1Y71A

X-ray crystal structure of kinase-associated protein b from bacillus cereus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
124
structure length
109
Chain Sequence
b'TFEIGEIVTGIYKTGKYIGEVTNSRPGSYVVKVLAVLKHPVQERRALAFREQTNIPEQMVKKYEGEIPDYTESLKLALETQMNSFSEDDSPFAERSLETLQQLKKDYKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kinase-associated protein B
publication title X-ray crystal structure of kinase-associated protein B from Bacillus cereus
rcsb
source organism Bacillus cereus
molecule tags Structural genomics, unknown function
total genus 29
structure length 109
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08810 KapB Kinase associated protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.430 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1y71A00
1Y71A
chains in the Genus database with same CATH superfamily
4PJOA 4F17A 4N0AC 3CCMA 4RKUE 2WACA 3DB3A 3TSZA 5GANg 1M30A 2RD1A 1QCOA 1TUCA 2F2WA 3N5BB 3L2QA 4HCBA 2LJ0A 2VV5A 1D09B 1KSWA 1VQOQ 5LJ3g 2EQIA 3T9NA 2ECZA 4QVCA 3GOXA 2YRCA 3JRZA 1YIJA 1OX8A 4DEXA 5KYWB 5C0MA 5IXFA 4LNPA 3QXEB 1OULA 4C92G 2OTLT 2EKOA 2X4YA 1MMGA 1MV0B 2DLPA 2QEXA 3OMGA 1H3ZA 1BYMA 3QZ9B 4AFQC 4E7KA 1D1BA 2AHJB 2MCNA 2K57A 2KYMA 1WPYA 4OP0A 3CPWS 1U8RA 4ZNXA 1IHWA 2DJQA 4JJCA 1S72Q 1S1NA 2EJFA 3SFMA 1JXMA 2X9HA 2JMAA 3FRNA 1HJDA 2PVGB 4OMMA 3CPWA 1BI2A 5GAN4 2DIQA 5IHKA 2OJ2A 2AKLA 5GAMf 5GAN3 3QDFA 1VQ8T 3G1JA 4BDZA 2RMOA 4AG1C 4OGCA 3MEWA 3X28B 2YT6A 1ZA1B 1LVKA 2HL5C 2ZPEB 1C6VX 4J9IA 1VQ9A 1NM7A 1VQLA 1UHCA 3ZFJA 5ECAA 1OI1A 2JS0A 2JTEA 3CMEA 1NYGA 2EYYA 4PJOE 1AOJA 5CKBA 3I35A 1OPKA 3U23A 4RG2A 3CPFA 4OMLA 1NG2A 3RBBB 1Y0MA 3EGXA 2OTLQ 4OF1A 4KGXB 1N5ZA 2J6KA 3E1SA 5KE2A 3DKMA 1KQ2A 3NTHA 3G6EA 3FEOA 4DQ2A 5A0DA 4O5VA 2JOYA 2VVKA 2Y4XA 3PVLA 1VQ5T 4BI8B 3RERA 3CXCS 3MEAA 2FHDA 1CSKA 2K2VA 5GAOq 1G5VA 1KQSS 3C0CA 3UF4A 1E6HA 2HL3A 4RMOA 3RMSA 1YHQT 3NMZC 2RQRA 3CXCA 2GGRA 2L2PA 5FU6B 3PMIA 1VQ8Q 1GBQA 2CZ1B 2HDAA 3I56T 2MOXA 1NLPC 1U5SA 1KQSA 5CQXA 4FU6A 3HFOA 3FC3A 4XTVA 1M1KR 4BI4A 3M0PA 5CKFA 4NL3A 1O9SA 1UTIA 1IRXA 1XJWB 1EIFA 2B8AA 2DJZA 1AZGB 4N0AA 1D1AA 3TSWA 2M1HA 3A1PA 2RK2A 2JW4A 5I2MA 1QVFS 2ZAEA 2DRMA 4OB2B 1WHMA 1PSFA 2ZPIB 4ZN1A 5DM7R 1YJ9A 1B3QA 1K1ZA 2YHTA 3BDUA 1JEGA 3QPHA 1TOVA 1WDXA 3HRSA 4RG8A 3V8LA 2NUTB 3J81E 2J6OA 4KGZB 4F7UA 1VQ5Q 1Q86C 1QVFA 3OQ5A 1PKSA 3H9NA 3JB9G 1BK2A 3TU4K 3RKXA 3G71T 3SD4A 2QQ9A 4EMGA 2KNBB 1W6XA 2SRCA 1SSHA 4FYVB 2O31A 1JB0E 5CCAA 2Z0WA 2EJGA 1YHQQ 3A8OB 3EG0A 3LWIA 2X4XA 3V7RA 2C0IA 3C12A 1S72A 3L2ZA 1HD3A 3SWNC 2MYSA 3C4SA 2DEQA 4IUUA 3VU3C 4M7DG 3RR6A 4E7ZA 3H0IA 4PJNA 4A4GA 1FMWA 2JNGA 3EHRA 2ROTA 2O9VA 3PIOA 2V26A 2GFAA 3JCMV 3OBWA 4ME7A 1N9RA 3ZEHA 2DIGA 4X1VA 3TCJA 3QIIA 4EDUA 2FEIA 3H6ZA 1W4SA 2FZCB 1Y71A 1WA7A 4P5NA 3I5SA 1UHFA 2OTLA 4KUDK 2HEQA 3CCMT 5FW9A 2CZ7B 1HSQA 2KK4A 2RHIA 1C1AA 2XKOC 4LUDA 1M3BA 4NS5A 4CI0C 1Q81C 2XDBA 2DL4A 2DVJA 4E2FB 2LNVA 2RPNA 3QKJA 2HQXA 1MMNA 1K8AC 1I81A 2HMAA 3ME9A 1K73R 1X6GA 5KH6A 5LJ5d 1YI2T 1U3OA 3CC4A 4F7UE 1PG5B 2PQWA 2BUDA 3RKWA 3VS7A 5AYFA 4XU0A 2BTTA 2OI3A 1M1KU 4CC7A 3X24B 4BD3A 2DXBA 1WGSA 2PVOB 3LH0A 4Z02A 1RLQC 1X01A 2GTJA 2J7IA 3VV0A 2DM1A 4RTXA 2D9TA 3EFOB 1K8AR 2ABLA 2L5QA 2QQSA 4DBFA 1YN8A 5LJ5j 2P4TA 2HAXA 3OA6A 3VRZA 1UFFA 3JCMd 2QASA 5GAN7 3L2VA 2E3HA 1IGQA 2EGAA 5GANe 2E4HA 3F70A 4JS4A 1WFWA 1PRLC 1I4K1 3LW5E 2JXBA 1BI1A 2LVMA 2DZCA 4PJOC 1TS9A 1GCQC 1KC8R 1X27A 4K11A 4E47A 1D3BB 4J9GA 4OB0B 1H641 2E10A 2MWOA 1FMKA 4X9DA 2EFIA 1R77A 1SSFA 2ATCB 1MNEA 4QT7A 3CCMQ 3OBYA 4OMPA 5EG2A 2A3LA 5GMKe 5GAOp 1PD0A 2EQMA 3L1AA 4Z8AA 2BZYA 1UJ0A 2F2XA 4HXJA 3EG1A 4KULA 3RUXA 2HD0A 2E64A 3CMET 2QQRA 1IREB 3FB9A 4ZGEB 4B6MA 4LDUA 2K6DA 2A28A 3ER0A 2RJEA 4HT8A 4C5IA 3CBPA 1GL5A 1E6GA 3EFSA 3CC2T 1XNIA 4RCCA 5LJ5h 3LLRA 1QVGP 1PKTA 2QEXQ 2WSCE 2D8JA 2CUBA 2CP0A 1FWZA 3TQ7P 5J39A 5CO7A 3E2UA 4CC4B 5M9OA 3L2UA 3OW2P 2KGTA 4JJNK 1SKUB 4C8QF 3TVTA 1WI7A 3I56A 2F69A 2ENMA 2L3PA 1ABQA 1PC0A 4YTLA 2A37A 3QBYA 2RQTA 2GF7A 2OAUA 1M9SA 1UECA 2DAQA 3JCMh 4FT4A 3SWNB 4UC4A 1K9MR 4PJOD 4OVAA 2KRNA 3NTKA 3D7SB 3VS6A 2RHUA 1K9AA 1I07A 2YDLA 1C0MA 2DKGA 4IUTA 2G3RA 4BY6C 2L3RA 2FRYA 2DO3A 1TUGB 2FB7A 1K73U 1VQ9Q 1VQLQ 2GQVA 1ZUUA 2M9UA 3CMEQ 1D0XA 2JTFA 1VQ4T 1WHJA 3LX7A 3OS1A 5LJ3d 1I5LA 2HZYA 2QDYB 4A4EA 4DOWA 3G71A 1U1SA 2FYKA 5CVIA 2BZXA 2ED1A 4FM4B 3THKA 3CC2Q 2W10A 1Y96B 1I1JA 1Z9QA 1K8AU 3CCEA 1QKWA 2D6FA 5CKHA 2JMCA 2DBKA 1OX9A 2I2LA 2B86A 1GBRA 3OY9A 3ASKA 1Y57A 4C8QA 1UUEA 4J9CA 1X43A 4J9BA 1MUZA 5LJ3j 3EH2A 3DLLA 2QXFA 2AT1B 1SRMA 1YWPA 3JCMW 4OGEA 3MP8A 3UPUA 4C5HA 4BI3A 1KC8U 2RI2A 4GLKA 5GJWB 2EAYA 5L8RE 2FPFA 2JS2A 5KYXB 1VQMA 2ZPGB 4N4IA 4J83A 3REAB 1RL2A 1G3WA 3L2RA 1GRIA 3A8LB 2OTJT 1M2OA 2V8JA 5GAN6 1YP5A 3A98A 4FYYB 1M27C 1TXQA 4FSXA 4QQDA 2O01E 1M8MA 2YUQA 1WHHA 2WSEE 3LGLA 2XK0A 2JT4A 1WJSA 3M0RA 3CCVT 2F5KA 5LJ5f 1VQ7T 1G8XA 5FWBA 1UEBA 1GCQA 1OOTA 4C92E 2JZ2A 2E5KA 2YUPA 5HK0A 1P92A 3QO3A 1VQ4Q 4PJOB 4MZPA 5L23A 5GAOr 3NTIA 3A5ZB 4OMFB 2K3XA 3HPWA 2IVWA 2DPPB 3JB9F 5LJ3h 4JJBA 5A2QE 1GXIE 3R6NA 1YJ9Q 1YI2A 3JCMf 1T3SA 1HYOA 5FROA 1KD1C 2KROA 2F1LA 2CSQA 2GTOA 3CQTA 2VUBA 1RI9A 4FCYA 3OYYA 4A54A 1OYXA 4JZ4A 2EQJA 1RI0A 2E65A 3LWHA 2H3EB 2X3XD 4GLMA 4JS5A 1K9MU 1V1CA 3CC7T 3SDZA 2DERA 4M7DF 1E7OA 3QSUA 5HCKA 4C8QE 4N4HA 4M78C 1KD1R 4DBRA 2E41A 3JB9J 2LZ6B 3JCMb 2OTJQ 1PWTA 3CC4T 3GLXA 2CREA 2NUPA 1MV3A 3INZA 4M75F 3SB2A 3I9QA 5IH2A 1UE9A 2K5LA 3OYEA 1X69A 2NYSA 2DL5A 2HQHA 1N6AA 1KHIA 2RA2A 1OEBA 3VUBA 3HKSA 3MCAB 4PFPA 2X4WA 2VXFA 4JPBW 1VQ7Q 3MPUB 1X6BA 2DILA 1AHJB 4XTZA 1JO8A 2DF6A 2K2MA 3A8GB 3MJXA 4LD9K 2Y90A 1U06A 2CZ6B 4BY6B 2ROLA 5GAOn 1YFNA 1WNLA 1WQ7A 3NHNA 2CZ0B 4L59A 3WVDB 3M53A 8AT1B 1F1BB 3CC2A 2L89A 1LPLA 3BW1A 4C0DC 1NPRA 2O88A 1PSEA 4FIBA 3EGXB 5CR2A 2IIMA 1KIKA 4PJMA 5DY9A 2DXUA 2KSSA 4C5EA 4M7DA 5J26A 1VOMA 2LT4A 1BI3A 2PNIA 2L3QA 2H8HA 4LDWA 1QWFA 1VUBA 5FRNA 2VGMA 4ZGDB 3G4SA 4M75A 2FG0A 2LX9A 4F7UF 3CC4Q 1UJYA 4D6WA 4M77F 2P4RA 3ULRB 1QCFA 4KRTA 3S3MA 1M1KC 5IHIA 2BIVA 2HSEB 2JTMA 4PJOG 3OYMA 2M51A 2A0FB 2RI3A 1QCNA 1QVGS 1ZX6A 2KAFA 3QG1A 1D0YA 1M4ZA 5LJ3f 4QQGA 2LRQA 