1Y71A

X-ray crystal structure of kinase-associated protein b from bacillus cereus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
124
structure length
109
Chain Sequence
TFEIGEIVTGIYKTGKYIGEVTNSRPGSYVVKVLAVLKHPVQERRALAFREQTNIPEQMVKKYEGEIPDYTESLKLALETQMNSFSEDDSPFAERSLETLQQLKKDYKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of kinase-associated protein B from Bacillus cereus
rcsb
source organism Bacillus cereus
molecule tags Structural genomics, unknown function
molecule keywords Kinase-associated protein B
total genus 29
structure length 109
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08810 KapB Kinase associated protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.430 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1y71A00
1Y71A
chains in the Genus database with same CATH superfamily
3C94A 4PJOF 5FROA 4F04B 2OTJA 4X34A 4MMLA 2BE9B 3RKXA 1UHCA 2C0OA 4DEXA 1ZSZA 2QQRA 2VXEA 4IUQA 5CR2A 2X9HA 4JLGA 2PZ1A 1YHQQ 3EHQA 1WJRA 3OQ5A 2KYMA 4A4KA 2RH2A 2YHTA 1QVGP 1VQKT 1VQ6T 4MZPA 5M9OA 5GAOl 1U1SA 3GNFB 2BZ8A 3PVQA 1IO6A 1GCQA 1OV3A 3CXCP 2V8JA 2DJQA 2KEAA 2OAWA 2RQWA 3CXCS 2L89A 4PKCC 4JRQA 1NZ9A 1BI3A 3G4SA 3I55T 1SPKA 1X2QA 1WZOA 4DEYA 1WQWA 1SG5A 3J81E 3GF5A 2J06A 2CP6A 2I0NA 2QEXT 3G4SQ 3JB9I 4DBFA 3CEYA 4J5YA 2PUOB 1R8OB 2JZ2A 1ACMB 3A8HB 3QO3A 4IKFA 2B8AA 2VVKA 1W4SA 1YCSB 5LJ3g 1MHNA 2OTLT 2RHXA 2DTOA 3M0UA 4AT1B 2EQKA 5CKBA 1UUEA 3VYHB 1LPLA 4Z88A 5I21A 4ZNXA 5GAOp 4JPBW 4LUEA 4ANJA 1N8RC 3VS7A 2WACA 1TS9A 5HK0A 3QDFA 2HQHA 3NPFA 1TSFA 3D7SB 2RQRA 3J7AF 2E1HA 1YWPA 2ESWA 2G6FX 3QJYA 4NS5A 3I55Q 3PTAA 5GANf 1WXUA 3AT1B 1MV3A 1LVKA 2F2VA 5I22A 2LDMA 4XU2A 2K3BA 3RNJA 1YITQ 2L3SA 1Q86C 1AWWA 5GJVB 1ZSGA 3VS2A 3CPFA 4XTYA 5GAOq 4PL6A 4QVCA 1JJ2A 5KYNA 4FIBA 3DKMA 5CKDA 4FSSA 1QCOA 3CCVA 1VQPT 2KROA 5LJ3h 3CD6A 2KBTA 5LJ3f 1VYVA 2QA4T 2J7IA 2A08A 1B34A 2DL5A 2JT4A 2FPFA 2DMOA 2OAUA 3OYKA 3CC2Q 2YDLA 2XMFA 2D8HA 2VC8A 2PTKA 1K9MU 1VQNQ 3OYYA 3M56A 1YIJT 4X1VA 2RA2A 3KBGA 1QVFA 5GANh 4FT4A 4J9IA 3CMEQ 2FZCB 3REAB 4KH1B 2RB6A 3GNGA 1R77A 4HVVA 1SHFA 5D7UA 3TREA 1KFZA 2E5KA 3JCMe 3CXCA 2ECZA 4AFSC 3CD6Q 4F14A 5FU6C 3PIOA 1XQHA 2RQVA 4BB7A 3UA6A 3A5ZB 1N9RA 4FW1A 4A53A 2K5IA 2HQXA 1KHIA 1PG5B 2QEXA 1GRIA 1I8FA 1KIKA 3O5ZA 1PNJA 3PT9A 1HSQA 4ELZC 2X51A 2DJZA 1WX6A 2A7YA 4LDWA 3C12A 1W2BS 2KNBB 4BE0A 5C0MA 2EQIA 3N5BB 5L8RE 4ESRA 1AWJA 4Y92A 5IHIA 2E5QA 4J9DA 2XI9A 2E6NA 2RF0A 4OMQA 4BY6B 2RJCA 1W70A 4EMKC 5KH6A 1KQSP 2PVDB 4IURA 3RDVA 2E12A 4C92B 3QXEB 1GL5A 1X6BA 4II1A 4MDWA 5DY9A 4M78F 2A0FB 2EVRA 3OSSC 3CCLT 4E7LA 1XOVA 4LDVA 2DF6A 3VS0A 1TTHB 3NTKA 1D3BA 2DK3A 4QKUA 3A98A 4KT0E 2GQIA 3H8ZA 2FB7A 1OEBA 1RLQC 1N8RR 1HYOA 4M78E 8ATCB 2AZSA 5HK3A 1YCYA 2XDDA 1OU9A 2C0IA 3CCRA 1KHCA 1VQKQ 1KC8U 1MV0B 4MDXA 2RJFA 4VUBA 1YHQT 1V1CA 1V76A 2X4XA 4RTTA 3PIPA 1VYUA 2KR3A 3GIBA 1ZLMA 3JCMb 2DRKA 2E70A 4ELYC 1S72T 1RAGB 3T9NA 2X3XD 4KUIA 2BTTA 1VQ9Q 2LJ3A 2LMJA 4PJOE 1Y57A 1ZSZC 1PD1A 3OW2S 1Y7XA 1RLPC 5KE3A 2EGEA 3OY9A 4J7IA 1M1KU 2XG8D 1O75A 3CCLQ 5LJ5j 2DIQA 5LL6S 3ULRB 1B34B 1CKBA 3RUXA 4RMOA 4WCIA 4LDUA 2RM4A 1M8VA 1RABB 2BZXA 4OF1A 4M77G 2E65A 3QZ9B 2AHJB 1VQLT 2HCKA 3PGGA 1MNEA 2V26A 4NOYA 2D1XA 3WVDB 1VIEA 1Y96A 2PVGB 4N4IA 3EFOB 4M7AG 1YJNT 2JW4A 2O9SA 1KJWA 1IHVA 1RI9A 3SWNB 3JB9F 3UDCA 1K9MC 2QEXQ 3L2QA 1J3TA 1WPYA 2AZVA 1OZ3A 4PJOD 5J3BA 2DERA 2FPEA 1XJWB 1V29B 4C8QD 5GMKl 5GANg 4LN2A 2E41A 1BU1A 1AHJB 1BK2A 4JLIA 2IG0A 2DIGA 3JB9G 1K0XA 4M75B 1G83A 4C92F 4K11A 1VQMQ 3OSVA 2YRVA 5CCAA 1RADB 2K5LA 1K0SA 3CCUT 4OMMA 2DLPA 5D6WA 5LJ5f 3RMQA 2FVUA 1VQ7A 3ZL7C 3CBOA 4HCBA 2FEIA 3SHWA 2LQNA 3CPWP 4WTOB 3G71Q 1JJ2S 2DILA 1WYXA 4FCYA 3I9QA 2MI6A 1I81A 1AT1B 2BE7D 1RAIB 4CC7A 3LWIA 2LRQA 1Y07A 2EPDA 3CMET 3G7ZA 3OMCA 2L2PA 2RMOA 3JAME 1VQOT 1Q86R 3RBBB 4M7AA 1OX9A 5GAN7 4HKEA 4BDZA 2VYTA 1G3WA 2XU8A 4CI0C 2RHZA 2YT6A 3R6OA 4C92E 5GAMj 1NBEB 1U5SA 1X01A 5GJWB 1R0BG 3RR6A 2YUQA 3BDUA 1IB8A 4E7SA 4Y91A 4X9DA 3HP9A 1EIFA 3C95A 4GLMA 2L3PA 1YJNQ 2F2WA 2AK5A 2RJEA 2X3WD 2DZ9A 1WHMA 1OYXA 1MUZA 2LCSA 2ED0A 3M0TA 4KBMB 2FRWA 3CCMQ 2VWFA 2YUOA 1YBYA 1RAHB 4C92A 1YI2A 1M2OA 1TUGB 1W6XA 2JM9A 4TVRA 1JBMA 2ZPHB 2DYBA 5GMKm 9ATCB 3EH1A 1UGVA 1BCMA 3UT1A 1OOTA 5GAN3 2CUBA 3I56A 8AT1B 3EGXA 1TOVA 1AZEA 1HK9A 4C5GA 2K7AA 4XU3A 2NUTA 3RIRA 4FU6A 4NL2A 2DD5A 4XU1A 1TXQA 3PNWC 3JCMV 1SSHA 1U06A 2CUDA 2P4TA 4R55A 1VQ4T 3SWNC 2RQTA 1QMCA 4XTWA 4R0KA 1VQMA 3CMAA 1X6OA 5GAN5 3REBB 7AT1B 3CCJT 1K73U 1VQ5A 3HRTA 1WHGA 2K2VA 3CC2A 3CC7T 2FZGB 2MYSA 3JCMd 5IHKA 5GAMf 1MMGA 3VV0A 1OU8A 4N4GA 3QIIA 4J6YA 1FYNA 3BW1A 1Q7YR 4PJNA 1H3HA 2KVQG 1WJQA 3JB9H 2LJ1A 3QWYA 4GLKA 1TUCA 2Y4YA 2RO0A 1M1GA 4GY5A 1B3QA 1SF9A 2CS7A 2KYBA 4FL6A 1VQNT 1EZZB 4L5GA 1VQLQ 4BACA 2ZPBB 2XKOC 3THKA 3CQTA 3PE0A 3CCSQ 1YI2Q 2CP5A 2O9VA 4LNPA 1NE8A 4LXCA 1H641 3X20B 2W10A 1ARKA 4RTUA 2M0OA 4C92G 2CT3A 2EQJA 3HRUA 1QWEA 3P8BB 2LTOA 2ATCB 1X69A 3QKJA 1ZX6A 1QVGS 3I55A 4JZ3A 2L8DA 3TQ7P 1GXIE 1PSFA 1T0JA 2JVVA 4C8QA 1JXMA 3MP1A 2O88A 2EYYA 3JCMX 1GBQA 1U8RA 2EGCA 4RCCA 2QDLA 3L2VA 2E3IA 1YJNA 3NTIA 4OB1B 5I11A 4PJLA 1VQ4Q 1VQ8Q 1WIEA 2DPPB 2OTLA 5LJ5g 2JTMA 2HQEA 2V8KA 4L6V5 3LW5E 3A8LB 3VS5A 4E2FB 1VQ4A 2GQVA 2EBPA 1Z9QA 1WA7A 4QQGA 1MMAA 5KYXA 2QTXA 4JRKA 2OX7A 1EFNA 1TH7A 1TUDA 4BI3A 1WNLA 3CC7Q 4FSXA 3QHSA 1BCOA 2DEQA 4C8QB 2HAXA 1QVFP 4BE1A 4UC4A 1PHTA 2K5FA 4PLLA 4HCZA 4IUVA 4PJOB 1GFCA 2L3QA 4BY6C 3H41A 2AKLA 4HT8A 3E2UA 3HL8A 1JXOA 2GFUA 1RI0A 2MK5A 1Q7YU 3MEAA 1KSWA 5CK9A 2DXBA 4C8QC 5GMKh 2FPDA 4IUPA 4E7KA 3QBYA 2GTJA 2PNIA 3A8OB 1LJOA 1EX4A 1C6VX 4A4GA 4RKUE 2LT1A 3RERA 1VQ9A 4BUGA 2R57A 2DRMA 2JM8A 3INZA 3MP8A 1VQOA 4BDYA 3CCRT 3PMIA 2BZYA 1Q81U 4JRIA 5J39A 1R0CB 3EFSA 3RMSA 1VQ9T 2R5MA 4C5EA 1VQ8T 3TSZA 2H3JA 2E6ZA 5IHNA 1ZUKA 1PWTA 3ZEHA 3EFRA 3L1AA 5AYFA 4BI8B 4C0ZA 4B9WA 5GAN8 1VQLA 2FZKB 3JCMJ 1KQ1A 2HSPA 5KYUB 1TG0A 2DKGA 2F69A 4D6WA 1U3OA 1BKBA 1H8KA 4J7FA 3E9GA 3G6EA 2CH4W 3M58A 1BIAA 4IIOA 3NGPA 2LX9A 2KDSA 3FIFA 1W2BA 2YRDA 4M4ZA 1KK7A 3V8JA 2H3EB 3MPUB 2AIRB 4CRIA 4JZ4A 4M75G 2HL5C 1N8RU 1YP5A 1Z9ZA 3I5RA 5FWBA 2RHYA 4HVUA 2LJ0A 3U23A 5GAMg 4M78D 2KT8A 4M78A 4OMPA 