2VV5A

The open structure of mscs
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
256
structure length
256
Chain Sequence
LSYAVNIVAALAIIIVGLIIARMISNAVNRLMISRKIDATVADFLSALVRYGIIAFTLIAALGRVGVQTASVIAVLGAAGLVVGLALQGSLSNLAAGVLLVMFRPFRAGEYVDLGGVAGTVLSVQIFSTTMRTADGKIIVIPNGKIIAGNIINFSREPVRRNEFIIGVAYDSDIDQVKQILTNIIQSEDRILKDREMTVRLNELGASSINFVVRVWSNSGDLQNVYWDVLERIKREFDAAGISFPYPQMDVNFKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SMALL-CONDUCTANCE MECHANOSENSITIVE CHANNEL
publication title The Structure of an Open Form of an E. Coli Mechanosensitive Channel at 3.45 A Resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 83
structure length 256
sequence length 256
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2008-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00924 MS_channel Mechanosensitive ion channel
A PF05552 TM_helix Conserved TM helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.60 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2vv5A02
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vv5A03
1GXUA 5K9FA 2HFNA 4DN9A 4Y2KA 1OQ6A 5B09A 2OP5A 2LQ9A 2BJDA 1VIEA 1FESA 1Q4RA 2OD4A 3FMBA 4OIXA 4U9RA 1KQKA 4A47A 3MCSA 5B0AA 2GV1A 2XMVA 1JK9B 3VTIA 3HX9A 1KVJA 2N4CA 2BUNA 3BM7A 3CJKA 2HIQA 1N5TA 2FB0A 2QYCA 3K7RA 2K2PA 2KKHA 2KYZA 3IWLA 3I9ZA 2OFGX 1FEEA 5B0CA 2XMWA 1WD6A 2G9OA 2AJ0A 3HHLB 1QUPA 1RJJA 2ROGA 1FVQA 1N5QA 1Q8LA 1Y9OA 4OJHA 2GGPB 1URRA 2HLTA 3T9NA 2AJ1A 2LXFA 2BBEA 1Y3KA 2FHMA 2GO8A 2RSQA 2N7YA 3QGPA 1TZ0A 1FE0A 3LGMA 4NL5A 1N5SA 1CC7A 3DXSX 5B0GA 5T7LB 1K0VA 3KKFA 2XMUA 2OFHX 2FIUA 4YEAA 1FE4A 1W2IA 3BN7A 4FNIA 2P4TA 2RU9A 1MWYA 1OQ3A 1P6TA 1Q8BA 3DCAA 2K7JA 2OD6A 2OMOA 1FVSA 2W4DA 3BF4A 1TL5A 2XMMA 3MZIA 1APSA 1VQSA 2N4DA 3E8OA 4HL9A 4OJ3A 3HF5A 1LQ9A 1SI9A 2CRLA 4OJ1A 2FTRA 1KVIA 5B0EA 3CJKB 3QMQA 2GQVA 2PGCA 2QLXA 4HI2A 2HFOA 1SB6A 1FD8A 1VIFA 1XBWA 2EW9A 3FRYA 2IYIA 3WDOA 4DPOA 2LDIA 1YJVA 2AW0A 4A4JA 1GXTA 1YJRA 3GZ7A 3LGNA 4Y2IA 5B0FA 3KG0A 1CC8A 1U7LA 3KG1A 1ULRA 2ASYA 4Y2MA 5IXUA 2W4PA 2Q3PA 2XMKA 2VH7A 3LO3A 3TOQA 2QIFA 2KT3A 1YG0A 1X8DA 2XMJA 5B0BA 4YDXA 1Q53A 4A46A 4F67A 2GA7A 1X0PA 3BGUA 2HQIA 3IWXA 4A48A 1P8GA 2RMLA 4QOTA 5F0UA 3HHLD 1Y3JA 3F44A 3KNGA 1Y0HA 3UDCA 2K1RA 4OJGA 5A6PA 2RILA 2RK2A 1JWWA 4Q2LA 2AP6A 1TR0A 1TUVA 1OSDA 2ACYA 2GCFA 1S6UA 3HDSA 5F0WA 2KT2A 1AFJA 2RK1A 5B0DA 2XMTA 2JDJA 1YRXA 2LQBA 2RH2A 3BR8A 1N5VA 4HH1A 2PD1A 2QLWA 3TNVA 1AFIA 5A6WA 1AW0A 1R6YA 1IUJA 2W4CA 1YJTA 4FNHA 2IFXA 4HH0A 2ROPA 2ZDOA 3HHLC 4ZOSA 2GFFA 1CPZA 3HFKA 5KAKA 3TRGA 4NPOA 3FGVA 2ROEA 1SQEA 1V3ZA 4HI1A 1TL4A 2BJEA 3BDEA 3HHLA 3SFMA 4Q2MA 4DL0C 2HLUA 2ZDPA 1VQYA 2IYGA 2L3MA 2GGPA 1YJUA 4ZA1A 2VV5A 2OKQA 3BB5A 5B08A 2K1RB 2K7KA 1OPZA 2OAUA 5T7LA 1MWZA 4EFAC 2BYCA 1S6OA 1X7VA
chains in the Genus database with same CATH superfamily
1UE9A 4CI0C 3CCUQ 4F25A 1IWAA 3VJPA 3A8GB 1PRMC 4BE2A 4N8OA 4QQBA 2RA2A 4F4ZA 4LUDA 1RDRA 3K7RA 5ETQA 3KXTA 2E5JA 3BY7A 4CC3A 2A7YA 1RJJA 3IFEA 2A28A 4LVOP 4NMLA 1VA7A 3M4YA 2X9HA 1B07A 2YUOA 3E2EA 5ITHA 1UFLA 4QVZA 3GYNA 1YI2S 4JV1A 3J81j 3D6MB 3TUPA 2HBYB 2AJQA 3CXCP 2UXBJ 3BZQA 4DPOA 4J9FA 4CLFA 4USJC 4IDKB 1VJQA 2HQXA 1RB0A 3UN5A 2ERRA 2AHJB 4OYMA 4DN0A 3EYZA 2V9KA 3QNWB 4OZ1A 3MPVA 1S4EA 3MAAB 4C8QF 3VAIA 2XC9A 2RKIA 3TUIC 1BQMB 4IRDA 3LAKA 1DTTB 3TI0A 1D9FA 1AROP 1F3FA 2PI4A 1M5SA 2J6FA 4CC7A 1N0VC 3HFKA 3HZGA 3VZHA 1S72Q 5C25A 2LJ1A 5J3BA 2U1AA 4OL8A 1WXUA 1OV3A 2IYGA 2O66A 5GAN4 1SIZA 1JBMA 3HULA 1IREB 3LLRA 1HR0J 2LQ9A 2C0OA 2BJDA 2MWPA 2E41A 3CBMA 1JMTA 3Q2TC 4RTUA 4C8ZA 1MW7A 2CP0A 4BI3A 3TVKA 3GBQA 4NASA 4B9VA 5KG0A 3S6WA 1RWVB 4QT7A 2N7YA 4X1VA 2V8DA 2EKHA 4DOWA 4XIUA 2PVOB 2DT9A 2HRYA 1JJ4A 4ZK7M 3MOJB 4JB8B 2CIMA 5KFBA 3IRWP 3H59A 2ZD1A 5KYXA 1NHVA 1Q7LB 1HBMA 2UUBJ 2AKKA 3QYYA 3AJDA 4MKBA 1JLAB 1TL1A 2FDNA 2XMKA 2KNBB 1U8RA 4DU8A 1UFFA 2BZXA 4D3HA 4O3QA 2VQFF 1WQ7A 2RMLA 2ZWOA 5F0UA 3FEXB 1T8EA 2UUWA 3HXMA 4Q8FA 3IO1A 2NUPA 2ZOMA 2ENMA 1ZLMA 5DDRC 4OMPA 2YRVA 1AZGB 5I42A 5KFYA 2M70A 3ZNJ1 2BE2A 2HWHA 4IUVA 3A8IA 5D6XA 3PX0A 1DRZA 2XS7A 2W25A 1AWWA 3HSGA 3AODA 1PYTA 3JB9I 1TUWA 2RQCA 2MY8A 1JKHB 4ZP7A 1IR0A 3M2UB 3LTOA 3OFHA 5FRNA 4LF7F 3I9V9 4MKYA 1M90U 3CUNA 1Y0MA 3CBPA 1HHQA 1T9VA 2DCUB 4M94A 4OYAA 4RTXA 2R8GA 3ELHA 3HX9A 1F9FA 1KOHA 5GAOp 4X65F 3CCVT 2H65B 2BUNA 3DNCA 3HFOA 4PLIA 2JC0A 4ZIVA 5GAEI 3TX0A 2DNYA 3R6NA 2KRSA 3GG1A 3I9QA 3POTB 4ATNA 5B0CA 3M6UA 2LJ3A 5C2CA 4DV1J 3CVKA 4ID5B 2FC9A 4OYBA 3TZYA 1VQPS 1UHCA 2DPPB 4C8QA 1UUEA 4DF4A 2BIVA 2F69A 4HKQA 4AFZC 1RT2A 1RWOB 2D7SA 4IUQA 1WA7A 3DLEA 2V4RA 3EZ5A 2HFOA 3FRYA 4W4MA 2OEKA 2LU1A 2DCLA 2E12A 3CCRT 2F40A 1HNIB 2V2KA 4OYWA 1SJ1A 3QWPA 1YITS 1U09A 5KFUA 1PD1A 2XMAA 3RW7A 2RI2A 2FJWA 4EO8A 5GANd 2LQNA 2B3TB 2VZ9A 4UUXA 2VQEJ 3VALA 3D67A 5ETSA 5AXLA 3E9GA 2OTLA 2L9NA 3SQGA 2IAJA 5KFOA 2V8KA 1VQ4S 4LF6J 2DXFA 3AAWB 4FSSA 1YJUA 4ZCLA 1RTDB 3CJQA 3QGGA 3J80Y 2J8AA 2OI3A 3IM9A 3CCSQ 1HSQA 4WCEQ 4NCAA 5DQIA 4O44B 2MMYA 3P5TL 1UWBA 2HGMA 4ELYC 1WTFA 2ZPHB 2KZZA 4LF9F 2CPXA 1ZA1B 2GMLA 4RKUE 2GO8A 4OYPA 3LGMA 1RHJB 4P2XA 1LNXA 5K20B 4F7UG 2XS2A 1JO8A 