2VV5A

The open structure of mscs
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
256
structure length
256
Chain Sequence
LSYAVNIVAALAIIIVGLIIARMISNAVNRLMISRKIDATVADFLSALVRYGIIAFTLIAALGRVGVQTASVIAVLGAAGLVVGLALQGSLSNLAAGVLLVMFRPFRAGEYVDLGGVAGTVLSVQIFSTTMRTADGKIIVIPNGKIIAGNIINFSREPVRRNEFIIGVAYDSDIDQVKQILTNIIQSEDRILKDREMTVRLNELGASSINFVVRVWSNSGDLQNVYWDVLERIKREFDAAGISFPYPQMDVNFKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of an Open Form of an E. Coli Mechanosensitive Channel at 3.45 A Resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords SMALL-CONDUCTANCE MECHANOSENSITIVE CHANNEL
total genus 83
structure length 256
sequence length 256
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2008-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00924 MS_channel Mechanosensitive ion channel
A PF05552 TM_helix Conserved TM helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.60 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2vv5A02
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vv5A03
2ZDPA 2QLXA 1W2IA 2RMLA 2OAUA 3HX9A 1Y3JA 5B08A 2ASYA 1TL4A 4NPOA 2IFXA 1K0VA 2FB0A 2N4DA 2AJ1A 1AW0A 1X0PA 1S6UA 2BBEA 2OD6A 3HHLB 2PD1A 2GCFA 3HFKA 1V3ZA 2FTRA 1CPZA 3WDOA 3HHLA 4Q2LA 1Q53A 2FIUA 5B0AA 1YRXA 3BDEA 4A47A 2ROGA 1FE0A 2AP6A 1VIFA 1SI9A 4EFAC 1FE4A 2XMWA 2ROPA 1MWYA 3FRYA 2GV1A 2N4CA 2K7KA 2GQVA 3KNGA 2N7YA 5B0GA 1Y0HA 2PGCA 1Y3KA 3DXSX 5F0UA 1KVIA 1AFIA 3I9ZA 2AW0A 1AFJA 2K7JA 5K9FA 2BUNA 2G9OA 3HDSA 1KVJA 4QOTA 2GO8A 4Y2IA 3F44A 4YEAA 2QLWA 2BJEA 1TR0A 1Q8BA 1CC7A 2EW9A 3DCAA 2HIQA 2Q3PA 3CJKA 2IYGA 5B09A 2ACYA 1YG0A 1VIEA 1TZ0A 2GGPB 1FEEA 2KYZA 4FNIA 1OQ6A 5A6PA 2XMVA 3HF5A 1SB6A 2RILA 3KKFA 4OJ3A 4A4JA 4DN9A 1URRA 4DPOA 2W4DA 2HFNA 4F67A 3BB5A 3QMQA 4FNHA 3BN7A 2K2PA 1FVSA 1FESA 1TUVA 1ULRA 1WD6A 1YJTA 1U7LA 3FMBA 1JK9B 1VQYA 2LDIA 1CC8A 3IWXA 2OKQA 4NL5A 3TNVA 2P4TA 2L3MA 2BJDA 2CRLA 2ZDOA 1Q4RA 2VH7A 3K7RA 3KG0A 4HI1A 3SFMA 5F0WA 2OFGX 2XMMA 2GA7A 4Q2MA 3FGVA 1SQEA 2KT2A 2QYCA 3BGUA 1MWZA 3GZ7A 4OJGA 1S6OA 1TL5A 4A46A 3MZIA 2BYCA 4HI2A 3E8OA 2HLTA 3LGNA 2LXFA 1LQ9A 2QIFA 2W4CA 3LO3A 4HL9A 5B0BA 1X8DA 2XMUA 1IUJA 4OIXA 4Y2KA 1FVQA 1OSDA 5T7LA 1YJRA 2XMTA 2GGPA 2RH2A 2KT3A 1N5QA 1OQ3A 2OFHX 2RU9A 2K1RA 2OMOA 2HQIA 3BM7A 3BR8A 2HFOA 2VV5A 1R6YA 4Y2MA 1YJUA 1KQKA 1N5VA 4DL0C 5B0CA 1RJJA 2RK2A 3MCSA 2JDJA 4U9RA 2K1RB 1APSA 5B0DA 2RK1A 4YDXA 1QUPA 5B0EA 1GXUA 3TOQA 5T7LB 3KG1A 3IWLA 5B0FA 3LGMA 2XMJA 3HHLC 3TRGA 1OPZA 1X7VA 3UDCA 1FD8A 4ZOSA 1VQSA 4OJHA 2ROEA 2W4PA 1P6TA 4ZA1A 2LQBA 2AJ0A 2RSQA 1XBWA 1N5SA 1Q8LA 2FHMA 3T9NA 2HLUA 4HH0A 3HHLD 3CJKB 2LQ9A 4OJ1A 3VTIA 2GFFA 1GXTA 2XMKA 2OD4A 2KKHA 4A48A 3QGPA 1N5TA 1Y9OA 5A6WA 4HH1A 2IYIA 3BF4A 5IXUA 2OP5A 1YJVA 1JWWA 5KAKA 1P8GA
chains in the Genus database with same CATH superfamily
3ZZ0A 2WSEE 3H4BA 3OSSC 1FJ7A 3AB2B 1MN9A 1VJQA 3LYIA 4LREA 3HHTB 4M77F 2GIFA 1D09B 3N5BB 4RZRA 3L2VA 2LJ0A 4F3MA 1UTAA 3SDEA 3POTB 1C2PA 2HS0A 4MK7A 2ZHAA 4WKRA 1ZUYA 4UY85 3M7VA 4HT8A 2UV8G 1U1SA 2YQ0A 1AFIA 4EMKC 5D7UA 2R7RA 4GC6A 1SUQB 2UU9J 1W2BA 2PSZA 1VQ8T 3DGPA 4F16A 5GAMj 5J2MB 1YJ9Q 3CDBA 1U1LA 2Z57B 1FT8A 1CSJA 3W61A 3SWNB 4LE9A 4OB0B 2L48A 3FEXB 2OEJA 4B6MA 1DY3A 2LU2A 2J6KA 4JBCA 2DILA 2DD4A 2E9TA 1D1UA 1X75C 5DG7A 3AOAA 3EPGA 1IREB 2DCUB 1B64A 2YHTA 4EMHA 4F8RA 2W9AA 3TO8A 1JLGB 4HEA9 3VUZA 1GX6A 3KWMA 1X01A 4J9MA 2JLFA 1ZOTA 3A1PA 4Q5WA 5KCHA 4LSNB 4CH0S 2I2YA 1N36F 2WSFC 4TXSA 2MQNA 5K8NA 2HBRB 4DL2A 3Q0AA 3MM7B 1NJIC 1B70B 1QE1A 4DV3F 3N4WA 2RHQB 2C3UA 3AAWB 2WVFA 4PKCC 3DFEA 2V6AA 1QKXA 3MOZA 2K5FA 4OB1B 5F8HA 1H38A 2DVIA 1SUQA 1P27B 3T5JA 4ID5A 2UXBF 1NM2A 3SMZA 3JCMX 1NK7A 3R6OA 1K4US 3C16A 3HHEA 3HL8A 3PFSA 4CLTA 1TXQA 1Y3KA 1EX4A 1V29B 3NS5A 4OL8A 1VHIA 3MMAB 4I6WA 4X4OA 3G4SA 2RB6A 4USVA 3HKSA 1P9QC 2AJ2A 4A4KA 4E2FB 2U1AA 2DPJA 2CNOB 4EBEA 4GKJJ 4C92D 1D9DA 1I4K1 3K5PA 3P8BB 3CXCP 5A2QE 2DEJA 1Q0NA 2J9DA 3K59A 2PFFB 4LRAA 2EVZA 4I6YA 4KO0A 2MOXA 2FQQB 2RS2A 4M7DB 4EMKB 2BJ9A 3G86A 5A0LA 3J7YU 1KWMA 4RO0A 1LVKA 1GMWD 2JM9A 4U8VA 1S72T 3CPWA 5FU6C 1S77D 1ABOA 1LJOA 3H20A 5D77A 2ZH9A 3ZZPA 5GAMf 3MUMP 1D8ZA 2KT8A 4DFJA 3U1NA 4LR7A 2FYXA 2P0KA 2YSQA 4JRPA 4C8QC 4WYLA 3I6PA 4YP3A 4F7UF 2YX7A 2FRYA 2GIRA 5LMUJ 2WACA 1X9MA 3AQPA 1FDAA 4WK1A 2XU8A 3OVAA 2ZDPA 4F7UG 4TYBA 2O01C 1K0VA 4OX7A 4RU2A 3MEAA 1NJXA 4B3OA 3HVTA 1G3TA 1AZSA 3UI3A 2JUFA 4ZPCA 2KB2A 4O0NA 4R5PA 5DG9A 3OS2A 4ES1A 2P5VA 4M5DB 4M95A 2YQ1A 5KFZA 1XR6A 3MEVA 2GJIA 3CC2T 5GMKe 4RW6A 3TEEA 1N33F 2QYZA 4L3KA 1UTIA 2V4RA 4K4XA 4RCBA 4MK8A 1FRHA 1RT1A 2JNJA 1VIXA 2HNIA 1HBUA 4TVAB 4DR7F 3EFOA 4HCZA 2SEMA 1YG0A 3M59A 4DA4A 4BE1A 2HFNA 3LWHA 2V8DA 3L7UA 3TSZA 2RJEA 4ZITA 4DI6A 4B9XA 3C95A 3JCMQ 4JI0J 3LTOA 4CLYA 2F69A 1NHUA 1Q7YR 4ZVSB 3CJRA 1WIEA 4RR5A 2D3OR 3VKIA 1RI9A 1YHQT 5I42A 4N41A 3GE9A 5I3UA 2RK2A 1KC8C 1N0VC 3ZZOA 1NCLA 3NLCA 3UDCA 1KQSR 2HQ3A 3M30B 2I5JA 2VPYB 1Q8LA 2JOQA 4PJOG 3PJXA 1DLOB 3DMJA 2YXYA 4G3IA 1TQLA 3VWSA 1JB0C 1AUDA 2VVKA 5DZ6A 5IAYA 2FPHX 3QWUA 3SD4A 2VA2A 3RR7A 4M77A 2Q1LA 3VGUA 4XTWA 1IWGA 4OX9J 4LF5F 1U09A 3HSGA 2OX7A 1PAUB 