1Y71A

X-ray crystal structure of kinase-associated protein b from bacillus cereus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
124
structure length
109
Chain Sequence
TFEIGEIVTGIYKTGKYIGEVTNSRPGSYVVKVLAVLKHPVQERRALAFREQTNIPEQMVKKYEGEIPDYTESLKLALETQMNSFSEDDSPFAERSLETLQQLKKDYKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of kinase-associated protein B from Bacillus cereus
rcsb
source organism Bacillus cereus
molecule tags Structural genomics, unknown function
molecule keywords Kinase-associated protein B
total genus 29
structure length 109
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08810 KapB Kinase associated protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.430 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1y71A00
1Y71A
chains in the Genus database with same CATH superfamily
3EG9A 4BY6B 1UJYA 1R8OB 3OYEA 1NLPC 5GMKm 2EQJA 2OX7A 2CH4W 2EKOA 1VOMA 3HFNA 1N8RU 4RUGA 2RH2A 5KYNA 4LDXA 2L2PA 2PQWA 1VQ4Q 2DIGA 4J6YA 1GBQA 1YFNA 4XU0A 5LJ5g 4J6XA 4CRIA 4KT0E 1R77A 2YUPA 1K76A 2XIDA 3VUZA 2F5TX 3G7ZA 3CCVQ 2EPDA 1G8XA 5GAOq 1QVGP 3EFSA 2AK5A 5HK3A 4C8QG 5ECAA 1YJ9T 1VUBA 2VB6A 2XICA 3TEEA 1AT1B 4M7AA 4KUDK 2VUBA 5GAN8 3SEMA 2CP0A 2DL7A 3PE0A 4D8KA 3OA6A 1KQ1A 1YCSB 2HQXA 3BDUA 2X35A 1WQWA 3QDRB 3V8LA 3FEOA 3A8HB 2O31A 3SWNB 1VQMQ 4C92A 4LDYA 3QXEB 2KNBB 4C0DC 4KGXB 3G6EA 3H9NA 5DM7R 3M59A 1RUWA 2GBQA 5EG2A 2JM8A 2QI2A 2EGAA 4M75B 3PGGA 1NE8A 2BE9B 4RTTA 1E6HA 4E7LA 2NUZA 2SRCA 5DLQE 5HCKA 1D3BB 2NUPA 1K9MR 1M8VA 3THKA 1M3BA 1KQSA 2E6NA 3URGA 4PJOD 4C92E 3JB9D 2RNAA 2KGTA 4C92B 1BI1A 4C8QB 1X27A 3NTHA 3L42A 4KRTA 1U06A 1N9RA 1EZZB 4IUQA 1K9MC 3CC7Q 1Q81U 3MHXA 3QWYA 1ZA1B 4C0DB 2V8KA 3DLMA 1RACB 4E47A 1OU8A 5GMKe 2CT4A 4RTUA 3RKWA 1ABOA 2LQWA 2HQEA 3OYJA 1VYTA 3CCRT 1S72A 4X9DA 3Q1JA 3OS2A 2EFIA 2LJ3A 3LH0A 2OI3A 3EH2A 5LL6S 4JJDA 3M0RA 1MMGA 2O4XB 2L3SA 4IKFA 4J9DA 4PLLA 2GNCA 4EIKA 4D6WA 5L8RE 4M78B 1MMNA 2KK4A 3MEWA 3MEVA 4ELYC 3JCMX 4OMPA 2LMJA 1PKSA 2DLPA 2NLUA 3EG3A 4M7DE 1YI2T 1M1KC 1NEBA 1T3LA 2HD0A 4ZN1A 5GMKi 3HPWA 2QXFA 3CD6T 2D0NA 3UATA 3OYFA 1VQ9Q 2LCLA 3V8KA 2JT4A 4XU1A 4MZTA 3M0QA 1W70A 2ROLA 2OTLT 2AHJB 2V8IA 4EMKC 3H41A 3LLRA 2KYBA 2KMTA 3EGUA 4MDXA 4C5HA 2V1QA 3ZL7C 4CC2A 3BDLA 3EFOB 1PSEA 5HY6A 7AT1B 1I5LA 3QUIA 4Z8AA 4C0ZA 3A1PA 1VQPA 4M7DC 5FRMA 3JCMW 1WIEA 1YHQA 1D3BA 3PT9A 2KYMA 2Y90A 4M7AG 2E41A 2CSQA 1KC8U 2WSEE 3OW2S 1C0MA 1K0SA 3CPWP 1OZ2A 4ANJA 1YJ9A 1H3ZA 1B7TA 3M4GA 3FLGA 3MPUB 1VQKQ 4MDWA 3A8OB 2CP5A 1UE9A 2KVQG 3F70A 1GRIA 2DILA 1MNDA 2KRSA 3NTIA 2E1HA 3G4SA 1ABQA 1E7OA 2E5QA 2FO0A 5AT1B 1U8RA 3M53A 3UA7A 1JJ2A 1SG5A 4MMKA 2PZ1A 4J5YA 2HAXA 1GCPA 3C94A 1S72T 1NEGA 4PFOA 1M5Q1 3VS3A 4A54A 3GF5A 5GMKl 3CCUT 4KGVB 1RL2A 1NBEB 5GMKj 1JBMA 4C0GA 2DJQA 1QCNA 2VYTA 3QZ5B 4XK8E 4LDWA 2DYBA 1F1BB 4OMQA 3M0SA 1GL5A 3VV0A 1M1KU 1BI3A 5KE2A 2K9GA 2YRVA 1RAGB 2E12A 3M55A 2X4YA 2QA4T 1HSQA 1VQOQ 2ZZDA 4QT7A 1XNIA 4JRQA 1WZOA 4JRPA 3QJYA 2EYWA 3M0TA 4LXCA 1QMCA 1VQ7Q 1KK7A 2FPEA 1JO8A 1ZA2B 3UT1A 1UGVA 1VQPQ 1YJNA 3S3MA 1BIAA 1VQLT 3CC2Q 4J7IA 2R5MA 2L89A 2LNHB 2ESWA 1PSFA 2QQSA 3EGDB 1A0NB 1TUCA 2DTHA 1RABB 1AOJA 1NLOC 2OTLQ 2KSSA 1WJRA 2LQ8A 4OB3B 4N4HA 3DLLA 1U1TA 5CR2A 4J9FA 3PIPA 2DTIA 4TVRA 5CAIA 2RF0A 2VGMA 3J81E 1ZSZC 2BKDN 4Q5WA 4DA4A 3P8HA 4C92D 1QKXA 1B07A 1Y07A 2MPXC 3ME9A 3JB9H 2G6FX 3TCJA 5LJ3g 3QYHB 5GAN4 4C92G 3LWIA 4FT4A 5LJ3h 1WDXA 1MMDA 4LUEA 3QSUA 2NUTA 3JSCA 5I11A 3G4SQ 1ZX6A 1I5OB 1M27C 2YT6A 4RCCA 4Z88A 3VS6A 1N9SA 3A8MB 1BI0A 2MK5A 4M78C 4UC4A 3CC2A 4HT8A 1SEMA 1ZLMA 3LGLA 2DXUA 1NJIU 3HRSA 2DX1A 4V2SA 1W2BA 3T9NA 1XJWB 2O4XA 3CCMA 1CKBA 3G71A 1GFCA 1BK2A 4QQGA 3CCMQ 1BB9A 1M90C 4QQ6A 2EQKA 4HXJA 2A7YA 2KQWA 4EMGA 4DBQA 4FSXA 4C8QF 3EGXB 5CKEA 3CXCP 3CC4T 4F7UF 3J80E 1JQQA 3BW1A 1IXDA 5GAOm 2VWFA 2AKLA 1IB8A 3JCMf 2RI3A 4DOWA 1K9MU 3RKYA 3QWXX 1E6GA 1M1GA 4DBFA 3CC7T 3M5AA 2K79A 4FIBA 4ESRA 3HSBA 2CP2A 1BCMA 3JCMQ 2EBPA 3G1JA 2Z0WA 2MOXA 3RMSA 1K73R 2A08A 2GTOA 4M78F 1XQHA 1G3YA 4IURA 3H6ZA 3PVQA 1H3HA 6AT1B 3M57A 4M7DA 3JAME 1IGUA 4Y91A 1UJ0A 2XMFA 2CZ6B 1WYXA 2B86A 2RJFA 4C5GA 2DK3A 1IZ6A 1M4ZA 4OB1B 2MMPA 1YHQT 2QTXA 3EG9B 4D8DA 1PHTA 1VQ5T 1ARKA 4ZGDB 5CCAA 3M58A 2K5IA 2LCSA 3JCMP 2DIQA 5GAMj 1RLQC 5GMKh 2FL7A 3JB9F 1QCOA 1PD1A 1RAFB 1ZUKA 4IIMA 1YITA 2ZAEA 1AZGB 4IIOA 4O6JA 4M77B 2KT1A 1QW1A 1G2BA 2EQMA 3LYIA 2DERA 3LGFA 3MKDA 2RHZA 1X6BA 2XKOC 1UG1A 3ZFJA 3TVTA 2LVMA 3ZEHA 2GCXA 2HBPA 1YBYA 2JS0A 3RNJA 2GQVA 1ZSZB 2F5KA 2R58A 3SWNA 4CC4B 2A28A 3E1SA 4E2FB 3M56A 2COYA 1GCQC 4FW2A 2KXCA 2OTLA 3S3NA 2J05A 4Y92A 1S1NA 3CXCS 4AFZC 1TTHB 2RHYA 3CC4Q 3INZA 4ATOA 3CCRA 4M78G 5IN1A 1NJIR 2AZSA 4M7AC 2ZPBB 4OGEA 3I55Q 2K3YA 4AT1B 4BE1A 2OAUA 1H8KA 3EH1A 3ZBDA 4M78D 1RAHB 2DL3A 1Q86C 1JXMA 3KUFA 5FWBA 3OYMA 4YTLA 3CPWA 3E9GA 2IIMA 2O9SA 2F2VA 1C1AA 2XI9A 1X2KA 4RTWA 5LJ3j 3CEYA 4BI8B 2A3LA 1TSFA 2QYZA 1OOTA 2DXCA 4AFUC 4IUTA 3CCJT 4XU2A 2YUQA 2HZYA 1VA7A 3CMEA 4HVVA 4KUIA 2DL8A 2EW3A 4Z02A 3PMIA 2DZCA 4EMKA 1O75A 3CD6Q 1KFZA 2MAMA 3EFOA 1J3TA 2PUOB 5KYYA 2KEAA 1QVFS 2HKNA 1JB0E 4FYYB 4OF1A 3DB4A 2D9TA 2KR3A 2D8HA 2HCKA 4BB7A 1KJWA 2FVUA 2K6DA 4M78A 3ASKA 1OYXA 1UFFA 3RUXA 2QQBA 2EJGA 2E64A 3OYHA 1HD3A 1G5VA 1LPLA 2E10A 3AT1B 1PM3A 3VYHB 1SPKA 1U1SA 2VGNA 1V29B 4OMFB 3A8GB 4HT9A 2CZ1B 4ZTFA 1X75C 1GFDA 2DKGA 3DKMA 3CCEQ 3X24B 1MV0B 4R0KA 3C95A 3X26B 5M9OA 2RK1A 2DD4A 5I21A 1YITT 4E7ZA 2RMOA 1FMWA 2MWPA 4VUBA 4A4GA 4FM4B 1MGQA 1C6VX 4OB2B 1UEBA 1LVKA 5A2QE 2AT1B 4RMOA 2QQ9A 2DXTA 1KIKA 1N5ZA 4E7SA 2KE9A 3C4SA 4ZTJA 3G71T 3META 2P0QA 1MV3A 4X9CA 4C92F 4LNPA 1N8RR 1WI7A 2HSPA 1WPYA 5FU6B 4EDUA 4CC3A 3D7SB 2DYIA 2KI7A 1IHWA 4CC7A 2XHCA 2AZVA 2C0TA 3OYKA 4N0AA 1M1KR 2RM4A 1TH7A 2OTJQ 2XDDA 2GF7A 2OTJA 1D1BA 3RIRA 1KG1A 1QCFA 3OSSC 2QG9B 3UDCA 2R57A 2C0IA 2EYQA 1VQOT 5LJ5j 3QDFA 1W4SA 1ZBJA 2ZCFB 1O9SA 2JTEA 2DVEA 1NZ9A 1KQSP 3VJPA 1PCXA 1DJ7B 1AZEA 2K2VA 3QJ6A 4IUPA 3JCMe 3GPLA 2YDLA 2CH4A 3VYGA 2MYSA 3MEAA 3CCVA 5FU7B 2QQAA 1D1AA 3QKJA 4M78E 4L5GA 1SHFA 2D0QB 2IVWA 3A8LB 1SRMA 2FRYA 4J9GA 4Y28E 2CUDA 4C8QC 1ZBXA 1LJOA 2IPOB 2O01E 1UUEA 3JB9G 3CMAT 5LJ5e 4LDUA 2BZ8A 4FU6A 1I4K1 2LDMA 