4IIMA

Crystal structure of the second sh3 domain of itsn1 bound with a synthetic peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
57
structure length
57
Chain Sequence
LLQAQALYPWRAKKDNHLNFNKNDVITVLEQQDMWWFGEVQGQKGWFPKSYVKLISA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Intersectin-1
publication title Crystal structure of the Second SH3 Domain of ITSN1 bound with a synthetic peptide
rcsb
source organism Homo sapiens
molecule tags Endocytosis
total genus 13
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4iimA00
1UTIA 5FWBA 4A63B 1I1JA 1UFFA 2LQNA 3NPFA 4RUGA 4R0KA 1Z9QA 1EFNA 1NEBA 1NLPC 2DJQA 2IIMA 4RTZA 4X1VA 1T0JA 1X6GA 4J9DA 2SEMA 2YSQA 1AWJA 2FRWA 1U3OA 2GBQA 1CKBA 2EYWA 3H0HA 2CT4A 4JZ4A 1JXMA 2LJ0A 1SPKA 2GNCA 3R6NA 4HVVA 2FPEA 1VYTA 3EHQA 2M51A 2RNAA 2C0OA 2BZXA 4F17A 2KEAA 3QWYA 4JJCA 1ZUKA 2CT3A 2DL4A 1NYFA 2JS0A 3VS3A 1ABQA 3H0FA 4IIMA 1CKAA 4J9CA 1E7OA 3VS7A 2FO0A 1ARKA 2O9VA 3TSZA 1GFCA 2F2XA 2JM9A 2CUBA 2J06A 3UA7A 2EYYA 1YWOA 2XMFA 2KRNA 1T3LA 3VS2A 5IHKA 2V1RA 1AEYA 2NUZA 1WX6A 2DE0X 4LUEA 2JM8A 1AWOA 2RQRA 2KYMA 5I22A 1GCQA 1QKXA 4CC3A 4HVWA 2KXDA 3PVLA 2DVJA 1B07A 1ABOA 2D8HA 2YT6A 2LX7A 4KRTA 2J6OA 2ED1A 1PWTA 4RTTA 1B3QA 3EG0A 3ULRB 2V1QA 1NM7A 2J6KA 2ECZA 3EGUA 2QDLA 1JQQA 1S1NA 4OMNA 1KFZA 2HCKA 2EKHA 1HJDA 1X43A 1ZUUA 1MV3A 2OAWA 1AD5A 2JXBA 1X69A 2ROTA 2RPNA 3M0UA 2FPFA 1K9AA 1UECA 1T0HA 1SHFA 1AOJA 1KIKA 2J05A 4AG2C 1X27A 3RBBB 2AKLA 1RLQC 1M8MA 2DM1A 4OMMA 2JMAA 3QWXX 2YUQA 1QWFA 2F2WA 3LH5A 5FWCA 1ZUYA 2D8JA 4WCIA 2EGAA 2DMOA 4RTUA 2J6FA 2KROA 1WXBA 2KT8A 4LE9A 4AFQC 2W10A 2MIOA 1NYGA 2A37A 2K2MA 3M0SA 2DL8A 4RTVA 2YDLA 2ABLA 1BK2A 2JT4A 2HDAA 4HXJA 2KRMA 1WYXA 2K7AA 3NGPA 1Y0MA 2O88A 2OI3A 1QCFA 1X2KA 4Y92A 1QLYA 1N5ZA 1OEBA 3A98A 3EHRA 4J9FA 2L3QA 1YWPA 2KR3A 1NLOC 1SEMA 1UJYA 1FMKA 2DBMA 5FW9A 3VRZA 1PRMC 5ECAA 1T3SA 2LZ6B 1SSHA 2AKKA 3I5SA 1WXTA 2BTTA 2CH4A 2EGCA 4J9BA 1AZEA 3GBQA 2KE9A 5GJVB 1A0NB 2RQWA 3SHWA 3VRYA 2KYBA 3SEMA 1QWEA 3NMZC 2FG0A 2K79A 1AZGB 5IHNA 2JTEA 2KNBB 1G2BA 2O2OA 2OJ2A 3EG3A 1X6BA 2RN8A 5I11A 1K76A 1UG1A 2CREA 1PNJA 2C0TA 3O5ZA 5L23A 1K4US 1UDLA 3THKA 4JJDA 4CC2A 1K0XA 2KRSA 2K6DA 1OPLA 4J9IA 2I0NA 2RF0A 4CC7A 2JMCA 1ZX6A 2SRCA 2FEIA 1TUDA 1W70A 1YNZA 5IXBA 1H3HA 2VWFA 2KXCA 1ZSGA 1H92A 2ENMA 1I07A 2HBWA 2DILA 4CC4B 4RTWA 1GBRA 2RQUA 2HSPA 2H8HA 1UE9A 2E5KA 1FYNA 1XOVA 4J9HA 1YP5A 2A08A 2B86A 2D1XA 1JEGA 2BZYA 2VVKA 2EQIA 4RTXA 2JW4A 2GGRA 2ESWA 3H41A 3VS5A 1Z9ZA 2CUDA 1PKSA 3U23A 4F16A 1I0CA 2LJ3A 4LUDA 2CH4W 2D0NA 4QT7A 5EC7A 1KSWA 1VA7A 3VS4A 1OOTA 1W1FA 3VS6A 4ORZA 1CSKA 2AK5A 3EG1A 1TG0A 4JPBW 3PVQA 2YUOA 5IHIA 2KBTA 1BU1A 2LQWA 1GCQC 4Z8AA 4LN2A 2FPDA 2AZSA 3VS0A 5IH2A 4DEXA 4DEYA 2DF6A 3IQLA 4FSSA 4EIKA 4Z89A 1NEGA 4D8KA 1TUCA 2DA9A 3TSWA 1X2QA 3EG2A 4OMQA 3FJ5A 1PHTA 2DL5A 2DBKA 2L3PA 1GFDA 1WA7A 2GQIA 1K1ZA 2BZ8A 3REAB 4J9EA 3M0QA 1RUWA 1M30A 2G6FX 2RQVA 1WIEA 1K0SA 2PNIA 2JS2A 2F2VA 2LMJA 2DYBA 2DRKA 2X3XD 1PKTA 1E6HA 2ROLA 1RLPC 2YUPA 1ZLMA 1JO8A 1UUEA 1KJWA 4GBQA 2EGEA 4HCKA 1SRMA 4J9GA 3I5RA 1WDXA 2EVRA 2L2PA 2DL3A 2LJ1A 3JV3A 2P4RA 1WLPB 5GJWB 2KT1A 2DX1A 1GL5A 1UGVA 1Y57A 2FRYA 1V1CA 4K11A 3I35A 1QKWA 3RNJA 2HEQA 1M27C 1HSQA 2EPDA 3NHNA 3UA6A 2NWMA 2YUNA 3I9QA 3ZL7C 3REBB 4RTYA 1UHCA 1AWXA 1GCPA 1SRLA 3PE0A 2PTKA 1BB9A 2EYZA 1E6GA 3VS1A 1G83A 1WI7A 2AZVA 1H8KA 4E6RA 3M0RA 1MUZA 3KFVA 4OMPA 4Z88A 2DRMA 1JXOA 2EYXA 4AG1C 4OMOA 4JZ3A 4AFZC 2LCSA 2A28A 2W0ZA 1ZBJA 1LCKA 4OMLA 1WFWA 2O9SA 3UF4A 2EW3A 1PRLC 2J7IA 2M0YA 3M0TA 1OPKA 1VYUA 1UHFA 3CQTA 1M3AA 4ESRA 1YCSB 2CSQA 2GTOA 4AFUC 2C0IA 1BBZA 1OV3A 1U5SA 1UJ0A 1SHGA 1IO6A 1W6XA 1AWWA 2LNHB 2CSIA 2ED0A 3M0PA 4GLMA 2CDTA 4HVUA 2RQTA 4M4ZA 1RI9A 1U06A 1YN8A 1M3BA 2LP5A 4AFSC 2DL7A 2L0AA 2X3WD 4ZNXA 3TVTA 2RMOA 2MCNA 1JU5C 2DNUA 2EBPA 3H0IA 2A36A 4JJBA 1GBQA 2VKNA 1GRIA 4IIOA 1J3TA 5HCKA 2DLPA 2K3BA 1WXUA 4LNPA 1HD3A 4D8DA 4F14A 3C0CA 1MV0B 1VYVA 5IXFA 1NG2A 2K9GA 1M3CA 2KGTA 2O31A 1AVZC 2MOXA 2PZ1A 2GTJA 2L3SA 3UATA
chains in the Genus database with same CATH superfamily
2I2LA 3QXEB 5FWBA 2XG8D 3EG9B 4RUGA 3EG9A 2JNGA 9ATCB 1D1CA 4M78E 3JCMe 3OYJA 1T0JA 4J9DA 4N0AA 1TU0B 1FMVA 2FRWA 1U3OA 5FROA 1RABB 3OW2A 3CBMA 4KH0B 2CT4A 4JZ4A 1JXMA 3OW2S 4DA4A 1SPKA 3C12A 4BE0A 4HVVA 1K9MR 1VYTA 1D1AA 3RUXA 2HSEB 3JCMb 2C0OA 1VIFA 1VQOT 3HPWA 1VQ9T 1VQKA 1ZUKA 2DL4A 1NYFA 4IIMA 1CKAA 4ELZC 1TSFA 2YRVA 1E7OA 1YITA 1GFCA 2CUBA 1Y71A 1OX8A 4C92C 3OBYA 4BI4A 3ASKA 3SDZA 4M7DF 2QXFA 2FVUA 5KH6A 4LUEA 1LJOA 1AWOA 1WHMA 5DLQE 3JCMQ 4CC3A 3JCMf 2LDMA 3PVLA 2DVJA 3OYFA 2CP0A 1QCNA 3P8HA 3X24B 2EJ9A 2LX7A 2J6OA 3CCVA 3QJ6A 2HKNA 5FU7C 2WSCE 2EKOA 3S3NA 3CCET 5KYWB 2QDLA 5KYWA 2K5LA 4OMNA 1KFZA 3SB2A 2HCKA 2EKHA 4M75C 2P0QA 2COWA 3CMEQ 1VQ5Q 1MV3A 1SSFA 1PG5B 3A5ZB 1SHFA 1KIKA 2J05A 2ZCFB 4LDWA 1YJ9A 1KK7A 2DM1A 3CC2A 1KHCA 1RAIB 3CPWP 3LH5A 2RJEA 3CXCA 1NJIR 3MPUB 4FYXB 1YITT 4PJOE 5HK3A 2J6FA 2DD4A 2VYTA 3ZFJA 3CCUQ 1MMAA 4LE9A 2DXCA 4XU2A 1RAHB 2KVQG 3JCMV 2MIOA 1VQMQ 1XJWB 2V8IA 2A37A 1F1BB 3M0SA 3RR6A 1AHJB 2DL8A 2YDLA 2ABLA 1AT1B 4C8QB 4C8QA 2CZ7B 1DJ7B 3EFSA 4JS5A 4C0FA 3NTIA 4BY6B 5DY9A 3JB9J 1QCFA 1X2KA 1QLYA 1N5ZA 1OEBA 2M1HA 2VB6A 4VUBA 5I21A 1FMKA 3CCVT 5FW9A 5ECAA 2LZ6B 2AIRB 4PFOA 2RM4A 2CH4A 2EGCA 3GF5A 5LJ3j 4R55A 4J9BA 4J7FA 2KE9A 2K4YA 2QQRA 1QWEA 1AZGB 5IHNA 3E19A 1G2BA 5GAN8 5GAMh 1YHQT 4HT8A 1WZOA 3OA6A 3PMTA 2PVDB 5I11A 1YI2Q 4RKUE 1UG1A 1K9MC 1M2OA 5GAN3 1G3TA 1PNJA 4M7AE 5L23A 3CC7T 3CCSQ 3VV0A 1PCXA 2KI7A 4ZN1A 4JS4A 1BIAA 1IHWA 1YJ9T 1KD1R 4PK4A 4PFPA 2RF0A 3RERA 4QVCA 4CC7A 3G4SA 3PTAA 3VYHB 1M1GA 1TUDA 1N27A 2E3IA 3A8OB 2VC8A 2KXCA 3M57A 1TTHB 4RG8A 3VJPA 1YJWQ 2DILA 4CC4B 4RTWA 2LQ8A 5C0MA 1GBRA 2X4XA 3LWHA 1ZA1B 3GNFB 3CCJQ 1JEGA 3OS0A 2OTJT 2BZYA 2DETA 2EQIA 2FL7A 3OYAA 3CD6Q 5LJ5e 4M7DB 4M7DA 5EC7A 5LJ3g 3META 1G3YA 3GLXA 3VS6A 4E7IA 1CSKA 3S3MA 3BDUA 3EG1A 1MMDA 5IHIA 2HL3A 1BU1A 2DD5A 4OVAA 3CMAA 2DF6A 1VQNQ 4WF2A 3L2QA 2PQWA 4C92F 1C6VX 1NEGA 1Y7XA 1TUCA 2DA9A 3TSWA 3QKJA 3JCMh 1S72A 2QQ9A 1OX9A 2GQIA 1KC8C 1BCMA 4J9EA 1BYMA 4J6YA 2VUBA 2X4YA 4FYYB 1NJIC 2GCXA 3QZ5B 