2VV5A 5KYWA 3LH5A 1NJIC 3GLXA 4D8DA 1PKTA 3LH0A 1QW1A 2X4WA 1Q82C 2DL8A 4C5IA 3IQLA 4DOWA 4M77A 4HCKA 5IXFA 3LWHA 4KUDK 2G3RA 1DJ7B 2J6KA 4J6XA 1OQKA 5LJ5d 1UJYA 2EYWA 4M7DE 4BI4A 1M4ZA 3OMGA 1C0MA 4PJJA 1WXBA 2P84A 1WFWA 2BUDA 2JS0A 3ZFJA 2EYZA 1M1KR 3CCLA 3FEOA 2YLBA 4V2SA 3VUZA 3P8DA 5DM7R 3PMTA 1QP2A 3AHUA 4CC3A 4XTUA 5D6YA 4JS5A 2FHDA 2LNHB 1F1BB 1MMNA 2FO0A 1SKUB 1LOJA 2O2OA 2A3LA 1YIJA 2YRCA 2GNCA 4HT9A 3BFMA 4OMFB 2CKKA 1U1TA 2D0NA 4KGXB 1M3BA 4RTZA 2P0QA 3QJ6A 5IN1A 1N9SA 3X26B 1H92A 4M75A 4M7DF 2CREA 1AZGB 4JRPA 4JJDA 5CQXA 3M0RA 1W1FA 2DETA 3L42A 1Y96B 2AKKA 2B86A 4BE2A 2DVEA 2BIVA 1C1AA 2JNGA 2YWWA 4QT7A 3QG1A 4C0DC 2LP5A 3QPHA 4M7DD 1GCPA 3JCMc 5GANe 3UA7A 1N5ZA 2QQAA 5AT1B 3F70A 2VGMA 3QYHB 3CCSA 3L2WA 4J83A 1K8AC 4C8QE 1X43A 3JCMh 4JJNK 2KXCA 4M75E 5GMKe 2PQWA 3CBMA 3G6EQ 4J6WA 4EMGA 1YITA 4ORZA 5A0GA 1QVGA 3HFOA 1ZUYA 3M53A 5KYXB 1OPKA 3V8LA 3M0PA 4N4HA 1SEMA 3SFMA 2CZ0B 5LJ3e 5HKCA 4LE9A 4OGEA 1K8AU 4RTXA 3GPLA 2X4JA 4M7AE 1M30A 5GAN6 3CCVQ 3UPUA 2H8HA 3G71A 3UATA 1UEBA 1UG1A 4CC2A 1VQ6A 2KMTA 3WVEB 1UHFA 3CCJA 2OTLQ 1UJ0A 2DBKA 2JS2A 3MJXA 1X2KA 4J9FA 3ASKA 5IAYA 4HA8A 4RTVA 3FJ5A 1D0XA 5GAMd 3OYGA 4A4EA 3OYIA 2PVOB 3EG1A 2EQMA 1BYMA 1CSKA 4OB0B 2PUKB 1JB0E 3M59A 1YN8A 2COYA 3JCMf 1BI1A 2VXFA 4ZTJA 2DL3A 4C0GA 4E6RA 1SRLA 1JRIA 2EIFA 4M77D 3SD4A 5GAOm 3L2ZA 3X28B 1ZA1B 3QZ5B 2EKHA 4OMNA 4LUDA 4M7AF 1VQ7Q 2KRSA 4PK4A 2SEMA 2JTFA 4AMCA 2KE9A 2ROTA 4JJBA 3S3MA 2O4XA 5A2QE 1FX7A 3OS2A 2JMCA 4RCBA 4Z89A 1NPPA 1WXTA 1WGSA 1FMWA 1UE9A 5CIUA 3VRYA 4F7UB 4OVAA 3G1JA 2J6OA 2YLCA 4M7AD 2EYQA 1ABOA 3OYHA 4OMOA 1X6GA 1PRLC 3HFNA 1NEGA 2P0KA 5KE2A 1UFFA 2M02A 4B9XA 4RUGA 2QXFA 3CCJQ 4BD3A 1OULA 3L2RA 3UWNA 3R6NA 2V1QA 3CCQT 1WHHA 3NFCA 4XTVA 4F7UA 3X24B 1VOMA 2CGHA 2HDAA 1S72A 2XDBA 2X4YA 3OS0A 2RI5A 2HEQA 5CKFA 3VS1A 4RTYA 2ZPIB 2GFAA 4XU0A 1I07A 4M77C 1G2BA 1I0CA 2CSQA 2ZCFB 3CC4T 2QQSA 1KC8C 3FJPA 2EAYA 2YUNA 2CZ7B 2O01E 1G8XA 5GAN2 2LT4A 4PFOA 4EPCA 2RI3A 3OS1A 1G5VA 2WSEE 3EG0A 4C0FA 2QQBA 2KK4A 1ZBJA 1D09B 4KGVB 1GFDA 1YWOA 3ME9A 2GBQA 2IVWA 2EFIA 2CZ1B 4DBQA 4O6JA 1I5LA 3CCUA 4AFZC 1G3SA 2MF2A 2CYZB 1UECA 3OA6A 1YJWA 3OYFA 1RAEB 3LLRA 2WSCE 4N0AC 3HRSA 2HZYA 1B7TA 1E7OA 3RESA 2EYXA 1VYTA 1H3ZA 2F2XA 5GAN4 1D1BA 5KYYB 1K76A 3PFSA 1VIFA 3J80E 1ZBXA 4XK8E 4M7DC 2Y4XA 5CQYA 2VASA 3M4GA 4QW2A 3X25B 1KD1U 4WF2A 2MOXA 4F7UE 1NLPC 3G71T 3G6ET 2YUPA 1N27A 1WDXA 1AVZC 3CCMA 3M5AA 5FU7C 2LCLA 5A0LA 2KXDA 1ZA2B 1K1ZA 3FLGA 3TU4K 1IRXA 1JQQA 4L59A 2QDYB 1Y0MA 1VA7A 2LQ8A 4ZGDB 1JEGA 2HMAA 1Q7YC 1YJ9Q 3TVTA 2E4HA 3CC7A 3CC2T 2KT1A 2LCCA 1X27A 5CAIA 1BI2A 4F16A 4D8KA 2JOYA 3E19A 1TWBA 1MMDA 2MWPA 1AD5A 2I2LA 2RNAA 2ZAEA 3FB9A 1NJIR 4FYVB 2JXBA 2A28A 3HHTB 3VKIA 3MKDA 3BDLA 1LNXA 2QA4Q 2AT1B 2M1HA 2QYZA 3MHXA 1LCKA 4C0DB 1FWZA 3OYDA 2LVMA 1K9MR 1M5Q1 2HKNA 2YXYA 4M78C 4RG8A 3EG2A 2E3HA 3FRNA 4M78G 1Q81C 4M77B 3V8KA 3OW2P 2QGGA 3NMZC 3H0FA 3MO8A 4NL3A 3BY7A 4M7AC 3C0CA 1M8MA 3V7RA 3A8MB 5KYWB 3HSBA 2P4RA 5FW9A 1PM3A 4ME7A 2JJ9A 3M55A 1K73C 1M3AA 4ZGEB 2ABLA 4P5NA 2LZ6B 3M4YA 3G4ST 1ZQ1A 3QUIA 1VQNA 1BI0A 4AG1C 5GMKj 3KXTA 4J9HA 1T3LA 2KRNA 5LJ3d 5L23A 1PRMC 4M7AB 4FYWB 3QSUA 5ECAA 2L0AA 1YFNA 1KG1A 1WHLA 2DXUA 5EG2A 2E10A 1VQ8A 4MZTA 1AWXA 2DL7A 5CO7A 2O31A 1PKSA 3I35A 4OGCA 4XQ3A 3CCQQ 2QA4A 2MMPA 3TCJA 2KSSA 3C4SA 1VQOQ 2FG0A 2EJ9A 3EH2A 5GAOn 1JO8A 2CZ6B 2EWNA 2QGFB 3I56Q 2DA9A 3HTRA 5KCOA 4AFUC 4O5VA 4N0AA 1WHKA 4M77F 2VGNA 3VUBA 1KD1R 2EQUA 3CCEA 2CP2A 1I1JA 1MGQA 4E7IA 2XDPA 3E9FA 2FYKA 3OYCA 4C92C 2C06A 5IXBA 2DXCA 3URGA 2CP3A 1QCFA 2OJ2A 1HXDA 2XK0A 1FXXA 2KRMA 4QQDA 4DQ2A 4DOVA 4M7DG 2D0QB 1D1AA 6AT1B 2NWMA 2F5KA 3CPWA 2XD0A 1NEBA 4ZN1A 4E7HA 2ENMA 3EG9A 3CPWS 1JU5C 4ZN3A 1IREB 1KQ2A 4PJOA 3A8GB 3QYGB 2YSQA 4XAXB 1S1NA 3CC4Q 3DB4A 4QQ6A 2MAMA 3DB3A 2MCNA 5GMKi 2K3XA 4E47A 5FU7B 2O4XB 3I56T 3LGFA 1Q86U 2ROLA 4DA4A 2QAZA 3EFOA 2DM1A 2RI2A 2E64A 2M51A 1SSFA 5FRMA 3GOXA 2ZPEB 3OB9A 2OTJQ 4XTXA 2JTEA 2NLUA 1W2BP 4IIMA 3H0IA 5FU6B 1QP3A 2ZGWA 2DZCA 3MP6A 5I2SA 4M7DB 3S3OA 4M75D 3CD6T 3LYIA 1AOJA 2QQ9A 4EMHA 2JN0A 2P0PA 1QWFA 1XNIA 4R56A 3OYBA 2OI3A 1K8AR 2QG9B 2R58A 5CVIA 2CT4A 3UF4A 4M75F 4M7DA 4PFPA 1M1KC 3OYNA 2IIMA 3NTHA 2BKDN 2RJDA 2KAFA 1OZ2A 1QKWA 3MEUA 2SRCA 2V8IA 2RN8A 1JJ2P 2K4YA 4EDUA 4A4HA 4FW2A 3QWXX 2K79A 3KFVA 1YJ9T 4KH0B 2NYSA 3CMAT 2CP0A 3OS5A 3Q1JA 4F17A 2KQWA 2VUBA 1B07A 3GP8A 2PU9B 3M0QA 1QVFS 4Y28E 3GBQA 2ZZDA 4M77E 3JCMW 1IXDA 2Z0WA 2MWOA 1A0NB 2D6FA 5C6SA 4F7UG 3H9NA 1NJIU 4AFQC 2EJFA 3MCAB 3H6ZA 3M9QA 1E6GA 4E7JA 2L5QA 4KULA 1P92A 1QVPA 2COWA 1TU0B 4JDSA 1YJWQ 3JRZA 1NYFA 3FDRA 1KQSA 1M2VA 1PCXA 2J05A 2OTJT 4FM4B 3EHRA 2LNVA 4HVWA 1GBRA 1K4US 1D1CA 3VJPA 2K6DA 3VS4A 4LD9K 4PFZA 3OYMA 3LGLA 3QDRB 3S6WA 1D0YA 3VU3C 3CCEQ 5CKEA 4E7ZA 4OB2B 2M9UA 2DTHA 4OB3B 1N6AA 5KCHA 1M3CA 4HXJA 3CCMT 3OYLA 4B6MA 2F5TX 3EGDB 3NHNA 4J9EA 1IGUA 2XICA 5IT9E 3MEWA 3S3NA 4JJCA 3V7CA 4KGZB 4LDYA 1YJ9A 1ZSZB 1QKXA 2CH4A 1KQSS 2QI2A 5CKHA 4F7UF 3EGUA 4PLIA 4LDXA 1BIBA 2M0YA 3VS3A 2C0TA 1ZHIA 2DNUA 2QK0A 2VB6A 1I5OB 1RACB 2J6FA 3DLLA 4A54A 3CCET 4M78B 2A37A 1WI7A 3VYGA 2LC4A 4FYYB 4X9CA 3JCMP 2EKOA 1IGQA 3OYJA 1M90C 3JSCA 1BB9A 2FRYA 1KC8R 4GBQA 5EC7A 4Q5WA 4PNOA 1YITT 5HCKA 2EGAA 4ATOA 4A63B 1VQ6Q 1YJWT 1YIJQ 1D0ZA 2DXTA 2NUPA 5GANd 5DLOA 2GF7A 2HBPA 2LX7A 3JCMQ 4C8QF 3HPWA 3M0SA 1M2VB 2KI7A 1VQPQ 1NLOC 3EGDA 3M57A 2DD4A 5KYUA 2RQUA 3L2UA 1PC0A 4Z8AA 1ZUUA 5D6XA 1RAFB 1M9SA 2HBWA 3MEVA 4ZGJB 2D8JA 4OP0A 1AEYA 2M16A 3HKSA 3OBWA 1VQKA 2DEUA 2COZA 2DAQA 3TSWA 3DLMA 4YTLA 2DTIA 4C8QG 3E1SA 2CDTA 1KD1C 3META 2DYIA 1M90U 2KY9A 2K2MA 1I4K1 2EJGA 3SWNA 5GAMh 4J9GA 2MIOA 3JB9D 1QCNA 1GCQC 1G3YA 5GANj 3OW2A 4DBHA 3TEEA 1ABQA 2V1RA 3OYEA 2RPNA 3WXMB 2CSIA 2HNIA 2RK1A 4DBRA 5HY6A 1Y71A 5LJ5e 1M90R 3JV3A 1RUWA 4HCCA 2DX1A 1PSEA 4ZTFA 3H0HA 3FC3A 1E6HA 1UGRB 4JUVA 4MZMA 1RL2A 1VQ7T 1O9SA 4M75C 1UTIA 4Z02A 4CC4B 4PJMA 4QVZA 5LJ3j 1S72Q 1T3SA 2MPXC 2X35A 2DO3A 3CCQA 2A36A 1CKAA 1MNDA 2GCXA 1NPRA 1VQ5T 3RKYA 3SDZA 2L3RA 1UDLA 3KUFA 4IUTA 3OYAA 5KYYA 1T0HA 1WHJA 1IHWA 3RKWA 4LD6A 2DFUA 2ED1A 3O8VA 1Q82U 1YHQA 1HD3A 2K9GA 2WSFE 1FMKA 4A4FA 2XHCA 1HJDA 1YNZA 1FMVA 1SRMA 3I5SA 2RHUA 4KRTA 1WQ7A 5A0DA 1OX8A 1IZ6A 1NG2A 4J9BA 5FWCA 2RHIA 2W0ZA 1NYGA 3CCVT 1VQPA 1VUBA 5J26A 2GGRA 2HSEB 2CP7A 2NUZA 2RD1A 2ZPFB 5IH2A 3JCMg 4JS4A 2ZPGB 1D3BB 3VRZA 2DVJA 2KGTA 4FT2A 1VQMT 2DL4A 3CCUQ 3CCRQ 1AWOA 2XIDA 2JMAA 5FLXE 4RG2A 4EMKA 2DBMA 1WLPB 4QVDA 3CMAQ 2VKNA 1K73R 5GAOr 2DE0X 4XTZA 1M1FA 4J9CA 5FRNA 1XTDA 1OI1A 4EIKA 1OPLA 2K3YA 1VQ5Q 3CC4A 3SEMA 2RK2A 4IUUA 4J8OA 3CCST 3CBPA 5LJ5h 3EG9B 4RTWA 1SHGA 2JUFA 1QLYA 4PJOG 4AG2C 3PVLA 1UGSB 3CMEA 4C5HA 3ZBDA 5GAMe 2QASA 5DLQE 2NUTB 1Q82R 3M54A 2GTOA 3EGXB 2QTVA 1NM7A 1UB4A 2F1LA 1G3TA 4FYXB 1YI2T 3VS6A 4OMLA 3EAEA 1WJSA 3ER0A 2LQKA 3JB9J 1Q81R 3EG3A 2NUPB 3OBYA 1RAAB 2IPOB 4EMKB 4C92D 2EW3A 3BE3A 2Y90A 4MMKA 4PJOC 2HL3A 5I2MA 1M27C 1X75C 1UGPB 2HKQB 3SB2A 3P8HA 1QQJA 2FL7A 1UGQB 2R5AA 2D9TA 2K57A 1BBZA 1K9AA 3V7SA 1Q95G 2HD0A 1PD0A 3LX7A 2LQWA 3A1PA
