DTHA 1TL7B 1JX4A 1X60A 1JMTA 1TV6B 2RJFA 5C0MA 4N76A 4QBUA 4RG2A 3WVEB 4QWAA 2AWZA 1N33F 2MXYA 1FVQA 2KSSA 3TJ9A 4ZIVA 1SIWB 2XI2A 4CZCA 1VJQA 4IFVA 3RUXA 2O4XA 1PYOB 3IM9A 1VLYA 2DVEA 2YPYA 2KYMA 2VIHA 2V4JB 1O0PA 1S1WB 4F16A 2LX7A 2ADCA 2KQWA 2G0JA 5HMZA 2OEKA 3X28B 1HBOB 3IR5B 3D1HA 2LXIA 3UR3C 3DLEB 4C48A 1UECA 2CQIA 2ZPIB 1ZLMA 1VRUA 3MCSA 3G8TA 4CLPA 2QA4S 2YH0A 5KG2A 3MOZA 4DR5F 3HSDA 5KYXB 4OJ3A 3CVKA 1R0AA 4DV6J 2JFDA 1TKXA 2ROPA 5M2UA 5HLFB 3J81Y 2OTLT 1KLMA 1QSLA 1KQSS 3UN2A 4BHQA 5IZHA 4AFFA 2HQ3A 4KGXB 4AMCA 2D3O1 2YNGA 4ZP9A 4V1Ak 3QT5A 2L08A 2M88A 1WF1A 3CMEA 1Y5IB 5ETQA 2PFDA 1G5VA 3FJ2A 4CI0B 4HCBA 1VQMS 3TEEA 4BE0A 4IDKB 2QV6A 2CFXA 4ELVA 2YLBA 2M3DA 2M0GB 3CCMT 1K8AC 2GGPA 3BDPA 1WC4A 5F8MA 2X3GA 4RL1A 4XAXB 5A6WA 4KYZA 1FF2A 2QYCA 1X2KA 1PO6A 5IXBA 3DLGA 4JBCA 3PVQA 4K4VA 4NX9A 3EZ5A 1RT2A 3Q8RB 4ZVTB 4M78F 2W2MP 2V8VA 2MKKA 1JQQA 1M1KU 1Q86R 4DPTA 4JRKA 4ZGJB 1G2BA 3THTA 5C25B 4CC4B 1WWHA 2KT3A 1J5EJ 2HFUA 2QEXA 3QXEB 4H4MB 1NK9A 3ENAA 2DNNA 1ZSZA 1TL7A 3IGNA 3LUYA 4P5NA 1JRIA 3NTHA 3OL7A 3M0RA 2LZ6B 1VBXA 1HHSA 1OEBA 3AD8C 2J7UA 1D0ZA 4DPOA 2MMYA 2JLFA 2R7XA 1G3WA 1FK9B 4LF9J 2QI2A 5G0RB 3HVWA 3VVUA 4R5PA 1CG2A 3MZIA 3I9QA 2L3RA 2I5JB 3V4IB 3HF5A 4K5SA 3AA9A 2OAWA 2VC8A 1G8XA 2BOAA 1QAIA 2K7JA 5FU6C 3LP2B 3B4DA 4LUDA 2GMLA 3VAGA 3TA2A 3CCMS 4OYIA 4RW7B 1TU0B 2F2WA 3VHQA 1T9YA 3WC0A 3DNCA 1QWFA 1FEHA 4P52A 2CPZA 1WDTA 3KK1A 1GH8A 4B9MA 2AYEA 1C6VX 3N28A 2L3SA 1Y9OA 1K9MC 1QD1A 1FDNA 2MKCA 1L5UA 3K17A 4KBMB 4HVWA 1X4EA 2DRDA 4JRPA 3LA0A 4Q8EA 2PUOB 2AT1B 4QW8A 1R7IA 3D54A 3SCIE 4ZPTR 1YJNQ 2O3DA 3W5YA 1XTDA 1WPYA 