3T9NA 2DRKA 2IVWA 2X3XD 1VQLQ 3VKIA 1PKTA 1RLPC 1ZLMA 1TWBA 3MEUA 3E9FA 3OS5A 2XICA 5LJ5f 3I5RA 3V8JA 4CRIA 3I55A 2QQAA 4A54A 2EVRA 8AT1B 2L2PA 2MK5A 5LJ5g 4OB1B 1U8RA 4J7IA 4L6V5 5GJWB 2K57A 3ZEHA 1K9MU 3OYDA 1UGVA 1C0MA 2QTXA 3WXMB 1QKWA 2EFIA 1M27C 3CEYA 3CCLA 3UA6A 4L5GA 4RTYA 7AT1B 2YRCA 1AWXA 3EFOB 5GMKe 3EFOA 1GCPA 3QYGB 2PTKA 3VS1A 1E6GA 2AZVA 4E6RA 3QPHA 5CAIA 4J8OA 4XTXA 4OMPA 4Z88A 4EMGA 1KD1C 4LXCA 2L3RA 1JRIA 4JZ3A 1Q81R 2W0ZA 1LCKA 3UF4A 1HXDA 1PRLC 2J7IA 2M0YA 1M1KR 1TS9A 1YFNA 4M75E 3LH0A 3X20B 2MWOA 4J6XA 1XNIA 1M3AA 4ESRA 2DTIA 4FT2A 2C0IA 2CGHA 4QVZA 4PLLA 4RCCA 1W6XA 2KQWA 4CI0C 3I55T 2VASA 2DTOA 5GANd 4GY5A 4KULA 1WJRA 1MNDA 2CSIA 2ED0A 1PSEA 4C0GA 3SWNC 2QA4T 2LP5A 4B9XA 2RMOA 4QQDA 4XTWA 3S3OA 1NPPA 2HQEA 2A36A 4JRIA 3V8LA 1PD1A 3CCLT 2VKNA 3LX7A 4IIOA 2K3XA 2AT1B 1H3ZA 1I81A 1QVFS 2QYZA 2DXUA 1M90R 4FYWB 4M77E 1JB0E 1VYVA 4PLIA 2K9GA 1YIJT 1AVZC 2MOXA 1W4SA 2PZ1A 2G3RA 2YLCA 2ZPIB 4A63B 2ZPBB 4R0KA 4NL3A 2PU9B 4JUVA 1RAFB 1Z9QA 4IURA 4C92B 3LGFA 4A4GA 4C92A 2NUPB 2NUPA 2OX7A 2XKOC 4RTZA 1X6GA 1NZ9A 1K73C 4D6WA 2SEMA 3PIPA 2YSQA 2YXYA 3HRUA 2EQUA 3HFOA 1QVGS 2EYWA 3H0HA 3EH1A 4J5YA 3L42A 2RI2A 2LJ0A 5GMKm 1B34B 1VQ4Q 1B34A 3R6NA 2R57A 3CCQQ 2RD1A 3SD4A 1NPRA 4PJNA 3X26B 1M5Q1 2KEAA 1Q7YC 3QWYA 5FU7B 2CT3A 3VS3A 3URGA 1BCOA 3MKDA 2LVMA 3M54A 3OYGA 2DIQA 1IXDA 4BUGA 2FYKA 1YWOA 1W2BA 3N5BB 5DLOA 2KRNA 2H3JA 2V1RA 1Q86R 1K8AU 1UGRB 1WX6A 4BB7A 5J26A 1BIBA 5LJ5h 2KYMA 5AYFA 1GCQA 3QDRB 3CCMT 2KXDA 4E7KA 2NUTB 2NUTA 3BE3A 3UT1A 5GAOn 1ZSZC 3M55A 4E7ZA 2YT6A 1Q81C 5KCOA 2ED1A 5D6XA 1M1KC 2EQJA 5KYNA 2V1QA 1WHJA 3R6OA 3EGUA 3FJPA 1JQQA 4HCZA 3M9QA 2E1HA 1HJDA 1X43A 3CPFA 4E2FB 2OAWA 3QDFA 4X34A 3OYCA 4PKCC 5GAN6 3M59A 4ZTFA 1T0HA 3RKYA 1U1SA 3RBBB 3CCRA 4FM4B 1N8RU 1M8MA 2E4HA 3LW5E 1G8XA 3QWXX 2YHTA 3RESA 2EWNA 1ZUYA 4AT1B 2BUDA 4F04B 1WXBA 2W10A 3BW1A 3QJYA 2K2MA 1M90C 3I56Q 3C4SA 2QG9B 4EMKC 1BK2A 1ZA2B 2HDAA 2JT4A 3MEWA 2KRMA 4HXJA 1WYXA 3CMEA 3G71A 1UB4A 1Y0MA 2O88A 1RADB 5I2SA 2Y4XA 3EHRA 3JCMX 4C8QE 2X4JA 2L3QA 1YWPA 2FZCB 3G6EQ 1IRXA 3VRZA 1T3SA 4DBQA 5GMKh 2IPOB 4J83A 2AKKA 4F7UB 4F7UA 1WXTA 2BTTA 1AZEA 4FIBA 5GJVB 1N6AA 1WQWA 3VRYA 3A8LB 4BDYA 2K79A 4LD6A 2JTEA 2KNBB 2O2OA 1UEBA 2OJ2A 4XU1A 1VQMA 2Z0WA 5GAMd 3GP8A 1X6BA 2RN8A 2BIVA 1K76A 1QP2A 5A0LA 3O5ZA 2GFAA 5GAN4 2RHYA 3LGLA 2K6DA 1OPLA 2YRDA 2ZGWA 3CCRT 1BI3A 2MAMA 1MGQA 4GLKA 3RKXA 2JMCA 1VQ7T 2RJFA 2E12A 1O75A 1VQOQ 3JCMc 1VQ8A 4XTZA 2ENMA 2ZPEB 1Q86C 2MF2A 4BD3A 3UPUA 2RQUA 2HSPA 2P4TA 1UE9A 4R56A 2E5KA 5CQXA 2M9UA 4BACA 3G71T 1LPLA 3NTHA 3VS5A 3BY7A 1I8FA 3RKWA 1PC0A 2LCCA 4ZGJB 3U23A 2F5KA 3TEEA 1I0CA 3KBGA 3OY9A 4XTVA 3VS4A 1OOTA 1H641 3FIFA 2HD0A 4M78G 2AK5A 2OTLA 5CCAA 2YUOA 2KBTA 4M7DE 4O6JA 3DKMA 2MPXC 1GCQC 4FW2A 1KC8R 5M9OA 5CO7A 1UGPB 1VQKT 3L1AA 2CYZB 3CCEQ 1YJWA 1M90U 3CXCS 4D8KA 4FL6A 4EDUA 4HA8A 3CCJA 1QVPA 4IUTA 3JCMd 1WA7A 2RK2A 3QHSA 3MEVA 2KDSA 3M0QA 1M30A 2G6FX 2RQVA 5D7UA 1WIEA 1TOVA 1K0SA 1VQ8T 2LMJA 2RH2A 2ZPGB 2ROLA 4PFZA 5HK0A 1RAGB 5FU6C 1Y96B 1Y96A 2EGEA 4JRQA 1YITQ 4JRKA 4XTUA 5LJ3e 1RACB 1WDXA 1VQNA 3V7RA 2D0QB 1D0YA 2JZ2A 1WLPB 2GF7A 3ZBDA 3H8ZA 3OYMA 2QI2A 1V1CA 2XHCA 3I35A 4M77D 3JRZA 1X01A 1HSQA 2OTLT 2EPDA 2GQVA 2MWPA 3HSBA 4DOWA 2DK3A 3CCVQ 1G3SA 1UHCA 3CC2T 3JB9D 1FWZA 1BB9A 2EYZA 5CKFA 1YJWT 1Q82C 1OU8A 3QSUA 5CKBA 3SWNB 3KFVA 3SWNA 3OYIA 3HKSA 2DRMA 1YHQQ 1OULA 4JLIA 4LDVA 5AT1B 4ELYC 4J6WA 2LTOA 2K5IA 2FHDA 3CC7Q 2EW3A 3TREA 3M0TA 4DOVA 1YJ9Q 1UHFA 1YJNQ 2LRQA 5LJ3f 3OYEA 2CZ1B 2LT4A 4Q5WA 4XAXB 4AFUC 2RHIA 1OV3A 1U5SA 1UJ0A 1SHGA 1IO6A 1AWWA 1IHVA 1ACMB 2HZYA 2RO0A 2VXFA 2LNHB 3QBYA 3X25B 1KQSA 4HVUA 1KQSS 2OTJQ 3TQ7P 2L0AA 2X3WD 4ZNXA 4ZGEB 2DNUA 4DBFA 1M8VA 4O5VA 5KCHA 2Y90A 3L2WA 2COZA 4JRPA 2B8AA 2JN0A 2KY9A 4XQ3A 2DLPA 3OS1A 1WXUA 1ZHIA 4D8DA 4F14A 3G4ST 5GANj 3C0CA 4C5EA 1R0BG 2JJ9A 2O31A 3M58A 2GTJA 1K73R 4M7AG 5D6WA 3OYKA 3UATA 3OYBA 2DEUA 1UFFA 2LQNA 4L59A 3RDVA 2EYQA 3LWIA 1NEBA 3A8GB 2DJQA 3EAEA 2IIMA 3E2UA 4X1VA 4NL2A 4KH1B 1LOJA 2M16A 1AWJA 1D1BA 5EG2A 1Q7YR 1OZ2A 5L8RE 4C92E 3RIRA 2GFUA 1XTDA 2XIDA 2V8KA 1KHIA 2JUFA 3PGGA 2KMTA 5A0DA 5KYXA 5KYXB 2GNCA 2FPEA 3EHQA 4PL6A 1ZQ1A 1ZSZB 1ZSZA 3NFCA 1QVFP 3CMAT 4M78C 4KGVB 4MDXA 2K5FA 2JS0A 1ABQA 3V8KA 4J9CA 3MP6A 4XK8E 2E70A 4M78D 1ARKA 2MYSA 2F2XA 2JM9A 2J06A 1S72T 2MMPA 3VS2A 2NUZA 4C8QD 1IREB 5A2QE 2MI6A 2JM8A 1SKUB 5LJ5d 4FW1A 1I4K1 4MMLA 4B6MA 1EX4A 1QKXA 1D0ZA 2BKDN 1QVGP 3GOXA 5CKDA 1O9SA 2E6NA 2CP7A 1RAAB 3CCQA 2DKGA 4JLGA 4RTTA 3J7AF 1B3QA 2DZCA 3ULRB 1KQ1A 1WGSA 2CP2A 2A3LA 2HNIA 4OGEA 4M77F 1D09B 5CVIA 1TXQA 4EMKB 4EMKA 1ZUUA 3JB9F 1AD5A 3CBPA 1KC8U 2JXBA 2E64A 1I5OB 2RPNA 1K9AA 1UECA 3CC4A 3INZA 2XK0A 1AOJA 4MMKA 1X27A 3L2ZA 2AKLA 4ZGDB 1NJIU 3FEOA 3I55Q 2L89A 4DBRA 3RMSA 1QP3A 2JMAA 2XDBA 4PNOA 2F2WA 3M56A 2YWWA 2ZAEA 2D8JA 3V7SA 4HT9A 2DMOA 2F5TX 3GNGA 2QA4Q 1VQPA 2KT8A 3MO8A 4AFQC 5LJ3h 3PIOA 1VQ6A 5A0GA 1G3WA 4EMHA 4BI3A 3CCLQ 1KG1A 2EJFA 1VUBA 2WSFE 4ANJA 1QCOA 5GMKl 3NGPA 3G1JA 5HKCA 1YCYA 4KGXB 2JTMA 2OI3A 4C5HA 4M7DD 4Y92A 1WHKA 2RI5A 4J9FA 2KR3A 1JJ2A 2E5QA 1SEMA 1YIJQ 1JJ2S 2DBMA 3QUIA 1PRMC 4QW2A 5CK9A 4WTOB 4RCBA 5GAOl 4M75G 2JVVA 3I5SA 1LVKA 3P8DA 4OMFB 1TUGB 4PJOD 5I2MA 2RB6A 3SEMA 5GAOp 2FG0A 1WHLA 4QQ6A 1X75C 2E3HA 4F7UE 5KE3A 1KD1U 1KQ2A 3EG3A 5GAOm 3CC4T 4C0ZA 1RAEB 1K4US 3VYGA 4B9WA 2KRSA 4HCCA 1W2BS 4J9IA 1V76A 4DBHA 3OBWA 2HBPA 3F70A 1RI0A 1ZX6A 2XI9A 3JB9I 4AMCA 2RHXA 1W70A 1YNZA 1PM3A 1H3HA 2VWFA 3G6EA 1ZSGA 2H3EB 4FU6A 1VQPT 1GXIE 1I07A 1VQ6T 3OS2A 1NE8A 3OW2P 3PNWC 5GAMj 2H8HA 1FYNA 1XOVA 2A08A 2LT1A 1QW1A 4M77G 3HRTA 2GGRA 2HQXA 3H41A 4M7AD 2PVGB 1IGUA 2CUDA 2HKQB 1PKSA 2D6FA 2O01E 2QGGA 2X4WA 2CH4W 2RHZA 3JB9G 4QT7A 1KSWA 3CCMQ 1VA7A 3OYLA 1W1FA 4ORZA 3OSSC 2XDPA 3FB9A 1TH7A 3ME9A 4M78F 1TG0A 3PVQA 5FU6B 2X51A 4ZN3A 2LX9A 4LN2A 5KYUB 5KYUA 5IH2A 3E9GA 2DERA 1OI1A 4DEXA 4LD9K 4KGZB 1I5LA 4II1A 2DJZA 4C8QF 3X28B 2QEXQ 4MZPA 1FMWA 2DAQA 3O8VA 1WPYA 4EIKA 4Z89A 3HRSA 4QKUA 4M77B 4M77A 5J39A 3EG2A 4JDSA 3FJ5A 1IB8A 1PHTA 2DL5A 4FSXA 1GFDA 1K1ZA 3REAB 1K73U 4Z02A 1RUWA 2NYSA 2HL5C 1WHGA 1G5VA 3BDLA 