1Y71A

X-ray crystal structure of kinase-associated protein b from bacillus cereus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
124
structure length
109
Chain Sequence
TFEIGEIVTGIYKTGKYIGEVTNSRPGSYVVKVLAVLKHPVQERRALAFREQTNIPEQMVKKYEGEIPDYTESLKLALETQMNSFSEDDSPFAERSLETLQQLKKDYKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Kinase-associated protein B
publication title X-ray crystal structure of kinase-associated protein B from Bacillus cereus
rcsb
source organism Bacillus cereus
total genus 29
structure length 109
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08810 KapB Kinase associated protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.430 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1y71A00
1Y71A
chains in the Genus database with same CATH superfamily
3VS1A 2CH4W 5LJ5d 1G83A 1M3AA 1PKSA 3PFSA 3JCMd 1YI2T 1OOTA 4QVCA 4ATOA 4F7UA 2RQRA 4HVWA 1OYXA 2QA4Q 1K73C 3SWNC 3S3OA 6AT1B 1C0MA 4FT4A 4M7AB 2E6NA 4OGEA 5GMKi 2YUNA 1W2BA 4MZMA 1GBQA 3CBOA 3MEWA 3J81E 3VRYA 3VS3A 2I0NA 1ZQ1A 1KK7A 2EYZA 2YXYA 2CZ1B 1RAFB 4DQ2A 4A4HA 4HT9A 4E7KA 2VKNA 2QDLA 3P8HA 4OP0A 2QEXQ 1RAAB 5GAN3 1K9MU 3G6EA 5GMKm 1K9AA 4F16A 3WVDB 4O6JA 2E5KA 3V8KA 3FJPA 2ZPHB 1AVZC 2E10A 2O01E 2A7YA 5CKDA 4N0AA 2DL4A 4PLIA 1FYNA 5GAN4 3JSCA 1ZBJA 4JJDA 1UJ0A 2AIRB 4ELZC 3SEMA 2FB7A 2EVRA 2AKLA 3C0CA 1MNDA 4E7JA 4LDXA 2NYSA 1YIJA 2FPDA 1XNIA 1ZSZA 5GAOm 2KROA 2SRCA 3I56T 1WGSA 2HL3A 1TSFA 1Q86R 1AEYA 4M7AC 1T3LA 2KT1A 5LJ3d 2EWNA 2P0QA 1TU0B 2M0OA 2MOXA 3I9QA 4ZTFA 2RJCA 5GAMe 3E19A 3CCUT 1Y7XA 2JS2A 3RESA 3OYEA 4LDVA 1HSQA 1QKWA 1UGPB 3M4GA 3JCMW 2WACA 2GQIA 1YBYA 1EFNA 3O8VA 3P8BB 1N8RR 3QWYA 1BI1A 3VS6A 1UB4A 3OYBA 4C8QA 4JZ3A 2QA4A 1UJYA 3EG3A 1JU5C 2F2VA 2B8AA 5HKCA 2Y4YA 3KUFA 4PFOA 5LJ5f 4XU2A 3JCMf 2XHCA 3LH0A 4HXJA 2XKOC 1Q82U 2FVUA 1QLYA 2QAZA 5KYWA 2DL7A 3META 3NGPA 4ESRA 4KH1B 1ZUKA 4XTVA 2HSEB 3OA6A 2CDTA 3MP6A 4GLMA 4MZTA 2X3XD 3A5ZB 3MJXA 1HXDA 5IN1A 2X35A 2OTJT 1Y96A 3LWIA 4BDYA 4FSSA 4J9FA 4R56A 4M78B 2E3IA 2RJDA 1WQ7A 2BE7D 3HRTA 1SHFA 2HQEA 5KCOA 4KT0E 1YJ9T 2ZPBB 1G5VA 2DRKA 1VQ5T 4PLLA 2RI3A 4HCBA 4Y91A 3N5BB 3CCSQ 2LNHB 2E12A 2DXTA 3INZA 3CCVT 4M77B 3OYIA 4J9DA 4ZGEB 2K79A 1T0HA 1PC0A 3HTRA 3JV3A 2M9UA 4IURA 1OZ2A 1XQHA 1QVPA 3JCMQ 1D1BA 4XU1A 4MDXA 2CP7A 4EPCA 5CKEA 1SRLA 5LJ5g 3LLRA 2K5FA 3JCMg 3G4SQ 2D8JA 3UPUA 1G2BA 2CKKA 2D8HA 2RM4A 4X1VA 2E3HA 2VWFA 3MCAB 4ZGJB 3RKYA 3V7SA 4M7AF 1AWXA 2KRNA 3HHTB 2HQHA 3X24B 3TEEA 3OYMA 4M78C 1C1AA 4M7AG 1WA7A 3QIIA 2DNUA 5LJ5j 1JXOA 4JJNK 2YDLA 1RLQC 3OYLA 2JZ2A 2XDPA 3PVQA 2JM8A 4D8KA 1E6HA 4QQGA 1PM3A 3CCMT 1GRIA 3L2QA 2RO0A 2RHZA 4J8OA 4GLKA 4M77C 1VQLQ 2QG9B 3GP8A 2KRMA 1H641 1WHGA 2R58A 2ED0A 3KBGA 3OBWA 3S3MA 4ZGDB 5CVIA 1U1SA 4JPBW 2E41A 4EMGA 3MHXA 2FRWA 2HEQA 1KQ1A 4FM4B 3AHUA 1JJ2A 3CBMA 2VYTA 2LCSA 1JJ2S 2KT8A 4F14A 2E1HA 3EFOB 2K9GA 4X34A 1H3HA 3E2UA 5D6WA 1Q86U 3FJ5A 3UT1A 4L59A 4RG2A 4YTLA 4RTWA 1PWTA 1SG5A 4C92B 3OW2S 3C94A 3PGGA 3TREA 3LW5E 2LZ6B 3LGLA 1B34B 4JLGA 2ROLA 2ZPEB 2DRMA 1BCMA 5GANe 1MMGA 2JUFA 3RKWA 5DLOA 5LJ3g 3CCJT 3V8LA 3I5RA 5I2MA 4M7DF 4BDZA 1X75C 3VS4A 4ZN3A 4HT8A 3OS1A 3THKA 1OV3A 3VU3C 1G3TA 2O2OA 1N8RU 2V8JA 2RH2A 5GAN6 2LT1A 1VUBA 1FX7A 1VQ9A 4IUTA 3I55A 3TSZA 3G4SA 1SSHA 2EQJA 5IXBA 2M51A 4AFZC 5KYXB 4RTTA 5LJ3j 2MAMA 1QW1A 4EDUA 4CC2A 2KGTA 2EQKA 3VRZA 2EPDA 4ME7A 4M7AE 3HSBA 1BIAA 2HBWA 3JCMX 3OMCA 4RCCA 1KQSA 3OYJA 2F2XA 4M75D 5CKHA 4FCYA 5CIUA 4N4HA 1D3BA 1K73R 4C92C 1IZ6A 1ZUUA 2RK2A 4PJOA 3M54A 4JZ4A 1T0JA 1VQLA 5GAN7 1S72T 3RMQA 3D7SB 1UFFA 3EFRA 4M78F 1N5ZA 5GAMd 1VQ7A 2L89A 1QMCA 2P4TA 4J9GA 4DEXA 5FW9A 4M78G 5GMKe 1X6BA 4HVVA 2KYMA 1NYFA 2O4XA 1FXXA 3EGDA 1FMWA 2KAFA 4M77F 3OYYA 2VXFA 2LMJA 1YI2Q 3ASKA 4II1A 2CZ6B 3PIPA 2O9VA 2KE9A 4M77G 3OS0A 1N9SA 3P8DA 5GJVB 4ORZA 3X26B 1VQ6T 1GXIE 4LUEA 4CC4B 2L2PA 5I22A 3GPLA 2CP3A 4HA8A 1VQOA 2XG8D 4JLIA 1U1TA 4NL3A 1JB0E 3HL8A 3NMZC 2DXBA 1WHLA 4RTXA 3JCMV 3CCET 4AFUC 1I81A 1WXUA 1WNLA 1YN8A 3RERA 4E7IA 2R5MA 4OMNA 1R8OB 4J9EA 3VKIA 1HYOA 4UC4A 4XTZA 1XJWB 2DVJA 1B3QA 4OVAA 1OZ3A 1MMNA 1Y71A 5I11A 4FU6A 4LDUA 3SDZA 1NE8A 4OGCA 1IHVA 3HKSA 4XQ3A 4X9DA 2EKHA 1VQNT 3CCQT 1T3SA 1BI0A 3CC7A 1YJWT 3VUZA 3CPWS 1H8KA 2RQVA 1EX4A 1KFZA 5I21A 1JXMA 1M3BA 2L3PA 4E47A 3I56Q 5IT9E 3M9QA 2ECZA 2Z0WA 3TU4K 3CXCA 5M9OA 1UGRB 1Q81C 3GLXA 3CXCS 2BE9B 3CCUQ 1D1AA 1ZSZB 3FB9A 1GCQA 4M78E 2DJQA 3R6NA 5CQYA 2M1HA 4J6WA 2PUKB 2D9TA 4BI3A 2K3BA 3CC4A 3L2WA 2YRVA 1X27A 2LRQA 4XTWA 4EMHA 1M8MA 4C92F 2EQUA 3ER0A 4C0GA 5EG2A 3CMET 5GAMf 1YJNT 3R6OA 1YI2A 2RI2A 5D6YA 2VGMA 2OTLT 3RKXA 4C92G 1UECA 4M77E 2EJ9A 3JB9F 1V76A 4JS5A 4LD9K 1ZA2B 4IUQA 3MEVA 2E70A 2XU8A 3GOXA 1LJOA 4LDYA 1D1CA 3IQLA 2MWOA 1EZZB 2JMAA 3OYAA 1D0XA 4C8QB 4HCZA 2RA2A 1JJ2P 4N0AC 4A54A 1RI0A 2QQAA 1ZHIA 2YT6A 3TCJA 1V1CA 2EAYA 1WFWA 2A37A 1W2BS 1NJIC 3OW2P 5KYWB 2OTJQ 2H3JA 1OX8A 4Y28E 4E7SA 1YJ9Q 2IPOB 4Z89A 1SKUB 3EG0A 1VQ5Q 4HCCA 1K73U 1K0XA 4BY6B 1ZSZC 5FROA 4E7HA 1WDXA 4QT7A 2LTOA 4KGVB 5GJWB 5FWBA 2LP5A 2DL5A 1YCSB 5A0DA 3WXMB 4DEYA 3CCVQ 4JS4A 2NUZA 4R55A 3FDRA 5GANd 4XU3A 3I35A 3A98A 2LC4A 2FPFA 2OI3A 3BE3A 1KJWA 3ZBDA 2LX9A 2OAWA 3I56A 4BB7A 2C06A 1I1JA 3NPFA 4RTVA 4ZTJA 2K3XA 1YP5A 3BFMA 4ELYC 3OS2A 1Q7YC 2AK5A 4Z88A 1QP2A 3CCUA 4OB2B 1CSKA 4C8QC 2DD4A 1N27A 4Y92A 4NL2A 4DOWA 1M90C 2DPPB 5GAOq 2QDYB 2K7AA 1KC8C 5GAMj 3G6ET 1KD1C 2DX1A 5D6XA 1N6AA 2L5QA 2ENMA 3SFMA 1AOJA 4C92E 4JDSA 3NTKA 3OSVA 4JJBA 2YHTA 2PTKA 3JCMJ 1YITA 3URGA 4NS5A 1TG0A 2QXFA 2D6FA 8AT1B 3UDCA 1VQMQ 4BY6C 4O5VA 1SF9A 2KQWA 2DL3A 2BZ8A 2ZGWA 3EAEA 2HD0A 4F7UG 3HPWA 3CCMQ 1WJRA 3REBB 1UTIA 3UA6A 1Y0MA 4AFSC 4LN2A 3EHQA 2Y90A 4QVZA 4QW2A 2YUPA 2CP5A 3MEAA 4BD3A 1Q82C 1NG2A 1YHQT 2OTJA 1UGVA 1VQ8T 3EHRA 4MMKA 3VV0A 4RUGA 4EIKA 2DXUA 3H9NA 2GTJA 2M0YA 4KGXB 5J3BA 2YUQA 2OX7A 2J6KA 3QG1A 2QEXA 5GAN2 2G6FX 2ZPFB 1UGQB 1LOJA 4OMMA 3CCVA 5KYYA 4RCBA 2NUPA 3SD4A 4QQDA 3RDVA 4BE0A 2VVKA 4FL6A 2DLPA 3JCMb 3LH5A 4RTZA 1H92A 4CC7A 1RABB 2COZA 2AHJB 3CC2T 1I8FA 2RF0A 3QSUA 3CCJQ 1GFCA 2ESWA 2CUBA 3FC3A 5GAN5 3OSSC 3OQ5A 3NFCA 4P5NA 3CEYA 3UF4A 2V26A 5GANf 1UUEA 4J83A 3QPHA 4QVDA 3OYHA 4KBMB 