5FU7B

Drosophila nanos nbr peptide bound to the not module of the human ccr4-not complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
191
structure length
191
Chain Sequence
EMVTDQFGMIGLLTFIRAAETDPGMVHLALGSDLTTLGLNLNSPENLYPKFASPWASSPCRPQDIDFHVPSEYLTNIHIRDKLAAIKLGRYGEDLLFYLYYMNGGDVLQLLAAVELFNRDWRYHKEERVWITRAPGMEPTMKTNTYERGTYYFFDCLNWRKVAKEFHLEYDKLEERPHLPSTFNYNPAQQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Distinct Modes of Recruitment of the Ccr4-not Complex by Drosophila and Vertebrate Nanos
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
molecule keywords CCR4-NOT TRANSCRIPTION COMPLEX SUBUNIT 1
total genus 34
structure length 191
sequence length 191
chains with identical sequence F
ec nomenclature
pdb deposition date 2016-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04153 NOT2_3_5 NOT2 / NOT3 / NOT5 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1020 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5fu7B00
4C0DC 5FU6B 4C0DB 4BY6B 5FU7B 4C0GA 4BY6C 5FU7C 4C0FA 5FU6C
chains in the Genus database with same CATH superfamily
2EAYA 1VUBA 2R58A 1YJNT 1PWTA 4JJNK 3JCMe 1D0XA 1KQSP 2CYZB 4YTLA 2HKNA 5DY9A 2KXCA 1WX6A 2ED0A 1QMCA 3SEMA 4F14A 1U5SA 2RHYA 4ZTFA 2CSQA 2RMOA 3CCUT 1MNEA 1VQLA 1Q86C 2X4WA 3QUIA 2BUDA 4PJOG 2NUPA 3LLRA 1WHHA 3H6ZA 2ZPBB 2X4YA 2EBPA 3HPWA 4EMGA 2PU9B 2VUBA 1HXDA 5GMKe 2EGCA 5GANh 3G1JA 2DTIA 3C12A 3CCEA 1U06A 4A4KA 2O01E 3X20B 2A7YA 4DBQA 3MEVA 2PVGB 1G3SA 4FSSA 3GLXA 4KUDK 2AIRB 1YBYA 4A63B 2RQVA 2HNIA 3JB9G 3DB3A 2VXFA 1WLPB 1Y71A 4OB3B 1B34B 1YIJA 3A8OB 1TSFA 3M53A 3S3NA 1PHTA 3RMSA 2MOXA 4ZN1A 4C0FA 2JW4A 4EMKA 3DB4A 3V8JA 3GBQA 1Q95G 2VVKA 3GP8A 2AT1B 2RHZA 2QQAA 3HFOA 4PFPA 4AT1B 2DD4A 3BDLA 1ZUKA 2YLBA 2FO0A 3E1SA 1D0ZA 5ECAA 4RG8A 3LW5E 1JU5C 2DYBA 2E3IA 2CH4A 1NPPA 3QG1A 5CQXA 3JCMh 1UB4A 2Y4XA 4ZGDB 4J9DA 3JCMf 4ATOA 1I1JA 4J5YA 1QVPA 4FCYA 5CAIA 3FIFA 4JLGA 4MZTA 4ZGJB 2DXUA 4O6JA 1V76A 1VQ9A 5I11A 2RQUA 1W1FA 4TVRA 1ACMB 4XU3A 2DZCA 1K9MU 1YITT 2KYMA 3UWNA 2RHUA 2EQKA 4QVZA 3M58A 4QVDA 1YP5A 3J81E 1JJ2S 2QDLA 1RAIB 2CS7A 1PRMC 4PLIA 5FLXE 4DBHA 3QDRB 3LGFA 1ZHIA 2XU8A 3CPWA 1VQ9Q 2KBTA 1D3BA 3VKIA 3RUXA 5GMKh 1YITQ 3N5BB 2IPOB 2LNHB 2FPFA 3CD6T 2VGMA 4C92D 3EG0A 2KNBB 2HSPA 2QEXA 2NLUA 4ZNXA 1OX9A 1SRLA 1BI3A 5J26A 1BBZA 2C0OA 4GLMA 2OAUA 5KCOA 1MMNA 2JJ9A 4IKFA 4QT7A 3META 5D6XA 3OA6A 4A4GA 3OYJA 5LJ3h 1GCQC 1NM7A 3S6WA 3EFSA 4JZ3A 4PLLA 3CQTA 3OYKA 1Q7YR 4RCBA 1K1ZA 4ELYC 5KH6A 2VKNA 2KROA 5C6SA 5GANf 3PE0A 4JJCA 2D8JA 1U3OA 4KGZB 1M27C 1WHKA 4ZGEB 1M90R 3NTHA 1VQ6A 2EKOA 5L8RE 1M90U 1S72A 3JCMQ 2EYQA 4M7DF 3FC3A 1VQMA 2EQMA 2RK2A 2CREA 3M54A 3X26B 5IHNA 4RTYA 1GBRA 2YRDA 3SD4A 1WGSA 2XMFA 5LJ3f 5CO7A 3CC4T 4MDXA 4C8QB 1M3AA 3M55A 2RM4A 1LOJA 3CCRT 1YWPA 3CXCS 2MYSA 3GNFB 3VS0A 4FT2A 4DA4A 3I56A 1VQPQ 1YIJT 1UECA 4P5NA 1PSEA 1LJOA 4FM4B 3HTRA 4RUGA 5GMKl 4B6MA 4KUIA 5AT1B 5GAN5 4J9HA 1WNLA 2GF7A 2DIQA 2VV5A 1GCQA 1QWEA 2DEUA 3V8KA 1OZ3A 3JCMg 2M0YA 4FU6A 5GANe 1JBMA 4C8QA 2QYZA 3ER0A 3L1AA 5CKDA 5IXFA 1KC8U 3JB9F 3VYHB 2MWOA 2YRCA 2LMJA 3GNGA 3QKJA 4CRIA 1BIBA 3EGXB 2LJ0A 3C4SA 1D0YA 3OYEA 4PJLA 2KEAA 4DOWA 3QHSA 5LJ3d 3DLMA 1KQ2A 2HD0A 2NUPB 2L3QA 1XQHA 1TXQA 2MPXC 2K2VA 3QJ6A 2F2VA 1WDXA 2DL3A 3A1PA 4C0GA 3CEYA 4LDXA 2RA2A 4LDYA 5KYWA 2FG0A 2HBWA 5CKHA 8AT1B 1FYNA 4M75C 4E7LA 5GAOm 4ELZC 1NEBA 3CCJQ 2CP6A 4JS4A 1I81A 3THKA 3CD6A 1U1TA 4M77C 3RIRA 1CKAA 5FU7C 2QEXT 1ZSGA 4C5GA 2XG8D 1IGUA 2DJZA 1K73U 1TUCA 2LZ6B 3ASKA 2O4XA 3AT1B 1YCYA 1LPLA 4Z8AA 2XICA 1DJ7B 5J3BA 1BCOA 1BCMA 2QA4A 2PZ1A 2EYZA 5I2MA 5J39A 2QXFA 1IXDA 1VIEA 2CP3A 2LX7A 2XDPA 2O9SA 5L23A 4J8OA 4C5EA 3BE3A 4FYWB 1VQ4A 4WTOB 2QK0A 3GF5A 2JMCA 1UUEA 2DL5A 1KD1U 4J9IA 1VQ6T 2VB6A 3CCRQ 4PKCC 1NPRA 4ORZA 2FB7A 4NL3A 3G4ST 4RKUE 1WJSA 2COZA 3P8BB 5CQYA 4C5HA 3CCVA 1R0BG 4BI3A 2LQKA 5DLQE 2R5AA 2RK1A 2DNUA 3CC4A 1JO8A 2RO0A 4KT0E 1D09B 1N5ZA 1YJ9Q 1VQKQ 1PRLC 3CCRA 1VQNQ 2I0NA 3G4SQ 4BUGA 1WXUA 1C0MA 3TVTA 2YWWA 2VYTA 1HSQA 4PJMA 1D3BB 2X51A 2DK3A 1T3LA 3FJPA 1YWOA 3OYYA 2E10A 2D1XA 2A36A 1MUZA 1VQKA 3CMEQ 2Y4YA 5I2SA 3I56Q 1X2QA 2KAFA 1NZ9A 2P4TA 1M3CA 3M0QA 2EGAA 1JRIA 3M0PA 4F7UG 3UA6A 4C8QE 1KJWA 1VYVA 2HBPA 3AHUA 2NUZA 3PFSA 3VYGA 4BE1A 4E2FB 1MMAA 2P0KA 3R6OA 2HL5C 2F1LA 1WZOA 4BY6C 1KQSS 3GPLA 1I5OB 3PVLA 2MAMA 1YN8A 1N6AA 4J6WA 3ULRB 2VWFA 3JV3A 3M59A 4FYVB 1KC8C 2PUKB 2EQUA 5GAN3 4XK8E 1ZSZA 2DA9A 5CKFA 3OYAA 3G6EQ 4HT9A 3P8DA 2YUNA 4AG2C 5IH2A 5CKBA 4AFZC 2W10A 5GANg 1AZGB 3CCMQ 4HCCA 1QW1A 4M77D 3PIOA 1NG2A 2KE9A 1W2BS 3I55A 1UE9A 5I22A 3A8MB 2PNIA 4D6WA 2J6FA 2LCSA 1OX8A 3MP6A 2AHJB 1ZLMA 2ED1A 1JEGA 3G6ET 1QP3A 2GBQA 3V7SA 2RQTA 2GQIA 2J6KA 3O5ZA 3LWIA 4BDZA 2XK0A 2WSCE 2HQXA 4BB7A 2MI6A 3CCMT 1K9MC 2K7AA 2BIVA 2PVOB 3JCMJ 4Z89A 2XHCA 3ZBDA 2QA4T 4OB2B 1UGQB 3VS1A 3M0RA 2D9TA 3H0HA 1TOVA 2ZPGB 1HJDA 3OQ5A 1VQ5T 3OY9A 2WACA 1RLQC 4AMCA 2EYYA 1SPKA 1N8RU 2E64A 3A8LB 5I21A 4N0AA 1QCOA 3CCUQ 2L89A 1W4SA 1SRMA 3H8ZA 4EIKA 2ABLA 2F5KA 4LDUA 2BTTA 4JZ4A 3OSVA 1XOVA 2EKHA 3CCVT 2YUOA 1KIKA 3RKYA 2YRVA 3SHWA 2YSQA 3NFCA 3OW2P 4RMOA 4PFOA 3KFVA 2F2WA 2NWMA 4QVCA 4QQ6A 1VQ8A 2JS0A 1C6VX 1LCKA 4XU0A 2RJFA 4XTWA 1GBQA 3OW2S 2E41A 2X4XA 4IUVA 2JTFA 3EGDB 4EPCA 3CCLA 4FT4A 2X4JA 1NE8A 1TH7A 1X75C 3PIPA 3PVQA 1QWFA 4MMKA 1JJ2P 2E6NA 1QP2A 1AEYA 5FWCA 3C95A 2AKKA 4M78C 2PQWA 3V7CA 3NGPA 2DETA 2AZSA 2FVUA 1VYUA 4FW2A 3DKMA 2CP2A 3CBMA 5FRMA 1TU0B 4GLKA 4PJOC 1BK2A 5GJWB 4ZTJA 2GTJA 4E7SA 3MHXA 4M78E 3HRSA 1MGQA 2CKKA 3HRUA 5KYNA 1VQOA 1NEGA 5KE3A 1C1AA 1WJQA 2EYWA 2GCXA 2KRNA 3JB9J 1TTHB 3QO3A 2XIDA 2FPEA 4PJOF 2ROTA 2RI2A 2X35A 3G7ZA 1UGRB 1BU1A 1G8XA 5D6WA 1FMKA 1G3TA 3C0CA 2SRCA 4B9WA 2RF0A 1WHJA 4OF1A 1D1AA 1AWJA 4J9BA 1VQOQ 4HVUA 1PKTA 5FU6C 2ZCFB 1PG5B 1ABOA 4A4EA 3CBOA 2HL3A 1W70A 2FL7A 1FWZA 4C92C 5C0MA 1NLOC 4Z02A 1WFWA 2RJCA 2WSEE 3I9QA 4OMPA 2EPDA 3HSBA 1SEMA 1VQ5Q 1KQ1A 4F7UB 4ME7A 3GIBA 4M7AC 1K9MR 4RTUA 3CCMA 3P8HA 1Q82C 1IRXA 2QASA 3OYDA 3E2UA 3QDFA 5EC7A 3EH2A 4KH1B 2LT4A 5GAN7 3M0UA 2XD0A 4C5IA 1K8AC 2XDBA 3VJPA 3CC2A 5HY6A 5LJ3j 3CMAA 2KQWA 4CC4B 4PFZA 1K9AA 2ECZA 2BE9B 1PC0A 1O75A 1N8RC 2X3WD 4M7AG 1R77A 5LJ5g 2QQBA 5FU7B 2PVDB 2GFAA 3TEEA 