5FU7B

Drosophila nanos nbr peptide bound to the not module of the human ccr4-not complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
191
structure length
191
Chain Sequence
EMVTDQFGMIGLLTFIRAAETDPGMVHLALGSDLTTLGLNLNSPENLYPKFASPWASSPCRPQDIDFHVPSEYLTNIHIRDKLAAIKLGRYGEDLLFYLYYMNGGDVLQLLAAVELFNRDWRYHKEERVWITRAPGMEPTMKTNTYERGTYYFFDCLNWRKVAKEFHLEYDKLEERPHLPSTFNYNPAQQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Gene regulation
molecule keywords CCR4-NOT TRANSCRIPTION COMPLEX SUBUNIT 1
publication title Distinct Modes of Recruitment of the Ccr4-not Complex by Drosophila and Vertebrate Nanos
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 191
sequence length 191
chains with identical sequence F
ec nomenclature
pdb deposition date 2016-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04153 NOT2_3_5 NOT2 / NOT3 / NOT5 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1020 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5fu7B00
4BY6C 5FU7C 4C0DC 5FU6B 4C0FA 4C0GA 4BY6B 5FU6C 5FU7B 4C0DB
chains in the Genus database with same CATH superfamily
3JCMQ 3DLLA 1PWTA 2I0NA 5FU6C 4IIMA 4C0DB 4L5GA 1H8KA 2K3YA 1PKSA 3MEWA 2EJ9A 4CC2A 4C5EA 5J26A 5CQXA 5CIUA 3PMTA 3GP8A 2JOYA 4DOVA 2CH4A 2GTJA 3BE3A 2BE9B 3JCMg 3CMEA 3PE0A 2CGHA 3UA6A 3CMEQ 3G6EQ 3O5ZA 3REAB 1VYTA 1KFZA 4M78D 3UWNA 3G4SQ 4C92C 3JRZA 1ZA1B 2K2MA 2JS2A 1NM7A 4Z89A 2HD0A 3QWXX 3A8GB 2GQIA 2L3PA 2KGTA 3M56A 3MO8A 3CCUT 5DY9A 4C8QA 2NYSA 2K5IA 2D9TA 2DL8A 1VQKT 4M77C 1QVFP 1QMCA 3MPUB 3E9FA 2CZ1B 5L23A 1K9MC 1K73C 3HPWA 1ZSZB 2DL5A 1M2OA 1Y7XA 3EG1A 4M7DA 4A4FA 1W2BP 2NUPB 1K4US 1IRXA 1YCSB 3CC2A 2CREA 5A2QE 3CC2Q 2EAYA 3HFOA 5IHNA 1PC0A 3C12A 2CUBA 1T0HA 3EGXA 1M3BA 2MK5A 3JCMh 2H3JA 2CP3A 5EC7A 2NLUA 2JJ9A 2YUOA 1MNEA 2ZPHB 1OV3A 2DFUA 3BY7A 3CCSQ 3QBYA 1UHFA 4JJBA 2KR3A 1QWFA 2OTLQ 2RD1A 2DE0X 2MAMA 2XMFA 3PVLA 2M0OA 1AWWA 2F5KA 2LMJA 3OYJA 2B86A 3MHXA 2RQVA 3FJPA 2QQSA 1D3BB 1YITQ 1PD0A 1EZZB 3EFOA 3EG9B 4LE9A 4PFOA 1K9MU 1K73U 2X9HA 4QVZA 5LJ3j 1K8AC 1X27A 2GFAA 2LDMA 4A53A 1D1BA 5FW9A 4KGXB 1OEBA 1M27C 3V8KA 2I2LA 2YLBA 2V8KA 3X28B 2CT4A 4HXJA 2K5FA 4KBMB 3CCMQ 3M55A 3FIFA 5CKFA 4PK4A 1Q7YR 1XNIA 1WQ7A 4RG8A 3FEOA 2C0OA 1VIEA 2J7IA 2RK1A 1QCNA 2VVKA 4J9IA 4EMGA 4OB0B 3QXEB 1YIJQ 1VQLT 4D6WA 3CCJT 3TSZA 3L42A 1UUEA 2DIQA 2ZGWA 3NGPA 1SF9A 4BD3A 3QZ9B 3JB9J 3N5BB 1F1BB 2B8AA 3FDRA 2DD4A 1W70A 4LUEA 1K8AU 2GBQA 1E6GA 4XTZA 2DXUA 4C8QG 5KCHA 2ROTA 2QGGA 1WQWA 2XIDA 5GAMe 2P4TA 1C1AA 2DAQA 1EX4A 5I22A 1RLPC 1QW1A 2ZPGB 4M7DG 3J80E 4X34A 2KAFA 4C8QD 5GAMf 4BACA 2EYQA 1YHQA 2JTEA 1YHQQ 2EW3A 2HQHA 2VC8A 4NOYA 4M78E 1CKBA 1WGSA 1KIKA 2DVJA 3OYBA 4M7DD 2HBWA 3CMET 4BE2A 4N4IA 2A28A 4EMKC 5LJ3d 3G4ST 3RDVA 1PKTA 2RQRA 2KNBB 4E7HA 2F5TX 3E2UA 3OY9A 2DTHA 3VS1A 7AT1B 5IT9E 5GMKl 3CCRQ 3OB9A 3EG3A 2C0TA 1IZ6A 4BE1A 4A4GA 4XTUA 1VA7A 2FPFA 4ELYC 2M51A 4JPBW 1OPLA 4HVVA 2DJZA 3G7ZA 2RNAA 1EFNA 2VXFA 1B34B 3ULRB 2K57A 4E7SA 4M7AA 4QW2A 1VQMA 3HL8A 1RAAB 4XU0A 3CC2T 2YUQA 3M0UA 4HCKA 2DL7A 1WFWA 5GAN5 2YUPA 1GXIE 1N9RA 4YTLA 2CP5A 3BW1A 3VV0A 1SSHA 1X2QA 2AKKA 1M1KR 4FW1A 1AWXA 1RLQC 3LX7A 3LWHA 3QJ6A 4OMFB 1QVGS 1Q7YC 2YRCA 4LN2A 2LP5A 2LCCA 3QZ5B 2JMCA 1QVGA 2QEXA 1WYXA 5FROA 4BY6B 4PJOG 1YBYA 2OJ2A 2RPNA 4C5HA 5GMKi 5CQYA 4C0ZA 1YWPA 5KH6A 3ASKA 4M75A 3GNFB 4O6JA 1K0XA 2ZPIB 3RMQA 3CC7A 1N8RR 2FVUA 1NPPA 3JB9G 2PNIA 2EYYA 2YRDA 1M2VB 1OZ2A 1AWOA 1TUDA 2YRVA 1PCXA 2JN0A 4QVDA 2L0AA 4E2FB 2EQUA 5CK9A 4J9HA 4KH1B 1A0NB 1GRIA 2GQVA 2FYKA 1LCKA 3LWIA 4GLKA 4F7UB 1QP2A 1WX6A 1BI3A 1AWJA 1RACB 3M0TA 1G3TA 2D0NA 3OSVA 1Q7YU 2VUBA 1C6VX 3H6ZA 2V26A 1N9SA 1WPYA 5GANj 2D0QB 1I0CA 3NFCA 1YIJT 2SRCA 2R57A 4AG1C 2LNHB 4DA4A 1VQ7A 2WSEE 3CBOA 2EQKA 1ZSGA 3CC4A 3JCMV 3VS4A 5KYUA 5HK3A 3CC4Q 2DA9A 1VIFA 2KXCA 4AFSC 2AZSA 1KHIA 3SHWA 5CVIA 1YP5A 3EH1A 2J6OA 2MI6A 2KEAA 4OMMA 3I5RA 3WXMB 3UATA 2ECZA 2DPPB 4PL6A 2LRQA 2KSSA 1AT1B 3OYLA 2OI3A 1AOJA 3EHRA 4ZGDB 1VUBA 2EPDA 4R56A 2DJQA 2FPDA 2IPOB 2RA2A 1FX7A 3HTRA 2LTOA 1YHQT 3J7AF 3CXCP 1BK2A 2JW4A 1VQKQ 2MOXA 4M7AD 3JCMe 2F69A 2FG0A 1JXOA 1JXMA 4XK8E 3S3NA 3PVQA 1JO8A 4F7UF 3CCEA 1OQKA 1YI2Q 3H41A 3VRZA 2AHJB 3OS2A 2AKLA 1YJNQ 2RB6A 1MUZA 2BIVA 1Q81C 2EYWA 4KUDK 2OAUA 3RERA 2MIOA 1PNJA 1U1SA 3VKIA 5LL6S 2DZCA 3CCRT 1MV3A 4ZN1A 4FYWB 2RF0A 1IGQA 4JLIA 5GAN7 4C5IA 5FWCA 2RJCA 3E1SA 1AVZC 3KUFA 5KYWA 5GANg 4RTWA 1Y96B 2Y4XA 4M75G 1WJRA 1WJSA 5EG2A 5KE2A 4F04B 1D3BA 2LC4A 5DLOA 2ZPFB 3EG9A 1O75A 4C92E 2HKQB 3CCQQ 4JRKA 2LT1A 3V8LA 4LDXA 2RHUA 2KT1A 2X4XA 1RAGB 3SB2A 4M75D 2L5QA 3RBBB 2DL3A 1LJOA 1Z9ZA 3M0RA 6AT1B 1KC8C 3WVEB 4M77E 1LNXA 2OTJQ 2E10A 3PIOA 3CBMA 4JRQA 4A4HA 2DM1A 2XICA 2OAWA 1QCOA 1VOMA 2A7YA 1M1KU 3PIPA 3S3OA 1QVFS 1Q95G 3E19A 5M9OA 4XTWA 1VQ9A 2CDTA 2QEXT 1VQ9Q 1M30A 1QVFA 1Y71A 4OMPA 1KQSP 1IHVA 1IREB 4R0KA 4OGEA 5KYNA 3LH5A 5GANh 2W0ZA 1ABQA 2BE7D 5FU7B 2EWNA 2ZPBB 1RL2A 2RJDA 4GY5A 4HVWA 2DO3A 3CC7T 3M0SA 4A4EA 1RAEB 3CCJQ 2YDLA 4OMQA 4C8QC 2J6FA 1N8RU 3JCMc 2X51A 3AT1B 4V2SA 4A54A 2RN8A 3OYYA 2RO0A 2Y90A 4RKUE 1N27A 2ED1A 3ME9A 3JV3A 1M90U 1NPRA 2DYBA 3MP1A 4ME7A 5C0MA 4M7DC 2LQWA 3H8ZA 1UG1A 3V7RA 1GCQC 3OYEA 3X26B 4BUGA 2PUKB 2PQWA 3SWNB 2X35A 1D1AA 3CD6A 3KFVA 3CD6Q 2G3RA 2KE9A 3EGDB 4XU3A 3OSSC 2CSIA 3PT9A 3QYGB 4UC4A 3JCMJ 4X1VA 2XDPA 3BFMA 5I11A 2JT4A 1NEGA 2W10A 2K4YA 1VQ7T 2KVQG 2RI5A 4KH0B 5D6XA 4LUDA 2DEQA 3CC4T 4B9XA 1WLPB 1TG0A 2JM8A 2HCKA 2E6NA 3Q1JA 4RG2A 3RR6A 2CP0A 2HL3A 4CC7A 1W4SA 4ANJA 3FJ5A 5IHKA 2GTOA 2FHDA 1UDLA 1S72A 2XHCA 4PJMA 1UGQB 3PNWC 1N5ZA 1VYUA 3RMSA 1U1TA 3JCMX 2KQWA 4J6WA 5A0DA 4QQGA 1MGQA 2D6FA 3M53A 5IH2A 1U8RA 4XU1A 3C94A 2QI2A 4J8OA 1SRMA 4O5VA 5GMKj 5LJ3f 2YLCA 3QKJA 3TU4K 1YI2T 3CCET 4ELZC 1GCQA 3H0FA 1YJNT 3OQ5A 2DXTA 4J9CA 1TTHB 2HL5C 3ZEHA 3DLMA 2DXCA 1WNLA 2ABLA 2V1QA 1M3CA 1YJWA 4JJDA 2PVDB 4WF2A 3UF4A 1UGVA 3GBQA 4PLLA 3I35A 2K7AA 4JJCA 1ZHIA 1JRIA 3LLRA 4ZGEB 1U06A 5GJWB 5ECAA 1JEGA 2KRNA 3QWYA 1JBMA 4OB1B 5DLQE 2QTXA 2NUTA 3QYHB 4RTUA 5A0LA 3TSWA 3CCQT 2KYBA 2WSCE 2HDAA 4K11A 2GF7A 4M78B 3FB9A 4PKCC 3L2WA 5GAN8 2QDYB 3MP8A 4L59A 2L3SA 1QKWA 2HEQA 3VUZA 3V7CA 4JZ4A 1N6AA 2OTJT 4F7UA 4DBRA 5CCAA 2LVMA 2CYZB 3O8VA 4DQ2A 1E7OA 3P8HA 