chains in the Genus database with same CATH topology
3C94A 2JN0A 4PJOF 2P0PA 5FROA 1XNIA 3ASKA 5IAYA 1X01A 2OTJA 4X34A 4HA8A 4R56A 3OYBA 4MMLA 3RKXA 5GAMd 3OYGA 2R58A 4A4EA 3OYIA 2PVOB 5CVIA 2EQMA 2QQRA 1BYMA 3BDUA 2VXEA 4Y91A 4OB0B 4IUQA 4X9DA 3HP9A 2PUKB 1EIFA 3C95A 4M75F 5CR2A 4JLGA 4M7DA 1JB0E 1M1KC 1WJRA 3OQ5A 3M59A 4A4KA 2RH2A 2YHTA 3JCMf 3OYNA 1BI1A 2RJEA 2BKDN 2RJDA 3NTHA 1VQKT 2VXFA 4ZTJA 1VQ6T 2KAFA 1OZ2A 3MEUA 4C0GA 2DZ9A 4MZPA 5M9OA 1OYXA 1JRIA 2V8IA 5GAOl 1U1SA 2EIFA 2K4YA 4M77D 3L2ZA 3SD4A 3X28B 4KBMB 3QZ5B 5GAOm 3GNFB 4EDUA 4A4HA 1YBYA 4C92A 4M7AF 1YI2A 1K73U 2V8JA 1YJ9T 2JTFA 4TVRA 1JBMA 2ZPHB 3CXCS 5GMKm 2L89A 2O4XA 3S3MA 4PKCC 5A2QE 1FX7A 3OS2A 4JRQA 1NZ9A 1BI3A 3G4SA 4RCBA 3I55T 3CMAT 1NPPA 3UT1A 1WGSA 5GAN3 3I56A 3OS5A 3Q1JA 5CIUA 4F7UB 2KQWA 4OVAA 2VUBA 1HK9A 3GP8A 2PU9B 2YLCA 4M7AD 4C5GA 1WQWA 1QVFS 4XU3A 4Y28E 3J81E 2ZZDA 2EYQA 3GF5A 2QEXT 4M77E 3OYHA 3JCMW 3JB9I 3CEYA 2MWOA 4J5YA 3HFNA 2PUOB 3RIRA 4FU6A 4NL2A 2DD5A 2P0KA 4XU1A 1R8OB 3PNWC 5KE2A 2JZ2A 3QO3A 3A8HB 3JCMV 4B9XA 2D6FA 2P4TA 5C6SA 4F7UG 4IKFA 2QXFA 4R55A 1VQ4T 1NJIU 2B8AA 3SWNC 2EJFA 1W4SA 3MCAB 3H6ZA 4BD3A 1MHNA 3M9QA 5LJ3g 2OTLT 4XTWA 3L2RA 1VQMA 2RHXA 3UWNA 2DTOA 4E7JA 3CMAA 1X6OA 5GAN5 1VQ5A 2L5QA 4KULA 3CCJT 1P92A 2EQKA 1QVPA 3HRTA 3NFCA 5CKBA 3VYHB 2K2VA 5I21A 4JDSA 3CC2A 4XTVA 3JRZA 5GAOp 3CC7T 3JCMd 4F7UA 5GAMf 1N8RC 3FDRA 3VV0A 3X24B 1KQSA 2CGHA 2WACA 4N4GA 1S72A 2OTJT 3QIIA 4FM4B 4J6YA 3BW1A 2LNVA 5HK0A 2XDBA 2X4YA 2KVQG 1WJQA 3OS0A 3J7AF 2RI5A 3JB9H 3VJPA 2E1HA 4GLKA 5CKFA 4LD9K 2Y4YA 2RO0A 1M1GA 4GY5A 2ZPIB 2GFAA 3OYMA 3LGLA 2CS7A 3QJYA 4FL6A 4NS5A 4XU0A 5GANf 3PTAA 3QDRB 1VQNT 3S6WA 4M77C 4L5GA 4BACA 2ZPBB 3VU3C 5CKEA 2XKOC 2ZCFB 2LDMA 4OB2B 4XU2A 3CC4T 2QQSA 2M9UA 1NE8A 1KC8C 2DTHA 4OB3B 3FJPA 1N6AA 2EAYA 5KCHA 1H641 3X20B 1Q86C 2CZ7B 2M0OA 2O01E 4C92G 3OYLA 5GAN2 2EQJA 3CPFA 2F5TX 3HRUA 3CCMT 4XTYA 2LT4A 4PL6A 5GAOq 3P8BB 4QVCA 2LTOA 4EPCA 2RI3A 2XICA 3OS1A 1JJ2A 1G5VA 5IT9E 2WSEE 3QKJA 4C0FA 2QQBA 3MEWA 3S3NA 2KK4A 3DKMA 4FIBA 3V7CA 3I55A 5CKDA 1QVGS 2L8DA 3ME9A 4LDYA 1YJ9A 1GXIE 1KQSS 2QI2A 1PSFA 5CKHA 4F7UF 3CCVA 1VQPT 2JVVA 2IVWA 2EFIA 2CZ1B 4PLIA 1BIBA 5LJ3f 5LJ3h 4C8QA 2QA4T 4LDXA 3CD6A 4O6JA 1I5LA 3MP1A 1B34A 3CCUA 1G3SA 2MF2A 3JCMX 1U8RA 2OAUA 2CYZB 4RCCA 3OYKA 3OA6A 1ZHIA 3L2VA 1YJNA 3NTIA 1YJWA 4OB1B 3OYFA 3LLRA 2WSCE 4N0AC 3HRSA 3DLLA 2DPPB 2OTLA 4A54A 5LJ5g 3CCET 4M78B 2VC8A 3RESA 2JTMA 2HQEA 3VYGA 2V8KA 2LC4A 1K9MU 4X9CA 3JCMP 2EKOA 1H3ZA 4L6V5 3LW5E 3M56A 3OYYA 5GAN4 3OYJA 3A8LB 1YIJT 1M90C 3JSCA 1VQ4A 2RA2A 2GQVA 3KBGA 1QVFA 5GANh 4Q5WA 3PFSA 4FT4A 1VIFA 4QQGA 4PNOA 3J80E 1YITT 1ZBXA 2QTXA 2RB6A 4JRKA 4ATOA 3GNGA 1TH7A 4XK8E 4BI3A 1WNLA 1YJWT 4FSXA 3QHSA 4M7DC 2DXTA 2Y4XA 5CQYA 3TREA 2DEQA 3M4GA 4QW2A 4C8QB 5DLOA 5GANd 3JCMe 3X25B 3CXCA 2HAXA 2GF7A 4BE1A 1KD1U 2HBPA 5FU6C 4WF2A 3PIOA 1XQHA 3JCMQ 4BB7A 4UC4A 3HPWA 3A5ZB 4C8QF 4F7UE 1N9RA 2K5FA 4PLLA 4HCZA 4A53A 3G71T 3G6ET 4IUVA 4PJOB 2K5IA 3M57A 4BY6C 2HQXA 2DD4A 1KHIA 2QEXA 4HT8A 1N27A 3HL8A 2GFUA 1I8FA 3L2UA 3CCMA 1RI0A 3M5AA 1Q7YU 3MEAA 5FU7C 2LCLA 5D6XA 5CK9A 2DXBA 1M9SA 3PT9A 5A0LA 3MEVA 4ZGJB 4C8QC 5GMKh 4ELZC 4IUPA 4E7KA 3QBYA 4OP0A 2M16A 3HKSA 2DJZA 3OBWA 1VQKA 2A7YA 3A8OB 1LJOA 3FLGA 4LDWA 2DAQA 3TU4K 4A4GA 3C12A 4RKUE 2LT1A 3RERA 3DLMA 4YTLA 1VQ9A 1W2BS 2DTIA 4L59A 4BUGA 4C8QG 4BE0A 2QDYB 2R57A 5C0MA 3CCQT 2LQ8A 3N5BB 5L8RE 4ZGDB 3E1SA 1KD1C 3META 3INZA 1Q7YC 2E5QA 3MP8A 1M90U 1VQOA 2KY9A 3CC7A 3CC2T 4BDYA 4PJOD 2LCCA 1I4K1 2E6NA 2EJGA 2XI9A 3PMIA 3SWNA 5CAIA 5GAMh 1BI2A 3CCRT 1Q81U 4JRIA 3JB9D 5J39A 4BY6B 2RJCA 3EFSA 1G3YA 2JOYA 4EMKC 3RMSA 5GANj 1VQ9T 3OW2A 2R5MA 5KH6A 2PVDB 4IURA 3TEEA 4C5EA 2E12A 3E19A 3QXEB 4C92B 3OYEA 2MWPA 1VQ8T 2H3JA 2E6ZA 4II1A 4MDWA 3WXMB 5DY9A 4M78F 2I2LA 3ZEHA 2RK1A 2HNIA 3EFRA 3L1AA 3FB9A 5AYFA 3OSSC 4BI8B 4B9WA 4C0ZA 5GAN8 3CCLT 5HY6A 1VQLA 4E7LA 1XOVA 1Y71A 4LDVA 5LJ5e 3JCMJ 1KQ1A 3HHTB 3VKIA 4HCCA 3NTKA 1D3BA 2DK3A 2DKGA 1PSEA 4ZTFA 3BDLA 3FC3A 1LNXA 1UGRB 4KT0E 4JUVA 4MZMA 3H8ZA 2M1HA 1RL2A 3MHXA 2FB7A 2F69A 1VQ7T 4D6WA 4C0DB 1O9SA 1FWZA 4M75C 3OYDA 4M78E 1BKBA 5HK3A 2LVMA 4Z02A 1YCYA 2XDDA 4J7FA 4QVZA 5LJ3j 3CCRA 3E9GA 3G6EA 3M58A 1KHCA 1M5Q1 1BIAA 4M78C 2LX9A 2X35A 2DO3A 4RG8A 3CCQA 1KC8U 4MDXA 2RJFA 2KDSA 4VUBA 3FIFA 1YHQT 1W2BA 3FRNA 2X4XA 2GCXA 4M78G 1Q81C 4M77B 3V8KA 1NPRA 3PIPA 1VQ5T 3V8JA 3RKYA 3GIBA 3SDZA 3MO8A 4NL3A 3BY7A 4M7AC 4CRIA 2L3RA 3KUFA 3JCMb 4IUTA 4M75G 3OYAA 1N8RU 2E70A 4ELYC 1S72T 3V7RA 2RHYA 3T9NA 3A8MB 3HSBA 4KUIA 5GAMg 3RKWA 4M78D 4M78A 4PJOE 2VV5A 4LD6A 4ME7A 1NJIC 3GLXA 3O8VA 3OW2S 1Y7XA 3LH0A 1YHQA 1QW1A 1Q82U 3M55A 2X4WA 2WSFE 4A4FA 5KE3A 2XHCA 1Q82C 1K73C 4ZGEB 4C5IA 3OY9A 4J7IA 1M1KU 2XG8D 1O75A 4DOWA 3M4YA 4P5NA 5LJ5j 2DIQA 4M77A 1ZQ1A 2RHUA 5LL6S 3G4ST 1B34B 3QUIA 1VQNA 1BI0A 1WQ7A 3RUXA 5GMKj 3LWHA 4KUDK 2G3RA 1DJ7B 5A0DA 4J6XA 4RMOA 3KXTA 1IZ6A 5LJ5d 4LDUA 5LJ3d 2RHIA 2RM4A 4M7DE 1M8VA 4BI4A 3CCVT 4OF1A 1VQPA 1VUBA 1M4ZA 5J26A 3OMGA 4M77G 4M7AB 3QSUA 2E65A 2BUDA 3QZ9B 3ZFJA 2RD1A 1KG1A 2ZPFB 2AHJB 3JCMg 2DXUA 5EG2A 2E10A 2ZPGB 1D3BB 4JS4A 1VQ8A 1VQLT 3CCLA 3FEOA 2YLBA 4MZTA 4V2SA 3VUZA 3P8DA 4OGCA 5CO7A 4XQ3A 4FT2A 5DM7R 2QA4A 1VQMT 2MMPA 3TCJA 3PGGA 3PMTA 1QP2A 3AHUA 2KSSA 3C4SA 4NOYA 4XTUA 