4F14A 1LWEB 1NBEB 3OJSA 4JYAJ 4DU8A 4ORZA 2MKHA 4I69A 1SQEA 2KRRA 3VS6A 2R2UA 3V8KA 4UUXA 4JJBA 5GAN3 3SFMA 4YB1P 3FDRA 4I67A 1HPZA 5JUMA 2BJ7A 2I1RA 3MGJA 3K2YA 1RBOB 2WOMB 1V9OA 4DBFA 3TSZA 3NXZA 2UVUA 2JNGA 2XHCA 3VS1A 2OSQA 2LC4A 2MZRA 3KXTA 5EWFA 3VYGA 3T1YF 3UQSA 2W7AA 1MMGA 4LF8F 3TWZA 4DEZA 1GCQA 4KO0B 4KHRA 4J9VA 2EC0A 5IM0B 4DX6A 2VBYA 3R5DA 4NS5A 3BY7A 2BM0A 4ES1A 5G4DA 3K89A 3A1PA 2HHSA 4RW4B 3V7RA 3BQ2A 2AYMA 2LQNA 2ZFHA 1PYSB 1XMQF 3CCVT 2FRYA 2K5FA 1VBYA 1AT1B 5EN1A 4FN5A 3QO9B 4WP9A 3CMET 2WSFC 3VJPA 1H8KA 4HHHA 2F4VJ 3G71S 1TAUA 4GLKA 2MKSA 1VHIA 3A8JA 4ES3A 1MMLA 4CCHA 2RK1A 4LD6A 5C24B 1LW2A 2IC3B 1G3SA 5IFMA 2V8DA 3W5XA 4GKJF 4IG3B 4ATNA 2FB0A 3HVTA 5KFRA 3KLHA 4E7ZA 2QJ3A 3L4BC 4FF3A 3GIKA 1HNXJ 1X0PA 2E5HA 1SKUB 3L7UA 1PIEA 4EMGA 2H4WB 2XZDB 1NDCA 1R0BG 1LKZA 1AZSA 2CUYA 5DG7A 2HYIB 3I5CA 4J9GA 4ZS6A 4AT1B 5FDLB 1SPKA 4DV7J 4C92C 2OIHA 1X9WA 2O67A 3MPWA 1EIFA 2WHOA 1L3KA 3Q0AA 2MAMA 2Y1RI 2K9GA 1MV3A 5FWCA 4DQQA 3MD1A 1LOJA 5KFVA 5KYYA 5D4PA 4LFAF 2RHZA 2APOA 5FWBA 2XD0A 5LJ3Y 4MIWA 1CJKA 5B09A 4NYPA 3R9LA 1U1PA 5J1NA 4A46A 3NLCA 2I2YA 4CO3A 3RYLA 4FCYA 3L2ZA 4P6QA 3HRSA 1JJ4A 5A0YB 3HZGA 2RHIA 1N5TA 4A8XA 5IM0A 4AQYF 4L6V5 3PW4A 2ECZA 2FZKB 1UVNA 2HEKA 3SCKE 1UW4A 3ZXWA 4DR1J 3KG0A 3D67A 1GFWB 2BE9B 1Y3KA 4DV3F 2R57A 4OMFG 3U02A 2KYZA 4ZVUB 2X3WD 3FRZA 3IWLA 4KULA 5C25A 4JI0F 5DQHA 3C12A 3CPWR 4IUTA 4M8LA 1QVGS 1MN7A 4ZN1A 3UDCA 1VQLS 1VQPQ 3CEDA 2OKQA 5GMKa 3PHEA 2PEBA 3CD0A 3X20B 4ELYC 3CJ2A 2KFYA 1UVKA 4F7UG 3EDQB 4EBCA 3VAJA 3PNIA 2XS7A 2D9OA 1OIAA 4DV5F 4PNOA 3PRBA 4ZJQA 3L9ZA 1QP2A 2B8AA 3HFZB 2ZM6J 5KOWA 2IJFA 