2VV5A

The open structure of mscs
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
256
structure length
256
Chain Sequence
LSYAVNIVAALAIIIVGLIIARMISNAVNRLMISRKIDATVADFLSALVRYGIIAFTLIAALGRVGVQTASVIAVLGAAGLVVGLALQGSLSNLAAGVLLVMFRPFRAGEYVDLGGVAGTVLSVQIFSTTMRTADGKIIVIPNGKIIAGNIINFSREPVRRNEFIIGVAYDSDIDQVKQILTNIIQSEDRILKDREMTVRLNELGASSINFVVRVWSNSGDLQNVYWDVLERIKREFDAAGISFPYPQMDVNFKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SMALL-CONDUCTANCE MECHANOSENSITIVE CHANNEL
publication title The Structure of an Open Form of an E. Coli Mechanosensitive Channel at 3.45 A Resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 83
structure length 256
sequence length 256
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2008-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00924 MS_channel Mechanosensitive ion channel
A PF05552 TM_helix Conserved TM helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.60 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2vv5A02
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vv5A03
2HFNA 1APSA 4OIXA 2G9OA 1FESA 3QGPA 3UDCA 1MWYA 1X7VA 2HLTA 2QLWA 4OJHA 1XBWA 2JDJA 2K2PA 2P4TA 2N7YA 1N5VA 4A48A 5B0CA 3HF5A 1YJUA 2BYCA 2QYCA 1OSDA 4DPOA 1AFJA 4FNIA 2RILA 4U9RA 1S6UA 2AW0A 2L3MA 2OMOA 2K7KA 3BN7A 5B09A 2IFXA 1VIEA 3IWXA 1P8GA 4FNHA 4NPOA 4ZA1A 1CC7A 3BB5A 1QUPA 1TL5A 3MZIA 4Y2MA 2OFGX 3I9ZA 1N5TA 3KG0A 1URRA 3DXSX 1N5QA 5B0GA 1Y3JA 1YG0A 4DN9A 2LQBA 1OPZA 2BJDA 5B08A 2XMTA 1R6YA 2ZDPA 2KKHA 2XMUA 4A47A 3K7RA 2HLUA 2OKQA 4Q2MA 2XMVA 1N5SA 2EW9A 3MCSA 1YRXA 1IUJA 1V3ZA 4HH0A 3HHLA 5B0DA 2OFHX 3SFMA 1FEEA 2ASYA 2KT3A 1ULRA 5KAKA 3VTIA 1CPZA 2K1RA 3T9NA 1Q8LA 1AW0A 3TOQA 2ZDOA 1K0VA 5F0WA 3CJKB 4HL9A 5T7LA 1Y0HA 3LGMA 1SI9A 4YEAA 1Y9OA 1CC8A 2K7JA 4A4JA 3BR8A 2LXFA 3KG1A 2RSQA 5A6WA 4DL0C 2ACYA 1X8DA 1YJTA 1FD8A 1MWZA 2QIFA 2XMKA 2W4PA 3KNGA 2AP6A 1TR0A 2HIQA 3HFKA 2PD1A 1KQKA 1LQ9A 1YJVA 1Q4RA 1OQ3A 2N4CA 2GGPA 2FHMA 2XMJA 5A6PA 1U7LA 3WDOA 2LQ9A 2IYGA 2ROGA 5B0EA 2VV5A 1TUVA 1JK9B 2XMWA 1AFIA 3FMBA 2GQVA 2PGCA 1W2IA 4ZOSA 2RK1A 1TL4A 3HHLD 2GO8A 3KKFA 1Q53A 2VH7A 2HQIA 3HX9A 1RJJA 1VQSA 2ROPA 1JWWA 4Q2LA 2K1RB 3FRYA 1Q8BA 2ROEA 3QMQA 3DCAA 4Y2KA 5B0AA 1X0PA 1FE0A 3BM7A 1S6OA 1SQEA 1FE4A 2FB0A 2W4CA 4HI1A 5F0UA 3BF4A 3F44A 5K9FA 4EFAC 2KYZA 4F67A 1P6TA 2RH2A 3LO3A 2KT2A 2CRLA 5B0BA 2AJ0A 3BGUA 1VIFA 2OP5A 2FTRA 3TNVA 4OJ1A 1KVJA 1GXTA 2BUNA 2GGPB 1VQYA 2BJEA 3LGNA 2W4DA 4HH1A 4A46A 3HHLC 2RK2A 2Q3PA 2OAUA 3BDEA 3FGVA 2QLXA 1OQ6A 4QOTA 4Y2IA 3CJKA 1GXUA 4NL5A 1Y3KA 2RU9A 2FIUA 2GV1A 1WD6A 3HHLB 2BBEA 2HFOA 2OD4A 2RMLA 2AJ1A 2N4DA 5IXUA 2GA7A 5B0FA 2GFFA 2IYIA 3GZ7A 3HDSA 2OD6A 5T7LB 1YJRA 1FVQA 4OJ3A 2LDIA 3TRGA 1FVSA 4HI2A 2GCFA 3E8OA 4YDXA 2XMMA 3IWLA 1TZ0A 1SB6A 1KVIA 4OJGA
chains in the Genus database with same CATH superfamily
2ACMA 3UDCA 1KSWA 2YH0A 2UUCF 1YIJT 2QYCA 3D1QA 1IBKJ 3A98A 1MNDA 2F3JA 3PW7A 1YP5A 3F56A 5GAMh 3BO4A 1IBCB 3UA6A 3B6BA 4USKA 2ZBIA 3GIBA 3DNCA 1X9WA 4IRCA 3KK2B 2VXEA 1VQ5T 4R0EA 3DOMA 3OTOJ 3K5LA 4B02A 2YVSA 5I2SA 2ILZA 2YKMA 3L7PA 2GZOA 1I4K1 1NPPA 1VQ7Q 3I56A 4ECRA 3THVA 4C0HA 1B0TA 3WVDB 2BANA 3K17A 5F9NA 3A8GB 1NK6A 4DV1J 1XJWB 3TUJC 3JCMV 2CPHA 2GMLA 3I4HX 3E9FA 2UUBF 3NL0A 2DPJA 5GMKe 3BQ2A 3X1LB 1R8HA 4C8KA 2EEYA 2BQRA 4C97A 1Q7YU 4IUQA 4GBQA 1J5OA 1YITQ 2YLCA 2HAIA 3L95X 5LJ5f 2IC3B 4ZCIA 5F3TA 3HRTA 3R5BA 1Q5VA 4RG8A 1X6BA 3CT9A 4RTUA 4OMNA 2OPRA 4M1KA 3DN9A 4YB1P 1Q7LB 1U0HB 1WHVA 2XMFA 1FVSA 3UT1A 3OYIA 4PJJA 5DG9A 3D5MA 3CC7S 3PJ9A 2HLTA 3TAPA 1RKIA 1KLNA 2MXYA 5LSLA 2MKYA 2H3EB 4X4UA 2B9YA 3C6UB 2KVQE 1UG1A 4YR3A 1Q81T 4GO5X 3VVUA 1KDNA 4DPTA 1WACA 5F3ZA 1YIJA 3HVRA 1H3HA 3GR1A 3DRPB 4NLTA 4LF4J 2RM4A 2CIMA 4YY3J 3BS9A 5CD4H 1VQ9T 2XMVA 1M3AA 4WFNQ 3QJJA 1CS4A 1KOHA 2VOOA 1VQ7S 4CLFA 1E6VB 2FPDA 3W66A 3Q1JA 3CDWA 3GIKA 1FXLA 2DR5A 4JJCA 1VQ5A 3UDVA 4ELUA 1NLKL 5A2QU 4Y2CA 2N7CA 3C94A 2LQ8A 4M5KA 3EG0A 4F3OA 1RT2B 2Q43A 1G3SA 4PG7A 2WVEA 1C1CA 3KKFA 5KYYA 4U7CA 1S77D 1Z9QA 4P73A 4LF8F 4JPBW 3TJ8A 2CQHA 1HBOB 1NK4A 3MCAB 1YITS 2FC9A 2LKZA 3M2RA 3MM5A 4EZ6A 4FF2A 4X84A 3DLEA 3WX8A 4DPWA 4XTYA 1WF1A 2PC6A 2BZ8A 3QLHB 3K5OA 3QAEA 2N4DA 4F7UF 1IGUA 1Y5NB 1KQ2A 5KG4A 1TUDA 1YJRA 2GCFA 1WKKA 2WSCC 3EG9B 4L73A 3VAKA 2NUZA 1HSQA 5KFZA 4RUHA 1X7VA 1H38A 2HGNA 4AD6A 1I3OB 3ZEHA 3R9LA 1PKUA 2YLBA 1RT7A 1H2UX 1TS9A 3OBYA 4CDIA 1VYTA 2DVEA 3W9IA 5DG8A 2YRVA 2J9DA 4F8RA 1Z2LA 1YG0A 5K14A 1T8EA 1JXLA 4NS5A 1KC8T 3H98A 2UUWA 1U3OA 3CCET 2MIOA 2X3DA 2O31A 1S48A 3V6JA 3QJ6A 2SRCA 3Q2TC 1PBUA 5KYXB 3DRYA 3W65A 1VQ9A 2MKKA 3EZOA 2E7VA 4EBDA 4G3IA 1G7CB 1X5TA 2VV5A 3KNAA 4ZVHA 2XIDA 3POTB 2LEPA 3EG2A 1QVFP 3RRKA 1QE1B 5E41A 1PJ5A 3IRXA 4WIQA 2O2OA 3HKWA 1TL1A 3IR5B 5KYWA 2C3OA 4X1VA 4QIFA 1ZBTA 3DKMA 4OI2A 2JFKA 3EH1A 1LW0A 2K3KA 5I42A 1FWZA 5HBMA 3CPWP 2RU3A 4CCHA 5GAMd 4M7AD 1APSA 2NSBA 1PC5A 3TA1A 2W25A 4ZPVR 3M56A 3PJXA 1D1AA 4O3SA 1BC6A 3EDQB 4UUWA 3LP2B 5I22A 3H5XA 3BDUA 3CMET 3OTBA 2B4UA 4R8UB 1OO0B 3ITHB 3EGZA 3R5DA 4DX7A 1P8GA 2EQIA 2HHXA 1N0UA 1TQLA 2YWKA 3RAMA 4OYWA 4AG1C 4PYAA 2CJ9A 2HKEA 4QWBA 3GOXA 4ZVFA 4JI7J 