4IIMA

Crystal structure of the second sh3 domain of itsn1 bound with a synthetic peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
57
structure length
57
Chain Sequence
LLQAQALYPWRAKKDNHLNFNKNDVITVLEQQDMWWFGEVQGQKGWFPKSYVKLISA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Endocytosis
molecule keywords Intersectin-1
publication title Crystal structure of the Second SH3 Domain of ITSN1 bound with a synthetic peptide
rcsb
source organism Homo sapiens
total genus 13
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4iimA00
1ZX6A 2ROTA 2CDTA 2EPDA 1UHCA 3VS2A 2KYBA 1NLPC 2FRYA 1B07A 1E6HA 2CH4W 4J9GA 2ED1A 2DLPA 1BB9A 2MCNA 2M51A 3GBQA 3VS1A 2G6FX 4J9BA 1X2KA 1KJWA 1CKBA 3M0RA 4RTYA 3VS7A 2EBPA 4RTXA 1YWOA 2GGRA 5EC7A 2V1RA 1W6XA 1T3LA 2C0OA 1VYTA 2DL8A 2X3XD 4J9DA 5ECAA 1T0HA 3I5SA 1VYUA 5IHKA 2A36A 1ZBJA 2RPNA 2RNAA 2KRMA 2BZ8A 1B3QA 3CQTA 2KROA 4RTWA 2KRNA 4JJBA 2DL4A 2L2PA 4AG1C 2EYXA 2JW4A 2W10A 2FRWA 5FW9A 2C0TA 1NG2A 2K7AA 2LP5A 2DBKA 1UHFA 2ECZA 2YUQA 2HBWA 1H92A 2DF6A 2D1XA 5IXFA 2IIMA 3VS3A 1FMKA 1I0CA 4QT7A 2KGTA 2SRCA 2GQIA 4JZ3A 4JJCA 2YSQA 4Y92A 3REAB 1UECA 1VYVA 2K3BA 4IIOA 1K4US 2L3SA 2J06A 4JPBW 3EG1A 4AFSC 2KEAA 2CSIA 2ED0A 2P4RA 1NEGA 2CUBA 2FEIA 4Z88A 1UFFA 1AWOA 1TG0A 1J3TA 2RQUA 2LZ6B 1T3SA 1ARKA 4CC7A 1ZUKA 5FWBA 4JZ4A 1X2QA 3UA6A 1I1JA 4JJDA 1BU1A 2FG0A 4OMQA 3TVTA 1T0JA 2KT1A 4OMOA 5FWCA 2XMFA 1AWXA 2C0IA 3VS6A 2LCSA 2BZXA 1S1NA 1FYNA 2DL3A 2EYYA 2F2XA 2W0ZA 2EGAA 1QWEA 2FPFA 1WXTA 2GNCA 2KXDA 1JU5C 2LQNA 2HEQA 2A28A 2LJ0A 1SSHA 2FPEA 1OPLA 1PKTA 2K2MA 1WLPB 2JXBA 2V1QA 4OMMA 2CH4A 2JTEA 1RLPC 4OMLA 2EQIA 3H41A 1CSKA 1SHGA 4RUGA 2DRMA 1UJYA 1RUWA 5IHIA 3VRZA 1TUCA 2RF0A 4HXJA 2AKLA 1JXOA 1AZGB 1Z9QA 2HCKA 1ZUUA 1SRMA 1NLOC 1WXUA 3H0IA 3U23A 4J9CA 2DVJA 2A37A 1GCQA 2ESWA 1X69A 4LUEA 1WA7A 1BBZA 2DYBA 3O5ZA 3ULRB 4K11A 3VS0A 5IH2A 2DJQA 1WIEA 2QDLA 3UATA 1CKAA 1MUZA 1EFNA 4Z89A 2MOXA 1AEYA 2LNHB 1ABOA 4GBQA 1YNZA 1I07A 3QWXX 4A63B 1SRLA 3A98A 2CUDA 4LUDA 2CREA 1BK2A 2LMJA 1A0NB 2YT6A 4RTZA 1MV0B 1X6GA 1NYGA 2CT4A 1V1CA 1OPKA 4KRTA 2D0NA 1HD3A 1GRIA 1QWFA 2H8HA 2OAWA 3I35A 1G83A 1QKWA 1U3OA 4EIKA 2O31A 4M4ZA 2VKNA 2YUOA 4WCIA 1YWPA 2GTOA 1K1ZA 3UF4A 2J6OA 2NUZA 3PVQA 1X27A 1WFWA 3LH5A 4D8DA 2O9VA 1OOTA 3KFVA 5I22A 2KBTA 4HVVA 4DEXA 1AOJA 1OEBA 2O9SA 5HCKA 2K6DA 2VWFA 4AFQC 1PRMC 2JM8A 1VA7A 3M0QA 2PZ1A 1MV3A 2FPDA 1UTIA 3VS4A 4J9EA 3I9QA 3M0TA 2AKKA 1TUDA 2BZYA 1K0SA 4RTUA 1K76A 3H0FA 1GL5A 1Y57A 4J9HA 2RQRA 2DRKA 1SEMA 1UDLA 4HVUA 1GBQA 1M3BA 2HDAA 1N5ZA 1H8KA 2DM1A 4J9IA 5GJVB 1GCPA 3TSZA 2NWMA 2DILA 4AFUC 4OMNA 2DL5A 2DA9A 1AWJA 2ABLA 2JS2A 1W1FA 2D8JA 2KR3A 4GLMA 1WDXA 1QKXA 1YN8A 1W70A 2JMCA 4F16A 2AZSA 1K0XA 1E6GA 1M27C 2EW3A 1Y0MA 2EGCA 1NEBA 2KRSA 2KT8A 4ORZA 3NMZC 1E7OA 1ZSGA 4DEYA 1K9AA 1PWTA 1UE9A 3SEMA 2KNBB 2MIOA 4R0KA 1X43A 2D8HA 2ENMA 2EYZA 3NGPA 3PVLA 1GFCA 1H3HA 1SPKA 1UG1A 3SHWA 3TSWA 5IXBA 2KE9A 1JXMA 2DX1A 1YCSB 5GJWB 2L3QA 1HSQA 2LQWA 2DL7A 2A08A 4ESRA 2GTJA 2KXCA 3EHRA 1PNJA 3RBBB 2PTKA 4LN2A 2X3WD 1WX6A 4AFZC 3QWYA 4LNPA 2HSPA 1JO8A 2L0AA 1M30A 3EG2A 3UA7A 2F2VA 2OJ2A 3M0UA 1M8MA 2O88A 1QCFA 1RLQC 2EKHA 4HVWA 1UJ0A 1UGVA 1SHFA 2VVKA 2BTTA 2PNIA 1PHTA 1ZLMA 1OV3A 1AZEA 2JT4A 3M0PA 4OMPA 4RTTA 1ABQA 4E6RA 4CC2A 4F17A 3R6NA 1XOVA 2I0NA 2RQTA 2DMOA 2DBMA 2RQWA 2YDLA 2LX7A 2K9GA 3EHQA 2L3PA 1PKSA 2DNUA 4CC4B 2B86A 2JMAA 1YP5A 3REBB 1Z9ZA 3EGUA 2OI3A 3H0HA 4J9FA 1GBRA 2ROLA 1G2BA 1KIKA 1KSWA 2E5KA 2AZVA 1UUEA 1AD5A 4IIMA 4LE9A 1KFZA 5I11A 1QLYA 1NYFA 2CT3A 2K79A 2SEMA 3JV3A 3PE0A 4HCKA 1HJDA 1U06A 3IQLA 3M0SA 1NM7A 2KYMA 3THKA 2M0YA 3FJ5A 3EG0A 1AWWA 1IO6A 2EVRA 1U5SA 3VRYA 1LCKA 2GBQA 2EGEA 2J05A 4F14A 1WXBA 4ZNXA 2RN8A 2YUNA 2FO0A 1AVZC 4Z8AA 2YUPA 4AG2C 2O2OA 2RQVA 1JEGA 2EYWA 5L23A 1JQQA 2LJ3A 2DE0X 1X6BA 2J7IA 2J6KA 1GFDA 2RMOA 2JM9A 1PRLC 4RTVA 3EG3A 1M3AA 1M3CA 3NPFA 2F2WA 3NHNA 1WYXA 4FSSA 1RI9A 4D8KA 2AK5A 4X1VA 2LJ1A 1GCQC 1ZUYA 4CC3A 2J6FA 2JS0A 3RNJA 3I5RA 3ZL7C 3C0CA 2CSQA 5IHNA 1WI7A 3VS5A
chains in the Genus database with same CATH superfamily
2ZPEB 1M1KR 1C0MA 4R56A 3A8HB 2XI9A 2FRYA 1B07A 2ED1A 4EMKA 1X2KA 1CKBA 1YI2A 1YFNA 3CCST 2OTLT 5EC7A 2E12A 4NOYA 1W6XA 4KH0B 4Z02A 3JB9G 2L89A 4J9DA 1Y07A 3MEUA 1N9RA 1FWZA 3ER0A 1KC8U 5KYYB 2RPNA 3NTKA 3CQTA 4RTWA 2L2PA 5KYNA 3DKMA 5DLQE 1DJ7B 2JW4A 2RH2A 2K2VA 4RKUE 4XTXA 3EGXA 2QA4T 2LP5A 1PC0A 3G7ZA 3CCJA 4C5IA 1D09B 2DF6A 2D1XA 3BFMA 3G71Q 3JCMf 1FMKA 4QT7A 2DXBA 2GQIA 2X4YA 1D1AA 2YSQA 4V2SA 1IXDA 5FU6C 4IIOA 1K4US 3I56Q 1QW1A 2LTOA 2L3SA 3I55T 1LVKA 2QEXT 5M9OA 2COWA 2CSIA 1RI0A 4FW1A 4Z88A 1JBMA 3V7RA 3OB9A 4A53A 1AWOA 2CP3A 5GAN7 1UEBA 2G3RA 1VQ5T 3MHXA 3WXMB 2B8AA 3DLLA 3UA6A 2ZPBB 3C4SA 2FG0A 1OZ3A 3LLRA 3TVTA 2KT1A 3JCMd 3OS0A 2C0IA 1H3ZA 5KE3A 3A5ZB 1G3WA 4B9WA 2BZXA 3SB2A 1M2VB 2DXTA 3CCRA 4DBHA 2FPFA 4M75C 2LQNA 2A28A 2LJ0A 3UWNA 4M7AC 5GAOl 5KYXA 2JTEA 4Y28E 2EQIA 4F7UG 1SHGA 3CC7Q 2RK2A 1IREB 2GQVA 2PVDB 1XQHA 1AZGB 1HYOA 2X4XA 3EGDA 1X01A 3OYGA 1WXUA 4E47A 2CP2A 3U23A 3QYGB 4J9CA 4M7DG 1B34A 2DVJA 1QVFA 2A37A 4F7UA 3FC3A 1GCQA 3UPUA 4LUEA 2LCLA 1PD0A 4M78E 2DIQA 3OYDA 3O5ZA 4EMGA 3JCMW 5IH2A 3VS0A 2QDLA 2FZKB 4BY6C 2HD0A 3QJ6A 1MMAA 2CP0A 1KHIA 3OBWA 3FRNA 4A63B 3A98A 2Y4YA 3QKJA 3WVDB 2OTJQ 4PLIA 2M0OA 4RCBA 1UGRB 4QQDA 4KT0E 1OPKA 3CD6A 2D0NA 3MCAB 1M90R 1QWFA 2OAWA 1G83A 5FLXE 4M4ZA 2GTOA 3VKIA 3GNGA 1QVFP 2RI2A 4YTLA 2DZCA 3PVQA 4PKCC 5CIUA 2XDBA 1K73U 3G6EA 3ZFJA 1PG5B 2KBTA 2FB7A 1AOJA 4DEXA 3X26B 3V8JA 1ZHIA 2P0KA 3CCJT 2K6DA 3OMCA 2VWFA 2COZA 2OAUA 2GF7A 3M54A 3BE3A 2ATCB 2P0PA 2X9HA 1G3YA 2FPDA 2EWNA 2CP7A 2K5IA 1Q7YR 3M0TA 1TUDA 4RTUA 4FSXA 3HHTB 3H0FA 1YITA 3H8ZA 1Y57A 4J9HA 4HVUA 4HKEA 2D6FA 1H8KA 5CCAA 4BDYA 1GCPA 1KQSP 4WF2A 5KYYA 4AFUC 4M78D 4OMNA 2DL5A 1W1FA 4GLMA 1SG5A 2V8KA 1OU9A 1K0XA 1RAGB 3N5BB 2JTMA 2EW3A 3G71T 5IAYA 2EGCA 3SWNC 4JJNK 2AHJB 2O01E 1ZSGA 2CZ0B 2VGNA 1K9AA 1KD1C 5A0LA 5HK0A 3I56T 1HK9A 1VQ8Q 4R0KA 3GP8A 2ENMA 4MMKA 1UG1A 2YWWA 3TSWA 5IXBA 1JXMA 2DX1A 4FYWB 6AT1B 2DD5A 4OF1A 2RI3A 1KQ1A 3T9NA 2VC8A 2YRVA 1UB4A 3CBOA 4ZGDB 2LQWA 3DB3A 2GTJA 4J7IA 2DAQA 