2E5KA 3QUIA 4ATOA 2AZVA 2DF6A 4XU2A 4NL3A 1VQ9T 2DNUA 2EBPA 2HKNA 4DOWA 3QDRB 2DL4A 3CCLA 2HSEB 3E9GA 2EFIA 1Y57A 2ZZDA 1R0BG 2FEIA 2BUDA 2MMPA 2ED0A 5I2SA 2HNIA 1W1FA 1H3HA 2O4XB 3KBGA 4PJOA 2L3RA 4CC3A 4OMOA 2K5LA 1VQNA 2KROA 4FCYA 3EAEA 4PJLA 1ZUKA 4M7AC 2EJGA 2FRWA 3GIBA 1I4K1 4EDUA 3CPWP 1QKXA 1U5SA 1JQQA 3VS2A 3L2VA 3CPFA 1X01A 2JTFA 2R58A 4M78F 3HRUA 3CD6T 1TUGB 1G83A 1OX8A 1PSEA 2LNVA 1YCYA 1G3SA 2CT3A 2LCSA 1Q82R 2X4YA 4KGVB 4Z88A 2D1XA 1X69A 3FRNA 2M02A 5LJ3g 1OZ3A 4ZGJB 1GFDA 4JRIA 5GMKh 3NMZC 5AT1B 1UE9A 1R8OB 2H3EB 4AG2C 2HBPA 2E64A 4M75C 2QYZA 2FZKB 3I55A 1S72T 1Y96A 2PTKA 2Z0WA 5KYYA 5C6SA 1J3TA 1OI1A 2QXFA 2YT6A 4EPCA 2EGAA 1SSFA 1XTDA 1H641 5CKEA 4JLGA 2RK2A 4FYXB 5IHIA 1GL5A 3EFSA 4C0DC 3OYKA 2L2PA 3JCMb 2ZCFB 3EGUA 4X9CA 1JU5C 1WDXA 4F7UG 4L6V5 4IUTA 4NL2A 3RKXA 1VQMQ 1GBQA 2EGEA 2QQBA 2DXBA 4HCBA 1I5OB 2YXYA 2COYA 3TREA 4PNOA 3SDZA 3QPHA 1M8VA 1MMAA 5LJ3h 2QA4A 3UA7A 4N0AC 2ENMA 3GPLA 4BDZA 1YJWT 1RAFB 4Y92A 4OVAA 2VXEA 5GANe 4WTOB 3VS3A 2XDBA 2HQEA 3V7SA 2X3XD 1G5VA 1K76A 3CXCS 4IIOA 2DBMA 1IO6A 1ZLMA 5GANf 1ZBXA 4KULA 1I1JA 3U23A 3CXCA 2PVGB 2QEXQ 4DEYA 8ATCB 1BKBA 2JM9A 2XDDA 2ESWA 4PLIA 2FB7A 2RJFA 1R77A 3LH0A 2L8DA 3CBPA 5FU6B 1S1NA 3SEMA 3L2ZA 2EYZA 3NHNA 5LJ5j 3CC7Q 2EQMA 2QDLA 4J9FA 1EIFA 2DZ9A 4PJOD 1PRMC 1SRLA 3NTHA 1M90R 2BZ8A 3S6WA 3VS6A 3SWNA 2DEUA 4B9WA 1BCOA 3L2UA 3M4YA 2RJEA 3JB9D 2H8HA 2E41A 3INZA 1IXDA 2FRYA 2MCNA 3UDCA 2RM4A 1RAIB 3J81E 3EGDA 2EQIA 4LDUA 2XI9A 2QG9B 1X6BA 3X20B 4JUVA 1Q82C 2D8JA 3TCJA 2J05A 2CZ7B 2RI3A 3CCLT 3EFOB 2MF2A 4C92B 2COWA 4Y28E 2SEMA 2O31A 1W6XA 2JVVA 1ABOA 3CMAA 4N0AA 3CCVA 2ZAEA 3CCVQ 4KT0E 1VQ7Q 4FT4A 1Q86R 2M9UA 5KYXB 1VQNT 3BDUA 2ZPEB 4M77B 4BB7A 4R55A 1JJ2S 1X2KA 2F2VA 2K9GA 1XJWB 3RNJA 3ZL7C 3RESA 2JUFA 4PJNA 1JJ2A 4QKUA 3MJXA 2VB6A 1AZEA 1LOJA 3OYNA 3OA6A 1KQSS 3A8HB 2MWPA 2EYXA 4ZNXA 3V8JA 1OOTA 4C8QE 3H0HA 1VQ4A 2DILA 2GGRA 1KQSA 3OS0A 1VQ4Q 1NG2A 2J06A 5J3BA 4RTZA 3GNGA 4QVCA 1ZSZA 1T3LA 2HAXA 1B07A 1V29B 4D8DA 4IUPA 1Q82U 4M7DE 1WXBA 4J5YA 2RQTA 2DYIA 5LJ5g 2NUPA 4KRTA 1WXUA 3OW2P 2LZ6B 3LGLA 4IUVA 1YWOA 1UTIA 1PHTA 4BI8B 4D8KA 1MMGA 1M4ZA 4EIKA 3JAME 1FMVA 1KD1R 4HT8A 4LDYA 5LJ5d 4MZPA 3CCEQ 1BBZA 4FT2A 2VKNA 4TVRA 1WXTA 3I55T 2CSQA 4C92F 1M1KC 2PZ1A 5D6YA 3HP9A 1KK7A 1NEBA 1B7TA 4OB3B 1Y07A 3X25B 1GFCA 2E70A 3GLXA 2DRKA 3OMGA 1G8XA 1HD3A 1KQ1A 1UECA 2IVWA 4N4HA 2KBTA 4M77F 1Z9QA 2JZ2A 2E6ZA 1K1ZA 1O9SA 1UEBA 1N8RC 1VQMT 1BCMA 3JB9H 2BTTA 1PD1A 3GOXA 1MNDA 2QA4T 1KG1A 1M90C 4ZTFA 3URGA 5GAOp 3M5AA 1P92A 4MZTA 5CAIA 5IN1A 3SFMA 2JTMA 4IUQA 1AD5A 1UB4A 3A8LB 3PMIA 4MZMA 5IXFA 5A0GA 3OBWA 4M7AB 5GAN3 1YJ9A 2E12A 2E1HA 4BDYA 3ZBDA 1VQOA 1YJ9Q 3EHQA 4FU6A 2C06A 1GCPA 1IGUA 1CKAA 1V76A 1W2BS 1WI7A 3OS1A 5D6WA 4F17A 2VV5A 1Q86C 1W2BA 2GCXA 4LDWA 2YSQA 4P5NA 3M57A 4J83A 2K3XA 4JS5A 2KMTA 1QWEA 2RI2A 1TOVA 2EKHA 5D7UA 1OYXA 4PFPA 1RUWA 1TUCA 1TWBA 1SHGA 2K6DA 1OULA 2L89A 2DIGA 1ZUYA 2DRMA 4FSXA 4J6YA 2DK3A 4KGZB 2YHTA 4FIBA 4J9GA 5HKCA 4EMKB 3DB4A 3BDLA 5GMKe 4M75B 2O2OA 5CKBA 3CEYA 5IAYA 2EKOA 2PVOB 3EG2A 1K9AA 4ZTJA 1AZGB 2GFUA 3CCVT 3A5ZB 4XAXB 3M0QA 4OP0A 1KD1C 3VJPA 4E7JA 4CRIA 4MMKA 8AT1B 1Q86U 4M7AF 1M1GA 5GAOm 1FXXA 1TS9A 3A1PA 4FYYB 9ATCB 2KK4A 3M9QA 2VWFA 4M78G 1ZBJA 1M1FA 1WHLA 2A37A 2YWWA 1S72Q 4MDXA 2XKOC 1VQ4T 4LXCA 2IG0A 1B34A 2COZA 2VGNA 3G6EA 4M7AE 3C4SA 3EG0A 5LJ3e 3G4SA 2M0YA 5KYUB 2O9VA 2P4RA 3MKDA 2DLPA 1ACMB 1UGSB 3JCMd 2FL7A 4MDWA 1OU9A 4A63B 4CI0C 3CPWS 1M9SA 2BZYA 1K0SA 2K2VA 4RUGA 4CC4B 4F14A 3TVTA 3OYIA 3S3MA 3CPWA 1VQ8A 1KD1U 3EFRA 1BI1A 2RH2A 5CKDA 1VQ8Q 2JS0A 2D8HA 4M75F 3IQLA 1ARKA 4E7ZA 3MCAB 3R6NA 4J7IA 2G6FX 4XTXA 1YJWQ 5FRMA 4PJOC 2DX1A 3QDFA 3HKSA 4IUUA 3QG1A 4RMOA 4HT9A 3G71A 4M75E 3G71Q 2LT4A 4E6RA 3L2RA 3OYCA 1I5LA 2KT8A 1M2VA 2LX9A 1X75C 1UHCA 3A98A 1M3AA 3CCSA 4C0GA 1BU1A 3JCMP 1TXQA 3MEVA 5GAOl 1VQ5A 2BZXA 2JMAA 2OTLA 2MWOA 1VQ5Q 1UGPB 2CZ0B 5KYWB 2V8JA 5HY6A 4HCCA 3UT1A 2DVEA 1YITA 1LVKA 2PU9B 2E65A 2VGMA 3P8BB 4C92A 1BYMA 3MEAA 1YJ9T 1G3WA 1YNZA 3OMCA 5HK0A 1HK9A 1RAHB 1VQOT 4OGCA 2E4HA 1WA7A 1I8FA 3CCLQ 5GAOq 5KYXA 1D0XA 2AIRB 4OMNA 1KHCA 2M16A 4E7IA 3CCMA 4DBFA 4M77A 3WVDB 2FZGB 1D0ZA 4Z8AA 5GMKm 2E3HA 1GBRA 1M5Q1 3TQ7P 2DTIA 3OBYA 3T9NA 4HVUA 1VQNQ 5CO7A 2ATCB 3HFNA 3M59A 3VYHB 3H0IA 1D0YA 1HJDA 1DJ7B 1YIJA 1T0JA 2HSPA 2O01E 1D1CA 4AMCA 1QLYA 3QHSA 4FW2A 2OX7A 1NE8A 2P0PA 4PFZA 1MMNA 1ZUUA 1LPLA 2EGCA 2VASA 3ER0A 3OS5A 4BE0A 1MHNA 2R5AA 3GF5A 4IURA 2CUDA 2O9SA 4FYVB 1FWZA 1ZQ1A 4LDVA 2A08A 2EVRA 1WHJA 4RTYA 4XQ3A 5FU7C 4ESRA 1ZA2B 4LD6A 4HCZA 4AFQC 1HSQA 4J9EA 4VUBA 3OYAA 3C95A 2WACA 4ZN3A 3UPUA 2AT1B 1TU0B 1CSKA 1NJIR 1X6OA 4DEXA 3I55Q 1NLPC 2M1HA 1UFFA 2P0QA 1OX9A 4BI3A 4RCBA 3G6ET 4RCCA 1RABB 5KE3A 3SWNC 4LD9K 5LJ5e 5GAN4 3JSCA 1D09B 4XTYA 3QIIA 4E7LA 3CQTA 1OU8A 3PTAA 4OB2B 3G1JA 5IXBA 3OYFA 3CCRA 5LJ5f 3I56A 4J7FA 3I56Q 1VQ6A 4J9BA 2FPEA 1VQ6Q 1B3QA 1WZOA 1VQPA 3NTKA 1VQPQ 3D7SB 1VQ8T 4HA8A 4C92G 2KI7A 3FLGA 1TH7A 2FO0A 2QA4Q 5GAN2 4JJNK 1QVPA 3RKYA 2F2XA 2RHZA 2P84A 2YUNA 3ZFJA 2KDSA 5GAMj 1X43A 4C8QB 3M54A 2GNCA 4JRPA 2QAZA 2DKGA 2R5MA 2XU8A 2NUZA 4C92D 2QQRA 1SEMA 1KQ2A 3M4GA 5DM7R 2LQNA 4Y91A 2XD0A 4M77G 3OW2S 3G71T 2LCLA 4GBQA 2QQ9A 2MYSA 4GLMA 5FRNA 2V1RA 4M7DB 3I5SA 1WJQA 4II1A 1Q81R 1BI0A 3OW2A 2QQAA 4PJJA 2FZCB 4KUIA 1HYOA 3PGGA 4J9DA 2KYMA 1MV0B 1WHHA 1RI0A 1HXDA 3CCST 3PFSA 3EGXB 1SHFA 4M77D 4Q5WA 4MMLA 2CZ6B 1H92A 1ZSZC 1VQ5T 2O88A 2HZYA 2OTLT 2KY9A 1PRLC 1VYVA 1WIEA 3THKA 3OYGA 2JNGA 1FMKA 5AYFA 2WSFE 2QTVA 2V8IA 4A4KA 1YITT 4EMKA 2LJ0A 2NUTB 1NBEB 2EJFA 1XOVA 2KRMA 2ROLA 2DMOA 3H9NA 3RKWA 2QK0A 5KCOA 3HRSA 1KC8R 3R6OA 2A0FB 3VS0A 3LGFA 3DB3A 1H3ZA 4QQDA 1KJWA 3CCMT 5I2MA 4JS4A 1UGRB 3VYGA 1SG5A 1NZ9A 3RUXA 2K3BA 1MMDA 1FMWA 3L1AA 3C0CA 3AHUA 3CMAQ 2HQXA 2MPXC 1IHWA 4M78C 5GAN6 3A8MB 3VU3C 1UJ0A 4C8QF 4C5GA 3X24B 1C0MA 3F70A 1BB9A 4N4GA 1WHGA 4HKEA 5GAMg 5GAOn 1AHJB 1NJIC 5GJVB 1V1CA 3A8OB 2DD5A 5FLXE 2KRSA 4M7DF 1PG5B 2X4WA 3NTIA 2JXBA 3EH2A 1BI2A 3VRYA 2IIMA 5GAMd 4E7KA 3QJYA 3JCMW 4IKFA 3I9QA 2KXDA 4B6MA 4XTVA 1SPKA 4PJOB 2XG8D 3TEEA 1X6GA 1G3YA 1I07A 4RTVA 2RMOA 2LJ1A 4OMLA 4M7AG 2RHIA 2VYTA 4QQ6A 2X4JA 2CH4W 3VS7A 1XQHA 2CP6A 3HHTB 3M0PA 3HRTA 5L8RE 4C0FA 2RQUA 3CCUA 2LJ3A 3CCUQ 2CKKA 1QVGP 1VQKA 1NYFA 3QSUA 4NS5A 1R0CB 1QP3A 1TSFA 1YFNA 4E47A 1Y0MA 4EMHA 3VUBA 1NJIU 3M58A 4F16A 3OYDA 4X9DA 5GAMh 4DBQA 4WCIA 1SKUB 2QASA 1YI2A 2RQWA 4LNPA 5J39A 2Y4YA 3JB9I 1YJNA 3P8DA 2EIFA 1RI9A 4M78A 3JCMf 5HCKA 4FL6A 4BI4A 2J6KA 1WHMA 4FM4B 2P0KA 1BIAA 2L3QA 3MP6A 2PUOB 2X3WD 3I56T 3HSBA 4ORZA 1ZX6A 1VQ6T 5GAOr 2DTOA 1NYGA 4AT1B 3L2QA 1IB8A 1VQPT 1QCFA 1G2BA 2LX7A 4Z02A 4F7UE 1JB0E 5KYYB 4JDSA 5LJ5h 2RHXA 2DERA 1AEYA 1E6HA 2AK5A 3CCQA 3LYIA 2LQKA 2A3LA 5GANd 2CP7A 2EQJA 4PJOF 1M8MA 1WHKA 2NWMA 3OYMA 5CR2A 1OPKA 1PM3A 1K9MR 1K73R 4AFZC 1YN8A 4DBHA 2QGFB 3DKMA 3VS5A 2F1LA 4M4ZA 1U3OA 2F2WA 3JB9F 5FWBA 4RTTA 2E3IA 2E5QA 1FYNA 1VQOQ 2BKDN 2OTJA 1I81A 5CKHA 4QT7A 2O4XA 3LW5E 4PJOE 2DETA 4J6XA 1Q81U 3NPFA 4OF1A 1JJ2P 3REBB 2HMAA 4RTXA 3RIRA 3SD4A 2DBKA 1BIBA 1QQJA 2A36A 4FSSA 1KSWA 2CS7A 2XK0A 3QO3A 1VQLA 3CCJA 1VQLQ 3FC3A 1PSFA 2LQ8A 4AFUC 2K79A 1RADB 3MEUA 1K8AR 2RHYA 1UJYA 3META 1KC8U 4JZ3A 3CMAT 1NLOC 4BY6C 1T3SA 2CP2A 2C0IA 3OYHA 5I21A 3KXTA
chains in the Genus database with same CATH topology
3JCMQ 3DLLA 1YJWT 4M7AD 3JCMe 2F69A 5FU6C 4OVAA 1I8FA 2VXEA 5GANe 4C0DB 4XK8E 4L5GA 3S3NA 5GAOq 2XDBA 2HQEA 2K3YA 4F7UF 3MEWA 1KHCA 2M16A 3CCEA 2EJ9A 3V7SA 3CCMA 4E7IA 1G5VA 4C5EA 2AHJB 5J26A 3OS2A 4M77A 3WVDB 3CXCS 2RB6A 5CQXA 5GMKm 5CIUA 2BIVA 1Q81C 5GANf 1ZBXA 4KULA 4KUDK 2OAUA 1M5Q1 3CXCA 3RERA 2PVGB 1U1SA 3PMTA 3VKIA 2DTIA 5LL6S 1BKBA 2DZCA 3CCRT 3GP8A 2JOYA 3OBYA 3T9NA 4ZN1A 2XDDA 4DOVA 4PLIA 5CO7A 3HFNA 2FB7A 3M59A 3VYHB 4JLIA 2RJFA 5GAN7 3LH0A 2L8DA 3JCMg 3CMEA 4C5IA 2CGHA 1DJ7B 2RJCA 3E1SA 3KUFA 5GANg 3CBPA 2O01E 1VQOT 1YIJA 5FU6B 1Y96B 2Y4XA 4M75G 1WJRA 4M78D 1WJSA 3L2ZA 5EG2A 3UWNA 5KE2A 5LJ5j 3QHSA 1D3BA 2LC4A 4C92C 1NE8A 2EQMA 2P0PA 3JRZA 1EIFA 5DLOA 2DZ9A 2ZPFB 4PJOD 1O75A 4C92E 3NTHA 3ER0A 4JRKA 2LT1A 3S6WA 3V8LA 4LDXA 2RHUA 3OS5A 3SWNA 2HD0A 4B9WA 2X4XA 3L2UA 4BE0A 3M4YA 1MHNA 3A8GB 2R5AA 2RJEA 3GF5A 3M56A 3MO8A 3SB2A 3JB9D 4M75D 4IURA 2E41A 3INZA 3CCUT 3UDCA 5DY9A 1FWZA 2L5QA 1ZQ1A 2RM4A 4LDVA 4C8QA 3J81E 1LJOA 2K5IA 2D9TA 4XQ3A 1VQKT 4LDUA 4M77C 2XI9A 1KC8C 5FU7C 3WVEB 3X20B 3E9FA 4LD6A 4M77E 2CZ1B 4JUVA 1Q82C 1K9MC 4HCZA 3TCJA 1K73C 2CZ7B 2RI3A 1LNXA 3HPWA 3CCLT 2E10A 2MF2A 4C92B 4VUBA 3PIOA 3OYAA 3C95A 3CBMA 4JRQA 1Y7XA 4A4HA 4M7DA 2XICA 4A4FA 2WACA 4ZN3A 4Y28E 3UPUA 2A7YA 1M1KU 3PIPA 3S3OA 2JVVA 3CMAA 1QVFS 4N0AA 5HK0A 3CCVA 3CC2A 3E19A 5M9OA 4KT0E 2EAYA 4XTWA 3HFOA 5A2QE 1VQ9A 1X6OA 3C12A 2M9UA 4FT4A 2QEXT 1QVFA 2M1HA 1Y71A 2P0QA 1VQNT 3BDUA 4BI3A 3JCMh 1IREB 2H3JA 2ZPEB 4M77B 4RCBA 4OGEA 4BB7A 4R55A 1JJ2S 5GANh 2NLUA 5FU7B 2EWNA 3G6ET 4RCCA 2ZPBB 1RL2A 3RESA 2RJDA 5KE3A 2JUFA 4GY5A 3SWNC 4LD9K 2ZPHB 5LJ5e 5GAN4 2DO3A 3JSCA 3CC7T 1JJ2A 4A4EA 3BY7A 4XTYA 3QIIA 4E7LA 1LOJA 3OYNA 3OA6A 4C8QC 3QBYA 1KQSS 3A8HB 1N8RU 2MWPA 3JCMJ 3JCMc 3PTAA 4OB2B 3V8JA 2RD1A 2MAMA 4V2SA 4C8QE 3OYFA 4A54A 3CCRA 3OYYA 2M0OA 5LJ5f 3I56A 2RO0A 4J7FA 1VQ4A 1KQSA 2Y90A 3OS0A 4RKUE 1N27A 2F5KA 1VQ6A 5J3BA 3OYJA 3MHXA 3ME9A 3FJPA 2QQSA 1VQPA 1D3BB 1NPRA 3NTKA 3MP1A 4ME7A 1M90U 3GNGA 5C0MA 4M7DC 4QVCA 1VQ8T 4HA8A 3H8ZA 3V7RA 2HAXA 1V29B 1Q82U 1K9MU 4IUPA 4M7DE 4J5YA 4C92G 3X26B 4BUGA 2PUKB 4QVZA 3OYEA 3FLGA 1TH7A 5LJ3j 5LJ5g 4BDYA 5GAN2 4JJNK 2PQWA 1QVPA 3SWNB 1K8AC 3RKYA 2X35A 3LGLA 2RHZA 4IUVA 2GFAA 2LDMA 3ZFJA 4A53A 2KDSA 3CD6A 4BI8B 5GAMj 3V8KA 1M4ZA 2G3RA 2I2LA 4C8QB 2YLBA 3JAME 2V8KA 3X28B 3M54A 4HT8A 4XU3A 3OSSC 4JRPA 4LDYA 2DKGA 2R5MA 3PT9A 2K5FA 3QYGB 4MZPA 4KBMB 2XU8A 2XDPA 4UC4A 3BFMA 4C92D 2QQRA 3M55A 4FT2A 3M4GA 5DM7R 1KQ2A 2K4YA 1VQ7T 4Y91A 4TVRA 4M77G 2XD0A 3FIFA 3OW2S 3G71T 2LCLA 2KVQG 2RI5A 2QQ9A 5CKFA 5D6XA 3I55T 2DEQA 4C92F 1M1KC 1XNIA 5FRNA 4M7DB 1WJQA 5D6YA 4B9XA 3CC4T 3HP9A 1WQ7A 4II1A 4RG8A 3FEOA 1BI0A 3OW2A 2QQAA 4KUIA 1Y07A 4OB3B 1VIEA 2E6NA 2RK1A 3Q1JA 3X25B 3PGGA 2E70A 4RG2A 3GLXA 4EMGA 1RI0A 3OMGA 4OB0B 1KQ1A 1HXDA 1W4SA 3QXEB 3CCST 3PFSA 1VQLT 4M77D 2IVWA 4D6WA 4Q5WA 4MMLA 4N4HA 3CCJT 3L42A 2CZ6B 1VQ5T 2DIQA 2FHDA 1K73U 2OTLT 2KY9A 2ZGWA 4M77F 2JZ2A 2JNGA 3OYGA 1S72A 2XHCA 5AYFA 2E6ZA 4BD3A 3QZ9B 3JB9J 3N5BB 1UGQB 2WSFE 3PNWC 1O9SA 2V8IA 4A4KA 1UEBA 1N8RC 2B8AA 1VQMT 3RMSA 4EMKA 1YITT 1U1TA 3JCMX 3FDRA 2DD4A 2KQWA 3JB9H 2EJFA 4J6WA 5A0DA 4QQGA 3GOXA 1MGQA 2D6FA 3M53A 1K8AU 1XOVA 4XTZA 1U8RA 2DXUA 2QA4T 4XU1A 4C8QG 1M90C 1KG1A 4ZTFA 3C94A 3RKWA 2QI2A 3URGA 5KCHA 5GAOp 5KCOA 1WQWA 2XIDA 3M5AA 1P92A 5GAMe 4MZTA 2P4TA 5CAIA 5IN1A 4J8OA 2DAQA 3HRSA 4O5VA 5GMKj 5LJ3f 3SFMA 2JTMA 3R6OA 4IUQA 1QW1A 2YLCA 3QKJA 2ZPGB 1UB4A 3LGFA 3DB3A 3TU4K 4QQDA 1YI2T 3CCET 3A8LB 4ELZC 3CCMT 3PMIA 4MZMA 5I2MA 4JS4A 1UGRB 3VYGA 3J80E 1YJNT 4X34A 4M7DG 5A0GA 2KAFA 1NZ9A 3OBWA 3OQ5A 4M7AB 3RUXA 5GAN3 2DXTA 4C8QD 5GAMf 3L1AA 2EYQA 4BACA 1YHQA 3AHUA 2HQXA 1YJ9A 2E12A 2E1HA 3DLMA 2DXCA 1WNLA 4M78C 3A8MB 3VU3C 3ZBDA 2VC8A 3ZEHA 4C8QF 4NOYA 1VQOA 1YJWA 4C5GA 4FU6A 2PVDB 4WF2A 3X24B 2C06A 3F70A 4M78E 4PLLA 1W2BS 1ZHIA 1WGSA 4N4GA 1JRIA 5LJ5d 3LLRA 4ZGEB 4HKEA 3OYBA 4M7DD 5GAMg 3CMET 5GAOn 1AHJB 3OS1A 4BE2A 1NJIC 4N4IA 3A8OB 2DD5A 5D6WA 2VV5A 1JBMA 5FLXE 1W2BA 2GCXA 4EMKC 4LDWA 1Q86C 5LJ3d 4M7DF 4OB1B 5DLQE 4P5NA 3G4ST 2QTXA 3M57A 2X4WA 3NTIA 3QYHB 1BI2A 4J83A 4E7HA 2F5TX 5A0LA 2K3XA 3OY9A 4JS5A 2DTHA 5GAMd 3CCQT 2KMTA 4E7KA 2RI2A 2WSCE 3QJYA 3JCMW 4IKFA 5IT9E 5GMKl 3OB9A 1OYXA 1H3ZA 2GF7A 4M78B 4XTVA 1IZ6A 4BE1A 4A4GA 4XTUA 3FB9A 4ELYC 2L89A 4PKCC 2DIGA 4PJOB 3L2WA 5GAN8 2XG8D 2QDYB 2DJZA 3G7ZA 4FSXA 4J6YA 3MP8A 3TEEA 2DK3A 2YHTA 2VXFA 4FIBA 1B34B 4L59A 5HKCA 1G3YA 4EMKB 2K57A 3VUZA 4M7AA 3V7CA 3DB4A 1N6AA 3BDLA 5GMKe 2OTJT 4F7UA 4M75B 4QW2A 5CCAA 4M7AG 2LVMA 5CKBA 2CYZB 2RHIA 3O8VA 4DQ2A 1VQMA 2VYTA 3CEYA 5IAYA 2EKOA 4QQ6A 2X4JA 2PVOB 3P8HA 4ZTJA 3HL8A 1XQHA 3HHTB 3CCUA 3HRTA 5L8RE 4C0FA 3QUIA 2CKKA 4ATOA 2GFUA 4XU2A 4XU0A 3CCVT 4NL3A 3CC2T 1VQKA 3QSUA 1VQ9T 3A5ZB 4XAXB 4NS5A 1QP3A 4DOWA 4E47A 4EMHA 4OP0A 3VUBA 3QDRB 5GAN5 1KD1C 1NJIU 3M58A 3VJPA 4E7JA 1GXIE 4CRIA 1N9RA 4MMKA 4YTLA 3BW1A 3OYDA 4X9DA 3VV0A 1Q86U 3E9GA 5GAMh 3CCLA 2EFIA 3LX7A 3LWHA 4M7AF 1M1GA 5GAOm 3QJ6A 1FXXA 5J39A 1YI2A 2ZZDA 2Y4YA 4OMFB 3JB9I 1Q7YC 1QVGS 1YJNA 2BUDA 2KK4A 2MMPA 2EIFA 3P8DA 5I2SA 