4IIMA

Crystal structure of the second sh3 domain of itsn1 bound with a synthetic peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
57
structure length
57
Chain Sequence
LLQAQALYPWRAKKDNHLNFNKNDVITVLEQQDMWWFGEVQGQKGWFPKSYVKLISA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Intersectin-1
publication title Crystal structure of the Second SH3 Domain of ITSN1 bound with a synthetic peptide
rcsb
source organism Homo sapiens
molecule tags Endocytosis
total genus 13
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4iimA00
4GBQA 2A36A 2EYXA 2ROLA 3O5ZA 2K9GA 3VS6A 2EQIA 3EG2A 1X2KA 2NUZA 2DM1A 3EG1A 2RQTA 1WXUA 1NG2A 2O2OA 3U23A 2OAWA 2J06A 2O9VA 3EG3A 1QWEA 5I11A 1W70A 2CT3A 3H0FA 4D8DA 1M30A 3M0QA 1TG0A 1TUDA 2ESWA 2L3SA 2LJ1A 2LQWA 4GLMA 2LCSA 1UECA 1AWJA 1ZBJA 2DLPA 1YWOA 4Y92A 1I07A 3NPFA 2DX1A 2V1QA 5FW9A 1PKTA 4LN2A 1QCFA 2A08A 3C0CA 2BZXA 4IIMA 2EYWA 1SHGA 3FJ5A 1GBQA 3VS5A 1S1NA 4ZNXA 4JJBA 1E6GA 5IHKA 2BZ8A 2A37A 1ZUUA 2KXDA 2ED0A 1K9AA 2EVRA 1PRLC 4Z8AA 1WXBA 3UF4A 1JEGA 4E6RA 1H8KA 2JS0A 1PHTA 1PWTA 2JTEA 2CSIA 2W10A 4IIOA 4AFSC 1OV3A 1EFNA 4J9EA 2K2MA 2EGAA 1CKAA 1KJWA 1PKSA 2A28A 1E6HA 1B3QA 2AK5A 2O88A 2HSPA 2OI3A 1QKXA 2J7IA 1BK2A 4J9DA 2K7AA 2JS2A 3NGPA 1UJ0A 3REBB 2HDAA 1X43A 1AVZC 2JW4A 3I35A 2KYBA 1YN8A 4F14A 2GTJA 1IO6A 5ECAA 2O9SA 2KEAA 4AG1C 3VS7A 1WA7A 3VRZA 4KRTA 3TSWA 1JO8A 4JJDA 2SEMA 4RTYA 1OPLA 2CT4A 2D1XA 1T3LA 2CH4W 4J9IA 2RQWA 4F17A 2AZVA 1UE9A 1Y0MA 3I5RA 3VS0A 4R0KA 2RN8A 4J9BA 2LJ3A 1NLPC 1K4US 2C0IA 2G6FX 2EPDA 2J6KA 1K76A 2X3XD 2YUNA 1WLPB 1UHCA 1SRMA 4A63B 1SSHA 1T3SA 1HSQA 2EGCA 3QWYA 4OMOA 1X69A 4ESRA 2DNUA 4LE9A 2LX7A 2O31A 2D0NA 4M4ZA 3A98A 1BB9A 2FPEA 1NYGA 2MIOA 1QWFA 1U06A 1YNZA 2DRKA 2EBPA 1GL5A 1NEGA 2D8HA 1PRMC 2JT4A 4CC3A 3RBBB 2LNHB 2DBMA 2KXCA 2EGEA 4CC2A 2CSQA 5IHIA 3KFVA 3H0IA 2P4RA 2JXBA 1T0HA 4Z88A 2CH4A 3ULRB 1ABOA 1FYNA 2HBWA 2FPDA 3CQTA 3GBQA 2GTOA 1UGVA 1M8MA 1VA7A 3IQLA 2DJQA 1KIKA 1Y57A 2RNAA 1U5SA 1X2QA 2GNCA 2BTTA 2LJ0A 4Z89A 1JQQA 4LNPA 2DL3A 2B86A 4HVWA 1SPKA 1WFWA 1WX6A 5GJWB 2YUPA 2MCNA 1GFDA 4OMPA 1NYFA 2EW3A 5HCKA 1OPKA 3EHQA 3VS3A 2HCKA 3UA6A 2M0YA 1AWOA 2J6OA 2CUBA 1X6GA 4X1VA 1KFZA 2CREA 1K0XA 1GBRA 4ORZA 4AFUC 2L3QA 3M0PA 2DYBA 1SHFA 3TVTA 1ZX6A 2PNIA 1WI7A 1G83A 3EHRA 3NHNA 4J9HA 1VYTA 5IXBA 2VWFA 2RQVA 1GCQA 5IHNA 2CUDA 3M0UA 1CKBA 3LH5A 3I5SA 1QKWA 3PVLA 1BU1A 2YUQA 2VKNA 3H0HA 4HVUA 1K1ZA 1GCQC 3VS4A 1ZSGA 5EC7A 1UTIA 5IH2A 3VS1A 4F16A 2F2WA 2W0ZA 1HD3A 4J9GA 4RTTA 2JMCA 1AD5A 2KRNA 1UG1A 4K11A 4WCIA 3TSZA 4EIKA 2DILA 1UDLA 2BZYA 2DE0X 2FRWA 1VYUA 2ENMA 1BBZA 2L3PA 1I0CA 1UUEA 2FPFA 1WYXA 2DL4A 1WIEA 1I1JA 3UATA 4OMMA 2JM8A 2FO0A 1NEBA 2DVJA 1ZUKA 2AKLA 2F2VA 1Z9ZA 2KYMA 5GJVB 1U3OA 2AKKA 1W1FA 2D8JA 1GCPA 1AEYA 4JPBW 1OOTA 2HEQA 2RQRA 1AOJA 2IIMA 4JZ3A 1JXOA 2LP5A 2KNBB 5FWCA 1KSWA 2KR3A 1ABQA 1RLPC 3SEMA 2C0TA 2ED1A 2EYYA 4OMLA 1M27C 2KROA 2I0NA 1QLYA 4HVVA 2AZSA 4OMNA 4J9FA 2DL7A 1M3AA 4RTZA 1T0JA 2JM9A 5L23A 3VRYA 4OMQA 2H8HA 2JMAA 3NMZC 2FG0A 4D8KA 1M3CA 1X27A 4RTWA 1MV0B 2EKHA 1GRIA 1G2BA 1JU5C 3I9QA 4LUEA 2V1RA 1ZLMA 2DRMA 4CC7A 1LCKA 2XMFA 1J3TA 3H41A 2KRMA 1MUZA 3RNJA 1E7OA 4QT7A 1AZGB 2LQNA 2K3BA 4RTUA 1Z9QA 2PTKA 4RUGA 1YCSB 4FSSA 3PVQA 1UHFA 2LZ6B 2YSQA 3M0TA 1V1CA 2DBKA 2J05A 1NM7A 4HCKA 1YP5A 4CC4B 2K79A 1A0NB 3EG0A 2EYZA 3EGUA 2KBTA 3VS2A 1WDXA 4AFZC 3JV3A 2RQUA 1AWXA 2DL5A 2L0AA 2SRCA 1GFCA 2ECZA 1JXMA 2FRYA 1UJYA 1NLOC 2OJ2A 1FMKA 3REAB 1H3HA 3QWXX 4AG2C 2LMJA 2KE9A 2J6FA 1H92A 2DF6A 2MOXA 3THKA 5I22A 2YT6A 1VYVA 4RTXA 4DEXA 2RF0A 2KT8A 5IXFA 4JJCA 1N5ZA 1UFFA 1RI9A 1YWPA 1ZUYA 2GBQA 3ZL7C 2KRSA 2X3WD 2VVKA 2ABLA 4AFQC 2E5KA 3PE0A 2GQIA 1K0SA 2F2XA 2KT1A 3SHWA 4LUDA 2L2PA 3M0SA 4DEYA 2QDLA 2DMOA 3UA7A 1AWWA 2KGTA 2M51A 4RTVA 2YDLA 1AZEA 2RPNA 1RUWA 1SRLA 3R6NA 1MV3A 1ARKA 2K6DA 1HJDA 1SEMA 1RLQC 2C0OA 1CSKA 2DL8A 5FWBA 2PZ1A 1M3BA 1X6BA 1TUCA 4HXJA 2ROTA 1OEBA 2FEIA 4J9CA 1XOVA 2CDTA 4JZ4A 2DA9A 3M0RA 2GGRA 1W6XA 2RMOA 1WXTA 1B07A 2YUOA 1PNJA 2NWMA
chains in the Genus database with same CATH superfamily
3UPUA 2GFUA 2A36A 5GANh 2K9GA 4C8QE 2KK4A 3EG1A 1NG2A 2O2OA 5KCOA 3U23A 4LDXA 9ATCB 1KK7A 4RG2A 2LX9A 2M16A 2O4XB 5GAN5 1QWEA 1VQKA 2E6NA 1ZQ1A 3H0FA 3PNWC 1M30A 1KD1C 5I2SA 2ESWA 2HD0A 2OX7A 5GAMe 3OY9A 2VGNA 2DLPA 1D09B 4O6JA 4Y92A 1QVGP 2M02A 1PM3A 2RHXA 5CKBA 1XTDA 3EG9A 2QEXQ 4ZNXA 4QKUA 3HFNA 3CPWS 1NJIR 3HKSA 1ZUUA 2KXDA 5J26A 4DBQA 2XU8A 1K9AA 2EVRA 1PRLC 2ZPHB 1VQ5A 4FW2A 1VQ7Q 4M7AC 1P92A 2QQAA 3AT1B 4XTVA 2E1HA 1OV3A 2NLUA 4XTZA 4MZTA 2KVQG 2A28A 4PJJA 3CCQA 3GNFB 2OTJA 4DBFA 5DM7R 1VQMT 4M7AE 2DERA 2JW4A 4RCCA 2COZA 2KYBA 3SWNC 4M77D 1K8AR 2X35A 4FT4A 2KEAA 4M7AF 1PG5B 3VRZA 4FL6A 2EYQA 4MDWA 5FROA 4PJOE 1JO8A 4C92A 1UB4A 2SEMA 4RTYA 4KGXB 1M1FA 2D1XA 5CKFA 2RQWA 5FU7B 5FU6C 4ELYC 3HRTA 2KMTA 3TREA 4J9BA 3CBOA 3QG1A 1NLPC 3CD6Q 1R0BG 3MCAB 2VASA 4JLIA 4OP0A 1TUGB 2HL3A 5J39A 4M7DA 2HBPA 2LX7A 2O31A 5IT9E 3RKXA 3DB4A 1UGQB 1TU0B 1M2VA 3A98A 4HKEA 2X51A 5GANj 3JSCA 4PJLA 3RERA 1YNZA 1GL5A 4XTXA 3JCMJ 2EAYA 2OTLT 1IGQA 1ZSZA 1PRMC 3M55A 3OS1A 3G7ZA 4VUBA 1QP3A 3QDFA 4BUGA 5IHIA 3OYEA 3J81E 1B7TA 3VUZA 1RAIB 1BCOA 3JCMe 3OYCA 1Q86C 2V8JA 1Y96B 4MDXA 3R6OA 1Q7YC 3P8DA 1N27A 5CCAA 1X6OA 2PVGB 2BKDN 2KY9A 1KD1U 1KIKA 3P8HA 1Y57A 1U5SA 2HMAA 1JQQA 4LNPA 3JCMb 4HVWA 4C92D 1JJ2A 1SPKA 1Q81C 3BY7A 5GJWB 2RHYA 4DA4A 1M90C 4KBMB 4BY6B 3EHQA 1KC8R 1SSFA 2E70A 1VQPQ 2JTFA 1QCNA 3UA6A 5A0LA 2M0YA 1YBYA 1JRIA 2J6OA 1KFZA 2ZPBB 4AFUC 3M0PA 3MJXA 5CIUA 1KQSP 4ZGEB 2HKNA 4XU2A 3JB9F 1G83A 3EHRA 4PJNA 4FYYB 3FRNA 2VWFA 5CQYA 1GCQA 3CMEQ 5IHNA 4M7DD 3VYGA 2CUDA 4HT9A 4HVUA 1QVPA 3VS4A 4ME7A 3CCMT 5EC7A 4PLIA 5IH2A 1VQMA 4PLLA 1GXIE 4XTUA 4F7UB 4RTTA 1ZA2B 4K11A 1G3TA 2BZYA 2P4TA 3P8BB 1TSFA 1N9RA 3HL8A 1WGSA 2VV5A 1BBZA 3EFRA 1KHIA 4KGZB 2YRVA 3CCUQ 4F7UG 1G5VA 1WYXA 4M78D 1BI0A 2DL4A 4OMMA 5LJ3j 2D9TA 1QVFA 3T9NA 2AKLA 4JRIA 3F70A 3RMSA 3CCVT 4J6XA 2EJGA 4E7LA 2DIQA 5GJVB 1U3OA 1AEYA 3LWIA 3CC4T 3L2VA 3EG9B 1JXOA 2X4YA 1KSWA 2CZ6B 1W2BS 2G3RA 3QDRB 4EMKC 3RIRA 2XK0A 5HK0A 3MP1A 1PD1A 2AZSA 4FYWB 4OMNA 3PTAA 1OX8A 1M3AA 