2DTHA 4PL6A 3QJYA 4XU3A 5IT9E 2R57A 1PNJA 4LN2A 4RMOA 1MNEA 3JAME 1KC8R 2P4TA 4O6JA 3HRUA 3TEEA 2NLUA 4M78B 3L1AA 4X9DA 2D9TA 1VQ8A 1YCYA 3RESA 1QCFA 1M1KU 3CBPA 4A4GA 4C0ZA 1WNLA 4IURA 4KBMB 1VQMA 4KH1B 3CC7T 2GFAA 2VVKA 1VQPQ 2P84A 3MP8A 2BTTA 1QVGS 1PHTA 4TVRA 2DERA 4DBRA 4E6RA 4PJNA 3JCMV 4JS5A 2E3HA 4HT8A 4C92C 4P5NA 3J80E 2LX7A 1YJNQ 2L3PA 1N6AA 2B86A 2JMAA 3QDRB 3CCMA 1C1AA 5HKCA 1YP5A 4Q5WA 1Z9ZA 4M75E 4M7AE 2DEQA 3CCQQ 1FXXA 1KIKA 4M77E 3CCVQ 3L2UA 3GF5A 1KFZA 5I11A 3OYFA 1N8RC 4EMHA 2X4WA 4DOWA 2OTJT 5KH6A 5GAN2 4NL2A 1WQ7A 3IQLA 3M0SA 1NM7A 2ZPGB 1W2BA 2VASA 1KK7A 3FJ5A 3EG0A 2VXFA 3A8GB 2EVRA 1LCKA 3LH0A 1X6OA 2EGEA 3RDVA 3VYHB 4PJOC 2GCXA 1JEGA 3CC4Q 4KUIA 1TU0B 4PK4A 2P0QA 2LJ3A 2DXCA 2DD4A 3LGLA 2RMOA 2JM9A 5GMKl 5FRMA 3EG3A 1M3AA 2PVOB 1VQKQ 1PSFA 4XAXB 3OYBA 2DKGA 3TREA 2J6FA 4M7AF 4XTUA 5GAN6 1MNDA 4GY5A 2CSQA 5IHNA 3OYEA 2LNVA 3MJXA 2ROTA 3CCLQ 3O8VA 5CVIA 3CCSA 2CDTA 2EPDA 1UHCA 2OTLA 2KYBA 4M75D 3DB4A 2K5FA 5I21A 1VIFA 1Q82C 3CC2Q 2MCNA 2DLPA 2Y90A 3G4SQ 4M77D 4C0GA 1M8VA 4J9BA 1YJWQ 5FU6B 3M0RA 3VS7A 4RTXA 2GGRA 2E6ZA 2V1RA 4MZPA 4FYYB 1YIJQ 2DL8A 4ZTFA 4QVZA 1VQ8T 3BY7A 3VUBA 1OYXA 2RNAA 2KRMA 3RKYA 1EX4A 3INZA 4JJBA 2DL4A 4LDWA 2ZPIB 3PIOA 2CS7A 4AG1C 2W10A 4M7DF 2FRWA 2C0TA 3P8HA 4JRPA 1UHFA 2HBWA 3I55A 2QEXA 3VS3A 4NL3A 4KUDK 3OW2A 2V26A 2XD0A 3REAB 2R5MA 1XNIA 4QQ6A 4LD9K 3C95A 1VQ5A 3JRZA 5GAOr 2NUTB 3MEVA 4M75B 2J06A 4JPBW 2KEAA 4C5HA 4M7AB 2ED0A 1RAEB 2HBPA 2P4RA 3OYKA 2CUBA 2FEIA 4M78A 2QI2A 5LJ5e 1HXDA 3M4GA 2AT1B 2JNGA 1C6VX 3JCMX 4J5YA 2FVUA 1ARKA 3MPUB 4CC7A 5I2MA 4EPCA 2Z0WA 1VQPT 1TOVA 1WPYA 4OB2B 5FWBA 1D0ZA 1OULA 1K9MC 3EH2A 4JJDA 2OX7A 2NUPB 1XJWB 3CPWS 3TCJA 3J7AF 2KSSA 1Q86R 5FWCA 5GANg 1LJOA 2XMFA 1AWXA 1NBEB 2LCSA 3PGGA 4N4IA 1YJNT 3OW2P 4ELYC 2F2XA 1FYNA 4BY6B 2W0ZA 3GIBA 1JJ2P 2EGAA 2GNCA 1PM3A 5C0MA 2KXDA 2E41A 1I81A 2LVMA 2HEQA 1R0CB 1OPLA 3CCQT 2JXBA 2CH4A 1RLPC 3CCVT 1V76A 2XKOC 2DRMA 2NYSA 1UJYA 1RUWA 4PNOA 3VRZA 4HXJA 1M1FA 4ZN1A 2QQSA 2HCKA 1SRMA 1NLOC 5AT1B 2BE7D 1VQNQ 4C92E 3URGA 4HCCA 5GANe 2EFIA 1X75C 3OYLA 1K8AC 9ATCB 4AT1B 4XTVA 2QK0A 1PD1A 1BBZA 2EQUA 3X24B 3SFMA 1WIEA 3UATA 1CKAA 3FEOA 1GXIE 1EZZB 5AYFA 4C8QC 4Z89A 2MOXA 1Q81R 2LNHB 3EFSA 2RJCA 3CC4T 3QWXX 3RIRA 1BI2A 1Q82R 1TUGB 3EAEA 5CKFA 1KHCA 4RTZA 1MV0B 1X6GA 2QG9B 1VQ4Q 1OU8A 1NYGA 1NJIC 3FJPA 1HD3A 4QVDA 5CKBA 5CKEA 1JJ2S 1GRIA 2PVGB 4DQ2A 2NUZA 4JS4A 2RHXA 1X27A 2EIFA 4FT4A 4L6V5 4LDVA 3FLGA 3M56A 4PJOE 3LH5A 3R6OA 2O9VA 5I22A 4HVVA 3LWIA 5L8RE 2O9SA 5KCOA 3L2RA 1R77A 1PRMC 2JM8A 1M1GA 3SWNB 2RHIA 3UDCA 3G4ST 4FL6A 4C5EA 3VS4A 4C92F 3I9QA 1O9SA 1YJWT 2AKKA 1NPRA 4E7ZA 4BE0A 2EQKA 1YIJT 4LDXA 1GL5A 2Y4XA 3AHUA 2DRKA 4ANJA 2DYIA 3VUZA 3RR6A 1N5ZA 4FU6A 1O75A 3ASKA 3TSZA 3G71A 3CXCA 2NWMA 2I2LA 4LDUA 1I5LA 1AWJA 2ABLA 1WDXA 4A4HA 3I56A 1W70A 1K9MR 1Y0MA 4E7SA 4ZGJB 4J6XA 4ORZA 4M77G 1E7OA 2JOYA 1I4K1 2IG0A 1X43A 4PJOF 3HRSA 3QDFA 2VB6A 3PVLA 1H3HA 2K5LA 2NUTA 4M75A 4C0DC 1PSEA 2BE9B 2EJFA 3NTHA 2L3QA 1HSQA 3GNFB 2DL7A 4M77A 5CKDA 3CXCP 3G1JA 1VQ7Q 4OVAA 3EHRA 1XTDA 2QDYB 4E7IA 4J8OA 2PTKA 5GMKm 4C92B 4DOVA 3CMEQ 3QBYA 3CCUQ 1IB8A 2JUFA 2NUPA 4LNPA 1WHMA 4Y91A 3MP1A 2L0AA 1M30A 3CC7A 3ME9A 2QTVA 1IGQA 4M7DC 2L5QA 5GMKe 2OJ2A 2JVVA 2YHTA 2VV5A 3VU3C 2EKHA 3M59A 4HVWA 1SHFA 2PNIA 1ZLMA 1AZEA 1S72Q 4B6MA 2HQEA 2X35A 4OMPA 4PFOA 1ABQA 5A0DA 4CC2A 4VUBA 1VQNT 3E9FA 2HNIA 1XOVA 2I0NA 3CCUA 2DBMA 3JSCA 2L3RA 2E70A 2RI5A 2K9GA 3EHQA 4CC4B 3JCMJ 4E7LA 5A2QE 1SF9A 4PJOB 5LJ5f 3REBB 1VQLQ 3EGUA 2V8JA 1TWBA 3H0HA 3QZ9B 2DXUA 4B9XA 3FIFA 2OTJA 2ROLA 1G2BA 1UUEA 3QUIA 1AD5A 4LE9A 1BKBA 1FMWA 1TSFA 3QZ5B 2O4XB 2HQHA 3EFOB 4HCKA 2M9UA 8AT1B 4XK8E 1VQ4T 1G3SA 3E1SA 1TH7A 2M0YA 1MMDA 3MO8A 5GAN5 4L5GA 5GAOp 1IO6A 1BIBA 2LQKA 2EJ9A 3EG9B 5LJ5d 1YHQQ 1D3BB 4C8QE 4ME7A 4ZNXA 2YUNA 2FO0A 1AVZC 5GAMe 2YUPA 1N8RU 1QVFS 1Q86U 5CK9A 3OYIA 2H3JA 2J6KA 1Y96B 3QIIA 5CR2A 3CPFA 3SWNA 5GANf 1WHKA 4E2FB 1TS9A 4FSSA 3OYAA 2RA2A 4J83A 4D8KA 1AHJB 2AK5A 2QASA 3A8MB 4IUUA 5LJ3e 2JS0A 4BE1A 3M53A 3VV0A 3C0CA 3M57A 2RJFA 1YJ9Q 3VS5A 1FMVA 1YHQA 3A8OB 4N0AC 2XDDA 3VS2A 4KGZB 4QW2A 1E6HA 1KQSS 2CH4W 3LGFA 4J9GA 2M51A 3GBQA 3VS1A 3PMTA 1KJWA 4RTYA 2JZ2A 5CO7A 1YWOA 1M2VA 3RKXA 5GANd 4DBFA 1K73C 2C0OA 2K4YA 1VYTA 5ECAA 1T0HA 4MDWA 4C8QF 3VYGA 5C6SA 2A36A 5HY6A 1Q81U 1N27A 2KRNA 4XU2A 2EYXA 1JRIA 4BDZA 1NG2A 1ZQ1A 1Q82U 1KG1A 2DETA 2K7AA 2ECZA 2YUQA 1WHHA 1ZSZC 2FZGB 2HKQB 1H92A 1BI0A 4BI8B 2KGTA 3CMET 1UGSB 4JJCA 3CCUT 4Y92A 3L2QA 3JB9F 2K3BA 4C92A 2MWOA 4AFSC 1VQPA 4XTZA 3TU4K 1OZ2A 2QQAA 2ZCFB 2QQRA 2VGMA 1VUBA 2M1HA 1J3TA 2RQUA 3JCMQ 3M9QA 2FHDA 3M5AA 4HT9A 1I1JA 3KXTA 1YJNA 5D6WA 3OS2A 1S72T 4OMQA 3L2VA 2F1LA 3JCMb 5FU7C 3CCQA 5D6YA 4JRIA 2RHYA 5KYUB 3CCVA 4M7DE 1F1BB 2DL3A 4C8QB 3QSUA 2LCCA 1QWEA 2PU9B 1WXTA 4QVCA 3X25B 1SSHA 2A0FB 1PKTA 4PJOA 2K2MA 1WLPB 3L2WA 1VQ6Q 4QKUA 4OMLA 3H41A 4RUGA 1KD1R 1K9MU 4ATOA 3OYHA 1W2BP 1QCOA 3X20B 1TUCA 2QQBA 2RF0A 4FW2A 2AKLA 1JXOA 5CQXA 1VQ9Q 4XU1A 3A8LB 1ZUUA 4WTOB 3JB9J 4FCYA 2ZPHB 5GAOm 3H0IA 2O4XA 1M1KC 3EFOA 3BW1A 3V8KA 3L2ZA 3D7SB 3M58A 2BUDA 3KBGA 4M7AD 5GAN3 2BIVA 2ESWA 1X69A 4BI4A 3CC4A 2EYQA 2DYBA 4CI0C 3ULRB 4K11A 2HAXA 1YHQT 3ZBDA 1EFNA 3HL8A 3CCEQ 4F7UF 1BI3A 1U8RA 1AEYA 2R58A 2IVWA 3EG9A 4RG2A 1VQKA 1D3BA 4GBQA 1I07A 1ZA1B 4IUTA 2CUDA 4LUDA 5LJ5g 2CREA 5LJ5j 2CT4A 3NTIA 3P8DA 4KRTA 2HQXA 1Y96A 3CCLA 3JB9H 3AT1B 3I35A 4M78G 1VOMA 1U3OA 2O31A 2MF2A 2VKNA 2D0QB 4WCIA 1YWPA 3UF4A 2J6OA 3EFRA 3CC2A 2EKOA 3J81E 3G4SA 3V7CA 3PIPA 1YJ9T 1WFWA 5A0GA 4M7DD 4D8DA 1YJWA 1OOTA 3KFVA 2RM4A 4JUVA 4AFQC 1YIJA 1WHLA 1VA7A 3M0QA 2PZ1A 1VQOQ 1MV3A 1UTIA 3SDZA 4R55A 4J9EA 1R0BG 1M9SA 4E7JA 4QQGA 2QGFB 1IHVA 2RQRA 1N9SA 1SEMA 1UDLA 4C5GA 4C0DB 1N8RR 2HL5C 5CQYA 1GBQA 1OQKA 4HCZA 4J9IA 3KUFA 5GJVB 2LX9A 4F7UB 2F5KA 5GANj 2DA9A 1OI1A 2MMPA 2E64A 2KR3A 3CMAQ 1YN8A 2JMCA 4F16A 4IUQA 1E6GA 2GFUA 3PMIA 2K57A 3LX7A 4PLLA 3NMZC 4DEYA 2R5AA 3OSVA 2YRCA 1OX9A 3OYJA 4M7DB 3MEWA 5LJ3f 3SEMA 3QYHB 1WJQA 3RMQA 2X4JA 1U1TA 3QG1A 3X28B 4XU0A 2D8HA 3NGPA 1GFCA 1YI2Q 3SHWA 4II1A 5EG2A 2DVEA 2KE9A 3OA6A 5J26A 5GJWB 4NS5A 