3BR9A 2JVRA 2W9AA 1UJ6A 3DRPB 4JLIA 3CCRS 4JV5J 4DFPA 2FRWA 1NHKL 2B4VA 3KDOA 3JCMX 1UA1A 4EFAC 4DR5J 4TU8A 3GTYX 3KKFA 2B56A 3EVOA 1R31A 2XG8A 3FEOA 3QGHA 1N5SA 3H7HB 2PSZA 4HTJA 2E5QA 1YJWT 2B5JB 1VQMA 1RABB 2FTRA 1VQ4T 3FFIA 5I2MA 1ZBJA 3M8YA 2JC1A 4ECWA 3QJPA 3L42A 3EM1A 3CUNA 4M77D 1S10A 2JOQA 1H2VZ 2GNKA 1CJKB 2AX1A 3WXMB 3MUMP 4C0FA 3G82A 2HQIA 2DHGA 4RCBA 2B9WA 2IG0A 2J9EA 3T3FA 2MKIA 1OMSA 1YITQ 4GKJJ 4FIBA 4RNHA 1E6HA 4J5OA 3C15A 4NYZA 2MZQA 1T9WA 4WKYA 2QA4A 2KDSA 2NCKL 2E64A 3P4UB 3TQEA 1XNRF 3CCVA 4G1IA 3BN4A 3N79A 3TJ8A 4FM4B 5HBMA 1JLFB 3ZZTA 4C5GA 3JCMP 2YQ3A 1VR6A 3I6PA 4XTTA 5KFSA 5DO2A 2CSIA 4M5DB 2FIUA 2C3PA 1FA0A 5D6XA 4CLWA 1S6UA 3ZFVA 4UQGA 1MGQA 1YIJT 1QAYA 4CLKA 3V4MA 2PQWA 3MEVA 1YBUA 1PM3A 5D6WA 3M9QA 2JN0A 4RU2A 1AA1B 1QCOA 3K8VA 5JVGQ 3PR5B 1AZGB 1WQWA 4M5LA 4FT4A 1YJNT 4O3QA 4ZPWR 3WZ0A 3TQ7P 4WF9Q 4KO0A 1QCNA 3LAMA 1VC6A 4X34A 3ZTOA 5KFIA 2ZKTA 2LP4A 3C19A 5GAHU 2LT1A 3TYTA 3CJTA 4LF9F 1F1BB 4JI1F 1B0PA 4Y00A 2G2YA 4QWCA 3M59A 1FX2A 3HRTA 1LQ9A 2FJXA 2LEBA 4O4GB 5C6SA 3KMSA 3SYZA 1WHGA 2R8HA 4XTWA 3HHTB 5FROA 2GV1A 3META 3CWJA 1LPLA 2YNHB 4C8OA 2I2LA 2RI3A 3S1TA 3JB9H 1YJRA 2AIRB 1M5HA 1YFNA 2A6MA 1S1VA 5I11A 2AHOB 1SB6A 1GTEA 2YKMB 1NJIC 3UPFA 5C7PA 1VQ9A 2XO7A 3JYTB 3OYLA 1Q81R 3L7OA 4KGKA 3RB6A 1JXEA 1VQLQ 1PSEA 3C94A 1I5LA 3AJ1A 1FFSB 4LREA 2V8JA 4NLDA 3H4DA 1U47A 3C46A 3CCLQ 4B3SF 4LVNP 1VJWA 3O2IA 5KFMA 2HS0A 4CO0A 5T14A 1M90R 4ZLPA 3PW5A 3OR1A 1K9AA 1RTDA 3P8DA 2XMWA 1YDLA 3DU5A 3D1OA 2VG5B 1OX8A 2KO1A 4J83A 4MMOA 1VQNA 4QQBA 3HO1A 3KJQB 1VK3A 4LDYA 1PC4A 2RQ4A 1A9NB 2QQSA 3M8SA 2DT9A 2K1RA 2VQEJ 