2KSSA

Nmr structure of myxococcus xanthus antirepressor cars1
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
86
structure length
86
Chain Sequence
MIQDPSLIICHDVDGAPVRIGAKVKVVPHSEDGTISQRFLGQTGIVVGLVFDDPATQYPDDPLIQVLVEGLGEDLFFPEELELAPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carotenogenesis protein carS
publication title A bacterial antirepressor with SH3 domain topology mimics operator DNA in sequestering the repressor DNA recognition helix.
pubmed doi rcsb
source organism Myxococcus xanthus
molecule tags Transcription regulator
total genus 4
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2010-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18354 SH3_18 CarS bacterial SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.630 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2kssA01
2KSSA
chains in the Genus database with same CATH superfamily
2VASA 5GAOn 4D8KA 4XTXA 5CK9A 1V29B 4RTXA 3QXEB 4FM4B 3JCMQ 5GAOr 1ACMB 1IO6A 4ZTFA 1K73C 2MPXC 4VUBA 3O8VA 5LJ5f 1MNDA 5A0DA 1IRXA 4C92E 2NUZA 1C6VX 1T3LA 2GCXA 4OGCA 4ZGEB 2RD1A 6AT1B 4BB7A 2X4YA 1VQ5T 1VQMA 1MGQA 1TUDA 1QP2A 1NE8A 1OPKA 4EDUA 2KR3A 3A5ZB 5HK3A 3EG9B 3C4SA 2LQKA 2C0TA 1D3BA 2ZPIB 3REAB 3M0TA 4BD3A 1SSHA 3WXMB 4O5VA 2RQWA 2RB6A 1NYFA 2FEIA 2M51A 2GFAA 1SG5A 2LQ8A 3VS3A 4GY5A 2OTLQ 1X2KA 1E6GA 4KBMB 4KUDK 3CCSQ 2IG0A 1QVFP 4CI0C 4Z8AA 4IIOA 1Z9QA 2VYTA 5D6WA 3P8DA 2XG8D 3QPHA 4J9FA 3SD4A 1X6GA 2EJFA 3CBOA 2LQNA 1JXMA 3T9NA 2KT8A 4C0GA 4J9DA 2L0AA 4UC4A 1X75C 4N4IA 2X4JA 3OW2A 4LDXA 3JB9G 4Z89A 4ZNXA 2BTTA 4DBRA 1G3SA 2JMCA 4OB3B 2DF6A 2NUPB 1D1AA 3VS2A 3OYNA 1VQ4A 2KE9A 2PUOB 3CCMT 5D7UA 1VQPT 1V1CA 4Y28E 3RIRA 3HSBA 4XU1A 1ZUKA 3TU4K 4J9CA 4D6WA 2J7IA 3MKDA 1IZ6A 4XU3A 2GTOA 3RMQA 4Q5WA 