1G8XA 1RACB 1BIAA 3PT9A 2YXYA 2A08A 4ESRA 2VUBA 2KXCA 4EMKC 5LJ5h 1Q95G 3ZEHA 4AMCA 7AT1B 2X3WD 3MP6A 1WX6A 4BB7A 1R8OB 3QWYA 3RERA 2VYTA 2CZ7B 2M16A 5KE2A 3CCJQ 5KCHA 5LJ3d 3S3OA 1IHWA 4BE2A 1M8MA 2O88A 2QQ9A 5KYUA 1BYMA 2E1HA 2WSEE 1WJSA 1VQKT 4C8QA 2KVQG 1VQ6T 3E19A 3OYCA 3OW2S 1M5Q1 5LL6S 2A7YA 1VQNA 1UGVA 1IGUA 2E3IA 1UGPB 1M90C 4MZMA 2DJZA 3OQ5A 1OV3A 2JT4A 3P8BB 2CP6A 2CP5A 1VQ9T 4F17A 3CCLT 3S3MA 2YLCA 2DMOA 2E10A 4KGVB 8ATCB 2ZZDA 1PKSA 2DNUA 1RAAB 2LC4A 3QXEB 3WVEB 4A4EA 1I5OB 2K3YA 2KAFA 3CC2T 3RUXA 2VXEA 4FIBA 2RJDA 1Q7YC 4BI3A 4MDXA 1VIEA 3CCET 4XTYA 5GANh 1VQ4A 3L42A 2AIRB 4N4GA 2E5KA 2AZVA 4IKFA 3QO3A 4IIMA 3BDLA 3CCRQ 2LT4A 1RAIB 1QLYA 1NYFA 4C92D 1W4SA 5D7UA 4JRQA 2SEMA 4A4KA 2RHUA 1LNXA 1WHGA 1AWWA 4E7HA 2XIDA 4M75G 3VRYA 2GBQA 4M7AG 2J05A 4F14A 2XG8D 1WXBA 2PUKB 2V8IA 2RN8A 4Z8AA 2DO3A 3HSBA 1TTHB 4UC4A 1QP3A 2EYWA 3PFSA 5L23A 2LQ8A 1JQQA 2MAMA 1FX7A 2DE0X 1D1CA 1VQOT 3MKDA 5GMKj 5D6XA 1WGSA 1D0YA 4RTVA 4IUPA 2ZAEA 1M3CA 4M7AA 2KDSA 2KK4A 3H6ZA 2DEUA 4XQ3A 1WYXA 2DFUA 1RI9A 2E6NA 4M77C 4PJOD 1IRXA 1GCQC 1ZUYA 2LJ1A 4O5VA 3I5RA 4LD6A 1UGQB 1KC8C 3CD6Q 1M27C 1KD1U 1ZX6A 3M55A 3OYMA 1ZSZB 1BCMA 4ZN3A 3S6WA 1NLPC 1B7TA 2KY9A 1K8AR 3CMAT 1MGQA 3GOXA 1BB9A 1WZOA 2G6FX 3G6EQ 2EBPA 1RL2A 2H3EB 4ELZC 1U1SA 1T3LA 2X3XD 1AT1B 3I5SA 5GAN4 2RB6A 2QGGA 1VYUA 5IHKA 4M7DA 2FL7A 1VQ7A 3OY9A 1ZBJA 1NPPA 3FB9A 2BZ8A 2KQWA 1YI2T 1B3QA 2KROA 3GLXA 3CMEA 3BDUA 1YITQ 1NJIR 5FW9A 2HKNA 4FM4B 2DBKA 2F69A 1KQSA 1KQ2A 1SKUB 3C12A 1RAHB 5IXFA 2IIMA 5FU7B 1I0CA 5GAMg 1MMNA 2SRCA 4JZ3A 3E9GA 4OGCA 3CXCS 5GAMj 2WSFE 1UECA 3QHSA 2F5TX 1VYVA 2MWPA 2JJ9A 1QVGA 1G3TA 1MMGA 3EG1A 1SSFA 1NEGA 4DA4A 1TXQA 1S72A 1UFFA 2BKDN 1TG0A 2CZ6B 2E4HA 2LZ6B 4DBQA 1T3SA 2MK5A 5LJ3g 1ZUKA 1Y7XA 4M78F 4X34A 4JZ4A 4MZTA 1X2QA 4XTWA 5DLOA 5LJ3j 3V7SA 5GMKh 1BU1A 2LT1A 3PNWC 1QQJA 1WHJA 2CZ1B 1T0JA 2LDMA 1VQLA 4OMOA 5J3BA 1BI1A 2LRQA 3DLMA 4J6YA 2L8DA 4E7KA 3VS6A 4JDSA 2EAYA 2DIGA 2EQJA 4F04B 5GMKi 1S1NA 1D1BA 2EYYA 2RK1A 3E2UA 1H641 4OB1B 3HPWA 1QVGP 1JU5C 3HFOA 4BACA 3RMSA 3LW5E 2FPEA 1NE8A 4OMMA 2V1QA 1CSKA 2E65A 2E5QA 3F70A 3M4YA 5IHIA 3CCRT 1Z9QA 3FDRA 4X9CA 1VQMQ 4LXCA 4JRKA 4PJMA 4RCCA 1PCXA 3SD4A 4GLKA 1QP2A 2XHCA 1WA7A 4IUVA 1ZBXA 2DJQA 4L59A 1MUZA 1RABB 5DY9A 4N0AA 2PQWA 1ABOA 1IZ6A 1YNZA 2XK0A 3CCMQ 4BD3A 4A54A 2EQMA 1SRLA 3EH1A 5KYWB 3LYIA 1BK2A 2LMJA 1A0NB 2YT6A 3JCMg 4C92G 1EIFA 5GAMh 3UT1A 1YJ9A 1V1CA 5FRNA 2QAZA 5GAN8 4C8QD 1BCOA 2H8HA 1VQ7T 2YRDA 1QKWA 1RAFB 3HRTA 4EIKA 2YUOA 1K1ZA 2IPOB 5I2SA 1WQWA 2ZGWA 5CAIA 1D0XA 3CD6T 3TQ7P 4BUGA 2COYA 3QPHA 2DPPB 1OEBA 4PJJA 5HCKA 5LJ3h 3JCMc 1ZSZA 3HP9A 2MPXC 2QYZA 4J7FA 4ZTJA 2FYKA 2WSCE 2CKKA 3G6ET 4N4HA 2KMTA 3GPLA 3JB9D 3JCMe 2BZYA 1K0SA 5GAOq 5IN1A 1K76A 4F7UE 2JTFA 1M3BA 2HDAA 3JB9I 4PJOG 1Q86C 2DM1A 5DM7R 5CKHA 2RO0A 4JLIA 4MMLA 4PFPA 2HSEB 2DILA 1YITT 1RADB 3OMGA 4EMKB 2JS2A 3RKWA 2D8JA 1QKXA 2AZSA 4HA8A 2JN0A 1VQLT 1NEBA 2KRSA 1ACMB 2KT8A 3CCSQ 4OGEA 2OTLQ 2X51A 1PWTA 1UE9A 2KNBB 2MIOA 4PJLA 2HMAA 3HFNA 3MEAA 2EYZA 3CPWA 1SPKA 2QTXA 2A3LA 3EGXB 1YCSB 2CYZB 5J39A 2CGHA 2QA4Q 1M4ZA 4M75F 4D6WA 2YLBA 2RHZA 4OB0B 3RBBB 3OYYA 2XICA 4M77F 3JCMh 2K3XA 1Q81C 4AFZC 3HKSA 3OS5A 2HSPA 1JO8A 5FROA 3VJPA 1VQ6A 2RJEA 3I55Q 3EG2A 2QEXQ 2DK3A 3META 3UA7A 2M02A 1V29B 2F2VA 3JCMP 4OB3B 3M0UA 4HCBA 2QXFA 1RLQC 1VQ9A 2XDPA 3CPWP 1UJ0A 1K8AU 1VQ5Q 1G5VA 2ZPFB 1K73R 3LWHA 2FZCB 2HZYA 3OYNA 2QA4A 3M0PA 4RTTA 4C0FA 3R6NA 1VQMT 3A1PA 1QVPA 1W2BS 4J6WA 2RQTA 3CCEA 1NZ9A 2RQWA 2YDLA 1M2OA 2DZ9A 1I8FA 4OMFB 5KYXB 4M78C 2OI3A 2PUOB 1NJIU 4J9FA 1GBRA 4KGXB 1M90U 3CEYA 4ZGEB 4FT2A 4KULA 1KSWA 1P92A 1JJ2A 4FYVB 3CCMT 3EGDB 2MI6A 3HTRA 4JLGA 4A4FA 4LDYA 4CRIA 2CT3A 2K79A 3PE0A 3JV3A 2MYSA 1HJDA 5GAMf 1B34B 1LOJA 1U06A 4M77B 2XU8A 5KYWA 2KYMA 3THKA 3CBMA 3S3NA 3OBYA 3Q1JA 5GAOn 3OS1A 1YBYA 3NFCA 1Q7YU 1U5SA 2RD1A 3H9NA 3V8LA 4EDUA 1VQOA 1QMCA 3PTAA 1ZA2B 4AG2C 2O2OA 2RQVA 3OSSC 4OP0A 2EJGA 1X6BA 4PFZA 1OX8A 2J7IA 1GFDA 1JB0E 3C94A 2HL3A 5HK3A 1PRLC 3NPFA 4FYXB 5GAMd 2F2WA 1QCNA 3NHNA 1WJRA 2DTIA 4X1VA 4CC3A 4RG8A 3RNJA 3ZL7C 3CMAA 1Y71A 4C8QG 2C06A 2WACA 2KI7A 1LPLA 2DTOA 1WI7A 1MHNA
chains in the Genus database with same CATH topology
1ZX6A 2ROTA 2CDTA 2EPDA 1UHCA 3VS2A 2KYBA 1NLPC 2FRYA 1B07A 1E6HA 2CH4W 4J9GA 2ED1A 2DLPA 1BB9A 2MCNA 2M51A 3GBQA 3VS1A 2G6FX 4J9BA 1X2KA 1KJWA 1CKBA 3M0RA 4RTYA 3VS7A 2EBPA 4RTXA 1YWOA 2GGRA 5EC7A 2V1RA 1W6XA 1T3LA 2C0OA 1VYTA 2DL8A 2X3XD 4J9DA 5ECAA 1T0HA 3I5SA 1VYUA 5IHKA 2A36A 1ZBJA 2RPNA 2RNAA 2KRMA 2BZ8A 1B3QA 3CQTA 2KROA 4RTWA 2KRNA 4JJBA 2DL4A 2L2PA 4AG1C 2EYXA 2JW4A 2W10A 2FRWA 5FW9A 2C0TA 1NG2A 2K7AA 2LP5A 2DBKA 1UHFA 2ECZA 2YUQA 2HBWA 1H92A 2DF6A 2D1XA 5IXFA 2IIMA 3VS3A 1FMKA 1I0CA 4QT7A 2KGTA 2SRCA 2GQIA 4JZ3A 4JJCA 2YSQA 4Y92A 3REAB 1UECA 1VYVA 2K3BA 4IIOA 1K4US 2L3SA 2J06A 4JPBW 3EG1A 4AFSC 2KEAA 2CSIA 2ED0A 2P4RA 1NEGA 2CUBA 2FEIA 4Z88A 1UFFA 1AWOA 1TG0A 1J3TA 2RQUA 2LZ6B 1T3SA 1ARKA 4CC7A 1ZUKA 5FWBA 4JZ4A 1X2QA 3UA6A 1I1JA 4JJDA 1BU1A 2FG0A 4OMQA 3TVTA 1T0JA 2KT1A 4OMOA 5FWCA 2XMFA 1AWXA 2C0IA 3VS6A 2LCSA 2BZXA 1S1NA 1FYNA 2DL3A 2EYYA 2F2XA 2W0ZA 2EGAA 1QWEA 2FPFA 1WXTA 2GNCA 2KXDA 1JU5C 2LQNA 2HEQA 2A28A 2LJ0A 1SSHA 2FPEA 1OPLA 1PKTA 2K2MA 1WLPB 2JXBA 2V1QA 4OMMA 2CH4A 2JTEA 1RLPC 4OMLA 2EQIA 3H41A 1CSKA 1SHGA 4RUGA 2DRMA 1UJYA 1RUWA 5IHIA 3VRZA 1TUCA 2RF0A 4HXJA 2AKLA 1JXOA 1AZGB 1Z9QA 2HCKA 1ZUUA 1SRMA 1NLOC 1WXUA 3H0IA 3U23A 4J9CA 2DVJA 2A37A 1GCQA 2ESWA 1X69A 4LUEA 1WA7A 1BBZA 2DYBA 3O5ZA 3ULRB 4K11A 3VS0A 5IH2A 2DJQA 1WIEA 2QDLA 3UATA 1CKAA 1MUZA 1EFNA 4Z89A 2MOXA 1AEYA 2LNHB 1ABOA 4GBQA 1YNZA 1I07A 3QWXX 4A63B 1SRLA 3A98A 2CUDA 4LUDA 2CREA 1BK2A 2LMJA 1A0NB 2YT6A 4RTZA 1MV0B 1X6GA 1NYGA 2CT4A 1V1CA 1OPKA 4KRTA 2D0NA 1HD3A 1GRIA 1QWFA 2H8HA 2OAWA 3I35A 1G83A 1QKWA 1U3OA 4EIKA 2O31A 4M4ZA 2VKNA 2YUOA 4WCIA 1YWPA 2GTOA 1K1ZA 3UF4A 2J6OA 2NUZA 3PVQA 1X27A 1WFWA 3LH5A 4D8DA 2O9VA 1OOTA 3KFVA 5I22A 2KBTA 4HVVA 4DEXA 1AOJA 1OEBA 2O9SA 5HCKA 2K6DA 2VWFA 4AFQC 1PRMC 2JM8A 1VA7A 3M0QA 2PZ1A 1MV3A 2FPDA 1UTIA 3VS4A 4J9EA 3I9QA 3M0TA 2AKKA 1TUDA 2BZYA 1K0SA 4RTUA 1K76A 