1JJ2A 1Y0MA 4JDSA 5GJVB 3D7SB 3ZEHA 5GMKj 2HCKA 3FLGA 4WCIA 3UDCA 4BI8B 3CMAQ 2EJGA 2R57A 1G3WA 4II1A 3EFOB 4M78D 3OYBA 2HEQA 1KFZA 3FEOA 4X9DA 2FRWA 4DQ2A 3SWNC 2KT1A 2COYA 4OGEA 3QIIA 3A98A 2DILA 4BE0A 1UTIA 4LDVA 2COWA 2XI9A 1M1FA 4OVAA 2QQSA 4J6YA 1KD1C 1M3BA 3OB9A 1PM3A 1XJWB 1NJIU 4C0DC 2OX7A 1YIJQ 1A0NB 2RQRA 5GAOr 2O9VA 3KBGA 4LE9A 1V1CA 2ZZDA 1IGQA 2CGHA 4A53A 3CCQA 2MCNA 3X24B 3LWHA 1FMWA 5LJ5e 2CP0A 1WPYA 4F17A 3M5AA 2L3PA 4UC4A 4EMKC 2HKQB 3CCLQ 3OYCA 2OTJQ 1WQ7A 1Q81C 4J9CA 4BI4A 7AT1B 2K3BA 5GAMd 2GTOA 1X69A 1V29B 5FROA 1WI7A 1UGPB 1GXIE 2CH4W 2CT3A 1VQOT 4D8DA 2DAQA 2CZ6B 1MHNA 2I2LA 1K8AU 2OTJT 1N9SA 4JLIA 5CCAA 2OTLQ 4E7KA 4EMHA 1YI2T 4NOYA 1M2VA 2DMOA 3E9FA 2DE0X 3RESA 1J3TA 1ZA1B 2MWPA 2P0QA 4NS5A 5LJ3e 1QVFA 2LX9A 4CI0C 3CXCA 1M8VA 2ZPFB 4M77E 4M7DG 4M7DA 4BD3A 3H9NA 2QGGA 1Z9ZA 2DEQA 1EX4A 1G83A 3NTIA 3JCMP 2EGEA 5D7UA 3EGUA 1VQ9T 3RDVA 2CZ0B 4MZMA 1YITA 1AWXA 2JNGA 2JOYA 1T0JA 3CCJT 3MEAA 4OGCA 1BI1A 1HD3A 3Q1JA 3VU3C 4JRKA 1RI0A 2KDSA 3EG1A 2JUFA 1LVKA 5GAN8 3QYGB 4N4HA 1CKBA 4CC2A 1B7TA 2ZGWA 4LXCA 3CC2T 3V7RA 2J7IA 1RAHB 2HAXA 3CMAT 2RPNA 1EIFA 3HKSA 3VS7A 2K2MA 1QVGA 4RTWA 3M4GA 1AT1B 1AVZC 2CP7A 1M1KC 2GQVA 4M7AE 2M02A 5KYUB 1X01A 4Y92A 1BI0A 1SHGA 3EFRA 3HRTA 2DXTA 4OMFB 1GRIA 1Y96A 5DLOA 1UJ0A 1I8FA 3QBYA 5CIUA 1VQ6Q 1LNXA 2MIOA 3CC2Q 4J9GA 3REAB 1W2BP 2A0FB 3UPUA 2YHTA 2VGNA 1S72Q 4F04B 2EYXA 3RMQA 4CC7A 3RERA 1KHCA 1VQMQ 1AHJB 2DJQA 1CSKA 3M57A 4MZPA 5FU6B 3NHNA 3CPWP 2DRKA 3TSZA 1ZBXA 3JSCA 1UG1A 4M75F 3OYFA 2DKGA 3X25B 1S72T 1KD1R 2RJDA 1TUDA 1VQPT 1VQMT 1I0CA 2DXBA 3EG3A 4R55A 2QQRA 4R56A 3QZ5B 2DLPA 4JUVA 3E19A 2VC8A 3L2VA 5IAYA 2OTLT 4DBRA 1YI2Q 4RTXA 3I56T 1MV3A 1RADB 1UDLA 2EFIA 4KH0B 1HYOA 1W6XA 1UGSB 3EGXA 1YHQA 1G2BA 2DL8A 4JPBW 1WJRA 2F5TX 3OMGA 4MDWA 2CUDA 2OTJA 3OYLA 1YI2A 4L5GA 3VS5A 3R6NA 2KVQG 3I5RA 2A08A 1X6GA 3OBYA 2DO3A 4IUTA 4PJOA 4XU2A 3LH5A 2VXEA 1WXTA 1KC8R 2M1HA 4DEYA 1OULA 3M0SA 4VUBA 3NTKA 5HKCA 4KULA 3PGGA 3UA7A 2JT4A 2K9GA 2EVRA 3CC7Q 1U1SA 2NUTA 2X9HA 1X6BA 4QQDA 4HVWA 2FZKB 5GMKi 2RQWA 4BACA 2JTMA 1X6OA 1IB8A 1RACB 3U23A 1BB9A 2H3EB 4PJNA 1QCNA 5CK9A 1MMGA 3ME9A 2L3RA 3CCJA 3OS5A 2ZPHB 3CC7T 2QEXQ 1JXOA 2V1RA 2DPPB 3VUZA 4M78F 4XTYA 1M1KU 3F70A 3MKDA 1NLPC 3QPHA 1OQKA 5FW9A 4E47A 1I5LA 2LCLA 2QA4Q 2KSSA 1PNJA 4QW2A 2LQWA 3HHTB 3QXEB 4L6V5 2CZ7B 3HP9A 1K73R 4Q5WA 1Y57A 4PNOA 3RKXA 1YJWA 1KG1A 3EG2A 1YJNA 1B3QA 3JCMV 4M77F 1BIAA 4NL2A 4ZN3A 4V2SA 4FL6A 3C94A 2PTKA 2FYKA 3LX7A 6AT1B 2EIFA 4C92G 2LQ8A 5GANd 4RTTA 2DTOA 4M7DD 4LN2A 2DERA 2HQEA 3RKWA 5CVIA 1VQNT 3T9NA 3OYIA 2V8IA 1AWWA 3G4SA 1VQPA 1TUGB 2MMPA 4C8QD 5LJ3g 4LUDA 3OSSC 3CCET 4LDWA 1VQLQ 1P92A 2E5KA 3BDUA 5HK3A 4LD9K 3SWNA 5GAMj 4HVVA 4IUUA 9ATCB 4ANJA 2NYSA 1IREB 1Q81R 2DL4A 4OB1B 3L42A 2RN8A 4KGXB 3OYGA 4K11A 5KYXA 2BE7D 2LJ3A 1M8MA 1NBEB 4E6RA 4M78A 3EHRA 2FPDA 4PL6A 5EG2A 1QVFP 5KYXB 1ZA2B 2A37A 1SG5A 1KQSA 3OS0A 3QYHB 1B07A 1IO6A 1QVGS 1RUWA 4A54A 2BZXA 1K4US 4BE2A 3V8LA 4IIMA 1JQQA 1UEBA 4J6XA 2PUOB 1QVGP 2D0NA 1YFNA 3SFMA 1H3ZA 3G71A 4M77B 1HK9A 4LUEA 1ZSZB 2L3SA 2K57A 2MK5A 1WHLA 1RAAB 2D8HA 2RI5A 1AD5A 2A28A 3PT9A 3X28B 4OMQA 5GAOl 4B9XA 4OMNA 1VQ7A 3MP8A 3JCMd 4RG2A 3J80E 3G71Q 3CC7A 4J9FA 4XQ3A 1Q82R 2CZ1B 2JZ2A 4HCKA 4OMMA 1Q86U 2KYBA 1ZQ1A 5FWBA 1UHFA 1X27A 1G5VA 3WVEB 1QKWA 4ESRA 3H41A 1K8AR 3H0IA 3CCSA 3JCMW 2QTXA 2IVWA 2DF6A 1GFCA 4M75A 1NYFA 1VQ7Q 1U8RA 2ZPIB 5A0LA 3BY7A 2DRMA 2XDDA 2E5QA 1K76A 1RAFB 2M51A 2DFUA 2GNCA 3SWNB 3QJYA 3EHQA 2HMAA 2QQ9A 1AZEA 5DM7R 1YJWT 4M75D 1OZ2A 3A5ZB 3PNWC 4C92B 2CUBA 2KGTA 1WYXA 3CCVQ 4FIBA 1TS9A 4QQGA 4OMOA 1M30A 1WQWA 1SSFA 2A3LA 1RAEB 1KK7A 1YJWQ 1ZUUA 1Q82U 1AOJA 2KK4A 1YJNQ 2KY9A 2RJEA 1VQNA 3QWXX 1YNZA 2K5FA 2BZ8A 4FW1A 4HCZA 5KYWB 4C92A 4KRTA 3M4YA 2EWNA 3A8HB 1O9SA 2Z0WA 1VQ8T 2RNAA 4AFQC 4PJOE 1RAGB 4BDYA 3ZL7C 2DIGA 1ZX6A 2Y90A 4M7AB 2MF2A 2BZYA 3EH1A 3VUBA 2DL7A 4M4ZA 3CCLT 1IZ6A 4X1VA 3FDRA 2WSFE 4O5VA 5AYFA 1Z9QA 1IHVA 1E6HA 1MNDA 1B34A 1PSFA 5GAMh 1W2BA 3MPUB 3E9GA 4AFUC 5M9OA 3BW1A 3CC4Q 3TU4K 2DM1A 5IHKA 2K79A 3PMIA 2X3XD 4IUPA 5D6YA 3L2QA 1WHMA 3QSUA 2JM8A 5KYYA 3FRNA 4J7IA 4XTXA 3NMZC 1H3HA 3EAEA 2XKOC 2CT4A 1M5Q1 3G71T 2HZYA 2IG0A 4KBMB 2LT1A 3CMEA 2E3HA 2DYIA 4C8QC 1OPLA 4KGVB 4AFSC 1QCFA 2LCCA 2E70A 3WXMB 4JS5A 4DBFA 1BKBA 2KI7A 4E7JA 3VV0A 1JXMA 4AG1C 3TQ7P 2L0AA 1H641 1VQ7T 5LL6S 2K3YA 1KHIA 1VA7A 4JRIA 3KUFA 3H0FA 4IURA 4GY5A 1SKUB 4M78G 3CCST 4M7AA 3REBB 2KRMA 4F16A 2GGRA 1UJYA 2K3XA 3CXCP 3O8VA 3KXTA 2FZGB 3M56A 2DTHA 3OW2A 2E12A 1QKXA 4C92F 5CR2A 1D1BA 2V1QA 1K0SA 2OAWA 3PTAA 1VOMA 3OYHA 3JB9I 3CCSQ 3PMTA 4M77G 2V8JA 1RL2A 2C0TA 2P4RA 1BI2A 4PK4A 2JXBA 3CD6Q 4EMKB 2JS2A 2LNVA 3M9QA 5CKEA 1H92A 2ESWA 1VQ4T 2CP5A 2QDYB 3L2RA 4Y91A 1KSWA 3CPFA 1Q86R 3QZ9B 1M1KR 1VQ8Q 1K0XA 2D0QB 2O4XB 1E6GA 2QG9B 1VYTA 4LD6A 4RTZA 2ZPEB 3SB2A 2K6DA 1M90C 1OU8A 2DBMA 4IIOA 2B86A 1N8RR 1I07A 3JCMc 2F69A 2YUPA 2FHDA 3S3MA 1OU9A 2RHIA 1VQ4Q 1WA7A 4N4IA 3FJ5A 4F7UF 2H8HA 3L2UA 4MMLA 1Q7YC 3VS2A 3MO8A 3UT1A 4Y28E 3MP1A 2NUTB 3JCMb 2DXCA 4J7FA 3OS1A 1GFDA 1UGVA 1WXBA 2OI3A 1T0HA 1Q81U 2DVEA 2LTOA 2JN0A 3VS4A 5IN1A 2LRQA 1YJ9A 3OYMA 3CCQT 3L2ZA 3QWYA 2J05A 2JTEA 3MEWA 4HT8A 2FEIA 2FZCB 2L8DA 2KXDA 1VQKT 1SSHA 2AZVA 2YT6A 5GAN2 4OB0B 4OP0A 5GANj 3GOXA 2V26A 2EQIA 2OJ2A 1RLPC 4F7UE 2E4HA 3RNJA 1Y07A 4C0ZA 3NPFA 1PKSA 1PCXA 2B8AA 4OMLA 3LGLA 1ABQA 5IHIA 3JRZA 5KYUA 4E7ZA 2J06A 2LC4A 5IT9E 2RI3A 4LNPA 4BY6B 1I4K1 3CMET 4HKEA 3IQLA 5GAN6 1M4ZA 4CC3A 2O88A 1VIFA 4XTVA 2P0PA 3S3OA 4M7DC 4FYXB 3BFMA 4FSXA 2SEMA 1ZSZC 5GAOp 4N4GA 4HCBA 5GAMe 5HK0A 1XTDA 5LJ5j 5GAN4 1X2KA 3UF4A 1M2VB 2M16A 2LVMA 2DZ9A 1BYMA 4M7AD 2YUQA 1N27A 3JCMX 1Y7XA 2M9UA 1IHWA 4J9EA 2O31A 1N9RA 5A2QE 3TSWA 1Q7YU 1NYGA 2M0OA 3A8GB 3I55T 2LDMA 2QTVA 2G3RA 1YCSB 2QAZA 4PJJA 5GAOq 4C8QG 5GMKm 4M75E 5FRNA 3G6EA 2KR3A 4WF2A 2C06A 1OYXA 1X43A 1RI9A 4J83A 3FB9A 2F2XA 2P84A 3I55Q 3JB9D 3OMCA 3INZA 3CBPA 5LJ5d 3URGA 5KE2A 5A0DA 5A0GA 1RABB 1TG0A 2AK5A 5KYYB 2KRSA 1PD1A 4GBQA 4QKUA 1M2OA 2BKDN 1VQ5A 2JMAA 4XAXB 4N0AC 2EQJA 2D6FA 5GAMf 3MEUA 3EGDA 4L59A 1T3SA 3MCAB 1ZBJA 2R5MA 4X34A 2ZAEA 1K73C 2JM9A 4EDUA 1WHGA 1ZUYA 4RTVA 4DOVA 2E65A 2VASA 3HFNA 4R0KA 2W0ZA 4PJOD 3M0TA 