1YIJQ 1YJNT 3GOXA 3CCSQ 4IUUA 2B8AA 1K1ZA 3LW5E 2BE7D 2C0OA 4PJOC 3HKSA 2L5QA 3QBYA 2RHIA 3GBQA 2LRQA 4C0FA 3VKIA 2DL5A 4F04B 1VQ9T 4NOYA 3PVLA 1OPKA 5KYWA 4X34A 2PTKA 2RQWA 5CKBA 1UGSB 2QDLA 3TREA 2RQTA 3KFVA 2MI6A 3EHRA 4M75C 2F1LA 4KULA 1QKWA 3UPUA 1H92A 4CI0C 3X28B 2O88A 2RD1A 2JJ9A 2M9UA 2QAZA 4FYWB 3CQTA 3MCAB 3KXTA 2ZPIB 3M54A 3OYLA 1TXQA 4E7HA 2M16A 2K5FA 3RKXA 2DD5A 2RPNA 2AKKA 1NPRA 5C6SA 1V76A 2X3XD 4XTYA 5L23A 1WXTA 2ATCB 3JCMJ 3TU4K 1JXOA 2EQIA 3OMCA 4B6MA 1EX4A 4PNOA 2JM9A 3L2QA 3P8DA 2O9VA 4O5VA 1OU9A 3M9QA 3I56T 4J9CA 3WVEB 4R56A 3R6NA 2JMAA 1OX9A 2KY9A 1M9SA 3L2ZA 3L2UA 2DF6A 1FYNA 3VS1A 3GIBA 3CCJA 2DTOA 2FRWA 1KHCA 4ME7A 2XDPA 4RTYA 2DA9A 2VASA 1SHGA 5KYUA 1Y96B 2H8HA 2YHTA 2CZ7B 4XU3A 5CIUA 4F7UA 3V7CA 2QEXQ 1FX7A 2PNIA 3H0HA 4BACA 5IAYA 3OW2P 4C8QA 3CBPA 1BBZA 1WHJA 1RAEB 4J9EA 2RQRA 2LCCA 3SD4A 1X43A 4RTXA 1VQKT 8AT1B 3CCSA 3PFSA 1UECA 4Z89A 3V8JA 4A4FA 1IREB 2BIVA 2WSFE 1Q82R 1K8AC 1RLPC 1WLPB 3VS5A 1T0HA 1PD0A 1YJWA 4PKCC 2X4WA 4PJOA 1N27A 2RB6A 1M2VA 4N0AC 1MHNA 4M77E 1PWTA 2QGGA 3S3OA 4MZMA 5GANf 5GAN2 1IGQA 1MNEA 5J3BA 1W2BP 4BI4A 1BI2A 3N5BB 2MCNA 3UWNA 2V26A 1FMVA 2X4JA 2DM1A 2RHUA 2QEXA 2RN8A 5GAMf 2YUOA 2DBKA 3JCMc 4LN2A 3LH5A 1G83A 1Y71A 1VQKA 1SRLA 1JU5C 2JVVA 3EHQA 1KD1R 2P4TA 4KH1B 1Q7YR 3EG2A 2PVDB 3CCLQ 2W0ZA 2FB7A 2PUKB 3EG1A 1CSKA 1HJDA 4PFZA 2HL5C 2M02A 1PKTA 1X01A 2EGCA 1YHQQ 1QVGS 5KYXA 4OB0B 2FZKB 4N4GA 5GAN6 3CCUQ 1VQ8A 4JUVA 1RAIB 5J39A 1I07A 3OSVA 5GAOp 1X2QA 1Q7YC 5D6XA 1KD1U 1Q81R 2E70A 4JLIA 1AD5A 3PMTA 4ZGJB 5FROA 1AWWA 4DBRA 2VC8A 5KYUB 4J8OA 4GLMA 2ZPFB 3V7RA 5CO7A 4ORZA 2RHXA 1VQNQ 2YRCA 3X20B 5GJWB 2QA4Q 1VQ6A 5CK9A 1VQ9A 2DVJA 3WVDB 3REBB 4A4EA 1B34A 2FPDA 4ZNXA 3OY9A 1BYMA 1I0CA 4A4KA 2YXYA 2C06A 1ZSGA 1YWOA 4JZ4A 1UTIA 1X69A 3C0CA 4KGZB 2Y4XA 1TUDA 5FLXE 5IXBA 2E6ZA 5GAN5 1I8FA 2CGHA 2KRMA 2D8JA 1S72Q 1M2VB 4M7AF 4LE9A 3PNWC 4PJOB 5GAMg 1Y57A 2HL3A 5CKHA 2HQHA 1JJ2P 5D6WA 3OW2A 3MP1A 2BTTA 2DRMA 2W10A 2KRNA 2CSIA 1Y96A 3CCLT 1YN8A 3GNGA 1YJWT 4BY6C 4RKUE 3GLXA 1EIFA 4M75F 3NPFA 1AWJA 1Z9ZA 2FPFA 4A53A 2L8DA 2ED0A 2WACA 4MMLA 2XU8A 2YRDA 3AHUA 1WHMA 2DZ9A 3E2UA 3HFOA 3HTRA 3RR6A 5FW9A 2YUNA 2FZGB 4DOVA 1YITQ 1UGPB 4B9WA 2HEQA 3GNFB 1VQNT 4PJLA 4C8QD 3UF4A 4F14A 2DMOA 4PLIA 1M90R 4M77D 3QG1A 3JCMb 1Q86R 2XDBA 2EYYA 2ZPHB 3CCVT 2VXEA 1KD1C 1GXIE 1BIBA 1D0XA 4RTVA 3G6EQ 1P92A 3I55A 2ENMA 3CCQT 1QP2A 1N6AA 3QZ9B 2CKKA 1SF9A 5IT9E 2RI5A 2EAYA 2XK0A 3M4YA 1NG2A 2EKHA 2R5AA 1V1CA 4KBMB 5IHKA 3X25B 1IO6A 2RA2A 5GAMh 4WF2A 1XTDA 1OI1A 1TG0A 1WXUA 1B3QA 1VQMA 1IRXA 2ZPEB 5I22A 5KE3A 4FYVB 3I35A 2CS7A 2V8JA 4BDZA 1VQ5A 1MMAA 3V7SA 5FWCA 1YIJT 3SFMA 2EYXA 4L6V5 2KT8A 1K0XA 3I9QA 1QVPA 5GAMe 2KBTA 3CCST 3CC7A 3P8BB 2NYSA 4OMOA 3I5SA 3VS0A 1LCKA 3JCMh 2CDTA 2HDAA 4JRIA 1FWZA 4NL2A 4ELZC 3TSZA 4M7DF 2EQUA 3JB9I 1OULA 1UHFA 2CP3A 5DY9A 2DPPB 5FRNA 4XQ3A 1KQSS 1TU0B 5D6YA 1PG5B 3C12A 3QIIA 2EWNA 4HVWA 3FC3A 4M75D 5LJ5d 2JW4A 2KXDA 1VQMT 2L3PA 3J7AF 1BCOA 1SSHA 2EYZA 4HA8A 4LDVA 2LT4A 1VYUA 3FRNA 3CCUA 2DJZA 4JJBA 1LNXA 1OX8A 2M0OA 3VRZA 2J6FA 1VQ5Q 3MP6A 3G4ST 5KYWB 1QWEA 3CBOA 2LX7A 2CUBA 1AEYA 4E6RA 4NS5A 1K9AA 3CCRQ 3HRTA 1G3WA 2JNGA 3RESA 1GBRA 3VU3C 4E7IA 2JMCA 4M77C 1B34B 3CMAA 1YIJA 5GAMd 5CKFA 4F7UB 3OYGA 5CVIA 4E7JA 2QQRA 2YWWA 4DBHA 1Q95G 3RMQA 1BU1A 1MUZA 4J9IA 5FU7C 4QQDA 3VS2A 3OYCA 4XTVA 4GLKA 4OGCA 1RAAB 4PK4A 2LZ6B 4HCKA 1NJIC 2RK2A 2K2MA 3OYDA 2YSQA 1VIEA 5I2MA 1Y0MA 2ZGWA 1YJWQ 2CZ0B 3CMAQ 3IQLA 4PL6A 1QLYA 4ZGEB 1WHGA 1M90U 2CREA 5IH2A 1M3CA 3OYIA 2L0AA 4HCBA 3VS7A 3CC4A 1XOVA 1Y7XA 5CKDA 4M4ZA 4J9HA 5HK0A 4JZ3A 1OQKA 2PVOB 2RQVA 1HXDA 4JJCA 2O2OA 1UB4A 3QHSA 4JS4A 2XD0A 2F2XA 5GAN3 4HCCA 1T0JA 2LNVA 1R0BG 4C5EA 3KBGA 4OMMA 3HL8A 3LWHA 3PTAA 1RI9A 3TQ7P 2OTJT 2K7AA 2DFUA 2MWOA 3FIFA 4M75G 1QP3A 2JOYA 3OYAA 1T3SA 4HCZA 4M7DG 2K4YA 5I2SA 1VIFA 1KHIA 1M3AA 2YLCA 5LJ5f 1ZUUA 3MEUA 2J06A 1RI0A 4RCBA 1IHVA 3OS0A 1QVFP 8ATCB 4M7AB 3DB3A 4PFPA 4IUVA 4C8QE 3QPHA 2LC4A 2GQIA 2RO0A 1D0ZA 5GANj 2H3JA 3R6OA 4KH0B 2J7IA 2COZA 1Z9QA 2COWA 5LJ5h 2XG8D 4ZN3A 3OMGA 1ZQ1A 5IXFA 4N4IA 5DLOA 4JS5A 2RJCA 2FYKA 2V1RA 3SHWA 4AG1C 4BI3A 2KDSA 5GAOl 1W1FA 1RADB 1VQ7A 1EFNA 2IG0A 4BUGA 1ZUYA 1UDLA 3VRYA 3FDRA 4HKEA 1YJNQ 1AHJB 3SB2A 1NPPA 4RG8A 1VYVA 1YWPA 1JEGA 3OYBA 4BE2A 4M77A 3NGPA 2AIRB 2HBWA 3CMEQ 2QA4A 1VQ6Q 3SDZA 3EG0A 1WJQA 4JPBW 2H3EB 3OYYA 2FHDA 2VVKA 4GBQA 4XTZA 3NFCA 3CPWS 1WJSA 2KROA 2L3RA 4FT2A 4B9XA 2CYZB 3I5RA 2DAQA 4F16A 5GANd 3OS1A 5GANg 2D1XA 2E4HA 3E9FA 4P5NA 3GP8A 4PJMA 2X4XA 3U23A 3JV3A 3WXMB 2EIFA 2QTVA 4FYXB 2JZ2A 4XTWA 3TSWA 2DO3A 2K3BA 3CCET 1NYGA 5HKCA 4XTUA 1WXBA 1Q86U 4X1VA 3CC2T 3MO8A 1Q82C 1ZSZA 4BD3A 1UHCA 1YJ9Q 4NL3A 2VXFA 2F2WA 1OEBA 5KH6A 4F7UE 5EC7A 2OAWA 4LUDA 1M30A 1FXXA 1D09B 2CP6A 4JDSA 3G71Q 3S6WA 4PJOG 4M7DB 2ZPGB 3ULRB 2E3HA 3NHNA 5KYXB 3HRUA 2NUTB 4QVZA 3L2VA 4M75A 2PU9B 3VS4A 2KAFA 2WSCE 3JB9J 4DEXA 2X9HA 3RDVA 2A36A 1VQNA 4QVCA 1K73U 4M77F 2P84A 4DEYA 4PJOE 2K5LA 1HYOA 3EAEA 5KCOA 4J9BA 2E5KA 2QDYB 1VQ8Q 1BKBA 4RG2A 3MJXA 1ACMB 2RJDA 2DETA 5FU6C 5CQYA 3CPFA 3M0PA 1JRIA 9ATCB 3JRZA 1PRMC 4J83A 1GCQA 1AWXA 4M75E 3CCLA 2EJFA 3REAB 2JXBA 1VQLA 4OMLA 1SSFA 3HP9A 1QVFA 3SWNC 2X3WD 1R0CB 3QO3A 4C5IA 4EMHA 4J6WA 3MP8A 4OVAA 2M0YA 4RTZA 2MIOA 5AYFA 2P0PA 4QKUA 1VQ6T 2P4RA 4R55A 4M7AE 1UGRB 3G6ET 4EPCA 1PNJA 3QYGB 3L1AA 3CCQQ 1M1FA 4XAXB 2EJ9A 2HNIA 3HHTB 2DXBA 2EGEA 2JTMA 1D0YA 4XTXA 2LP5A 2JTFA 2GFUA 4QW2A 4M7DD 3H0IA 3LX7A 5KYYB 4PJJA 3O8VA 1X6GA 3O5ZA 1TWBA 4GY5A 3I56Q 1WX6A 1WHLA 2ABLA 4PJNA 2GTJA 4AFQC 4M77G 3OS5A 1QVGA 2CT3A 5GANh 2DBMA 4J7FA 5A0LA 1QQJA 3OYNA 3CBMA 3PIOA 1K8AU 2G3RA 1I81A 1WA7A 2YLBA 5CQXA 1YI2Q 2LTOA 3CCMT 1TOVA 2QGFB 2DE0X 3CXCA 1W2BS 3CMET 2OJ2A 2MF2A 2HKQB 1OPLA 2J6KA 2E65A 2QEXT 4BE0A 2GFAA 3JCMg 2A37A 2PVGB 1OZ3A 4JJNK 1ZHIA 5GAOn 2DRKA 1K8AR 3A98A 1VQPT 1TUGB 1M8MA 5KCHA 3CCEA 3OB9A 2RI2A 1HK9A 2VV5A 3FJPA 4PJOF 4II1A 1K4US 1W6XA 2P0KA 3BY7A 4EMKB 5C0MA 2HSEB 2NWMA 3OBWA 3BE3A 1KSWA 4C92C 1AWOA 2FZCB 3I55T 4A4HA 1SKUB 2J6OA 4AG2C 1YNZA 2GGRA 3FJ5A 4L59A 5LJ3d 4FW1A 4F7UG 2F69A 3CD6A 4OP0A 1KQ2A 1PC0A 3EGXA 1FMKA 2EVRA 3E19A 1U5SA 5GANe 4LD6A 3ER0A 2JN0A 2HMAA 1JJ2S 1OV3A 1D1CA 3RBBB 2FG0A 5GJVB 1VQ4A 2E3IA 2K57A 3JCMd 4F17A 5GAN7 3CCQA 1WHHA 1G3SA 3OQ5A 2LT1A 3I56A 5LJ3e 1I1JA 2ROTA 2QK0A 1G3TA 4WCIA 2ED1A 2LQNA 4QVDA 1Q81C 4E7KA 1WGSA 2LJ1A 4FL6A 4DQ2A 2VKNA 5A0DA 3JCMV 2I0NA 5LJ3f 3NTKA 2M51A 4BDYA 2Y4YA 1U3OA 4A63B 1LOJA 1X6OA 5GAOr 1WNLA 1WFWA 1YI2A 2BZXA 3H0FA 4AFSC 2D6FA 2LJ0A 3L2RA 1M2OA 3BFMA 2DL4A 1K73C 2DNUA 3CCJQ 2K3XA 4OMNA 1PRLC 1VQ7T 5A0GA 1VQLQ 3NMZC 2LX9A 3H8ZA 5D7UA 4JLGA 2NUPB 3UA6A 1CKAA 4JRKA 1QWFA 2LQKA 1YCYA 2CP7A 3FB9A 4MZPA 2M1HA 2I2LA 2QASA 4AMCA 1Q82U 2L3QA 1TS9A 1UGQB 4WTOB 2JS2A 3EFRA 3OBYA 4FCYA 4M7AD 2ECZA 1KC8R 2DEUA 4K11A 4LD9K 1YP5A 1WHKA 2BZYA 2RJEA 1VQ8T 3RERA 4FSSA 5IHIA 3M0UA 2FEIA 3A5ZB 5IHNA 1NM7A 2SEMA 2BUDA 3VUBA 3L2WA 2RQUA 1Q7YU 2X51A 2DEQA 2A0FB 4HVUA 1VQOA 1NYFA 5J26A 1N8RC 1KC8C 1WQ7A 1AVZC 1H641 2JUFA 3EGDA 1VQ4T