3H0FA 1GL5A 1Y57A 4J9HA 2RQRA 2DRKA 1SEMA 1UDLA 4HVUA 1GBQA 1M3BA 2HDAA 1N5ZA 1H8KA 2DM1A 4J9IA 5GJVB 1GCPA 3TSZA 2NWMA 2DILA 4AFUC 4OMNA 2DL5A 2DA9A 1AWJA 2ABLA 2JS2A 1W1FA 2D8JA 2KR3A 4GLMA 1WDXA 1QKXA 1YN8A 1W70A 2JMCA 4F16A 2AZSA 1K0XA 1E6GA 1M27C 2EW3A 1Y0MA 2EGCA 1NEBA 2KRSA 2KT8A 4ORZA 3NMZC 1E7OA 1ZSGA 4DEYA 1K9AA 1PWTA 1UE9A 3SEMA 2KNBB 2MIOA 4R0KA 1X43A 2D8HA 2ENMA 2EYZA 3NGPA 3PVLA 1GFCA 1H3HA 1SPKA 1UG1A 3SHWA 3TSWA 5IXBA 2KE9A 1JXMA 2DX1A 1YCSB 5GJWB 2L3QA 1HSQA 2LQWA 2DL7A 2A08A 4ESRA 2GTJA 2KXCA 3EHRA 1PNJA 3RBBB 2PTKA 4LN2A 2X3WD 1WX6A 4AFZC 3QWYA 4LNPA 2HSPA 1JO8A 2L0AA 1M30A 3EG2A 3UA7A 2F2VA 2OJ2A 3M0UA 1M8MA 2O88A 1QCFA 1RLQC 2EKHA 4HVWA 1UJ0A 1UGVA 1SHFA 2VVKA 2BTTA 2PNIA 1PHTA 1ZLMA 1OV3A 1AZEA 2JT4A 3M0PA 4OMPA 4RTTA 1ABQA 4E6RA 4CC2A 4F17A 3R6NA 1XOVA 2I0NA 2RQTA 2DMOA 2DBMA 2RQWA 2YDLA 2LX7A 2K9GA 3EHQA 2L3PA 1PKSA 2DNUA 4CC4B 2B86A 2JMAA 1YP5A 3REBB 1Z9ZA 3EGUA 2OI3A 3H0HA 4J9FA 1GBRA 2ROLA 1G2BA 1KIKA 1KSWA 2E5KA 2AZVA 1UUEA 1AD5A 4IIMA 4LE9A 1KFZA 5I11A 1QLYA 1NYFA 2CT3A 2K79A 2SEMA 3JV3A 3PE0A 4HCKA 1HJDA 1U06A 3IQLA 3M0SA 1NM7A 2KYMA 3THKA 2M0YA 3FJ5A 3EG0A 1AWWA 1IO6A 2EVRA 1U5SA 3VRYA 1LCKA 2GBQA 2EGEA 2J05A 4F14A 1WXBA 4ZNXA 2RN8A 2YUNA 2FO0A 1AVZC 4Z8AA 2YUPA 4AG2C 2O2OA 2RQVA 1JEGA 2EYWA 5L23A 1JQQA 2LJ3A 2DE0X 1X6BA 2J7IA 2J6KA 1GFDA 2RMOA 2JM9A 1PRLC 4RTVA 3EG3A 1M3AA 1M3CA 3NPFA 2F2WA 3NHNA 1WYXA 4FSSA 1RI9A 4D8KA 2AK5A 4X1VA 2LJ1A 1GCQC 1ZUYA 4CC3A 2J6FA 2JS0A 3RNJA 3I5RA 3ZL7C 3C0CA 2CSQA 5IHNA 1WI7A 3VS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZX6 A;  2ROT A;  2CDT A;  2EPD A;  1UHC A;  3VS2 A;  2KYB A;  1NLP C;  2FRY A;  1B07 A;  1E6H A;  2CH4 W;  4J9G A;  2ED1 A;  2DLP A;  1BB9 A;  2MCN A;  2M51 A;  3GBQ A;  3VS1 A;  2G6F X;  4J9B A;  1X2K A;  1KJW A;  1CKB A;  3M0R A;  4RTY A;  3VS7 A;  2EBP A;  4RTX A;  1YWO A;  2GGR A;  5EC7 A;  2V1R A;  1W6X A;  1T3L A;  2C0O A;  1VYT A;  2DL8 A;  2X3X D;  4J9D A;  5ECA A;  1T0H A;  3I5S A;  1VYU A;  5IHK A;  2A36 A;  1ZBJ A;  2RPN A;  2RNA A;  2KRM A;  2BZ8 A;  1B3Q A;  3CQT A;  2KRO A;  4RTW A;  2KRN A;  4JJB A;  2DL4 A;  2L2P A;  4AG1 C;  2EYX A;  2JW4 A;  2W10 A;  2FRW A;  5FW9 A;  2C0T A;  1NG2 A;  2K7A A;  2LP5 A;  2DBK A;  1UHF A;  2ECZ A;  2YUQ A;  2HBW A;  1H92 A;  2DF6 A;  2D1X A;  5IXF A;  2IIM A;  3VS3 A;  1FMK A;  1I0C A;  4QT7 A;  2KGT A;  2SRC A;  2GQI A;  4JZ3 A;  4JJC A;  2YSQ A;  4Y92 A;  3REA B;  1UEC A;  1VYV A;  2K3B A;  4IIO A;  1K4U S;  2L3S A;  2J06 A;  4JPB W;  3EG1 A;  4AFS C;  2KEA A;  2CSI A;  2ED0 A;  2P4R A;  1NEG A;  2CUB A;  2FEI A;  4Z88 A;  1UFF A;  1AWO A;  1TG0 A;  1J3T A;  2RQU A;  2LZ6 B;  1T3S A;  1ARK A;  4CC7 A;  1ZUK A;  5FWB A;  4JZ4 A;  1X2Q A;  3UA6 A;  1I1J A;  4JJD A;  1BU1 A;  2FG0 A;  4OMQ A;  3TVT A;  1T0J A;  2KT1 A;  4OMO A;  5FWC A;  2XMF A;  1AWX A;  2C0I A;  3VS6 A;  2LCS A;  2BZX A;  1S1N A;  1FYN A;  2DL3 A;  2EYY A;  2F2X A;  2W0Z A;  2EGA A;  1QWE A;  2FPF A;  1WXT A;  2GNC A;  2KXD A;  1JU5 C;  2LQN A;  2HEQ A;  2A28 A;  2LJ0 A;  1SSH A;  2FPE A;  1OPL A;  1PKT A;  2K2M A;  1WLP B;  2JXB A;  2V1Q A;  4OMM A;  2CH4 A;  2JTE A;  1RLP C;  4OML A;  2EQI A;  3H41 A;  1CSK A;  1SHG A;  4RUG A;  2DRM A;  1UJY A;  1RUW A;  5IHI A;  3VRZ A;  1TUC A;  2RF0 A;  4HXJ A;  2AKL A;  1JXO A;  1AZG B;  1Z9Q A;  2HCK A;  1ZUU A;  1SRM A;  1NLO C;  1WXU A;  3H0I A;  3U23 A;  4J9C A;  2DVJ A;  2A37 A;  1GCQ A;  2ESW A;  1X69 A;  4LUE A;  1WA7 A;  1BBZ A;  2DYB A;  3O5Z A;  3ULR B;  4K11 A;  3VS0 A;  5IH2 A;  2DJQ A;  1WIE A;  2QDL A;  3UAT A;  1CKA A;  1MUZ A;  1EFN A;  4Z89 A;  2MOX A;  1AEY A;  2LNH B;  1ABO A;  4GBQ A;  1YNZ A;  1I07 A;  3QWX X;  4A63 B;  1SRL A;  3A98 A;  2CUD A;  4LUD A;  2CRE A;  1BK2 A;  2LMJ A;  1A0N B;  2YT6 A;  4RTZ A;  1MV0 B;  1X6G A;  1NYG A;  2CT4 A;  1V1C A;  1OPK A;  4KRT A;  2D0N A;  1HD3 A;  1GRI A;  1QWF A;  2H8H A;  2OAW A;  3I35 A;  1G83 A;  1QKW A;  1U3O A;  4EIK A;  2O31 A;  4M4Z A;  2VKN A;  2YUO A;  4WCI A;  1YWP A;  2GTO A;  1K1Z A;  3UF4 A;  2J6O A;  2NUZ A;  3PVQ A;  1X27 A;  1WFW A;  3LH5 A;  4D8D A;  2O9V A;  1OOT A;  3KFV A;  5I22 A;  2KBT A;  4HVV A;  4DEX A;  1AOJ A;  1OEB A;  2O9S A;  5HCK A;  2K6D A;  2VWF A;  4AFQ C;  1PRM C;  2JM8 A;  1VA7 A;  3M0Q A;  2PZ1 A;  1MV3 A;  2FPD A;  1UTI A;  3VS4 A;  4J9E A;  3I9Q A;  3M0T A;  2AKK A;  1TUD A;  2BZY A;  1K0S A;  4RTU A;  1K76 A;  3H0F A;  1GL5 A;  1Y57 A;  4J9H A;  2RQR A;  2DRK A;  1SEM A;  1UDL A;  4HVU A;  1GBQ A;  1M3B A;  2HDA A;  1N5Z A;  1H8K A;  2DM1 A;  4J9I A;  5GJV B;  1GCP A;  3TSZ A;  2NWM A;  2DIL A;  4AFU C;  4OMN A;  2DL5 A;  2DA9 A;  1AWJ A;  2ABL A;  2JS2 A;  1W1F A;  2D8J A;  2KR3 A;  4GLM A;  1WDX A;  1QKX A;  1YN8 A;  1W70 A;  2JMC A;  4F16 A;  2AZS A;  1K0X A;  1E6G A;  1M27 C;  2EW3 A;  1Y0M A;  2EGC A;  1NEB A;  2KRS A;  2KT8 A;  4ORZ A;  3NMZ C;  1E7O A;  1ZSG A;  4DEY A;  1K9A A;  1PWT A;  1UE9 A;  3SEM A;  2KNB B;  2MIO A;  4R0K A;  1X43 A;  2D8H A;  2ENM A;  2EYZ A;  3NGP A;  3PVL A;  1GFC A;  1H3H A;  1SPK A;  1UG1 A;  3SHW A;  3TSW A;  5IXB A;  2KE9 A;  1JXM A;  2DX1 A;  1YCS B;  5GJW B;  2L3Q A;  1HSQ A;  2LQW A;  2DL7 A;  2A08 A;  4ESR A;  2GTJ A;  2KXC A;  3EHR A;  1PNJ A;  3RBB B;  2PTK A;  4LN2 A;  2X3W D;  1WX6 A;  4AFZ C;  3QWY A;  4LNP A;  2HSP A;  1JO8 A;  2L0A A;  1M30 A;  3EG2 A;  3UA7 A;  2F2V A;  2OJ2 A;  3M0U A;  1M8M A;  2O88 A;  1QCF A;  1RLQ C;  2EKH A;  4HVW A;  1UJ0 A;  1UGV A;  1SHF A;  2VVK A;  2BTT A;  2PNI A;  1PHT A;  1ZLM A;  1OV3 A;  1AZE A;  2JT4 A;  3M0P A;  4OMP A;  4RTT A;  1ABQ A;  4E6R A;  4CC2 A;  4F17 A;  3R6N A;  1XOV A;  2I0N A;  2RQT A;  2DMO A;  2DBM A;  2RQW A;  2YDL A;  2LX7 A;  2K9G A;  3EHQ A;  2L3P A;  1PKS A;  2DNU A;  4CC4 B;  2B86 A;  2JMA A;  1YP5 A;  3REB B;  1Z9Z A;  3EGU A;  2OI3 A;  3H0H A;  4J9F A;  1GBR A;  2ROL A;  1G2B A;  1KIK A;  1KSW A;  2E5K A;  2AZV A;  1UUE A;  1AD5 A;  4IIM A;  4LE9 A;  1KFZ A;  5I11 A;  1QLY A;  1NYF A;  2CT3 A;  2K79 A;  2SEM A;  3JV3 A;  3PE0 A;  4HCK A;  1HJD A;  1U06 A;  3IQL A;  3M0S A;  1NM7 A;  2KYM A;  3THK A;  2M0Y A;  3FJ5 A;  3EG0 A;  1AWW A;  1IO6 A;  2EVR A;  1U5S A;  3VRY A;  1LCK A;  2GBQ A;  2EGE A;  2J05 A;  4F14 A;  1WXB A;  4ZNX A;  2RN8 A;  2YUN A;  2FO0 A;  1AVZ C;  4Z8A A;  2YUP A;  4AG2 C;  2O2O A;  2RQV A;  1JEG A;  2EYW A;  5L23 A;  1JQQ A;  2LJ3 A;  2DE0 X;  1X6B A;  2J7I A;  2J6K A;  1GFD A;  2RMO A;  2JM9 A;  1PRL C;  4RTV A;  3EG3 A;  1M3A A;  1M3C A;  3NPF A;  2F2W A;  3NHN A;  1WYX A;  4FSS A;  1RI9 A;  4D8K A;  2AK5 A;  4X1V A;  2LJ1 A;  1GCQ C;  1ZUY A;  4CC3 A;  2J6F A;  2JS0 A;  3RNJ A;  3I5R A;  3ZL7 C;  3C0C A;  2CSQ A;  5IHN A;  1WI7 A;  3VS5 A; 