2A0FB 3A1PA 1PD0A 3L2RA 4KBMB 2PNIA 1VQ5A 2JS2A 2DPPB 2DYBA 1WHHA 5CKHA 3VUBA 2VXEA 2R5MA 1M4ZA 1KJWA 2AHJB 4HCKA 2RHUA 2FB7A 1Q7YU 4OF1A 1WNLA 5GAN5 3CCEA 4IUQA 2LJ1A 4V2SA 3JV3A 2EIFA 2K2VA 3OQ5A 2DX1A 1GL5A 4UC4A 3CCUA 4BE1A 2FRYA 3CXCP 1Q82R 3RNJA 4X9CA 1IZ6A 3NHNA 1RL2A 3PFSA 2YUNA 3ZL7C 2RA2A 3E1SA 2E6ZA 1G83A 1WI7A 1H8KA 1Q81U 3M0RA 1MUZA 1VQ9Q 3EGXB 3EGXA 1M1KU 2X35A 4A4HA 2XD0A 1JXOA 2EYXA 4C0DC 3GIBA 1UGSB 2LCSA 4OMLA 4N4IA 2O9SA 3MJXA 4C92D 1VIEA 3CMET 2QDYB 3M4GA 4KUIA 3CCRQ 1VQ5T 1VYUA 1N9RA 4HCBA 4IUPA 2P84A 1JBMA 1QMCA 1YCSB 4A4FA 1YI2A 4PJOF 1VQ7Q 4XU3A 5IT9E 4DQ2A 1SG5A 3CCSA 2DVEA 3JCMg 2ZPFB 4LDUA 2QASA 4LDYA 3C94A 1IGQA 3M0PA 4GLMA 3JAME 2RQTA 1RI9A 4XU0A 1M3BA 3CCUT 1B7TA 3H6ZA 2EAYA 4A4KA 4C8QG 2DL7A 3G71Q 3JB9H 3TVTA 1VQMT 2X9HA 1YHQA 5FRMA 3FRNA 1R8OB 4NS5A 2FZKB 4M75D 1PSFA 5GMKi 3LYIA 1M1FA 3CC7A 3M5AA 2V26A 1GRIA 2LCLA 5HCKA 1WJSA 4MZMA 1YJNA 2BE7D 4LNPA 4KUDK 3CD6A 3TU4K 2CZ0B 2DTHA 5IXFA 1NG2A 1M3CA 3NTKA 1XQHA 4PJLA 3JCMJ 4QQGA 4M78B 1VQKQ 4M78A 2L3SA 4A53A 4M7AF 2R58A 1UTIA 1I1JA 3NPFA 3SFMA 1YBYA 3DB3A 4QVDA 1EFNA 2QTVA 1NLPC 2OTJA 3HTRA 1KQSP 1MNEA 1YI2T 2RJDA 4M77C 2GBQA 1CKBA 3CCST 3HP9A 2FZGB 1VQ8Q 5LL6S 3DLMA 4E7JA 3VU3C 4PJJA 4IKFA 2M51A 2RNAA 4OB0B 3ER0A 2BZXA 4F17A 4Y91A 4JJCA 1UGQB 1VQLA 3QZ9B 4OB2B 3H0FA 1BI2A 1Q86U 3M53A 3L2VA 3FC3A 3VS7A 2FO0A 1OZ3A 4ME7A 2O9VA 3TSZA 2XDDA 3DLLA 3UWNA 3UA7A 3CCJT 2KSSA 3RMQA 2EYYA 2XMFA 5CIUA 4M7DG 1T3LA 5IHKA 2WACA 4N0AC 1AEYA 2OAUA 2DE0X 1YJNT 2CP5A 2OTLQ 3CD6T 4BI8B 2RK1A 2RQRA 4BDZA 4OGCA 3CPWA 1MMGA 5I22A 2L8DA 3CPWS 1BKBA 3CC2Q 1K8AR 1OYXA 2PUKB 4HVWA 4PJOG 5CKEA 5GAOq 3EFRA 2IG0A 3A8HB 1B07A 1ABOA 2D8HA 2PUOB 3FDRA 2COYA 4KRTA 4A4EA 2P0KA 2VGNA 1PWTA 5KE2A 3EG0A 1NM7A 2J6KA 1VQNT 2ECZA 4FCYA 1S1NA 1U1TA 4PJMA 3OYNA 5LJ5j 3QG1A 5J3BA 5IAYA 4ZTJA 1X69A 2ROTA 1WJQA 3M0UA 2FPFA 2EQMA 1NBEB 4YTLA 4JJNK 3MEAA 4AG2C 2WSEE 3KXTA 3EGDB 3EGDA 1OU9A 4PJOB 5GANe 4PJOA 1RLQC 4OMMA 2DXTA 1VQLT 2YUQA 2QQBA 1QWFA 4C5GA 5GAN2 5FWCA 4WCIA 4X9DA 2EGAA 2KAFA 1N8RR 4RTUA 3A8MB 2F1LA 2KROA 2BE9B 5LJ3d 1NYGA 1C1AA 1M9SA 2ATCB 4RTVA 2CP3A 1X6OA 2LQKA 2HAXA 2CS7A 2R5AA 4N4GA 3TCJA 1R77A 2CKKA 2K7AA 2L5QA 3G4SQ 3A98A 4P5NA 1NLOC 1VOMA 1UJYA 2QGFB 4FT4A 3OMGA 4HKEA 2DYIA 4OB3B 1SSHA 3Q1JA 3AHUA 4OP0A 4M75F 1HYOA 3GBQA 1A0NB 1Q82U 3KUFA 2RQWA 4M7AB 3SHWA 4M7AA 2KYBA 3NMZC 2QA4A 2Y4YA 2ZPHB 3EH2A 1N9SA 5GANf 3OB9A 3JCMW 1EZZB 2DEQA 2CREA 4C8QC 2C0TA 2RJCA 2VGMA 3CBOA 3D7SB 1UDLA 3THKA 5GANg 2E10A 4JJDA 4CC2A 4E7LA 1K0XA 4BY6C 3M4YA 2I0NA 3L2UA 1Y07A 3WVEB 2EQKA 5GMKj 2SRCA 2FEIA 2VV5A 2YLBA 5CQYA 3CMAQ 4MDWA 5IXBA 1YIJA 3WVDB 2DO3A 1H92A 8ATCB 1VQ4A 2HBWA 2E65A 3S6WA 1JJ2P 3VUZA 4E7HA 2QQSA 3AT1B 3MP8A 1S72Q 4J9HA 1YP5A 2B86A 2D1XA 2VVKA 4RTXA 2JW4A 2ESWA 1K8AC 5D6YA 4E47A 1Z9ZA 4F16A 4KT0E 2LJ3A 4LUDA 2D0NA 2CP6A 2RI3A 1BI0A 3BFMA 5DM7R 2PVOB 3PMIA 4JPBW 2F69A 1W2BP 2LQWA 4Z8AA 2FPDA 1MHNA 2AZSA 3OMCA 3VS0A 1OQKA 4DEYA 3IQLA 4FSSA 3HHTB 3J81E 4C92G 4BE2A 2K3YA 2O4XB 2O4XA 3J80E 2HMAA 3C95A 1X2QA 4OMQA 1LNXA 2DBKA 2L3PA 1QVFA 3OSVA 2BZ8A 2XU8A 4M7DC 1D3BB 1D3BA 1R0CB 3MCAB 4F7UF 2D9TA 2F2VA 1N8RC 2DIGA 3CCMA 3H9NA 4EPCA 3G7ZA 1E6HA 2YUPA 1VQ4T 5FLXE 3PT9A 3FLGA 1JO8A 3CCQT 1UUEA 4RMOA 4GBQA 1FXXA 4PJOC 4J9GA 1SRMA 1D0XA 4IUVA 2LNVA 1WQ7A 2EJGA 3LLRA 3MHXA 4C0DB 2DL3A 3OYYA 2ZZDA 3UDCA 4Y28E 2QEXA 2P4RA 3JCMP 4XTYA 1QVGA 2KT1A 3DB4A 1Y57A 1V29B 4K11A 3JSCA 2HEQA 3QIIA 2HQHA 3I56A 4MZTA 5C6SA 2NWMA 3MP1A 3I9QA 3REBB 1HK9A 2QK0A 3GPLA 1FX7A 1SRLA 3PE0A 2V8JA 2JTFA 2CZ6B 2M0OA 4M75B 2DZ9A 2JOYA 4M75A 5GAMe 4AG1C 4OMOA 4AFZC 2A28A 2P0PA 3CC4Q 2E41A 2LC4A 4M7AC 1ZBJA 1WFWA 1BI1A 2M02A 3HFNA 1OPKA 3HL8A 4N4HA 3QO3A 3CQTA 4FYVB 4ATOA 2GTOA 2CSQA 1MMNA 1BBZA 1M2VB 1M2VA 1P92A 1VQPQ 5GANh 4LDXA 4NOYA 1VQ6Q 2DXBA 3QYHB 2DFUA 4C5IA 5FRNA 4TVRA 2CDTA 4E7SA 2QEXT 4RG2A 1VQOA 4M4ZA 1U06A 1YN8A 1VQ9A 4AFSC 5KYYB 5KYYA 5HY6A 2MCNA 1JU5C 2EBPA 3H0IA 2KK4A 3OYHA 3I56T 5CR2A 4JJBA 1GBQA 2QAZA 1J3TA 1EIFA 2NLUA 3V7CA 1SF9A 5GAN7 2C06A 1Q95G 3P8BB 2K3BA 1HD3A 5GAMf 1VQ7A 4IUUA 1MV0B 4F7UG 5GAOr 6AT1B 2KGTA 5IN1A 2A7YA 3G6ET 5GAMg 1QQJA 1ZBXA
chains in the Genus database with same CATH topology
1UTIA 5FWBA 4A63B 1I1JA 1UFFA 2LQNA 3NPFA 4RUGA 4R0KA 1Z9QA 1EFNA 1NEBA 1NLPC 2DJQA 2IIMA 4RTZA 4X1VA 1T0JA 1X6GA 4J9DA 2SEMA 2YSQA 1AWJA 2FRWA 1U3OA 2GBQA 1CKBA 2EYWA 3H0HA 2CT4A 4JZ4A 1JXMA 2LJ0A 1SPKA 2GNCA 3R6NA 4HVVA 2FPEA 1VYTA 3EHQA 2M51A 2RNAA 2C0OA 2BZXA 4F17A 2KEAA 3QWYA 4JJCA 1ZUKA 2CT3A 2DL4A 1NYFA 2JS0A 3VS3A 1ABQA 3H0FA 4IIMA 1CKAA 4J9CA 1E7OA 3VS7A 2FO0A 1ARKA 2O9VA 3TSZA 1GFCA 2F2XA 2JM9A 2CUBA 2J06A 3UA7A 2EYYA 1YWOA 2XMFA 2KRNA 1T3LA 3VS2A 5IHKA 2V1RA 1AEYA 2NUZA 1WX6A 2DE0X 4LUEA 2JM8A 1AWOA 2RQRA 2KYMA 5I22A 1GCQA 1QKXA 4CC3A 4HVWA 2KXDA 3PVLA 2DVJA 1B07A 1ABOA 2D8HA 2YT6A 2LX7A 4KRTA 2J6OA 2ED1A 1PWTA 4RTTA 1B3QA 3EG0A 3ULRB 2V1QA 1NM7A 2J6KA 2ECZA 3EGUA 2QDLA 1JQQA 1S1NA 4OMNA 1KFZA 2HCKA 2EKHA 1HJDA 1X43A 1ZUUA 1MV3A 2OAWA 1AD5A 2JXBA 1X69A 2ROTA 2RPNA 3M0UA 2FPFA 1K9AA 1UECA 1T0HA 1SHFA 1AOJA 1KIKA 2J05A 4AG2C 1X27A 3RBBB 2AKLA 1RLQC 1M8MA 2DM1A 4OMMA 2JMAA 3QWXX 2YUQA 1QWFA 2F2WA 3LH5A 5FWCA 1ZUYA 2D8JA 4WCIA 2EGAA 2DMOA 4RTUA 2J6FA 2KROA 1WXBA 2KT8A 4LE9A 4AFQC 2W10A 2MIOA 1NYGA 2A37A 2K2MA 3M0SA 2DL8A 4RTVA 2YDLA 2ABLA 1BK2A 2JT4A 2HDAA 4HXJA 2KRMA 1WYXA 2K7AA 3NGPA 1Y0MA 2O88A 2OI3A 1QCFA 1X2KA 4Y92A 1QLYA 1N5ZA 1OEBA 3A98A 3EHRA 4J9FA 2L3QA 1YWPA 2KR3A 1NLOC 1SEMA 1UJYA 1FMKA 2DBMA 5FW9A 3VRZA 1PRMC 5ECAA 1T3SA 2LZ6B 1SSHA 2AKKA 3I5SA 1WXTA 2BTTA 2CH4A 2EGCA 4J9BA 1AZEA 3GBQA 2KE9A 5GJVB 1A0NB 2RQWA 3SHWA 3VRYA 2KYBA 3SEMA 1QWEA 3NMZC 2FG0A 2K79A 1AZGB 5IHNA 2JTEA 2KNBB 1G2BA 2O2OA 2OJ2A 3EG3A 1X6BA 2RN8A 5I11A 1K76A 1UG1A 2CREA 1PNJA 2C0TA 3O5ZA 5L23A 1K4US 1UDLA 3THKA 4JJDA 4CC2A 1K0XA 2KRSA 2K6DA 1OPLA 4J9IA 2I0NA 2RF0A 4CC7A 2JMCA 1ZX6A 2SRCA 2FEIA 1TUDA 1W70A 1YNZA 5IXBA 1H3HA 2VWFA 2KXCA 1ZSGA 1H92A 2ENMA 1I07A 2HBWA 2DILA 4CC4B 4RTWA 1GBRA 2RQUA 2HSPA 2H8HA 1UE9A 2E5KA 1FYNA 1XOVA 4J9HA 1YP5A 2A08A 2B86A 2D1XA 1JEGA 2BZYA 2VVKA 2EQIA 4RTXA 2JW4A 