2EJ9A 2XIDA 5D6YA 3WVDB 4JS5A 1VIEA 1Y96A 5FLXE 4RG2A 5GAOn 2FHDA 2CZ6B 2EWNA 2PVGB 4EMKA 4N4IA 4QVDA 4M7AG 5KCOA 1YJNT 5GAOr 4O5VA 4N0AA 1LOJA 4XTZA 1M1FA 2A3LA 1YIJA 4M77F 3SWNB 3JB9F 2VGNA 3UDCA 1XTDA 3VUBA 5FRNA 4HT9A 3BFMA 1OI1A 4OMFB 2EQUA 1K9MC 3CCEA 2CKKA 2K3YA 3CC4A 1U1TA 3L2QA 2RK2A 4IUUA 4J8OA 1WPYA 1MGQA 1OZ3A 4E7IA 2XDPA 3E9FA 2FYKA 5J3BA 3OYCA 4C92C 3CCST 2P0QA 3CBPA 2C06A 3QJ6A 5LJ5h 5IN1A 2DXCA 1N9SA 3URGA 3X26B 1V29B 4M75A 4M7DF 1HXDA 2XK0A 1FXXA 4C8QD 4QQDA 4DQ2A 4DOVA 4JRPA 2JUFA 4M7DG 5CQXA 5GMKl 2D0QB 5GANg 3L42A 2E41A 1Y96B 4PJOG 1AHJB 2F5KA 4JLIA 3CPWA 4BE2A 2XD0A 2IG0A 2DIGA 1UGSB 3CMEA 4C5HA 2DVEA 3ZBDA 2BIVA 3JB9G 4M75B 4ZN1A 4E7HA 5GAMe 2JNGA 4C0DC 3QG1A 3QPHA 5DLQE 3CPWS 4M7DD 4C92F 3OSVA 3JCMc 3M54A 2YRVA 2QQAA 5GANe 5CCAA 3F70A 1IREB 2K5LA 4ZN3A 2VGMA 5D6WA 5LJ5f 3CCUT 1KQ2A 4PJOA 3QYHB 3RMQA 3CCSA 3A8GB 1UB4A 3QYGB 3L2WA 4XAXB 1G3TA 4J83A 1YI2T 3DB4A 4QQ6A 2FVUA 2MAMA 3DB3A 4C8QE 5GMKi 1K8AC 2K3XA 4E47A 5FU7B 2O4XB 3I56T 3EAEA 1VQ7A 3JCMh 1WJSA 3CBOA 3ER0A 3LGFA 1Q86U 4HCBA 4JJNK 2LQKA 4DA4A 4M75E 3JB9J 5GMKe 2PQWA 3CBMA 4J6WA 4EMGA 1YITA 1JJ2S 3OBYA 5A0GA 2MI6A 2RI2A 1I81A 3HFOA 4C92D 4EMKB 1QVGA 2E64A 3M53A 2Y90A 4MMKA 1SSFA 3V8LA 5FRMA 4PJOC 3LWIA 2LRQA 4N4HA 1Y07A 5I2MA 3CMET 3G7ZA 3OMCA 3SFMA 2ZPEB 3GOXA 3OB9A 2CZ0B 5LJ3e 5HKCA 4OGEA 4XTXA 2NLUA 1K8AU 1X75C 1UGPB 5FU6B 3SB2A 3P8HA 2FL7A 3GPLA 1QP3A 1UGQB 2X4JA 3JAME 4M7AE 1VQOT 5GAN6 2ZGWA 2DZCA 3UPUA 2R5AA 4M7AA 2D9TA 2K57A 3MP6A 5GAN7 4HKEA 5I2SA 3G71A 1UEBA 4BDZA 4M7DB 2VYTA 1G3WA 2XU8A 3V7SA 4CI0C 3S3OA 1VQ6A 2RHZA 4M75D 3CD6T 2KMTA 3R6OA 3LYIA 3WVEB 3CCJA 2HD0A 2QQ9A 3LX7A 4EMHA 4C92E 5GAMj
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y71 A; 
#chains in the Genus database with same CATH topology
 3C94 A;  4PJO F;  5FRO A;  4F04 B;  2OTJ A;  4X34 A;  4MML A;  2BE9 B;  3RKX A;  1UHC A;  2C0O A;  4DEX A;  1ZSZ A;  2QQR A;  2VXE A;  4IUQ A;  5CR2 A;  2X9H A;  4JLG A;  2PZ1 A;  1YHQ Q;  3EHQ A;  1WJR A;  3OQ5 A;  2KYM A;  4A4K A;  2RH2 A;  2YHT A;  1QVG P;  1VQK T;  1VQ6 T;  4MZP A;  5M9O A;  5GAO l;  1U1S A;  3GNF B;  2BZ8 A;  3PVQ A;  1IO6 A;  1GCQ A;  1OV3 A;  3CXC P;  2V8J A;  2DJQ A;  2KEA A;  2OAW A;  2RQW A;  3CXC S;  2L89 A;  4PKC C;  4JRQ A;  1NZ9 A;  1BI3 A;  3G4S A;  3I55 T;  1SPK A;  1X2Q A;  1WZO A;  4DEY A;  1WQW A;  1SG5 A;  3J81 E;  3GF5 A;  2J06 A;  2CP6 A;  2I0N A;  2QEX T;  3G4S Q;  3JB9 I;  4DBF A;  3CEY A;  4J5Y A;  2PUO B;  1R8O B;  2JZ2 A;  1ACM B;  3A8H B;  3QO3 A;  4IKF A;  2B8A A;  2VVK A;  1W4S A;  1YCS B;  5LJ3 g;  1MHN A;  2OTL T;  2RHX A;  2DTO A;  3M0U A;  4AT1 B;  2EQK A;  5CKB A;  1UUE A;  3VYH B;  1LPL A;  4Z88 A;  5I21 A;  4ZNX A;  5GAO p;  4JPB W;  4LUE A;  4ANJ A;  1N8R C;  3VS7 A;  2WAC A;  1TS9 A;  5HK0 A;  3QDF A;  2HQH A;  3NPF A;  1TSF A;  3D7S B;  2RQR A;  3J7A F;  2E1H A;  1YWP A;  2ESW A;  2G6F X;  3QJY A;  4NS5 A;  3I55 Q;  3PTA A;  5GAN f;  1WXU A;  3AT1 B;  1MV3 A;  1LVK A;  2F2V A;  5I22 A;  2LDM A;  4XU2 A;  2K3B A;  3RNJ A;  1YIT Q;  2L3S A;  1Q86 C;  1AWW A;  5GJV B;  1ZSG A;  3VS2 A;  3CPF A;  4XTY A;  5GAO q;  4PL6 A;  4QVC A;  1JJ2 A;  5KYN A;  4FIB A;  3DKM A;  5CKD A;  4FSS A;  1QCO A;  3CCV A;  1VQP T;  2KRO A;  5LJ3 h;  3CD6 A;  2KBT A;  5LJ3 f;  1VYV A;  2QA4 T;  2J7I A;  2A08 A;  1B34 A;  2DL5 A;  2JT4 A;  2FPF A;  2DMO A;  2OAU A;  3OYK A;  3CC2 Q;  2YDL A;  2XMF A;  2D8H A;  2VC8 A;  2PTK A;  1K9M U;  1VQN Q;  3OYY A;  3M56 A;  1YIJ T;  4X1V A;  2RA2 A;  3KBG A;  1QVF A;  5GAN h;  4FT4 A;  4J9I A;  3CME Q;  2FZC B;  3REA B;  4KH1 B;  2RB6 A;  3GNG A;  1R77 A;  4HVV A;  1SHF A;  5D7U A;  3TRE A;  1KFZ A;  2E5K A;  3JCM e;  3CXC A;  2ECZ A;  4AFS C;  3CD6 Q;  4F14 A;  5FU6 C;  3PIO A;  1XQH A;  2RQV A;  4BB7 A;  3UA6 A;  3A5Z B;  1N9R A;  4FW1 A;  4A53 A;  2K5I A;  2HQX A;  1KHI A;  1PG5 B;  2QEX A;  1GRI A;  1I8F A;  1KIK A;  3O5Z A;  1PNJ A;  3PT9 A;  1HSQ A;  4ELZ C;  2X51 A;  2DJZ A;  1WX6 A;  2A7Y A;  4LDW A;  3C12 A;  1W2B S;  2KNB B;  4BE0 A;  5C0M A;  2EQI A;  3N5B B;  5L8R E;  4ESR A;  1AWJ A;  4Y92 A;  5IHI A;  2E5Q A;  4J9D A;  2XI9 A;  2E6N A;  2RF0 A;  4OMQ A;  4BY6 B;  2RJC A;  1W70 A;  4EMK C;  5KH6 A;  1KQS P;  2PVD B;  4IUR A;  3RDV A;  2E12 A;  4C92 B;  3QXE B;  1GL5 A;  1X6B A;  4II1 A;  4MDW A;  5DY9 A;  4M78 F;  2A0F B;  2EVR A;  3OSS C;  3CCL T;  4E7L A;  1XOV A;  4LDV A;  2DF6 A;  3VS0 A;  1TTH B;  3NTK A;  1D3B A;  2DK3 A;  4QKU A;  3A98 A;  4KT0 E;  2GQI A;  3H8Z A;  2FB7 A;  1OEB A;  1RLQ C;  1N8R R;  1HYO A;  4M78 E;  8ATC B;  2AZS A;  5HK3 A;  1YCY A;  2XDD A;  1OU9 A;  2C0I A;  3CCR A;  1KHC A;  1VQK Q;  1KC8 U;  1MV0 B;  4MDX A;  2RJF A;  4VUB A;  1YHQ T;  1V1C A;  1V76 A;  2X4X A;  4RTT A;  3PIP A;  1VYU A;  2KR3 A;  3GIB A;  1ZLM A;  3JCM b;  2DRK A;  2E70 A;  4ELY C;  1S72 T;  1RAG B;  3T9N A;  2X3X D;  4KUI A;  2BTT A;  1VQ9 Q;  2LJ3 A;  2LMJ A;  4PJO E;  1Y57 A;  1ZSZ C;  1PD1 A;  3OW2 S;  1Y7X A;  1RLP C;  5KE3 A;  2EGE A;  3OY9 A;  4J7I A;  1M1K U;  2XG8 D;  1O75 A;  3CCL Q;  5LJ5 j;  2DIQ A;  5LL6 S;  3ULR B;  1B34 B;  1CKB A;  3RUX A;  4RMO A;  4WCI A;  4LDU A;  2RM4 A;  1M8V A;  1RAB B;  2BZX A;  4OF1 A;  4M77 G;  2E65 A;  3QZ9 B;  2AHJ B;  1VQL T;  2HCK A;  3PGG A;  1MNE A;  2V26 A;  4NOY A;  2D1X A;  3WVD B;  1VIE A;  1Y96 A;  2PVG B;  4N4I A;  3EFO B;  4M7A G;  1YJN T;  2JW4 A;  2O9S A;  1KJW A;  1IHV A;  1RI9 A;  3SWN B;  3JB9 F;  3UDC A;  1K9M C;  2QEX Q;  3L2Q A;  1J3T A;  1WPY A;  2AZV A;  1OZ3 A;  4PJO D;  5J3B A;  2DER A;  2FPE A;  1XJW B;  1V29 B;  4C8Q D;  5GMK l;  5GAN g;  4LN2 A;  2E41 A;  1BU1 A;  1AHJ B;  1BK2 A;  4JLI A;  2IG0 A;  2DIG A;  3JB9 G;  1K0X A;  4M75 B;  1G83 A;  4C92 F;  4K11 A;  1VQM Q;  3OSV A;  2YRV A;  5CCA A;  1RAD B;  2K5L A;  1K0S A;  3CCU T;  4OMM A;  2DLP A;  5D6W A;  5LJ5 f;  3RMQ A;  2FVU A;  1VQ7 A;  3ZL7 C;  3CBO A;  4HCB A;  2FEI A;  3SHW A;  2LQN A;  3CPW P;  4WTO B;  3G71 Q;  1JJ2 S;  2DIL A;  1WYX A;  4FCY A;  3I9Q A;  2MI6 A;  1I81 A;  1AT1 B;  2BE7 D;  1RAI B;  4CC7 A;  3LWI A;  2LRQ A;  1Y07 A;  2EPD A;  