#chains in the Genus database with same CATH topology
 2ZPE B;  1M1K R;  1C0M A;  4R56 A;  3A8H B;  2XI9 A;  2FRY A;  1B07 A;  2ED1 A;  4EMK A;  1X2K A;  1CKB A;  1YI2 A;  1YFN A;  3CCS T;  2OTL T;  5EC7 A;  2E12 A;  4NOY A;  1W6X A;  4KH0 B;  4Z02 A;  3JB9 G;  2L89 A;  4J9D A;  1Y07 A;  3MEU A;  1N9R A;  1FWZ A;  3ER0 A;  1KC8 U;  5KYY B;  2RPN A;  3NTK A;  3CQT A;  4RTW A;  2L2P A;  5KYN A;  3DKM A;  5DLQ E;  1DJ7 B;  2JW4 A;  2RH2 A;  2K2V A;  4RKU E;  4XTX A;  3EGX A;  2QA4 T;  2LP5 A;  1PC0 A;  3G7Z A;  3CCJ A;  4C5I A;  1D09 B;  2DF6 A;  2D1X A;  3BFM A;  3G71 Q;  3JCM f;  1FMK A;  4QT7 A;  2DXB A;  2GQI A;  2X4Y A;  1D1A A;  2YSQ A;  4V2S A;  1IXD A;  5FU6 C;  4IIO A;  1K4U S;  3I56 Q;  1QW1 A;  2LTO A;  2L3S A;  3I55 T;  1LVK A;  2QEX T;  5M9O A;  2COW A;  2CSI A;  1RI0 A;  4FW1 A;  4Z88 A;  1JBM A;  3V7R A;  3OB9 A;  4A53 A;  1AWO A;  2CP3 A;  5GAN 7;  1UEB A;  2G3R A;  1VQ5 T;  3MHX A;  3WXM B;  2B8A A;  3DLL A;  3UA6 A;  2ZPB B;  3C4S A;  2FG0 A;  1OZ3 A;  3LLR A;  3TVT A;  2KT1 A;  3JCM d;  3OS0 A;  2C0I A;  1H3Z A;  5KE3 A;  3A5Z B;  1G3W A;  4B9W A;  2BZX A;  3SB2 A;  1M2V B;  2DXT A;  3CCR A;  4DBH A;  2FPF A;  4M75 C;  2LQN A;  2A28 A;  2LJ0 A;  3UWN A;  4M7A C;  5GAO l;  5KYX A;  2JTE A;  4Y28 E;  2EQI A;  4F7U G;  1SHG A;  3CC7 Q;  2RK2 A;  1IRE B;  2GQV A;  2PVD B;  1XQH A;  1AZG B;  1HYO A;  2X4X A;  3EGD A;  1X01 A;  3OYG A;  1WXU A;  4E47 A;  2CP2 A;  3U23 A;  3QYG B;  4J9C A;  4M7D G;  1B34 A;  2DVJ A;  1QVF A;  2A37 A;  4F7U A;  3FC3 A;  1GCQ A;  3UPU A;  4LUE A;  2LCL A;  1PD0 A;  4M78 E;  2DIQ A;  3OYD A;  3O5Z A;  4EMG A;  3JCM W;  5IH2 A;  3VS0 A;  2QDL A;  2FZK B;  4BY6 C;  2HD0 A;  3QJ6 A;  1MMA A;  2CP0 A;  1KHI A;  3OBW A;  3FRN A;  4A63 B;  3A98 A;  2Y4Y A;  3QKJ A;  3WVD B;  2OTJ Q;  4PLI A;  2M0O A;  4RCB A;  1UGR B;  4QQD A;  4KT0 E;  1OPK A;  3CD6 A;  2D0N A;  3MCA B;  1M90 R;  1QWF A;  2OAW A;  1G83 A;  5FLX E;  4M4Z A;  2GTO A;  3VKI A;  3GNG A;  1QVF P;  2RI2 A;  4YTL A;  2DZC A;  3PVQ A;  4PKC C;  5CIU A;  2XDB A;  1K73 U;  3G6E A;  3ZFJ A;  1PG5 B;  2KBT A;  2FB7 A;  1AOJ A;  4DEX A;  3X26 B;  3V8J A;  1ZHI A;  2P0K A;  3CCJ T;  2K6D A;  3OMC A;  2VWF A;  2COZ A;  2OAU A;  2GF7 A;  3M54 A;  3BE3 A;  2ATC B;  2P0P A;  2X9H A;  1G3Y A;  2FPD A;  2EWN A;  2CP7 A;  2K5I A;  1Q7Y R;  3M0T A;  1TUD A;  4RTU A;  4FSX A;  3HHT B;  3H0F A;  1YIT A;  3H8Z A;  1Y57 A;  4J9H A;  4HVU A;  4HKE A;  2D6F A;  1H8K A;  5CCA A;  4BDY A;  1GCP A;  1KQS P;  4WF2 A;  5KYY A;  4AFU C;  4M78 D;  4OMN A;  2DL5 A;  1W1F A;  4GLM A;  1SG5 A;  2V8K A;  1OU9 A;  1K0X A;  1RAG B;  3N5B B;  2JTM A;  2EW3 A;  3G71 T;  5IAY A;  2EGC A;  3SWN C;  4JJN K;  2AHJ B;  2O01 E;  1ZSG A;  2CZ0 B;  2VGN A;  1K9A A;  1KD1 C;  5A0L A;  5HK0 A;  3I56 T;  1HK9 A;  1VQ8 Q;  4R0K A;  3GP8 A;  2ENM A;  4MMK A;  1UG1 A;  2YWW A;  3TSW A;  5IXB A;  1JXM A;  2DX1 A;  4FYW B;  6AT1 B;  2DD5 A;  4OF1 A;  2RI3 A;  1KQ1 A;  3T9N A;  2VC8 A;  2YRV A;  1UB4 A;  3CBO A;  4ZGD B;  2LQW A;  3DB3 A;  2GTJ A;  4J7I A;  2DAQ A;  2DTH A;  4PL6 A;  3QJY A;  4XU3 A;  5IT9 E;  2R57 A;  1PNJ A;  4LN2 A;  4RMO A;  1MNE A;  3JAM E;  1KC8 R;  2P4T A;  4O6J A;  3HRU A;  3TEE A;  2NLU A;  4M78 B;  3L1A A;  4X9D A;  2D9T A;  1VQ8 A;  1YCY A;  3RES A;  1QCF A;  1M1K U;  3CBP A;  4A4G A;  4C0Z A;  1WNL A;  4IUR A;  4KBM B;  1VQM A;  4KH1 B;  3CC7 T;  2GFA A;  2VVK A;  1VQP Q;  2P84 A;  3MP8 A;  2BTT A;  1QVG S;  1PHT A;  4TVR A;  2DER A;  4DBR A;  4E6R A;  4PJN A;  3JCM V;  4JS5 A;  2E3H A;  4HT8 A;  4C92 C;  4P5N A;  3J80 E;  2LX7 A;  1YJN Q;  2L3P A;  1N6A A;  2B86 A;  2JMA A;  3QDR B;  3CCM A;  1C1A A;  5HKC A;  1YP5 A;  4Q5W A;  1Z9Z A;  4M75 E;  4M7A E;  2DEQ A;  3CCQ Q;  1FXX A;  1KIK A;  4M77 E;  3CCV Q;  3L2U A;  3GF5 A;  1KFZ A;  5I11 A;  3OYF A;  1N8R C;  4EMH A;  2X4W A;  4DOW A;  2OTJ T;  5KH6 A;  5GAN 2;  4NL2 A;  1WQ7 A;  3IQL A;  3M0S A;  1NM7 A;  2ZPG B;  1W2B A;  2VAS A;  1KK7 A;  3FJ5 A;  3EG0 A;  2VXF A;  3A8G B;  2EVR A;  1LCK A;  3LH0 A;  1X6O A;  2EGE A;  3RDV A;  3VYH B;  4PJO C;  2GCX A;  1JEG A;  3CC4 Q;  4KUI A;  1TU0 B;  4PK4 A;  2P0Q A;  2LJ3 A;  2DXC A;  2DD4 A;  3LGL A;  2RMO A;  2JM9 A;  5GMK l;  5FRM A;  3EG3 A;  1M3A A;  2PVO B;  1VQK Q;  1PSF A;  4XAX B;  3OYB A;  2DKG A;  3TRE A;  2J6F A;  4M7A F;  4XTU A;  5GAN 6;  1MND A;  4GY5 A;  2CSQ A;  5IHN A;  3OYE A;  2LNV A;  3MJX A;  2ROT A;  3CCL Q;  3O8V A;  5CVI A;  3CCS A;  2CDT A;  2EPD A;  1UHC A;  2OTL A;  2KYB A;  4M75 D;  3DB4 A;  2K5F A;  5I21 A;  1VIF A;  1Q82 C;  3CC2 Q;  2MCN A;  2DLP A;  2Y90 A;  3G4S Q;  4M77 D;  4C0G A;  1M8V A;  4J9B A;  1YJW Q;  5FU6 B;  3M0R A;  3VS7 A;  4RTX A;  2GGR A;  2E6Z A;  2V1R A;  4MZP A;  4FYY B;  1YIJ Q;  2DL8 A;  4ZTF A;  4QVZ A;  1VQ8 T;  3BY7 A;  3VUB A;  1OYX A;  2RNA A;  2KRM A;  3RKY A;  1EX4 A;  3INZ A;  4JJB A;  2DL4 A;  4LDW A;  2ZPI B;  3PIO A;  2CS7 A;  4AG1 C;  2W10 A;  4M7D F;  2FRW A;  2C0T A;  3P8H A;  4JRP A;  1UHF A;  2HBW A;  3I55 A;  2QEX A;  3VS3 A;  4NL3 A;  4KUD K;  3OW2 A;  2V26 A;  2XD0 A;  3REA B;  2R5M A;  1XNI A;  4QQ6 A;  4LD9 K;  3C95 A;  1VQ5 A;  3JRZ A;  5GAO r;  2NUT B;  3MEV A;  4M75 B;  2J06 A;  4JPB W;  2KEA A;  4C5H A;  4M7A B;  2ED0 A;  1RAE B;  2HBP A;  2P4R A;  3OYK A;  2CUB A;  2FEI A;  4M78 A;  2QI2 A;  5LJ5 e;  1HXD A;  3M4G A;  2AT1 B;  2JNG A;  1C6V X;  3JCM X;  