2ZZTA 5IH2A 1OPLA 2RO0A 5EUHA 3CCJQ 1RT5B 2BKNA 1PC4A 3H42A 5GAMd 4XIUA 4PPDA 3JRZA 2K3XA 9RUBA 1UA1A 2KYMA 2EGCA 2MQLA 2AKWB 3V6JA 1B34A 1CSKA 2V2ZA 2AZ1A 3M8QA 4JV1A 3AXMA 2MWPA 2EI5A 1JKHB 1IBMF 4J8OA 1NRKA 5LJ5j 4Z37A 4IO9Q 4JI6F 4C8ZA 1YJTA 3TJ9A 3MEEA 3WC0A 3RKXA 4LIWA 1FYNA 2HVEA 4WFAQ 2E5GA 1T3OA 4KHPF 4C0HA 4K2XA 2FLLA 1YIJQ 4RX6A 1YHQA 3MM8B 2AJ4A 1W70A 1KQKA 3QSIA 2W9CB 3D7SB 2R3VA 1YBAA 1RYRA 2RHUA 3AXKA 5M2PA 1KC8T 1VQPQ 4ZP8A 4YB7A 1OPZA 4XPEA 2AU0A 1Y5NB 4DF8A 2AYBA 3JB9J 1O6XA 2NXUA 2QSWA 1C1CA 2BKDN 3UDVA 3T1YF 2Y8WA 3MKDA 4KGMA 3PIPQ 2YUOA 1O5JA 4TQRA 1UVKA 4DQRA 2W9BB 3LUYA 3R1LA 1F60B 2IHR1 2OTJT 2P2CB 2DRDA 2E64A 2JJ4D 2H65B 1BGXT 4QR0A 1HD1A 4BACA 2OELA 4R8UB 4LQ3A 3OD2A 3JS9A 2VA3A 1U06A 2KYBA 2QDYB 5GMEA 2PA3A 1G2EA 4JLGA 1QWFA 3DB3A 2HL5C 3W5ZA 2IM1A 3WQPA 3MAHA 4UZCA 4JI0F 2DRBA 1YZ6A 3M8WA 4PUOB 1L3SA 2MZJA 2W9CA 4IH6A 2MK5A 1FKPA 1GXLA 3PR5B 1VYVA 2DY9A 5JXSA 3GSIA 2E9ZA 3CCUQ 2PIIA 5L8RE 1HYOA 1IBKF 3EG9A 1YJWQ 5RUBA 3W1YC 3MEGA 3GSDA 1K0XA 3QJ6A 1UA0A 4CLLA 3IBCB 2VQEF 1RA7A 1D3BA 2K6DA 2HZYA 1UB4A 2XMJA 2MKKA 4N77A 4EMGA 4HCCA 4WE1A 2V4QA 1OYXA 2GFFA 3JCMW 4ZCKA 2CDQA 3F41A 2QA1A 3BSOA 2GHWA 3QRPA 2W2PP 4N4IA 4X4RA 5IN1A 2AYGA 4J9QA 1QVFS 3G6ES 1HPZB 3INZA 2YKQA 2DXFA 4QWAA 2FIUA 5HMWA 3TARA 1S49A 1RTIA 1ZM4A 3GG1A 3QPIA 4ZN1A 2KFYA 4NEZA 1VYTA 1PD0A 4M7AB 3TA1A 1V9OA 3CCSS 2G3RA 1RDRA 1IBMJ 3M8PA 2DVJA 1HNXJ 2P0QA 4JI6J 4H4KC 4JI5F 4M94A 2WSCE 3ZC4A 5KFAA 2M7SA 1NMEB 4EK2A 4MIWA 1GCPA 4I7FB 4RNFA 4WP3A 2CJYB 3G1JA 3M0UA 2MLXA 3EE3A 2VL1A 1A0OB 1BHNA 1RT6A 1M2OA 5KYWB 5E3QA 3PKYA 1XC9A 1NPRA 1PC5A 2V67A 4ICLB 3MFHA 2XDDA 4M7AC 2F2XA 1H8KA 2RT3A 4FIBA 2G1DA 5L38A 4M77D 1IB8A 1N5ZA 1QCNA 1JLQA 2W7OA 3ZTPA 5DG8A 2HVIA 2OEKA 2CQ2A 3TRGA 5H9EK 3M5AA 1VQOT 3B6BA 5IV3A 3FBCA 3OTDA 1FHTA 2B86A 2BM0A 1WC4A 3EGXA 2COZA 4YOEA 4JI8J 1XNRJ 1RT1B 2W2QP 4ECUA 3ILIA 3QIDA 1FWKA 2O2OA 3HRUA 3CCTA 4M78A 3R97A 1PO6A 4TQSA 1NB7A 2WOMA 1VQPT 1ZSZA 2O9SA 4EYHB 4RW8A 4IUPA 1TUCA 4LFBF 1J5EJ 2O88A 3HVTB 2ZGWA 1KDNA 3CIMA 3PCOB 2JZ2A 4PJJA 4BDPA 4MDWA 2AW0A 1IRXA 1Q81R 3TUIC 5LJ3e 5ETVA 1RT6B 3J81Y 1V3RA 3QO3A 1IR2A 5M2RA 3KK1A 5D4OA 4JJDA 2PVOB 5CYJA 4ZVRB 1IBKJ 4XTZA 3I0RA 4DCJB 4WU3A 2HS4A 3PACA 2I2LA 2XI2A 3H0IA 4F14A 1VQMA 3JTNA 2IDLA 4JV5J 1X69A 4OYPA 4BCAA 3PT9A 4OJGA 4KUIA 2QX0A 2RRAA 1KS2A 5C6SA 4M5IA 2LXFA 3LO3A 4RG8A 3SEOA 4CT9A 1SPBP 4C8LA 4E98A 2KT3A 3VS0A 2F3JA 3N5FA 1VQNS 1Q1KA 1F1BB 1WYXA 4JI1J 5FU7C 4G6VB 2WRMA 2GF7A 3CCQA 3KG1A 4JRIA 1NPKA 3CCQQ 1FNMA 5KFEA 1I81A 3CJ0A 2JVOA 1VQNT 3JSMB 4M7DC 2RDJA 4IG3A 4FCYA 3G8SA 2E1CA 2X35A 3UD5A 2HDAA 2VOOA 3TX8A 4Y28E 2LCWA 2RJCA 1S1XB 3BBBA 1IGUA 3DRSA 1PBAA 2COWA 3QXEB 4C3KA 3E51A 3ILLA 3GV7B 3D9BA 2XY5A 2L3PA 1F6TA 4NS5A 1GK8A 4WF9Q 1JLCB 3ADAC 2EYXA 5CD4H 2CQIA 5AT1B 4UC4A 3OT9A 1F9HA 5JVGQ 5IWAF 2AEJA 2DVEA 5F8GA 2HWTA 4AFFA 2BZ8A 1M8VA 2EBPA 2GVZA 1ROFA 5LJ5g 1CVJA 2Q6CA 2DGXA 3M55A 4I2QB 4ZS6A 2GGPB 1Q81T 5J1EB 1VQNA 1TWBA 1D1AA 2O9VA 4M5HA 3I96A 4QU6A 2MXYA 1Y5LB 1G3SA 1S72S 1T05A 1EP4B 5D8HB 1YN8A 2XGPA 1U8RA 3UATA 4R56A 3GZ7A 4FF4A 2VWFA 3E8OA 4CT8A 2BUDA 3M4GA 1I3OB 2X4YA 4DV7F 2EGAA 1WDDA 3GLJA 1FWZA 1T9UA 5D4LA 3D54A 1CJVB 2BJ8A 2ZKUA 5CXTA 1IKWA 3QZ8A 1NDKA 2PU9B 3IC1A 4J7FA 2CZ9A 1HNWF 1KIKA 4M75B 2DNZA 3C8YA 1K47A 1J5EF 3ISNC 3VAKA 3SDEB 2KXNB 2UVRA 2DL3A 2EBEA 2CPXA 4MKYA 4WFNQ 4QWCA 1SJRA 2VFSA 4DG1B 3KUFA 3R6LB 2BQ3A 3R7SB 1SJ3P 3RKWA 4FYXB 3PTAA 3MPUB 1VQMQ 3VRYA 3KLIA 1D1BA 3CJKA 1PAEX 2QA2A 3OR1B 3BSNA 4TY8A 1VLYA 3UDLA 1EHWA 2DAQA 2ZH7A 3CCRS 1M3AA 3CD6A 3V7SA 1YJ7A 1R8OB 1WFWA 3M0PA 2VPZB 2IVFB 1FERA 1HSQA 3NGUA 1B07A 3QWPA 2LXUA 1JLEB 4V19X 5KFLA 1HKAA 3CCVQ 4QWDA 2MZRA 4LF6J 1TUWA 3ENVA 2W7AA 1EB0A 2KRNA 3TAMA 5KFGA 1UWBB 1VC0A 5IT0A 1HBOB 2P9CA 1BC6A 5LM7E 4BDYA 2CJKA 1IJFB 3LF0A 2QL7B 1N36J 3DLLQ 4M77G 1I94F 2PVGB 1AXQA 1FD8A 1YRUA 5EC7A 2J76E 3R3TA 4YB1P 2JC1A 2DO0A 3QWYA 3M6XA 1M5VC 1YJ9A 1GAOA 1JLEA 2J8SA 5CKEA 1ZZFA 3NGRA 2OP5A 3TCJA 3QAUA 1QDUB 1I5OB 4OVAA 5GAEU 2HMIA 2YBVA 4ECSA 2R7XA 3SCJE 1QW1A 1RT3A 4AFSC 3GYGA 2C2EA 2PUKB 1TKXB 1WHLA 1QJHA 3RGIA 2AP6A 4DPUA 1D0ZA 4GC7A 3DHXA 3HRSA 4QCLA 2MKIA 3A98A 3BY7A 4F4XA 5D0RA 3PVXA 1WI6A 3GR1A 3S3NA 3VVUA 5D3GA 3A4TA 1J5OB 4HXJA 4X65F 1CJTB 2C1EB 3BZQA 4ECQA 2ZNZA 3JCMJ 1WD6A 6FDRA 3CBPA 3FMBA 4MJKA 3CCET 5IT9Y 3BGUA 3G71A 3R5CA 3NPFA 2BJ1A 2K2VA 3NCRA 4RW6B 3JCMb 1X5TA 3PJWA 1NK4A 2WONA 4M5DA 4Y2MA 1SH0A 3D1QA 1EIFA 1UEBA 2JTMA 2KK4A 5EDWA 3DHWC 3GNGA 1XR7A 3TOQA 3CCMT 4CLZA 2O5DA 1R31A 3DOLB 2MY7A 2PQWA 1Q5YA 4B3TJ 4DZDA 4RTTA 3UT1A 1S0MA 2G2YA 1MG7A 5HK0A 2D0NA 3OYAA 3G82A 1W2IA 1SF9A 1U2FA 4PJLA 3MPVA 2YT6A 3CCRA 4O3OA 1V3ZA 3DU5A 4E7ZA 4CTAB 5E3CA 1WQ7A 3SI8A 1B99A 1M1HA 4C4WA 5H9EJ 3ZL7C 1YBUA 4LFCF 3KNGA 5F0UA 2CJAA 3MM6A 1NUEA 2LXIA 1JJ4A 1KD1U 3SYZA 4HVWA 2VXFA 3AA8A 3I56S 3KXTA 3CMAT 2F5TX 4O23A 2KR3A 4A4JA 4AD6A 5DDRC 2D3O1 4Q8FA 1ZHIA 4NOHA 1S1XA 1JLQB 4URGA 5E41A 2DPPB 3RESA 2OUGA 2UUAF 1ZUKA 4DOWA 3SFUA 4ZIVA 5FDLA 4ZJOA 1SQEA 1XJWB 2DNGA 4ZTJA 3R5AA 3QSYB 2CP7A 4ECVA 2A6OA 2DERA 4FN5A 4X84A 1FVQA 1TMJA 1H92A 2V2KA 5KYYB 4C11A 2QASA 