3VKIA 2EYQA 3GNGA 2EQKA 4LN2A 3OW2S 5I11A 3I5RA 4M78F 1H3HA 3HP9A 4R56A 1QVGA 1WXBA 4JLGA 3VUZA 1AD5A 7AT1B 2EGCA 3H0HA 5HY6A 2XU8A 4QW2A 1X2KA 3RMQA 2PU9B 1KJWA 5C6SA 3OW2A 2DX1A 1RAAB 1VQ4A 2LTOA 2DBMA 2ZCFB 1Q82R 2R58A 5KCOA 4PJJA 3PE0A 3PVQA 3X26B 3QWXX 5CQYA 2LMJA 4J6YA 3V7SA 2LJ1A 1ZUYA 4DBQA 1KD1U 4E7SA 5EC7A 2G6FX 3M4GA 2YWWA 3BFMA 2DXTA 2KY9A 1R8OB 4LDYA 2E5QA 4M77A 1V76A 4A4KA 4PFOA 4XK8E 1YJNA 4LD6A 4NOYA 3M0TA 2XI9A 2DL7A 5I22A 2QTVA 4M7DE 3MEUA 4MMLA 1X75C 4MMKA 2QA4T 3CCET 1WXTA 2OTJA 3GIBA 5FWCA 4C0ZA 5D6XA 4PNOA 3H8ZA 4M75E 5KYYA 5KYNA 5GMKm 4M78A 2RHZA 2EWNA 1OZ2A 3I56Q 1ACMB 1KFZA 1FMVA 3CCVA 3CD6T 2O4XA 1NE8A 1WQWA 1VIEA 4II1A 2KEAA 5D6WA 1M5Q1 1VQ7A 3EGUA 3O5ZA 3RIRA 3EGDA 4KUIA 2D0QB 2JUFA 2RHXA 4ZTFA 1RAHB 1X2QA 4OMNA 1MMDA 4HCKA 1VQMT 4C92C 1MMAA 1WHLA 2XICA 2MIOA 3GBQA 1YITT 1M2VA 2CP2A 4QKUA 2EYWA 3UA7A 2FVUA 1SPKA 4RTUA 1AT1B 1H92A 5GAN5 3J7AF 2CS7A 1VYVA 1K73C 4PLLA 1D1CA 1X6OA 3EAEA 1WX6A 1NJIR 1NEBA 2MAMA 2Y4YA 1HXDA 4A53A 3V8KA 3CCLA 2P0PA 4BACA 1VQKT 2KT1A 4C0GA 4XTUA 3CC7A 4FYWB 5CKDA 3G71Q 5CKEA 5GAMe 2BZ8A 4C8QC 4C0DB 2QA4Q 3CCEQ 2FRWA 2COZA 1LJOA 4RTWA 3VS5A 4M77E 2R5AA 4EIKA 4IIOA 3CCQT 2ZZDA 3NGPA 4M7AF 1N8RC 2O2OA 1ZSGA 2AZVA 2R5MA 1NPPA 4C0FA 3VS3A 4E6RA 3CD6Q 1ZHIA 4ELYC 2KT8A 1B34A 1KC8C 1R0BG 2J05A 1Q82U 4FL6A 2V8KA 3JB9I 3VS2A 1VQMQ 3C94A 1O75A 2J06A 4M78E 4EMKA 4C92D 3JCMX 4JUVA 2FPDA 5IXBA 4PFZA 3OYCA 2OAWA 1N8RR 5CAIA 2FL7A 2CYZB 3EG9A 2VASA 4DOVA 2EQUA 4PK4A 2DRKA 1BIAA 2J6FA 4EPCA 1IO6A 2P0QA 2LCLA 4IIMA 4HA8A 4A4HA 5IN1A 2QQBA 4JRKA 2JM9A 1NBEB 4C92F 3CCST 4Y92A 5GAN8 3R6OA 2HBPA 5LL6S 5KCHA 3EFRA 4BUGA 4C8QD 1QWEA 3RNJA 1VQNT 2RH2A 1YI2Q 4M7AA 2VXEA 5KYUA 2KE9A 2X4JA 4OB1B 1BKBA 2FPEA 1K9MC 4RCBA 2AK5A 5GMKi 1ZUKA 4ANJA 2ZPHB 2HKQB 4E7LA 4B9XA 4ZTJA 3GF5A 4HCCA 3VS1A 3G4ST 3JCMP 5D6YA 2VC8A 4VUBA 3P8DA 3JCMc 4J9HA 1VYUA 1KQ1A 1NJIU 1UB4A 9ATCB 1ZSZA 3OB9A 5GAN2 1IZ6A 3M0SA 4C5GA 2CDTA 2W0ZA 1CKAA 2MI6A 4C92A 2KRSA 2LQWA 1U1TA 1LCKA 4L6V5 3VRYA 1AZEA 3OYBA 2I0NA 3CCSQ 1AWJA 3WXMB 2GNCA 3OYDA 4X34A 2K7AA 3CCJT 1QW1A 1UGVA 2KVQG 3EG2A 4RTVA 5GANd 2A7YA 1TWBA 5IT9E 3CMAT 4LDVA 4XU2A 3C95A 1Q7YR 3AT1B 3VS0A 3PNWC 1M90C 1CKBA 1VQNQ 2E6NA 1TH7A 4FYXB 1YWOA 5CK9A 2CKKA 1QKXA 4M7DC 3ZL7C 1T3LA 5FU7C 2QA4A 5GAOm 2DL8A 1XTDA 4LXCA 2KRMA 5GANj 4JDSA 1WJRA 4AFZC 4XTYA 1TSFA 1NEGA 1TG0A 1ZLMA 1WHGA 1FX7A 1PM3A 2CH4W 4D8DA 4M75C 4M7AE 1BIBA 3KFVA 3BY7A 1N8RU 1QMCA 2GCXA 1VQOT 1M90R 3NFCA 1RACB 2V1QA 4C8QB 5GAMg 3CD6A 3P8HA 2CGHA 3G4SQ 1YJNT 2VKNA 5GMKj 2VB6A 2KMTA 2CP3A 4KT0E 2CP5A 4IUPA 1M3CA 2AIRB 1FYNA 3JAME 1IXDA 2RNAA 2QTXA 2E3IA 5KE3A 2K79A 1YITA 2KR3A 2C06A 3JB9D 1UDLA 2COWA 1GFCA 3L42A 1TUDA 2K5FA 5HKCA 2VYTA 3O8VA 3MEVA 5DLOA 1UGPB 1QP2A 3S6WA 3QZ5B 2QG9B 3CCJQ 4HT9A 1FXXA 3PFSA 1WZOA 3S3OA 4LUEA 3CMAQ 2EKHA 2M02A 1RAIB 3BE3A 2DTIA 1OU8A 5D7UA 1T0HA 1UGSB 3PTAA 2DL3A 4KBMB 5HK3A 5GANh 1VQKA 2V8IA 2CT4A 3QYHB 3VS4A 2WSFE 2YSQA 3HTRA 4M7DD 1H8KA 2GQIA 4PL6A 2EYXA 1K0XA 2CP6A 5FLXE 2RF0A 2RB6A 1BBZA 4ORZA 1ARKA 1D0ZA 4M4ZA 4M77C 1AWXA 5GMKh 4FW1A 1BU1A 2KI7A 2LQ8A 3CCQA 4NL2A 1VQ6A 3UT1A 1TTHB 4M75D 1WJQA 5KYWA 2YLBA 2DFUA 1PD1A 3CCLT 3OYNA 2K4YA 2DEUA 1AWWA 1YJNQ 4DEYA 4HVVA 2XDDA 2LP5A 2JM8A 1K76A 1AEYA 4BB7A 2ESWA 4BDYA 4E7IA 2PVDB 4V2SA 1UGQB 3CCRT 1GCPA 2JVVA 3M0QA 2P84A 4RTTA 3J80E 3QHSA 2NUPB 3FJ5A 2DTOA 4GBQA 3CCVQ 2HBWA 1Q7YU 1N27A 2X3WD 3OYIA 3AHUA 4XQ3A 3H0FA 2DD4A 4BE2A 1EZZB 2YUOA 2RI5A 2QDLA 2RK1A 3CCSA 3OYFA 4ZGJB 1ZQ1A 2R57A 1EFNA 3GNFB 3UDCA 2DVEA 4C8QG 1JRIA 4MZMA 4RUGA 3KXTA 2JN0A 2K3BA 4J6XA 1OQKA 2OX7A 1VQNA 1M90U 1K4US 2PUKB 1W1FA 4E7HA 4M77D 3MHXA 1SHFA 4GY5A 1WXUA 3SHWA 1ZA2B 2KXDA 2YXYA 3CCLQ 1HK9A 4J7FA 3I55T 2DA9A 1QLYA 4XTXA 3CC7Q 2KBTA 4M7DB 2XHCA 3URGA 5FU7B 2QQAA 2LNHB 1Q95G 4KH0B 4M78D 2GBQA 3X25B 4B9WA 3WVEB 2DE0X 3M4YA 1I5OB 1PNJA 3CCRQ 2M16A 2YLCA 1BCMA 2C0TA 5GANf 2RQUA 4M75B 3QDRB 2A36A 3M58A 4IUVA 8ATCB 4AFUC 4MZTA 5I2SA 4DBHA 4EMKC 2KXCA 3JCMJ 1Q82C 4F16A 2DTHA 4ELZC 4J6WA 1LNXA 5GJVB 5J3BA 4BE1A 3OS2A 3OYHA 4FT2A 1PCXA 1AVZC 2LT1A 2QYZA 3CCJA 2DK3A 1JJ2P 2KDSA 4PKCC 2ZGWA 4HKEA 3CMAA 1W70A 3CCUT 1JBMA 1RADB 2CH4A 4HCZA 3OYGA 3X20B 1LOJA 3ZBDA 3GP8A 2LC4A 1RAEB 3Q1JA 3FIFA 4FSSA 1SRLA 1M1GA 3PIPA 3MO8A 4J9DA 3EHQA 3FJPA 2O9SA 4D8KA 3I55Q 4WTOB 1MGQA 4XU1A 5IAYA 4Z89A 2PTKA 1B7TA 3M9QA 1VQOA 4M7AC 1UG1A 2HNIA 3H41A 1VQPT 5IHNA 1KK7A 1WYXA 4ZN3A 2NLUA 2RJFA 4RTZA 4J5YA 2QGGA 4F7UB 2LCSA 2NUTA 2CUDA 5LJ5e 2EBPA 2FZGB 4M77B 4IKFA 2DZ9A 4L5GA 4F04B 2E1HA 4IUQA 4HVWA 3OYLA 1K0SA 3CBMA 2M0YA 1WHKA 3P8BB 1M8VA 1OPLA 1JXOA 1NLOC 4AFSC 4CC3A 1QP3A 1XQHA 4TVRA 3S3NA 2VGNA 3META 3L2WA 1WIEA 1G83A 5KYYB 4M78B 3M54A 2XD0A 1ZSZC 1TU0B 4J7IA 3JCMe 2D1XA 4KH1B 1RAGB 4WCIA 4OMQA 1W2BP 1ZBJA 2C0OA 2HQEA 5GMKl 2ED0A 2O4XB 2D0NA 3OS0A 3CCUQ 1NJIC 2A08A 1Q86R 3REBB 3EGDB 4JRQA 3UA6A 2COYA 2V1RA 2MK5A 2RM4A 2PUOB 3LGFA 2K9GA 4J9FA 1M2VB 3MP1A 1BB9A 1RABB 1IB8A 4AMCA 2BE9B 2E12A 3M5AA 4M75G 2L8DA 4PJLA 4R0KA 4M7AD 4Z88A 1VQPQ 4JJDA 1YJWT 3LYIA 5FRMA 2RHYA 1Y07A 4XAXB 2VWFA 1J3TA 4PLIA 2SEMA 4XU3A 1PHTA 2MPXC 3VJPA 3M57A 1G3SA 2FO0A 5AT1B 2FZKB 2EGEA 1SG5A 2D8HA 4OMOA 3QJ6A 2KYBA 4J8OA 3M0UA 1QQJA 2EYZA 3PGGA 3TEEA 4N4GA 3CCRA 4FW2A 1G3YA 1VQ6T 1KG1A 2XDPA 1G3TA 1M1FA 4CC2A 5CIUA 3CPWP 2K5IA 1YIJT 1DJ7B 1I8FA 4A4FA 4QVZA 4JRIA 1QVPA 2NUZA 5A0GA 4MDXA 6AT1B 3TREA 4E7JA 1B34B 3FLGA 3E19A 1NZ9A 4Q5WA 3HRUA 2QEXT 4WF2A 3EFOA 3M56A 1YITQ 1Q81R 4IURA 2P0KA 2RN8A 2HCKA 4EMKB 2XG8D 2M0OA 2LJ3A 1I0CA 2JJ9A 4R55A 1ZBXA 1VQ8A 4BE0A 1SEMA 4J9EA 2MF2A 3EG9B 4F7UG 4A63B 4M77G 4LE9A 2DD5A 4Y28E 2L0AA 3QWYA 2AZSA 1MNDA 2HSPA 3KUFA 1YJWQ 4LDXA 1GFDA 1D3BA 4AT1B 2DXCA 3I55A 1VQKQ 1Y7XA 3OS5A 1R0CB 1VA7A 5LJ3e 2DETA 2MMPA 4M78G 4QVDA 2DYIA 1EX4A 1G2BA 2E70A 2RJDA 1NYFA 2YRDA 2RQVA 4XTWA 2PZ1A 2AKKA 3UATA 3KBGA 3M59A 1JU5C 4X9CA 3EH1A 3CCQQ 1VQ6Q 1YCSB 1VQ9T 1VQLT 2EW3A 4M7AB 2QAZA 1AWOA 1IHVA 3HHTB 3QYGB 1VQ5A 1Z9ZA 2RJCA 5KYUB 1YIJQ 1YNZA 3CXCP 1Q86U 4CRIA 4KGVB 3CBOA 5GAMd 3E9FA 2IPOB 3HL8A 3BDLA 1OV3A 1V29B 2RO0A 3IQLA 2LQKA 5LJ5g 1A0NB 1KQSP 2H3JA 2ZPFB 4JRPA 3UWNA 3G6ET 2K3YA 1YHQA 1XOVA 4DA4A 2CSIA 2YUNA 3DB4A 3PMTA 1UGRB 3OSSC 1BCOA 3CCUA 2KQWA 1SF9A 2F5TX 3DLMA 5I21A 1YBYA 1RLPC 2ZPBB 3OSVA 1Q7YC 1PRMC 5GAMj 4AG2C 3JB9H 3JSCA 2EIFA 3OMCA 3G7ZA 1ZSZB 3SWNA 1KHCA 2IG0A 3JCMg 2DNUA 1B07A 2HKNA 5DLQE 4C92B 4JZ3A 3JV3A 4QQ6A 1OU9A 1JJ2S 1OZ3A 3VYHB 4O6JA 2QI2A 3HRTA 1VQPA 4JLIA 1YCYA 3OYKA 1QVFP 3M55A 2X51A 3A8MB 1VIFA 3LH5A 2L3SA 4F14A 2LDMA 3V7CA 3RESA 2BKDN 1JJ2A 3CEYA 3SEMA 3NPFA 2QGFB 2DMOA 1M3AA 4EMHA 2CT3A 4PJOF 2CP7A 2RQWA 2EJ9A 1Y96A 2YRVA 2F2VA 1Q81U 1T0JA 2LQNA 3FDRA 3V8JA 3GPLA 2X35A 5GAOl 2NWMA 3QJYA 5GAMh 1VYTA 2BE7D 4ESRA 3G6EQ 1JQQA 1YJ9T 1SHGA 4ATOA 1WLPB 1RUWA 4RTYA 2EPDA 1MHNA 3MKDA 3PT9A 3QUIA 3HSBA 2XIDA 2LCCA 4Y91A 2QK0A 5KYXA 5FU6C 3A8HB 3RDVA 3OYAA 3HFNA 3EG3A 1IGUA 2LX7A 4MDWA 1RAFB 2MWPA 1ABOA 4M7AG 4OB3B 2E6ZA 1W2BS 3RKYA 2XMFA 5A0LA 1N9SA 3VYGA 1S72T 1YJWA 2EVRA 2DYBA 2GFUA 1BI0A 4HVUA 3MP6A 3E9GA 3OYJA 3JCMQ 1W2BA