2GGRA 2ESWA 3H41A 3VS5A 1Z9ZA 2CUDA 1PKSA 3U23A 4F16A 1I0CA 2LJ3A 4LUDA 2CH4W 2D0NA 4QT7A 5EC7A 1KSWA 1VA7A 3VS4A 1OOTA 1W1FA 3VS6A 4ORZA 1CSKA 2AK5A 3EG1A 1TG0A 4JPBW 3PVQA 2YUOA 5IHIA 2KBTA 1BU1A 2LQWA 1GCQC 4Z8AA 4LN2A 2FPDA 2AZSA 3VS0A 5IH2A 4DEXA 4DEYA 2DF6A 3IQLA 4FSSA 4EIKA 4Z89A 1NEGA 4D8KA 1TUCA 2DA9A 3TSWA 1X2QA 3EG2A 4OMQA 3FJ5A 1PHTA 2DL5A 2DBKA 2L3PA 1GFDA 1WA7A 2GQIA 1K1ZA 2BZ8A 3REAB 4J9EA 3M0QA 1RUWA 1M30A 2G6FX 2RQVA 1WIEA 1K0SA 2PNIA 2JS2A 2F2VA 2LMJA 2DYBA 2DRKA 2X3XD 1PKTA 1E6HA 2ROLA 1RLPC 2YUPA 1ZLMA 1JO8A 1UUEA 1KJWA 4GBQA 2EGEA 4HCKA 1SRMA 4J9GA 3I5RA 1WDXA 2EVRA 2L2PA 2DL3A 2LJ1A 3JV3A 2P4RA 1WLPB 5GJWB 2KT1A 2DX1A 1GL5A 1UGVA 1Y57A 2FRYA 1V1CA 4K11A 3I35A 1QKWA 3RNJA 2HEQA 1M27C 1HSQA 2EPDA 3NHNA 3UA6A 2NWMA 2YUNA 3I9QA 3ZL7C 3REBB 4RTYA 1UHCA 1AWXA 1GCPA 1SRLA 3PE0A 2PTKA 1BB9A 2EYZA 1E6GA 3VS1A 1G83A 1WI7A 2AZVA 1H8KA 4E6RA 3M0RA 1MUZA 3KFVA 4OMPA 4Z88A 2DRMA 1JXOA 2EYXA 4AG1C 4OMOA 4JZ3A 4AFZC 2LCSA 2A28A 2W0ZA 1ZBJA 1LCKA 4OMLA 1WFWA 2O9SA 3UF4A 2EW3A 1PRLC 2J7IA 2M0YA 3M0TA 1OPKA 1VYUA 1UHFA 3CQTA 1M3AA 4ESRA 1YCSB 2CSQA 2GTOA 4AFUC 2C0IA 1BBZA 1OV3A 1U5SA 1UJ0A 1SHGA 1IO6A 1W6XA 1AWWA 2LNHB 2CSIA 2ED0A 3M0PA 4GLMA 2CDTA 4HVUA 2RQTA 4M4ZA 1RI9A 1U06A 1YN8A 1M3BA 2LP5A 4AFSC 2DL7A 2L0AA 2X3WD 4ZNXA 3TVTA 2RMOA 2MCNA 1JU5C 2DNUA 2EBPA 3H0IA 2A36A 4JJBA 1GBQA 2VKNA 1GRIA 4IIOA 1J3TA 5HCKA 2DLPA 2K3BA 1WXUA 4LNPA 1HD3A 4D8DA 4F14A 3C0CA 1MV0B 1VYVA 5IXFA 1NG2A 2K9GA 1M3CA 2KGTA 2O31A 1AVZC 2MOXA 2PZ1A 2GTJA 2L3SA 3UATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UTI A;  5FWB A;  4A63 B;  1I1J A;  1UFF A;  2LQN A;  3NPF A;  4RUG A;  4R0K A;  1Z9Q A;  1EFN A;  1NEB A;  1NLP C;  2DJQ A;  2IIM A;  4RTZ A;  4X1V A;  1T0J A;  1X6G A;  4J9D A;  2SEM A;  2YSQ A;  1AWJ A;  2FRW A;  1U3O A;  2GBQ A;  1CKB A;  2EYW A;  3H0H A;  2CT4 A;  4JZ4 A;  1JXM A;  2LJ0 A;  1SPK A;  2GNC A;  3R6N A;  4HVV A;  2FPE A;  1VYT A;  3EHQ A;  2M51 A;  2RNA A;  2C0O A;  2BZX A;  4F17 A;  2KEA A;  3QWY A;  4JJC A;  1ZUK A;  2CT3 A;  2DL4 A;  1NYF A;  2JS0 A;  3VS3 A;  1ABQ A;  3H0F A;  4IIM A;  1CKA A;  4J9C A;  1E7O A;  3VS7 A;  2FO0 A;  1ARK A;  2O9V A;  3TSZ A;  1GFC A;  2F2X A;  2JM9 A;  2CUB A;  2J06 A;  3UA7 A;  2EYY A;  1YWO A;  2XMF A;  2KRN A;  1T3L A;  3VS2 A;  5IHK A;  2V1R A;  1AEY A;  2NUZ A;  1WX6 A;  2DE0 X;  4LUE A;  2JM8 A;  1AWO A;  2RQR A;  2KYM A;  5I22 A;  1GCQ A;  1QKX A;  4CC3 A;  4HVW A;  2KXD A;  3PVL A;  2DVJ A;  1B07 A;  1ABO A;  2D8H A;  2YT6 A;  2LX7 A;  4KRT A;  2J6O A;  2ED1 A;  1PWT A;  4RTT A;  1B3Q A;  3EG0 A;  3ULR B;  2V1Q A;  1NM7 A;  2J6K A;  2ECZ A;  3EGU A;  2QDL A;  1JQQ A;  1S1N A;  4OMN A;  1KFZ A;  2HCK A;  2EKH A;  1HJD A;  1X43 A;  1ZUU A;  1MV3 A;  2OAW A;  1AD5 A;  2JXB A;  1X69 A;  2ROT A;  2RPN A;  3M0U A;  2FPF A;  1K9A A;  1UEC A;  1T0H A;  1SHF A;  1AOJ A;  1KIK A;  2J05 A;  4AG2 C;  1X27 A;  3RBB B;  2AKL A;  1RLQ C;  1M8M A;  2DM1 A;  4OMM A;  2JMA A;  3QWX X;  2YUQ A;  1QWF A;  2F2W A;  3LH5 A;  5FWC A;  1ZUY A;  2D8J A;  4WCI A;  2EGA A;  2DMO A;  4RTU A;  2J6F A;  2KRO A;  1WXB A;  2KT8 A;  4LE9 A;  4AFQ C;  2W10 A;  2MIO A;  1NYG A;  2A37 A;  2K2M A;  3M0S A;  2DL8 A;  4RTV A;  2YDL A;  2ABL A;  1BK2 A;  2JT4 A;  2HDA A;  4HXJ A;  2KRM A;  1WYX A;  2K7A A;  3NGP A;  1Y0M A;  2O88 A;  2OI3 A;  1QCF A;  1X2K A;  4Y92 A;  1QLY A;  1N5Z A;  1OEB A;  3A98 A;  3EHR A;  4J9F A;  2L3Q A;  1YWP A;  2KR3 A;  1NLO C;  1SEM A;  1UJY A;  1FMK A;  2DBM A;  5FW9 A;  3VRZ A;  1PRM C;  5ECA A;  1T3S A;  2LZ6 B;  1SSH A;  2AKK A;  3I5S A;  1WXT A;  2BTT A;  2CH4 A;  2EGC A;  4J9B A;  1AZE A;  3GBQ A;  2KE9 A;  5GJV B;  1A0N B;  2RQW A;  3SHW A;  3VRY A;  2KYB A;  3SEM A;  1QWE A;  3NMZ C;  2FG0 A;  2K79 A;  1AZG B;  5IHN A;  2JTE A;  2KNB B;  1G2B A;  2O2O A;  2OJ2 A;  3EG3 A;  1X6B A;  2RN8 A;  5I11 A;  1K76 A;  1UG1 A;  2CRE A;  1PNJ A;  2C0T A;  3O5Z A;  5L23 A;  1K4U S;  1UDL A;  3THK A;  4JJD A;  4CC2 A;  1K0X A;  2KRS A;  2K6D A;  1OPL A;  4J9I A;  2I0N A;  2RF0 A;  4CC7 A;  2JMC A;  1ZX6 A;  2SRC A;  2FEI A;  1TUD A;  1W70 A;  1YNZ A;  5IXB A;  1H3H A;  2VWF A;  2KXC A;  1ZSG A;  1H92 A;  2ENM A;  1I07 A;  2HBW A;  2DIL A;  4CC4 B;  4RTW A;  1GBR A;  2RQU A;  2HSP A;  2H8H A;  1UE9 A;  2E5K A;  1FYN A;  1XOV A;  4J9H A;  1YP5 A;  2A08 A;  2B86 A;  2D1X A;  1JEG A;  2BZY A;  2VVK A;  2EQI A;  4RTX A;  2JW4 A;  2GGR A;  2ESW A;  3H41 A;  3VS5 A;  1Z9Z A;  2CUD A;  1PKS A;  3U23 A;  4F16 A;  1I0C A;  2LJ3 A;  4LUD A;  2CH4 W;  2D0N A;  4QT7 A;  5EC7 A;  1KSW A;  1VA7 A;  3VS4 A;  1OOT A;  1W1F A;  3VS6 A;  4ORZ A;  1CSK A;  2AK5 A;  3EG1 A;  1TG0 A;  4JPB W;  3PVQ A;  2YUO A;  5IHI A;  2KBT A;  1BU1 A;  2LQW A;  1GCQ C;  4Z8A A;  4LN2 A;  2FPD A;  2AZS A;  3VS0 A;  5IH2 A;  4DEX A;  4DEY A;  2DF6 A;  3IQL A;  4FSS A;  4EIK A;  4Z89 A;  1NEG A;  4D8K A;  1TUC A;  2DA9 A;  3TSW A;  1X2Q A;  3EG2 A;  4OMQ A;  3FJ5 A;  1PHT A;  2DL5 A;  2DBK A;  2L3P A;  1GFD A;  1WA7 A;  2GQI A;  1K1Z A;  2BZ8 A;  3REA B;  4J9E A;  3M0Q A;  1RUW A;  1M30 A;  2G6F X;  2RQV A;  1WIE A;  1K0S A;  2PNI A;  2JS2 A;  2F2V A;  2LMJ A;  2DYB A;  2DRK A;  2X3X D;  1PKT A;  1E6H A;  2ROL A;  1RLP C;  2YUP A;  1ZLM A;  1JO8 A;  1UUE A;  1KJW A;  4GBQ A;  2EGE A;  4HCK A;  1SRM A;  4J9G A;  3I5R A;  1WDX A;  2EVR A;  2L2P A;  2DL3 A;  2LJ1 A;  3JV3 A;  2P4R A;  1WLP B;  5GJW B;  2KT1 A;  2DX1 A;  1GL5 A;  1UGV A;  1Y57 A;  2FRY A;  1V1C A;  4K11 A;  3I35 A;  1QKW A;  3RNJ A;  2HEQ A;  1M27 C;  1HSQ A;  2EPD A;  3NHN A;  3UA6 A;  2NWM A;  2YUN A;  3I9Q A;  3ZL7 C;  3REB B;  4RTY A;  1UHC A;  1AWX A;  1GCP A;  1SRL A;  3PE0 A;  2PTK A;  1BB9 A;  2EYZ A;  1E6G A;  3VS1 A;  1G83 A;  1WI7 A;  2AZV A;  1H8K A;  4E6R A;  3M0R A;  1MUZ A;  3KFV A;  4OMP A;  4Z88 A;  2DRM A;  1JXO A;  2EYX A;  4AG1 C;  4OMO A;  4JZ3 A;  4AFZ C;  2LCS A;  2A28 A;  2W0Z A;  1ZBJ A;  1LCK A;  4OML A;  1WFW A;  2O9S A;  3UF4 A;  2EW3 A;  1PRL C;  2J7I A;  2M0Y A;  3M0T A;  1OPK A;  1VYU A;  1UHF A;  3CQT A;  1M3A A;  4ESR A;  1YCS B;  2CSQ A;  2GTO A;  4AFU C;  2C0I A;  1BBZ A;  1OV3 A;  1U5S A;  1UJ0 A;  1SHG A;  1IO6 A;  1W6X A;  1AWW A;  2LNH B;  2CSI A;  2ED0 A;  3M0P A;  4GLM A;  2CDT A;  4HVU A;  2RQT A;  4M4Z A;  1RI9 A;  1U06 A;  1YN8 A;  1M3B A;  2LP5 A;  4AFS C;  2DL7 A;  2L0A A;  2X3W D;  4ZNX A;  3TVT A;  2RMO A;  2MCN A;  1JU5 C;  2DNU A;  2EBP A;  3H0I A;  2A36 A;  4JJB A;  1GBQ A;  2VKN A;  1GRI A;  4IIO A;  1J3T A;  5HCK A;  2DLP A;  2K3B A;  1WXU A;  4LNP A;  1HD3 A;  4D8D A;  4F14 A;  3C0C A;  1MV0 B;  1VYV A;  5IXF A;  1NG2 A;  2K9G A;  1M3C A;  2KGT A;  2O31 A;  1AVZ C;  2MOX A;  2PZ1 A;  2GTJ A;  2L3S A;  3UAT A; 