2ZCFB 1AD5A 1LOJA 2E41A 2HDAA 4M78B 5GAOm 1TTHB 2RH2A 1WYXA 5LJ5j 4NL2A 4M75B 1YJWA 1VQKQ 2QEXT 4QQDA 3S6WA 2YDLA 1VQ5A 3VRYA 1WXBA 4MZTA 4DEYA 1RAIB 3G6EA 1RLQC 1D1BA 3R6OA 2LZ6B 1PD0A 3MP6A 4R56A 3CCQQ 4C92F 1U06A 1LJOA 2OTJA 1PD1A 1WNLA 2V1QA 3JCMJ 2RJEA 3CC4T 1RACB 2CH4A 1C0MA 1VQ6T 2L5QA 3RERA 4M7DG 2P0QA 2IVWA 1K0XA 1NEBA 1K4US 2L3SA 3INZA 4C0DB 1VQ9T 3L2WA 5CR2A 3RKXA 3JCMX 2B8AA 4OVAA 1K9AA 1RI0A 8AT1B 1NG2A 4JLIA 2MWPA 2PUKB 1N8RR 1K9MR 2VV5A 1KD1C 3KUFA 2DL5A 2XK0A 3EG9A 2FPFA 1M1GA 5FU6C 1N8RU 4FYXB 1K9MU 3PFSA 2D6FA 2LCLA 1ZLMA 1AVZC 1I8FA 1LCKA 1EIFA 3CXCS 1LNXA 3IQLA 1GCPA 1WXTA 2COZA 4Z02A 2F2WA 3PVLA 3M0SA 2LX7A 2ZPHB 4P5NA 1Z9ZA 2JVVA 1SPKA 2CSIA 3LH0A 4AFZC 4JS4A 1MMAA 1S72Q 5GANf 4NOYA 4E7ZA 3RDVA 1M4ZA 1M3AA 2QQSA 1PHTA 4J9HA 4A4GA 2CUBA 4E47A 1KQ1A 2E5KA 3TQ7P 2EWNA 3FJ5A 2K2MA 4LN2A 2JS2A 1M90C 2J6OA 1OOTA 3I56T 3CC2T 3E19A 1YIJQ 1M1KR 1UE9A 1Y7XA 2AT1B 4C5IA 2DKGA 4F14A 3JCMb 1A0NB 5LJ5e 5GAN8 1YITA 3X26B 3SWNC 1KQSP 2PVDB 2D0NA 1YFNA 3JRZA 1K1ZA 3TSZA 3CMAA 1M1KU 2NUPA 4L59A 3D7SB 2QK0A 1UB4A 2KRSA 1Q7YC 1GBQA 4FL6A 3EG3A 2XI9A 2GNCA 2VWFA 1Q81C 2ZAEA 2EKOA 1GFCA 1W6XA 3C94A 3JCMh 1BBZA 1HD3A 4J6WA 4X9CA 2YWWA 4FYYB 2DILA 2R5MA 5GAN7 3G71T 4PJOB 4XTVA 5HY6A 4OB0B 3MHXA 4F04B 3HHTB 3EGDB 5A0LA 5LJ5h 2YUOA 1M3BA 4IUPA 1FXXA 2F2XA 2AK5A 1PRMC 2VVKA 4QQ6A 3OYKA 3MP1A 4J7FA 3SEMA 3G4SA 5GAMj 2FRYA 4RTWA 2HL5C 3EFSA 1N6AA 1EX4A 3L2ZA 3L2QA 2LJ1A 1M5Q1 3HRUA 3CCRQ 1CSKA 2XDDA 1RABB 1AWJA 2HSEB 3CCVQ 1KK7A 3E9FA 4B9XA 4M7DB 2JM8A 1RAHB 3GF5A 2D9TA 3EFOB 2V26A 3NTKA 3PNWC 1YJ9A 4AG2C 5A2QE 4LDVA 1MMDA 1H3HA 5GANj 5CKFA 2KQWA 4BY6C 4OMFB 5FU7C 3J7AF 1SF9A 1MMGA 3JV3A 5KE3A 5GMKl 5C0MA 1KJWA 1CKBA 2BE9B 3A98A 3CQTA 1GL5A 1TWBA 1HK9A 3V8KA 1EZZB 2OAWA 3FDRA 5GAN3 