4DBQA 3MAAA 2IM3A 1B7TA 1KTQA 2LQKA 1V1CA 2MKYA 3MF5A 5L1LA 1UJYA 2ZFHA 4U95A 4B9LA 5L1JA 1UUEA 2EFIA 2KJWA 1RT7A 2VG7A 3CMAA 1QE1B 2QEXS 4F4KA 3A8GB 2RH3A 4DR4J 3OW2P 2VKNA 1JWWA 1ICEB 5KAKA 3D2WA 2MZ1A 4O3NA 1TKZA 1GFCA 4DL7A 4IH5A 1JLFB 3P8DA 4GLKA 2CQ0A 2VOPA 4JRQA 4C0ZA 5H1SV 5SUHA 3J7Z5 2L3RA 1JEGA 4A8SA 4WTYA 4NZ6A 1X4BA 2VQFF 1RXOB 4LF8F 5I2MA 2E5KA 4F7UB 1H3ZA 4M78G 3I55A 2MZQA 4C0OC 3EZOA 1WSVA 5E3RA 3IBFB 4MZMA 1LFPA 1OJ4A 2R7TA 1MLAA 1PKSA 4PAAA 5LXRA 2HQXA 4U6PA 2XTJP 2MY8A 3RW6A 4FNHA 3AQOA 2XICA 1ULRA 1NB2A 2AD9A 3LW5C 4OZ2A 5IT4A 2IJRA 4DXLA 1SKWA 1WG1A 4MIAA 4K7QA 3EG9B 3OL8A 1SG5A 1WEZA 1TS9A 2FJDB 2J7IA 5LJ5f 1MU2B 3K17A 2HW3A 3MCOA 4FM4B 4L59A 1J5OA 4A53A 2DETA 3W63A 3QZ9B 2IMWP 4J9IA 2D69A 4R25A 1SHGA 2ZH3A 4OJHA 1VCTA 4FF2A 4UT4A 3PHTA 1IGQA 2CKWA 2QT7A 5K20B 5F3TA 1FO1A 2YPZA 3CXCS 3W2WA 3ZZRA 3O1LA 2KYXA 3D0HE 2P8IA 2BZ2A 1R43A 5F8IA 3TREA 3E9FA 2H4WB 4DX7A 4I7FA 3ZTRA 1WORA 1G4CA 1XK8A 1QLYA 3T1HF 5DO2A 1SRLA 4P9SA 3OYGA 2YKMB 2GMJA 5BXIA 3BPSP 2CJBA 3I4PA 1U8WA 4OX6A 1YIJT 2MGZA 1B0PA 2W9BA 4JI7F 3GFHA 2C0OA 1UVNA 4QYRA 2B8QA 4DQSA 2D3UA 3ZZYA 1GXIE 2FRWA 1WEYA 4MAKA 4E7KA 1PYSB 3BEGB 5HMYA 3Q8RB 3VALA 3ULHA 2UXDJ 4HT9A 3OFFA 3D0GE 1Z2LA 2M9KA 2WB1D 2RDIA 1OOTA 4HKQA 2PZ1A 2DBBA 4UZBA 3R8YA 2YNHB 4ETXA 2JSXA 2YQ3A 3CMAQ 1NHVA 1Y5IB 2O67A 3RKYA 2ZH1A 3OR1A 1HW9A 1U26A 2HQIA 1OV3A 1F2HA 2IA0A 1I1JA 2OPRB 3QGIA 3GCWP 1Y0MA 2J0WA 1VBXA 2D9OA 2CP5A 4LUDA 2L9WA 4J9FA 3DLMA 2EGEA 2OPPA 2ROLA 2HHQA 4MYUA 4DG1A 3PHEA 4C5IA 1HMVA 2DZCA 1MN7A 3C3LA 4UUWA 1VK8A 3MP6A 2XBPA 4DDFA 5IHIA 2H5EA 2HAXA 4WKYA 3OTCA 2JL9A 5GAN3 3D1OA 4M75A 1FXXA 3THPA 3HSDA 4ZVPB 4XU1A 3ILJA 3CT9A 2GV1A 3M2RA 4R8UA 1C4CA 3W7BA 4NLOA 1JO8A 1U1RA 3H40A 4XPCA 1LWCA 2MQMA 3VR1A 3I5AA 1IQZA 3OTEA 1HQUB 3VAGA 4FW2A 2UUTA 5K8PA 1HYSA 2I5JB 4L72B 3ELHA 5D4NA 4YHHF 2D0QB 1OSCA 1V5IB 3K5OA 3V4IA 3FSIA 3PE0A 1K1QA 1YX2A 5I3UB 2HGMA 1ZYQA 4D3HA 2C2OB 5L46A 1EP4A 2WTFA 4K2JA 1TFWA 3SB2A 2GMHA 1U1OA 1TL5A 4L3NA 5IFMA 2LEPA 2AQ4A 1VBKA 4RTWA 3FBBA 1T3LA 4FF3A 1TVRB 2KXCA 1NO8A 2GGPA 3UQSA 4CNZA 2HAFA 4ZPVR 2NCKL 2MKJA 2LJ1A 1UPMB 4CO1A 2MDAA 3W9IA 1BB9A 1RL2A 3DDNA 1YJWS 4ZNXA 3V7CA 1IR0A 1XOVA 4HH0A 2VJVA 4BC7A 4ZVUB 5CCAA 1OWXA 2H48B 3EGWB 1GNKA 1AYEA 3CSKA 4IUUA 3FVYA 3SV4A 1VQOS 2GTJA 1KR4A 3HK2A 2GCXA 2LP5A 4KBIA 1LWEB 4HLBA 1WEXA 1SJFA 1WQWA 5KYXA 3G9CA 4FVCA 1YFNA 4YFUA 2N7YA 2RRBA 2RE1A 1YJNA 4YEAA 2R8HA 4C97A 3QSUA 3OYDA 3E3XA 3O6QA 3V2UC 2F7VA 1RWUA 2DMOA 3OTOJ 3LAKA 1HYSB 1NLPC 2RQMA 1JK9B 1UKUA 2Y0SD 3KLEA 2ZPBB 4HI1A 1BBZA 3TVTA 2VG7B 4J9BA 3CC7T 2KT2A 2YNGB 3PG9A 5KG0A 4QWEA 3LPYA 5LJ5h 1VJWA 4URSA 4OGEA 2VICA 3CBOA 3BR9A 1KTVA 4LBIA 4C0FA 4OB2B 3KTQA 2RPNA 1WWHA 4OYZA 1FDNA 3CCMA 2FVCA 5BYQA 3KHLA 5GAOr 4KGZB 2YWEA 3QUIA 2LQBA 3REAB 2OAWA 4NCBA 4FXDA 2JJ9A 3OYKA 4A48A 1HMVB 4Q43A 1VQ8Q 3FDRA 3P4UB 2RNEA 2BRKA 2IA6A 4NCAA 3BH6B 4HKEA 5J2QB 3LWIA 1RU1A 1HJDA 3CPWR 2C0TA 1S6QB 2HGLA 1NKBA 1U1KA 2ZITA 3QT6A 4OV6A 1GH8A 4NXNF 1QAIA 2J9EA 4KIAA 2DJZA 2WHOA 2HNZB 2KU7A 1Q81U 5L1KA 2VFRA 5GAN4 2DA9A 5H9FJ 1XNQJ 2MQOA 1QVGP 2QLWA 4CTAA 2QLFB 3L2ZA 1LOUA 3HTRA 1RYSA 5GAN8 2DCLA 3VS3A 5LT5A 4LSNA 3BN7A 2Y9HA 5BJRA 2HURA 4WIIA 3OS0A 5CH7B 4OYWA 3KK2B 4Z88A 4M5NA 1JLGA 3FUYA 4NL3A 2D74B 2VH7A 2XZTB 2NUUG 1RTZA 1M3BA 2QA4S 4X64J 4ED2A 3M4YA 2P9EA 4DV7J 2M16A 1NXIA 4PPZA 4DV6F 4M7DD 3GFXA 4MTPA 1ZM3A 4HL9A 4OMFB 3Q8YA 3FK4A 2WK4A 2GHVC 3NAHA 4DPTA 1AD5A 5A8KB 2AYEA 2YKMA 2YLCA 2XULA 2QMXA 5ITHA 2XYPB 1RAIB 3T9NA 4Q44A 5CAAA 1NJIT 4ALZA 1UZHA 3RUBL 1IXDA 4YUDA 1Y7XA 4USMA 1DQ8A 5GANh 3A13A 4WFBQ 1RP5A 1UWAA 5HL7Q 1XERA 4JV0A 2BEFA 3POTA 2EKHA 3U7JA 1BIBA 3EFRA 1OULA 2QQRA 5AXLA 2DNYA 3JCMd 1IBLF 1MU2A 2Q66A 2CG4A 5DS7A 2O01E 1RTDB 3HRTA 5CHCB 3R6GB 1AVZC 3THVA 3TANA 2EQKA 2GQ2A 2ROTA 2NZCA 2V8IA 1MW7A 1MV0B 4JLIA 2K5IA 4DN0A 2E3IA 1UEVA 1QMCA 2HMIB 3DRPB 4K0KF 3SCLE 2RDDA 1SIZA 3HHKA 2LDIA 2RQWA 1I6JA 1VQ6S 3ETMA 2QLJB 2FEIA 1SH2A 1LW2B 2J9CA 1HBMA 4P7TA 4X62J 4A46A 4LRCA 4ZJQA 3KK3B 4WPAA 3TW0A 3OVSA 1U6BA 2F65A 2K1RA 3KK2A 2FHJD 4ED6A 1RU2A 1S76D 2XHWA 3BDPA 4UQTA 5A8WA 2G13A 3TAMB 1GTHA 1AZEA 2FHMA 1DTQB 3HHLD 3MXHP 1MMGA 3R5BA 1SC1B 2HBPA 3M58A 2XLKA 3KLHB 4JUVA 2DM1A 4WFYA 4DCPB 4AL5A 1SV5B 3Q23A 2RUSA 3C15B 4V1Ak 4ATOA 3L95X 4NXNJ 1GMVA 1BQMA 3BGLA 1HW8A 1NZ9A 3LANA 4IR9A 4NL2A 2NYHA 1OYDA 5KYYA 4MMLA 5GAOq 1ABQA 1RWOB 4DX5A 2QTVA 1HNZF 3CTRA 2K7AA 1U2RA 1YLXA 4LSLA 3CMEA 3T5LA 2DF6A 1QAXA 3TP2A 3RBZA 1QAYA 1TAUA 5FDLB 5KOXA 2HPUA 3CC4Q 2FVPA 2RF2A 4OYXA 2EPDA 2JHEA 3EG1A 1VMBA 4D8DA 3H4DA 1SVDA 5IC4B 1FVSA 4LDYA 3AD8C 3UN3A 1HI8A 1JBMA 4CH1A 4DV6J 3BO3A 1U1MA 3CC7A 3UPUA 2K3KA 3CVKA 3UR0A 4M77C 3LW5E 4IUQA 1Y00A 3MWBA 4DZ6A 2GJ2A 4WP8A 3OXGA 1JKHA 2BMBA 4IG0A 4LDXA 2JTEA 3GONA 1QLNA 2DRMA 3KOAA 5D15A 4OX8A 3M2UB 4O44A 3PJ9A 3G4SQ 3QRRA 4WF2A 3NRBA 4X34A 3LP2B 3GPAA 3RR8A 2XMAA 2LQ9A 1UJ4A 3UA6A 5HVGA 5FLXE 2RHSB 2AZSA 3DYAA 4WXOA 5KFTA 1K8AR 2OAUA 2UXCJ 3RB4A 2N4DA 3H8YA 4I2QA 2DXEA 5GAOp 5KYXB 3M2UA 3GB0A 2V0NA 2LECA 3OLAA 2F1FA 4LFCJ 2M0YA 4K59A 4WYWA 2EJFA 5A8RB 1SBRA 5DGAA 4N5SA 2M9UA 3H7HB 4EBDA 