4LIRA 2ZPGB 4PFOA 1F3VA 1VUBA 4M7AF 2RJCA 2WAQD 2NZCA 2EI5A 2A2DA 3OYIA 3G6YA 4YR0A 1RT6B 4CI0C 2JVOA 1NJIR 4K4XA 4R56A 3TA1A 1Q7YT 2Y8WA 4ZVGA 5DRKA 3T9NA 4I2QA 1QJHA 2RDIA 1UG1A 2A18A 3SWNA 2D0NA 3FBBA 1FI4A 4NYOA 1YX2A 4RWXA 2JFKA 3VALA 2NLUA 1RAFB 3TZZA 1E6YA 2EFVA 1XNRJ 1GNKA 2GA7A 2IIHA 3OYNA 1OS5A 4DV7F 1SL0A 1M8MA 2E44A 1GFCA 4DOZA 4CC2A 2QEXS 3W60A 2YNHA 1D3WA 5KFQA 4F3OA 2CPIA 1M1HA 4HR2A 1QMCA 4CH0S 3ZTPA 2PNIA 4DSIA 4PKCC 1MMAA 1HQEA 4JI6J 3M2VA 1Q86C 4USHA 3MR5A 4JI4J 3PVLA 4NLSA 3OQ5A 2V2VA 1OOTA 4RW8A 2X51A 2ATLA 1D3BA 2QSFA 3IWNC 2ROTA 3E1SA 4ILRA 1T05B 2KYBA 3LGNA 4IUVA 2V8PA 3MEEB 4FKXA 2MZSA 4OI4A 1ZOTA 9ATCB 2GZOA 4ZCLA 3DRPA 3HKSA 1EX4A 1X4CA 1HI0P 1S6PA 3RZAA 1HNZJ 4F4XA 2KL8A 3PHTA 1UVIA 5K8PA 2DPIA 1TKZA 4QU7A 2L8DA 1FNOA 3BGLA 1CC7A 2CNNB 2WVEA 4B02A 5GAOm 3PDNA 3CCES 5CXTA 2HS3A 5HCKA 2VODA 5E3RA 1WHKA 4EMHA 4HCCA 1IQZA 1DJ7B 4EEYA 1KHCA 3U1MA 3G82B 3OR2A 4K2XA 5J2PB 4PYAA 3MECA 1DTTA 1WORA 4I2QB 1X4AA 2EQUA 4KV8A 5GMKi 5A2QE 1UDLA 2W2QP 4OL8A 1AFJA 2WACA 5GAMg 2DMOA 1FWPA 3HCXA 3FBFA 1IZ6A 3VS3A 3TQ1A 4DUZJ 1RAIB 3TCJA 1Q7LB 3I56Q 1APSA 1Z4UA 4KBIA 2RRBA 2XGPA 1M3AA 3CC4T 5T7LB 4M5MA 4AD6A 1Q8IA 3RW7A 2RA2A 2LECA 4PCQA 4IURA 4CTAA 2KROA 4F3MA 2ASYA 3TX0A 4CLZA 4RUHA 2W4DA 2COWA 2ASLA 1ICEB 4QVZA 1FERA 5IQQA 3M7VA 5C42B 2HEQA 2HHWA 4C0DC 1D3BB 1NYFA 2LKZA 4DFJA 2ALYB 2IAJA 3HT0A 3PY8A 4YDDB 1S9EA 3MM9B 1OYDA 4M77E 4WYLA 5CD4A 4DWIA 1OSDA 3UNGC 3T5LA 2CNOB 2BM1A 5GAMh 2CQ0A 4EWTA 2DNGA 2J0WA 2FLLA 1A0NB 1FX4A 4U95A 7FD1A 1KQKA 2COLA 3MMJA 5HI7A 2GVDB 4DR3F 5IS2A 1WI7A 2VFUA 2KG1A 1S1VB 4ESRA 2AKWB 2C2DA 3MEKA 