2V8IA 2LJ0A 1X6BA 2P0KA 2H3JA 4BDYA 2COWA 4JRIA 4HCCA 2E1HA 4OMOA 2YXYA 3PIPA 3CCUA 2JTMA 1SHFA 2OTLT 2I2LA 3CC7Q 1B07A 2BZYA 3QUIA 5FRMA 4KGZB 3KFVA 2ZPGB 2FVUA 3CCST 2P84A 2JM9A 3GP8A 1TG0A 4WTOB 2XDBA 1BB9A 2HQEA 3A1PA 2JXBA 4JPBW 3VS7A 1VQLQ 4Z88A 3OYLA 4JJNK 3DB4A 3M0QA 3OSSC 3M53A 3M59A 1VQNQ 2ATCB 3V7RA 1UGVA 1K76A 2JW4A 3I55A 3TCJA 1KC8C 3DLMA 3TEEA 5I21A 2BZXA 5CAIA 5GJWB 5IXBA 1UUEA 5GAN2 2OX7A 3N5BB 3QKJA 1BIAA 1NM7A 1K73R 2RM4A 1F1BB 3P8HA 3GNFB 4A4EA 5CCAA 2CZ6B 1M8MA 2E10A 2QDLA 1X2QA 1TUCA 2XMFA 1I81A 2M0OA 1K73U 1YHQQ 5GAMe 1WJQA 5DY9A 3OYFA 2H8HA 2QA4Q 3ER0A 4OMMA 4K11A 1CKAA 3GPLA 4HT9A 4D8DA 4BACA 2LMJA 2M0YA 4LDWA 5DLQE 4BE2A 4MDXA 4J9EA 1BCMA 1TOVA 2QQBA 2FZKB 4PJOA 4E7SA 1VQ7Q 3GIBA 1KHIA 1KHCA 3L2UA 3CCJA 4ANJA 1X43A 3EGDA 1VQKT 3EG1A 3VS6A 2CSQA 4HCBA 4Y91A 2L8DA 2PTKA 1UECA 1AWWA 2R5AA 1NLPC 2E6NA 4M78E 1JXOA 3HL8A 9ATCB 1KQSA 3UT1A 2DJZA 4XK8E 4AMCA 5GANe 2RQVA 4M75E 1H641 3G7ZA 2RHZA 2Y4XA 4BI4A 2HSPA 3CCQT 2F1LA 3QDFA 5CKEA 2OAUA 3OS0A 4PJJA 3NTHA 1MNEA 2O88A 3DLLA 3CCLT 1UEBA 3EFOA 1OEBA 3V8LA 2MCNA 3ZFJA 4LD6A 1KIKA 2DL7A 3CMEQ 4FU6A 4M78D 3J80E 2EQMA 4M75D 5GANh 3M0UA 1JJ2S 2HQXA 2DO3A 4NS5A 1KQ2A 3JSCA 4J6XA 1RL2A 4RMOA 4BE0A 2QQAA 1BI1A 3OB9A 3CCEA 1W4SA 1ZBJA 4MZMA 4QQGA 3UF4A 2J6KA 4B9WA 2A28A 3I35A 2MF2A 3VUBA 4A4FA 4KRTA 1ABQA 3KBGA 4DBQA 2JNGA 4FT2A 1TSFA 1B3QA 2CP3A 5GMKh 4OF1A 4M78C 1WIEA 2DBMA 3L2RA 2DIGA 4M75C 3M57A 1S72T 1ZSZC 1RUWA 3VJPA 2RQTA 2VUBA 5LJ3d 4M7AG 1GCQC 5GAN5 2LCSA 2E3IA 1IREB 2F5KA 1Q95G 1OV3A 2DTHA 4Y92A 2DTOA 2O9SA 2RN8A 2O2OA 1YP5A 3JCMW 1VQ8T 2I0NA 1SEMA 3VYHB 1VYTA 2XICA 1VQOQ 1JRIA 1QVGS 3VUZA 1RAAB 3RNJA 4IUUA 1JQQA 2KGTA 2KAFA 1M3CA 4FSSA 2XIDA 3M9QA 4C0DC 1OZ3A 3EGXB 1XJWB 4M78F 1KD1R 3TSWA 4C92G 1M2OA 4ZN1A 