chains in the Genus database with same CATH topology
4PJOA 5GAN5 4IUVA 3L2UA 4N0AC 3J7AF 2CS7A 4MZTA 4RKUE 5I2SA 3CCMA 4PLLA 1K73C 4JJNK 2WACA 4EMKC 1X6OA 3DB3A 3EAEA 4C8QF 3JCMJ 5GANg 1Q82C 3I56A 2RD1A 2F69A 2DTHA 2MAMA 2Y4YA 1LNXA 4J6WA 4ELZC 1HXDA 5J3BA 4A53A 4BE1A 3N5BB 3V8KA 3OS2A 3CCLA 3L2QA 2P0PA 4YTLA 3OYHA 4BACA 4FT2A 4HCBA 2VV5A 1VQKT 3QBYA 5LJ3g 4C0GA 3T9NA 4XTUA 2LT1A 4QVCA 3CC7A 5CKDA 2GF7A 2OAUA 1M9SA 3GOXA 3CCJA 1YIJA 3JRZA 2DK3A 2DAQA 5CKEA 3JCMh 2KDSA 4FT4A 3SWNB 4UC4A 5GAMe 5C0MA 4C8QC 4PKCC 4PJOD 2ZGWA 4HKEA 4OVAA 3CMAA 4C0DB 1YJ9T 3NTKA 3CCUT 3QXEB 4C92G 1JBMA 2RHUA 2OTLT 4HCZA 1LJOA 2EKOA 2X4YA 2R5AA 4M77E 3OYGA 2DKGA 4IUTA 3X20B 1LOJA 2ZZDA 3OMGA 2QEXA 3CCQT 3ZBDA 2G3RA 3GP8A 2LC4A 4M7AF 1H3ZA 4BY6C 1BYMA 3Q1JA 3FIFA 3QZ9B 1N8RC 2L3RA 1M1GA 3PIPA 2R5MA 3MO8A 1NPPA 2DO3A 4C0FA 4E7KA 2AHJB 2FB7A 1ZHIA 1K73U 3FJPA 4ELYC 1B34A 1KC8C 2GQVA 1Q82U 2K57A 4FL6A 1WPYA 4OP0A 3CPWS 1U8RA 1MGQA 4XU1A 2V8KA 2M9UA 2JTFA 5IAYA 3JB9I 1VQ4T 3LX7A 3C94A 1O75A 3M9QA 4M78E 2HNIA 5LJ3d 4C92D 4EMKA 3OS1A 1VQOA 3JCMX 1VQPT 4JUVA 1I5LA 2QDYB 4A4EA 4ZN3A 2NLUA 3OYCA 2RJFA 4DOWA 2EJFA 3SFMA 3G71A 1U1SA 2FYKA 5CVIA 4FM4B 4J5YA 5CAIA 2FL7A 2CYZB 4DOVA 1Y96B 3FRNA 4F7UB 2PVGB 5LJ5e 4M77B 2EQUA 1K8AU 2DZ9A 1BI2A 4L5GA 2E1HA 4IUQA 3CPWA 5GAN4 3CCEA 1BIAA 2D6FA 5CKHA 2DIQA 2I2LA 4EPCA 2P0QA 5GAMf 3OY9A 3ASKA 5GAN3 3OYLA 2LCLA 3CBMA 1VQ8T 4C8QA 3P8BB 4M7AC 1M8VA 4HA8A 4A4HA 4BDZA 4OGCA 3MEWA 5IN1A 3X28B 5LJ3j 2QQBA 4JRKA 3DLLA 2QXFA 2ZPEB 1QP3A 1XQHA 4TVRA 4C92F 3S3NA 3CCST 2VGNA 3META 3JCMW 4OGEA 3L2WA 3MP8A 3UPUA 1VQ9A 4C5HA 4BI3A 1VQLA 5GAN8 2RI2A 4GLKA 1KC8U 3ZFJA 2EAYA 4M78B 3R6OA 5L8RE 1OI1A 3M54A 2XD0A 3CMEA 2HBPA 5LL6S 5KCHA 4PJOE 5CKBA 4J7IA 3JCMe 1VQMA 4RG2A 2ZPGB 3EFRA 3CPFA 4J83A 4N4IA 1RL2A 1G3WA 4BUGA 3L2RA 2HQEA 3A8LB 4C8QD 5GMKl 2O4XB 2OTJT 3OS0A 4OF1A 1NJIC 1VQNT 2V8JA 2RH2A 5GAN6 4JRQA 3E1SA 4M7AA 4FSXA 5KE2A 3DKMA 4QQDA 2O01E 1KQ2A 3NTHA 3G6EA 2VXEA 2RM4A 3FEOA 2PUOB 2WSEE 4DQ2A 3LGFA 5A0DA 3LGLA 2X4JA 4OB1B 2XK0A 3CCVT 1WJSA 4O5VA 1BKBA 2F5KA 5LJ5f 3MP1A 2JOYA 2Y4XA 4RCBA 1K9MC 1VQ7T 1UEBA 2E12A 3M5AA 4M75G 5GMKi 1VQ5T 4C92E 2L8DA 4BI8B 3RERA 3CXCS 2JZ2A 2ZPHB 3MEAA 2FHDA 5HK0A 1P92A 3QO3A 4PJOB 4MZPA 4E7LA 4B9XA 4M7AD 5GAOr 4ZTJA 3NTIA 3GF5A 3A5ZB 4OMFB 1YJWT 2K3XA 4HCCA 3G4ST 3LYIA 5FRMA 2K2VA 1Y07A 2RHYA 5GAOq 3JCMP 1G5VA 3HPWA 5D6YA 2IVWA 1KQSS 2DPPB 3JB9F 2VC8A 4VUBA 4XAXB 5LJ3h 4RMOA 3P8DA 3RMSA 4PLIA 1YHQT 4XU3A 3JCMc 5A2QE 1GXIE 1KQ1A 1NJIU 1UB4A 3CXCA 1YI2A 3JCMf 3OB9A 3M57A 3VJPA 5GAN2 5FROA 1IZ6A 1KD1C 1G3SA 4C5GA 5FU6B 3PMIA 2CZ1B 2VUBA 3QJ6A 2MI6A 4J8OA 3OYYA 4C92A 4A54A 3I56T 3PGGA 3TEEA 3CCRA 4N4GA 1OYXA 1U1TA 1KQSA 5CQXA 4L6V5 1G3YA 4FU6A 2EQJA 3HFOA 1VQ6T 3FC3A 1RI0A 2E65A 2XDPA 3OYBA 1KG1A 1G3TA 3LWHA 4XTVA 4BI4A 5CKFA 4JS5A 3WXMB 4NL3A 1K9MU 1M1FA 3OYDA 3CC7T 4X34A 5CIUA 3SDZA 4M7DF 3CCJT 2K5IA 1YIJT 1QW1A 1DJ7B 1I8FA 2KVQG 4A4FA 3QSUA 5GANd 1O9SA 4C8QE 4QVZA 4JRIA 1QVPA 2A7YA 5A0GA 5IT9E 3CMAT 4N4HA 4MDXA 4LDVA 4M78C 4XU2A 3C95A 1EIFA 2B8AA 2DJZA 3TREA 4E7JA 2E41A 4N0AA 3JB9J 3JCMb 1B34B 3FLGA 3CC4T 3PNWC 2M1HA 1M90C 3GLXA 2E6NA 2RK2A 3E19A 3INZA 1TH7A 4M75F 1NZ9A 4Q5WA 3HRUA 2CKKA 5I2MA 5CK9A 3SB2A 4WF2A 2QEXT 1QVFS 2K5LA 3M56A 4M7DC 4IURA 4OB2B 2P0KA 3OYEA 1YJ9A 1PSFA 2ZPIB 5FU7C 2XG8D 4EMKB 4ZN1A 5DM7R 2M0OA 2YHTA 3BDUA 2QA4A 1N6AA 3QPHA 1ZBXA 5GAOm 4R55A 1VQ8A 2RA2A 1KHIA 4BE0A 1XTDA 3HSBA 3HRSA 3VUBA 3HKSA 4JDSA 3MCAB 1WJRA 2MF2A 4RG8A 5GANj 4F7UG 2X4WA 2VXFA 4XTYA 3V8LA 4M77G 1FX7A 3J81E 4M75C 4F7UA 2DD5A 4Y28E 1Q86C 1QVFA 3OQ5A 4M7AE 1AHJB 1BIBA 1N8RU 3BY7A 3JB9G 2GCXA 1VQOT 3TU4K 3NFCA 4C8QB 3RKXA 3KUFA 4XTZA 5GAMg 3CD6A 3P8HA 3G71T 4LDXA 2CGHA 3SD4A 1YJNT 1D3BA 2QQ9A 4EMGA 2DXCA 3I55A 5GMKj 1Y7XA 3OS5A 3A8GB 2KMTA 4LD9K 1JB0E 2Y90A 5CCAA 4KT0E 5LJ3e 2EJGA 2CZ6B 4IUPA 2MMPA 3A8OB 4BY6B 4M78G 4QVDA 3JAME 5GAOn 3LWIA 2X4XA 3V7RA 1WNLA 2QTXA 2E70A 1WQ7A 2RJDA 3C12A 1S72A 5KE3A 2CZ0B 4L59A 3L2ZA 3WVDB 3M53A 4XTWA 1YITA 3SWNC 3C4SA 4M7DB 3CC2A 2L89A 2DEQA 3BW1A 4IUUA 3KBGA 3M59A 4C0DC 1NPRA 2C06A 4X9CA 3VU3C 1PSEA 4M7DG 4FIBA 5CR2A 3JB9D 5DY9A 2DXUA 3L42A 4A4GA 1VQ9T 2K5FA 2KSSA 4C5EA 5HKCA 4M7DA 5J26A 2VYTA 1VQLT 3O8VA 3MEVA 2JNGA 4M7AB 5DLOA 3PIOA 1UGPB 2LT4A 1QP2A 2GFAA 3JCMV 3S6WA 1BI3A 3HHTB 3QZ5B 3QYGB 1VQ5A 2RJCA 4HT9A 1FXXA 4LDWA 3OBWA 3PFSA 1Q86U 1VUBA 4ME7A 3S3OA 5FRNA 4CRIA 3CBOA 5GAMd 3E9FA 1N9RA 3BDLA 3HL8A 2DIGA 3TCJA 3ZEHA 2VGMA 1V29B 2DTIA 4ZGDB 3QIIA 2RO0A 3G4SA 4M75A 2LQKA 5LJ5g 1UGSB 2LX9A 4F7UF 5HK3A 4KBMB 2H3JA 4D6WA 4M77F 5GANh 3PTAA 1VQKA 2ZPFB 2V8IA 4EDUA 3H6ZA 1W4SA 3QYHB 3UWNA 3G6ET 4JRPA 3S3MA 1M1KC 2BIVA 2JTMA 2K3YA 4PJOG 1YHQA 1XOVA 2WSFE 3OYMA 4M7DD 1Y71A 2RI3A 4DA4A 1QVGS 3DB4A 2KAFA 3PMTA 3QG1A 4P5NA 1UGRB 3OSSC 4PL6A 3CCUA 2OTLA 2KQWA 1M4ZA 5LJ3f 5FLXE 4QQGA 2F5TX 2LRQA 3DLMA 2RB6A 2EYQA 3VKIA 5I21A 4KUDK 1YBYA 2ZPBB 3OSVA 1Q7YC 3GNGA 3CCMT 4M77C 2EQKA 5GMKh 5GAMj 2CZ7B 3OW2S 3JB9H 3JSCA 2LQ8A 3CCQA 4NL2A 1VQ6A 2KK4A 2RHIA 2XKOC 3UT1A 4M75D 4NS5A 2EIFA 3OMCA 3G7ZA 4M78F 4CI0C 3HP9A 1KHCA 1WJQA 3SWNA 4R56A 2YLBA 2IG0A 1QVGA 3JCMg 1Q81C 3CCLT 3OYNA 2XDBA 2K4YA 4IKFA 5DLQE 4C92B 4JLGA 2LNVA 3VUZA 5HY6A 3QKJA 2XDDA 2HQXA 2XU8A 4QW2A 4QQ6A 1I81A 1K8AC 1JJ2S 