4Z7YA 5HN0A 1KJWA 1BCOA 2X3GA 4HHHA 5HK4A 1NSKL 1F1BB 4QR1A 3DI6A 2LXFA 3R6OA 4C8MA 4OHYA 3WVEB 2XWYA 2ENMA 2V5HG 4RW9B 5G0RA 4ELZC 3CCEA 1PKTA 2DL4A 4FYVB 2FJDB 1KHVA 2NPIA 3CW2C 2Z58B 4WXOA 3AD7C 2YPYA 4ENOA 2E10A 5FW9A 5GAHI 3QIPB 1QTNB 1RAEB 3HLUA 3DCAA 3RU0A 2A6OA 4PWUA 4DJBA 3EYZA 1T94A 1SHFA 5K8NA 4C0FA 1RE1B 4LF7J 5K9FA 4E7ZA 5ADZA 1PC0A 2HNZB 2LQ5A 1Y7XA 3H59A 2RQKA 2CG8A 2V4QA 3SEMA 2VFUA 1WHJA 1X4AA 4RBVA 5HMZA 3G6VA 4KH1B 4L59A 2RI5A 3SWNC 2WB4A 3GYXB 4CLSA 4C0BA 5L1JA 5CKFA 3S01A 4A8SA 3M2UA 4RKUE 5I3UA 3LWLA 4XU1A 2UXDF 1M90R 2W24A 3BGRA 3DLKA 1S1TB 2F5KA 4CC4B 3SCKE 5IFMA 1UUEA 3LW5C 4C92F 4K4XA 4JRPA 1UZDA 3FSXA 1TL3A 3J7AN 4HKQA 2GAGC 2ZFHA 4F02A 4MZMA 3CMEA 4S0MA 2KHCA 3A8LB 3R5GA 3DFEA 1EQMA 5MLCV 1HQ2A 2J0WA 2ZD1B 2MZSA 2HG4A 4JI8J 2YX4A 1TV6B 4L76A 4O3OA 4N7TA 4N8OA 3VGSA 1T0HA 3MAHA 2IM2A 3CEDA 2RJFA 2D69A 1BI0A 2MHEA 4HDGA 2DYAA 1KC8R 2M5YA 3TR5A 1E6YB 2I0XA 2ZBRA 1TL4A 2V8HA 1N48A 3LWHA 4OHZA 3IAM9 4LSLB 5KFDA 3HVTA 2V69A 5CKHA 4LFCJ 1RT6B 4CTAB 1W2BS 3HHNB 4L75A 3GJTB 4O4GA 4QW9A 1S6QA 4DX6A 2JOYA 4WK3A 5CAAA 5CKEA 2MQMA 3T1HJ 3E51A 2F40A 3HHLC 5EN1A 3QDFA 2M0GB 3H41A 2DBKA 5CK9A 1KLMB 2MGZA 2LJ3A 1TKXB 2V2QA 1VK3A 3Q8UA 2DHXA 2J76E 2DTOA 3M05A 1B99A 1BD6A 4LR7A 5GMKi 2NXCA 4M5LA 4LMZA 4ES2A 2R42A 3M0UA 2NXJA 2J6UA 4ELTA 3L9ZA 4ZPDA 2ROLA 1OIAA 3VYGA 4LSZB 3H90A 1N36F 2D3ZA 3D3BJ 2OFGX 3ET6A 4JLGA 4Z2XA 3AOAA 1WXBA 2H3JA 2FO0A 1K47A 2BJDA 1SH0A 1F5CA 3FJ5A 2BMBA 3QT8A 4USWA 4NLWA 4ZVQB 3GMGA 1ZSZA 4HH0A 1QSSA 1YLXA 1UVLA 2V26A 1V5IB 2E9ZA 2Y1JA 2XI9A 4LFBJ 4PQUA 2QLBB 2MWOA 1Q86R 3ZTRA 2W4PA 3AH6A 3M8QB 2DMOA 4K50A 1M90U 3T5KA 3RB0A 1AT1B 2VB6A 2V9KA 3ZTSA 2XS5A 3BE3A 4K8RA 1I94F 2QYZA 1WWHA 2FJBB 3HHLD 4WXWA 1SHGA 3KK3A 2M70A 2HQIA 2RNAA 2YTCA 4ZHRA 1KVKA 2MJUA 2K9GA 3ZZPA 4KGVB 1KN6A 3K5NA 5AYFA 3CCRQ 2G0IA 1OX9A 5ETPA 3UWNA 4DPXA 4DHVA 2HIYA 2K8GA 4JV5F 2V34A 4NL5A 3EICA 3EGNA 3D9BA 4I1TA 3M30B 2ZH4A 2V67A 1C0TB 2ATLA 3HCXA 4XDCA 2NYHA 2ZM6J 4XO0A 2R4FA 1Y96A 4B9TA 1M1KT 3CJQA 2HNDA 3PRVA 1WX6A 4WTOB 3OBWA 2XY7A 3G9CA 1NKCA 1IBMJ 2F63A 5AXMA 5K8OA 3U02A 1WKLA 2YUQA 2QTXA 2OMOA 4KHPF 2H4WB 1RTIA 2KMTA 2JTEA 3ZZOA 1IXDA 4NL3A 3FJPA 4K4ZA 4OMQA 4GMKA 2MYSA 4XU2A 4KUDK 3MUVP 2XMUA 4DQQA 1UFLA 2NUTB 2QAZA 3RJMB 2CQ2A 1LPLA 2AT1B 1MMGA 2YWWA 2G1DA 1OWXA 3FZBA 3W1YC 3MD1A 1WGSA 4Y28C 4RW6A 5B0EA 3MCNA 3SCJE 1IKWB 2HHWA 2E5KA 1SQGA 3AJDA 4IOBA 4KE5A 4B9WA 1HHSA 2OPQB 1KOOA 2Z2ZA 4DCJB 2P0KA 2HMAA 1IWAA 2BJ3A 4F17A 3N4WA 1HQEB 2MTLA 2LNHB 1RK8A 2XEXA 3MEDA 4Q8FA 1QY7A 2XB2D 1H641 2HWIA 4YDDB 1JJ2R 1D9DA 3QZ7A 2ZPHB 3HD1A 1OYDA 5J2PB 1HBNA 2Z57B 3CVKA 1N5YA 3RW6A 4U95A 4A8OA 4XAKA 3N9UC 3DHWC 2RILA 1L5UA 1XTDA 4M77E 3PHTA 1KQSP 3R7SB 4IG0B 3H20A 2ZC3A 5D6YA 4DPUA 3MEKA 4PG5A 1SEMA 3VJPA 1MSWD 1WI7A 1X60A 2K1RA 3R5JB 3NWGA 2DHAA 1NPRA 4QIGA 1YKWA 3DLMA 1M1HA 4OHWA 2VL1A 2DL7A 1Q7YT 2KVIA 2ZPEB 2DXUA 2DETA 4KRWA 1IKXA 2DXCA 5CCLA 1Q4RA 5J2MA 3X20B 1LWXA 1CVJA 5LXRA 4D3GA 3VWSA 3JSMB 2W8KA 4CNYA 2CWXA 3R5AA 4IIMA 2O5DA 1RHUB 2MHNA 3G82B 2X4XA 4ZVRB 1T9UA 4C5HA 4RTVA 4ZJLA 2ZITA 3NAHA 1UWBB 4K2JA 1LFPA 2ZOGA 3HI9A 3HT0A 2K3YA 3JB9k 2KJWA 1KEKA 1RABB 3FRZA 4DUZJ 1NO8A 3HHEA 1VI7A 4H4OB 1JLGA 2MKCA 4XTTA 3I55T 3TVTA 2OEJA 5JVGQ 2MZJA 3HDSA 1VQMT 5KT2A 3GFYA 3RDVA 4DV4F 3BBCA 1YWOA 1MROB 2EFIA 3PFEA 5LJ5e 4CLUA 3PW0A 2BQ3A 2DJWA 2HHPA 2FRYA 4DR2J 5FRMA 1XR6A 2NCKL 1NNDA 1R3NA 2MQLA 2HVZA 3EFSA 4F7VA 3CCST 1HBUB 3FMWA 3M8WA 2U1AA 4B3MJ 4P75A 3D1HA 2KU7A 3HP6A 3OS2A 1M0SA 2GJ2A 3IGVA 4E98A 1C4CA 1U1RA 5HMXA 3G71S 4DR7J 3SSQA 1HQUB 5GAMf 3OYLA 2OMLA 2KSSA 3MAAB 5L1IA 1VQ6Q 1GXLA 1S1UA 2M3DA 1WC1A 1VS3A 5EDWA 3ILJA 1MLAA 2H9ZA 5E0OA 2AZSA 3TP2A 4AE5A 2EQMA 4Q43A 3P5BP 1RAAB 3O3LA 2XS2A 4M5DA 1UVKA 1WDXA 4I67A 3T41A 2WHOA 4EU0A 3I55A 4P74A 4E47A 3DDKA 1BCMA 2E3IA 4BY6C 5A0LA 3E9GA 1V5VA 4OIXA 3OV7A 1PGZA 4ED5A 2A28A 1WXUA 3S3OA 2N3LA 4NCGA 4LQ9A 4DV0J 2VFSA 1NLPC 1Y10A 4L3NA 1S1WA 2PTKA 1U48A 1EX8A 4EZ9A 1PYTA 4K5SA 3ER0A 2KYXA 2M8DB 1VGYA 2WVCA 5GJWB 5J26A 1RHRB 3TJAA 2H1YA 1OS5A 3EPGA 4GKJF 4J5YA 1N32J 3CCSA 4TU7A 2BRLA 3N5FA 1Y9OA 1FCAA 2X1FA 1D0XA 1S99A 2YQ1A 2EFPA 1G3YA 1OU8A 4JI3J 1FX7A 2GGPA 2MMYA 4HVUA 3S3NA 2F1LA 3VS3A 3M8PA 1LNXA 3DYAA 1PCAA 1VQ6S 1PYSB 4FF1A 3FRYA 4M78F 3TW0A 4QYRA 2XDDA 2OTLQ 1DLOB 2CKWA 2AZ1A 5B0BA 1AWWA 4ZVOB 4NXMJ 2VBWA 4N5SA 1HI0P 4TYAA 1Q95G 2YNIA 1M3BA 4V2SA 3FC9A 3LUYA 2EIFA 1UETA 1Z1ZA 3NS7B 3T3FA 4WYLA 4PYDA 5DDOC 4WE1B 5KFUA 3K0JA 3M4GA 3UD5A 3I82A 2K3XA 3D6FB 8ATCB 2AIRB 4ES1A 2XHWA 3NGTA 2OJ2A 1YJNQ 2N7YA 1WSRA 3OW2S 1RQ0A 4ED6A 4IFVA 3V4IB 3AFGA 2PNIA 3MOZA 4FW1A 4M7AB 3AD8C 3UDLA 2EG2A 2K7AA 3UN5A 1IUJA 4OF1A 1FEEA 1M5HA 1RZMA 1EZZB 2Z8QA 2I1RA 4H4MB 1SKUB 4RNHA 2O9SA 3FEZA 3KUEA 2EFVA 4C11A 2JRSA 3OXLA 2R8IA 1HLWA 2VXFA 4JI5F 1U5SA 5CYJA 4X9CA 4LSNB 1TUVA 4BS2A 2YHTA 1R8PA 2O01C 3MPDA 2DNYA 2WSCE 2WBRA 5HCKA 2BX6A 5BR8J 5CVIA 1R0CB 2OTLS 4ITSA 3K2YA 2W4CA 2RD5C 2MMPA 1AZSA 1YTYA 3W2VB 2XY6A 1IHVA 2DXEA 4KKOB 3MM9B 4PQAA 1AROP 2QC3A 2UXCJ 1K8AT 2I38A 2R7OA 3FJ2A 2MLZA 4N76A 1FKPB 3T9ZA 1S97A 4L74A 3UNYA 3GNGA 2C06A 3H6ZA 4QVZA 4PR6A 2GBQA 