1OI1A 4HA8A 4D8KA 2AKLA 4X9CA 1E7OA 1Y96B 2K5IA 2DBKA 3SDZA 3VRYA 5GAOn 1FX7A 1M1GA 2O2OA 4IUQA 2ENMA 3CCQQ 2G6FX 1SF9A 2RB6A 3HL8A 3CCUA 3CCEQ 1VQLT 1H8KA 1QVFS 2ATCB 2KT8A 3TREA 1S1NA 5HCKA 2J6OA 1D1CA 3ZFJA 2ROLA 3WVDB 1QQJA 1FXXA 2HDAA 2QGFB 3I5SA 3LH0A 3VRZA 4PJOB 3EG9B 1UFFA 1F1BB 2HQHA 1WIEA 5LJ5h 1OPKA 2QI2A 3JB9H 3OS2A 3EFOA 1R0CB 1YJ9T 1TWBA 2CSIA 2LJ1A 2L2PA 1FMVA 4M78B 4C0DB 1YHQQ 2EJFA 2H3JA 2HSEB 4F7UA 2OTLA 4DEXA 1NJIC 2YDLA 4E7IA 1NJIR 2C0IA 2DX1A 2EJ9A 2YLCA 2LP5A 4XU1A 3VS6A 1XNIA 1EFNA 2FRYA 2E6ZA 4JJDA 4JRPA 2KMTA 1YHQT 1PD0A 3CPWS 1OOTA 1M9SA 3OBWA 1UHCA 4XTZA 1R8OB 2GFUA 1MV0B 4M75G 4M75B 3RBBB 3TCJA 4XTUA 4E7HA 4FYYB 1OV3A 1SHFA 1AWOA 2V8KA 4JRQA 3J7AF 4JJBA 5KCHA 1OEBA 2K4YA 1GCPA 4RCCA 4Z88A 2DVJA 3EG9A 4C92E 4M7AF 3LYIA 2JVVA 2DD5A 3MJXA 1JB0E 3UATA 2YXYA 2LQNA 2CDTA 3DLLA 5LJ5f 4A4HA 4M7DE 3JAME 4M77A 2E1HA 2K5LA 1G3YA 2EW3A 2IIMA 3L2WA 5GAMg 1MMDA 4M7DB 2RD1A 3OYNA 4HXJA 2RHXA 1QLYA 2L5QA 2RH2A 3I35A 4A4FA 3RR6A 1ARKA 5IXBA 1EZZB 4C8QF 3VS3A 1GL5A 8ATCB
chains in the Genus database with same CATH topology
2EAYA 1VUBA 5DLOA 2R58A 1YJNT 1I8FA 3AHUA 3QBYA 5CIUA 3VYGA 3PFSA 1LNXA 1M5Q1 3JCMe 3G71T 2IG0A 4KBMB 4JJNK 4BE1A 2CYZB 2P0KA 2LT1A 3CMEA 3R6OA 3UPUA 2YHTA 4YTLA 2VGNA 4C8QC 5DY9A 3RMQA 4BY6C 2LCCA 3RERA 1KHCA 2E70A 3WXMB 1KQSS 3GPLA 4JS5A 1AHJB 2RHYA 4ZTFA 1BKBA 2MAMA 3M57A 3CCUT 4E7JA 1N6AA 1VQLA 4J6WA 4MZPA 1Q86C 3VV0A 5FU6B 2X4WA 3QUIA 3M59A 2BUDA 4PJOG 1H641 3LLRA 3H6ZA 1KC8C 1ZBXA 3JSCA 1VQ7T 5LL6S 2PUKB 2X4YA 2ZPBB 3HPWA 4M75F 2DKGA 3OYFA 2EQUA 2K3YA 3X25B 2RJDA 4EMGA 2PU9B 1KHIA 4XK8E 5GAN3 5CKFA 2VUBA 1HXDA 3OYAA 5GMKe 1VQPT 4HT9A 1VQMT 3P8DA 2DXBA 4R55A 5GANh 4JRIA 3KUFA 5CKBA 2QQRA 4R56A 2DTIA 3QZ5B 3C12A 4IURA 5GANg 3CCEA 4JUVA 4A4KA 4HCCA 2O01E 3X20B 4GY5A 1QW1A 2A7YA 3E19A 4M77D 2VC8A 3PIOA 3MEVA 4M78G 3CCST 3L2VA 1W2BS 5IAYA 3I55A 4M7AA 2PVGB 3A8MB 4D6WA 1G3SA 4KUDK 3GLXA 1YBYA 2K3XA 3O8VA 3MP6A 2AHJB 2HNIA 2OTLT 3KXTA 3M56A 3G6ET 1QP3A 2DTHA 3V7SA 3JB9G 3OW2A 2E12A 3DB3A 2VXFA 1Y71A 4OB3B 3I56T 1B34B 4C92F 5CR2A 3A8OB 2XK0A 2WSCE 2HQXA 3LWIA 4BDZA 1YIJA 4BB7A 2MI6A 3M53A 3S3NA 3CCMT 3PTAA 2EFIA 3RMSA 3OYHA 1K9MC 4ZN1A 2BIVA 2PVOB 4C0FA 3JB9I 4EMKA 3JCMJ 3PMTA 3DB4A 1UGSB 4M77G 2XHCA 2V8JA 1YHQA 3ZBDA 2QA4T 3V8JA 4OB2B 1UGQB 1RL2A 1BI2A 1WJRA 2F5TX 3OMGA 4MDWA 3GP8A 3HFOA 2D9TA 2QQAA 2RHZA 2LNVA 3M9QA 4EMKB 2OTJA 3OYLA 2ZPGB 3OQ5A 5CKEA 2DD4A 3BDLA 3OY9A 1VQ5T 1YI2A 4L5GA 2WACA 1VQ4T 2QDYB 2YLBA 3L2RA 4Y91A 3CPFA 2KVQG 3E1SA 3QZ9B 3OBYA 2D0QB 2DO3A 2O4XB 4IUTA 4RG8A 4XU2A 4PJOA 3LW5E 2VXEA 4LD6A 2M1HA 1NPPA 2ZPEB 3QG1A 5CQXA 3SB2A 3JCMh 1N8RU 1UB4A 2E64A 2Y4XA 3A8LB 4N0AA 4ZGDB 5I21A 4VUBA 2L89A 3NTKA 1W4SA 3JCMc 2F69A 5HKCA 3H8ZA 4KULA 2F5KA 3PGGA 4LDUA 2FHDA 3JCMf 4ATOA 3S3MA 2RHIA 3OSVA 4J5YA 1QVPA 1XOVA 5CAIA 3FIFA 1U1SA 4N4IA 4JLGA 3CCVT 4F7UF 4MZTA 3RKYA 2YRVA 4QQDA 3NFCA 4ZGJB 4MMLA 5GMKi 4RMOA 2DXUA 3L2UA 4O6JA 4QVCA 1Q7YC 4QQ6A 4BACA 3MO8A 2JTMA 3UT1A 4Y28E 1VQ8A 3MP1A 1X6OA 1VQ9A 4XU0A 3JCMb 2RJFA 4XTWA 2DXCA 4J7FA 4TVRA 3OS1A 3OW2S 4XU3A 2DZCA 2E41A 1K9MU 1YITT 5CK9A 2X4XA 4IUVA 3UWNA 2RHUA 3ME9A 2EQKA 2L3RA 4QVZA 3OS5A 2ZPHB 2JTFA 3M58A 3CCJA 4QVDA 4EPCA 3CC7T 3CCLA 3J81E 4FT4A 2DPPB 3VUZA 1Q81U 4M78F 1JJ2S 4XTYA 2X4JA 2DVEA 2LTOA 1NE8A 1TH7A 1M1KU 3F70A 1X75C 2CS7A 3PIPA 4PLIA 5FLXE 2JN0A 3QDRB 3LGFA 1ZHIA 4MMKA 5IN1A 2XU8A 2LRQA 3CPWA 3QPHA 1YJ9A 2E6NA 1QP2A 3OYMA 3L2ZA 3CCQT 1D3BA 3MEWA 3RUXA 3VKIA 5GMKh 4HT8A 4E47A 1I5LA 2L8DA 2LCLA 3C95A 2KSSA 3N5BB 1VQKT 4M78C 5GAN2 4OB0B 2PQWA 4OP0A 5GANj 3GOXA 3V7CA 4QW2A 4F7UE 3CD6T 2VGMA 4C92D 3HHTB 1Y07A 3QXEB 4C0ZA 2FVUA 4L6V5 2QEXA 2NLUA 3DKMA 2CZ7B 2B8AA 3CBMA 3HP9A 1BI3A 3LGLA 5FRMA 4GLKA 4Q5WA 5J26A 4PJOC 3JRZA 4PNOA 3RKXA 2OAUA 5KCOA 1YJWA 4IKFA 1KG1A 4ZTJA 3META 1YJNA 3MHXA 4M78E 5D6XA 2LC4A 3HRSA 4A4GA 3OYJA 2RI3A 3OA6A 1MGQA 4M77F 5LJ3h 1BIAA 2CKKA 3HRUA 3JCMV 4NL2A 4BY6B 3S6WA 4ZN3A 1VQOA 1I4K1 4V2SA 3EFSA 4FL6A 5KE3A 3C94A 4PLLA 3CMET 1WJQA 2FYKA 3LX7A 2GCXA 4HKEA 3JB9J 3OYKA 3QO3A 2XIDA 5GAN6 4RCBA 1M4ZA 2EIFA 4C92G 4ELYC 5KH6A 2LQ8A 5GANd 2DTOA 4PJOF 2RI2A 4M7DD 2X35A 1VIFA 3G7ZA 2P0PA 4XTVA 5C6SA 3S3OA 4M7DC 1UGRB 5GANf 1M90C 3BFMA 4FSXA 2HQEA 5GAOp 5D6WA 4N4GA 4HCBA 5GAMe 5HK0A 1XTDA 3RKWA 5LJ5j 4ZGEB 1G3TA 5GAN4 3NTHA 1VQ6A 5CVIA 2EKOA 2M16A 2LVMA 4B9WA 1VQNT 2DZ9A 4OF1A 3T9NA 3OYIA 5L8RE 1M90U 1S72A 1BYMA 3JCMQ 2V8IA 2EYQA 4M7DF 3G4SA 1VQPA 4M7AD 3FC3A 1VQMA 2EQMA 1N27A 5FU6C 3JCMX 2RK2A 1Y7XA 2MMPA 2M9UA 2ZCFB 3M54A 4C8QD 4A4EA 3CBOA 1N9RA 3X26B 5A2QE 5LJ3g 3OSSC 3CCET 2FL7A 4LDWA 3SD4A 1FWZA 1Q7YU 1WGSA 4C92C 5C0MA 1P92A 2M0OA 3A8GB 3BDUA 5LJ3f 4Z02A 5CO7A 5HK3A 3CC4T 3I55T 2LDMA 4LD9K 4MDXA 2G3RA 4C8QB 2RJCA 3SWNA 5GAMj 3M55A 2RM4A 2WSEE 5GAOq 4C8QG 1LOJA 3CCRT 3HSBA 5GMKm 4IUUA 4M75E 5FRNA 3G6EA 3CXCS 3GNFB 4WF2A 1KQ1A 4F7UB 4FT2A 4DA4A 1IREB 2C06A 4ME7A 3I56A 3GIBA 1YIJT 4OB1B 1OYXA 4M7AC 3L42A 4J83A 4P5NA 3FB9A 3CCMA 1PSEA 3P8HA 3OYGA 1Q82C 1LJOA 4FM4B 3OYDA 5GMKl 4M78A 4KUIA 4PL6A 3OMCA 3INZA 3CBPA 3JB9D 5LJ5d 5EG2A 2LT4A 5GAN7 3URGA 5KE2A 5GAN5 5A0DA 2XD0A 5A0GA 1WNLA 2GF7A 2DIQA 2VV5A 4C5IA 1KQSA 3OS0A 3QYHB 1K8AC 2XDBA 3VJPA 3CC2A 5HY6A 5LJ3j 2BKDN 1QVGS 3CMAA 1VQ5A 2KQWA 4XAXB 3V8KA 4N0AC 1OZ3A 2EQJA 2D6FA 4A54A 5GAMf 3MEUA 4L59A 3JCMg 4BE2A 3V8LA 3MCAB 4FU6A 5GANe 1JBMA 2R5MA 4X34A 1O75A 1K73C 4C8QA 3ER0A 3L1AA 4EDUA 1UEBA 5CKDA 1N8RC 1KC8U 3JB9F 3VYHB 4J6XA 2PUOB 4DOVA 2E65A 3HFNA 2MWOA 4M7AG 3SFMA 5LJ5g 2QQBA 4PJOD 1H3ZA 5FU7B 2PVDB 1OI1A 3G71A 2GFAA 4HA8A 3TEEA 1JJ2A 4JDSA 4M77B 3GNGA 1HK9A 4X9CA 3QKJA 3ZEHA 4CRIA 1Y96B 5GMKj 3FLGA 3UDCA 4BI8B 2K57A 2EJGA 2K5IA 3SDZA 1BIBA 2R57A 3C4SA 5GAOn 1FX7A 1M1GA 2RI5A 4IUQA 3OYEA 1G3WA 4II1A 4M78D 4DOWA 3OYBA 3QHSA 2RB6A 3HL8A 5LJ3d 3DLMA 3CCUA 1KQ2A 1VQLT 3PT9A 2HD0A 1QVFS 3FEOA 3X28B 3TREA 4X9DA 1XQHA 4DQ2A 4OGEA 3SWNC 4B9XA 5GAOl 2K2VA 3QIIA 3QJ6A 1VQ7A 3ZFJA 3MP8A 4BE0A 3WVDB 4RG2A 4C0GA 3CEYA 3JCMd 1FXXA 3J80E 3CC7A 4LDVA 3LH0A 4XQ3A 4LDXA 4PJOB 2XI9A 1M1FA 2CZ1B 2JZ2A 4OVAA 2QQSA 4J6YA 5IT9E 1KD1C 3OB9A 2RA2A 1Q86U 1NJIU 1ZQ1A 5LJ5h 4C0DC 4LDYA 2QI2A 5GAOr 3JB9H 3KBGA 1G5VA 3OS2A 3WVEB 4A53A 2ZZDA 1YJ9T 2CGHA 