#chains in the Genus database with same CATH topology
 2I2L A;  3QXE B;  5FWB A;  2XG8 D;  3EG9 B;  4RUG A;  3EG9 A;  2JNG A;  9ATC B;  1D1C A;  4M78 E;  3JCM e;  3OYJ A;  1T0J A;  4J9D A;  4N0A A;  1TU0 B;  1FMV A;  2FRW A;  1U3O A;  5FRO A;  1RAB B;  3OW2 A;  3CBM A;  4KH0 B;  2CT4 A;  4JZ4 A;  1JXM A;  3OW2 S;  4DA4 A;  1SPK A;  3C12 A;  4BE0 A;  4HVV A;  1K9M R;  1VYT A;  1D1A A;  3RUX A;  2HSE B;  3JCM b;  2C0O A;  1VIF A;  1VQO T;  3HPW A;  1VQ9 T;  1VQK A;  1ZUK A;  2DL4 A;  1NYF A;  4IIM A;  1CKA A;  4ELZ C;  1TSF A;  2YRV A;  1E7O A;  1YIT A;  1GFC A;  2CUB A;  1Y71 A;  1OX8 A;  4C92 C;  3OBY A;  4BI4 A;  3ASK A;  3SDZ A;  4M7D F;  2QXF A;  2FVU A;  5KH6 A;  4LUE A;  1LJO A;  1AWO A;  1WHM A;  5DLQ E;  3JCM Q;  4CC3 A;  3JCM f;  2LDM A;  3PVL A;  2DVJ A;  3OYF A;  2CP0 A;  1QCN A;  3P8H A;  3X24 B;  2EJ9 A;  2LX7 A;  2J6O A;  3CCV A;  3QJ6 A;  2HKN A;  5FU7 C;  2WSC E;  2EKO A;  3S3N A;  3CCE T;  5KYW B;  2QDL A;  5KYW A;  2K5L A;  4OMN A;  1KFZ A;  3SB2 A;  2HCK A;  2EKH A;  4M75 C;  2P0Q A;  2COW A;  3CME Q;  1VQ5 Q;  1MV3 A;  1SSF A;  1PG5 B;  3A5Z B;  1SHF A;  1KIK A;  2J05 A;  2ZCF B;  4LDW A;  1YJ9 A;  1KK7 A;  2DM1 A;  3CC2 A;  1KHC A;  1RAI B;  3CPW P;  3LH5 A;  2RJE A;  3CXC A;  1NJI R;  3MPU B;  4FYX B;  1YIT T;  4PJO E;  5HK3 A;  2J6F A;  2DD4 A;  2VYT A;  3ZFJ A;  3CCU Q;  1MMA A;  4LE9 A;  2DXC A;  4XU2 A;  1RAH B;  2KVQ G;  3JCM V;  2MIO A;  1VQM Q;  1XJW B;  2V8I A;  2A37 A;  1F1B B;  3M0S A;  3RR6 A;  1AHJ B;  2DL8 A;  2YDL A;  2ABL A;  1AT1 B;  4C8Q B;  4C8Q A;  2CZ7 B;  1DJ7 B;  3EFS A;  4JS5 A;  4C0F A;  3NTI A;  4BY6 B;  5DY9 A;  3JB9 J;  1QCF A;  1X2K A;  1QLY A;  1N5Z A;  1OEB A;  2M1H A;  2VB6 A;  4VUB A;  5I21 A;  1FMK A;  3CCV T;  5FW9 A;  5ECA A;  2LZ6 B;  2AIR B;  4PFO A;  2RM4 A;  2CH4 A;  2EGC A;  3GF5 A;  5LJ3 j;  4R55 A;  4J9B A;  4J7F A;  2KE9 A;  2K4Y A;  2QQR A;  1QWE A;  1AZG B;  5IHN A;  3E19 A;  1G2B A;  5GAN 8;  5GAM h;  1YHQ T;  4HT8 A;  1WZO A;  3OA6 A;  3PMT A;  2PVD B;  5I11 A;  1YI2 Q;  4RKU E;  1UG1 A;  1K9M C;  1M2O A;  5GAN 3;  1G3T A;  1PNJ A;  4M7A E;  5L23 A;  3CC7 T;  3CCS Q;  3VV0 A;  1PCX A;  2KI7 A;  4ZN1 A;  4JS4 A;  1BIA A;  1IHW A;  1YJ9 T;  1KD1 R;  4PK4 A;  4PFP A;  2RF0 A;  3RER A;  4QVC A;  4CC7 A;  3G4S A;  3PTA A;  3VYH B;  1M1G A;  1TUD A;  1N27 A;  2E3I A;  3A8O B;  2VC8 A;  2KXC A;  3M57 A;  1TTH B;  4RG8 A;  3VJP A;  1YJW Q;  2DIL A;  4CC4 B;  4RTW A;  2LQ8 A;  5C0M A;  1GBR A;  2X4X A;  3LWH A;  1ZA1 B;  3GNF B;  3CCJ Q;  1JEG A;  3OS0 A;  2OTJ T;  2BZY A;  2DET A;  2EQI A;  2FL7 A;  3OYA A;  3CD6 Q;  5LJ5 e;  4M7D B;  4M7D A;  5EC7 A;  5LJ3 g;  3MET A;  1G3Y A;  3GLX A;  3VS6 A;  4E7I A;  1CSK A;  3S3M A;  3BDU A;  3EG1 A;  1MMD A;  5IHI A;  2HL3 A;  1BU1 A;  2DD5 A;  4OVA A;  3CMA A;  2DF6 A;  1VQN Q;  4WF2 A;  3L2Q A;  2PQW A;  4C92 F;  1C6V X;  1NEG A;  1Y7X A;  1TUC A;  2DA9 A;  3TSW A;  3QKJ A;  3JCM h;  1S72 A;  2QQ9 A;  1OX9 A;  2GQI A;  1KC8 C;  1BCM A;  4J9E A;  1BYM A;  4J6Y A;  2VUB A;  2X4Y A;  4FYY B;  1NJI C;  2GCX A;  3QZ5 B;  3T9N A;  2DRK A;  2IVW A;  2X3X D;  1VQL Q;  3VKI A;  1PKT A;  1RLP C;  1ZLM A;  1TWB A;  3MEU A;  3E9F A;  3OS5 A;  2XIC A;  5LJ5 f;  3I5R A;  3V8J A;  4CRI A;  3I55 A;  2QQA A;  4A54 A;  2EVR A;  8AT1 B;  2L2P A;  2MK5 A;  5LJ5 g;  4OB1 B;  1U8R A;  4J7I A;  4L6V 5;  5GJW B;  2K57 A;  3ZEH A;  1K9M U;  3OYD A;  1UGV A;  1C0M A;  2QTX A;  3WXM B;  1QKW A;  2EFI A;  1M27 C;  3CEY A;  3CCL A;  3UA6 A;  4L5G A;  4RTY A;  7AT1 B;  2YRC A;  1AWX A;  3EFO B;  5GMK e;  3EFO A;  1GCP A;  3QYG B;  2PTK A;  3VS1 A;  1E6G A;  2AZV A;  4E6R A;  3QPH A;  5CAI A;  4J8O A;  4XTX A;  4OMP A;  4Z88 A;  4EMG A;  1KD1 C;  4LXC A;  2L3R A;  1JRI A;  4JZ3 A;  1Q81 R;  2W0Z A;  1LCK A;  3UF4 A;  1HXD A;  1PRL C;  2J7I A;  2M0Y A;  1M1K R;  1TS9 A;  1YFN A;  4M75 E;  3LH0 A;  3X20 B;  2MWO A;  4J6X A;  1XNI A;  1M3A A;  4ESR A;  2DTI A;  4FT2 A;  2C0I A;  2CGH A;  4QVZ A;  4PLL A;  4RCC A;  1W6X A;  2KQW A;  4CI0 C;  3I55 T;  2VAS A;  2DTO A;  5GAN d;  4GY5 A;  4KUL A;  1WJR A;  1MND A;  2CSI A;  2ED0 A;  1PSE A;  4C0G A;  3SWN C;  2QA4 T;  2LP5 A;  4B9X A;  2RMO A;  4QQD A;  4XTW A;  3S3O A;  1NPP A;  2HQE A;  2A36 A;  4JRI A;  3V8L A;  1PD1 A;  3CCL T;  2VKN A;  3LX7 A;  4IIO A;  2K3X A;  2AT1 B;  1H3Z A;  1I81 A;  1QVF S;  2QYZ A;  2DXU A;  1M90 R;  4FYW B;  4M77 E;  1JB0 E;  1VYV A;  4PLI A;  2K9G A;  1YIJ T;  1AVZ C;  2MOX A;  1W4S A;  2PZ1 A;  2G3R A;  2YLC A;  2ZPI B;  4A63 B;  2ZPB B;  4R0K A;  4NL3 A;  2PU9 B;  4JUV A;  1RAF B;  1Z9Q A;  4IUR A;  4C92 B;  3LGF A;  4A4G A;  4C92 A;  2NUP B;  2NUP A;  2OX7 A;  2XKO C;  4RTZ A;  1X6G A;  1NZ9 A;  1K73 C;  4D6W A;  2SEM A;  3PIP A;  2YSQ A;  2YXY A;  3HRU A;  2EQU A;  3HFO A;  1QVG S;  2EYW A;  3H0H A;  3EH1 A;  4J5Y A;  3L42 A;  2RI2 A;  2LJ0 A;  5GMK m;  1B34 B;  1VQ4 Q;  1B34 A;  3R6N A;  2R57 A;  3CCQ Q;  2RD1 A;  3SD4 A;  1NPR A;  4PJN A;  3X26 B;  1M5Q 1;  2KEA A;  1Q7Y C;  3QWY A;  5FU7 B;  2CT3 A;  3VS3 A;  3URG A;  1BCO A;  3MKD A;  2LVM A;  3M54 A;  3OYG A;  2DIQ A;  1IXD A;  4BUG A;  2FYK A;  1YWO A;  1W2B A;  3N5B B;  5DLO A;  2KRN A;  2H3J A;  2V1R A;  1Q86 R;  1K8A U;  1UGR B;  1WX6 A;  4BB7 A;  5J26 A;  1BIB A;  5LJ5 h;  2KYM A;  5AYF A;  1GCQ A;  3QDR B;  3CCM T;  2KXD A;  4E7K A;  2NUT B;  2NUT A;  3BE3 A;  3UT1 A;  5GAO n;  1ZSZ C;  