4J5Y A;  2FVU A;  1ARK A;  3MPU B;  4CC7 A;  5I2M A;  4EPC A;  2Z0W A;  1VQP T;  1TOV A;  1WPY A;  4OB2 B;  5FWB A;  1D0Z A;  1OUL A;  1K9M C;  3EH2 A;  4JJD A;  2OX7 A;  2NUP B;  1XJW B;  3CPW S;  3TCJ A;  3J7A F;  2KSS A;  1Q86 R;  5FWC A;  5GAN g;  1LJO A;  2XMF A;  1AWX A;  1NBE B;  2LCS A;  3PGG A;  4N4I A;  1YJN T;  3OW2 P;  4ELY C;  2F2X A;  1FYN A;  4BY6 B;  2W0Z A;  3GIB A;  1JJ2 P;  2EGA A;  2GNC A;  1PM3 A;  5C0M A;  2KXD A;  2E41 A;  1I81 A;  2LVM A;  2HEQ A;  1R0C B;  1OPL A;  3CCQ T;  2JXB A;  2CH4 A;  1RLP C;  3CCV T;  1V76 A;  2XKO C;  2DRM A;  2NYS A;  1UJY A;  1RUW A;  4PNO A;  3VRZ A;  4HXJ A;  1M1F A;  4ZN1 A;  2QQS A;  2HCK A;  1SRM A;  1NLO C;  5AT1 B;  2BE7 D;  1VQN Q;  4C92 E;  3URG A;  4HCC A;  5GAN e;  2EFI A;  1X75 C;  3OYL A;  1K8A C;  9ATC B;  4AT1 B;  4XTV A;  2QK0 A;  1PD1 A;  1BBZ A;  2EQU A;  3X24 B;  3SFM A;  1WIE A;  3UAT A;  1CKA A;  3FEO A;  1GXI E;  1EZZ B;  5AYF A;  4C8Q C;  4Z89 A;  2MOX A;  1Q81 R;  2LNH B;  3EFS A;  2RJC A;  3CC4 T;  3QWX X;  3RIR A;  1BI2 A;  1Q82 R;  1TUG B;  3EAE A;  5CKF A;  1KHC A;  4RTZ A;  1MV0 B;  1X6G A;  2QG9 B;  1VQ4 Q;  1OU8 A;  1NYG A;  1NJI C;  3FJP A;  1HD3 A;  4QVD A;  5CKB A;  5CKE A;  1JJ2 S;  1GRI A;  2PVG B;  4DQ2 A;  2NUZ A;  4JS4 A;  2RHX A;  1X27 A;  2EIF A;  4FT4 A;  4L6V 5;  4LDV A;  3FLG A;  3M56 A;  4PJO E;  3LH5 A;  3R6O A;  2O9V A;  5I22 A;  4HVV A;  3LWI A;  5L8R E;  2O9S A;  5KCO A;  3L2R A;  1R77 A;  1PRM C;  2JM8 A;  1M1G A;  3SWN B;  2RHI A;  3UDC A;  3G4S T;  4FL6 A;  4C5E A;  3VS4 A;  4C92 F;  3I9Q A;  1O9S A;  1YJW T;  2AKK A;  1NPR A;  4E7Z A;  4BE0 A;  2EQK A;  1YIJ T;  4LDX A;  1GL5 A;  2Y4X A;  3AHU A;  2DRK A;  4ANJ A;  2DYI A;  3VUZ A;  3RR6 A;  1N5Z A;  4FU6 A;  1O75 A;  3ASK A;  3TSZ A;  3G71 A;  3CXC A;  2NWM A;  2I2L A;  4LDU A;  1I5L A;  1AWJ A;  2ABL A;  1WDX A;  4A4H A;  3I56 A;  1W70 A;  1K9M R;  1Y0M A;  4E7S A;  4ZGJ B;  4J6X A;  4ORZ A;  4M77 G;  1E7O A;  2JOY A;  1I4K 1;  2IG0 A;  1X43 A;  4PJO F;  3HRS A;  3QDF A;  2VB6 A;  3PVL A;  1H3H A;  2K5L A;  2NUT A;  4M75 A;  4C0D C;  1PSE A;  2BE9 B;  2EJF A;  3NTH A;  2L3Q A;  1HSQ A;  3GNF B;  2DL7 A;  4M77 A;  5CKD A;  3CXC P;  3G1J A;  1VQ7 Q;  4OVA A;  3EHR A;  1XTD A;  2QDY B;  4E7I A;  4J8O A;  2PTK A;  5GMK m;  4C92 B;  4DOV A;  3CME Q;  3QBY A;  3CCU Q;  1IB8 A;  2JUF A;  2NUP A;  4LNP A;  1WHM A;  4Y91 A;  3MP1 A;  2L0A A;  1M30 A;  3CC7 A;  3ME9 A;  2QTV A;  1IGQ A;  4M7D C;  2L5Q A;  5GMK e;  2OJ2 A;  2JVV A;  2YHT A;  2VV5 A;  3VU3 C;  2EKH A;  3M59 A;  4HVW A;  1SHF A;  2PNI A;  1ZLM A;  1AZE A;  1S72 Q;  4B6M A;  2HQE A;  2X35 A;  4OMP A;  4PFO A;  1ABQ A;  5A0D A;  4CC2 A;  4VUB A;  1VQN T;  3E9F A;  2HNI A;  1XOV A;  2I0N A;  3CCU A;  2DBM A;  3JSC A;  2L3R A;  2E70 A;  2RI5 A;  2K9G A;  3EHQ A;  4CC4 B;  3JCM J;  4E7L A;  5A2Q E;  1SF9 A;  4PJO B;  5LJ5 f;  3REB B;  1VQL Q;  3EGU A;  2V8J A;  1TWB A;  3H0H A;  3QZ9 B;  2DXU A;  4B9X A;  3FIF A;  2OTJ A;  2ROL A;  1G2B A;  1UUE A;  3QUI A;  1AD5 A;  4LE9 A;  1BKB A;  1FMW A;  1TSF A;  3QZ5 B;  2O4X B;  2HQH A;  3EFO B;  4HCK A;  2M9U A;  8AT1 B;  4XK8 E;  1VQ4 T;  1G3S A;  3E1S A;  1TH7 A;  2M0Y A;  1MMD A;  3MO8 A;  5GAN 5;  4L5G A;  5GAO p;  1IO6 A;  1BIB A;  2LQK A;  2EJ9 A;  3EG9 B;  5LJ5 d;  1YHQ Q;  1D3B B;  4C8Q E;  4ME7 A;  4ZNX A;  2YUN A;  2FO0 A;  1AVZ C;  5GAM e;  2YUP A;  1N8R U;  1QVF S;  1Q86 U;  5CK9 A;  3OYI A;  2H3J A;  2J6K A;  1Y96 B;  3QII A;  5CR2 A;  3CPF A;  3SWN A;  5GAN f;  1WHK A;  4E2F B;  1TS9 A;  4FSS A;  3OYA A;  2RA2 A;  4J83 A;  4D8K A;  1AHJ B;  2AK5 A;  2QAS A;  3A8M B;  4IUU A;  5LJ3 e;  2JS0 A;  4BE1 A;  3M53 A;  3VV0 A;  3C0C A;  3M57 A;  2RJF A;  1YJ9 Q;  3VS5 A;  1FMV A;  1YHQ A;  3A8O B;  4N0A C;  2XDD A;  3VS2 A;  4KGZ B;  4QW2 A;  1E6H A;  1KQS S;  2CH4 W;  3LGF A;  4J9G A;  2M51 A;  3GBQ A;  3VS1 A;  3PMT A;  1KJW A;  4RTY A;  2JZ2 A;  5CO7 A;  1YWO A;  1M2V A;  3RKX A;  5GAN d;  4DBF A;  1K73 C;  2C0O A;  2K4Y A;  1VYT A;  5ECA A;  1T0H A;  4MDW A;  4C8Q F;  3VYG A;  5C6S A;  2A36 A;  5HY6 A;  1Q81 U;  1N27 A;  2KRN A;  4XU2 A;  2EYX A;  1JRI A;  4BDZ A;  1NG2 A;  1ZQ1 A;  1Q82 U;  1KG1 A;  2DET A;  2K7A A;  2ECZ A;  2YUQ A;  1WHH A;  1ZSZ C;  2FZG B;  2HKQ B;  1H92 A;  1BI0 A;  4BI8 B;  2KGT A;  3CME T;  1UGS B;  4JJC A;  3CCU T;  4Y92 A;  3L2Q A;  3JB9 F;  2K3B A;  4C92 A;  2MWO A;  4AFS C;  1VQP A;  4XTZ A;  3TU4 K;  1OZ2 A;  2QQA A;  2ZCF B;  2QQR A;  2VGM A;  1VUB A;  2M1H A;  1J3T A;  2RQU A;  3JCM Q;  3M9Q A;  2FHD A;  3M5A A;  4HT9 A;  1I1J A;  3KXT A;  1YJN A;  5D6W A;  3OS2 A;  1S72 T;  4OMQ A;  3L2V A;  2F1L A;  3JCM b;  5FU7 C;  3CCQ A;  5D6Y A;  4JRI A;  2RHY A;  5KYU B;  3CCV A;  4M7D E;  1F1B B;  2DL3 A;  4C8Q B;  3QSU A;  2LCC A;  1QWE A;  2PU9 B;  1WXT A;  4QVC A;  3X25 B;  1SSH A;  2A0F B;  1PKT A;  4PJO A;  2K2M A;  1WLP B;  3L2W A;  1VQ6 Q;  4QKU A;  4OML A;  3H41 A;  4RUG A;  1KD1 R;  1K9M U;  4ATO A;  3OYH A;  1W2B P;  1QCO A;  3X20 B;  1TUC A;  2QQB A;  2RF0 A;  4FW2 A;  2AKL A;  1JXO A;  5CQX A;  1VQ9 Q;  4XU1 A;  3A8L B;  1ZUU A;  4WTO B;  3JB9 J;  4FCY A;  2ZPH B;  5GAO m;  3H0I A;  2O4X A;  1M1K C;  3EFO A;  3BW1 A;  3V8K A;  3L2Z A;  3D7S B;  3M58 A;  2BUD A;  3KBG A;  4M7A D;  5GAN 3;  2BIV A;  2ESW A;  1X69 A;  4BI4 A;  3CC4 A;  2EYQ A;  2DYB A;  4CI0 C;  3ULR B;  4K11 A;  2HAX A;  1YHQ T;  3ZBD A;  1EFN A;  3HL8 A;  3CCE Q;  4F7U F;  1BI3 A;  1U8R A;  1AEY A;  2R58 A;  2IVW A;  3EG9 A;  4RG2 A;  1VQK A;  1D3B A;  4GBQ A;  1I07 A;  1ZA1 B;  4IUT A;  2CUD A;  4LUD A;  5LJ5 g;  2CRE A;  5LJ5 j;  2CT4 A;  3NTI A;  3P8D A;  4KRT A;  2HQX A;  1Y96 A;  3CCL A;  3JB9 H;  3AT1 B;  3I35 A;  4M78 G;  1VOM A;  1U3O A;  2O31 A;  2MF2 A;  2VKN A;  2D0Q B;  4WCI A;  1YWP A;  3UF4 A;  2J6O A;  3EFR A;  3CC2 A;  2EKO A;  3J81 E;  3G4S A;  3V7C A;  3PIP A;  1YJ9 T;  1WFW A;  5A0G A;  4M7D D;  4D8D A;  1YJW A;  1OOT A;  3KFV A;  2RM4 A;  4JUV A;  4AFQ C;  1YIJ A;  1WHL A;  1VA7 A;  3M0Q A;  2PZ1 A;  1VQO Q;  1MV3 A;  1UTI A;  3SDZ A;  4R55 A;  4J9E A;  1R0B G;  1M9S A;  4E7J A;  4QQG A;  2QGF B;  1IHV A;  2RQR A;  1N9S A;  1SEM A;  1UDL A;  4C5G A;  4C0D B;  1N8R R;  2HL5 C;  5CQY A;  1GBQ A;  1OQK A;  4HCZ A;  4J9I A;  3KUF A;  5GJV B;  2LX9 A;  4F7U B;  2F5K A;  5GAN j;  2DA9 A;  1OI1 A;  2MMP A;  2E64 A;  2KR3 A;  3CMA Q;  1YN8 A;  2JMC A;  4F16 A;  4IUQ A;  1E6G A;  2GFU A;  3PMI A;  2K57 A;  3LX7 A;  4PLL A;  3NMZ C;  4DEY A;  2R5A A;  3OSV A;  2YRC A;  1OX9 A;  3OYJ A;  4M7D B;  3MEW A;  5LJ3 f;  3SEM A;  3QYH B;  1WJQ A;  3RMQ A;  2X4J A;  1U1T A;  3QG1 A;  3X28 B;  4XU0 A;  2D8H A;  3NGP A;  1GFC A;  1YI2 Q;  3SHW A;  4II1 A;  5EG2 A;  2DVE A;  2KE9 A;  3OA6 A;  5J26 A;  5GJW B;  4NS5 A;  1G8X A;  1RAC B;  1BIA A;  3PT9 A;  2YXY A;  2A08 A;  4ESR A;  2VUB A;  2KXC A;  4EMK C;  5LJ5 h;  1Q95 G;  3ZEH A;  4AMC A;  7AT1 B;  2X3W D;  3MP6 A;  1WX6 A;  4BB7 A;  1R8O B;  3QWY A;  3RER A;  2VYT A;  2CZ7 B;  2M16 A;  5KE2 A;  3CCJ Q;  5KCH A;  5LJ3 d;  3S3O A;  1IHW A;  4BE2 A;  1M8M A;  2O88 A;  2QQ9 A;  5KYU A;  1BYM A;  2E1H A;  2WSE E;  1WJS A;  1VQK T;  4C8Q A;  2KVQ G;  1VQ6 T;  3E19 A;  3OYC A;  3OW2 S;  1M5Q 1;  5LL6 S;  2A7Y A;  1VQN A;  1UGV A;  1IGU A;  2E3I A;  1UGP B;  1M90 C;  4MZM A;  2DJZ A;  3OQ5 A;  1OV3 A;  2JT4 A;  3P8B B;  2CP6 A;  2CP5 A;  1VQ9 T;  4F17 A;  3CCL T;  3S3M A;  2YLC A;  2DMO A;  2E10 A;  4KGV B;  8ATC B;  2ZZD A;  1PKS A;  2DNU A;  1RAA B;  2LC4 A;  3QXE B;  3WVE B;  4A4E A;  1I5O B;  2K3Y A;  2KAF A;  3CC2 T;  3RUX A;  2VXE A;  4FIB A;  2RJD A;  1Q7Y C;  4BI3 A;  4MDX A;  1VIE A;  3CCE T;  4XTY A;  5GAN h;  1VQ4 A;  3L42 A;  2AIR B;  4N4G A;  2E5K A;  2AZV A;  4IKF A;  3QO3 A;  4IIM A;  3BDL A;  3CCR Q;  2LT4 A;  1RAI B;  1QLY A;  1NYF A;  4C92 D;  1W4S A;  5D7U A;  4JRQ A;  2SEM A;  4A4K A;  2RHU A;  1LNX A;  1WHG A;  1AWW A;  4E7H A;  2XID A;  4M75 G;  3VRY A;  2GBQ A;  4M7A G;  2J05 A;  4F14 A;  2XG8 D;  1WXB A;  2PUK B;  2V8I A;  2RN8 A;  4Z8A A;  2DO3 A;  3HSB A;  1TTH B;  4UC4 A;  1QP3 A;  2EYW A;  3PFS A;  5L23 A;  2LQ8 A;  1JQQ A;  2MAM A;  1FX7 A;  2DE0 X;  1D1C A;  1VQO T;  3MKD A;  5GMK j;  5D6X A;  1WGS A;  1D0Y A;  4RTV A;  4IUP A;  2ZAE A;  1M3C A;  4M7A A;  2KDS A;  2KK4 A;  3H6Z A;  2DEU A;  4XQ3 A;  1WYX A;  2DFU A;  1RI9 A;  2E6N A;  4M77 C;  4PJO D;  1IRX A;  1GCQ C;  1ZUY A;  2LJ1 A;  4O5V A;  3I5R A;  4LD6 A;  1UGQ B;  1KC8 C;  3CD6 Q;  1M27 C;  1KD1 U;  1ZX6 A;  3M55 A;  3OYM A;  1ZSZ B;  1BCM A;  4ZN3 A;  3S6W A;  1NLP C;  1B7T A;  2KY9 A;  1K8A R;  3CMA T;  1MGQ A;  3GOX A;  1BB9 A;  1WZO A;  2G6F X;  3G6E Q;  2EBP A;  1RL2 A;  2H3E B;  4ELZ C;  1U1S A;  1T3L A;  2X3X D;  1AT1 B;  3I5S A;  5GAN 4;  2RB6 A;  2QGG A;  1VYU A;  5IHK A;  4M7D A;  2FL7 A;  1VQ7 A;  3OY9 A;  1ZBJ A;  1NPP A;  3FB9 A;  2BZ8 A;  2KQW A;  1YI2 T;  1B3Q A;  2KRO A;  3GLX A;  3CME A;  3BDU A;  1YIT Q;  1NJI R;  5FW9 A;  2HKN A;  4FM4 B;  2DBK A;  2F69 A;  1KQS A;  1KQ2 A;  1SKU B;  3C12 A;  1RAH B;  5IXF A;  2IIM A;  5FU7 B;  1I0C A;  5GAM g;  1MMN A;  2SRC A;  4JZ3 A;  3E9G A;  4OGC A;  3CXC S;  5GAM j;  2WSF E;  1UEC A;  3QHS A;  2F5T X;  1VYV A;  2MWP A;  2JJ9 A;  1QVG A;  1G3T A;  1MMG A;  3EG1 A;  1SSF A;  1NEG A;  4DA4 A;  1TXQ A;  1S72 A;  1UFF A;  2BKD N;  1TG0 A;  2CZ6 B;  2E4H A;  2LZ6 B;  4DBQ A;  1T3S A;  2MK5 A;  5LJ3 g;  1ZUK A;  1Y7X A;  4M78 F;  4X34 A;  4JZ4 A;  4MZT A;  1X2Q A;  4XTW A;  5DLO A;  5LJ3 j;  3V7S A;  5GMK h;  1BU1 A;  2LT1 A;  3PNW C;  1QQJ A;  1WHJ A;  2CZ1 B;  1T0J A;  2LDM A;  1VQL A;  4OMO A;  5J3B A;  1BI1 A;  2LRQ A;  3DLM A;  4J6Y A;  2L8D A;  4E7K A;  3VS6 A;  4JDS A;  2EAY A;  2DIG A;  2EQJ A;  4F04 B;  5GMK i;  1S1N A;  1D1B A;  2EYY A;  2RK1 A;  3E2U A;  1H64 1;  4OB1 B;  3HPW A;  1QVG P;  1JU5 C;  3HFO A;  4BAC A;  3RMS A;  3LW5 E;  2FPE A;  1NE8 A;  4OMM A;  2V1Q A;  1CSK A;  2E65 A;  2E5Q A;  3F70 A;  3M4Y A;  5IHI A;  3CCR T;  1Z9Q A;  3FDR A;  4X9C A;  1VQM Q;  4LXC A;  4JRK A;  4PJM A;  4RCC A;  1PCX A;  3SD4 A;  4GLK A;  1QP2 A;  2XHC A;  1WA7 A;  4IUV A;  1ZBX A;  2DJQ A;  4L59 A;  1MUZ A;  1RAB B;  5DY9 A;  4N0A A;  2PQW A;  1ABO A;  1IZ6 A;  1YNZ A;  2XK0 A;  3CCM Q;  4BD3 A;  4A54 A;  2EQM A;  1SRL A;  3EH1 A;  5KYW B;  3LYI A;  1BK2 A;  2LMJ A;  1A0N B;  2YT6 A;  3JCM g;  4C92 G;  1EIF A;  5GAM h;  3UT1 A;  1YJ9 A;  1V1C A;  5FRN A;  2QAZ A;  5GAN 8;  4C8Q D;  1BCO A;  2H8H A;  1VQ7 T;  2YRD A;  1QKW A;  1RAF B;  3HRT A;  4EIK A;  2YUO A;  1K1Z A;  2IPO B;  5I2S A;  1WQW A;  2ZGW A;  5CAI A;  1D0X A;  3CD6 T;  3TQ7 P;  4BUG A;  2COY A;  3QPH A;  2DPP B;  1OEB A;  4PJJ A;  5HCK A;  5LJ3 h;  3JCM c;  1ZSZ A;  3HP9 A;  2MPX C;  2QYZ A;  4J7F A;  4ZTJ A;  2FYK A;  2WSC E;  2CKK A;  3G6E T;  4N4H A;  2KMT A;  3GPL A;  3JB9 D;  3JCM e;  2BZY A;  1K0S A;  5GAO q;  5IN1 A;  1K76 A;  4F7U E;  2JTF A;  1M3B A;  2HDA A;  3JB9 I;  4PJO G;  1Q86 C;  2DM1 A;  5DM7 R;  5CKH A;  2RO0 A;  4JLI A;  4MML A;  4PFP A;  2HSE B;  2DIL A;  1YIT T;  1RAD B;  3OMG A;  4EMK B;  2JS2 A;  3RKW A;  2D8J A;  1QKX A;  2AZS A;  4HA8 A;  2JN0 A;  1VQL T;  1NEB A;  2KRS A;  1ACM B;  2KT8 A;  3CCS Q;  4OGE A;  2OTL Q;  2X51 A;  1PWT A;  1UE9 A;  2KNB B;  2MIO A;  4PJL A;  2HMA A;  3HFN A;  3MEA A;  2EYZ A;  3CPW A;  1SPK A;  2QTX A;  2A3L A;  3EGX B;  1YCS B;  2CYZ B;  5J39 A;  2CGH A;  2QA4 Q;  1M4Z A;  4M75 F;  4D6W A;  2YLB A;  2RHZ A;  4OB0 B;  3RBB B;  3OYY A;  2XIC A;  4M77 F;  3JCM h;  2K3X A;  1Q81 C;  4AFZ C;  3HKS A;  3OS5 A;  2HSP A;  1JO8 A;  5FRO A;  3VJP A;  1VQ6 A;  2RJE A;  3I55 Q;  3EG2 A;  2QEX Q;  2DK3 A;  3MET A;  3UA7 A;  2M02 A;  1V29 B;  2F2V A;  3JCM P;  4OB3 B;  3M0U A;  4HCB A;  2QXF A;  1RLQ C;  1VQ9 A;  2XDP A;  3CPW P;  1UJ0 A;  1K8A U;  1VQ5 Q;  1G5V A;  2ZPF B;  1K73 R;  3LWH A;  2FZC B;  2HZY A;  3OYN A;  2QA4 A;  3M0P A;  4RTT A;  4C0F A;  3R6N A;  1VQM T;  3A1P A;  1QVP A;  1W2B S;  4J6W A;  2RQT A;  3CCE A;  1NZ9 A;  2RQW A;  2YDL A;  1M2O A;  2DZ9 A;  1I8F A;  4OMF B;  5KYX B;  4M78 C;  2OI3 A;  2PUO B;  1NJI U;  4J9F A;  1GBR A;  4KGX B;  1M90 U;  3CEY A;  4ZGE B;  4FT2 A;  4KUL A;  1KSW A;  1P92 A;  1JJ2 A;  4FYV B;  3CCM T;  3EGD B;  2MI6 A;  3HTR A;  4JLG A;  4A4F A;  4LDY A;  4CRI A;  2CT3 A;  2K79 A;  3PE0 A;  3JV3 A;  2MYS A;  1HJD A;  5GAM f;  1B34 B;  1LOJ A;  1U06 A;  4M77 B;  2XU8 A;  5KYW A;  2KYM A;  3THK A;  3CBM A;  3S3N A;  3OBY A;  3Q1J A;  5GAO n;  3OS1 A;  1YBY A;  3NFC A;  1Q7Y U;  1U5S A;  2RD1 A;  3H9N A;  3V8L A;  4EDU A;  1VQO A;  1QMC A;  3PTA A;  1ZA2 B;  4AG2 C;  2O2O A;  2RQV A;  3OSS C;  4OP0 A;  2EJG A;  1X6B A;  4PFZ A;  1OX8 A;  2J7I A;  1GFD A;  1JB0 E;  3C94 A;  2HL3 A;  5HK3 A;  1PRL C;  3NPF A;  4FYX B;  5GAM d;  2F2W A;  1QCN A;  3NHN A;  1WJR A;  2DTI A;  4X1V A;  4CC3 A;  4RG8 A;  3RNJ A;  3ZL7 C;  3CMA A;  1Y71 A;  4C8Q G;  2C06 A;  2WAC A;  2KI7 A;  1LPL A;  2DTO A;  1WI7 A;  1MHN A; 
