4IIMA

Crystal structure of the second sh3 domain of itsn1 bound with a synthetic peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
57
structure length
57
Chain Sequence
LLQAQALYPWRAKKDNHLNFNKNDVITVLEQQDMWWFGEVQGQKGWFPKSYVKLISA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the Second SH3 Domain of ITSN1 bound with a synthetic peptide
rcsb
source organism Homo sapiens
molecule tags Endocytosis
molecule keywords Intersectin-1
total genus 13
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4iimA00
2FRYA 1ZUKA 1U5SA 2DRMA 1ZX6A 2D1XA 1H3HA 1GRIA 2LNHB 1I0CA 2YUQA 1WI7A 1AWWA 2QDLA 4JZ4A 1UTIA 2O9SA 1X2QA 2K7AA 1PWTA 2EW3A 2KXDA 4J9HA 3RNJA 2J6OA 2EGCA 4JPBW 1G83A 3A98A 1BB9A 4CC3A 1H8KA 2AKLA 2A37A 2KGTA 2AZVA 3VRZA 2EGEA 2E5KA 1WDXA 1MUZA 1GCQC 1ZUUA 2RQUA 1NEBA 3H0IA 1QWFA 2YUOA 1PKTA 3I35A 1HD3A 2GBQA 2LQWA 2DF6A 2JXBA 4AFZC 1B3QA 2X3WD 4Z88A 1KFZA 2X3XD 2ED0A 1PNJA 1XOVA 2KEAA 4JZ3A 2L2PA 5ECAA 2KBTA 1T3SA 2CSQA 3R6NA 1LCKA 2HEQA 1SPKA 4AG1C 1CKBA 2JTEA 1PRLC 1YCSB 5I11A 2EVRA 3NPFA 4OMQA 4J9CA 1ARKA 4LUDA 4J9GA 1X2KA 2JS2A 1K0XA 2B86A 4F17A 4D8DA 3EG0A 1VA7A 1GFCA 1RLQC 3GBQA 1Z9QA 2D8JA 4J9EA 1HJDA 1SHFA 4LUEA 2HDAA 2KNBB 2KRNA 1X27A 2DILA 4ESRA 2XMFA 1RUWA 2LJ3A 1AEYA 5L23A 5IXFA 3M0PA 1U06A 1Z9ZA 3H0HA 2MIOA 2YDLA 2AZSA 2KYBA 3UA6A 2DBKA 2KE9A 2LX7A 1RI9A 1WYXA 2DE0X 2BZXA 2K2MA 1FMKA 1YNZA 1KJWA 2K3BA 1YP5A 2OAWA 2PNIA 2KT1A 3M0TA 5GJVB 4J9IA 4RTYA 2H8HA 2O2OA 2ED1A 2NWMA 2KRMA 3EG1A 1A0NB 2HSPA 1K9AA 1K4US 1NLPC 1T0HA 1WIEA 1SRLA 2PZ1A 3QWYA 2GGRA 2DL5A 4RTXA 2EGAA 1UGVA 2ABLA 2W10A 2DVJA 1QLYA 2CT4A 4D8KA 3ZL7C 4E6RA 4IIOA 4F14A 5FW9A 3NHNA 4LE9A 3LH5A 1CSKA 1NG2A 1PHTA 1JXMA 4LNPA 3REBB 3O5ZA 4HCKA 4DEXA 4OMOA 2ROLA 1OPLA 2AKKA 2HBWA 1WXBA 2F2VA 2D8HA 2F2XA 1YWOA 1GCQA 3UF4A 2JW4A 4J9FA 3EHQA 1VYVA 2FPDA 2DX1A 3PVLA 2K9GA 1CKAA 2KYMA 2P4RA 4AG2C 1QCFA 2DA9A 2CSIA 4JJBA 3VS1A 2JT4A 4LN2A 2FPFA 2I0NA 3KFVA 2LJ0A 4Y92A 2EYXA 2SRCA 4OMMA 2JMAA 5IXBA 1JEGA 1OPKA 2RQTA 3EHRA 5FWBA 2YT6A 3EG3A 5EC7A 3THKA 1ZBJA 1GL5A 2FRWA 3C0CA 4CC7A 4HVUA 2DNUA 4JJDA 2KXCA 2FPEA 1X6GA 4AFUC 2A36A 1QKXA 1WLPB 4ZNXA 5IHIA 3H41A 3VS7A 4HVVA 3IQLA 2GTJA 1FYNA 1Y0MA 1UG1A 1JXOA 2GQIA 2RMOA 1NM7A 1JQQA 4ORZA 1YN8A 3UA7A 3TSZA 2CUDA 1W6XA 1K0SA 4GBQA 2J7IA 4KRTA 1GCPA 2RQVA 1E7OA 1UJYA 1I1JA 4CC4B 5IH2A 2EYWA 3EGUA 2EYZA 1UFFA 2AK5A 2DBMA 1PRMC 1U3OA 1GFDA 2J6KA 4J9DA 1OV3A 3SHWA 3PE0A 1TUDA 2FEIA 3VRYA 4WCIA 3I5RA 2O88A 1ZSGA 2JM9A 2FO0A 2W0ZA 1M3AA 2IIMA 2J05A 2CT3A 2LCSA 1QKWA 2C0OA 1MV0B 1N5ZA 4M4ZA 1HSQA 1NYFA 2RQRA 1UE9A 2DL8A 2DYBA 1SEMA 3ULRB 1AWXA 2DM1A 1WXUA 2BZ8A 2MOXA 1AVZC 1WXTA 4DEYA 1G2BA 2DJQA 4EIKA 4HXJA 2DMOA 1ZLMA 4OMNA 4F16A 1EFNA 5GJWB 1E6HA 1IO6A 3VS2A 4R0KA 3TSWA 2EQIA 1WA7A 3QWXX 1AOJA 3FJ5A 5HCKA 2OJ2A 2EPDA 1TG0A 2DL4A 1B07A 2GNCA 2FG0A 3I5SA 1I07A 1K76A 2DL3A 1JO8A 1VYUA 1X6BA 2G6FX 2J6FA 1ZUYA 2J06A 1S1NA 1M30A 2L3SA 1BU1A 2YUNA 3UATA 1J3TA 1GBQA 2D0NA 1MV3A 3JV3A 2LMJA 2RNAA 2JS0A 4J9BA 1ABQA 4RUGA 2VVKA 3TVTA 2OI3A 2L3PA 2KT8A 1M8MA 1M27C 1GBRA 3VS0A 4IIMA 1OOTA 2EBPA 1WFWA 1RLPC 2F2WA 5I22A 3PVQA 2JMCA 3U23A 2KROA 2C0IA 2LQNA 4QT7A 2EYYA 1SSHA 3M0SA 1SHGA 1PKSA 3SEMA 2RF0A 1M3BA 2L3QA 4X1VA 1AWJA 2RQWA 2CREA 1UHFA 5FWCA 2CDTA 2DLPA 4RTTA 2ROTA 4OMLA 2CH4W 1AWOA 1BK2A 2O31A 2A08A 1KIKA 4AFSC 2KR3A 2ENMA 1BBZA 1AD5A 2A28A 3CQTA 1KSWA 3VS6A 2SEMA 1M3CA 2M51A 1UECA 5IHKA 1T0JA 1E6GA 3H0FA 1SRMA 4RTUA 1K1ZA 2V1QA 1X69A 1VYTA 2NUZA 1UUEA 3M0QA 2K79A 4Z8AA 3NGPA 2RN8A 5IHNA 3VS3A 3EG2A 1JU5C 1AZEA 2VKNA 4GLMA 1X43A 3I9QA 2CUBA 1YWPA 3M0UA 4K11A 1NLOC 4CC2A 1Y57A 3REAB 2ESWA 1WX6A 2C0TA 2KRSA 1NEGA 4RTWA 2V1RA 2YSQA 2DRKA 2YUPA 2M0YA 2RPNA 4RTVA 2MCNA 4FSSA 1T3LA 4A63B 4JJCA 1TUCA 4AFQC 2BTTA 1W1FA 1NYGA 3RBBB 2BZYA 2HCKA 2EKHA 2VWFA 1QWEA 1AZGB 3VS5A 1OEBA 3NMZC 4OMPA 2LZ6B 3M0RA 2O9VA 4RTZA 1V1CA 2CH4A 2JM8A 1H92A 1UHCA 2ECZA 2LP5A 2L0AA 3VS4A 4Z89A 4HVWA 1ABOA 2K6DA 1UDLA 2GTOA 1W70A 1UJ0A 2DL7A 2LJ1A 2PTKA
chains in the Genus database with same CATH superfamily
1ZUKA 2DRMA 1RAAB 1ZX6A 2VXFA 2XDPA 3EGXA 3JB9I 1GRIA 4C8QA 3CCJT 1WZOA 1AWWA 2XICA 1EZZB 1VQOT 1UTIA 3M56A 2K7AA 1PWTA 2EW3A 1VUBA 2XHCA 4M7DD 4J9HA 3VV0A 4C0DB 5GANj 4PJJA 1IRXA 3HRSA 2A37A 2V8KA 3H9NA 3FRNA 1MUZA 3OYHA 2JUFA 2RHZA 3H0IA 1VQ8Q 1JBMA 5CVIA 4AFZC 2M0OA 4Z88A 2X3XD 1JJ2S 3GPLA 4JZ3A 3JSCA 1OU8A 3CCEA 3R6NA 1SPKA 1KQSS 1CKBA 5I11A 2EVRA 5FRMA 3CCSQ 1K0XA 1VQMT 2DYIA 4D8DA 4KBMB 1VA7A 2DPPB 5FLXE 4WF2A 1JRIA 2CZ1B 1N9RA 1G3WA 2NUPA 1M5Q1 2QQBA 5IAYA 4J9EA 3CCET 3X24B 1M1KR 1SHFA 2HDAA 2KNBB 4NOYA 2HQEA 1X27A 4PFOA 1QVFA 1VQ6A 2QYZA 1VQ7T 2K2VA 1AEYA 1K9MU 2M9UA 3RESA 1U06A 1NPRA 5GAN2 2V8JA 3E2UA 4DBRA 3L2WA 2DBKA 2KE9A 2LX7A 1RACB 1KC8C 1X01A 4PL6A 5LL6S 1KJWA 1SKUB 2OAWA 2PNIA 2KT1A 4OF1A 4M77C 4JJNK 1Q7YU 3MHXA 1RAFB 4XAXB 4E7LA 4XTXA 1A0NB 3JCMh 4OB0B 2HSPA 3EFSA 1NLPC 4LDWA 1NPPA 1VQNA 1V76A 2DIQA 4NL3A 1YJ9A 1JB0E 3CCUQ 3OYEA 3CCMQ 1G3TA 2QA4Q 1Y7XA 1WQWA 3L2UA 3CCJQ 1VQKT 3MCAB 4QVZA 4M77A 1OPLA 4BDZA 2AHJB 2AKKA 5CR2A 1WXBA 2F2VA 2D8HA 2F2XA 4XK8E 2JW4A 4MZPA 2V26A 3ASKA 4J9FA 3CC7A 3M58A 2FPDA 2K9GA 1CKAA 4OVAA 2KYMA 2DVEA 2DA9A 8AT1B 3V8JA 3QSUA 2MI6A 4ZGDB 2JT4A 2LQKA 1RABB 4J6WA 4HCBA 3EGDA 2I0NA 3JCMW 4IKFA 8ATCB 1K9MC 2SRCA 3I56Q 4FW1A 1JEGA 3V8KA 1OPKA 2O4XA 2LDMA 5EC7A 3THKA 1ZBJA 2KSSA 2QA4T 1N8RC 4XU3A 2KXCA 2FPEA 4HCZA 2A36A 2DD5A 5GANg 1O75A 1YJ9T 4RCCA 4ZNXA 2P0QA 3VS7A 4HVVA 3IQLA 2E65A 1JXOA 1BKBA 5GANh 3J7AF 1K73U 2EQMA 3TSZA 2CUDA 2NUTA 2L5QA 4XTVA 2QI2A 4GBQA 3QXEB 1OU9A 2J7IA 3ZBDA 2VGNA 1UJYA 1I1JA 2LT1A 5IH2A 2JOYA 2J6KA 1M1FA 3R6OA 4A54A 3QBYA 1D1CA 4GY5A 2G3RA 2RM4A 2ZPBB 5LJ3g 4M7AG 3ZEHA 1K8AU 2O88A 2JM9A 4BI4A 1S72T 1MMNA 1VQPA 2IIMA 2CZ7B 2CT3A 2LCSA 1YIJT 1VQNQ 1MV0B 1N5ZA 3OYCA 1B34B 3CXCP 2PVOB 1SEMA 2GFAA 3CPWS 3BDLA 1WXTA 2WACA 3M9QA 1G2BA 4KUIA 2VV5A 2LVMA 4R0KA 1Q95G 4OP0A 3QWXX 3S3OA 1IHWA 3FJ5A 2OJ2A 2EPDA 3OYYA 4MMKA 3I5SA 3RR6A 2DTIA 3DB4A 2QGGA 3KBGA 4OB1B 1JO8A 1AHJB 1RI0A 5LJ5h 1PM3A 2G6FX 4II1A 4KT0E 1ZUYA 1S1NA 3CCVA 1WNLA 1X75C 4M75C 1NJIR 1MV3A 3OYJA 2LMJA 3DLMA 