4ER8A 2LQWA 4K0KJ 1FTRA 5K8NA 2EYYA 1X6GA 4YS2A 2L41A 4CLTA 3M9MB 1RQ0A 2FRWA 3OV7A 2MYSA 3CC2T 2E7WA 3EGWB 4HDHA 3MUTP 5CYMA 4FZVA 2CZVC 2B5JB 2R4FA 3GIJA 4ZJOA 3LWHA 2FHKA 2N7CA 1VQ8T 5D6WA 3N6MA 1EP4B 2YKNB 1NPPA 3FB9A 1HKAA 1F5CA 1XTDA 2B8AA 4ED5A 3CW2C 3DLMA 1W2BR 2BZ8A 2O4XA 4C0DC 1AFJA 2LFVA 2CJBA 2NPFA 3MEVA 4KHMA 5LM7E 5GAMh 2ROPA 2DITA 1UECA 5AYFA 4DEYA 3H8YA 5F9LA 5F9NA 1N36F 3SCLE 3GQCA 4DR5J 1PJ6A 2JS0A 4WTOB 1VQPQ 3CMAT 1M5VC 3C66A 4GLMA 2CT3A 3V7CA 5GMKm 3ENQA 4JI1F 3E01B 3ISND 1PKUA 1YITQ 1WNLA 1X27A 5AE3A 1U06A 1F0XA 1RGVA 3W5YA 4J9PA 1QVPA 3IS9B 5IV4A 4BWMA 3RU0A 4PWDB 5C24A 4PCQA 1RT4A 2OMOA 4X84A 2I9SA 1REVB 2YWWA 2Z0WA 2BMBA 4C8QG 1VHFA 4B3MJ 1QAIA 1VQ4Q 3A8OB 5KFZA 3W5XA 4CT8A 2MSSA 2MQPA 1ICEB 4HACB 2QEXA 2G4BA 3QJPA 1NDCA 4NZ0A 4ZITA 1X0PA 3F73A 2F7VA 2UUAJ 3NMRA 3QG1A 3TA1A 1Y0HA 4KAIA 5U47A 2W2PP 2DHSA 2ZBRA 5KT3A 4PRFA 2VXEA 2M0YA 1AHJB 3DRYA 4R55A 3R2DJ 4GO7X 1C0TB 4CO3A 2CPDA 5KYYB 4DR6F 5LJ5g 2ILZA 2CUBA 2LVWA 4QPXA 4C8OA 2LKZA 1OYXA 3CC4S 4K4WA 2RI3A 5HMWA 3UE2A 3D54A 1J5EF 3X3UA 1D09B 4DBFA 2P6SA 3GV7B 3HKWA 2KYZA 5KG2A 5IHKA 3HRSA 4NLYA 1XN9A 3M8ZA 3KK3A 2KXFA 3M58A 4X4VA 4ZVRB 2MZ1A 2ECZA 2BACA 2AJ2A 1GK8A 3DDNA 1KC8U 2BKPA 3LPYA 2D0QB 3HHTB 5KFAA 3CDEA 1WC5A 2D9TA 1N4LA 2OPRB 2OIHA 2GQVA 3DN9A 4QYRA 2AKWB 5FLXY 4F4XA 3LP0A 3ZZPA 4EZ9A 3H20A 1R7IA 4GVBA 1L3KA 1OMSA 2E10A 4PUOA 1W25A 4LDVA 4A63B 1TKXB 2H3EB 2QX0A 3CDUA 3IWXA 4OZ5A 4NLXA 2VBYA 3TCJA 2MQLA 3GTYX 5KG3A 4DPTA 3G71T 3M8PB 5ETRA 1XERA 3OYFA 5KG7A 2HK3A 3HSJA 2ZGWA 1T9UA 4WK1A 2YX4A 2LCCA 4QQ6A 1H3HA 1OZ2A 4B3SF 1LW2A 3H0PA 2PIIA 1MROB 1WXBA 1U2FA 4AXIA 4IOBA 3G7ZA 3R5AA 4OX8A 3JB9D 4H4KA 3EG3A 2CP3A 5KH6A 2BX6A 5HP1B 4JI3J 3OYMA 1MMLA 1ZZFA 4OYOA 4CM2A 3EDQB 3PRDA 3RUBL 4QYZK 4JZ3A 3K5OA 3QUIA 2HRTA 2KHCA 5GMKj 4L72B 1QVGR 2B86A 3D2WA 4ANJA 1JLQB 4M5GA 2JTEA 4OYXA 2M0GB 3QGPA 2GMHA 3M57A 2HS4A 4UZBA 3U1LA 1WIEA 2P4TA 3DYAA 2IBKA 2F5KA 2WW8A 4RUHA 3EGUA 3HMJG 2CYYA 5HQMA 4CH1A 5HK0A 5A8KA 3FKBA 3UCGA 3Q8YA 3QT7A 2QSWA 3BDLA 1S9EA 1HBNA 5CH7B 3S1TA 5IT4A 1S1VB 2GJFA 3CD5A 5DG7A 4B02A 1X4BA 1EJ7L 4QU6A 1AA1B 2YH1A 3GFXA 4WFZA 2YKOA 4OLPA 2JEFA 2GCFA 3THTA 2VU5A 5A2QY 3CD6S 1YHQS 2DBKA 5GAN2 4LIWA 1S4FA 3JB9F 1IKXB 5GAMg 1N6QB 2AEJA 1S0VA 1QLNA 2XG8D 1FDBA 5BR8J 3B78A 4K4VA 1XMOJ 5FDLA 1YJWQ 2IDEA 3J81Y 3M0SA 2FJDB 1ZBTA 2GGPA 2M3DA 1G2EA 5HL7Q 2LEBA 2J0QD 2K6DA 2M7SA 3DDIA 1NHUA 3TX8A 1WDTA 3BO3A 2MWOA 4L59A 4XU1A 1D1CA 1YIJA 4YY3J 3TZWA 2JT4A 4ERDA 1PHTA 2E65A 4RUAA 2XEXA 2I6WA 5GMKa 2CP5A 4RNMA 1XJWB 3ZFVA 3CCTA 3RMSA 1RHQB 3IQLA 5D15A 4X9DA 3H0FA 1NK7A 1T3OA 2N3OA 5D0EA 4ES1A 2L48A 2WSFE 5EG2A 3PACA 2A08A 1EARA 1V6HA 1S6PB 3HVTB 4DLEA 3GP8A 1KHCA 1DJ0A 4ZPTR 2G3RA 4FYDA 5GANe 4BB7A 5H1SV 3GE9A 2R8HA 3I32A 3FCHA 1F2HA 4X62J 2H54B 1UVLA 3IAS9 2NLUA 2DL5A 1KJWA 3K8WA 4ME7A 2X35A 1U0SA 1CJTB 4A46A 2EJFA 2G0JA 1H74A 2XO6A 2HGLA 3LH5A 2E7VA 2HYIB 1NDPA 1OIAA 4EMKA 1YGYA 2CPZA 1J5OB 1F60B 2K2VA 2NUZA 2DERA 2RQUA 3N5BA 2IC3B 2ADCA 5DM7R 2MDAA 2HGNA 4HH0A 2DGTA 1CPZA 2MQOA 3OFFA 3VRYA 3C14B 3RBXA 4JJDA 3OTBA 2LXUA 3A8MB 2NUTB 1JEGA 5I3QA 4IOAQ 1M3CA 2Q1LA 3VU3C 1FXDA 2DNUA 3A12A 3PW4A 3OBIA 2AT1B 2KROA 4KT0E 5C42A 4HT5A 2MXYA 4JRQA 2ADBA 2OELA 3GR0A 3CCJS 4FVCA 1RKIA 2CQCA 2J0XA 4A8YA 1V3SA 2EYQA 4C11B 1KSPA 2MJUA 3M0TA 4A8OA 3G6VA 2PA3A 3OW2A 1GMUA 3SSSA 4DV7F 2A3JA 3KK2A 3I5AA 4K59A 4QWAA 1IKVA 3UD3P 3C15A 1KN6A 4DCOB 1YHQQ 2F2VA 5BJRA 2ZH1A 3BSNA 1W7WA 1RWPB 3G6ET 4Q45A 5GMEA 2QA2A 2BR0A 1NB2A 5ETPA 5D4LA 2JVRA 3VGUA 3S3MA 2D8JA 3DI6B 2DRKA 1VISA 1KKHA 3TZXA 3CJTA 2J9CA 2HHHJ 4LSNA 2CJQA 4RW7B 1WI8A 4BACA 3EZOA 3MO8A 4FBTA 2K3BA 3Q89A 3SD4A 1YFNA 4UT4A 4U96A 2BJ7A 5IT9U 2CSIA 1PBAA 2PU9B 4UOFA 5DLOA 2MIOA 4G1IA 3DLGA 1DY3A 1KS2A 4Z88A 4DR7J 2MGZA 1Q5VA 3R5CA 4JP8A 1SJFA 1FX2A 1SXLA 4LQ3A 4KQZA 4DEXA 1JK9B 4KC5A 1NYFA 4R8UA 1FTCA 2OPSA 3SEOA 3NHNA 2GF7A 1M9SA 1I5LA 4W92B 5A0YA 1HMVA 3V8JA 3CCQA 2YPYA 3R97A 4OYZA 3MPYA 3MM6A 2JVOA 4DPXA 5HY6A 4Y2AA 5AT1B 2K3XA 3BF4A 2VG5A 3BH7B 1HNVB 2XG8A 2E9TA 4K8RA 3W3SA 1Y10A 4AL5A 2AZSA 2KN4A 2OSRA 3NTKA 3VZIA 3PY8A 3ZTSA 2W8LA 1D1UA 3RKXA 4F4KA 1U1RA 1JLCB 2B9YA 3EDRB 2UXDF 2HK2A 3RMQA 1YQHA 2ZITA 1I3OB 4Y00A 2HNYA 3OYAA 3LWLA 3VGVA 3NS7B 2QGFB 3PM9A 4LF8F 2KYBA 2RILA 1DTQA 1RA7A 1NUEA 5F0WA 3KMQA 2DIGA 2NXEA 2ZH6A 4RBVA 2V8PA 1RAFB 2H5IB 2QMXA 2V5HG 3I0SB 1W2BS 3S7RA 3BR9A 2KE9A 1N6AA 5JVGQ 3PW7A 3L7OA 3META 3V2UC 3TSWA 3ZZTA 4R0JA 2KU7A 2BQUA 2VYTA 4YB7A 3E51A 3CMET 1Q95G 1A6LA 3SB2A 5G4DA 2C2RA 4M75G 1FJGJ 4NI2B 1LK7A 3CPWP 4LFBJ 1JB0E 2RSQA 5BYQA 5EWEA 2W24A 1CJKA 1T3NA 1ACMB 5KFKA 1T94A 5D3GA 2NSBA 3K58A 2F5GA 3M1VA 3HK2A 3NTHA 2MY7A 2CRLA 4DSIA 4RKUC 2PGCA 3HL8A 1U26A 1WI7A 2RQKA 4N47A 5KT2A 4RJVA 3DOLA 5L1IA 2FVPA 1R0AB 3KG0A 1UJ4A 3V6HA 3CF5Q 4J37A 2PVGB 3JB9G 1ZPVA 4ZGDB 3QIIA 4RMOA 3HPOA 4TVRA 4LF2A 1WC4A 4CYUB 3Q2SC 1YJ9S 1IBKF 3TUZC 5IAYA 3GB0A 4LF5F 3A8HB 2FVRA 4RLEA 5KG6A 4B17A 1UG1A 1OX8A 2GGRA 3LP2B 4HDGA 3IR6B 4PFZA 4OZNA 3RESA 1WF1A 3A4TA 1RT3B 4F04B 3HHLC 3LALA 1GH8A 2FUG9 4J7CA 4BWJA 2WZ1A 3MM8A 1U6FA 2AYEA 4OYIA 2CPJA 3JAMU 4NA1A 3MMAB 1RLCL 