4N4GA 3M58A 4IKFA 1T0JA 3M9QA 3DB3A 5L23A 2D6FA 1M4ZA 3CPFA 2DO3A 3CC7T 1Q82C 2OTLA 3EAEA 2P0QA 4LDWA 1M3CA 4M77E 5GANg 3QYGB 3OB9A 2FZCB 5KYUA 4LUEA 3RUXA 3G4ST 3SDZA 2X4WA 3H6ZA 3KXTA 8ATCB 1ZLMA 2ZZDA 3JAME 1FWZA 3OMCA 3JCMh 2XMFA 3VV0A 3H41A 4BI4A 3OW2P 4QT7A 1AZGB 2K3BA 1PSFA 4RTUA 4RUGA 2RHZA 2CP3A 5KYNA 1VQNT 1UHFA 2O4XA 4M75C 1M9SA 1D1CA 3M0TA 2YSQA 1YJNT 3BFMA 2DBKA 2CZ7B 3UWNA 2R57A 3FDRA 2K79A 3M5AA 4JLGA 1WDXA 2CP2A 4XK8E 1GFCA 4N0AA 3QSUA 2MMPA 1UJYA 2RHUA 3CBPA 3DKMA 4B9WA 1RABB 3MHXA 5J3BA 1KD1R 4M75E 5GAN2 3EGXA 2CS7A 3PIOA 3SWNA 3OYMA 4OB0B 1VYVA 2LQKA 1O9SA 2RB6A 1OI1A 2RJCA 2YXYA 3CC2T 4M75F 4PFOA 2DTIA 2RF0A 5GAOq 2VC8A 1N5ZA 1UFFA 2GBQA 5CO7A 2ABLA 2K3XA 4J83A 1ZSZB 5I2MA 4LUDA 1PC0A 3CCMA 2QDLA 5GAN8 1YHQT 2M51A 4RTVA 4KUDK 4A54A 1RUWA 1U8RA 1VQ6T 4CI0C 2DL8A 1KQSS 5LJ5j 3CPWP 4QQ6A 4HXJA 3Q1JA 4FIBA 5GANf 2DPPB 3OBWA 4JZ4A 5GAN6 1YI2T 2GGRA 1N8RU 2RMOA 3CCVA 3SFMA 1WXTA 2DIGA 2F5KA 1PNJA 2OAWA 2X3XD 1IRXA 2NWMA 1W4SA 1NJIU 2LC4A 5LJ3g 3AHUA 3VS6A 1X2KA 3ER0A 2DM1A 4BE1A 1VQ4T 1WXUA 3CC4A 4FU6A 2PQWA 3HPWA 1LJOA 2J06A 4FW1A 5I11A 2FVUA 3M0QA 1VQLT 2L3SA 2LQWA 1AWJA 1ZBJA 1BKBA 3MO8A 4XU1A 3SD4A 3QYHB 1MNEA 1H3ZA 1SF9A 1Y71A 3CC7A 5GAOp 3FB9A 3LW5E 3EH2A 1Q82U 3X25B 2NUTA 1K8AU 4LDYA 2LDMA 2ZCFB 3J7AF 5C0MA 4N4HA 5IHKA 1C6VX 2BZ8A 3G4SA 2A37A 4B9XA 2ED0A 4E7ZA 1UGPB 3EH1A 3HP9A 4EMHA 1H8KA 2JTEA 1PWTA 2W10A 3JCMW 2QI2A 4IIOA 4AFSC 2E5QA 2R5MA 2RJDA 2HSEB 6AT1B 3WVDB 3OBYA 1VQOQ 2YLCA 5C6SA 2AK5A 1VQNA 1WHJA 2MAMA 2HSPA 2OI3A 3CMAT 2J7IA 3VU3C 1YJNA 4J9DA 2K7AA 1X43A 2RO0A 2V26A 1Q86R 4XU3A 3CCRQ 2A7YA 3N5BB 4F14A 5KE3A 1IO6A 2O9SA 3A5ZB 3A8GB 4AG1C 2LTOA 3TU4K 4C0FA 1FXXA 3GNGA 2WSEE 4C8QG 2X4JA 1YFNA 2K3YA 3JCMc 2KSSA 2ZGWA 4J9IA 3OW2S 5GMKj 2QYZA 3CMAQ 2AZVA 4FT2A 1Y0MA 3CC2A 1Q81R 1IZ6A 5CAIA 3I5RA 4R0KA 2LJ3A 1WJQA 2CYZB 2HAXA 1BI1A 2C0IA 2G6FX 1F1BB 1PD0A 1RAAB 1K76A 4C8QC 3FEOA 2CP6A 4A4FA 1WLPB 4LD9K 3BW1A 3LLRA 1UHCA 4OGCA 1SRMA 4ANJA 5LJ3e 1HSQA 5GANd 3G6ET 2DVEA 5KYUB 2A0FB 5CQXA 1YHQA 4ESRA 2RA2A 2D0NA 4M4ZA 4F7UA 1VQ6A 1OYXA 4BI8B 4J7FA 4V2SA 2QQRA 2MIOA 3G71T 3OS5A 3OYDA 5CKDA 4EMKA 2QEXT 2A3LA 5HKCA 1IGUA 3RBBB 2LNHB 4C8QF 1YI2A 4M7AB 2DBMA 2KDSA 2EGEA 3G6EQ 5LJ5g 2BIVA 2V8KA 4CC2A 1KC8U 1TWBA 3H9NA 1R77A 1VQ7T 2HQEA 1HYOA 5KCHA 5AT1B 2JXBA 2VYTA 1T0HA 4Z88A 3ASKA 2CH4A 2XIDA 3S3NA 1VQ4A 4M7AG 3G71Q 3MP8A 2XDDA 3HRSA 1N8RR 3EGXB 1OU9A 2QA4Q 3SWNB 4PK4A 2RH2A 5GAOm 1VQLA 2DJQA 4AMCA 4PJOG 1X2QA 1VQ8Q 3G1JA 2NYSA 5GAN3 4PNOA 1QW1A 2HKQB 1FMWA 1D1AA 2DL3A 2B86A 3D7SB 1WX6A 3C95A 2FL7A 1NYFA 2EW3A 2FYKA 5FU6B 1Y7XA 1AWOA 4X1VA 4PJOC 2CREA 1S72Q 2EFIA 3DLMA 3WXMB 2R58A 3TVTA 2KI7A 2EQMA 1Q82R 2O01E 4JDSA 4RG8A 3CD6T 5HY6A 1W2BP 1CKBA 3LH5A 3I5SA 1QKWA 4UC4A 3X20B 2QASA 4MZPA 1WNLA 2DXTA 2GCXA 3MEWA 3X24B 3CMAA 3A8OB 1UTIA 3QHSA 4F16A 7AT1B 1HD3A 1BCMA 4D6WA 4PJOF 1K9MC 2E41A 4WCIA 3TSZA 3MEVA 3OMGA 5LJ3d 1D1BA 1VYUA 1QP2A 4QVCA 4P5NA 2YLBA 2JVVA 2DD4A 2L3PA 2K4YA 4DBHA 1UUEA 5LJ5f 3UATA 2HZYA 4E7HA 2JM8A 2FO0A 3KUFA 1ZUKA 1Z9ZA 1RACB 1LVKA 2AKKA 3CCLQ 3CXCP 1W1FA 1GCPA 4JPBW 4Z02A 1ZBXA 2NUTB 2HEQA 2F5TX 2B8AA 2IIMA 1NPPA 2LP5A 3CCET 2HQXA 3OSVA 3G6EA 3PMIA 2KNBB 5FWCA 2COWA 1ABQA 4KULA 3SEMA 2C0TA 2EQJA 1XNIA 3L1AA 3TEEA 4R55A 1JJ2S 3L2QA 1QLYA 1K73C 4HVVA 2LCCA 3JB9G 4J9FA 4ZN3A 1MMAA 1G3SA 4RTZA 4E47A 3G71A 3L2WA 4OMQA 1LNXA 1YJ9Q 2LCLA 2QEXA 1D0ZA 1RI0A 2XICA 1VQPT 3JCMf 1X27A 3CCEQ 3JRZA 4LD6A 1GRIA 1OU8A 3I9QA 1D0YA 5GAMh 4ATOA 1VQ7A 4OMFB 4C0DC 5KYWB 2DRMA 3LX7A 3CMET 4YTLA 2Z0WA 1WHHA 3TCJA 1Z9QA 4FSSA 3QJYA 2XG8D 3CBMA 2LZ6B 2M9UA 3LH0A 1NM7A 1RAGB 5FRNA 1UEBA 1N9SA 3EG0A 2EYZA 3VS2A 4PJMA 5IAYA 2QQSA 2SRCA 1NPRA 2FRYA 4X9CA 2OJ2A 3CCUT 1NBEB 3ZFJA 2JNGA 1RAEB 1H3HA 1M2OA 3X26B 4AG2C 4L5GA 2J6FA 3E19A 2DF6A 2MOXA 1OX9A 3QIIA 3THKA 2YT6A 1NZ9A 2QK0A 5IXFA 2ZPIB 2DXBA 4JJCA 3CD6A 3MEUA 2JTMA 2X3WD 2VVKA 2VGMA 4AFQC 4EMKB 2JZ2A 1YIJQ 2F2XA 3I55Q 3SHWA 3S3OA 2L2PA 3M57A 4JS4A 5GMKe 4IUTA 5LJ5d 2OAUA 2DXCA 2XI9A 4M77G 1K9MU 2YDLA 1YITQ 4C5HA 3V8KA 1VOMA 2MI6A 1JBMA 1MV3A 4C8QA 1ARKA 2K6DA 2FZKB 4C5EA 1HJDA 1SEMA 1RLQC 5CVIA 2PZ1A 2BE7D 1M3BA 2RK1A 4RCBA 4LDUA 2QGGA 3OYLA 1XOVA 2CDTA 3C94A 4L6V5 3MKDA 4M77C 3M4GA 2EWNA 2Y4XA 1QVGA 3QXEB 4BDYA 4GBQA 4E7KA 1WJRA 2EYXA 2EQIA 3EG2A 2NUZA 3RKYA 3PMTA 4M75B 1OZ3A 2DEUA 1X75C 4FCYA 3CCEA 2O9VA 3OYGA 4ZTJA 4D8DA 3CCJQ 1TUDA 2LJ1A 4GLMA 4M75G 1K73U 2VUBA 1MMNA 4M77F 1UECA 5M9OA 2RD1A 3UDCA 1RADB 5D7UA 3NPFA 4BE2A 5FW9A 2V1QA 1IB8A 1Q86U 1V76A 2DD5A 1QCFA 2EJFA 3UT1A 4IIMA 1Q7YU 1VQPA 1SHGA 3FJ5A 1YJWQ 1GBQA 3CXCS 1S1NA 3NTHA 4KH0B 4C0GA 2C06A 4M7AA 3GP8A 1W2BA 4Z8AA 1WXBA 4IUQA 3H8ZA 3FC3A 4E6RA 2JS0A 1KQ2A 2CSIA 3CMEA 1Q81U 1EFNA 2EKOA 4J9EA 1U1TA 4PJOA 1M90U 1PKSA 1E6HA 1Y07A 4A4GA 5GAOn 4HCZA 1QKXA 4NOYA 1AHJB 4GY5A 1BK2A 2V8IA 2E12A 1UJ0A 3NGPA 3ZBDA 2HDAA 1AVZC 2MWOA 4IURA 3QO3A 1VQ9Q 1YN8A 3SB2A 2DAQA 1G8XA 1OULA 3CCUA 1VUBA 1B34A 4KRTA 3C4SA 4ZTFA 4JJDA 2CT4A 2YRCA 1T3LA 2CH4W 3M59A 2DK3A 4C92C 4F17A 1WHMA 2JN0A 3V8LA 4JRKA 4C0ZA 4DOWA 3V7SA 5KYXB 1R8OB 2EPDA 2J6KA 4A63B 4E7JA 1SSHA 1T3SA 2L8DA 4C92E 2EGCA 3QWYA 3M54A 4OMOA 5D6YA 5KYYA 2DNUA 1XQHA 4OVAA 4M7DC 4C92F 2JJ9A 1BB9A 2FPEA 5GANe 4A53A 1NYGA 3LGLA 5FLXE 2CZ0B 4M78G 1NEGA 3I56Q 4M7AD 2D8HA 2KAFA 1IREB 4CC3A 1K9MR 2PUKB 2CSQA 1JB0E 3FLGA 3KFVA 4M7DE 4ELZC 3CCSQ 3JCMP 2WACA 3HSBA 3H0IA 1TOVA 2F69A 2ZPEB 2WSFE 4M78C 4M7DF 1ABOA 3OYAA 2HBWA 3GBQA 2GTOA 1VQOT 2GF7A 2E4HA 1KQSA 1I4K1 4QQDA 4ZGJB 3LWHA 2E3HA 3HTRA 1FMVA 1VQKQ 2ATCB 2RNAA 2BTTA 2CGHA 3CCRT 2LJ0A 4LDVA 4M78E 3M53A 1WFWA 2YUPA 2ZPFB 4OMPA 3OS0A 5HCKA 4M78F 4TVRA 2HCKA 1WHKA 2LRQA 2CUBA 1K73R 1K0XA 1GBRA 4ORZA 1U1SA 2AIRB 3EGDA 3BDLA 1PCXA 4C8QB 2PNIA 3ZEHA 3NHNA 4J9HA 1VQ5Q 1M8VA 5KYWA 4PKCC 2QDYB 1Q7YR 2YRDA 2K57A 1BU1A 2YUQA 2VKNA 1JJ2P 4Q5WA 1K1ZA 1GCQC 1ZSGA 5CK9A 2DJZA 4XTYA 5D6XA 3VS1A 2F2WA 3LGFA 4J9GA 2NUPB 2KRNA 4EIKA 2DILA 1UDLA 4OB1B 2DZ9A 2BUDA 1M90R 2RM4A 2XKOC 2ENMA 3L42A 5GAN4 4EMGA 1MNDA 4C5GA 4DQ2A 3S6WA 3PIPA 2L3RA 1WQWA 2FB7A 3CEYA 4GLKA 1WIEA 2K2VA 3OYFA 2XHCA 2EQKA 4KGVB 2DETA 1BI2A 2GFAA 3JCMX 