5CKHA 3CCQA 3X24B 3CCSA 3LWHA 3JCMW 4M75C 4M78B 4C0DB 4E7LA 2QTXA 5LJ5e 2EJFA 2H3JA 5GAOm 1WPYA 2IVWA 4ELZC 3M5AA 4JS4A 4F7UA 1I81A 4UC4A 4EMKC 2OTLA 4M75A 3CD6A 1NJIC 3OYCA 1U1TA 4M77C 3RIRA 4E7IA 1U8RA 2ZPIB 5A0LA 1WQ7A 3BY7A 2XDDA 5FU7C 2E5QA 2QEXT 1Q81C 2EJ9A 4BI4A 4C5GA 2YLCA 3SWNB 2XG8D 3QJYA 4XU1A 2DJZA 1XNIA 2QQ9A 5GAMd 1K73U 1V29B 3ASKA 5DM7R 2E6ZA 5FROA 2O4XA 1YCYA 1UGPB 1YJWT 4JRPA 2KMTA 1YHQT 4M75D 2XICA 1DJ7B 5J3BA 3CPWS 2QA4A 1GXIE 1M9SA 1OZ2A 3A5ZB 3PNWC 3OBWA 5I2MA 5J39A 4C92B 1R8OB 2QXFA 2GFUA 2DAQA 4XTZA 1VQOT 1VIEA 2CZ6B 1MHNA 2XDPA 2I2LA 1K8AU 2OTJT 4M75G 1N9SA 4JLIA 4J8OA 4M75B 5CCAA 4FIBA 4QQGA 4EMHA 4E7KA 4C5EA 1YI2T 4NOYA 1VQ4A 1WQWA 3TCJA 4XTUA 1SSFA 2A3LA 4E7HA 3E9FA 3GF5A 3RESA 1Q82U 2MWPA 2KK4A 1KD1U 2KY9A 2P0QA 4NS5A 2V8KA 5LJ3e 2LX9A 2RJEA 4CI0C 1QVFA 3CXCA 1VQ6T 2ZPFB 4JRQA 1VQNA 3J7AF 1M8VA 4PKCC 5KCHA 1NPRA 4M77E 2K5FA 4M7DG 4HCZA 4M7DA 4C92A 2FB7A 4NL3A 4BD3A 3G4ST 4RKUE 1WJSA 2K4YA 3M4YA 3P8BB 2EWNA 4RCCA 5CQYA 4C5HA 2DEQA 3CCVA 3A8HB 3NTIA 1O9SA 3JCMP 4C92E 4BI3A 2LQKA 5DLQE 2R5AA 2RK1A 1VQ9T 1VQ8T 4M7AF 4PJOE 3CC4A 3LYIA 4BDYA 2CZ0B 2RO0A 2DIGA 2DD5A 2JVVA 4KT0E 1JB0E 2Y90A 3CCRA 4M7AB 4MZMA 2MF2A 1YITA 3VUBA 2JNGA 3DLLA 2JOYA 5LJ5f 4BUGA 4A4HA 3CCJT 4M7DE 3JAME 4M77A 3CCLT 1IZ6A 2E1HA 2K5LA 3MEAA 4OGCA 3FDRA 1BI1A 2WSFE 4O5VA 5AYFA 1G3YA 2VYTA 1S72T 3Q1JA 1D3BB 3VU3C 1B34A 3L2WA 4JRKA 1PSFA 1RI0A 2DK3A 2KDSA 3FJPA 5GAMh 2JUFA 1W2BA 5GAN8 5GAMg 3E9GA 3OYYA 3QYGB 4N4HA 5M9OA 3BW1A 2E10A 4M7DB 2RD1A 3OYNA 3TU4K 2ZGWA 2RHXA 1VQKA 3CC2T 2L5QA 3V7RA 3PMIA 2HAXA 2RH2A 2Y4YA 4IUPA 5D6YA 5I2SA 3CMAT 4A4FA 2KAFA 1EIFA 1NZ9A 3HKSA 3L2QA 2P4TA 1QVGA 3QSUA 3M4GA 1M1KC 2GQVA 3FRNA 4M7AE 1JRIA 4J7IA 4C8QF 4XTXA 1X01A 4F7UG 4C8QE 3EAEA 1BI0A 2XKOC 3EFRA 3HRTA 2DXTA 4OMFB 2HBPA 1Y96A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C0D C;  5FU6 B;  4C0D B;  4BY6 B;  5FU7 B;  4C0G A;  4BY6 C;  5FU7 C;  4C0F A;  5FU6 C; 
#chains in the Genus database with same CATH topology
 2EAY A;  1VUB A;  2R58 A;  1YJN T;  1PWT A;  4JJN K;  3JCM e;  1D0X A;  1KQS P;  2CYZ B;  4YTL A;  2HKN A;  5DY9 A;  2KXC A;  1WX6 A;  2ED0 A;  1QMC A;  3SEM A;  4F14 A;  1U5S A;  2RHY A;  4ZTF A;  2CSQ A;  2RMO A;  3CCU T;  1MNE A;  1VQL A;  1Q86 C;  2X4W A;  3QUI A;  2BUD A;  4PJO G;  2NUP A;  3LLR A;  1WHH A;  3H6Z A;  2ZPB B;  2X4Y A;  2EBP A;  3HPW A;  4EMG A;  2PU9 B;  2VUB A;  1HXD A;  5GMK e;  2EGC A;  5GAN h;  3G1J A;  2DTI A;  3C12 A;  3CCE A;  1U06 A;  4A4K A;  2O01 E;  3X20 B;  2A7Y A;  4DBQ A;  3MEV A;  2PVG B;  1G3S A;  4FSS A;  3GLX A;  4KUD K;  2AIR B;  1YBY A;  4A63 B;  2RQV A;  2HNI A;  3JB9 G;  3DB3 A;  2VXF A;  1WLP B;  1Y71 A;  4OB3 B;  1B34 B;  1YIJ A;  3A8O B;  1TSF A;  3M53 A;  3S3N A;  1PHT A;  3RMS A;  2MOX A;  4ZN1 A;  4C0F A;  2JW4 A;  4EMK A;  3DB4 A;  3V8J A;  3GBQ A;  1Q95 G;  2VVK A;  3GP8 A;  2AT1 B;  2RHZ A;  2QQA A;  3HFO A;  4PFP A;  4AT1 B;  2DD4 A;  3BDL A;  1ZUK A;  2YLB A;  2FO0 A;  3E1S A;  1D0Z A;  5ECA A;  4RG8 A;  3LW5 E;  1JU5 C;  2DYB A;  2E3I A;  2CH4 A;  1NPP A;  3QG1 A;  5CQX A;  3JCM h;  1UB4 A;  2Y4X A;  4ZGD B;  4J9D A;  3JCM f;  4ATO A;  1I1J A;  4J5Y A;  1QVP A;  4FCY A;  5CAI A;  3FIF A;  4JLG A;  4MZT A;  4ZGJ B;  2DXU A;  4O6J A;  1V76 A;  1VQ9 A;  5I11 A;  2RQU A;  1W1F A;  4TVR A;  1ACM B;  4XU3 A;  2DZC A;  1K9M U;  1YIT T;  2KYM A;  3UWN A;  2RHU A;  2EQK A;  4QVZ A;  3M58 A;  4QVD A;  1YP5 A;  3J81 E;  1JJ2 S;  2QDL A;  1RAI B;  2CS7 A;  1PRM C;  4PLI A;  5FLX E;  4DBH A;  3QDR B;  3LGF A;  1ZHI A;  2XU8 A;  3CPW A;  1VQ9 Q;  2KBT A;  1D3B A;  3VKI A;  3RUX A;  5GMK h;  1YIT Q;  3N5B B;  2IPO B;  2LNH B;  2FPF A;  3CD6 T;  2VGM A;  4C92 D;  3EG0 A;  2KNB B;  2HSP A;  2QEX A;  2NLU A;  4ZNX A;  1OX9 A;  1SRL A;  1BI3 A;  5J26 A;  1BBZ A;  2C0O A;  4GLM A;  2OAU A;  5KCO A;  1MMN A;  2JJ9 A;  4IKF A;  4QT7 A;  3MET A;  5D6X A;  3OA6 A;  4A4G A;  3OYJ A;  5LJ3 h;  1GCQ C;  1NM7 A;  3S6W A;  3EFS A;  4JZ3 A;  4PLL A;  3CQT A;  3OYK A;  1Q7Y R;  4RCB A;  1K1Z A;  4ELY C;  5KH6 A;  2VKN A;  2KRO A;  5C6S A;  5GAN f;  3PE0 A;  4JJC A;  2D8J A;  1U3O A;  4KGZ B;  1M27 C;  1WHK A;  4ZGE B;  1M90 R;  3NTH A;  1VQ6 A;  2EKO A;  5L8R E;  1M90 U;  1S72 A;  3JCM Q;  2EYQ A;  4M7D F;  3FC3 A;  1VQM A;  2EQM A;  2RK2 A;  2CRE A;  3M54 A;  3X26 B;  5IHN A;  4RTY A;  1GBR A;  2YRD A;  3SD4 A;  1WGS A;  2XMF A;  5LJ3 f;  5CO7 A;  3CC4 T;  4MDX A;  4C8Q B;  1M3A A;  3M55 A;  2RM4 A;  1LOJ A;  3CCR T;  1YWP A;  3CXC S;  2MYS A;  3GNF B;  3VS0 A;  4FT2 A;  4DA4 A;  3I56 A;  1VQP Q;  1YIJ T;  1UEC A;  4P5N A;  1PSE A;  1LJO A;  4FM4 B;  3HTR A;  4RUG A;  5GMK l;  4B6M A;  4KUI A;  5AT1 B;  5GAN 5;  4J9H A;  1WNL A;  2GF7 A;  2DIQ A;  2VV5 A;  1GCQ A;  1QWE A;  2DEU A;  3V8K A;  1OZ3 A;  3JCM g;  2M0Y A;  4FU6 A;  5GAN e;  1JBM A;  4C8Q A;  2QYZ A;  3ER0 A;  3L1A A;  5CKD A;  5IXF A;  1KC8 U;  3JB9 F;  3VYH B;  2MWO A;  2YRC A;  2LMJ A;  3GNG A;  3QKJ A;  4CRI A;  1BIB A;  3EGX B;  2LJ0 A;  3C4S A;  1D0Y A;  3OYE A;  4PJL A;  2KEA A;  4DOW A;  3QHS A;  5LJ3 d;  3DLM A;  1KQ2 A;  2HD0 A;  2NUP B;  2L3Q A;  1XQH A;  1TXQ A;  2MPX C;  2K2V A;  3QJ6 A;  2F2V A;  1WDX A;  2DL3 A;  3A1P A;  4C0G A;  3CEY A;  4LDX A;  2RA2 A;  4LDY A;  5KYW A;  2FG0 A;  2HBW A;  5CKH A;  8AT1 B;  1FYN A;  4M75 C;  4E7L A;  5GAO m;  4ELZ C;  1NEB A;  3CCJ Q;  2CP6 A;  4JS4 A;  1I81 A;  3THK A;  3CD6 A;  1U1T A;  4M77 C;  3RIR A;  1CKA A;  5FU7 C;  2QEX T;  1ZSG A;  4C5G A;  2XG8 D;  1IGU A;  2DJZ A;  1K73 U;  1TUC A;  2LZ6 B;  3ASK A;  2O4X A;  3AT1 B;  1YCY A;  1LPL A;  4Z8A A;  2XIC A;  1DJ7 B;  5J3B A;  1BCO A;  1BCM A;  2QA4 A;  2PZ1 A;  2EYZ A;  5I2M A;  5J39 A;  2QXF A;  1IXD A;  1VIE A;  2CP3 A;  2LX7 A;  2XDP A;  2O9S A;  5L23 A;  4J8O A;  4C5E A;  3BE3 A;  4FYW B;  1VQ4 A;  4WTO B;  2QK0 A;  3GF5 A;  2JMC A;  1UUE A;  2DL5 A;  1KD1 U;  4J9I A;  1VQ6 T;  2VB6 A;  3CCR Q;  4PKC C;  1NPR A;  4ORZ A;  2FB7 A;  4NL3 A;  3G4S T;  4RKU E;  1WJS A;  2COZ A;  3P8B B;  5CQY A;  4C5H A;  3CCV A;  1R0B G;  4BI3 A;  2LQK A;  5DLQ E;  2R5A A;  2RK1 A;  2DNU A;  3CC4 A;  1JO8 A;  2RO0 