2LCCA 3M9QA 4M78A 3JCMf 4FL6A 4BI4A 2HNIA 3QZ5B 4FM4B 4M78G 1QVGA 2O4XB 3KBGA 2QEXA 2P0KA 4PJOA 1BIAA 1M1FA 2L3RA 5FROA 3MP6A 4BY6B 4PJOG 1YBYA 2K5LA 2XKOC 2PUOB 1VQNA 4MDXA 3I56T 1VQ4T 3EAEA 2IG0A 4C5HA 3HSBA 4M7AC 2EJGA 5GMKi 1B34A 5CQYA 4C0ZA 1VQ6T 3GIBA 5GAOr 2DTOA 1I4K1 4EDUA 5KH6A 2VGNA 3L2QA 3G6EA 4M7AE 1VQPT 3ASKA 4M75A 3GNFB 4Z02A 4F7UE 3C4SA 4O6JA 1JB0E 2ZPIB 3RMQA 3CC7A 2FVUA 1NPPA 3JB9G 4JDSA 5LJ3e 5LJ5h 3G4SA 2RHXA 3L2VA 3CPFA 1X01A 1OZ2A 2JTFA 2R58A 1UGSB 4M78F 3JCMd 3HRUA 3CCQA 3LYIA 2FL7A 4MDWA 3CD6T 2LQKA 2A3LA 2YRVA 5GANd 1PSEA 4CI0C 3CPWS 2LNVA 2EQJA 1M9SA 1YCYA 2JN0A 4PJOF 1G3SA 2K2VA 4QVDA 3OYMA 2EQUA 5CR2A 5CK9A 3OYIA 3S3MA 2X4YA 3CPWA 2GQVA 3DKMA 2FYKA 1VQ8A 1KD1U 3EFRA 1BI1A 2RH2A 5CKDA 3LWIA 4GLKA 4F7UB 3JB9F 4M75F 1QP2A 2E5QA 3FRNA 1BI3A 3MCAB 5LJ3g 1OZ3A 4J7IA 1G3TA 2BKDN 3OSVA 4XTXA 4ZGJB 1I81A 5FRMA 2OTJA 4JRIA 1Q7YU 4PJOC 5CKHA 2VUBA 5GMKh 2O4XA 3H6ZA 3LW5E 1N9SA 1WPYA 4PJOE 5GANj 4J6XA 2D0QB 1Q81U 3HKSA 1R8OB 4OF1A 3NFCA 4IUUA 1YIJT 3QG1A 2HBPA 4RMOA 2R57A 2E64A 4DA4A 4M75C 1VQ7A 2WSEE 4HT9A 3G71A 3I55A 4M75E 2LT4A 3CBOA 3RIRA 3SD4A 2EQKA 1Y96A 3L2RA 1S72T 3CC4A 3OYCA 1I5LA 3JCMV 5HK3A 5C6SA 1OI1A 2QXFA 2LX9A 1BIBA 4EPCA 1VIFA 1SSFA 1XTDA 1KHIA 1X75C 1H641 5CVIA 5CKEA 4JLGA 2CS7A 2MI6A 3CCSA 2XK0A 3QO3A 2RK2A 4C0GA 1VQLA 3CCJA 3JCMP 3WXMB 3EFSA 3FC3A 3MEVA 5GAOl 4C0DC 1VQ5A 2OTLA 3OYKA 1PSFA 2DPPB 2MWOA 4PL6A 2LRQA 3JCMb 2KSSA 1UGPB 3OYLA 2LQ8A 2ZCFB 3MEUA 4X9CA 2CZ0B 4ZGDB 1VUBA 2V8JA 5HY6A 4R56A 4HCCA 4F7UG 3UT1A 2DVEA 4L6V5 2RA2A 1FX7A 4IUTA 4NL2A 1YITA 3RKXA 5GAN6 2RHYA 2PU9B 2E65A 2VGMA 2LTOA 2QQBA 3META 2DXBA 3P8BB 1KC8U 4HCBA 4C92A 3CMAT 3TREA 4PNOA 4BY6C 3SDZA 3QPHA 3OYHA 1YHQT 3J7AF 1M8VA 3MEAA 5I21A 5LJ3h 2QA4A 1YJ9T 1BYMA 1G3WA 3OMCA 1HK9A 4N0AC 3KXTA 3GPLA 4OGCA 4BDZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BY6 C;  5FU7 C;  4C0D C;  5FU6 B;  4C0F A;  4C0G A;  4BY6 B;  5FU6 C;  5FU7 B;  4C0D B; 
#chains in the Genus database with same CATH topology
 3JCM Q;  3DLL A;  1PWT A;  2I0N A;  5FU6 C;  4IIM A;  4C0D B;  4L5G A;  1H8K A;  2K3Y A;  1PKS A;  3MEW A;  2EJ9 A;  4CC2 A;  4C5E A;  5J26 A;  5CQX A;  5CIU A;  3PMT A;  3GP8 A;  2JOY A;  4DOV A;  2CH4 A;  2GTJ A;  3BE3 A;  2BE9 B;  3JCM g;  3CME A;  3PE0 A;  2CGH A;  3UA6 A;  3CME Q;  3G6E Q;  3O5Z A;  3REA B;  1VYT A;  1KFZ A;  4M78 D;  3UWN A;  3G4S Q;  4C92 C;  3JRZ A;  1ZA1 B;  2K2M A;  2JS2 A;  1NM7 A;  4Z89 A;  2HD0 A;  3QWX X;  3A8G B;  2GQI A;  2L3P A;  2KGT A;  3M56 A;  3MO8 A;  3CCU T;  5DY9 A;  4C8Q A;  2NYS A;  2K5I A;  2D9T A;  2DL8 A;  1VQK T;  4M77 C;  1QVF P;  1QMC A;  3MPU B;  3E9F A;  2CZ1 B;  5L23 A;  1K9M C;  1K73 C;  3HPW A;  1ZSZ B;  2DL5 A;  1M2O A;  1Y7X A;  3EG1 A;  4M7D A;  4A4F A;  1W2B P;  2NUP B;  1K4U S;  1IRX A;  1YCS B;  3CC2 A;  2CRE A;  5A2Q E;  3CC2 Q;  2EAY A;  3HFO A;  5IHN A;  1PC0 A;  3C12 A;  2CUB A;  1T0H A;  3EGX A;  1M3B A;  2MK5 A;  3JCM h;  2H3J A;  2CP3 A;  5EC7 A;  2NLU A;  2JJ9 A;  2YUO A;  1MNE A;  2ZPH B;  1OV3 A;  2DFU A;  3BY7 A;  3CCS Q;  3QBY A;  1UHF A;  4JJB A;  2KR3 A;  1QWF A;  2OTL Q;  2RD1 A;  2DE0 X;  2MAM A;  2XMF A;  3PVL A;  2M0O A;  1AWW A;  2F5K A;  2LMJ A;  3OYJ A;  2B86 A;  3MHX A;  2RQV A;  3FJP A;  2QQS A;  1D3B B;  1YIT Q;  1PD0 A;  1EZZ B;  3EFO A;  3EG9 B;  4LE9 A;  4PFO A;  1K9M U;  1K73 U;  2X9H A;  4QVZ A;  5LJ3 j;  1K8A C;  1X27 A;  2GFA A;  2LDM A;  4A53 A;  1D1B A;  5FW9 A;  4KGX B;  1OEB A;  1M27 C;  3V8K A;  2I2L A;  2YLB A;  2V8K A;  3X28 B;  2CT4 A;  4HXJ A;  2K5F A;  4KBM B;  3CCM Q;  3M55 A;  3FIF A;  5CKF A;  4PK4 A;  1Q7Y R;  1XNI A;  1WQ7 A;  4RG8 A;  3FEO A;  2C0O A;  1VIE A;  2J7I A;  2RK1 A;  1QCN A;  2VVK A;  4J9I A;  4EMG A;  4OB0 B;  3QXE B;  1YIJ Q;  1VQL T;  4D6W A;  3CCJ T;  3TSZ A;  3L42 A;  1UUE A;  2DIQ A;  2ZGW A;  3NGP A;  1SF9 A;  4BD3 A;  3QZ9 B;  3JB9 J;  3N5B B;  1F1B B;  2B8A A;  3FDR A;  2DD4 A;  1W70 A;  4LUE A;  1K8A U;  2GBQ A;  1E6G A;  4XTZ A;  2DXU A;  4C8Q G;  5KCH A;  2ROT A;  2QGG A;  1WQW A;  2XID A;  5GAM e;  2P4T A;  1C1A A;  2DAQ A;  1EX4 A;  5I22 A;  1RLP C;  1QW1 A;  2ZPG B;  4M7D G;  3J80 E;  4X34 A;  2KAF A;  4C8Q D;  5GAM f;  4BAC A;  2EYQ A;  1YHQ A;  2JTE A;  1YHQ Q;  2EW3 A;  2HQH A;  2VC8 A;  4NOY A;  4M78 E;  1CKB A;  1WGS A;  1KIK A;  2DVJ A;  3OYB A;  4M7D D;  2HBW A;  3CME T;  4BE2 A;  4N4I A;  2A28 A;  4EMK C;  5LJ3 d;  3G4S T;  3RDV A;  1PKT A;  2RQR A;  2KNB B;  4E7H A;  2F5T X;  3E2U A;  3OY9 A;  2DTH A;  3VS1 A;  7AT1 B;  5IT9 E;  5GMK l;  3CCR Q;  3OB9 A;  3EG3 A;  2C0T A;  1IZ6 A;  4BE1 A;  4A4G A;  4XTU A;  1VA7 A;  2FPF A;  4ELY C;  2M51 A;  4JPB W;  1OPL A;  4HVV A;  2DJZ A;  3G7Z A;  2RNA A;  1EFN A;  2VXF A;  1B34 B;  3ULR B;  2K57 A;  4E7S A;  4M7A A;  4QW2 A;  1VQM A;  3HL8 A;  1RAA B;  4XU0 A;  3CC2 T;  2YUQ A;  3M0U A;  4HCK A;  2DL7 A;  1WFW A;  5GAN 5;  2YUP A;  1GXI E;  1N9R A;  4YTL A;  2CP5 A;  3BW1 A;  3VV0 A;  1SSH A;  1X2Q A;  2AKK A;  1M1K R;  4FW1 A;  1AWX A;  1RLQ C;  3LX7 A;  3LWH A;  3QJ6 A;  4OMF B;  1QVG S;  1Q7Y C;  2YRC A;  4LN2 A;  2LP5 A;  2LCC A;  3QZ5 B;  2JMC A;  1QVG A;  2QEX A;  1WYX A;  5FRO A;  4BY6 B;  4PJO G;  1YBY A;  2OJ2 A;  2RPN A;  4C5H A;  5GMK i;  5CQY A;  4C0Z A;  1YWP A;  5KH6 A;  3ASK A;  4M75 A;  3GNF B;  4O6J A;  1K0X A;  2ZPI B;  3RMQ A;  3CC7 A;  1N8R R;  2FVU A;  1NPP A;  3JB9 G;  2PNI A;  2EYY A;  2YRD A;  1M2V B;  1OZ2 A;  1AWO A;  1TUD A;  2YRV A;  1PCX A;  2JN0 A;  4QVD A;  2L0A A;  4E2F B;  2EQU A;  5CK9 A;  4J9H A;  4KH1 B;  1A0N B;  1GRI A;  2GQV A;  2FYK A;  1LCK A;  3LWI A;  4GLK A;  4F7U B;  1QP2 A;  1WX6 A;  1BI3 A;  1AWJ A;  1RAC B;  3M0T A;  1G3T A;  2D0N A;  3OSV A;  1Q7Y U;  2VUB A;  1C6V X;  3H6Z A;  2V26 A;  1N9S A;  1WPY A;  5GAN j;  2D0Q B;  1I0C A;  3NFC A;  1YIJ T;  2SRC A;  2R57 A;  4AG1 C;  2LNH B;  4DA4 A;  1VQ7 A;  2WSE E;  3CBO A;  2EQK A;  1ZSG A;  3CC4 A;  3JCM V;  3VS4 A;  5KYU A;  5HK3 A;  3CC4 Q;  2DA9 A;  1VIF A;  2KXC A;  4AFS C;  2AZS A;  1KHI A;  3SHW A;  5CVI A;  1YP5 A;  3EH1 A;  2J6O A;  2MI6 A;  2KEA A;  4OMM A;  3I5R A;  3WXM B;  3UAT A;  2ECZ A;  2DPP B;  