1OOTA 3J80E 4O5VA 4JZ3A 4M77A 3RKWA 5I21A 2QA4T 1BIAA 2L89A 2Y90A 2KR3A 3JCMQ 2ED1A 1WHGA 2EYYA 4OMLA 4PFPA 2KROA 1VQ8T 2LNVA 1G3YA 3OW2A 4B6MA 4ZN1A 1QVFP 2JM9A 1KQ1A 3VRYA 1BI3A 4DBRA 4PJOB 5GAMf 3RR6A 2H8HA 1I8FA 3VUBA 2CP7A 1S72T 4C5IA 1WJSA 1VIEA 1G2BA 1JU5C 2P84A 4CRIA 1IXDA 2GQVA 2E65A 4CC7A 4BDZA 1RAFB 1J3TA 1MUZA 1QCOA 1B34B 1VQOA 2MF2A 4M75A 5FU7C 1E7OA 2IPOB 4HCCA 2QXFA 2ZAEA 4IUVA 3PVQA 2YHTA 3JCMg 1M5Q1 1XJWB 3V7CA 1V1CA 2J05A 2PVOB 3CCRA 1YP5A 4CC4B 1I81A 4OB2B 3BE3A 2CKKA 4AFZC 2RQUA 2DL5A 2L0AA 2XD0A 5FRMA 1WQ7A 1NLOC 2DEQA 2MPXC 1FMKA 1NE8A 2RJEA 3REAB 4N0AC 2EIFA 2KE9A 1M1KC 5KYYB 5I22A 4XQ3A 4WF2A 4RTXA 3OYHA 3CPWA 1R0CB 2KT8A 3INZA 4JJNK 3CCLT 1N6AA 1EZZB 1DJ7B 1RI9A 1YWPA 5GMKi 2KRSA 3PE0A 2I2LA 2QAZA 1K0SA 3M0SA 4DEYA 3UA7A 2EJ9A 2KGTA 5GMKl 3NTIA 3VKIA 3GIBA 4BE0A 1VQMQ 1RAHB 1ACMB 2LQ8A 2RI3A 2P0PA 2C0OA 2CZ1B 1CSKA 5KE2A 2X4XA 5FWBA 5LJ5e 1YJ9T 2H3EB 1TUCA 2ROTA 2JUFA 1EIFA 5LJ3h 4C0DB 3LYIA 1W6XA 2HNIA 4JUVA 4L59A 1B07A 4FYXB 2QQBA 1SG5A 2DXUA 4M75D 2ROLA 3O5ZA 4OB3B 3EFOB 4EDUA 2RQTA 1Q95G 5GAMd 1SKUB 5KYXA 5DY9A 2QA4A 3EG3A 2K5IA 4II1A 1W70A 2CT3A 1TG0A 2EQUA 4E7IA 1VQ8A 1G3WA 4E7SA 3EGDB 2E10A 4M78A 2LCSA 3OSSC 4A4HA 1YWOA 2PUOB 1I07A 2DX1A 1PKTA 4LN2A 1TXQA 4MMLA 4FSXA 2A08A 3C0CA 2BZXA 2EYWA 2OTLQ 1KG1A 3GLXA 3VS5A 4JJBA 5GMKm 1E6GA 3RMQA 1QQJA 1S72A 2HQHA 1M1GA 3E1SA 1I5LA 3UF4A 3QJ6A 4HT8A 3QPHA 1JEGA 1PHTA 3RESA 2K2MA 3META 3PT9A 2EGAA 1CKAA 1KJWA 2DTOA 1YIJT 3I55T 2MK5A 3ME9A 1B3QA 3FIFA 5LL6S 3URGA 5IN1A 2O88A 1QVFS 1V29B 1MMGA 2K5FA 2F1LA 5CKEA 4A4KA 3M4YA 1BYMA 4PFZA 2JS2A 1YITT 5CKHA 3A8HB 3REBB 3FJPA 3I35A 5KH6A 2GTJA 5ECAA 3A8LB 3VS7A 4F04B 2QTVA 1WA7A 4M77B 4IUUA 3TSWA 2AHJB 1WZOA 3OYKA 1QVGS 1IHVA 1M1KU 1OPLA 2MWPA 4NL3A 2RHIA 3OYBA 2FZGB 2QG9B 3C12A 3OQ5A 4JS5A 1UE9A 1X01A 4BY6C 1MMDA 3GPLA 2QTXA 3CCLA 3VS0A 3GOXA 2RN8A 1O75A 2DKGA 1MGQA 1K4US 4R56A 2QQ9A 2YUNA 3HFOA 2DFUA 3CCMQ 4WTOB 3KBGA 1N8RC 3CCJT 2JOYA 1X69A 4J5YA 4LE9A 1C1AA 4X9DA 3OYYA 3V8JA 2LT1A 3VJPA 2NUPA 1NJIC 2VXEA 5LJ5h 1YJ9A 3QUIA 1QWFA 1U06A 3QZ9B 2DRKA 2EBPA 4Y91A 1YJWT 3QZ5B 2JT4A 1ZHIA 2KXCA 3JCMd 1D3BA 3E9GA 3CCVQ 2RJFA 5GAN7 4HA8A 2BE9B 2P4RA 5GAMj 4F7UE 3ULRB 1HXDA 1FYNA 4N4IA 3OYJA 4Y28E 2FPDA 1KHCA 3CQTA 3CC4Q 1K8AC 3MPUB 3BDUA 4BI3A 4F7UF 1UGVA 2DYIA 1M8MA 1TH7A 1VA7A 3IQLA 3WVEB 5DLOA 2GNCA 1VIFA 2E6ZA 3L2ZA 4DOVA 4BD3A 4Z89A 1VQ9T 2RK2A 3MP6A 1LOJA 1OQKA 2PVDB 1UGSB 2MCNA 1GFDA 3CC7Q 4J7IA 4C92B 2M0OA 1OPKA 3VS3A 1AT1B 1QMCA 2K5LA 1TS9A 4ZGDB 2CP5A 1X6GA 2CP0A 1RL2A 4C8QD 1I5OB 2L3QA 8AT1B 2DYBA 1SHFA 3G4SQ 3TQ7P 1ZX6A 2RI2A 4C92G 4RMOA 3JB9I 1WI7A 1VYTA 5HK3A 5IXBA 4QQGA 4BB7A 2RQVA 3JB9H 2R5AA 3M0UA 3DLLA 1YIJA 3I55A 2QGFB 3PVLA 4LXCA 3H0HA 4JRQA 4KH1B 4M7DB 3M56A 1VQNQ 1ZA1B 3CXCA 2W0ZA 3JCMV 1YITA 1YJNQ 1M2VB 2JMCA 4A4EA 1AD5A 1UG1A 2DE0X 2FRWA 3X28B 4M7DG 3MEAA 2LVMA 4KUIA 3I56T 3QKJA 2D0QB 1I0CA 2FPFA 3OA6A 1I1JA 1YCYA 5GMKh 2DTHA 2COYA 1NEBA 2DVJA 2XDBA 2KQWA 3VYHB 4M78B 3A1PA 4JRPA 2X9HA 3PFSA 2F2VA 5EG2A 3CCST 3CC2Q 2HL5C 2KYMA 1C0MA 4FM4B 4HCBA 2H3JA 2RI5A 3GF5A 2D8JA 5GAOr 3HHTB 4XTWA 2E64A 2RQRA 1M1KR 1AOJA 1FX7A 5AYFA 3OYNA 4EPCA 1RLPC 3CCJA 1VQKT 4J6YA 3OYIA 1KC8C 1M27C 1YHQQ 4RKUE 1ZSZC 2I0NA 4J8OA 2E3IA 4XU0A 4PJOD 1BIBA 2DL7A 2M1HA 1VQ6Q 2JMAA 3NMZC 2FG0A 1YJWA 1LPLA 5DLQE 4QVDA 4D8KA 2VB6A 2WSCE 4MZMA 4RTWA 1MV0B 2EKHA 3QBYA 1YI2Q 3HRUA 4FYVB 4MMKA 2V1RA 3S3MA 1VQ5T 5L8RE 1LCKA 2KRMA 2FHDA 5D6WA 2AT1B 1VQ4Q 3RNJA 1WHLA 3EFOA 3JB9J 5A0GA 2LQNA 5GAMg 2PTKA 1YCSB 2P0KA 3CCQT 3L2UA 3O8VA 4XAXB 4J6WA 4QW2A 2OTJT 1VQLQ 1WPYA 2YWWA 4HCKA 1A0NB 3EGUA 1EX4A 1VQ9A 2KBTA 1PSEA 2VXFA 3JV3A 1AWXA 2ECZA 1JXMA 2LT4A 4BACA 4PL6A 1Y96A 1MHNA 1UGRB 4NL2A 1H641 3QWXX 1TTHB 2LMJA 3CCQQ 2IVWA 1H92A 3NTKA 4IUPA 2DZCA 2OTJQ 3RDVA 3E2UA 4DEXA 4E2FB 2Y4YA 4QVZA 2L5QA 2XDPA 1ZUYA 3ZL7C 1IHWA 2E5KA 3EFSA 5A0DA 2GQIA 1HK9A 2KT1A 3OS2A 1D3BB 2DMOA 1AWWA 1OZ2A 1D0XA 5GAOl 5CR2A 5LJ3f 3L2RA 1AZEA 2RPNA 1SRLA 4OF1A 3R6NA 3JB9D 3I56A 1X6BA 3A8MB 1OEBA 2FEIA 2IG0A 4J9CA 4AT1B 4NS5A 2ZPGB 2DA9A 2PU9B 4X34A 3PGGA 3M0RA 3V7RA 2MYSA 3CCSA 2YUOA 3NFCA 5A2QE 4OGEA 3E9FA 4KT0E
chains in the Genus database with same CATH topology
4GBQA 2A36A 2EYXA 2ROLA 3O5ZA 2K9GA 3VS6A 2EQIA 3EG2A 1X2KA 2NUZA 2DM1A 3EG1A 2RQTA 1WXUA 1NG2A 2O2OA 3U23A 2OAWA 2J06A 2O9VA 3EG3A 1QWEA 5I11A 1W70A 2CT3A 3H0FA 4D8DA 1M30A 3M0QA 1TG0A 1TUDA 2ESWA 2L3SA 2LJ1A 2LQWA 4GLMA 2LCSA 1UECA 1AWJA 1ZBJA 2DLPA 1YWOA 4Y92A 1I07A 3NPFA 2DX1A 2V1QA 5FW9A 1PKTA 4LN2A 1QCFA 2A08A 3C0CA 2BZXA 4IIMA 2EYWA 1SHGA 3FJ5A 1GBQA 3VS5A 1S1NA 4ZNXA 4JJBA 1E6GA 5IHKA 2BZ8A 2A37A 1ZUUA 2KXDA 2ED0A 1K9AA 2EVRA 1PRLC 4Z8AA 1WXBA 3UF4A 1JEGA 4E6RA 1H8KA 2JS0A 1PHTA 1PWTA 2JTEA 2CSIA 2W10A 4IIOA 4AFSC 1OV3A 1EFNA 4J9EA 2K2MA 2EGAA 1CKAA 1KJWA 1PKSA 2A28A 1E6HA 1B3QA 2AK5A 2O88A 2HSPA 2OI3A 1QKXA 2J7IA 1BK2A 4J9DA 2K7AA 2JS2A 3NGPA 1UJ0A 3REBB 2HDAA 1X43A 1AVZC 2JW4A 3I35A 2KYBA 1YN8A 4F14A 2GTJA 1IO6A 5ECAA 2O9SA 2KEAA 4AG1C 3VS7A 1WA7A 3VRZA 4KRTA 3TSWA 1JO8A 4JJDA 2SEMA 4RTYA 1OPLA 2CT4A 2D1XA 1T3LA 2CH4W 4J9IA 2RQWA 4F17A 2AZVA 1UE9A 1Y0MA 3I5RA 3VS0A 4R0KA 2RN8A 4J9BA 2LJ3A 1NLPC 1K4US 2C0IA 2G6FX 2EPDA 2J6KA 1K76A 2X3XD 2YUNA 1WLPB 1UHCA 1SRMA 4A63B 1SSHA 1T3SA 1HSQA 2EGCA 3QWYA 4OMOA 1X69A 4ESRA 2DNUA 4LE9A 2LX7A 2O31A 2D0NA 4M4ZA 3A98A 1BB9A 2FPEA 1NYGA 2MIOA 1QWFA 1U06A 1YNZA 2DRKA 2EBPA 1GL5A 1NEGA 2D8HA 1PRMC 2JT4A 4CC3A 3RBBB 2LNHB 2DBMA 2KXCA 2EGEA 4CC2A 2CSQA 5IHIA 3KFVA 3H0IA 2P4RA 2JXBA 1T0HA 4Z88A 2CH4A 3ULRB 1ABOA 1FYNA 2HBWA 2FPDA 3CQTA 3GBQA 2GTOA 1UGVA 1M8MA 1VA7A 3IQLA 2DJQA 1KIKA 1Y57A 2RNAA 1U5SA 1X2QA 2GNCA 2BTTA 2LJ0A 4Z89A 1JQQA 4LNPA 2DL3A 2B86A 4HVWA 1SPKA 1WFWA 1WX6A 5GJWB 2YUPA 2MCNA 1GFDA 4OMPA 1NYFA 2EW3A 5HCKA 1OPKA 3EHQA 3VS3A 2HCKA 3UA6A 2M0YA 1AWOA 2J6OA 2CUBA 1X6GA 4X1VA 1KFZA 2CREA 1K0XA 1GBRA 4ORZA 4AFUC 2L3QA 3M0PA 2DYBA 1SHFA 3TVTA 1ZX6A 2PNIA 1WI7A 1G83A 3EHRA 3NHNA 4J9HA 1VYTA 5IXBA 2VWFA 2RQVA 1GCQA 5IHNA 2CUDA 3M0UA 1CKBA 3LH5A 3I5SA 1QKWA 3PVLA 1BU1A 2YUQA 2VKNA 3H0HA 4HVUA 1K1ZA 1GCQC 3VS4A 1ZSGA 5EC7A 1UTIA 5IH2A 3VS1A 