2RNAA 2VB6A 5CKDA 2DEUA 1VQNT 3RKWA 4O5VA 4RUGA 3CCLT 3I56T 1PG5B 5J26A 2OI3A 4M77B 3QZ5B 2NYSA 2OTJA 4FU6A 2YHTA 3I56A 1ZBXA 2LQNA 2QTXA 1SSHA 2VUBA 1Y96A 5KYYA 4M78E 1M3BA 4A53A 1VQ5T 4OGCA 1TXQA 1PCXA 3OS1A 2CREA 1UHFA 4BE2A 2CDTA 5GAMg 4OMLA 4FYXB 1O9SA 3C95A 4N4GA 4AFSC 3CEYA 5J3BA 1HYOA 3GLXA 2E1HA 1M2VB 4E7ZA 1R0CB 5D7UA 2A28A 3CQTA 1G8XA 5KYYB 2SEMA 1Q7YR 1QVGP 4RTUA 2F5KA 2DIGA 1VYTA 3M0QA 5LJ3f 3NGPA 2RN8A 4ZGEB 5IHNA 4E7HA 2DEQA 3VS3A 3V7SA 1JU5C 4BI8B 1YJNQ 1VQMA 3FJPA 2CUBA 1YWPA 3M0UA 3CCVT 2IVWA 1NLOC 1YHQT 4J8OA 4M7AF 3VKIA 5C6SA 4RTWA 2WSCE 2E41A 2V1RA 3LYIA 2XI9A 2E3HA 1M8VA 1WQ7A 4JJCA 1TUCA 4EMKA 2DTHA 4C0DC 4ATOA 2XK0A 1Q82U 2GQVA 2VC8A 3DLLA 4OMPA 1VIFA 4EMHA 1H92A 2ECZA 4PJNA 4Z89A 3JB9H 3OYLA 2M02A 2QTVA 1UDLA 2JZ2A 1VQKQ 2RI5A 2MYSA 1YJNA 5GAOn 3KXTA 2GTOA 1W2BA 5KYUA 3RIRA 2JTFA 2K4YA 2Y90A 4J7IA 2LNHB 4M78F 2YUQA 4E47A 2F5TX 3BW1A 2QDLA 4DQ2A 2EJGA 1W2BP 3CC4A 1ACMB 2LRQA 4M78G 4C92D 4HT9A 4O6JA 2KXDA 5CKHA 3BFMA 2EIFA 3M4GA 4OB3B 3MEUA 4ZTJA 3NTIA 4M7DA 4XU0A 3G7ZA 1BB9A 3RMQA 2L8DA 1H8KA 1OX9A 3QDFA 2AKLA 2E70A 4OMFB 1LPLA 3UT1A 4IURA 4F7UF 2VASA 3QYGB 2HSEB 2YUOA 3I35A 2GBQA 2LQWA 2QQSA 1KD1U 1B3QA 1TS9A 3N5BB 1KFZA 3META 3JB9D 2ED0A 2ZGWA 3OS5A 3LWIA 1XOVA 1VQOQ 2L2PA 5GMKe 1T3SA 2CSQA 4B9WA 1LCKA 2E4HA 1F1BB 1PRLC 5LJ3j 2M1HA 3OYFA 3CC4Q 3CMEA 3QPHA 1ARKA 4LUDA 1X2KA 1IXDA 3CPWA 3SD4A 4F17A 5GAOp 5GAMd 4M7DC 3EG0A 4IUUA 4LDVA 3BY7A 1HJDA 4QVCA 1MNEA 4C8QC 2O01E 2KRNA 4FSXA 3CPWP 3CC2Q 4ESRA 2XMFA 2QEXA 2LJ3A 3HRTA 4DBHA 5L23A 3VYHB 5IXFA 2QDYB 4N4IA 2KYBA 4ZN1A 5GAOr 2PVGB 2DE0X 2BZXA 1FMKA 5CK9A 2X4YA 2OX7A 2EQUA 2O2OA 3LH0A 2A0FB 2NWMA 2KRMA 1QMCA 1K9AA 3RKXA 4A4HA 2GGRA 2DL5A 3UDCA 2YLBA 2O4XB 4XTYA 2EGAA 2W10A 2FHDA 3M4YA 4D6WA 2DVJA 1QLYA 5CO7A 3X26B 4D8KA 1TH7A 3ZL7C 3SB2A 2PU9B 4IIOA 4NL2A 4M75F 1EIFA 1BI0A 3CC2T 1U1SA 5FW9A 3NHNA 5GAN6 1NG2A 2E64A 1XTDA 3EGDB 1JXMA 4LNPA 3RKYA 4HCKA 4DEXA 2ROLA 3QG1A 1YFNA 3HFNA 1YWOA 2RJFA 3UF4A 5HY6A 5CQYA 1RAGB 1YITQ 1VYVA 4M75G 4AG2C 2CSIA 1KC8U 1OI1A 1W4SA 3QUIA 4J7FA 2MMPA 3OQ5A 1TWBA 4DOWA 1QVPA 1XJWB 3CCMT 4LDUA 4PLLA 3PTAA 4OMMA 4PKCC 2JMAA 2DTOA 5IXBA 1ZHIA 1IHVA 3G6EQ 3EG3A 2QG9B 1GL5A 4C92B 4PJOC 5AYFA 4CC7A 3OBYA 1M90R 1QVFS 1GXIE 2EJ9A 3CBOA 2LX9A 3CXCA 1FYNA 4M7AC 1UG1A 3QKJA 2RHUA 1C6VX 2RMOA 1NM7A 3MP8A 4M77E 3CCLQ 4M7AE 2VYTA 3UA7A 2DXUA 3EG9B 4M78B 1LNXA 3HFOA 3Q1JA 3OYIA 1N27A 1VQMQ 2EKOA 4KULA 1ZSZA 4FYYB 2EYWA 3CCMA 2EYZA 2CYZB 2FB7A 1VQ5Q 2HL5C 1SSFA 3PE0A 1TUDA 1KHCA 3H6ZA 1HK9A 3I5RA 1ZSGA 2FO0A 2D9TA 5CKEA 4A4KA 1MGQA 2XDBA 1D0XA 1QKWA 3PT9A 3CXCS 2C0OA 4IUVA 2OAUA 3CCEQ 1I5OB 1BIAA 4PJOG 1NYFA 3JB9F 2DL8A 4C0FA 5AT1B 2H3JA 3ULRB 1WXUA 3QIIA 3I55Q 1HXDA 5KCOA 4IUTA 1NZ9A 1ZLMA 4OMNA 2DKGA 4KGVB 4Z02A 4PJMA 4B6MA 1E6HA 4F7UA 5J39A 1NJIU 1WA7A 2X4JA 3V7CA 1K76A 7AT1B 2DL3A 1D0ZA 1M2OA 5A0LA 1V29B 2DETA 5GANd 3JCMg 1ZSZC 2L3SA 3PFSA 1BU1A 3SWNC 2FYKA 3QO3A 2XDDA 3JV3A 2MWOA 4J9BA 1R0BG 2RI2A 3S6WA 3VUZA 2VVKA 2D0QB 2DXCA 4JLIA 3HRUA 2L3PA 2KT8A 5GMKl 5FU7B 3QYHB 1N8RR 3OMCA 2EBPA 1QP2A 1QW1A 1WFWA 4QQ6A 1RLPC 1BCOA 2K5LA 3PVQA 1VQ6T 1VQ7Q 2C0IA 2L89A 4QT7A 2EYYA 3M0SA 3CMEQ 3RERA 2L3QA 4E7IA 4X1VA 5LJ5e 2YXYA 4EDUA 2RJEA 2DZ9A 3CCRT 1WHJA 1DJ7B 2CH4W 2MK5A 4BD3A 4C5HA 2A08A 1KIKA 3C12A 2ENMA 4F04B 3CCRQ 3L1AA 1BBZA 1VQPQ 1AD5A 1QVGS 2EFIA 1KSWA 1VIEA 4C5GA 5IN1A 5DLQE 1BI3A 5IHKA 1T0JA 1SRMA 1K1ZA 1Q82R 5KYWB 1I8FA 2YWWA 3X25B 5LJ5f 2AT1B 4Z8AA 1YJ9Q 2DERA 1D09B 1AZEA 3F70A 1X43A 2ZPFB 3I9QA 3SDZA 1OULA 4LXCA 1G3SA 3REAB 2ESWA 2DFUA 3OYBA 3MKDA 2DRKA 2M0YA 2MCNA 4FSSA 3MEVA 4A63B 3VU3C 2BTTA 3CMAA 2ZZDA 2YLCA 1NYGA 2BZYA 1U1TA 3LX7A 1XQHA 1OEBA 4C8QF 1WPYA 5D6XA 2O9VA 3P8DA 3M55A 3PMTA 2XG8D 1YJNT 1C0MA 4OGEA 3GOXA 1EX4A 4C0GA 1U8RA 4C92G 3JCMJ 2QASA 3S3MA 3A8MB 1QP3A 2PUOB 4R55A 1M1KC 2CGHA 1BI2A 2DJZA 3RUXA 1KQ2A 1UJ0A 2DL7A 1BI1A 2LJ1A 4PJOA 3BE3A 2PTKA 1U5SA 1Y71A 4CI0C 5FU6C 3EGXB 1H3HA 1I0CA 4EMGA 1WI7A 1VQ4Q 2V8IA 3HHTB 3EFOB 3G6ET 2O9SA 3CCQA 4F7UG 1X6OA 4CRIA 4XTZA 4QW2A 3RNJA 2NUTB 3ZFJA 2J6OA 2EGCA 1G3YA 2XIDA 4VUBA 4C0ZA 3A98A 4CC3A 5GAN3 1Q81C 1Q86U 1BYMA 3G71Q 2KGTA 3VRZA 1ZA1B 4BY6B 2E5KA 2Y4YA 4JDSA 4JRPA 1GCQC 1LOJA 1IB8A 1ZUUA 2RQUA 1JJ2P 1QWFA 2RJCA 2BIVA 2DF6A 2JXBA 2X3WD 4DOVA 1PNJA 3J80E 1YHQQ 3E19A 4RKUE 2DD4A 2QQRA 5ECAA 2KBTA 3CC7Q 3GIBA 1WHMA 4J5YA 1N6AA 1M2VA 2JTEA 3SFMA 1YCSB 1BIBA 1YITT 1H3ZA 3MO8A 4OMQA 4J9CA 2JS2A 3HSBA 2KI7A 5C0MA 1P92A 5GMKi 4ZN3A 2ZPHB 5HK3A 3JCMb 1VQ4T 4JRKA 4LUEA 5DM7R 2K3XA 1K8AC 1OYXA 1RAHB 4C8QE 4M75D 1RUWA 2BE9B 4FM4B 4YTLA 1D1AA 3HKSA 3JCMP 4RMOA 1Z9ZA 2CP2A 3H0HA 2MIOA 2AZSA 2IG0A 3UA6A 2QXFA 1RI9A 1WYXA 1FMVA 2K3BA 1KQSA 3VUBA 4J83A 3M0TA 3CMAQ 3CMET 2RK2A 2H8HA 1KD1C 2ED1A 1BCMA 3EG1A 3GNGA 4N0AC 1K4US 2PVDB 1S72Q 1T0HA 1SRLA 3QWYA 3CD6Q 4BY6C 2CP5A 3RDVA 3M57A 3SWNA 2F1LA 2M16A 4RTXA 1UGVA 2HQHA 2CT4A 4E6RA 1KC8R 4IUPA 4A4EA 1UGSB 1MHNA 4RG2A 3OA6A 5GAN4 2CP0A 4LE9A 4DBFA 4FW2A 3CCST 2YRDA 3M54A 3REBB 3O5ZA 4OMOA 3G1JA 1Q7YC 4XTUA 3G71A 3G4SA 4Y91A 3OW2S 2KDSA 3CC4T 4KGXB 9ATCB 1VQOA 1N8RU 4C92A 4M75A 2P4RA 3CMAT 4EMKC 3JB9J 2JVVA 3VS1A 3CCQQ 1FX7A 2RJDA 3LGFA 2OTLQ 2NUPB 5A0GA 1IGUA 2FPFA 6AT1B 1I5LA 1ZA2B 3I55T 2DK3A 2LCLA 1LVKA 4Y92A 2EYXA 3V7RA 1H641 1QCNA 3OW2A 3S3NA 1SF9A 2BUDA 3EHRA 5FWBA 4X9CA 4M7AD 3J81E 4HVUA 1QVGA 2DNUA 3OSVA 4JJDA 1QKXA 2K5IA 4X9DA 4UC4A 5IHIA 5GAN7 2OTLA 3CBPA 1Y0MA 4ANJA 4BI3A 2K57A 3X28B 1YJWA 1YCYA 1JQQA 1D3BA 1YN8A 3C4SA 3GP8A 4M78D 1W6XA 5I2SA 2MAMA 4FT2A 3NFCA 5KE3A 1VQLQ 4KH0B 1GCPA 4FL6A 1E7OA 4ZGJB 1VQ9A 2A3LA 3EGUA 2AK5A 4HCCA 3OSSC 1PRMC 4J9DA 2L3RA 5L8RE 2FEIA 4PJOD 5LJ5g 3VRYA 2OTLT 2QK0A 1OZ3A 1RAIB 3HPWA 2QQ9A 3INZA 1M3AA 2J05A 2FZGB 2ZAEA 3KUFA 3E1SA 4ELYC 1VQ4A 3A1PA 1HSQA 2E6NA 4EMKB 5HKCA 4JS4A 2RQRA 2BZ8A 2MOXA 2BKDN 1D1BA 4V2SA 2DJQA 1MMGA 4HXJA 5FU7C 2DMOA 1WHLA 2KAFA 5GJWB 1IO6A 3VS2A 2RD1A 3TEEA 2KMTA 1IZ6A 3TSWA 1Q81U 1AOJA 1VQLT 1TG0A 2GNCA 1QQJA 1I07A 1I81A 2RH2A 1VYUA 3MP6A 3V8LA 3SWNB 4BACA 1RL2A 2J6FA 1ZSZB 2A7YA 1M30A 4EPCA 2DO3A 5KYXB 2EQJA 2YUNA 2ZPIB 2ATCB 4M75E 5FROA 3WXMB 4C92F 2HD0A 