4PL6 A;  2LRQ A;  2KSS A;  1AT1 B;  3OYL A;  2OI3 A;  1AOJ A;  3EHR A;  4ZGD B;  1VUB A;  2EPD A;  4R56 A;  2DJQ A;  2FPD A;  2IPO B;  2RA2 A;  1FX7 A;  3HTR A;  2LTO A;  1YHQ T;  3J7A F;  3CXC P;  1BK2 A;  2JW4 A;  1VQK Q;  2MOX A;  4M7A D;  3JCM e;  2F69 A;  2FG0 A;  1JXO A;  1JXM A;  4XK8 E;  3S3N A;  3PVQ A;  1JO8 A;  4F7U F;  3CCE A;  1OQK A;  1YI2 Q;  3H41 A;  3VRZ A;  2AHJ B;  3OS2 A;  2AKL A;  1YJN Q;  2RB6 A;  1MUZ A;  2BIV A;  1Q81 C;  2EYW A;  4KUD K;  2OAU A;  3RER A;  2MIO A;  1PNJ A;  1U1S A;  3VKI A;  5LL6 S;  2DZC A;  3CCR T;  1MV3 A;  4ZN1 A;  4FYW B;  2RF0 A;  1IGQ A;  4JLI A;  5GAN 7;  4C5I A;  5FWC A;  2RJC A;  3E1S A;  1AVZ C;  3KUF A;  5KYW A;  5GAN g;  4RTW A;  1Y96 B;  2Y4X A;  4M75 G;  1WJR A;  1WJS A;  5EG2 A;  5KE2 A;  4F04 B;  1D3B A;  2LC4 A;  5DLO A;  2ZPF B;  3EG9 A;  1O75 A;  4C92 E;  2HKQ B;  3CCQ Q;  4JRK A;  2LT1 A;  3V8L A;  4LDX A;  2RHU A;  2KT1 A;  2X4X A;  1RAG B;  3SB2 A;  4M75 D;  2L5Q A;  3RBB B;  2DL3 A;  1LJO A;  1Z9Z A;  3M0R A;  6AT1 B;  1KC8 C;  3WVE B;  4M77 E;  1LNX A;  2OTJ Q;  2E10 A;  3PIO A;  3CBM A;  4JRQ A;  4A4H A;  2DM1 A;  2XIC A;  2OAW A;  1QCO A;  1VOM A;  2A7Y A;  1M1K U;  3PIP A;  3S3O A;  1QVF S;  1Q95 G;  3E19 A;  5M9O A;  4XTW A;  1VQ9 A;  2CDT A;  2QEX T;  1VQ9 Q;  1M30 A;  1QVF A;  1Y71 A;  4OMP A;  1KQS P;  1IHV A;  1IRE B;  4R0K A;  4OGE A;  5KYN A;  3LH5 A;  5GAN h;  2W0Z A;  1ABQ A;  2BE7 D;  5FU7 B;  2EWN A;  2ZPB B;  1RL2 A;  2RJD A;  4GY5 A;  4HVW A;  2DO3 A;  3CC7 T;  3M0S A;  4A4E A;  1RAE B;  3CCJ Q;  2YDL A;  4OMQ A;  4C8Q C;  2J6F A;  1N8R U;  3JCM c;  2X51 A;  3AT1 B;  4V2S A;  4A54 A;  2RN8 A;  3OYY A;  2RO0 A;  2Y90 A;  4RKU E;  1N27 A;  2ED1 A;  3ME9 A;  3JV3 A;  1M90 U;  1NPR A;  2DYB A;  3MP1 A;  4ME7 A;  5C0M A;  4M7D C;  2LQW A;  3H8Z A;  1UG1 A;  3V7R A;  1GCQ C;  3OYE A;  3X26 B;  4BUG A;  2PUK B;  2PQW A;  3SWN B;  2X35 A;  1D1A A;  3CD6 A;  3KFV A;  3CD6 Q;  2G3R A;  2KE9 A;  3EGD B;  4XU3 A;  3OSS C;  2CSI A;  3PT9 A;  3QYG B;  4UC4 A;  3JCM J;  4X1V A;  2XDP A;  3BFM A;  5I11 A;  2JT4 A;  1NEG A;  2W10 A;  2K4Y A;  1VQ7 T;  2KVQ G;  2RI5 A;  4KH0 B;  5D6X A;  4LUD A;  2DEQ A;  3CC4 T;  4B9X A;  1WLP B;  1TG0 A;  2JM8 A;  2HCK A;  2E6N A;  3Q1J A;  4RG2 A;  3RR6 A;  2CP0 A;  2HL3 A;  4CC7 A;  1W4S A;  4ANJ A;  3FJ5 A;  5IHK A;  2GTO A;  2FHD A;  1UDL A;  1S72 A;  2XHC A;  4PJM A;  1UGQ B;  3PNW C;  1N5Z A;  1VYU A;  3RMS A;  1U1T A;  3JCM X;  2KQW A;  4J6W A;  5A0D A;  4QQG A;  1MGQ A;  2D6F A;  3M53 A;  5IH2 A;  1U8R A;  4XU1 A;  3C94 A;  2QI2 A;  4J8O A;  1SRM A;  4O5V A;  5GMK j;  5LJ3 f;  2YLC A;  3QKJ A;  3TU4 K;  1YI2 T;  3CCE T;  4ELZ C;  1GCQ A;  3H0F A;  1YJN T;  3OQ5 A;  2DXT A;  4J9C A;  1TTH B;  2HL5 C;  3ZEH A;  3DLM A;  2DXC A;  1WNL A;  2ABL A;  2V1Q A;  1M3C A;  1YJW A;  4JJD A;  2PVD B;  4WF2 A;  3UF4 A;  1UGV A;  3GBQ A;  4PLL A;  3I35 A;  2K7A A;  4JJC A;  1ZHI A;  1JRI A;  3LLR A;  4ZGE B;  1U06 A;  5GJW B;  5ECA A;  1JEG A;  2KRN A;  3QWY A;  1JBM A;  4OB1 B;  5DLQ E;  2QTX A;  2NUT A;  3QYH B;  4RTU A;  5A0L A;  3TSW A;  3CCQ T;  2KYB A;  2WSC E;  2HDA A;  4K11 A;  2GF7 A;  4M78 B;  3FB9 A;  4PKC C;  3L2W A;  5GAN 8;  2QDY B;  3MP8 A;  4L59 A;  2L3S A;  1QKW A;  2HEQ A;  3VUZ A;  3V7C A;  4JZ4 A;  1N6A A;  2OTJ T;  4F7U A;  4DBR A;  5CCA A;  2LVM A;  2CYZ B;  3O8V A;  4DQ2 A;  1E7O A;  3P8H A;  2E5K A;  3QUI A;  4ATO A;  2AZV A;  2DF6 A;  4XU2 A;  4NL3 A;  1VQ9 T;  2DNU A;  2EBP A;  2HKN A;  4DOW A;  3QDR B;  2DL4 A;  3CCL A;  2HSE B;  3E9G A;  2EFI A;  1Y57 A;  2ZZD A;  1R0B G;  2FEI A;  2BUD A;  2MMP A;  2ED0 A;  5I2S A;  2HNI A;  1W1F A;  1H3H A;  2O4X B;  3KBG A;  4PJO A;  2L3R A;  4CC3 A;  4OMO A;  2K5L A;  1VQN A;  2KRO A;  4FCY A;  3EAE A;  4PJL A;  1ZUK A;  4M7A C;  2EJG A;  2FRW A;  3GIB A;  1I4K 1;  4EDU A;  3CPW P;  1QKX A;  1U5S A;  1JQQ A;  3VS2 A;  3L2V A;  3CPF A;  1X01 A;  2JTF A;  2R58 A;  4M78 F;  3HRU A;  3CD6 T;  1TUG B;  1G83 A;  1OX8 A;  1PSE A;  2LNV A;  1YCY A;  1G3S A;  2CT3 A;  2LCS A;  1Q82 R;  2X4Y A;  4KGV B;  4Z88 A;  2D1X A;  1X69 A;  3FRN A;  2M02 A;  5LJ3 g;  1OZ3 A;  4ZGJ B;  1GFD A;  4JRI A;  5GMK h;  3NMZ C;  5AT1 B;  1UE9 A;  1R8O B;  2H3E B;  4AG2 C;  2HBP A;  2E64 A;  4M75 C;  2QYZ A;  2FZK B;  3I55 A;  1S72 T;  1Y96 A;  2PTK A;  2Z0W A;  5KYY A;  5C6S A;  1J3T A;  1OI1 A;  2QXF A;  2YT6 A;  4EPC A;  2EGA A;  1SSF A;  1XTD A;  1H64 1;  5CKE A;  4JLG A;  2RK2 A;  4FYX B;  5IHI A;  1GL5 A;  3EFS A;  4C0D C;  3OYK A;  2L2P A;  3JCM b;  2ZCF B;  3EGU A;  4X9C A;  1JU5 C;  1WDX A;  4F7U G;  4L6V 5;  4IUT A;  4NL2 A;  3RKX A;  1VQM Q;  1GBQ A;  2EGE A;  2QQB A;  2DXB A;  4HCB A;  1I5O B;  2YXY A;  2COY A;  3TRE A;  4PNO A;  3SDZ A;  3QPH A;  1M8V A;  1MMA A;  5LJ3 h;  2QA4 A;  3UA7 A;  4N0A C;  2ENM A;  3GPL A;  4BDZ A;  1YJW T;  1RAF B;  4Y92 A;  4OVA A;  2VXE A;  5GAN e;  4WTO B;  3VS3 A;  2XDB A;  2HQE A;  3V7S A;  2X3X D;  1G5V A;  1K76 A;  3CXC S;  4IIO A;  2DBM A;  1IO6 A;  1ZLM A;  5GAN f;  1ZBX A;  4KUL A;  1I1J A;  3U23 A;  3CXC A;  2PVG B;  2QEX Q;  4DEY A;  8ATC B;  1BKB A;  2JM9 A;  2XDD A;  2ESW A;  4PLI A;  2FB7 A;  2RJF A;  1R77 A;  3LH0 A;  2L8D A;  3CBP A;  5FU6 B;  1S1N A;  3SEM A;  3L2Z A;  2EYZ A;  3NHN A;  5LJ5 j;  3CC7 Q;  2EQM A;  2QDL A;  4J9F A;  1EIF A;  2DZ9 A;  4PJO D;  1PRM C;  1SRL A;  3NTH A;  1M90 R;  2BZ8 A;  3S6W A;  3VS6 A;  3SWN A;  2DEU A;  4B9W A;  1BCO A;  3L2U A;  3M4Y A;  2RJE A;  3JB9 D;  2H8H A;  2E41 A;  3INZ A;  1IXD A;  2FRY A;  2MCN A;  3UDC A;  2RM4 A;  1RAI B;  3J81 E;  3EGD A;  2EQI A;  4LDU A;  2XI9 A;  2QG9 B;  1X6B A;  3X20 B;  4JUV A;  1Q82 C;  2D8J A;  3TCJ A;  2J05 A;  2CZ7 B;  2RI3 A;  3CCL T;  3EFO B;  2MF2 A;  4C92 B;  2COW A;  4Y28 E;  2SEM A;  2O31 A;  1W6X A;  2JVV A;  1ABO A;  3CMA A;  4N0A A;  3CCV A;  2ZAE A;  3CCV Q;  4KT0 E;  1VQ7 Q;  4FT4 A;  1Q86 R;  2M9U A;  5KYX B;  1VQN T;  3BDU A;  2ZPE B;  4M77 B;  4BB7 A;  4R55 A;  1JJ2 S;  1X2K A;  2F2V A;  2K9G A;  1XJW B;  3RNJ A;  3ZL7 C;  3RES A;  2JUF A;  4PJN A;  1JJ2 A;  4QKU A;  3MJX A;  2VB6 A;  1AZE A;  1LOJ A;  3OYN A;  3OA6 