4F16A 2F2WA 2W0ZA 1HD3A 4J9GA 4RTTA 2JMCA 1AD5A 2KRNA 1UG1A 4K11A 4WCIA 3TSZA 4EIKA 2DILA 1UDLA 2BZYA 2DE0X 2FRWA 1VYUA 2ENMA 1BBZA 2L3PA 1I0CA 1UUEA 2FPFA 1WYXA 2DL4A 1WIEA 1I1JA 3UATA 4OMMA 2JM8A 2FO0A 1NEBA 2DVJA 1ZUKA 2AKLA 2F2VA 1Z9ZA 2KYMA 5GJVB 1U3OA 2AKKA 1W1FA 2D8JA 1GCPA 1AEYA 4JPBW 1OOTA 2HEQA 2RQRA 1AOJA 2IIMA 4JZ3A 1JXOA 2LP5A 2KNBB 5FWCA 1KSWA 2KR3A 1ABQA 1RLPC 3SEMA 2C0TA 2ED1A 2EYYA 4OMLA 1M27C 2KROA 2I0NA 1QLYA 4HVVA 2AZSA 4OMNA 4J9FA 2DL7A 1M3AA 4RTZA 1T0JA 2JM9A 5L23A 3VRYA 4OMQA 2H8HA 2JMAA 3NMZC 2FG0A 4D8KA 1M3CA 1X27A 4RTWA 1MV0B 2EKHA 1GRIA 1G2BA 1JU5C 3I9QA 4LUEA 2V1RA 1ZLMA 2DRMA 4CC7A 1LCKA 2XMFA 1J3TA 3H41A 2KRMA 1MUZA 3RNJA 1E7OA 4QT7A 1AZGB 2LQNA 2K3BA 4RTUA 1Z9QA 2PTKA 4RUGA 1YCSB 4FSSA 3PVQA 1UHFA 2LZ6B 2YSQA 3M0TA 1V1CA 2DBKA 2J05A 1NM7A 4HCKA 1YP5A 4CC4B 2K79A 1A0NB 3EG0A 2EYZA 3EGUA 2KBTA 3VS2A 1WDXA 4AFZC 3JV3A 2RQUA 1AWXA 2DL5A 2L0AA 2SRCA 1GFCA 2ECZA 1JXMA 2FRYA 1UJYA 1NLOC 2OJ2A 1FMKA 3REAB 1H3HA 3QWXX 4AG2C 2LMJA 2KE9A 2J6FA 1H92A 2DF6A 2MOXA 3THKA 5I22A 2YT6A 1VYVA 4RTXA 4DEXA 2RF0A 2KT8A 5IXFA 4JJCA 1N5ZA 1UFFA 1RI9A 1YWPA 1ZUYA 2GBQA 3ZL7C 2KRSA 2X3WD 2VVKA 2ABLA 4AFQC 2E5KA 3PE0A 2GQIA 1K0SA 2F2XA 2KT1A 3SHWA 4LUDA 2L2PA 3M0SA 4DEYA 2QDLA 2DMOA 3UA7A 1AWWA 2KGTA 2M51A 4RTVA 2YDLA 1AZEA 2RPNA 1RUWA 1SRLA 3R6NA 1MV3A 1ARKA 2K6DA 1HJDA 1SEMA 1RLQC 2C0OA 1CSKA 2DL8A 5FWBA 2PZ1A 1M3BA 1X6BA 1TUCA 4HXJA 2ROTA 1OEBA 2FEIA 4J9CA 1XOVA 2CDTA 4JZ4A 2DA9A 3M0RA 2GGRA 1W6XA 2RMOA 1WXTA 1B07A 2YUOA 1PNJA 2NWMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GBQ A;  2A36 A;  2EYX A;  2ROL A;  3O5Z A;  2K9G A;  3VS6 A;  2EQI A;  3EG2 A;  1X2K A;  2NUZ A;  2DM1 A;  3EG1 A;  2RQT A;  1WXU A;  1NG2 A;  2O2O A;  3U23 A;  2OAW A;  2J06 A;  2O9V A;  3EG3 A;  1QWE A;  5I11 A;  1W70 A;  2CT3 A;  3H0F A;  4D8D A;  1M30 A;  3M0Q A;  1TG0 A;  1TUD A;  2ESW A;  2L3S A;  2LJ1 A;  2LQW A;  4GLM A;  2LCS A;  1UEC A;  1AWJ A;  1ZBJ A;  2DLP A;  1YWO A;  4Y92 A;  1I07 A;  3NPF A;  2DX1 A;  2V1Q A;  5FW9 A;  1PKT A;  4LN2 A;  1QCF A;  2A08 A;  3C0C A;  2BZX A;  4IIM A;  2EYW A;  1SHG A;  3FJ5 A;  1GBQ A;  3VS5 A;  1S1N A;  4ZNX A;  4JJB A;  1E6G A;  5IHK A;  2BZ8 A;  2A37 A;  1ZUU A;  2KXD A;  2ED0 A;  1K9A A;  2EVR A;  1PRL C;  4Z8A A;  1WXB A;  3UF4 A;  1JEG A;  4E6R A;  1H8K A;  2JS0 A;  1PHT A;  1PWT A;  2JTE A;  2CSI A;  2W10 A;  4IIO A;  4AFS C;  1OV3 A;  1EFN A;  4J9E A;  2K2M A;  2EGA A;  1CKA A;  1KJW A;  1PKS A;  2A28 A;  1E6H A;  1B3Q A;  2AK5 A;  2O88 A;  2HSP A;  2OI3 A;  1QKX A;  2J7I A;  1BK2 A;  4J9D A;  2K7A A;  2JS2 A;  3NGP A;  1UJ0 A;  3REB B;  2HDA A;  1X43 A;  1AVZ C;  2JW4 A;  3I35 A;  2KYB A;  1YN8 A;  4F14 A;  2GTJ A;  1IO6 A;  5ECA A;  2O9S A;  2KEA A;  4AG1 C;  3VS7 A;  1WA7 A;  3VRZ A;  4KRT A;  3TSW A;  1JO8 A;  4JJD A;  2SEM A;  4RTY A;  1OPL A;  2CT4 A;  2D1X A;  1T3L A;  2CH4 W;  4J9I A;  2RQW A;  4F17 A;  2AZV A;  1UE9 A;  1Y0M A;  3I5R A;  3VS0 A;  4R0K A;  2RN8 A;  4J9B A;  2LJ3 A;  1NLP C;  1K4U S;  2C0I A;  2G6F X;  2EPD A;  2J6K A;  1K76 A;  2X3X D;  2YUN A;  1WLP B;  1UHC A;  1SRM A;  4A63 B;  1SSH A;  1T3S A;  1HSQ A;  2EGC A;  3QWY A;  4OMO A;  1X69 A;  4ESR A;  2DNU A;  4LE9 A;  2LX7 A;  2O31 A;  2D0N A;  4M4Z A;  3A98 A;  1BB9 A;  2FPE A;  1NYG A;  2MIO A;  1QWF A;  1U06 A;  1YNZ A;  2DRK A;  2EBP A;  1GL5 A;  1NEG A;  2D8H A;  1PRM C;  2JT4 A;  4CC3 A;  3RBB B;  2LNH B;  2DBM A;  2KXC A;  2EGE A;  4CC2 A;  2CSQ A;  5IHI A;  3KFV A;  3H0I A;  2P4R A;  2JXB A;  1T0H A;  4Z88 A;  2CH4 A;  3ULR B;  1ABO A;  1FYN A;  2HBW A;  2FPD A;  3CQT A;  3GBQ A;  2GTO A;  1UGV A;  1M8M A;  1VA7 A;  3IQL A;  2DJQ A;  1KIK A;  1Y57 A;  2RNA A;  1U5S A;  1X2Q A;  2GNC A;  2BTT A;  2LJ0 A;  4Z89 A;  1JQQ A;  4LNP A;  2DL3 A;  2B86 A;  4HVW A;  1SPK A;  1WFW A;  1WX6 A;  5GJW B;  2YUP A;  2MCN A;  1GFD A;  4OMP A;  1NYF A;  2EW3 A;  5HCK A;  1OPK A;  3EHQ A;  3VS3 A;  2HCK A;  3UA6 A;  2M0Y A;  1AWO A;  2J6O A;  2CUB A;  1X6G A;  4X1V A;  1KFZ A;  2CRE A;  1K0X A;  1GBR A;  4ORZ A;  4AFU C;  2L3Q A;  3M0P A;  2DYB A;  1SHF A;  3TVT A;  1ZX6 A;  2PNI A;  1WI7 A;  1G83 A;  3EHR A;  3NHN A;  4J9H A;  1VYT A;  5IXB A;  2VWF A;  2RQV A;  1GCQ A;  5IHN A;  2CUD A;  3M0U A;  1CKB A;  3LH5 A;  3I5S A;  1QKW A;  3PVL A;  1BU1 A;  2YUQ A;  2VKN A;  3H0H A;  4HVU A;  1K1Z A;  1GCQ C;  3VS4 A;  1ZSG A;  5EC7 A;  1UTI A;  5IH2 A;  3VS1 A;  4F16 A;  2F2W A;  2W0Z A;  1HD3 A;  4J9G A;  4RTT A;  2JMC A;  1AD5 A;  2KRN A;  1UG1 A;  4K11 A;  4WCI A;  3TSZ A;  4EIK A;  2DIL A;  1UDL A;  2BZY A;  2DE0 X;  2FRW A;  1VYU A;  2ENM A;  1BBZ A;  2L3P A;  1I0C A;  1UUE A;  2FPF A;  1WYX A;  2DL4 A;  1WIE A;  1I1J A;  3UAT A;  4OMM A;  2JM8 A;  2FO0 A;  1NEB A;  2DVJ A;  1ZUK A;  2AKL A;  2F2V A;  1Z9Z A;  2KYM A;  5GJV B;  1U3O A;  2AKK A;  1W1F A;  2D8J A;  1GCP A;  1AEY A;  4JPB W;  1OOT A;  2HEQ A;  2RQR A;  1AOJ A;  2IIM A;  4JZ3 A;  1JXO A;  2LP5 A;  2KNB B;  5FWC A;  1KSW A;  2KR3 A;  1ABQ A;  1RLP C;  3SEM A;  2C0T A;  2ED1 A;  2EYY A;  4OML A;  1M27 C;  2KRO A;  2I0N A;  1QLY A;  4HVV A;  2AZS A;  4OMN A;  4J9F A;  2DL7 A;  1M3A A;  4RTZ A;  1T0J A;  2JM9 A;  5L23 A;  3VRY A;  4OMQ A;  2H8H A;  2JMA A;  3NMZ C;  2FG0 A;  4D8K A;  1M3C A;  1X27 A;  4RTW A;  1MV0 B;  2EKH A;  1GRI A;  1G2B A;  1JU5 C;  3I9Q A;  4LUE A;  2V1R A;  1ZLM A;  2DRM A;  4CC7 A;  1LCK A;  2XMF A;  1J3T A;  3H41 A;  2KRM A;  1MUZ A;  3RNJ A;  1E7O A;  4QT7 A;  1AZG B;  2LQN A;  2K3B A;  4RTU A;  1Z9Q A;  2PTK A;  4RUG A;  1YCS B;  4FSS A;  3PVQ A;  1UHF A;  2LZ6 B;  2YSQ A;  3M0T A;  1V1C A;  2DBK A;  2J05 A;  1NM7 A;  4HCK A;  1YP5 A;  4CC4 B;  2K79 A;  1A0N B;  3EG0 A;  2EYZ A;  3EGU A;  2KBT A;  3VS2 A;  1WDX A;  4AFZ C;  3JV3 A;  2RQU A;  1AWX A;  2DL5 A;  2L0A A;  2SRC A;  1GFC A;  2ECZ A;  1JXM A;  2FRY A;  1UJY A;  1NLO C;  2OJ2 A;  1FMK A;  3REA B;  1H3H A;  3QWX X;  4AG2 C;  2LMJ A;  2KE9 A;  2J6F A;  1H92 A;  2DF6 A;  2MOX A;  3THK A;  5I22 A;  2YT6 A;  1VYV A;  4RTX A;  4DEX A;  2RF0 A;  2KT8 A;  5IXF A;  4JJC A;  1N5Z A;  1UFF A;  1RI9 A;  1YWP A;  1ZUY A;  2GBQ A;  3ZL7 C;  2KRS A;  2X3W D;  2VVK A;  2ABL A;  4AFQ C;  2E5K A;  3PE0 A;  2GQI A;  1K0S A;  2F2X A;  2KT1 A;  3SHW A;  4LUD A;  2L2P A;  3M0S A;  4DEY A;  2QDL A;  2DMO A;  3UA7 A;  1AWW A;  2KGT A;  2M51 A;  4RTV A;  2YDL A;  1AZE A;  2RPN A;  1RUW A;  1SRL A;  3R6N A;  1MV3 A;  1ARK A;  2K6D A;  1HJD A;  1SEM A;  1RLQ C;  2C0O A;  1CSK A;  2DL8 A;  5FWB A;  2PZ1 A;  1M3B A;  1X6B A;  1TUC A;  4HXJ A;  2ROT A;  1OEB A;  2FEI A;  4J9C A;  1XOV A;  2CDT A;  4JZ4 A;  2DA9 A;  3M0R A;  2GGR A;  1W6X A;  2RMO A;  1WXT A;  1B07 A;  2YUO A;  1PNJ A;  2NWM A; 