4D6WA 3DHWC 2IIHA 5DLQE 3EPGA 2QASA 3KLFB 2GC8A 3F41A 2OTJA 1HA1A 2ZBIA 4W90B 4FF4A 1KP6A 1ZHIA 1T05B 2HLTA 3LP1A 2BBEA 2HQFA 3DGPA 2O67A 5KFDA 3REAB 1W2IA 3DOKB 3PFSA 6AT1B 2RN8A 4OI0A 3W2WB 2QA4G 5IT9E 3AXMA 1RAHB 3R5JB 1C1BB 1F2GA 3RDVA 1KD1R 3ZTPA 2VFSA 2AZ3A 3PXGa 4NXMJ 4ECUA 5DGAA 3KK1A 4OQJA 4PJMA 1LNQA 2CQGA 4M5LA 2AYMA 3W2VB 2CNOB 5ETLA 1WJQA 2NXJA 2UVVA 2R8IA 1R8HA 2W2OP 2FVSA 3UNYA 3RBZA 3BBCA 2Z56B 4LRAA 4I0WA 2KG0A 1M2OA 1M90C 1M30A 4H4MB 1NKBA 1N32F 4DU7A 2ASJA 4JI7F 1OPKA 1JLBA 2JDJA 2DGWA 3W64A 2EQIA 4JI4J 4U95A 1G7CB 3DC2A 4OI2A 1D0ZA 2W9CB 1K44A 4X64J 2R57A 2JL9A 4R25A 2AQ4A 9ATCB 4NA2A 1YWPA 2V2QA 5E5NA 1MN7A 4BE0A 1VQ6T 2L3QA 4Y28E 1WC3A 1GBQA 3DOLB 4Y2CA 1EHWA 3G4SS 5AE2A 2O2OA 1S1WA 3D5MA 3ET6A 5GAHI 2KKHA 3HVRA 2Z30B 2CWKA 2DRBA 5IQQA 1VLOA 1YJ9Q 4RW6B 4ZGJB 1RLDA 3AA9A 2XNQA 3JSMA 1M90T 2C42A 3A1YG 3CIZA 2DIVA 3OTOJ 4DG1B 1XNIA 4KKOA 2GFAA 5H9EK 3CDBA 3DB3A 2HHPA 2EC2A 2AYGA 1HYSA 3ETMA 3M6XA 2OPPA 4DX5A 1U7LA 2MAMA 1WSRA 3JB9k 1VQNA 4P2MA 2Z2ZA 2XSJB 4RBUA 2QTXA 1NJWA 1UWAA 5LJ5e 4J6XA 2H51B 2R7QA 1TMJA 3PJ9A 2F8HA 1JWWA 2LP5A 1KR4A 4ITSA 1IBLF 3GLXA 2RK1A 1RU2A 5CKEA 2WTFA 2RF0A 1X5OA 1RTIB 1HHSA 2FHJD 3CCUA 4BDPA 1D9AA 5LMUF 3CMAQ 2AJ4A 4B9UA 2LNHB 1QW1A 2D74B 1FXRA 3HTRA 2K7KA 3T5JA 1NJIU 2WSCE 1BK2A 5GAOq 3TJ8A 1Q16B 2CGHA 1H73A 5IHIA 3V6DA 4F7VA 4F4WA 2F8MA 1E6YA 2APOA 1Q78A 3PHEA 1GTHA 3FRZA 4E7SA 2HDAA 3PW2A 2YNGA 4A4FA 1ZTTA 4AL6A 3QRRA 4QR0A 1GEHA 4QZVB 3JYTB 4C5GA 3ZC4A 2IMWP 2RHIA 3KKFA 2DR8A 4PAAA 5F8LA 4DX6A 4Y0FA 3RAQA 2EQMA 3DCAA 2R2UA 1T9XA 2G13A 1T0TV 3MCMA 3JAME 2IMOA 3MMBB 4M7AF 1FO1A 1D1BA 3SBMA 1RL2A 2BM1A 4J7IA 4NLPA 4XTVA 1M90R 1HPZB 1T95A 3EGVA 1SCJB 5GAHU 4EBDA 2VOOA 4QVDA 1IXDA 2FG0A 1NJZA 1DJ7B 1HQUB 2VUGA 1P9QC 3IG1B 1H2TZ 4U6PA 3MEGB 4EMHA 1UETA 1TV6B 4MJKA 2HQEA 5A0GA 1FJEB 4ZTFA 3OR2B 1JXOA 1T0HA 2VOPA 2MZTA 2ACYA 3BYPA 1VQKT 4Q7AA 2FLPA 3S3OA 3TNVA 5KFTA 2CDRB 4I67A 1I81A 2GJIA 4IFVB 1ZM9A 5CYQB 1HLWA 1RADB 5AE1A 2LT4A 4OI6A 1NSAA 4BDZA 2AEMA 1K73U 1T0JA 2WCXA 4NLVA 1K9MR 3H41A 2IA6A 4N8NA 4BI8B 4FDFA 4DN9A 4AQYJ 5KFLA 3AQOA 5LJ3j 3CJKA 3JSBA 2HQHA 5AXKA 4HVUA 4CIOA 2FHOB 4OZ3A 1R0BG 4LBPA 1FVQA 1FRLA 3OD2A 3TREA 4LF4F 3PX4A 3G1JA 5D4PA 1M0SA 1P1TA 3UFCX 2EFGA 1TL5A 2QA4T 2KJWA 2NXCA 2KZMA 4O0NA 2B7CB 3M30A 1Q81R 2W9BA 3OSVA 4KGMA 1T3SA 4H4OA 2WSFC 3WC0A 2RRAA 1OU9A 2IJNA 5EGYA 4DZDA 3L2RA 5KG4A 1FX7A 5CKDA 5IH2A 1YG0A 1NHKL 3UVJB 4TYAA 1RAGB 2YWKA 4F4YA 3M32B 4DBRA 3VAGA 4K11A 2F9DA 4J9SA 1KIKA 1VRUA 4C0BA 3I55A 2UV8G 2IPOB 3QZ5B 5IV3A 4NLGA 2YUPA 2XY7A 4EBEA 3RIRA 5KCOA 1K1ZA 2OEMA 4ZA1A 2CP7A 1KLMA 4ZVGA 1KC8C 5E41A 4ZLLA 5CO7A 1NLKL 3CCZA 3VQTA 2FC8A 2DXEA 2DL3A 2IBOA 4NEZA 3QPIA 2OTLS 4J5YA 2YNFB 5MAOA 5J1EB 4PQUB 1RI9A 5KFVA 1E6VA 2GQIA 4KT0C 2C1EB 1BYMA 2VGMA 4DL4A 4M78B 1RWUA 2CZ4A 4PXCA 1XMQJ 2FHJA 3SCIE 3BSCA 4TU8A 1WPYA 1I6JA 2DGUA 2QFIA 5CD4H 4JYAF 3QGHA 3OYBA 4KGKA 4PKCC 2ZNZA 2DKOB 1ZM2A 1YJ7A 4QIEA 5AXNA 5GAMf 3KHGA 4GKKJ 4RZRA 4YHHJ 2R7SA 5IXUA 3FCVA 5DM7Q 4PK4A 3R7SB 2BANB 2GHPA 1VQMT 3J80U 2E1MC 4MFBB 4J8OA 3I5CA 1KC8T 4WTYA 2JMCA 2PEHA 1CULA 2J9DE 1X4CA 2LVMA 3BBBA 1RAOA 3VYHB 4GVLA 3M9QA 1VJWA 3CCSA 3VHQA 1LW0B 2ACMA 2AZVA 3KOAA 1A9NB 4B9LA 1WOSA 2NWMA 2L2PA 5EDWA 1IBMJ 2HAFA 3A13A 4IFYA 2V1RA 5E33A 3RG6A 1YBAA 1WNEA 3UR3C 3MPUB 2X1BA 1KQSA 1HWLA 1VIXA 2CNNB 4QWEA 1T7PA 1U1PA 3C94A 1PC5A 1SEMA 3AD9C 4ED8A 3VTIA 3BREA 2R8JA 1NH8A 4DR1J 1QSSA 3M4XA 3R8YA 3BE3A 5ETMA 3RKWA 4DV3J 3TUJC 1S0NA 2V8JA 4F02A 2DZCA 1EETB 3M9NB 4PZVA 2R8KA 2LP4A 2CJAA 3FZ2A 4DL5A 2FJBB 2HHUA 1WUUA 4XTYA 4I2PA 1RTJA 2KMTA 3OUYB 2EJGA 1B0PA 1FK9B 1SB6A 4M5KA 3RBDA 3CQTA 1TUCA 3QXEB 3TEGA 1X60A 1UTIA 4NOHA 3F56A 3KFVA 3MF5A 2MKCA 5F8IA 1N8RU 2LC4A 4M7AB 5EWFA 2RK2A 3QZ9B 4FYWB 3HJVA 2UUCF 2OTLQ 2DJWA 3O2IA 5IS2A 1U49A 2L08A 1AW0A 4G3IA 3BV8A 2L3SA 1RBOB 2HPUA 3BGFA 4I2QA 4MDWA 1VBZA 5KT7A 2QEXS 4Z89A 1VQ7A 1JXLA 4I6AA 1J3TA 4U7CA 1IM6A 1LWFB 1HBUB 1MNDA 2B56A 1YITA 2ASDA 2COZA 1OPZA 3WVEB 5GMKi 5KFEA 2LX7A 1D0XA 2HFNA 1VC0A 5HK4A 1YJNT 2YNHB 2HURA 1O75A 5F8HA 3ZNUA 2DGSA 2XU8A 3FEOA 1VQ9T 3I9ZA 3MAHA 3NNHA 4KFBB 2EI5A 3I5RA 2FHMA 1Y7XA 1V5IB 3JCMW 1SPKA 4KULA 5ETOA 4LRCA 3CCWA 3ILLA 1JLGB 4JZ4A 4RX6A 2EBPA 1S1TA 2E5HA 1Z9QA 1JB0C 2IM3A 4P7VA 2FZKB 3MP6A 1UEUA 1VIFA 3NEKA 4O3SA 5JUMA 1IKYB 2XGPA 3HT0A 4ED1A 2RHUA 1VC5A 5KYWA 5GADI 3J7A1 2RM4A 1D9DA 4RW4B 4JOUA 2DETA 5I2SA 2CZ0B 2VFTA 1QMCA 2H8HA 4FT4A 2A2CA 4LR8A 1RT1B 1AVZC 4HCZA 1PJ7A 1GCQC 3GJSB 2PMZD 4X4RA 4DQRA 2NYIA 2DPIA 4M4ZA 4HA8A 3G86A 2DISA 4DL0C 1HWKA 2ZDPA 1YWOA 3CCEA 1ZSZB 2YXLA 2GNCA 2OPQB 3VQSA 1RAEB 3IR5B 2Y90A 3ZBDA 2YBVA 2Z0GA 3J80E 3JSCA 4DX8H 4WE1A 1IRXA 2E1PA 5FLXU 1HQ2A 2QGGA 3LGFA 4AD6A 2I1RA 2O5DA 5EUHA 2HVHA 4NMXA 2QN6B 1SJQA 5EX0A 4C2MA 3S6EA 4N0AA 4DR2F 4J83A 2EYXA 4ZJLA 2ROGA 2OEJA 4ELTA 4I64A 5F8MA 3G6XA 1Y3KA 3RGIA 4DR3J 3VCDA 1N5SA 3DOMA 4L5GA 5A8WB 2VKZG 3F0NA 2EWHA 4FIBA 3A8EA 4Q0BB 3H9NA 3TA0A 2X4JA 2VG7B 4BS2A 3L2QA 4TQRA 2RT3A 1HI0P 3EG1A 3TA2A 2K3IA 3E9FA 3MFIA 1K76A 3UA6A 3LWMA 2QEXQ 4J9DA 4PL6A 1N9RA 3NFCA 4AMCA 3D6FB 2XZDB 2FPEA 3OYDA 5L38A 4LVNP 