1UVMA 3MECA 1HNIA 3GR0A 2CPZA 1OIAA 3FJ2A 4J6YA 1WNLA 3G96A 4H4OB 4OHWA 3I56T 4DPXA 2ZC4A 5KT5A 4M7AE 2BDPA 4QKUA 3DOMB 4IOBA 2AZ3A 2YWGA 4C92B 1PBUA 1SKRA 1OSDA 3WVDB 1BQXA 3LOUA 2Q6BA 2RJFA 3VYHB 2BACA 3KMQA 1VRUB 1SSFA 1X5OA 2MQ8A 2XZWA 5DM7R 3K8WA 3EH2A 2WSCC 3CMES 2YUNA 2EYYA 3BGFA 3GYNA 2AYMA 2X4JA 4A4GA 5L23A 4NLXA 4J9EA 2X1AA 4B9TA 2F4VJ 4EZ9A 2V5HG 4LF9F 1H3DA 2PTKA 3D6TB 4NOYA 5A8WB 4BI4A 1S9EA 5AE2A 4ES2A 3TZXA 2G2ZA 4OF1A 3OYBA 2XS2A 4GY5A 1S9GB 4DFPA 3AD9C 3NP5A 2DGSA 3FNNA 3TA0A 3A8OB 4NCGA 1ZM2A 4WCIA 3HP9A 4O44B 1N8RT 2OPPB 2OPSB 3MHYA 5C5JA 3N01A 3VZHA 1RAAB 4HVUA 3VQSA 3OYCA 4AFZC 2AJFE 3AD7C 5L9NA 2B9WA 3CJ4A 5LSRA 4M7DA 1Q86R 2HKNA 1QSLA 4YMEA 3OYIA 4A8MP 2XKOC 4ILRA 3KFWX 1YITQ 2XYHB 3OR2A 2E7VA 2GA7A 1S59A 3AH6A 3EGXB 3HVRA 4A8XA 1RAGB 4TLRA 2FUG9 2ESWA 5CABA 5GAN2 2QV6A 4K4UA 2NUTB 4QYZJ 4DV4F 1YJRA 3QQCD 1HNVA 1HI1A 2KRBA 4PWWA 2JRSA 5HI7A 3EG0A 4AFQC 1P6TA 1S4EA 2ERRA 4UW2A 1UAWA 1N54B 3E01A 1M1KR 1C0MA 3E19A 2AKLA 3CEDA 3P8HA 4CI0C 4QQGA 4C8YA 2AHJB 2DIGA 2MLZA 1YI2A 3EVOA 1YI2Q 2V8KA 5LJ5Y 3CXCR 2AT1B 3R6NA 2B51A 3EICA 1T9WA 1RAEB 2VKRA 2UVVA 4DX8H 1JXLA 4JI7J 4PNOA 1WSRA 3O3LA 1BD6A 1EJ7L 3U1MA 3IRWP 1FJEB 5DJBA 3MMBB 3DDKA 4LF6F 5E2QA 2HD0A 4AG2C 2OI3A 2EWHA 4EWTA 3V6KA 1IBCB 2DNUA 1VISA 2EPIA 1XNIA 4OI3A 1V6HA 3CCSQ 3KK3A 1S0VA 5BR8F 3NWGA 2OJ3A 1I94J 1CQMA 2BABA 3CC4A 5A0YB 4NLDA 4PQUB 1PHTA 2CPJA 4R55A 1TTHB 4BD3A 3KG0A 1A6LA 2DH7A 3OSVA 3UDEA 3JSCA 2VGMA 4I2PB 1N34F 2HNZA 4ATNA 4FYDA 4QVZA 4RTUA 1LK7A 1GL5A 4DEXA 1K76A 2KL8A 1FD2A 4RUAA 3QHSA 1HQEB 3FRNA 2QL9B 4Z7CA 1YJUA 3K2YA 3AB4B 3HXMA 3BYRA 1HQEA 5M9OA 3CC2Q 3MEGB 4XO0A 2A37A 2I0XA 3DLJA 1S7IA 3A12A 4KKOA 4I2PA 1OMSA 4ZKAA 1G2BA 4IG3B 3NMAA 3JSMA 3UD3P 4DFMA 1S0NA 1F2GA 4WFXA 4JB8B 3C4SA 2OO4A 2DYAA 1FCAA 4PJOD 1FI4A 1Q53A 4CRIA 4B3SJ 1K8AC 4OHYA 1JXEA 3C0CA 3H0HA 1FE4A 3PDNA 4RL1A 3I5BA 1JXMA 1M4ZA 3CC7Q 4KBMB 4CO0A 2H3EB 4CC4B 3K5MA 2DD8S 2V1RA 4ZHRA 1Y57A 2KYZA 2WAQD 3V8KA 5EGYA 2BZXA 4Q45A 4KUDK 2GNCA 1TAQA 2DIQA 3VAIA 3FZBA 4IOCQ 3ZFVA 4USIA 2ASDA 1E6YA 4RWWA 2O31A 4QIEA 1OO0B 1WLPB 1KOHA 2GAHC 2HQCA 5GMKj 1B0VA 1SPKA 1MWZA 1MROA 4NLGA 3TX0A 2IBKA 4QYZK 3JCMf 2QRRA 3K89A 2LVWA 4ZTFA 2YUPA 1GMUA 2NWMA 5B0CA 4MYTA 4UY8T 1WHGA 1TL1A 3NAIA 1MNDA 5C2GA 3IWLA 3OSNA 4LRFA 4RW8B 4P71A 1VQSA 4OI0A 3NOGA 4LDWA 1YRTA 3LGLA 2Y90A 3M57A 2JH3A 4E7JA 1FRIA 2XMKA 3BGRB 2K57A 5B7WA 1L5UA 4IUFA 3T6JA 2YTCA 3CCQS 1ZPWX 1S6QA 1P8GA 4K4TA 1WC1A 2DR5A 2V8HA 1H2VZ 3M6WA 1U2CA 5I11A 1HHSA 3CGIA 1CLFA 3D6FB 5CIUA 4RUHA 5HN0A 1T02A 2KG0A 1UGQB 1N8RR 1XMQJ 1N32F 2OEMA 3PFEA 3ETOA 3JSRA 1TKDA 3F56A 5ADZA 3MR6A 3IQLA 4TVRA 4UQGA 5AJ3J 4I0WA 1FKOA 1KSWA 1CS4B 2X1GA 4PZVA 5DM7Q 1LKZA 1KQ2A 3V4IB 2VG6A 3WZ0A 3CDAA 2OI2A 1FWLA 3AJDA 3CUNA 4M5MA 2DKGA 4P2SA 2CAJA 4C0DB 3OVBA 1N33J 2CZ4A 2UVUA 2RN8A 1LWCB 4DS5A 1X5PA 4DUZJ 3EVMA 1OY9A 3JCMg 1KHIA 3LGNA 3E2UA 4NMLA 3MEKA 4ZGJB 3PKMA 1QSSA 2F8MA 2K8GA 4U9RA 2W7PA 2K79A 3G7ZA 2L9NA 1DTTB 4GO7X 3QT5A 4RCCA 4USUA 4JOUA 3M0QA 2W2OP 1FJCA 4W4MA 1QCFA 3HSJA 1PRLC 4B9UA 2CFXA 3B4MA 3Q8QB 3CCUS 1TL4A 3H59A 4HT7A 1D3BB 4RUBA 2LC4A 2JEFA 3BO4A 4CC7A 1EQMA 1FXDA 2FJAB 4DSJA 3IFEA 3BGRA 5KYUB 3REBB 3FJ5A 1S1VB 4L75A 4F36A 5B0GA 4DQPA 2GW8A 1MNEA 5A8RA 4X66J 2I38A 1S99A 3KHGA 2VBYA 1FKPB 4HHHA 2CSQA 5GANg 3JB9D 1FTCA 4DR6J 2NLUA 5LJ5e 4M63A 4CO5A 3THKA 3CD0A 3DRRA 1VQKQ 1A7GE 1TVRA 1UGPB 4ZP7A 2ALZA 3CQTA 4X9DA 2XI9A 1FESA 3BW1A 2NUPA 4OX9F 3T19A 3EVWA 1HL6A 3TAPA 1NZAA 2CT3A 3MOJB 4FP9A 3SIPB 3BDUA 2HMAA 2C2NA 5KE2A 1S6OA 4DL5A 2E1AA 3ER0A 1TK8A 2P84A 3D3CJ 1T11A 5ETLA 4LN2A 3A5ZB 3CMQA 2RH2A 2KRRA 4ZVOB 1RUWA 1F5AA 4KAIA 2EAYA 2VU5A 3RBEA 2RK1A 1VI7A 4JZ4A 3Q8VA 3LP0B 5EX0A 2Z2MA 5KT2A 1NK0A 2HVHA 4JDSA 4Y92A 1FA0A 1T94A 2CH4A 2EK1A 3CJKB 2RVJA 3D67A 3KLIB 2IDEA 4PYAA 5DZ7A 3CO0P 1ZBJA 4II1A 4M7DF 3RRGA 1X2QA 2H5IB 1DQ9A 1EKRA 2PO4A 3X28B 3J7AF 2BBEA 3OYYA 4E47A 1UW9A 2YXLA 2E1HA 1YHQQ 4TYAA 4O5VA 3DRYA 4PJOB 3I0SA 3H8ZA 5LL6S 1ZX6A 1QY7A 3W8PA 2ZBQA 4RW7A 1SRMA 3TQ1A 3NG8A 2HHPA 3KLFB 4F3OA 1SL1A 4Y0FA 4J9RA 1TFYA 4LF1A 9ATCB 1TU0B 2CQDA 3VS6A 1AA1B 3M56A 2RILA 2YRDA 3OJUA 5KFWA 2ZH5A 3C66A 4BLGA 3SDZA 2I6WA 2MAMA 3MP1A 3A3OB 2RQTA 1M5Q1 4WZQA 2WVCA 4IIMA 4OI1A 2K3YA 1G83A 5HK3A 1NK8A 5GAOm 1FKAF 1VQ6T 3Q89A 3QJLA 4DS4A 2K1RB 4B3MJ 1FEHA 1M5OC 1Z9ZA 1HI0P 1PILA 3MMBA 3AHUA 1EARA 1O51A 1PRMC 2CP3A 4IUTA 4ERDA 1F9FA 1FWPA 4DR3F 4IQXA 4FW1A 3N9UC 3SWNA 1H2UX 4MKAA 1OYEA 2DH8A 5KFYA 2LQJA 1MWQA 4IRKA 2E5LJ 3H2VE 3M9MB 2R58A 4RPFA 2M0GB 5SZTA 3MEUA 4E8UA 4X66F 2XNQA 4PG5A 3W9HA 1T0HA 4DSFA 1X6GA 2DXDA 2KH9A 4DPYA 3M8ZA 4F4YA 3ZBDA 3E01B 4J9LA 4J9SA 3OYMA 4FBUA 1NK9A 1UDLA 2QG9B 4LFAJ 1PJ7A 4NA2A 5K9FA 4C8MA 1JQGA 2B6AA 2GNKA 3HDSA 4XTXA 1IKYB 1QD1A 2WVBA 2VG5B 5EHHA 2APOA 2QI2A 1IJEB 1RLPC 4ZLLA 1T3NA 1Q82T 4XTVA 4PR6A 1PM3A 2LDMA 4ZLJA 3I35A 3B54A 4EEYA 2MSSA 1KFSA 4AG1C 3X26B 1SXLA 3I56A 2VHGA 3MM6B 2CJXB 2LZ6B 1WKJA 2ZE2A 4P10A 7AT1B 1QP3A 4OLOA 1UGRB 4JI5J 3QJJA 2NS1B 4DHVA 2DNMA 2KQWA 3R5JB 4CC2A 3KDOA 3HT3A 4NCGB 4TY9A 3SHWA 2EQUA 1VQ7A 3QNWB 5KFUA 1FMKA 4CYUA 3EUNA 4PABA 3IAS9 1Q5VA 4DLEA 