chains in the Genus database with same CATH topology
4FIBA 4M7AB 3HSBA 3DB3A 4BY6B 2LCCA 3JCMQ 3SD4A 4IUVA 4C8QE 1R8OB 1VQKT 3QPHA 2LC4A 3RMSA 3CCSA 3OYEA 5GMKm 3PFSA 2RO0A 5GANj 2EQJA 2H3JA 2EKOA 4M78F 3R6OA 3V8JA 3HFNA 1XQHA 1G3YA 5LJ5h 2XG8D 4ZN3A 4A4FA 3OMGA 1IREB 1ZQ1A 4IURA 1N8RU 4N4IA 5DLOA 3H6ZA 4JS5A 2BIVA 2RH2A 2FYKA 2RJCA 2WSFE 4LDXA 1K8AC 3M57A 2PQWA 4M7DA 3JAME 2DIGA 4J6YA 4BI3A 4Y91A 2KDSA 4XU0A 5LJ5g 5GAOl 1YJWA 4J6XA 1VQ7A 4CRIA 2CZ6B 4KT0E 2IG0A 2X4WA 4PKCC 3VUZA 2XIDA 1N27A 2RB6A 2F5TX 3G7ZA 4BUGA 4PJOA 3FDRA 4HKEA 5GAOq 4N0AC 2RJFA 1MHNA 3EFSA 2DK3A 4M77E 1AHJB 4C5GA 5HK3A 1IZ6A 1M4ZA 4OB1B 1NPPA 3SB2A 4C8QG 3S3OA 4RG8A 4MZMA 5GANf 1YJ9T 1VUBA 2MMPA 1YHQT 5GAN2 2QTXA 2XICA 3TEEA 4M7AA 5J3BA 3OYBA 4KUDK 4BE2A 1VQ5T 2VUBA 4BI4A 1BI2A 3N5BB 3UWNA 4M77A 4ZGDB 5GAN8 2X4JA 5CCAA 3M58A 2K5IA 3JCMP 2DIQA 2RHUA 5GAMj 2QEXA 5GMKh 2QA4A 5GAMf 2FL7A 3SDZA 3JB9F 3JCMc 3OA6A 1WJQA 1KQ1A 2HQXA 3BDUA 2X35A 1YITA 1Y71A 1VQKA 1WQWA 3OYYA 2FHDA 3QDRB 3V8LA 4XTZA 3NFCA 3CPWS 3FEOA 2JVVA 1WJSA 4M77B 3A8HB 4O6JA 2L3RA 1QW1A 2EQMA 4FT2A 2CYZB 3SWNB 3LYIA 4B9XA 4C92A 4LDYA 3QXEB 3LGFA 2RHZA 2DAQA 5GANd 2P4TA 2XKOC 5GANg 3OS1A 3ZFJA 4C0DC 3E9FA 2LVMA 2PVDB 4P5NA 3ZEHA 2GCXA 3G6EA 3GP8A 2HBPA 1YBYA 5DM7R 2FB7A 2PUKB 2X4XA 2GQVA 3M59A 3WXMB 2EIFA 2F5KA 1X01A 2JZ2A 4XTWA 2R58A 2DO3A 3SWNA 1QVGS 5EG2A 3E1SA 4OB0B 4N4GA 3CCET 5GAN6 2QI2A 1VQ8A 3M56A 4JUVA 5HKCA 4M75B 4XTUA 5J39A 3PGGA 3OSVA 1NE8A 5GAOp 1Q86U 3CC2T 3MO8A 1Q7YC 3CD6T 5D6XA 4E7LA 1KD1U 1Q82C 4BD3A 2OTLA 5DLQE 2E70A 4JLIA 4ZGJB 3PMTA 3S3NA 1D3BB 5FROA 2VC8A 3CXCS 1M8VA 4J8OA 3V7RA 2VXFA 2ZPFB 5CO7A 4NL3A 2RHYA 5KH6A 2RHXA 3INZA 3X20B 2E6NA 4F7UE 3URGA 1KQSA 4ATOA 4PJOD 4C92E 3CCRA 4M78G 5IN1A 3JB9D 4M7AC 4C92B 1VQ6A 1BI1A 4C8QB 2ZPBB 4OGEA 3NTHA 2K3YA 1FXXA 3L42A 5CK9A 4JDSA 1VQ9A 3S6WA 4PJOG 4BE1A 2OAUA 4M7DB 1N9RA 2ZPGB 3WVDB 3ZBDA 4M78D 4A4EA 1B34A 4IUQA 1K9MC 3HRUA 3OY9A 1Q86C 1Q81U 3MHXA 4QVZA 3L2VA 3KUFA 4M75A 3OYMA 1BYMA 4YTLA 4C0DB 3CPWA 2PU9B 3E9GA 4A4KA 2V8KA 3DLMA 4E47A 2KAFA 2XI9A 5GMKe 2C06A 2WSCE 3RKWA 3JB9J 5LJ3j 2Y4XA 3CEYA 2HQEA 3OYJA 4BI8B 2A3LA 5FLXE 3CCRT 1S72A 4X9DA 3Q1JA 3OS2A 1VQNA 2EFIA 2E6ZA 4QVCA 5GAN5 3LH0A 4M77F 1K73U 2DXCA 1I8FA 2CGHA 5LL6S 4PJOE 4IUTA 4M7AF 4PJOB 3PNWC 2K5LA 3CCJT 5GAMg 2O4XB 4XU2A 3EAEA 4IKFA 5CKHA 3CMEA 4PLLA 5KCOA 5D6WA 4KUIA 3OW2A 2QDYB 3MP1A 4D6WA 1BKBA 4RG2A 4M78B 5L8RE 4Z02A 1Y96A 2KK4A 3CCLT 3PMIA 2DZCA 2RJDA 3GNGA 3MEVA 3MEWA 4EMKA 4BY6C 1O75A 1YJWT 4RKUE 5FU6C 2MAMA 5CQYA 2PUOB 3CPFA 1JRIA 4ELYC 1QVFS 3GLXA 1EIFA 1JB0E 3JRZA 4J83A 4M75E 3JCMX 4OF1A 3DB4A 3CCLA 4M75F 2EJFA 2NLUA 2D9TA 1VQLA 4M7DE 1YI2T 4A53A 2L8DA 1SSFA 3HP9A 4BB7A 1QVFA 2WACA 4MMLA 2XU8A 2FVUA 2HD0A 4M78A 3ASKA 3SWNC 1M1KC 3AHUA 1OYXA 4ZN1A 3RUXA 2QQBA 3QO3A 5GMKi 3HPWA 2DZ9A 2EJGA 2QXFA 4J6WA 3HFOA 4C5IA 3MP8A 2E64A 4EMHA 3OYFA 2LCLA 3V8KA 3OYHA 1G5VA 2E10A 4OVAA 4XU1A 4MZTA 4DOVA 2OTLT 1UGPB 3VYHB 4B9WA 1U1SA 2P0PA 2VGNA 3GNFB 5AYFA 2AHJB 1VQ6T 1V29B 1VQNT 2V8IA 4EMKC 4OMFB 4R55A 4M7AE 1UGRB 3A8GB 4HT9A 3G6ET 4EPCA 2CZ1B 3LLRA 4ZTFA 3QYGB 2KMTA 1X75C 3L1AA 4C8QD 1M1FA 2DKGA 4XAXB 4MDXA 3DKMA 4C5HA 2EJ9A 4PLIA 3X24B 4M77D 3C95A 3QG1A 3X26B 2HNIA 3JCMb 3BDLA 5M9OA 2XDBA 3HHTB 2DXBA 2RK1A 2DD4A 2JTMA 1PSEA 5HY6A 5I21A 2ZPHB 4XTXA 3CCVT 2VXEA 1YITT 1GXIE 2JTFA 4VUBA 2MWPA 4A4GA 2GFUA 4QW2A 1KD1C 1BIBA 1MGQA 3QUIA 4FM4B 1I5LA 4M7DD 4C0ZA 3LX7A 1VQPA 4M7DC 1P92A 3I55A 5FRMA 3O8VA 3CCQT 4OB2B 3JCMW 1QP2A 1N6AA 1UEBA 1YHQA 3QZ9B 2CKKA 1D3BA 4GY5A 3PT9A 5IT9E 4M7AG 2Y90A 5A2QE 2RI5A 2EAYA 2XK0A 3M4YA 4RMOA 2E41A 1KC8U 2QQ9A 2R5AA 2WSEE 2DXTA 3OW2S 4KBMB 1OZ2A 4M77G 3X25B 3OS5A 1QVGA 2RA2A 3C4SA 5GAMh 4WF2A 1YJ9A 3M4GA 1XTDA 3FLGA 4ZTJA 1OI1A 5GANh 4J7FA 4MDWA 3G71T 5A0LA 3META 3A8OB 2P0QA 2KVQG 3CBMA 3F70A 4X9CA 4C92F 3PIOA 3OYNA 1K8AU 3NTIA 2G3RA 1VQMA 1I81A 2E1HA 2YLBA 5CQXA 3G4SA 2ZPEB 2LTOA 3CCMT 5KE3A 1WPYA 2E5QA 5FU6B 2CS7A 2V8JA 3CXCA 4BDZA 1VQ5A 1W2BS 4EDUA 3V7SA 3CMET 1YIJT 1U8RA 2MF2A 3SFMA 3M53A 1JJ2A 4L6V5 2E65A 4MMKA 2QEXT 2XHCA 3OYKA 4BE0A 4J5YA 2HAXA 2GFAA 4N0AA 3JCMg 1QVPA 5GAMe 2PVGB 2RM4A 3CCST 1TH7A 1OZ3A 4JJNK 1ZHIA 3C94A 5GAOn 3CC7A 3P8BB 2XDDA 2GF7A 1S72T 1M5Q1 2OTJA 4A54A 1VQPT 3GF5A 5GMKl 3JCMh 3CCUT 4JRIA 5KCHA 3RIRA 1FWZA 3OB9A 4NL2A 4ELZC 2RI2A 3CCEA 3OSSC 4M7DF 1KG1A 2EQUA 1HK9A 1RL2A 3JB9I 1H3ZA 2VV5A 3FJPA 4PJOF 5DY9A 5GMKj 1JBMA 2DPPB 2R57A 4XQ3A 3UDCA 4C0GA 1KQSS 2EYQA 1VQOT 5FRNA 2VYTA 3QZ5B 4XK8E 4LDWA 5LJ5j 5D6YA 4II1A 1W4SA 3C12A 2ZCFB 3QIIA 3VV0A 2EWNA 1O9SA 3FC3A 2DVEA 1M1KU 1NZ9A 2P0KA 3BY7A 4M75D 3VJPA 4EMKB 1BI3A 5C0MA 5LJ5d 3OBWA 5KE2A 1VQMT 2YRVA 3J7AF 1DJ7B 2E12A 2K2VA 3M55A 2X4YA 4C92C 2QA4T 3QJ6A 4IUPA 4HA8A 4LDVA 2LT4A 3I55T 3JCMe 4A4HA 3GPLA 2ZZDA 3FRNA 3VYGA 1XNIA 4JRQA 3CCUA 4JRPA 3QJYA 4L59A 2DJZA 5LJ3d 3MEAA 4F7UG 3CCVA 5FU7B 2QQAA 2F69A 3QKJA 4M78E 4L5GA 1LNXA 3CD6A 4OP0A 2M0OA 1KQ2A 2D0QB 2IVWA 3A8LB 3MP6A 3G4ST 3UT1A 4Y28E 4C8QC 1ZBXA 3E19A 1BIAA 3S3MA 1YJNA 1LJOA 3CBOA 1VQLT 5GANe 4LD6A 2O01E 3ER0A 2JN0A 4J7IA 4NS5A 2R5MA 2L89A 3JB9G 3CMAT 5LJ5e 1PSFA 4LDUA 1JJ2S 2QQSA 4FU6A 1I4K1 2LDMA 1YJNT 3HRTA 1G3WA 3GOXA 2JNGA 3RESA 2K57A 1VQ4A 3VU3C 4IUUA 4E7IA 2B8AA 2DTHA 3LW5E 4M77C 3JCMd 1B34B 5GAN7 3CCQA 3CMAA 1YIJA 