1JLFB 1C0UB 2AWZA 3OXFA 3Q83A 2AV5A 4CLKA 1N34F 2V0NA 1FRMA 2CT4A 3M2RB 3KMSA 2E64A 1A0OB 3IBCB 3QJ6A 4M7DD 3QZ7A 3QFHA 2V67A 1D3BA 5CCLA 2HQGA 2LDMA 3SDEA 3TAMA 2QTVA 1XNQJ 1HHTP 3C6UA 3EVMA 5GANf 1VYAA 4ED7A 2VG6B 1HIYA 3V7RA 4OZLA 2ATLA 3QDFA 1WHGA 1HW9A 4CO0A 1YDLA 4RTTA 2IM1A 3PIPQ 3MPDA 2KDSA 1WOPA 4C5EA 3I0RA 4LR9A 3CMEQ 2F8EX 2AGOA 2J8SA 2DZ9A 1V5VA 2HRUA 4ELVA 3PNWC 5J2NB 3M0PA 2IVMA 4Y28C 2J0WA 4X66J 5H9FK 3RRKA 4WYWA 3FQKA 2XLJA 3M8YA 4C92D 3RR7A 3M56A 1RE1B 3OS5A 4QYZJ 2DBMA 3SXLA 4YEAA 4ICLB 1YRUA 4MZPA 5HROB 4X4QA 2HG4A 2LA6A 2UVRA 5A2QU 4L73A 4KGXB 2QDYB 1SI9A 5A0LA 2NS1B 1G8XA 2HEQA 3GIIA 4MMKA 3PJXA 2VHGA 3HVAA 3WHIA 1YIJS 2B6AB 1S6QA 4USUA 1C1CA 3BYRA 1GXIE 2ZUAA 4RR5A 3J81U 3KJVB 1CJUA 2VH7A 3KLIA 2UVWA 1HD0A 3NKYA 2W9AA 4M7DF 4I56A 4I1TA 1U1LA 2W2QP 3VS4A 5LSRA 1R8OB 2DM1A 1UDLA 1YJWA 1BU1A 4QU7A 2VXFA 1AZSB 1YNZA 3HDSA 2NYSA 5LJ3h 4PJOB 2JZ5A 3VGTA 1PJ5A 2VBZA 1OS5A 4L3KA 4P2SA 1RZMA 2A6MA 2BW2A 4OB2B 4QIGA 4DL3A 2RE1A 3OFEA 2C22A 4RW8B 5J1NA 1YX2A 3L42A 2BOAA 1VQLT 1N48A 3N01A 4LSZB 3HSZA 4C92F 1E6GA 5J2PA 2AD9A 2WVDA 5HMXA 2DFUA 3JXOA 9RUBA 3MUMP 5F3TA 4Y92A 2G2OA 4M77B 2XD0A 2VPYB 1JXEA 4YTLA 1XR6A 5DS7A 3SWNB 1H38A 2L5QA 2WSCC 2Q6BA 3T9NA 3CC7T 1F6TA 1U1NA 3MEAA 1KFDA 3UR0A 3M8SA 3MEKA 2IA0A 4IR9A 5FD1A 2Y1IA 4OMMA 1VQ5T 3TSZA 4EGLA 3MURP 4LJMA 3TARA 1X01A 2CVIA 5FLXE 3EH2A 1WLPB 3LANA 3WX8A 1WC0A 2B4OA 2NPIA 4K4YA 4NL3A 3OW2S 5E3QA 2KR3A 2CH4W 1X0FA 1IQTA 2QA1A 3G82A 1WYXA 5LJ3Y 3DM2A 1UEBA 3WIUA 4KPCA 1VUBA 2ZVSA 4PNOA 1SHFA 1T03B 4JI8F 2ZH2A 3GFHA 3I5BA 2HBQB 2CZ6B 2ZZMA 1D0YA 2IJFA 2FVCA 4LREA 3RYLA 1VQOA 2VKNA 2IRUA 2VPXB 4IG0A 2LCLA 1HQEB 3X24B 3L95X 2JS2A 3MM5B 2CPFA 2EVZA 2YKQA 3CJ8A 7FDRA 3BQ2A 3PT9A 2RJZA 1GCPA 4DUZF 1QJHA 2MCNA 1SBRA 1C1CB 4OHZA 4KYZA 3VAHA 1T02A 4ZVOB 2EKYA 1FMVA 4X4UA 1X69A 1WHLA 1YHQA 4Q8EA 3REBB 4DV0F 3HFVA 4TY8B 2VQFJ 2WOMB 3Q23A 4PKDB 1G2BA 1KHVA 2HZYA 1Y5NB 4M7DA 2M8DB 3K5LA 3V4IA 4IKAA 3DXBA 3FDSA 3MMJA 4OJ3A 1YK9A 3JCMd 1LQ9A 4ZN1A 3ULRB 2LU2A 3JCMQ 4M78E 4A54A 3EVWA 3A8LB 5HI7A 4OI3A 1X5PA 4MDXA 4LF7J 3CCQS 3QSIA 1BY9A 2DNGA 4F26A 2W0ZA 1V76A 3M8RA 2BZ2A 3CMQA 2NCKL 4X65J 1MWQA 2VVKA 3NTIA 2DF6A 2DXUA 3L09A 3PZPA 5ADZA 4C92A 2O9SA 1FKPB 3AH6A 3ETOA 1HL6A 2AEFA 4QBUA 3QRQA 4B9WA 5A2QE 4CRIA 4PJLA 3P3DA 4MYTA 1P9YA 2ZNYA 2P8IA 7FD1A 1UVIA 4UQTA 2HNDB 4UW2A 4CLWA 4II1A 3J81E 5K8MA 3DRPA 1S6OA 4M5IA 2E6ZA 4M5DA 4BBYA 4ZNXA 4K2JA 2EBGA 3V7SA 1LWEA 3UWTA 4FL6A 1GAOA 2IVYA 1NJXA 5LOQA 1EQMA 5HBMB 4ZLPA 2HVIA 1KQSR 1FKAF 4ZP8A 2LT1A 2RPNA 2J9EA 1IQZA 3FFIA 1K0VA 3B4MA 1GL5A 2XSFA 3I31A 3PEJA 3G8QA 1Q82R 4PXBA 1WQWA 4NZ6A 2J0SD 3S3NA 2WSEE 2K9GA 3CCLT 1V29B 1MMGA 3CCMT 4EDUA 2GMJA 3I5SA 5KT4A 2HAIA 3KNAA 1XMQF 4TNOA 1IVZA 3DHXA 2XCPA 1XIQA 4ZIWA 2PZ1A 4J7FA 5GMKe 5FW9A 2EKNA 4ZVTB 2QIFA 1EZZB 4G1PA 4I7FB 2E1AA 1NJIC 3DLKA 4J91A 1PSFA 5I3UA 1VQKQ 4YHHF 3CGIA 2CQPA 3PJWA 3TYTA 3G8SA 3VGSA 3OYNA 2IDLA 4LF9J 2RF2A 4HHHA 1YRXA 4GY5A 3AD8C 5KYUB 2O9VA 1KVKA 2YUQA 1QVFR 1SJRA 5D4NA 4Z37A 4KHRA 3QIDA 4M7AE 4LIRA 3MUVP 4NPOA 1LJOA 2GIRA 1WJRA 1SKSA 3NGDA 3J7YU 1YCSB 3MGJA 3HCXA 2CNLB 2R5MA 3L2UA 1IB8A 2YXYA 5IM0A 1SJ3P 4OGEA 2B4PA 1FDDA 4O4GA 3CCQQ 5CAAA 1I5OB 2XCAA 2B8PA 2QMUB 3TQ7P 2RQTA 1NJIT 1TP7A 3D28A 5HLFA 2QA4Q 2J6SA 3EPIA 4B08A 2MF2A 1VS3A 2RU9A 1OQ3A 5I3PA 2J7UA 1NLOC 3L2VA 3NRBA 4MYUA 4CC4B 1N36J 3MR3A 1NU4A 2OTJS 4TU7A 2OO4A 1S97A 4NOYA 1R6VA 3LUYA 3VF0B 2RDJA 2BRKA 3MAQA 2RHZA 5B0BA 2DVJA 1WG5A 2EYZA 1QUVA 2DTJA 3B6BA 3MMCA 2DNOA 4EYHB 4JI1J 2K1RA 1BCOA 2E5LF 4KUIA 3NS5A 5F8GA 2V26A 4BDYA 2GAGC 5KOXA 5FU7B 3KG4A 3C16B 4H54A 1Q7YU 5HQ8A 2P9GA 1X4DA 3CCVA 3KLGB 4ORZA 4IUPA 4JS4A 2EQJA 3ITHA 2F4VF 2UP1A 3VUZA 2DH8A 3CXCR 2ZM6F 2EKOA 2FJEB 3DLJA 2KI7A 4JLIA 1FWPA 1KTQA 4IR1A 1TKZB 1HNZF 3W62A 4P75A 4DDFA 2QLJB 3Q22A 3JTOA 1REGX 3IAM9 2QLBB 1Y57A 4P71A 4M1KA 3W8PA 3ZZ0A 4XO0A 4LXCA 3HHLB 4LE9A 1O5JA 1K73T 4RWWA 3CCRA 1UAWA 2LQ5A 3TQ1A 4PYAA 4E7JA 4DV6F 4FKYA 2W2NP 4RUCA 3UATA 4ETZA 3THPA 4NX9A 4FVMA 2MHEA 2GFUA 5EC7A 3E8OA 2A3LA 3EFRA 1FDAA 1JLEB 2KT8A 4HTJA 1IO6A 3D68A 4DR6J 2VF3A 4IO1A 3EG9A 5CKHA 2DO0A 3M59A 2BRLA 3I35A 2H4WB 1RT5A 3OLAA 2XMJA 3QDRB 1UJ5A 1J5EJ 2EGCA 2ESWA 4TLQA 3T5KA 3QYHB 5JMNA 4YB6A 1OZ3A 3M5AA 2AP6A 1SV5B 3I56T 1OSDA 4HCKA 4R56A 3V6JA 4JS5A 1SKWA 2AMCB 3UA7A 4LSLA 4HR2A 2XM3A 3A3OB 3ENWA 4N77A 4ZHRA 2JOQA 1UB4A 2YUNA 1ZM4A 2GHWA 1VQNS 5KFMA 5T7LA 2E3IA 1UVNA 3M6VA 4IURA 2ZH3A 3KTQA 4Y91A 2OTJQ 2DK2A 3CC2A 3EFOA 1DBDA 2CP6A 3CCUS 3DKMA 1WD6A 4RO0A 1WHXA 1HNXF 2R7WA 1VQ8A 3UDLA 1FKOA 5D0RA 4WU2A 3MWBA 4V2SA 2Y1JA 3JCMJ 1K73R 1T11A 4C3KA 1U3OA 2DO4A 4ES3A 4ESRA 5G0RB 5HSPA 3ITHB 2I2LA 4DR3F 4B3SJ 3BGLA 1X9MA 1UJYA 1RHUB 5LXRA 1PO6A 3QT8A 2V8IA 2IM0A 4C0GA 2DGVA 2ASYA 2W4PA 2QV6A 2BOPA 5H9EJ 4HYKA 4RTZA 4OMOA 3CMAA 1HI8A 3P8DA 2FYKA 1BQNA 4MIAA 3TEHB 4Z7YA 3MM7A 1MMAA 3OPKA 4GRSA 3I6PA 2FY8A 2I5JB 2K3KA 5LSOA 5KTQA 2Z57B 1PIEA 1NO8A 1WKKA 4J9BA 3MR5A 1D0EA 2DJZA 4ECYA 2LECA 2WW4A 3SFMA 1N52B 5KFXA 1H92A 3K57A 4PJOE 4C8KA 2JN0A 1B0TA 1O6XA 4F3QA 3BB5A 2R7OA 3EXCX 4ECVA 2BM0A 4OHXA 2JSXA 1YJNQ 4ECTA 3DRXA 4M63A 3QKJA 