2D0NA 4XU1A 5KYUB 2NLUA 3CD6T 4C8QG 2LC4A 2E5QA 2E3IA 3AT1B 3TVTA 4MDWA 3CCSA 1VOMA 5I2MA 1K73R 2QEXQ 1GBRA 3G6EA 4F7UB 3QJYA 4MMLA 1OOTA 1VQ8T 2F2WA 4P5NA 1WGSA 2JMCA 4M77D 4KH1B 4A4FA 5GMKh 2KROA 4M7DF 3A5ZB 1W2BS 2Z0WA 2KVQG 1PKSA 3SEMA 2X4XA 1UGQB 4LD9K 3JCMe 1TTHB 5KCHA 3FB9A 4GLKA 5LJ3e 4AMCA 4RTTA 2X4WA 1RADB 5GMKj 2O31A 1UB4A 3JRZA 3E9FA 4N4HA 4RCBA 1WJRA 2CS7A 3CCJA 4PK4A 3EH2A 5KYXA 3VS6A 1WHKA 5DY9A 2P0PA 3I55A 4M78C 4PLIA 2QA4A 4QQDA 3H0FA 4FT4A 3M53A 2V1QA 1X69A 1MMAA 3D7SB 4FYVB 3M59A 3EG2A 4QQGA 2LCCA 3FDRA 4K11A 4M77F 2P0KA 3LLRA 2X51A 4CC2A 1Y57A 4JRQA 1WX6A 1NE8A 3JCMc 2C0TA 1NEGA 2YSQA 3GNFB 4HKEA 2RPNA 4RTVA 5GANf 1TUGB 3OYAA 2E10A 2F69A 5CKBA 4BUGA 4IUQA 4JLGA 1W1FA 2DAQA 2HCKA 2VWFA 2EKHA 1AZGB 3VS5A 3NMZC 1KD1R 2HQXA 4M78A 2HKNA 2LZ6B 3CCQT 4RTZA 5FU6B 1PSEA 1VQ6Q 4M7DG 3BDUA 1ABOA 3HTRA 2K6DA 4QKUA 5LJ5j 5GAN8 3CC2A 5HK0A 3CBMA 2WSEE 1M4ZA 2VXEA 1I4K1 1G5VA 1WLPB 4M7DE 2FRYA 2X35A 2D1XA 5KYWA 1N9SA 3JAME 5GMKm 5EG2A 1NBEB 4JZ4A 1PSFA 3EFOA 1WJQA 4M77G 1X2QA 3CC7T 2H3EB 3OS0A 3GF5A 3OYNA 1YBYA 3X20B 2B8AA 1ZQ1A 2CZ6B 1YIJQ 3HP9A 4JPBW 2RA2A 3JCMX 3P8HA 3JB9G 1G83A 3JCMd 4C8QD 1VQ5A 1PC0A 2AZVA 2DXTA 2EGEA 2HL3A 1WDXA 4PNOA 5GAMf 2ZPGB 1NEBA 4J6YA 1PKTA 1TU0B 1HD3A 4HA8A 4N0AA 2DZCA 2KEAA 1AT1B 1YITA 1WHHA 2EWNA 4MDXA 2HEQA 4AG1C 3LW5E 4ELZC 2GFUA 4Y28E 3A8LB 3NPFA 4MZMA 2AIRB 3P8BB 4J9GA 5GAMe 2B86A 2QQAA 3EFRA 5A0DA 1GFCA 1OQKA 4L6V5 1RLQC 4C5IA 3GBQA 1Z9QA 2D8JA 4Q5WA 3UPUA 1KK7A 1MNDA 2K3YA 2GCXA 2OTJQ 1VQ9Q 4R56A 5GAN5 2HMAA 4L5GA 2DILA 4X34A 1Q81R 2HBPA 3TREA 5GAMh 3MEAA 4XQ3A 3M0PA 3DKMA 2JNGA 3M5AA 1B34A 1WJSA 5KE2A 4FIBA 1TOVA 5CKFA 2YDLA 3OYGA 3EH1A 2FZCB 3LGLA 5FRNA 1M90U 3JCMf 2RI3A 2MWPA 2K2MA 1YNZA 1YP5A 3FIFA 5D6WA 5GJVB 4J9IA 4RTYA 2FL7A 2E12A 5LJ5d 5A2QE 4BB7A 2ZPEB 4L59A 3AHUA 2CZ0B 1QCOA 2PZ1A 1WIEA 1UGPB 1D0YA 3URGA 1K9MR 3A8OB 1B7TA 2CP6A 5GAOq 2PQWA 2ABLA 3OYDA 2DXBA 2XU8A 4FCYA 3CCUA 4F14A 2P4TA 3L2RA 2FVUA 4C92E 2COZA 3LH5A 1CSKA 2EYQA 1PHTA 1YI2T 2C06A 2KY9A 4JS5A 3DB3A 4FYWB 2BE7D 2P84A 1VQLA 2HBWA 1IREB 4NS5A 1GCQA 3CCRA 3RMSA 5GANe 3A8HB 3EHQA 2DX1A 2MPXC 3PVLA 1LJOA 4LD6A 3EG9A 3L42A 5GAOl 1YHQA 3CCLA 5LJ3h 1QCFA 1IGQA 2RHYA 4JJBA 2VGMA 2QEXT 3QZ9B 3H8ZA 4RG8A 3OY9A 4LN2A 2Y4XA 2RHIA 3QHSA 3KFVA 3EAEA 5KYNA 2LJ0A 4LDYA 4E7JA 2JTMA 1M1GA 2QGFB 1C1AA 4B9XA 1TSFA 2RQTA 4E7SA 2YT6A 1VQKA 1KQ1A 4E2FB 4PJOE 2FRWA 3CD6A 4PJLA 3C0CA 2K5FA 1X6GA 4AFUC 4HT8A 2R5AA 3ME9A 1R77A 2FZKB 3PNWC 2GF7A 3H41A 4TVRA 2GTJA 2GQIA 4WTOB 3MPUB 3CCVQ 1JJ2A 1RAEB 2CP3A 2XKOC 4M7AB 5CAIA 1OZ2A 4ORZA 1VQPT 4BE0A 3QDRB 1KQSP 1KG1A 3TCJA 3OYKA 1K0SA 1VQ8A 4PJOB 4C92C 4KRTA 3L2QA 2RQVA 4CC4B 1UFFA 3LWHA 2DBMA 1U3OA 1GFDA 3MEWA 1OV3A 3SHWA 4M7AA 2RO0A 1QVFP 4J6XA 4WCIA 1FXXA 5GAOm 5CQXA 2W0ZA 2RK1A 1UGRB 2LQ8A 5IT9E 2ZCFB 1S72A 3O8VA 4M4ZA 2XD0A 3ER0A 2LT4A 3WVEB 1UE9A 3G71T 2DYBA 2KQWA 2IPOB 1AWXA 2DM1A 2I2LA 1AVZC 3FEOA 3L2VA 3OMGA 4DEYA 5I21A 3PIPA 1M90C 1M1KU 4EIKA 2R5MA 4OB2B 5DLOA 4F16A 5GAMj 1EFNA 2COWA 2JN0A 3G4ST 2YRVA 2CKKA 2EQIA 2COYA 5D6YA 5HCKA 2E6ZA 1UEBA 1VQ7A 2DL4A 4MZTA 1B07A 4KGZB 2FG0A 4M75B 1YIJA 3OBWA 4E7KA 2EQKA 1X6BA 1YJWT 1OX8A 4PJOF 4C5EA 4AT1B 2J06A 1Y96B 3PMIA 3UATA 1J3TA 4KUDK 3MJXA 3TQ7P 1GBQA 2RHXA 4F7UE 4A4GA 1M9SA 2JJ9A 2R57A 2JS0A 3FC3A 1ABQA 4DA4A 3OB9A 2R58A 3NTKA 3PGGA 1M8MA 1M27C 3VS0A 4IIMA 3TU4K 3VYGA 3L2ZA 2HAXA 2HNIA 2MF2A 5I22A 2KK4A 4PFZA 5KH6A 3U23A 1XNIA 1SG5A 3OYMA 1SHGA 2EAYA 2RF0A 2WSFE 3T9NA 2CP7A 1Q82C 1Q86C 3JCMQ 4C8QB 3JCMV 1AWJA 3CPFA 2RQWA 2D6FA 2LNVA 5LJ3d 3OW2P 5FWCA 2DLPA 3HL8A 2ROTA 1Y07A 5M9OA 4M7DB 1AWOA 3G4SQ 1BK2A 4JRIA 1PD1A 2HZYA 2KR3A 2OTJT 3FLGA 1FWZA 3PIOA 4BDYA 1K73C 1M3CA 2M51A 5CIUA 1UECA 1E6GA 3MP1A 1R8OB 2NUZA 1UUEA 2K79A 3CCUT 1FMWA 4QVDA 4XTWA 3A8GB 3WVDB 2QAZA 2VKNA 4GLMA 4ZTFA 3C94A 3NTHA 2KRSA 3E9GA 4ME7A 2YUPA 2X9HA 1T3LA 1Q86R 1MMDA 1WHGA 3QJ6A 4AFQC 3VJPA 1NJIC 4LDXA 2EJFA 1VQ9T 3OS2A 2RB6A 3RBBB 5CCAA 4BE1A 1QWEA 2YRCA 1YI2Q 1PD0A 3M0RA 1V1CA 2CH4A 2JM8A 1UHCA 2PUKB 2LP5A 1D3BB 2L0AA 3VS4A 4DBQA 4JUVA 4HVWA 1K8AR 1YI2A 1YJWQ 4PFPA 3UWNA 2LTOA 1KHIA 2HKQB 4XU2A 1W70A
chains in the Genus database with same CATH topology
2FRYA 1ZUKA 1U5SA 2DRMA 1ZX6A 2D1XA 1H3HA 1GRIA 2LNHB 1I0CA 2YUQA 1WI7A 1AWWA 2QDLA 4JZ4A 1UTIA 2O9SA 1X2QA 2K7AA 1PWTA 2EW3A 2KXDA 4J9HA 3RNJA 2J6OA 2EGCA 4JPBW 1G83A 3A98A 1BB9A 4CC3A 1H8KA 2AKLA 2A37A 2KGTA 2AZVA 3VRZA 2EGEA 2E5KA 1WDXA 1MUZA 1GCQC 1ZUUA 2RQUA 1NEBA 3H0IA 1QWFA 2YUOA 1PKTA 3I35A 1HD3A 2GBQA 2LQWA 2DF6A 2JXBA 4AFZC 1B3QA 2X3WD 4Z88A 1KFZA 2X3XD 2ED0A 1PNJA 1XOVA 2KEAA 4JZ3A 2L2PA 5ECAA 2KBTA 1T3SA 2CSQA 3R6NA 1LCKA 2HEQA 1SPKA 4AG1C 1CKBA 2JTEA 1PRLC 1YCSB 5I11A 2EVRA 3NPFA 4OMQA 4J9CA 1ARKA 4LUDA 4J9GA 1X2KA 2JS2A 1K0XA 2B86A 4F17A 4D8DA 3EG0A 1VA7A 1GFCA 1RLQC 3GBQA 1Z9QA 2D8JA 4J9EA 1HJDA 1SHFA 4LUEA 2HDAA 2KNBB 2KRNA 1X27A 2DILA 4ESRA 2XMFA 1RUWA 2LJ3A 1AEYA 5L23A 5IXFA 3M0PA 1U06A 1Z9ZA 3H0HA 2MIOA 2YDLA 2AZSA 2KYBA 3UA6A 2DBKA 2KE9A 2LX7A 1RI9A 1WYXA 2DE0X 2BZXA 2K2MA 1FMKA 1YNZA 1KJWA 2K3BA 1YP5A 2OAWA 2PNIA 2KT1A 3M0TA 5GJVB 4J9IA 4RTYA 2H8HA 2O2OA 2ED1A 2NWMA 2KRMA 3EG1A 1A0NB 2HSPA 1K9AA 1K4US 1NLPC 1T0HA 1WIEA 1SRLA 2PZ1A 3QWYA 2GGRA 2DL5A 4RTXA 2EGAA 1UGVA 2ABLA 2W10A 2DVJA 1QLYA 2CT4A 4D8KA 3ZL7C 4E6RA 4IIOA 4F14A 5FW9A 3NHNA 4LE9A 3LH5A 1CSKA 1NG2A 1PHTA 1JXMA 4LNPA 3REBB 3O5ZA 4HCKA 4DEXA 4OMOA 2ROLA 1OPLA 2AKKA 2HBWA 1WXBA 2F2VA 2D8HA 2F2XA 1YWOA 1GCQA 3UF4A 2JW4A 4J9FA 3EHQA 1VYVA 2FPDA 2DX1A 3PVLA 2K9GA 1CKAA 2KYMA 2P4RA 4AG2C 1QCFA 2DA9A 2CSIA 4JJBA 3VS1A 2JT4A 4LN2A 2FPFA 2I0NA 3KFVA 2LJ0A 4Y92A 2EYXA 2SRCA 4OMMA 2JMAA 5IXBA 1JEGA 1OPKA 2RQTA 3EHRA 5FWBA 2YT6A 3EG3A 5EC7A 3THKA 1ZBJA 1GL5A 2FRWA 3C0CA 4CC7A 4HVUA 2DNUA 4JJDA 2KXCA 2FPEA 1X6GA 4AFUC 2A36A 1QKXA 1WLPB 4ZNXA 5IHIA 3H41A 3VS7A 4HVVA 3IQLA 2GTJA 1FYNA 1Y0MA 1UG1A 1JXOA 2GQIA 2RMOA 1NM7A 1JQQA 4ORZA 1YN8A 3UA7A 3TSZA 2CUDA 1W6XA 1K0SA 4GBQA 2J7IA 4KRTA 1GCPA 2RQVA 1E7OA 1UJYA 1I1JA 4CC4B 5IH2A 2EYWA 3EGUA 2EYZA 1UFFA 2AK5A 2DBMA 1PRMC 1U3OA 1GFDA 2J6KA 4J9DA 1OV3A 3SHWA 3PE0A 1TUDA 2FEIA 3VRYA 4WCIA 