#chains in the Genus database with same CATH topology
 3UPU A;  2GFU A;  2A36 A;  5GAN h;  2K9G A;  4C8Q E;  2KK4 A;  3EG1 A;  1NG2 A;  2O2O A;  5KCO A;  3U23 A;  4LDX A;  9ATC B;  1KK7 A;  4RG2 A;  2LX9 A;  2M16 A;  2O4X B;  5GAN 5;  1QWE A;  1VQK A;  2E6N A;  1ZQ1 A;  3H0F A;  3PNW C;  1M30 A;  1KD1 C;  5I2S A;  2ESW A;  2HD0 A;  2OX7 A;  5GAM e;  3OY9 A;  2VGN A;  2DLP A;  1D09 B;  4O6J A;  4Y92 A;  1QVG P;  2M02 A;  1PM3 A;  2RHX A;  5CKB A;  1XTD A;  3EG9 A;  2QEX Q;  4ZNX A;  4QKU A;  3HFN A;  3CPW S;  1NJI R;  3HKS A;  1ZUU A;  2KXD A;  5J26 A;  4DBQ A;  2XU8 A;  1K9A A;  2EVR A;  1PRL C;  2ZPH B;  1VQ5 A;  4FW2 A;  1VQ7 Q;  4M7A C;  1P92 A;  2QQA A;  3AT1 B;  4XTV A;  2E1H A;  1OV3 A;  2NLU A;  4XTZ A;  4MZT A;  2KVQ G;  2A28 A;  4PJJ A;  3CCQ A;  3GNF B;  2OTJ A;  4DBF A;  5DM7 R;  1VQM T;  4M7A E;  2DER A;  2JW4 A;  4RCC A;  2COZ A;  2KYB A;  3SWN C;  4M77 D;  1K8A R;  2X35 A;  4FT4 A;  2KEA A;  4M7A F;  1PG5 B;  3VRZ A;  4FL6 A;  2EYQ A;  4MDW A;  5FRO A;  4PJO E;  1JO8 A;  4C92 A;  1UB4 A;  2SEM A;  4RTY A;  4KGX B;  1M1F A;  2D1X A;  5CKF A;  2RQW A;  5FU7 B;  5FU6 C;  4ELY C;  3HRT A;  2KMT A;  3TRE A;  4J9B A;  3CBO A;  3QG1 A;  1NLP C;  3CD6 Q;  1R0B G;  3MCA B;  2VAS A;  4JLI A;  4OP0 A;  1TUG B;  2HL3 A;  5J39 A;  4M7D A;  2HBP A;  2LX7 A;  2O31 A;  5IT9 E;  3RKX A;  3DB4 A;  1UGQ B;  1TU0 B;  1M2V A;  3A98 A;  4HKE A;  2X51 A;  5GAN j;  3JSC A;  4PJL A;  3RER A;  1YNZ A;  1GL5 A;  4XTX A;  3JCM J;  2EAY A;  2OTL T;  1IGQ A;  1ZSZ A;  1PRM C;  3M55 A;  3OS1 A;  3G7Z A;  4VUB A;  1QP3 A;  3QDF A;  4BUG A;  5IHI A;  3OYE A;  3J81 E;  1B7T A;  3VUZ A;  1RAI B;  1BCO A;  3JCM e;  3OYC A;  1Q86 C;  2V8J A;  1Y96 B;  4MDX A;  3R6O A;  1Q7Y C;  3P8D A;  1N27 A;  5CCA A;  1X6O A;  2PVG B;  2BKD N;  2KY9 A;  1KD1 U;  1KIK A;  3P8H A;  1Y57 A;  1U5S A;  2HMA A;  1JQQ A;  4LNP A;  3JCM b;  4HVW A;  4C92 D;  1JJ2 A;  1SPK A;  1Q81 C;  3BY7 A;  5GJW B;  2RHY A;  4DA4 A;  1M90 C;  4KBM B;  4BY6 B;  3EHQ A;  1KC8 R;  1SSF A;  2E70 A;  1VQP Q;  2JTF A;  1QCN A;  3UA6 A;  5A0L A;  2M0Y A;  1YBY A;  1JRI A;  2J6O A;  1KFZ A;  2ZPB B;  4AFU C;  3M0P A;  3MJX A;  5CIU A;  1KQS P;  4ZGE B;  2HKN A;  4XU2 A;  3JB9 F;  1G83 A;  3EHR A;  4PJN A;  4FYY B;  3FRN A;  2VWF A;  5CQY A;  1GCQ A;  3CME Q;  5IHN A;  4M7D D;  3VYG A;  2CUD A;  4HT9 A;  4HVU A;  1QVP A;  3VS4 A;  4ME7 A;  3CCM T;  5EC7 A;  4PLI A;  5IH2 A;  1VQM A;  4PLL A;  1GXI E;  4XTU A;  4F7U B;  4RTT A;  1ZA2 B;  4K11 A;  1G3T A;  2BZY A;  2P4T A;  3P8B B;  1TSF A;  1N9R A;  3HL8 A;  1WGS A;  2VV5 A;  1BBZ A;  3EFR A;  1KHI A;  4KGZ B;  2YRV A;  3CCU Q;  4F7U G;  1G5V A;  1WYX A;  4M78 D;  1BI0 A;  2DL4 A;  4OMM A;  5LJ3 j;  2D9T A;  1QVF A;  3T9N A;  2AKL A;  4JRI A;  3F70 A;  3RMS A;  3CCV T;  4J6X A;  2EJG A;  4E7L A;  2DIQ A;  5GJV B;  1U3O A;  1AEY A;  3LWI A;  3CC4 T;  3L2V A;  3EG9 B;  1JXO A;  2X4Y A;  1KSW A;  2CZ6 B;  1W2B S;  2G3R A;  3QDR B;  4EMK C;  3RIR A;  2XK0 A;  5HK0 A;  3MP1 A;  1PD1 A;  2AZS A;  4FYW B;  4OMN A;  3PTA A;  1OX8 A;  1M3A A;  4N4G A;  3M58 A;  4IKF A;  1T0J A;  3M9Q A;  3DB3 A;  5L23 A;  2D6F A;  1M4Z A;  3CPF A;  2DO3 A;  3CC7 T;  1Q82 C;  2OTL A;  3EAE A;  2P0Q A;  4LDW A;  1M3C A;  4M77 E;  5GAN g;  3QYG B;  3OB9 A;  2FZC B;  5KYU A;  4LUE A;  3RUX A;  3G4S T;  3SDZ A;  2X4W A;  3H6Z A;  3KXT A;  8ATC B;  1ZLM A;  2ZZD A;  3JAM E;  1FWZ A;  3OMC A;  3JCM h;  2XMF A;  3VV0 A;  3H41 A;  4BI4 A;  3OW2 P;  4QT7 A;  1AZG B;  2K3B A;  1PSF A;  4RTU A;  4RUG A;  2RHZ A;  2CP3 A;  5KYN A;  1VQN T;  1UHF A;  2O4X A;  4M75 C;  1M9S A;  1D1C A;  3M0T A;  2YSQ A;  1YJN T;  3BFM A;  2DBK A;  2CZ7 B;  3UWN A;  2R57 A;  3FDR A;  2K79 A;  3M5A A;  4JLG A;  1WDX A;  2CP2 A;  4XK8 E;  1GFC A;  4N0A A;  3QSU A;  2MMP A;  1UJY A;  2RHU A;  3CBP A;  3DKM A;  4B9W A;  1RAB B;  3MHX A;  5J3B A;  1KD1 R;  4M75 E;  5GAN 2;  3EGX A;  2CS7 A;  3PIO A;  3SWN A;  3OYM A;  4OB0 B;  1VYV A;  2LQK A;  1O9S A;  2RB6 A;  1OI1 A;  2RJC A;  2YXY A;  3CC2 T;  4M75 F;  4PFO A;  2DTI A;  2RF0 A;  5GAO q;  2VC8 A;  1N5Z A;  1UFF A;  2GBQ A;  5CO7 A;  2ABL A;  2K3X A;  4J83 A;  1ZSZ B;  5I2M A;  4LUD A;  1PC0 A;  3CCM A;  2QDL A;  5GAN 8;  1YHQ T;  2M51 A;  4RTV A;  4KUD K;  4A54 A;  1RUW A;  1U8R A;  1VQ6 T;  4CI0 C;  2DL8 A;  1KQS S;  5LJ5 j;  3CPW P;  4QQ6 A;  4HXJ A;  3Q1J A;  4FIB A;  5GAN f;  2DPP B;  3OBW A;  4JZ4 A;  5GAN 6;  1YI2 T;  2GGR A;  1N8R U;  2RMO A;  3CCV A;  3SFM A;  1WXT A;  2DIG A;  2F5K A;  1PNJ A;  2OAW A;  2X3X D;  1IRX A;  2NWM A;  1W4S A;  1NJI U;  2LC4 A;  5LJ3 g;  3AHU A;  3VS6 A;  1X2K A;  3ER0 A;  2DM1 A;  4BE1 A;  1VQ4 T;  1WXU A;  3CC4 A;  4FU6 A;  2PQW A;  3HPW A;  1LJO A;  2J06 A;  4FW1 A;  5I11 A;  2FVU A;  3M0Q A;  1VQL T;  2L3S A;  2LQW A;  1AWJ A;  1ZBJ A;  1BKB A;  3MO8 A;  4XU1 A;  3SD4 A;  3QYH B;  1MNE A;  1H3Z A;  1SF9 A;  1Y71 A;  3CC7 A;  5GAO p;  3FB9 A;  3LW5 E;  3EH2 A;  1Q82 U;  3X25 B;  2NUT A;  1K8A U;  4LDY A;  2LDM A;  2ZCF B;  3J7A F;  5C0M A;  4N4H A;  5IHK A;  1C6V X;  2BZ8 A;  3G4S A;  2A37 A;  4B9X A;  2ED0 A;  4E7Z A;  1UGP B;  3EH1 A;  3HP9 A;  4EMH A;  1H8K A;  2JTE A;  1PWT A;  2W10 A;  3JCM W;  2QI2 A;  4IIO A;  4AFS C;  2E5Q A;  2R5M A;  2RJD A;  2HSE B;  6AT1 B;  3WVD B;  3OBY A;  1VQO Q;  2YLC A;  5C6S A;  2AK5 A;  1VQN A;  1WHJ A;  2MAM A;  2HSP A;  2OI3 A;  3CMA T;  2J7I A;  3VU3 