3BPSP 1XNQF 2KEAA 4A8WA 4GMKA 3CSKA 3JQJA 1KONA 3RJMB 2L9WA 4UUWA 5I2MA 1NZ9A 2MHNA 1TVRB 5FIIA 4F50A 1RWNB 3U23A 3JCMe 4NYOA 3W61A 4KH0B 4KV8B 4HHUA 1MUZA 2PFFB 1N8RC 4M77E 2WONB 4M78G 3OBYA 3V81B 1WHMA 4F7UF 2K4YA 3UI3A 4LQ9A 2ED0A 2DXCA 3JB9J 2ZPIB 3VS7A 3O8WA 1ZQ1A 3R5BA 4ENOA 1WJSA 4DHVA 5LL6S 2MJNA 1YJVA 1YRTA 4Z2XA 4OB1B 4IUFA 3G2XA 1P92A 1FCAA 1VQNQ 2YTCA 4E7ZA 4ECSA 2DJQA 5IQ6A 3HP6A 2KVQG 1E7OA 1WKLA 3AXKA 2E1HA 1NK9A 3GSIA 2LMJA 4L6V3 1WHKA 4QVCA 1OULA 1UL3A 2FVQA 1MU2B 1C4AA 1QVGA 2CJXB 3HKZD 1KBRA 5CCMA 1RT7B 1NZAA 4ZVHA 1WHVA 5E3AA 3V8KA 4K5RA 1C0MA 1N8RT 3MECA 3R1HA 4JV5F 2O01E 4Q2MA 3F70A 5CKBA 1TAQA 4URQU 2ZBCA 1QKWA 3OXGA 1YBUA 1GMWA 3AJ2A 3M05A 1FF2A 4FS1A 1U4BA 2N3LA 4IG3A 1SL2A 3DRRB 3I55S 3VWSA 1ZUYA 3M53A 2DGQA 2ZUGA 4DEZA 1ZBXA 1GFWB 1FXXA 1XQHA 4O3RA 3PO5A 3PRBA 4OHWA 4CWBA 2V8VA 1TKTA 5K14A 5KFCA 5GAN5 4YN3B 5LSLA 2HW3A 5L8RE 5KT6A 1VYUA 5D8HB 2LCWA 4USWA 1JXMA 4FKXA 3MZIA 4B3OA 1APSA 3S8SA 1M4ZA 3M2VA 2FLNA 1CLFA 2BJ9A 3G71A 3A3NB 1XBWA 3O1LA 3MD1A 3CPWA 4O3OA 5DGBA 4YB1P 1UGRB 1OI1A 2Y1LB 1AB8A 4Y2MA 2J05A 8ATCB 5HMZA 2FLOA 1CKBA 1ABQA 3P8HA 2BDPA 3H0IA 4WZQA 1PC0A 1U8WA 3W1YC 2Q43A 1H0HB 2JLGA 4RWXA 1B7YB 2HMIB 4HT8A 2WACA 2D69A 4TYBA 2DEJA 4C6AA 1N0UA 3FBCA 2ROLA 5C5JA 3OR1B 2JMAA 3Q8QB 3MR2A 2QG9B 2KJVA 4DV7J 3MXHP 4OB0B 1BB9A 2K06A 1S99A 3P5BP 1B34B 3TR5A 1Y07A 1BKBA 3MPWA 4X4OA 2LQKA 3TJ9A 1QAYA 1MLAA 1CJVB 2I0XA 3GYXB 4NLQA 4F7UA 1CQNA 2BKOA 4YFUA 1KQ1A 2XI3A 5LL6d 3CEDA 5KFHA 4KBIA 4P52A 2PEBA 2YNIA 4DSKA 2JH3A 2GJ2A 3KLEB 1WORA 3CCSS 4NWBA 1FRKA 1KRPA 4ECZA 3S01A 2Y8YA 4C8YA 5DY9A 3OW2P 3OTEA 3OSPA 1M3BA 3PRVA 2EBEA 5GANj 3N0VA 1CS4A 1NM2A 1KQSS 1N5YA 2JZ2A 1Q8KA 2M2BA 2XK0A 4PFOA 4X4TA 2NUHA 2OHDA 1JJHA 4KIAA 3C6TA 3D9BA 2G6FX 1ZBJA 4JPBW 1IHVA 2VFUA 1WSVA 3NCRA 1Z4UA 3KYLA 3OS0A 4C0FA 3K2YA 3C2PA 3EG2A 5DLGA 3D0HE 4ZCMA 5J2QA 2X4XA 4FU6A 4WXWA 4M78C 2CQBA 3D6TB 2W8KA 1SC3B 4Q5WA 1JQGA 1Q5YA 3GIMA 3I55Q 1QAXA 3BR8A 5DO2A 4ECWA 1BI2A 4QKUA 3ILOA 2CQ3A 1SUQA 1MV3A 4A4KA 2COWA 1ZAVA 4LBIA 3CJ2A 4IUTA 2HQDA 3ZEHA 1QDUB 2HLUA 4K4SA 3HP9A 2EFPA 2IG0A 2DR6A 2RKIB 5JVHQ 5K9FA 1BXNA 2RJDA 1WELA 5KFSA 2VDIA 4P2FA 1TL3A 2UXDJ 1SVDA 1T3LA 2CQDA 1CQMA 3INZA 1KQGB 2V4QA 5EX3A 3QO3A 5C25B 3DRSA 3CC7Q 4AFUC 3OL7A 1S72T 2DD5A 3NCQA 1VQ7S 4LF8J 5SZTA 4EIKA 2XMUA 1PYOB 4Q44A 4DV2F 3EJMA 4RNFA 1GXLA 1IXKA 2OSQA 4TY9A 1WEXA 2BJ3A 2JM8A 4YR3A 3JCMb 3QMQA 1TL7A 2V69A 4KBMB 2BQ3A 2LXIA 4A8XA 1NPKA 3RB0A 4R5PA 1K9AA 3GIKA 1JXVA 1H2VZ 2BE9B 2WSEC 1YBYA 4J9CA 4Z8AA 4PQAA 5GAGI 3ISZA 5HCKA 4O23A 3PHTA 3RRHA 4EI2A 4DJBA 1TXQA 2MKJA 2K2MA 4HTIA 2F65A 4Q2LA 1X9WA 1TUVA 2E44A 3MKDA 3BFMA 2ZD1B 1NG2A 5KYXB 3VYGA 1QD1A 3MHYA 2CPHA 1ZA2B 1HBMB 2EIFA 4PG4A 1R6YA 1TL1B 4ZOSA 1U47A 2K5LA 2DVIA 3SCKE 2JVVA 2BABA 2PMHA 2NXUA 1HWIA 4URGA 1A0NB 1KG1A 5KE2A 2C2NA 2NUPB 3ULHA 4M7AC 4CTAA 3CXCS 5I42B 1KQKA 2JX2A 2BE2B 5M9OA 3IWLA 3G6EA 3VRZA 4ES2A 2DH7A 1IBKJ 1VBYA 2D8HA 4LF5J 4L76A 1UFWA 2DRDA 3OYEA 3AOCA 3CCES 2C3UA 4X4NA 1PM3A 3PCOB 4LDWA 1DLOA 1YI2T 2PI5A 2AJFE 1VQSA 3BSOA 1OPLA 2ASLA 5I4MA 2QAZA 5E3RA 2EW9A 1BQXA 1S1XA 1RACB 2PMWA 2RRBA 2J5AA 4A4JA 2RIJA 3WC2A 5ECAA 2GS8A 1K8AU 2KQWA 2F1FA 1S10A 4DPWA 3BO4A 4DQSA 2M51A 3H5XA 1RYSA 1GNKA 4CO1A 4I4BA 4E0DA 3PX6A 4A48A 3HHLD 1Y3JA 4C8QB 3MM9A 5KFJA 2KDOA 2C28A 1RT2B 1X4EA 3DLEB 3SMZA 4PJOG 2R3VA 3C46A 1U48A 2NZCA 4ELZC 3MEEA 3GU0A 4J9MA 8AT1B 1VRTA 1VQ7Q 3NL0A 2J7WA 1KFSA 2HHQA 1UPMB 5GAGU 2DR7A 2XDBA 4C8LA 3TEEA 1WZOA 2GNKA 1MG7A 1IKWA 3QBCA 2C2ZB 4PXDA 4QWDA 3PYDA 5F3ZA 1QSLA 2KGTA 2QQ9A 1FESA 3IRXA 1Q4RA 2RVJA 3U1MA 2MQQA 2YKMA 3SQGB 1ARKA 2IAJB 1U0HA 2FB0A 2RNEA 3H7HB 3A5ZB 5D78A 1N32J 2FD2A 4GKJF 2XTJP 1JJ2P 3R9LA 2F9JA 3CCLQ 1UFKA 4JI7J 1ZSZC 1BIAA 2GQ2A 3IXQA 1UWBB 1YN8A 1ZZNA 5GAOm 2RUGA 2PDAA 3EH1A 5CAIA 3M4GA 4FS2A 2JTMA 5LJ3f 4FF3A 5L46A 2ZPFB 2JWNA 3BDUA 1W6XA 4QWCA 2I8EA 2HFVA 3BJYA 2HCKA 5DLFA 3KG1A 2RAQA 2RD5C 4IH6A 1G3SA 4IYQA 4HVZA 5T41A 3BGUA 4DUYF 2MEWA 3VV2B 4YUDA 1AUDA 3VAJA 5AXMA 2K57A 1C2PA 3PIPA 2QL5B 5CYMB 4JDSA 2MZRA 1N27A 1NKCA 1CG2A 3CMEA 1IGUA 2GQCA 5MLCV 2C2MB 1NH7A 2P0KA 1VK8A 2A2DA 3CCEQ 1Y00A 2PUKB 5BYSA 3J7Z5 1RT6A 2XHWA 2OUGA 2M02A 2LJ0A 3M8QA 2SEMA 2FEIA 3M54A 4QIFA 2UU9F 4WYLA 2ZBQA 2V4JA 2O4XB 1YJWS 1EKRA 1AEYA 2BJ8A 3I82A 3NBPA 4F0HA 1LKZA 2R58A 2C2OB 1QKXA 2OFGX 1IZ6A 2H1YA 2JFDA 3Q1JA 2RHXA 1BI3A 1OX9A 4J6YA 1QE1A 2KFYA 2L9DA 3EGXA 3BDPA 1IBLJ 2G2ZA 3UNGC 4W98A 1QP2A 1VQPT 1VCTA 3MEEB 4E7HA 4DQQA 4M75D 1S1UA 5H9FJ 3C0CA 1M2VA 1WOOA 2DVEA 2KXDA 3VS2A 4HI2A 5LMUJ 3QO9A 2PUOB 3QIPA 2HWIA 1P1LA 4FXWA 3T1YF 1YITT 4KTQA 1SKRA 1HBOA 1QQJA 1CKAA 2KT3A 4NYZA 5C24B 1M1KU 2Z58B 2CAJA 1RT4B 1WC6A 3L7UA 4MTPA 2ZCFB 3Q24A 4EPCA 3QGIA 4WFBQ 3JSRA 3A98A 2BE7D 4YP3A 1VQ4T 2IVFB 2CDTA 2V63A 1R8CA 1NE8A 2QDLA 3TJAA 3K17A 4KHPF 3LW5E 3CEYA 2D1CA 4S0MA 4N7TA 2BJEA 2HNZA 1NK6A 4KE5A 2D1XA 1TAUA 4DOVA 3J7AF 2OKQA 3U7JA 3FBFA 4UOGA 5LMNF 2DR9A 1HWJA 1KWMA 4MIWA 3DMJA 1NYGA 5CQGA 3FMBA 5IC4B 4C3LA 4WFYA 3LGHA 2PN6A 4PJOC 1TTHB 2HBZB 1PILA 2K2PA 2JW4A 1WDDA 4M75F 1WEZA 2RJCA 2M5YA 2ZE2A 4WXOA 1VQOS 3RRGA 3P4UB 1K0SA 5KE3A 2QQSA 