2VV5A

The open structure of mscs
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
256
structure length
256
Chain Sequence
LSYAVNIVAALAIIIVGLIIARMISNAVNRLMISRKIDATVADFLSALVRYGIIAFTLIAALGRVGVQTASVIAVLGAAGLVVGLALQGSLSNLAAGVLLVMFRPFRAGEYVDLGGVAGTVLSVQIFSTTMRTADGKIIVIPNGKIIAGNIINFSREPVRRNEFIIGVAYDSDIDQVKQILTNIIQSEDRILKDREMTVRLNELGASSINFVVRVWSNSGDLQNVYWDVLERIKREFDAAGISFPYPQMDVNFKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords SMALL-CONDUCTANCE MECHANOSENSITIVE CHANNEL
publication title The Structure of an Open Form of an E. Coli Mechanosensitive Channel at 3.45 A Resolution.
pubmed doi rcsb
source organism Escherichia coli
total genus 83
structure length 256
sequence length 256
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2008-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00924 MS_channel Mechanosensitive ion channel
A PF05552 TM_helix Conserved TM helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.60 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2vv5A02
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vv5A03
1GXUA 5IXUA 1TL5A 1YRXA 1YJUA 3LGNA 1N5VA 2FTRA 4YDXA 3HFKA 4DL0C 3VTIA 4A47A 5B0AA 3DCAA 2LXFA 1OQ3A 1AW0A 1CC7A 2BJDA 1P8GA 2BBEA 2IFXA 5B0GA 5K9FA 1VQSA 2ZDPA 1OSDA 2L3MA 1Q53A 1JK9B 2JDJA 4U9RA 1FVQA 3BB5A 2QIFA 2RH2A 1Y9OA 5A6WA 2VH7A 1KQKA 2OKQA 2BUNA 3HHLB 2OD4A 5A6PA 2FIUA 4YEAA 1FE0A 2XMMA 1SB6A 1S6UA 1TR0A 2IYGA 2W4DA 2OFGX 4Y2MA 3MZIA 3KKFA 2RMLA 2OMOA 4Q2MA 1Q4RA 2W4PA 1VIFA 5B0DA 1YJRA 2PD1A 3KG0A 2XMVA 2FHMA 1SQEA 4HI2A 2FB0A 4Y2KA 1N5SA 2PGCA 5KAKA 2RU9A 2GGPA 1AFJA 5F0WA 4OJHA 3T9NA 2K2PA 1FD8A 2ROEA 1W2IA 3TRGA 1Y0HA 2AJ0A 1N5TA 3LGMA 5B08A 5B0BA 3QMQA 1U7LA 2ROGA 4OJ1A 4Q2LA 2RSQA 2HIQA 2OP5A 2GO8A 2GQVA 3FMBA 3WDOA 4DN9A 2BJEA 1TZ0A 2GCFA 2K1RA 3FGVA 1QUPA 3BDEA 3K7RA 4FNHA 3TNVA 1CC8A 4OIXA 3HHLD 5T7LA 2AW0A 2LQ9A 3F44A 4HL9A 1X7VA 4OJ3A 1YG0A 2N4DA 5B0FA 4NPOA 4A48A 2XMKA 2KKHA 2XMWA 2AP6A 3HX9A 1JWWA 2RK2A 1FE4A 2XMJA 1RJJA 4EFAC 1X8DA 1KVJA 2N4CA 1SI9A 2GGPB 3BN7A 2OFHX 2KT3A 5B09A 3MCSA 5B0EA 2BYCA 1V3ZA 1WD6A 3BGUA 4ZA1A 2XMTA 2W4CA 1LQ9A 3GZ7A 1Q8LA 5B0CA 1APSA 3BR8A 3HF5A 1KVIA 3CJKA 2EW9A 1YJVA 1GXTA 1MWZA 2K1RB 1Y3JA 1S6OA 3I9ZA 1Y3KA 2RILA 3SFMA 4FNIA 4NL5A 2QLWA 5F0UA 2OD6A 2ACYA 2GFFA 2LQBA 2P4TA 1OPZA 5T7LB 4A46A 1IUJA 1VQYA 1TL4A 1FEEA 1N5QA 1CPZA 2GA7A 2HLTA 3LO3A 2RK1A 1R6YA 3KNGA 4ZOSA 4F67A 1FVSA 2QYCA 3QGPA 4HH1A 4QOTA 3IWXA 1TUVA 2G9OA 2VV5A 2KYZA 1MWYA 2N7YA 3KG1A 1URRA 1YJTA 2ROPA 2ZDOA 1Q8BA 2XMUA 2AJ1A 1P6TA 3DXSX 3FRYA 1VIEA 1AFIA 1K0VA 3TOQA 2HFNA 1ULRA 3UDCA 3CJKB 2K7JA 1FESA 1X0PA 3HHLA 2K7KA 2LDIA 3HDSA 4HH0A 2HFOA 2IYIA 2HLUA 2OAUA 2CRLA 3E8OA 3IWLA 2QLXA 2Q3PA 4HI1A 2KT2A 4Y2IA 1XBWA 4A4JA 2ASYA 2HQIA 3BF4A 2GV1A 3HHLC 1OQ6A 4DPOA 4OJGA 3BM7A
chains in the Genus database with same CATH superfamily
1M1FA 1SRMA 2VC8A 4AFZC 4QYZK 3VTIA 3CBMA 1N6QA 5KFLA 1BWVA 1HHQA 4YS2A 5DDPC 2EYZA 3R5BA 2IC3A 1LJOA 3PT9A 3BKTA 4TY8A 2ZWPA 2YPZA 2HZYA 3ELHA 1GNKA 4C9DA 2DXFA 4OJHA 3VAGA 4R56A 1X4AA 3MCMA 1JU5C 3JRZA 5B08A 1YJWT 5E2QA 1U02A 5D0EA 1UGPB 2HZVA 2W10A 1RTIB 1FRIA 4IFVA 4M75B 1K9MR 2HG4A 3CO0P 3HFZB 4YP3A 1OOTA 3JS9A 1ZBTA 2MKCA 4OMNA 2V4JA 4E8UA 4DSIA 3CCSA 3EGWB 1Q7YT 4USMA 1GXTA 4R0JA 2HVIA 3OR2B 3PVQA 4EBCA 1OMSA 2Y4XA 4CH7A 3JCMQ 1RXOB 1WX6A 3G4SA 2ATCB 5D7UA 1Q78A 3NS7B 4WP8A 2YRDA 2G9OA 1Y5NB 5GAGU 2A0FB 5F8JA 3OYFA 3NNCA 3R8YA 3PEJA 3CPWR 2FZCB 4MK8A 4ZTJA 4ID8A 5AYFA 4C0BA 4OYIA 2NZ4A 1IBCB 3HRTA 3G96A 3D28A 1G3OA 5K5MA 3ZTSA 2M9KA 1JJ2S 4UZBA 1QY7A 4MKBA 2LA4A 3CCTA 2BX6A 1KVKA 3C15B 3CMEQ 4WFZA 1EQ0A 3UDLA 2F63A 5KFXA 3M6XA 1R8HA 4QR2A 1R8OB 2MZQA 3J80Y 1WI8A 3D1HA 4DR1J 4AG1C 5HK4A 2COLA 3V4IB 5KFDA 2MY8A 3HJFA 3DLKB 1IKWB 3KLFB 2ROLA 4JV1A 3LP0B 1VQ5S 1S12A 2DPIA 5GAOq 3X3UA 3NCPA 4TNOA 2DD5A 1YJ9Q 1Q7YR 2V2QA 4KO0B 2VBYA 5L8RC 2DNMA 4RNMA 2IHR1 2LVMA 1CJTB 1HW9A 4FT2A 2VG7A 5I2SA 3VVUA 2ZEJA 1P92A 1DZ5A 1Y07A 3G6ET 4F4KA 2JOQA 4KGXB 4JS4A 1YKWA 2J7WA 5CAAA 2NUPA 4HT8A 1VQOT 1H3DA 3THKA 2B4VA 4E7SA 3TI0A 3CCLT 2AT1B 3JYTB 2F1LA 2ZH9A 3TZWA 5CAIA 1M5PC 4KT0E 1D1BA 3UR3C 3OTOJ 2GMHA 5K14B 4F7VA 2RHIA 1M1KC 4QQDA 1Q53A 2B9WA 2DIQA 2JTEA 1GBQA 1CBKA 2J6KA 2MYSA 4DXLA 2VXEA 2JM9A 1WQWA 2M1HA 3DN9A 2V2ZA 3CPWA 5I42A 3EGNA 4RTXA 3OL7A 2E1AA 4UUWA 1T05B 3P5TL 1Z4UA 1RTJB 2FHOB 4F4AA 2EYYA 2K2VA 3OMCA 2W0ZA 2HHQA 2DVIA 1LWCB 1S9FA 1N8RR 2XYHB 3NMAA 2XMWA 3ETOA 2XMJA 2HGMA 1KBRA 3CC4T 2BA9A 3POTA 2QASA 2JW4A 1YJWA 4ANDA 4P2MA 2J6SA 4WYLA 1B3TA 1OZ2A 3QSIA 3G71Q 1MWZA 1Y3JA 2JTMA 1NJIT 2Q6BA 4LN2A 3LAKA 4P52A 5CH7B 5F41A 1T11A 1QTMA 4K4TA 3KG1A 4ID5B 2Y1IA 2RNEA 1S6QB 2EXUA 4OZNA 5J2QB 4HH0A 2OAUA 3MMBB 2CREA 2KRNA 2JRSA 4FVCA 1Y11A 4W90B 1RK8A 2KT1A 3M8QB 1NYGA 5T14A 2A1BA 1BQMA 2V8IA 4ZLPA 2X4YA 2GC8A 3M2RA 3HL8A 1TAQA 3M4XA 5GAN8 5HCKA 1RB0A 2KL8A 3PO4A 1D1AA 1GEHA 2XLKA 4Z8AA 4PNOA 2W4PA 2N82B 4J9MA 3URGA 3N6MA 3TQEA 2UUAJ 3QPHA 1G8XA 2MSSA 1VBXA 3J7YU 4A8OA 3KMSA 2EPIA 4IG3B 5T7LA 4AFSC 1FD2A 1UFFA 2OPSA 3C6TB 3PM9A 4DV4J 4B3OB 1VIXA 4PPDA 1CJUA 3VUZA 3IAS9 1NJIR 1HSQA 1NK4A 3CJ4A 2RHUA 1ZA1B 