C;  1YJN A;  4J9D A;  2K7A A;  1X43 A;  2RO0 A;  2V26 A;  1Q86 R;  4XU3 A;  3CCR Q;  2A7Y A;  3N5B B;  4F14 A;  5KE3 A;  1IO6 A;  2O9S A;  3A5Z B;  3A8G B;  4AG1 C;  2LTO A;  3TU4 K;  4C0F A;  1FXX A;  3GNG A;  2WSE E;  4C8Q G;  2X4J A;  1YFN A;  2K3Y A;  3JCM c;  2KSS A;  2ZGW A;  4J9I A;  3OW2 S;  5GMK j;  2QYZ A;  3CMA Q;  2AZV A;  4FT2 A;  1Y0M A;  3CC2 A;  1Q81 R;  1IZ6 A;  5CAI A;  3I5R A;  4R0K A;  2LJ3 A;  1WJQ A;  2CYZ B;  2HAX A;  1BI1 A;  2C0I A;  2G6F X;  1F1B B;  1PD0 A;  1RAA B;  1K76 A;  4C8Q C;  3FEO A;  2CP6 A;  4A4F A;  1WLP B;  4LD9 K;  3BW1 A;  3LLR A;  1UHC A;  4OGC A;  1SRM A;  4ANJ A;  5LJ3 e;  1HSQ A;  5GAN d;  3G6E T;  2DVE A;  5KYU B;  2A0F B;  5CQX A;  1YHQ A;  4ESR A;  2RA2 A;  2D0N A;  4M4Z A;  4F7U A;  1VQ6 A;  1OYX A;  4BI8 B;  4J7F A;  4V2S A;  2QQR A;  2MIO A;  3G71 T;  3OS5 A;  3OYD A;  5CKD A;  4EMK A;  2QEX T;  2A3L A;  5HKC A;  1IGU A;  3RBB B;  2LNH B;  4C8Q F;  1YI2 A;  4M7A B;  2DBM A;  2KDS A;  2EGE A;  3G6E Q;  5LJ5 g;  2BIV A;  2V8K A;  4CC2 A;  1KC8 U;  1TWB A;  3H9N A;  1R77 A;  1VQ7 T;  2HQE A;  1HYO A;  5KCH A;  5AT1 B;  2JXB A;  2VYT A;  1T0H A;  4Z88 A;  3ASK A;  2CH4 A;  2XID A;  3S3N A;  1VQ4 A;  4M7A G;  3G71 Q;  3MP8 A;  2XDD A;  3HRS A;  1N8R R;  3EGX B;  1OU9 A;  2QA4 Q;  3SWN B;  4PK4 A;  2RH2 A;  5GAO m;  1VQL A;  2DJQ A;  4AMC A;  4PJO G;  1X2Q A;  1VQ8 Q;  3G1J A;  2NYS A;  5GAN 3;  4PNO A;  1QW1 A;  2HKQ B;  1FMW A;  1D1A A;  2DL3 A;  2B86 A;  3D7S B;  1WX6 A;  3C95 A;  2FL7 A;  1NYF A;  2EW3 A;  2FYK A;  5FU6 B;  1Y7X A;  1AWO A;  4X1V A;  4PJO C;  2CRE A;  1S72 Q;  2EFI A;  3DLM A;  3WXM B;  2R58 A;  3TVT A;  2KI7 A;  2EQM A;  1Q82 R;  2O01 E;  4JDS A;  4RG8 A;  3CD6 T;  5HY6 A;  1W2B P;  1CKB A;  3LH5 A;  3I5S A;  1QKW A;  4UC4 A;  3X20 B;  2QAS A;  4MZP A;  1WNL A;  2DXT A;  2GCX A;  3MEW A;  3X24 B;  3CMA A;  3A8O B;  1UTI A;  3QHS A;  4F16 A;  7AT1 B;  1HD3 A;  1BCM A;  4D6W A;  4PJO F;  1K9M C;  2E41 A;  4WCI A;  3TSZ A;  3MEV A;  3OMG A;  5LJ3 d;  1D1B A;  1VYU A;  1QP2 A;  4QVC A;  4P5N A;  2YLB A;  2JVV A;  2DD4 A;  2L3P A;  2K4Y A;  4DBH A;  1UUE A;  5LJ5 f;  3UAT A;  2HZY A;  4E7H A;  2JM8 A;  2FO0 A;  3KUF A;  1ZUK A;  1Z9Z A;  1RAC B;  1LVK A;  2AKK A;  3CCL Q;  3CXC P;  1W1F A;  1GCP A;  4JPB W;  4Z02 A;  1ZBX A;  2NUT B;  2HEQ A;  2F5T X;  2B8A A;  2IIM A;  1NPP A;  2LP5 A;  3CCE T;  2HQX A;  3OSV A;  3G6E A;  3PMI A;  2KNB B;  5FWC A;  2COW A;  1ABQ A;  4KUL A;  3SEM A;  2C0T A;  2EQJ A;  1XNI A;  3L1A A;  3TEE A;  4R55 A;  1JJ2 S;  3L2Q A;  1QLY A;  1K73 C;  4HVV A;  2LCC A;  3JB9 G;  4J9F A;  4ZN3 A;  1MMA A;  1G3S A;  4RTZ A;  4E47 A;  3G71 A;  3L2W A;  4OMQ A;  1LNX A;  1YJ9 Q;  2LCL A;  2QEX A;  1D0Z A;  1RI0 A;  2XIC A;  1VQP T;  3JCM f;  1X27 A;  3CCE Q;  3JRZ A;  4LD6 A;  1GRI A;  1OU8 A;  3I9Q A;  1D0Y A;  5GAM h;  4ATO A;  1VQ7 A;  4OMF B;  4C0D C;  5KYW B;  2DRM A;  3LX7 A;  3CME T;  4YTL A;  2Z0W A;  1WHH A;  3TCJ A;  1Z9Q A;  4FSS A;  3QJY A;  2XG8 D;  3CBM A;  2LZ6 B;  2M9U A;  3LH0 A;  1NM7 A;  1RAG B;  5FRN A;  1UEB A;  1N9S A;  3EG0 A;  2EYZ A;  3VS2 A;  4PJM A;  5IAY A;  2QQS A;  2SRC A;  1NPR A;  2FRY A;  4X9C A;  2OJ2 A;  3CCU T;  1NBE B;  3ZFJ A;  2JNG A;  1RAE B;  1H3H A;  1M2O A;  3X26 B;  4AG2 C;  4L5G A;  2J6F A;  3E19 A;  2DF6 A;  2MOX A;  1OX9 A;  3QII A;  3THK A;  2YT6 A;  1NZ9 A;  2QK0 A;  5IXF A;  2ZPI B;  2DXB A;  4JJC A;  3CD6 A;  3MEU A;  2JTM A;  2X3W D;  2VVK A;  2VGM A;  4AFQ C;  4EMK B;  2JZ2 A;  1YIJ Q;  2F2X A;  3I55 Q;  3SHW A;  3S3O A;  2L2P A;  3M57 A;  4JS4 A;  5GMK e;  4IUT A;  5LJ5 d;  2OAU A;  2DXC A;  2XI9 A;  4M77 G;  1K9M U;  2YDL A;  1YIT Q;  4C5H A;  3V8K A;  1VOM A;  2MI6 A;  1JBM A;  1MV3 A;  4C8Q A;  1ARK A;  2K6D A;  2FZK B;  4C5E A;  1HJD A;  1SEM A;  1RLQ C;  5CVI A;  2PZ1 A;  2BE7 D;  1M3B A;  2RK1 A;  4RCB A;  4LDU A;  2QGG A;  3OYL A;  1XOV A;  2CDT A;  3C94 A;  4L6V 5;  3MKD A;  4M77 C;  3M4G A;  2EWN A;  2Y4X A;  1QVG A;  3QXE B;  4BDY A;  4GBQ A;  4E7K A;  1WJR A;  2EYX A;  2EQI A;  3EG2 A;  2NUZ A;  3RKY A;  3PMT A;  4M75 B;  1OZ3 A;  2DEU A;  1X75 C;  4FCY A;  3CCE A;  2O9V A;  3OYG A;  4ZTJ A;  4D8D A;  3CCJ Q;  1TUD A;  2LJ1 A;  4GLM A;  4M75 G;  1K73 U;  2VUB A;  1MMN A;  4M77 F;  1UEC A;  5M9O A;  2RD1 A;  3UDC A;  1RAD B;  5D7U A;  3NPF A;  4BE2 A;  5FW9 A;  2V1Q A;  1IB8 A;  1Q86 U;  1V76 A;  2DD5 A;  1QCF A;  2EJF A;  3UT1 A;  4IIM A;  1Q7Y U;  1VQP A;  1SHG A;  3FJ5 A;  1YJW Q;  1GBQ A;  3CXC S;  1S1N A;  3NTH A;  4KH0 B;  4C0G A;  2C06 A;  4M7A A;  3GP8 A;  1W2B A;  4Z8A A;  1WXB A;  4IUQ A;  3H8Z A;  3FC3 A;  4E6R A;  2JS0 A;  1KQ2 A;  2CSI A;  3CME A;  1Q81 U;  1EFN A;  2EKO A;  4J9E A;  1U1T A;  4PJO A;  1M90 U;  1PKS A;  1E6H A;  1Y07 A;  4A4G A;  5GAO n;  4HCZ A;  1QKX A;  4NOY A;  1AHJ B;  4GY5 A;  1BK2 A;  2V8I A;  2E12 A;  1UJ0 A;  3NGP A;  3ZBD A;  2HDA A;  1AVZ C;  2MWO A;  4IUR A;  3QO3 A;  1VQ9 Q;  1YN8 A;  3SB2 A;  2DAQ A;  1G8X A;  1OUL A;  3CCU A;  1VUB A;  1B34 A;  4KRT A;  3C4S A;  4ZTF A;  4JJD A;  2CT4 A;  2YRC A;  1T3L A;  2CH4 W;  3M59 A;  2DK3 A;  4C92 C;  4F17 A;  1WHM A;  2JN0 A;  3V8L A;  4JRK A;  4C0Z A;  4DOW A;  3V7S A;  5KYX B;  1R8O B;  2EPD A;  2J6K A;  4A63 B;  4E7J A;  1SSH A;  1T3S A;  2L8D A;  4C92 E;  2EGC A;  3QWY A;  3M54 A;  4OMO A;  5D6Y A;  5KYY A;  2DNU A;  1XQH A;  4OVA A;  4M7D C;  4C92 F;  2JJ9 A;  1BB9 A;  2FPE A;  5GAN e;  4A53 A;  1NYG A;  3LGL A;  5FLX E;  2CZ0 B;  4M78 G;  1NEG A;  3I56 Q;  4M7A D;  2D8H A;  2KAF A;  1IRE B;  4CC3 A;  1K9M R;  2PUK B;  2CSQ A;  1JB0 E;  3FLG A;  3KFV A;  4M7D E;  4ELZ C;  3CCS Q;  3JCM P;  2WAC A;  3HSB A;  3H0I A;  1TOV A;  2F69 A;  2ZPE B;  2WSF E;  4M78 C;  4M7D F;  1ABO A;  3OYA A;  2HBW A;  3GBQ A;  2GTO A;  1VQO T;  2GF7 A;  2E4H A;  1KQS A;  1I4K 1;  4QQD A;  4ZGJ B;  3LWH A;  2E3H A;  3HTR A;  1FMV A;  1VQK Q;  2ATC B;  2RNA A;  2BTT A;  2CGH A;  3CCR T;  2LJ0 A;  4LDV A;  4M78 E;  3M53 A;  1WFW A;  2YUP A;  2ZPF B;  4OMP A;  3OS0 A;  5HCK A;  4M78 F;  4TVR A;  2HCK A;  