1DTQB 3SB2A 3GV7B 1E6VA 4I7FA 3R2DJ 2D9TA 1CPZA 5KFAA 5HAOA 1G3YA 4QIFA 3TVYA 3SBMA 2Z56B 5F8HA 5T41A 2VKNA 1VGYA 2BUNA 1NM2A 3OR2B 5J2PA 1YRTA 1JXLA 3HM9A 4NXNJ 1IKWA 4DF4A 1S4FA 3GJRB 2KRMA 1WJRA 1KC8R 2BR0A 4Z88A 3ILLA 2ZOFA 5B0DA 2EC2A 4F2RA 4YUDA 2DF6A 5EG2A 1DJ0A 1Z1ZA 3DRRB 2ZJQQ 5JXSA 5KFTA 4JZ3A 2CPEA 3JCMf 2ZCFB 4PQUB 4ME7A 3REAB 1H98A 1IR1A 3QKJA 1Q81U 4ZVFA 1NJIT 3KJVA 3HP9A 2VWFA 4UOGA 4EMKB 5CHCB 4PG8A 3GWCA 1QVGA 3I55S 2ATCB 3TVKA 2HBPA 1Q8KA 2CH4W 3CCRA 2FD2A 1I3OB 2ZBCA 1EP4A 2ZHAA 3EGNA 3Q8YA 1K8AU 4RUBA 3LH0A 5KFHA 4DCJB 4DR7F 1PILA 4X62F 1Q5YA 4USJC 2BZXA 4ED6A 3F70A 2RB7A 1LWFB 1WJQA 5KFKA 4M7DD 1JQGA 3NKYA 1FXRA 3AJDA 1SH0A 2A36A 2XULA 1EX8A 1VQOA 5IT9Y 4FP9A 4KR0B 4A8SA 5AE3A 2JS0A 2GVZA 3CJ3A 4M78C 4ICLA 5KFDA 2D74B 1QLYA 4PXEA 4B3RJ 5CCLA 1RAGB 3IS9B 2CZ7B 1RTHB 2SXLA 3JAMY 5U47A 1GFDA 3PJ9A 3VKIA 4L3NA 2K5LA 4S0MA 2FY1A 1BWVA 2GHVC 3RMQA 2O01C 5DGBA 2V1QA 4C8QA 3NNHA 3CTRA 2KAFA 2DTJA 1T05A 4F4KA 4JI7J 5CABA 2A3JA 2DL3A 1S6QB 1UZHA 3VV2B 4JJNK 2XTJP 4Q2LA 1F6TA 3LP0A 2ERRA 1K1ZA 2CJAA 1PG5B 1CS4A 3IRXB 1BK2A 3MCAB 4M7AA 5GAOl 2LLZA 4LSNB 4BACA 3I55T 3JSRA 4UUWA 1WHHA 3I4HX 1EFNA 3CXCP 3GZ7A 2C06A 1JIHA 2V5HG 4QQDA 1FXLA 3OW2P 1IJFB 2ZKUA 2AK5A 3DRSA 5E3AA 4RNOA 1J27A 3CDBA 4D8DA 4DV2F 5KE3A 1KOHA 3CO0P 2LQJA 3G71A 1B70B 2DPPB 1FTRA 1HBNA 5CYMA 3OTBA 3E01B 2YT6A 3ZL7C 5LXYA 4DL4A 1X0FA 1U1OA 5L38A 1IN0A 5GAGI 3UA6A 3SFGA 1O6XA 1WFWA 4FSSA 1WSVA 3R7NB 5KFPA 4LT6A 2JMAA 2DD5A 1ZTWA 1C0TB 2COZA 4TY8B 5D0GA 2B86A 4B3OA 2VXFA 4C6AA 1WZOA 3M30A 5GAOr 2XHWA 3HL8A 4A54A 3CT9A 2WRMA 3ZTRA 3EFRA 3MD3A 2E3HA 3MEUA 2OTLQ 