A;  4KT0 E;  1D09 B;  1N5Z A;  1YJ9 Q;  1VQK Q;  1PRL C;  3CCR A;  1VQN Q;  2I0N A;  3G4S Q;  4BUG A;  1WXU A;  1C0M A;  3TVT A;  2YWW A;  2VYT A;  1HSQ A;  4PJM A;  1D3B B;  2X51 A;  2DK3 A;  1T3L A;  3FJP A;  1YWO A;  3OYY A;  2E10 A;  2D1X A;  2A36 A;  1MUZ A;  1VQK A;  3CME Q;  2Y4Y A;  5I2S A;  3I56 Q;  1X2Q A;  2KAF A;  1NZ9 A;  2P4T A;  1M3C A;  3M0Q A;  2EGA A;  1JRI A;  3M0P A;  4F7U G;  3UA6 A;  4C8Q E;  1KJW A;  1VYV A;  2HBP A;  3AHU A;  2NUZ A;  3PFS A;  3VYG A;  4BE1 A;  4E2F B;  1MMA A;  2P0K A;  3R6O A;  2HL5 C;  2F1L A;  1WZO A;  4BY6 C;  1KQS S;  3GPL A;  1I5O B;  3PVL A;  2MAM A;  1YN8 A;  1N6A A;  4J6W A;  3ULR B;  2VWF A;  3JV3 A;  3M59 A;  4FYV B;  1KC8 C;  2PUK B;  2EQU A;  5GAN 3;  4XK8 E;  1ZSZ A;  2DA9 A;  5CKF A;  3OYA A;  3G6E Q;  4HT9 A;  3P8D A;  2YUN A;  4AG2 C;  5IH2 A;  5CKB A;  4AFZ C;  2W10 A;  5GAN g;  1AZG B;  3CCM Q;  4HCC A;  1QW1 A;  4M77 D;  3PIO A;  1NG2 A;  2KE9 A;  1W2B S;  3I55 A;  1UE9 A;  5I22 A;  3A8M B;  2PNI A;  4D6W A;  2J6F A;  2LCS A;  1OX8 A;  3MP6 A;  2AHJ B;  1ZLM A;  2ED1 A;  1JEG A;  3G6E T;  1QP3 A;  2GBQ A;  3V7S A;  2RQT A;  2GQI A;  2J6K A;  3O5Z A;  3LWI A;  4BDZ A;  2XK0 A;  2WSC E;  2HQX A;  4BB7 A;  2MI6 A;  3CCM T;  1K9M C;  2K7A A;  2BIV A;  2PVO B;  3JCM J;  4Z89 A;  2XHC A;  3ZBD A;  2QA4 T;  4OB2 B;  1UGQ B;  3VS1 A;  3M0R A;  2D9T A;  3H0H A;  1TOV A;  2ZPG B;  1HJD A;  3OQ5 A;  1VQ5 T;  3OY9 A;  2WAC A;  1RLQ C;  4AMC A;  2EYY A;  1SPK A;  1N8R U;  2E64 A;  3A8L B;  5I21 A;  4N0A A;  1QCO A;  3CCU Q;  2L89 A;  1W4S A;  1SRM A;  3H8Z A;  4EIK A;  2ABL A;  2F5K A;  4LDU A;  2BTT A;  4JZ4 A;  3OSV A;  1XOV A;  2EKH A;  3CCV T;  2YUO A;  1KIK A;  3RKY A;  2YRV A;  3SHW A;  2YSQ A;  3NFC A;  3OW2 P;  4RMO A;  4PFO A;  3KFV A;  2F2W A;  2NWM A;  4QVC A;  4QQ6 A;  1VQ8 A;  2JS0 A;  1C6V X;  1LCK A;  4XU0 A;  2RJF A;  4XTW A;  1GBQ A;  3OW2 S;  2E41 A;  2X4X A;  4IUV A;  2JTF A;  3EGD B;  4EPC A;  3CCL A;  4FT4 A;  2X4J A;  1NE8 A;  1TH7 A;  1X75 C;  3PIP A;  3PVQ A;  1QWF A;  4MMK A;  1JJ2 P;  2E6N A;  1QP2 A;  1AEY A;  5FWC A;  3C95 A;  2AKK A;  4M78 C;  2PQW A;  3V7C A;  3NGP A;  2DET A;  2AZS A;  2FVU A;  1VYU A;  4FW2 A;  3DKM A;  2CP2 A;  3CBM A;  5FRM A;  1TU0 B;  4GLK A;  4PJO C;  1BK2 A;  5GJW B;  4ZTJ A;  2GTJ A;  4E7S A;  3MHX A;  4M78 E;  3HRS A;  1MGQ A;  2CKK A;  3HRU A;  5KYN A;  1VQO A;  1NEG A;  5KE3 A;  1C1A A;  1WJQ A;  2EYW A;  2GCX A;  2KRN A;  3JB9 J;  1TTH B;  3QO3 A;  2XID A;  2FPE A;  4PJO F;  2ROT A;  2RI2 A;  2X35 A;  3G7Z A;  1UGR B;  1BU1 A;  1G8X A;  5D6W A;  1FMK A;  1G3T A;  3C0C A;  2SRC A;  4B9W A;  2RF0 A;  1WHJ A;  4OF1 A;  1D1A A;  1AWJ A;  4J9B A;  1VQO Q;  4HVU A;  1PKT A;  5FU6 C;  2ZCF B;  1PG5 B;  1ABO A;  4A4E A;  3CBO A;  2HL3 A;  1W70 A;  2FL7 A;  1FWZ A;  4C92 C;  5C0M A;  1NLO C;  4Z02 A;  1WFW A;  2RJC A;  2WSE E;  3I9Q A;  4OMP A;  2EPD A;  3HSB A;  1SEM A;  1VQ5 Q;  1KQ1 A;  4F7U B;  4ME7 A;  3GIB A;  4M7A C;  1K9M R;  4RTU A;  3CCM A;  3P8H A;  1Q82 C;  1IRX A;  2QAS A;  3OYD A;  3E2U A;  3QDF A;  5EC7 A;  3EH2 A;  4KH1 B;  2LT4 A;  5GAN 7;  3M0U A;  2XD0 A;  4C5I A;  1K8A C;  2XDB A;  3VJP A;  3CC2 A;  5HY6 A;  5LJ3 j;  3CMA A;  2KQW A;  4CC4 B;  4PFZ A;  1K9A A;  2ECZ A;  2BE9 B;  1PC0 A;  1O75 A;  1N8R C;  2X3W D;  4M7A G;  1R77 A;  5LJ5 g;  2QQB A;  5FU7 B;  2PVD B;  2GFA A;  3TEE A;  1JJ2 A;  1Y0M A;  4JDS A;  5GJV B;  3D7S B;  3ZEH A;  5GMK j;  2HCK A;  3FLG A;  4WCI A;  3UDC A;  4BI8 B;  3CMA Q;  2EJG A;  2R57 A;  1G3W A;  4II1 A;  3EFO B;  4M78 D;  3OYB A;  2HEQ A;  1KFZ A;  3FEO A;  4X9D A;  2FRW A;  4DQ2 A;  3SWN C;  2KT1 A;  2COY A;  4OGE A;  3QII A;  3A98 A;  2DIL A;  4BE0 A;  1UTI A;  4LDV A;  2COW A;  2XI9 A;  1M1F A;  4OVA A;  2QQS A;  4J6Y A;  1KD1 C;  1M3B A;  3OB9 A;  1PM3 A;  1XJW B;  1NJI U;  4C0D C;  2OX7 A;  1YIJ Q;  1A0N B;  2RQR A;  5GAO r;  2O9V A;  3KBG A;  4LE9 A;  1V1C A;  2ZZD A;  1IGQ A;  2CGH A;  4A53 A;  3CCQ A;  2MCN A;  3X24 B;  3LWH A;  1FMW A;  5LJ5 e;  2CP0 A;  1WPY A;  4F17 A;  3M5A A;  2L3P A;  4UC4 A;  4EMK C;  2HKQ B;  3CCL Q;  3OYC A;  2OTJ Q;  1WQ7 A;  1Q81 C;  4J9C A;  4BI4 A;  7AT1 B;  2K3B A;  5GAM d;  2GTO A;  1X69 A;  1V29 B;  5FRO A;  1WI7 A;  1UGP B;  1GXI E;  2CH4 W;  2CT3 A;  1VQO T;  4D8D A;  2DAQ A;  2CZ6 B;  1MHN A;  2I2L A;  1K8A U;  2OTJ T;  1N9S A;  4JLI A;  5CCA A;  2OTL Q;  4E7K A;  4EMH A;  1YI2 T;  4NOY A;  1M2V A;  2DMO A;  3E9F A;  2DE0 X;  3RES A;  1J3T A;  1ZA1 B;  2MWP A;  2P0Q A;  4NS5 A;  5LJ3 e;  1QVF A;  2LX9 A;  4CI0 C;  3CXC A;  1M8V A;  2ZPF B;  4M77 E;  4M7D G;  4M7D A;  4BD3 A;  3H9N A;  2QGG A;  1Z9Z A;  2DEQ A;  1EX4 A;  1G83 A;  3NTI A;  3JCM P;  2EGE A;  5D7U A;  3EGU A;  1VQ9 T;  3RDV A;  2CZ0 B;  4MZM A;  1YIT A;  1AWX A;  2JNG A;  2JOY A;  1T0J A;  3CCJ T;  3MEA A;  4OGC A;  1BI1 A;  1HD3 A;  3Q1J A;  3VU3 C;  4JRK A;  1RI0 A;  2KDS A;  3EG1 A;  2JUF A;  1LVK A;  5GAN 8;  3QYG B;  4N4H A;  1CKB A;  4CC2 A;  1B7T A;  2ZGW A;  4LXC A;  3CC2 T;  3V7R A;  2J7I A;  1RAH B;  2HAX A;  3CMA T;  2RPN A;  1EIF A;  3HKS A;  3VS7 A;  2K2M A;  1QVG A;  4RTW A;  3M4G A;  1AT1 B;  1AVZ C;  2CP7 A;  1M1K C;  2GQV A;  4M7A E;  2M02 A;  5KYU B;  1X01 A;  4Y92 A;  1BI0 A;  1SHG A;  3EFR A;  3HRT A;  2DXT A;  4OMF B;  1GRI A;  1Y96 A;  5DLO A;  1UJ0 A;  1I8F A;  3QBY A;  5CIU A;  1VQ6 Q;  1LNX A;  2MIO A;  3CC2 Q;  4J9G A;  3REA B;  1W2B P;  2A0F B;  3UPU A;  2YHT A;  2VGN A;  1S72 Q;  4F04 B;  2EYX A;  3RMQ A;  4CC7 A;  3RER A;  1KHC A;  1VQM Q;  1AHJ B;  2DJQ A;  1CSK A;  3M57 A;  4MZP A;  5FU6 B;  3NHN A;  3CPW P;  2DRK A;  3TSZ A;  1ZBX A;  3JSC A;  1UG1 A;  4M75 F;  3OYF A;  2DKG A;  3X25 B;  1S72 T;  1KD1 R;  2RJD A;  1TUD A;  1VQP T;  1VQM T;  1I0C A;  2DXB A;  3EG3 A;  4R55 A;  2QQR A;  4R56 A;  3QZ5 B;  2DLP A;  4JUV A;  3E19 A;  2VC8 A;  3L2V A;  5IAY A;  2OTL T;  4DBR A;  1YI2 Q;  4RTX A;  3I56 T;  1MV3 A;  1RAD B;  1UDL A;  2EFI A;  4KH0 B;  1HYO A;  1W6X A;  1UGS B;  3EGX A;  1YHQ A;  1G2B A;  2DL8 A;  4JPB W;  1WJR A;  2F5T X;  3OMG A;  4MDW A;  2CUD A;  2OTJ A;  3OYL A;  1YI2 A;  4L5G A;  3VS5 