3I5RA 2O88A 1ZSGA 2JM9A 2FO0A 2W0ZA 1M3AA 2IIMA 2J05A 2CT3A 2LCSA 1QKWA 2C0OA 1MV0B 1N5ZA 4M4ZA 1HSQA 1NYFA 2RQRA 1UE9A 2DL8A 2DYBA 1SEMA 3ULRB 1AWXA 2DM1A 1WXUA 2BZ8A 2MOXA 1AVZC 1WXTA 4DEYA 1G2BA 2DJQA 4EIKA 4HXJA 2DMOA 1ZLMA 4OMNA 4F16A 1EFNA 5GJWB 1E6HA 1IO6A 3VS2A 4R0KA 3TSWA 2EQIA 1WA7A 3QWXX 1AOJA 3FJ5A 5HCKA 2OJ2A 2EPDA 1TG0A 2DL4A 1B07A 2GNCA 2FG0A 3I5SA 1I07A 1K76A 2DL3A 1JO8A 1VYUA 1X6BA 2G6FX 2J6FA 1ZUYA 2J06A 1S1NA 1M30A 2L3SA 1BU1A 2YUNA 3UATA 1J3TA 1GBQA 2D0NA 1MV3A 3JV3A 2LMJA 2RNAA 2JS0A 4J9BA 1ABQA 4RUGA 2VVKA 3TVTA 2OI3A 2L3PA 2KT8A 1M8MA 1M27C 1GBRA 3VS0A 4IIMA 1OOTA 2EBPA 1WFWA 1RLPC 2F2WA 5I22A 3PVQA 2JMCA 3U23A 2KROA 2C0IA 2LQNA 4QT7A 2EYYA 1SSHA 3M0SA 1SHGA 1PKSA 3SEMA 2RF0A 1M3BA 2L3QA 4X1VA 1AWJA 2RQWA 2CREA 1UHFA 5FWCA 2CDTA 2DLPA 4RTTA 2ROTA 4OMLA 2CH4W 1AWOA 1BK2A 2O31A 2A08A 1KIKA 4AFSC 2KR3A 2ENMA 1BBZA 1AD5A 2A28A 3CQTA 1KSWA 3VS6A 2SEMA 1M3CA 2M51A 1UECA 5IHKA 1T0JA 1E6GA 3H0FA 1SRMA 4RTUA 1K1ZA 2V1QA 1X69A 1VYTA 2NUZA 1UUEA 3M0QA 2K79A 4Z8AA 3NGPA 2RN8A 5IHNA 3VS3A 3EG2A 1JU5C 1AZEA 2VKNA 4GLMA 1X43A 3I9QA 2CUBA 1YWPA 3M0UA 4K11A 1NLOC 4CC2A 1Y57A 3REAB 2ESWA 1WX6A 2C0TA 2KRSA 1NEGA 4RTWA 2V1RA 2YSQA 2DRKA 2YUPA 2M0YA 2RPNA 4RTVA 2MCNA 4FSSA 1T3LA 4A63B 4JJCA 1TUCA 4AFQC 2BTTA 1W1FA 1NYGA 3RBBB 2BZYA 2HCKA 2EKHA 2VWFA 1QWEA 1AZGB 3VS5A 1OEBA 3NMZC 4OMPA 2LZ6B 3M0RA 2O9VA 4RTZA 1V1CA 2CH4A 2JM8A 1H92A 1UHCA 2ECZA 2LP5A 2L0AA 3VS4A 4Z89A 4HVWA 1ABOA 2K6DA 1UDLA 2GTOA 1W70A 1UJ0A 2DL7A 2LJ1A 2PTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FRY A;  1ZUK A;  1U5S A;  2DRM A;  1ZX6 A;  2D1X A;  1H3H A;  1GRI A;  2LNH B;  1I0C A;  2YUQ A;  1WI7 A;  1AWW A;  2QDL A;  4JZ4 A;  1UTI A;  2O9S A;  1X2Q A;  2K7A A;  1PWT A;  2EW3 A;  2KXD A;  4J9H A;  3RNJ A;  2J6O A;  2EGC A;  4JPB W;  1G83 A;  3A98 A;  1BB9 A;  4CC3 A;  1H8K A;  2AKL A;  2A37 A;  2KGT A;  2AZV A;  3VRZ A;  2EGE A;  2E5K A;  1WDX A;  1MUZ A;  1GCQ C;  1ZUU A;  2RQU A;  1NEB A;  3H0I A;  1QWF A;  2YUO A;  1PKT A;  3I35 A;  1HD3 A;  2GBQ A;  2LQW A;  2DF6 A;  2JXB A;  4AFZ C;  1B3Q A;  2X3W D;  4Z88 A;  1KFZ A;  2X3X D;  2ED0 A;  1PNJ A;  1XOV A;  2KEA A;  4JZ3 A;  2L2P A;  5ECA A;  2KBT A;  1T3S A;  2CSQ A;  3R6N A;  1LCK A;  2HEQ A;  1SPK A;  4AG1 C;  1CKB A;  2JTE A;  1PRL C;  1YCS B;  5I11 A;  2EVR A;  3NPF A;  4OMQ A;  4J9C A;  1ARK A;  4LUD A;  4J9G A;  1X2K A;  2JS2 A;  1K0X A;  2B86 A;  4F17 A;  4D8D A;  3EG0 A;  1VA7 A;  1GFC A;  1RLQ C;  3GBQ A;  1Z9Q A;  2D8J A;  4J9E A;  1HJD A;  1SHF A;  4LUE A;  2HDA A;  2KNB B;  2KRN A;  1X27 A;  2DIL A;  4ESR A;  2XMF A;  1RUW A;  2LJ3 A;  1AEY A;  5L23 A;  5IXF A;  3M0P A;  1U06 A;  1Z9Z A;  3H0H A;  2MIO A;  2YDL A;  2AZS A;  2KYB A;  3UA6 A;  2DBK A;  2KE9 A;  2LX7 A;  1RI9 A;  1WYX A;  2DE0 X;  2BZX A;  2K2M A;  1FMK A;  1YNZ A;  1KJW A;  2K3B A;  1YP5 A;  2OAW A;  2PNI A;  2KT1 A;  3M0T A;  5GJV B;  4J9I A;  4RTY A;  2H8H A;  2O2O A;  2ED1 A;  2NWM A;  2KRM A;  3EG1 A;  1A0N B;  2HSP A;  1K9A A;  1K4U S;  1NLP C;  1T0H A;  1WIE A;  1SRL A;  2PZ1 A;  3QWY A;  2GGR A;  2DL5 A;  4RTX A;  2EGA A;  1UGV A;  2ABL A;  2W10 A;  2DVJ A;  1QLY A;  2CT4 A;  4D8K A;  3ZL7 C;  4E6R A;  4IIO A;  4F14 A;  5FW9 A;  3NHN A;  4LE9 A;  3LH5 A;  1CSK A;  1NG2 A;  1PHT A;  1JXM A;  4LNP A;  3REB B;  3O5Z A;  4HCK A;  4DEX A;  4OMO A;  2ROL A;  1OPL A;  2AKK A;  2HBW A;  1WXB A;  2F2V A;  2D8H A;  2F2X A;  1YWO A;  1GCQ A;  3UF4 A;  2JW4 A;  4J9F A;  3EHQ A;  1VYV A;  2FPD A;  2DX1 A;  3PVL A;  2K9G A;  1CKA A;  2KYM A;  2P4R A;  4AG2 C;  1QCF A;  2DA9 A;  2CSI A;  4JJB A;  3VS1 A;  2JT4 A;  4LN2 A;  2FPF A;  2I0N A;  3KFV A;  2LJ0 A;  4Y92 A;  2EYX A;  2SRC A;  4OMM A;  2JMA A;  5IXB A;  1JEG A;  1OPK A;  2RQT A;  3EHR A;  5FWB A;  2YT6 A;  3EG3 A;  5EC7 A;  3THK A;  1ZBJ A;  1GL5 A;  2FRW A;  3C0C A;  4CC7 A;  4HVU A;  2DNU A;  4JJD A;  2KXC A;  2FPE A;  1X6G A;  4AFU C;  2A36 A;  1QKX A;  1WLP B;  4ZNX A;  5IHI A;  3H41 A;  3VS7 A;  4HVV A;  3IQL A;  2GTJ A;  1FYN A;  1Y0M A;  1UG1 A;  1JXO A;  2GQI A;  2RMO A;  1NM7 A;  1JQQ A;  4ORZ A;  1YN8 A;  3UA7 A;  3TSZ A;  2CUD A;  1W6X A;  1K0S A;  4GBQ A;  2J7I A;  4KRT A;  1GCP A;  2RQV A;  1E7O A;  1UJY A;  1I1J A;  4CC4 B;  5IH2 A;  2EYW A;  3EGU A;  2EYZ A;  1UFF A;  2AK5 A;  2DBM A;  1PRM C;  1U3O A;  1GFD A;  2J6K A;  4J9D A;  1OV3 A;  3SHW A;  3PE0 A;  1TUD A;  2FEI A;  3VRY A;  4WCI A;  3I5R A;  2O88 A;  1ZSG A;  2JM9 A;  2FO0 A;  2W0Z A;  1M3A A;  2IIM A;  2J05 A;  2CT3 A;  2LCS A;  1QKW A;  2C0O A;  1MV0 B;  1N5Z A;  4M4Z A;  1HSQ A;  1NYF A;  2RQR A;  1UE9 A;  2DL8 A;  2DYB A;  1SEM A;  3ULR B;  1AWX A;  2DM1 A;  1WXU A;  2BZ8 A;  2MOX A;  1AVZ C;  1WXT A;  4DEY A;  1G2B A;  2DJQ A;  4EIK A;  4HXJ A;  2DMO A;  1ZLM A;  4OMN A;  4F16 A;  1EFN A;  5GJW B;  1E6H A;  1IO6 A;  3VS2 A;  4R0K A;  3TSW A;  2EQI A;  1WA7 A;  3QWX X;  1AOJ A;  3FJ5 A;  5HCK A;  2OJ2 A;  2EPD A;  1TG0 A;  2DL4 A;  1B07 A;  2GNC A;  2FG0 A;  3I5S A;  1I07 A;  1K76 A;  2DL3 A;  1JO8 A;  1VYU A;  1X6B A;  2G6F X;  2J6F A;  1ZUY A;  2J06 A;  1S1N A;  1M30 A;  2L3S A;  1BU1 A;  2YUN A;  3UAT A;  1J3T A;  1GBQ A;  2D0N A;  1MV3 A;  3JV3 A;  2LMJ A;  2RNA A;  2JS0 A;  4J9B A;  1ABQ A;  4RUG A;  2VVK A;  3TVT A;  2OI3 A;  2L3P A;  2KT8 A;  1M8M A;  1M27 C;  1GBR A;  3VS0 A;  4IIM A;  1OOT A;  2EBP A;  1WFW A;  1RLP C;  2F2W A;  5I22 A;  3PVQ A;  2JMC A;  3U23 A;  2KRO A;  2C0I A;  2LQN A;  4QT7 A;  2EYY A;  1SSH A;  3M0S A;  1SHG A;  1PKS A;  3SEM A;  2RF0 A;  1M3B A;  2L3Q A;  4X1V A;  1AWJ A;  2RQW A;  2CRE A;  1UHF A;  5FWC A;  2CDT A;  2DLP A;  4RTT A;  2ROT A;  4OML A;  2CH4 W;  1AWO A;  1BK2 A;  2O31 A;  2A08 A;  1KIK A;  4AFS C;  2KR3 A;  2ENM A;  1BBZ A;  1AD5 A;  2A28 A;  3CQT A;  1KSW A;  3VS6 A;  2SEM A;  1M3C A;  2M51 A;  1UEC A;  5IHK A;  1T0J A;  1E6G A;  3H0F A;  1SRM A;  4RTU A;  1K1Z A;  2V1Q A;  1X69 A;  1VYT A;  2NUZ A;  1UUE A;  3M0Q A;  2K79 A;  4Z8A A;  3NGP A;  2RN8 A;  5IHN A;  3VS3 A;  3EG2 A;  1JU5 C;  1AZE A;  2VKN A;  4GLM A;  1X43 A;  3I9Q A;  2CUB A;  1YWP A;  3M0U A;  4K11 A;  1NLO C;  4CC2 A;  1Y57 A;  3REA B;  2ESW A;  1WX6 A;  2C0T A;  2KRS A;  1NEG A;  4RTW A;  2V1R A;  2YSQ A;  2DRK A;  2YUP A;  2M0Y A;  2RPN A;  4RTV A;  2MCN A;  4FSS A;  1T3L A;  4A63 B;  4JJC A;  1TUC A;  4AFQ C;  2BTT A;  1W1F A;  1NYG A;  3RBB B;  2BZY A;  2HCK A;  2EKH A;  2VWF A;  1QWE A;  1AZG B;  3VS5 A;  1OEB A;  3NMZ C;  4OMP A;  2LZ6 B;  3M0R A;  2O9V A;  4RTZ A;  1V1C A;  2CH4 A;  2JM8 A;  1H92 A;  1UHC A;  2ECZ A;  2LP5 A;  2L0A A;  3VS4 A;  4Z89 A;  4HVW A;  1ABO A;  2K6D A;  1UDL A;  2GTO A;  1W70 A;  1UJ0 A;  2DL7 A;  2LJ1 A;  2PTK A; 