A;  1KQS S;  3A8H B;  2MWP A;  2EYX A;  4ZNX A;  3V8J A;  1OOT A;  4C8Q E;  3H0H A;  1VQ4 A;  2DIL A;  2GGR A;  1KQS A;  3OS0 A;  1VQ4 Q;  1NG2 A;  2J06 A;  5J3B A;  4RTZ A;  3GNG A;  4QVC A;  1ZSZ A;  1T3L A;  2HAX A;  1B07 A;  1V29 B;  4D8D A;  4IUP A;  1Q82 U;  4M7D E;  1WXB A;  4J5Y A;  2RQT A;  2DYI A;  5LJ5 g;  2NUP A;  4KRT A;  1WXU A;  3OW2 P;  2LZ6 B;  3LGL A;  4IUV A;  1YWO A;  1UTI A;  1PHT A;  4BI8 B;  4D8K A;  1MMG A;  1M4Z A;  4EIK A;  3JAM E;  1FMV A;  1KD1 R;  4HT8 A;  4LDY A;  5LJ5 d;  4MZP A;  3CCE Q;  1BBZ A;  4FT2 A;  2VKN A;  4TVR A;  1WXT A;  3I55 T;  2CSQ A;  4C92 F;  1M1K C;  2PZ1 A;  5D6Y A;  3HP9 A;  1KK7 A;  1NEB A;  1B7T A;  4OB3 B;  1Y07 A;  3X25 B;  1GFC A;  2E70 A;  3GLX A;  2DRK A;  3OMG A;  1G8X A;  1HD3 A;  1KQ1 A;  1UEC A;  2IVW A;  4N4H A;  2KBT A;  4M77 F;  1Z9Q A;  2JZ2 A;  2E6Z A;  1K1Z A;  1O9S A;  1UEB A;  1N8R C;  1VQM T;  1BCM A;  3JB9 H;  2BTT A;  1PD1 A;  3GOX A;  1MND A;  2QA4 T;  1KG1 A;  1M90 C;  4ZTF A;  3URG A;  5GAO p;  3M5A A;  1P92 A;  4MZT A;  5CAI A;  5IN1 A;  3SFM A;  2JTM A;  4IUQ A;  1AD5 A;  1UB4 A;  3A8L B;  3PMI A;  4MZM A;  5IXF A;  5A0G A;  3OBW A;  4M7A B;  5GAN 3;  1YJ9 A;  2E12 A;  2E1H A;  4BDY A;  3ZBD A;  1VQO A;  1YJ9 Q;  3EHQ A;  4FU6 A;  2C06 A;  1GCP A;  1IGU A;  1CKA A;  1V76 A;  1W2B S;  1WI7 A;  3OS1 A;  5D6W A;  4F17 A;  2VV5 A;  1Q86 C;  1W2B A;  2GCX A;  4LDW A;  2YSQ A;  4P5N A;  3M57 A;  4J83 A;  2K3X A;  4JS5 A;  2KMT A;  1QWE A;  2RI2 A;  1TOV A;  2EKH A;  5D7U A;  1OYX A;  4PFP A;  1RUW A;  1TUC A;  1TWB A;  1SHG A;  2K6D A;  1OUL A;  2L89 A;  2DIG A;  1ZUY A;  2DRM A;  4FSX A;  4J6Y A;  2DK3 A;  4KGZ B;  2YHT A;  4FIB A;  4J9G A;  5HKC A;  4EMK B;  3DB4 A;  3BDL A;  5GMK e;  4M75 B;  2O2O A;  5CKB A;  3CEY A;  5IAY A;  2EKO A;  2PVO B;  3EG2 A;  1K9A A;  4ZTJ A;  1AZG B;  2GFU A;  3CCV T;  3A5Z B;  4XAX B;  3M0Q A;  4OP0 A;  1KD1 C;  3VJP A;  4E7J A;  4CRI A;  4MMK A;  8AT1 B;  1Q86 U;  4M7A F;  1M1G A;  5GAO m;  1FXX A;  1TS9 A;  3A1P A;  4FYY B;  9ATC B;  2KK4 A;  3M9Q A;  2VWF A;  4M78 G;  1ZBJ A;  1M1F A;  1WHL A;  2A37 A;  2YWW A;  1S72 Q;  4MDX A;  2XKO C;  1VQ4 T;  4LXC A;  2IG0 A;  1B34 A;  2COZ A;  2VGN A;  3G6E A;  4M7A E;  3C4S A;  3EG0 A;  5LJ3 e;  3G4S A;  2M0Y A;  5KYU B;  2O9V A;  2P4R A;  3MKD A;  2DLP A;  1ACM B;  1UGS B;  3JCM d;  2FL7 A;  4MDW A;  1OU9 A;  4A63 B;  4CI0 C;  3CPW S;  1M9S A;  2BZY A;  1K0S A;  2K2V A;  4RUG A;  4CC4 B;  4F14 A;  3TVT A;  3OYI A;  3S3M A;  3CPW A;  1VQ8 A;  1KD1 U;  3EFR A;  1BI1 A;  2RH2 A;  5CKD A;  1VQ8 Q;  2JS0 A;  2D8H A;  4M75 F;  3IQL A;  1ARK A;  4E7Z A;  3MCA B;  3R6N A;  4J7I A;  2G6F X;  4XTX A;  1YJW Q;  5FRM A;  4PJO C;  2DX1 A;  3QDF A;  3HKS A;  4IUU A;  3QG1 A;  4RMO A;  4HT9 A;  3G71 A;  4M75 E;  3G71 Q;  2LT4 A;  4E6R A;  3L2R A;  3OYC A;  1I5L A;  2KT8 A;  1M2V A;  2LX9 A;  1X75 C;  1UHC A;  3A98 A;  1M3A A;  3CCS A;  4C0G A;  1BU1 A;  3JCM P;  1TXQ A;  3MEV A;  5GAO l;  1VQ5 A;  2BZX A;  2JMA A;  2OTL A;  2MWO A;  1VQ5 Q;  1UGP B;  2CZ0 B;  5KYW B;  2V8J A;  5HY6 A;  4HCC A;  3UT1 A;  2DVE A;  1YIT A;  1LVK A;  2PU9 B;  2E65 A;  2VGM A;  3P8B B;  4C92 A;  1BYM A;  3MEA A;  1YJ9 T;  1G3W A;  1YNZ A;  3OMC A;  5HK0 A;  1HK9 A;  1RAH B;  1VQO T;  4OGC A;  2E4H A;  1WA7 A;  1I8F A;  3CCL Q;  5GAO q;  5KYX A;  1D0X A;  2AIR B;  4OMN A;  1KHC A;  2M16 A;  4E7I A;  3CCM A;  4DBF A;  4M77 A;  3WVD B;  2FZG B;  1D0Z A;  4Z8A A;  5GMK m;  2E3H A;  1GBR A;  1M5Q 1;  3TQ7 P;  2DTI A;  3OBY A;  3T9N A;  4HVU A;  1VQN Q;  5CO7 A;  2ATC B;  3HFN A;  3M59 A;  3VYH B;  3H0I A;  1D0Y A;  1HJD A;  1DJ7 B;  1YIJ A;  1T0J A;  2HSP A;  2O01 E;  1D1C A;  4AMC A;  1QLY A;  3QHS A;  4FW2 A;  2OX7 A;  1NE8 A;  2P0P A;  4PFZ A;  1MMN A;  1ZUU A;  1LPL A;  2EGC A;  2VAS A;  3ER0 A;  3OS5 A;  4BE0 A;  1MHN A;  2R5A A;  3GF5 A;  4IUR A;  2CUD A;  2O9S A;  4FYV B;  1FWZ A;  1ZQ1 A;  4LDV A;  2A08 A;  2EVR A;  1WHJ A;  4RTY A;  4XQ3 A;  5FU7 C;  4ESR A;  1ZA2 B;  4LD6 A;  4HCZ A;  4AFQ C;  1HSQ A;  4J9E A;  4VUB A;  3OYA A;  3C95 A;  2WAC A;  4ZN3 A;  3UPU A;  2AT1 B;  1TU0 B;  1CSK A;  1NJI R;  1X6O A;  4DEX A;  3I55 Q;  1NLP C;  2M1H A;  1UFF A;  2P0Q A;  1OX9 A;  4BI3 A;  4RCB A;  3G6E T;  4RCC A;  1RAB B;  5KE3 A;  3SWN C;  4LD9 K;  5LJ5 e;  5GAN 4;  3JSC A;  1D09 B;  4XTY A;  3QII A;  4E7L A;  3CQT A;  1OU8 A;  3PTA A;  4OB2 B;  3G1J A;  5IXB A;  3OYF A;  3CCR A;  5LJ5 f;  3I56 A;  4J7F A;  3I56 Q;  1VQ6 A;  4J9B A;  2FPE A;  1VQ6 Q;  1B3Q A;  1WZO A;  1VQP A;  3NTK A;  1VQP Q;  3D7S B;  1VQ8 T;  4HA8 A;  4C92 G;  2KI7 A;  3FLG A;  1TH7 A;  2FO0 A;  2QA4 Q;  5GAN 2;  4JJN K;  1QVP A;  3RKY A;  2F2X A;  2RHZ A;  2P84 A;  2YUN A;  3ZFJ A;  2KDS A;  5GAM j;  1X43 A;  4C8Q B;  3M54 A;  2GNC A;  4JRP A;  2QAZ A;  2DKG A;  2R5M A;  2XU8 A;  2NUZ A;  4C92 D;  2QQR A;  1SEM A;  1KQ2 A;  3M4G A;  5DM7 R;  2LQN A;  4Y91 A;  2XD0 A;  4M77 G;  3OW2 S;  3G71 T;  2LCL A;  4GBQ A;  2QQ9 A;  2MYS A;  4GLM A;  5FRN A;  2V1R A;  4M7D B;  3I5S A;  1WJQ A;  4II1 A;  1Q81 R;  1BI0 A;  3OW2 A;  2QQA A;  4PJJ A;  2FZC B;  4KUI A;  1HYO A;  3PGG A;  4J9D A;  2KYM A;  1MV0 B;  1WHH A;  1RI0 A;  1HXD A;  3CCS T;  3PFS A;  3EGX B;  1SHF A;  4M77 D;  4Q5W A;  4MML A;  2CZ6 B;  1H92 A;  1ZSZ C;  1VQ5 T;  2O88 A;  2HZY A;  2OTL T;  2KY9 A;  1PRL C;  1VYV A;  1WIE A;  3THK A;  3OYG A;  2JNG A;  1FMK A;  5AYF A;  2WSF E;  2QTV A;  2V8I A;  4A4K A;  1YIT T;  4EMK A;  2LJ0 A;  2NUT B;  1NBE B;  2EJF A;  1XOV A;  2KRM A;  2ROL A;  2DMO A;  3H9N A;  3RKW A;  2QK0 A;  5KCO A;  3HRS A;  1KC8 R;  3R6O A;  2A0F B;  3VS0 A;  3LGF A;  3DB3 A;  1H3Z A;  4QQD A;  1KJW A;  3CCM T;  5I2M A;  4JS4 A;  1UGR B;  3VYG A;  1SG5 A;  1NZ9 A;  3RUX A;  2K3B A;  1MMD A;  1FMW A;  3L1A A;  3C0C A;  3AHU A;  3CMA Q;  2HQX A;  2MPX C;  1IHW A;  4M78 C;  5GAN 6;  3A8M B;  3VU3 C;  1UJ0 A;  4C8Q F;  4C5G A;  3X24 B;  1C0M A;  3F70 A;  1BB9 A;  4N4G A;  1WHG A;  4HKE A;  5GAM g;  5GAO n;  1AHJ B;  1NJI C;  5GJV B;  1V1C A;  3A8O B;  2DD5 A;  5FLX E;  2KRS A;  4M7D F;  1PG5 B;  2X4W A;  3NTI A;  2JXB A;  3EH2 A;  1BI2 