4KKOB 2OPPA 3G96A 1SV5A 3MM8A 3CBMA 3PXGa 4I6AA 2XLJA 1FJGF 2CVEA 5DM6Q 2ED1A 1ZAXA 2P4RA 4M95A 3OTEA 2V34A 2UUCJ 5RUBA 3VS7A 2CP3A 4ECUA 1LNXA 3OYBA 3NOGA 3GLJA 3N5BA 1VQ8A 3P3DA 2OTJA 4LF6F 2DNYA 8AT1B 2EVZA 3DYAA 4NPOA 3RRKA 1KFSA 4C8QB 3A8MB 1Q53A 3JS9A 5JMNA 1M5KC 1G83A 3I56T 4K5RA 1RU2A 3BGRB 3VGSA 2V26A 2VBZA 4HI2A 3EGZA 4EMDA 3I82A 4I2PB 2NUUG 2DGXA 4OYPA 4J9UE 1VQOS 4DBHA 4NLTA 3K7RA 2UZAA 1D1AA 4Y2KA 1R0CB 4Y28E 1JNRB 3Q8UA 2RB6A 2VH7A 3POTB 1EZZB 3P8BB 4L6V3 3OXLA 3BO3A 1SC3B 2WSCE 2QSWA 3QLHB 4RO0A 2DNKA 1AUDA 1YN8A 2E1HA 2ZC4A 3I9V9 1E7OA 1MSWD 1CJUA 2DNRA 3M0TA 3WX8A 1RWMB 2OLWA 3IAM9 1H7XA 2QLJB 3KK2B 1FHTA 4CYUB 1QVFA 1ITPA 4PJOG 2CQDA 2PVOB 2OX7A 3BGFA 4L74A 4TNOA 3HHNB 3OS2A 5KE2A 2RQWA 5I2SA 2QL5B 4DPXA 2BOPA 4DL6A 4RPFA 2DHHA 2HS4A 1QY7A 1O51A 1JKHB 3OYEA 1MLAA 4EO8A 2CP6A 3WQPA 3M30B 3RKXA 2DNLA 4ZVPB 2ZHBA 3BBBA 3EFOA 5A8KB 3DFEA 2K3BA 1ZAVA 3BSCA 5D6GA 3DRRA 4ZGEB 3MMCA 4OZLA 2RHSB 3RR7A 4OZ1A 2YX1A 1TL1B 3BDLA 4O3RA 3KK3B 3LALA 4DSLA 5D6YA 5I3UB 3KJVB 3CCQA 2MKYA 3MP6A 4QT7A 3OUYB 3D0GE 3JAMU 4F17A 1HBMB 4ZVRB 5IT4A 3OBWA 1TMMA 1ABQA 3T5HA 1C0UA 1S79A 4M5HA 1TQLA 2KU7A 1WTBA 5KTQA 4LF5F 1HWIA 1NEEA 5CYJA 4B6MA 3HFKA 4B3TF 3KG1A 2HRUA 1SEMA 2HLUA 3O5TB 2GC8A 2HL5C 4LE9A 1KOOA 3LH5A 1LWFA 2F65A 4AL6A 2HZAA 2MQMA 4WE1B 3MTJA 4DS5A 3MHXA 3FSIA 1VBKA 3IMQJ 5AXKA 5HANA 2WTFA 2PT0A 3GIJA 2C2RA 4YDXA 3G71T 4DQ2A 3T1AA 5DETA 3CULA 4ICLB 2WVBA 3MJXA 4O0IA 2B8QA 4G6VB 1C1BA 1ROFA 1K0TA 3NPFA 1RTHA 2JH3A 1I0CA 7AT1B 2YRVA 3GB0A 4X4OA 2RMOA 4JI5J 3ILOA 3WX4A 4Q5VA 4MT1A 3T1HJ 4M78A 2R7VA 5A0GA 3PCOB 1AWJA 4AG2C 4P2MA 2FVPA 1T03B 