A;  3R6N A;  2KVQ G;  3I5R A;  2A08 A;  1X6G A;  3OBY A;  2DO3 A;  4IUT A;  4PJO A;  4XU2 A;  3LH5 A;  2VXE A;  1WXT A;  1KC8 R;  2M1H A;  4DEY A;  1OUL A;  3M0S A;  4VUB A;  3NTK A;  5HKC A;  4KUL A;  3PGG A;  3UA7 A;  2JT4 A;  2K9G A;  2EVR A;  3CC7 Q;  1U1S A;  2NUT A;  2X9H A;  1X6B A;  4QQD A;  4HVW A;  2FZK B;  5GMK i;  2RQW A;  4BAC A;  2JTM A;  1X6O A;  1IB8 A;  1RAC B;  3U23 A;  1BB9 A;  2H3E B;  4PJN A;  1QCN A;  5CK9 A;  1MMG A;  3ME9 A;  2L3R A;  3CCJ A;  3OS5 A;  2ZPH B;  3CC7 T;  2QEX Q;  1JXO A;  2V1R A;  2DPP B;  3VUZ A;  4M78 F;  4XTY A;  1M1K U;  3F70 A;  3MKD A;  1NLP C;  3QPH A;  1OQK A;  5FW9 A;  4E47 A;  1I5L A;  2LCL A;  2QA4 Q;  2KSS A;  1PNJ A;  4QW2 A;  2LQW A;  3HHT B;  3QXE B;  4L6V 5;  2CZ7 B;  3HP9 A;  1K73 R;  4Q5W A;  1Y57 A;  4PNO A;  3RKX A;  1YJW A;  1KG1 A;  3EG2 A;  1YJN A;  1B3Q A;  3JCM V;  4M77 F;  1BIA A;  4NL2 A;  4ZN3 A;  4V2S A;  4FL6 A;  3C94 A;  2PTK A;  2FYK A;  3LX7 A;  6AT1 B;  2EIF A;  4C92 G;  2LQ8 A;  5GAN d;  4RTT A;  2DTO A;  4M7D D;  4LN2 A;  2DER A;  2HQE A;  3RKW A;  5CVI A;  1VQN T;  3T9N A;  3OYI A;  2V8I A;  1AWW A;  3G4S A;  1VQP A;  1TUG B;  2MMP A;  4C8Q D;  5LJ3 g;  4LUD A;  3OSS C;  3CCE T;  4LDW A;  1VQL Q;  1P92 A;  2E5K A;  3BDU A;  5HK3 A;  4LD9 K;  3SWN A;  5GAM j;  4HVV A;  4IUU A;  9ATC B;  4ANJ A;  2NYS A;  1IRE B;  1Q81 R;  2DL4 A;  4OB1 B;  3L42 A;  2RN8 A;  4KGX B;  3OYG A;  4K11 A;  5KYX A;  2BE7 D;  2LJ3 A;  1M8M A;  1NBE B;  4E6R A;  4M78 A;  3EHR A;  2FPD A;  4PL6 A;  5EG2 A;  1QVF P;  5KYX B;  1ZA2 B;  2A37 A;  1SG5 A;  1KQS A;  3OS0 A;  3QYH B;  1B07 A;  1IO6 A;  1QVG S;  1RUW A;  4A54 A;  2BZX A;  1K4U S;  4BE2 A;  3V8L A;  4IIM A;  1JQQ A;  1UEB A;  4J6X A;  2PUO B;  1QVG P;  2D0N A;  1YFN A;  3SFM A;  1H3Z A;  3G71 A;  4M77 B;  1HK9 A;  4LUE A;  1ZSZ B;  2L3S A;  2K57 A;  2MK5 A;  1WHL A;  1RAA B;  2D8H A;  2RI5 A;  1AD5 A;  2A28 A;  3PT9 A;  3X28 B;  4OMQ A;  5GAO l;  4B9X A;  4OMN A;  1VQ7 A;  3MP8 A;  3JCM d;  4RG2 A;  3J80 E;  3G71 Q;  3CC7 A;  4J9F A;  4XQ3 A;  1Q82 R;  2CZ1 B;  2JZ2 A;  4HCK A;  4OMM A;  1Q86 U;  2KYB A;  1ZQ1 A;  5FWB A;  1UHF A;  1X27 A;  1G5V A;  3WVE B;  1QKW A;  4ESR A;  3H41 A;  1K8A R;  3H0I A;  3CCS A;  3JCM W;  2QTX A;  2IVW A;  2DF6 A;  1GFC A;  4M75 A;  1NYF A;  1VQ7 Q;  1U8R A;  2ZPI B;  5A0L A;  3BY7 A;  2DRM A;  2XDD A;  2E5Q A;  1K76 A;  1RAF B;  2M51 A;  2DFU A;  2GNC A;  3SWN B;  3QJY A;  3EHQ A;  2HMA A;  2QQ9 A;  1AZE A;  5DM7 R;  1YJW T;  4M75 D;  1OZ2 A;  3A5Z B;  3PNW C;  4C92 B;  2CUB A;  2KGT A;  1WYX A;  3CCV Q;  4FIB A;  1TS9 A;  4QQG A;  4OMO A;  1M30 A;  1WQW A;  1SSF A;  2A3L A;  1RAE B;  1KK7 A;  1YJW Q;  1ZUU A;  1Q82 U;  1AOJ A;  2KK4 A;  1YJN Q;  2KY9 A;  2RJE A;  1VQN A;  3QWX X;  1YNZ A;  2K5F A;  2BZ8 A;  4FW1 A;  4HCZ A;  5KYW B;  4C92 A;  4KRT A;  3M4Y A;  2EWN A;  3A8H B;  1O9S A;  2Z0W A;  1VQ8 T;  2RNA A;  4AFQ C;  4PJO E;  1RAG B;  4BDY A;  3ZL7 C;  2DIG A;  1ZX6 A;  2Y90 A;  4M7A B;  2MF2 A;  2BZY A;  3EH1 A;  3VUB A;  2DL7 A;  4M4Z A;  3CCL T;  1IZ6 A;  4X1V A;  3FDR A;  2WSF E;  4O5V A;  5AYF A;  1Z9Q A;  1IHV A;  1E6H A;  1MND A;  1B34 A;  1PSF A;  5GAM h;  1W2B A;  3MPU B;  3E9G A;  4AFU C;  5M9O A;  3BW1 A;  3CC4 Q;  3TU4 K;  2DM1 A;  5IHK A;  2K79 A;  3PMI A;  2X3X D;  4IUP A;  5D6Y A;  3L2Q A;  1WHM A;  3QSU A;  2JM8 A;  5KYY A;  3FRN A;  4J7I A;  4XTX A;  3NMZ C;  1H3H A;  3EAE A;  2XKO C;  2CT4 A;  1M5Q 1;  3G71 T;  2HZY A;  2IG0 A;  4KBM B;  2LT1 A;  3CME A;  2E3H A;  2DYI A;  4C8Q C;  1OPL A;  4KGV B;  4AFS C;  1QCF A;  2LCC A;  2E70 A;  3WXM B;  4JS5 A;  4DBF A;  1BKB A;  2KI7 A;  4E7J A;  3VV0 A;  1JXM A;  4AG1 C;  3TQ7 P;  2L0A A;  1H64 1;  1VQ7 T;  5LL6 S;  2K3Y A;  1KHI A;  1VA7 A;  4JRI A;  3KUF A;  3H0F A;  4IUR A;  4GY5 A;  1SKU B;  4M78 G;  3CCS T;  4M7A A;  3REB B;  2KRM A;  4F16 A;  2GGR A;  1UJY A;  2K3X A;  3CXC P;  3O8V A;  3KXT A;  2FZG B;  3M56 A;  2DTH A;  3OW2 A;  2E12 A;  1QKX A;  4C92 F;  5CR2 A;  1D1B A;  2V1Q A;  1K0S A;  2OAW A;  3PTA A;  1VOM A;  3OYH A;  3JB9 I;  3CCS Q;  3PMT A;  4M77 G;  2V8J A;  1RL2 A;  2C0T A;  2P4R A;  1BI2 A;  4PK4 A;  2JXB A;  3CD6 Q;  4EMK B;  2JS2 A;  2LNV A;  3M9Q A;  5CKE A;  1H92 A;  2ESW A;  1VQ4 T;  2CP5 A;  2QDY B;  3L2R A;  4Y91 A;  1KSW A;  3CPF A;  1Q86 R;  3QZ9 B;  1M1K R;  1VQ8 Q;  1K0X A;  2D0Q B;  2O4X B;  1E6G A;  2QG9 B;  1VYT A;  4LD6 A;  4RTZ A;  2ZPE B;  3SB2 A;  2K6D A;  1M90 C;  1OU8 A;  2DBM A;  4IIO A;  2B86 A;  1N8R R;  1I07 A;  3JCM c;  2F69 A;  2YUP A;  2FHD A;  3S3M A;  1OU9 A;  2RHI A;  1VQ4 Q;  1WA7 A;  4N4I A;  3FJ5 A;  4F7U F;  2H8H A;  3L2U A;  4MML A;  1Q7Y C;  3VS2 A;  3MO8 A;  3UT1 A;  4Y28 E;  3MP1 A;  2NUT B;  3JCM b;  2DXC A;  4J7F A;  3OS1 A;  1GFD A;  1UGV A;  1WXB A;  2OI3 A;  1T0H A;  1Q81 U;  2DVE A;  2LTO A;  2JN0 A;  3VS4 A;  5IN1 A;  2LRQ A;  1YJ9 A;  3OYM A;  3CCQ T;  3L2Z A;  3QWY A;  2J05 A;  2JTE A;  3MEW A;  4HT8 A;  2FEI A;  2FZC B;  2L8D A;  2KXD A;  1VQK T;  1SSH A;  2AZV A;  2YT6 A;  5GAN 2;  4OB0 B;  4OP0 A;  5GAN j;  3GOX A;  2V26 A;  2EQI A;  2OJ2 A;  1RLP C;  4F7U E;  2E4H A;  3RNJ A;  1Y07 A;  4C0Z A;  3NPF A;  1PKS A;  1PCX A;  2B8A A;  4OML A;  3LGL A;  1ABQ A;  5IHI A;  3JRZ A;  5KYU A;  4E7Z A;  2J06 A;  2LC4 A;  5IT9 E;  2RI3 A;  4LNP A;  4BY6 B;  1I4K 1;  3CME T;  4HKE A;  3IQL A;  5GAN 6;  1M4Z A;  4CC3 A;  2O88 A;  1VIF A;  4XTV A;  2P0P A;  3S3O A;  4M7D C;  4FYX B;  3BFM A;  4FSX A;  2SEM A;  1ZSZ C;  5GAO p;  4N4G A;  4HCB A;  5GAM e;  5HK0 A;  1XTD A;  5LJ5 j;  5GAN 4;  1X2K A;  3UF4 A;  1M2V B;  2M16 A;  2LVM A;  2DZ9 A;  1BYM A;  4M7A D;  2YUQ A;  1N27 A;  3JCM X;  1Y7X A;  2M9U A;  1IHW A;  4J9E A;  2O31 A;  1N9R A;  5A2Q E;  3TSW A;  1Q7Y U;  1NYG A;  2M0O A;  3A8G B;  3I55 T;  2LDM A;  2QTV A;  2G3R A;  1YCS B;  2QAZ A;  4PJJ A;  5GAO q;  4C8Q G;  5GMK m;  4M75 E;  5FRN A;  3G6E A;  2KR3 A;  4WF2 A;  2C06 A;  1OYX A;  1X43 A;  1RI9 A;  4J83 A;  3FB9 A;  2F2X A;  2P84 A;  3I55 Q;  3JB9 D;  3OMC A;  3INZ A;  3CBP A;  5LJ5 d;  3URG A;  5KE2 A;  5A0D A;  5A0G A;  1RAB B;  1TG0 A;  2AK5 A;  5KYY B;  2KRS