3L1AA 4M75F 1UGSB 2DD5A 2QXFA 3MJXA 3M5AA 1KD1U 1PKSA 4M77A 4ORZA 1PM3A 4JLGA 3CCLA 3H41A 4QVCA 1YJNA 4IKFA 1QP3A 2PNIA 4JUVA 4PKCC 4E7KA 1LVKA 4J83A 2DL3A 2PVOB 4FSXA 1BI3A 1N27A 4JRQA 3JB9D 1GRIA 4ME7A 1K0SA 4HA8A 2RQRA 3UDCA 2QI2A 4OB1B 1MUZA 1WX6A 4GLMA 5CKDA 3CCRT 1T3SA 1OPLA 4R55A 4PFPA 5HKCA 1G8XA 4CC7A 4RTUA 3CCVT 4RTVA 1M90R 4CC2A 1BU1A 3OS5A 2GGRA 4PJOG 3VYGA 4IUVA 4F7UA 3CD6T 5EC7A 3JCMc 5L8RE 1M90U 4ZN3A 2LVMA 4MMLA 4M7DE 3MO8A 4MDWA 4C5HA 1VQMQ 1MV0B 1PSFA 3ZBDA 1I5LA 2HNIA 2WSFE 2E4HA 1H8KA 1QVGP 2EGAA 1Q7YR 2J05A 1BCOA 3QDRB 2D8JA 1ZX6A 3SHWA 4CRIA 5L23A 1Q81R 2KT1A 3J81E 2EQJA 3MPUB 3QWXX 1Q7YU 2KROA 5ECAA 3EGUA 4J9GA 3H9NA 3AHUA 4KGXB 1Q81U 2LRQA 1VQ8A 3LW5E 2Z0WA 2FO0A 2HQHA 2F5TX 2R57A 4XTYA 3CC7T 4J5YA 3I5SA 1Y0MA 4M7DD 2HMAA 1PCXA 1UJYA 2V8KA 3E9GA 1AWXA 3CPFA 1YBYA 2AZSA 1VQLT 1Q86C 2M02A 1VIFA 4AFSC 1YWPA 3JB9F 3EAEA 1VQNT 2DXCA 1WQWA 5CIUA 3EHQA 5I2MA 2PU9B 4M7AB 1AZGB 2RK2A 3ULRB 1NJIC 1B7TA 2C06A 2EYZA 1JB0E 2YUPA 3QYHB 4DBHA 4F16A 3VS0A 3CPWA 2L3QA 2C0IA 2L3RA 2RI3A 1RAFB 5DM7R 1VQ4Q 2RNAA 2EYXA 5CKHA 4M7DC 2HD0A 2ABLA 3CCMA 2O31A 3JB9I 1HJDA 1VQPA 4DA4A 1YHQT 1ZA2B 2VXEA 3X20B 2E64A 4CC4B 2YRVA 4C92B 1FMWA 5FW9A 3VS5A 3EGXA 2QA4T 1KFZA 4PJMA 4J9IA 3JCMP 3JCMe 3S3OA 2DTIA 3HP9A 5KCOA 2O4XA 1J3TA 2MIOA 1YJWQ 4FYWB 3CD6A 3V8JA 3RKYA 1VQ7T 1M27C 5CO7A 2QEXA 3GOXA 1VQ5Q 3OYDA 3L42A 3G6EQ 4N0AA 3QWYA 3BFMA 2GTJA 1U5SA 2OTJQ 1W70A 4EMKA 1N5ZA 1JU5C 2E6ZA 4M7DF 2XDPA 1MHNA 2EGEA 1NYGA 3OYAA 3UPUA 1QVFA 3PVQA 2EAYA 4HVUA 3CC4A 1ZBXA 1R8OB 2KK4A 1WLPB 4LUDA 1H3ZA 1VQ6A 1KC8R 4M77G 4FW2A 4E6RA 4OGEA 5GMKm 2K6DA 2F69A 1YI2T 4A63B 3OMCA 2EYWA 4PLIA 2ED1A 3CEYA 1C1AA 3JB9H 1KC8U 1WJRA 1VQ9A 1I0CA 1RAGB 3BW1A 2WACA 3CMET 3OYEA 2DXBA 2DRKA 2DAQA 4BDZA 3CXCP 1YCSB 3DKMA 