3VZHA 3IG1A 4DL0C 5ITHA 4F0MA 4ID5A 3PX6A 1Q1KA 2OPQB 4DR7J 3ICLA 1FX7A 5JVHQ 3A98A 1CS4B 3CCJA 1FCAA 4ANDA 2RU9A 3NGSA 4B9UA 1RDRA 2QFIA 4IKFA 3DOKB 1FRIA 4WFNQ 2H48B 4P7VA 3MMBB 4OYXA 2GFAA 4M7DE 1AW0A 3DRSB 3ZZ0A 4XPEA 4OI3A 1MNEA 1NK0A 1VQOQ 5GAMf 4OHZA 2HIQA 1KKHA 1TTHB 2YKAA 1OULA 2KFZA 2J76E 3TAMB 3TA0A 2KR3A 4Y91A 1I6JA 4DG1A 4ZVOB 2DGUA 3TSWA 4LR7A 1S48A 1OZ2A 1JLEA 2RPNA 2HGLA 2QTXA 4OYWA 2XI3A 3BSOA 1C0UB 2DILA 1VS3A 1C0TA 3EUNA 4HT8A 4XAKA 3W2VB 5DGAA 1F9EB 1B07A 3IM8A 1TUVA 1BHNA 2JDJA 2XDPA 1QUPA 1Q78A 2GX8A 5CIUA 5GAN4 3LF0A 4RNNA 3TZXA 4DQSA 1JLBB 2KY9A 3NS5A 3MHYA 3CBPA 3LLRA 3D3CJ 5IAYA 1HQUB 4Z37A 3GIBA 1PHTA 3RDVA 2XGQA 3OYFA 2UXCJ 4QVCA 3G2XA 5J39A 3BYRA 1SVDA 2LX9A 2VQFJ 3D6FB 3P8HA 2DCUB 4JI0J 1KFDA 2LCWA 3UCZP 3UDLA 4OX8A 1NK5A 1F5AA 3VUBA 1FWLA 1N52B 1UVJA 1NM7A 1S1TB 5EX0A 1W2BR 4Z02A 3PFEA 2NUPA 1HL6A 3CDAA 3NCRA 1T7PA 2B4OA 1RU1A 1TFYA 2CH4A 4M5JA 2DIUA 2OPQA 3V6DA 3HTRA 3GCWP 1AXQA 1KSPA 1N88A 1HYSA 2DIGA 4ZVHA 4R0EA 1IHVA 5GAGU 2E65A 2B0GA 2CJ9A 4OB3B 5LJ5e 1WXTA 2DJZA 2RJEA 3EPGA 4WFYA 5D0HA 4MIBA 1HFEL 5GAEI 1YJWS 2J7IA 1NDKA 1ZZNA 1VQ4S 2FQQB 4DV1F 1UEVA 2PEHA 1CULA 5CA5A 1H641 4NZ6A 4XO0A 4HVZA 2IM3A 3CC2A 2RT3A 2DITA 4G1QB 2GQVA 1VQ7A 4MK7A 2F8HA 4EO6A 2ABYA 1U2RA 4C5IA 1W2BP 3HFVA 2Z58B 3KNGA 2A37A 4ZTJA 4X9DA 1YJUA 2MJUA 3HHLA 3OHBA 3KHLA 1XWLA 2RS8A 2YQ0A 2M0OA 4B9TA 3DDNA 3HX9A 1YIJQ 4QYZJ 2N4DA 3N4WA 4AFUC 3TAPA 1HNVA 1NB2A 1QWEA 9RUBA 4YOEA 1SUQB 3MMAB 1GMUA 4X66F 5GAOq 5CQYA 1T0JA 1NE8A 2XYHB 3EFSA 1YJWA 3UE2A 2HHVA 3CE8A 1URNA 4OGEA 1NH7A 4TLQA 2RNEA 3JSYA 3BPDA 2KM8B 4USKA 4PG6A 3JCMd 3R5JB