4DX8H 1QMCA 3LP1A 1G8XA 3I87A 3PYEA 3UW1A 1X2QA 3FRNA 3CCVQ 1N5ZA 1YJNS 3OQ5A 4QWDA 1FT8A 4DSFA 2FVRA 5IAYA 1IKYB 2W8LA 2CFXA 4USVA 2XWXA 2DRDA 2A18A 1AFJA 1HD0A 4LF9J 5GANj 2XZDB 5HKCA 2RJDA 6AT1B 3HSGA 3M1VB 2DISA 4OZ1A 3EGUA 4RNMA 5A8RB 3FVYA 5B08A 3BW1A 3DLLQ 2IJFA 4LR9A 4FP9A 2JNGA 2Z30B 2G6FX 1CJTA 1SC3B 1XWLA 3AAWB 2OFHX 5ETQA 5ETNA 2F2VA 1BU1A 1JB0C 1AVZC 1FNMA 1V6HA 1GX6A 2VD3A 2CSQA 2CWKA 1T05A 1RT5B 4DLEA 3IO1A 4X66J 2KRSA 2UU9J 1YIJS 2CPXA 2YUNA 4LD9K 1G3TA 4LFAF 1XNQJ 1H98A 3GE9A 1V3SA 4ED7A 4F7UA 1T0TV 3OJUA 1UVMA 2D8JA 2HEQA 4JRKA 2MI6A 4LR8A 4YB6A 2VG5B 2K3IA 2W2PP 2QEXQ 2YPZA 5GAEI 2CNOB 3IS9B 3K89A 2FG0A 5FU7B 4KBMB 5KG6A 1C0MA 3NBPA 1Q82C 1QCOA 1T3SA 2DERA 2HMIA 4F25A 2AV5A 3W7BA 1VJQA 1B34B 3QYGB 4MKAA 4IUPA 1RTHA 4RPFA 1Q16B 2JHEA 3EMTA 1RAGB 3KMSA 4RW7B 1JJCB 2JMAA 1K0XA 4DR1J 2RQVA 2M8HA 4I64A 5LMUF 2R7XA 3VS6A 2LLZA 3IWXA 1CULA 2D7SA 4RTTA 3TSZA 1NRKA 4DN9A 1PHTA 1YHQT 2QTWA 4X62F 2K2VA 5KFOA 3U23A 1TKTB 4E8UA 5DQHA 2AU0A 3FSIA 3M8YA 2DRAA 5DM6Q 1EKSA 5A6WA 1GNKA 1X5OA 3W3SA 2XMKA 1RT3B 4GKKF 1YJ9T 4IUVA 1KQ1A 2CYYA 2ZVIA 1PIEA 4PXDA 3OYBA 2AEFA 2COZA 3OSPA 5CQYA 4EMKC 1FFGB 2QG9B 1X43A 3HFVA 2V2ZA 2QEXS 4F0MA 2YKQA 1BY9A 4F67A 2D8HA 2XM3A 5J1EB 3LW5E 2WSEC 4DFPA 1WNEA 4PZVA 2YKNB 1V9OA 2V8VA 4CIOA 3ONQA 1RHJB 1ZM2A 1T11A 3HHLB 2RE1A 2Z0WA 2W0ZA 4YN3B 2HHUA 1RT1B 1KD1R 1TZ0A 4ZLLA 2C0IA 3QZ9B 4C8QC 1N8RC 2QFIA 3PYFA 3ZFJA 4RLEA 3DRXA 4ECVA 2DXDA 1X5PA 2M88A 4QCLA 2C2ZB 2ZKUA 3KLIA 5HVGA 2HHHF 3G7ZA 4OZ3A 4ECTA 1WG4A 2O88A 4N47A 1HMVB 2IJRA 1RI7A 3C95A 2JTMA 1QVFR 4P2MA 1YHQA 2I2LA 2AQ4A 1HJDA 2BW7A 3MP1A 4NLQA 3GIRA 3V7SA 1FD8A 2E9TA 1R0AB 4C0GA 1XTZA 3I6PA 4J9OA 3LAMA 3CCLQ 3IR6B 4HTIA 3RRHA 1HPZA 2QI2A 3CCWA 3LPYA 2B7CB 3CD6Q 2PGCA 1HNVA 4DV2F 3CPWR 1YJ9A 3HO1A 2HQGA 3SXLA 1SQEA 1FTCA 3H5UA 2WVDA 3KK1A 1FFSB 1JIHA 4DWIA 1Y0MA 3W2WB 2PMHA 7FDRA 3CCES 4O5VA 3NRBA 2RU9A 3UR0A 3T6BA 3HVAA 4CO1A 2JUFA 5HK3A 1NHVA 1NCLA 1QDUB 5E3CA 4B3RF 2ASLA 3M32B 2K5FA 1R6VA 1XBWA 3VU3C 2HKQB 2NSCA 5L39A 1IR0A 3GG1A 4O44A 1S0OA 1XMOF 4N0AA 5M2PA 4DR6F 1TFWA 4JJBA 2ROTA 3CDUA 3UATA 1XIQA 2D74B 1R6YA 2DK3A 5DLGA 1SKSA 1N6QB 3M0QA 1TG0A 4NEYA 4DBFA 5K8MA 2P0QA 4BDPA 1KK7A 1TVRA 1TKZB 2AYBA 2DPIA 1K0TA 5ITHA 3CCLS 4ED1A 5J2NB 2IHR1 4FM4B 3KNGA 3W61A 3KUGA 4OV1A 1UJ6A 1ZX6A 3TA0A 1ZH5A 4D3HA 4E7KA 3CD6S 5J2QA 4ZLPA 4XK8C 2VASA 2L3RA 3KXTA 1G6BA 5D7UA 2X3WD 3D2WA 2AGQA 1FE4A 4IFYB 3BF4A 2ZC4A 3PNIA 3EGWB 1B4SA 1GX5A 4DV5F 3CJ0A 3UD3P 1VBKA 5KFJA 3TVKA 2F4VF 3CB4A 2Y8WA 2DO4A 3CCQT 4PABA 4ZP6A 1U6BA 4PRFA 2DVJA 1WOOA 2L08A 4K4WA 4EIKA 3TO8A 4URGA 2W2MP 2FVPA 5FROA 2F8HA 3UNGC 1LOUA 2HHVA 1BI3A 1YFNA 4M75G 3LPEA 1ZZNA 1QAIA 3GV7B 2OAWA 2W1BA 4R5PA 1I5LA 4J9CA 4HCKA 4HCCA 3J80U 5B09A 2UUAJ 4CYUB 3A5ZB 5D6XA 4BCAA 1WC0A 1HW9A 2MZTA 2V9WA 4ECSA 1B0VA 4U96A 3MI7X 1VC0A 2LFVA 6FD1A 4USJC 2ZH1A 1JQGA 3JCMQ 2WK4A 3QG1A 2HCKA 5KFHA 1ABQA 5HY6A 1SCJB 2B51A 3CDAA 3FNNA 1WYXA 2VG6B 2XSJB 3OYYA 5A6PA 3OUYA 3ZZZA 4DF4A 3SEOA 3KHHA 1AEYA 3VR1A 3C14B 3V81B 4GO7X 4A4HA 3OTCA 5ETSA 4DA4A 4NMLA 1Q81C 3I5AA 5M9OA 1HI1A 1VQ4Q 1VQOQ 1K1QA 1UVJA 5KFNA 2DH9A 3RIRA 2BUDA 1JLEA 4A8MP 1DTQA 1XERA 3OR2B 4U8VA 3CCQA 4DZ6A 2ZH3A 4RCCA 3LGLA 1FKOB 4L5GA 1VA7A 3M5AA 5EWGA 2E6NA 5CCAA 5C25B 4MZTA 4RUGA 2O66A 4IKAA 2BABA 2DD8S 1JLCB 1N33J 2DKGA 4M7AF 4AFUC 3QGHA 3HZGA 4X4VA 3CF5Q 2KG0A 3LGHA 1MMNA 2H4YB 1CC8A 1XR5A 2RHQB 1TAQA 2QMUB 3R6NA 1U1TA 3FBCA 3M4YA 4I56A 1U7LA 2JS0A 2IYGA 2WAQD 1TTHB 4RNFA 1T03B 2RK1A 4PPDA 5CYQB 1U0HA 1VQ7T 3ENVA 2X51A 2FJEB 2CPZA 2JVRA 2RH2A 3FZ2A 4A8QA 1IZ6A 2O67A 1VQ4S 1VQOS 4KB7A 3OT9A 3GPLA 4KAIA 1PNJA 5FWBA 4OMMA 2R57A 2XLJA 4WPAA 3C6UA 5F8LA 4M75A 1I1GA 1N9SA 2BZXA 3I5RA 3CJ4A 4KIAA 2B9WA 3P8BB 3H42A 5C24A 1AD5A 1YITT 2W9CB 4JI4F 2L9WA 3BDLA 3N6LA 5DGAA 2FVUA 4QR2A 4HT5A 3OW2P 1E6VA 5THWA 2IFXA 4OZ0A 2W7OA 3QGGA 3JB9G 1FRHA 2J8AA 4HVZA 1U1LA 4WP3A 4O6JA 3IA0A 3GP9A 3H0FA 1S12A 3OTDA 1BQMA 4FN5A 2KYBA 2GVDA 4A8XA 2J7UA 5ETOA 1HBOA 2GNKA 5KYUA 2EGEA 1MW7A 2D6FA 2AK5A 2OPPB 2DLPA 1WHYA 5K20B 4M78G 5GAGU 3RW7A 2MEWA 3PRBA 5DDRC 5IC6B 4WBFA 3QPIA 4DQRA 1SSFA 3PDNA 3VZHA 1B3QA 5DRKA 4FF3A 2R7TA 1KQGB 1U1QA 2DK2A 4WTYA 5KG1A 4JI0J 3EG9A 3LP0B 4F26A 5HL7Q 5L46A 3FEYB 3H5YA 2AJ0A 2HQXA 1YGYA 1VQ7A 1F5BA 2BTTA 4HEA9 2LJ0A 4HH1A 5JJBA 3R1LA 4CLWA 4YHHJ 4OYAA 3OYNA 3L7OA 4XQ3A 1KQSR 2R8GA 2RF2A 2YWFA 2ZGWA 4MT1A 1ITPA 2ED1A 2PVOB 5IV4A 2DH8A 2YXLA 2NPFA 2A1BA 1SBRA 3C3LA 2BXJA 3GR0A 5IS2A 3MMAB 2MOXA 1YITA 3JV3A 5FJ4A 4FCYA 5KT7A 3GYNA 1MMAA 2QJ3A 3UDEA 2KFNA 4U6PA 3ZNJ1 4F4AA 4OX9F 3QDRB 3VHQA 5J1PA 4IRDA 1UGRB 4Q2MA 2P6TA 1NLOC 1UEUA 4ZKAA 1BQXA 4PUOB 2VA3A 3N5BB 3M57A 2EW3A 3EVMA 2E12A 3CC2Q 1KQKA 1UA0A 1RCXB 3M0PA 2ILYA 2AF6A 2E1HA 4JI1J 3OSVA 1S6PB 3J81U 4PFPA 1EQ0A 1OPKA 3QBCA 1P9YA 2VH7A 3HX9A 1JWWA 2XKOC 1KFDA 1LK5A 1Q8BA 2JL9A 2EWHA 2VQEF 2E64A 1UGPB 3PVQA 1SUQA 5HANA 4F4KA 4NA1A 3EE3A 2J0SD 3SZ2A 1ZSZC 4OI6A 2FEIA 3LP2A 4Y2IA 2ADBA 5IWAJ 3FBFA 1OY9A 4LF5J 1VMBA 2VPZB 5L9NA 4F4ZA 4IO1A 2X4JA 4ANJA 1QVGA 4TQSA 2C2DA 2ZAEA 3VYHB 4B08A 3EGXB 1VRQC 2QQBA 2CT3A 4ELYC 1U8WA 2IRUA 4FNIA 5LXYA 