#chains in the Genus database with same CATH topology
 1ZUK A;  2DRM A;  1RAA B;  1ZX6 A;  2VXF A;  2XDP A;  3EGX A;  3JB9 I;  1GRI A;  4C8Q A;  3CCJ T;  1WZO A;  1AWW A;  2XIC A;  1EZZ B;  1VQO T;  1UTI A;  3M56 A;  2K7A A;  1PWT A;  2EW3 A;  1VUB A;  2XHC A;  4M7D D;  4J9H A;  3VV0 A;  4C0D B;  5GAN j;  4PJJ A;  1IRX A;  3HRS A;  2A37 A;  2V8K A;  3H9N A;  3FRN A;  1MUZ A;  3OYH A;  2JUF A;  2RHZ A;  3H0I A;  1VQ8 Q;  1JBM A;  5CVI A;  4AFZ C;  2M0O A;  4Z88 A;  2X3X D;  1JJ2 S;  3GPL A;  4JZ3 A;  3JSC A;  1OU8 A;  3CCE A;  3R6N A;  1SPK A;  1KQS S;  1CKB A;  5I11 A;  2EVR A;  5FRM A;  3CCS Q;  1K0X A;  1VQM T;  2DYI A;  4D8D A;  4KBM B;  1VA7 A;  2DPP B;  5FLX E;  4WF2 A;  1JRI A;  2CZ1 B;  1N9R A;  1G3W A;  2NUP A;  1M5Q 1;  2QQB A;  5IAY A;  4J9E A;  3CCE T;  3X24 B;  1M1K R;  1SHF A;  2HDA A;  2KNB B;  4NOY A;  2HQE A;  1X27 A;  4PFO A;  1QVF A;  1VQ6 A;  2QYZ A;  1VQ7 T;  2K2V A;  1AEY A;  1K9M U;  2M9U A;  3RES A;  1U06 A;  1NPR A;  5GAN 2;  2V8J A;  3E2U A;  4DBR A;  3L2W A;  2DBK A;  2KE9 A;  2LX7 A;  1RAC B;  1KC8 C;  1X01 A;  4PL6 A;  5LL6 S;  1KJW A;  1SKU B;  2OAW A;  2PNI A;  2KT1 A;  4OF1 A;  4M77 C;  4JJN K;  1Q7Y U;  3MHX A;  1RAF B;  4XAX B;  4E7L A;  4XTX A;  1A0N B;  3JCM h;  4OB0 B;  2HSP A;  3EFS A;  1NLP C;  4LDW A;  1NPP A;  1VQN A;  1V76 A;  2DIQ A;  4NL3 A;  1YJ9 A;  1JB0 E;  3CCU Q;  3OYE A;  3CCM Q;  1G3T A;  2QA4 Q;  1Y7X A;  1WQW A;  3L2U A;  3CCJ Q;  1VQK T;  3MCA B;  4QVZ A;  4M77 A;  1OPL A;  4BDZ A;  2AHJ B;  2AKK A;  5CR2 A;  1WXB A;  2F2V A;  2D8H A;  2F2X A;  4XK8 E;  2JW4 A;  4MZP A;  2V26 A;  3ASK A;  4J9F A;  3CC7 A;  3M58 A;  2FPD A;  2K9G A;  1CKA A;  4OVA A;  2KYM A;  2DVE A;  2DA9 A;  8AT1 B;  3V8J A;  3QSU A;  2MI6 A;  4ZGD B;  2JT4 A;  2LQK A;  1RAB B;  4J6W A;  4HCB A;  3EGD A;  2I0N A;  3JCM W;  4IKF A;  8ATC B;  1K9M C;  2SRC A;  3I56 Q;  4FW1 A;  1JEG A;  3V8K A;  1OPK A;  2O4X A;  2LDM A;  5EC7 A;  3THK A;  1ZBJ A;  2KSS A;  2QA4 T;  1N8R C;  4XU3 A;  2KXC A;  2FPE A;  4HCZ A;  2A36 A;  2DD5 A;  5GAN g;  1O75 A;  1YJ9 T;  4RCC A;  4ZNX A;  2P0Q A;  3VS7 A;  4HVV A;  3IQL A;  2E65 A;  1JXO A;  1BKB A;  5GAN h;  3J7A F;  1K73 U;  2EQM A;  3TSZ A;  2CUD A;  2NUT A;  2L5Q A;  4XTV A;  2QI2 A;  4GBQ A;  3QXE B;  1OU9 A;  2J7I A;  3ZBD A;  2VGN A;  1UJY A;  1I1J A;  2LT1 A;  5IH2 A;  2JOY A;  2J6K A;  1M1F A;  3R6O A;  4A54 A;  3QBY A;  1D1C A;  4GY5 A;  2G3R A;  2RM4 A;  2ZPB B;  5LJ3 g;  4M7A G;  3ZEH A;  1K8A U;  2O88 A;  2JM9 A;  4BI4 A;  1S72 T;  1MMN A;  1VQP A;  2IIM A;  2CZ7 B;  2CT3 A;  2LCS A;  1YIJ T;  1VQN Q;  1MV0 B;  1N5Z A;  3OYC A;  1B34 B;  3CXC P;  2PVO B;  1SEM A;  2GFA A;  3CPW S;  3BDL A;  1WXT A;  2WAC A;  3M9Q A;  1G2B A;  4KUI A;  2VV5 A;  2LVM A;  4R0K A;  1Q95 G;  4OP0 A;  3QWX X;  3S3O A;  1IHW A;  3FJ5 A;  2OJ2 A;  2EPD A;  3OYY A;  4MMK A;  3I5S A;  3RR6 A;  2DTI A;  3DB4 A;  2QGG A;  3KBG A;  4OB1 B;  1JO8 A;  1AHJ B;  1RI0 A;  5LJ5 h;  1PM3 A;  2G6F X;  4II1 A;  4KT0 E;  1ZUY A;  1S1N A;  3CCV A;  1WNL A;  1X75 C;  4M75 C;  1NJI R;  1MV3 A;  3OYJ A;  2LMJ A;  3DLM A;  2RNA A;  2VB6 A;  5CKD A;  2DEU A;  1VQN T;  3RKW A;  4O5V A;  4RUG A;  3CCL T;  3I56 T;  1PG5 B;  5J26 A;  2OI3 A;  4M77 B;  3QZ5 B;  2NYS A;  2OTJ A;  4FU6 A;  2YHT A;  3I56 A;  1ZBX A;  2LQN A;  2QTX A;  1SSH A;  2VUB A;  1Y96 A;  5KYY A;  4M78 E;  1M3B A;  4A53 A;  1VQ5 T;  4OGC A;  1TXQ A;  1PCX A;  3OS1 A;  2CRE A;  1UHF A;  4BE2 A;  2CDT A;  5GAM g;  4OML A;  4FYX B;  1O9S A;  3C95 A;  4N4G A;  4AFS C;  3CEY A;  5J3B A;  1HYO A;  3GLX A;  2E1H A;  1M2V B;  4E7Z A;  1R0C B;  5D7U A;  2A28 A;  3CQT A;  1G8X A;  5KYY B;  2SEM A;  1Q7Y R;  1QVG P;  4RTU A;  2F5K A;  2DIG A;  1VYT A;  3M0Q A;  5LJ3 f;  3NGP A;  2RN8 A;  4ZGE B;  5IHN A;  4E7H A;  2DEQ A;  3VS3 A;  3V7S A;  1JU5 C;  4BI8 B;  1YJN Q;  1VQM A;  3FJP A;  2CUB A;  1YWP A;  3M0U A;  3CCV T;  2IVW A;  1NLO C;  1YHQ T;  4J8O A;  4M7A F;  3VKI A;  5C6S A;  4RTW A;  2WSC E;  2E41 A;  2V1R A;  3LYI A;  2XI9 A;  2E3H A;  1M8V A;  1WQ7 A;  4JJC A;  1TUC A;  4EMK A;  2DTH A;  4C0D C;  4ATO A;  2XK0 A;  1Q82 U;  2GQV A;  2VC8 A;  3DLL A;  4OMP A;  1VIF A;  4EMH A;  1H92 A;  2ECZ A;  4PJN A;  4Z89 A;  3JB9 H;  3OYL A;  2M02 A;  2QTV A;  1UDL A;  2JZ2 A;  1VQK Q;  2RI5 A;  2MYS A;  1YJN A;  5GAO n;  3KXT A;  2GTO A;  1W2B A;  5KYU A;  3RIR A;  2JTF A;  2K4Y A;  2Y90 A;  4J7I A;  2LNH B;  4M78 F;  2YUQ A;  4E47 A;  2F5T X;  3BW1 A;  2QDL A;  4DQ2 A;  2EJG A;  1W2B P;  3CC4 A;  1ACM B;  2LRQ A;  4M78 G;  4C92 D;  4HT9 A;  4O6J A;  2KXD A;  5CKH A;  3BFM A;  2EIF A;  3M4G A;  4OB3 B;  3MEU A;  4ZTJ A;  3NTI A;  4M7D A;  4XU0 A;  3G7Z A;  1BB9 A;  3RMQ A;  2L8D A;  1H8K A;  1OX9 A;  3QDF A;  2AKL A;  2E70 A;  4OMF B;  1LPL A;  3UT1 A;  4IUR A;  4F7U F;  2VAS A;  3QYG B;  2HSE B;  2YUO A;  3I35 A;  2GBQ A;  2LQW A;  2QQS A;  1KD1 U;  1B3Q A;  1TS9 A;  3N5B B;  1KFZ A;  3MET A;  3JB9 D;  2ED0 A;  2ZGW A;  3OS5 A;  3LWI A;  1XOV A;  1VQO Q;  2L2P A;  5GMK e;  1T3S A;  2CSQ A;  4B9W A;  1LCK A;  2E4H A;  1F1B B;  1PRL C;  5LJ3 j;  2M1H A;  3OYF A;  3CC4 Q;  3CME A;  3QPH A;  1ARK A;  4LUD A;  1X2K A;  1IXD A;  3CPW A;  3SD4 A;  4F17 A;  5GAO p;  5GAM d;  4M7D C;  3EG0 A;  4IUU A;  4LDV A;  3BY7 A;  1HJD A;  4QVC A;  1MNE A;  4C8Q C;  2O01 E;  2KRN A;  4FSX A;  3CPW P;  3CC2 Q;  4ESR A;  2XMF A;  2QEX A;  2LJ3 A;  3HRT A;  