2AMCB 5J2NB 5C42B 1JX4A 4URQU 4DL0C 2ZZNA 4KR0B 4ZMMA 1Z1ZA 1XR5A 4O3PA 1FRMA 3VVTA 2BANA 3CCEA 5J3BA 4FF1A 1FMVA 5I3QA 2KROA 1JNRB 5KFIA 1K9MU 2VQEJ 2Y3YA 1RACB 3CEYA 1E6GA 4JS5A 2ZKTA 3OUYA 3B4DA 2M02A 3MAAB 1X6BA 5D78A 2EG1A 2EWNA 1S1UB 5IHKA 3SQOP 4C8OA 1OEBA 1VQ5S 1U6ZA 2B6AB 3OLBA 3MM9A 1RKIA 1X4DA 2DYBA 3FIFA 2MKCA 5IQ6A 3CCRT 5J39A 1H2TZ 1VQMS 1N56A 2KN4A 2AEFA 3QAEA 2FVRA 5KYWA 4J9UE 3NL0A 2QFIA 5THWA 2G1HA 4ITSA 1UL3A 2BOAA 1RWVB 2RB7A 1W2BS 2YWHA 3CO9A 3F70A 1HNXF 1NSAA 4OYIA 2RHXA 3NNAA 3QDRB 2IJNA 2DL7A 4FDFA 4YB5A 2QGFB 1Y9OA 3AOCA 5E5NA 5AXMA 2E5LF 4K0KJ 3MM7A 3BPDA 2JVVA 3GIIA 4M7AA 3OL9A 4WBFA 5LJ3h 4NLSA 4OHXA 3H5SA 4WZMA 1NH7A 2JC0A 2EC0A 3MHXA 3S7RA 1S6UA 4FXWA 5DQHA 2G4BA 4ZN3A 1WHWA 2OHDA 2JT4A 2Z2ZA 3DM2A 2LX9A 3KUGA 2HVDA 2XMWA 1B0TA 2BZYA 1SJ4P 4U7UD 1RTJA 3LP2A 3AOBA 2LU1A 1K8AU 2CGHA 1R0BG 2PMHA 1RBLA 2LA6A 3FRZA 4DF4A 2RQUA 4WE1B 4I4BA 4YQWA 4LDUA 4QBUA 1MHNA 3BN4A 3K5LA 2HHHJ 3DLBA 4G1QB 5FWBA 1CC8A 3S6WA 3CNQP 4M5KA 2BQRA 1VQ7Q 4C7QA 2E5HA 5F0WA 1VQLS 4G1PA 4FU6A 1E7OA 1RHMB 2KHDA 3JB9I 5GAGU 5DDOC 1VQ4T 4HI2A 2KI2A 1ACMB 4A8OA 3AFGA 4H4MA 1CJTA 5I4MA 1HNZJ 3CCES 1KQ1A 3N6MA 1TSFA 1VR6A 2Z0WA 3R7NB 5T7LB 4NYZA 2JMAA 4BUGA 3G6VA 3I9QA 3BKUA 3J80Y 4DV0J 3UFCX 3H41A 2ENMA 3CCJT 3U1LA 4A4HA 1QM9A 1IKWB 1EETB 1SQFA 1ZAXA 3ISZA 2KMTA 3OBYA 2RMLA 3ZNUA 4YY3J 1Z4UA 1LWFA 4Q0BA 1YJ9S 1LXJA 1KLNA 2CPDA 2BX6A 2LVMA 1CPZA 2SXLA 5B0AA 3HJVA 1YTYA 4OZJA 4RTZA 1SI9A 1Q7YU 3HHDA 3S3OA 3W5YA 4L76A 5KFVA 1Y0HA 4E0DA 4M78D 4O4GB 3W65A 5LJ3g 3EM1A 1K0TA 1SEMA 3QYHB 4AE5A 3NS7B 4LT6A 1HHTP 2COLA 1U48A 3QGGA 2PE8A 4K5SA 4CI0B 1H74A 2F5GA 4ES3A 1LW2A 4HDHA 5FRMA 3PM9A 3MM8A 1S57A 4Y2CA 2BTTA 2QAZA 1AUSL 4DJBA 4YDDB 3EXYA 3IR5B 3J7AN 1D9FA 3OYNA 2R5MA 3DRPA 4X1VA 3KDNA 8RUCA 2DZ9A 1N5QA 2QJ3A 2GTOA 2RQCA 1CQNA 2L08A 2LP4A 3GQCA 2LX7A 1ZA2B 3EDRB 4JI3F 3M8QB 2CPFA 4X2BA 1S1TB 1YCSB 2FL7A 3CIZA 1P92A 1W7WA 1NSKL 5HSPA 1EZZB 5B08A 4WTOB 3S3MA 3EMTA 3M8YA 3PRVA 4TU7A 3KJVB 2KHCA 5MLCV 3RBBB 3ZFJA 3JCMP 1HWJA 1FDBA 2XK0A 1DURA 4G1IA 2RI2A 2NXNA 2CUYA 4PXBA 3C19A 1LNXA 4LQ9A 1NKEA 1CG2A 3HJFA 4ZPWR 2QEXQ 4Y2IA 1K1ZA 4C92C 2DTOA 2DITA 4IKAA 3DMJB 4W92B 1M1KU 3I0RB 4F0HA 4HHJA 4Z7YA 3M9QA 2R8IA 2ZEJA 2I1RA 1VQ8A 2ZOGA 2EBGA 1YCYA 1KRPA 3HF5A 2XO7A 1YI2T 5HLFB 2ZZDA 2F1LA 3IGNA 1KQSP 5CK9A 2L5QA 2JS2A 2QO3A 3GYXB 1WX6A 1I5LA 3FJPA 4LF9J 2ZDOA 4RBVA 2L2PA 4F7UE 3CCUA 1S10A 4FSSA 4YTLA 2W4CA 2Z8QA 4M75G 2W2MP 3QWXX 1OPIA 3IRXB 3TNVA 2LTOA 1VQLT 3PYEA 2CP6A 4C48A 3GP9A 4OFZA 1JU5C 5B0FA 2GFUA 1ZTTA 4AT1B 4ZVTB 3IAM9 3U27A 3PY8A 1WG4A 2ZJQQ 2YVSA 2IYIA 4A8FA 4GVBB 4TN2A 1DARA 4YB6A 4KYZA 3C46A 1Y10A 2ZZMA 3LH5A 4DQQA 1J3TA 2A3JA 1EFNA 1N9SA 2BV3A 1TL1B 2RUGA 1R8AA 1AZSB 2DRKA 3VS5A 2E5QA 2RAQA 2BANB 1YVFA 2W8KA 1R8CA 2CPYA 2N4CA 5ECAA 1RQ0A 2W01A 2RJZA 4IRDA 2PGCA 1PSEA 4U8YA 2XS5A 3GF5A 5EWEA 3GIKA 1Q8BA 3TA2A 3CD5A 1E6YB 4DLGA 4DV2F 1CKBA 3CC7S 2UUWA 2VDIA 5LJ3f 4PJOE 5A0DA 2HWIA 5ETOA 4OHZA 3SBMA 3D1HA 2FHJA 4ANCA 2V8JA 1QVFR 1ZS6A 2RQRA 3QJPA 4DOZA 2CPIA 4ZGDB 4RW9B 1G3OA 2VC0A 2B56A 2XMMA 3KLEB 5CYQB 3MEDA 4NLRA 2PI5A 4EMKA 1VQ9Q 2DXBA 2KXDA 1R27B 1YDLA 3NHNA 2E29A 1RTIB 1GX5A 3D3BJ 2FJWA 2OMOA 3JCMV 1RI7A 5IM0B 3BSAA 4X4VA 4IO1A 2JXBA 2DXTA 3IN5A 1QUPA 1VQOA 3W64A 1YSJA 1QQJA 3MD1A 2AJQA 3PNWC 1Q82U 3OTBA 1IKXA 3CCJS 2HHUA 2ZH2A 3PW2A 3FB9A 4J9HA 2DL8A 2EFVA 3OYEA 4U7UK 5A76A 1VQPS 5BR8J 1VUBA 3IMQJ 4KKOB 5DY9A 4PLIA 4F4WA 4ED1A 2QEXA 2R42A 3DLGB 5CCMA 3MURP 4N0AC 2OTLQ 1VQNQ 4ID5B 4HHUA 3L2RA 2K06A 2MF2A 3OQ2A 2MPXC 1PD1A 3VQTA 2JLEA 1WOOA 2FVUA 2UV8A 3I31A 1F9EB 3ME9A 2Y0BB 5CA5A 4HACA 3IWNC 3FLGA 2DNLA 1KFZA 3W60A 3JQJA 2IBOA 1TZ0A 5DQGA 3CDWA 4OJ3A 1U02A 2Z4PA 2ED0A 2DBMA 2V2VA 2AGOA 3BBCA 2CRLA 3K7RA 1GTEA 3AY0A 2DKOB 3QFWA 3DU6A 4V2SA 2OGUA 4PG8A 2AZVA 3WIUA 5HO4A 1VQ6A 3E2EA 5GAN6 4AXIA 4OMNA 5L39A 2XWXA 2B9EA 5GANe 3PEJA 2LMJA 1PYTA 2FZGB 1U1NA 5DGBA 3PGGA 2O4XB 3BQ2A 2HNDB 4J5OA 3VCDA 2IIMA 3W9JA 2J0QD 5HVHA 2FHDA 4WCEQ 3VRZA 3OPKA 3M8RA 3H5YA 2NXCA 2KRMA 2W2NP 3JAME 3T41A 2KDSA 1K44A 1UJ5A 3I0SB 2I0NA 5LMUF 5JJBA 3N5BA 2B3TB 1NJWA 2CADA 4ED0A 3H0FA 3H9NA 3RJMB 4KSEB 2FJBB 3QO9A 2NUTA 2M3DA 1UGVA 1XMOF 2IM0A 2E65A 2FGCA 2RJDA 4L6V3 3X25B 4K11A 3VYGA 1Q7YT 4JPBW 1QTMA 1F5CA 3ZTOA 1N8RU 3W62A 5B09A 1S6PA 1TL7B 2HK2A 3G71Q 3EGUA 1RWWB 1URNA 2X9HA 4DR4F 3I55Q 1T9TA 3VGVA 4NL5A 4XAKA 3JQMA 4IFVB 4EPCA 2KT1A 2B7CB 1MMNA 1RT5A 3DDIA 4K8RA 3SFGA 2CNKB 3R5GA 2Z56B 4LRBA 3JAMY 1XIQA 3FFIA 2E10A 1RAHB 5FROA 1IUJA 2M8DB 4JYAJ 4PEOA 3BM7A 4B9SA 2XZDB 2KJVA 2Y1RI 2LNHB 4F0MA 4BI8B 2CYYA 2YKOA 4M77B 2OIHA 3AA9A 1SQGA 2OPQB 5JVHQ 2LCLA 3RERA 1G5VA 5L1IA 2JMCA 1HFEL 2W4PA 4ZPDA 2AJ0A 1PGZA 2V34A 2WVDA 2VUBA 1NSPA 2IY5B 2ZBRA 1YJWA 2AV5A 1JIHA 2MKHA 1L3VA 1S1VA 4NPOA 4X4SA 5LMNJ 1M2VB 5KG5A 4CLWA 1V5VA 1AROP 1VRUA 3VJPA 1SC6A 2ZVIA 2HS3A 3KHHA 3QJYA 3OS1A 4NMXA 5LXYA 3W2WB 3C14A 3DKMA 4P7VA 3JQKA 4P5NA 2EK6A 3O2IA 3ZEHA 4RKUC 1DRZA 1WA7A 3QO9B 3L09A 2M4MA 3TZYA 2VBZA 4K4YA 4F2RA 3MR7A 3CPFA 1WHXA 1UVLA 3ULRB 5FIIA 4FNIA 3OB9A 3V7RA 1YJNS 2VIHA 2COYA 1HNIB 3MI7X 1WJRA 3CC4T 3EFOB 1HBUB 2R7SA 