3URGA 1S9EB 4RW9A 2E29A 1RYSA 3L7UA 1NZ9A 2GJFA 4F2RA 3C6TA 3MM7B 2P0PA 2VKZG 2CXEA 1HW8A 3I55S 3M9OB 1HWKA 3MTKA 3GF5A 4M78A 1KHWA 2CQPA 2VDIA 3CC2S 4IH7A 2JJ9A 3QO9B 2HNZA 4KQZA 4DOWA 2BRKA 3HJVA 1N34J 1U4BA 2M0OA 2AX0A 1NJWA 3IBWA 3LAKA 4ZIVA 4EI2A 2G2YA 2V1QA 4WP8A 2XD0A 3RBDA 4IKFA 3VRZA 1S7IA 4B3SF 4JB8B 3CCSS 4CC3A 5LMNF 4CLZA 4M7DG 3IC1A 1S1TA 1NB7A 1HD1A 1W1FA 1I07A 1ABOA 3T5LA 2BJEA 1F2HA 3LGNA 1VRTA 1UPMB 1J5EJ 5C7PA 3RKYA 4DSKA 5A0YA 1HWJA 3O8WA 4NLRA 2MF2A 3EDRB 2KZMA 1JNRB 1RHKB 3A4TA 1HFEL 3RR6A 2N82B 2HGLA 3RAQA 4TQRA 1FFWB 1GMVA 2NREA 3UF4A 1JB0E 2DTIA 2Y1RI 3LANA 1SH3A 2R9LA 2LA6A 2I6WA 1M9SA 2ZH9A 2QN6B 4U67Q 1QCNA 4CLPA 2DYBA 4K0KF 2VODA 1OY6A 2HURA 1Y00A 1G3WA 1Y11A 2AHOB 1U1PA 2FGCA 4OYZA 3AOCA 2YKPA 3NGSA 4N77A 1X2KA 2LX7A 3HZEA 1RTJA 2EBGA 4AG2C 1RT6A 4CTAA 4XPCA 2FZKB 1YBAA 1GT8A 2LCWA 1O0PA 1L3UA 4LD6A 4USMA 3AJ2A 2PUOB 3TZYA 4LF2A 1RAJA 2KFZA 3KJQB 3S8SA 1ZTTA 1T95A 3MHXA 5GANh 1M1KC 1KLMA 1TKXA 3DM2B 3DRRA 3I0SB 3RB4A 3SI8A 7FD1A 1RBOB 3QHSA 2IMOA 2ZBQA 3PV8A 3UCUP 4J91A 4AQYF 5KOWA 4RU2A 3AQPA 3UN2A 2ED0A 3FCVA 1YDLA 2CUDA 2OJ3A 3MR5A 2KYMA 4DUYJ 1Q1KA 2L8DA 2YT6A 2RI2A 3KJVA 2JEGA 4DQ2A 1ZM9A 4B9LA 4MKBA 2UZAA 3V6DB 4DLGA 1TWBA 2GTJA 2YWHA 3HFZB 1T9XA 1GCQA 3ZZYA 2QLWA 3EAEA 1W2BA 2RPNA 2B8PA 4XU3A 3DOLB 3IBFB 2F8EX 1ZAWA 4LT6A 3MZIA 2GJIA 3I9ZA 1EHWA 5IQ6A 3Q8YA 4B9SA 2XGQA 1C1BA 1QUVA 1NK9A 5GAN4 4PKCC 3PVXA 4TY9A 4A63B 3VS1A 4MFBB 2C1EB 2DAQA 3MCOA 4E7HA 5F8HA 4DL0C 2J06A 2FHDA 4C8LA 5DS7A 1BK2A 1K0SA 2IRXA 3W8GA 2IA6A 4J9MA 4Z89A 1JRIA 4J83A 1ARKA 3P8DA 2KROA 2GQVA 3CCZA 4M7DA 2IVYA 3M30A 1WTBA 2X9HA 4CLTA 1K4US 1PJ6A 2ZOFA 4NYPA 3BKUA 1UCNA 2CPEA 4DCPB 2V50A 4G1QA 2F9DA 4ZNXA 4DR4J 3MMBB 3R7NB 2HBWA 3NLCA 5G4DA 2K3BA 1J27A 4OZLA 3ENQA 2E1PA 2NQPA 4MDXA 5KFWA 2GCXA 5J3BA 3GV8B 3GLJA 1WXTA 2LDIA 1OX8A 1K1ZA 3OL8A 2EYZA 1K9MT 2BANB 3CCRT 2WOMB 4RTYA 2RNEA 1F6TA 2DVIA 1Q7YC 2LU1A 4A8WA 1C2PA 2NZ4A 3MP6A 2C2EA 3OYFA 3J7YU 1S6UA 1ZUKA 3KLGB 1BXNA 3AXKA 2C3MA 1PRMC 4A4KA 4HDHA 2EKNA 4KO0B 1WHMA 3HT3A 1S72Q 2D9PA 1JJHA 3VAJA 1IKWA 1FKAF 1J5OB 5EC7A 2RDDA 2RHIA 1YRXA 3E1SA 5JVHQ 5M2RA 4ZP7A 2UXBJ 2WONA 4PJOG 4FYXB 1RI0A 3QYYA 2VQFJ 2OPQA 2E70A 2HD0A 2FHOB 4OB0B 4LF6J 1PYOB 3QPHA 1KP6A 3JB9J 1JU5C 2CUYA 5DM7R 2RRAA 5AE3A 5C2CA 4WFBQ 3WQPA 4BDZA 2ZZNA 2CPJA 3MHYA 5J2PA 2VA2A 3UVJA 2GVZB 2HVIA 3CGIA 5D77A 2ABLA 4CI0B 4C0OC 2O4XB 2U2FA 2KXFA 1CS4B 4Z37A 2ZHOA 2CDTA 4OVAA 2O1PA 2GX8A 3TYTA 4PL6A 2XGPA 4AUKA 4M5MA 2KB2A 2E5QA 2LQJA 3D0IE 1N5VA 1F9EB 1R43A 4F2SA 3D7SB 1GBQA 4H4KA 2VDHA 2DGXA 1C1CB 3CCRA 1EP4A 4NPOA 3SSSA 1IM4A 4K7QA 3D66A 3DXSX 4XK8E 3CJRA 5IM0A 3MM5B 3JSMA 3AOBA 2R2RA 4DV7F 1V3ZA 4MKYA 2VPWB 2PVDB 2ZCFB 4F14A 1V29B 5GAOm 5CKDA 4K4YA 1WOPA 4F50A 5HROB 2CH4W 3MPYA 4XTWA 2PZ1A 3WXMB 4LRFA 2ZKTA 5KT4A 3W5ZA 3ISNC 1AB8A 2Y1LB 2QA4Q 1S1VB 1YHQS 4P2FA 4NLUA 2GFUA 1OPIA 1MROA 3MJXA 3F41A 1FMVA 1GXTA 5K14B 5AJ3F 3EFRA 1XNRF 4NRTA 5A0DA 3M55A 2IRYA 4BACA 3ZTPA 1MUZA 2EK6A 4URSA 4XIUA 2DY9A 3MEWA 2MKIA 1R8BA 5C2GA 1YJ9S 2DBBA 2HDAA 4LUDA 2X1GA 1Q82T 4C5GA 1QP2A 1IM6A 3JB9I 3DLHA 1SPBP 3ICLA 2NXEA 1NJYA 1U2FA 3MEVA 1IBKF 3CCUQ 1XOVA 3VF0B 1R77A 2VC8A 5HI7A 1SG5A 2IA0A 3TEEA 4M7AG 2J7KA 3BO3A 1DAXA 3B78A 2ALYB 4PJOA 2DHHA 3EVWA 2LDYA 1WEYA 4F16A 1RA7A 1ZAVA 4ED3A 5IXBA 1HQUA 1U47A 4DN0A 3OTOF 2EAYA 2J9DE 4RBUA 2BKPA 2VUGA 2VIHA 3MAAA 4QBUA 5GAOl 5T7LA 2HBPA 3FDSA 4K5RA 5H9EJ 4MH8A 2DHGA 2JLGA 4C8QG 1LW0B 1KNZA 2LQKA 4NLXA 5I42B 2FB7A 4CT8A 1ZM3A 4DV1F 1GFCA 4ED2A 2EGAA 1UJ5A 4J9HA 1WC5A 2ZHAA 3DGPA 5CD4A 2EQKA 2SEMA 1G2BA 3VV2B 4Y2KA 4QPXA 2YBVA 5IOLA 2HAXA 5EHHA 2OGUA 5L38A 2XYGB 4ETZA 1F0XA 4Z88A 2BUNA 4RUBA 1UDLA 3LOUA 2RF0A 4LREA 4JI6J 3TUZC 2I5JB 2DB1A 1B07A 2F5GA 2RQCA 1H73A 4BE0A 3L42A 4RTZA 1NJIU 4OZNA 3CCUS 3TQ1A 4WCIA 2A2DA 4YUDA 1LXJA 1SC4B 2MJNA 3VS7A 3ZTQA 5LL6d 2G0CA 3EJMA 3RBBB 5CH7B 5FD1A 4O3QA 3VUBA 1U24A 2ZUGA 4HHUA 4P7TA 3E2UA 4DV6J 3Q83A 4YY3F 3R8YA 1RDRA 4A53A 2HAFA 4AL7A 4J6XA 1SC1B 2MK5A 5EUHA 3CCMQ 1OYEA 3K5MA 1HNXJ 4C0DC 2D0QB 3M53A 3MOJB 1CSKA 1K8AC 4DFJA 3R6GB 2LVMA 1T02A 5I3UB 5SUHA 3KHRA 3CC4Q 4J9LA 2FHMA 1RLPC 3BGRB 1DBDA 4G1PA 4C48A 5KFPA 1W2IA 5H1SV 2VC0A 1Q53A 1MU2A 3M0TA 2EKOA 2EJGA 4YB5A 4C8NA 1JLQB 1AWXA 1X75C 5GAN8 1UL3A 5AE2A 1X4HA 1TL3B 2KRNA 1CJUB 2ZBPA 3C15B 2LRQA 1XQHA 3EGVA 4Q7AA 1IVZA 3QZ8A 1RBAA 2X3XD 4I69A 1YI2Q 1HNZJ 1MGQA 4M63A 4I0WA 4XTVA 2B3TB 4EMDA 2DNRA 2DJZA 3RG6A 2OTLT 2RQWA 2RRBA 4KV8B 3SV4A 1WJRA 3L2WA 4MIAA 3MEEB 4M7AA 4MMKA 4IQXA 3DMJB 4M77D 2VG7B 5T14A 4P7VA 2NUUG 2X1BA 2EKHA 3P6YC 4H4MA 3AT1B 1JEGA 3K58A 5DJBA 2KT1A 1XMQJ 4ER8A 1JJ4A 3NS6A 4G6VB 3NNAA 3MPVA 1D0YA 2YKOA 1URNA 4O4GB 1LWEA 3BBBA 5FRNA 3J81j 2XG8D 1YJNT 4FU6A 1E6HA 2DGTA 2WTFA 1RA6A 3OLBA 3CCMS 3MDFA 2XZTB 3OYGA 1V3RA 2E1AA 2RDJA 2B5JA 5I3PA 2HWTA 3TOQA 2DNQA 4LIWA 4NRUA 1ZA2B 2ZPBB 4IDKA 2BE2B 2DE0X 1YK9A 5KFQA 2VPXB 3NWRA 2A6MA 3CC4S 4LVOP 2J7WA 4KKOA 4U7UK 3MM9A 1MWQA 2RQRA 1G3OA 5HVHA 1HKAA 5DY9A 2RHZA 1FKPA 4O3NA 3BSAA 1JJ2S 4Q2LA 4AMCA 3MMJA 1WIEA 3HM9A 4EK2A 1DARA 4Y92A 2V8GA 3H4BA 1YI2S 2HQHA 2H5JB 5A8WB 3K8VA 4ANDA 4HLBA 4OMLA 2M4MA 