A;  1PD1 A;  4GBQ A;  4QKU A;  1M2O A;  2BKD N;  1VQ5 A;  2JMA A;  4XAX B;  4N0A C;  2EQJ A;  2D6F A;  5GAM f;  3MEU A;  3EGD A;  4L59 A;  1T3S A;  3MCA B;  1ZBJ A;  2R5M A;  4X34 A;  2ZAE A;  1K73 C;  2JM9 A;  4EDU A;  1WHG A;  1ZUY A;  4RTV A;  4DOV A;  2E65 A;  2VAS A;  3HFN A;  4R0K A;  2W0Z A;  4PJO D;  3M0T A;  1OI1 A;  4HA8 A;  4D8K A;  2AKL A;  4X9C A;  1E7O A;  1Y96 B;  2K5I A;  2DBK A;  3SDZ A;  3VRY A;  5GAO n;  1FX7 A;  1M1G A;  2O2O A;  4IUQ A;  2ENM A;  3CCQ Q;  2G6F X;  1SF9 A;  2RB6 A;  3HL8 A;  3CCU A;  3CCE Q;  1VQL T;  1H8K A;  1QVF S;  2ATC B;  2KT8 A;  3TRE A;  1S1N A;  5HCK A;  2J6O A;  1D1C A;  3ZFJ A;  2ROL A;  3WVD B;  1QQJ A;  1FXX A;  2HDA A;  2QGF B;  3I5S A;  3LH0 A;  3VRZ A;  4PJO B;  3EG9 B;  1UFF A;  1F1B B;  2HQH A;  1WIE A;  5LJ5 h;  1OPK A;  2QI2 A;  3JB9 H;  3OS2 A;  3EFO A;  1R0C B;  1YJ9 T;  1TWB A;  2CSI A;  2LJ1 A;  2L2P A;  1FMV A;  4M78 B;  4C0D B;  1YHQ Q;  2EJF A;  2H3J A;  2HSE B;  4F7U A;  2OTL A;  4DEX A;  1NJI C;  2YDL A;  4E7I A;  1NJI R;  2C0I A;  2DX1 A;  2EJ9 A;  2YLC A;  2LP5 A;  4XU1 A;  3VS6 A;  1XNI A;  1EFN A;  2FRY A;  2E6Z A;  4JJD A;  4JRP A;  2KMT A;  1YHQ T;  1PD0 A;  3CPW S;  1OOT A;  1M9S A;  3OBW A;  1UHC A;  4XTZ A;  1R8O B;  2GFU A;  1MV0 B;  4M75 G;  4M75 B;  3RBB B;  3TCJ A;  4XTU A;  4E7H A;  4FYY B;  1OV3 A;  1SHF A;  1AWO A;  2V8K A;  4JRQ A;  3J7A F;  4JJB A;  5KCH A;  1OEB A;  2K4Y A;  1GCP A;  4RCC A;  4Z88 A;  2DVJ A;  3EG9 A;  4C92 E;  4M7A F;  3LYI A;  2JVV A;  2DD5 A;  3MJX A;  1JB0 E;  3UAT A;  2YXY A;  2LQN A;  2CDT A;  3DLL A;  5LJ5 f;  4A4H A;  4M7D E;  3JAM E;  4M77 A;  2E1H A;  2K5L A;  1G3Y A;  2EW3 A;  2IIM A;  3L2W A;  5GAM g;  1MMD A;  4M7D B;  2RD1 A;  3OYN A;  4HXJ A;  2RHX A;  1QLY A;  2L5Q A;  2RH2 A;  3I35 A;  4A4F A;  3RR6 A;  1ARK A;  5IXB A;  1EZZ B;  4C8Q F;  3VS3 A;  1GL5 A;  8ATC B; 
#chains in the Genus database with same CATH homology
 2EAY A;  1VUB A;  5DLO A;  2R58 A;  1YJN T;  1I8F A;  3AHU A;  3QBY A;  5CIU A;  3VYG A;  3PFS A;  1LNX A;  1M5Q 1;  3JCM e;  3G71 T;  2IG0 A;  4KBM B;  4JJN K;  4BE1 A;  2CYZ B;  2P0K A;  2LT1 A;  3CME A;  3R6O A;  3UPU A;  2YHT A;  4YTL A;  2VGN A;  4C8Q C;  5DY9 A;  3RMQ A;  4BY6 C;  2LCC A;  3RER A;  1KHC A;  2E70 A;  3WXM B;  1KQS S;  3GPL A;  4JS5 A;  1AHJ B;  2RHY A;  4ZTF A;  1BKB A;  2MAM A;  3M57 A;  3CCU T;  4E7J A;  1N6A A;  1VQL A;  4J6W A;  4MZP A;  1Q86 C;  3VV0 A;  5FU6 B;  2X4W A;  3QUI A;  3M59 A;  2BUD A;  4PJO G;  1H64 1;  3LLR A;  3H6Z A;  1KC8 C;  1ZBX A;  3JSC A;  1VQ7 T;  5LL6 S;  2PUK B;  2X4Y A;  2ZPB B;  3HPW A;  4M75 F;  2DKG A;  3OYF A;  2EQU A;  2K3Y A;  3X25 B;  2RJD A;  4EMG A;  2PU9 B;  1KHI A;  4XK8 E;  5GAN 3;  5CKF A;  2VUB A;  1HXD A;  3OYA A;  5GMK e;  1VQP T;  4HT9 A;  1VQM T;  3P8D A;  2DXB A;  4R55 A;  5GAN h;  4JRI A;  3KUF A;  5CKB A;  2QQR A;  4R56 A;  2DTI A;  3QZ5 B;  3C12 A;  4IUR A;  5GAN g;  3CCE A;  4JUV A;  4A4K A;  4HCC A;  2O01 E;  3X20 B;  4GY5 A;  1QW1 A;  2A7Y A;  3E19 A;  4M77 D;  2VC8 A;  3PIO A;  3MEV A;  4M78 G;  3CCS T;  3L2V A;  1W2B S;  5IAY A;  3I55 A;  4M7A A;  2PVG B;  3A8M B;  4D6W A;  1G3S A;  4KUD K;  3GLX A;  1YBY A;  2K3X A;  3O8V A;  3MP6 A;  2AHJ B;  2HNI A;  2OTL T;  3KXT A;  3M56 A;  3G6E T;  1QP3 A;  2DTH A;  3V7S A;  3JB9 G;  3OW2 A;  2E12 A;  3DB3 A;  2VXF A;  1Y71 A;  4OB3 B;  3I56 T;  1B34 B;  4C92 F;  5CR2 A;  3A8O B;  2XK0 A;  2WSC E;  2HQX A;  3LWI A;  4BDZ A;  1YIJ A;  4BB7 A;  2MI6 A;  3M53 A;  3S3N A;  3CCM T;  3PTA A;  2EFI A;  3RMS A;  3OYH A;  1K9M C;  4ZN1 A;  2BIV A;  2PVO B;  4C0F A;  3JB9 I;  4EMK A;  3JCM J;  3PMT A;  3DB4 A;  1UGS B;  4M77 G;  2XHC A;  2V8J A;  1YHQ A;  3ZBD A;  2QA4 T;  3V8J A;  4OB2 B;  1UGQ B;  1RL2 A;  1BI2 A;  1WJR A;  2F5T X;  3OMG A;  4MDW A;  3GP8 A;  3HFO A;  2D9T A;  2QQA A;  2RHZ A;  2LNV A;  3M9Q A;  4EMK B;  2OTJ A;  3OYL A;  2ZPG B;  3OQ5 A;  5CKE A;  2DD4 A;  3BDL A;  3OY9 A;  1VQ5 T;  1YI2 A;  4L5G A;  2WAC A;  1VQ4 T;  2QDY B;  2YLB A;  3L2R A;  4Y91 A;  3CPF A;  2KVQ G;  3E1S A;  3QZ9 B;  3OBY A;  2D0Q B;  2DO3 A;  2O4X B;  4IUT A;  4RG8 A;  4XU2 A;  4PJO A;  3LW5 E;  2VXE A;  4LD6 A;  2M1H A;  1NPP A;  2ZPE B;  3QG1 A;  5CQX A;  3SB2 A;  3JCM h;  1N8R U;  1UB4 A;  2E64 A;  2Y4X A;  3A8L B;  4N0A A;  4ZGD B;  5I21 A;  4VUB A;  2L89 A;  3NTK A;  1W4S A;  3JCM c;  2F69 A;  5HKC A;  3H8Z A;  4KUL A;  2F5K A;  3PGG A;  4LDU A;  2FHD A;  3JCM f;  4ATO A;  3S3M A;  2RHI A;  3OSV A;  4J5Y A;  1QVP A;  1XOV A;  5CAI A;  3FIF A;  1U1S A;  4N4I A;  4JLG A;  3CCV T;  4F7U F;  4MZT A;  3RKY A;  2YRV A;  4QQD A;  3NFC A;  4ZGJ B;  4MML A;  5GMK i;  4RMO A;  2DXU A;  3L2U A;  4O6J A;  4QVC A;  1Q7Y C;  4QQ6 A;  4BAC A;  3MO8 A;  2JTM A;  3UT1 A;  4Y28 E;  1VQ8 A;  3MP1 A;  1X6O A;  1VQ9 A;  4XU0 A;  3JCM b;  2RJF A;  4XTW A;  2DXC A;  4J7F A;  4TVR A;  3OS1 A;  3OW2 S;  4XU3 A;  2DZC A;  2E41 A;  1K9M U;  1YIT T;  5CK9 A;  2X4X A;  4IUV A;  3UWN A;  2RHU A;  3ME9 A;  2EQK A;  2L3R A;  4QVZ A;  3OS5 A;  2ZPH B;  2JTF A;  3M58 A;  3CCJ A;  4QVD A;  4EPC A;  3CC7 T;  3CCL A;  3J81 E;  4FT4 A;  2DPP B;  3VUZ A;  1Q81 U;  4M78 F;  1JJ2 S;  4XTY A;  2X4J A;  2DVE A;  2LTO A;  1NE8 A;  1TH7 A;  1M1K U;  3F70 A;  1X75 C;  2CS7 A;  3PIP A;  4PLI A;  5FLX E;  2JN0 A;  3QDR B;  3LGF A;  1ZHI A;  4MMK A;  5IN1 A;  2XU8 A;  2LRQ A;  3CPW A;  3QPH A;  1YJ9 A;  2E6N A;  1QP2 A;  3OYM A;  3L2Z A;  3CCQ T;  1D3B A;  3MEW A;  3RUX A;  3VKI A;  5GMK h;  4HT8 A;  4E47 A;  1I5L A;  2L8D A;  2LCL A;  3C95 A;  2KSS A;  3N5B B;  1VQK T;  4M78 C;  5GAN 2;  4OB0 B;  2PQW A;  4OP0 A;  5GAN j;  3GOX A;  3V7C A;  4QW2 A;  4F7U E;  3CD6 T;  2VGM A;  4C92 D;  3HHT B;  1Y07 A;  3QXE B;  4C0Z A;  2FVU A;  4L6V 5;  2QEX A;  2NLU A;  3DKM A;  2CZ7 B;  2B8A A;  3CBM A;  3HP9 A;  1BI3 A;  3LGL A;  5FRM A;  4GLK A;  4Q5W A;  5J26 A;  4PJO C;  3JRZ A;  4PNO A;  3RKX A;  2OAU A;  5KCO A;  1YJW A;  4IKF A;  1KG1 A;  4ZTJ A;  3MET A;  1YJN A;  3MHX A;  4M78 E;  5D6X A;  2LC4 A;  3HRS A;  4A4G A;  3OYJ A;  2RI3 A;  3OA6 A;  1MGQ A;  4M77 F;  5LJ3 h;  1BIA A;  2CKK A;  3HRU A;  3JCM