1RHRB 1DBDA 2X7IA 3QDFA 2KDOA 3O5ZA 3TZWA 3MPYA 3MZIA 4P72A 3I87A 2HRTA 4PJOC 4E7SA 3HP6A 1WGSA 4ME7A 2N3LA 2NPFA 4UF4A 2CKKA 2R7WA 4FYVB 4R5PB 2UP1A 2W1BA 2J7WA 3LALA 5D0EA 1XQIA 3BSCA 1U5SA 4OYMA 2X1FA 1UFKA 3M6VA 1T95A 1XMQF 1KHCA 1WC6A 1R8BA 1CS4A 5KFSA 4M75D 2BXJA 3I82A 3FC9A 5EG2A 3DM2B 3CCMS 4B3TF 3M9NB 1GFDA 3WX4A 1VLOA 2DFUA 1BY9A 1LW0A 3HFOA 3EHQA 1UJ0A 3DN9A 2WSEC 4EO8A 2FYKA 1AW0A 2FO0A 4FS1A 1CULA 1KP6A 4LD6A 5HROB 3RB6A 4CM2A 3EFSA 4USHA 4BY6B 3GIMA 1RT7B 1UJ6A 1Q86C 3LPEA 4P73A 4IG0B 1WI8A 4PG4A 2ECZA 2PC6A 2BKOA 1SH3A 1C0TA 4NYOA 4C0GA 3JAMU 2EW9A 4ZP9A 1X4FA 4RUCA 1K73U 3RG6A 4KH0B 3UO0A 3DRSB 1M30A 2WSFE 4JRKA 1RT2B 1NHKL 1K73C 3IS9A 2VFTA 4ENOA 1M90U 2JX2A 2C3YA 3OYLA 1CJUA 1TUGB 4ZP6A 5CQXA 5DLGA 2B9XA 3CDEA 1IKXB 3TJAA 4OP0A 3MUVP 4JI4F 2B9YA 2R7QA 3DC2A 3J7YI 3AODA 2GHPA 2IMOA 4OIXA 2UUCF 4LF7F 1KKHA 2DXCA 4KY3A 5J1NA 1SIWB 1FXRA 1R8PA 2HNYA 3I56Q 1NEGA 2VBXA 1WPYA 3LWMA 3OUYB 2DX1A 2R2SA 4DSKA 4BE2A 4F4AA 2JFDA 4XK8E 4WK3A 2QK0A 4ED3A 3ISND 5GAHI 4NYPA 2DISA 4X4QA 3DB4A 2RI3A 2HZAA 1R0AB 4HA8A 1S48A 3BKTA 4N47A 4B3OB 2LCCA 1TL3A 3MM5A 2XY7A 2KXFA 3KK1B 1LCKA 2PD1A 4I1TA 1RLQC 2ZM6J 4C3LA 1Y96A 3J7ZT 3UF4A 3DOKB 1FF2A 5KH6A 3DLLA 4CZCA 2E1MC 3CJTA 3OJSA 2DHHA 4AUKA 4GKJF 3NWRA 2DH9A 4DR2J 2J6TA 2KFNA 1KD1T 2JS0A 1WTFA 1UW4A 2WONB 3META 5J2MA 3BYPA 2YDLA 4RBTA 2WOMB 4EDUA 5GANf 5C25B 4M78B 3L7PA 4LJMA 1YKWA 3PV8A 1DJ0A 4O0IA 3KJNB 1RTDA 1VC5A 3CC4S 2IIHA 4C8KA 2HAIA 3HULA 1F0XA 5D3GB 1GBRA 3PO5A 2QQAA 1KQFB 4C3MA 3MMAA 4C9DA 4LFAF 1GXUA 4F7VA 4CO4A 3JCMh 1CJKB 5KG1A 1EX8A 1NJIU 4DR5F 3S8SA 3K0JA 4PG7A 2KVQE 2Z58B 3UVJA 2UVWA 1LK5A 3G87A 4ICLA 1JNZB 4CDIA 3C16B 3SQGA 1F3FA 1GXTA 3VAJA 3OTOF 4KGXB 4DQ2A 5M2UA 2YRVA 3M9OB 1S9FA 2HBWA 3LWLA 5T41A 3UW1A 2XSJA 2EYQA 1Q16B 2AIRB 2R7UA 2JN0A 1IWAA 1TMMA 3DNCA 3KJQB 4LR8A 3A8HB 3T1HJ 2BE2B 4AXJA 4C8NA 1JLBB 3CCWA 5HBMA 2EQMA 4KFBB 3HFNA 2JZ5A 4A8KA 2LJ3A 3IM9A 2CIMA 2WB4A 3W2VB 2E66A 2FDNA 2POKA 3NKYA 2YNIA 2GO8A 3SQGB 5GMKi 2CNLB 4RBUA 1N6AA 2LNVA 3O8VA 2KTQA 1UWBA 2EYWA 3HFVA 2V2QA 1CJKA 3MMJA 1RT4A 3CCJA 3QZ5B 2Y4XA 2DYIA 2FZKB 2VFUA 4BDZA 4HVVA 3DLKA 4LRDA 2OFGX 4KT0C 3QRQA 3PYFA 2XWYA 3OQ5A 1S12A 2L0AA 4B9NA 1RWPB 2W10A 5EWGA 3IA0A 4L5GA 4O3QA 1O75A 1AWWA 3DGPB 2KGTA 1YIJA 4AL6A 3P3DA 3J80E 2E1PA 2R9LA 3EPIA 4ZA1A 4M78E 1MMAA 2RKIA 5GAMh 4C92E 1JJ2P 2CJQA 2KVIA 4DV1J 3UD4P 2DJQA 1UECA 4QQBA 4RTVA 1S9GA 1YBTA 4X64F 5FRNA 2VFVA 2Z0GA 2DR9A 5EN1A 3N0VA 2ROGA 4O4GA 3HD1A 3A3NB 2E70A 2XYGB 3CWJA 4GRSA 4M7AD 3GILA 3CMEQ 3LP0A 4RU9A 3PW7A 1WKKA 1PYOB 3IP0A 3M1VB 4XDDA 4KRWA 3SSQA 4J9NA 2A10A 4KHPJ 2QZ8A 2EFGA 4YHHJ 3QBCA 4CLFA 3WX8A 4GKKJ 2A2CA 1M90R 3TUJC 3UE2A 2XB2D 1T05B 4KTQA 3V6DB 2RD1A 3TQ7P 1C1CB 2BW2A 2DGVA 3DLEB 3I5CA 2IJFA 1AOJA 1UE9A 1K73R 2DR8A 1X9WA 2V4JA 5J1EA 4WIQA 2L3SA 2X3DA 2A3LA 1RJJA 4H4OA 1PC0A 1DQAA 2OTJQ 4DBHA 4XTYA 4ZVGA 3RZAA 4BWJA 2FJEB 4MKBA 1KC8U 2LMIA 4ILLA 2ZBCA 1X4GA 3A3PB 1JLCA 1S72Q 3C12A 1ZSGA 3BF4A 1QVGA 1YJWT 3JTOA 4CO2A 2QTXA 2EQJA 4PQAA 3HX9A 3K57A 3G6XA 2CVEA 3H0PA 4F2SA 2R7VA 2DHXA 1HR0F 1G6BA 4RWXA 2LCSA 3AHPA 1I8FA 3R9LA 4A47A 3UNYA 2DEQA 3DLEA 3VV2B 2C2ZB 3A8IA 3FSYA 2UUBF 4J90A 2V9KA 3RMSA 4OI2A 4S0MA 5ETSA 4DSEA 3LGFA 3GJTB 1UFLA 1GBQA 2JNGA 3B82A 2DL4A 2C28A 3NFCA 1HD0A 1UFFA 2FVQA 1YBYA 2DT9A 3ZTQA 1YP5A 3I32A 4YY3F 3Q2SC 2JFKA 2DR7A 4BWMA 2Q79A 4PJOF 1PWTA 3K5NA 4TU9A 2RI5A 3C2PA 2YKNA 3M2RB 1F5BA 2DBKA 2QMUB 3NGTA 1JJ2A 1JQQA 4HCKA 4IR1A 2IVWA 5L9XA 4NLUA 3URGA 3RNJA 1RHJB 2C42A 4OZ5A 4R0JA 4ZOSA 4J9KA 2I9SA 2K4YA 1KVKA 5IC6B 3LP1A 5HY6A 3P96A 2XS7A 5KFBA 2HRUA 1HXDA 2F2WA 2PN6A 1UP1A 4W98A 2M88A 4L6V5 1WUUA 2Z2YB 1ZSZB 2D3ZA 4E7LA 2MEWA 4YR0A 2EKYA 1PCAA 4DL4A 1FXLA 1OX8A 3I5RA 2E6ZA 5E7OB 3TVYA 2HHHF 2B5JA 2AK5A 2KNBB 1V76A 2QDLA 4O4RA 3JYTB 4XAXB 3CCVT 2M5YA 5F9NA 4QW2A 3GIJA 2H3JA 3DXSX 3FKBA 1YJNT 3BE3A 2R2RA 2G9OA 4PG6A 3KLHA 4JI3J 2HBZB 1Q79A 1DTQA 2X4WA 1NU4A 4C8QE 2IRXA 1VIEA 1WELA 1RT4B 2AHOB 3G8QA 4M75F 4M78C 4KH1B 1U0HA 1RWMB 3THTA 4JJBA 3ET6A 4PRFA 4DR1J 3D4JA 2JOYA 4FL6A 2OKQA 1NDCA 1IM6A 2KZMA 2MHNA 3EHRA 4OMMA 3HVWA 2YKPA 4NZ0A 3VF0B 1QTNB 2DGQA 2VODA 1WJ9A 4HTIA 1R3NA 3M2VA 5HBMB 1SL2A 1XWLA 2HCKA 1R6YA 2AX0A 1L3UA 1KQSS 3TSWA 1G3YA 3QG1A 2WW4A 1KJWA 3DLHA 5K8OA 2XSJB 5CD4A 2GVDB 2WCXA 1H72C 4G65A 2AX1A 5HK4A 4EBCA 2B8PA 4HVZA 2VGNA 4LFBJ 4NRUA 4MH8A 1T0JA 2VG5A 4XDCA 4Y28C 4C2MA 2HWHA 5KT4A 3HHLA 4Q2LA 5LJ5d 4C6AA 1AHJB 1P1TA 2DEUA 1RAOA 5IS2A 3EDQB 1UFWA 2CQ3A 1S72A 3JB9G 1SCJB 2OTLA 1JJ2R 1T0TV 5KG7A 1U49A 1QCOA 3A8EA 5MAOA 4CP5A 2BRLA 1LXNA 3EZ5A 2GMLA 4OMFG 2Y4YA 4N7TA 1UHFA 3KFVA 1KQSA 4JV5F 2W4DA 1X4EA 4KGKA 1HHQA 4M75C 5A8KA 1IO6A 3CD6Q 2AGQA 1JJCB 4RMOA 4TU8A 1Z2ZA 2WBMA 2HZCA 1WC5A 4PUOA 1M90C 3J81U 4ZVQB 3NS6A 1BWEA 2VPWB 1AWOA 1WXTA 5GAMe 3NGKA 4PXDA 1JLFA 4M4ZA 2KO1A 2KFZA 3A8KA 2CYZB 4RUGA 2BW7A 2YNFA 4B17A 3H2UB 3OSPA 2ZPFB 1FFSB 3BKFA 1R0AA 4CC3A 3V81A 3R2DJ 1T3SA 1WKLA 5KG4A 1YJVA 2C2KB 3IG1A 1NDLA 4MZPA 5HQLA 2BOPA 4A8YA 2IRUA 2HQEA 2ZD1A 4C11B 1YK9A 1Q82R 2PI4A 3M6UA 2AF6A 3VGTA 3KLFA 4OMQA 4RW7B 2VJUA 4ANDA 4PJOA 2XG8D 2E4HA 1W4SA 2XCAA 3AJ1A 