2RK2A 4TNOA 3KFWX 2DITA 4PKDB 1HIYA 1ZSZB 4GRSA 2VYTA 4DQPA 1BYMA 4R0KA 3OSSC 4IR9A 4DV3J 4NZ7A 5A8RA 1RWKB 1VIFA 2E5JA 2LMJA 2ZNZA 2Q66A 2ZH6A 2OTLA 1UGSB 3FDRA 3CTRA 1RAOA 3W5YA 5LM7E 2W9AA 4N56A 2FUG9 1NYGA 2M9UA 1A7GE 2M9KA 3KK3B 5CO7A 1VIEA 3QATA 3C16A 4DCOB 3M2VA 3JCMW 4PXCA 5GAOq 3CCVT 4NXNJ 3O5ZA 1R0BG 4JI7F 1LNQA 5HAOA 3CE8A 1QSLA 3US5A 4Z02A 3UPUA 3BGOP 1Y0HA 2EJ9A 4OHVA 1YJNA 4Q5WA 4URQU 1FRIA 2J6TA 2QIFA 3C12A 4DOZA 1N8RR 1Y96B 1OQ3A 3IS9A 3PT9A 3DB4A 4OI0A 5F8JA 1SQFA 2ZBCA 1P1LA 2HBQB 2YH1A 3THKA 2GO8A 2RJZA 2HVHA 5FDLB 3BKFA 1PSEA 4LF7F 3JSRA 3VUZA 3E01B 4N0AC 1BI1A 3BN4A 4M5NA 4OMOA 2DNGA 1TL7B 4RW7A 4CM0A 3OW2R 1PJ7A 2DO3A 3BPSP 5MAOA 4MIBA 4NI2A 1YBYA 3BR9A 4RUCA 4IO9Q 9ATCB 2J6SA 1U1KA 3BQ1A 4RWWA 2G1HA 1DFDA 1PKSA 5C5JA 2XQCA 3VV0A 3HPOA 1Y5LB 4RJVA 2QEXT 2LQNA 3ISZA 3OFEA 3FBBA 3GG0A 4IQMA 4OX7A 4OMFB 2HPUA 3M54A 1TKTA 3GB0A 1M3CA 5D4LA 5GMDA 4NE9C 3SQOP 3E2EA 3GNFB 4OP0A 1NEBA 1MN9A 4J7FA 3NCPA 2GAHC 4ZA1A 4HVVA 2HQEA 3A8JA 3ULRB 2KDSA 3LQVA 4USUA 4ZVTB 4ES3A 2LQBA 1XC9A 3SSRA 3AA8A 2UVRA 3L2RA 1VISA 4DR5J 1Y7PA 2B7BB 2HQDA 3CCVA 4QQDA 2DX1A 1ZPWX 4F36A 3MEDB 1WHHA 3VZIA 2ZNYA 4X4NA 4TY8A 4PXBA 4JI8F 4DFMA 2MLYA 1EETB 5I2MA 3D54A 3JTPA 3MMCA 3Q2SC 1YRUA 2HW3A 4TXSA 5EX3A 2RVJA 2RDIA 2Y8YA 4YOEA 2YKNA 1SKRA 3SMZA 4NCBA 4LBIA 3TX0A 2QGGA 2WB1D 3KWMA 1HBNB 5EG2A 2R8KA 3DLLA 3PX6A 2E5LJ 4HACA 4LFCF 1M4ZA 1R89A 2MY8A 1RT1A 2DGVA 5KFKA 4N4GA 3T1HF 2J6FA 3Q0AA 3BJYA 5IT9Y 3PW5A 2CP0A 1FDDA 3A13A 3TRGA 2CUBA 1HMVA 5JXSA 1JKHB 1MG7A 3DGVA 1IKXB 2C2RA 5HQLA 3PE0A 5GANf 2OHDA 4IG3A 4ZVSB 5J2MB 4ZPTR 2QEXA 2LA4A 2DRMA 3U1LA 2Y4YA 2CH4A 3E3XA 3UA7A 1R31A 5HSPA 2COLA 2L3SA 3KLEA 4FNHA 4PLLA 3ETOA 4FPRA 2EG1A 3IBCB 4KULA 3AB2B 1QVGS 3T1AA 1GTEA 2RHXA 5B0DA 2KRRA 2KT3A 4WFXA 1JLGB 4LFBF 5F0WA 1JNZB 2KNBB 3U1MA 3BSCA 3T6JA 4IUTA 4JJNK 4J8OA 1VDHA 3HFKA 3W2WA 4ZVPB 1JLBB 1H8KA 3WDOA 3QJYA 1Q79A 3KTQA 2EWNA 3PVLA 3TQ7P 2BJ9A 5J39A 1TK8A 4XAXB 4HKEA 4R56A 1S7HA 5B7WA 4M95A 5LSOA 3E19A 3R1HA 3BREA 3PO5A 3CCLT 2P5VA 3NGRA 4Z7CA 1UJ0A 3M32A 4DR3J 2H51B 1FK9A 2HHSA 4OYXA 3G4SQ 2H65B 3CD6T 1X5SA 4DEZA 2LX9A 2XMAA 1NSAA 2OD4A 1SJRA 2ZM6F 2IIMA 5I11A 2MQNA 4P2SA 1WC3A 5A8KA 3IWLA 5FWCA 3V7RA 4ILLA 1KTVA 1MWYA 3QJLA 1IBMF 4C8ZA 1N6QA 1FWLA 3KOAA 1YJUA 4OGEA 1OSDA 1UPPA 2HRTA 1Z4UA 4Q44A 1K73T 2GGRA 2MZQA 4BB7A 5J2NA 1KONA 4FT2A 1Q81R 3QIIA 2PFDA 4IOAQ 1D0ZA 2MKSA 3EH2A 3VTIA 5GAGI 2K6DA 4M75C 3IP0A 4C8OA 1UVNA 2FC8A 4IURA 4IFYA 4J6YA 4M5DB 4ZN3A 4F0KA 3EHQA 2FLNA 1L3TA 1D09B 1Z2ZA 5H9EK 3OXFA 2OPSB 3HHDA 2DNOA 2LMIA 3Q24A 2DPPB 3JAMU 2I2YA 3OYHA 5AE1A 1RSCA 3GYGA 1NK0A 1X4BA 3H8ZA 4KGMA 4NCGB 4VUBA 2B56A 4QQGA 2CJQA 4M5HA 5F8IA 2QSFA 1W6XA 1UMJA 1K9AA 3SB2A 2CDRB 3OYMA 3G4SS 2PEBA 3MUTP 2KEAA 1HR0J 3G1JA 3CCLA 2YNGB 3QRPA 1QAXA 2BBEA 2A3LA 2KFYA 4B6MA 4CYUA 1VQPA 3CD6A 3UCZP 1U2CA 4QKUA 1WPYA 4O4RA 4ZJOA 2CZ6B 2FHJA 2CQCA 3Q23A 2E1MC 4U7UD 3THTA 3M8PB 4DMZA 2XNQA 3DYAB 4CT9A 4M75D 4O23A 2VGNA 1NJXA 3GSIA 1S1XA 3DC2A 2DIQA 4O3RA 1Y3JA 1IBLJ 2VG6A 3GFXA 1GH8A 3ADAC 1S4FA 4AFQC 2XLIA 3OFHA 4YTLA 1VBYA 2LT4A 2KH9A 3IGNA 1SF9A 1D9AA 2H5EA 3IQLA 1T9TA 2QT7A 1IHWA 4IUFA 4V19X 2Y0BB 1UECA 3SHWA 2LDMA 3LYIA 3P5TL 1RJJA 3BDPA 4A54A 2CG4A 2VF3A 2EPDA 5KFXA 3OR2A 3JSYA 2XNRA 2JSXA 3U1NA 4JS4A 4ECZA 2KYZA 2DHSA 1H72C 4IFVB 4QIWD 1NJIT 3MEAA 4DUZF 4KGZB 2YDLA 1Y07A 1FKOA 4QQBA 1QWFA 4PXEA 2Y4XA 3BDEA 1UFWA 4ETXA 2WW4A 3C4SA 5C25A 4J37A 3VAMA 1ACMB 3OTEA 4DUTA 1XNIA 2DCLA 2WRMA 4ATOA 2XDPA 1IB8A 2OTJQ 1W4SA 3EX7B 1I0CA 2BW2A 1VQ4T 1VQOT 2OELA 5IHKA 3QWUA 2BEFA 1VQKQ 4USHA 1WSVA 1RT4B 1S0NA 5KOXA 4DR2F 3OXGA 2E5GA 3BB5A 4DU7A 4CP5A 2JVVA 5FU6B 5D4OA 4B3MF 4ZLNA 5KG7A 3KDOA 2JXBA 2R5MA 1T03A 1NJZA 2KGTA 2FLOA 5CYQA 4WF9Q 4NLGA 2FL7A 4Y65A 5DZ6A 3SCIE 1HARA 2IY5B 4P10A 2F2XA 1B70B 3JYTB 5KFTA 5CABA 1LQ9A 3VGVA 1H3DA 4DR7F 3ZBDA 2LQ9A 4WIIA 1RWVB 3GCXP 2I8EA 2QE5A 3CULA 4RW8B 1U09A 4KGXB 2DFUA 4KHMA 1NK5A 3SDEB 4KTQA 3PTAA 4EPCA 3M58A 1FEHA 1YWPA 4A46A 3K5PA 1KC8U 3FGVA 2L3PA 4MKVA 2V94A 3CJ3A 2AX1A 4M78C 2VFVA 3KDNA 4DOVA 1CJTB 3I96A 4QU6A 3QNWB 2VOPA 4RBTA 2OTJS 1NUEA 2ZZTA 4NLOA 2CDQA 2DD4A 2C2NA 4ZTJA 1UEBA 3MF5A 3NG8A 2QXFA 4FSXA 3QSIA 1FMKA 1QVFS 2G9OA 4JYAJ 1VQKS 2ERRA 4RUAA 2HNYA 2QMWA 4DV0F 2G2ZA 2B8AA 1A9NB 2RIJA 1WDTA 4DS4A 1UGVA 4PAAA 1VQ4A 1VQOA 2P6SA 4EBCA 1YNZA 5HJXA 3CCJQ 4XDDA 4C2MA 2FY8A 2OPPA 2X35A 4W98A 1QJHA 1BWVA 3N6NA 3GTYX 5BYQA 2AGOA 1SJ1A 5KT5A 4BWJA 3CPWS 3JB9D 4DQIA 4M77B 4UUXA 1N32F 3QRQA 1H2TZ 1WUUA 4QPTA 2RMOA 4JRIA 1FA0A 1GMWD 1D3BA 4NMXA 3A1YG 1FO1A 3NS5A 2EFNA 2HMIB 4JI3F 4C0DB 3CCRS 2Z2YB 2CQ1A 4RZRA 3RBXA 1VC5A 2KQWA 4LRBA 3NCRA 1JJ2P 2BJ1A 4ZOSA 3TAMA 2W9BA 1DQ8A 5GAN2 3EG3A 1C6VX 4LBPA 3HFNA 4UOHA 1Q86U 2F7VA 1VLYA 2VKRA 3QT7A 1P6TA 4A4GA 1MMLA 4NXMF 2X7IA 2E5HA 3UQSA 3X3UA 3CD7A 4RG2A 1FRKA 4C3MA 5CA5A 2GC8A 1R7IA 1ZAXA 3BGLA 2XI2A 4J9VA 1REGX 1UGQB 2WBMA 1JLFA 2MZ1A 2JTFA 4YDXA 1EFNA 3EG1A 1HA1A 4PK4A 3TUIC 3OPKA 3WC2A 4ATNA 4ZCMA 2K2PA 4M5GA 2ZPFB 1VQLQ 2QZ8A 5C6SA 2FLPA 3PMIA 1VQ8Q 3ZZ0A 4PUOA 5IT9E 3N5BA 4YS2A 3OLAA 1M2OA 2R2TA 2B86A 4JLIA 5KTQA 2HZAA 3RKWA 3JS9A 1NSQA 