1M1KC 2M16A 1R77A 4J9CA 2O31A 2JS0A 4ZNXA 2KBTA 2DM1A 1UDLA 1ARKA 1K4US 1W70A 3QKJA 1I0CA 2O9SA 2XMFA 3CPWP 2IVWA 2F2WA 3VJPA 3VYGA 1UHFA 2RHIA 2W0ZA 2DXCA 3QZ9B 5EC7A 3GIBA 2CH4A 4MZPA 2QK0A 1IXDA 2AKKA 2KEAA 1VQKT 3QBYA 1RADB 3HFOA 2GF7A 1OULA 2LT4A 2DBMA 2OJ2A 3ZL7C 4XU0A 4C8QF 3PMIA 1VQMA 4WF2A 4IUPA 1K8AC 4F17A 3L2ZA 3PTAA 3CXCP 1N9RA 4M7AD 1QCOA 3JB9J 2X4WA 2QQBA 1F1BB 2CZ0B 3ZFJA 1VIEA 2DZ9A 4FYXB 4WCIA 3U23A 4C8QG 2KXCA 4C5IA 4XK8E 4AMCA 2DETA 3CMAT 2I2LA 4RMOA 2EGCA 4M7DA 1S72Q 1WI7A 4NOYA 4OB1B 2E64A 3M4YA 2VXEA 1D3BB 3M56A 1UHCA 2IG0A 2PVOB 3EH1A 2HBPA 4AG2C 5FU6C 4PJOB 3CD6T 2RQWA 3E9GA 4DBQA 2BUDA 1VQ4T 2K5IA 1SEMA 4OMQA 3A8GB 2C0TA 5KCHA 1W1FA 2HNIA 3M53A 1WXBA 5KE3A 2MMPA 1PRMC 4C0ZA 2GNCA 1WHJA 4N4IA 2DERA 1WJSA 2O4XB 5LJ5e 4J9HA 2MYSA 3JCMe 3EGDB 1VQ6Q 2CP0A 1ACMB 2E5QA 3EG2A 3EGXB 5CR2A 1W2BP 4L6V5 3CCJA 1XOVA 3A8MB 4M75A 1RI9A 3CCEQ 3CCSA 3M5AA 2X4XA 3PNWC 1WHKA 1AT1B 1BIBA 1VOMA 3VYHB 3OB9A 3J80E 2EYXA 2XICA 3OBYA 4X9CA 1BYMA 2FZCB 1UEBA 2L3SA 4M7DD 1Q95G 2XK0A 5J26A 1Q81R 1FMVA 2FEIA 1WZOA 2DIQA 1QWFA 5I2SA 2LJ3A 1B07A 9ATCB 2L8DA 4PJOC 3H41A 1KSWA 1VQNQ 1AZGB 4PJLA 3CCQQ 4KRTA 1VQPT 2BZXA 2K4YA 1YJWQ 3ZEHA 4C8QE 1QCNA 2X3WD 1G3SA 1VYVA 1WLPB 2BZYA 3OYDA 2EYWA 4J7FA 5GAOn 2YRCA 2COYA 2DAQA 2D0QB 3EH2A 1OX9A 3OS5A 5HK0A 4B9WA 4A4EA 1WX6A 1IGQA 2KRSA 3PIOA 3O5ZA 4AG1C 1KQSS 4BE1A 2EGAA 3HRSA 2LQ8A 4IUUA 3M0PA 2EGEA 1UGSB 2FRYA 4AT1B 3M0SA 1X2KA 2F69A 1V29B 5LJ3e 3EG9B 5C6SA 1H3ZA 2P0PA 4K11A 2B86A 1OEBA 1VQ9T 2CYZB 4HVUA 3I55T 3CMEQ 1RAHB 1YJNQ 3J7AF 5GMKj 2RQTA 1VYTA 5DM7R 1PKTA 2OTLQ 2WSFE 1QVGA 2KXDA 2EIFA 2NWMA 1ZSGA 1TUGB 2LQKA 3BDLA 4QKUA 1QVGS 2LNVA 4MDWA 1NEGA 7AT1B 5LJ5h 3H0IA 3JCMh 1BKBA 5KYUA 3M57A 2NUTB 1VQ6A 2GBQA 3EGUA 4EMKA 4JRPA 4M75G 4XTXA 3C95A 1DJ7B 2ZZDA 5AT1B 1BB9A 1S1NA 2VGNA 4PK4A 3CCEA 2HL5C 2DVEA 2DMOA 3M55A 3NHNA 2QGFB 3H0HA 3JB9I 2HQXA 2DEUA 3C12A 2K2VA 5CKFA 1MNEA 1TTHB 2R57A 1RAIB 3QXEB 5DY9A 2DYIA 4F7UB 1IGUA 1VQ7T 2DO3A 2MPXC 1Q7YR 2CP6A 2HAXA 4JUVA 2MIOA 1GBRA 3RMSA 4XTUA 1B34A 1KC8R 2K3YA 1VQNA 1PD1A 1KD1R 2V8IA 3CCQA 3MPUB 5CKBA 1M2VA 2HZYA 4OMOA 1WJQA 2KMTA 4OB0B 2J06A 1YFNA 1RAEB 1R0CB 1YJWA 2E6ZA 1VIFA 3G71T 1LCKA 4FW2A 2K2MA 2DTOA 1WYXA 1GCQC 2X51A 2F5TX 5FRMA 3QDFA 2J6OA 5KYNA 5IHNA 1VQOT 2DKGA 3S6WA 2LX7A 4PJOF 1TS9A 1FWZA 3G7ZA 2DA9A 2RB6A 2CS7A 3CCLT 4PJOG 4C0DB 3H8ZA 1AWOA 2ZCFB 4KH0B 5LJ3h 2FHDA 2KNBB 4LE9A 3CCRT 2AT1B 4F04B 3ULRB 4J7IA 1TXQA 2QGGA 2V1QA 3CMEA 1YJNA 3CPFA 1KG1A 4KUDK 3OYFA 3BDUA 3HRUA 2OTLA 4PFPA 1WIEA 1ABOA 2DJZA 1D0ZA 4J9IA 4QQ6A 3X25B 3GBQA 4Z02A 2GTOA 4FSXA 1PHTA 2CT4A 2CREA 1OPLA 4RTYA 5L23A 2GFAA 2VV5A 3H6ZA 3CC7T 2HMAA 3JB9D 1Q81U 4FT2A 5CK9A 2L3QA 2VC8A 1M1FA 3QWXX 4D8DA 3ME9A 2YSQA 2EYQA 2D1XA 2PVDB 1OI1A 4FIBA 4BUGA 2J6FA 2KVQG 2QQ9A 1YHQQ 1VQ8Q 2A3LA 2BTTA 1YWOA 1X43A 2LQNA 1LNXA 2YLCA 1M1KR 4JRQA 2JT4A 2EYYA 2RN8A 2RK1A 2FG0A 1NEBA 2CGHA 2FZGB 2DEQA 2A28A 4IUVA 4C0DC 2JTEA 3CC4T 1QCFA 2ROTA 2DTIA 1GCPA 4J5YA 2P0KA 2JN0A 2CT3A 1OPKA 1NM7A 3SHWA 1MHNA 5IHIA 1I07A 4B6MA 1OU8A 1M27C 3G1JA 4ANJA 3CC2Q 4DA4A 1BI2A 1K9MC 3DB4A 1K8AR 5KYYB 2JTFA 2NUPB 4RKUE 1BU1A 1A0NB 1Y96B 1NJIU 1PD0A 3TVTA 5FLXE 1RACB 2XDBA 3EG1A 4GY5A 3JCMP 5FWCA 4PJOE 1M30A 4FYYB 2A36A 1QVFA 1ZUYA 3I5SA 4E2FB 2CZ7B 2L0AA 1QVFS 1OQKA 5GAMg 3L2VA 2ED1A 2BIVA 5LL6S 1Z9ZA 5C0MA 2VASA 1HD3A 2VUBA 2H3EB 1WXTA 2JVVA 2QQRA 1MV0B 2JJ9A 3L42A 1JQQA 1C6VX 5A0LA 3QYGB 1VQKQ 2QQSA 1I4K1 3SWNA 3M0UA 3MKDA 2LVMA 1KQSP 4Q5WA 2AZSA 2DZCA 1K76A 2DK3A 2HDAA 1MV3A 4M4ZA 2FZKB 3FRNA 3TSWA 2RJEA 1FMKA 1YCYA 1Q7YU 3CMAQ 2CP2A 1JO8A 4F7UF 3PT9A 2PVGB 5J39A 2QTVA 1E6GA 2LCCA 1M90U 4D6WA 1KQ2A 3GF5A 1KC8U 3QJYA 1KD1U 1QVGP 1YHQA 2PQWA 4A53A 1VQ8A 1EIFA 4VUBA 3LX7A 3HP9A 2QASA 3CD6Q 2MF2A 4M7DB 2OAUA 1VQ4Q 1YIJT 1RAGB 2HCKA 1SRMA 1O75A 3FIFA 1M4ZA 2XD0A 2V8KA 1QQJA 2XIDA 2EBPA 4AFQC 4A63B 2QI2A 2GGRA 3A8LB 1YJ9A 2FPEA 3CC2A 3GNGA 2GQVA 1PSEA 1YITT 3T9NA 4C0FA 1VQ5A 3OYKA 1W4SA 2H8HA 2A0FB 4M7AA 3M0TA 3X20B 3M0QA 1R0BG 2KK4A 3RBBB 2KI7A 3QJ6A 2KYBA 4LD6A 1BI3A 5KH6A 2YLBA 2P4RA 3F70A 2XDDA 1W6XA 2L3RA 4JJCA 2QA4T 3JB9H 4BACA 4M75B 2K5LA 1M1GA 2LJ1A 3M59A 1QP3A 2KDSA 3QZ5B 1NYGA 1HJDA 3QYHB 5FU6B 4WTOB 1MMDA 1OU9A 2JMCA 5HCKA 3QHSA 1QWEA 1XTDA 1VQKA 1RUWA 3BW1A 1IREB 1JRIA 4M7DC 1G8XA 2J05A 2QTXA 2JTMA 2F1LA 1ZA1B 1JEGA 2QEXT 4PNOA 1VQPQ 3JAME 3LGFA 1IRXA 1J3TA 2CSIA 4RTUA 4A4GA 5KE2A 1M1KU 3CMAA 1BBZA 3KXTA 2LQWA 4LXCA 4R0KA 4DOVA 4C8QD 4C5HA 2DIGA 3VS2A 2DTHA 1PRLC 5AYFA 1WHMA 2AZVA 3S3NA 2V1RA 4FYVB 4PJJA 1M2OA 4F7UE 3E9FA 4FW1A 3KFVA 4BI4A 2KSSA 2M02A 4OB3B 3DB3A 2WSEE 1PG5B 3CCMA 1K0SA 3M58A 5CCAA 2DFUA 3CD6A 5GAMh 3QUIA 2CUDA 2QYZA 1IHWA 3OY9A 1VQ4A 2F5KA 3Q1JA 4IIMA 1VQ9Q 1U3OA 4B9XA 3I55Q 2GCXA 1I5OB 1JBMA 1ZX6A 2FYKA 4M75C 1K8AU 4JRKA 5GAN8 5LJ3f 1NPRA 2O88A 2G3RA 2NLUA 3A8HB 1VA7A 3NTIA 3OMGA 4E7LA 5GANg 1VQMT 4KUIA 5HK3A 3HFNA 4OMPA 5KYUB 3A8OB 4PFZA 2EQIA 4EMKB 1MUZA 3PVLA 3MEUA 4IIOA 1PSFA 2PU9B 2RJFA 2DILA 2A08A 4CI0C 1Q86C 1VQ7Q 2HKQB 2IIMA 1U8RA 4RG8A 3LWHA 4L5GA 5GANj 2GFUA 1TUDA 4PJNA 4Z8AA 2RD1A 3PMTA 1TH7A 2KY9A 3OYCA 5ECAA 4M78A 3VS0A 4V2SA 8ATCB 2RNAA 2EKOA 2YRDA 3V7RA 5IAYA 3UWNA 1VQPA 3QO3A 1KHCA 3VS7A 3G71Q 3OW2A 1I5LA 4A4KA 2RHUA 2JOYA 4LUDA 1LPLA 1N8RC 1NBEB 2COWA 2EJGA 1HK9A 1QVFP 3X28B 1WPYA 5GMKl 4M77A 3H0FA 1M2VB 1YNZA 1VQOQ 1NZ9A 1QKXA 4MMLA 2E65A 2PUOB 5L8RE 1PNJA 2DF6A 3CCST 2EQMA 2RPNA 3CCLQ 3FLGA 2J7IA 3FEOA 2D0NA 1Z9QA 4M7DG 3C4SA 2VB6A 4OF1A 3CCRQ 2JNGA 4EMKC 2FL7A 1S72A 3AT1B 4OMFB 1RLPC 1AD5A 3RR6A 2JXBA 4FYWB 2RHXA 5GAOl 2ABLA 5GAOp 1CKBA 4PJMA 2X4JA 4TVRA 3V8JA 3NTHA 2MCNA 1D0YA 1U06A 2DE0X 2K6DA 4M78D 1NJIR 3G4ST 3L2RA 2SEMA 3CC7Q 3SB2A 1NLPC 2Y4XA 4XTYA 4CRIA 2PZ1A 1M8VA 2RQUA 3OYNA 2K57A 4M75F 5FU7B 4ZN1A 2HSPA 4J9BA 3DLMA 3RNJA 2DBKA 1U5SA 1K9MR 2ZPIB 1KIKA 2W10A 3M0RA 4M77D 1UE9A 5GAOr 4DBRA 1M3CA 2KR3A 1O9SA 5A2QE 4PL6A 2DL8A 4IKFA 2X4YA 1LVKA 4PKCC 1UG1A 2ZPGB 1NLOC 3VS5A 1BCOA 3CC4Q 1NPPA 2BKDN 2JM9A 5CQXA 3CQTA 1VQLT 1B7TA 3TQ7P 4A4FA 4C5GA 5A0GA 1GL5A 3EGXA 2CSQA 3OYGA 3EFOA 2DYBA 3JCMc 2X9HA 3G71A 1TUCA 2EW3A 4GBQA 2YUOA 2WSCE 1ABQA 4C92A 4DBHA 4LDWA 1AHJB 2EJFA 5GANh 1M90R 3DKMA 1ZLMA 4C5EA 1TWBA 1X01A 3MP1A 4J6XA 3QDRB 1X2QA 1D09B 1G3YA 2LDMA 3REAB 4KGZB 4CC3A 1BK2A 3CCLA 4M7DE 4J6YA 1SSFA 5CAIA 2RHYA 3L1AA 5FU7C 5IHKA 4LNPA 3MP8A 1KHIA 3UATA 3GNFB 2LJ0A 3CCRA 1RL2A 4PJOD 1GFDA 1AWWA 1IO6A 3BY7A 3MO8A 1MMAA 3CBPA 1CKAA 5KYXA 1K1ZA 1AZEA 4KULA 2E4HA 5D7UA 3LYIA 1AWJA 3E1SA 3WVEB 4BE2A 1SHGA 2P84A 4HCKA 3G6EQ 2RMOA 3L2UA 1Q82R 1TOVA 1Y07A 1M5Q1 3DLLA 3CPWA 2C0OA 5IXFA 2ZAEA 1M9SA 2MK5A 2EFIA 3SWNB 5CO7A 4OMLA 1MGQA 3JRZA 3PE0A 2MWPA 4JRIA 2RI5A 3RUXA 4C92D 5DLQE 4M75E 2JW4A 1SPKA 1IB8A 1Y57A 3EG9A 4N4GA 3RIRA 2YWWA 1P92A 1YIJQ 5GMKh 2C0IA 2MI6A 2FO0A 3UA7A 1X6GA 1YWPA 4HKEA 1WQWA 4XAXB 2LCLA 2XI9A 4E7ZA 2NUTA 2ATCB 4DBFA 1VYUA 1E7OA 3A1PA 1G3WA 3VUBA 2PNIA 1X69A 5IH2A 5FRNA 1X6OA 4BI8B 3EFSA 1PCXA 1YITQ 2R5AA 4E6RA 3V7CA 2HKNA 5HY6A 2DD5A 1WHHA 3JB9G 1ZBXA