3VAMA 3D6HB 4HTJA 2E3HA 2ACYA 2V63A 1Q81C 2XDBA 2C0IA 4NXMJ 2XD0A 1JLAA 2HGNA 2C2RA 3BB5A 2K2PA 3GBQA 2RF0A 4B3SF 4DCOB 3RAMA 3IWXA 5GMKh 2ZHBA 4DMZA 4M7AG 1HBNA 1C0TB 2C3PA 1VQOQ 5K14A 1VQ5T 4OGCA 4NLWA 3MEDB 3I55S 3CPWS 3PVLA 1W2BP 4J5YA 2CPHA 4DQIA 1E6VA 1OI1A 2LQ8A 2AWZA 1U1TA 3L1AA 4AFUC 3Q86A 2JEGA 2K5LA 4EO6A 4WJBA 4OJ1A 1NYGA 5CR2A 4IDKB 1X4CA 2P4RA 1NE8A 3EG2A 4M1KA 4NEYA 3A1YG 2YWWA 4MZTA 4Y65A 3T5KA 4DV2J 4ANEA 2KM8C 2DL5A 4ZLPA 1RSCA 1VRQC 1REVB 3G6ET 3TUZC 4GLMA 3V4MA 4MIBA 3TEHB 1MSWD 4DPWA 1FE0A 5KFOA 3OL7A 1KD1C 5LSLA 3M30A 3CCLQ 2HBYB 4AMCA 4PWDB 4K5RA 4A4EA 3G4ST 2ZH4A 1ZQ1A 1F3VA 5I22A 4A54A 1PJ6A 4XU0A 1VIOA 5I42B 5DLFA 5GAMg 1FEEA 3MCAB 5KTQA 1CBKA 4FZVA 3DOMA 4NLVA 2FJVA 2LEBA 3H90A 4X4TA 3QIPA 1KOOA 5HKCA 1Y4ZB 1N32J 2QL5B 3WVEB 3E9GA 2VD3A 5CZVA 2QYGA 2ATLA 2V4JB 2WZ1A 1MMDA 2SRCA 1QSYA 4ECTA 2UUCJ 2BQUA 2D6FA 1J27A 1DTTA 2XNRA 1H6KX 1VRTA 4XU3A 2MQPA 2CXEA 1XMOJ 3O44A 2F9DA 1U1PA 4DSLA 5KG6A 1RADB 1M2VA 3AJ2A 3UNGC 2LQNA 1HK9A 1NK5A 1RAFB 1WF1A 1WACA 3EWGA 4CLKA 5IZHA 3X1LB 1TELA 3CCEQ 1GEHA 1WXUA 2DNQA 2JW4A 1VC6A 3M53A 4NA1A 4C5HA 2E1RA 2W8LA 3GOXA 1GRIA 1KNZA 3QT8A 2PUOB 2IAJB 4DWIA 4WU2A 1YWXA 1Y3JA 4MT1A 4RKUE 2MMPA 1MUZA 2IFXA 3D66A 4EU0A 3MCNA 1QVFP 1J2VA 5IT9E 5J2PA 4J9CA 3GJRB 4Q5VA 4DX6A 1HBOA 1YITA 2F9JA 5HAOA 4X65J 1YIJS 2KE9A 4P6QA 1AFJA 4ZCIA 1Q86U 1E6VB 2B7BB 3FCVA 2ASJA 2ZC3A 3UR3C 2DPIA 2DR6A 4Y00A 1URRA 2HFVA 3QLHB 3X3UA 5KFRA 2UZAA 2RNAA 1SSHA 5F8LA 3NCQA 2XY6A 1UETA 3OFEA 5K14B 4KT0E 2W24A 1RE1B 1WHVA 1X43A 2V26A 4ZPAA 4Q2MA 2VF3A 3FBFA 1X27A 2UXBJ 2HQFA 1PSFA 5CKFA 1VQ6Q 4M7DG 2IM2A 2MQQA 2VV5A 3HZEA 4NLPA 3OYJA 4DR5J 1WI7A 4JP8A 4J6WA 2MIOA 3JB9F 3EJMA 3IBWA 2FY1A 4KV8B 3BO2A 4U7CA 2MSTA 3SCKE 2JM8A 5GADI 1RHKB 2KKHA 2FGOA 1YITS 3FSXA 1PKUA 5GANd 2MLYA 2H4YB 4IUVA 2LA4A 2HNDA 4RNNA 4OB3B 2MGZB 2XLIA 2UU9F 2NYIA 4DUZF 4ER8A 3CCUT 2MTLA 5GMKl 5CKHA 3T1AA 2E6NA 3KG4A 2YH0A 5KOWA 1S79A 3TVZA 5HVFA 2ROPA 4Y2AA 4CLPA 3HLUA 3GJQB 1IHWA 1JJ2S 1RBAA 1NH8A 3PRDA 3NNCA 4BE0A 2VBWA 2CDRB 4ECXA 2E9RX 2NYSA 3MPDA 1RLCL 2ADCA 3F0NA 2BJ7A 2L41A 3OS5A 1RTHA 4IYQA 4K4WA 3M8SA 3D6MB 2LQ5A 4UOGA 4ECYA 2V1QA 4Z89A 3Q8PB 2ZOMA 4DOVA 2GVZB 2XI3A 4A63B 2V50A 4OZNA 3OMGA 2NPIA 5D4PA 1M3CA 3NGPA 5HJYA 1N34J 2PNIA 1HD3A 2WVEA 3FZ2A 2DHSA 3NTKA 5C25A 1NM7A 1C4AA 3BQ1A 3UN5A 3BFMA 2RSQA 4KB7A 4J9OA 5KYNA 2EEYA 1IN0A 2HFZA 1VK3A 1WHJA 2J9DE 2A08A 4PQUA 4QJVA 1WDTA 4E6RA 3FCWA 3IO1A 4F26A 3OW2A 2OTJA 3MAQA 1T9VA 1NLOC 2BE7D 3KJFB 1EIYB 1B7FA 2Y1IA 2PMWA 2DJWA 2J06A 2K3BA 3KXDA 5F41A 1BWVA 2YKAA 3JSBA 5GAGI 4PJMA 4ZGEB 3W2VA 1TKZB 3GCXP 4DR3J 3O5TB 4PCQA 5ETKA 3H98A 1D3WA 4D3GA 4KC5A 1K0SA 1AZGB 2IYGA 2DNPA 4QPTA 2KAFA 5GMKm 4ELTA 2BR0A 3BS9A 2RA2A 2HL3A 3NXZA 1X60A 1OX9A 1FDDA 2OLWA 1IVZA 3BDLA 3H6ZA 1RHUB 3PO4A 2DK3A 1VGYA 5HMXA 4UOFA 3ZZUA 2VPXB 4KV8A 2DRAA 3M0RA 2QFJA 2QTWA 2HZVA 4MFBB 3NTHA 4FPRA 5KFQA 2HVZA 2DNRA 1C6VX 5HQ8A 1RKJA 4USTA 4CQ1A 1HNVB 4OZ0A 3PX0A 4LNPA 4OHVA 1T03A 2CQBA 4RNHA 4NLQA 2R8GA 4IIOA 5IXBA 3LGHA 2QLBB 3HSZA 1Y11A 2CZ1B 1QUVA 1VYAA 3OR2B 5GADU 1VA7A 1VQ7S 4LXCA 5T14A 2XDPA 3FQLA 1Q95G 2G0JA 2QA4Q 2GGRA 1RBOB 1T8EA 3MD3A 1SJQA 4BHQA 3RTVA 1NK6A 3PIOA 1Y7PA 3RAQA 3P49B 1PIEA 2M51A 3BREA 3QYYA 2MYSA 1WC3A 5CAIA 3BDEA 2MJUA 2BKPA 2VDHA 3SCIE 1ARKA 3PMIA 1M1KC 3BGOP 3LP1B 3G82B 3P5BP 4B3MF 8AT1B 2MI6A 2MZTA 2FC8A 1GFWB 1IBLJ 2KEAA 4DU8A 3MMCA 5AJ3F 1UMJA 3MM5B 1R8HA 4YN3B 2PDAA 3CJ2A 5HLFA 5HP1B 1X31C 5L8RC 4NE9C 1BK2A 4M77E 2LT1A 4NX9A 2YNGA 4F04B 2DO4A 2PFDA 3WHIA 4HCBA 2HG4A 1SJ1A 5K5MA 4DV5F 1QAJA 3ZNJ1 5KFDA 1VQ5A 4ZLNA 2B4VA 2R8JA 3BR8A 1OQ3A 4ILMA 4YS2A 1M1FA 5FLXY 3CF5Q 4F17A 4NLYA 3FQKA 1XTZA 4RW4A 1HPZA 2BVZA 1X7VA 2HFSA 4F02A 2CT4A 3DKDA 2C3MA 4LF5J 2EFOA 1OZ2A 3FEYB 3US5A 4H4KA 4E7HA 1B3QA 4N4HA 2HIYA 3HSBA 1YWPA 3FC3A 4CLSA 3RB3A 2X3GA 3PRBA 3W3SA 5GMKa 3GJSB 3TQEA 1KEKA 3MECB 3FEZA 2OD6A 1RT3B 3RRHA 1FFGB 2CQHA 4I64A 5G0RA 3CJ8A 3OV7A 2P0PA 4EFAC 2A2DA 4FPIA 3MR3A 2XSFA 4DSIA 5D6XA 1H73A 2CQGA 4PXCA 4ECZA 2DE0X 3BH7B 1I07A 1HWUA 3SZ2A 4C5EA 2OTLT 2JVRA 4BI3A 4RNOA 4KJIA 3DCAA 1ELOA 2W25A 4DL6A 1R6VA 4ZVFA 4HYKA 3CBMA 3PTWA 1SB6A 4OYBA 1LW0B 5ETMA 4I68A 1N8RC 1R0CB 3RMQA 3A8MB 3ITHB 3V6DA 3OL6A 3WC2A 2O3DA 4M5GA 3LAMA 2QYCA 4Y34A 3FFIB 5KG2A 2ZOFA 3T1YJ 3GV8B 1GCQC 8ATCB 1TH7A 4L74A 2RU9A 4CM0A 1PJ5A 3M1VA 3PIOQ 3X24B 2ZHOA 1S1WA 2YUQA 4ZPBA 4QW9A 1H641 3VS2A 1ZM9A 2B4OA 2LQWA 4DEYA 5EX3A 1DJ7B 2ZBPA 4LF4F 3GIBA 1FTRA 4KHRA 4IH7A 5DLOA 4QIVA 4YR3A 3G8TA 4GKKF 1NDPA 3O8WA 2O1PA 1RZMA 2XMFA 2H51B 3CCRQ 4OLPA 2GC8A 4EI2A 3HFKA 2FPDA 3GV5B 5EWFA 2UXCF 3KHRA 2H5JB 2VKZG 5E33A 3D0IE 3UCUP 2VONA 2K7KA 4LSLB 4I67A 1XN9A 2HHSA 2M52A 4PYDA 1VOMA 5I21A 3ZZZA 5DQIA 2H9ZA 2OPRA 4USWA 3H2LA 2ZD1B 3R1HA 3MEEB 1I1GA 2O4XA 4XK8C 1CJVA 5E3PA 3SEMA 1KFDA 1SKUB 4DV5J 2CP2A 4P75A 1BIAA 5C24A 2YNHA 4KPYA 4C8QD 1YHQS 2XQCA 2K9GA 3CCLT 2PVDB 3G2XA 2ATCB 3WXMB 5LSOA 1VQ8S 4JI2F 3QFHA 3M0SA 3T5HA 3HM9A 3G71T 2CQPA 1UVIA 3I5SA 4WXWA 2OPQA 2AGPA 3CE8A 3NY0A 3CULA 1VQLQ 1WG5A 1KBRA 1LPLA 1W2BR 2NUPB 4WWSA 4X4PA 4LVOP 2DGUA 2LFVA 2EJ9A 2V8VA 2J8AA 3PFOA 5KT3A 