3M55 A;  4E7Z A;  2YT6 A;  1Q81 C;  5KCO A;  2ED1 A;  5D6X A;  1M1K C;  2EQJ A;  5KYN A;  2V1Q A;  1WHJ A;  3R6O A;  3EGU A;  3FJP A;  1JQQ A;  4HCZ A;  3M9Q A;  2E1H A;  1HJD A;  1X43 A;  3CPF A;  4E2F B;  2OAW A;  3QDF A;  4X34 A;  3OYC A;  4PKC C;  5GAN 6;  3M59 A;  4ZTF A;  1T0H A;  3RKY A;  1U1S A;  3RBB B;  3CCR A;  4FM4 B;  1N8R U;  1M8M A;  2E4H A;  3LW5 E;  1G8X A;  3QWX X;  2YHT A;  3RES A;  2EWN A;  1ZUY A;  4AT1 B;  2BUD A;  4F04 B;  1WXB A;  2W10 A;  3BW1 A;  3QJY A;  2K2M A;  1M90 C;  3I56 Q;  3C4S A;  2QG9 B;  4EMK C;  1BK2 A;  1ZA2 B;  2HDA A;  2JT4 A;  3MEW A;  2KRM A;  4HXJ A;  1WYX A;  3CME A;  3G71 A;  1UB4 A;  1Y0M A;  2O88 A;  1RAD B;  5I2S A;  2Y4X A;  3EHR A;  3JCM X;  4C8Q E;  2X4J A;  2L3Q A;  1YWP A;  2FZC B;  3G6E Q;  1IRX A;  3VRZ A;  1T3S A;  4DBQ A;  5GMK h;  2IPO B;  4J83 A;  2AKK A;  4F7U B;  4F7U A;  1WXT A;  2BTT A;  1AZE A;  4FIB A;  5GJV B;  1N6A A;  1WQW A;  3VRY A;  3A8L B;  4BDY A;  2K79 A;  4LD6 A;  2JTE A;  2KNB B;  2O2O A;  1UEB A;  2OJ2 A;  4XU1 A;  1VQM A;  2Z0W A;  5GAM d;  3GP8 A;  1X6B A;  2RN8 A;  2BIV A;  1K76 A;  1QP2 A;  5A0L A;  3O5Z A;  2GFA A;  5GAN 4;  2RHY A;  3LGL A;  2K6D A;  1OPL A;  2YRD A;  2ZGW A;  3CCR T;  1BI3 A;  2MAM A;  1MGQ A;  4GLK A;  3RKX A;  2JMC A;  1VQ7 T;  2RJF A;  2E12 A;  1O75 A;  1VQO Q;  3JCM c;  1VQ8 A;  4XTZ A;  2ENM A;  2ZPE B;  1Q86 C;  2MF2 A;  4BD3 A;  3UPU A;  2RQU A;  2HSP A;  2P4T A;  1UE9 A;  4R56 A;  2E5K A;  5CQX A;  2M9U A;  4BAC A;  3G71 T;  1LPL A;  3NTH A;  3VS5 A;  3BY7 A;  1I8F A;  3RKW A;  1PC0 A;  2LCC A;  4ZGJ B;  3U23 A;  2F5K A;  3TEE A;  1I0C A;  3KBG A;  3OY9 A;  4XTV A;  3VS4 A;  1OOT A;  1H64 1;  3FIF A;  2HD0 A;  4M78 G;  2AK5 A;  2OTL A;  5CCA A;  2YUO A;  2KBT A;  4M7D E;  4O6J A;  3DKM A;  2MPX C;  1GCQ C;  4FW2 A;  1KC8 R;  5M9O A;  5CO7 A;  1UGP B;  1VQK T;  3L1A A;  2CYZ B;  3CCE Q;  1YJW A;  1M90 U;  3CXC S;  4D8K A;  4FL6 A;  4EDU A;  4HA8 A;  3CCJ A;  1QVP A;  4IUT A;  3JCM d;  1WA7 A;  2RK2 A;  3QHS A;  3MEV A;  2KDS A;  3M0Q A;  1M30 A;  2G6F X;  2RQV A;  5D7U A;  1WIE A;  1TOV A;  1K0S A;  1VQ8 T;  2LMJ A;  2RH2 A;  2ZPG B;  2ROL A;  4PFZ A;  5HK0 A;  1RAG B;  5FU6 C;  1Y96 B;  1Y96 A;  2EGE A;  4JRQ A;  1YIT Q;  4JRK A;  4XTU A;  5LJ3 e;  1RAC B;  1WDX A;  1VQN A;  3V7R A;  2D0Q B;  1D0Y A;  2JZ2 A;  1WLP B;  2GF7 A;  3ZBD A;  3H8Z A;  3OYM A;  2QI2 A;  1V1C A;  2XHC A;  3I35 A;  4M77 D;  3JRZ A;  1X01 A;  1HSQ A;  2OTL T;  2EPD A;  2GQV A;  2MWP A;  3HSB A;  4DOW A;  2DK3 A;  3CCV Q;  1G3S A;  1UHC A;  3CC2 T;  3JB9 D;  1FWZ A;  1BB9 A;  2EYZ A;  5CKF A;  1YJW T;  1Q82 C;  1OU8 A;  3QSU A;  5CKB A;  3SWN B;  3KFV A;  3SWN A;  3OYI A;  3HKS A;  2DRM A;  1YHQ Q;  1OUL A;  4JLI A;  4LDV A;  5AT1 B;  4ELY C;  4J6W A;  2LTO A;  2K5I A;  2FHD A;  3CC7 Q;  2EW3 A;  3TRE A;  3M0T A;  4DOV A;  1YJ9 Q;  1UHF A;  1YJN Q;  2LRQ A;  5LJ3 f;  3OYE A;  2CZ1 B;  2LT4 A;  4Q5W A;  4XAX B;  4AFU C;  2RHI A;  1OV3 A;  1U5S A;  1UJ0 A;  1SHG A;  1IO6 A;  1AWW A;  1IHV A;  1ACM B;  2HZY A;  2RO0 A;  2VXF A;  2LNH B;  3QBY A;  3X25 B;  1KQS A;  4HVU A;  1KQS S;  2OTJ Q;  3TQ7 P;  2L0A A;  2X3W D;  4ZNX A;  4ZGE B;  2DNU A;  4DBF A;  1M8V A;  4O5V A;  5KCH A;  2Y90 A;  3L2W A;  2COZ A;  4JRP A;  2B8A A;  2JN0 A;  2KY9 A;  4XQ3 A;  2DLP A;  3OS1 A;  1WXU A;  1ZHI A;  4D8D A;  4F14 A;  3G4S T;  5GAN j;  3C0C A;  4C5E A;  1R0B G;  2JJ9 A;  2O31 A;  3M58 A;  2GTJ A;  1K73 R;  4M7A G;  5D6W A;  3OYK A;  3UAT A;  3OYB A;  2DEU A;  1UFF A;  2LQN A;  4L59 A;  3RDV A;  2EYQ A;  3LWI A;  1NEB A;  3A8G B;  2DJQ A;  3EAE A;  2IIM A;  3E2U A;  4X1V A;  4NL2 A;  4KH1 B;  1LOJ A;  2M16 A;  1AWJ A;  1D1B A;  5EG2 A;  1Q7Y R;  1OZ2 A;  5L8R E;  4C92 E;  3RIR A;  2GFU A;  1XTD A;  2XID A;  2V8K A;  1KHI A;  2JUF A;  3PGG A;  2KMT A;  5A0D A;  5KYX A;  5KYX B;  2GNC A;  2FPE A;  3EHQ A;  4PL6 A;  1ZQ1 A;  1ZSZ B;  1ZSZ A;  3NFC A;  1QVF P;  3CMA T;  4M78 C;  4KGV B;  4MDX A;  2K5F A;  2JS0 A;  1ABQ A;  3V8K A;  4J9C A;  3MP6 A;  4XK8 E;  2E70 A;  4M78 D;  1ARK A;  2MYS A;  2F2X A;  2JM9 A;  2J06 A;  1S72 T;  2MMP A;  3VS2 A;  2NUZ A;  4C8Q D;  1IRE B;  5A2Q E;  2MI6 A;  2JM8 A;  1SKU B;  5LJ5 d;  4FW1 A;  1I4K 1;  4MML A;  4B6M A;  1EX4 A;  1QKX A;  1D0Z A;  2BKD N;  1QVG P;  3GOX A;  5CKD A;  1O9S A;  2E6N A;  2CP7 A;  1RAA B;  3CCQ A;  2DKG A;  4JLG A;  4RTT A;  3J7A F;  1B3Q A;  2DZC A;  3ULR B;  1KQ1 A;  1WGS A;  2CP2 A;  2A3L A;  2HNI A;  4OGE A;  4M77 F;  1D09 B;  5CVI A;  1TXQ A;  4EMK B;  4EMK A;  1ZUU A;  3JB9 F;  1AD5 A;  3CBP A;  1KC8 U;  2JXB A;  2E64 A;  1I5O B;  2RPN A;  1K9A A;  1UEC A;  3CC4 A;  3INZ A;  2XK0 A;  1AOJ A;  4MMK A;  1X27 A;  3L2Z A;  2AKL A;  4ZGD B;  1NJI U;  3FEO A;  3I55 Q;  2L89 A;  4DBR A;  3RMS A;  1QP3 A;  2JMA A;  2XDB A;  4PNO A;  2F2W A;  3M56 A;  2YWW A;  2ZAE A;  2D8J A;  3V7S A;  4HT9 A;  2DMO A;  2F5T X;  3GNG A;  2QA4 Q;  1VQP A;  2KT8 A;  3MO8 A;  4AFQ C;  5LJ3 h;  3PIO A;  1VQ6 A;  5A0G A;  1G3W A;  4EMH A;  4BI3 A;  3CCL Q;  1KG1 A;  2EJF A;  1VUB A;  2WSF E;  4ANJ A;  1QCO A;  5GMK l;  3NGP A;  3G1J A;  5HKC A;  1YCY A;  4KGX B;  2JTM A;  2OI3 A;  4C5H A;  4M7D D;  4Y92 A;  1WHK A;  2RI5 A;  4J9F A;  2KR3 A;  1JJ2 A;  2E5Q A;  1SEM A;  1YIJ Q;  1JJ2 S;  2DBM A;  3QUI A;  1PRM C;  4QW2 A;  5CK9 A;  4WTO B;  4RCB A;  5GAO l;  4M75 G;  2JVV A;  3I5S A;  1LVK A;  3P8D A;  4OMF B;  1TUG B;  4PJO D;  5I2M A;  2RB6 A;  3SEM A;  5GAO p;  2FG0 A;  1WHL A;  4QQ6 A;  1X75 C;  2E3H A;  4F7U E;  5KE3 A;  1KD1 U;  1KQ2 A;  3EG3 A;  5GAO m;  3CC4 T;  4C0Z A;  1RAE B;  1K4U S;  3VYG A;  4B9W A;  2KRS A;  4HCC A;  1W2B S;  4J9I A;  1V76 A;  4DBH A;  3OBW A;  2HBP A;  3F70 A;  1RI0 A;  1ZX6 A;  2XI9 A;  3JB9 I;  4AMC A;  2RHX A;  1W70 A;  1YNZ A;  1PM3 A;  1H3H A;  2VWF A;  3G6E A;  1ZSG A;  2H3E B;  4FU6 A;  1VQP T;  1GXI E;  1I07 A;  1VQ6 T;  3OS2 A;  1NE8 A;  3OW2 P;  3PNW C;  5GAM j;  2H8H A;  1FYN A;  1XOV A;  2A08 A;  2LT1 A;  1QW1 A;  4M77 G;  3HRT A;  2GGR A;  2HQX A;  3H41 A;  4M7A D;  2PVG