chains in the Genus database with same CATH topology
3OYKA 2CZ6B 3JCMe 1W4SA 5LJ5d 3PIPA 1VQ9T 3PFSA 3JCMd 4M77G 1YI2T 4M7AA 2E5QA 4QVCA 5CR2A 3X20B 1N9SA 3OS0A 4ATOA 4F7UA 3P8DA 4L6V5 3CCJA 1XOVA 2KK4A 3X26B 3QJ6A 3A8MB 1VQ6T 1GXIE 1OYXA 4LD6A 1BI3A 4M75A 1K73C 3GPLA 4HA8A 3SWNC 3CCSA 5KH6A 1VQOA 2XG8D 3S3OA 2YLBA 1U1TA 4FT4A 4JLIA 4M7AB 4NL3A 3F70A 3M5AA 1JB0E 2X4XA 3HL8A 3PNWC 2E6NA 4OGEA 2XDDA 2L3RA 5GMKi 2DXBA 1BIBA 1W2BA 3VYHB 3JCMV 4MZMA 2QA4T 3CCET 3JB9H 4BACA 3OB9A 3J80E 4M75B 2K5LA 1M1GA 3CBOA 3M59A 1I81A 2XICA 3MEWA 3J81E 1QP3A 1WNLA 3OBYA 4X9CA 2KDSA 1BYMA 3QZ5B 3RERA 1ZQ1A 4E7IA 2R5MA 3QYHB 1UEBA 1VQ5A 5FU6B 4M7DD 1R8OB 2CZ1B 3VKIA 2XK0A 5J26A 4DQ2A 4A4HA 4HT9A 3QHSA 4E7KA 4UC4A 4XTZA 2DIQA 1XTDA 3P8HA 4OP0A 1VQKA 5I2SA 5GAN3 1K9MU 3BW1A 1IREB 1JRIA 3G6EA 4M7DC 4OVAA 2QTXA 5GMKm 1OZ3A 2JTMA 2L8DA 1Y71A 4PJOC 2QEXT 4PNOA 4FU6A 3LGFA 3WVDB 3JAME 4O6JA 4LDUA 3SDZA 3V8KA 3FJPA 1NE8A 2ZPHB 4OGCA 3HKSA 4XQ3A 4X9DA 2E10A 1VQPT 2O01E 4A4GA 2A7YA 2K4YA 1VQNT 5KE2A 3ZEHA 5CKDA 4N0AA 4PLIA 3CCQT 1M1KU 3CMAA 3KXTA 5GAN4 4C8QE 3JSCA 4DOVA 1BI0A 3CC7A 1YJWT 3VUZA 1G3SA 4C8QD 4C5HA 3OYDA 2DIGA 4ELZC 3CPWS 4J7FA 2DTHA 5GAOn 2FB7A 5AYFA 2DAQA 2D0QB 3S3NA 3OS5A 5I21A 5HK0A 4B9WA 4F7UE 3E9FA 4A4EA 4E7JA 4LDXA 4BI4A 5IT9E 4E47A 2KSSA 4OB3B 3DB3A 1YIJA 2WSEE 3PIOA 3CCMA 1KQSS 4BE1A 3M9QA 1XNIA 3M58A 5CCAA 3CD6A 5GAMh 5GAOm 3HRSA 2LQ8A 3QUIA 4IUUA 3I56T 1WGSA 3OY9A 3TU4K 2F5KA 3Q1JA 1VQ4A 4M7AE 3CXCA 1UGSB 5M9OA 4M7AC 1UGRB 1Q81C 4B9XA 2GCXA 2F69A 3GLXA 3CXCS 1V29B 1JBMA 5C6SA 5LJ3e 3FB9A 4M78E 1H3ZA 2P0PA 2FYKA 2M1HA 4M75C 5CQYA 2EWNA 4J6WA 5LJ3d 2CYZB 2D9TA 2P0QA 2PUKB 2M0OA 4JRKA 5GAN8 3I55T 4ZTFA 3J7AF 2RJCA 5LJ3f 4BI3A 5GAMe 1NPRA 3E19A 1Y7XA 2YRVA 5GMKj 3L2WA 3CCUT 3CC4A 2LRQA 4XTWA 4EMHA 5DM7R 4C92F 2WSFE 2EQUA 2G3RA 1QVGA 2EIFA 2NLUA 3ER0A 4C0GA 2LQKA 5EG2A 3RESA 3BDLA 5GAMf 4LDVA 3OYEA 3CMET 1YJNT 1QVGS 2LNVA 3A8HB 4MDWA 3R6OA 5LJ5h 1YI2A 2RI2A 5D6YA 2VGMA 2OTLT 3RKXA 3JCMh 1UGPB 3M4GA 3NTIA 1BKBA 2WACA 4C92G 3JCMW 3M57A 2EJ9A 1YBYA 4M77E 3JB9F 1VQ6A 4JS5A 3OMGA 3O8VA 5GANg 4E7LA 3P8BB 1VQMT 4KUIA 5HK3A 4EMKA 4JRPA 4LD9K 3HFNA 4M75G 4XTXA 1BI1A 3C95A 1DJ7B 2ZZDA 4IUQA 1UB4A 3MEVA 3OYBA 4C8QA 2VGNA 2E70A 2XU8A 3GOXA 1LJOA 4LDYA 2QA4A 3A8OB 3CCEA 2MWOA 2DVEA 4EMKB 3M55A 3MEUA 2B8AA 5HKCA 2Y4YA 3KUFA 1PSFA 2PU9B 3OYAA 5LJ5f 4C8QB 2RJFA 4HCZA 4XU2A 3JB9I 2RA2A 3JCMf 2HQXA 2XHCA 3LH0A 1Q82U 2XKOC 4CI0C 1Q86C 2FVUA 3C12A 2K2VA 5CKFA 3META 4N0AC 1U8RA 4A54A 2R57A 1RI0A 2QQAA 3QXEB 4RG8A 1ZHIA 4L5GA 3LWHA 5GANj 2GFUA 5DY9A 4F7UB 4XTVA 3TCJA 2RD1A 3PMTA 2DO3A 3OA6A 1VQ7T 2EAYA 3MP6A 1TH7A 1NJIC 1W2BS 2KY9A 4MZTA 3OYCA 3A5ZB 2HAXA 2H3JA 4JUVA 4M78A 4V2SA 1HXDA 3RMSA 5IN1A 2X35A 2EKOA 4XTUA 4Y28E 3V7RA 5IAYA 3UWNA 1VQPA 2OTJT 3QO3A 1KHCA 1B34A 1Y96A 2K3YA 3LWIA 4HCCA 1VQNA 2V8IA 4BDYA 1K73U 3CCQA 4BY6B 5FROA 4R56A 4M78B 4A4KA 5CKBA 3OW2A 2LTOA 4E7HA 1I5LA 1WJQA 2RJDA 1WQ7A 2KMTA 2JOYA 2RHUA 3HRTA 4OB0B 2HQEA 5KCOA 4KT0E 1YJ9T 2ZPBB 1G5VA 1N8RC 1YJWA 2E6ZA 2EJGA 1VQ5T 1HK9A 4PLLA 5A0DA 1VIFA 2RI3A 3WXMB 5LJ5e 3G71T 4JS4A 4HCBA 4Y91A 1WPYA 3N5BB 3X28B 4R55A 5GMKl 4M77A 2DTOA 3FDRA 2F5TX 5FRMA 1NZ9A 2E12A 5GANd 2DXTA 3INZA 4XU3A 4MMLA 3CCVT 2E65A 2PUOB 2LC4A 5L8RE 4M77B 3CCST 2DKGA 1VQOT 3S6WA 4PJOF 3ZBDA 3OYIA 2EQMA 2LX9A 3I56A 2C06A 1FWZA 4BB7A 4ZGEB 3G7ZA 3FLGA 3FEOA 4ZTJA 2K3XA 4M7DG 3C4SA 2RB6A 3BFMA 2CS7A 4OF1A 3CCLT 4PJOG 4ELYC 4C0DB 2JNGA 3H8ZA 2ZCFB 4EMKC 3OS2A 1Q7YC 2M9UA 2FL7A 1S72A 5LJ3h 1QP2A 1OZ2A 1XQHA 4IURA 3CCUA 2FHDA 1QVPA 4OB2B 4OMFB 4C8QC 2DD4A 3CCRT 3JCMQ 1N27A 4XU1A 4MDXA 4J7IA 2RHXA 5CKEA 4EPCA 3CMEA 1YJNA 3CPFA 4NL2A 4DOWA 1M90C 2DPPB 5GAOl 1KG1A 5GAOq 2QDYB 4KUDK 5GAOp 5LJ5g 3BDUA 3HRUA 5GAMj 3OYFA 3LLRA 3G6ET 1KC8C 1KD1C 2OTLA 2K5FA 2X4JA 3JCMg 4TVRA 3V8JA 5D6XA 1N6AA 2L5QA 3NTHA 3UPUA 3SFMA 2DJZA 2CKKA 2RM4A 4C92E 4JDSA 4QQ6A 3MCAB 3X25B 4ZGJB 4M78D 3G4ST 3NTKA 3OSVA 3RKYA 3V7SA 4Z02A 3L2RA 4M7AF 2YHTA 3JCMJ 3SB2A 2Y4XA 4FSXA 4XTYA 4CRIA 1YITA 3URGA 3HHTB 4NS5A 3X24B 1M8VA 3TEEA 2QXFA 3OYNA 2K57A 2D6FA 4M75F 5FU7B 3UDCA 2GFAA 4BY6C 4ZN1A 2VV5A 4M78C 4O5VA 3OYMA 2ZGWA 2KQWA 3H6ZA 3CC7T 3EAEA 3JB9D 1Q81U 3DLMA 2HD0A 4M7AG 4FT2A 4F7UG 3QIIA 5LJ5j 3HPWA 5CK9A 2ZPIB 1WJRA 2VC8A 4JJNK 1M1FA 4M77D 3OYLA 2JZ2A 2XDPA 3ME9A 4QQGA 5GAOr 2EYQA 3CCMT 2PVDB 1O9SA 1OI1A 2RO0A 5A2QE 4PL6A 3L2QA 2RHZA 4FIBA 4BUGA 4J8OA 4IKFA 2KVQG 2QQ9A 2Y90A 4QVZA 2X4YA 4GLKA 4QW2A 4PKCC 4M77C 2A3LA 2ZPGB 3MEAA 4BD3A 1LNXA 2YLCA 3GP8A 4JRQA 1Q82C 1NPPA 2BKDN 2RK1A 1YHQT 1K8AU 2OTJA 1H641 5CQXA 1VQ8T 2R58A 4MMKA 3VV0A 2CGHA 1VQLT 3KBGA 3OBWA 3S3MA 2DXUA 4A4FA 2DEQA 4IUVA 4C5GA 5CVIA 1U1SA 4C0DC 4ZGDB 2E41A 5A0GA 3CC4T 4EMGA 3OYGA 3MHXA 2DTIA 4J5YA 5J3BA 2P0KA 3JCMc 2JN0A 3G71A 1KQ1A 3QG1A 4FM4B 3AHUA 2QEXA 5GAN2 2WSCE 1JJ2A 2ZPFB 3CBMA 1MHNA 2VYTA 1UGQB 1LOJA 4C92A 1JJ2S 3CCVA 2E1HA 4LDWA 1AHJB 2EJFA 4X34A 5GANh 4RCBA 3DKMA 3SD4A 5D6WA 4QQDA 1Q86U 4C5EA 4BE0A 4DA4A 1BI2A 4L59A 3UT1A 4FL6A 4RG2A 4YTLA 3JCMb 1X01A 4C92B 3MP1A 4J6XA 3OW2S 3DB4A 3C94A 1K9MC 3PGGA 3TREA 3CC2T 2AHJB 2JTFA 3LW5E 3QDRB 3LGLA 1I8FA 4RKUE 3QSUA 1B34B 1G3YA 2LDMA 1Y96B 1NJIU 4JLGA 3CCLA 5FLXE 3FC3A 2XDBA 4M7DE 2ZPEB 5GAN5 4J6YA 5GANe 1SSFA 5CAIA 2RHYA 3OSSC 2JUFA 3OQ5A 3RKWA 5DLOA 4GY5A 3L1AA 5FU7C 