3RMQA 2PU9B 3ME9A 1OZ3A 5C6SA 3OW2A 3VYHB 5KH6A 5LJ5d 4BB7A 1VQ4A 1YI2T 4O6JA 2LTOA 3CC4A 2QI2A 3HRTA 2ZCFB 4F7UE 4BDYA 2PVDB 2PQWA 2BUDA 2R58A 4JLIA 5KCOA 3RKWA 4E7IA 1VQPA 1YCYA 3OYKA 3M55A 4XU0A 5AYFA 4V2SA 1M1KU 1UGQB 3X26B 3X24B 3CCRT 3A8MB 1VIFA 5CQYA 4BD3A 2LDMA 2DXBA 1WGSA 4J6YA 2PVOB 3V7CA 2JVVA 3LH0A 3RESA 2BKDN 4Z02A 3V7SA 3J80E 1JJ2A 1X01A 3QHSA 3CEYA 3VV0A 2DTOA 1KD1U 2D9TA 1Q7YU 4EMHA 1N27A 2L5QA 3M4GA 3OYIA 3AHUA 4PJOF 2QQSA 5LJ5j 4XQ3A 3BFMA 2DXTA 2DD4A 2KY9A 2P4TA 4BE2A 2HAXA 2EJ9A 2RI5A 3OA6A 1Y96A 2YRVA 3JCMd 1R8OB 4LDYA 2E5QA 4M77A 5GAN7 3CCSA 2RK1A 1Q81U 4A4KA 3L2VA 3FDRA 3OYFA 4XK8E 1YJNA 4LD6A 4NOYA 3V8JA 3GPLA 2XI9A 4ZGJB 1ZQ1A 2R57A 2X35A 5GANe 3F70A 5GAOl 4JS4A 4M7DE 3MEUA 3QJYA 5GAMh 1I4K1 3LW5E 3GNFB 1X75C 4MMLA 1BI1A 2DVEA 2LVMA 2DZCA 4MMKA 3UDCA 1JRIA 4C8QG 4ATOA 4PJOC 4MZMA 3KXTA 2QA4T 2JN0A 3CCET 4J6XA 1MHNA 4E47A 1D3BB 2OTJA 4OB0B 1H641 2E10A 2MWOA 3GIBA 4X9DA 2EFIA 1VQNA 1M90U 3PT9A 1SSFA 4C0ZA 2PUKB 4PNOA 3H8ZA 4M75E 5D6XA 3QUIA 5GMKm 4E7HA 3OBYA 4M78A 5EG2A 2XIDA 4M77D 2A3LA 5GMKe 2LCCA 5GAOp 4Y91A 2RHZA 3MHXA 2EQMA 3L1AA 2EWNA 1OZ2A 4GY5A 5FU6C 3A8HB 3CCVA 3CD6T 3OYAA 4KULA 2O4XA 1NE8A 1HK9A 1WQWA 3HFNA 1VIEA 3RUXA 4J7FA 4II1A 3I55T 4MDWA 5D6WA 1M5Q1 1VQ7A 2HD0A 2E64A 4XTXA 2MWPA 3RIRA 4KUIA 2D0QB 2JUFA 2QQRA 3CMET 1IREB 2RHXA 3FB9A 4ZGEB 4ZTFA 1VQMT 4LDUA 4M7AG 2XHCA 4C92C 4OB3B 2E6ZA 1W2BS 3ER0A 3URGA 5FU7B 3RKYA 2RJEA 2XICA 1N9SA 2QQAA 5A0LA 3VYGA 1S72T 4HT8A 4M78D 3X25B 1YJWA 4C5IA 3CBPA 4B9WA 1YITT 3WVEB 3EFSA 3CC2T 2GFUA 1XNIA 3M4YA 4RCCA 5LJ5h 3LLRA 2M16A 1BI0A 2YLCA 2WSCE 5GANf 3MP6A 3E9GA 2FVUA 4M75B 3QDRB 3OYJA 1FWZA 3JCMQ 5J39A 3M58A 5CO7A 5M9OA 1W2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y71 A; 
#chains in the Genus database with same CATH topology
 4PJO A;  4F17 A;  4N0A C;  3CCM A;  4RKU E;  2WAC A;  3DB3 A;  3TSZ A;  5GAN g;  1M30 A;  2RD1 A;  1QCO A;  1TUC A;  2F2W A;  3N5B B;  3L2Q A;  4HCB A;  2LJ0 A;  2VV5 A;  1D09 B;  1KSW A;  1VQO Q;  5LJ3 g;  2EQI A;  3T9N A;  2ECZ A;  4QVC A;  3GOX A;  2YRC A;  3JRZ A;  1YIJ A;  1OX8 A;  4DEX A;  5KYW B;  5C0M A;  5IXF A;  4LNP A;  3QXE B;  1OUL A;  4C92 G;  2OTL T;  2EKO A;  2X4Y A;  1MMG A;  1MV0 B;  2DLP A;  2QEX A;  3OMG A;  1H3Z A;  1BYM A;  3QZ9 B;  4AFQ C;  4E7K A;  1D1B A;  2AHJ B;  2MCN A;  2K57 A;  2KYM A;  1WPY A;  4OP0 A;  3CPW S;  1U8R A;  4ZNX A;  1IHW A;  2DJQ A;  4JJC A;  1S72 Q;  1S1N A;  2EJF A;  3SFM A;  1JXM A;  2X9H A;  2JMA A;  3FRN A;  1HJD A;  2PVG B;  4OMM A;  3CPW A;  1BI2 A;  5GAN 4;  2DIQ A;  5IHK A;  2OJ2 A;  2AKL A;  5GAM f;  5GAN 3;  3QDF A;  1VQ8 T;  3G1J A;  4BDZ A;  2RMO A;  4AG1 C;  4OGC A;  3MEW A;  3X28 B;  2YT6 A;  1ZA1 B;  1LVK A;  2HL5 C;  2ZPE B;  1C6V X;  4J9I A;  1VQ9 A;  1NM7 A;  1VQL A;  1UHC A;  3ZFJ A;  5ECA A;  1OI1 A;  2JS0 A;  2JTE A;  3CME A;  1NYG A;  2EYY A;  4PJO E;  1AOJ A;  5CKB A;  3I35 A;  1OPK A;  3U23 A;  4RG2 A;  3CPF A;  4OML A;  1NG2 A;  3RBB B;  1Y0M A;  3EGX A;  2OTL Q;  4OF1 A;  4KGX B;  1N5Z A;  2J6K A;  3E1S A;  5KE2 A;  3DKM A;  1KQ2 A;  3NTH A;  3G6E A;  3FEO A;  4DQ2 A;  5A0D A;  4O5V A;  2JOY A;  2VVK A;  2Y4X A;  3PVL A;  1VQ5 T;  4BI8 B;  3RER A;  3CXC S;  3MEA A;  2FHD A;  1CSK A;  2K2V A;  5GAO q;  1G5V A;  1KQS S;  3C0C A;  3UF4 A;  1E6H A;  2HL3 A;  4RMO A;  3RMS A;  1YHQ T;  3NMZ C;  2RQR A;  3CXC A;  2GGR A;  2L2P A;  5FU6 B;  3PMI A;  1VQ8 Q;  1GBQ A;  2CZ1 B;  2HDA A;  3I56 T;  2MOX A;  1NLP C;  1U5S A;  1KQS A;  5CQX A;  4FU6 A;  3HFO A;  3FC3 A;  4XTV A;  1M1K R;  4BI4 A;  3M0P A;  5CKF A;  4NL3 A;  1O9S A;  1UTI A;  1IRX A;  1XJW B;  1EIF A;  2B8A A;  2DJZ A;  1AZG B;  4N0A A;  1D1A A;  3TSW A;  2M1H A;  3A1P A;  2RK2 A;  2JW4 A;  5I2M A;  1QVF S;  2ZAE A;  2DRM A;  4OB2 B;  1WHM A;  1PSF A;  2ZPI B;  4ZN1 A;  5DM7 R;  1YJ9 A;  1B3Q A;  1K1Z A;  2YHT A;  3BDU A;  1JEG A;  3QPH A;  1TOV A;  1WDX A;  3HRS A;  4RG8 A;  3V8L A;  2NUT B;  3J81 E;  2J6O A;  4KGZ B;  4F7U A;  1VQ5 Q;  1Q86 C;  1QVF A;  3OQ5 A;  1PKS A;  3H9N A;  3JB9 G;  1BK2 A;  3TU4 K;  3RKX A;  3G71 T;  3SD4 A;  2QQ9 A;  4EMG A;  2KNB B;  1W6X A;  2SRC A;  1SSH A;  4FYV B;  2O31 A;  1JB0 E;  5CCA A;  2Z0W A;  2EJG A;  1YHQ Q;  3A8O B;  3EG0 A;  3LWI A;  2X4X A;  3V7R A;  2C0I A;  3C12 A;  1S72 A;  3L2Z A;  1HD3 A;  3SWN C;  2MYS A;  3C4S A;  2DEQ A;  4IUU A;  3VU3 C;  4M7D G;  3RR6 A;  4E7Z A;  3H0I A;  4PJN A;  4A4G A;  1FMW A;  2JNG A;  3EHR A;  2ROT A;  2O9V A;  3PIO A;  2V26 A;  2GFA A;  3JCM V;  3OBW A;  4ME7 A;  1N9R A;  3ZEH A;  2DIG A;  4X1V A;  3TCJ A;  3QII A;  4EDU A;  2FEI A;  3H6Z A;  1W4S A;  2FZC B;  1Y71 A;  1WA7 A;  4P5N A;  3I5S A;  1UHF A;  2OTL A;  4KUD K;  2HEQ A;  3CCM T;  5FW9 A;  2CZ7 B;  1HSQ A;  2KK4 A;  2RHI A;  1C1A A;  2XKO C;  4LUD A;  1M3B A;  4NS5 A;  4CI0 C;  1Q81 C;  2XDB A;  2DL4 A;  2DVJ A;  4E2F B;  2LNV A;  2RPN A;  3QKJ A;  2HQX A;  1MMN A;  1K8A C;  1I81 A;  2HMA A;  3ME9 A;  1K73 R;  1X6G A;  5KH6 A;  5LJ5 d;  1YI2 T;  1U3O A;  3CC4 A;  4F7U E;  1PG5 B;  2PQW A;  2BUD A;  3RKW A;  3VS7 A;  5AYF A;  4XU0 A;  2BTT A;  2OI3 A;  1M1K U;  4CC7 A;  3X24 B;  4BD3 A;  2DXB A;  1WGS A;  2PVO B;  3LH0 A;  4Z02 A;  1RLQ C;  1X01 A;  2GTJ A;  2J7I A;  3VV0 A;  2DM1 A;  4RTX A;  2D9T A;  3EFO B;  1K8A R;  2ABL A;  2L5Q A;  2QQS A;  4DBF A;  1YN8 A;  5LJ5 j;  2P4T A;  2HAX A;  3OA6 A;  3VRZ A;  1UFF A;  3JCM d;  2QAS A;  5GAN 7;  3L2V A;  2E3H A;  1IGQ A;  2EGA A;  5GAN e;  2E4H A;  3F70 A;  4JS4 A;  1WFW A;  1PRL C;  1I4K 1;  3LW5 E;  2JXB A;  1BI1 A;  2LVM A;  2DZC A;  4PJO C;  1TS9 A;  1GCQ C;  1KC8 R;  1X27 A;  4K11 A;  4E47 A;  1D3B B;  4J9G A;  4OB0 B;  1H64 1;  2E10 A;  2MWO A;  1FMK A;  4X9D A;  2EFI A;  1R77 A;  1SSF A;  2ATC B;  1MNE A;  4QT7 A;  3CCM Q;  3OBY A;  4OMP A;  5EG2 A;  2A3L A;  5GMK e;  5GAO p;  1PD0 A;  2EQM A;  3L1A A;  4Z8A A;  2BZY A;  1UJ0 A;  2F2X A;  4HXJ A;  3EG1 A;  4KUL A;  3RUX A;  2HD0 A;  2E64 A;  3CME T;  2QQR A;  1IRE B;  3FB9 A;  4ZGE B;  4B6M A;  4LDU A;  2K6D A;  2A28 A;  3ER0 A;  2RJE A;  4HT8 A;  4C5I A;  3CBP A;  1GL5 A;  1E6G