A;  3VRY A;  2IIM A;  5GAM d;  4E7K A;  3QJY A;  3JCM W;  4IKF A;  3I9Q A;  2KXD A;  4B6M A;  4XTV A;  1SPK A;  4PJO B;  2XG8 D;  3TEE A;  1X6G A;  1G3Y A;  1I07 A;  4RTV A;  2RMO A;  2LJ1 A;  4OML A;  4M7A G;  2RHI A;  2VYT A;  4QQ6 A;  2X4J A;  2CH4 W;  3VS7 A;  1XQH A;  2CP6 A;  3HHT B;  3M0P A;  3HRT A;  5L8R E;  4C0F A;  2RQU A;  3CCU A;  2LJ3 A;  3CCU Q;  2CKK A;  1QVG P;  1VQK A;  1NYF A;  3QSU A;  4NS5 A;  1R0C B;  1QP3 A;  1TSF A;  1YFN A;  4E47 A;  1Y0M A;  4EMH A;  3VUB A;  1NJI U;  3M58 A;  4F16 A;  3OYD A;  4X9D A;  5GAM h;  4DBQ A;  4WCI A;  1SKU B;  2QAS A;  1YI2 A;  2RQW A;  4LNP A;  5J39 A;  2Y4Y A;  3JB9 I;  1YJN A;  3P8D A;  2EIF A;  1RI9 A;  4M78 A;  3JCM f;  5HCK A;  4FL6 A;  4BI4 A;  2J6K A;  1WHM A;  4FM4 B;  2P0K A;  1BIA A;  2L3Q A;  3MP6 A;  2PUO B;  2X3W D;  3I56 T;  3HSB A;  4ORZ A;  1ZX6 A;  1VQ6 T;  5GAO r;  2DTO A;  1NYG A;  4AT1 B;  3L2Q A;  1IB8 A;  1VQP T;  1QCF A;  1G2B A;  2LX7 A;  4Z02 A;  4F7U E;  1JB0 E;  5KYY B;  4JDS A;  5LJ5 h;  2RHX A;  2DER A;  1AEY A;  1E6H A;  2AK5 A;  3CCQ A;  3LYI A;  2LQK A;  2A3L A;  5GAN d;  2CP7 A;  2EQJ A;  4PJO F;  1M8M A;  1WHK A;  2NWM A;  3OYM A;  5CR2 A;  1OPK A;  1PM3 A;  1K9M R;  1K73 R;  4AFZ C;  1YN8 A;  4DBH A;  2QGF B;  3DKM A;  3VS5 A;  2F1L A;  4M4Z A;  1U3O A;  2F2W A;  3JB9 F;  5FWB A;  4RTT A;  2E3I A;  2E5Q A;  1FYN A;  1VQO Q;  2BKD N;  2OTJ A;  1I81 A;  5CKH A;  4QT7 A;  2O4X A;  3LW5 E;  4PJO E;  2DET A;  4J6X A;  1Q81 U;  3NPF A;  4OF1 A;  1JJ2 P;  3REB B;  2HMA A;  4RTX A;  3RIR A;  3SD4 A;  2DBK A;  1BIB A;  1QQJ A;  2A36 A;  4FSS A;  1KSW A;  2CS7 A;  2XK0 A;  3QO3 A;  1VQL A;  3CCJ A;  1VQL Q;  3FC3 A;  1PSF A;  2LQ8 A;  4AFU C;  2K79 A;  1RAD B;  3MEU A;  1K8A R;  2RHY A;  1UJY A;  3MET A;  1KC8 U;  4JZ3 A;  3CMA T;  1NLO C;  4BY6 C;  1T3S A;  2CP2 A;  2C0I A;  3OYH A;  5I21 A;  3KXT A; 
#chains in the Genus database with same CATH homology
 3JCM Q;  3DLL A;  1YJW T;  4M7A D;  3JCM e;  2F69 A;  5FU6 C;  4OVA A;  1I8F A;  2VXE A;  5GAN e;  4C0D B;  4XK8 E;  4L5G A;  3S3N A;  5GAO q;  2XDB A;  2HQE A;  2K3Y A;  4F7U F;  3MEW A;  1KHC A;  2M16 A;  3CCE A;  2EJ9 A;  3V7S A;  3CCM A;  4E7I A;  1G5V A;  4C5E A;  2AHJ B;  5J26 A;  3OS2 A;  4M77 A;  3WVD B;  3CXC S;  2RB6 A;  5CQX A;  5GMK m;  5CIU A;  2BIV A;  1Q81 C;  5GAN f;  1ZBX A;  4KUL A;  4KUD K;  2OAU A;  1M5Q 1;  3CXC A;  3RER A;  2PVG B;  1U1S A;  3PMT A;  3VKI A;  2DTI A;  5LL6 S;  1BKB A;  2DZC A;  3CCR T;  3GP8 A;  2JOY A;  3OBY A;  3T9N A;  4ZN1 A;  2XDD A;  4DOV A;  4PLI A;  5CO7 A;  3HFN A;  2FB7 A;  3M59 A;  3VYH B;  4JLI A;  2RJF A;  5GAN 7;  3LH0 A;  2L8D A;  3JCM g;  3CME A;  4C5I A;  2CGH A;  1DJ7 B;  2RJC A;  3E1S A;  3KUF A;  5GAN g;  3CBP A;  2O01 E;  1VQO T;  1YIJ A;  5FU6 B;  1Y96 B;  2Y4X A;  4M75 G;  1WJR A;  4M78 D;  1WJS A;  3L2Z A;  5EG2 A;  3UWN A;  5KE2 A;  5LJ5 j;  3QHS A;  1D3B A;  2LC4 A;  4C92 C;  1NE8 A;  2EQM A;  2P0P A;  3JRZ A;  1EIF A;  5DLO A;  2DZ9 A;  2ZPF B;  4PJO D;  1O75 A;  4C92 E;  3NTH A;  3ER0 A;  4JRK A;  2LT1 A;  3S6W A;  3V8L A;  4LDX A;  2RHU A;  3OS5 A;  3SWN A;  2HD0 A;  4B9W A;  2X4X A;  3L2U A;  4BE0 A;  3M4Y A;  1MHN A;  3A8G B;  2R5A A;  2RJE A;  3GF5 A;  3M56 A;  3MO8 A;  3SB2 A;  3JB9 D;  4M75 D;  4IUR A;  2E41 A;  3INZ A;  3CCU T;  3UDC A;  5DY9 A;  1FWZ A;  2L5Q A;  1ZQ1 A;  2RM4 A;  4LDV A;  4C8Q A;  3J81 E;  1LJO A;  2K5I A;  2D9T A;  4XQ3 A;  1VQK T;  4LDU A;  4M77 C;  2XI9 A;  1KC8 C;  5FU7 C;  3WVE B;  3X20 B;  3E9F A;  4LD6 A;  4M77 E;  2CZ1 B;  4JUV A;  1Q82 C;  1K9M C;  4HCZ A;  3TCJ A;  1K73 C;  2CZ7 B;  2RI3 A;  1LNX A;  3HPW A;  3CCL T;  2E10 A;  2MF2 A;  4C92 B;  4VUB A;  3PIO A;  3OYA A;  3C95 A;  3CBM A;  4JRQ A;  1Y7X A;  4A4H A;  4M7D A;  2XIC A;  4A4F A;  2WAC A;  4ZN3 A;  4Y28 E;  3UPU A;  2A7Y A;  1M1K U;  3PIP A;  3S3O A;  2JVV A;  3CMA A;  1QVF S;  4N0A A;  5HK0 A;  3CCV A;  3CC2 A;  3E19 A;  5M9O A;  4KT0 E;  2EAY A;  4XTW A;  3HFO A;  5A2Q E;  1VQ9 A;  1X6O A;  3C12 A;  2M9U A;  4FT4 A;  2QEX T;  1QVF A;  2M1H A;  1Y71 A;  2P0Q A;  1VQN T;  3BDU A;  4BI3 A;  3JCM h;  1IRE B;  2H3J A;  2ZPE B;  4M77 B;  4RCB A;  4OGE A;  4BB7 A;  4R55 A;  1JJ2 S;  5GAN h;  2NLU A;  5FU7 B;  2EWN A;  3G6E T;  4RCC A;  2ZPB B;  1RL2 A;  3RES A;  2RJD A;  5KE3 A;  2JUF A;  4GY5 A;  3SWN C;  4LD9 K;  2ZPH B;  5LJ5 e;  5GAN 4;  2DO3 A;  3JSC A;  3CC7 T;  1JJ2 A;  4A4E A;  3BY7 A;  4XTY A;  3QII A;  4E7L A;  1LOJ A;  3OYN A;  3OA6 A;  4C8Q C;  3QBY A;  1KQS S;  3A8H B;  1N8R U;  2MWP A;  3JCM J;  3JCM c;  3PTA A;  4OB2 B;  3V8J A;  2RD1 A;  2MAM A;  4V2S A;  4C8Q E;  3OYF A;  4A54 A;  3CCR A;  3OYY A;  2M0O A;  5LJ5 f;  3I56 A;  2RO0 A;  4J7F A;  1VQ4 A;  1KQS A;  2Y90 A;  3OS0 A;  4RKU E;  1N27 A;  2F5K A;  1VQ6 A;  5J3B A;  3OYJ A;  3MHX A;  3ME9 A;  3FJP A;  2QQS A;  1VQP A;  1D3B B;  1NPR A;  3NTK A;  3MP1 A;  4ME7 A;  1M90 U;  3GNG A;  5C0M A;  4M7D C;  4QVC A;  1VQ8 T;  4HA8 A;  3H8Z A;  3V7R A;  2HAX A;  1V29 B;  1Q82 U;  1K9M U;  4IUP A;  4M7D E;  4J5Y A;  4C92 G;  3X26 B;  4BUG A;  2PUK B;  4QVZ A;  3OYE A;  3FLG A;  1TH7 A;  5LJ3 j;  5LJ5 g;  4BDY A;  5GAN 2;  4JJN K;  2PQW A;  1QVP A;  3SWN B;  1K8A C;  3RKY A;  2X35 A;  3LGL A;  2RHZ A;  4IUV A;  2GFA A;  2LDM A;  3ZFJ A;  4A53 A;  2KDS A;  3CD6 A;  4BI8 B;  5GAM j;  3V8K A;  1M4Z A;  2G3R A;  2I2L A;  4C8Q B;  2YLB A;  3JAM E;  2V8K A;  3X28 B;  3M54 A;  4HT8 A;  4XU3 A;  3OSS C;  4JRP A;  4LDY A;  2DKG A;  2R5M A;  3PT9 A;  2K5F A;  3QYG B;  4MZP A;  4KBM B;  2XU8 A;  2XDP A;  4UC4 A;  3BFM A;  4C92 D;  2QQR A;  3M55 A;  4FT2 A;  3M4G A;  5DM7 R;  1KQ2 A;  2K4Y A;  1VQ7 T;  4Y91 A;  4TVR A;  4M77 G;  2XD0 A;  3FIF A;  3OW2 S;  3G71 T;  2LCL A;  2KVQ G;  2RI5 A;  2QQ9 A;  5CKF A;  5D6X A;  3I55 T;  2DEQ A;  4C92 F;  1M1K C;  1XNI A;  5FRN A;  4M7D B;  1WJQ A;  5D6Y A;  4B9X A;  3CC4 T;  3HP9 A;  1WQ7 A;  4II1 A;  4RG8 A;  3FEO A;  1BI0 A;  3OW2 A;  2QQA A;  4KUI A;  1Y07 A;  4OB3 B;  1VIE A;  2E6N A;  2RK1 A;  3Q1J A;  3X25 B;  3PGG A;  2E70 A;  4RG2 A;  3GLX A;  4EMG A;  1RI0 A;  3OMG A;  4OB0 B;  1KQ1 A;  1HXD A;  1W4S