3JCMc 2F7VA 1PD0A 1UGQB 1LCKA 5K8MA 4JZ4A 2ZVSA 3BBCA 4JOUA 2YKOA 3DMJA 2GJIA 2QXFA 2IJFA 2QTXA 3N6NA 4X62F 3R97A 5AT1B 4M7DD 2DPJA 4FKXA 4X4RA 4FYXB 2MZSA 2XWYA 1WOPA 4F7UA 1XR7A 3AD9C 4QIGA 2VFSA 3G6EA 1HR0F 4ES2A 1VQ8S 2DHHA 3BY7A 4LDUA 4DOWA 4CLTA 1VQOA 2CDRB 3BEGB 1T0JA 1FFWB 3QIPB 4U9RA 2WOMB 4X4SA 2YTCA 2KY9A 3CCLA 3OLBA 4DV4F 2KRMA 4L3NA 4K4YA 3FSIA 4OHYA 3A8LB 2ZH3A 4DBHA 4F4XA 3RMQA 4PK4A 3H5YA 3JB9H 4NS5A 1T7PA 4MJKA 5B0BA 2DTHA 2KFYA 4R8UA 2H3JA 2IG0A 3EM1A 5BXIA 4Y6IA 5KE3A 4DX6A 1YCSB 4AL6A 4FF1A 4LIRA 4HYKA 2KI2A 2D1CA 1JWWA 2LA6A 3LOUA 3DOMB 3DLHA 1XTZA 1HBUB 4XTVA 1UETA 2RB6A 3F41A 1H7XA 4UOHA 1GFCA 2QEXS 4AXJA 1VQ6S 3NCRA 2ZNZA 3GYGA 1B64A 1BCMA 3CC4A 3W8GA 4HCKA 3QJ6A 2IPOB 3UWTA 1YDLA 3CJTA 2DH9A 1H641 3B8HA 3MAAA 2QYZA 3OVBA 5H1SV 4A8FA 4YQWA 2FVUA 4OX9J 3KHLA 2HQDA 1EQMA 3QLHB 5GAN4 1K76A 4HACB 1G2EA 3RRHA 2W2QP 4ESRA 1PJ7A 2BBEA 2IFXA 1FKOB 4I68A 1VQLQ 1GTEA 1CSJA 2VH7A 4DN0A 4EEYA 3MP8A 4H4KA 1UFLA 5IHKA 1Y96A 4BLGA 1NZ9A 2HDAA 3BO2A 3HRUA 1SH3A 4UUXA 1QSYA 2FQQB 2QTWA 1U2RA 2CP7A 3PGGA 2YVSA 2J9CA 5KFBA 4PXBA 3TWZA 3O5TB 1AZGB 2PSZA 4R55A 3EGXA 3OFGA 3LWMA 2XDPA 4ZVFA 1F0XA 3KJNB 1N33J 3SYZA 3H59A 4P7TA 1HNXJ 3CD6T 4OX9F 3EXCX 1BCOA 2E12A 2QK0A 5KOWA 4ZLLA 2FJXA 4DX8H 2HNIA 4FKYA 3O8WA 3RG6A 3IP0A 4NRTA 2WW8A 1OPLA 3A8GB 1HQUA 1X0FA 1X4CA 1J5EJ 4ECXA 4ENOA 1N36J 3NNHA 4PFOA 1FK9B 4PG4A 1ZZNA 1D0XA 3OV7A 3RW7A 3CCSS 1OEBA 3MHXA 4CO5A 1MNEA 2O4XA 2GHPA 1D0EA 1R7IA 1QAIA 2CPZA 2BOPA 3G4SS 3ZO7A 5HP1B 2QQ9A 4M75C 1TOVA 1FMVA 5I22A 4EU0A 2DYIA 1NDCA 1N33F 4ZHRB 4CRJA 2EFGA 1HNXF 1MV0B 1VYUA 1FDNA 2VG5B 4HTIA 5ETSA 1RHUB 2DPPB 1HWKA 5HK3A 2DRDA 5HVHA 4OB2B 2MB0B 4IO1A 2J9DA 3K17A 4ED6A 2YNIB 4NCBA 5I11A 4M8LA 2EQMA 3BO4A 1R31A 1Q5VA 3KHHA 3U27A 2OJ2A 2L9NA 1AROP 3GPAA 1W2IA 1KQGB 3Q2SC 4L73A 3M9MB 2AJ0A 3K2YA 5IS2A 1J5EF 3TQ1A 1GFDA 1PBAA 1NG2A 2JMAA 3BDEA 2X1BA 4LFAJ 4NLXA 4J9RA 1YP5A 2BZ8A 3VAJA 4OIXA 2VOOA 2EKOA 4EMKA 2MWPA 1K4US 1SC4B 4CWBA 2MKIA 1GAOA 2ESWA 3IGNA 1S9GB 8RUCA 5LJ3Y 4MMOA 2G2OA 3EFRA 2DL3A 5A0YA 2K1RB 4NZ0A 2FPHX 3N79A 4Z37A 4FNIA 1A0OB 2O67A 3S6WA 2BRKA 1DTTA 2V0NA 3PNWC 4Y92A 4WIQA 1RWNB 3J81Y 4CRIA 1ZTTA 2VD3A 1V3SA 2FJWA 2FVPA 2XGPA 1XNQJ 1OU8A 3FRYA 4OZ3A 3FZBA 4PUOB 1WC5A 2IA0A 4RW9B 3CBPA 1QE1A 1IHVA 5D6YA 4DS5A 2L2PA 1K1SA 3QWUA 1N48A 2ZH2A 4DL0C 2PDAA 2C3YA 4JI4F 1U2CA 3B6BA 3I0RA 3PZPA 1GCQA 4KR0B 2JWNA 4YFUA 3WVDB 1X4HA 2B8AA 4F3QA 1BQNB 2BE2A 2L08A 1I1GA 2EJGA 1MROA 4Y2KA 5HATA 3CCUQ 2GGPA 3DGPB 1CJKA 3TRGA 4G1QB 4N4HA 1VDHA 5J2PA 2DBKA 4ZCKA 2QLFB 1XNQF 3CPWS 3OXLA 4G1PA 4XU0A 1WQ7A 3BE3A 1IKXB 2M0OA 5KYXB 1IR0A 3VALA 2BJ9A 5ETLA 3BR9A 3M0SA 1I3OB 2DR5A 2X1FA 4YUDA 1KFDA 2V6AA 1ROFA 4VUBA 1FRKA 1N32J 2ERRA 4NLSA 4PYDA 5FJ4A 1R0BG 2ALYB 4TQRA 4NRUA 3BQ1A 1RT3A 2CZ7B 3CD6A 2RKIA 1S1VB 1CLFA 2EIFA 2DMOA 3IWXA 2O01E 3CQTA 2KHDA 2E10A 1UFKA 3H0HA 1AZEA 1NEGA 4IIMA 2BZ2A 2C2MB 4I7FB 3CEYA 1X69A 4JRKA 2ASDA 2FHKA 4WXOA 5I4MA 1O51A 2CNLB 1H8KA 4KIAA 1YJUA 3ISND 4Y2AA 2RHSB 2DEUA 1XC9A 2J0SD 1VQNQ 3PIOQ 1URNA 1DJ7B 5EDWA 2EJ9A 4JRQA 3AA9A 3PJ9A 2G0CA 1WHXA 2FO0A 2ZH7A 1RISA 1N32F 2BKNA 1RWXB 1RT1B 1WACA 2VONA 2W2OP 5JVHQ 2LP4A 4HVZA 1PKUA 3CC7Q 1CKBA 5GAMj 3CMQA 2D41A 5FU7C 2ZBQA 2ROTA 4NYOA 2XEXA 4DFJA 4K8RA 5E7OB 2C2RA 2YQ0A 3K7RA 1BI1A 3FEZA 1NH7A 3TVYA 3W3SA 2CQ4A 3KLGA 3MMAA 1N54B 3D6FB 3MM9A 3QJLA 4TKTA 3CIZA 4I6YA 3E9FA 1U3OA 2E5IA 2EFPA 2DD4A 3I5BA 3JB9k 1VQMQ 1FA0A 4KULA 3U23A 2KB2A 3CUNA 3CJKA 3SCJE 1U8RA 3TJ9A 4Z2XA 3F56A 4A4FA 1V76A 2DXUA 3VGUA 2X9HA 3MOJB 3ZZUA 4PJNA 4J9HA 4L74A 1U0HB 5DS7A 1JJ4A 4DPWA 3CULA 4TYBA 3QHSA 5KG6A 4C3MA 5J2MB 2ZE2A 2DYBA 4F50A 1IKYA 3HVTA 3WX8A 1SRLA 3ZFJA 2JM8A 1EIYB 2AZVA 3D67A 1S0MA 1VQPQ 4DDFA 3I5SA 2FUG9 3HVRA 2H54B 3D0GE 2HQEA 1SSHA 3I5RA 2GVZA 4ANJA 2B0GA 4LRDA 3CJ3A 3KG0A 3EPIA 4IRCA 2GNCA 1R0CB 3P8HA 3JCMP 4M77C 4KBMB 3ZZ0A 4W4MA 2VWFA 4ECQA 4LF8J 3WC2A 1N88A 2NXEA 3JB9I 2W25A 5CD4A 2PEBA 1NHVA 2PI4A 4FL6A 3MFHA 2UXCJ 3UD5A 3G6ES 4E7KA 5F8NA 2RAQA 4M5MA 1HNVB 3MM7B 3PCOB 4IFYB 1VQOS 3LUYA 2IA6A 5GAOn 3GB0A 3MF5A 2GBQA 4OMPA 3LGMA 4X4TA 3HCXA 1PRMC 2HKEA 3CCLS 1E6YB 1YZ6A 3MPYA 1NAQA 2DRAA 2I6WA 2HCKA 4WCIA 2F5KA 5CO7A 1IWGA 1N0UA 5IT9E 1E6VB 2WAQD 1YBUA 2PFFB 2VZ9A 2AF6A 3QXEB 2XMTA 2ZH4A 1Q8LA 4F25A 3I32A 5KT4A 2KRRA 1M5OC 4LF8F 3LWHA 1Y0MA 2XM3A 4P7VA 3PX4A 2BTTA 1LW0A 2FC8A 2B51A 2QA4Q 2JHEA 2UXDJ 4C92E 3C12A 2UXCF 2CPHA 2KT5A 2GAGC 5FROA 2ZAEA 2XBPA 2KXCA 4M5NA 1T9XA 3IWNC 1Q8BA 1FDAA 1NHUA 1Q82C 3C6UA 1UDLA 3JTOA 2BV3A 4NLOA 3TYTA 4P2XA 2XD0A 1WHJA 3X25B 5GANj 1KR4A 2IRXA 3C95A 4HKQA 5FRNA 3QSUA 3CC4S 3R27A 2BANB 2DHGA 1P8GA 2E9TA 3MOZA 4J9EA 1WEZA 4LXCA 2OPPA 2BR0A 4LVOP 3HHLB 4DFPA 3FUYA 1M5HA 5GAOr 1RAIB 3ZTPA 1CQNA 1NSQA 4RW6B 2YSQA 5LXYA 4K4ZA 4CLKA 4R0KA 5D0HA 4J9KA 1WHYA 3DHWC 2ROEA 2UXDF 5HN0A 4DN9A 5EX0A 4B17A 3CVKA 3HKSA 2RI3A 3OYAA 4P5NA 1OV3A 3P45B 3OR1A 2FVRA 2BUDA 1HBMB 1KFZA 3VYHB 4C6AA 3EMTA 3AAWB 4ECWA 5IT9U 3BYRA 1ZTWA 3FCHA 4ED4A 1S79A 2CA9A 1ZQ1A 2I1RA 5ETQA 2MXYA 3BGRB 5EX3A 3OUYB 2WVFA 5HMYA 1FTCA 2H4YB 3HM9A 2RJZA 2CXEA 3JQJA 1K8AT 2J7KA 1GXIE 3PR5B 1E6HA 2KQWA 3RB3A 