3CME T;  3G7Z A;  3OMC A;  2L2P A;  2RMO A;  3JAM E;  1VQO T;  1Q86 R;  3RBB B;  4M7A A;  1OX9 A;  5GAN 7;  4HKE A;  4BDZ A;  2VYT A;  1G3W A;  2XU8 A;  4CI0 C;  2RHZ A;  2YT6 A;  3R6O A;  4C92 E;  5GAM j;  1NBE B;  1U5S A;  1X01 A;  5GJW B;  1R0B G;  3RR6 A;  2YUQ A;  3BDU A;  1IB8 A;  4E7S A;  4Y91 A;  4X9D A;  3HP9 A;  1EIF A;  3C95 A;  4GLM A;  2L3P A;  1YJN Q;  2F2W A;  2AK5 A;  2RJE A;  2X3W D;  2DZ9 A;  1WHM A;  1OYX A;  1MUZ A;  2LCS A;  2ED0 A;  3M0T A;  4KBM B;  2FRW A;  3CCM Q;  2VWF A;  2YUO A;  1YBY A;  1RAH B;  4C92 A;  1YI2 A;  1M2O A;  1TUG B;  1W6X A;  2JM9 A;  4TVR A;  1JBM A;  2ZPH B;  2DYB A;  5GMK m;  9ATC B;  3EH1 A;  1UGV A;  1BCM A;  3UT1 A;  1OOT A;  5GAN 3;  2CUB A;  3I56 A;  8AT1 B;  3EGX A;  1TOV A;  1AZE A;  1HK9 A;  4C5G A;  2K7A A;  4XU3 A;  2NUT A;  3RIR A;  4FU6 A;  4NL2 A;  2DD5 A;  4XU1 A;  1TXQ A;  3PNW C;  3JCM V;  1SSH A;  1U06 A;  2CUD A;  2P4T A;  4R55 A;  1VQ4 T;  3SWN C;  2RQT A;  1QMC A;  4XTW A;  4R0K A;  1VQM A;  3CMA A;  1X6O A;  5GAN 5;  3REB B;  7AT1 B;  3CCJ T;  1K73 U;  1VQ5 A;  3HRT A;  1WHG A;  2K2V A;  3CC2 A;  3CC7 T;  2FZG B;  2MYS A;  3JCM d;  5IHK A;  5GAM f;  1MMG A;  3VV0 A;  1OU8 A;  4N4G A;  3QII A;  4J6Y A;  1FYN A;  3BW1 A;  1Q7Y R;  4PJN A;  1H3H A;  2KVQ G;  1WJQ A;  3JB9 H;  2LJ1 A;  3QWY A;  4GLK A;  1TUC A;  2Y4Y A;  2RO0 A;  1M1G A;  4GY5 A;  1B3Q A;  1SF9 A;  2CS7 A;  2KYB A;  4FL6 A;  1VQN T;  1EZZ B;  4L5G A;  1VQL Q;  4BAC A;  2ZPB B;  2XKO C;  3THK A;  3CQT A;  3PE0 A;  3CCS Q;  1YI2 Q;  2CP5 A;  2O9V A;  4LNP A;  1NE8 A;  4LXC A;  1H64 1;  3X20 B;  2W10 A;  1ARK A;  4RTU A;  2M0O A;  4C92 G;  2CT3 A;  2EQJ A;  3HRU A;  1QWE A;  3P8B B;  2LTO A;  2ATC B;  1X69 A;  3QKJ A;  1ZX6 A;  1QVG S;  3I55 A;  4JZ3 A;  2L8D A;  3TQ7 P;  1GXI E;  1PSF A;  1T0J A;  2JVV A;  4C8Q A;  1JXM A;  3MP1 A;  2O88 A;  2EYY A;  3JCM X;  1GBQ A;  1U8R A;  2EGC A;  4RCC A;  2QDL A;  3L2V A;  2E3I A;  1YJN A;  3NTI A;  4OB1 B;  5I11 A;  4PJL A;  1VQ4 Q;  1VQ8 Q;  1WIE A;  2DPP B;  2OTL A;  5LJ5 g;  2JTM A;  2HQE A;  2V8K A;  4L6V 5;  3LW5 E;  3A8L B;  3VS5 A;  4E2F B;  1VQ4 A;  2GQV A;  2EBP A;  1Z9Q A;  1WA7 A;  4QQG A;  1MMA A;  5KYX A;  2QTX A;  4JRK A;  2OX7 A;  1EFN A;  1TH7 A;  1TUD A;  4BI3 A;  1WNL A;  3CC7 Q;  4FSX A;  3QHS A;  1BCO A;  2DEQ A;  4C8Q B;  2HAX A;  1QVF P;  4BE1 A;  4UC4 A;  1PHT A;  2K5F A;  4PLL A;  4HCZ A;  4IUV A;  4PJO B;  1GFC A;  2L3Q A;  4BY6 C;  3H41 A;  2AKL A;  4HT8 A;  3E2U A;  3HL8 A;  1JXO A;  2GFU A;  1RI0 A;  2MK5 A;  1Q7Y U;  3MEA A;  1KSW A;  5CK9 A;  2DXB A;  4C8Q C;  5GMK h;  2FPD A;  4IUP A;  4E7K A;  3QBY A;  2GTJ A;  2PNI A;  3A8O B;  1LJO A;  1EX4 A;  1C6V X;  4A4G A;  4RKU E;  2LT1 A;  3RER A;  1VQ9 A;  4BUG A;  2R57 A;  2DRM A;  2JM8 A;  3INZ A;  3MP8 A;  1VQO A;  4BDY A;  3CCR T;  3PMI A;  2BZY A;  1Q81 U;  4JRI A;  5J39 A;  1R0C B;  3EFS A;  3RMS A;  1VQ9 T;  2R5M A;  4C5E A;  1VQ8 T;  3TSZ A;  2H3J A;  2E6Z A;  5IHN A;  1ZUK A;  1PWT A;  3ZEH A;  3EFR A;  3L1A A;  5AYF A;  4BI8 B;  4C0Z A;  4B9W A;  5GAN 8;  1VQL A;  2FZK B;  3JCM J;  1KQ1 A;  2HSP A;  5KYU B;  1TG0 A;  2DKG A;  2F69 A;  4D6W A;  1U3O A;  1BKB A;  1H8K A;  4J7F A;  3E9G A;  3G6E A;  2CH4 W;  3M58 A;  1BIA A;  4IIO A;  3NGP A;  2LX9 A;  2KDS A;  3FIF A;  1W2B A;  2YRD A;  4M4Z A;  1KK7 A;  3V8J A;  2H3E B;  3MPU B;  2AIR B;  4CRI A;  4JZ4 A;  4M75 G;  2HL5 C;  1N8R U;  1YP5 A;  1Z9Z A;  3I5R A;  5FWB A;  2RHY A;  4HVU A;  2LJ0 A;  3U23 A;  5GAM g;  4M78 D;  2KT8 A;  4M78 A;  4OMP A;  2VV5 A;  5KYW A;  3LH5 A;  1NJI C;  3GLX A;  4D8D A;  1PKT A;  3LH0 A;  1QW1 A;  2X4W A;  1Q82 C;  2DL8 A;  4C5I A;  3IQL A;  4DOW A;  4M77 A;  4HCK A;  5IXF A;  3LWH A;  4KUD K;  2G3R A;  1DJ7 B;  2J6K A;  4J6X A;  1OQK A;  5LJ5 d;  1UJY A;  2EYW A;  4M7D E;  4BI4 A;  1M4Z A;  3OMG A;  1C0M A;  4PJJ A;  1WXB A;  2P84 A;  1WFW A;  2BUD A;  2JS0 A;  3ZFJ A;  2EYZ A;  1M1K R;  3CCL A;  3FEO A;  2YLB A;  4V2S A;  3VUZ A;  3P8D A;  5DM7 R;  3PMT A;  1QP2 A;  3AHU A;  4CC3 A;  4XTU A;  5D6Y A;  4JS5 A;  2FHD A;  2LNH B;  1F1B B;  1MMN A;  2FO0 A;  1SKU B;  1LOJ A;  2O2O A;  2A3L A;  1YIJ A;  2YRC A;  2GNC A;  4HT9 A;  3BFM A;  4OMF B;  2CKK A;  1U1T A;  2D0N A;  4KGX B;  1M3B A;  4RTZ A;  2P0Q A;  3QJ6 A;  5IN1 A;  1N9S A;  3X26 B;  1H92 A;  4M75 A;  4M7D F;  2CRE A;  1AZG B;  4JRP A;  4JJD A;  5CQX A;  3M0R A;  1W1F A;  2DET A;  3L42 A;  1Y96 B;  2AKK A;  2B86 A;  4BE2 A;  2DVE A;  2BIV A;  1C1A A;  2JNG A;  2YWW A;  4QT7 A;  3QG1 A;  4C0D C;  2LP5 A;  3QPH A;  4M7D D;  1GCP A;  3JCM c;  5GAN e;  3UA7 A;  1N5Z A;  2QQA A;  5AT1 B;  3F70 A;  2VGM A;  3QYH B;  3CCS A;  3L2W A;  4J83 A;  1K8A C;  4C8Q E;  1X43 A;  3JCM h;  4JJN K;  2KXC A;  4M75 E;  5GMK e;  2PQW A;  3CBM A;  3G6E Q;  4J6W A;  4EMG A;  1YIT A;  4ORZ A;  5A0G A;  1QVG A;  3HFO A;  1ZUY A;  3M53 A;  5KYX B;  1OPK A;  3V8L A;  3M0P A;  4N4H A;  1SEM A;  3SFM A;  2CZ0 B;  5LJ3 e;  5HKC A;  4LE9 A;  4OGE A;  1K8A U;  4RTX A;  3GPL A;  2X4J A;  4M7A E;  1M30 A;  5GAN 6;  3CCV Q;  3UPU A;  2H8H A;  3G71 A;  3UAT A;  1UEB A;  1UG1 A;  4CC2 A;  1VQ6 A;  2KMT A;  3WVE B;  1UHF A;  3CCJ A;  2OTL Q;  1UJ0 A;  2DBK A;  2JS2 A;  3MJX A;  1X2K A;  4J9F A;  3ASK A;  5IAY A;  4HA8 A;  4RTV A;  3FJ5 A;  1D0X A;  5GAM d;  3OYG A;  4A4E A;  3OYI A;  2PVO B;  3EG1 A;  2EQM A;  1BYM A;  1CSK A;  4OB0 B;  2PUK B;  1JB0 E;  3M59 A;  1YN8 A;  2COY A;  3JCM f;  1BI1 A;  2VXF A;  4ZTJ A;  2DL3 A;  4C0G A;  4E6R A;  1SRL A;  1JRI A;  2EIF A;  4M77 D;  3SD4 A;  5GAO m;  3L2Z A;  3X28 B;  1ZA1 B;  3QZ5 B;  2EKH A;  4OMN A;  4LUD A;  4M7A F;  1VQ7 Q;  2KRS A;  4PK4 A;  2SEM A;  2JTF A;  4AMC A;  2KE9 A;  2ROT A;  4JJB A;  3S3M A;  2O4X A;  5A2Q E;  1FX7 A;  3OS2 A;  2JMC A;  4RCB A;  4Z89 A;  1NPP A;  1WXT A;  1WGS A;  1FMW A;  1UE9 A;  5CIU A;  3VRY A;  4F7U B;  4OVA A;  3G1J A;  2J6O A;  2YLC A;  4M7A D;  2EYQ A;  1ABO A;  3OYH A;  4OMO A;  1X6G A;  1PRL C;  3HFN A;  1NEG A;  2P0K A;  5KE2 A;  1UFF A;  2M02 A;  4B9X A;  4RUG A;  2QXF A;  3CCJ Q;  4BD3 A;  1OUL A;  3L2R