V;  4NL2 A;  4BY6 B;  3S6W A;  4ZN3 A;  1VQO A;  1I4K 1;  4V2S A;  3EFS A;  4FL6 A;  5KE3 A;  3C94 A;  4PLL A;  3CME T;  1WJQ A;  2FYK A;  3LX7 A;  2GCX A;  4HKE A;  3JB9 J;  3OYK A;  3QO3 A;  2XID A;  5GAN 6;  4RCB A;  1M4Z A;  2EIF A;  4C92 G;  4ELY C;  5KH6 A;  2LQ8 A;  5GAN d;  2DTO A;  4PJO F;  2RI2 A;  4M7D D;  2X35 A;  1VIF A;  3G7Z A;  2P0P A;  4XTV A;  5C6S A;  3S3O A;  4M7D C;  1UGR B;  5GAN f;  1M90 C;  3BFM A;  4FSX A;  2HQE A;  5GAO p;  5D6W A;  4N4G A;  4HCB A;  5GAM e;  5HK0 A;  1XTD A;  3RKW A;  5LJ5 j;  4ZGE B;  1G3T A;  5GAN 4;  3NTH A;  1VQ6 A;  5CVI A;  2EKO A;  2M16 A;  2LVM A;  4B9W A;  1VQN T;  2DZ9 A;  4OF1 A;  3T9N A;  3OYI A;  5L8R E;  1M90 U;  1S72 A;  1BYM A;  3JCM Q;  2V8I A;  2EYQ A;  4M7D F;  3G4S A;  1VQP A;  4M7A D;  3FC3 A;  1VQM A;  2EQM A;  1N27 A;  5FU6 C;  3JCM X;  2RK2 A;  1Y7X A;  2MMP A;  2M9U A;  2ZCF B;  3M54 A;  4C8Q D;  4A4E A;  3CBO A;  1N9R A;  3X26 B;  5A2Q E;  5LJ3 g;  3OSS C;  3CCE T;  2FL7 A;  4LDW A;  3SD4 A;  1FWZ A;  1Q7Y U;  1WGS A;  4C92 C;  5C0M A;  1P92 A;  2M0O A;  3A8G B;  3BDU A;  5LJ3 f;  4Z02 A;  5CO7 A;  5HK3 A;  3CC4 T;  3I55 T;  2LDM A;  4LD9 K;  4MDX A;  2G3R A;  4C8Q B;  2RJC A;  3SWN A;  5GAM j;  3M55 A;  2RM4 A;  2WSE E;  5GAO q;  4C8Q G;  1LOJ A;  3CCR T;  3HSB A;  5GMK m;  4IUU A;  4M75 E;  5FRN A;  3G6E A;  3CXC S;  3GNF B;  4WF2 A;  1KQ1 A;  4F7U B;  4FT2 A;  4DA4 A;  1IRE B;  2C06 A;  4ME7 A;  3I56 A;  3GIB A;  1YIJ T;  4OB1 B;  1OYX A;  4M7A C;  3L42 A;  4J83 A;  4P5N A;  3FB9 A;  3CCM A;  1PSE A;  3P8H A;  3OYG A;  1Q82 C;  1LJO A;  4FM4 B;  3OYD A;  5GMK l;  4M78 A;  4KUI A;  4PL6 A;  3OMC A;  3INZ A;  3CBP A;  3JB9 D;  5LJ5 d;  5EG2 A;  2LT4 A;  5GAN 7;  3URG A;  5KE2 A;  5GAN 5;  5A0D A;  2XD0 A;  5A0G A;  1WNL A;  2GF7 A;  2DIQ A;  2VV5 A;  4C5I A;  1KQS A;  3OS0 A;  3QYH B;  1K8A C;  2XDB A;  3VJP A;  3CC2 A;  5HY6 A;  5LJ3 j;  2BKD N;  1QVG S;  3CMA A;  1VQ5 A;  2KQW A;  4XAX B;  3V8K A;  4N0A C;  1OZ3 A;  2EQJ A;  2D6F A;  4A54 A;  5GAM f;  3MEU A;  4L59 A;  3JCM g;  4BE2 A;  3V8L A;  3MCA B;  4FU6 A;  5GAN e;  1JBM A;  2R5M A;  4X34 A;  1O75 A;  1K73 C;  4C8Q A;  3ER0 A;  3L1A A;  4EDU A;  1UEB A;  5CKD A;  1N8R C;  1KC8 U;  3JB9 F;  3VYH B;  4J6X A;  2PUO B;  4DOV A;  2E65 A;  3HFN A;  2MWO A;  4M7A G;  3SFM A;  5LJ5 g;  2QQB A;  4PJO D;  1H3Z A;  5FU7 B;  2PVD B;  1OI1 A;  3G71 A;  2GFA A;  4HA8 A;  3TEE A;  1JJ2 A;  4JDS A;  4M77 B;  3GNG A;  1HK9 A;  4X9C A;  3QKJ A;  3ZEH A;  4CRI A;  1Y96 B;  5GMK j;  3FLG A;  3UDC A;  4BI8 B;  2K57 A;  2EJG A;  2K5I A;  3SDZ A;  1BIB A;  2R57 A;  3C4S A;  5GAO n;  1FX7 A;  1M1G A;  2RI5 A;  4IUQ A;  3OYE A;  1G3W A;  4II1 A;  4M78 D;  4DOW A;  3OYB A;  3QHS A;  2RB6 A;  3HL8 A;  5LJ3 d;  3DLM A;  3CCU A;  1KQ2 A;  1VQL T;  3PT9 A;  2HD0 A;  1QVF S;  3FEO A;  3X28 B;  3TRE A;  4X9D A;  1XQH A;  4DQ2 A;  4OGE A;  3SWN C;  4B9X A;  5GAO l;  2K2V A;  3QII A;  3QJ6 A;  1VQ7 A;  3ZFJ A;  3MP8 A;  4BE0 A;  3WVD B;  4RG2 A;  4C0G A;  3CEY A;  3JCM d;  1FXX A;  3J80 E;  3CC7 A;  4LDV A;  3LH0 A;  4XQ3 A;  4LDX A;  4PJO B;  2XI9 A;  1M1F A;  2CZ1 B;  2JZ2 A;  4OVA A;  2QQS A;  4J6Y A;  5IT9 E;  1KD1 C;  3OB9 A;  2RA2 A;  1Q86 U;  1NJI U;  1ZQ1 A;  5LJ5 h;  4C0D C;  4LDY A;  2QI2 A;  5GAO r;  3JB9 H;  3KBG A;  1G5V A;  3OS2 A;  3WVE B;  4A53 A;  2ZZD A;  1YJ9 T;  2CGH A;  5CKH A;  3CCQ A;  3X24 B;  3CCS A;  3LWH A;  3JCM W;  4M75 C;  4M78 B;  4C0D B;  4E7L A;  2QTX A;  5LJ5 e;  2EJF A;  2H3J A;  5GAO m;  1WPY A;  2IVW A;  4ELZ C;  3M5A A;  4JS4 A;  4F7U A;  1I81 A;  4UC4 A;  4EMK C;  2OTL A;  4M75 A;  3CD6 A;  1NJI C;  3OYC A;  1U1T A;  4M77 C;  3RIR A;  4E7I A;  1U8R A;  2ZPI B;  5A0L A;  1WQ7 A;  3BY7 A;  2XDD A;  5FU7 C;  2E5Q A;  2QEX T;  1Q81 C;  2EJ9 A;  4BI4 A;  4C5G A;  2YLC A;  3SWN B;  2XG8 D;  3QJY A;  4XU1 A;  2DJZ A;  1XNI A;  2QQ9 A;  5GAM d;  1K73 U;  1V29 B;  3ASK A;  5DM7 R;  2E6Z A;  5FRO A;  2O4X A;  1YCY A;  1UGP B;  1YJW T;  4JRP A;  2KMT A;  1YHQ T;  4M75 D;  2XIC A;  1DJ7 B;  5J3B A;  3CPW S;  2QA4 A;  1GXI E;  1M9S A;  1OZ2 A;  3A5Z B;  3PNW C;  3OBW A;  5I2M A;  5J39 A;  4C92 B;  1R8O B;  2QXF A;  2GFU A;  2DAQ A;  4XTZ A;  1VQO T;  1VIE A;  2CZ6 B;  1MHN A;  2XDP A;  2I2L A;  1K8A U;  2OTJ T;  4M75 G;  1N9S A;  4JLI A;  4J8O A;  4M75 B;  5CCA A;  4FIB A;  4QQG A;  4EMH A;  4E7K A;  4C5E A;  1YI2 T;  4NOY A;  1VQ4 A;  1WQW A;  3TCJ A;  4XTU A;  1SSF A;  2A3L A;  4E7H A;  3E9F A;  3GF5 A;  3RES A;  1Q82 U;  2MWP A;  2KK4 A;  1KD1 U;  2KY9 A;  2P0Q A;  4NS5 A;  2V8K A;  5LJ3 e;  2LX9 A;  2RJE A;  4CI0 C;  1QVF A;  3CXC A;  1VQ6 T;  2ZPF B;  4JRQ A;  1VQN A;  3J7A F;  1M8V A;  4PKC C;  5KCH A;  1NPR A;  4M77 E;  2K5F A;  4M7D G;  4HCZ A;  4M7D A;  4C92 A;  2FB7 A;  4NL3 A;  4BD3 A;  3G4S T;  4RKU E;  1WJS A;  2K4Y A;  3M4Y A;  3P8B B;  2EWN A;  4RCC A;  5CQY A;  4C5H A;  2DEQ A;  3CCV A;  3A8H B;  3NTI A;  1O9S A;  3JCM P;  4C92 E;  4BI3 A;  2LQK A;  5DLQ E;  2R5A A;  2RK1 A;  1VQ9 T;  1VQ8 T;  4M7A F;  4PJO E;  3CC4 A;  3LYI A;  4BDY A;  2CZ0 B;  2RO0 A;  2DIG A;  2DD5 A;  2JVV A;  4KT0 E;  1JB0 E;  2Y90 A;  3CCR A;  4M7A B;  4MZM A;  2MF2 A;  1YIT A;  3VUB A;  2JNG A;  3DLL A;  2JOY A;  5LJ5 f;  4BUG A;  4A4H A;  3CCJ T;  4M7D E;  3JAM E;  4M77 A;  3CCL T;  1IZ6 A;  2E1H A;  2K5L A;  3MEA A;  4OGC A;  3FDR A;  1BI1 A;  2WSF E;  4O5V A;  5AYF A;  1G3Y A;  2VYT A;  1S72 T;  3Q1J A;  1D3B B;  3VU3 C;  1B34 A;  3L2W A;  4JRK A;  1PSF A;  1RI0 A;  2DK3 A;  2KDS A;  3FJP A;  5GAM h;  2JUF A;  1W2B A;  5GAN 8;  5GAM g;  3E9G A;  3OYY A;  3QYG B;  4N4H A;  5M9O A;  3BW1 A;  2E10 A;  4M7D B;  2RD1 A;  3OYN A;  3TU4 K;  2ZGW A;  2RHX A;  1VQK A;  3CC2 T;  2L5Q A;  3V7R A;  3PMI A;  2HAX A;  2RH2 A;  2Y4Y A;  4IUP A;  5D6Y A;  5I2S A;  3CMA T;  4A4F A;  2KAF A;  1EIF A;  1NZ9 A;  3HKS A;  3L2Q A;  2P4T A;  1QVG A;  3QSU A;  3M4G A;  1M1K C;  2GQV A;  3FRN A;  4M7A E;  1JRI A;  4J7I A;  4C8Q F;  4XTX A;  1X01 A;  4F7U G;  4C8Q E;  3EAE A;  1BI0 A;  2XKO C;  3EFR A;  3HRT A;  2DXT A;  4OMF B;  2HBP A;  1Y96 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...