1G3SA 3OQ5A 4PJOC 3HKSA 2KSSA 2LT1A 5CKFA 2LQ8A 1WJRA 4OB3B 5LJ3e 5GAMd 2L5QA 3QBYA 4N4HA 4F7UB 3OYGA 3DLLA 5CVIA 4E7JA 2RHIA 1U1TA 5CR2A 2LRQA 4C0FA 3VKIA 2QQRA 1G3TA 3PIPA 2DTIA 1VQ9T 4TVRA 4QVDA 5CAIA 1Q81C 2VGMA 4NOYA 3RMQA 3J81E 4E7KA 1WGSA 2BKDN 4Q5WA 5FU7C 4QQDA 4DA4A 3OYCA 4X34A 4XTVA 3P8HA 4GLKA 4C92D 4OGCA 5CKBA 1UGSB 4FL6A 4DQ2A 3TREA 5A0DA 1Y07A 3JCMV 2MI6A 3ME9A 3JB9H 5LJ3f 4M75C 1NJIC 3TCJA 5LJ3g 2RK2A 3QYHB 3NTKA 3OYDA 1VIEA 5GAN4 4C92G 3LWIA 4BDYA 4FT4A 5I2MA 5LJ3h 4KULA 3UPUA 2Y4YA 2ZGWA 4CI0C 3X28B 1LOJA 2CZ0B 2RD1A 1X6OA 3QSUA 5GAOr 2M9UA 3JSCA 1WNLA 3MCAB 3KXTA 4PL6A 4ZGEB 2ZPIB 3M54A 3OYLA 1YI2A 1M90U 4E7HA 3OYIA 2D6FA 4RCCA 3L2RA 3BFMA 1N9SA 1K73C 4HCBA 3A8MB 1BI0A 2K3XA 4M78C 2M16A 4UC4A 3CC2A 2K5FA 1VQ7T 4HT8A 3CC4A 1XOVA 3RKXA 2DD5A 1Y7XA 5A0GA 5CKDA 3I56A 1NPRA 5C6SA 4XTYA 3JCMJ 3TU4K 3LGLA 2LX9A 2DXUA 3H8ZA 5HK0A 1NJIU 3HRSA 4V2SA 4JLGA 3OMCA 2PVOB 1W2BA 1HXDA 4PNOA 3T9NA 2O4XA 3CCMA 3G71A 3L2QA 1UB4A 4QQGA 3P8DA 3QHSA 4JRKA 2LQKA 4JS4A 1YCYA 4O5VA 3FB9A 3M9QA 4MZPA 2XD0A 5GAN3 3I56T 3WVEB 1M90C 4HCCA 4QQ6A 2EQKA 4R56A 2A7YA 2KQWA 4EMGA 2M1HA 4FSXA 2LNVA 4C5EA 2I2LA 4C8QF 2KY9A 3KBGA 1M9SA 1Q82U 5CKEA 3L2ZA 3CC4T 3L2UA 3HL8A 1UGQB 3LWHA 3PTAA 3GIBA 4F7UF 3CCJA 2DTOA 1KHCA 3EFRA 3OBYA 4M7AD 2OTJT 3J80E 2MWOA 4ME7A 3FIFA 2XDPA 3BW1A 4LD9K 4M75G 1QP3A 2JOYA 2RJEA 3OYAA 1VQ8T 5GAOm 1Y96B 3RERA 4HCZA 4M7DG 2K4YA 2YHTA 3A5ZB 5I2SA 1VIFA 2CZ7B 1KHIA 4XU3A 5CIUA 2BUDA 3VUBA 3JCMf 4F7UA 3V7CA 1FX7A 2RI3A 2YLCA 3L2WA 5LJ5f 1Q7YU 4DOWA 2DEQA 3MEUA 5IAYA 4BACA 1K9MU 3RKYA 4C8QA 1RI0A 3CBPA 5J26A 1VQOA 1M1GA 4RCBA 1N8RC 1KC8C 1WQ7A 3CC7T 2JUFA 1H641 3M5AA 3OS0A 1VQ4T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y71 A; 
#chains in the Genus database with same CATH topology
 3EG9 A;  4BY6 B;  1UJY A;  1R8O B;  3OYE A;  1NLP C;  5GMK m;  2EQJ A;  2OX7 A;  2CH4 W;  2EKO A;  1VOM A;  3HFN A;  1N8R U;  4RUG A;  2RH2 A;  5KYN A;  4LDX A;  2L2P A;  2PQW A;  1VQ4 Q;  2DIG A;  4J6Y A;  1GBQ A;  1YFN A;  4XU0 A;  5LJ5 g;  4J6X A;  4CRI A;  4KT0 E;  1R77 A;  2YUP A;  1K76 A;  2XID A;  3VUZ A;  2F5T X;  3G7Z A;  3CCV Q;  2EPD A;  1G8X A;  5GAO q;  1QVG P;  3EFS A;  2AK5 A;  5HK3 A;  4C8Q G;  5ECA A;  1YJ9 T;  1VUB A;  2VB6 A;  2XIC A;  3TEE A;  1AT1 B;  4M7A A;  4KUD K;  2VUB A;  5GAN 8;  3SEM A;  2CP0 A;  2DL7 A;  3PE0 A;  4D8K A;  3OA6 A;  1KQ1 A;  1YCS B;  2HQX A;  3BDU A;  2X35 A;  1WQW A;  3QDR B;  3V8L A;  3FEO A;  3A8H B;  2O31 A;  3SWN B;  1VQM Q;  4C92 A;  4LDY A;  3QXE B;  2KNB B;  4C0D C;  4KGX B;  3G6E A;  3H9N A;  5DM7 R;  3M59 A;  1RUW A;  2GBQ A;  5EG2 A;  2JM8 A;  2QI2 A;  2EGA A;  4M75 B;  3PGG A;  1NE8 A;  2BE9 B;  4RTT A;  1E6H A;  4E7L A;  2NUZ A;  2SRC A;  5DLQ E;  5HCK A;  1D3B B;  2NUP A;  1K9M R;  1M8V A;  3THK A;  1M3B A;  1KQS A;  2E6N A;  3URG A;  4PJO D;  4C92 E;  3JB9 D;  2RNA A;  2KGT A;  4C92 B;  1BI1 A;  4C8Q B;  1X27 A;  3NTH A;  3L42 A;  4KRT A;  1U06 A;  1N9R A;  1EZZ B;  4IUQ A;  1K9M C;  3CC7 Q;  1Q81 U;  3MHX A;  3QWY A;  1ZA1 B;  4C0D B;  2V8K A;  3DLM A;  1RAC B;  4E47 A;  1OU8 A;  5GMK e;  2CT4 A;  4RTU A;  3RKW A;  1ABO A;  2LQW A;  2HQE A;  3OYJ A;  1VYT A;  3CCR T;  1S72 A;  4X9D A;  3Q1J A;  3OS2 A;  2EFI A;  2LJ3 A;  3LH0 A;  2OI3 A;  3EH2 A;  5LL6 S;  4JJD A;  3M0R A;  1MMG A;  2O4X B;  2L3S A;  4IKF A;  4J9D A;  4PLL A;  2GNC A;  4EIK A;  4D6W A;  5L8R E;  4M78 B;  1MMN A;  2KK4 A;  3MEW A;  3MEV A;  4ELY C;  3JCM X;  4OMP A;  2LMJ A;  1PKS A;  2DLP A;  2NLU A;  3EG3 A;  4M7D E;  1YI2 T;  1M1K C;  1NEB A;  1T3L A;  2HD0 A;  4ZN1 A;  5GMK i;  3HPW A;  2QXF A;  3CD6 T;  2D0N A;  3UAT A;  3OYF A;  1VQ9 Q;  2LCL A;  3V8K A;  2JT4 A;  4XU1 A;  4MZT A;  3M0Q A;  1W70 A;  2ROL A;  2OTL T;  2AHJ B;  2V8I A;  4EMK C;  3H41 A;  3LLR A;  2KYB A;  2KMT A;  3EGU A;  4MDX A;  4C5H A;  2V1Q A;  3ZL7 C;  4CC2 A;  3BDL A;  3EFO B;  1PSE A;  5HY6 A;  7AT1 B;  1I5L A;  3QUI A;  4Z8A A;  4C0Z A;  3A1P A;  1VQP A;  4M7D C;  5FRM A;  3JCM W;  1WIE A;  1YHQ A;  1D3B A;  3PT9 A;  2KYM A;  2Y90 A;  4M7A G;  2E41 A;  2CSQ A;  1KC8 U;  2WSE E;  3OW2 S;  1C0M A;  1K0S A;  3CPW P;  1OZ2 A;  4ANJ A;  1YJ9 A;  1H3Z A;  1B7T A;  3M4G A;  3FLG A;  3MPU B;  1VQK Q;  4MDW A;  3A8O B;  2CP5 A;  1UE9 A;  2KVQ G;  3F70 A;  1GRI A;  2DIL A;  1MND A;  2KRS A;  3NTI A;  2E1H A;  3G4S A;  1ABQ A;  1E7O A;  2E5Q A;  2FO0 A;  5AT1 B;  1U8R A;  3M53 A;  3UA7 A;  1JJ2 A;  1SG5 A;  4MMK A;  2PZ1 A;  4J5Y A;  2HAX A;  1GCP A;  3C94 A;  1S72 T;  1NEG A;  4PFO A;  1M5Q 1;  3VS3 A;  4A54 A;  3GF5 A;  5GMK l;  3CCU T;  4KGV B;  1RL2 A;  1NBE B;  5GMK j;  1JBM A;  4C0G A;  2DJQ A;  1QCN A;  2VYT A;  3QZ5 B;  4XK8 E;  4LDW A;  2DYB A;  1F1B B;  4OMQ A;  3M0S A;  1GL5 A;  3VV0 A;  1M1K U;  1BI3 A;  5KE2 A;  2K9G A;  2YRV A;  1RAG B;  2E12 A;  3M55 A;  2X4Y A;  2QA4 T;  1HSQ A;  1VQO Q;  2ZZD A;  4QT7 A;  1XNI A;  4JRQ A;  1WZO A;  4JRP A;  3QJY A;  2EYW A;  3M0T A;  4LXC A;  1QMC A;  1VQ7 Q;  1KK7 A;  2FPE A;  1JO8 A;  1ZA2 B;  3UT1 A;  1UGV A;  1VQP Q;  1YJN A;  3S3M A;  1BIA A;  1VQL T;  3CC2 Q;  4J7I A;  2R5M A;  2L89 A;  2LNH B;  2ESW A;  1PSF A;  2QQS A;  3EGD B;  1A0N B;  1TUC A;  2DTH A;  1RAB B;  1AOJ A;  1NLO C;  2OTL Q;  2KSS A;  1WJR A;  2LQ8 A;  4OB3 B;  4N4H A;  3DLL A;  1U1T A;  5CR2 A;  4J9F A;  3PIP A;  2DTI A;  4TVR A;  5CAI A;  2RF0 A;  2VGM A;  3J81 E;  1ZSZ C;  2BKD N;  4Q5W A;  4DA4 A;  3P8H A;  4C92 D;  1QKX A;  1B07 A;  1Y07 A;  2MPX C;  3ME9 A;  3JB9 H;  2G6F X;  3TCJ A;  5LJ3 g;  3QYH B;  5GAN 4;  4C92 G;  3LWI A;  4FT4 A;  5LJ3 h;  1WDX A;  1MMD A;  4LUE A;  3QSU A;  2NUT A;  3JSC A;  5I11 A;  3G4S Q;  1ZX6 A;  1I5O B;  1M27 C;  2YT6 A;  4RCC A;  4Z88 A;  3VS6 A;  1N9S A;  3A8M B;  1BI0 A;  2MK5 A;  4M78 C;  4UC4 A;  3CC2 A;  4HT8 A;  1SEM A;  1ZLM A;  3LGL A;  2DXU A;  1NJI U;  3HRS A;  2DX1 A;  4V2S A;  1W2B A;  3T9N A;  1XJW B;  2O4X A;  3CCM A;  1CKB A;  3G71 A;  1GFC A;  1BK2 A;  4QQG A;  3CCM Q;  1BB9 A;  1M90 C;  4QQ6 A;  2EQK A;  4HXJ A;  2A7Y A;  2KQW A;  4EMG A;  4DBQ A;  4FSX A;  4C8Q F;  3EGX B;  5CKE A;  