4LREA 3LALA 3CJ5A 4II1A 3M6UA 3L2WA 3M30A 1ZBJA 1M90T 3IS9A 2EQJA 3OHAA 3P8BB 5ETNA 1M1KT 1CEZA 4KQZA 2Y0BB 3DLLQ 4ICLA 2EK1A 3MI7X 3J80E 1M3BA 2W4DA 4ZP7A 4QVDA 5F3ZA 3NS6A 3KUHA 3SV3A 1X6OA 1QAJA 1WUUA 4J6YA 4ZN3A 5HLFB 1L3KA 1GBRA 2LDMA 2DTOA 3PIPA 1N5YB 4C92F 4ZVEA 4O4GA 5CA5A 2HHXA 2J76E 1TL1A 2CQ3A 4XU2A 2O1PA 3GV7B 3CXCP 4DQRA 3RBXA 3QT8A 4DF4A 2EVZA 1TFYA 4LDVA 4J9FA 3FQKA 2QTVA 2F65A 5GAMf 2C3MA 4CT9A 2RB7A 3RKWA 2C2KB 3W64A 1C2PA 2JH3A 1RUWA 1HBNA 2MKYA 1K8AR 4ECRA 4Q43A 2E5LJ 5KFGA 1WOSA 2CGHA 4C0GA 1TK8A 3UCUP 1M90R 2QLJB 2O9VA 4A4GA 4M7AC 3ZTQA 2HVDA 2YLBA 4PZVA 1M1KR 2NUZA 4GC7A 2L5QA 4Y65A 4FYWB 3FSXA 5KYUA 2QG9B 4L59A 2LP5A 1I07A 1HI0P 2UP1A 1AZSB 2FJVA 2QN6B 2UV8A 3VS6A 2KYXA 4QWBA 2YKAA 1Q86C 1WJRA 3MD3A 4IH7A 2BQUA 3FKBA 3G82B 1JLEA 4USTA 2BVZA 4LJMA 2D3ZA 4H4MA 2JEGA 2GFAA 3RUXA 2IDLA 1LWFB 3VUBA 1RHMB 2E5LF 2F8MA 1TV6A 4NCGA 2CZ0B 2I0NA 1K9AA 1EETA 2RA2A 3V7CA 4UQTA 3SDEB 1XMQJ 2CSQA 1YHQT 3C16B 1GT8A 4MK9A 4MZMA 1VRUA 1FE4A 2LECA 3CCQT 2A3JA 4FPIA 3IFEA 4USUA 1NB2A 2L9WA 3SSQA 1SEMA 4X4NA 5HQLA 1RABB 1SL1A 4DR7J 1I1JA 4A8MP 5C2CA 1NK5A 1G4CA 4B9TA 2GTOA 2ZBCA 5E0OA 3VS4A 2GIRA 1RQ0A 5T41A 3QAEA 2RMOA 5CCLA 3VS7A 5IT0A 2X3GA 4DQQA 2QFIA 4GKKJ 5IQQA 2DBMA 4JV5J 2HURA 2EKYA 4PQUB 2V2VA 2FHJA 3DRSB 2KVQG 3HT0A 1CVJA 1XMQF 5JVGQ 2D74B 3I55T 3PX6A 3DHXA 1FNOA 3TJAA 1VQ8Q 4DR5J 2LCCA 3W9IA 2YKMB 1R8PA 4RWXA 3AOBA 1FVQA 1K73C 2CQ1A 3GFHA 1VJWA 4P2SA 1FJCA 3FJPA 3OY9A 6AT1B 4ME7A 3LX7A 4IURA 3TAMA 4GVBA 2XS2A 4DR7F 3ZXWA 3CC2S 2UU9J 5GAN7 3NTIA 4J9CA 4M78F 1ELOA 3Q89A 1MW7A 3KWMA 2RO0A 2IVFB 2H65B 5GANf 4J9NA 4WK3A 2LQJA 2RQ4A 4RMOA 3UN2A 4Y00A 3DKDA 1V6HA 5HMXA 1AWXA 5DG7A 5KYYA 2UV8G 4J6XA 4KRTA 4JV5F 4KPYA 3D1OA 1HQEA 3HKWA 3BSNA 4IOBA 5CR2A 2RQVA 4O5VA 3BN4A 3MWBA 2QEXQ 2AEMA 5HQ8A 4KPCA 1FVSA 4J9UE 3G7ZA 5LL6S 5C24B 3BREA 4KH0B 4B08A 1URRA 1QVFR 5FLXY 1RI7A 3NWGA 1UB4A 1S4EA 3GCXP 3KXTA 4PG5A 4YB1P 2UU9F 1NSKL 1RWWB 2D3OR 2DNOA 3OW2R 4RNOA 2COZA 2BABA 3KNAA 2QQRA 2HQIA 4MIAA 3EWGA 2XCAA 4FF3A 4LRAA 1GXUA 5AXNA 3FCVA 3IA0A 3QWXX 3CGIA 3VGTA 3ET6A 3DLGA 2JLEA 4LQ3A 1UEKA 1QCFA 1HHTP 2MGZA 3BB5A 4QQBA 1KFSA 4PFZA 5D0GA 3VZHA 1B7YB 2FIUA 3OHBA 3V8LA 3E01A 4IH5A 4IUTA 1UL3A 4KGZB 3P49B 1H74A 3M7VA 3MMCB 1H0HB 2G0JA 3KDNA 4PJOG 3OYLA 3OFHA 5HO4A 4I2PB 2XWXA 3DI6A 4TVAB 3PRDA 1S9EA 1IBKJ 1S76D 3QYGB 4KKOB 3OYHA 2F8EX 1YITT 4LF4J 3HO1A 3OS1A 2AEJA 2KT8A 1SJ4P 2X3WD 1S1WA 3OTEA 4ZVQB 1F5BA 1LQ9A 2E1HA 1NYFA 3JSRA 1YJVA 2DR6A 3PO5A 3FFIB 2H3EB 2A2DA 1Q81T 4M5DA 1YHQA 2DJWA 2AZ3A 2DGUA 1FMWA 1RAEB 3CCQA 3CCJQ 1R6YA 5KFQA 2QYCA 2OELA 3MHYA 1UE9A 3UPFA 3VAKA 3GFXA 3OSVA 4NXMJ 4LF7J 1JRIA 3JB9D 1VFJA 2FGCA 3NFCA 2HVZA 3CCSQ 4ANEA 3EFOB 4M4ZA 3JSMB 4ANCA 2UXBJ 4LSNB 4LBHA 2HMIA 1X43A 1IBKF 3NGDA 4LF4F 2HS0A 1QVFA 2AWZA 2IJRA 3UF4A 2VPXB 2A2CA 4D8KA 3OW2A 4ZVPB 4F7UE 3SQOP 2EGCA 2CPYA 1T3OA 2DTJA 1Q7YU 1IM4A 4N56A 2HRYA 3I55A 3DDNA 4ZP8A 1D9DA 1HNZJ 3L42A 3C46A 2A36A 5E3AA 4XO0A 1PC0A 2E5QA 3MEKA 4C8QA 1OU9A 2W9CB 4NXMF 2A6MA 4LF7F 1Z9QA 3H90A 1IGUA 3NTKA 2VPZB 3PY8A 3EZUA 4DR2J 4BCAA 4M75D 1BI2A 2CADA 4R5PA 4QIEA 2UXBF 3MP1A 4RW4B 2NUTA 4WE1B 1Q8IA 5D8HB 4M7DB 2Y3YA 2AQ4A 2EFNA 3ETMA 3MAQA 5I3UA 3W65A 1Q81R 1QAYA 2AV5A 4G65A 2XZWA 3KMQA 2VU5A 2A3LA 1T9VA 2W8LA 3MGJA 1RLQC 2YQ1A 4V19J 5BR8J 2DNUA 3H4BA 4LRFA 3IN5A 4LFBJ 4PRFA 1HNZF 4ZJOA 2MHNA 4CTAB 2LCWA 2QZ8A 1VQ9S 2XICA 4U95A 5KYNA 2FTRA 5B0GA 2RHYA 1B99A 3GONA 1N8RU 2ZHOA 4DCOB 1JXLA 3PEHA 1VIFA 2ZD1B 3TEHB 1YVFA 3EJMA 4C5EA 3RAXA 3QJPA 4USKA 1RAGB 3T9NA 1CS4A 5IV3A 3RZAA 5BR8F 1NLPC 2BJ3A 1IZ6A 4DR4J 4OYXA 4LFBF 3K5LA 1M1HA 1PSEA 1BK2A 1UZDA 5IHNA 1RLCL 1VYTA 5E41A 4CLUA 2E5KA 3BGUA 1OJ4A 4KTQA 1XR6A 1WI7A 3RKXA 4HT9A 4C8QG 1W2BP 2BJ1A 2CP0A 1SPKA 5GMKl 4BBYA 5J1EB 3KJVA 3OS0A 1RT2A 4GY5A 4NL2A 1YITA 2JL9A 1BIAA 2MEWA 2EG1A 4QOTA 1HWJA 2HBQB 2LXIA 4KT0C 2ZH1A 1FJEB 2WRMA 2C3OA 2HZAA 4F7UF 2VGNA 4EK2A 2B8QA 5D6GA 4J9GA 4X9DA 2Y9HA 4Y2IA 4ECSA 1QTNB 3T1HJ 2CZ6B 4DR4F 1SG5A 1R27B 3QIIA 2OSQA 2Z56B 1NPPA 3CCVT 1KC8T 2U2FA 3UNGC 2EYXA 3G8QA 1KOHA 2NCKL 1X9MA 1RTIA 3BSAA 4N8NA 5L38A 1RI0A 4YY3J 4EBDA 3M2VB 4L3KA 1U1KA 3E51A 2KM8C 3KUGA 1NJIU 3GG1A 1HW8A 3QG1A 1NSPA 1Y0HA 2C2OB 1PWTA 2EQKA 5A2QU 2ENMA 2FPEA 3HHEA 4U7CA 3OR2A 4FSSA 3KFWX 2J9DE 2DNHA 2HHHJ 2LJ3A 4HCCA 2V63A 5HSPA 2LNVA 3K89A 5G4DA 5IC4B 4Z7CA 3Q1JA 1GXLA 2W4CA 2MQPA 2HHWA 2Y1RI 2ZZDA 4JZ3A 4ZITA 3HP6A 3QIDA 1XOVA 2QFJA 4LDWA 2RU3A 1FRLA 2OLWA 3W7BA 3D1QA 1FRJA 1NKEA 2CS7A 1YN8A 1YI2T 1K44A 1YJTA 2J8SA 2K79A 5CYJA 2R8JA 3JCMe 1A9NB 2HEQA 3DRPB 2LDIA 3GF5A 3ADAC 3GOXA 3C15A 2V68A 2F3JA 4M63A 3M6WA 5DY9A 2EGEA 2YWWA 1KC8R 3IBCB 2FY8A 2HKNA 2LXFA 3KLHB 4JLGA 4CO1A 5BYSA 3V4IA 1UEVA 1V5IB 3AFGA 4DU7A 4KGKA 3DLKA 1IKWA 1FCAA 1ZAXA 3KLFA 3OQ2A 2Z58B 2WZ1A 3EDRB 5I2MA 3GYNA 3LP0A 8ATCB 3G6EQ 3NCQA 3ZTRA 3IG1B 5GAGI 4KY3A 4X66J 1VQOQ 4KO0A 3I35A 4Q8EA 4DSKA 4B9MA 4XDDA 3M0TA 2B5JB 1CJTA 2P0KA 3JCMW 3OBWA 1X6GA 3CCLQ 1ZM3A 2FY1A 5H9EJ 4QVCA 4QR0A 2WBMA 4NLGA 1JJ2P 4JP8A 4JI7J 1JLBB 4RBTA 4M77D 4FIBA 3CDWA 4ORZA 4ZCLA 2YH0A 2YNHB 2QMXA 3R6LB 1K0SA 2MAMA 3KLVA 2FVQA 3JYTA 2C3PA 5DG8A 