1D8ZA 4VUBA 3RAMA 2QTWA 2YKPA 5L1LA 2N4DA 4QWBA 1H7XA 2HHXA 1Q7YC 4M77C 1IBCB 5I22A 1L3TA 5A8RA 3EG0A 2EC0A 3BO2A 2QQRA 3KK3B 3UT1A 2D3ZA 3SWNC 2AF6A 1ZUUA 1LWXA 2ZC4A 4UF4A 4A8SA 4DWIA 1SHGA 4N5SA 3FEYB 3KLHA 5BXIA 2XBPA 4QOTA 1VQ6A 3CPWR 3OXLA 1X2KA 2YDLA 4ETXA 3MCAB 2XMTA 4CDIA 2EGEA 4HH1A 3LP0B 3P45B 3SI8A 2ZHOA 4GVBB 1M27C 1NSQA 4EZ6A 4LF4J 1UGQB 3FDRA 4PUOB 1PAEX 1AOJA 4USVA 2C0TA 4WFNQ 5GANh 3ZXWA 4J9IA 3JS9A 5KFRA 4J9UE 4O3PA 4KO0A 1G3TA 2GVZA 1CSJA 2LA4A 4R0EA 4JI2F 1Q7YT 3I87A 4U9RA 2FPHX 3R7BB 2O01C 2XI2A 3O44A 3X26B 1B3TA 2V6AA 4CO2A 1LW2B 4J6WA 2W2MP 4P73A 4RG8A 1TSFA 3JCMV 1GTEA 1PBUA 4WZMA 2GBQA 4CLZA 3ZZRA 2W1BA 4PPZA 3K5MA 3NOCA 2DXDA 2DD8S 2OFHX 4O0IA 3BN7A 1UVMA 1IGQA 2MPUA 1U45A 2NLWA 4DUTA 2PSZA 2RDDA 4ZVQB 1D8YA 3T5HA 3G87A 2HHSA 1XK8A 5L8RC 4FF2A 1S7HA 3VS1A 3TWZA 1CC8A 1U02A 3ZTOA 3A8KA 4CLUA 4M5HA 1VGYA 1X75C 5LJ5d 1X4HA 2PC6A 3DYAB 4QR1A 4WP8A 1Y96A 3PG9A 3MI7X 3Q8SB 1GFDA 3EGDA 5HJYA 1LK5A 4JJBA 5HK3A 5A8KB 2G1HA 3GR1A 1NXIA 3CJ4A 1S9EB 1HBNB 2AGPA 2RD1A 4EO6A 3OYGA 4FW2A 1X31C 1VQOQ 4P7TA 5C6SA 1V1CA 4M75A 1S9GA 1OQKA 4RW9A 2L3MA 3PKMA 4JYAJ 1Y5IB 4Y34A 3CC4T 4DSLA 1FFSB 1VBKA 2ZEJA 4G1QA 2P5VA 2W10A 1VIEA 1RTHA 3BM7A 1N5TA 5DG8A 1BLUA 2JUFA 4DV4J 5FDLB 1UGPB 1Q7YR 2GGPB 2NYHA 3AQPA 1PGZA 1IJFB 2A18A 4J9NA 2K3YA 1MWYA 1WKJA 4ILRA 3JTPA 1YP5A 3MEDA 2ZZDA 2I2YA 2M0OA 4XTUA 4I68A 3H8ZA 2FTRA 3OJSA 5J2MA 2MZSA 1VQKA 2Y4YA 2XS5A 3FLGA 3DDKA 4X9CA 1B7TA 3QJLA 1QCFA 2M52A 4DSEA 2WK4A 5GJVB 4J9EA 4A4EA 1QCOA 2OJ2A 5GVQA 4LR7A 1LWCA 1UVKA 1H7WA 3J7ZT 2DNRA 2GVDA 4CO4A 1KQFB 5CR2A 3DU6A 4CNZA 4YDDB 5F41A 1GX5A 4P74A 1AD5A 4KSEB 1RWKB 4PYDA 1QM9A 1VQYA 4EMKB 2EK1A 3W60A 3CJSA 3N5BB 2HBPA 2QA4A 2ZZTA 3EWGA 4U7UD 2J6TA 5K8OA 2FQQB 1MNEA 3T1HF 3CCVS 2MI6A 1U1MA 4IDKA 3UD4P 2ED1A 3MP8A 4RNOA 2AJ1A 2R2TA 3OTDA 4MAKA 2HD0A 4EMGA 2UUCJ 3H2LA 2FVUA 3L3CA 2Y0SD 1RI0A 4ANEA 2B4VA 5JXSA 3SDZA 4NLWA 3CD7A 5C42B 5L1KA 4WKRA 3V8LA 3MAAA 2XGQA 5GMKl 3BW1A 1KOOA 3TU4K 1HARA 4K7QA 3OLBA 1SSHA 2Z8QA 4JV2A 1CBKA 2DIUA 2EEYA 3N28A 2KYMA 4E7IA 1DTTA 2XZWA 3FJ2A 3BKUA 1OPIA 3QZ8A 5GAMd 3CCRS 4USKA 2VIHA 3KK2B 5BYRA 1JQQA 1O51A 4QW8A 1IKVB 3E2UA 3C15B 3NGRA 2PO4A 3KUGA 4DCJB 2CKWA 3GJRB 3CD6T 1V9OA 1YHQT 4IOCQ 2PE8A 4RNHA 2LQ8A 1N5VA 2PNIA 4L3NA 2QLWA 4P10A 4MKAA 4FYXB 4C8QE 4JI6F 2DNQA 3OYHA 3MEDB 4ALZA 3BPDA 1AWJA 1EB0A 3E3XA 2V34A 1S49A 3W9HA 5GANg 2C3PA 5CK9A 2CPIA 4ECXA 1ZX6A 4LSNB 2E1RA 3N5FA 3OVBA 3SV4A 3RB3A 4V19J 2YVSA 2JC1A 3AT1B 5FU7C 3K0JA 3PE0A 2EGAA 4LF1A 1QUPA 2V2ZA 4IKFA 1RBLA 1JLAA 1OEBA 1VQMA 3DLGB 1KD1U 2FIUA 2JEIA 3EE3A 1FE4A 3MCNA 2JEGA 1XMBA 2BJ1A 2MGZB 1ZPWX 2E1CA 2UUTA 1FFGB 3VAFA 4R8UB 1I4K1 5GAN6 2OPSB 4B9XA 1EFNA 4A4HA 3HHKA 3CC2S 5A0YB 2AW0A 3AHUA 1I94F 4ZPVR 1HMVB 2HHVA 3MM6B 5GAN8 2GX8A 3P8BB 3LO3A 3SFUA 3T1AA 1YZ7A 2CH4A 1VQ8S 3GWCA 1S0OA 2GO9A 3JCMf 3KWMA 3NCPA 4CM0A 2FJXA 2Z2LA 2VG5B 2GZOA 1JKHA 1ZSGA 3ICLA 4JRKA 3DKDA 3M2UA 2G0CA 5ETKA 4DR2J 2YHTA 3R27A 4HLBA 3CCVQ 2VJVA 2DY1A 4V1Ak 3BSAA 4JRPA 3KUEA 1UCNA 3HHEA 2QYGA 2CQ1A 4LBHA 2HNYB 3POTA 2W7OA 1T9YA 2HHTA 3O8VA 4PWWA 4OLOA 1DTQB 3NMZC 3CMAS 4ZCKA 4ID5A 4TLRA 3CCJT 2OP5A 1LXNA 4KB7A 3G96A 4C7QA 2HIQA 4P9SA 2C3MA 4HKEA 4K2XA 2XMWA 3CCRQ 4XU2A 4C4WA 1I1GA 4C48A 1B7FA 5CQXA 1Q8LA 3MR7A 3PGGA 1HNIA 4OJHA 2DNKA 2BQRA 1FJCA 1XNRF 1N34J 1YVFA 5B0GA 2DR5A 1HD3A 2EFVA 1HK9A 2HZAA 3IM8A 3FJPA 1LFPA 1NSKL 3KJNB 2A1BA 4F0KA 2EPDA 3VVTA 3GONA 1NK4A 3KDNA 5KFIA 2X4WA 3H40A 3A8JA 1AWXA 2QLFB 4XPCA 1CJKB 2DHAA 2L3RA 5M2RA 2RU3A 1SH3A 2KT5A 2DKGA 1ABOA 1FD2A 5D3GB 1RTDA 3D0IE 3M1VB 2ZOGA 3UCZP 3NGPA 1S77D 3UQSA 2FGCA 1YJNA 4O44A 4Q43A 3SEMA 2I0NA 4UZCA 2X3DA 2YWHA 5A6WA 2HEKA 3OFGA 4PR6A 1VQ9A 2DILA 1RHKB 3OYLA 2FYXA 4ED0A 5AJ3F 2P0QA 3TAQA 2V8GA 2RS2A 4B9NA 3ZZOA 1WHHA 5KFWA 1QVGS 1NJYA 2DPJA 5B0AA 3CC2Q 5D0GA 2JM9A 2IJRA 4LUEA 1M5PC 3M9OB 5LJ5h 1M5Q1 1GBRA 3MM8B 2GTOA 1TELA 2BKDN 2B5JA 1QSYA 1VQ8Q 2Y9HA 1YI2Q 2D6FA 4NL5A 1I0CA 2CQ2A 5D0HA 2DLPA 1Q8BA 1EP4A 2YKNA 1U25A 4XTTA 2LDYA 2K79A 5I11A 3HLUA 4OP0A 3PIOA 2A36A 1FDNA 4ZPDA 3QJYA 2E66A 2ABYA 5RUBA 2WB4A 2VUBA 4XTZA 3MEWA 3HSBA 2FPFA 1RAAB 2UV8A 1X6OA 3LP1B 3CDAA 3DGPB 1WG4A 4B3TF 4J9OA 3HKSA 2IHR1 5HVGA 3HD1A 5FROA 3HM9A 3MFHA 3JCMX 3OA6A 4NRTA 3EMTA 5B0DA 3G71S 5CZXA 2RH2A 3DFEA 1FI4A 3KK1B 1K9MU 1RA6A 1E6HA 3CPWS 3OT9A 4NCGA 3OSSC 3E01A 1SSFA 2HAXA 4ZVSB 1WJ9A 4NL2A 3TRGA 1DAXA 2UXCJ 4HT7A 1RLQC 3IS9A 3N79A 2OAUA 2AZ1A 4C0OC 2F5TX 4C0HA 4PWDA 1S12A 2R7XA 5EN1A 2DAQA 4J9LA 5DZ7A 2DO3A 1JLBB 3LW5C 1ZAXA 3SIPB 5L23A 2KVIA 1REVA 3G6YA 5LJ5Y 1RP5A 1GCQA 2CQ4A 1K8AC 2C06A 2AJ0A 1N5QA 2BW7A 4HACA 5CVIA 4O6JA 2KRRA 1Q81U 1UP1A 1M1HA 4ZS6A 1U8SA 1EX4A 1U1OA 3R6OA 4JI8J 1EIFA 1ITPA 4WF2A 3UO0A 3CULA 1S1WB 3ET6B 5IXBA 4L75A 2R5AA 2V1QA 2VWFA 2WVFA 1YJRA 2HFUA 4YOEA 4U8YA 3FEZA 1C0TA 4KGZB 1YJ9T 1FRHA 3NY0A 4XK8E 3L1AA 3DLLA 3JSMB 4DUZJ 5KYYA 3NG8A 1NKEA 1FT8A 3PYFA 2M1HA 1H72C 4CH7A 3UPFA 1W1FA 4KKOB 3UD5A 3PKYA 1NPRA 4DV0J 2VFVA 4PG5A 1NCLA 3ENAA 1HYSB 4B9TA 5GAEU 1K8AT 2OPPB 4NXNF 2J6KA 2VBXA 3GG0A 4Y6IA 3PW0A 4HI1A 4XDDA 4YR0A 1M8MA 1DQ8A 1TS9A 4J9QA 4OX9F 2E5IA 2HL3A 