A;  3UWN A;  3R6N A;  2V1Q A;  3CCQ T;  1WHH A;  3NFC A;  4XTV A;  4F7U A;  3X24 B;  1VOM A;  2CGH A;  2HDA A;  1S72 A;  2XDB A;  2X4Y A;  3OS0 A;  2RI5 A;  2HEQ A;  5CKF A;  3VS1 A;  4RTY A;  2ZPI B;  2GFA A;  4XU0 A;  1I07 A;  4M77 C;  1G2B A;  1I0C A;  2CSQ A;  2ZCF B;  3CC4 T;  2QQS A;  1KC8 C;  3FJP A;  2EAY A;  2YUN A;  2CZ7 B;  2O01 E;  1G8X A;  5GAN 2;  2LT4 A;  4PFO A;  4EPC A;  2RI3 A;  3OS1 A;  1G5V A;  2WSE E;  3EG0 A;  4C0F A;  2QQB A;  2KK4 A;  1ZBJ A;  1D09 B;  4KGV B;  1GFD A;  1YWO A;  3ME9 A;  2GBQ A;  2IVW A;  2EFI A;  2CZ1 B;  4DBQ A;  4O6J A;  1I5L A;  3CCU A;  4AFZ C;  1G3S A;  2MF2 A;  2CYZ B;  1UEC A;  3OA6 A;  1YJW A;  3OYF A;  1RAE B;  3LLR A;  2WSC E;  4N0A C;  3HRS A;  2HZY A;  1B7T A;  1E7O A;  3RES A;  2EYX A;  1VYT A;  1H3Z A;  2F2X A;  5GAN 4;  1D1B A;  5KYY B;  1K76 A;  3PFS A;  1VIF A;  3J80 E;  1ZBX A;  4XK8 E;  4M7D C;  2Y4X A;  5CQY A;  2VAS A;  3M4G A;  4QW2 A;  3X25 B;  1KD1 U;  4WF2 A;  2MOX A;  4F7U E;  1NLP C;  3G71 T;  3G6E T;  2YUP A;  1N27 A;  1WDX A;  1AVZ C;  3CCM A;  3M5A A;  5FU7 C;  2LCL A;  5A0L A;  2KXD A;  1ZA2 B;  1K1Z A;  3FLG A;  3TU4 K;  1IRX A;  1JQQ A;  4L59 A;  2QDY B;  1Y0M A;  1VA7 A;  2LQ8 A;  4ZGD B;  1JEG A;  2HMA A;  1Q7Y C;  1YJ9 Q;  3TVT A;  2E4H A;  3CC7 A;  3CC2 T;  2KT1 A;  2LCC A;  1X27 A;  5CAI A;  1BI2 A;  4F16 A;  4D8K A;  2JOY A;  3E19 A;  1TWB A;  1MMD A;  2MWP A;  1AD5 A;  2I2L A;  2RNA A;  2ZAE A;  3FB9 A;  1NJI R;  4FYV B;  2JXB A;  2A28 A;  3HHT B;  3VKI A;  3MKD A;  3BDL A;  1LNX A;  2QA4 Q;  2AT1 B;  2M1H A;  2QYZ A;  3MHX A;  1LCK A;  4C0D B;  1FWZ A;  3OYD A;  2LVM A;  1K9M R;  1M5Q 1;  2HKN A;  2YXY A;  4M78 C;  4RG8 A;  3EG2 A;  2E3H A;  3FRN A;  4M78 G;  1Q81 C;  4M77 B;  3V8K A;  3OW2 P;  2QGG A;  3NMZ C;  3H0F A;  3MO8 A;  4NL3 A;  3BY7 A;  4M7A C;  3C0C A;  1M8M A;  3V7R A;  3A8M B;  5KYW B;  3HSB A;  2P4R A;  5FW9 A;  1PM3 A;  4ME7 A;  2JJ9 A;  3M55 A;  1K73 C;  1M3A A;  4ZGE B;  2ABL A;  4P5N A;  2LZ6 B;  3M4Y A;  3G4S T;  1ZQ1 A;  3QUI A;  1VQN A;  1BI0 A;  4AG1 C;  5GMK j;  3KXT A;  4J9H A;  1T3L A;  2KRN A;  5LJ3 d;  5L23 A;  1PRM C;  4M7A B;  4FYW B;  3QSU A;  5ECA A;  2L0A A;  1YFN A;  1KG1 A;  1WHL A;  2DXU A;  5EG2 A;  2E10 A;  1VQ8 A;  4MZT A;  1AWX A;  2DL7 A;  5CO7 A;  2O31 A;  1PKS A;  3I35 A;  4OGC A;  4XQ3 A;  3CCQ Q;  2QA4 A;  2MMP A;  3TCJ A;  2KSS A;  3C4S A;  1VQO Q;  2FG0 A;  2EJ9 A;  3EH2 A;  5GAO n;  1JO8 A;  2CZ6 B;  2EWN A;  2QGF B;  3I56 Q;  2DA9 A;  3HTR A;  5KCO A;  4AFU C;  4O5V A;  4N0A A;  1WHK A;  4M77 F;  2VGN A;  3VUB A;  1KD1 R;  2EQU A;  3CCE A;  2CP2 A;  1I1J A;  1MGQ A;  4E7I A;  2XDP A;  3E9F A;  2FYK A;  3OYC A;  4C92 C;  2C06 A;  5IXB A;  2DXC A;  3URG A;  2CP3 A;  1QCF A;  2OJ2 A;  1HXD A;  2XK0 A;  1FXX A;  2KRM A;  4QQD A;  4DQ2 A;  4DOV A;  4M7D G;  2D0Q B;  1D1A A;  6AT1 B;  2NWM A;  2F5K A;  3CPW A;  2XD0 A;  1NEB A;  4ZN1 A;  4E7H A;  2ENM A;  3EG9 A;  3CPW S;  1JU5 C;  4ZN3 A;  1IRE B;  1KQ2 A;  4PJO A;  3A8G B;  3QYG B;  2YSQ A;  4XAX B;  1S1N A;  3CC4 Q;  3DB4 A;  4QQ6 A;  2MAM A;  3DB3 A;  2MCN A;  5GMK i;  2K3X A;  4E47 A;  5FU7 B;  2O4X B;  3I56 T;  3LGF A;  1Q86 U;  2ROL A;  4DA4 A;  2QAZ A;  3EFO A;  2DM1 A;  2RI2 A;  2E64 A;  2M51 A;  1SSF A;  5FRM A;  3GOX A;  2ZPE B;  3OB9 A;  2OTJ Q;  4XTX A;  2JTE A;  2NLU A;  1W2B P;  4IIM A;  3H0I A;  5FU6 B;  1QP3 A;  2ZGW A;  2DZC A;  3MP6 A;  5I2S A;  4M7D B;  3S3O A;  4M75 D;  3CD6 T;  3LYI A;  1AOJ A;  2QQ9 A;  4EMH A;  2JN0 A;  2P0P A;  1QWF A;  1XNI A;  4R56 A;  3OYB A;  2OI3 A;  1K8A R;  2QG9 B;  2R58 A;  5CVI A;  2CT4 A;  3UF4 A;  4M75 F;  4M7D A;  4PFP A;  1M1K C;  3OYN A;  2IIM A;  3NTH A;  2BKD N;  2RJD A;  2KAF A;  1OZ2 A;  1QKW A;  3MEU A;  2SRC A;  2V8I A;  2RN8 A;  1JJ2 P;  2K4Y A;  4EDU A;  4A4H A;  4FW2 A;  3QWX X;  2K79 A;  3KFV A;  1YJ9 T;  4KH0 B;  2NYS A;  3CMA T;  2CP0 A;  3OS5 A;  3Q1J A;  4F17 A;  2KQW A;  2VUB A;  1B07 A;  3GP8 A;  2PU9 B;  3M0Q A;  1QVF S;  4Y28 E;  3GBQ A;  2ZZD A;  4M77 E;  3JCM W;  1IXD A;  2Z0W A;  2MWO A;  1A0N B;  2D6F A;  5C6S A;  4F7U G;  3H9N A;  1NJI U;  4AFQ C;  2EJF A;  3MCA B;  3H6Z A;  3M9Q A;  1E6G A;  4E7J A;  2L5Q A;  4KUL A;  1P92 A;  1QVP A;  2COW A;  1TU0 B;  4JDS A;  1YJW Q;  3JRZ A;  1NYF A;  3FDR A;  1KQS A;  1M2V A;  1PCX A;  2J05 A;  2OTJ T;  4FM4 B;  3EHR A;  2LNV A;  4HVW A;  1GBR A;  1K4U S;  1D1C A;  3VJP A;  2K6D A;  3VS4 A;  4LD9 K;  4PFZ A;  3OYM A;  3LGL A;  3QDR B;  3S6W A;  1D0Y A;  3VU3 C;  3CCE Q;  5CKE A;  4E7Z A;  4OB2 B;  2M9U A;  2DTH A;  4OB3 B;  1N6A A;  5KCH A;  1M3C A;  4HXJ A;  3CCM T;  3OYL A;  4B6M A;  2F5T X;  3EGD B;  3NHN A;  4J9E A;  1IGU A;  2XIC A;  5IT9 E;  3MEW A;  3S3N A;  4JJC A;  3V7C A;  4KGZ B;  4LDY A;  1YJ9 A;  1ZSZ B;  1QKX A;  2CH4 A;  1KQS S;  2QI2 A;  5CKH A;  4F7U F;  3EGU A;  4PLI A;  4LDX A;  1BIB A;  2M0Y A;  3VS3 A;  2C0T A;  1ZHI A;  2DNU A;  2QK0 A;  2VB6 A;  1I5O B;  1RAC B;  2J6F A;  3DLL A;  4A54 A;  3CCE T;  4M78 B;  2A37 A;  1WI7 A;  3VYG A;  2LC4 A;  4FYY B;  4X9C A;  3JCM P;  2EKO A;  1IGQ A;  3OYJ A;  1M90 C;  3JSC A;  1BB9 A;  2FRY A;  1KC8 R;  4GBQ A;  5EC7 A;  4Q5W A;  4PNO A;  1YIT T;  5HCK A;  2EGA A;  4ATO A;  4A63 B;  1VQ6 Q;  1YJW T;  1YIJ Q;  1D0Z A;  2DXT A;  2NUP A;  5GAN d;  5DLO A;  2GF7 A;  2HBP A;  2LX7 A;  3JCM Q;  4C8Q F;  3HPW A;  3M0S A;  1M2V B;  2KI7 A;  1VQP Q;  1NLO C;  3EGD A;  3M57 A;  2DD4 A;  5KYU A;  2RQU A;  3L2U A;  1PC0 A;  4Z8A A;  1ZUU A;  5D6X A;  1RAF B;  1M9S A;  2HBW A;  3MEV A;  4ZGJ B;  2D8J A;  4OP0 A;  1AEY A;  2M16 A;  3HKS A;  3OBW A;  1VQK A;  2DEU A;  2COZ A;  2DAQ A;  3TSW A;  3DLM A;  4YTL A;  2DTI A;  4C8Q G;  3E1S A;  2CDT A;  1KD1 C;  3MET A;  2DYI A;  1M90 U;  2KY9 A;  2K2M A;  1I4K 1;  2EJG A;  3SWN A;  5GAM h;  4J9G A;  2MIO A;  3JB9 D;  1QCN A;  1GCQ C;  1G3Y A;  5GAN j;  3OW2 A;  4DBH A;  3TEE A;  1ABQ A;  2V1R A;  3OYE A;  2RPN A;  3WXM B;  2CSI A;  2HNI A;  2RK1 A;  4DBR A;  5HY6 A;  1Y71 A;  5LJ5 e;  1M90 R;  3JV3 A;  1RUW A;  4HCC A;  2DX1 A;  1PSE A;  4ZTF A;  3H0H A;  3FC3 A;  