4ICLB 5KG3A 5KE2A 1FWPA 4MTPA 2YY3A 2L0AA 1X4DA 3A8HB 4FBTA 4JZ4A 1ZOTA 2IM3A 3C66A 4M94A 2B6AA 2EI5A 4NASA 3LF0A 3TU4K 4LF1A 2CP6A 4J9BA 2HBYB 3TZZA 3BR8A 1SVDA 1D3WA 4Y6IA 2R8HA 1O9SA 2ZZMA 2DYIA 2PI4A 3OL9A 3K57A 1GCQC 2POKA 3DRSB 1RTDA 2COYA 3IMQJ 5BR8F 4LDYA 3B54A 4CO2A 2HVDA 3B4MA 3CC2T 3V2UC 3O6QA 3EGXA 4FKYA 3UR3C 2UXCF 3HXMA 3JSBA 2XICA 3NMZC 4DXLA 1WJQA 3L1AA 2ZH2A 2JMCA 4CM2A 2UV8A 1NM2A 1GEHA 4OYIA 1SSHA 3QQCD 5E7OB 2V68A 4CO5A 2PN6A 3FFIB 1WA7A 2DNPA 3M8ZA 1LW2A 2XK0A 3MM7A 1PSFA 1M1KR 3TAQA 1EX4A 2AKLA 1UKUA 2ZE2B 2NYSA 4M7DC 2GMJA 4KFBA 4P9SA 1HPZB 4OZJA 1WORA 3K59A 1RAHB 4LF9F 4JUVA 3FQKA 3GIMA 1HNVB 3AQOA 4LJMA 1I5OB 2GIQA 1ZUYA 2MPXC 1TL5A 1KKHA 4F4XA 4JOUA 2EVZA 3WIUA 2A36A 1FJGJ 4X64J 3H4DA 1NBEB 2M51A 2F1FA 4C0ZA 1U1SA 2AYEA 2CP2A 4R55A 4X66F 2HS4A 4P71A 1JX4A 4OL8A 3CJ2A 2UU9F 4DPYA 2FVSA 4ZDNA 3PW2A 5LJ3f 3VAIA 1AHJB 2VBYA 3GFZA 4X4SA 1XNQF 2PA3A 1SL1A 2JWNA 3H7HB 3BEGB 4F3QA 4AYBD 3RAXA 4EEYA 5H9FJ 3LTOA 3QMQA 2GMHA 3QWPA 2DR9A 2BA9A 1WQWA 4ME7A 2KAFA 2KT2A 1M5PC 2D1CA 5F8MA 2DTHA 1DQAA 3TNVA 3NPFA 1BLUA 4MIWA 2DZ9A 3UD4P 4ZVGA 5L9XA 3CC2A 1SC6A 1Q5YA 4HXJA 3TQEA 3MXHP 2W7AA 3M59A 5L8RC 2K57A 1WHGA 3HMJG 4PCQA 5GMKm 2DNHA 2DF6A 3E8OA 3QT5A 2KXDA 4QW2A 1X01A 2AMCB 2J6OA 3CXCA 4DR1F 2UP1A 1RAIB 5CYMA 3FQLA 5J2QB 4DL2A 1TMMA 2EKYA 1X31C 5DGBA 5GAEU 1FYNA 1IREB 4NA2A 1QVGP 3ZL7C 2J0XA 5CQXA 4DSIA 2E5IA 4UY8T 3JCMJ 4DBHA 4OYOA 4WU3A 3DM2A 3OJSA 1PD0A 5GANe 2R7SA 3I0SA 3PHEA 2IPOB 2R3VA 3A8IA 1S9GB 3NNHA 3TEGA 4PEOA 1Q7YR 3GIJA 4UQGA 3LGFA 2FVCA 2B9XA 4FXDA 4F7UG 4L6V5 3THPA 4NL2A 3UWTA 1EAYC 5E33A 4H4KC 1K9MC 3MTJA 1DTTB 3C8YA 4R5PB 5GADU 2EXUA 4W90B 4B3TJ 4M5IA 1QVPA 3V6DA 2G2OA 2RAQA 3G86A 4B9MA 1NSPA 3PO4A 3EWGA 3RB3A 3UFCX 2CPYA 4UTGA 1FDBA 3RMSA 5L23A 2FY1A 1P27B 5GMKl 2AD9A 3ZXWA 4KR0B 2ZJRQ 2I9SA 2OD6A 1HHTP 2HFZA 3PIOQ 1Q0NA 4ECQA 1YRTA 3PM9A 2W2NP 5DLOA 4F4YA 4L3KA 4B3OB 2ABYA 5D78A 1S5ZA 4ZPCA 1MHNA 3HRSA 3PX0A 3BN7A 5KFVA 5HO4A 3ZZTA 2W10A 2Y9HA 3VALA 4O0IA 5IQQA 3Q22A 3AHUA 4LDWA 3PRDA 3PGGA 1LEOA 1W25A 2ZDPA 5CZXA 2C0TA 4BE1A 3CC7Q 3ENAA 2X4WA 1CJKB 2QX0A 1PWTA 4YEAA 1JLEB 1UEVA 2HQFA 4RX6A 2IM0A 3KG1A 1R8CA 1DTQB 2CJXB 4ZCLA 1HK9A 3MMBA 1FJEB 3DLJA 1KQSS 3JTNA 5C42A 4E6RA 1PAEX 3JCMg 2OEKA 1VQNQ 2LJ1A 2BM1A 2YNFB 1LWCA 3PKMA 5HQ8A 4ECXA 4ZK7M 2BDPA 4B9UA 2DXTA 4QR0A 4PJOC 4IOCQ 1VYVA 1U02A 1IR1A 2WOMA 1WC4A 2QYGA 3TA2A 2DKOB 5KFYA 1P92A 4Z8AA 2ZWPA 3CJKA 1IGQA 3RYLA 4FVMA 5KT3A 1YZ7A 3KLGA 4P5NA 4FXVA 3DXBA 2GHVC 2KJVA 2V1RA 2JC0A 4PWDB 1HI8A 3EFOB 4KO0A 3HD2A 1GTHA 2XMMA 3P96A 1TELA 3C0CA 2JS2A 4FBUA 4FF4A 2EJFA 3I4PA 4F4WA 2NUPA 1TUGB 4IUUA 2LP4A 3R97A 4I6WA 2NZCA 1CC7A 1DQ9A 2EYQA 4K59A 1N5QA 3KLHA 3W9HA 2P8IA 1NEGA 4X65J 4HA8A 3S7RA 3R5CA 3SFMA 1W2BP 4OV6A 5F9LA 3INZA 4M75B 3AB4B 3AA9A 5IV3A 2Q1LA 2HSPA 1CJVB 4BE2A 4J9PA 1SJFA 3LH0A 1JLAB 1S72T 2ZJQQ 1U06A 4PJOD 3IG1B 2GVZA 2KG1A 5C24B 1WHLA 2YUOA 4ZMMA 4OQJA 1VQNS 3KFVA 2FGOA 2DIUA 4PG6A 2CS7A 1FRLA 2O4XA 3VS2A 4RU9A 3CJTA 4KGKA 2EQJA 2NR0A 2CQIA 5HP1A 4J9IA 2Z56B 3SWNB 1YZ6A 3OR1A 3CCVS 3OSNA 4I2PB 1M2VA 3ZZRA 4QYZJ 2E3HA 1ZBXA 3I5CA 2J6KA 2V8KA 2HZCA 1N4LA 4C92G 2PT0A 4WFAQ 1RAFB 3WHIA 3MEGA 1BQMB 2IYIA 2GVDB 1M90T 4K4VA 1ROFA 2L3QA 1WC6A 2COWA 1KVIA 5KYUB 2W2QP 2P9CA 4M75E 3I31A 2EPIA 2RKIB 2BE9B 3CBMA 2V4JB 1U6ZA 5GAN7 5HLFB 2QASA 1HBMB 2GO9A 2DJQA 2EVRA 4EGLA 4RL1A 4UC4A 2RHYA 2UUAF 1VRUA 1QAYA 4UOFA 2QA4G 3DLGA 2VICA 1HWUA 1LJOA 4M77F 1PRLC 5HROA 1I51B 3MCSA 2A3JA 2J05A 2AGPA 2CQ3A 3GIIA 3GJQB 4AXJA 1HNWJ 4CWBA 1S1VA 3I5BA 2RF2B 2RSQA 3MECB 3GJSB 5CIUA 1YJWQ 1U45A 5GMKj 2IIHA 4M7AC 4EYHB 4MYUA 1WI6A 2YNHA 5CQGA 3MGJA 2EYXA 2DBMA 3MD3A 1UTIA 1S72A 3L2QA 3BYRA 4NLPA 2GIRA 1EIFA 3OQ2A 4ZS6A 1HWLA 2C3PA 3Q8PB 1DJ7B 4OJ1A 3PMTA 3J80Y 2R8JA 3U27A 2NWMA 2L89A 2Y1IA 2D1XA 1K8AR 4CH7A 2M2BA 3Q8SB 3QWYA 1WOSA 1X9SA 2QA4T 2KI2A 5F8NA 1SV5A 2GS8A 2QLJB 1FJ7A 3G8TA 5IXFA 1MNEA 2GIFA 4J5OA 2YRCA 2Q6BA 3KUFA 2UUCJ 3OYAA 2HVEA 3OMGA 4J9RA 2K7KA 3ZZUA 5KFIA 1IN0A 2MZRA 4WKRA 4NZ6A 4QJVA 1N33F 3SFGA 1IKVA 3HPWA 2DNMA 3CIZA 1SUQB 1BGXT 2RB7A 1VQPQ 1WHXA 3CCUT 1WHWA 3BSOA 2IBKA 2VBZA 3V8JA 1AW0A 1JXMA 2MQPA 2QDYB 1YJWS 1Q86T 2XC9A 8AT1B 1IJFB 1F3FA 4A4JA 2KK4A 1YJTA 4JRQA 1BWEA 4V19J 3REBB 1NE8A 1WG1A 1FHTA 2PD1A 3P49B 1ZUUA 2CNNB 4C8QD 1U0SA 4C92A 4BBYA 2MQOA 1TXQA 2I5JA 3T5HA 4HYKA 3D6HB 2UUBJ 4Q0BA 7AT1B 2ROEA 1M5Q1 4OB1B 3A1PA 1T9YA 2H8HA 2DIGA 1RXOB 2EBEA 3AD9C 3TJ9A 3PNWC 4ZTFA 3F73A 3C6TB 2J0QD 3OL6A 2O3DA 3LH2S 2LXIA 2WVFA 4DG1A 2GA7A 4M78B 2D9OA 1RWNB 4ZP9A 1ELOA 3MM8B 4KC5A 4OJ3A 2DRKA 3MEUA 3OYDA 2Q79A 2D3UA 5FU7C 2CP7A 4WWSA 2QA4A 2MYFA 1OOTA 2ZOMA 1RUWA 4MJKA 1VYAA 2CVEA 2P9EA 3D3CJ 4QZVB 3R7BB 1LV5A 3LWIA 3BZQA 2KVQG 1LCKA 2UVWA 1KD1U 1WI8A 4ELVA 3QBYA 3H2VE 1VQPS 3QO3A 3PIPQ 1WLPB 4YR2A 3QKJA 1C0UB 4QIVA 1SRLA 1HYSA 5KG5A 1CPZA 5DM7Q 1VRTB 3D0HE 1K8AU 3CMQA 1JLQA 5A0YB 2KI7A 2ZWOA 4X9DA 5IT9U 1SIZA 3CCUA 2DNLA 5D4PA 3X24B 1MWZA 1XK8A 1CJUA 3C15A 3EGDA 2CQDA 4M78E 5ETRA 3H0HA 4JP8A 2CJYB 3G87A 5D4NA 2XSFA 2K2MA 3NFCA 3G2XA 4IYQA 3CCMT 4PG8A 2MWPA 3AODA 3I35A 3I0RA 2FJWA 1BQNB 3BH6B 4NLDA 1E6GA 