4DBH A;  5L23 A;  3VYH B;  5IXF A;  2QDY B;  4N4I A;  2KYB A;  4ZN1 A;  5GAO r;  2PVG B;  2DE0 X;  2BZX A;  1FMK A;  5CK9 A;  2X4Y A;  2OX7 A;  2EQU A;  2O2O A;  3LH0 A;  2A0F B;  2NWM A;  2KRM A;  1QMC A;  1K9A A;  3RKX A;  4A4H A;  2GGR A;  2DL5 A;  3UDC A;  2YLB A;  2O4X B;  4XTY A;  2EGA A;  2W10 A;  2FHD A;  3M4Y A;  4D6W A;  2DVJ A;  1QLY A;  5CO7 A;  3X26 B;  4D8K A;  1TH7 A;  3ZL7 C;  3SB2 A;  2PU9 B;  4IIO A;  4NL2 A;  4M75 F;  1EIF A;  1BI0 A;  3CC2 T;  1U1S A;  5FW9 A;  3NHN A;  5GAN 6;  1NG2 A;  2E64 A;  1XTD A;  3EGD B;  1JXM A;  4LNP A;  3RKY A;  4HCK A;  4DEX A;  2ROL A;  3QG1 A;  1YFN A;  3HFN A;  1YWO A;  2RJF A;  3UF4 A;  5HY6 A;  5CQY A;  1RAG B;  1YIT Q;  1VYV A;  4M75 G;  4AG2 C;  2CSI A;  1KC8 U;  1OI1 A;  1W4S A;  3QUI A;  4J7F A;  2MMP A;  3OQ5 A;  1TWB A;  4DOW A;  1QVP A;  1XJW B;  3CCM T;  4LDU A;  4PLL A;  3PTA A;  4OMM A;  4PKC C;  2JMA A;  2DTO A;  5IXB A;  1ZHI A;  1IHV A;  3G6E Q;  3EG3 A;  2QG9 B;  1GL5 A;  4C92 B;  4PJO C;  5AYF A;  4CC7 A;  3OBY A;  1M90 R;  1QVF S;  1GXI E;  2EJ9 A;  3CBO A;  2LX9 A;  3CXC A;  1FYN A;  4M7A C;  1UG1 A;  3QKJ A;  2RHU A;  1C6V X;  2RMO A;  1NM7 A;  3MP8 A;  4M77 E;  3CCL Q;  4M7A E;  2VYT A;  3UA7 A;  2DXU A;  3EG9 B;  4M78 B;  1LNX A;  3HFO A;  3Q1J A;  3OYI A;  1N27 A;  1VQM Q;  2EKO A;  4KUL A;  1ZSZ A;  4FYY B;  2EYW A;  3CCM A;  2EYZ A;  2CYZ B;  2FB7 A;  1VQ5 Q;  2HL5 C;  1SSF A;  3PE0 A;  1TUD A;  1KHC A;  3H6Z A;  1HK9 A;  3I5R A;  1ZSG A;  2FO0 A;  2D9T A;  5CKE A;  4A4K A;  1MGQ A;  2XDB A;  1D0X A;  1QKW A;  3PT9 A;  3CXC S;  2C0O A;  4IUV A;  2OAU A;  3CCE Q;  1I5O B;  1BIA A;  4PJO G;  1NYF A;  3JB9 F;  2DL8 A;  4C0F A;  5AT1 B;  2H3J A;  3ULR B;  1WXU A;  3QII A;  3I55 Q;  1HXD A;  5KCO A;  4IUT A;  1NZ9 A;  1ZLM A;  4OMN A;  2DKG A;  4KGV B;  4Z02 A;  4PJM A;  4B6M A;  1E6H A;  4F7U A;  5J39 A;  1NJI U;  1WA7 A;  2X4J A;  3V7C A;  1K76 A;  7AT1 B;  2DL3 A;  1D0Z A;  1M2O A;  5A0L A;  1V29 B;  2DET A;  5GAN d;  3JCM g;  1ZSZ C;  2L3S A;  3PFS A;  1BU1 A;  3SWN C;  2FYK A;  3QO3 A;  2XDD A;  3JV3 A;  2MWO A;  4J9B A;  1R0B G;  2RI2 A;  3S6W A;  3VUZ A;  2VVK A;  2D0Q B;  2DXC A;  4JLI A;  3HRU A;  2L3P A;  2KT8 A;  5GMK l;  5FU7 B;  3QYH B;  1N8R R;  3OMC A;  2EBP A;  1QP2 A;  1QW1 A;  1WFW A;  4QQ6 A;  1RLP C;  1BCO A;  2K5L A;  3PVQ A;  1VQ6 T;  1VQ7 Q;  2C0I A;  2L89 A;  4QT7 A;  2EYY A;  3M0S A;  3CME Q;  3RER A;  2L3Q A;  4E7I A;  4X1V A;  5LJ5 e;  2YXY A;  4EDU A;  2RJE A;  2DZ9 A;  3CCR T;  1WHJ A;  1DJ7 B;  2CH4 W;  2MK5 A;  4BD3 A;  4C5H A;  2A08 A;  1KIK A;  3C12 A;  2ENM A;  4F04 B;  3CCR Q;  3L1A A;  1BBZ A;  1VQP Q;  1AD5 A;  1QVG S;  2EFI A;  1KSW A;  1VIE A;  4C5G A;  5IN1 A;  5DLQ E;  1BI3 A;  5IHK A;  1T0J A;  1SRM A;  1K1Z A;  1Q82 R;  5KYW B;  1I8F A;  2YWW A;  3X25 B;  5LJ5 f;  2AT1 B;  4Z8A A;  1YJ9 Q;  2DER A;  1D09 B;  1AZE A;  3F70 A;  1X43 A;  2ZPF B;  3I9Q A;  3SDZ A;  1OUL A;  4LXC A;  1G3S A;  3REA B;  2ESW A;  2DFU A;  3OYB A;  3MKD A;  2DRK A;  2M0Y A;  2MCN A;  4FSS A;  3MEV A;  4A63 B;  3VU3 C;  2BTT A;  3CMA A;  2ZZD A;  2YLC A;  1NYG A;  2BZY A;  1U1T A;  3LX7 A;  1XQH A;  1OEB A;  4C8Q F;  1WPY A;  5D6X A;  2O9V A;  3P8D A;  3M55 A;  3PMT A;  2XG8 D;  1YJN T;  1C0M A;  4OGE A;  3GOX A;  1EX4 A;  4C0G A;  1U8R A;  4C92 G;  3JCM J;  2QAS A;  3S3M A;  3A8M B;  1QP3 A;  2PUO B;  4R55 A;  1M1K C;  2CGH A;  1BI2 A;  2DJZ A;  3RUX A;  1KQ2 A;  1UJ0 A;  2DL7 A;  1BI1 A;  2LJ1 A;  4PJO A;  3BE3 A;  2PTK A;  1U5S A;  1Y71 A;  4CI0 C;  5FU6 C;  3EGX B;  1H3H A;  1I0C A;  4EMG A;  1WI7 A;  1VQ4 Q;  2V8I A;  3HHT B;  3EFO B;  3G6E T;  2O9S A;  3CCQ A;  4F7U G;  1X6O A;  4CRI A;  4XTZ A;  4QW2 A;  3RNJ A;  2NUT B;  3ZFJ A;  2J6O A;  2EGC A;  1G3Y A;  2XID A;  4VUB A;  4C0Z A;  3A98 A;  4CC3 A;  5GAN 3;  1Q81 C;  1Q86 U;  1BYM A;  3G71 Q;  2KGT A;  3VRZ A;  1ZA1 B;  4BY6 B;  2E5K A;  2Y4Y A;  4JDS A;  4JRP A;  1GCQ C;  1LOJ A;  1IB8 A;  1ZUU A;  2RQU A;  1JJ2 P;  1QWF A;  2RJC A;  2BIV A;  2DF6 A;  2JXB A;  2X3W D;  4DOV A;  1PNJ A;  3J80 E;  1YHQ Q;  3E19 A;  4RKU E;  2DD4 A;  2QQR A;  5ECA A;  2KBT A;  3CC7 Q;  3GIB A;  1WHM A;  4J5Y A;  1N6A A;  1M2V A;  2JTE A;  3SFM A;  1YCS B;  1BIB A;  1YIT T;  1H3Z A;  3MO8 A;  4OMQ A;  4J9C A;  2JS2 A;  3HSB A;  2KI7 A;  5C0M A;  1P92 A;  5GMK i;  4ZN3 A;  2ZPH B;  5HK3 A;  3JCM b;  1VQ4 T;  4JRK A;  4LUE A;  5DM7 R;  2K3X A;  1K8A C;  1OYX A;  1RAH B;  4C8Q E;  4M75 D;  1RUW A;  2BE9 B;  4FM4 B;  4YTL A;  1D1A A;  3HKS A;  3JCM P;  4RMO A;  1Z9Z A;  2CP2 A;  3H0H A;  2MIO A;  2AZS A;  2IG0 A;  3UA6 A;  2QXF A;  1RI9 A;  1WYX A;  1FMV A;  2K3B A;  1KQS A;  3VUB A;  4J83 A;  3M0T A;  3CMA Q;  3CME T;  2RK2 A;  2H8H A;  1KD1 C;  2ED1 A;  1BCM A;  3EG1 A;  3GNG A;  4N0A C;  1K4U S;  2PVD B;  1S72 Q;  1T0H A;  1SRL A;  3QWY A;  3CD6 Q;  4BY6 C;  2CP5 A;  3RDV A;  3M57 A;  3SWN A;  2F1L A;  2M16 A;  4RTX A;  1UGV A;  2HQH A;  2CT4 A;  4E6R A;  1KC8 R;  4IUP A;  4A4E A;  1UGS B;  1MHN A;  4RG2 A;  3OA6 A;  5GAN 4;  2CP0 A;  4LE9 A;  4DBF A;  4FW2 A;  3CCS T;  2YRD A;  3M54 A;  3REB B;  3O5Z A;  4OMO A;  3G1J A;  1Q7Y C;  4XTU A;  3G71 A;  3G4S A;  4Y91 A;  3OW2 S;  2KDS A;  3CC4 T;  4KGX B;  9ATC B;  1VQO A;  1N8R U;  4C92 A;  4M75 A;  2P4R A;  3CMA T;  4EMK C;  3JB9 J;  2JVV A;  3VS1 A;  3CCQ Q;  1FX7 A;  2RJD A;  3LGF A;  2OTL Q;  2NUP B;  5A0G A;  1IGU A;  2FPF A;  6AT1 B;  1I5L A;  1ZA2 B;  3I55 T;  2DK3 A;  2LCL A;  1LVK A;  4Y92 A;  2EYX A;  3V7R A;  1H64 1;  1QCN A;  3OW2 A;  3S3N A;  1SF9 A;  2BUD A;  3EHR A;  5FWB A;  4X9C A;  4M7A D;  3J81 E;  4HVU A;  1QVG A;  2DNU A;  3OSV A;  4JJD A;  1QKX A;  2K5I A;  4X9D A;  4UC4 A;  5IHI A;  5GAN 7;  2OTL A;  3CBP A;  1Y0M A;  4ANJ A;  4BI3 A;  2K57 A;  3X28 B;  1YJW A;  1YCY A;  1JQQ A;  1D3B A;  1YN8 A;  3C4S A;  3GP8 A;  4M78 D;  1W6X A;  5I2S A;  2MAM A;  4FT2 A;  3NFC A;  5KE3 A;  1VQL Q;  4KH0 B;  1GCP A;  4FL6 A;  1E7O A;  4ZGJ B;  1VQ9 A;  2A3L A;  3EGU A;  2AK5 A;  4HCC A;  3OSS C;  1PRM C;  4J9D A;  2L3R A;  5L8R