1E6H A;  1UGR B;  4JUV A;  4MZM A;  1RL2 A;  1VQ7 T;  1O9S A;  4M75 C;  1UTI A;  4Z02 A;  4CC4 B;  4PJM A;  4QVZ A;  5LJ3 j;  1S72 Q;  1T3S A;  2MPX C;  2X35 A;  2DO3 A;  3CCQ A;  2A36 A;  1CKA A;  1MND A;  2GCX A;  1NPR A;  1VQ5 T;  3RKY A;  3SDZ A;  2L3R A;  1UDL A;  3KUF A;  4IUT A;  3OYA A;  5KYY A;  1T0H A;  1WHJ A;  1IHW A;  3RKW A;  4LD6 A;  2DFU A;  2ED1 A;  3O8V A;  1Q82 U;  1YHQ A;  1HD3 A;  2K9G A;  2WSF E;  1FMK A;  4A4F A;  2XHC A;  1HJD A;  1YNZ A;  1FMV A;  1SRM A;  3I5S A;  2RHU A;  4KRT A;  1WQ7 A;  5A0D A;  1OX8 A;  1IZ6 A;  1NG2 A;  4J9B A;  5FWC A;  2RHI A;  2W0Z A;  1NYG A;  3CCV T;  1VQP A;  1VUB A;  5J26 A;  2GGR A;  2HSE B;  2CP7 A;  2NUZ A;  2RD1 A;  2ZPF B;  5IH2 A;  3JCM g;  4JS4 A;  2ZPG B;  1D3B B;  3VRZ A;  2DVJ A;  2KGT A;  4FT2 A;  1VQM T;  2DL4 A;  3CCU Q;  3CCR Q;  1AWO A;  2XID A;  2JMA A;  5FLX E;  4RG2 A;  4EMK A;  2DBM A;  1WLP B;  4QVD A;  3CMA Q;  2VKN A;  1K73 R;  5GAO r;  2DE0 X;  4XTZ A;  1M1F A;  4J9C A;  5FRN A;  1XTD A;  1OI1 A;  4EIK A;  1OPL A;  2K3Y A;  1VQ5 Q;  3CC4 A;  3SEM A;  2RK2 A;  4IUU A;  4J8O A;  3CCS T;  3CBP A;  5LJ5 h;  3EG9 B;  4RTW A;  1SHG A;  2JUF A;  1QLY A;  4PJO G;  4AG2 C;  3PVL A;  1UGS B;  3CME A;  4C5H A;  3ZBD A;  5GAM e;  2QAS A;  5DLQ E;  2NUT B;  1Q82 R;  3M54 A;  2GTO A;  3EGX B;  2QTV A;  1NM7 A;  1UB4 A;  2F1L A;  1G3T A;  4FYX B;  1YI2 T;  3VS6 A;  4OML A;  3EAE A;  1WJS A;  3ER0 A;  2LQK A;  3JB9 J;  1Q81 R;  3EG3 A;  2NUP B;  3OBY A;  1RAA B;  2IPO B;  4EMK B;  4C92 D;  2EW3 A;  3BE3 A;  2Y90 A;  4MMK A;  4PJO C;  2HL3 A;  5I2M A;  1M27 C;  1X75 C;  1UGP B;  2HKQ B;  3SB2 A;  3P8H A;  1QQJ A;  2FL7 A;  1UGQ B;  2R5A A;  2D9T A;  2K57 A;  1BBZ A;  1K9A A;  3V7S A;  1Q95 G;  2HD0 A;  1PD0 A;  3LX7 A;  2LQW A;  3A1P A; 
#chains in the Genus database with same CATH homology
 3C94 A;  2JN0 A;  4PJO F;  2P0P A;  5FRO A;  1XNI A;  3ASK A;  5IAY A;  1X01 A;  2OTJ A;  4X34 A;  4HA8 A;  4R56 A;  3OYB A;  4MML A;  3RKX A;  5GAM d;  3OYG A;  2R58 A;  4A4E A;  3OYI A;  2PVO B;  5CVI A;  2EQM A;  2QQR A;  1BYM A;  3BDU A;  2VXE A;  4Y91 A;  4OB0 B;  4IUQ A;  4X9D A;  3HP9 A;  2PUK B;  1EIF A;  3C95 A;  4M75 F;  5CR2 A;  4JLG A;  4M7D A;  1JB0 E;  1M1K C;  1WJR A;  3OQ5 A;  3M59 A;  4A4K A;  2RH2 A;  2YHT A;  3JCM f;  3OYN A;  1BI1 A;  2RJE A;  2BKD N;  2RJD A;  3NTH A;  1VQK T;  2VXF A;  4ZTJ A;  1VQ6 T;  2KAF A;  1OZ2 A;  3MEU A;  4C0G A;  2DZ9 A;  4MZP A;  5M9O A;  1OYX A;  1JRI A;  2V8I A;  5GAO l;  1U1S A;  2EIF A;  2K4Y A;  4M77 D;  3L2Z A;  3SD4 A;  3X28 B;  4KBM B;  3QZ5 B;  5GAO m;  3GNF B;  4EDU A;  4A4H A;  1YBY A;  4C92 A;  4M7A F;  1YI2 A;  1K73 U;  2V8J A;  1YJ9 T;  2JTF A;  4TVR A;  1JBM A;  2ZPH B;  3CXC S;  5GMK m;  2L89 A;  2O4X A;  3S3M A;  4PKC C;  5A2Q E;  1FX7 A;  3OS2 A;  4JRQ A;  1NZ9 A;  1BI3 A;  3G4S A;  4RCB A;  3I55 T;  3CMA T;  1NPP A;  3UT1 A;  1WGS A;  5GAN 3;  3I56 A;  3OS5 A;  3Q1J A;  5CIU A;  4F7U B;  2KQW A;  4OVA A;  2VUB A;  1HK9 A;  3GP8 A;  2PU9 B;  2YLC A;  4M7A D;  4C5G A;  1WQW A;  1QVF S;  4XU3 A;  4Y28 E;  3J81 E;  2ZZD A;  2EYQ A;  3GF5 A;  2QEX T;  4M77 E;  3OYH A;  3JCM W;  3JB9 I;  3CEY A;  2MWO A;  4J5Y A;  3HFN A;  2PUO B;  3RIR A;  4FU6 A;  4NL2 A;  2DD5 A;  2P0K A;  4XU1 A;  1R8O B;  3PNW C;  5KE2 A;  2JZ2 A;  3QO3 A;  3A8H B;  3JCM V;  4B9X A;  2D6F A;  2P4T A;  5C6S A;  4F7U G;  4IKF A;  2QXF A;  4R55 A;  1VQ4 T;  1NJI U;  2B8A A;  3SWN C;  2EJF A;  1W4S A;  3MCA B;  3H6Z A;  4BD3 A;  1MHN A;  3M9Q A;  5LJ3 g;  2OTL T;  4XTW A;  3L2R A;  1VQM A;  2RHX A;  3UWN A;  2DTO A;  4E7J A;  3CMA A;  1X6O A;  5GAN 5;  1VQ5 A;  2L5Q A;  4KUL A;  3CCJ T;  1P92 A;  2EQK A;  1QVP A;  3HRT A;  3NFC A;  5CKB A;  3VYH B;  2K2V A;  5I21 A;  4JDS A;  3CC2 A;  4XTV A;  3JRZ A;  5GAO p;  3CC7 T;  3JCM d;  4F7U A;  5GAM f;  1N8R C;  3FDR A;  3VV0 A;  3X24 B;  1KQS A;  2CGH A;  2WAC A;  4N4G A;  1S72 A;  2OTJ T;  3QII A;  4FM4 B;  4J6Y A;  3BW1 A;  2LNV A;  5HK0 A;  2XDB A;  2X4Y A;  2KVQ G;  1WJQ A;  3OS0 A;  3J7A F;  2RI5 A;  3JB9 H;  3VJP A;  2E1H A;  4GLK A;  5CKF A;  4LD9 K;  2Y4Y A;  2RO0 A;  1M1G A;  4GY5 A;  2ZPI B;  2GFA A;  3OYM A;  3LGL A;  2CS7 A;  3QJY A;  4FL6 A;  4NS5 A;  4XU0 A;  5GAN f;  3PTA A;  3QDR B;  1VQN T;  3S6W A;  4M77 C;  4L5G A;  4BAC A;  2ZPB B;  3VU3 C;  5CKE A;  2XKO C;  2ZCF B;  2LDM A;  4OB2 B;  4XU2 A;  3CC4 T;  2QQS A;  2M9U A;  1NE8 A;  1KC8 C;  2DTH A;  4OB3 B;  3FJP A;  1N6A A;  2EAY A;  5KCH A;  1H64 1;  3X20 B;  1Q86 C;  2CZ7 B;  2M0O A;  2O01 E;  4C92 G;  3OYL A;  5GAN 2;  2EQJ A;  3CPF A;  2F5T X;  3HRU A;  3CCM T;  4XTY A;  2LT4 A;  4PL6 A;  5GAO q;  3P8B B;  4QVC A;  2LTO A;  4EPC A;  2RI3 A;  2XIC A;  3OS1 A;  1JJ2 A;  1G5V A;  5IT9 E;  2WSE E;  3QKJ A;  4C0F A;  2QQB A;  3MEW A;  3S3N A;  2KK4 A;  3DKM A;  4FIB A;  3V7C A;  3I55 A;  5CKD A;  1QVG S;  2L8D A;  3ME9 A;  4LDY A;  1YJ9 A;  1GXI E;  1KQS S;  2QI2 A;  1PSF A;  5CKH A;  4F7U F;  3CCV A;  1VQP T;  2JVV A;  2IVW A;  2EFI A;  2CZ1 B;  4PLI A;  1BIB A;  5LJ3 f;  5LJ3 h;  4C8Q A;  2QA4 T;  4LDX A;  3CD6 A;  4O6J A;  1I5L A;  3MP1 A;  1B34 A;  3CCU A;  1G3S A;  2MF2 A;  3JCM X;  1U8R A;  2OAU A;  2CYZ B;  4RCC A;  3OYK A;  3OA6 A;  1ZHI A;  3L2V A;  1YJN A;  3NTI A;  1YJW A;  4OB1 B;  3OYF A;  3LLR A;  2WSC E;  4N0A C;  3HRS A;  3DLL A;  2DPP B;  2OTL A;  4A54 A;  5LJ5 g;  3CCE T;  4M78 B;  2VC8 A;  3RES A;  2JTM A;  2HQE A;  3VYG A;  2V8K A;  2LC4 A;  1K9M U;  4X9C A;  3JCM P;  2EKO A;  1H3Z A;  4L6V 5;  3LW5 E;  3M56 A;  3OYY A;  5GAN 4;  3OYJ A;  3A8L B;  1YIJ T;  1M90 C;  3JSC A;  1VQ4 A;  2RA2 A;  2GQV A;  3KBG A;  1QVF A;  5GAN h;  4Q5W A;  3PFS A;  4FT4 A;  1VIF A;  4QQG A;  4PNO A;  3J80 E;  1YIT T;  1ZBX A;  2QTX A;  2RB6 A;  4JRK A;  4ATO A;  3GNG A;  1TH7 A;  4XK8 E;  4BI3 A;  1WNL A;  1YJW T;  4FSX A;  3QHS A;  4M7D C;  2DXT A;  2Y4X A;  5CQY A;  3TRE A;  2DEQ A;  3M4G A;  4QW2 A;  4C8Q B;  5DLO A;  5GAN d;  3JCM e;  3X25 B;  3CXC A;  2HAX A;  2GF7 A;  4BE1 A;  1KD1 U;  2HBP A;  5FU6 C;  4WF2 A;  3PIO A;  1XQH A;  3JCM Q;  4BB7 A;  4UC4 