1WHK A;  2LRQ A;  2CUB A;  1K73 R;  1K0X A;  1GBR A;  4ORZ A;  1U1S A;  2AIR B;  3EGD A;  3BDL A;  1PCX A;  4C8Q B;  2PNI A;  3ZEH A;  3NHN A;  4J9H A;  1VQ5 Q;  1M8V A;  5KYW A;  4PKC C;  2QDY B;  1Q7Y R;  2YRD A;  2K57 A;  1BU1 A;  2YUQ A;  2VKN A;  1JJ2 P;  4Q5W A;  1K1Z A;  1GCQ C;  1ZSG A;  5CK9 A;  2DJZ A;  4XTY A;  5D6X A;  3VS1 A;  2F2W A;  3LGF A;  4J9G A;  2NUP B;  2KRN A;  4EIK A;  2DIL A;  1UDL A;  4OB1 B;  2DZ9 A;  2BUD A;  1M90 R;  2RM4 A;  2XKO C;  2ENM A;  3L42 A;  5GAN 4;  4EMG A;  1MND A;  4C5G A;  4DQ2 A;  3S6W A;  3PIP A;  2L3R A;  1WQW A;  2FB7 A;  3CEY A;  4GLK A;  1WIE A;  2K2V A;  3OYF A;  2XHC A;  2EQK A;  4KGV B;  2DET A;  1BI2 A;  2GFA A;  3JCM X;  1OOT A;  3J80 E;  4O5V A;  4JZ3 A;  4M77 A;  3RKW A;  5I21 A;  2QA4 T;  1BIA A;  2L89 A;  2Y90 A;  2KR3 A;  3JCM Q;  2ED1 A;  1WHG A;  2EYY A;  4OML A;  4PFP A;  2KRO A;  1VQ8 T;  2LNV A;  1G3Y A;  3OW2 A;  4B6M A;  4ZN1 A;  1QVF P;  2JM9 A;  1KQ1 A;  3VRY A;  1BI3 A;  4DBR A;  4PJO B;  5GAM f;  3RR6 A;  2H8H A;  1I8F A;  3VUB A;  2CP7 A;  1S72 T;  4C5I A;  1WJS A;  1VIE A;  1G2B A;  1JU5 C;  2P84 A;  4CRI A;  1IXD A;  2GQV A;  2E65 A;  4CC7 A;  4BDZ A;  1RAF B;  1J3T A;  1MUZ A;  1QCO A;  1B34 B;  1VQO A;  2MF2 A;  4M75 A;  5FU7 C;  1E7O A;  2IPO B;  4HCC A;  2QXF A;  2ZAE A;  4IUV A;  3PVQ A;  2YHT A;  3JCM g;  1M5Q 1;  1XJW B;  3V7C A;  1V1C A;  2J05 A;  2PVO B;  3CCR A;  1YP5 A;  4CC4 B;  1I81 A;  4OB2 B;  3BE3 A;  2CKK A;  4AFZ C;  2RQU A;  2DL5 A;  2L0A A;  2XD0 A;  5FRM A;  1WQ7 A;  1NLO C;  2DEQ A;  2MPX C;  1FMK A;  1NE8 A;  2RJE A;  3REA B;  4N0A C;  2EIF A;  2KE9 A;  1M1K C;  5KYY B;  5I22 A;  4XQ3 A;  4WF2 A;  4RTX A;  3OYH A;  3CPW A;  1R0C B;  2KT8 A;  3INZ A;  4JJN K;  3CCL T;  1N6A A;  1EZZ B;  1DJ7 B;  1RI9 A;  1YWP A;  5GMK i;  2KRS A;  3PE0 A;  2I2L A;  2QAZ A;  1K0S A;  3M0S A;  4DEY A;  3UA7 A;  2EJ9 A;  2KGT A;  5GMK l;  3NTI A;  3VKI A;  3GIB A;  4BE0 A;  1VQM Q;  1RAH B;  1ACM B;  2LQ8 A;  2RI3 A;  2P0P A;  2C0O A;  2CZ1 B;  1CSK A;  5KE2 A;  2X4X A;  5FWB A;  5LJ5 e;  1YJ9 T;  2H3E B;  1TUC A;  2ROT A;  2JUF A;  1EIF A;  5LJ3 h;  4C0D B;  3LYI A;  1W6X A;  2HNI A;  4JUV A;  4L59 A;  1B07 A;  4FYX B;  2QQB A;  1SG5 A;  2DXU A;  4M75 D;  2ROL A;  3O5Z A;  4OB3 B;  3EFO B;  4EDU A;  2RQT A;  1Q95 G;  5GAM d;  1SKU B;  5KYX A;  5DY9 A;  2QA4 A;  3EG3 A;  2K5I A;  4II1 A;  1W70 A;  2CT3 A;  1TG0 A;  2EQU A;  4E7I A;  1VQ8 A;  1G3W A;  4E7S A;  3EGD B;  2E10 A;  4M78 A;  2LCS A;  3OSS C;  4A4H A;  1YWO A;  2PUO B;  1I07 A;  2DX1 A;  1PKT A;  4LN2 A;  1TXQ A;  4MML A;  4FSX A;  2A08 A;  3C0C A;  2BZX A;  2EYW A;  2OTL Q;  1KG1 A;  3GLX A;  3VS5 A;  4JJB A;  5GMK m;  1E6G A;  3RMQ A;  1QQJ A;  1S72 A;  2HQH A;  1M1G A;  3E1S A;  1I5L A;  3UF4 A;  3QJ6 A;  4HT8 A;  3QPH A;  1JEG A;  1PHT A;  3RES A;  2K2M A;  3MET A;  3PT9 A;  2EGA A;  1CKA A;  1KJW A;  2DTO A;  1YIJ T;  3I55 T;  2MK5 A;  3ME9 A;  1B3Q A;  3FIF A;  5LL6 S;  3URG A;  5IN1 A;  2O88 A;  1QVF S;  1V29 B;  1MMG A;  2K5F A;  2F1L A;  5CKE A;  4A4K A;  3M4Y A;  1BYM A;  4PFZ A;  2JS2 A;  1YIT T;  5CKH A;  3A8H B;  3REB B;  3FJP A;  3I35 A;  5KH6 A;  2GTJ A;  5ECA A;  3A8L B;  3VS7 A;  4F04 B;  2QTV A;  1WA7 A;  4M77 B;  4IUU A;  3TSW A;  2AHJ B;  1WZO A;  3OYK A;  1QVG S;  1IHV A;  1M1K U;  1OPL A;  2MWP A;  4NL3 A;  2RHI A;  3OYB A;  2FZG B;  2QG9 B;  3C12 A;  3OQ5 A;  4JS5 A;  1UE9 A;  1X01 A;  4BY6 C;  1MMD A;  3GPL A;  2QTX A;  3CCL A;  3VS0 A;  3GOX A;  2RN8 A;  1O75 A;  2DKG A;  1MGQ A;  1K4U S;  4R56 A;  2QQ9 A;  2YUN A;  3HFO A;  2DFU A;  3CCM Q;  4WTO B;  3KBG A;  1N8R C;  3CCJ T;  2JOY A;  1X69 A;  4J5Y A;  4LE9 A;  1C1A A;  4X9D A;  3OYY A;  3V8J A;  2LT1 A;  3VJP A;  2NUP A;  1NJI C;  2VXE A;  5LJ5 h;  1YJ9 A;  3QUI A;  1QWF A;  1U06 A;  3QZ9 B;  2DRK A;  2EBP A;  4Y91 A;  1YJW T;  3QZ5 B;  2JT4 A;  1ZHI A;  2KXC A;  3JCM d;  1D3B A;  3E9G A;  3CCV Q;  2RJF A;  5GAN 7;  4HA8 A;  2BE9 B;  2P4R A;  5GAM j;  4F7U E;  3ULR B;  1HXD A;  1FYN A;  4N4I A;  3OYJ A;  4Y28 E;  2FPD A;  1KHC A;  3CQT A;  3CC4 Q;  1K8A C;  3MPU B;  3BDU A;  4BI3 A;  4F7U F;  1UGV A;  2DYI A;  1M8M A;  1TH7 A;  1VA7 A;  3IQL A;  3WVE B;  5DLO A;  2GNC A;  1VIF A;  2E6Z A;  3L2Z A;  4DOV A;  4BD3 A;  4Z89 A;  1VQ9 T;  2RK2 A;  3MP6 A;  1LOJ A;  1OQK A;  2PVD B;  1UGS B;  2MCN A;  1GFD A;  3CC7 Q;  4J7I A;  4C92 B;  2M0O A;  1OPK A;  3VS3 A;  1AT1 B;  1QMC A;  2K5L A;  1TS9 A;  4ZGD B;  2CP5 A;  1X6G A;  2CP0 A;  1RL2 A;  4C8Q D;  1I5O B;  2L3Q A;  8AT1 B;  2DYB A;  1SHF A;  3G4S Q;  3TQ7 P;  1ZX6 A;  2RI2 A;  4C92 G;  4RMO A;  3JB9 I;  1WI7 A;  1VYT A;  5HK3 A;  5IXB A;  4QQG A;  4BB7 A;  2RQV A;  3JB9 H;  2R5A A;  3M0U A;  3DLL A;  1YIJ A;  3I55 A;  2QGF B;  3PVL A;  4LXC A;  3H0H A;  4JRQ A;  4KH1 B;  4M7D B;  3M56 A;  1VQN Q;  1ZA1 B;  3CXC A;  2W0Z A;  3JCM V;  1YIT A;  1YJN Q;  1M2V B;  2JMC A;  4A4E A;  1AD5 A;  1UG1 A;  2DE0 X;  2FRW A;  3X28 B;  4M7D G;  3MEA A;  2LVM A;  4KUI A;  3I56 T;  3QKJ A;  2D0Q B;  1I0C A;  2FPF A;  3OA6 A;  1I1J A;  1YCY A;  5GMK h;  2DTH A;  2COY A;  1NEB A;  2DVJ A;  2XDB A;  2KQW A;  3VYH B;  4M78 B;  3A1P A;  4JRP A;  2X9H A;  3PFS A;  2F2V A;  5EG2 A;  3CCS T;  3CC2 Q;  2HL5 C;  2KYM A;  1C0M A;  4FM4 B;  4HCB A;  2H3J A;  2RI5 A;  3GF5 A;  2D8J A;  5GAO r;  3HHT B;  4XTW A;  2E64 A;  2RQR A;  1M1K R;  1AOJ A;  1FX7 A;  5AYF A;  3OYN A;  4EPC A;  1RLP C;  3CCJ A;  1VQK T;  4J6Y A;  3OYI A;  1KC8 C;  1M27 C;  1YHQ Q;  4RKU E;  1ZSZ C;  2I0N A;  4J8O A;  2E3I A;  4XU0 A;  4PJO D;  1BIB A;  2DL7 A;  2M1H A;  1VQ6 Q;  2JMA A;  3NMZ C;  2FG0 A;  1YJW A;  1LPL A;  5DLQ E;  4QVD A;  4D8K A;  2VB6 A;  2WSC E;  4MZM A;  4RTW A;  1MV0 B;  2EKH A;  3QBY A;  1YI2 Q;  3HRU A;  4FYV B;  4MMK A;  2V1R A;  3S3M A;  1VQ5 T;  5L8R E;  1LCK A;  2KRM A;  2FHD A;  5D6W A;  2AT1 B;  1VQ4 Q;  3RNJ A;  1WHL A;  3EFO A;  3JB9 J;  5A0G A;  2LQN A;  5GAM g;  2PTK A;  1YCS B;  2P0K A;  3CCQ T;  3L2U A;  3O8V A;  4XAX B;  4J6W A;  4QW2 A;  2OTJ T;  1VQL Q;  1WPY A;  2YWW A;  4HCK A;  1A0N B;  3EGU A;  1EX4 A;  1VQ9 A;  2KBT A;  1PSE A;  2VXF A;  3JV3 A;  1AWX A;  2ECZ A;  1JXM A;  2LT4 A;  4BAC A;  4PL6 A;  1Y96 A;  1MHN A;  1UGR B;  4NL2 A;  1H64 1;  3QWX X;  1TTH B;  2LMJ A;  3CCQ Q;  2IVW A;  1H92 A;  3NTK A;  4IUP A;  2DZC A;  2OTJ Q;  3RDV A;  3E2U A;  4DEX A;  4E2F B;  2Y4Y A;  4QVZ A;  2L5Q A;  2XDP A;  1ZUY A;  3ZL7 C;  1IHW A;  2E5K A;  3EFS A;  5A0D A;  2GQI A;  1HK9 A;  2KT1 A;  3OS2 A;  1D3B B;  2DMO A;  1AWW A;  1OZ2 A;  1D0X A;  5GAO l;  5CR2 A;  5LJ3 f;  3L2R A;  1AZE A;  2RPN A;  1SRL A;  4OF1 A;  3R6N A;  3JB9 D;  3I56 A;  1X6B A;  3A8M B;  1OEB A;  2FEI A;  2IG0 A;  4J9C A;  4AT1 B;  4NS5 A;  2ZPG B;  2DA9 A;  2PU9 B;  4X34 A;  3PGG A;  3M0R A;  3V7R A;  2MYS A;  3CCS A;  2YUO A;  3NFC A;  5A2Q E;  4OGE A;  3E9F A;  4KT0 E; 