3CXC P;  3CC4 T;  4F7U F;  3J80 E;  1JQQ A;  3BW1 A;  1IXD A;  5GAO m;  2VWF A;  2AKL A;  1IB8 A;  3JCM f;  2RI3 A;  4DOW A;  1K9M U;  3RKY A;  3QWX X;  1E6G A;  1M1G A;  4DBF A;  3CC7 T;  3M5A A;  2K79 A;  4FIB A;  4ESR A;  3HSB A;  2CP2 A;  1BCM A;  3JCM Q;  2EBP A;  3G1J A;  2Z0W A;  2MOX A;  3RMS A;  1K73 R;  2A08 A;  2GTO A;  4M78 F;  1XQH A;  1G3Y A;  4IUR A;  3H6Z A;  3PVQ A;  1H3H A;  6AT1 B;  3M57 A;  4M7D A;  3JAM E;  1IGU A;  4Y91 A;  1UJ0 A;  2XMF A;  2CZ6 B;  1WYX A;  2B86 A;  2RJF A;  4C5G A;  2DK3 A;  1IZ6 A;  1M4Z A;  4OB1 B;  2MMP A;  1YHQ T;  2QTX A;  3EG9 B;  4D8D A;  1PHT A;  1VQ5 T;  1ARK A;  4ZGD B;  5CCA A;  3M58 A;  2K5I A;  2LCS A;  3JCM P;  2DIQ A;  5GAM j;  1RLQ C;  5GMK h;  2FL7 A;  3JB9 F;  1QCO A;  1PD1 A;  1RAF B;  1ZUK A;  4IIM A;  1YIT A;  2ZAE A;  1AZG B;  4IIO A;  4O6J A;  4M77 B;  2KT1 A;  1QW1 A;  1G2B A;  2EQM A;  3LYI A;  2DER A;  3LGF A;  3MKD A;  2RHZ A;  1X6B A;  2XKO C;  1UG1 A;  3ZFJ A;  3TVT A;  2LVM A;  3ZEH A;  2GCX A;  2HBP A;  1YBY A;  2JS0 A;  3RNJ A;  2GQV A;  1ZSZ B;  2F5K A;  2R58 A;  3SWN A;  4CC4 B;  2A28 A;  3E1S A;  4E2F B;  3M56 A;  2COY A;  1GCQ C;  4FW2 A;  2KXC A;  2OTL A;  3S3N A;  2J05 A;  4Y92 A;  1S1N A;  3CXC S;  4AFZ C;  1TTH B;  2RHY A;  3CC4 Q;  3INZ A;  4ATO A;  3CCR A;  4M78 G;  5IN1 A;  1NJI R;  2AZS A;  4M7A C;  2ZPB B;  4OGE A;  3I55 Q;  2K3Y A;  4AT1 B;  4BE1 A;  2OAU A;  1H8K A;  3EH1 A;  3ZBD A;  4M78 D;  1RAH B;  2DL3 A;  1Q86 C;  1JXM A;  3KUF A;  5FWB A;  3OYM A;  4YTL A;  3CPW A;  3E9G A;  2IIM A;  2O9S A;  2F2V A;  1C1A A;  2XI9 A;  1X2K A;  4RTW A;  5LJ3 j;  3CEY A;  4BI8 B;  2A3L A;  1TSF A;  2QYZ A;  1OOT A;  2DXC A;  4AFU C;  4IUT A;  3CCJ T;  4XU2 A;  2YUQ A;  2HZY A;  1VA7 A;  3CME A;  4HVV A;  4KUI A;  2DL8 A;  2EW3 A;  4Z02 A;  3PMI A;  2DZC A;  4EMK A;  1O75 A;  3CD6 Q;  1KFZ A;  2MAM A;  3EFO A;  1J3T A;  2PUO B;  5KYY A;  2KEA A;  1QVF S;  2HKN A;  1JB0 E;  4FYY B;  4OF1 A;  3DB4 A;  2D9T A;  2KR3 A;  2D8H A;  2HCK A;  4BB7 A;  1KJW A;  2FVU A;  2K6D A;  4M78 A;  3ASK A;  1OYX A;  1UFF A;  3RUX A;  2QQB A;  2EJG A;  2E64 A;  3OYH A;  1HD3 A;  1G5V A;  1LPL A;  2E10 A;  3AT1 B;  1PM3 A;  3VYH B;  1SPK A;  1U1S A;  2VGN A;  1V29 B;  4OMF B;  3A8G B;  4HT9 A;  2CZ1 B;  4ZTF A;  1X75 C;  1GFD A;  2DKG A;  3DKM A;  3CCE Q;  3X24 B;  1MV0 B;  4R0K A;  3C95 A;  3X26 B;  5M9O A;  2RK1 A;  2DD4 A;  5I21 A;  1YIT T;  4E7Z A;  2RMO A;  1FMW A;  2MWP A;  4VUB A;  4A4G A;  4FM4 B;  1MGQ A;  1C6V X;  4OB2 B;  1UEB A;  1LVK A;  5A2Q E;  2AT1 B;  4RMO A;  2QQ9 A;  2DXT A;  1KIK A;  1N5Z A;  4E7S A;  2KE9 A;  3C4S A;  4ZTJ A;  3G71 T;  3MET A;  2P0Q A;  1MV3 A;  4X9C A;  4C92 F;  4LNP A;  1N8R R;  1WI7 A;  2HSP A;  1WPY A;  5FU6 B;  4EDU A;  4CC3 A;  3D7S B;  2DYI A;  2KI7 A;  1IHW A;  4CC7 A;  2XHC A;  2AZV A;  2C0T A;  3OYK A;  4N0A A;  1M1K R;  2RM4 A;  1TH7 A;  2OTJ Q;  2XDD A;  2GF7 A;  2OTJ A;  1D1B A;  3RIR A;  1KG1 A;  1QCF A;  3OSS C;  2QG9 B;  3UDC A;  2R57 A;  2C0I A;  2EYQ A;  1VQO T;  5LJ5 j;  3QDF A;  1W4S A;  1ZBJ A;  2ZCF B;  1O9S A;  2JTE A;  2DVE A;  1NZ9 A;  1KQS P;  3VJP A;  1PCX A;  1DJ7 B;  1AZE A;  2K2V A;  3QJ6 A;  4IUP A;  3JCM e;  3GPL A;  2YDL A;  2CH4 A;  3VYG A;  2MYS A;  3MEA A;  3CCV A;  5FU7 B;  2QQA A;  1D1A A;  3QKJ A;  4M78 E;  4L5G A;  1SHF A;  2D0Q B;  2IVW A;  3A8L B;  1SRM A;  2FRY A;  4J9G A;  4Y28 E;  2CUD A;  4C8Q C;  1ZBX A;  1LJO A;  2IPO B;  2O01 E;  1UUE A;  3JB9 G;  3CMA T;  5LJ5 e;  4LDU A;  2BZ8 A;  4FU6 A;  1I4K 1;  2LDM A;  1YIJ Q;  1YJN T;  3GOX A;  3CCS Q;  4IUU A;  2B8A A;  1K1Z A;  3LW5 E;  2BE7 D;  2C0O A;  4PJO C;  3HKS A;  2L5Q A;  3QBY A;  2RHI A;  3GBQ A;  2LRQ A;  4C0F A;  3VKI A;  2DL5 A;  4F04 B;  1VQ9 T;  4NOY A;  3PVL A;  1OPK A;  5KYW A;  4X34 A;  2PTK A;  2RQW A;  5CKB A;  1UGS B;  2QDL A;  3TRE A;  2RQT A;  3KFV A;  2MI6 A;  3EHR A;  4M75 C;  2F1L A;  4KUL A;  1QKW A;  3UPU A;  1H92 A;  4CI0 C;  3X28 B;  2O88 A;  2RD1 A;  2JJ9 A;  2M9U A;  2QAZ A;  4FYW B;  3CQT A;  3MCA B;  3KXT A;  2ZPI B;  3M54 A;  3OYL A;  1TXQ A;  4E7H A;  2M16 A;  2K5F A;  3RKX A;  2DD5 A;  2RPN A;  2AKK A;  1NPR A;  5C6S A;  1V76 A;  2X3X D;  4XTY A;  5L23 A;  1WXT A;  2ATC B;  3JCM J;  3TU4 K;  1JXO A;  2EQI A;  3OMC A;  4B6M A;  1EX4 A;  4PNO A;  2JM9 A;  3L2Q A;  3P8D A;  2O9V A;  4O5V A;  1OU9 A;  3M9Q A;  3I56 T;  4J9C A;  3WVE B;  4R56 A;  3R6N A;  2JMA A;  1OX9 A;  2KY9 A;  1M9S A;  3L2Z A;  3L2U A;  2DF6 A;  1FYN A;  3VS1 A;  3GIB A;  3CCJ A;  2DTO A;  2FRW A;  1KHC A;  4ME7 A;  2XDP A;  4RTY A;  2DA9 A;  2VAS A;  1SHG A;  5KYU A;  1Y96 B;  2H8H A;  2YHT A;  2CZ7 B;  4XU3 A;  5CIU A;  4F7U A;  3V7C A;  2QEX Q;  1FX7 A;  2PNI A;  3H0H A;  4BAC A;  5IAY A;  3OW2 P;  4C8Q A;  3CBP A;  1BBZ A;  1WHJ A;  1RAE B;  4J9E A;  2RQR A;  2LCC A;  3SD4 A;  1X43 A;  4RTX A;  1VQK T;  8AT1 B;  3CCS A;  3PFS A;  1UEC A;  4Z89 A;  3V8J A;  4A4F A;  1IRE B;  2BIV A;  2WSF E;  1Q82 R;  1K8A C;  1RLP C;  1WLP B;  3VS5 A;  1T0H A;  1PD0 A;  1YJW A;  4PKC C;  2X4W A;  4PJO A;  1N27 A;  2RB6 A;  1M2V A;  4N0A C;  1MHN A;  4M77 E;  1PWT A;  2QGG A;  3S3O A;  4MZM A;  5GAN f;  5GAN 2;  1IGQ A;  1MNE A;  5J3B A;  1W2B P;  4BI4 A;  1BI2 A;  3N5B B;  2MCN A;  3UWN A;  2V26 A;  1FMV A;  2X4J A;  2DM1 A;  2RHU A;  2QEX A;  2RN8 A;  5GAM f;  2YUO A;  2DBK A;  3JCM c;  4LN2 A;  3LH5 A;  1G83 A;  1Y71 A;  1VQK A;  1SRL A;  1JU5 C;  2JVV A;  3EHQ A;  1KD1 R;  2P4T A;  4KH1 B;  1Q7Y R;  3EG2 A;  2PVD B;  3CCL Q;  2W0Z A;  2FB7 A;  2PUK B;  3EG1 A;  1CSK A;  1HJD A;  4PFZ A;  2HL5 C;  2M02 A;  1PKT A;  1X01 A;  2EGC A;  1YHQ Q;  1QVG S;  5KYX A;  4OB0 B;  2FZK B;  4N4G A;  5GAN 6;  3CCU Q;  1VQ8 A;  4JUV A;  1RAI B;  5J39 A;  1I07 A;  3OSV A;  5GAO p;  1X2Q A;  1Q7Y C;  5D6X A;  1KD1 U;  1Q81 R;  2E70 A;  4JLI A;  1AD5 A;  3PMT A;  4ZGJ B;  5FRO A;  1AWW A;  4DBR A;  2VC8 A;  5KYU B;  4J8O A;  4GLM A;  2ZPF B;  3V7R A;  5CO7 A;  4ORZ A;  2RHX A;  1VQN Q;  2YRC A;  3X20 B;  5GJW B;  2QA4 Q;  1VQ6 A;  5CK9 A;  1VQ9 A;  2DVJ A;  3WVD B;  3REB B;  4A4E A;  1B34 