3JCMP 5LJ3g 3CCJT 4PJOE 3NFCA 3MP8A 3V8LA 1KHIA 3CEYA 4P5NA 1QVFA 5I2MA 3GNFB 5GANf 3CCRA 1RL2A 1X75C 4BDZA 4M7DF 4PJOD 2CZ7B 4ZN3A 4J83A 1QVFS 3QPHA 4QVDA 3OYHA 4KBMB 1M1KC 5GAMg 2M16A 3OS1A 3L2VA 4HT8A 2BIVA 5LL6S 3VU3C 3BY7A 1G3TA 5C0MA 3MO8A 1N8RU 3CBPA 2VUBA 2JVVA 2QQRA 2V8JA 2RH2A 5GAN6 2LT1A 3QKJA 4KULA 1VUBA 1FX7A 3LYIA 1VQ9A 3L42A 4IUTA 3I55A 2IVWA 3E1SA 3VJPA 3G4SA 3WVEB 2EQJA 3QYGB 3VYGA 5A0LA 4BE2A 2RHIA 4C0FA 2QQSA 2DXCA 3QZ9B 1I4K1 3SWNA 3GIBA 5LJ3j 2MAMA 3L2UA 2LVMA 1Y07A 4MZPA 1M5Q1 1QW1A 3DLLA 4Q5WA 3QBYA 3CPWA 1VQKT 4EDUA 3HFOA 2GF7A 2LT4A 1M9SA 2DZCA 2EFIA 2EQKA 3SWNB 2DK3A 4XU0A 5CO7A 4C8QF 3PMIA 3FRNA 1VQMA 4ME7A 4WF2A 2RJEA 1YCYA 1MGQA 1BIAA 4IUPA 3JRZA 1K8AC 3HSBA 3JCMX 3OMCA 3L2ZA 3PTAA 1Q7YU 4RCCA 1KQSA 1N9RA 2MWPA 4M7AD 4JRIA 2RI5A 3OYJA 3JB9J 2X4WA 3RUXA 2QQBA 5DLQE 4C92D 4M75E 2CZ0B 3ZFJA 1VIEA 2DZ9A 4C8QG 4F7UF 4N4GA 3PT9A 4C5IA 2PVGB 4M75D 4XK8E 5J39A 5CKHA 3CMAT 2I2LA 4N4HA 5CIUA 2LCCA 3RIRA 4RMOA 1D3BA 4D6WA 1M90U 4M7DA 1KQ2A 1P92A 3GF5A 3QJYA 1KC8U 1KD1U 4NOYA 1IZ6A 4OB1B 4C92C 2RK2A 2E64A 1YHQA 4PJOA 2PQWA 3M54A 4A53A 1VQ8A 3M4YA 5GMKh 2VXEA 1EIFA 4VUBA 3LX7A 1VQLA 3HP9A 2MF2A 5GAN7 2MI6A 1D3BB 1S72T 3RMQA 2OAUA 3M56A 4M7DB 2IG0A 3EFRA 4HKEA 1WQWA 4M78F 2PVOB 1YIJT 2HBPA 4XAXB 5GAMd 2LCLA 5FU6C 2XI9A 1VQ7A 4PJOB 3CD6T 2L89A 3E9GA 2P4TA 2BUDA 1G3WA 3VUBA 1VQ4T 3FIFA 1O75A 2K5IA 4M78G 5GMKe 1M4ZA 2XD0A 2V8KA 5FRNA 1X6OA 3A8GB 4BI8B 3EFSA 2XIDA 2O4XA 5KCHA 2R5AA 1FXXA 2QI2A 2HNIA 3M53A 3V7CA 2KAFA 4M77F 3A8LB 2VXFA 2MMPA 3OYYA 5HY6A 2DD5A 5KE3A 1YJ9A 4C0ZA 3CC2A 3GNGA 2GQVA 3ASKA 1PSEA 4II1A 4N4IA 3T9NA 1WJSA 3JB9G 1ZBXA 2O4XB 1YITT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y71 A; 
#chains in the Genus database with same CATH topology
 3VS1 A;  2CH4 W;  5LJ5 d;  1G83 A;  1M3A A;  1PKS A;  3PFS A;  3JCM d;  1YI2 T;  1OOT A;  4QVC A;  4ATO A;  4F7U A;  2RQR A;  4HVW A;  1OYX A;  2QA4 Q;  1K73 C;  3SWN C;  3S3O A;  6AT1 B;  1C0M A;  4FT4 A;  4M7A B;  2E6N A;  4OGE A;  5GMK i;  2YUN A;  1W2B A;  4MZM A;  1GBQ A;  3CBO A;  3MEW A;  3J81 E;  3VRY A;  3VS3 A;  2I0N A;  1ZQ1 A;  1KK7 A;  2EYZ A;  2YXY A;  2CZ1 B;  1RAF B;  4DQ2 A;  4A4H A;  4HT9 A;  4E7K A;  2VKN A;  2QDL A;  3P8H A;  4OP0 A;  2QEX Q;  1RAA B;  5GAN 3;  1K9M U;  3G6E A;  5GMK m;  1K9A A;  4F16 A;  3WVD B;  4O6J A;  2E5K A;  3V8K A;  3FJP A;  2ZPH B;  1AVZ C;  2E10 A;  2O01 E;  2A7Y A;  5CKD A;  4N0A A;  2DL4 A;  4PLI A;  1FYN A;  5GAN 4;  3JSC A;  1ZBJ A;  4JJD A;  1UJ0 A;  2AIR B;  4ELZ C;  3SEM A;  2FB7 A;  2EVR A;  2AKL A;  3C0C A;  1MND A;  4E7J A;  4LDX A;  2NYS A;  1YIJ A;  2FPD A;  1XNI A;  1ZSZ A;  5GAO m;  2KRO A;  2SRC A;  3I56 T;  1WGS A;  2HL3 A;  1TSF A;  1Q86 R;  1AEY A;  4M7A C;  1T3L A;  2KT1 A;  5LJ3 d;  2EWN A;  2P0Q A;  1TU0 B;  2M0O A;  2MOX A;  3I9Q A;  4ZTF A;  2RJC A;  5GAM e;  3E19 A;  3CCU T;  1Y7X A;  2JS2 A;  3RES A;  3OYE A;  4LDV A;  1HSQ A;  1QKW A;  1UGP B;  3M4G A;  3JCM W;  2WAC A;  2GQI A;  1YBY A;  1EFN A;  3O8V A;  3P8B B;  1N8R R;  3QWY A;  1BI1 A;  3VS6 A;  1UB4 A;  3OYB A;  4C8Q A;  4JZ3 A;  2QA4 A;  1UJY A;  3EG3 A;  1JU5 C;  2F2V A;  2B8A A;  5HKC A;  2Y4Y A;  3KUF A;  4PFO A;  5LJ5 f;  4XU2 A;  3JCM f;  2XHC A;  3LH0 A;  4HXJ A;  2XKO C;  1Q82 U;  2FVU A;  1QLY A;  2QAZ A;  5KYW A;  2DL7 A;  3MET A;  3NGP A;  4ESR A;  4KH1 B;  1ZUK A;  4XTV A;  2HSE B;  3OA6 A;  2CDT A;  3MP6 A;  4GLM A;  4MZT A;  2X3X D;  3A5Z B;  3MJX A;  1HXD A;  5IN1 A;  2X35 A;  2OTJ T;  1Y96 A;  3LWI A;  4BDY A;  4FSS A;  4J9F A;  4R56 A;  4M78 B;  2E3I A;  2RJD A;  1WQ7 A;  2BE7 D;  3HRT A;  1SHF A;  2HQE A;  5KCO A;  4KT0 E;  1YJ9 T;  2ZPB B;  1G5V A;  2DRK A;  1VQ5 T;  4PLL A;  2RI3 A;  4HCB A;  4Y91 A;  3N5B B;  3CCS Q;  2LNH B;  2E12 A;  2DXT A;  3INZ A;  3CCV T;  4M77 B;  3OYI A;  4J9D A;  4ZGE B;  2K79 A;  1T0H A;  1PC0 A;  3HTR A;  3JV3 A;  2M9U A;  4IUR A;  1OZ2 A;  1XQH A;  1QVP A;  3JCM Q;  1D1B A;  4XU1 A;  4MDX A;  2CP7 A;  4EPC A;  5CKE A;  1SRL A;  5LJ5 g;  3LLR A;  2K5F A;  3JCM g;  3G4S Q;  2D8J A;  3UPU A;  1G2B A;  2CKK A;  2D8H A;  2RM4 A;  4X1V A;  2E3H A;  2VWF A;  3MCA B;  4ZGJ B;  3RKY A;  3V7S A;  4M7A F;  1AWX A;  2KRN A;  3HHT B;  2HQH A;  3X24 B;  3TEE A;  3OYM A;  4M78 C;  1C1A A;  4M7A G;  1WA7 A;  3QII A;  2DNU A;  5LJ5 j;  1JXO A;  4JJN K;  2YDL A;  1RLQ C;  3OYL A;  2JZ2 A;  2XDP A;  3PVQ A;  2JM8 A;  4D8K A;  1E6H A;  4QQG A;  1PM3 A;  3CCM T;  1GRI A;  3L2Q A;  2RO0 A;  2RHZ A;  4J8O A;  4GLK A;  4M77 C;  1VQL Q;  2QG9 B;  3GP8 A;  2KRM A;  1H64 1;  1WHG A;  2R58 A;  2ED0 A;  3KBG A;  3OBW A;  3S3M A;  4ZGD B;  5CVI A;  1U1S A;  4JPB W;  2E41 A;  4EMG A;  3MHX A;  2FRW A;  2HEQ A;  1KQ1 A;  4FM4 B;  3AHU A;  1JJ2 A;  3CBM A;  2VYT A;  2LCS A;  1JJ2 S;  2KT8 A;  4F14 A;  2E1H A;  3EFO B;  2K9G A;  4X34 A;  1H3H A;  3E2U A;  5D6W A;  1Q86 U;  3FJ5 A;  3UT1 A;  4L59 A;  4RG2 A;  4YTL A;  4RTW A;  1PWT A;  1SG5 A;  4C92 B;  3OW2 S;  3C94 A;  3PGG A;  3TRE A;  3LW5 E;  2LZ6 B;  3LGL A;  1B34 B;  4JLG A;  2ROL A;  2ZPE B;  2DRM A;  1BCM A;  5GAN e;  1MMG A;  2JUF A;  3RKW A;  5DLO A;  5LJ3 g;  3CCJ T;  3V8L A;  3I5R A;  5I2M A;  4M7D F;  4BDZ A;  1X75 C;  3VS4 A;  4ZN3 A;  4HT8 A;  3OS1 A;  3THK A;  1OV3 A;  3VU3 C;  1G3T A;  2O2O A;  1N8R U;  2V8J A;  2RH2 A;  5GAN 6;  2LT1 A;  1VUB A;  1FX7 A;  1VQ9 A;  4IUT A;  3I55 A;  3TSZ A;  3G4S A;  1SSH A;  2EQJ A;  5IXB A;  2M51 A;  4AFZ C;  5KYX B;  4RTT A;  5LJ3 j;  2MAM A;  1QW1 A;  4EDU A;  4CC2 A;  2KGT A;  2EQK A;  3VRZ A;  2EPD A;  4ME7 A;  4M7A E;  3HSB A;  1BIA A;  2HBW A;  3JCM X;  3OMC A;  4RCC A;  1KQS A;  3OYJ A;  2F2X A;  4M75 D;  5CKH A;  4FCY A;  5CIU A;  4N4H A;  1D3B A;  1K73 R;  4C92 C;  1IZ6 A;  1ZUU A;  2RK2 A;  4PJO A;  3M54 A;  4JZ4 A;  1T0J A;  1VQL A;  5GAN 7;  1S72 T;  3RMQ A;  3D7S B;  1UFF A;  3EFR A;  4M78 F;  1N5Z A;  5GAM d;  1VQ7 A;  2L89 A;  1QMC A;  2P4T A;  4J9G A;  4DEX A;  5FW9 A;  4M78 G;  5GMK e;  1X6B A;  4HVV A;  2KYM A;  1NYF A;  2O4X A;  1FXX A;  3EGD A;  1FMW A;  2KAF A;  4M77 F;  3OYY A;  2VXF A;  2LMJ A;  1YI2 