#chains in the Genus database with same CATH homology
 4GBQ A;  2A36 A;  2EYX A;  2ROL A;  3O5Z A;  2K9G A;  3VS6 A;  2EQI A;  3EG2 A;  1X2K A;  2NUZ A;  2DM1 A;  3EG1 A;  2RQT A;  1WXU A;  1NG2 A;  2O2O A;  3U23 A;  2OAW A;  2J06 A;  2O9V A;  3EG3 A;  1QWE A;  5I11 A;  1W70 A;  2CT3 A;  3H0F A;  4D8D A;  1M30 A;  3M0Q A;  1TG0 A;  1TUD A;  2ESW A;  2L3S A;  2LJ1 A;  2LQW A;  4GLM A;  2LCS A;  1UEC A;  1AWJ A;  1ZBJ A;  2DLP A;  1YWO A;  4Y92 A;  1I07 A;  3NPF A;  2DX1 A;  2V1Q A;  5FW9 A;  1PKT A;  4LN2 A;  1QCF A;  2A08 A;  3C0C A;  2BZX A;  4IIM A;  2EYW A;  1SHG A;  3FJ5 A;  1GBQ A;  3VS5 A;  1S1N A;  4ZNX A;  4JJB A;  1E6G A;  5IHK A;  2BZ8 A;  2A37 A;  1ZUU A;  2KXD A;  2ED0 A;  1K9A A;  2EVR A;  1PRL C;  4Z8A A;  1WXB A;  3UF4 A;  1JEG A;  4E6R A;  1H8K A;  2JS0 A;  1PHT A;  1PWT A;  2JTE A;  2CSI A;  2W10 A;  4IIO A;  4AFS C;  1OV3 A;  1EFN A;  4J9E A;  2K2M A;  2EGA A;  1CKA A;  1KJW A;  1PKS A;  2A28 A;  1E6H A;  1B3Q A;  2AK5 A;  2O88 A;  2HSP A;  2OI3 A;  1QKX A;  2J7I A;  1BK2 A;  4J9D A;  2K7A A;  2JS2 A;  3NGP A;  1UJ0 A;  3REB B;  2HDA A;  1X43 A;  1AVZ C;  2JW4 A;  3I35 A;  2KYB A;  1YN8 A;  4F14 A;  2GTJ A;  1IO6 A;  5ECA A;  2O9S A;  2KEA A;  4AG1 C;  3VS7 A;  1WA7 A;  3VRZ A;  4KRT A;  3TSW A;  1JO8 A;  4JJD A;  2SEM A;  4RTY A;  1OPL A;  2CT4 A;  2D1X A;  1T3L A;  2CH4 W;  4J9I A;  2RQW A;  4F17 A;  2AZV A;  1UE9 A;  1Y0M A;  3I5R A;  3VS0 A;  4R0K A;  2RN8 A;  4J9B A;  2LJ3 A;  1NLP C;  1K4U S;  2C0I A;  2G6F X;  2EPD A;  2J6K A;  1K76 A;  2X3X D;  2YUN A;  1WLP B;  1UHC A;  1SRM A;  4A63 B;  1SSH A;  1T3S A;  1HSQ A;  2EGC A;  3QWY A;  4OMO A;  1X69 A;  4ESR A;  2DNU A;  4LE9 A;  2LX7 A;  2O31 A;  2D0N A;  4M4Z A;  3A98 A;  1BB9 A;  2FPE A;  1NYG A;  2MIO A;  1QWF A;  1U06 A;  1YNZ A;  2DRK A;  2EBP A;  1GL5 A;  1NEG A;  2D8H A;  1PRM C;  2JT4 A;  4CC3 A;  3RBB B;  2LNH B;  2DBM A;  2KXC A;  2EGE A;  4CC2 A;  2CSQ A;  5IHI A;  3KFV A;  3H0I A;  2P4R A;  2JXB A;  1T0H A;  4Z88 A;  2CH4 A;  3ULR B;  1ABO A;  1FYN A;  2HBW A;  2FPD A;  3CQT A;  3GBQ A;  2GTO A;  1UGV A;  1M8M A;  1VA7 A;  3IQL A;  2DJQ A;  1KIK A;  1Y57 A;  2RNA A;  1U5S A;  1X2Q A;  2GNC A;  2BTT A;  2LJ0 A;  4Z89 A;  1JQQ A;  4LNP A;  2DL3 A;  2B86 A;  4HVW A;  1SPK A;  1WFW A;  1WX6 A;  5GJW B;  2YUP A;  2MCN A;  1GFD A;  4OMP A;  1NYF A;  2EW3 A;  5HCK A;  1OPK A;  3EHQ A;  3VS3 A;  2HCK A;  3UA6 A;  2M0Y A;  1AWO A;  2J6O A;  2CUB A;  1X6G A;  4X1V A;  1KFZ A;  2CRE A;  1K0X A;  1GBR A;  4ORZ A;  4AFU C;  2L3Q A;  3M0P A;  2DYB A;  1SHF A;  3TVT A;  1ZX6 A;  2PNI A;  1WI7 A;  1G83 A;  3EHR A;  3NHN A;  4J9H A;  1VYT A;  5IXB A;  2VWF A;  2RQV A;  1GCQ A;  5IHN A;  2CUD A;  3M0U A;  1CKB A;  3LH5 A;  3I5S A;  1QKW A;  3PVL A;  1BU1 A;  2YUQ A;  2VKN A;  3H0H A;  4HVU A;  1K1Z A;  1GCQ C;  3VS4 A;  1ZSG A;  5EC7 A;  1UTI A;  5IH2 A;  3VS1 A;  4F16 A;  2F2W A;  2W0Z A;  1HD3 A;  4J9G A;  4RTT A;  2JMC A;  1AD5 A;  2KRN A;  1UG1 A;  4K11 A;  4WCI A;  3TSZ A;  4EIK A;  2DIL A;  1UDL A;  2BZY A;  2DE0 X;  2FRW A;  1VYU A;  2ENM A;  1BBZ A;  2L3P A;  1I0C A;  1UUE A;  2FPF A;  1WYX A;  2DL4 A;  1WIE A;  1I1J A;  3UAT A;  4OMM A;  2JM8 A;  2FO0 A;  1NEB A;  2DVJ A;  1ZUK A;  2AKL A;  2F2V A;  1Z9Z A;  2KYM A;  5GJV B;  1U3O A;  2AKK A;  1W1F A;  2D8J A;  1GCP A;  1AEY A;  4JPB W;  1OOT A;  2HEQ A;  2RQR A;  1AOJ A;  2IIM A;  4JZ3 A;  1JXO A;  2LP5 A;  2KNB B;  5FWC A;  1KSW A;  2KR3 A;  1ABQ A;  1RLP C;  3SEM A;  2C0T A;  2ED1 A;  2EYY A;  4OML A;  1M27 C;  2KRO A;  2I0N A;  1QLY A;  4HVV A;  2AZS A;  4OMN A;  4J9F A;  2DL7 A;  1M3A A;  4RTZ A;  1T0J A;  2JM9 A;  5L23 A;  3VRY A;  4OMQ A;  2H8H A;  2JMA A;  3NMZ C;  2FG0 A;  4D8K A;  1M3C A;  1X27 A;  4RTW A;  1MV0 B;  2EKH A;  1GRI A;  1G2B A;  1JU5 C;  3I9Q A;  4LUE A;  2V1R A;  1ZLM A;  2DRM A;  4CC7 A;  1LCK A;  2XMF A;  1J3T A;  3H41 A;  2KRM A;  1MUZ A;  3RNJ A;  1E7O A;  4QT7 A;  1AZG B;  2LQN A;  2K3B A;  4RTU A;  1Z9Q A;  2PTK A;  4RUG A;  1YCS B;  4FSS A;  3PVQ A;  1UHF A;  2LZ6 B;  2YSQ A;  3M0T A;  1V1C A;  2DBK A;  2J05 A;  1NM7 A;  4HCK A;  1YP5 A;  4CC4 B;  2K79 A;  1A0N B;  3EG0 A;  2EYZ A;  3EGU A;  2KBT A;  3VS2 A;  1WDX A;  4AFZ C;  3JV3 A;  2RQU A;  1AWX A;  2DL5 A;  2L0A A;  2SRC A;  1GFC A;  2ECZ A;  1JXM A;  2FRY A;  1UJY A;  1NLO C;  2OJ2 A;  1FMK A;  3REA B;  1H3H A;  3QWX X;  4AG2 C;  2LMJ A;  2KE9 A;  2J6F A;  1H92 A;  2DF6 A;  2MOX A;  3THK A;  5I22 A;  2YT6 A;  1VYV A;  4RTX A;  4DEX A;  2RF0 A;  2KT8 A;  5IXF A;  4JJC A;  1N5Z A;  1UFF A;  1RI9 A;  1YWP A;  1ZUY A;  2GBQ A;  3ZL7 C;  2KRS A;  2X3W D;  2VVK A;  2ABL A;  4AFQ C;  2E5K A;  3PE0 A;  2GQI A;  1K0S A;  2F2X A;  2KT1 A;  3SHW A;  4LUD A;  2L2P A;  3M0S A;  4DEY A;  2QDL A;  2DMO A;  3UA7 A;  1AWW A;  2KGT A;  2M51 A;  4RTV A;  2YDL A;  1AZE A;  2RPN A;  1RUW A;  1SRL A;  3R6N A;  1MV3 A;  1ARK A;  2K6D A;  1HJD A;  1SEM A;  1RLQ C;  2C0O A;  1CSK A;  2DL8 A;  5FWB A;  2PZ1 A;  1M3B A;  1X6B A;  1TUC A;  4HXJ A;  2ROT A;  1OEB A;  2FEI A;  4J9C A;  1XOV A;  2CDT A;  4JZ4 A;  2DA9 A;  3M0R A;  2GGR A;  1W6X A;  2RMO A;  1WXT A;  1B07 A;  2YUO A;  1PNJ A;  2NWM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...