A;  2FPD A;  4ZNX A;  3OY9 A;  1BYM A;  1I0C A;  4A4K A;  2YXY A;  2C06 A;  1ZSG A;  1YWO A;  4JZ4 A;  1UTI A;  1X69 A;  3C0C A;  4KGZ B;  2Y4X A;  1TUD A;  5FLX E;  5IXB A;  2E6Z A;  5GAN 5;  1I8F A;  2CGH A;  2KRM A;  2D8J A;  1S72 Q;  1M2V B;  4M7A F;  4LE9 A;  3PNW C;  4PJO B;  5GAM g;  1Y57 A;  2HL3 A;  5CKH A;  2HQH A;  1JJ2 P;  5D6W A;  3OW2 A;  3MP1 A;  2BTT A;  2DRM A;  2W10 A;  2KRN A;  2CSI A;  1Y96 A;  3CCL T;  1YN8 A;  3GNG A;  1YJW T;  4BY6 C;  4RKU E;  3GLX A;  1EIF A;  4M75 F;  3NPF A;  1AWJ A;  1Z9Z A;  2FPF A;  4A53 A;  2L8D A;  2ED0 A;  2WAC A;  4MML A;  2XU8 A;  2YRD A;  3AHU A;  1WHM A;  2DZ9 A;  3E2U A;  3HFO A;  3HTR A;  3RR6 A;  5FW9 A;  2YUN A;  2FZG B;  4DOV A;  1YIT Q;  1UGP B;  4B9W A;  2HEQ A;  3GNF B;  1VQN T;  4PJL A;  4C8Q D;  3UF4 A;  4F14 A;  2DMO A;  4PLI A;  1M90 R;  4M77 D;  3QG1 A;  3JCM b;  1Q86 R;  2XDB A;  2EYY A;  2ZPH B;  3CCV T;  2VXE A;  1KD1 C;  1GXI E;  1BIB A;  1D0X A;  4RTV A;  3G6E Q;  1P92 A;  3I55 A;  2ENM A;  3CCQ T;  1QP2 A;  1N6A A;  3QZ9 B;  2CKK A;  1SF9 A;  5IT9 E;  2RI5 A;  2EAY A;  2XK0 A;  3M4Y A;  1NG2 A;  2EKH A;  2R5A A;  1V1C A;  4KBM B;  5IHK A;  3X25 B;  1IO6 A;  2RA2 A;  5GAM h;  4WF2 A;  1XTD A;  1OI1 A;  1TG0 A;  1WXU A;  1B3Q A;  1VQM A;  1IRX A;  2ZPE B;  5I22 A;  5KE3 A;  4FYV B;  3I35 A;  2CS7 A;  2V8J A;  4BDZ A;  1VQ5 A;  1MMA A;  3V7S A;  5FWC A;  1YIJ T;  3SFM A;  2EYX A;  4L6V 5;  2KT8 A;  1K0X A;  3I9Q A;  1QVP A;  5GAM e;  2KBT A;  3CCS T;  3CC7 A;  3P8B B;  2NYS A;  4OMO A;  3I5S A;  3VS0 A;  1LCK A;  3JCM h;  2CDT A;  2HDA A;  4JRI A;  1FWZ A;  4NL2 A;  4ELZ C;  3TSZ A;  4M7D F;  2EQU A;  3JB9 I;  1OUL A;  1UHF A;  2CP3 A;  5DY9 A;  2DPP B;  5FRN A;  4XQ3 A;  1KQS S;  1TU0 B;  5D6Y A;  1PG5 B;  3C12 A;  3QII A;  2EWN A;  4HVW A;  3FC3 A;  4M75 D;  5LJ5 d;  2JW4 A;  2KXD A;  1VQM T;  2L3P A;  3J7A F;  1BCO A;  1SSH A;  2EYZ A;  4HA8 A;  4LDV A;  2LT4 A;  1VYU A;  3FRN A;  3CCU A;  2DJZ A;  4JJB A;  1LNX A;  1OX8 A;  2M0O A;  3VRZ A;  2J6F A;  1VQ5 Q;  3MP6 A;  3G4S T;  5KYW B;  1QWE A;  3CBO A;  2LX7 A;  2CUB A;  1AEY A;  4E6R A;  4NS5 A;  1K9A A;  3CCR Q;  3HRT A;  1G3W A;  2JNG A;  3RES A;  1GBR A;  3VU3 C;  4E7I A;  2JMC A;  4M77 C;  1B34 B;  3CMA A;  1YIJ A;  5GAM d;  5CKF A;  4F7U B;  3OYG A;  5CVI A;  4E7J A;  2QQR A;  2YWW A;  4DBH A;  1Q95 G;  3RMQ A;  1BU1 A;  1MUZ A;  4J9I A;  5FU7 C;  4QQD A;  3VS2 A;  3OYC A;  4XTV A;  4GLK A;  4OGC A;  1RAA B;  4PK4 A;  2LZ6 B;  4HCK A;  1NJI C;  2RK2 A;  2K2M A;  3OYD A;  2YSQ A;  1VIE A;  5I2M A;  1Y0M A;  2ZGW A;  1YJW Q;  2CZ0 B;  3CMA Q;  3IQL A;  4PL6 A;  1QLY A;  4ZGE B;  1WHG A;  1M90 U;  2CRE A;  5IH2 A;  1M3C A;  3OYI A;  2L0A A;  4HCB A;  3VS7 A;  3CC4 A;  1XOV A;  1Y7X A;  5CKD A;  4M4Z A;  4J9H A;  5HK0 A;  4JZ3 A;  1OQK A;  2PVO B;  2RQV A;  1HXD A;  4JJC A;  2O2O A;  1UB4 A;  3QHS A;  4JS4 A;  2XD0 A;  2F2X A;  5GAN 3;  4HCC A;  1T0J A;  2LNV A;  1R0B G;  4C5E A;  3KBG A;  4OMM A;  3HL8 A;  3LWH A;  3PTA A;  1RI9 A;  3TQ7 P;  2OTJ T;  2K7A A;  2DFU A;  2MWO A;  3FIF A;  4M75 G;  1QP3 A;  2JOY A;  3OYA A;  1T3S A;  4HCZ A;  4M7D G;  2K4Y A;  5I2S A;  1VIF A;  1KHI A;  1M3A A;  2YLC A;  5LJ5 f;  1ZUU A;  3MEU A;  2J06 A;  1RI0 A;  4RCB A;  1IHV A;  3OS0 A;  1QVF P;  8ATC B;  4M7A B;  3DB3 A;  4PFP A;  4IUV A;  4C8Q E;  3QPH A;  2LC4 A;  2GQI A;  2RO0 A;  1D0Z A;  5GAN j;  2H3J A;  3R6O A;  4KH0 B;  2J7I A;  2COZ A;  1Z9Q A;  2COW A;  5LJ5 h;  2XG8 D;  4ZN3 A;  3OMG A;  1ZQ1 A;  5IXF A;  4N4I A;  5DLO A;  4JS5 A;  2RJC A;  2FYK A;  2V1R A;  3SHW A;  4AG1 C;  4BI3 A;  2KDS A;  5GAO l;  1W1F A;  1RAD B;  1VQ7 A;  1EFN A;  2IG0 A;  4BUG A;  1ZUY A;  1UDL A;  3VRY A;  3FDR A;  4HKE A;  1YJN Q;  1AHJ B;  3SB2 A;  1NPP A;  4RG8 A;  1VYV A;  1YWP A;  1JEG A;  3OYB A;  4BE2 A;  4M77 A;  3NGP A;  2AIR B;  2HBW A;  3CME Q;  2QA4 A;  1VQ6 Q;  3SDZ A;  3EG0 A;  1WJQ A;  4JPB W;  2H3E B;  3OYY A;  2FHD A;  2VVK A;  4GBQ A;  4XTZ A;  3NFC A;  3CPW S;  1WJS A;  2KRO A;  2L3R A;  4FT2 A;  4B9X A;  2CYZ B;  3I5R A;  2DAQ A;  4F16 A;  5GAN d;  3OS1 A;  5GAN g;  2D1X A;  2E4H A;  3E9F A;  4P5N A;  3GP8 A;  4PJM A;  2X4X A;  3U23 A;  3JV3 A;  3WXM B;  2EIF A;  2QTV A;  4FYX B;  2JZ2 A;  4XTW A;  3TSW A;  2DO3 A;  2K3B A;  3CCE T;  1NYG A;  5HKC A;  4XTU A;  1WXB A;  1Q86 U;  4X1V A;  3CC2 T;  3MO8 A;  1Q82 C;  1ZSZ A;  4BD3 A;  1UHC A;  1YJ9 Q;  4NL3 A;  2VXF A;  2F2W A;  1OEB A;  5KH6 A;  4F7U E;  5EC7 A;  2OAW A;  4LUD A;  1M30 A;  1FXX A;  1D09 B;  2CP6 A;  4JDS A;  3G71 Q;  3S6W A;  4PJO G;  4M7D B;  2ZPG B;  3ULR B;  2E3H A;  3NHN A;  5KYX B;  3HRU A;  2NUT B;  4QVZ A;  3L2V A;  4M75 A;  2PU9 B;  3VS4 A;  2KAF A;  2WSC E;  3JB9 J;  4DEX A;  2X9H A;  3RDV A;  2A36 A;  1VQN A;  4QVC A;  1K73 U;  4M77 F;  2P84 A;  4DEY A;  4PJO E;  2K5L A;  1HYO A;  3EAE A;  5KCO A;  4J9B A;  2E5K A;  2QDY B;  1VQ8 Q;  1BKB A;  4RG2 A;  3MJX A;  1ACM B;  2RJD A;  2DET A;  5FU6 C;  5CQY A;  3CPF A;  3M0P A;  1JRI A;  9ATC B;  3JRZ A;  1PRM C;  4J83 A;  1GCQ A;  1AWX A;  4M75 E;  3CCL A;  2EJF A;  3REA B;  2JXB A;  1VQL A;  4OML A;  1SSF A;  3HP9 A;  1QVF A;  3SWN C;  2X3W D;  1R0C B;  3QO3 A;  4C5I A;  4EMH A;  4J6W A;  3MP8 A;  4OVA A;  2M0Y A;  4RTZ A;  2MIO A;  5AYF A;  2P0P A;  4QKU A;  1VQ6 T;  2P4R A;  4R55 A;  4M7A E;  1UGR B;  3G6E T;  4EPC A;  1PNJ A;  3QYG B;  3L1A A;  3CCQ Q;  1M1F A;  4XAX B;  2EJ9 A;  2HNI A;  3HHT B;  2DXB A;  2EGE A;  2JTM A;  1D0Y A;  4XTX A;  2LP5 A;  2JTF A;  2GFU A;  4QW2 A;  4M7D D;  3H0I A;  3LX7 A;  5KYY B;  4PJJ A;  3O8V A;  1X6G A;  3O5Z A;  1TWB A;  4GY5 A;  3I56 Q;  1WX6 A;  1WHL A;  2ABL A;  4PJN A;  2GTJ A;  4AFQ C;  4M77 G;  3OS5 A;  1QVG A;  2CT3 A;  5GAN h;  2DBM A;  4J7F A;  5A0L A;  1QQJ A;  3OYN A;  3CBM A;  3PIO A;  1K8A U;  2G3R A;  1I81 A;  1WA7 A;  2YLB A;  5CQX A;  1YI2 Q;  2LTO A;  3CCM T;  1TOV A;  2QGF B;  2DE0 X;  3CXC A;  1W2B S;  3CME T;  2OJ2 A;  2MF2 A;  2HKQ B;  1OPL A;  2J6K A;  2E65 A;  2QEX T;  4BE0 A;  2GFA A;  3JCM g;  2A37 A;  2PVG B;  1OZ3 A;  4JJN K;  1ZHI A;  5GAO n;  