A;  3EFS A;  3CC2 T;  1XNI A;  4RCC A;  5LJ5 h;  3LLR A;  1QVG P;  1PKT A;  2QEX Q;  2WSC E;  2D8J A;  2CUB A;  2CP0 A;  1FWZ A;  3TQ7 P;  5J39 A;  5CO7 A;  3E2U A;  4CC4 B;  5M9O A;  3L2U A;  3OW2 P;  2KGT A;  4JJN K;  1SKU B;  4C8Q F;  3TVT A;  1WI7 A;  3I56 A;  2F69 A;  2ENM A;  2L3P A;  1ABQ A;  1PC0 A;  4YTL A;  2A37 A;  3QBY A;  2RQT A;  2GF7 A;  2OAU A;  1M9S A;  1UEC A;  2DAQ A;  3JCM h;  4FT4 A;  3SWN B;  4UC4 A;  1K9M R;  4PJO D;  4OVA A;  2KRN A;  3NTK A;  3D7S B;  3VS6 A;  2RHU A;  1K9A A;  1I07 A;  2YDL A;  1C0M A;  2DKG A;  4IUT A;  2G3R A;  4BY6 C;  2L3R A;  2FRY A;  2DO3 A;  1TUG B;  2FB7 A;  1K73 U;  1VQ9 Q;  1VQL Q;  2GQV A;  1ZUU A;  2M9U A;  3CME Q;  1D0X A;  2JTF A;  1VQ4 T;  1WHJ A;  3LX7 A;  3OS1 A;  5LJ3 d;  1I5L A;  2HZY A;  2QDY B;  4A4E A;  4DOW A;  3G71 A;  1U1S A;  2FYK A;  5CVI A;  2BZX A;  2ED1 A;  4FM4 B;  3THK A;  3CC2 Q;  2W10 A;  1Y96 B;  1I1J A;  1Z9Q A;  1K8A U;  3CCE A;  1QKW A;  2D6F A;  5CKH A;  2JMC A;  2DBK A;  1OX9 A;  2I2L A;  2B86 A;  1GBR A;  3OY9 A;  3ASK A;  1Y57 A;  4C8Q A;  1UUE A;  4J9C A;  1X43 A;  4J9B A;  1MUZ A;  5LJ3 j;  3EH2 A;  3DLL A;  2QXF A;  2AT1 B;  1SRM A;  1YWP A;  3JCM W;  4OGE A;  3MP8 A;  3UPU A;  4C5H A;  4BI3 A;  1KC8 U;  2RI2 A;  4GLK A;  5GJW B;  2EAY A;  5L8R E;  2FPF A;  2JS2 A;  5KYX B;  1VQM A;  2ZPG B;  4N4I A;  4J83 A;  3REA B;  1RL2 A;  1G3W A;  3L2R A;  1GRI A;  3A8L B;  2OTJ T;  1M2O A;  2V8J A;  5GAN 6;  1YP5 A;  3A98 A;  4FYY B;  1M27 C;  1TXQ A;  4FSX A;  4QQD A;  2O01 E;  1M8M A;  2YUQ A;  1WHH A;  2WSE E;  3LGL A;  2XK0 A;  2JT4 A;  1WJS A;  3M0R A;  3CCV T;  2F5K A;  5LJ5 f;  1VQ7 T;  1G8X A;  5FWB A;  1UEB A;  1GCQ A;  1OOT A;  4C92 E;  2JZ2 A;  2E5K A;  2YUP A;  5HK0 A;  1P92 A;  3QO3 A;  1VQ4 Q;  4PJO B;  4MZP A;  5L23 A;  5GAO r;  3NTI A;  3A5Z B;  4OMF B;  2K3X A;  3HPW A;  2IVW A;  2DPP B;  3JB9 F;  5LJ3 h;  4JJB A;  5A2Q E;  1GXI E;  3R6N A;  1YJ9 Q;  1YI2 A;  3JCM f;  1T3S A;  1HYO A;  5FRO A;  1KD1 C;  2KRO A;  2F1L A;  2CSQ A;  2GTO A;  3CQT A;  2VUB A;  1RI9 A;  4FCY A;  3OYY A;  4A54 A;  1OYX A;  4JZ4 A;  2EQJ A;  1RI0 A;  2E65 A;  3LWH A;  2H3E B;  2X3X D;  4GLM A;  4JS5 A;  1K9M U;  1V1C A;  3CC7 T;  3SDZ A;  2DER A;  4M7D F;  1E7O A;  3QSU A;  5HCK A;  4C8Q E;  4N4H A;  4M78 C;  1KD1 R;  4DBR A;  2E41 A;  3JB9 J;  2LZ6 B;  3JCM b;  2OTJ Q;  1PWT A;  3CC4 T;  3GLX A;  2CRE A;  2NUP A;  1MV3 A;  3INZ A;  4M75 F;  3SB2 A;  3I9Q A;  5IH2 A;  1UE9 A;  2K5L A;  3OYE A;  1X69 A;  2NYS A;  2DL5 A;  2HQH A;  1N6A A;  1KHI A;  2RA2 A;  1OEB A;  3VUB A;  3HKS A;  3MCA B;  4PFP A;  2X4W A;  2VXF A;  4JPB W;  1VQ7 Q;  3MPU B;  1X6B A;  2DIL A;  1AHJ B;  4XTZ A;  1JO8 A;  2DF6 A;  2K2M A;  3A8G B;  3MJX A;  4LD9 K;  2Y90 A;  1U06 A;  2CZ6 B;  4BY6 B;  2ROL A;  5GAO n;  1YFN A;  1WNL A;  1WQ7 A;  3NHN A;  2CZ0 B;  4L59 A;  3WVD B;  3M53 A;  8AT1 B;  1F1B B;  3CC2 A;  2L89 A;  1LPL A;  3BW1 A;  4C0D C;  1NPR A;  2O88 A;  1PSE A;  4FIB A;  3EGX B;  5CR2 A;  2IIM A;  1KIK A;  4PJM A;  5DY9 A;  2DXU A;  2KSS A;  4C5E A;  4M7D A;  5J26 A;  1VOM A;  2LT4 A;  1BI3 A;  2PNI A;  2L3Q A;  2H8H A;  4LDW A;  1QWF A;  1VUB A;  5FRN A;  2VGM A;  4ZGD B;  3G4S A;  4M75 A;  2FG0 A;  2LX9 A;  4F7U F;  3CC4 Q;  1UJY A;  4D6W A;  4M77 F;  2P4R A;  3ULR B;  1QCF A;  4KRT A;  3S3M A;  1M1K C;  5IHI A;  2BIV A;  2HSE B;  2JTM A;  4PJO G;  3OYM A;  2M51 A;  2A0F B;  2RI3 A;  1QCN A;  1QVG S;  1ZX6 A;  2KAF A;  3QG1 A;  1D0Y A;  1M4Z A;  5LJ3 f;  4QQG A;  2LRQ A;  3VKI A;  2EYQ A;  3GNG A;  2EQK A;  4LN2 A;  3OW2 S;  5I11 A;  3I5R A;  4M78 F;  1H3H A;  3HP9 A;  4R56 A;  1QVG A;  1WXB A;  4JLG A;  3VUZ A;  1AD5 A;  7AT1 B;  2EGC A;  3H0H A;  5HY6 A;  2XU8 A;  4QW2 A;  1X2K A;  3RMQ A;  2PU9 B;  1KJW A;  5C6S A;  3OW2 A;  2DX1 A;  1RAA B;  1VQ4 A;  2LTO A;  2DBM A;  2ZCF B;  1Q82 R;  2R58 A;  5KCO A;  4PJJ A;  3PE0 A;  3PVQ A;  3X26 B;  3QWX X;  5CQY A;  2LMJ A;  4J6Y A;  3V7S A;  2LJ1 A;  1ZUY A;  4DBQ A;  1KD1 U;  4E7S A;  5EC7 A;  2G6F X;  3M4G A;  2YWW A;  3BFM A;  2DXT A;  2KY9 A;  1R8O B;  4LDY A;  2E5Q A;  4M77 A;  1V76 A;  4A4K A;  4PFO A;  4XK8 E;  1YJN A;  4LD6 A;  4NOY A;  3M0T A;  2XI9 A;  2DL7 A;  5I22 A;  2QTV A;  4M7D E;  3MEU A;  4MML A;  1X75 C;  4MMK A;  2QA4 T;  3CCE T;  1WXT A;  2OTJ A;  3GIB A;  5FWC A;  4C0Z A;  5D6X A;  4PNO A;  3H8Z A;  4M75 E;  5KYY A;  5KYN A;  5GMK m;  4M78 A;  2RHZ A;  2EWN A;  1OZ2 A;  3I56 Q;  1ACM B;  1KFZ A;  1FMV A;  3CCV A;  3CD6 T;  2O4X A;  1NE8 A;  1WQW A;  1VIE A;  4II1 A;  2KEA A;  5D6W A;  1M5Q 1;  1VQ7 A;  3EGU A;  3O5Z A;  3RIR A;  3EGD A;  4KUI A;  2D0Q B;  2JUF A;  2RHX A;  4ZTF A;  1RAH B;  1X2Q A;  4OMN A;  1MMD A;  4HCK A;  1VQM T;  4C92 C;  1MMA A;  1WHL A;  2XIC A;  2MIO A;  3GBQ A;  1YIT T;  1M2V A;  2CP2 A;  4QKU A;  2EYW A;  3UA7 A;  2FVU A;  1SPK A;  4RTU A;  1AT1 B;  1H92 A;  5GAN 5;  3J7A F;  2CS7 A;  1VYV A;  1K73 C;  4PLL A;  1D1C A;  1X6O A;  3EAE A;  1WX6 A;  1NJI R;  1NEB A;  2MAM A;  2Y4Y A;  1HXD A;  4A53 A;  3V8K A;  3CCL A;  2P0P A;  4BAC A;  1VQK T;  2KT1 A;  4C0G A;  4XTU A;  3CC7 A;  4FYW B;  5CKD A;  3G71 Q;  5CKE A;  5GAM e;  2BZ8 A;  4C8Q C;  4C0D B;  2QA4 Q;  3CCE Q;  2FRW A;  2COZ A;  1LJO A;  4RTW A;  3VS5 A;  4M77 E;  2R5A A;  4EIK A;  4IIO A;  3CCQ T;  2ZZD A;  3NGP A;  4M7A F;  1N8R C;  2O2O A;  1ZSG A;  2AZV A;  2R5M A;  1NPP A;  4C0F A;  3VS3 A;  4E6R A;  3CD6 Q;  1ZHI A;  4ELY C;  2KT8 A;  1B34 A;  1KC8 C;  1R0B G;  2J05 A;  1Q82 U;  4FL6 A;  2V8K A;  3JB9 I;  3VS2 A;  1VQM Q;  3C94 A;  1O75 A;  2J06 A;  4M78 E;  4EMK A;  4C92 D;  3JCM X;  4JUV A;  2FPD A;  5IXB A;  4PFZ A;  3OYC A;  2OAW A;  1N8R R;  5CAI A;  2FL7 A;  2CYZ B;  3EG9 A;  2VAS A;  4DOV A;  2EQU A;  4PK4 A;  2DRK A;  1BIA A;  2J6F A;  4EPC A;  1IO6 A;  2P0Q A;  2LCL A;  4IIM A;  4HA8 A;  4A4H A;  5IN1 A;  2QQB A;  4JRK A;  2JM9 A;  1NBE B;  4C92 F;  3CCS T;  4Y92 A;  5GAN 8;  3R6O A;  2HBP A;  5LL6 S;  5KCH A;  3EFR A;  4BUG A;  4C8Q D;  1QWE A;  3RNJ A;  1VQN T;  2RH2 A;  1YI2 Q;  4M7A A;  2VXE A;  5KYU A;  2KE9 A;  2X4J A;  