Q;  3ASK A;  4II1 A;  2CZ6 B;  3PIP A;  2O9V A;  2KE9 A;  4M77 G;  3OS0 A;  1N9S A;  3P8D A;  5GJV B;  4ORZ A;  3X26 B;  1VQ6 T;  1GXI E;  4LUE A;  4CC4 B;  2L2P A;  5I22 A;  3GPL A;  2CP3 A;  4HA8 A;  1VQO A;  2XG8 D;  4JLI A;  1U1T A;  4NL3 A;  1JB0 E;  3HL8 A;  3NMZ C;  2DXB A;  1WHL A;  4RTX A;  3JCM V;  3CCE T;  4AFU C;  1I81 A;  1WXU A;  1WNL A;  1YN8 A;  3RER A;  4E7I A;  2R5M A;  4OMN A;  1R8O B;  4J9E A;  3VKI A;  1HYO A;  4UC4 A;  4XTZ A;  1XJW B;  2DVJ A;  1B3Q A;  4OVA A;  1OZ3 A;  1MMN A;  1Y71 A;  5I11 A;  4FU6 A;  4LDU A;  3SDZ A;  1NE8 A;  4OGC A;  1IHV A;  3HKS A;  4XQ3 A;  4X9D A;  2EKH A;  1VQN T;  3CCQ T;  1T3S A;  1BI0 A;  3CC7 A;  1YJW T;  3VUZ A;  3CPW S;  1H8K A;  2RQV A;  1EX4 A;  1KFZ A;  5I21 A;  1JXM A;  1M3B A;  2L3P A;  4E47 A;  3I56 Q;  5IT9 E;  3M9Q A;  2ECZ A;  2Z0W A;  3TU4 K;  3CXC A;  5M9O A;  1UGR B;  1Q81 C;  3GLX A;  3CXC S;  2BE9 B;  3CCU Q;  1D1A A;  1ZSZ B;  3FB9 A;  1GCQ A;  4M78 E;  2DJQ A;  3R6N A;  5CQY A;  2M1H A;  4J6W A;  2PUK B;  2D9T A;  4BI3 A;  2K3B A;  3CC4 A;  3L2W A;  2YRV A;  1X27 A;  2LRQ A;  4XTW A;  4EMH A;  1M8M A;  4C92 F;  2EQU A;  3ER0 A;  4C0G A;  5EG2 A;  3CME T;  5GAM f;  1YJN T;  3R6O A;  1YI2 A;  2RI2 A;  5D6Y A;  2VGM A;  2OTL T;  3RKX A;  4C92 G;  1UEC A;  4M77 E;  2EJ9 A;  3JB9 F;  1V76 A;  4JS5 A;  4LD9 K;  1ZA2 B;  4IUQ A;  3MEV A;  2E70 A;  2XU8 A;  3GOX A;  1LJO A;  4LDY A;  1D1C A;  3IQL A;  2MWO A;  1EZZ B;  2JMA A;  3OYA A;  1D0X A;  4C8Q B;  4HCZ A;  2RA2 A;  1JJ2 P;  4N0A C;  4A54 A;  1RI0 A;  2QQA A;  1ZHI A;  2YT6 A;  3TCJ A;  1V1C A;  2EAY A;  1WFW A;  2A37 A;  1W2B S;  1NJI C;  3OW2 P;  5KYW B;  2OTJ Q;  2H3J A;  1OX8 A;  4Y28 E;  4E7S A;  1YJ9 Q;  2IPO B;  4Z89 A;  1SKU B;  3EG0 A;  1VQ5 Q;  4HCC A;  1K73 U;  1K0X A;  4BY6 B;  1ZSZ C;  5FRO A;  4E7H A;  1WDX A;  4QT7 A;  2LTO A;  4KGV B;  5GJW B;  5FWB A;  2LP5 A;  2DL5 A;  1YCS B;  5A0D A;  3WXM B;  4DEY A;  3CCV Q;  4JS4 A;  2NUZ A;  4R55 A;  3FDR A;  5GAN d;  4XU3 A;  3I35 A;  3A98 A;  2LC4 A;  2FPF A;  2OI3 A;  3BE3 A;  1KJW A;  3ZBD A;  2LX9 A;  2OAW A;  3I56 A;  4BB7 A;  2C06 A;  1I1J A;  3NPF A;  4RTV A;  4ZTJ A;  2K3X A;  1YP5 A;  3BFM A;  4ELY C;  3OS2 A;  1Q7Y C;  2AK5 A;  4Z88 A;  1QP2 A;  3CCU A;  4OB2 B;  1CSK A;  4C8Q C;  2DD4 A;  1N27 A;  4Y92 A;  4NL2 A;  4DOW A;  1M90 C;  2DPP B;  5GAO q;  2QDY B;  2K7A A;  1KC8 C;  5GAM j;  3G6E T;  1KD1 C;  2DX1 A;  5D6X A;  1N6A A;  2L5Q A;  2ENM A;  3SFM A;  1AOJ A;  4C92 E;  4JDS A;  3NTK A;  3OSV A;  4JJB A;  2YHT A;  2PTK A;  3JCM J;  1YIT A;  3URG A;  4NS5 A;  1TG0 A;  2QXF A;  2D6F A;  8AT1 B;  3UDC A;  1VQM Q;  4BY6 C;  4O5V A;  1SF9 A;  2KQW A;  2DL3 A;  2BZ8 A;  2ZGW A;  3EAE A;  2HD0 A;  4F7U G;  3HPW A;  3CCM Q;  1WJR A;  3REB B;  1UTI A;  3UA6 A;  1Y0M A;  4AFS C;  4LN2 A;  3EHQ A;  2Y90 A;  4QVZ A;  4QW2 A;  2YUP A;  2CP5 A;  3MEA A;  4BD3 A;  1Q82 C;  1NG2 A;  1YHQ T;  2OTJ A;  1UGV A;  1VQ8 T;  3EHR A;  4MMK A;  3VV0 A;  4RUG A;  4EIK A;  2DXU A;  3H9N A;  2GTJ A;  2M0Y A;  4KGX B;  5J3B A;  2YUQ A;  2OX7 A;  2J6K A;  3QG1 A;  2QEX A;  5GAN 2;  2G6F X;  2ZPF B;  1UGQ B;  1LOJ A;  4OMM A;  3CCV A;  5KYY A;  4RCB A;  2NUP A;  3SD4 A;  4QQD A;  3RDV A;  4BE0 A;  2VVK A;  4FL6 A;  2DLP A;  3JCM b;  3LH5 A;  4RTZ A;  1H92 A;  4CC7 A;  1RAB B;  2COZ A;  2AHJ B;  3CC2 T;  1I8F A;  2RF0 A;  3QSU A;  3CCJ Q;  1GFC A;  2ESW A;  2CUB A;  3FC3 A;  5GAN 5;  3OSS C;  3OQ5 A;  3NFC A;  4P5N A;  3CEY A;  3UF4 A;  2V26 A;  5GAN f;  1UUE A;  4J83 A;  3QPH A;  4QVD A;  3OYH A;  4KBM B;  1M1K C;  2M16 A;  1R77 A;  4J9C A;  2O31 A;  2JS0 A;  4ZNX A;  2KBT A;  2DM1 A;  1UDL A;  1ARK A;  1K4U S;  1W70 A;  3QKJ A;  1I0C A;  2O9S A;  2XMF A;  3CPW P;  2IVW A;  2F2W A;  3VJP A;  3VYG A;  1UHF A;  2RHI A;  2W0Z A;  2DXC A;  3QZ9 B;  5EC7 A;  3GIB A;  2CH4 A;  4MZP A;  2QK0 A;  1IXD A;  2AKK A;  2KEA A;  1VQK T;  3QBY A;  1RAD B;  3HFO A;  2GF7 A;  1OUL A;  2LT4 A;  2DBM A;  2OJ2 A;  3ZL7 C;  4XU0 A;  4C8Q F;  3PMI A;  1VQM A;  4WF2 A;  4IUP A;  1K8A C;  4F17 A;  3L2Z A;  3PTA A;  3CXC P;  1N9R A;  4M7A D;  1QCO A;  3JB9 J;  2X4W A;  2QQB A;  1F1B B;  2CZ0 B;  3ZFJ A;  1VIE A;  2DZ9 A;  4FYX B;  4WCI A;  3U23 A;  4C8Q G;  2KXC A;  4C5I A;  4XK8 E;  4AMC A;  2DET A;  3CMA T;  2I2L A;  4RMO A;  2EGC A;  4M7D A;  1S72 Q;  1WI7 A;  4NOY A;  4OB1 B;  2E64 A;  3M4Y A;  2VXE A;  1D3B B;  3M56 A;  1UHC A;  2IG0 A;  2PVO B;  3EH1 A;  2HBP A;  4AG2 C;  5FU6 C;  4PJO B;  3CD6 T;  2RQW A;  3E9G A;  4DBQ A;  2BUD A;  1VQ4 T;  2K5I A;  1SEM A;  4OMQ A;  3A8G B;  2C0T A;  5KCH A;  1W1F A;  2HNI A;  3M53 A;  1WXB A;  5KE3 A;  2MMP A;  1PRM C;  4C0Z A;  2GNC A;  1WHJ A;  4N4I A;  2DER A;  1WJS A;  2O4X B;  5LJ5 e;  4J9H A;  2MYS A;  3JCM e;  3EGD B;  1VQ6 Q;  2CP0 A;  1ACM B;  2E5Q A;  3EG2 A;  3EGX B;  5CR2 A;  1W2B P;  4L6V 5;  3CCJ A;  1XOV A;  3A8M B;  4M75 A;  1RI9 A;  3CCE Q;  3CCS A;  3M5A A;  2X4X A;  3PNW C;  1WHK A;  1AT1 B;  1BIB A;  1VOM A;  3VYH B;  3OB9 A;  3J80 E;  2EYX A;  2XIC A;  3OBY A;  4X9C A;  1BYM A;  2FZC B;  1UEB A;  2L3S A;  4M7D D;  1Q95 G;  2XK0 A;  5J26 A;  1Q81 R;  1FMV A;  2FEI A;  1WZO A;  2DIQ A;  1QWF A;  5I2S A;  2LJ3 A;  1B07 A;  9ATC B;  2L8D A;  4PJO C;  3H41 A;  1KSW A;  1VQN Q;  1AZG B;  4PJL A;  3CCQ Q;  4KRT A;  1VQP T;  2BZX A;  2K4Y A;  1YJW Q;  3ZEH A;  4C8Q E;  1QCN A;  2X3W D;  1G3S A;  1VYV A;  1WLP B;  2BZY A;  3OYD A;  2EYW A;  4J7F A;  5GAO n;  2YRC A;  2COY A;  2DAQ A;  2D0Q B;  3EH2 A;  1OX9 A;  3OS5 A;  5HK0 A;  4B9W A;  4A4E A;  1WX6 A;  1IGQ A;  2KRS A;  3PIO A;  3O5Z A;  4AG1 C;  1KQS S;  4BE1 A;  2EGA A;  3HRS A;  2LQ8 A;  4IUU A;  3M0P A;  2EGE A;  1UGS B;  2FRY A;  4AT1 B;  3M0S A;  1X2K A;  2F69 A;  1V29 B;  5LJ3 e;  3EG9 B;  5C6S A;  1H3Z A;  2P0P A;  4K11 A;  2B86 A;  1OEB A;  1VQ9 T;  2CYZ B;  4HVU A;  3I55 T;  3CME Q;  1RAH B;  1YJN Q;  3J7A F;  5GMK j;  2RQT A;  1VYT A;  5DM7 R;  1PKT A;  2OTL Q;  2WSF E;  1QVG A;  2KXD A;  2EIF A;  2NWM A;  1ZSG A;  1TUG B;  2LQK A;  3BDL A;  4QKU A;  1QVG S;  2LNV A;  4MDW A;  1NEG