1KD1T 2DZCA 2CPEA 5IN1A 2QLBB 5CQYA 4LDXA 1WTFA 5K14A 1Y7PA 1GMWD 1NB7A 1ZS6A 1Q82T 5CVIA 3TOQA 4OHVA 3OVAA 4ZGJB 2K7KA 4LF2A 2MWOA 3BF4A 4ED5A 4X4UA 2CQIA 3MTKA 3QNWB 3SIPB 2C0TA 3E2UA 1T05A 3CC4Q 4MAKA 3VR1A 4JI7F 1WC1A 1RTJA 3UPUA 4O3QA 2VASA 1VRQC 3KYLA 2M0GB 4IDKB 1YWOA 3TZXA 3DRRB 2YNFB 1LWCA 2OX7A 1VQ7T 1UMJA 1VR6A 2VQEJ 3U02A 2PD1A 2R8KA 2Z4PA 2R4FA 4BC7A 2F4FA 1MNDA 3CCVA 2YXLA 3MTJA 1AVZC 1FFGB 3I9QA 1F9EB 4MFBB 4ED7A 4DWIA 2KDOA 2VC0A 2JEJA 2X4XA 4C3LA 4MKAA 3V7SA 1RWVB 1M5SA 2AHJB 1MLAA 2OPRB 3KK2B 3V81B 2DL5A 1Z2ZA 3LANA 2V5HG 2FRYA 1BYMA 3Q0AA 2D1XA 3H2VE 4CM2A 3KXDA 4ID5A 4RUHA 1S6QA 2DH7A 5J2QA 1KD1R 3OFEA 3MMBA 5LM7E 3LYIA 1BUXA 4X4PA 4URQU 3M8QA 5DLOA 2CP2A 1N9SA 4FCYA 1Q82R 2VQEF 2PUKB 1TFWA 3IBFB 4TLRA 2ABLA 5GAMh 3VZIA 4OZJA 1KWMA 3BBFA 4CI0B 1T03A 5HJYA 5GAOm 3CCQS 2R8HA 4DV2F 2R58A 2WSCE 1IBLF 4FN5A 1JKHB 1YI2A 1G3TA 2WONA 1C4AA 2F9DA 2RQUA 1VQ4Q 3AHUA 2PE8A 4ZCMA 1WJQA 3OA6A 2A28A 3M32B 3DOKB 4IG3A 2XU8A 4GO7X 4NOYA 4Y2MA 3SWNC 2Z57B 2LQ5A 3PR4A 1TG0A 3GE9A 3J7A1 4E47A 3R5JB 1T3NA 2ZJQQ 1JIHA 1QM9A 2VGMA 3L1AA 3C6TA 1P1LA 5RUBA 1QVFS 3IR5B 4DPUA 2M5YA 3CJ8A 4B3OA 2DR7A 4DEXA 3OW2S 2AJFE 4OLPA 1FKPB 2C06A 4RO0A 4RKUE 3A12A 4MMKA 3I55S 2M9UA 3RGIA 3VCDA 2Q66A 2HMAA 5ECAA 4P74A 5C42B 1M30A 2AYEA 3TAPA 1AB8A 4A53A 1JJCB 2PEHA 9RUBA 5B0CA 2DL8A 3NNAA 2YQ3A 4X4VA 1SV5B 1Y3KA 5D4OA 2CQ2A 3SCKE 1TUWA 5I21A 2VG6B 4ZPWR 2PMHA 3TO8A 1TU0B 3JTPA 5KG5A 5FWCA 2GNKA 1UJ5A 3MD1A 2CZ4A 4J37A 1O0PA 3QIPA 3J7YI 2WOMA 4MH8A 4IQXA 3UDCA 1JXEA 4UF4A 4TN2A 4O3PA 3E3XA 1V29B 2QGFB 6FDRA 1WHLA 3F70A 2GMLA 4X84A 5HKCA 3DOLB 3FIFA 4F16A 3NP5A 2PZ1A 2XG8A 2DL7A 4YTLA 1HPZA 5GAHI 1F1BB 5MAOA 3MUVP 5CABA 2MJNA 3EGVA 2NQPA 3CTRA 2GQQA 1P27B 3AH6A 2BJ7A 3MEUA 2JFKA 1X9SA 2H5IB 1YJRA 3R1HA 3ISZA 1NM7A 3VS0A 2RU9A 3NPFA 2DD8S 1X01A 2DAQA 1HBUA 3UATA 3C0CA 3AJDA 1Y7XA 2HBYB 2N3OA 2HS3A 2GJFA 1CC8A 1VQ7A 2WB4A 4IUPA 1QP2A 2KTQA 1VCTA 3GP9A 4M7AD 1ZM4A 4WZQA 2FZKB 4Y2CA 4J5OA 1R43A 4USWA 1V3RA 4ITSA 1NE8A 1PM3A 4EZ6A 4UOFA 2KI7A 5AJ3J 2ZJPQ 2BDPA 3M0QA 1BMQB 4NWBA 1S10A 2YX4A 4J9PA 1EP4B 4O44B 3BQ0A 1GTHA 1NPKA 3J81j 2XULA 4HACA 2RHZA 2ZPEB 5D6XA 3LW5E 3LP2B 1FKOA 1UGRB 5IAYA 2BQRA 4P2FA 2ZPBB 1I94J 3MAHA 1QW1A 4DS4A 1YITS 3OYYA 2HRUA 2RF2B 1U06A 1ZHIA 3CMET 2PMZD 3CMAQ 4NYPA 2DR8A 3PHEA 2J6UA 1F5AA 1K73T 4TU7A 2DNZA 2CPIA 2ECZA 1SF9A 5AJ3F 2K7AA 4BE2A 1PJ6A 3MM8B 1S6UA 4Z89A 2JN0A 4B9SA 4DQPA 2DILA 4OQJA 4C7QA 2XYPB 2DNNA 3H0PA 3BGOP 3H2UB 5GAN6 3CC2Q 2MI6A 5GMKa 5H9EK 1YJ9T 3H9NA 2RVJA 2HHVA 1DURA 3AA8A 3B54A 3M58A 2MJUA 2XSJB 2Z2LA 2CZ9A 2G13A 2JUFA 3F44A 1I94F 3JCMX 2K57A 1U25A 3GIKA 4ZK7M 1FK9A 4E98A 2M51A 4CLLA 3M05A 2DBBA 1RHQB 1R0AB 5LJ3h 1OY6A 4LUBA 3BDUA 3AD8C 3OBIA 3IC1A 3OYNA 4K5RA 3Q8QB 1RAJA 5AXLA 4P10A 2XTJP 2OD6A 2DCUB 4XPCA 3BO3A 3S3NA 3DRXA 1ZUKA 5HP1A 1FKAF 1N5QA 3JSCA 2QA1A 1S1TB 2EGAA 4L76A 4EIKA 1U1QA 4ZHRA 2VV5A 4XAXB 4PG7A 2VG5A 3CNQP 1WZOA 4E0DA 2HIYA 4AG2C 2LC4A 2BXJA 2FHDA 1O6XA 2YNIA 3M0UA 2KVQE 1BHNA 4B9WA 1RT6B 4A8WA 1K73R 3GSDA 2DK3A 5A76A 2WK4A 3POTB 3MPWA 3A8JA 4HR2A 4JJDA 5KG2A 1QVGP 2DXTA 4DSLA 3WQPA 3X28B 3SZ2A 1S9GA 4DV0J 1QLYA 3R7BB 1FD8A 2KK4A 2LJ1A 1H92A 2YNGB 2L41A 4QW8A 2FB7A 2GQVA 1RL2A 3UCZP 2K1RA 4L72B 4NASA 3G71T 2VDIA 3CCWA 1YG0A 2N4DA 5ETOA 3ZZYA 2LU1A 2F2XA 2R3VA 3CEDA 1RJJA 4N77A 4PYAA 3H8YA 3N6LA 3GV8B 2U1AA 1O5JA 1WF0A 4WPAA 3WC0A 4PUOA 5LJ5g 3ZFVA 3QGGA 2GFFA 1M8MA 2MZTA 4RW9A 5MLCV 3DB3A 1ZUYA 3NS5A 3A8HB 1OS5A 1K1ZA 2V8HA 2POKA 1MWYA 3OXFA 2EBEA 3EGDA 4DV0F 1BU1A 1W70A 5E3RA 4NA1A 5ITHA 4K2XA 5KFPA 1SKUB 1OY9A 4KSEB 3ULRB 1BQNA 3TANA 5A0GA 2XC9A 3M55A 3DGPA 1UHCA 1WOOA 5L8RE 1UTIA 2BJDA 3UE2A 4JB8B 3A8KA 1MN7A 4G1QA 2HGLA 4O0IA 2DGSA 2F40A 3L2ZA 2MKJA 1Y9OA 2EFIA 1CJUB 2MOXA 1MMLA 1B34A 1IKXA 1S7HA 3EH2A 3TZYA 1B0TA 3CMEA 4KGMA 2L3RA 3H41A 3MJXA 3VF0B 4C8LA 1DLOB 1BKBA 2AX1A 3GBQA 1HL6A 4DUTA 1KHCA 4PJOE 4MDWA 2IM3A 1MUZA 2WTFA 2E44A 2EWNA 2KE9A 5LSLA 4LRCA 2MQ8A 1X4DA 2WACA 1AUDA 3CCVS 1S1VA 2GF7A 1SI9A 1F2GA 4C92C 4NMLA 3TCJA 5F8LA 1AD5A 1YJ9A 3BYPA 1DQAA 1UGSB 4LVNP 3NGKA 2RRNA 4ED2A 1X5TA 4E7LA 4IG0B 3CJQA 4ZVSB 2KMTA 4P73A 4Q0BA 2FG0A 2EBPA 5SUHA 2JZ2A 2NXUA 4ZOSA 5HVFA 3CPWP 1FXLA 2L3PA 3OYDA 3KFVA 2UVRA 3N0VA 4ELYC 2XI2A 2Z2YB 5FU6C 2DNKA 5KFHA 2KGTA 5IHIA 4USIA 1WDXA 3CXCR 2PIIA 3ILJA 3B4DA 4MYUA 1RT1A 3RESA 1VQ9Q 4OJGA 2HRTA 5GANe 2KFNA 2RQTA 1I5OB 3ZC4A 2VBZA 3AD7C 4U7UK 3JCMb 2RS2A 5CYQB 1QKXA 3KDOA 1S1UB 2AJQA 4HDHA 2QL5B 5C2GA 1U5SA 1BLUA 2Z8QA 4FXDA 4OYMA 2VL1A 1QKWA 4RUAA 3BFMA 4L6V3 2R2UA 1YI2S 3RBEA 4FYYB 1RT5B 4FPRA 2IY5B 2HQGA 2CSIA 1GL5A 1ZSGA 2JS2A 1K8AU 4JPBW 4O3NA 4ALZA 1RWKB 5KFIA 5DM7R 4CI0C 3N5BA 4FT4A 2MZ1A 2VODA 3PW2A 3KLIB 5J2MA 2EW3A 1M90U 4DZ6A 2MHEA 3R6OA 5CQXA 2J06A 3G71A 1M1KU 3WVEB 1IXKA 3BSCA 3OSPA 3OD2A 5J2NB 2C2EA 4DQIA 4A4EA 2CG4A 2AX0A 2QDYB 2E5GA 2R8GA 1T02A 4F8RA 1RTDB 2JZ5A 1TKXB 1U1OA 2NSBA 3K58A 4M1KA 1LVKA 4C3KA 3D9BA 3S3OA 2R7OA 1HNIB 1FRMA 3DFEA 4NI2A 1IHWA 2KH9A 1HNVA 4PWUA 2XDDA 2HPUA 4IFYA 2X4WA 3TUZC 1TK0A 1VIOA 2UUBJ 1UVIA 2AGQA 2XSFA 5D77A 3K5NA 1E6YA 1HMVA 4ED3A 2KVIA 3EZ5A 1JLCB 4LF5J 5KFFA 