B;  1IGU A;  2CUD A;  2HKQ B;  1PKS A;  2D6F A;  2O01 E;  2QGG A;  2X4W A;  2CH4 W;  2RHZ A;  3JB9 G;  4QT7 A;  1KSW A;  3CCM Q;  1VA7 A;  3OYL A;  1W1F A;  4ORZ A;  3OSS C;  2XDP A;  3FB9 A;  1TH7 A;  3ME9 A;  4M78 F;  1TG0 A;  3PVQ A;  5FU6 B;  2X51 A;  4ZN3 A;  2LX9 A;  4LN2 A;  5KYU B;  5KYU A;  5IH2 A;  3E9G A;  2DER A;  1OI1 A;  4DEX A;  4LD9 K;  4KGZ B;  1I5L A;  4II1 A;  2DJZ A;  4C8Q F;  3X28 B;  2QEX Q;  4MZP A;  1FMW A;  2DAQ A;  3O8V A;  1WPY A;  4EIK A;  4Z89 A;  3HRS A;  4QKU A;  4M77 B;  4M77 A;  5J39 A;  3EG2 A;  4JDS A;  3FJ5 A;  1IB8 A;  1PHT A;  2DL5 A;  4FSX A;  1GFD A;  1K1Z A;  3REA B;  1K73 U;  4Z02 A;  1RUW A;  2NYS A;  2HL5 C;  1WHG A;  1G5V A;  3BDL A;  2A0F B;  3A1P A;  1PD0 A;  3L2R A;  4KBM B;  2PNI A;  1VQ5 A;  2JS2 A;  2DPP B;  2DYB A;  1WHH A;  5CKH A;  3VUB A;  2VXE A;  2R5M A;  1M4Z A;  1KJW A;  2AHJ B;  4HCK A;  2RHU A;  2FB7 A;  1Q7Y U;  4OF1 A;  1WNL A;  5GAN 5;  3CCE A;  4IUQ A;  2LJ1 A;  4V2S A;  3JV3 A;  2EIF A;  2K2V A;  3OQ5 A;  2DX1 A;  1GL5 A;  4UC4 A;  3CCU A;  4BE1 A;  2FRY A;  3CXC P;  1Q82 R;  3RNJ A;  4X9C A;  1IZ6 A;  3NHN A;  1RL2 A;  3PFS A;  2YUN A;  3ZL7 C;  2RA2 A;  3E1S A;  2E6Z A;  1G83 A;  1WI7 A;  1H8K A;  1Q81 U;  3M0R A;  1MUZ A;  1VQ9 Q;  3EGX B;  3EGX A;  1M1K U;  2X35 A;  4A4H A;  2XD0 A;  1JXO A;  2EYX A;  4C0D C;  3GIB A;  1UGS B;  2LCS A;  4OML A;  4N4I A;  2O9S A;  3MJX A;  4C92 D;  1VIE A;  3CME T;  2QDY B;  3M4G A;  4KUI A;  3CCR Q;  1VQ5 T;  1VYU A;  1N9R A;  4HCB A;  4IUP A;  2P84 A;  1JBM A;  1QMC A;  1YCS B;  4A4F A;  1YI2 A;  4PJO F;  1VQ7 Q;  4XU3 A;  5IT9 E;  4DQ2 A;  1SG5 A;  3CCS A;  2DVE A;  3JCM g;  2ZPF B;  4LDU A;  2QAS A;  4LDY A;  3C94 A;  1IGQ A;  3M0P A;  4GLM A;  3JAM E;  2RQT A;  1RI9 A;  4XU0 A;  1M3B A;  3CCU T;  1B7T A;  3H6Z A;  2EAY A;  4A4K A;  4C8Q G;  2DL7 A;  3G71 Q;  3JB9 H;  3TVT A;  1VQM T;  2X9H A;  1YHQ A;  5FRM A;  3FRN A;  1R8O B;  4NS5 A;  2FZK B;  4M75 D;  1PSF A;  5GMK i;  3LYI A;  1M1F A;  3CC7 A;  3M5A A;  2V26 A;  1GRI A;  2LCL A;  5HCK A;  1WJS A;  4MZM A;  1YJN A;  2BE7 D;  4LNP A;  4KUD K;  3CD6 A;  3TU4 K;  2CZ0 B;  2DTH A;  5IXF A;  1NG2 A;  1M3C A;  3NTK A;  1XQH A;  4PJL A;  3JCM J;  4QQG A;  4M78 B;  1VQK Q;  4M78 A;  2L3S A;  4A53 A;  4M7A F;  2R58 A;  1UTI A;  1I1J A;  3NPF A;  3SFM A;  1YBY A;  3DB3 A;  4QVD A;  1EFN A;  2QTV A;  1NLP C;  2OTJ A;  3HTR A;  1KQS P;  1MNE A;  1YI2 T;  2RJD A;  4M77 C;  2GBQ A;  1CKB A;  3CCS T;  3HP9 A;  2FZG B;  1VQ8 Q;  5LL6 S;  3DLM A;  4E7J A;  3VU3 C;  4PJJ A;  4IKF A;  2M51 A;  2RNA A;  4OB0 B;  3ER0 A;  2BZX A;  4F17 A;  4Y91 A;  4JJC A;  1UGQ B;  1VQL A;  3QZ9 B;  4OB2 B;  3H0F A;  1BI2 A;  1Q86 U;  3M53 A;  3L2V A;  3FC3 A;  3VS7 A;  2FO0 A;  1OZ3 A;  4ME7 A;  2O9V A;  3TSZ A;  2XDD A;  3DLL A;  3UWN A;  3UA7 A;  3CCJ T;  2KSS A;  3RMQ A;  2EYY A;  2XMF A;  5CIU A;  4M7D G;  1T3L A;  5IHK A;  2WAC A;  4N0A C;  1AEY A;  2OAU A;  2DE0 X;  1YJN T;  2CP5 A;  2OTL Q;  3CD6 T;  4BI8 B;  2RK1 A;  2RQR A;  4BDZ A;  4OGC A;  3CPW A;  1MMG A;  5I22 A;  2L8D A;  3CPW S;  1BKB A;  3CC2 Q;  1K8A R;  1OYX A;  2PUK B;  4HVW A;  4PJO G;  5CKE A;  5GAO q;  3EFR A;  2IG0 A;  3A8H B;  1B07 A;  1ABO A;  2D8H A;  2PUO B;  3FDR A;  2COY A;  4KRT A;  4A4E A;  2P0K A;  2VGN A;  1PWT A;  5KE2 A;  3EG0 A;  1NM7 A;  2J6K A;  1VQN T;  2ECZ A;  4FCY A;  1S1N A;  1U1T A;  4PJM A;  3OYN A;  5LJ5 j;  3QG1 A;  5J3B A;  5IAY A;  4ZTJ A;  1X69 A;  2ROT A;  1WJQ A;  3M0U A;  2FPF A;  2EQM A;  1NBE B;  4YTL A;  4JJN K;  3MEA A;  4AG2 C;  2WSE E;  3KXT A;  3EGD B;  3EGD A;  1OU9 A;  4PJO B;  5GAN e;  4PJO A;  1RLQ C;  4OMM A;  2DXT A;  1VQL T;  2YUQ A;  2QQB A;  1QWF A;  4C5G A;  5GAN 2;  5FWC A;  4WCI A;  4X9D A;  2EGA A;  2KAF A;  1N8R R;  4RTU A;  3A8M B;  2F1L A;  2KRO A;  2BE9 B;  5LJ3 d;  1NYG A;  1C1A A;  1M9S A;  2ATC B;  4RTV A;  2CP3 A;  1X6O A;  2LQK A;  2HAX A;  2CS7 A;  2R5A A;  4N4G A;  3TCJ A;  1R77 A;  2CKK A;  2K7A A;  2L5Q A;  3G4S Q;  3A98 A;  4P5N A;  1NLO C;  1VOM A;  1UJY A;  2QGF B;  4FT4 A;  3OMG A;  4HKE A;  2DYI A;  4OB3 B;  1SSH A;  3Q1J A;  3AHU A;  4OP0 A;  4M75 F;  1HYO A;  3GBQ A;  1A0N B;  1Q82 U;  3KUF A;  2RQW A;  4M7A B;  3SHW A;  4M7A A;  2KYB A;  3NMZ C;  2QA4 A;  2Y4Y A;  2ZPH B;  3EH2 A;  1N9S A;  5GAN f;  3OB9 A;  3JCM W;  1EZZ B;  2DEQ A;  2CRE A;  4C8Q C;  2C0T A;  2RJC A;  2VGM A;  3CBO A;  3D7S B;  1UDL A;  3THK A;  5GAN g;  2E10 A;  4JJD A;  4CC2 A;  4E7L A;  1K0X A;  4BY6 C;  3M4Y A;  2I0N A;  3L2U A;  1Y07 A;  3WVE B;  2EQK A;  5GMK j;  2SRC A;  2FEI A;  2VV5 A;  2YLB A;  5CQY A;  3CMA Q;  4MDW A;  5IXB A;  1YIJ A;  3WVD B;  2DO3 A;  1H92 A;  8ATC B;  1VQ4 A;  2HBW A;  2E65 A;  3S6W A;  1JJ2 P;  3VUZ A;  4E7H A;  2QQS A;  3AT1 B;  3MP8 A;  1S72 Q;  4J9H A;  1YP5 A;  2B86 A;  2D1X A;  2VVK A;  4RTX A;  2JW4 A;  2ESW A;  1K8A C;  5D6Y A;  4E47 A;  1Z9Z A;  4F16 A;  4KT0 E;  2LJ3 A;  4LUD A;  2D0N A;  2CP6 A;  2RI3 A;  1BI0 A;  3BFM A;  5DM7 R;  2PVO B;  3PMI A;  4JPB W;  2F69 A;  1W2B P;  2LQW A;  4Z8A A;  2FPD A;  1MHN A;  2AZS A;  3OMC A;  3VS0 A;  1OQK A;  4DEY A;  3IQL A;  4FSS A;  3HHT B;  3J81 E;  4C92 G;  4BE2 A;  2K3Y A;  2O4X B;  2O4X A;  3J80 E;  2HMA A;  3C95 A;  1X2Q A;  4OMQ A;  1LNX A;  2DBK A;  2L3P A;  1QVF A;  3OSV A;  2BZ8 A;  2XU8 A;  4M7D C;  1D3B B;  1D3B A;  1R0C B;  3MCA B;  4F7U F;  2D9T A;  2F2V A;  1N8R C;  2DIG A;  3CCM A;  3H9N A;  4EPC A;  3G7Z A;  1E6H A;  2YUP A;  1VQ4 T;  5FLX E;  3PT9 A;  3FLG A;  1JO8 A;  3CCQ T;  1UUE A;  4RMO A;  4GBQ A;  1FXX A;  4PJO C;  4J9G A;  1SRM A;  1D0X A;  4IUV A;  2LNV A;  1WQ7 A;  2EJG A;  3LLR A;  3MHX A;  4C0D B;  2DL3 A;  3OYY A;  2ZZD A;  3UDC A;  4Y28 E;  2QEX A;  2P4R A;  3JCM P;  4XTY A;  1QVG A;  2KT1 A;  3DB4 A;  1Y57 A;  1V29 B;  4K11 A;  3JSC A;  2HEQ A;  3QII A;  2HQH A;  3I56 A;  4MZT A;  5C6S A;  2NWM A;  3MP1 A;  3I9Q A;  3REB B;  1HK9 A;  2QK0 A;  3GPL A;  1FX7 A;  1SRL A;  3PE0 A;  2V8J A;  2JTF A;  2CZ6 B;  2M0O A;  4M75 B;  2DZ9 A;  2JOY A;  4M75 A;  5GAM e;  4AG1 C;  4OMO A;  4AFZ C;  2A28 A;  2P0P A;  3CC4 Q;  2E41 A;  2LC4 A;  4M7A C;  1ZBJ A;  1WFW A;  1BI1 A;  2M02 A;  3HFN A;  1OPK A;  3HL8 A;  4N4H A;  3QO3 A;  3CQT A;  4FYV B;  4ATO A;  2GTO A;  2CSQ A;  1MMN A;  1BBZ A;  1M2V B;  1M2V A;  1P92 A;  1VQP Q;  5GAN h;  4LDX A;  4NOY A;  1VQ6 Q;  2DXB A;  3QYH B;  2DFU A;  4C5I A;  5FRN A;  4TVR A;  2CDT A;  4E7S A;  2QEX T;  4RG2 A;  1VQO A;  4M4Z A;  1U06 A;  1YN8 A;  1VQ9 A;  4AFS C;  5KYY B;  5KYY A;  5HY6 A;  2MCN A;  1JU5 C;  2EBP A;  3H0I A;  2KK4 A;  3OYH A;  3I56 T;  5CR2 A;  4JJB A;  1GBQ A;  2QAZ A;  1J3T A;  1EIF A;  2NLU A;  3V7C A;  1SF9 A;  5GAN 7;  2C06 A;  1Q95 G;  3P8B B;  2K3B A;  1HD3 A;  5GAM f;  1VQ7 A;  4IUU A;  1MV0 B;  4F7U G;  5GAO r;  6AT1 B;  2KGT A;  5IN1 A;  2A7Y A;  3G6E T;  5GAM g;  1QQJ A;  1ZBX A; 