2LCSA 2YQ3A 2XLIA 2XLKA 3URGA 2QL7B 1IR1A 2DEUA 3GJQB 2RQRA 1X6BA 4F0MA 2DY9A 4X4PA 1XEZA 2OPRA 2YQ0A 4UOHA 3GIRA 2J6UA 1URNA 4ZLJA 1LOJA 3IWNC 4G65A 1BUXA 1R89A 3PTWA 1RWMB 2WVEA 1TKXA 5GAMe 2JJ9A 2EYWA 2XMMA 3V6DB 4NCGB 2QK0A 3G71Q 3D3CJ 3P6YC 1E6YB 2IRYA 3M8PA 5FU6B 4PEOA 2HVDA 8RUCA 2FJAB 2YNGB 3KHRA 4EUVA 3B4DA 2VB6A 4DXLA 3KLVA 4PJNA 3LYIA 2F63A 3FVYA 1YLXA 2DNNA 2MMPA 1PKSA 3ILIA 3R5DA 3H42A 1HJDA 3ER0A 1MN9A 4XAXB 1WDXA 1MROA 2GA7A 2ZKUA 5HVHA 2DL8A 4LFCF 4NLTA 3ZZZA 1VQLA 1FRIA 2KSSA 2ATCB 4PJJA 2G1DA 4ZDNA 2U2FA 4N4GA 2XICA 1Y5LB 5DRKA 5HP1A 4DA4A 4X2BA 1SRMA 3PMTA 5DDOC 2DNLA 4DL6A 1WC1A 1K47A 1F5AA 3EM1A 1JJCB 1JLQA 3KDOA 4U67Q 1WWHA 1SH0A 1K8AR 3CC7A 4ED3A 5B08A 2RHQB 4FW1A 3G4ST 2ZFHA 4ZVFA 4AFFA 2EPIA 2CQ0A 4DL2A 1VQ5A 2JRSA 4WKYA 3FZBA 1Q0NA 3H5SA 2QYCA 4KY3A 1UEVA 1W70A 1OYDA 3IBWA 1RWXB 5GMDA 2DRAA 1M1KC 1S1VA 2PVDB 2OI2A 5ETNA 5HN0A 4X34A 4P6QA 4OX7A 4DV4F 2YX1A 4HL9A 5DZ6A 2EVRA 3CJKB 2KFNA 1HNWF 5KCHA 4X4SA 4QIWD 1QAJA 2M9UA 1S9FA 4CQ1A 1RU1A 2XWXA 3G6ES 1IKXA 2A10A 4DV5F 3EGNA 1N6QA 3NGKA 4QIVA 2ZPEB 4P72A 1Q53A 3U27A 3RUXA 4M75E 2DYIA 3X28B 5GAOr 2FHDA 3FC9A 4B9SA 4K50A 2UVUA 3D66A 4WCIA 3M30B 3SFGA 1W4SA 2W9BB 2X51A 3OYYA 4H4OB 3CT9A 1IUJA 3EXYA 3PTAA 4QR2A 2RB7A 3MHXA 4OGCA 2V2VA 1FEHA 1V3ZA 1M1KT 4DFPA 5C2GA 4LD9K 2MZJA 4C5IA 4D8DA 2QMWA 3N4WA 3CJ5A 2DHGA 2IVWA 1BC6A 3CDWA 2CG8A 4EFAC 2XQCA 3PO4A 3CTRA 4CH0S 3TANA 1VRUB 1GT8A 1S6PA 3HVTA 3MCSA 3BKTA 2CS7A 4OV1A 2HVZA 1DHMA 1B99A 2Z4PA 2XDPA 3TVYA 4C8MA 1Q86U 2E5LJ 1S79A 1KLMB 4U7UK 3JB9H 4ZGEB 3W7BA 4IRCA 4FNIA 1CJTA 3HPWA 3OYIA 1QVFA 4DQ2A 1N33J 2QI2A 2ZBPA 5F8NA 1J5OA 4KRTA 3TAPA 2F4VJ 1JU5C 4L74A 2A37A 4DFJA 2EW3A 2IC3A 2ZM6J 5IT0A 3SQOP 2R9LA 1E6VB 2LX9A 4EBCA 1KC8R 1MV0B 2HS0A 5CYJA 3X25B 1HNZJ 3C14A 3JTNA 2NUTA 1U1QA 3PMIA 2MLXA 2L8DA 1F9HA 3FJ5A 4ED2A 4RTWA 2NSCA 2AKLA 4ANDA 5CA5A 2PFDA 1FXLA 4I69A 2M8HA 3M8WA 5M2PA 1RISA 1YBTA 3R1LA 3OMCA 3V5RA 1AFIA 1WHWA 2P84A 4DV6J 4J9VA 1S5ZA 5ETVA 3CO0P 1PCAA 2O31A 2JLFA 5EHHA 3CC4Q 3FBBA 4C11A 1H8KA 4BD3A 1UPPA 1CULB 3D1OA 1UKUA 3L4BC 2ALZA 1SQGA 2ZC3A 1HI1A 1GRIA 1M1KR 4C8QC 3CCLA 1H2UX 4AG1C 2GAHC 4A47A 1M5KC 1VMBA 3CCMA 1NM7A 3G6EQ 2D41A 1X9SA 1FEEA 3CMES 3FSYA 1S57A 3C4SA 1XQIA 4IFYB 2FLLA 1MSWD 3RKYA 1YTYA 1ZTWA 2CADA 1Y9OA 1W2BP 2QRRA 4IRKA 3RR8A 5KG1A 2HKNA 2ZH5A 4YMEA 5IWAF 4DBHA 2OD6A 2YKAA 3DI6A 2PQWA 1NBEB 3DB4A 4FF1A 2MOXA 3CJ0A 2VD3A 2AHOB 3W9JA 4BY6B 4LD6A 2POKA 4RW7A 3CXCA 2VKRA 1PCXA 5F8JA 3B54A 1TWBA 4F8RA 1I51B 4ED6A 4OMFB 2E4HA 3GIBA 3NGTA 5CD4A 2ZZNA 3OQ5A 5CXTA 5CQYA 4I2PB 1RTJB 1H3ZA 1R8BA 5A6PA 2VC1A 3C3LA 1FMWA 2RMOA 1HNXJ 3QT5A 2LQBA 2R7TA 1NZ8A 4LFAJ 3OHAA 2ZKTA 4M5JA 4ZMMA 2FL7A 4K4TA 4UY85 2UXBF 3K5NA 4BI4A 1ZAWA 1UTAA 4UQGA 3TW0A 5FRMA 4JI5J 1U1TA 2CUYA 3TZZA 2OTLT 3OB9A 1HNVA 2E29A 3HRUA 4B3RJ 2FGOA 3VS3A 1BWVA 3PV8A 4I2QB 3AOBA 4E7LA 1SC4B 2J9DA 2E6NA 3QHSA 5FWBA 1KEKA 4J5OA 1JLCA 1QP3A 3VS0A 3IN5A 1UGSB 4RL1A 5DG9A 3T3FA 4N4HA 1FVSA 2LQJA 1RUSA 4DPYA 3G9CA 4NS5A 5KG5A 1H98A 5C0MA 2V68A 1HR0F 4ANCA 3UWNA 3AHPA 3PVQA 2ZHBA 3FK4A 3I0SA 5GJWB 3MTKA 1HD1A 1DQAA 4CLSA 1LCKA 2XIDA 3PNIA 2RI5A 4JLGA 3CD6Q 2LEAA 1S1TB 3GFYA 1TR0A 2MZQA 3N6NA 2M88A 1TQLA 3LH0A 2W4CA 3BKFA 2DEIA 1B64A 2QQAA 1ZETA 2MK5A 5KAKA 1N56A 1OOTA 5KYWB 1NRKA 2ROEA 2LZ6B 4NI2A 2X3XD 1FRJA 4IQMA 4CP5A 2UUBF 1A7GE 1M1FA 3GOXA 1VQ6S 1T9TA 5THWA 1XR7A 1G5VA 3T9ZA 4PABA 2VDHA 2FRYA 2VPWB 5E3CA 1B4SA 2Y1RI 3JQKA 2GV1A 3QFWA 4KR0B 3Q86A 3R2CJ 1XTZA 1H6KX 5CIUA 2CPYA 4LRDA 1R0AA 5CKFA 4C5HA 3KJFB 4HCBA 3D6HB 4TN2A 1Z9ZA 4WFAQ 2C3OA 1ELOA 3K89A 1PKTA 3BEGB 1CSKA 4CYUA 3PR5B 1UA0A 4IO9Q 4WE1B 2W4DA 5L9XA 2MYFA 3I56A 1KVIA 3GV8B 2RHSB 3LP2A 2J7IA 4JV5J 3ZO7A 1GXTA 4CT9A 1WEYA 3THKA 4PPDA 2HZVA 1RT3A 4WIIA 5IZHA 4A4GA 1WFWA 4FP9A 3DOMB 2DIQA 1OYEA 1PSDA 3HT3A 3BQ1A 3MMAA 4DPUA 2EQUA 5D6GA 1QVGP 4WK3A 1B3QA 1WGSA 1JNZB 5J39A 1U24A 3WZ0A 4CNYA 4DV1F 2ILYA 2R7UA 3KLFA 1LEOA 1D3WA 2J6OA 5A76A 4RUBA 1ZH5A 2LLZA 2R7VA 3H2VE 2ZH4A 2RQWA 3ENVA 3UN2A 2QEXT 1SH2A 2OJ3A 1BMQB 1SQEA 4UC4A 4QQDA 1D1AA 1KD1C 1KHIA 1T05A 2IY5B 3CCJQ 3ONQA 3C19A 2NXNA 1CVJA 3DOKA 2HFZA 3D7SB 1TFWA 3IR7B 3M0UA 3W2WA 1I07A 2UXCF 2DTOA 4HVVA 2ABLA 2PA8D 1D3BB 2XY6A 1C1BA 3SDEB 3TAMB 2VQEF 2HQCA 3C6UB 3ZZUA 2G9OA 2E9ZA 1OSCA 1GFCA 3MJXA 2OGUA 1WHJA 3W2VA 1MMDA 1LOUA 4WJBA 4LF6F 3I0RB 1VFJA 2XDDA 1Y71A 1TOVA 1K1QA 2AYBA 4ZTJA 1M1GA 4H4MA 2B9XA 3IA0A 2HHWA 3H98A 1FD8A 2FB7A 2ZH7A 7AT1B 3T19A 4JRIA 1NNDA 3RB4A 4MK7A 2NR0A 3M55A 1VRQC 1PYSB 2W9CA 2JLEA 1ZOTA 4FXVA 1KD1T 1UMJA 4BC7A 2F4FA 3OQ2A 2W7AA 2KFZA 1VQ6Q 1O8BA 4DFKA 2WB1D 4H4KC 1VLYA 2MKHA 1NK8A 4WWSA 1S6QB 3OYKA 4XK8C 4Y65A 2C0IA 4K0KF 2PD1A 1YWXA 1VQKS 2GQQA 1OJ4A 1CJUB 2P9EA 3KLIB 1ZYQA 1U6BA 2E7XA 3PR4A 4RCBA 3IP0A 4RW6A 4E2FB 1XR5A 3I4HX 1EQ0A 2FO0A 5KFGA 4DSJA 4C97A 4DG1A 5KFPA 2JOYA 5L39A 1SJ4P 2D9OA 4JUVA 1Q82U 4J90A 1UW9A 1PC4A 3CJ3A 2KXHA 2DXBA 3GMGA 5DDQC 2MLYA 3OYJA 5HVFA 1BI1A 4XU3A 4JUZA 4KH1B 2D3OR 1Z1ZA 3ISNC 3QBYA 2XSJA 3J7YI 2DNHA 5J2PB 1XWLA 2QQBA 2WRMA 1JNRB 2VA3A 2QA4S 4DR5F 4DF8A 4QQGA 2XZTB 4IH5A 2UZAA 4M78D 3DLBA 4DLGA 1B0VA 3LGNA 3RB6A 1RTIA 