2MKKA 3CXCA 2MYFA 1WXBA 4DCJB 1E6VA 2HBZB 1YZ7A 2FB0A 1WLPB 1RTZA 3MEEB 1FJGF 2DHSA 3QQCD 3CDUA 2UUCF 4MKVA 1OO0B 3FEOA 3QO9B 2V4QA 1F9HA 2EVRA 2XMAA 4J9IA 2RJCA 4HL9A 3C94A 4B3TJ 1SXLA 2CJ9A 2R5AA 1PSDA 2D3O1 4BC9A 4IO9Q 2AKKA 4E7ZA 2L3SA 2K5IA 4ER8A 2AKWB 3PACA 2UUBF 3INZA 2GVDB 4C8QE 2NPIA 1FWKA 2N3LA 2ACYA 2E1RA 1UJYA 1FEEA 3OYIA 4ZPVR 2E1MC 2BANA 4EO8A 2DVJA 3PRBA 4XK8C 3MCAB 2CQCA 3HHLA 4OGCA 3W63A 4B9VA 2CRLA 4PXDA 3R6NA 5KYWB 5IZHA 2AK5A 4GMKA 1AUSL 4RW6A 1EHWA 1JLAB 1WFWA 4GO5X 3T3FA 4KC5A 3BJYA 4M78A 4PJMA 3I9V9 2H5EA 3T1AA 3RYLA 4J7FA 2V1QA 2QI2A 2OEMA 2RJFA 3UO0A 2RUGA 1Q1KA 1VBKA 4NLTA 4ZVHA 1HBMA 1J27A 1SJRA 5J1PA 5CK9A 1OYEA 4X4OA 3MM5B 1PHTA 1PD1A 2GO8A 2OP5A 2B6AA 5GAN5 5C5JA 2K2MA 4HXJA 2RD1A 3BQ2A 2PU9B 2HBPA 5KFNA 3R7NB 3FVYA 3GG0A 3RERA 4DV1J 5EWFA 2KEAA 3OUYA 3G9CA 4X1VA 2YPYA 2XHCA 1CULB 4U8VA 3B4MA 3NY0A 2BYCA 1HQ2A 2H4WB 3OVSA 3HHNB 3GNGA 4X2BA 3I9ZA 2MLYA 1IUJA 1IWAA 3G8TA 3M8SA 4NLDA 3LO3A 2J0QD 3FRNA 3P4UB 1K9MC 2E64A 1UEUA 4JV0A 4E7IA 4JLIA 2M3DA 5KOXA 4JI6J 4PLIA 4YHHJ 4JI1J 1ARKA 4B02A 5CXTA 3N5FA 3PJXA 1FESA 2DGQA 3QRQA 3KHRA 2QLXA 4DPYA 2W1BA 4O6JA 3LF0A 2I8EA 2R7RA 4CC4B 4FDFA 3CE8A 3SV4A 1X5PA 5LJ5d 3C4SA 1VRTB 4DV1F 1YBYA 3GNFB 3OTDA 3CCUT 3E1SA 5HLFA 2ZWOA 3OL9A 2RH2A 3R1LA 3I56Q 5C25B 2M0YA 1N5YA 3OYGA 1DJ0A 3HFVA 3LA0A 4RBVA 3RW6A 4GKJJ 4ZPCA 1N8RT 4WK1A 1KP6A 2V67A 1WC4A 2ZCFB 4C8QF 3H4DA 4M78G 1XQIA 4CM0A 2HIQA 5DLFA 4JI6F 1RWUA 2G1DA 3VQTA 4YHHF 4JI1F 3GTYX 3VKIA 2BKPA 2A37A 4PQAA 2IVYA 5DLQE 4BACA 2ZKTA 2RHQB 2DNPA 2R2RA 1S1XB 2HQXA 4MK7A 3QGIA 3C14B 4Y91A 4DR1F 5LOQA 2DFUA 1NU4A 2RPNA 3KHGA 1BY9A 5M2UA 3FC3A 1NKBA 5AXKA 2CAJA 2PC6A 4CH1A 4EZ9A 4JV2A 3FBCA 4IUVA 3RR8A 3TUJC 3EFSA 3QRPA 4DQSA 2EG2A 4GKJF 2DXDA 2ILZA 2LX9A 1VQNT 4OI1A 5DGAA 4V19X 1AZSA 1S7IA 1Q7YC 5LJ5e 1SSFA 3KLGB 3JB9J 3CCET 1B07A 1SL0A 4I69A 2Q43A 4LDYA 3UDVA 3EYZA 1KHIA 3ENWA 4JYAJ 1GMVA 4LF9J 1LWFA 3GILA 4I64A 3VS2A 4IUUA 5E33A 3SDEA 2M70A 4A63B 3C16A 1WORA 4PFPA 4ZIVA 4OI3A 1SKWA 1Q81U 2IIHA 3EX7B 1NUEA 2ZHAA 3OTOF 3GPLA 4AFQC 1KSPA 2MKSA 3VS1A 5KG4A 3CMES 4LUEA 2GIFA 2KSSA 3L2QA 3THVA 5L1IA 5FU7B 3I55Q 2X7IA 3JB9F 3BKFA 4OMFB 2V8KA 4RW8B 1KQFB 5KT2A 2E9ZA 1VQPT 1SVDA 4JYAF 2ZFHA 4LF9F 2QLWA 4Y0FA 4J9QA 2X3XD 1LK7A 4I6WA 3LH5A 3DRSA 1QSSA 4FW2A 2MLZA 4HH1A 1YJ9S 4OMLA 1JXOA 1DARA 1DQ8A 5DO2A 2YKMA 3BDPA 2R8IA 2VB6A 1NCLA 3HFNA 4EYHB 4D8DA 1WWHA 4RTTA 5D4PA 2W7AA 5LXRA 3C8YA 3RJMB 2VA3A 2GV1A 2OTJS 4ETZA 3CW2C 4DBRA 2DO0A 1W2BR 1Y4ZB 3OB9A 4XPEA 3T5JA 2NLWA 3DGVA 4M75F 1NNDA 1KQKA 3KTQA 1MHNA 1UW4A 3AOAA 2C42A 2MCNA 1UEBA 1AT1B 1I4K1 1HD3A 1V5VA 4U96A 7FD1A 4M77B 2R9LA 1IB8A 1T8EA 2GO9A 4OP0A 1C0TB 3CCUA 3DLJA 4DLEA 3TVZA 2CNKB 2E7WA 3ZZTA 1MV3A 3VV2B 1YGYA 4PL6A 1RTHB 3GFYA 3RTVA 2O31A 1D1CA 2LZ6B 1W6XA 1FWZA 4KBIA 2DRMA 2C22A 2QA4T 1XMBA 2PFDA 2OEJA 4WF2A 4H4OB 5C24A 2EFOA 3V6KA 3DLMA 2BKOA 4RCBA 4QPTA 4C8YA 2UUAF 5SZTA 3BZQA 2IAJB 3L2VA 4WFAQ 4KUDK 3QBYA 2E5JA 5D0RA 3BS9A 1G6BA 2XY6A 1YQHA 3QGPA 4V2SA 4AQYJ 5GAN3 1WYXA 2OPQB 4C5HA 1ULRA 5IT4A 1X0PA 1TKTB 3HDSA 3TEGA 5KFCA 4EWTA 2HLUA 1JLQB 1VQKT 5J1NA 3F0NA 3DXBA 1HYOA 1OQ6A 4OYPA 4KUIA 5ETMA 1U8WA 5IXUA 4PKCC 1NJIC 4NLPA 5GMKh 4WFBQ 3CD7A 1ZPWX 3MMCA 1VQNA 2QL7B 3AB4B 2KXFA 5KFAA 4K4XA 2RH3A 3Q8YA 4J9BA 1JQQA 3UT1A 3ENQA 3NTHA 6FD1A 2RD5C 4I2PA 4ZGEB 3UR0A 5L1LA 1V9OA 2PI5A 1T94A 3KKFA 3CCEA 4KKOA 3VS3A 2K3YA 5KCHA 2A7YA 2W24A 2XMVA 1SQEA 3H2LA 4M5GA 5LJ3g 1W2BA 1PYSB 1U7LA 3RDVA 4RUCA 4AQYF 1QUPA 3FFIA 4DBFA 3CXCS 5K8NA 2RJDA 3H20A 5CKBA 1HLWA 2JC0A 4ZVGA 3D2WA 2E7XA 2MQQA 1JLGB 2YRCA 1D0ZA 4ZA1A 3JAME 3PYEA 2LYVA 4HT5A 2RJEA 4WXWA 3IR6B 2UUTA 3EFOA 4ICLB 1HNWJ 4XDCA 1KC8U 2ZOGA 2YXYA 4K11A 4LSNA 3PMIA 1CPZA 2GA7A 3TUIC 2MPUA 1XIQA 1S97A 3GIJA 2XMUA 1MG7A 1VQPA 3W2VB 2X3DA 1XJWB 2J0WA 2KYBA 4F7UG 3FB9A 4U67Q 4A4JA 5DETA 4A8YA 4NX9A 4QJVA 4OI0A 4YB5A 4P9SA 4LBIA 2ZITA 1WKJA 2D69A 2E9RX 2M02A 3R7SB 1KTVA 2W9CA 5IV4A 3ZZPA 4MKYA 1WJ9A 1ZYQA 3D5MA 1X2KA 2XDBA 4IOCQ 2HL3A 3SCIE 2R7UA 5E3PA 2XZDB 3EZOA 3M8PB 1HBNB 5KCOA 2P9CA 4LSLA 4RW4A 4WE1A 4NZ6A 4DX5A 2VKZG 4M7DA 2HVEA 2XMFA 3QMQA 2P4RA 3HT3A 4KAIA 1UCNA 2RRAA 2VBWA 4DCPB 2ZBRA 2NSCA 1JQGA 4EMKC 3DLBA 1KN6A 2CQPA 4C48A 2MDAA 1OULA 4I4BA 5CZVA 3H25A 3PHTA 1VMBA 4TYAA 3DDIA 2EW9A 2CQGA 3FJ5A 2G3RA 1VK8A 4BS2A 4ECVA 4NZ7A 3JAMU 1U47A 2QA4A 1VLOA 2FPFA 1LOJA 4DR3J 2V50A 3BKUA 4JUVA 2FDNA 2YH1A 4CC3A 1C1BB 4JJCA 3V6HA 3D6TB 1GCPA 1SIZA 2P0QA 1ABOA 1GK8A 1RHKB 1EETB 3NOGA 3JCMf 4PWDB 2ZD1A 2J9EA 2VBXA 4YOEA 5DLGA 5DDRC 1RI9A 1N36F 3EGUA 4OI2A 3D0HE 5A2QY 3O6QA 4ILLA 2G2YA 5ETPA 2RM4A 2BUNA 2QDLA 4DG1B 2BIVA 1VQKA 4M7AB 1GCQC 4Y28E 2OMOA 4M77F 2CWXA 5GADU 2J6OA 3VAFA 1KD1U 3OSSC 4BY6C 4C11B 1N5TA 3OT9A 1JNRB 4FU6A 4OJ1A 3UI3A 4J83A 3A13A 4DR3F 1GX5A 3HKZD 3SEMA 2M8HA 5J1EA 1Q82U 1MMDA 2JJ9A 4M5HA 1M2VA 4CLSA 3OMGA 1D9FA 2O66A 3SQGB 1TL3B 1X6BA 3CT9A 2P5VA 1V3ZA 2JLFA 2DXBA 4RWWA 3VAMA 3R2CJ 4PJOB 4DX7A 5KFUA 4QW2A 2W7PA 3UN3A 4NL5A 1YBTA 1RADB 3KUEA 4LFAF 2CG8A 2W2NP 2AJ2A 4JJBA 3W2WA 1G2BA 3NG8A 1G3YA 1Z1ZA 2DEJA 4LIWA 2XLIA 1C0UA 2DITA 2DO3A 3NAIA 2DHAA 1I8FA 4BI3A 4BWMA 1YX2A 