#chains in the Genus database with same CATH homology
 1ZX6 A;  2ROT A;  2CDT A;  2EPD A;  1UHC A;  3VS2 A;  2KYB A;  1NLP C;  2FRY A;  1B07 A;  1E6H A;  2CH4 W;  4J9G A;  2ED1 A;  2DLP A;  1BB9 A;  2MCN A;  2M51 A;  3GBQ A;  3VS1 A;  2G6F X;  4J9B A;  1X2K A;  1KJW A;  1CKB A;  3M0R A;  4RTY A;  3VS7 A;  2EBP A;  4RTX A;  1YWO A;  2GGR A;  5EC7 A;  2V1R A;  1W6X A;  1T3L A;  2C0O A;  1VYT A;  2DL8 A;  2X3X D;  4J9D A;  5ECA A;  1T0H A;  3I5S A;  1VYU A;  5IHK A;  2A36 A;  1ZBJ A;  2RPN A;  2RNA A;  2KRM A;  2BZ8 A;  1B3Q A;  3CQT A;  2KRO A;  4RTW A;  2KRN A;  4JJB A;  2DL4 A;  2L2P A;  4AG1 C;  2EYX A;  2JW4 A;  2W10 A;  2FRW A;  5FW9 A;  2C0T A;  1NG2 A;  2K7A A;  2LP5 A;  2DBK A;  1UHF A;  2ECZ A;  2YUQ A;  2HBW A;  1H92 A;  2DF6 A;  2D1X A;  5IXF A;  2IIM A;  3VS3 A;  1FMK A;  1I0C A;  4QT7 A;  2KGT A;  2SRC A;  2GQI A;  4JZ3 A;  4JJC A;  2YSQ A;  4Y92 A;  3REA B;  1UEC A;  1VYV A;  2K3B A;  4IIO A;  1K4U S;  2L3S A;  2J06 A;  4JPB W;  3EG1 A;  4AFS C;  2KEA A;  2CSI A;  2ED0 A;  2P4R A;  1NEG A;  2CUB A;  2FEI A;  4Z88 A;  1UFF A;  1AWO A;  1TG0 A;  1J3T A;  2RQU A;  2LZ6 B;  1T3S A;  1ARK A;  4CC7 A;  1ZUK A;  5FWB A;  4JZ4 A;  1X2Q A;  3UA6 A;  1I1J A;  4JJD A;  1BU1 A;  2FG0 A;  4OMQ A;  3TVT A;  1T0J A;  2KT1 A;  4OMO A;  5FWC A;  2XMF A;  1AWX A;  2C0I A;  3VS6 A;  2LCS A;  2BZX A;  1S1N A;  1FYN A;  2DL3 A;  2EYY A;  2F2X A;  2W0Z A;  2EGA A;  1QWE A;  2FPF A;  1WXT A;  2GNC A;  2KXD A;  1JU5 C;  2LQN A;  2HEQ A;  2A28 A;  2LJ0 A;  1SSH A;  2FPE A;  1OPL A;  1PKT A;  2K2M A;  1WLP B;  2JXB A;  2V1Q A;  4OMM A;  2CH4 A;  2JTE A;  1RLP C;  4OML A;  2EQI A;  3H41 A;  1CSK A;  1SHG A;  4RUG A;  2DRM A;  1UJY A;  1RUW A;  5IHI A;  3VRZ A;  1TUC A;  2RF0 A;  4HXJ A;  2AKL A;  1JXO A;  1AZG B;  1Z9Q A;  2HCK A;  1ZUU A;  1SRM A;  1NLO C;  1WXU A;  3H0I A;  3U23 A;  4J9C A;  2DVJ A;  2A37 A;  1GCQ A;  2ESW A;  1X69 A;  4LUE A;  1WA7 A;  1BBZ A;  2DYB A;  3O5Z A;  3ULR B;  4K11 A;  3VS0 A;  5IH2 A;  2DJQ A;  1WIE A;  2QDL A;  3UAT A;  1CKA A;  1MUZ A;  1EFN A;  4Z89 A;  2MOX A;  1AEY A;  2LNH B;  1ABO A;  4GBQ A;  1YNZ A;  1I07 A;  3QWX X;  4A63 B;  1SRL A;  3A98 A;  2CUD A;  4LUD A;  2CRE A;  1BK2 A;  2LMJ A;  1A0N B;  2YT6 A;  4RTZ A;  1MV0 B;  1X6G A;  1NYG A;  2CT4 A;  1V1C A;  1OPK A;  4KRT A;  2D0N A;  1HD3 A;  1GRI A;  1QWF A;  2H8H A;  2OAW A;  3I35 A;  1G83 A;  1QKW A;  1U3O A;  4EIK A;  2O31 A;  4M4Z A;  2VKN A;  2YUO A;  4WCI A;  1YWP A;  2GTO A;  1K1Z A;  3UF4 A;  2J6O A;  2NUZ A;  3PVQ A;  1X27 A;  1WFW A;  3LH5 A;  4D8D A;  2O9V A;  1OOT A;  3KFV A;  5I22 A;  2KBT A;  4HVV A;  4DEX A;  1AOJ A;  1OEB A;  2O9S A;  5HCK A;  2K6D A;  2VWF A;  4AFQ C;  1PRM C;  2JM8 A;  1VA7 A;  3M0Q A;  2PZ1 A;  1MV3 A;  2FPD A;  1UTI A;  3VS4 A;  4J9E A;  3I9Q A;  3M0T A;  2AKK A;  1TUD A;  2BZY A;  1K0S A;  4RTU A;  1K76 A;  3H0F A;  1GL5 A;  1Y57 A;  4J9H A;  2RQR A;  2DRK A;  1SEM A;  1UDL A;  4HVU A;  1GBQ A;  1M3B A;  2HDA A;  1N5Z A;  1H8K A;  2DM1 A;  4J9I A;  5GJV B;  1GCP A;  3TSZ A;  2NWM A;  2DIL A;  4AFU C;  4OMN A;  2DL5 A;  2DA9 A;  1AWJ A;  2ABL A;  2JS2 A;  1W1F A;  2D8J A;  2KR3 A;  4GLM A;  1WDX A;  1QKX A;  1YN8 A;  1W70 A;  2JMC A;  4F16 A;  2AZS A;  1K0X A;  1E6G A;  1M27 C;  2EW3 A;  1Y0M A;  2EGC A;  1NEB A;  2KRS A;  2KT8 A;  4ORZ A;  3NMZ C;  1E7O A;  1ZSG A;  4DEY A;  1K9A A;  1PWT A;  1UE9 A;  3SEM A;  2KNB B;  2MIO A;  4R0K A;  1X43 A;  2D8H A;  2ENM A;  2EYZ A;  3NGP A;  3PVL A;  1GFC A;  1H3H A;  1SPK A;  1UG1 A;  3SHW A;  3TSW A;  5IXB A;  2KE9 A;  1JXM A;  2DX1 A;  1YCS B;  5GJW B;  2L3Q A;  1HSQ A;  2LQW A;  2DL7 A;  2A08 A;  4ESR A;  2GTJ A;  2KXC A;  3EHR A;  1PNJ A;  3RBB B;  2PTK A;  4LN2 A;  2X3W D;  1WX6 A;  4AFZ C;  3QWY A;  4LNP A;  2HSP A;  1JO8 A;  2L0A A;  1M30 A;  3EG2 A;  3UA7 A;  2F2V A;  2OJ2 A;  3M0U A;  1M8M A;  2O88 A;  1QCF A;  1RLQ C;  2EKH A;  4HVW A;  1UJ0 A;  1UGV A;  1SHF A;  2VVK A;  2BTT A;  2PNI A;  1PHT A;  1ZLM A;  1OV3 A;  1AZE A;  2JT4 A;  3M0P A;  4OMP A;  4RTT A;  1ABQ A;  4E6R A;  4CC2 A;  4F17 A;  3R6N A;  1XOV A;  2I0N A;  2RQT A;  2DMO A;  2DBM A;  2RQW A;  2YDL A;  2LX7 A;  2K9G A;  3EHQ A;  2L3P A;  1PKS A;  2DNU A;  4CC4 B;  2B86 A;  2JMA A;  1YP5 A;  3REB B;  1Z9Z A;  3EGU A;  2OI3 A;  3H0H A;  4J9F A;  1GBR A;  2ROL A;  1G2B A;  1KIK A;  1KSW A;  2E5K A;  2AZV A;  1UUE A;  1AD5 A;  4IIM A;  4LE9 A;  1KFZ A;  5I11 A;  1QLY A;  1NYF A;  2CT3 A;  2K79 A;  2SEM A;  3JV3 A;  3PE0 A;  4HCK A;  1HJD A;  1U06 A;  3IQL A;  3M0S A;  1NM7 A;  2KYM A;  3THK A;  2M0Y A;  3FJ5 A;  3EG0 A;  1AWW A;  1IO6 A;  2EVR A;  1U5S A;  3VRY A;  1LCK A;  2GBQ A;  2EGE A;  2J05 A;  4F14 A;  1WXB A;  4ZNX A;  2RN8 A;  2YUN A;  2FO0 A;  1AVZ C;  4Z8A A;  2YUP A;  4AG2 C;  2O2O A;  2RQV A;  1JEG A;  2EYW A;  5L23 A;  1JQQ A;  2LJ3 A;  2DE0 X;  1X6B A;  2J7I A;  2J6K A;  1GFD A;  2RMO A;  2JM9 A;  1PRL C;  4RTV A;  3EG3 A;  1M3A A;  1M3C A;  3NPF A;  2F2W A;  3NHN A;  1WYX A;  4FSS A;  1RI9 A;  4D8K A;  2AK5 A;  4X1V A;  2LJ1 A;  1GCQ C;  1ZUY A;  4CC3 A;  2J6F A;  2JS0 A;  3RNJ A;  3I5R A;  3ZL7 C;  3C0C A;  2CSQ A;  5IHN A;  1WI7 A;  3VS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...