A;  7AT1 B;  5LJ5 h;  3H0I A;  3JCM h;  1BKB A;  5KYU A;  3M57 A;  2NUT B;  1VQ6 A;  2GBQ A;  3EGU A;  4EMK A;  4JRP A;  4M75 G;  4XTX A;  3C95 A;  1DJ7 B;  2ZZD A;  5AT1 B;  1BB9 A;  1S1N A;  2VGN A;  4PK4 A;  3CCE A;  2HL5 C;  2DVE A;  2DMO A;  3M55 A;  3NHN A;  2QGF B;  3H0H A;  3JB9 I;  2HQX A;  2DEU A;  3C12 A;  2K2V A;  5CKF A;  1MNE A;  1TTH B;  2R57 A;  1RAI B;  3QXE B;  5DY9 A;  2DYI A;  4F7U B;  1IGU A;  1VQ7 T;  2DO3 A;  2MPX C;  1Q7Y R;  2CP6 A;  2HAX A;  4JUV A;  2MIO A;  1GBR A;  3RMS A;  4XTU A;  1B34 A;  1KC8 R;  2K3Y A;  1VQN A;  1PD1 A;  1KD1 R;  2V8I A;  3CCQ A;  3MPU B;  5CKB A;  1M2V A;  2HZY A;  4OMO A;  1WJQ A;  2KMT A;  4OB0 B;  2J06 A;  1YFN A;  1RAE B;  1R0C B;  1YJW A;  2E6Z A;  1VIF A;  3G71 T;  1LCK A;  4FW2 A;  2K2M A;  2DTO A;  1WYX A;  1GCQ C;  2X51 A;  2F5T X;  5FRM A;  3QDF A;  2J6O A;  5KYN A;  5IHN A;  1VQO T;  2DKG A;  3S6W A;  2LX7 A;  4PJO F;  1TS9 A;  1FWZ A;  3G7Z A;  2DA9 A;  2RB6 A;  2CS7 A;  3CCL T;  4PJO G;  4C0D B;  3H8Z A;  1AWO A;  2ZCF B;  4KH0 B;  5LJ3 h;  2FHD A;  2KNB B;  4LE9 A;  3CCR T;  2AT1 B;  4F04 B;  3ULR B;  4J7I A;  1TXQ A;  2QGG A;  2V1Q A;  3CME A;  1YJN A;  3CPF A;  1KG1 A;  4KUD K;  3OYF A;  3BDU A;  3HRU A;  2OTL A;  4PFP A;  1WIE A;  1ABO A;  2DJZ A;  1D0Z A;  4J9I A;  4QQ6 A;  3X25 B;  3GBQ A;  4Z02 A;  2GTO A;  4FSX A;  1PHT A;  2CT4 A;  2CRE A;  1OPL A;  4RTY A;  5L23 A;  2GFA A;  2VV5 A;  3H6Z A;  3CC7 T;  2HMA A;  3JB9 D;  1Q81 U;  4FT2 A;  5CK9 A;  2L3Q A;  2VC8 A;  1M1F A;  3QWX X;  4D8D A;  3ME9 A;  2YSQ A;  2EYQ A;  2D1X A;  2PVD B;  1OI1 A;  4FIB A;  4BUG A;  2J6F A;  2KVQ G;  2QQ9 A;  1YHQ Q;  1VQ8 Q;  2A3L A;  2BTT A;  1YWO A;  1X43 A;  2LQN A;  1LNX A;  2YLC A;  1M1K R;  4JRQ A;  2JT4 A;  2EYY A;  2RN8 A;  2RK1 A;  2FG0 A;  1NEB A;  2CGH A;  2FZG B;  2DEQ A;  2A28 A;  4IUV A;  4C0D C;  2JTE A;  3CC4 T;  1QCF A;  2ROT A;  2DTI A;  1GCP A;  4J5Y A;  2P0K A;  2JN0 A;  2CT3 A;  1OPK A;  1NM7 A;  3SHW A;  1MHN A;  5IHI A;  1I07 A;  4B6M A;  1OU8 A;  1M27 C;  3G1J A;  4ANJ A;  3CC2 Q;  4DA4 A;  1BI2 A;  1K9M C;  3DB4 A;  1K8A R;  5KYY B;  2JTF A;  2NUP B;  4RKU E;  1BU1 A;  1A0N B;  1Y96 B;  1NJI U;  1PD0 A;  3TVT A;  5FLX E;  1RAC B;  2XDB A;  3EG1 A;  4GY5 A;  3JCM P;  5FWC A;  4PJO E;  1M30 A;  4FYY B;  2A36 A;  1QVF A;  1ZUY A;  3I5S A;  4E2F B;  2CZ7 B;  2L0A A;  1QVF S;  1OQK A;  5GAM g;  3L2V A;  2ED1 A;  2BIV A;  5LL6 S;  1Z9Z A;  5C0M A;  2VAS A;  1HD3 A;  2VUB A;  2H3E B;  1WXT A;  2JVV A;  2QQR A;  1MV0 B;  2JJ9 A;  3L42 A;  1JQQ A;  1C6V X;  5A0L A;  3QYG B;  1VQK Q;  2QQS A;  1I4K 1;  3SWN A;  3M0U A;  3MKD A;  2LVM A;  1KQS P;  4Q5W A;  2AZS A;  2DZC A;  1K76 A;  2DK3 A;  2HDA A;  1MV3 A;  4M4Z A;  2FZK B;  3FRN A;  3TSW A;  2RJE A;  1FMK A;  1YCY A;  1Q7Y U;  3CMA Q;  2CP2 A;  1JO8 A;  4F7U F;  3PT9 A;  2PVG B;  5J39 A;  2QTV A;  1E6G A;  2LCC A;  1M90 U;  4D6W A;  1KQ2 A;  3GF5 A;  1KC8 U;  3QJY A;  1KD1 U;  1QVG P;  1YHQ A;  2PQW A;  4A53 A;  1VQ8 A;  1EIF A;  4VUB A;  3LX7 A;  3HP9 A;  2QAS A;  3CD6 Q;  2MF2 A;  4M7D B;  2OAU A;  1VQ4 Q;  1YIJ T;  1RAG B;  2HCK A;  1SRM A;  1O75 A;  3FIF A;  1M4Z A;  2XD0 A;  2V8K A;  1QQJ A;  2XID A;  2EBP A;  4AFQ C;  4A63 B;  2QI2 A;  2GGR A;  3A8L B;  1YJ9 A;  2FPE A;  3CC2 A;  3GNG A;  2GQV A;  1PSE A;  1YIT T;  3T9N A;  4C0F A;  1VQ5 A;  3OYK A;  1W4S A;  2H8H A;  2A0F B;  4M7A A;  3M0T A;  3X20 B;  3M0Q A;  1R0B G;  2KK4 A;  3RBB B;  2KI7 A;  3QJ6 A;  2KYB A;  4LD6 A;  1BI3 A;  5KH6 A;  2YLB A;  2P4R A;  3F70 A;  2XDD A;  1W6X A;  2L3R A;  4JJC A;  2QA4 T;  3JB9 H;  4BAC A;  4M75 B;  2K5L A;  1M1G A;  2LJ1 A;  3M59 A;  1QP3 A;  2KDS A;  3QZ5 B;  1NYG A;  1HJD A;  3QYH B;  5FU6 B;  4WTO B;  1MMD A;  1OU9 A;  2JMC A;  5HCK A;  3QHS A;  1QWE A;  1XTD A;  1VQK A;  1RUW A;  3BW1 A;  1IRE B;  1JRI A;  4M7D C;  1G8X A;  2J05 A;  2QTX A;  2JTM A;  2F1L A;  1ZA1 B;  1JEG A;  2QEX T;  4PNO A;  1VQP Q;  3JAM E;  3LGF A;  1IRX A;  1J3T A;  2CSI A;  4RTU A;  4A4G A;  5KE2 A;  1M1K U;  3CMA A;  1BBZ A;  3KXT A;  2LQW A;  4LXC A;  4R0K A;  4DOV A;  4C8Q D;  4C5H A;  2DIG A;  3VS2 A;  2DTH A;  1PRL C;  5AYF A;  1WHM A;  2AZV A;  3S3N A;  2V1R A;  4FYV B;  4PJJ A;  1M2O A;  4F7U E;  3E9F A;  4FW1 A;  3KFV A;  4BI4 A;  2KSS A;  2M02 A;  4OB3 B;  3DB3 A;  2WSE E;  1PG5 B;  3CCM A;  1K0S A;  3M58 A;  5CCA A;  2DFU A;  3CD6 A;  5GAM h;  3QUI A;  2CUD A;  2QYZ A;  1IHW A;  3OY9 A;  1VQ4 A;  2F5K A;  3Q1J A;  4IIM A;  1VQ9 Q;  1U3O A;  4B9X A;  3I55 Q;  2GCX A;  1I5O B;  1JBM A;  1ZX6 A;  2FYK A;  4M75 C;  1K8A U;  4JRK A;  5GAN 8;  5LJ3 f;  1NPR A;  2O88 A;  2G3R A;  2NLU A;  3A8H B;  1VA7 A;  3NTI A;  3OMG A;  4E7L A;  5GAN g;  1VQM T;  4KUI A;  5HK3 A;  3HFN A;  4OMP A;  5KYU B;  3A8O B;  4PFZ A;  2EQI A;  4EMK B;  1MUZ A;  3PVL A;  3MEU A;  4IIO A;  1PSF A;  2PU9 B;  2RJF A;  2DIL A;  2A08 A;  4CI0 C;  1Q86 C;  1VQ7 Q;  2HKQ B;  2IIM A;  1U8R A;  4RG8 A;  3LWH A;  4L5G A;  5GAN j;  2GFU A;  1TUD A;  4PJN A;  4Z8A A;  2RD1 A;  3PMT A;  1TH7 A;  2KY9 A;  3OYC A;  5ECA A;  4M78 A;  3VS0 A;  4V2S A;  8ATC B;  2RNA A;  2EKO A;  2YRD A;  3V7R A;  5IAY A;  3UWN A;  1VQP A;  3QO3 A;  1KHC A;  3VS7 A;  3G71 Q;  3OW2 A;  1I5L A;  4A4K A;  2RHU A;  2JOY A;  4LUD A;  1LPL A;  1N8R C;  1NBE B;  2COW A;  2EJG A;  1HK9 A;  1QVF P;  3X28 B;  1WPY A;  5GMK l;  4M77 A;  3H0F A;  1M2V B;  1YNZ A;  1VQO Q;  1NZ9 A;  1QKX A;  4MML A;  2E65 A;  2PUO B;  5L8R E;  1PNJ A;  2DF6 A;  3CCS T;  2EQM A;  2RPN A;  3CCL Q;  3FLG A;  2J7I A;  3FEO A;  2D0N A;  1Z9Q A;  4M7D G;  3C4S A;  2VB6 A;  4OF1 A;  3CCR Q;  2JNG A;  4EMK C;  2FL7 A;  1S72 A;  3AT1 B;  4OMF B;  1RLP C;  1AD5 A;  3RR6 A;  2JXB A;  4FYW B;  2RHX A;  5GAO l;  2ABL A;  5GAO p;  1CKB A;  4PJM A;  2X4J A;  4TVR A;  3V8J A;  3NTH A;  2MCN A;  1D0Y A;  1U06 A;  2DE0 X;  2K6D A;  4M78 D;  1NJI R;  3G4S T;  3L2R A;  2SEM A;  3CC7 Q;  3SB2 A;  1NLP C;  2Y4X A;  4XTY A;  4CRI A;  2PZ1 A;  1M8V A;  2RQU A;  3OYN A;  2K57 A;  4M75 F;  5FU7 B;  4ZN1 A;  2HSP A;  4J9B A;  3DLM A;  3RNJ A;  2DBK A;  1U5S