3M2UA 1H38A 5GAEU 2JVOA 1FRHA 2V8GA 2IMOA 1FNMA 1GRIA 3M2VA 4M94A 2GHVC 4C92D 2Z0GA 3GP8A 1YIJT 4OYZA 4W98A 1KQ1A 1DQ9A 2P6SA 1M1GA 3QPIA 1X4EA 3QFHA 2L48A 5CD4H 4O3OA 1JB0C 1I5LA 4Q2MA 3C66A 4WU3A 1KLMB 3QWYA 1DTQB 5ETTA 2MSTA 2E6NA 4USJC 3PFSA 2BACA 1YI2Q 2M52A 4JUZA 3PW4A 2KYMA 2CKKA 2I5JB 3DYAB 2LRQA 3UVJB 1PKSA 4X64J 2HQCA 4FXWA 4Q44A 2W2MP 1G5VA 4CP5A 4ZVTB 5KT3A 4ETXA 1H72C 2RQRA 3A8OB 2QEXT 2HNDB 1FI4A 5KFJA 1YJWS 1XK8A 4OYOA 3DLGB 3GJTB 1S6PB 4KB7A 2HW3A 3Q86A 1QCOA 4A8KA 1CJVA 2EI5A 5F8MA 3IRXB 2DX1A 2EYQA 1MU2B 3RKYA 3NGUA 3DM2B 1KLNA 2HVHA 4F0MA 3L2RA 5KT6A 4DL7A 1NH8A 2CZ1B 3KLHA 2HKQB 1SKSA 4DL2A 2HFNA 2I0XA 4ZJLA 4B3RJ 1W7WA 5BJRA 3ZTOA 4FVMA 1FDDA 4PCQA 4X64F 2VPWB 3RBDA 3IG1A 2HGNA 4USHA 2UZAA 1VBYA 4N0AA 3EG0A 1HA1A 1U4BA 1WA7A 1OSDA 1U2FA 2B5JA 1WC6A 3OL8A 3MO8A 3N9UC 2B3TB 1HWUA 2DGTA 4AYBD 1HYSA 4M5DB 3V7RA 1CG2A 2DGWA 2BE9B 4RKUC 4UQGA 2DEIA 3FDSA 1JLBA 4X65J 4C0DC 4F2RA 3H0FA 3L9ZA 4HHHA 3LQVA 3OL6A 4OHWA 3MECB 4CIOA 4DL4A 3MEDB 3OYJA 2KJWA 4TQSA 5DM6Q 3PVXA 4QWDA 1KQSR 3QKJA 2PVDB 2FVCA 5CKDA 4XTXA 1HIYA 1S77D 3CCUS 2BMBA 3CCJT 4YB7A 3BGLA 5CQGA 3LPEA 2XI3A 3TARA 5F0UA 5CKFA 4CO2A 5LJ3d 2G6FX 4GC6A 2H8HA 4RNNA 1M9SA 4OYWA 3AB2B 4IYQA 3A4TA 3PKMA 3AODA 3M8RA 3VRZA 4X65F 2X35A 1GQEA 4KV8B 4QWCA 4IDKA 2ZZNA 4BI8B 2QSFA 3ZZOA 2YNFA 1X4BA 2KT2A 4OZ1A 3G6YA 3CD5A 3T5LA 4R5PB 1F60B 2LEBA 1KTQA 4NYZA 2VKRA 4UY85 3EHQA 4J9LA 2FLLA 3JCMJ 4MFBA 1XERA 1U1PA 1IR2A 3DLEB 5GMEA 4WP3A 5I3UB 4EMDA 5GMKi 2XMMA 2KXDA 3I6PA 4DEYA 2O2OA 4ZPDA 5KG1A 2DJZA 2VFTA 3KK2A 1BD6A 3V81A 4I67A 1MMNA 2RI5A 2DY1A 2YX7A 1YCYA 1YIJA 1LWEB 2APOA 3N4WA 2ZC3A 3FEYB 3MPDA 4HT7A 1I51B 2XY7A 2V2KA 2DH8A 1TZ0A 4OZ0A 2R42A 5ETRA 3CCES 2HAXA 2EC0A 1UP1A 1YSJA 5DZ7A 2CIMA 2R7SA 3THTA 1IM6A 1XEZA 4DV7J 3NGPA 2CT3A 2CQ0A 1QVGR 4OGEA 5KFMA 1FYNA 2K3BA 1Q95G 3R9LA 3O5ZA 5LJ3e 1TUGB 1U1SA 3LW5C 3VAIA 3EG9B 3H98A 4QPXA 4B3MJ 5KH6A 1Z2LA 4DSEA 1K73U 3OTCA 2QEXA 1KQSA 4MDXA 3KNGA 1SL2A 1JKHA 2CWKA 1M2OA 4ED0A 4ZPAA 3RIRA 2ZDOA 3K59A 2RN8A 5A8KB 2K7JA 3M32A 2OO4A 3DOKA 3O2IA 3BPSP 1PAUB 2IYIA 4OHXA 2HHUA 3AHPA 2QYGA 2DETA 5D3GB 2JX2A 2YBVA 4ZP6A 4O23A 4Q5VA 1Q8KA 3ILIA 3GSIA 1UKUA 4G3IA 4OZ5A 1DFDA 4DV7F 2LJ0A 3THPA 1F5CA 1VQPS 1EB0A 2HWIA 4Q45A 3VGSA 1C1CB 3ME9A 3QYHB 4YEAA 4J7IA 5AE2A 4DUYJ 1S72T 1OX9A 3PTAA 2F5GA 4B3MF 1YLXA 1R6VA 1QVPA 2VJVA 3L09A 7FDRA 3HI9A 1VQ5Q 4CNZA 5C42A 2E3HA 2MZJA 3ENVA 2C3UA 3DRYA 3JQKA 5ETVA 4UY8T 1ICEB 5DQGA 2FVSA 2DGOA 1SV5A 3MR6A 4LUDA 1KRPA 2VG6A 1XTDA 3Q83A 3HHTB 3CBOA 2KDSA 1TSFA 4ES3A 2DGVA 3JXOA 3GMGA 2CFXA 2CPXA 3JV3A 2EEYA 1YJNT 2YUPA 5EUHA 1O9SA 1QVFP 3ITHB 1TL4A 1IQZA 2HLTA 3GIBA 3MURP 3MPUB 3V4MA 2WVCA 4DUYF 3OW2P 3PYDA 3CCJA 4EBEA 3HZGA 4KHPJ 1RLPC 1TUVA 3QUIA 3DOLA 3IMQJ 1QVGA 3TVTA 3RR6A 5F8IA 4YN3B 3AXKA 2EK6A 2D0NA 1PYOB 5G0RB 1NK6A 1ZSZB 3QDRB 1WDDA 3IR7B 1YNZA 4DPXA 2H1YA 2QA4S 2XCPA 1WSVA 2DO4A 2RE1A 2J6FA 4OVAA 3VQSA 2PA8D 4WFYA 1PKTA 1FWPA 1VGYA 2KJVA 2FLNA 1AWJA 3QATA 1FXXA 3GJSB 4CYUB 4HCBA 2WCXA 2BQ3A 4EYIB 4QU7A 2RQWA 3IXQA 2LNHB 2YWKA 4J5YA 1ZAWA 4BDYA 2C2DA 4LF1A 2RQCA 3OBYA 1J5OB 1NJYA 4M78E 4KHPF 4RTYA 1YK9A 1VQKS 3NGRA 1R8BA 2DNQA 1LW2B 2HAIA 2QA2A 1K1QA 2BM1A 2V4RA 1EP4A 2RIJA 4O44A 2KM8B 3I96A 2NWMA 3IBWA 1RAHB 5M2PA 4FW1A 2P2CB 1U49A 2M16A 3BN7A 2Y4YA 3RMSA 5B0EA 3LP2A 1UHFA 2B56A 1OI1A 1QCNA 1AXQA 3JCMV 4DL5A 9ATCB 3Q8UA 2KXHA 2RF2A 2DTIA 2F4VJ 4KFBB 1WF2A 1QJHA 2V9WA 4UT4A 4EMHA 2XS7A 3QT5A 1VC6A 1S0NA 1RT4A 4OX8A 5J3BA 1W25A 3D54A 4FM4B 1IKVB 2K5FA 4N8OA 5IOLA 4A8SA 2PO4A 3O3LA 3MM8A 1KDNA 1REVB 2FRWA 4OI4A 2ASYA 5KFWA 2VYTA 1SHGA 5J26A 3FCWA 2OTJQ 3EG1A 2DHXA 2X1AA 5LL6d 4OMOA 2LFVA 1TH7A 3HK2A 3TX8A 1S0OA 1K8AC 4IH6A 2GIQA 4PJOC 3TA2A 2XSJA 1NK7A 4MTPA 5C7PA 3U7JA 3X1LB 3GIRA 1ZLMA 3EICA 4EGLA 3SI8A 5D4NA 1L3SA 4UOGA 1KONA 1SJ3P 1M90C 5A8RB 2F4VF 1HFEL 3X26B 2ZBPA 3UA6A 1UUEA 1R0AA 2D0QB 2XK0A 4B9LA 5E5NA 4K4UA 3OYBA 2IMWP 1AYEA 1S72A 4ZKAA 4RG8A 2LCLA 4NLUA 4ZDNA 2UVUA 2JVVA 4IKFA 1S1TA 4BWJA 2KG1A 3C2PA 4B6MA 3T9ZA 3BH7B 1RBLA 1N9RA 4J91A 1JNZB 3ZEHA 2EYWA 3UA7A 4PPZA 1UVKA 3GLJA 4AUKA 3CD6S 5L23A 3KJFB 3EXYA 1RT6A 3D7SB 1TKDA 1IR1A 2VFUA 1X9WA 1YJNA 5DJBA 4O3RA 4XU1A 1FNXH 5FIIA 3E9GA 2YHTA 3OXGA 2ZH8A 5LSOA 1X75C 3PTWA 2KNBB 4OFZA 1D09B 1ZM2A 3A8MB 1YWXA 5M2RA 2XB2D 2UVWA 2AKLA 3QZ9B 1N5VA 2E66A 2FC9A 3DCAA 4AXIA 2DM1A 2YNGA 4S0MA 4AFFA 1NDKA 1N34J 4HTJA 3MM6B 1PCXA 2P9GA 4ECUA 1WG1A 3MZIA 3H7HB 4ZP9A 4GKKF 3IGVA 3PFOA 1FT8A 3PX0A 2EQIA 4HI2A 3TU4K 3ZZRA 2HNZB 1JLFB 2ALZA 3RR7A 2ROGA 4QWEA 4DR5F 2CT4A 3PYGA 1KJWA 1N4LA 5HROB 4DUZJ 1T03B 1FRXA 1VQ6Q 5D4LA 2IVMA 3M9NB 3B82A 1UZHA 3BW1A 1A0NB 4X62J 3K8WA 2WONB 1VLYA 2GQ2A 5LJ5j 4RNHA 2LKZA 3QZ8A 1N34F 1JMTA 1G1XA 1HR0J 2P4TA 1N6AA 1ZA2B 4G1IA 5AE1A 2EWHA 3GIIA 5KFOA 3NMRA 2NUHA 3P6YC 2EJFA 1M3CA 1AFIA 5CKHA 4JDSA 2GX8A 1TMJA 1VQ4T 4F04B 2YUOA 2WB1D 3HRSA 5GAHU 4PAAA 3REAB 2CJKA 1SBRA 5L39A 3A98A 2MZRA 2F8HA 2CUBA 1RGVA 4NL3A 2PMWA 3A1PA 4QWAA 1OPIA 1JXVA 4DUZF 5DM7Q 1RU1A 3R6GB 3ICLA 4BB7A 1DLOA 2IM2A 1VHFA 5K20B 3HXMA 3LWLA 2YT6A 1S59A 2GMJA 3JCMh 3CCZA 3DNCA 3HSGA 1C1AA 2ZZTA 4OB3B 3A3OB 3EVOA 2BZYA 