E;  2FEI A;  4PJO D;  5LJ5 g;  3VRY A;  2OTL T;  2QK0 A;  1OZ3 A;  1RAI B;  3HPW A;  2QQ9 A;  3INZ A;  1M3A A;  2J05 A;  2FZG B;  2ZAE A;  3KUF A;  3E1S A;  4ELY C;  1VQ4 A;  3A1P A;  1HSQ A;  2E6N A;  4EMK B;  5HKC A;  4JS4 A;  2RQR A;  2BZ8 A;  2MOX A;  2BKD N;  1D1B A;  4V2S A;  2DJQ A;  1MMG A;  4HXJ A;  5FU7 C;  2DMO A;  1WHL A;  2KAF A;  5GJW B;  1IO6 A;  3VS2 A;  2RD1 A;  3TEE A;  2KMT A;  1IZ6 A;  3TSW A;  1Q81 U;  1AOJ A;  1VQL T;  1TG0 A;  2GNC A;  1QQJ A;  1I07 A;  1I81 A;  2RH2 A;  1VYU A;  3MP6 A;  3V8L A;  3SWN B;  4BAC A;  1RL2 A;  2J6F A;  1ZSZ B;  2A7Y A;  1M30 A;  4EPC A;  2DO3 A;  5KYX B;  2EQJ A;  2YUN A;  2ZPI B;  2ATC B;  4M75 E;  5FRO A;  3WXM B;  4C92 F;  2HD0 A;  2D0N A;  4XU1 A;  5KYU B;  2NLU A;  3CD6 T;  4C8Q G;  2LC4 A;  2E5Q A;  2E3I A;  3AT1 B;  3TVT A;  4MDW A;  3CCS A;  1VOM A;  5I2M A;  1K73 R;  2QEX Q;  1GBR A;  3G6E A;  4F7U B;  3QJY A;  4MML A;  1OOT A;  1VQ8 T;  2F2W A;  4P5N A;  1WGS A;  2JMC A;  4M77 D;  4KH1 B;  4A4F A;  5GMK h;  2KRO A;  4M7D F;  3A5Z B;  1W2B S;  2Z0W A;  2KVQ G;  1PKS A;  3SEM A;  2X4X A;  1UGQ B;  4LD9 K;  3JCM e;  1TTH B;  5KCH A;  3FB9 A;  4GLK A;  5LJ3 e;  4AMC A;  4RTT A;  2X4W A;  1RAD B;  5GMK j;  2O31 A;  1UB4 A;  3JRZ A;  3E9F A;  4N4H A;  4RCB A;  1WJR A;  2CS7 A;  3CCJ A;  4PK4 A;  3EH2 A;  5KYX A;  3VS6 A;  1WHK A;  5DY9 A;  2P0P A;  3I55 A;  4M78 C;  4PLI A;  2QA4 A;  4QQD A;  3H0F A;  4FT4 A;  3M53 A;  2V1Q A;  1X69 A;  1MMA A;  3D7S B;  4FYV B;  3M59 A;  3EG2 A;  4QQG A;  2LCC A;  3FDR A;  4K11 A;  4M77 F;  2P0K A;  3LLR A;  2X51 A;  4CC2 A;  1Y57 A;  4JRQ A;  1WX6 A;  1NE8 A;  3JCM c;  2C0T A;  1NEG A;  2YSQ A;  3GNF B;  4HKE A;  2RPN A;  4RTV A;  5GAN f;  1TUG B;  3OYA A;  2E10 A;  2F69 A;  5CKB A;  4BUG A;  4IUQ A;  4JLG A;  1W1F A;  2DAQ A;  2HCK A;  2VWF A;  2EKH A;  1AZG B;  3VS5 A;  3NMZ C;  1KD1 R;  2HQX A;  4M78 A;  2HKN A;  2LZ6 B;  3CCQ T;  4RTZ A;  5FU6 B;  1PSE A;  1VQ6 Q;  4M7D G;  3BDU A;  1ABO A;  3HTR A;  2K6D A;  4QKU A;  5LJ5 j;  5GAN 8;  3CC2 A;  5HK0 A;  3CBM A;  2WSE E;  1M4Z A;  2VXE A;  1I4K 1;  1G5V A;  1WLP B;  4M7D E;  2FRY A;  2X35 A;  2D1X A;  5KYW A;  1N9S A;  3JAM E;  5GMK m;  5EG2 A;  1NBE B;  4JZ4 A;  1PSF A;  3EFO A;  1WJQ A;  4M77 G;  1X2Q A;  3CC7 T;  2H3E B;  3OS0 A;  3GF5 A;  3OYN A;  1YBY A;  3X20 B;  2B8A A;  1ZQ1 A;  2CZ6 B;  1YIJ Q;  3HP9 A;  4JPB W;  2RA2 A;  3JCM X;  3P8H A;  3JB9 G;  1G83 A;  3JCM d;  4C8Q D;  1VQ5 A;  1PC0 A;  2AZV A;  2DXT A;  2EGE A;  2HL3 A;  1WDX A;  4PNO A;  5GAM f;  2ZPG B;  1NEB A;  4J6Y A;  1PKT A;  1TU0 B;  1HD3 A;  4HA8 A;  4N0A A;  2DZC A;  2KEA A;  1AT1 B;  1YIT A;  1WHH A;  2EWN A;  4MDX A;  2HEQ A;  4AG1 C;  3LW5 E;  4ELZ C;  2GFU A;  4Y28 E;  3A8L B;  3NPF A;  4MZM A;  2AIR B;  3P8B B;  4J9G A;  5GAM e;  2B86 A;  2QQA A;  3EFR A;  5A0D A;  1GFC A;  1OQK A;  4L6V 5;  1RLQ C;  4C5I A;  3GBQ A;  1Z9Q A;  2D8J A;  4Q5W A;  3UPU A;  1KK7 A;  1MND A;  2K3Y A;  2GCX A;  2OTJ Q;  1VQ9 Q;  4R56 A;  5GAN 5;  2HMA A;  4L5G A;  2DIL A;  4X34 A;  1Q81 R;  2HBP A;  3TRE A;  5GAM h;  3MEA A;  4XQ3 A;  3M0P A;  3DKM A;  2JNG A;  3M5A A;  1B34 A;  1WJS A;  5KE2 A;  4FIB A;  1TOV A;  5CKF A;  2YDL A;  3OYG A;  3EH1 A;  2FZC B;  3LGL A;  5FRN A;  1M90 U;  3JCM f;  2RI3 A;  2MWP A;  2K2M A;  1YNZ A;  1YP5 A;  3FIF A;  5D6W A;  5GJV B;  4J9I A;  4RTY A;  2FL7 A;  2E12 A;  5LJ5 d;  5A2Q E;  4BB7 A;  2ZPE B;  4L59 A;  3AHU A;  2CZ0 B;  1QCO A;  2PZ1 A;  1WIE A;  1UGP B;  1D0Y A;  3URG A;  1K9M R;  3A8O B;  1B7T A;  2CP6 A;  5GAO q;  2PQW A;  2ABL A;  3OYD A;  2DXB A;  2XU8 A;  4FCY A;  3CCU A;  4F14 A;  2P4T A;  3L2R A;  2FVU A;  4C92 E;  2COZ A;  3LH5 A;  1CSK A;  2EYQ A;  1PHT A;  1YI2 T;  2C06 A;  2KY9 A;  4JS5 A;  3DB3 A;  4FYW B;  2BE7 D;  2P84 A;  1VQL A;  2HBW A;  1IRE B;  4NS5 A;  1GCQ A;  3CCR A;  3RMS A;  5GAN e;  3A8H B;  3EHQ A;  2DX1 A;  2MPX C;  3PVL A;  1LJO A;  4LD6 A;  3EG9 A;  3L42 A;  5GAO l;  1YHQ A;  3CCL A;  5LJ3 h;  1QCF A;  1IGQ A;  2RHY A;  4JJB A;  2VGM A;  2QEX T;  3QZ9 B;  3H8Z A;  4RG8 A;  3OY9 A;  4LN2 A;  2Y4X A;  2RHI A;  3QHS A;  3KFV A;  3EAE A;  5KYN A;  2LJ0 A;  4LDY A;  4E7J A;  2JTM A;  1M1G A;  2QGF B;  1C1A A;  4B9X A;  1TSF A;  2RQT A;  4E7S A;  2YT6 A;  1VQK A;  1KQ1 A;  4E2F B;  4PJO E;  2FRW A;  3CD6 A;  4PJL A;  3C0C A;  2K5F A;  1X6G A;  4AFU C;  4HT8 A;  2R5A A;  3ME9 A;  1R77 A;  2FZK B;  3PNW C;  2GF7 A;  3H41 A;  4TVR A;  2GTJ A;  2GQI A;  4WTO B;  3MPU B;  3CCV Q;  1JJ2 A;  1RAE B;  2CP3 A;  2XKO C;  4M7A B;  5CAI A;  1OZ2 A;  4ORZ A;  1VQP T;  4BE0 A;  3QDR B;  1KQS P;  1KG1 A;  3TCJ A;  3OYK A;  1K0S A;  1VQ8 A;  4PJO B;  4C92 C;  4KRT A;  3L2Q A;  2RQV A;  4CC4 B;  1UFF A;  3LWH A;  2DBM A;  1U3O A;  1GFD A;  3MEW A;  1OV3 A;  3SHW A;  4M7A A;  2RO0 A;  1QVF P;  4J6X A;  4WCI A;  1FXX A;  5GAO m;  5CQX A;  2W0Z A;  2RK1 A;  1UGR B;  2LQ8 A;  5IT9 E;  2ZCF B;  1S72 A;  3O8V A;  4M4Z A;  2XD0 A;  3ER0 A;  2LT4 A;  3WVE B;  1UE9 A;  3G71 T;  2DYB A;  2KQW A;  2IPO B;  1AWX A;  2DM1 A;  2I2L A;  1AVZ C;  3FEO A;  3L2V A;  3OMG A;  4DEY A;  5I21 A;  3PIP A;  1M90 C;  1M1K U;  4EIK A;  2R5M A;  4OB2 B;  5DLO A;  4F16 A;  5GAM j;  1EFN A;  2COW A;  2JN0 A;  3G4S T;  2YRV A;  2CKK A;  2EQI A;  2COY A;  5D6Y A;  5HCK A;  2E6Z A;  1UEB A;  1VQ7 A;  2DL4 A;  4MZT A;  1B07 A;  4KGZ B;  2FG0 A;  4M75 B;  1YIJ A;  3OBW A;  4E7K A;  2EQK A;  1X6B A;  1YJW T;  1OX8 A;  4PJO F;  4C5E A;  4AT1 B;  2J06 A;  1Y96 B;  3PMI A;  3UAT A;  1J3T A;  4KUD K;  3MJX A;  3TQ7 P;  1GBQ A;  2RHX A;  4F7U E;  4A4G A;  1M9S A;  2JJ9 A;  2R57 A;  2JS0 A;  3FC3 A;  1ABQ A;  4DA4 A;  3OB9 A;  2R58 A;  3NTK A;  3PGG A;  1M8M A;  1M27 C;  3VS0 A;  4IIM A;  3TU4 K;  3VYG A;  3L2Z A;  2HAX A;  2HNI A;  2MF2 A;  5I22 A;  2KK4 A;  4PFZ A;  5KH6 A;  3U23 A;  1XNI A;  1SG5 A;  3OYM A;  1SHG A;  2EAY A;  2RF0 A;  2WSF E;  3T9N A;  2CP7 A;  1Q82 C;  1Q86 C;  3JCM Q;  4C8Q B;  3JCM V;  1AWJ A;  3CPF A;  2RQW A;  2D6F A;  2LNV A;  5LJ3 d;  3OW2 P;  5FWC A;  2DLP A;  3HL8 A;  2ROT A;  1Y07 A;  5M9O A;  4M7D B;  1AWO A;  3G4S Q;  1BK2 A;  4JRI A;  1PD1 A;  2HZY A;  2KR3 A;  2OTJ T;  3FLG A;  1FWZ A;  3PIO A;  4BDY A;  1K73 C;  1M3C A;  2M51 A;  5CIU A;  1UEC A;  1E6G A;  3MP1 A;  1R8O B;  2NUZ A;  1UUE A;  2K79 A;  3CCU T;  1FMW A;  4QVD A;  4XTW A;  3A8G B;  3WVD B;  2QAZ A;  2VKN A;  4GLM A;  4ZTF A;  3C94 A;  3NTH A;  2KRS A;  3E9G A;  4ME7 A;  2YUP A;  2X9H A;  1T3L A;  1Q86 R;  1MMD A;  1WHG A;  3QJ6 A;  4AFQ C;  3VJP A;  1NJI C;  4LDX A;  2EJF A;  1VQ9 T;  3OS2 A;  2RB6 A;  3RBB B;  5CCA A;  4BE1 A;  1QWE A;  2YRC A;  1YI2 Q;  1PD0 A;  3M0R A;  1V1C A;  2CH4 A;  2JM8 A;  1UHC A;  2PUK B;  2LP5 A;  1D3B B;  2L0A A;  3VS4 A;  4DBQ A;  4JUV A;  4HVW A;  1K8A R;  1YI2 A;  1YJW Q;  4PFP A;  3UWN A;  2LTO A;  1KHI A;  2HKQ B;  4XU2 A;  1W70 A; 