A;  1K9M R;  2ZPI B;  1KIK A;  2W10 A;  3M0R A;  4M77 D;  1UE9 A;  5GAO r;  4DBR A;  1M3C A;  2KR3 A;  1O9S A;  5A2Q E;  4PL6 A;  2DL8 A;  4IKF A;  2X4Y A;  1LVK A;  4PKC C;  1UG1 A;  2ZPG B;  1NLO C;  3VS5 A;  1BCO A;  3CC4 Q;  1NPP A;  2BKD N;  2JM9 A;  5CQX A;  3CQT A;  1VQL T;  1B7T A;  3TQ7 P;  4A4F A;  4C5G A;  5A0G A;  1GL5 A;  3EGX A;  2CSQ A;  3OYG A;  3EFO A;  2DYB A;  3JCM c;  2X9H A;  3G71 A;  1TUC A;  2EW3 A;  4GBQ A;  2YUO A;  2WSC E;  1ABQ A;  4C92 A;  4DBH A;  4LDW A;  1AHJ B;  2EJF A;  5GAN h;  1M90 R;  3DKM A;  1ZLM A;  4C5E A;  1TWB A;  1X01 A;  3MP1 A;  4J6X A;  3QDR B;  1X2Q A;  1D09 B;  1G3Y A;  2LDM A;  3REA B;  4KGZ B;  4CC3 A;  1BK2 A;  3CCL A;  4M7D E;  4J6Y A;  1SSF A;  5CAI A;  2RHY A;  3L1A A;  5FU7 C;  5IHK A;  4LNP A;  3MP8 A;  1KHI A;  3UAT A;  3GNF B;  2LJ0 A;  3CCR A;  1RL2 A;  4PJO D;  1GFD A;  1AWW A;  1IO6 A;  3BY7 A;  3MO8 A;  1MMA A;  3CBP A;  1CKA A;  5KYX A;  1K1Z A;  1AZE A;  4KUL A;  2E4H A;  5D7U A;  3LYI A;  1AWJ A;  3E1S A;  3WVE B;  4BE2 A;  1SHG A;  2P84 A;  4HCK A;  3G6E Q;  2RMO A;  3L2U A;  1Q82 R;  1TOV A;  1Y07 A;  1M5Q 1;  3DLL A;  3CPW A;  2C0O A;  5IXF A;  2ZAE A;  1M9S A;  2MK5 A;  2EFI A;  3SWN B;  5CO7 A;  4OML A;  1MGQ A;  3JRZ A;  3PE0 A;  2MWP A;  4JRI A;  2RI5 A;  3RUX A;  4C92 D;  5DLQ E;  4M75 E;  2JW4 A;  1SPK A;  1IB8 A;  1Y57 A;  3EG9 A;  4N4G A;  3RIR A;  2YWW A;  1P92 A;  1YIJ Q;  5GMK h;  2C0I A;  2MI6 A;  2FO0 A;  3UA7 A;  1X6G A;  1YWP A;  4HKE A;  1WQW A;  4XAX B;  2LCL A;  2XI9 A;  4E7Z A;  2NUT A;  2ATC B;  4DBF A;  1VYU A;  1E7O A;  3A1P A;  1G3W A;  3VUB A;  2PNI A;  1X69 A;  5IH2 A;  5FRN A;  1X6O A;  4BI8 B;  3EFS A;  1PCX A;  1YIT Q;  2R5A A;  4E6R A;  3V7C A;  2HKN A;  5HY6 A;  2DD5 A;  1WHH A;  3JB9 G;  1ZBX A; 
#chains in the Genus database with same CATH homology
 3OYK A;  2CZ6 B;  3JCM e;  1W4S A;  5LJ5 d;  3PIP A;  1VQ9 T;  3PFS A;  3JCM d;  4M77 G;  1YI2 T;  4M7A A;  2E5Q A;  4QVC A;  5CR2 A;  3X20 B;  1N9S A;  3OS0 A;  4ATO A;  4F7U A;  3P8D A;  4L6V 5;  3CCJ A;  1XOV A;  2KK4 A;  3X26 B;  3QJ6 A;  3A8M B;  1VQ6 T;  1GXI E;  1OYX A;  4LD6 A;  1BI3 A;  4M75 A;  1K73 C;  3GPL A;  4HA8 A;  3SWN C;  3CCS A;  5KH6 A;  1VQO A;  2XG8 D;  3S3O A;  2YLB A;  1U1T A;  4FT4 A;  4JLI A;  4M7A B;  4NL3 A;  3F70 A;  3M5A A;  1JB0 E;  2X4X A;  3HL8 A;  3PNW C;  2E6N A;  4OGE A;  2XDD A;  2L3R A;  5GMK i;  2DXB A;  1BIB A;  1W2B A;  3VYH B;  3JCM V;  4MZM A;  2QA4 T;  3CCE T;  3JB9 H;  4BAC A;  3OB9 A;  3J80 E;  4M75 B;  2K5L A;  1M1G A;  3CBO A;  3M59 A;  1I81 A;  2XIC A;  3MEW A;  3J81 E;  1QP3 A;  1WNL A;  3OBY A;  4X9C A;  2KDS A;  1BYM A;  3QZ5 B;  3RER A;  1ZQ1 A;  4E7I A;  2R5M A;  3QYH B;  1UEB A;  1VQ5 A;  5FU6 B;  4M7D D;  1R8O B;  2CZ1 B;  3VKI A;  2XK0 A;  5J26 A;  4DQ2 A;  4A4H A;  4HT9 A;  3QHS A;  4E7K A;  4UC4 A;  4XTZ A;  2DIQ A;  1XTD A;  3P8H A;  4OP0 A;  1VQK A;  5I2S A;  5GAN 3;  1K9M U;  3BW1 A;  1IRE B;  1JRI A;  3G6E A;  4M7D C;  4OVA A;  2QTX A;  5GMK m;  1OZ3 A;  2JTM A;  2L8D A;  1Y71 A;  4PJO C;  2QEX T;  4PNO A;  4FU6 A;  3LGF A;  3WVD B;  3JAM E;  4O6J A;  4LDU A;  3SDZ A;  3V8K A;  3FJP A;  1NE8 A;  2ZPH B;  4OGC A;  3HKS A;  4XQ3 A;  4X9D A;  2E10 A;  1VQP T;  2O01 E;  4A4G A;  2A7Y A;  2K4Y A;  1VQN T;  5KE2 A;  3ZEH A;  5CKD A;  4N0A A;  4PLI A;  3CCQ T;  1M1K U;  3CMA A;  3KXT A;  5GAN 4;  4C8Q E;  3JSC A;  4DOV A;  1BI0 A;  3CC7 A;  1YJW T;  3VUZ A;  1G3S A;  4C8Q D;  4C5H A;  3OYD A;  2DIG A;  4ELZ C;  3CPW S;  4J7F A;  2DTH A;  5GAO n;  2FB7 A;  5AYF A;  2DAQ A;  2D0Q B;  3S3N A;  3OS5 A;  5I21 A;  5HK0 A;  4B9W A;  4F7U E;  3E9F A;  4A4E A;  4E7J A;  4LDX A;  4BI4 A;  5IT9 E;  4E47 A;  2KSS A;  4OB3 B;  3DB3 A;  1YIJ A;  2WSE E;  3PIO A;  3CCM A;  1KQS S;  4BE1 A;  3M9Q A;  1XNI A;  3M58 A;  5CCA A;  3CD6 A;  5GAM h;  5GAO m;  3HRS A;  2LQ8 A;  3QUI A;  4IUU A;  3I56 T;  1WGS A;  3OY9 A;  3TU4 K;  2F5K A;  3Q1J A;  1VQ4 A;  4M7A E;  3CXC A;  1UGS B;  5M9O A;  4M7A C;  1UGR B;  1Q81 C;  4B9X A;  2GCX A;  2F69 A;  3GLX A;  3CXC S;  1V29 B;  1JBM A;  5C6S A;  5LJ3 e;  3FB9 A;  4M78 E;  1H3Z A;  2P0P A;  2FYK A;  2M1H A;  4M75 C;  5CQY A;  2EWN A;  4J6W A;  5LJ3 d;  2CYZ B;  2D9T A;  2P0Q A;  2PUK B;  2M0O A;  4JRK A;  5GAN 8;  3I55 T;  4ZTF A;  3J7A F;  2RJC A;  5LJ3 f;  4BI3 A;  5GAM e;  1NPR A;  3E19 A;  1Y7X A;  2YRV A;  5GMK j;  3L2W A;  3CCU T;  3CC4 A;  2LRQ A;  4XTW A;  4EMH A;  5DM7 R;  4C92 F;  2WSF E;  2EQU A;  2G3R A;  1QVG A;  2EIF A;  2NLU A;  3ER0 A;  4C0G A;  2LQK A;  5EG2 A;  3RES A;  3BDL A;  5GAM f;  4LDV A;  3OYE A;  3CME T;  1YJN T;  1QVG S;  2LNV A;  3A8H B;  4MDW A;  3R6O A;  5LJ5 h;  1YI2 A;  2RI2 A;  5D6Y A;  2VGM A;  2OTL T;  3RKX A;  3JCM h;  1UGP B;  3M4G A;  3NTI A;  1BKB A;  2WAC A;  4C92 G;  3JCM W;  3M57 A;  2EJ9 A;  1YBY A;  4M77 E;  3JB9 F;  1VQ6 A;  4JS5 A;  3OMG A;  3O8V A;  5GAN g;  4E7L A;  3P8B B;  1VQM T;  4KUI A;  5HK3 A;  4EMK A;  4JRP A;  4LD9 K;  3HFN A;  4M75 G;  4XTX A;  1BI1 A;  3C95 A;  1DJ7 B;  2ZZD A;  4IUQ A;  1UB4 A;  3MEV A;  3OYB A;  4C8Q A;  2VGN A;  2E70 A;  2XU8 A;  3GOX A;  1LJO A;  4LDY A;  2QA4 A;  3A8O B;  3CCE A;  2MWO A;  2DVE A;  4EMK B;  3M55 A;  3MEU A;  2B8A A;  5HKC A;  2Y4Y A;  3KUF A;  1PSF A;  2PU9 B;  3OYA A;  5LJ5 f;  4C8Q B;  2RJF A;  4HCZ A;  4XU2 A;  3JB9 I;  2RA2 A;  3JCM f;  2HQX A;  2XHC A;  3LH0 A;  1Q82 U;  2XKO C;  4CI0 C;  1Q86 C;  2FVU A;  3C12 A;  2K2V A;  5CKF A;  3MET A;  4N0A C;  1U8R A;  4A54 A;  2R57 A;  1RI0 A;  2QQA A;  3QXE B;  4RG8 A;  1ZHI A;  4L5G A;  3LWH A;  5GAN j;  2GFU A;  5DY9 A;  4F7U B;  4XTV A;  3TCJ A;  2RD1 A;  3PMT A;  2DO3 A;  3OA6 A;  1VQ7 T;  2EAY A;  3MP6 A;  1TH7 A;  1NJI C;  1W2B S;  2KY9 A;  4MZT A;  3OYC A;  3A5Z B;  2HAX A;  2H3J A;  4JUV A;  4M78 A;  4V2S A;  1HXD A;  3RMS A;  5IN1 A;  2X35 A;  2EKO A;  4XTU A;  4Y28 E;  3V7R A;  5IAY A;  3UWN A;  1VQP A;  2OTJ T;  3QO3 A;  1KHC A;  1B34 A;  1Y96 A;  2K3Y A;  3LWI A;  4HCC A;  1VQN A;  2V8I A;  4BDY A;  1K73 U;  3CCQ A;  4BY6 B;  5FRO A;  4R56 A;  4M78 B;  4A4K A;  5CKB