4CNYA 2QL9B 4NLRA 2O88A 4QVZA 2R57A 3NXZA 3E19A 2BJEA 3SWNB 1F9FA 3UFCX 4FNHA 4GVLA 4QZVB 3CDEA 5CYMB 4C8QC 4IG0A 2K6DA 3AQPA 3EUNA 1NPRA 1YIJS 2W2PP 1U48A 2CDQA 2LTOA 1VK3A 1WC0A 2YDLA 1TL7B 5GAOp 3M56A 5IXFA 2VUGA 2OIHA 1WKKA 1ZM9A 2DT9A 2W7OA 1AHJB 4RPFA 4RW7B 2OAWA 2HNYB 1HPZB 3ZL7C 4I2QB 2FEIA 1RU2A 2KR3A 5FDLB 3QRRA 5KFKA 4DJBA 3G4SQ 1U6BA 3EHRA 2KYZA 5CYQA 1NEBA 1CSKA 1YBAA 3FMWA 5L46A 4R0EA 2K3XA 4J8OA 1S1UA 4O0NA 4QKUA 4F4YA 1UGVA 2FL7A 3M0RA 1NDPA 1KQSS 2LCSA 2MMYA 1S4FA 4WJBA 5I3PA 3TSZA 2PTKA 4K2JA 1UWBB 4J9DA 4ECTA 3KK3A 3T41A 5IM0B 4YDXA 3HTRA 1D9AA 1RT5A 4DV3J 5A6WA 2HL5C 4RUBA 2KFZA 4OMMA 4NLQA 1N0VC 4RL1A 4I0WA 1BQXA 3DC2A 3GYXB 3MEGA 3KLIA 2VJUA 3RRKA 4FBUA 3MXHP 2BM0A 2XO7A 3PW0A 3CJ2A 2KRBA 4HA8A 5J2NA 2NXCA 2AW0A 3MR2A 4OJ3A 4NPOA 2AP6A 1KVJA 4DSJA 1RTDA 2MY7A 1TKXA 1FEHA 5KTQA 2ADCA 2YKNB 3CSKA 2RILA 4DV3F 1HNIA 1IVZA 4C5IA 2E41A 2ZUAA 1SUQB 4BDZA 2GCXA 2ZKUA 3LP1A 2XNQA 4DR2F 3HD1A 3CMAT 5A8WB 3NMZC 1HBOA 3KBGA 1WPYA 1K0VA 1EFNA 1DHMA 1QQJA 2K4YA 3TA1A 1SIWB 5ADZA 1JLCA 1M27C 4X34A 3CCJS 3PFEA 1Q81C 5A2QE 4KHMA 2WSEE 5J39A 4L5GA 1T0TV 1S1NA 1WHVA 2WVBA 1QVGS 3MEEA 1FXRA 2M2BA 4ECZA 5JMNA 1VQ4A 2JDJA 3CC2T 1ZH5A 1LNXA 1U6FA 3KLEB 3V8KA 3QO9A 2GW8A 3CCMT 3LPYA 2FYKA 1LOUA 1FE0A 2P9EA 3GFZA 2KAFA 2OFGX 1G83A 4E2FB 5DZ6A 3FBBA 3KK1B 1DBDA 2WVEA 2ZOFA 4A4KA 2C2ZB 4ATNA 2GVDA 1TUDA 2G2ZA 3MCNA 1FTRA 4I6AA 1SKRA 4OL8A 2COWA 1ZSZC 1VYVA 4RU2A 4B9UA 4Z02A 5GAN2 1S48A 1I0CA 2CPFA 1YJWQ 4M7DE 3MUMP 4FS2A 3GZ7A 1X5OA 3QDFA 3NKYA 4K59A 3TUPA 1TTHB 2VOPA 3L95X 2D9TA 3I0SB 1S6OA 3W61A 4A8XA 4EMGA 2V94A 2AD9A 2IBKA 2AYGA 5KYWA 2LQBA 3FBFA 2JMCA 3R3TA 2J8AA 3EE3A 2BOAA 4PJJA 4RLEA 1JLAA 3IO1A 4OX6A 1XNIA 3NEKA 4JI4J 4DV5J 4M5LA 1RBAA 2RDIA 1WHMA 3FSYA 4LR7A 2L3QA 2CDTA 3LTOA 1NZ8A 4M75A 4ZCIA 2W9BB 1SC3B 3M6VA 5LJ5f 3BGFA 4F3OA 1N5ZA 1J3TA 1TVRB 4LFCJ 1F6TA 1VQSA 3GWCA 3MM5A 2HYIB 1DRZA 1RWPB 4PWWA 1K0XA 2C0IA 3FBEA 1VJQA 2WW4A 4M5JA 4OB0B 5THWA 3SHWA 3O8VA 2D3UA 4U7UD 3GU0A 3JQMA 3T1HF 4MYTA 3Q8VA 1IN0A 1CULA 4ED1A 4F36A 2NXJA 1S5ZA 2LVWA 4DV5F 3EGDB 1KG1A 4QQGA 4DFKA 3L7UA 2RNAA 5D6WA 3IM8A 2C1EB 3MEWA 4YY3F 3JB9G 5EG2A 4H54A 1T3LA 3HF5A 3V6DB 3VAHA 4LFCF 1S72S 4RTUA 2P6TA 1B34B 4Z7YA 2ED1A 4RZRA 1RT7B 2KRSA 3VYGA 1VRTA 4WYWA 2HHHF 4FXVA 2DLPA 1NZAA 2NZCA 3DDKA 2DJQA 1QWFA 1Q16B 2IRUA 3S1TA 3EVWA 3I87A 1HD1A 5HBMB 5C25A 1M5Q1 3QGHA 3QJYA 1KQ2A 3IQLA 5GMKe 3CMAA 1D3BB 4KH1B 1YJNS 2GZOA 1AW0A 1CC7A 3H8ZA 4BDPA 4P6QA 4P75A 4JBCA 4GLMA 3NBPB 4PJLA 4M75G 3H6ZA 2MPXC 2G1HA 3JSYA 2F69A 4Q0BB 3M9OB 1UJ4A 1IJEB 4PG6A 3ZNUA 5IXBA 1S1XA 1WHWA 4M7DF 1RAAB 3C14A 5U47A 1B3QA 1DY3A 2GTJA 2ZGWA 1ZOTA 3CC2A 4JI2J 2CJYB 3AY0A 3HVWA 3PYFA 3WDOA 1KC8C 3CCMA 4GRSA 4MZPA 1YRUA 3LAMA 1EKRA 3S6EA 1C4CA 2P84A 1MMGA 1YTYA 4B9XA 1LPLA 3CCEQ 4PXEA 3L7PA 2OTLT 3FC9A 4TVRA 2B43A 1UVMA 3SEOA 1F2HA 1H3ZA 4X66F 1FMKA 1AA1B 1BC6A 1WHKA 4N47A 4J9OA 4HKEA 3HMJG 4C92B 2LX7A 1FX7A 1VQ9T 1NK9A 3P8DA 1VIEA 3NWRA 1NLOC 2F2WA 1HXDA 3HSBA 2GHWA 4FZVA 4JI2F 2RS8A 1QWEA 2ZPHB 2EKNA 1NSAA 1CQMA 2L8DA 4DMZA 3N5BB 3WXMB 2ILYA 5FU6B 5B0AA 5IC6B 2QQAA 5C0MA 2NR0A 3R5DA 4BI4A 1FXDA 2D8HA 2RDDA 4DL6A 1MGQA 2OKQA 3CF5Q 1WC3A 3T1YJ 2JT4A 1AOJA 1ACMB 5K8OA 3QFWA 4L75A 1Q79A 1N5SA 3H40A 2B8PA 2H48B 3SD4A 3SCLE 4RW8A 4CC7A 5KT5A 3H5SA 2ZOMA 2IM1A 1U0SA 4HCZA 4ELZC 4WTOB 4J7CA 2FD2A 4IUFA 4NI2B 2KKHA 2DERA 2VICA 2JTFA 3U1LA 5A0LA 2RUSA 3RB6A 5KG0A 3CJRA 5GMDA 2XHWA 4F26A 1NK8A 1HMVB 2ZPFB 1NLKL 5EWEA 1YHQS 5F3TA 4RR5A 3M1VB 1L5UA 1TKZB 3T1YF 2V69A 4J9VA 2GAHC 2MTLA 2HHPA 5JJBA 1PC5A 4CLFA 2D7SA 2CH4W 2A10A 1B70B 2I2YA 4XTZA 2HFOA 2IDEA 3CCRT 1HI8A 3G8SA 2KHCA 1G3WA 4M77A 1SC6A 4BUGA 1KD1C 1M3AA 1NBEB 3QZ5B 1RACB 1C0TA 2MLXA 4E7JA 2AMCB 1YFNA 2ZDPA 2JOYA 1X27A 5CCAA 2M7SA 1SQGA 1NM2A 2QMUB 4NEZA 3HPWA 1RTHA 2CZVC 1UPMB 3QZ7A 1TR0A 3I82A 3VRYA 4H4OA 2AGPA 1GMWA 2DNLA 2XNRA 2X51A 1N6QB 3K5PA 2WSFE 1WG5A 4K50A 1RSCA 2DYAA 2KN4A 1ITPA 4LBPA 1G3SA 2GCFA 1VQKQ 1WTBA 2IC3B 4HHJA 1QDUB 1PC4A 3TREA 1UWAA 2IAJA 4TY8B 2A18A 1RAFB 1XN9A 1N27A 1JJHA 2MK5A 2NXNA 1TK5A 4OMFG 3Q2TC 1WD6A 3AJ2A 4M78B 5GAOl 2OPQA 2VA2A 2DB1A 3SMZA 2QSWA 3PNIA 1TKTA 1JLQA 4IFVB 4C8MA 2XY5A 2OTLA 4IUQA 4OYAA 1H98A 4WF9Q 1WNLA 4HLBA 5F9NA 1TUCA 2FJBB 2V4JB 1BB9A 4QCLA 2G4BA 3D0IE 1PRLC 2PVOB 4OMQA 4ZPBA 2K06A 1R77A 2B6AB 4NLYA 5KFTA 1B7TA 5A0DA 1ZPVA 3V2UC 1Q86T 4P71A 4DPOA 3BSOA 1VQ9A 2E6ZA 2Y8WA 2V9KA 3TW0A 4Y28C 3N28A 3DOMA 2E1CA 2Z2ZA 2J05A 3VGVA 5IQ6A 2DCLA 3N01A 3OQ5A 4JRIA 2YUNA 4A54A 1N56A 1WDTA 2IYGA 2VDHA 2YWGA 2F1FA 2P0PA 4M77G 3SBMA 5GANh 4TLQA 5LJ3j 3FLGA 1JLGA 1N52B 1VQ4S 2DIGA 5CCMA 2ZBIA 2DVEA 2R7XA 4E7HA 1S57A 4LQ9A 3JAMY 2YWEA 1IXDA 3JTNA 4NLWA 3SFGA 1MWQA 3QLHA 1U1TA 4L6V5 3GV5B 4N76A 1T9UA 2FHJD 4QIVA 3T5HA 1QP3A 1OSCA 1ZUUA 3OYCA 2QAZA 4N5SA 2VQFJ 2FYXA 4YR0A 2VFRA 3G6VA 2LT4A 2R7WA 2FLPA 4EDUA 2HBWA 4PJOD 3K8VA 3HULA 3W2VA 3M5AA 4CLZA 3PG9A 2CNOB 4ZIWA 3BV8A 3CD6Q 4HVWA 2HFVA 3WBZA 4IR1A 1FX4A 1JBMA 3TZZA 1SJ1A 5KFRA 2COYA 1MN9A 1IRXA 1LWXA 4F17A 3WHIA 3P5BP 2SRCA 2HZCA 1Q86R 2VG7B 3I56T 3PV8A 3VS5A 2A08A 1A7GE 4PG8A 1VHIA 5H9FJ 1KHWA 3M8PA 1UJ0A 1Y71A 