4KV8A 4JI0F 1VCTA 4LF8J 3A8EA 3MEEA 3F44A 1YJ7A 5H9FK 1KHCA 3CC4T 3DMJA 5D6GA 2IAJB 2VG7A 2DNKA 1R8AA 1WZOA 5T41A 4QIEA 1UE9A 1HNIA 1NAQA 2Z0GA 4YHHF 2R7RA 2XCAA 3Q86A 1J2VA 5FLXY 3MAQA 3G8SA 2CREA 4OMFG 2LEBA 1RTJB 4Y28E 4BLGA 2RD1A 3GCWP 3EXCX 4OJGA 3M7VA 3JCMh 2AJQA 3S6WA 4C5EA 3SBMA 3HK2A 1YI2T 4DU8A 1PCXA 1VUBA 2MLXA 4E7JA 4G65A 4KRTA 1H6KX 1S59A 2BE2A 4I7FA 3DOKB 4J9KA 3DRRB 4DI6A 1NM7A 2WSFC 2MKHA 2MB0B 2VHGA 3H2LA 3KUHA 4Y0FA 4RNOA 2B9EA 1TSFA 1ZSGA 4CO0A 4P52A 1PO6A 2GQCA 3KJVB 2PFFB 2RS2A 2DR6A 1IWGA 2QSWA 2R7UA 1GK8A 5A8WA 4FS1A 4JI1F 4GVBB 4CLYA 1D1UA 2PVGB 1UHCA 4QWAA 2DTJA 4B9XA 3JCMb 2UVUA 5F0UA 3CCMA 3OYJA 5L1LA 5KFMA 3HHTB 2FYXA 3KK2A 4OHXA 1C1BB 5LJ3e 4XTXA 5IWAF 3CC4A 5GANg 4LF5F 4FSSA 1OYXA 4KPYA 4TLRA 3TARA 3OYCA 4J9NA 1RTZA 1JJ2A 3CD5A 4YQWA 2PU9B 3A8KA 3IRWP 4JUZA 3HF5A 2DR7A 1AOJA 1PD1A 4M7DB 1RWOB 2AJFE 2F2WA 2JOQA 4TU8A 1YI2A 3KHGA 4WU2A 1URRA 3W5XA 3J81Y 5D3GB 4P6QA 2IC3A 2OI2A 4G1QB 2OKQA 1M8VA 1AXQA 5D0HA 3HFOA 5FDLA 3AJ1A 1C1AA 1GXIE 3BGFA 1AZGB 2CJKA 4J90A 1HL6A 2YX1A 1GFDA 3E01A 2R5AA 1QLYA 3ZNUA 1TL7A 1N34F 2MKJA 5K8PA 2IVFB 3OY9A 2BIVA 3X28B 2XMJA 3KJNB 1GBRA 1RWXB 1NH7A 3JQKA 1CG2A 2A10A 5I3QA 2EBPA 3QUIA 3IN5A 3CMAQ 3QXEB 1OPLA 3DRPA 4B9VA 2GFAA 2NXNA 4M7DE 1WEXA 3J7ZT 4J7IA 2EYYA 2CRLA 3UO0A 5GAOp 5AT1B 4NZ0A 3HJFA 3SCLE 4BY6B 3MKDA 2OAUA 3NGDA 2QFJA 1J5EF 2QA1A 5GMEA 1FDAA 3VAHA 4DL5A 1FX2A 4KYZA 2EK1A 3OS5A 3D6MB 3L2VA 1R27B 2WONB 4YFUA 1M30A 1S79A 1X4GA 2DY1A 1RT2A 2UXDJ 4HTJA 1H0HB 1ZLMA 2MSSA 3MM6B 1T3LA 4MMOA 3OVSA 3KLFB 3RUBL 4I2QB 2YRDA 1LWFB 1UHFA 2AEMA 1EETA 1OV3A 3OD2A 1DY3A 3O2IA 4C3LA 1GMUA 5IHNA 3GPAA 1TK0A 3TSWA 3AHPA 3QLHA 3UVJB 1UZHA 3V6HA 4BC9A 5LJ3j 1NHUA 1D1BA 4E7SA 3M6XA 4K4TA 4M75F 1N0VC 1UFFA 1RBLA 1RKJA 4EDUA 2WW8A 2QQRA 2QGFB 2OEMA 5F41A 2ZPGB 1X27A 5L8RE 2JJ4D 1SIWB 1BE4A 1M5KC 2MAMA 2AHJB 4MYTA 4ID5B 3CMAS 4IH6A 1QW1A 1REVB 3GONA 1A6LA 1HXDA 1EP4B 3NOGA 1JKHA 1Y4ZB 1K73C 3MP8A 2MQQA 1OI1A 1DURA 4DL6A 2UUTA 4C4WA 4QYZK 1F5AA 4OZ2A 2V6AA 3G71Q 5AXKA 5IM0B 4DUYF 3TANA 1Q8IA 5KYXA 3JCMd 3FIFA 3QIDA 4UQTA 3RZAA 1X6GA 1GFWB 2YQ0A 2K5IA 3KMQA 1MV3A 2JC1A 4Y00A 2P84A 3M9NB 3POTA 2APOA 4WF2A 3J80E 1UVIA 2L3MA 3SQGB 3LH5A 1QE1A 3AY0A 1N36J 4LRCA 2D9TA 1JLBA 5D15A 2CJAA 1JO8A 3CJ8A 4UY85 2RJEA 2OUGA 4NCAA 4FDFA 3SD4A 2FHJD 4NA3A 1CKBA 2ZH7A 2E1CA 2ADCA 4BD3A 2XS7A 2WZ1A 2YUPA 1YWXA 3V5RA 3D6TB 3C2PA 1O8BA 4N4HA 1HHQA 4TVRA 4OI4A 1AUSL 2XBPA 3EZ5A 3OVAA 4MK9A 2G3RA 2DEUA 1JK9B 4ECYA 4UT4A 4JV0A 1I94J 2B43A 3X26B 4A8FA 2JT4A 4R8UA 3ITHA 2E7WA 2C2OB 3NNCA 4HI1A 1D9FA 1RP5A 2DL8A 4DR4F 2G13A 2E41A 1YVFA 1WHKA 4PJOB 2IDLA 1L3VA 5KCOA 1OZ2A 2RQ4A 2L5QA 2YXYA 4LN2A 5ECAA 1TK5A 4JV5J 3G6ET 2W2OP 5GAN5 2F5TX 4I6AA 1B3TA 1VYUA 5CKBA 5T7LB 3NAIA 4HI2A 1ZHIA 2O01E 5KCHA 3G4ST 1RI9A 5IZHA 4BDYA 1FRXA 3QIPA 1OMSA 4FZVA 3DGPB 4C9DA 4A8KA 4KHPJ 2JEFA 2A2CA 3CSKA 3KBGA 2YKAA 2OPSA 2VJVA 4WZMA 4A47A 3CO0P 2FRWA 1VQMA 1B7TA 1NJIC 1EB0A 2UXBF 2HL3A 4PJOE 2RA2A 2VQFF 3CXCS 1M5VC 4QT7A 4EO8A 3ASKA 2DCUB 2BACA 3VQTA 4LDUA 4WCEQ 2PQWA 4LF6F 1XR7A 3V4MA 2XY5A 2X4YA 3QYHB 2JM9A 3JB9F 2LQWA 3B82A 3FMBA 2YNGA 4H54A 3OS1A 1K44A 2XULA 4ZPAA 1S76D 5EGYA 4FVCA 2CZ1B 3D68A 5E3PA 2F69A 2FQQB 3D1OA 2GHWA 2IDEA 4DDFA 5E3AA 4EFAC 2JLEA 4RW4B 1UJ4A 2KHDA 1T0JA 3T1YF 1KVJA 2JVOA 3Q8VA 4F04B 4R0JA 2GHPA 4N4IA 4DL3A 4UOGA 1VR6A 2ZD1A 2VPYB 5KFAA 2VONA 1QVGR 4ZN1A 5IXUA 1TV6A 5ETKA 2K79A 5LJ5j 3EVOA 1I81A 1CBKA 1TOVA 3DHXA 3FBEA 1FVQA 4NOHA 2JW4A 3G6EA 5DLQE 2WACA 1E6YA 2VWFA 2E66A 1WF0A 3X25B 3I56Q 1RU2A 1KTQA 4LSLA 2CZVC 2JN0A 1F60B 1MU2B 5FLXE 3G4SA 4K4UA 4M77G 3CNQP 4YP3A 2P2CB 2KKHA 4ECUA 2VVKA 3IWNC 5FIIA 4QQ6A 2L9DA 1NDPA 2ASYA 1TFYA 2ZHBA 2RHUA 1WJ9A 2BE7D 2YWGA 4LQ3A 4M5JA 3B4DA 3HKZD 4G1IA 1Q8KA 3KXDA 4ECWA 4EMKB 2RT3A 2AEJA 2KO1A 2QQAA 1PG5B 4WK1A 3M8SA 2FJVA 2PUKB 2YX7A 4NEZA 2GQIA 2GTOA 2DNZA 4A4EA 4ZPBA 4PNOA 1S57A 2RQUA 4UZBA 5DDQC 1OSCA 1B64A 4E0DA 3V8LA 2FB0A 5KG0A 3ZTOA 3META 1QKWA 2XTJP 5EWFA 3LO3A 4FW2A 1NG2A 3G6XA 1AZEA 1LWEB 2HHTA 1YX2A 4AL6A 4C8QB 1RT4A 3D67A 4DL7A 4Q8EA 4L6V3 2BZYA 1YIJQ 2VZ9A 5LOQA 3HKSA 5U47A 4Y34A 2B5JB 3GZ7A 1KD1T 1N52B 3M8QA 4IDKB 1M1GA 1WKJA 1NEEA 1S1NA 2NYIA 1EARA 2V8JA 2AJ2A 2WCXA 5GMKa 3I56S 4DV4J 2XDBA 5KH6A 3A12A 1IRXA 1QM9A 2EFQA 4M7AE 1VQ5Q 4X2BA 4B9NA 2WSEE 2PDAA 1G2EA 1RLQC 2DA9A 4OB3B 2BZ2A 3Q89A 2M1HA 1XMBA 4MK7A 3JYTA 1W70A 2OTJT 4ZGDB 1QAJA 3W9JA 4D8KA 4GC7A 2A37A 3F70A 2M52A 1S9FA 1VQKT 4KT0C 4RW8A 1ZA1B 5CXTA 4CNZA 1C0TA 3N6MA 4LBHA 1ZZFA 5CHCB 4C8QE 2HFSA 2HFUA 3SDEA 4F0HA 3I9QA 1WNLA 3A8OB 3DB3A 3J81E 2M02A 2DXFA 2ROGA 2HRUA 4HR2A 1MN7A 3UPFA 4W92B 2B4PA 5LT5A 3EXYA 3DOMB 4QWCA 2YKMB 3C16B 1VC6A 1VBZA 2OSRA 3BGUA 3M2VB 4P72A 2CPFA 4UZCA 2RB6A 4JI6F 1W7WA 2NUTA 1XEZA 3WBZA 1WFWA 5GMKh 4HT8A 1WD6A 4CZCA 5I21A 2CQ4A 4KHRA 3PCOB 5ETVA 4ZCKA 3O8VA 2JZ5A 3EHRA 2HBZB 2CZ7B 1W2BR 4M77A 1RISA 1FRJA 2PE8A 1VQ5S 3HTRA 1VQ9Q 2Z2MA 4IRKA 5AXLA 3JCMc 4CC7A 1CEZA 4M7DF 2PEHA 4HCZA 2OPRB 4Q45A 1NDKA 2L41A 3PEJA 1T7PA 4DV6F 3CCTA 2JX2A 5RUBA 1HQEA 4E7LA 2M0YA 2XG8A 4QVCA 2OTJA 4GKJJ 5LJ3g 4NI2B 1U49A 1Q8LA 4AFSC 2EC0A 1HNXF 2LVWA 