4OB1 B;  1BKB A;  2FPE A;  1K9M C;  4RCB A;  2AK5 A;  5GMK i;  1ZUK A;  4ANJ A;  2ZPH B;  2HKQ B;  4E7L A;  4B9X A;  4ZTJ A;  3GF5 A;  4HCC A;  3VS1 A;  3G4S T;  3JCM P;  5D6Y A;  2VC8 A;  4VUB A;  3P8D A;  3JCM c;  4J9H A;  1VYU A;  1KQ1 A;  1NJI U;  1UB4 A;  9ATC B;  1ZSZ A;  3OB9 A;  5GAN 2;  1IZ6 A;  3M0S A;  4C5G A;  2CDT A;  2W0Z A;  1CKA A;  2MI6 A;  4C92 A;  2KRS A;  2LQW A;  1U1T A;  1LCK A;  4L6V 5;  3VRY A;  1AZE A;  3OYB A;  2I0N A;  3CCS Q;  1AWJ A;  3WXM B;  2GNC A;  3OYD A;  4X34 A;  2K7A A;  3CCJ T;  1QW1 A;  1UGV A;  2KVQ G;  3EG2 A;  4RTV A;  5GAN d;  2A7Y A;  1TWB A;  5IT9 E;  3CMA T;  4LDV A;  4XU2 A;  3C95 A;  1Q7Y R;  3AT1 B;  3VS0 A;  3PNW C;  1M90 C;  1CKB A;  1VQN Q;  2E6N A;  1TH7 A;  4FYX B;  1YWO A;  5CK9 A;  2CKK A;  1QKX A;  4M7D C;  3ZL7 C;  1T3L A;  5FU7 C;  2QA4 A;  5GAO m;  2DL8 A;  1XTD A;  4LXC A;  2KRM A;  5GAN j;  4JDS A;  1WJR A;  4AFZ C;  4XTY A;  1TSF A;  1NEG A;  1TG0 A;  1ZLM A;  1WHG A;  1FX7 A;  1PM3 A;  2CH4 W;  4D8D A;  4M75 C;  4M7A E;  1BIB A;  3KFV A;  3BY7 A;  1N8R U;  1QMC A;  2GCX A;  1VQO T;  1M90 R;  3NFC A;  1RAC B;  2V1Q A;  4C8Q B;  5GAM g;  3CD6 A;  3P8H A;  2CGH A;  3G4S Q;  1YJN T;  2VKN A;  5GMK j;  2VB6 A;  2KMT A;  2CP3 A;  4KT0 E;  2CP5 A;  4IUP A;  1M3C A;  2AIR B;  1FYN A;  3JAM E;  1IXD A;  2RNA A;  2QTX A;  2E3I A;  5KE3 A;  2K79 A;  1YIT A;  2KR3 A;  2C06 A;  3JB9 D;  1UDL A;  2COW A;  1GFC A;  3L42 A;  1TUD A;  2K5F A;  5HKC A;  2VYT A;  3O8V A;  3MEV A;  5DLO A;  1UGP B;  1QP2 A;  3S6W A;  3QZ5 B;  2QG9 B;  3CCJ Q;  4HT9 A;  1FXX A;  3PFS A;  1WZO A;  3S3O A;  4LUE A;  3CMA Q;  2EKH A;  2M02 A;  1RAI B;  3BE3 A;  2DTI A;  1OU8 A;  5D7U A;  1T0H A;  1UGS B;  3PTA A;  2DL3 A;  4KBM B;  5HK3 A;  5GAN h;  1VQK A;  2V8I A;  2CT4 A;  3QYH B;  3VS4 A;  2WSF E;  2YSQ A;  3HTR A;  4M7D D;  1H8K A;  2GQI A;  4PL6 A;  2EYX A;  1K0X A;  2CP6 A;  5FLX E;  2RF0 A;  2RB6 A;  1BBZ A;  4ORZ A;  1ARK A;  1D0Z A;  4M4Z A;  4M77 C;  1AWX A;  5GMK h;  4FW1 A;  1BU1 A;  2KI7 A;  2LQ8 A;  3CCQ A;  4NL2 A;  1VQ6 A;  3UT1 A;  1TTH B;  4M75 D;  1WJQ A;  5KYW A;  2YLB A;  2DFU A;  1PD1 A;  3CCL T;  3OYN A;  2K4Y A;  2DEU A;  1AWW A;  1YJN Q;  4DEY A;  4HVV A;  2XDD A;  2LP5 A;  2JM8 A;  1K76 A;  1AEY A;  4BB7 A;  2ESW A;  4BDY A;  4E7I A;  2PVD B;  4V2S A;  1UGQ B;  3CCR T;  1GCP A;  2JVV A;  3M0Q A;  2P84 A;  4RTT A;  3J80 E;  3QHS A;  2NUP B;  3FJ5 A;  2DTO A;  4GBQ A;  3CCV Q;  2HBW A;  1Q7Y U;  1N27 A;  2X3W D;  3OYI A;  3AHU A;  4XQ3 A;  3H0F A;  2DD4 A;  4BE2 A;  1EZZ B;  2YUO A;  2RI5 A;  2QDL A;  2RK1 A;  3CCS A;  3OYF A;  4ZGJ B;  1ZQ1 A;  2R57 A;  1EFN A;  3GNF B;  3UDC A;  2DVE A;  4C8Q G;  1JRI A;  4MZM A;  4RUG A;  3KXT A;  2JN0 A;  2K3B A;  4J6X A;  1OQK A;  2OX7 A;  1VQN A;  1M90 U;  1K4U S;  2PUK B;  1W1F A;  4E7H A;  4M77 D;  3MHX A;  1SHF A;  4GY5 A;  1WXU A;  3SHW A;  1ZA2 B;  2KXD A;  2YXY A;  3CCL Q;  1HK9 A;  4J7F A;  3I55 T;  2DA9 A;  1QLY A;  4XTX A;  3CC7 Q;  2KBT A;  4M7D B;  2XHC A;  3URG A;  5FU7 B;  2QQA A;  2LNH B;  1Q95 G;  4KH0 B;  4M78 D;  2GBQ A;  3X25 B;  4B9W A;  3WVE B;  2DE0 X;  3M4Y A;  1I5O B;  1PNJ A;  3CCR Q;  2M16 A;  2YLC A;  1BCM A;  2C0T A;  5GAN f;  2RQU A;  4M75 B;  3QDR B;  2A36 A;  3M58 A;  4IUV A;  8ATC B;  4AFU C;  4MZT A;  5I2S A;  4DBH A;  4EMK C;  2KXC A;  3JCM J;  1Q82 C;  4F16 A;  2DTH A;  4ELZ C;  4J6W A;  1LNX A;  5GJV B;  5J3B A;  4BE1 A;  3OS2 A;  3OYH A;  4FT2 A;  1PCX A;  1AVZ C;  2LT1 A;  2QYZ A;  3CCJ A;  2DK3 A;  1JJ2 P;  2KDS A;  4PKC C;  2ZGW A;  4HKE A;  3CMA A;  1W70 A;  3CCU T;  1JBM A;  1RAD B;  2CH4 A;  4HCZ A;  3OYG A;  3X20 B;  1LOJ A;  3ZBD A;  3GP8 A;  2LC4 A;  1RAE B;  3Q1J A;  3FIF A;  4FSS A;  1SRL A;  1M1G A;  3PIP A;  3MO8 A;  4J9D A;  3EHQ A;  3FJP A;  2O9S A;  4D8K A;  3I55 Q;  4WTO B;  1MGQ A;  4XU1 A;  5IAY A;  4Z89 A;  2PTK A;  1B7T A;  3M9Q A;  1VQO A;  4M7A C;  1UG1 A;  2HNI A;  3H41 A;  1VQP T;  5IHN A;  1KK7 A;  1WYX A;  4ZN3 A;  2NLU A;  2RJF A;  4RTZ A;  4J5Y A;  2QGG A;  4F7U B;  2LCS A;  2NUT A;  2CUD A;  5LJ5 e;  2EBP A;  2FZG B;  4M77 B;  4IKF A;  2DZ9 A;  4L5G A;  4F04 B;  2E1H A;  4IUQ A;  4HVW A;  3OYL A;  1K0S A;  3CBM A;  2M0Y A;  1WHK A;  3P8B B;  1M8V A;  1OPL A;  1JXO A;  1NLO C;  4AFS C;  4CC3 A;  1QP3 A;  1XQH A;  4TVR A;  3S3N A;  2VGN A;  3MET A;  3L2W A;  1WIE A;  1G83 A;  5KYY B;  4M78 B;  3M54 A;  2XD0 A;  1ZSZ C;  1TU0 B;  4J7I A;  3JCM e;  2D1X A;  4KH1 B;  1RAG B;  4WCI A;  4OMQ A;  1W2B P;  1ZBJ A;  2C0O A;  2HQE A;  5GMK l;  2ED0 A;  2O4X B;  2D0N A;  3OS0 A;  3CCU Q;  1NJI C;  2A08 A;  1Q86 R;  3REB B;  3EGD B;  4JRQ A;  3UA6 A;  2COY A;  2V1R A;  2MK5 A;  2RM4 A;  2PUO B;  3LGF A;  2K9G A;  4J9F A;  1M2V B;  3MP1 A;  1BB9 A;  1RAB B;  1IB8 A;  4AMC A;  2BE9 B;  2E12 A;  3M5A A;  4M75 G;  2L8D A;  4PJL A;  4R0K A;  4M7A D;  4Z88 A;  1VQP Q;  4JJD A;  1YJW T;  3LYI A;  5FRM A;  2RHY A;  1Y07 A;  4XAX B;  2VWF A;  1J3T A;  4PLI A;  2SEM A;  4XU3 A;  1PHT A;  2MPX C;  3VJP A;  3M57 A;  1G3S A;  2FO0 A;  5AT1 B;  2FZK B;  2EGE A;  1SG5 A;  2D8H A;  4OMO A;  3QJ6 A;  2KYB A;  4J8O A;  3M0U A;  1QQJ A;  2EYZ A;  3PGG A;  3TEE A;  4N4G A;  3CCR A;  4FW2 A;  1G3Y A;  1VQ6 T;  1KG1 A;  2XDP A;  1G3T A;  1M1F A;  4CC2 A;  5CIU A;  3CPW P;  2K5I A;  1YIJ T;  1DJ7 B;  1I8F A;  4A4F A;  4QVZ A;  4JRI A;  1QVP A;  2NUZ A;  5A0G A;  4MDX A;  6AT1 B;  3TRE A;  4E7J A;  1B34 B;  3FLG A;  3E19 A;  1NZ9 A;  4Q5W A;  3HRU A;  2QEX T;  4WF2 A;  3EFO A;  3M56 A;  1YIT Q;  1Q81 R;  4IUR A;  2P0K A;  2RN8 A;  2HCK A;  4EMK B;  2XG8 D;  2M0O A;  2LJ3 A;  1I0C A;  2JJ9 A;  4R55 A;  1ZBX A;  1VQ8 A;  4BE0 A;  1SEM A;  4J9E A;  2MF2 A;  3EG9 B;  4F7U G;  4A63 B;  4M77 G;  4LE9 A;  2DD5 A;  4Y28 E;  2L0A A;  3QWY A;  2AZS A;  1MND A;  2HSP A;  3KUF A;  1YJW Q;  4LDX A;  1GFD A;  1D3B A;  4AT1 B;  2DXC A;  3I55 A;  1VQK Q;  1Y7X A;  3OS5 A;  1R0C B;  1VA7 A;  5LJ3 e;  2DET A;  2MMP A;  4M78 G;  4QVD A;  2DYI A;  1EX4 A;  1G2B A;  2E70 A;  2RJD A;  1NYF A;  2YRD A;  2RQV A;  4XTW A;  2PZ1 A;  2AKK A;  3UAT A;  3KBG A;  