2DRK A;  1K8A R;  3A98 A;  1VQP T;  1TUG B;  1M8M A;  5KCH A;  3CCE A;  3OB9 A;  2RI2 A;  1HK9 A;  2VV5 A;  3FJP A;  4PJO F;  4II1 A;  1K4U S;  1W6X A;  2P0K A;  3BY7 A;  4EMK B;  5C0M A;  2HSE B;  2NWM A;  3OBW A;  3BE3 A;  1KSW A;  4C92 C;  1AWO A;  2FZC B;  3I55 T;  4A4H A;  1SKU B;  2J6O A;  4AG2 C;  1YNZ A;  2GGR A;  3FJ5 A;  4L59 A;  5LJ3 d;  4FW1 A;  4F7U G;  2F69 A;  3CD6 A;  4OP0 A;  1KQ2 A;  1PC0 A;  3EGX A;  1FMK A;  2EVR A;  3E19 A;  1U5S A;  5GAN e;  4LD6 A;  3ER0 A;  2JN0 A;  2HMA A;  1JJ2 S;  1OV3 A;  1D1C A;  3RBB B;  2FG0 A;  5GJV B;  1VQ4 A;  2E3I A;  2K57 A;  3JCM d;  4F17 A;  5GAN 7;  3CCQ A;  1WHH A;  1G3S A;  3OQ5 A;  2LT1 A;  3I56 A;  5LJ3 e;  1I1J A;  2ROT A;  2QK0 A;  1G3T A;  4WCI A;  2ED1 A;  2LQN A;  4QVD A;  1Q81 C;  4E7K A;  1WGS A;  2LJ1 A;  4FL6 A;  4DQ2 A;  2VKN A;  5A0D A;  3JCM V;  2I0N A;  5LJ3 f;  3NTK A;  2M51 A;  4BDY A;  2Y4Y A;  1U3O A;  4A63 B;  1LOJ A;  1X6O A;  5GAO r;  1WNL A;  1WFW A;  1YI2 A;  2BZX A;  3H0F A;  4AFS C;  2D6F A;  2LJ0 A;  3L2R A;  1M2O A;  3BFM A;  2DL4 A;  1K73 C;  2DNU A;  3CCJ Q;  2K3X A;  4OMN A;  1PRL C;  1VQ7 T;  5A0G A;  1VQL Q;  3NMZ C;  2LX9 A;  3H8Z A;  5D7U A;  4JLG A;  2NUP B;  3UA6 A;  1CKA A;  4JRK A;  1QWF A;  2LQK A;  1YCY A;  2CP7 A;  3FB9 A;  4MZP A;  2M1H A;  2I2L A;  2QAS A;  4AMC A;  1Q82 U;  2L3Q A;  1TS9 A;  1UGQ B;  4WTO B;  2JS2 A;  3EFR A;  3OBY A;  4FCY A;  4M7A D;  2ECZ A;  1KC8 R;  2DEU A;  4K11 A;  4LD9 K;  1YP5 A;  1WHK A;  2BZY A;  2RJE A;  1VQ8 T;  3RER A;  4FSS A;  5IHI A;  3M0U A;  2FEI A;  3A5Z B;  5IHN A;  1NM7 A;  2SEM A;  2BUD A;  3VUB A;  3L2W A;  2RQU A;  1Q7Y U;  2X51 A;  2DEQ A;  2A0F B;  4HVU A;  1VQO A;  1NYF A;  5J26 A;  1N8R C;  1KC8 C;  1WQ7 A;  1AVZ C;  1H64 1;  2JUF A;  3EGD A;  1VQ4 T; 
#chains in the Genus database with same CATH homology
 4FIB A;  4M7A B;  3HSB A;  3DB3 A;  4BY6 B;  2LCC A;  3JCM Q;  3SD4 A;  4IUV A;  4C8Q E;  1R8O B;  1VQK T;  3QPH A;  2LC4 A;  3RMS A;  3CCS A;  3OYE A;  5GMK m;  3PFS A;  2RO0 A;  5GAN j;  2EQJ A;  2H3J A;  2EKO A;  4M78 F;  3R6O A;  3V8J A;  3HFN A;  1XQH A;  1G3Y A;  5LJ5 h;  2XG8 D;  4ZN3 A;  4A4F A;  3OMG A;  1IRE B;  1ZQ1 A;  4IUR A;  1N8R U;  4N4I A;  5DLO A;  3H6Z A;  4JS5 A;  2BIV A;  2RH2 A;  2FYK A;  2RJC A;  2WSF E;  4LDX A;  1K8A C;  3M57 A;  2PQW A;  4M7D A;  3JAM E;  2DIG A;  4J6Y A;  4BI3 A;  4Y91 A;  2KDS A;  4XU0 A;  5LJ5 g;  5GAO l;  1YJW A;  4J6X A;  1VQ7 A;  4CRI A;  2CZ6 B;  4KT0 E;  2IG0 A;  2X4W A;  4PKC C;  3VUZ A;  2XID A;  1N27 A;  2RB6 A;  2F5T X;  3G7Z A;  4BUG A;  4PJO A;  3FDR A;  4HKE A;  5GAO q;  4N0A C;  2RJF A;  1MHN A;  3EFS A;  2DK3 A;  4M77 E;  1AHJ B;  4C5G A;  5HK3 A;  1IZ6 A;  1M4Z A;  4OB1 B;  1NPP A;  3SB2 A;  4C8Q G;  3S3O A;  4RG8 A;  4MZM A;  5GAN f;  1YJ9 T;  1VUB A;  2MMP A;  1YHQ T;  5GAN 2;  2QTX A;  2XIC A;  3TEE A;  4M7A A;  5J3B A;  3OYB A;  4KUD K;  4BE2 A;  1VQ5 T;  2VUB A;  4BI4 A;  1BI2 A;  3N5B B;  3UWN A;  4M77 A;  4ZGD B;  5GAN 8;  2X4J A;  5CCA A;  3M58 A;  2K5I A;  3JCM P;  2DIQ A;  2RHU A;  5GAM j;  2QEX A;  5GMK h;  2QA4 A;  5GAM f;  2FL7 A;  3SDZ A;  3JB9 F;  3JCM c;  3OA6 A;  1WJQ A;  1KQ1 A;  2HQX A;  3BDU A;  2X35 A;  1YIT A;  1Y71 A;  1VQK A;  1WQW A;  3OYY A;  2FHD A;  3QDR B;  3V8L A;  4XTZ A;  3NFC A;  3CPW S;  3FEO A;  2JVV A;  1WJS A;  4M77 B;  3A8H B;  4O6J A;  2L3R A;  1QW1 A;  2EQM A;  4FT2 A;  2CYZ B;  3SWN B;  3LYI A;  4B9X A;  4C92 A;  4LDY A;  3QXE B;  3LGF A;  2RHZ A;  2DAQ A;  5GAN d;  2P4T A;  2XKO C;  5GAN g;  3OS1 A;  3ZFJ A;  4C0D C;  3E9F A;  2LVM A;  2PVD B;  4P5N A;  3ZEH A;  2GCX A;  3G6E A;  3GP8 A;  2HBP A;  1YBY A;  5DM7 R;  2FB7 A;  2PUK B;  2X4X A;  2GQV A;  3M59 A;  3WXM B;  2EIF A;  2F5K A;  1X01 A;  2JZ2 A;  4XTW A;  2R58 A;  2DO3 A;  3SWN A;  1QVG S;  5EG2 A;  3E1S A;  4OB0 B;  4N4G A;  3CCE T;  5GAN 6;  2QI2 A;  1VQ8 A;  3M56 A;  4JUV A;  5HKC A;  4M75 B;  4XTU A;  5J39 A;  3PGG A;  3OSV A;  1NE8 A;  5GAO p;  1Q86 U;  3CC2 T;  3MO8 A;  1Q7Y C;  3CD6 T;  5D6X A;  4E7L A;  1KD1 U;  1Q82 C;  4BD3 A;  2OTL A;  5DLQ E;  2E70 A;  4JLI A;  4ZGJ B;  3PMT A;  3S3N A;  1D3B B;  5FRO A;  2VC8 A;  3CXC S;  1M8V A;  4J8O A;  3V7R A;  2VXF A;  2ZPF B;  5CO7 A;  4NL3 A;  2RHY A;  5KH6 A;  2RHX A;  3INZ A;  3X20 B;  2E6N A;  4F7U E;  3URG A;  1KQS A;  4ATO A;  4PJO D;  4C92 E;  3CCR A;  4M78 G;  5IN1 A;  3JB9 D;  4M7A C;  4C92 B;  1VQ6 A;  1BI1 A;  4C8Q B;  2ZPB B;  4OGE A;  3NTH A;  2K3Y A;  1FXX A;  3L42 A;  5CK9 A;  4JDS A;  1VQ9 A;  3S6W A;  4PJO G;  4BE1 A;  2OAU A;  4M7D B;  1N9R A;  2ZPG B;  3WVD B;  3ZBD A;  4M78 D;  4A4E A;  1B34 A;  4IUQ A;  1K9M C;  3HRU A;  3OY9 A;  1Q86 C;  1Q81 U;  3MHX A;  4QVZ A;  3L2V A;  3KUF A;  4M75 A;  3OYM A;  1BYM A;  4YTL A;  4C0D B;  3CPW A;  2PU9 B;  3E9G A;  4A4K A;  2V8K A;  3DLM A;  4E47 A;  2KAF A;  2XI9 A;  5GMK e;  2C06 A;  2WSC E;  3RKW A;  3JB9 J;  5LJ3 j;  2Y4X A;  3CEY A;  2HQE A;  3OYJ A;  4BI8 B;  2A3L A;  5FLX E;  3CCR T;  1S72 A;  4X9D A;  3Q1J A;  3OS2 A;  1VQN A;  2EFI A;  2E6Z A;  4QVC A;  5GAN 5;  3LH0 A;  4M77 F;  1K73 U;  2DXC A;  1I8F A;  2CGH A;  5LL6 S;  4PJO E;  4IUT A;  4M7A F;  4PJO B;  3PNW C;  2K5L A;  3CCJ T;  5GAM g;  2O4X B;  4XU2 A;  3EAE A;  4IKF A;  5CKH A;  3CME A;  4PLL A;  5KCO A;  5D6W A;  4KUI A;  3OW2 A;  2QDY B;  3MP1 A;  4D6W A;  1BKB A;  4RG2 A;  4M78 B;  5L8R E;  4Z02 A;  1Y96 A;  2KK4 A;  3CCL T;  3PMI A;  2DZC A;  2RJD A;  3GNG A;  3MEV A;  3MEW A;  4EMK A;  4BY6 C;  1O75 A;  1YJW T;  4RKU E;  5FU6 C;  2MAM A;  5CQY A;  2PUO B;  3CPF A;  1JRI A;  4ELY C;  1QVF S;  3GLX A;  1EIF A;  1JB0 E;  3JRZ A;  4J83 A;  4M75 E;  3JCM X;  4OF1 A;  3DB4 A;  3CCL A;  4M75 F;  2EJF A;  2NLU A;  2D9T A;  1VQL A;  4M7D E;  1YI2 T;  4A53 A;  2L8D A;  1SSF A;  3HP9 A;  4BB7 A;  1QVF A;  2WAC A;  4MML A;  2XU8 A;  2FVU A;  2HD0 A;  4M78 A;  3ASK A;  3SWN C;  1M1K C;  3AHU A;  1OYX A;  4ZN1 A;  3RUX A;  2QQB A;  3QO3 A;  5GMK i;  3HPW A;  2DZ9 A;  2EJG A;  2QXF A;  4J6W A;  3HFO A;  4C5I A;  3MP8 A;  2E64 A;  4EMH A;  3OYF A;  2LCL A;  3V8K A;  3OYH A;  1G5V A;  2E10 A;  4OVA A;  4XU1 A;  4MZT A;  4DOV A;  2OTL T;  1UGP B;  3VYH B;  4B9W A;  1U1S A;  2P0P A;  2VGN A;  3GNF B;  5AYF A;  2AHJ B;  1VQ6 T;  1V29 B;  1VQN T;  2V8I A;  4EMK C;  4OMF B;  4R55 A;  4M7A E;  1UGR B;  3A8G B;  4HT9 A;  3G6E T;  4EPC A;  2CZ1 B;  3LLR A;  4ZTF A;  3QYG B;  2KMT A;  1X75 C;  3L1A A;  4C8Q D;  1M1F A;  2DKG A;  4XAX B;  4MDX A;  3DKM A;  4C5H A;  2EJ9 A;  4PLI A;  3X24 B;  4M77 D;  3C95 A;  3QG1 A;  3X26 B;  2HNI A;  3JCM b;  3BDL A;  5M9O A;  2XDB A;  3HHT B;  2DXB A;  2RK1 A;  2DD4 A;  2JTM A;  1PSE A;  5HY6 A;  5I21 A;  2ZPH B;  4XTX A;  3CCV T;  2VXE A;  1YIT T;  1GXI E;  2JTF A;  4VUB A;  2MWP A;  4A4G A;  2GFU A;  4QW2 A;  1KD1 C;  1BIB A;  1MGQ A;  3QUI A;  4FM4 B;  1I5L A;  4M7D D;  4C0Z A;  3LX7 A;  1VQP A;  4M7D C;  1P92 A;  3I55 A;  5FRM A;  3O8V A;  3CCQ T;  4OB2 B;  3JCM W;  1QP2 A;  1N6A A;  1UEB A;  1YHQ A;  3QZ9 B;  2CKK A;  1D3B A;  4GY5 A;  3PT9 A;  5IT9 E;  4M7A G;  2Y90 A;  5A2Q E;  2RI5 A;  2EAY A;  2XK0 A;  3M4Y A;  4RMO A;  2E41 A;  1KC8 U;  2QQ9 A;  2R5A A;  2WSE E;  2DXT A;  3OW2 S;  4KBM B;  1OZ2 A;  4M77 G;  3X25 B;  3OS5 A;  1QVG A;  2RA2 A;  3C4S A;  5GAM h;  4WF2 A;  1YJ9 A;  3M4G A;  1XTD A;  3FLG A;  4ZTJ A;  1OI1 A;  5GAN h;  4J7F A;  4MDW A;  3G71 T;  5A0L A;  3MET A;  3A8O B;  2P0Q A;  2KVQ G;  3CBM A;  3F70 A;  4X9C A;  4C92 F;  3PIO A;  3OYN A;  1K8A U;  3NTI A;  2G3R A;  1VQM A;  1I81 A;  2E1H A;  2YLB A;  5CQX A;  3G4S A;  2ZPE B;  2LTO A;  3CCM T;  5KE3 A;  1WPY A;  2E5Q A;  5FU6 B;  2CS7 A;  2V8J A;  3CXC A;  4BDZ A;  1VQ5 A;  1W2B S;  4EDU A;  3V7S A;  3CME T;  1YIJ T;  1U8R A;  2MF2 A;  3SFM A;  3M53 A;  1JJ2 A;  4L6V 5;  2E65 A;  4MMK A;  2QEX T;  2XHC A;  3OYK A;  4BE0 A;  4J5Y A;  2HAX A;  2GFA A;  4N0A A;  3JCM g;  1QVP A;  5GAM e;  2PVG B;  2RM4 A;  3CCS T;  1TH7 A;  1OZ3 A;  4JJN K;  1ZHI A;  3C94 A;  5GAO n;  3CC7 A;  3P8B B;  2XDD A;  2GF7 A;  1S72 T;  1M5Q 1;  2OTJ A;  4A54 A;  1VQP T;  3GF5 A;  5GMK l;  3JCM h;  3CCU T;  4JRI A;  5KCH A;  3RIR A;  1FWZ A;  3OB9 A;  4NL2 A;  4ELZ C;  2RI2 A;  3CCE A;  3OSS C;  4M7D F;  1KG1 A;  2EQU A;  1HK9 A;  1RL2 A;  3JB9 I;  1H3Z A;  2VV5 A;  3FJP A;  4PJO F;  5DY9 A;  5GMK j;  1JBM A;  2DPP B;  2R57 A;  4XQ3 A;  3UDC A;  4C0G A;  1KQS S;  2EYQ A;  1VQO T;  5FRN A;  2VYT A;  3QZ5 B;  4XK8 E;  4LDW A;  5LJ5 j;  5D6Y A;  4II1 A;  1W4S A;  3C12 A;  2ZCF B;  3QII A;  3VV0 A;  2EWN A;  1O9S A;  3FC3 A;  2DVE A;  1M1K U;  1NZ9 A;  2P0K A;  3BY7 A;  4M75 D;  3VJP A;  4EMK B;  1BI3 A;  5C0M A;  5LJ5 d;  3OBW A;  5KE2 A;  1VQM T;  2YRV A;  3J7A F;  1DJ7 B;  2E12 A;  2K2V A;  3M55 A;  2X4Y A;  4C92 C;  2QA4 T;  3QJ6 A;  4IUP A;  4HA8 A;  4LDV A;  2LT4 A;  3I55 T;  3JCM e;  4A4H A;  3GPL A;  2ZZD A;  3FRN A;  3VYG A;  1XNI A;  4JRQ A;  3CCU A;  4JRP A;  3QJY A;  4L59 A;  2DJZ A;  5LJ3 d;  3MEA A;  4F7U G;  3CCV A;  5FU7 B;  2QQA A;  2F69 A;  3QKJ A;  4M78 E;  4L5G A;  1LNX A;  3CD6 A;  4OP0 A;  2M0O A;  1KQ2 A;  2D0Q B;  2IVW A;  3A8L B;  3MP6 A;  3G4S T;  3UT1 A;  4Y28 E;  4C8Q C;  1ZBX A;  3E19 A;  1BIA A;  3S3M A;  1YJN A;  1LJO A;  3CBO A;  1VQL T;  5GAN e;  4LD6 A;  2O01 E;  3ER0 A;  2JN0 A;  4J7I A;  4NS5 A;  2R5M A;  2L89 A;  3JB9 G;  3CMA T;  5LJ5 e;  1PSF A;  4LDU A;  1JJ2 S;  2QQS A;  4FU6 A;  1I4K 1;  2LDM A;  1YJN T;  3HRT A;  1G3W A;  3GOX A;  2JNG A;  3RES A;  2K57 A;  1VQ4 A;  3VU3 C;  4IUU A;  4E7I A;  2B8A A;  2DTH A;  3LW5 E;  4M77 C;  3JCM d;  1B34 B;  5GAN 7;  3CCQ A;  3CMA A;  1YIJ A;  1G3S A;  3OQ5 A;  4PJO C;  3HKS A;  2KSS A;  2LT1 A;  5CKF A;  2LQ8 A;  1WJR A;  4OB3 B;  5LJ3 e;  5GAM d;  2L5Q A;  3QBY A;  4N4H A;  4F7U B;  3OYG A;  3DLL A;  5CVI A;  4E7J A;  2RHI A;  1U1T A;  5CR2 A;  2LRQ A;  4C0F A;  3VKI A;  2QQR A;  1G3T A;  3PIP A;  2DTI A;  1VQ9 T;  4TVR A;  4QVD A;  5CAI A;  1Q81 C;  2VGM A;  4NOY A;  3RMQ A;  3J81 E;  4E7K A;  1WGS A;  2BKD N;  4Q5W A;  5FU7 C;  4QQD A;  4DA4 A;  3OYC A;  4X34 A;  4XTV A;  3P8H A;  4GLK A;  4C92 D;  4OGC A;  5CKB A;  1UGS B;  4FL6 A;  4DQ2 A;  3TRE A;  5A0D A;  1Y07 A;  3JCM V;  2MI6 A;  3ME9 A;  3JB9 H;  5LJ3 f;  4M75 C;  1NJI C;  3TCJ A;  5LJ3 g;  2RK2 A;  3QYH B;  3NTK A;  3OYD A;  1VIE A;  5GAN 4;  4C92 G;  3LWI A;  4BDY A;  4FT4 A;  5I2M A;  5LJ3 h;  4KUL A;  3UPU A;  2Y4Y A;  2ZGW A;  4CI0 C;  3X28 B;  1LOJ A;  2CZ0 B;  2RD1 A;  1X6O A;  3QSU A;  5GAO r;  2M9U A;  3JSC A;  1WNL A;  3MCA B;  3KXT A;  4PL6 A;  4ZGE B;  2ZPI B;  3M54 A;  3OYL A;  1YI2 A;  1M90 U;  4E7H A;  3OYI A;  2D6F A;  4RCC A;  3L2R A;  3BFM A;  1N9S A;  1K73 C;  4HCB A;  3A8M B;  1BI0 A;  2K3X A;  4M78 C;  2M16 A;  4UC4 A;  3CC2 A;  2K5F A;  1VQ7 T;  4HT8 A;  3CC4 A;  1XOV A;  3RKX A;  2DD5 A;  1Y7X A;  5A0G A;  5CKD A;  3I56 A;  1NPR A;  5C6S A;  4XTY A;  3JCM J;  3TU4 K;  3LGL A;  2LX9 A;  2DXU A;  3H8Z A;  5HK0 A;  1NJI U;  3HRS A;  4V2S A;  4JLG A;  3OMC A;  2PVO B;  1W2B A;  1HXD A;  4PNO A;  3T9N A;  2O4X A;  3CCM A;  3G71 A;  3L2Q A;  1UB4 A;  4QQG A;  3P8D A;  3QHS A;  4JRK A;  2LQK A;  4JS4 A;  1YCY A;  4O5V A;  3FB9 A;  3M9Q A;  4MZP A;  2XD0 A;  5GAN 3;  3I56 T;  3WVE B;  1M90 C;  4HCC A;  4QQ6 A;  2EQK A;  4R56 A;  2A7Y A;  2KQW A;  4EMG A;  2M1H A;  4FSX A;  2LNV A;  4C5E A;  2I2L A;  4C8Q F;  2KY9 A;  3KBG A;  1M9S A;  1Q82 U;  5CKE A;  3L2Z A;  3CC4 T;  3L2U A;  3HL8 A;  1UGQ B;  3LWH A;  3PTA A;  3GIB A;  4F7U F;  3CCJ A;  2DTO A;  1KHC A;  3EFR A;  3OBY A;  4M7A D;  2OTJ T;  3J80 E;  2MWO A;  4ME7 A;  3FIF A;  2XDP A;  3BW1 A;  4LD9 K;  4M75 G;  1QP3 A;  2JOY A;  2RJE A;  3OYA A;  1VQ8 T;  5GAO m;  1Y96 B;  3RER A;  4HCZ A;  4M7D G;  2K4Y A;  2YHT A;  3A5Z B;  5I2S A;  1VIF A;  2CZ7 B;  1KHI A;  4XU3 A;  5CIU A;  2BUD A;  3VUB A;  3JCM f;  4F7U A;  3V7C A;  1FX7 A;  2RI3 A;  2YLC A;  3L2W A;  5LJ5 f;  1Q7Y U;  4DOW A;  2DEQ A;  3MEU A;  5IAY A;  4BAC A;  1K9M U;  3RKY A;  4C8Q A;  1RI0 A;  3CBP A;  5J26 A;  1VQO A;  1M1G A;  4RCB A;  1N8R C;  1KC8 C;  1WQ7 A;  3CC7 T;  2JUF A;  1H64 1;  3M5A A;  3OS0 A;  1VQ4 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...