#chains in the Genus database with same CATH homology
 2FRY A;  1ZUK A;  1U5S A;  2DRM A;  1ZX6 A;  2D1X A;  1H3H A;  1GRI A;  2LNH B;  1I0C A;  2YUQ A;  1WI7 A;  1AWW A;  2QDL A;  4JZ4 A;  1UTI A;  2O9S A;  1X2Q A;  2K7A A;  1PWT A;  2EW3 A;  2KXD A;  4J9H A;  3RNJ A;  2J6O A;  2EGC A;  4JPB W;  1G83 A;  3A98 A;  1BB9 A;  4CC3 A;  1H8K A;  2AKL A;  2A37 A;  2KGT A;  2AZV A;  3VRZ A;  2EGE A;  2E5K A;  1WDX A;  1MUZ A;  1GCQ C;  1ZUU A;  2RQU A;  1NEB A;  3H0I A;  1QWF A;  2YUO A;  1PKT A;  3I35 A;  1HD3 A;  2GBQ A;  2LQW A;  2DF6 A;  2JXB A;  4AFZ C;  1B3Q A;  2X3W D;  4Z88 A;  1KFZ A;  2X3X D;  2ED0 A;  1PNJ A;  1XOV A;  2KEA A;  4JZ3 A;  2L2P A;  5ECA A;  2KBT A;  1T3S A;  2CSQ A;  3R6N A;  1LCK A;  2HEQ A;  1SPK A;  4AG1 C;  1CKB A;  2JTE A;  1PRL C;  1YCS B;  5I11 A;  2EVR A;  3NPF A;  4OMQ A;  4J9C A;  1ARK A;  4LUD A;  4J9G A;  1X2K A;  2JS2 A;  1K0X A;  2B86 A;  4F17 A;  4D8D A;  3EG0 A;  1VA7 A;  1GFC A;  1RLQ C;  3GBQ A;  1Z9Q A;  2D8J A;  4J9E A;  1HJD A;  1SHF A;  4LUE A;  2HDA A;  2KNB B;  2KRN A;  1X27 A;  2DIL A;  4ESR A;  2XMF A;  1RUW A;  2LJ3 A;  1AEY A;  5L23 A;  5IXF A;  3M0P A;  1U06 A;  1Z9Z A;  3H0H A;  2MIO A;  2YDL A;  2AZS A;  2KYB A;  3UA6 A;  2DBK A;  2KE9 A;  2LX7 A;  1RI9 A;  1WYX A;  2DE0 X;  2BZX A;  2K2M A;  1FMK A;  1YNZ A;  1KJW A;  2K3B A;  1YP5 A;  2OAW A;  2PNI A;  2KT1 A;  3M0T A;  5GJV B;  4J9I A;  4RTY A;  2H8H A;  2O2O A;  2ED1 A;  2NWM A;  2KRM A;  3EG1 A;  1A0N B;  2HSP A;  1K9A A;  1K4U S;  1NLP C;  1T0H A;  1WIE A;  1SRL A;  2PZ1 A;  3QWY A;  2GGR A;  2DL5 A;  4RTX A;  2EGA A;  1UGV A;  2ABL A;  2W10 A;  2DVJ A;  1QLY A;  2CT4 A;  4D8K A;  3ZL7 C;  4E6R A;  4IIO A;  4F14 A;  5FW9 A;  3NHN A;  4LE9 A;  3LH5 A;  1CSK A;  1NG2 A;  1PHT A;  1JXM A;  4LNP A;  3REB B;  3O5Z A;  4HCK A;  4DEX A;  4OMO A;  2ROL A;  1OPL A;  2AKK A;  2HBW A;  1WXB A;  2F2V A;  2D8H A;  2F2X A;  1YWO A;  1GCQ A;  3UF4 A;  2JW4 A;  4J9F A;  3EHQ A;  1VYV A;  2FPD A;  2DX1 A;  3PVL A;  2K9G A;  1CKA A;  2KYM A;  2P4R A;  4AG2 C;  1QCF A;  2DA9 A;  2CSI A;  4JJB A;  3VS1 A;  2JT4 A;  4LN2 A;  2FPF A;  2I0N A;  3KFV A;  2LJ0 A;  4Y92 A;  2EYX A;  2SRC A;  4OMM A;  2JMA A;  5IXB A;  1JEG A;  1OPK A;  2RQT A;  3EHR A;  5FWB A;  2YT6 A;  3EG3 A;  5EC7 A;  3THK A;  1ZBJ A;  1GL5 A;  2FRW A;  3C0C A;  4CC7 A;  4HVU A;  2DNU A;  4JJD A;  2KXC A;  2FPE A;  1X6G A;  4AFU C;  2A36 A;  1QKX A;  1WLP B;  4ZNX A;  5IHI A;  3H41 A;  3VS7 A;  4HVV A;  3IQL A;  2GTJ A;  1FYN A;  1Y0M A;  1UG1 A;  1JXO A;  2GQI A;  2RMO A;  1NM7 A;  1JQQ A;  4ORZ A;  1YN8 A;  3UA7 A;  3TSZ A;  2CUD A;  1W6X A;  1K0S A;  4GBQ A;  2J7I A;  4KRT A;  1GCP A;  2RQV A;  1E7O A;  1UJY A;  1I1J A;  4CC4 B;  5IH2 A;  2EYW A;  3EGU A;  2EYZ A;  1UFF A;  2AK5 A;  2DBM A;  1PRM C;  1U3O A;  1GFD A;  2J6K A;  4J9D A;  1OV3 A;  3SHW A;  3PE0 A;  1TUD A;  2FEI A;  3VRY A;  4WCI A;  3I5R A;  2O88 A;  1ZSG A;  2JM9 A;  2FO0 A;  2W0Z A;  1M3A A;  2IIM A;  2J05 A;  2CT3 A;  2LCS A;  1QKW A;  2C0O A;  1MV0 B;  1N5Z A;  4M4Z A;  1HSQ A;  1NYF A;  2RQR A;  1UE9 A;  2DL8 A;  2DYB A;  1SEM A;  3ULR B;  1AWX A;  2DM1 A;  1WXU A;  2BZ8 A;  2MOX A;  1AVZ C;  1WXT A;  4DEY A;  1G2B A;  2DJQ A;  4EIK A;  4HXJ A;  2DMO A;  1ZLM A;  4OMN A;  4F16 A;  1EFN A;  5GJW B;  1E6H A;  1IO6 A;  3VS2 A;  4R0K A;  3TSW A;  2EQI A;  1WA7 A;  3QWX X;  1AOJ A;  3FJ5 A;  5HCK A;  2OJ2 A;  2EPD A;  1TG0 A;  2DL4 A;  1B07 A;  2GNC A;  2FG0 A;  3I5S A;  1I07 A;  1K76 A;  2DL3 A;  1JO8 A;  1VYU A;  1X6B A;  2G6F X;  2J6F A;  1ZUY A;  2J06 A;  1S1N A;  1M30 A;  2L3S A;  1BU1 A;  2YUN A;  3UAT A;  1J3T A;  1GBQ A;  2D0N A;  1MV3 A;  3JV3 A;  2LMJ A;  2RNA A;  2JS0 A;  4J9B A;  1ABQ A;  4RUG A;  2VVK A;  3TVT A;  2OI3 A;  2L3P A;  2KT8 A;  1M8M A;  1M27 C;  1GBR A;  3VS0 A;  4IIM A;  1OOT A;  2EBP A;  1WFW A;  1RLP C;  2F2W A;  5I22 A;  3PVQ A;  2JMC A;  3U23 A;  2KRO A;  2C0I A;  2LQN A;  4QT7 A;  2EYY A;  1SSH A;  3M0S A;  1SHG A;  1PKS A;  3SEM A;  2RF0 A;  1M3B A;  2L3Q A;  4X1V A;  1AWJ A;  2RQW A;  2CRE A;  1UHF A;  5FWC A;  2CDT A;  2DLP A;  4RTT A;  2ROT A;  4OML A;  2CH4 W;  1AWO A;  1BK2 A;  2O31 A;  2A08 A;  1KIK A;  4AFS C;  2KR3 A;  2ENM A;  1BBZ A;  1AD5 A;  2A28 A;  3CQT A;  1KSW A;  3VS6 A;  2SEM A;  1M3C A;  2M51 A;  1UEC A;  5IHK A;  1T0J A;  1E6G A;  3H0F A;  1SRM A;  4RTU A;  1K1Z A;  2V1Q A;  1X69 A;  1VYT A;  2NUZ A;  1UUE A;  3M0Q A;  2K79 A;  4Z8A A;  3NGP A;  2RN8 A;  5IHN A;  3VS3 A;  3EG2 A;  1JU5 C;  1AZE A;  2VKN A;  4GLM A;  1X43 A;  3I9Q A;  2CUB A;  1YWP A;  3M0U A;  4K11 A;  1NLO C;  4CC2 A;  1Y57 A;  3REA B;  2ESW A;  1WX6 A;  2C0T A;  2KRS A;  1NEG A;  4RTW A;  2V1R A;  2YSQ A;  2DRK A;  2YUP A;  2M0Y A;  2RPN A;  4RTV A;  2MCN A;  4FSS A;  1T3L A;  4A63 B;  4JJC A;  1TUC A;  4AFQ C;  2BTT A;  1W1F A;  1NYG A;  3RBB B;  2BZY A;  2HCK A;  2EKH A;  2VWF A;  1QWE A;  1AZG B;  3VS5 A;  1OEB A;  3NMZ C;  4OMP A;  2LZ6 B;  3M0R A;  2O9V A;  4RTZ A;  1V1C A;  2CH4 A;  2JM8 A;  1H92 A;  1UHC A;  2ECZ A;  2LP5 A;  2L0A A;  3VS4 A;  4Z89 A;  4HVW A;  1ABO A;  2K6D A;  1UDL A;  2GTO A;  1W70 A;  1UJ0 A;  2DL7 A;  2LJ1 A;  2PTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...