1W26A 2UVVA 3TEEA 4WP9A 2NUPB 3GIMA 3H42A 2YRVA 3MKDA 2IM0A 1U8SA 1WG4A 2VQFF 3CCRA 1BI3A 4NEYA 2CUDA 3IAM9 5ETKA 2VFVA 2NUUG 2SXLA 2QT7A 2IJNA 1S99A 1OIAA 1FO1A 3VV0A 2P8IA 5KFYA 4KHRA 4WZMA 4XK8E 2O01C 1TELA 3PVLA 1W1FA 2DXCA 2FJAB 3MEAA 1WI6A 3C19A 2LMIA 3L3CA 5I42B 3QSYB 5B0FA 3RAMA 3J80U 4F0HA 3TAQA 4AE5A 4DA4A 1UJ6A 2V8PA 2HWHA 1L3UA 1RWOB 4YR3A 1C1BA 3RUBL 1GH8A 3K5OA 4UW2A 5DDOC 4K4VA 2ZPIB 4OLOA 4UC4A 5KFSA 2B9EA 3ULHA 2C2NA 4A8QA 4PWDA 3M4GA 1XWLA 3GR1A 4C97A 1VUBA 3JCMg 3ILLA 4XTYA 3L2UA 3RAQA 4DG1A 4DPTA 4M7AA 1FWLA 3U1NA 2BZXA 4U6PA 2QQSA 4YB6A 1BGXT 3AQOA 4HEA9 2MMPA 4PR6A 4C11A 4OV1A 4ED8A 3CD0A 5CZXA 2XI9A 3K0JA 2ACMA 2SEMA 4I56A 2ZPGB 2L89A 1UA0A 2EKHA 1WKLA 1LFPA 3CMAS 3OSNA 1OZ3A 2JVRA 1BI0A 3SQGA 1TL3A 1BQMB 5CIUA 2CPDA 1X60A 2AYMA 4PJOA 3M2RB 3FJ2A 4CC2A 3O44A 2LU2A 1E7OA 1OYDA 4IRDA 4BE0A 2AZSA 1PG5B 5HMWA 5LMNJ 1QD1A 4PKDB 1YIJQ 3MP6A 5FRMA 4WFNQ 4WU2A 4ELVA 3CCMS 4NA2A 3SB2A 4DSFA 4KGVB 4C8ZA 5T7LB 4B9NA 2AHOB 4DOVA 4B3SJ 5GADI 2HQFA 2E70A 3S8SA 4IQMA 1NEEA 2OPSB 1O75A 2OH2A 1UW9A 2ROPA 3S7RA 5JUMA 1VI7A 2DF6A 1RA7A 5HMZA 2H51B 4C8QD 3E8OA 5M9OA 5KYXA 1NJZA 2RF0A 4F14A 2OHDA 3OTBA 5LT5A 2GJ2A 1KLMA 4RUGA 5L9XA 1DTQA 3DMJB 2LLZA 1FF2A 5LMNF 4OV6A 4PXCA 3SDZA 4LR8A 3UQSA 3DYAA 2I5JA 4Y3CA 2B4PA 3UVJA 2IBOA 3I56A 1P9QC 3HPOA 1R8AA 4Y34A 1LEOA 4F7UB 2GS8A 1KNZA 4M7AG 2KG0A 3D6HB 5HQMA 1HARA 3AT1B 3W5YA 2HNDA 1T9TA 2PVGB 1X4FA 4B3SF 2JNGA 2YX1A 5F0WA 1S6PA 4ZJQA 3X24B 1O8BA 1R3NA 3KJQB 1K9MU 4RJVA 2I2LA 5GAEI 3IRXA 2VVKA 3QBCA 5KG3A 4I7FA 1MU2A 1B7FA 3DM2A 2LQ9A 4LRBA 3PRVA 4DR6J 3HLUA 3M0PA 4NXNJ 4R8UB 2QC3A 3RBBB 3RBZA 4ZLNA 1RDRA 1Y57A 5LJ3f 2HK3A 1HWIA 4C4WA 3J7Z5 3M57A 1JEGA 5DDQC 2V8JA 2AJ1A 1HJDA 3CDAA 2NYSA 1SC1B 1NK0A 3IWLA 2LDYA 3HFOA 4CT8A 2XZTB 4RTVA 1HD0A 1D3WA 3EDQB 4DR6F 1BIBA 2BEFA 4QBUA 1KEKA 4JI5J 4NXNF 3R5GA 3ZZZA 3GLXA 3MECA 3MEDA 3IRWP 3NAHA 3MAAB 3W8PA 2EQUA 2KZZA 1KKHA 2DKGA 2CH4A 3FRZA 5HK0A 5LJ5h 1HWLA 4C0HA 3AOCA 1U0HA 3S01A 1YRTA 2ED0A 3DU5A 3SXLA 2J7IA 5KAKA 3HZEA 1VA7A 4KJIA 8AT1B 2WVDA 3OJUA 1VC0A 4CLWA 1MSWD 3TX0A 1MMAA 1WGSA 2A6OA 3FGVA 1P1TA 4M95A 2HK2A 5HJXA 1LXNA 3PIPQ 1Y96B 2AJ4A 5KFEA 1OQKA 4W92B 4LF6J 4CZCA 4UZCA 1JO8A 2R7TA 4KV8A 1VQLT 1APSA 4IKAA 4JI5F 3EGXB 2RDJA 1X31C 5EN1A 2HQ3A 1HHSA 2Z30B 3MM7A 4ILMA 3FQLA 3KOAA 4WWSA 2DRBA 4LSLB 3LWIA 4FYVB 3M53A 1A6LA 1OYXA 3RU0A 1XNRJ 3ASKA 3DLEA 5H9FK 2Q1LA 1M5KC 4WCEQ 4KE5A 2DNYA 2OJ3A 2OTLS 3HHLC 1HQUB 2V8DA 2DR9A 3J7ZT 1RHRB 4YDDB 1LWEA 3LGNA 5GMKm 2GGRA 4YMEA 3VWSA 2E29A 3EVMA 1LKZA 1VISA 3M59A 4DV6J 4LF6F 4TXSA 1T0HA 3M8WA 2O4XB 4M78C 1NJXA 3HD2A 2V26A 2CJBA 4ECYA 3PE0A 2HSEB 3A5ZB 2PN6A 5L9NA 2PGCA 1UAWA 5B7WA 4U8YA 2XO6A 4DBQA 2DIVA 2KBTA 4WBFA 4BD3A 3Q8PB 4QIWD 1VQ7S 3EG9A 1TMMA 2DEQA 2QX0A 1XNRF 2E5HA 3VVTA 2ZJRQ 2DNGA 4CLYA 4F2SA 4A48A 4LF5F 4PABA 2N4CA 2CJXB 4FP9A 2V1RA 3A8EA 2VPYB 4OF1A 1KIKA 4WIIA 5A8KA 1H6KX 5KT7A 4DV6F 3SFMA 1U1MA 1S72Q 2VIHA 4EMKB 4OZ2A 5D3GA 1RAOA 1SCJB 5FWBA 2ZH5A 4GBQA 2XGQA 4B3TF 3F73A 4WTYA 2NREA 4HHUA 3AXMA 2RHXA 4K4SA 3DXSX 1P6TA 3TSWA 5A0YB 1C1CA 3NRBA 1RP5A 1D1UA 3REBB 3J81E 1R8CA 4YR2A 1DTTB 3S3MA 3BM7A 1M2VB 2W01A 1FDBA 4A47A 4K0KJ 2AU0A 4PEOA 5HI7A 2RT3A 4LR9A 4DF8A 1YJNQ 2ZM6J 2FZGB 1F3FA 1SB6A 3G1JA 3TJ8A 1BWEA 1QE1B 1KS2A 1QMCA 1LXJA 3JCMd 3BGRA 1Q4RA 1ZETA 3EAEA 3OFFA 3ZNJ1 2FHMA 4XQ3A 3NGTA 2K2PA 3W2WB 1Y5LB 1BXNA 2CP6A 4ZPTR 1EAYC 1B0PA 2VC1A 2CNNB 3FNNA 4DOZA 1C0UB 1SH2A 2RSQA 3I0RB 3CCRS 3M2UB 3ITHA 3Q8RB 1F3VA 2BE2B 4BY6B 4ZS6A 5KFZA 5IH2A 2CUYA 4TU8A 2UUWA 1MROB 2GGPB 4QT7A 4K7QA 3CWJA 3MCSA 1CJKB 2DY9A 2JLGA 1H7WA 5J2PB 3MR3A 2J6TA 4K0KF 2HHTA 1ZBXA 2K9GA 4O4RA 3HHDA 2ZNYA 5G0RA 1ZSZA 1WSRA 2ZM6F 4LSZB 4A46A 1P9YA 4WFXA 3V5RA 2VUBA 3EPGA 5AE3A 3VU3C 3SFUA 4FF4A 3RNJA 3G6XA 1VQLA 2H9ZA 3A3NB 4CDIA 3HSJA 2K8GA 2EC2A 3HVAA 4CYUA 4BE1A 2DA9A 5EGYA 5DQHA 4QW9A 1RT3B 3MMJA 3IM9A 1YRXA 1WHHA 2OUGA 4RU9A 3J81U 2RKIB 2X4JA 1U1LA 1J5OA 1U6ZA 3EH1A 3RRGA 2F9JA 5HAOA 4CH0S 1LK5A 1CJVB 2CJAA 1IO6A 1LW2A 3LGFA 4M75E 1M5VC 3MR5A 4WKYA 2LQNA 4UOCA 4RX6A 4NA3A 1BE4A 2EFVA 5AXMA 5GAMg 1X5SA 4JJNK 4M5IA 2F5TX 3TNVA 2AZ1A 5F8HA 2YKPA 3GJQB 2KXNB 4A4HA 2L0AA 4X9CA 5GJVB 4KFBA 3D3CJ 5EC7A 4C5GA 3D6MB 1HK9A 1GFWB 2JNJA 2OEKA 3OJSA 2OSRA 1IKVA 4ZNXA 2B9XA 3BR8A 1KVIA 3VHQA 4TU9A 5HY6A 1EARA 1REVA 5CHCB 1YHQQ 3CB4A 3MMAB 1HYSB 3NL0A 1NXIA 3MM9B 4RBUA 3CCQQ 2AIRB 4KYZA 4LD9K 3G82A 3CC7T 1J2VA 5DGBA 3B78A 3D68A 2Y8YA 4UTGA 2M4MA 4URGA 5EHHA 3CJKB 1JXMA 1TAUA 3HHKA 1U1NA 1H73A 3M8ZA 3AJ1A 3T19A 5A8RA 2ZE2B 1T95A 2B7BB 1WXTA 1IKYB 3HVTB 3R2DJ 1VQMT 4ILRA 1DAXA 3H5UA 2MQNA 5GJWB 1Z9ZA 5L1KA 2GVZB 5LMUJ 2D8JA 2Z0WA 1RA6A 2BE7D 4JI0J 2XKOC 2B4OA 3C3LA 1AFJA 4CO0A 2YLCA 2EPDA 4DQ2A 4Q2LA 3I56S 3NLCA 1RWMB 2ZHBA 3LH2S 3PXGa 5E3QA 4PQUA 4C0DB 4ZN1A 2O3DA 1NKCA 3KG4A 1UVLA 1U26A 1N8RC 2M88A 4IRKA 2HEKA 1NMEB 2QO3A 1JX4A 4CO3A 2XG8D 3GCWP 1JB0E 4DV2J 4DEZA 4JI8J 5GMKj 1OPZA 1IBLJ 3CJ0A 4MT1A 4N7TA 1B4SA 3HP9A 5LMUF 3US5A 4D3GA 3OS5A 5BYQA 2JEFA 2MQMA 3LLRA 4JI0F 2JXBA 1H2UX 3MM6A 2ZH6A 2HAFA 4NCAA 4I1TA 4ZVOB 1LW0B 3BDLA 2HS4A 5GANg 1TL5A 2ATLA 1YWPA 1NO8A 1HKAA 4OZLA