3PW0A 1G3WA 5GAN7 1T9XA 2DLPA 3LLRA 2IAJA 2F2VA 2XCPA 1Y07A 5LJ3d 4MMKA 1GMWA 1DLOA 2ZVSA 1N5YB 3VAHA 1EQ0A 1DZ5A 5GJWB 3OHBA 4ELYC 2P6SA 1B7YB 1WF2A 4RTXA 1TKTA 3EXCX 3FDSA 3TJ8A 3S01A 2A36A 5G4DA 3IXQA 1HIYA 5IOLA 1H98A 5H9FK 1ZSZC 2A0FB 3MEWA 2CG8A 1VQ4S 1ZETA 3CMAS 1G8XA 1U7LA 2EFQA 3CCLA 2D7SA 5CO7A 2BJDA 4ETZA 5U47A 1T7PA 2V68A 4JI8F 5DRKA 4HR2A 2QSFA 3TYTA 1X8DA 3FEOA 2VASA 4NLTA 3TR5A 4Y3CA 3GPLA 4RW9A 1HWKA 2DGOA 1ITPA 2HK3A 4CCHA 4QVDA 2F40A 2ZH8A 3I55T 2DD5A 2ROEA 7FDRA 4BBYA 2Z30B 1YJ9T 3MMCB 2F4FA 4Y91A 1FJGJ 2IRYA 2ZJRQ 4QW8A 2WW8A 5BYRA 2CWXA 4IDKA 4TLQA 2GBQA 4ECWA 2UUBJ 5HCKA 1O0PA 2QEXT 2J0SD 1S4FA 1X0PA 1NEBA 4OZLA 3KYLA 5FJ4A 1VQ4A 2BM1A 2FJXA 1NNDA 4DUYF 4DU7A 4P2XA 1MWYA 4M7AF 2JTFA 2ZE2B 3PX4A 4NRTA 4OMOA 4O6JA 4KO0B 4N8OA 2RM4A 4QOTA 2OSQA 3NEKA 1C0UA 1U3OA 3EGZA 1Q78A 2Y1JA 1LV5A 3FMWA 1XTDA 3GFYA 4RJVA 5B0DA 2DTJA 4X62F 1IKYA 2VC1A 4PWUA 3TU4K 1XQHA 4UOHA 2J05A 3M54A 3BBFA 4K50A 3BQ0A 2R7OA 1VS3A 1Z9QA 1MROB 1BI1A 5CQYA 4A8WA 2XMTA 2KG1A 5KT6A 3UPFA 1NJIR 1B3TA 1DAXA 1KK7A 2CSIA 3GTYX 2QC3A 3OFHA 3HHLC 4FKYA 4ZIWA 2YKNB 4JS4A 1CEZA 2QA4G 1M5PC 5J1PA 1KQGB 3CB4A 3ONQA 1WF0A 3VTIA 5GAHU 1FX7A 4PJNA 4FXVA 2KSSA 3W66A 3M8PB 4RTYA 2FY8A 5HROA 2RD5C 5LJ3Y 5IWAJ 4WP9A 4CIOA 4EUVA 4EMDA 3P5TL 2YNFB 2LEAA 2GQIA 3HI9A 4ORZA 1K9MR 3EAEA 1PNJA 1RUSA 4O3SA 5A2QY 4Q8EA 2VQFJ 2DNNA 3HO1A 1H7XA 3DOLA 3NGDA 1L3KA 3DI6B 3OA6A 4A4FA 2FVSA 3QGHA 5F8MA 2R57A 4IURA 5A0GA 5E3AA 4ZJLA 1OQ6A 2XMVA 1KG1A 2E44A 4AQYF 3ZXWA 3QMQA 2DEIA 4VUBA 2A7YA 1GT8A 2DTIA 4P2MA 5KFJA 1RABB 2GX8A 2FPEA 3SFMA 1FX2A 1TOVA 3FGVA 1FRJA 3H25A 2XG8A 4L73A 1UHCA 2PA8D 3NGSA 2L9DA 5ETNA 1M0SA 1D8YA 2NUHA 4LSZB 4ESRA 2FB7A 4JZ3A 4KQZA 4Y2KA 1FFWB 1AWJA 1FK9B 2G0IA 3OXFA 1WTBA 3R7BB 4HT5A 3IRXA 2QQSA 1RWXB 1QP2A 5HANA 4O3RA 1RTHB 5IHNA 4M5JA 2DNKA 3UWTA 2N7CA 2G0CA 2PMZD 3RU0A 4NXMF 3S1TA 4U96A 1TKXA 4MK9A 2ZPHB 3VS7A 4M5LA 5IV4A 3Q24A 3JCMe 4LIRA 2GVDA 5LOQA 4GVLA 3GLXA 4ANJA 1WHYA 1OY6A 2J7KA 2Q43A 1E6HA 1HQUA 2KVQG 1MGQA 1M90T 1VQ9A 2JWNA 3L42A 3HT0A 4ECRA 3OFGA 2MCNA 4FT4A 5FU6B 5KT7A 2YWFA 2MHEA 3MGJA 1H0HB 2DNOA 3CJQA 2J6UA 1UPPA 2KXHA 2NUZA 3EYZA 1WHKA 4CH7A 2UXDF 1N52B 1U45A 3KMSA 3DRRB 1BI0A 1QWEA 4B9MA 1KD1R 1VQYA 1TV6B 4DFKA 3WBZA 2QQBA 4H4MB 2EKNA 3CDUA 2CDTA 2V8GA 3QBYA 2VUGA 2V69A 5D6YA 3A8JA 3VU3C 4PFOA 3R5DA 3RDVA 5B0BA 5KFMA 5KYUA 4TY8B 4CWBA 5AYFA 3D28A 3NCPA 4C8QB 2NSCA 4YDXA 5B0EA 2OH2A 2ADBA 4OI6A 3GIRA 5KG3A 3PEHA 3VZIA 2DK2A 2NLWA 2OPSA 2OD4A 2QMWA 1TV6A 3OW2S 2OTJS 5FU7B 1RTJB 4JYAF 1NJZA 1RHQB 2A18A 4N8NA 1JJHA 1YGYA 5F3ZA 3PZPA 2UUAJ 2FB0A 4ELZC 1RCXB 4RW4B 3NNHA 3M4XA 1RWKB 3CD7A 1L3TA 1WC0A 4USJC 1S9EB 4RNMA 1QVGS 2QA4A 4NI2B 2RQ4A 2QGGA 5IXFA 3GG0A 5GAOn 4GBQA 5KFXA 2HHXA 1UGSB 6AT1B 4KE5A 2MPUA 2EYZA 2K7JA 3PX6A 4DV3J 2X3XD 2KY9A 3V6HA 1HQ2A 2BE2A 2BJEA 2FZCB 2I8EA 2OJ2A 1IR1A 5D6GA 3SSRA 3HKWA 1QKWA 3TEGA 2VG6B 4ELUA 1HWIA 1BYMA 3OXLA 1XMBA 4EIKA 1FKOB 3PNIA 2IPOB 3JTPA 2RQKA 1ZAWA 1VFJA 1D9AA 2BYCA 1YI2S 1S1NA 4OZ1A 3PVQA 3X20B 3QIIA 4JJNK 1ZTWA 1M27C 2HQDA 1KHWA 3Q2TC 1FK9A 3MTKA 2XIDA 4Y6IA 3HCXA 3ZZTA 1FNXH 3LGMA 1WJQA 5KFHA 3MUTP 4K4VA 2C2MB 4UUXA 3K58A 2F8EX 4R0EA 3OBWA 2H1YA 4RG2A 1N48A 5CQGA 4FT2A 3QGPA 3EZUA 2F8HA 1LOJA 4KHMA 2N82B 5GAEI 3DLGA 2AJ1A 2DHGA 2FPFA 3N28A 4QQ6A 1BCOA 5C2CA 2IC3B 3DI6A 1PCXA 4IKFA 4J6XA 4MFBA 4DEZA 2X3WD 4F7UA 3CCST 1VQKA 4PXEA 3V8JA 4OYOA 1NSQA 3CJSA 3JCMc 1X9SA 1KVIA 2CUDA 4PK4A 1Y96B 4ELVA 1S97A 2GQQA 5IM0A 1RWNB 3HVAA 4MDXA 1U8SA 5ETTA 3TAQA 1JMTA 2P4TA 5CYQA 2YRCA 3LX7A 4P52A 3MDFA 1HA1A 3OYFA 2EFNA 2BE9B 4J83A 1WJSA 3OHAA 4TNOA 1TK5A 1M1GA 2HLTA 2CNNB 2QA4T 4RLEA 1N6QB 2JEJA 1RA6A 4DL3A 2C06A 4ED8A 5DETA 2FLPA 4LUBA 1LNQA 4OQJA 3BV8A 1NG2A 2D9TA 4B9WA 2D1XA 1XEZA 1JLAB 4CLUA 1VQ7T 2CZ0B 2KT5A 2ZUAA 1FRXA 5KFKA 2FHOB 3RBDA 1D0YA 2V8PA 4JUZA 2ZWOA 4LF8J 1JXVA 1O9SA 1BCMA 1RT2A 1W6XA 4LF7J 2MJNA 4LBHA 3T6BA 1VQPA 1S1UA 1NEEA 5JUMA 4C8QG 1R7IA 2CZ7B 2H54B 1D1CA 4WFZA 3L2QA 1S7HA 1H3HA 2LDYA 3CCMQ 4QQDA 3ZTSA 1C0UB 4QIWD 4ED5A 3VS4A 2EXUA 3PYDA 1O8BA 2EKOA 5CKBA 3PIPA 2J7UA 2R8KA 3PW5A 2EIFA 3OY9A 1BKBA 2LLZA 1SV5A 1T03B 1SC4B 1ZZNA 1GCQA 1U47A 1KVJA 3G6YA 2M1HA 1N9RA 5A0YA 3TVKA 3EG3A 2B0GA 4P2FA 2ACMA 3J80U 4C0BA 2EQIA 4CRJA 2ZM6F 3ENQA 4X9CA 2OTLS 3CD6T 4QU7A 4Z02A 3VV0A 4Z2XA 2YNIB 5C42A 5J2NA 4B3RF 5AXNA 2EW3A 2HHWA 1LQ9A 1WDXA 2XM3A 2ZWPA 3CD6S 3MR2A 4J9DA 2X51A 1X6OA 1JLBA 2AEMA 3KUEA 5KFPA 2MWOA 4FYYB 2DTHA 2FC9A 3FBEA 3CCVA 1T9YA 2LKZA 1X0FA 2Y8YA 3CXCA 4DR7J 4OV1A 3Q8SB 2B4UA 4DBRA 1XBWA 3H5UA 4NI2A 1M1KT 3TWZA 2CH4W 4J7CA 1I0CA 4ZDNA 1FMWA 1Q8IA 2ASYA 3UVJB 3V5RA 4X4NA 1RI0A 3KJVA 3GFZA 4R0KA 1IZ6A 3HHLB 4UOCA 3ENWA 3QZ7A 3HZGA 4KRTA 1YRXA 5IQQA 2EVRA 5C0MA 1YNZA 4LR9A 2DB1A 2ZAEA 2R4FA 4X4UA 3C14B 3DRXA 1AT1B 3MP8A 1YQHA 5F8JA 3GU0A 3VUBA 2ALYB 3U02A 4QT7A 3D68A 2HQGA 3OW2R 3PW4A 4P74A 4N76A 4F25A 4JV2A 1B4SA 1BE4A 1KN6A 4IFYA 1CKAA 3C6UA 4JI2J 3SSSA 2OSRA 2MYFA 1S0OA 2W0ZA 1UEUA 2C22A 4OMPA 4ED4A 5CVIA 1R77A 4LMZA 1ZBXA 3E1SA 2HFOA 2BA9A 2JDJA 3LQVA 3G71S 4PFPA 2D41A 3ET6B 1V3SA 1U0HB 5FD1A 4DR2F 2RHYA 3UCZP 2VXEA 2YX1A 3DGVA 1OQKA