A;  3HPW A;  3A5Z B;  4C8Q F;  4F7U E;  1N9R A;  2K5F A;  4PLL A;  4HCZ A;  4A53 A;  3G71 T;  3G6E T;  4IUV A;  4PJO B;  2K5I A;  3M57 A;  4BY6 C;  2HQX A;  2DD4 A;  1KHI A;  2QEX A;  4HT8 A;  1N27 A;  3HL8 A;  2GFU A;  1I8F A;  3L2U A;  3CCM A;  1RI0 A;  3M5A A;  1Q7Y U;  3MEA A;  5FU7 C;  2LCL A;  5D6X A;  5CK9 A;  2DXB A;  1M9S A;  3PT9 A;  5A0L A;  3MEV A;  4ZGJ B;  4C8Q C;  5GMK h;  4ELZ C;  4IUP A;  4E7K A;  3QBY A;  4OP0 A;  2M16 A;  3HKS A;  2DJZ A;  3OBW A;  1VQK A;  2A7Y A;  3A8O B;  1LJO A;  3FLG A;  4LDW A;  2DAQ A;  3TU4 K;  4A4G A;  3C12 A;  4RKU E;  2LT1 A;  3RER A;  3DLM A;  4YTL A;  1VQ9 A;  1W2B S;  2DTI A;  4L59 A;  4BUG A;  4C8Q G;  4BE0 A;  2QDY B;  2R57 A;  5C0M A;  3CCQ T;  2LQ8 A;  3N5B B;  5L8R E;  4ZGD B;  3E1S A;  1KD1 C;  3MET A;  3INZ A;  1Q7Y C;  2E5Q A;  3MP8 A;  1M90 U;  1VQO A;  2KY9 A;  3CC7 A;  3CC2 T;  4BDY A;  4PJO D;  2LCC A;  1I4K 1;  2E6N A;  2EJG A;  2XI9 A;  3PMI A;  3SWN A;  5CAI A;  5GAM h;  1BI2 A;  3CCR T;  1Q81 U;  4JRI A;  3JB9 D;  5J39 A;  4BY6 B;  2RJC A;  3EFS A;  1G3Y A;  2JOY A;  4EMK C;  3RMS A;  5GAN j;  1VQ9 T;  3OW2 A;  2R5M A;  5KH6 A;  2PVD B;  4IUR A;  3TEE A;  4C5E A;  2E12 A;  3E19 A;  3QXE B;  4C92 B;  3OYE A;  2MWP A;  1VQ8 T;  2H3J A;  2E6Z A;  4II1 A;  4MDW A;  3WXM B;  5DY9 A;  4M78 F;  2I2L A;  3ZEH A;  2RK1 A;  2HNI A;  3EFR A;  3L1A A;  3FB9 A;  5AYF A;  3OSS C;  4BI8 B;  4B9W A;  4C0Z A;  5GAN 8;  3CCL T;  5HY6 A;  1VQL A;  4E7L A;  1XOV A;  1Y71 A;  4LDV A;  5LJ5 e;  3JCM J;  1KQ1 A;  3HHT B;  3VKI A;  4HCC A;  3NTK A;  1D3B A;  2DK3 A;  2DKG A;  1PSE A;  4ZTF A;  3BDL A;  3FC3 A;  1LNX A;  1UGR B;  4KT0 E;  4JUV A;  4MZM A;  3H8Z A;  2M1H A;  1RL2 A;  3MHX A;  2FB7 A;  2F69 A;  1VQ7 T;  4D6W A;  4C0D B;  1O9S A;  1FWZ A;  4M75 C;  3OYD A;  4M78 E;  1BKB A;  5HK3 A;  2LVM A;  4Z02 A;  1YCY A;  2XDD A;  4J7F A;  4QVZ A;  5LJ3 j;  3CCR A;  3E9G A;  3G6E A;  3M58 A;  1KHC A;  1M5Q 1;  1BIA A;  4M78 C;  2LX9 A;  2X35 A;  2DO3 A;  4RG8 A;  3CCQ A;  1KC8 U;  4MDX A;  2RJF A;  2KDS A;  4VUB A;  3FIF A;  1YHQ T;  1W2B A;  3FRN A;  2X4X A;  2GCX A;  4M78 G;  1Q81 C;  4M77 B;  3V8K A;  1NPR A;  3PIP A;  1VQ5 T;  3V8J A;  3RKY A;  3GIB A;  3SDZ A;  3MO8 A;  4NL3 A;  3BY7 A;  4M7A C;  4CRI A;  2L3R A;  3KUF A;  3JCM b;  4IUT A;  4M75 G;  3OYA A;  1N8R U;  2E70 A;  4ELY C;  1S72 T;  3V7R A;  2RHY A;  3T9N A;  3A8M B;  3HSB A;  4KUI A;  5GAM g;  3RKW A;  4M78 D;  4M78 A;  4PJO E;  2VV5 A;  4LD6 A;  4ME7 A;  1NJI C;  3GLX A;  3O8V A;  3OW2 S;  1Y7X A;  3LH0 A;  1YHQ A;  1QW1 A;  1Q82 U;  3M55 A;  2X4W A;  2WSF E;  4A4F A;  5KE3 A;  2XHC A;  1Q82 C;  1K73 C;  4ZGE B;  4C5I A;  3OY9 A;  4J7I A;  1M1K U;  2XG8 D;  1O75 A;  4DOW A;  3M4Y A;  4P5N A;  5LJ5 j;  2DIQ A;  4M77 A;  1ZQ1 A;  2RHU A;  5LL6 S;  3G4S T;  1B34 B;  3QUI A;  1VQN A;  1BI0 A;  1WQ7 A;  3RUX A;  5GMK j;  3LWH A;  4KUD K;  2G3R A;  1DJ7 B;  5A0D A;  4J6X A;  4RMO A;  3KXT A;  1IZ6 A;  5LJ5 d;  4LDU A;  5LJ3 d;  2RHI A;  2RM4 A;  4M7D E;  1M8V A;  4BI4 A;  3CCV T;  4OF1 A;  1VQP A;  1VUB A;  1M4Z A;  5J26 A;  3OMG A;  4M77 G;  4M7A B;  3QSU A;  2E65 A;  2BUD A;  3QZ9 B;  3ZFJ A;  2RD1 A;  1KG1 A;  2ZPF B;  2AHJ B;  3JCM g;  2DXU A;  5EG2 A;  2E10 A;  2ZPG B;  1D3B B;  4JS4 A;  1VQ8 A;  1VQL T;  3CCL A;  3FEO A;  2YLB A;  4MZT A;  4V2S A;  3VUZ A;  3P8D A;  4OGC A;  5CO7 A;  4XQ3 A;  4FT2 A;  5DM7 R;  2QA4 A;  1VQM T;  2MMP A;  3TCJ A;  3PGG A;  3PMT A;  1QP2 A;  3AHU A;  2KSS A;  3C4S A;  4NOY A;  4XTU A;  2EJ9 A;  2XID A;  5D6Y A;  3WVD B;  4JS5 A;  1VIE A;  1Y96 A;  5FLX E;  4RG2 A;  5GAO n;  2FHD A;  2CZ6 B;  2EWN A;  2PVG B;  4EMK A;  4N4I A;  4QVD A;  4M7A G;  5KCO A;  1YJN T;  5GAO r;  4O5V A;  4N0A A;  1LOJ A;  4XTZ A;  1M1F A;  2A3L A;  1YIJ A;  4M77 F;  3SWN B;  3JB9 F;  2VGN A;  3UDC A;  1XTD A;  3VUB A;  5FRN A;  4HT9 A;  3BFM A;  1OI1 A;  4OMF B;  2EQU A;  1K9M C;  3CCE A;  2CKK A;  2K3Y A;  3CC4 A;  1U1T A;  3L2Q A;  2RK2 A;  4IUU A;  4J8O A;  1WPY A;  1MGQ A;  1OZ3 A;  4E7I A;  2XDP A;  3E9F A;  2FYK A;  5J3B A;  3OYC A;  4C92 C;  3CCS T;  2P0Q A;  3CBP A;  2C06 A;  3QJ6 A;  5LJ5 h;  5IN1 A;  2DXC A;  1N9S A;  3URG A;  3X26 B;  1V29 B;  4M75 A;  4M7D F;  1HXD A;  2XK0 A;  1FXX A;  4C8Q D;  4QQD A;  4DQ2 A;  4DOV A;  4JRP A;  2JUF A;  4M7D G;  5CQX A;  5GMK l;  2D0Q B;  5GAN g;  3L42 A;  2E41 A;  1Y96 B;  4PJO G;  1AHJ B;  2F5K A;  4JLI A;  3CPW A;  4BE2 A;  2XD0 A;  2IG0 A;  2DIG A;  1UGS B;  3CME A;  4C5H A;  2DVE A;  3ZBD A;  2BIV A;  3JB9 G;  4M75 B;  4ZN1 A;  4E7H A;  5GAM e;  2JNG A;  4C0D C;  3QG1 A;  3QPH A;  5DLQ E;  3CPW S;  4M7D D;  4C92 F;  3OSV A;  3JCM c;  3M54 A;  2YRV A;  2QQA A;  5GAN e;  5CCA A;  3F70 A;  1IRE B;  2K5L A;  4ZN3 A;  2VGM A;  5D6W A;  5LJ5 f;  3CCU T;  1KQ2 A;  4PJO A;  3QYH B;  3RMQ A;  3CCS A;  3A8G B;  1UB4 A;  3QYG B;  3L2W A;  4XAX B;  1G3T A;  4J83 A;  1YI2 T;  3DB4 A;  4QQ6 A;  2FVU A;  2MAM A;  3DB3 A;  4C8Q E;  5GMK i;  1K8A C;  2K3X A;  4E47 A;  5FU7 B;  2O4X B;  3I56 T;  3EAE A;  1VQ7 A;  3JCM h;  1WJS A;  3CBO A;  3ER0 A;  3LGF A;  1Q86 U;  4HCB A;  4JJN K;  2LQK A;  4DA4 A;  4M75 E;  3JB9 J;  5GMK e;  2PQW A;  3CBM A;  4J6W A;  4EMG A;  1YIT A;  1JJ2 S;  3OBY A;  5A0G A;  2MI6 A;  2RI2 A;  1I81 A;  3HFO A;  4C92 D;  4EMK B;  1QVG A;  2E64 A;  3M53 A;  2Y90 A;  4MMK A;  1SSF A;  3V8L A;  5FRM A;  4PJO C;  3LWI A;  2LRQ A;  4N4H A;  1Y07 A;  5I2M A;  3CME T;  3G7Z A;  3OMC A;  3SFM A;  2ZPE B;  3GOX A;  3OB9 A;  2CZ0 B;  5LJ3 e;  5HKC A;  4OGE A;  4XTX A;  2NLU A;  1K8A U;  1X75 C;  1UGP B;  5FU6 B;  3SB2 A;  3P8H A;  2FL7 A;  3GPL A;  1QP3 A;  1UGQ B;  2X4J A;  3JAM E;  4M7A E;  1VQO T;  5GAN 6;  2ZGW A;  2DZC A;  3UPU A;  2R5A A;  4M7A A;  2D9T A;  2K57 A;  3MP6 A;  5GAN 7;  4HKE A;  5I2S A;  3G71 A;  1UEB A;  4BDZ A;  4M7D B;  2VYT A;  1G3W A;  2XU8 A;  3V7S A;  4CI0 C;  3S3O A;  1VQ6 A;  2RHZ A;  4M75 D;  3CD6 T;  2KMT A;  3R6O A;  3LYI A;  3WVE B;  3CCJ A;  2HD0 A;  2QQ9 A;  3LX7 A;  4EMH A;  4C92 E;  5GAM j; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...