4A53A 1JJ2A 2DHXA 2BUDA 1BD6A 3ME9A 3PFOA 4Q5VA 4UY8T 2KG1A 3PW5A 3DU5A 2Y4XA 2R2SA 4F3MA 2D0NA 1WX6A 4DZ6A 2KM8B 1KLNA 3KHLA 3MP1A 1NK0A 3NPFA 4OV6A 4O5VA 4B3MF 5DM6Q 3FGVA 4DV2J 4DOZA 3P96A 4AT1B 1NDLA 3JYTA 1NDKA 3THVA 3LGLA 3G82B 4NA3A 2KHDA 4EU0A 3DM2B 1Z2LA 2SRCA 4E98A 3RBBB 1UJ0A 5GMKh 4ID8A 2X1GA 2UUAF 3MMBA 4XU0A 3ASKA 1KVJA 4M8LA 2P4RA 1DFDA 1HPZA 1BIBA 2FY1A 1V3RA 4IG0B 4PXEA 1OY9A 1HQUA 3FNNA 5IHNA 2HBWA 3ZTRA 3IG1A 3MEGA 4M78F 1TV6A 1Q79A 2YRCA 6FD1A 2YLCA 4EMKC 4C8NA 3OR2A 3MD3A 1BBZA 1XOVA 1SL0A 5HMYA 3SYZA 1YIJT 3CNQP 1K9MC 3KXDA 4PWUA 2CPEA 1GQEA 4LNPA 2COLA 3GF5A 2BXJA 5LJ3g 5HQLA 5J26A 2X7IA 4IFVA 2KY9A 3R5GA 5CYQA 2Q66A 1NMEB 4JI0J 4M7DB 4B9MA 2X3GA 4YQWA 1R27B 3V4IB 4CLPA 1VQMS 5GAN7 4U8VA 2DTHA 2XO7A 2RJEA 4DL7A 3KNGA 2DNZA 3CB4A 2D9PA 2X4YA 4USTA 2AIRB 4M75C 4C98A 5D7UA 4BE1A 4M7AD 3QLHA 2X3WD 4J9RA 2Y8WA 4KUDK 1Q81C 2Q79A 4K4UA 3BGRA 3CJRA 3GV5B 3Q8RB 1Y7PA 4MZTA 2CA9A 4OFZA 1AXQA 2X1FA 2QT7A 3QSUA 3KBGA 4AXJA 2HVEA 4DBQA 4C92B 1R77A 2ZVIA 2OMLA 2V94A 1K9MT 2MLZA 5CZVA 3RZAA 2HSPA 1KFZA 4ED4A 4AE5A 4NLSA 2VPZB 2COYA 3H2UB 5DJBA 1NK5A 4DR4J 2RUSA 3NOGA 1OU8A 3H6ZA 3D1HA 3JQMA 3DRPB 4OZ0A 2I38A 2DXTA 3UVJA 3M0RA 4M5DB 3M32A 2DL4A 1LWEB 2QZ8A 4FYVB 4AL7A 2F3JA 3QT6A 3D0GE 4K5SA 4OHVA 5L1JA 4JI3F 4Y2IA 3QQCD 2L0AA 3EGZA 2E70A 1N33F 3FFIB 1Q81T 3OY9A 1R3NA 5K8PA 3HRTA 4CI0B 1WG1A 2VC0A 1X5SA 2LMIA 1LV5A 2B7BB 2RO0A 3LWIA 4HCCA 1QY7A 2R7RA 4LN2A 4FM4B 4I6YA 1O0PA 1SQFA 4GKJJ 5LJ5f 5IC6B 2YNFA 3SSRA 5J1EA 1SC1B 4PQUA 1S72A 2K5FA 2EG1A 3EHQA 2KTQA 1FNOA 2Z2YB 3OL6A 3DLKB 3G4SQ 1WF2A 5I3UB 4M78A 4BLGA 4CO5A 4CLYA 4Z02A 3T5LA 1AWOA 2RF2B 1DQ9A 1PNJA 1G3OA 4YR2A 1YJNS 2XMVA 1L5UA 2F1LA 1NJIR 5DQGA 2P9CA 1VQ9S 3H0HA 1TMMA 4DUYJ 2JTFA 3AB4B 4DI6A 1VQMQ 2KB2A 2CXEA 2DD4A 2BANA 2EWNA 4MFBA 5BR8F 2K7JA 1XMOF 1I8FA 4DQIA 1EIYB 3QLHB 5IM0B 3NP5A 4V19X 2L89A 2WVBA 1M3AA 2DK3A 1FNXH 2QO3A 3NGUA 2MKSA 1B70B 4O4GB 1VR6A 3BGRB 1X2QA 5HANA 2B9WA 2B4UA 2QXFA 1LW0A 2CP2A 4IIMA 3CCQT 2M4MA 2XYPB 2UU9J 4NZ7A 4YY3F 5HLFB 2A0FB 1J2VA 2KI2A 1N54B 3QWXX 2AU0A 1XC9A 1BGXT 1P8GA 1I1JA 2CZ1B 4NEYA 3R6LB 1QLYA 3W9IA 2XB2D 3QAUA 3OW2R 1G4CA 4N56A 4FPIA 4WIQA 2CZ7B 4LDUA 2D3O1 3FC3A 3HZEA 2VGNA 4FN5A 4QW9A 4RG2A 1FFWB 4WP3A 3MMCB 1VHIA 1Y11A 4DS4A 2K1RB 4LFAF 1EETA 3UW1A 4X62F 1KHWA 3IBFB 1YI2A 4EMDA 1X5TA 4AFQC 3T1YJ 3N6LA 5KT5A 2EJ9A 3OUYA 3WBZA 2DGOA 1FK9A 4WFXA 4ZP6A 3TVTA 4M95A 4JI5F 4OMNA 1SG5A 1URRA 2KYXA 4B3RF 1R8AA 4GC6A 3G8TA 4EEYA 3GJTB 4DMZA 4M7AA 2RRNA 2JEJA 3N9UC 2ZJQQ 1KQ2A 3ZL7C 2HSEB 2A6OA 4KHPJ 4NLDA 3OVAA 1YZ6A 5LJ3d 4XPEA 2QFJA 2JNJA 1RHRB 1TK0A 5CCAA 3NAIA 4JBCA 5LMNJ 4NLRA 3FCWA 3VR1A 2VBWA 1LWFA 1HBUA 3L2WA 1U2CA 3JCMh 3T41A 4E47A 2N82B 4RTVA 4D8KA 4CC2A 2XYGB 2YNHA 2EK6A 4F2SA 2FPDA 2BVZA 4BCAA 3EG9B 3KFWX 1PD0A 1VQ9Q 4FSXA 5C7PA 4F36A 4ELUA 3LAMA 1RT5B 1Q86C 2P6TA 4KFBA 4PJOD 3EVOA 3GNGA 1MWZA 4F14A 4OZJA 2HMAA 2GIQA 2YLBA 1UJ6A 1JLGA 4USIA 2B51A 3M6WA 3AFGA 4LSLB 2DH9A 4MMLA 2KXNB 1VBXA 2HHHF 5A0DA 4ZHRB 4B6MA 3NNCA 1OWXA 1IKYA 4XAKA 6FDRA 5T7LB 4M77D 4ILLA 1EX8A 3GPLA 1G3YA 3PIOQ 4P5NA 2LNVA 4RW4A 4HHJA 2ROTA 3CWJA 1UEKA 3EFOB 3D3BJ 2OTJT 1RT1A 2IYIA 4OMQA 4DR7F 3HJFA 4DFMA 5FJ4A 2MKIA 2E9RX 1Q86T 3FSIA 2RDIA 2CFXA 1FKOB 4WPAA 1LVKA 4MT1A 1WHYA 1NEGA 2KO1A 4YDXA 4JI2J 4FBUA 1ZSZA 2RHYA 2OPQA 1TH7A 1LFWA 2DYAA 4RPFA 2ZJRQ 4PJOF 2LEPA 1GMVA 2LYVA 2XHCA 2SXLA 1LXJA 4N76A 2CWXA 1YJTA 3UF4A 2DYBA 3CIMA 2EQKA 5IOLA 2VA2A 4E8UA 1SC6A 2DRMA 4TU9A 1BQNB 1GXUA 3MM7B 1VQLS 1VQPA 5A8WA 2X1AA 3VAMA 2KRNA 1PG5B 4ZJQA 4M77F 4Q0BA 3RR6A 5K5MA 1Z2ZA 2VG7A 1DARA 3MOZA 2YT6A 1TKDA 2DE0X 3JCMP 2W01A 1WF0A 1BHNA 3OS2A 3DXSX 3AA8A 1M5OC 1IR2A 4LRFA 3CC7S 2E5KA 2MQMA 3CE8A 1SPBP 1JLFA 2DGXA 4C0DB 1C0UA 1S59A 4M7AG 3KHHA 3Q8PB 4QJVA 1VQ5S 3TP2A 5D4OA 1T9WA 3M2RA 3GYGA 3Q0AA 1VQ4A 1Q8IA 2EXUA 1U6ZA 3BQ0A 4GLKA 2V8HA 3GZ7A 3B82A 4GBQA 4ZLNA 2R42A 3DLLQ 2NUUG 2VODA 4MMOA 4FT2A 2HL5C 2VG6A 1FJGF 2FZGB 1FWKA 4LFBF 1Q86R 4J9HA 5E7OB 3BGOP 3BN4A 1WXTA 2BA9A 3RW6A 2XKOC 1JJ2R 5GAN3 2BTTA 4RNNA 1N8RR 3HD2A 4OZ2A 3NLCA 2MTLA 4OHYA 3O5ZA 3EAEA 5FU6C 5J2NA 4J9KA 2XI9A 1DURA 1VQNT 3OS1A 3LOUA 1S76D 4ECQA 2C2KB 4HEA9 2JHEA 5D77A 3OL8A 4ICLA 5HROA 1IN0A 5T14A 3VUBA 2MB0B 3O5TB 4LT6A 1VC6A 4KGVB 3ADAC 4DSFA 2XNRA 1S7IA 2YX7A 3CCUT 3GCWP 3JSYA 2EFNA 2P0PA 1RWWB 2B6AA 1U2RA 3MECB 1TUGB 2JFKA 3L9ZA 2VICA 1RSCA 3KJVA 1KTVA 2AGQA 3BBFA 2M16A 1P27B 1FWZA 3IMQJ 1PSEA 2DNPA 2WBMA 4IG3B 1HWUA 1AZSA 3OJUA 4PJOA 2YWFA 1ZUKA 1RAIB 4ZVPB 5KYNA 4HT9A 4OMFG 1TKTB 5K14B 3AJ1A 1FYNA 4LDXA 1FJ7A 3RBEA 3DGVA 1VQLQ 4RW8A 4B3OB 4CRJA 3C12A 3F44A 1QVFS 3M2VB 3JCMc 3RNJA 3JCMg 2VC8A 3T1HJ 3GNFB 2DTIA 4UTGA 5LXYA 3KUFA 4M7DE 4M77A 2J7KA 3QATA 3OVSA 3U02A 1CEZA 3J7AN 1K4US 1J27A 3SWNA 3QYGB 2KAFA 2B9EA 3OSNA 1RI7A 4NXMF 4F17A 2R2RA 1RAJA 1NEBA 1RK8A 1X7VA 4K4XA 2CKKA 4USHA 3EUNA 1VQ5Q 3V6KA 2JXBA 3AD7C 4F4AA 3EHRA 2CSQA 2HNIA 1UGVA 5HO4A 2AX0A 3K5PA 4OI4A 1ROFA 4O3NA 5GADU 4C92E 3PDNA 4JI4F 3QWYA 2ZPBB 4QW2A 4G6VB 1IJEB 3RTVA 4X64F 4F7UB 1C1AA 1AUSL 3H4BA 1FX4A 4EYIB 4IUUA 1IHWA 4USMA 2YNIB 3FIFA 4A8FA 3CCLS 3WX4A 3PFEA 4TQSA 4JI6J 1H3DA