A;  3QXE B;  3CCS T;  3PFS A;  1VQL T;  4M77 D;  2IVW A;  4D6W A;  4Q5W A;  4MML A;  4N4H A;  3CCJ T;  3L42 A;  2CZ6 B;  1VQ5 T;  2DIQ A;  2FHD A;  1K73 U;  2OTL T;  2KY9 A;  2ZGW A;  4M77 F;  2JZ2 A;  2JNG A;  3OYG A;  1S72 A;  2XHC A;  5AYF A;  2E6Z A;  4BD3 A;  3QZ9 B;  3JB9 J;  3N5B B;  1UGQ B;  2WSF E;  3PNW C;  1O9S A;  2V8I A;  4A4K A;  1UEB A;  1N8R C;  2B8A A;  1VQM T;  3RMS A;  4EMK A;  1YIT T;  1U1T A;  3JCM X;  3FDR A;  2DD4 A;  2KQW A;  3JB9 H;  2EJF A;  4J6W A;  5A0D A;  4QQG A;  3GOX A;  1MGQ A;  2D6F A;  3M53 A;  1K8A U;  1XOV A;  4XTZ A;  1U8R A;  2DXU A;  2QA4 T;  4XU1 A;  4C8Q G;  1M90 C;  1KG1 A;  4ZTF A;  3C94 A;  3RKW A;  2QI2 A;  3URG A;  5KCH A;  5GAO p;  5KCO A;  1WQW A;  2XID A;  3M5A A;  1P92 A;  5GAM e;  4MZT A;  2P4T A;  5CAI A;  5IN1 A;  4J8O A;  2DAQ A;  3HRS A;  4O5V A;  5GMK j;  5LJ3 f;  3SFM A;  2JTM A;  3R6O A;  4IUQ A;  1QW1 A;  2YLC A;  3QKJ A;  2ZPG B;  1UB4 A;  3LGF A;  3DB3 A;  3TU4 K;  4QQD A;  1YI2 T;  3CCE T;  3A8L B;  4ELZ C;  3CCM T;  3PMI A;  4MZM A;  5I2M A;  4JS4 A;  1UGR B;  3VYG A;  3J80 E;  1YJN T;  4X34 A;  4M7D G;  5A0G A;  2KAF A;  1NZ9 A;  3OBW A;  3OQ5 A;  4M7A B;  3RUX A;  5GAN 3;  2DXT A;  4C8Q D;  5GAM f;  3L1A A;  2EYQ A;  4BAC A;  1YHQ A;  3AHU A;  2HQX A;  1YJ9 A;  2E12 A;  2E1H A;  3DLM A;  2DXC A;  1WNL A;  4M78 C;  3A8M B;  3VU3 C;  3ZBD A;  2VC8 A;  3ZEH A;  4C8Q F;  4NOY A;  1VQO A;  1YJW A;  4C5G A;  4FU6 A;  2PVD B;  4WF2 A;  3X24 B;  2C06 A;  3F70 A;  4M78 E;  4PLL A;  1W2B S;  1ZHI A;  1WGS A;  4N4G A;  1JRI A;  5LJ5 d;  3LLR A;  4ZGE B;  4HKE A;  3OYB A;  4M7D D;  5GAM g;  3CME T;  5GAO n;  1AHJ B;  3OS1 A;  4BE2 A;  1NJI C;  4N4I A;  3A8O B;  2DD5 A;  5D6W A;  2VV5 A;  1JBM A;  5FLX E;  1W2B A;  2GCX A;  4EMK C;  4LDW A;  1Q86 C;  5LJ3 d;  4M7D F;  4OB1 B;  5DLQ E;  4P5N A;  3G4S T;  2QTX A;  3M57 A;  2X4W A;  3NTI A;  3QYH B;  1BI2 A;  4J83 A;  4E7H A;  2F5T X;  5A0L A;  2K3X A;  3OY9 A;  4JS5 A;  2DTH A;  5GAM d;  3CCQ T;  2KMT A;  4E7K A;  2RI2 A;  2WSC E;  3QJY A;  3JCM W;  4IKF A;  5IT9 E;  5GMK l;  3OB9 A;  1OYX A;  1H3Z A;  2GF7 A;  4M78 B;  4XTV A;  1IZ6 A;  4BE1 A;  4A4G A;  4XTU A;  3FB9 A;  4ELY C;  2L89 A;  4PKC C;  2DIG A;  4PJO B;  3L2W A;  5GAN 8;  2XG8 D;  2QDY B;  2DJZ A;  3G7Z A;  4FSX A;  4J6Y A;  3MP8 A;  3TEE A;  2DK3 A;  2YHT A;  2VXF A;  4FIB A;  1B34 B;  4L59 A;  5HKC A;  1G3Y A;  4EMK B;  2K57 A;  3VUZ A;  4M7A A;  3V7C A;  3DB4 A;  1N6A A;  3BDL A;  5GMK e;  2OTJ T;  4F7U A;  4M75 B;  4QW2 A;  5CCA A;  4M7A G;  2LVM A;  5CKB A;  2CYZ B;  2RHI A;  3O8V A;  4DQ2 A;  1VQM A;  2VYT A;  3CEY A;  5IAY A;  2EKO A;  4QQ6 A;  2X4J A;  2PVO B;  3P8H A;  4ZTJ A;  3HL8 A;  1XQH A;  3HHT B;  3CCU A;  3HRT A;  5L8R E;  4C0F A;  3QUI A;  2CKK A;  4ATO A;  2GFU A;  4XU2 A;  4XU0 A;  3CCV T;  4NL3 A;  3CC2 T;  1VQK A;  3QSU A;  1VQ9 T;  3A5Z B;  4XAX B;  4NS5 A;  1QP3 A;  4DOW A;  4E47 A;  4EMH A;  4OP0 A;  3VUB A;  3QDR B;  5GAN 5;  1KD1 C;  1NJI U;  3M58 A;  3VJP A;  4E7J A;  1GXI E;  4CRI A;  1N9R A;  4MMK A;  4YTL A;  3BW1 A;  3OYD A;  4X9D A;  3VV0 A;  1Q86 U;  3E9G A;  5GAM h;  3CCL A;  2EFI A;  3LX7 A;  3LWH A;  4M7A F;  1M1G A;  5GAO m;  3QJ6 A;  1FXX A;  5J39 A;  1YI2 A;  2ZZD A;  2Y4Y A;  4OMF B;  3JB9 I;  1Q7Y C;  1QVG S;  1YJN A;  2BUD A;  2KK4 A;  2MMP A;  2EIF A;  3P8D A;  5I2S A;  2LCC A;  3M9Q A;  4M78 A;  3JCM f;  4FL6 A;  4BI4 A;  2HNI A;  3QZ5 B;  4FM4 B;  4M78 G;  1QVG A;  2O4X B;  3KBG A;  2QEX A;  2P0K A;  4PJO A;  1BIA A;  1M1F A;  2L3R A;  5FRO A;  3MP6 A;  4BY6 B;  4PJO G;  1YBY A;  2K5L A;  2XKO C;  2PUO B;  1VQN A;  4MDX A;  3I56 T;  1VQ4 T;  3EAE A;  2IG0 A;  4C5H A;  3HSB A;  4M7A C;  2EJG A;  5GMK i;  1B34 A;  5CQY A;  4C0Z A;  1VQ6 T;  3GIB A;  5GAO r;  2DTO A;  1I4K 1;  4EDU A;  5KH6 A;  2VGN A;  3L2Q A;  3G6E A;  4M7A E;  1VQP T;  3ASK A;  4M75 A;  3GNF B;  4Z02 A;  4F7U E;  3C4S A;  4O6J A;  1JB0 E;  2ZPI B;  3RMQ A;  3CC7 A;  2FVU A;  1NPP A;  3JB9 G;  4JDS A;  5LJ3 e;  5LJ5 h;  3G4S A;  2RHX A;  3L2V A;  3CPF A;  1X01 A;  1OZ2 A;  2JTF A;  2R58 A;  1UGS B;  4M78 F;  3JCM d;  3HRU A;  3CCQ A;  3LYI A;  2FL7 A;  4MDW A;  3CD6 T;  2LQK A;  2A3L A;  2YRV A;  5GAN d;  1PSE A;  4CI0 C;  3CPW S;  2LNV A;  2EQJ A;  1M9S A;  1YCY A;  2JN0 A;  4PJO F;  1G3S A;  2K2V A;  4QVD A;  3OYM A;  2EQU A;  5CR2 A;  5CK9 A;  3OYI A;  3S3M A;  2X4Y A;  3CPW A;  2GQV A;  3DKM A;  2FYK A;  1VQ8 A;  1KD1 U;  3EFR A;  1BI1 A;  2RH2 A;  5CKD A;  3LWI A;  4GLK A;  4F7U B;  3JB9 F;  4M75 F;  1QP2 A;  2E5Q A;  3FRN A;  1BI3 A;  3MCA B;  5LJ3 g;  1OZ3 A;  4J7I A;  1G3T A;  2BKD N;  3OSV A;  4XTX A;  4ZGJ B;  1I81 A;  5FRM A;  2OTJ A;  4JRI A;  1Q7Y U;  4PJO C;  5CKH A;  2VUB A;  5GMK h;  2O4X A;  3H6Z A;  3LW5 E;  1N9S A;  1WPY A;  4PJO E;  5GAN j;  4J6X A;  2D0Q B;  1Q81 U;  3HKS A;  1R8O B;  4OF1 A;  3NFC A;  4IUU A;  1YIJ T;  3QG1 A;  2HBP A;  4RMO A;  2R57 A;  2E64 A;  4DA4 A;  4M75 C;  1VQ7 A;  2WSE E;  4HT9 A;  3G71 A;  3I55 A;  4M75 E;  2LT4 A;  3CBO A;  3RIR A;  3SD4 A;  2EQK A;  1Y96 A;  3L2R A;  1S72 T;  3CC4 A;  3OYC A;  1I5L A;  3JCM V;  5HK3 A;  5C6S A;  1OI1 A;  2QXF A;  2LX9 A;  1BIB A;  4EPC A;  1VIF A;  1SSF A;  1XTD A;  1KHI A;  1X75 C;  1H64 1;  5CVI A;  5CKE A;  4JLG A;  2CS7 A;  2MI6 A;  3CCS A;  2XK0 A;  3QO3 A;  2RK2 A;  4C0G A;  1VQL A;  3CCJ A;  3JCM P;  3WXM B;  3EFS A;  3FC3 A;  3MEV A;  5GAO l;  4C0D C;  1VQ5 A;  2OTL A;  3OYK A;  1PSF A;  2DPP B;  2MWO A;  4PL6 A;  2LRQ A;  3JCM b;  2KSS A;  1UGP B;  3OYL A;  2LQ8 A;  2ZCF B;  3MEU A;  4X9C A;  2CZ0 B;  4ZGD B;  1VUB A;  2V8J A;  5HY6 A;  4R56 A;  4HCC A;  4F7U G;  3UT1 A;  2DVE A;  4L6V 5;  2RA2 A;  1FX7 A;  4IUT A;  4NL2 A;  1YIT A;  3RKX A;  5GAN 6;  2RHY A;  2PU9 B;  2E65 A;  2VGM A;  2LTO A;  2QQB A;  3MET A;  2DXB A;  3P8B B;  1KC8 U;  4HCB A;  4C92 A;  3CMA T;  3TRE A;  4PNO A;  4BY6 C;  3SDZ A;  3QPH A;  3OYH A;  1YHQ T;  3J7A F;  1M8V A;  3MEA A;  5I21 A;  5LJ3 h;  2QA4 A;  1YJ9 T;  1BYM A;  1G3W A;  3OMC A;  1HK9 A;  4N0A C;  3KXT A;  3GPL A;  4OGC A;  4BDZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...