#chains in the Genus database with same CATH homology
 1UTI A;  5FWB A;  4A63 B;  1I1J A;  1UFF A;  2LQN A;  3NPF A;  4RUG A;  4R0K A;  1Z9Q A;  1EFN A;  1NEB A;  1NLP C;  2DJQ A;  2IIM A;  4RTZ A;  4X1V A;  1T0J A;  1X6G A;  4J9D A;  2SEM A;  2YSQ A;  1AWJ A;  2FRW A;  1U3O A;  2GBQ A;  1CKB A;  2EYW A;  3H0H A;  2CT4 A;  4JZ4 A;  1JXM A;  2LJ0 A;  1SPK A;  2GNC A;  3R6N A;  4HVV A;  2FPE A;  1VYT A;  3EHQ A;  2M51 A;  2RNA A;  2C0O A;  2BZX A;  4F17 A;  2KEA A;  3QWY A;  4JJC A;  1ZUK A;  2CT3 A;  2DL4 A;  1NYF A;  2JS0 A;  3VS3 A;  1ABQ A;  3H0F A;  4IIM A;  1CKA A;  4J9C A;  1E7O A;  3VS7 A;  2FO0 A;  1ARK A;  2O9V A;  3TSZ A;  1GFC A;  2F2X A;  2JM9 A;  2CUB A;  2J06 A;  3UA7 A;  2EYY A;  1YWO A;  2XMF A;  2KRN A;  1T3L A;  3VS2 A;  5IHK A;  2V1R A;  1AEY A;  2NUZ A;  1WX6 A;  2DE0 X;  4LUE A;  2JM8 A;  1AWO A;  2RQR A;  2KYM A;  5I22 A;  1GCQ A;  1QKX A;  4CC3 A;  4HVW A;  2KXD A;  3PVL A;  2DVJ A;  1B07 A;  1ABO A;  2D8H A;  2YT6 A;  2LX7 A;  4KRT A;  2J6O A;  2ED1 A;  1PWT A;  4RTT A;  1B3Q A;  3EG0 A;  3ULR B;  2V1Q A;  1NM7 A;  2J6K A;  2ECZ A;  3EGU A;  2QDL A;  1JQQ A;  1S1N A;  4OMN A;  1KFZ A;  2HCK A;  2EKH A;  1HJD A;  1X43 A;  1ZUU A;  1MV3 A;  2OAW A;  1AD5 A;  2JXB A;  1X69 A;  2ROT A;  2RPN A;  3M0U A;  2FPF A;  1K9A A;  1UEC A;  1T0H A;  1SHF A;  1AOJ A;  1KIK A;  2J05 A;  4AG2 C;  1X27 A;  3RBB B;  2AKL A;  1RLQ C;  1M8M A;  2DM1 A;  4OMM A;  2JMA A;  3QWX X;  2YUQ A;  1QWF A;  2F2W A;  3LH5 A;  5FWC A;  1ZUY A;  2D8J A;  4WCI A;  2EGA A;  2DMO A;  4RTU A;  2J6F A;  2KRO A;  1WXB A;  2KT8 A;  4LE9 A;  4AFQ C;  2W10 A;  2MIO A;  1NYG A;  2A37 A;  2K2M A;  3M0S A;  2DL8 A;  4RTV A;  2YDL A;  2ABL A;  1BK2 A;  2JT4 A;  2HDA A;  4HXJ A;  2KRM A;  1WYX A;  2K7A A;  3NGP A;  1Y0M A;  2O88 A;  2OI3 A;  1QCF A;  1X2K A;  4Y92 A;  1QLY A;  1N5Z A;  1OEB A;  3A98 A;  3EHR A;  4J9F A;  2L3Q A;  1YWP A;  2KR3 A;  1NLO C;  1SEM A;  1UJY A;  1FMK A;  2DBM A;  5FW9 A;  3VRZ A;  1PRM C;  5ECA A;  1T3S A;  2LZ6 B;  1SSH A;  2AKK A;  3I5S A;  1WXT A;  2BTT A;  2CH4 A;  2EGC A;  4J9B A;  1AZE A;  3GBQ A;  2KE9 A;  5GJV B;  1A0N B;  2RQW A;  3SHW A;  3VRY A;  2KYB A;  3SEM A;  1QWE A;  3NMZ C;  2FG0 A;  2K79 A;  1AZG B;  5IHN A;  2JTE A;  2KNB B;  1G2B A;  2O2O A;  2OJ2 A;  3EG3 A;  1X6B A;  2RN8 A;  5I11 A;  1K76 A;  1UG1 A;  2CRE A;  1PNJ A;  2C0T A;  3O5Z A;  5L23 A;  1K4U S;  1UDL A;  3THK A;  4JJD A;  4CC2 A;  1K0X A;  2KRS A;  2K6D A;  1OPL A;  4J9I A;  2I0N A;  2RF0 A;  4CC7 A;  2JMC A;  1ZX6 A;  2SRC A;  2FEI A;  1TUD A;  1W70 A;  1YNZ A;  5IXB A;  1H3H A;  2VWF A;  2KXC A;  1ZSG A;  1H92 A;  2ENM A;  1I07 A;  2HBW A;  2DIL A;  4CC4 B;  4RTW A;  1GBR A;  2RQU A;  2HSP A;  2H8H A;  1UE9 A;  2E5K A;  1FYN A;  1XOV A;  4J9H A;  1YP5 A;  2A08 A;  2B86 A;  2D1X A;  1JEG A;  2BZY A;  2VVK A;  2EQI A;  4RTX A;  2JW4 A;  2GGR A;  2ESW A;  3H41 A;  3VS5 A;  1Z9Z A;  2CUD A;  1PKS A;  3U23 A;  4F16 A;  1I0C A;  2LJ3 A;  4LUD A;  2CH4 W;  2D0N A;  4QT7 A;  5EC7 A;  1KSW A;  1VA7 A;  3VS4 A;  1OOT A;  1W1F A;  3VS6 A;  4ORZ A;  1CSK A;  2AK5 A;  3EG1 A;  1TG0 A;  4JPB W;  3PVQ A;  2YUO A;  5IHI A;  2KBT A;  1BU1 A;  2LQW A;  1GCQ C;  4Z8A A;  4LN2 A;  2FPD A;  2AZS A;  3VS0 A;  5IH2 A;  4DEX A;  4DEY A;  2DF6 A;  3IQL A;  4FSS A;  4EIK A;  4Z89 A;  1NEG A;  4D8K A;  1TUC A;  2DA9 A;  3TSW A;  1X2Q A;  3EG2 A;  4OMQ A;  3FJ5 A;  1PHT A;  2DL5 A;  2DBK A;  2L3P A;  1GFD A;  1WA7 A;  2GQI A;  1K1Z A;  2BZ8 A;  3REA B;  4J9E A;  3M0Q A;  1RUW A;  1M30 A;  2G6F X;  2RQV A;  1WIE A;  1K0S A;  2PNI A;  2JS2 A;  2F2V A;  2LMJ A;  2DYB A;  2DRK A;  2X3X D;  1PKT A;  1E6H A;  2ROL A;  1RLP C;  2YUP A;  1ZLM A;  1JO8 A;  1UUE A;  1KJW A;  4GBQ A;  2EGE A;  4HCK A;  1SRM A;  4J9G A;  3I5R A;  1WDX A;  2EVR A;  2L2P A;  2DL3 A;  2LJ1 A;  3JV3 A;  2P4R A;  1WLP B;  5GJW B;  2KT1 A;  2DX1 A;  1GL5 A;  1UGV A;  1Y57 A;  2FRY A;  1V1C A;  4K11 A;  3I35 A;  1QKW A;  3RNJ A;  2HEQ A;  1M27 C;  1HSQ A;  2EPD A;  3NHN A;  3UA6 A;  2NWM A;  2YUN A;  3I9Q A;  3ZL7 C;  3REB B;  4RTY A;  1UHC A;  1AWX A;  1GCP A;  1SRL A;  3PE0 A;  2PTK A;  1BB9 A;  2EYZ A;  1E6G A;  3VS1 A;  1G83 A;  1WI7 A;  2AZV A;  1H8K A;  4E6R A;  3M0R A;  1MUZ A;  3KFV A;  4OMP A;  4Z88 A;  2DRM A;  1JXO A;  2EYX A;  4AG1 C;  4OMO A;  4JZ3 A;  4AFZ C;  2LCS A;  2A28 A;  2W0Z A;  1ZBJ A;  1LCK A;  4OML A;  1WFW A;  2O9S A;  3UF4 A;  2EW3 A;  1PRL C;  2J7I A;  2M0Y A;  3M0T A;  1OPK A;  1VYU A;  1UHF A;  3CQT A;  1M3A A;  4ESR A;  1YCS B;  2CSQ A;  2GTO A;  4AFU C;  2C0I A;  1BBZ A;  1OV3 A;  1U5S A;  1UJ0 A;  1SHG A;  1IO6 A;  1W6X A;  1AWW A;  2LNH B;  2CSI A;  2ED0 A;  3M0P A;  4GLM A;  2CDT A;  4HVU A;  2RQT A;  4M4Z A;  1RI9 A;  1U06 A;  1YN8 A;  1M3B A;  2LP5 A;  4AFS C;  2DL7 A;  2L0A A;  2X3W D;  4ZNX A;  3TVT A;  2RMO A;  2MCN A;  1JU5 C;  2DNU A;  2EBP A;  3H0I A;  2A36 A;  4JJB A;  1GBQ A;  2VKN A;  1GRI A;  4IIO A;  1J3T A;  5HCK A;  2DLP A;  2K3B A;  1WXU A;  4LNP A;  1HD3 A;  4D8D A;  4F14 A;  3C0C A;  1MV0 B;  1VYV A;  5IXF A;  1NG2 A;  2K9G A;  1M3C A;  2KGT A;  2O31 A;  1AVZ C;  2MOX A;  2PZ1 A;  2GTJ A;  2L3S A;  3UAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...