3M59 A;  1JU5 C;  4X9C A;  3EH1 A;  3CCQ Q;  1VQ6 Q;  1YCS B;  1VQ9 T;  1VQL T;  2EW3 A;  4M7A B;  2QAZ A;  1AWO A;  1IHV A;  3HHT B;  3QYG B;  1VQ5 A;  1Z9Z A;  2RJC A;  5KYU B;  1YIJ Q;  1YNZ A;  3CXC P;  1Q86 U;  4CRI A;  4KGV B;  3CBO A;  5GAM d;  3E9F A;  2IPO B;  3HL8 A;  3BDL A;  1OV3 A;  1V29 B;  2RO0 A;  3IQL A;  2LQK A;  5LJ5 g;  1A0N B;  1KQS P;  2H3J A;  2ZPF B;  4JRP A;  3UWN A;  3G6E T;  2K3Y A;  1YHQ A;  1XOV A;  4DA4 A;  2CSI A;  2YUN A;  3DB4 A;  3PMT A;  1UGR B;  3OSS C;  1BCO A;  3CCU A;  2KQW A;  1SF9 A;  2F5T X;  3DLM A;  5I21 A;  1YBY A;  1RLP C;  2ZPB B;  3OSV A;  1Q7Y C;  1PRM C;  5GAM j;  4AG2 C;  3JB9 H;  3JSC A;  2EIF A;  3OMC A;  3G7Z A;  1ZSZ B;  3SWN A;  1KHC A;  2IG0 A;  3JCM g;  2DNU A;  1B07 A;  2HKN A;  5DLQ E;  4C92 B;  4JZ3 A;  3JV3 A;  4QQ6 A;  1OU9 A;  1JJ2 S;  1OZ3 A;  3VYH B;  4O6J A;  2QI2 A;  3HRT A;  1VQP A;  4JLI A;  1YCY A;  3OYK A;  1QVF P;  3M55 A;  2X51 A;  3A8M B;  1VIF A;  3LH5 A;  2L3S A;  4F14 A;  2LDM A;  3V7C A;  3RES A;  2BKD N;  1JJ2 A;  3CEY A;  3SEM A;  3NPF A;  2QGF B;  2DMO A;  1M3A A;  4EMH A;  2CT3 A;  4PJO F;  2CP7 A;  2RQW A;  2EJ9 A;  1Y96 A;  2YRV A;  2F2V A;  1Q81 U;  1T0J A;  2LQN A;  3FDR A;  3V8J A;  3GPL A;  2X35 A;  5GAO l;  2NWM A;  3QJY A;  5GAM h;  1VYT A;  2BE7 D;  4ESR A;  3G6E Q;  1JQQ A;  1YJ9 T;  1SHG A;  4ATO A;  1WLP B;  1RUW A;  4RTY A;  2EPD A;  1MHN A;  3MKD A;  3PT9 A;  3QUI A;  3HSB A;  2XID A;  2LCC A;  4Y91 A;  2QK0 A;  5KYX A;  5FU6 C;  3A8H B;  3RDV A;  3OYA A;  3HFN A;  3EG3 A;  1IGU A;  2LX7 A;  4MDW A;  1RAF B;  2MWP A;  1ABO A;  4M7A G;  4OB3 B;  2E6Z A;  1W2B S;  3RKY A;  2XMF A;  5A0L A;  1N9S A;  3VYG A;  1S72 T;  1YJW A;  2EVR A;  2DYB A;  2GFU A;  1BI0 A;  4HVU A;  3MP6 A;  3E9G A;  3OYJ A;  3JCM Q;  1W2B A; 
#chains in the Genus database with same CATH homology
 4PJO A;  5GAN 5;  4IUV A;  3L2U A;  4N0A C;  3J7A F;  2CS7 A;  4MZT A;  4RKU E;  5I2S A;  3CCM A;  4PLL A;  1K73 C;  4JJN K;  2WAC A;  4EMK C;  1X6O A;  3DB3 A;  3EAE A;  4C8Q F;  3JCM J;  5GAN g;  1Q82 C;  3I56 A;  2RD1 A;  2F69 A;  2DTH A;  2MAM A;  2Y4Y A;  1LNX A;  4J6W A;  4ELZ C;  1HXD A;  5J3B A;  4A53 A;  4BE1 A;  3N5B B;  3V8K A;  3OS2 A;  3CCL A;  3L2Q A;  2P0P A;  4YTL A;  3OYH A;  4BAC A;  4FT2 A;  4HCB A;  2VV5 A;  1VQK T;  3QBY A;  5LJ3 g;  4C0G A;  3T9N A;  4XTU A;  2LT1 A;  4QVC A;  3CC7 A;  5CKD A;  2GF7 A;  2OAU A;  1M9S A;  3GOX A;  3CCJ A;  1YIJ A;  3JRZ A;  2DK3 A;  2DAQ A;  5CKE A;  3JCM h;  2KDS A;  4FT4 A;  3SWN B;  4UC4 A;  5GAM e;  5C0M A;  4C8Q C;  4PKC C;  4PJO D;  2ZGW A;  4HKE A;  4OVA A;  3CMA A;  4C0D B;  1YJ9 T;  3NTK A;  3CCU T;  3QXE B;  4C92 G;  1JBM A;  2RHU A;  2OTL T;  4HCZ A;  1LJO A;  2EKO A;  2X4Y A;  2R5A A;  4M77 E;  3OYG A;  2DKG A;  4IUT A;  3X20 B;  1LOJ A;  2ZZD A;  3OMG A;  2QEX A;  3CCQ T;  3ZBD A;  2G3R A;  3GP8 A;  2LC4 A;  4M7A F;  1H3Z A;  4BY6 C;  1BYM A;  3Q1J A;  3FIF A;  3QZ9 B;  1N8R C;  2L3R A;  1M1G A;  3PIP A;  2R5M A;  3MO8 A;  1NPP A;  2DO3 A;  4C0F A;  4E7K A;  2AHJ B;  2FB7 A;  1ZHI A;  1K73 U;  3FJP A;  4ELY C;  1B34 A;  1KC8 C;  2GQV A;  1Q82 U;  2K57 A;  4FL6 A;  1WPY A;  4OP0 A;  3CPW S;  1U8R A;  1MGQ A;  4XU1 A;  2V8K A;  2M9U A;  2JTF A;  5IAY A;  3JB9 I;  1VQ4 T;  3LX7 A;  3C94 A;  1O75 A;  3M9Q A;  4M78 E;  2HNI A;  5LJ3 d;  4C92 D;  4EMK A;  3OS1 A;  1VQO A;  3JCM X;  1VQP T;  4JUV A;  1I5L A;  2QDY B;  4A4E A;  4ZN3 A;  2NLU A;  3OYC A;  2RJF A;  4DOW A;  2EJF A;  3SFM A;  3G71 A;  1U1S A;  2FYK A;  5CVI A;  4FM4 B;  4J5Y A;  5CAI A;  2FL7 A;  2CYZ B;  4DOV A;  1Y96 B;  3FRN A;  4F7U B;  2PVG B;  5LJ5 e;  4M77 B;  2EQU A;  1K8A U;  2DZ9 A;  1BI2 A;  4L5G A;  2E1H A;  4IUQ A;  3CPW A;  5GAN 4;  3CCE A;  1BIA A;  2D6F A;  5CKH A;  2DIQ A;  2I2L A;  4EPC A;  2P0Q A;  5GAM f;  3OY9 A;  3ASK A;  5GAN 3;  3OYL A;  2LCL A;  3CBM A;  1VQ8 T;  4C8Q A;  3P8B B;  4M7A C;  1M8V A;  4HA8 A;  4A4H A;  4BDZ A;  4OGC A;  3MEW A;  5IN1 A;  3X28 B;  5LJ3 j;  2QQB A;  4JRK A;  3DLL A;  2QXF A;  2ZPE B;  1QP3 A;  1XQH A;  4TVR A;  4C92 F;  3S3N A;  3CCS T;  2VGN A;  3MET A;  3JCM W;  4OGE A;  3L2W A;  3MP8 A;  3UPU A;  1VQ9 A;  4C5H A;  4BI3 A;  1VQL A;  5GAN 8;  2RI2 A;  4GLK A;  1KC8 U;  3ZFJ A;  2EAY A;  4M78 B;  3R6O A;  5L8R E;  1OI1 A;  3M54 A;  2XD0 A;  3CME A;  2HBP A;  5LL6 S;  5KCH A;  4PJO E;  5CKB A;  4J7I A;  3JCM e;  1VQM A;  4RG2 A;  2ZPG B;  3EFR A;  3CPF A;  4J83 A;  4N4I A;  1RL2 A;  1G3W A;  4BUG A;  3L2R A;  2HQE A;  3A8L B;  4C8Q D;  5GMK l;  2O4X B;  2OTJ T;  3OS0 A;  4OF1 A;  1NJI C;  1VQN T;  2V8J A;  2RH2 A;  5GAN 6;  4JRQ A;  3E1S A;  4M7A A;  4FSX A;  5KE2 A;  3DKM A;  4QQD A;  2O01 E;  1KQ2 A;  3NTH A;  3G6E A;  2VXE A;  2RM4 A;  3FEO A;  2PUO B;  2WSE E;  4DQ2 A;  3LGF A;  5A0D A;  3LGL A;  2X4J A;  4OB1 B;  2XK0 A;  3CCV T;  1WJS A;  4O5V A;  1BKB A;  2F5K A;  5LJ5 f;  3MP1 A;  2JOY A;  2Y4X A;  4RCB A;  1K9M C;  1VQ7 T;  1UEB A;  2E12 A;  3M5A A;  4M75 G;  5GMK i;  1VQ5 T;  4C92 E;  2L8D A;  4BI8 B;  3RER A;  3CXC S;  2JZ2 A;  2ZPH B;  3MEA A;  2FHD A;  5HK0 A;  1P92 A;  3QO3 A;  4PJO B;  4MZP A;  4E7L A;  4B9X A;  4M7A D;  5GAO r;  4ZTJ A;  3NTI A;  3GF5 A;  3A5Z B;  4OMF B;  1YJW T;  2K3X A;  4HCC A;  3G4S T;  3LYI A;  5FRM A;  2K2V A;  1Y07 A;  2RHY A;  5GAO q;  3JCM P;  1G5V A;  3HPW A;  5D6Y A;  2IVW A;  1KQS S;  2DPP B;  3JB9 F;  2VC8 A;  4VUB A;  4XAX B;  5LJ3 h;  4RMO A;  3P8D A;  3RMS A;  4PLI A;  1YHQ T;  4XU3 A;  3JCM c;  5A2Q E;  1GXI E;  1KQ1 A;  1NJI U;  1UB4 A;  3CXC A;  1YI2 A;  3JCM f;  3OB9 A;  3M57 A;  3VJP A;  5GAN 2;  5FRO A;  1IZ6 A;  1KD1 C;  1G3S A;  4C5G A;  5FU6 B;  3PMI A;  2CZ1 B;  2VUB A;  3QJ6 A;  2MI6 A;  4J8O A;  3OYY A;  4C92 A;  4A54 A;  3I56 T;  3PGG A;  3TEE A;  3CCR A;  4N4G A;  1OYX A;  1U1T A;  1KQS A;  5CQX A;  4L6V 5;  1G3Y A;  4FU6 A;  2EQJ A;  3HFO A;  1VQ6 T;  3FC3 A;  1RI0 A;  2E65 A;  2XDP A;  3OYB A;  1KG1 A;  1G3T A;  3LWH A;  4XTV A;  4BI4 A;  5CKF A;  4JS5 A;  3WXM B;  4NL3 A;  1K9M U;  1M1F A;  3OYD A;  3CC7 T;  4X34 A;  5CIU A;  3SDZ A;  4M7D F;  3CCJ T;  2K5I A;  1YIJ T;  1QW1 A;  1DJ7 B;  1I8F A;  2KVQ G;  4A4F A;  3QSU A;  5GAN d;  1O9S A;  4C8Q E;  4QVZ A;  4JRI A;  1QVP A;  2A7Y A;  5A0G A;  5IT9 E;  3CMA T;  4N4H A;  4MDX A;  4LDV A;  4M78 C;  4XU2 A;  3C95 A;  1EIF A;  2B8A A;  2DJZ A;  3TRE A;  4E7J A;  2E41 A;  4N0A A;  3JB9 J;  3JCM b;  1B34 B;  3FLG A;  3CC4 T;  3PNW C;  2M1H A;  1M90 C;  3GLX A;  2E6N A;  2RK2 A;  3E19 A;  3INZ A;  1TH7 A;  4M75 F;  1NZ9 A;  4Q5W A;  3HRU A;  2CKK A;  5I2M A;  5CK9 A;  3SB2 A;  4WF2 A;  2QEX T;  1QVF S;  2K5L A;  3M56 A;  4M7D C;  4IUR A;  4OB2 B;  2P0K A;  3OYE A;  1YJ9 A;  1PSF A;  2ZPI B;  5FU7 C;  2XG8 D;  4EMK B;  4ZN1 A;  5DM7 R;  2M0O A;  2YHT A;  3BDU A;  2QA4 A;  1N6A A;  3QPH A;  1ZBX A;  5GAO m;  4R55 A;  1VQ8 A;  2RA2 A;  1KHI A;  4BE0 A;  1XTD A;  3HSB A;  3HRS A;  3VUB A;  3HKS A;  4JDS A;  3MCA B;  1WJR A;  2MF2 A;  4RG8 A;  5GAN j;  4F7U G;  2X4W A;  2VXF A;  4XTY A;  3V8L A;  4M77 G;  1FX7 A;  3J81 E;  4M75 C;  4F7U A;  2DD5 A;  4Y28 E;  1Q86 C;  1QVF A;  3OQ5 A;  4M7A E;  1AHJ B;  1BIB A;  1N8R U;  3BY7 A;  3JB9 G;  2GCX A;  1VQO T;  3TU4 K;  3NFC A;  4C8Q B;  3RKX A;  3KUF A;  4XTZ A;  5GAM g;  3CD6 A;  3P8H A;  3G71 T;  4LDX A;  2CGH A;  3SD4 A;  1YJN T;  1D3B A;  2QQ9 A;  4EMG A;  2DXC A;  3I55 A;  5GMK j;  1Y7X A;  3OS5 A;  3A8G B;  2KMT A;  4LD9 K;  1JB0 E;  2Y90 A;  5CCA A;  4KT0 E;  5LJ3 e;  2EJG A;  2CZ6 B;  4IUP A;  2MMP A;  3A8O B;  4BY6 B;  4M78 G;  4QVD A;  3JAM E;  5GAO n;  3LWI A;  2X4X A;  3V7R A;  1WNL A;  2QTX A;  2E70 A;  1WQ7 A;  2RJD A;  3C12 A;  1S72 A;  5KE3 A;  2CZ0 B;  4L59 A;  3L2Z A;  3WVD B;  3M53 A;  4XTW A;  1YIT A;  3SWN C;  3C4S A;  4M7D B;  3CC2 A;  2L89 A;  2DEQ A;  3BW1 A;  4IUU A;  3KBG A;  3M59 A;  4C0D C;  1NPR A;  2C06 A;  4X9C A;  3VU3 C;  1PSE A;  4M7D G;  4FIB A;  5CR2 A;  3JB9 D;  5DY9 A;  2DXU A;  3L42 A;  4A4G A;  1VQ9 T;  2K5F A;  2KSS A;  4C5E A;  5HKC A;  4M7D A;  5J26 A;  2VYT A;  1VQL T;  3O8V A;  3MEV A;  2JNG A;  4M7A B;  5DLO A;  3PIO A;  1UGP B;  2LT4 A;  1QP2 A;  2GFA A;  3JCM V;  3S6W A;  1BI3 A;  3HHT B;  3QZ5 B;  3QYG B;  1VQ5 A;  2RJC A;  4HT9 A;  1FXX A;  4LDW A;  3OBW A;  3PFS A;  1Q86 U;  1VUB A;  4ME7 A;  3S3O A;  5FRN A;  4CRI A;  3CBO A;  5GAM d;  3E9F A;  1N9R A;  3BDL A;  3HL8 A;  2DIG A;  3TCJ A;  3ZEH A;  2VGM A;  1V29 B;  2DTI A;  4ZGD B;  3QII A;  2RO0 A;  3G4S A;  4M75 A;  2LQK A;  5LJ5 g;  1UGS B;  2LX9 A;  4F7U F;  5HK3 A;  4KBM B;  2H3J A;  4D6W A;  4M77 F;  5GAN h;  3PTA A;  1VQK A;  2ZPF B;  2V8I A;  4EDU A;  3H6Z A;  1W4S A;  3QYH B;  3UWN A;  3G6E T;  4JRP A;  3S3M A;  1M1K C;  2BIV A;  2JTM A;  2K3Y A;  4PJO G;  1YHQ A;  1XOV A;  2WSF E;  3OYM A;  4M7D D;  1Y71 A;  2RI3 A;  4DA4 A;  1QVG S;  3DB4 A;  2KAF A;  3PMT A;  3QG1 A;  4P5N A;  1UGR B;  3OSS C;  4PL6 A;  3CCU A;  2OTL A;  2KQW A;  1M4Z A;  5LJ3 f;  5FLX E;  4QQG A;  2F5T X;  2LRQ A;  3DLM A;  2RB6 A;  2EYQ A;  3VKI A;  5I21 A;  4KUD K;  1YBY A;  2ZPB B;  3OSV A;  1Q7Y C;  3GNG A;  3CCM T;  4M77 C;  2EQK A;  5GMK h;  5GAM j;  2CZ7 B;  3OW2 S;  3JB9 H;  3JSC A;  2LQ8 A;  3CCQ A;  4NL2 A;  1VQ6 A;  2KK4 A;  2RHI A;  2XKO C;  3UT1 A;  4M75 D;  4NS5 A;  2EIF A;  3OMC A;  3G7Z A;  4M78 F;  4CI0 C;  3HP9 A;  1KHC A;  1WJQ A;  3SWN A;  4R56 A;  2YLB A;  2IG0 A;  1QVG A;  3JCM g;  1Q81 C;  3CCL T;  3OYN A;  2XDB A;  2K4Y A;  4IKF A;  5DLQ E;  4C92 B;  4JLG A;  2LNV A;  3VUZ A;  5HY6 A;  3QKJ A;  2XDD A;  2HQX A;  2XU8 A;  4QW2 A;  4QQ6 A;  1I81 A;  1K8A C;  1JJ2 S;  3RMQ A;  2PU9 B;  3ME9 A;  1OZ3 A;  5C6S A;  3OW2 A;  3VYH B;  5KH6 A;  5LJ5 d;  4BB7 A;  1VQ4 A;  1YI2 T;  4O6J A;  2LTO A;  3CC4 A;  2QI2 A;  3HRT A;  2ZCF B;  4F7U E;  4BDY A;  2PVD B;  2PQW A;  2BUD A;  2R58 A;  4JLI A;  5KCO A;  3RKW A;  4E7I A;  1VQP A;  1YCY A;  3OYK A;  3M55 A;  4XU0 A;  5AYF A;  4V2S A;  1M1K U;  1UGQ B;  3X26 B;  3X24 B;  3CCR T;  3A8M B;  1VIF A;  5CQY A;  4BD3 A;  2LDM A;  2DXB A;  1WGS A;  4J6Y A;  2PVO B;  3V7C A;  2JVV A;  3LH0 A;  3RES A;  2BKD N;  4Z02 A;  3V7S A;  3J80 E;  1JJ2 A;  1X01 A;  3QHS A;  3CEY A;  3VV0 A;  2DTO A;  1KD1 U;  2D9T A;  1Q7Y U;  4EMH A;  1N27 A;  2L5Q A;  3M4G A;  3OYI A;  3AHU A;  4PJO F;  2QQS A;  5LJ5 j;  4XQ3 A;  3BFM A;  2DXT A;  2DD4 A;  2KY9 A;  2P4T A;  4BE2 A;  2HAX A;  2EJ9 A;  2RI5 A;  3OA6 A;  1Y96 A;  2YRV A;  3JCM d;  1R8O B;  4LDY A;  2E5Q A;  4M77 A;  5GAN 7;  3CCS A;  2RK1 A;  1Q81 U;  4A4K A;  3L2V A;  3FDR A;  3OYF A;  4XK8 E;  1YJN A;  4LD6 A;  4NOY A;  3V8J A;  3GPL A;  2XI9 A;  4ZGJ B;  1ZQ1 A;  2R57 A;  2X35 A;  5GAN e;  3F70 A;  5GAO l;  4JS4 A;  4M7D E;  3MEU A;  3QJY A;  5GAM h;  1I4K 1;  3LW5 E;  3GNF B;  1X75 C;  4MML A;  1BI1 A;  2DVE A;  2LVM A;  2DZC A;  4MMK A;  3UDC A;  1JRI A;  4C8Q G;  4ATO A;  4PJO C;  4MZM A;  3KXT A;  2QA4 T;  2JN0 A;  3CCE T;  4J6X A;  1MHN A;  4E47 A;  1D3B B;  2OTJ A;  4OB0 B;  1H64 1;  2E10 A;  2MWO A;  3GIB A;  4X9D A;  2EFI A;  1VQN A;  1M90 U;  3PT9 A;  1SSF A;  4C0Z A;  2PUK B;  4PNO A;  3H8Z A;  4M75 E;  5D6X A;  3QUI A;  5GMK m;  4E7H A;  3OBY A;  4M78 A;  5EG2 A;  2XID A;  4M77 D;  2A3L A;  5GMK e;  2LCC A;  5GAO p;  4Y91 A;  2RHZ A;  3MHX A;  2EQM A;  3L1A A;  2EWN A;  1OZ2 A;  4GY5 A;  5FU6 C;  3A8H B;  3CCV A;  3CD6 T;  3OYA A;  4KUL A;  2O4X A;  1NE8 A;  1HK9 A;  1WQW A;  3HFN A;  1VIE A;  3RUX A;  4J7F A;  4II1 A;  3I55 T;  4MDW A;  5D6W A;  1M5Q 1;  1VQ7 A;  2HD0 A;  2E64 A;  4XTX A;  2MWP A;  3RIR A;  4KUI A;  2D0Q B;  2JUF A;  2QQR A;  3CME T;  1IRE B;  2RHX A;  3FB9 A;  4ZGE B;  4ZTF A;  1VQM T;  4LDU A;  4M7A G;  2XHC A;  4C92 C;  4OB3 B;  2E6Z A;  1W2B S;  3ER0 A;  3URG A;  5FU7 B;  3RKY A;  2RJE A;  2XIC A;  1N9S A;  2QQA A;  5A0L A;  3VYG A;  1S72 T;  4HT8 A;  4M78 D;  3X25 B;  1YJW A;  4C5I A;  3CBP A;  4B9W A;  1YIT T;  3WVE B;  3EFS A;  3CC2 T;  2GFU A;  1XNI A;  3M4Y A;  4RCC A;  5LJ5 h;  3LLR A;  2M16 A;  1BI0 A;  2YLC A;  2WSC E;  5GAN f;  3MP6 A;  3E9G A;  2FVU A;  4M75 B;  3QDR B;  3OYJ A;  1FWZ A;  3JCM Q;  5J39 A;  3M58 A;  5CO7 A;  5M9O A;  1W2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...