3PW4A 1QVFA 3CIMA 3CCJT 1VQKA 1DJ0A 4CH1A 3P3DA 1CSJA 1KRPA 4DEYA 1TR0A 5GADI 3ETMA 4DEXA 4ID8A 1F3VA 3T1YJ 1FTRA 2KZZA 3OHAA 2HRYA 1XN9A 3MUMP 1VLOA 5JUMA 2IJNA 1YCSB 1SXLA 5B0AA 1FDNA 3CPWA 4IG0A 4OYPA 3VS5A 1Y71A 4LDXA 3RESA 4Y3CA 3IR7B 4BWMA 5E5NA 1HNZF 4ZP8A 2AYGA 2DH7A 1M8MA 4J6WA 4RNNA 1KHIA 2CNLB 4DBQA 3DU6A 4J7CA 5KYYB 3CJ5A 2CKKA 2KN4A 4NLVA 4TY8B 1S72S 4CO4A 4ICLA 2J8SA 5EX0A 5BJRA 3MMCB 2J9EA 3JCMP 2DGWA 3M2RB 1QWEA 2O9VA 1VQ9S 2CYZB 3W63A 1RLDA 3DLEB 2P4TA 4MAKA 5IHIA 3CCEQ 3G82A 5DETA 3AXMA 5GANd 1XMQF 3PG9A 2FZGB 1UWBA 4OMPA 4HACB 1N5TA 3V8KA 5B0GA 1D0EA 3TZWA 3REAB 2V8PA 1UEKA 3DRSA 3WC0A 4H4OA 1VQLT 4NYOA 4ANEA 1VQ8T 2ZEJA 5KAKA 1K0VA 4ZGEB 3GV5B 1RT7B 3NTIA 2MDAA 3NGUA 2VC1A 2C3UA 2BJ7A 4CH0S 3JCMf 3DDIA 1B7YB 3Q8QB 4JI5J 5KE3A 1N88A 3CCJA 2ZH5A 5D8HB 3ZO7A 3RR8A 3TUPA 4IG3B 3TWZA 4ILMA 2RQTA 5ETLA 1D1CA 2HNIA 3BSNA 1U1OA 2P9GA 2JM8A 5IC4B 3FFIA 1N6AA 2C0OA 3HSDA 2ASDA 3FCWA 3KLEB 1ZM4A 3A3NB 2GQQA 1HBUA 1NU4A 5D6WA 1UAWA 1LK7A 4TVAB 4TKTA 2ZE2A 2W4DA 3CBPA 1OEBA 2V2VA 4PG4A 4TYBA 4LDVA 5I4MA 2E1RA 2ZUAA 3OA6A 2AZVA 2WSFE 3A3PB 2HHQA 3CMEQ 3HSZA 4DV3F 1TKDA 3H0IA 3R27A 2DGOA 1SB6A 3CDEA 1O51A 1BIAA 3M0RA 2D0NA 3IRXB 1RCOB 2JLFA 1K9MR 2ZZDA 4A48A 4EBEA 4Y2AA 1TL1B 3BY7A 2RUGA 5KYWB 3ISND 1QUPA 5KG2A 4NXNF 5HBMB 1NDLA 3BV8A 1FMWA 2CADA 3L2ZA 4DSJA 1LKZA 4GVLA 1FK9B 4GC6A 2QA4S 4PPZA 1H3ZA 2ZJPQ 3V6KA 2FDNA 5HVFA 1RUSA 4BI4A 1VQLA 2CPIA 2IM1A 3M4XA 1VQ8A 3VCDA 1NKBA 3CBOA 3HSBA 3H40A 2PMZD 2E44A 1KS2A 5A8KB 1TMJA 3QRRA 1I6JA 2DRBA 4OLOA 3P45B 2RO0A 2HFVA 2XU8A 4LFAJ 4E2FB 1FERA 4HCBA 2LEAA 2H54B 2R7VA 1KSPA 4FYDA 3DI6B 2VKNA 3CWJA 5G0RB 2K06A 2QO3A 1AUDA 1UFKA 4PJOF 1K76A 3BH7B 3HL8A 3VKIA 1L3SA 2BOAA 5LJ5g 3CMES 1O5JA 4KH0B 3HVWA 1FXRA 3NEKA 2RJCA 3M6VA 1HD3A 3ILOA 2ZVSA 4TU9A 4JV1A 1TP7A 1QKXA 4EO6A 3NTHA 4KSEB 3UCGA 4CI0C 2DEQA 5A76A 1N27A 2XYHB 2BYCA 2YSQA 2VBXA 4DS5A 3MPUB 3ENWA 3QWXX 1S9GA 4IR1A 2BM0A 5LMUJ 1DLOA 2UVVA 2F8MA 5KFRA 4Y2MA 2B4OA 2EFOA 2CZ4A 3M2UB 1IXKA 1I8FA 1FXDA 2FZCB 4PJNA 5ETTA 2V4RA 2DGUA 4JS5A 4X62J 4DR5F 3DLKB 1NHKL 3NMRA 3TREA 4FIBA 1DTTA 1ULRA 3O44A 4DSLA 1VIXA 3CUNA 3F0NA 4WE1A 2K7JA 3TVYA 4EYIB 4J9FA 4DL4A 2GNCA 1UJYA 1VHFA 2XO7A 1WQ7A 3FUYA 2AZ3A 3GLXA 1KFZA 4ILRA 4GKKJ 4U8YA 2KT8A 1N54B 1K9MU 2V0NA 4OX6A 5D0EA 1RYRA 4JZ3A 2LNVA 3R3TA 3TZXA 3FK4A 4IH5A 3UE2A 2E5LF 4HT9A 3BBFA 4BHQA 1YBUA 3GBQA 4LXCA 1VJWA 3V4IA 1S6OA 1UA1A 3GILA 3NKYA 3J7Z5 1RB0A 1S1XB 2AKKA 3WX4A 5KT6A 2C28A 1RGVA 1JXVA 2EC2A 1VBXA 4B3OA 2QDLA 4X4TA 3DKDA 1QLNA 4C8YA 1BMQB 1GXUA 5E3QA 2FJAB 8RUCA 4RO0A 2RMLA 5A2QY 4ED8A 1LOJA 1RWWB 2EQUA 5IN1A 2PSZA 1AYEA 3HVTB 1G83A 4X34A 2GQ2A 1UW4A 2Y0SD 2C3YA 4LSNA 2HFNA 1S6QB 1X4CA 3FCHA 1YCYA 1GRIA 1Q82R 4OJHA 3L2UA 3MFIA 3K8WA 4BI8B 2IMWP 4FT4A 3N01A 1CJKA 5HJYA 2MGZB 3C46A 2CNKB 3W2VA 5GAMe 4R25A 2HHHJ 2EFGA 2SXLA 2OIHA 4MDWA 5KFSA 3CXCP 4PWWA 2DEIA 3KJFB 2YNFA 1T3OA 2DL3A 1G5VA 1VIOA 2KM8C 4N8NA 4OFZA 5IT4A 2NLUA 1X8DA 2C2KB 5E2QA 1W26A 4MK8A 3ET6B 1JBMA 1YJVA 4EMGA 1IKYA 3W62A 1TAUA 3RNJA 1M90C 2LECA 3CC7T 3VQSA 1U6FA 4AT1B 1PAUB 3FEOA 2FJXA 1YSJA 2Q6CA 4DV2J 4PWDA 3M1VA 3EFOA 4A8YA 2RS8A 2MY7A 4PQUB 4EWTA 2CSIA 4M4ZA 4DR3F 1TUWA 3DDNA 1OJ4A 5LJ3h 1VQNT 4C8QF 3KHLA 3DLBA 3BFMA 3VAGA 1NK7A 4J9SA 4LNPA 1M5OC 3ULHA 4FKXA 3NMAA 1UB4A 2KRBA 2XYPB 3M0SA 4LE9A 1RT5A 3IFEA 2IVWA 4ZHRB 1KQSA 1OQKA 2DO0A 1T9VA 2OSQA 4O3PA 3RGIA 1IO6A 2AJ4A 1X0FA 4B3RJ 2KTQA 1SL0A 1SRMA 4C92C 1NKEA 4HT7A 1KC8C 2QLFB 3JCMX 1WELA 5DQGA 1S0MA 2VG5A 1KG1A 2PA8D 4YR0A 3H2UB 1CJVA 1LFWA 1JLAA 3IG1A 3ILLA 1FNXH 3L4BC 2HKNA 1XMOJ 4OLPA 4DR6J 5EWEA 2BOPA 2HNDB 1O6XA 3PIOA 4M8LA 3DU5A 2EW9A 3BO2A 2DGQA 5ETMA 1B34A 2J7IA 4HL9A 3SWNA 1H2VZ 1RADB 3V7CA 4I2PA 4Q5VA 1RTIB 4OB2B 2AP6A 2H5IB 2F9JA 5FLXU 3ZC4A 4C5IA 4WP9A 3TCJA 2DNNA 1FF2A 5D0RA 1BHNA 4CLKA 1Q82U 3S6EA 3NTKA 2HWHA 3MURP 2H48B 2HNYB 4ZLJA 4NWBA 1V1CA 4XU0A 2HS0A 2CZ9A 1RL2A 2K5LA 1EKRA 1X0PA 3BM7A 3CEYA 3CC7A 1FRMA 2XI3A 4K4SA 5GAMj 1AWJA 3Q8RB 5GAOn 2RKIA 5GAHU 4WZQA 2V4JA 1HR0F 2BKOA 2JNJA 3RUXA 5HLFA 4DV5J 4JBCA 1HBMA 2HQCA 4RW6B 2F4VJ 5D0GA 4C92D 1TH7A 2V8DA 3EPIA 4USIA 1D3BB 3QZ5B 5GAOr 1VQNA 1RT3A 3RTVA 1M1FA 2JEJA 3MR6A 1D8ZA 5E3RA 5GJVB 5CZVA 3GSDA 1Q86C 2HZVA 1H7WA 3R2DJ 3QGPA 3ILIA 3N28A 3GWCA 5HMYA 2QL7B 4J9GA 3PY8A 5B0CA 2WVBA 4JI2F 4AXIA 1MV0B 4U9RA 3TAMB 2W9BB 2C42A 3MFHA 3MECA 3JAMY 5DZ7A 2F65A 1IBLF 1KR4A 1BKBA 5J1EA 2OX7A 3C19A 4WYWA 1BIBA 3VGUA 3K7RA 2BJ8A 4ZJQA 5SZTA 3HHLA 1N5YB 1KIKA 1C4AA 1UW9A 4J9QA 3T9NA 2D3O1 5DLFA 2MPUA 3JSCA 2CQ0A 2R7QA 2NXUA 2PIIA 2BKNA 4EMHA 3CD0A 2ECZA 3HHKA 2VGMA 1JLFB 4B17A 2W7PA 5HQMA 3R2CJ 2EYWA 4PLIA 1XQIA 1AFIA 4DQSA 1BUXA 1D8YA 4NX9A 3CQTA 3I55Q 2K1RB 1F2GA 1ZTWA 2L2PA 1YJWT 2E65A 1ICEB 4CRJA 2HYIB 2DL5A 1VQMQ 1B7FA 1O75A 4BI3A 1N8RU 2DGSA 3ZFVA 5CR2A 2E9RX 3OYEA 3QAUA 4GLKA 1SH2A 2KR3A 2ZPIB 1X69A 3GQCA 2QRRA 3IM8A 2B6AB 2HL5C 3P4UB 1R0AA 1QSYA 2KRMA 3A8MB 2KT5A 2FLLA 2LTOA 1F9FA 4FL6A 3CCSQ 4AFZC 4II1A 3T19A 3FSYA 3JTOA 4N41A 3PR5B 1RTDB 2AW0A 1PM3A 4DBRA 5C0MA 2DXBA 1QP3A 5M2UA 3MR2A 2CP3A 3GJRB 1J3TA 4CLLA 2R2SA 3GU0A 5GVQA 1U2RA 5LJ5h 3N79A 4V1Ak 1Y57A