A;  3OW2 A;  2LTO A;  4E7H A;  1I5L A;  1WJQ A;  2RJD A;  1WQ7 A;  2KMT A;  2JOY A;  2RHU A;  3HRT A;  4OB0 B;  2HQE A;  5KCO A;  4KT0 E;  1YJ9 T;  2ZPB B;  1G5V A;  1N8R C;  1YJW A;  2E6Z A;  2EJG A;  1VQ5 T;  1HK9 A;  4PLL A;  5A0D A;  1VIF A;  2RI3 A;  3WXM B;  5LJ5 e;  3G71 T;  4JS4 A;  4HCB A;  4Y91 A;  1WPY A;  3N5B B;  3X28 B;  4R55 A;  5GMK l;  4M77 A;  2DTO A;  3FDR A;  2F5T X;  5FRM A;  1NZ9 A;  2E12 A;  5GAN d;  2DXT A;  3INZ A;  4XU3 A;  4MML A;  3CCV T;  2E65 A;  2PUO B;  2LC4 A;  5L8R E;  4M77 B;  3CCS T;  2DKG A;  1VQO T;  3S6W A;  4PJO F;  3ZBD A;  3OYI A;  2EQM A;  2LX9 A;  3I56 A;  2C06 A;  1FWZ A;  4BB7 A;  4ZGE B;  3G7Z A;  3FLG A;  3FEO A;  4ZTJ A;  2K3X A;  4M7D G;  3C4S A;  2RB6 A;  3BFM A;  2CS7 A;  4OF1 A;  3CCL T;  4PJO G;  4ELY C;  4C0D B;  2JNG A;  3H8Z A;  2ZCF B;  4EMK C;  3OS2 A;  1Q7Y C;  2M9U A;  2FL7 A;  1S72 A;  5LJ3 h;  1QP2 A;  1OZ2 A;  1XQH A;  4IUR A;  3CCU A;  2FHD A;  1QVP A;  4OB2 B;  4OMF B;  4C8Q C;  2DD4 A;  3CCR T;  3JCM Q;  1N27 A;  4XU1 A;  4MDX A;  4J7I A;  2RHX A;  5CKE A;  4EPC A;  3CME A;  1YJN A;  3CPF A;  4NL2 A;  4DOW A;  1M90 C;  2DPP B;  5GAO l;  1KG1 A;  5GAO q;  2QDY B;  4KUD K;  5GAO p;  5LJ5 g;  3BDU A;  3HRU A;  5GAM j;  3OYF A;  3LLR A;  3G6E T;  1KC8 C;  1KD1 C;  2OTL A;  2K5F A;  2X4J A;  3JCM g;  4TVR A;  3V8J A;  5D6X A;  1N6A A;  2L5Q A;  3NTH A;  3UPU A;  3SFM A;  2DJZ A;  2CKK A;  2RM4 A;  4C92 E;  4JDS A;  4QQ6 A;  3MCA B;  3X25 B;  4ZGJ B;  4M78 D;  3G4S T;  3NTK A;  3OSV A;  3RKY A;  3V7S A;  4Z02 A;  3L2R A;  4M7A F;  2YHT A;  3JCM J;  3SB2 A;  2Y4X A;  4FSX A;  4XTY A;  4CRI A;  1YIT A;  3URG A;  3HHT B;  4NS5 A;  3X24 B;  1M8V A;  3TEE A;  2QXF A;  3OYN A;  2K57 A;  2D6F A;  4M75 F;  5FU7 B;  3UDC A;  2GFA A;  4BY6 C;  4ZN1 A;  2VV5 A;  4M78 C;  4O5V A;  3OYM A;  2ZGW A;  2KQW A;  3H6Z A;  3CC7 T;  3EAE A;  3JB9 D;  1Q81 U;  3DLM A;  2HD0 A;  4M7A G;  4FT2 A;  4F7U G;  3QII A;  5LJ5 j;  3HPW A;  5CK9 A;  2ZPI B;  1WJR A;  2VC8 A;  4JJN K;  1M1F A;  4M77 D;  3OYL A;  2JZ2 A;  2XDP A;  3ME9 A;  4QQG A;  5GAO r;  2EYQ A;  3CCM T;  2PVD B;  1O9S A;  1OI1 A;  2RO0 A;  5A2Q E;  4PL6 A;  3L2Q A;  2RHZ A;  4FIB A;  4BUG A;  4J8O A;  4IKF A;  2KVQ G;  2QQ9 A;  2Y90 A;  4QVZ A;  2X4Y A;  4GLK A;  4QW2 A;  4PKC C;  4M77 C;  2A3L A;  2ZPG B;  3MEA A;  4BD3 A;  1LNX A;  2YLC A;  3GP8 A;  4JRQ A;  1Q82 C;  1NPP A;  2BKD N;  2RK1 A;  1YHQ T;  1K8A U;  2OTJ A;  1H64 1;  5CQX A;  1VQ8 T;  2R58 A;  4MMK A;  3VV0 A;  2CGH A;  1VQL T;  3KBG A;  3OBW A;  3S3M A;  2DXU A;  4A4F A;  2DEQ A;  4IUV A;  4C5G A;  5CVI A;  1U1S A;  4C0D C;  4ZGD B;  2E41 A;  5A0G A;  3CC4 T;  4EMG A;  3OYG A;  3MHX A;  2DTI A;  4J5Y A;  5J3B A;  2P0K A;  3JCM c;  2JN0 A;  3G71 A;  1KQ1 A;  3QG1 A;  4FM4 B;  3AHU A;  2QEX A;  5GAN 2;  2WSC E;  1JJ2 A;  2ZPF B;  3CBM A;  1MHN A;  2VYT A;  1UGQ B;  1LOJ A;  4C92 A;  1JJ2 S;  3CCV A;  2E1H A;  4LDW A;  1AHJ B;  2EJF A;  4X34 A;  5GAN h;  4RCB A;  3DKM A;  3SD4 A;  5D6W A;  4QQD A;  1Q86 U;  4C5E A;  4BE0 A;  4DA4 A;  1BI2 A;  4L59 A;  3UT1 A;  4FL6 A;  4RG2 A;  4YTL A;  3JCM b;  1X01 A;  4C92 B;  3MP1 A;  4J6X A;  3OW2 S;  3DB4 A;  3C94 A;  1K9M C;  3PGG A;  3TRE A;  3CC2 T;  2AHJ B;  2JTF A;  3LW5 E;  3QDR B;  3LGL A;  1I8F A;  4RKU E;  3QSU A;  1B34 B;  1G3Y A;  2LDM A;  1Y96 B;  1NJI U;  4JLG A;  3CCL A;  5FLX E;  3FC3 A;  2XDB A;  4M7D E;  2ZPE B;  5GAN 5;  4J6Y A;  5GAN e;  1SSF A;  5CAI A;  2RHY A;  3OSS C;  2JUF A;  3OQ5 A;  3RKW A;  5DLO A;  4GY5 A;  3L1A A;  5FU7 C;  3JCM P;  5LJ3 g;  3CCJ T;  4PJO E;  3NFC A;  3MP8 A;  3V8L A;  1KHI A;  3CEY A;  4P5N A;  1QVF A;  5I2M A;  3GNF B;  5GAN f;  3CCR A;  1RL2 A;  1X75 C;  4BDZ A;  4M7D F;  4PJO D;  2CZ7 B;  4ZN3 A;  4J83 A;  1QVF S;  3QPH A;  4QVD A;  3OYH A;  4KBM B;  1M1K C;  5GAM g;  2M16 A;  3OS1 A;  3L2V A;  4HT8 A;  2BIV A;  5LL6 S;  3VU3 C;  3BY7 A;  1G3T A;  5C0M A;  3MO8 A;  1N8R U;  3CBP A;  2VUB A;  2JVV A;  2QQR A;  2V8J A;  2RH2 A;  5GAN 6;  2LT1 A;  3QKJ A;  4KUL A;  1VUB A;  1FX7 A;  3LYI A;  1VQ9 A;  3L42 A;  4IUT A;  3I55 A;  2IVW A;  3E1S A;  3VJP A;  3G4S A;  3WVE B;  2EQJ A;  3QYG B;  3VYG A;  5A0L A;  4BE2 A;  2RHI A;  4C0F A;  2QQS A;  2DXC A;  3QZ9 B;  1I4K 1;  3SWN A;  3GIB A;  5LJ3 j;  2MAM A;  3L2U A;  2LVM A;  1Y07 A;  4MZP A;  1M5Q 1;  1QW1 A;  3DLL A;  4Q5W A;  3QBY A;  3CPW A;  1VQK T;  4EDU A;  3HFO A;  2GF7 A;  2LT4 A;  1M9S A;  2DZC A;  2EFI A;  2EQK A;  3SWN B;  2DK3 A;  4XU0 A;  5CO7 A;  4C8Q F;  3PMI A;  3FRN A;  1VQM A;  4ME7 A;  4WF2 A;  2RJE A;  1YCY A;  1MGQ A;  1BIA A;  4IUP A;  3JRZ A;  1K8A C;  3HSB A;  3JCM X;  3OMC A;  3L2Z A;  3PTA A;  1Q7Y U;  4RCC A;  1KQS A;  1N9R A;  2MWP A;  4M7A D;  4JRI A;  2RI5 A;  3OYJ A;  3JB9 J;  2X4W A;  3RUX A;  2QQB A;  5DLQ E;  4C92 D;  4M75 E;  2CZ0 B;  3ZFJ A;  1VIE A;  2DZ9 A;  4C8Q G;  4F7U F;  4N4G A;  3PT9 A;  4C5I A;  2PVG B;  4M75 D;  4XK8 E;  5J39 A;  5CKH A;  3CMA T;  2I2L A;  4N4H A;  5CIU A;  2LCC A;  3RIR A;  4RMO A;  1D3B A;  4D6W A;  1M90 U;  4M7D A;  1KQ2 A;  1P92 A;  3GF5 A;  3QJY A;  1KC8 U;  1KD1 U;  4NOY A;  1IZ6 A;  4OB1 B;  4C92 C;  2RK2 A;  2E64 A;  1YHQ A;  4PJO A;  2PQW A;  3M54 A;  4A53 A;  1VQ8 A;  3M4Y A;  5GMK h;  2VXE A;  1EIF A;  4VUB A;  3LX7 A;  1VQL A;  3HP9 A;  2MF2 A;  5GAN 7;  2MI6 A;  1D3B B;  1S72 T;  3RMQ A;  2OAU A;  3M56 A;  4M7D B;  2IG0 A;  3EFR A;  4HKE A;  1WQW A;  4M78 F;  2PVO B;  1YIJ T;  2HBP A;  4XAX B;  5GAM d;  2LCL A;  5FU6 C;  2XI9 A;  1VQ7 A;  4PJO B;  3CD6 T;  2L89 A;  3E9G A;  2P4T A;  2BUD A;  1G3W A;  3VUB A;  1VQ4 T;  3FIF A;  1O75 A;  2K5I A;  4M78 G;  5GMK e;  1M4Z A;  2XD0 A;  2V8K A;  5FRN A;  1X6O A;  3A8G B;  4BI8 B;  3EFS A;  2XID A;  2O4X A;  5KCH A;  2R5A A;  1FXX A;  2QI2 A;  2HNI A;  3M53 A;  3V7C A;  2KAF A;  4M77 F;  3A8L B;  2VXF A;  2MMP A;  3OYY A;  5HY6 A;  2DD5 A;  5KE3 A;  1YJ9 A;  4C0Z A;  3CC2 A;  3GNG A;  2GQV A;  3ASK A;  1PSE A;  4II1 A;  4N4I A;  3T9N A;  1WJS A;  3JB9 G;  1ZBX A;  2O4X B;  1YIT T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...