2QTXA 2CH4W 5LJ3g 2MI6A 1M30A 2PQWA 3OYYA 3M55A 2AKLA 7AT1B 1AZEA 4A54A 3FB9A 3CBMA 1U8RA 4EMGA 1IHWA 1R77A 2VKNA 2NLUA 2CKKA 3GNGA 4F7UG 3OYIA 3ASKA 5FU6B 1UFFA 3HRSA 4IURA 2B86A 2MYSA 2X3XD 4C8QG 2F2VA 1QCOA 4AFQC 1JO8A 4OMNA 3HFOA 3QJYA 2CZ7B 1X69A 3M0PA 1HSQA 1UHFA 2K2VA 2RO0A 3PT9A 4XTWA 4O6JA 4GBQA 1QVGA 5GAMg 2H3EB 3UATA 4FW1A 4ELYC 1IGUA 3M56A 4LUEA 1OX8A 2HEQA 3SB2A 2RI2A 4M7AA 2RQUA 1D0YA 2FPDA 3I56A 3X24B 4CC3A 3EHRA 1YITQ 3CC2A 1AEYA 3QHSA 2YRCA 4KT0E 3CMAQ 2K3YA 3TVTA 1U1SA 3OSVA 2KI7A 2DVJA 5KYXB 1TUGB 4DBFA 1VQOT 5DLOA 1ZHIA 5GMKj 4E7LA 1QMCA 1AWOA 4LNPA 4KGVB 2HAXA 4YTLA 1VIEA 5KYUB 2DPPB 2K4YA 5J3BA 2CT3A 1D0XA 3PGGA 2EFIA 4C92A 1WA7A 1YNZA 1UTIA 3G71A 1YI2A 2KY9A 2KNBB 2KYMA 2QQ9A 5FLXE 5AT1B 1RLPC 1OYXA 2LC4A 3C12A 1M2VB 1I07A 1I4K1 5IXFA 1TH7A 2LJ3A 3GBQA 1QKWA 3G4SQ 4IUQA 2K3XA 1Q82C 1M8VA 2ROTA 1G2BA 1GFDA 3CBPA 1Y71A 2KYBA 2GBQA 2YUQA 2AZVA 3PTAA 3E1SA 5LJ5d 2CREA 3QJ6A 2CZ0B 2VGNA 1FMKA 3NMZC 4QKUA 2SRCA 2K5LA 3H0FA 2CP0A 4HVVA 4M77B 2RHIA 4DEXA 4QVDA 2EYQA 1YJ9Q 5IAYA 3HKSA 3M4YA 4J9BA 2FHDA 4BI8B 2BIVA 3SDZA 1WHJA 2RK1A 1LPLA 4PK4A 2EW3A 2CS7A 4LDUA 1VQMT 1QCNA 2G6FX 3LWHA 1BYMA 2BKDN 4LD9K 3OMGA 2DBKA 2OJ2A 4HT8A 2CT4A 4DQ2A 4RTTA 2R58A 4RTZA 1QVPA 3OY9A 4BY6B 1NLOC 2CP6A 2GQIA 2LP5A 4N4HA 3QSUA 2FL7A 4ZGJB 3CCUQ 3OYHA 1KG1A 5HK0A 4F7UB 2DERA 2OTLA 2QGGA 1BK2A 2DE0X 1G3WA 1K8AC 3CCSA 3LWIA 2OI3A 2K7AA 2RI5A 2KBTA 5GMKe 2JT4A 3OBWA 1DJ7B 4C8QB 2A08A 5I11A 2CUDA 2L89A 5GAOq 1RADB 1UGRB 4E7HA 3CXCA 3I55Q 1Y96B 4OB2B 4PL6A 3HFNA 1TU0B 2O9VA 4WF2A 4EMHA 1ARKA 2YT6A 5AYFA 2GQVA 2W0ZA 4JZ3A 3QIIA 2X9HA 1WFWA 3A8LB 4HCZA 1IXDA 2VXFA 1FMVA 2A3LA 3S3MA 2BE7D 5KYXA 2YLBA 3RKWA 3JAME 3S3NA 2NYSA 1G83A 2K57A 2MAMA 1RAEB 2G3RA 3UA7A 2SEMA 2K5IA 2E70A 5KYUA 3V7SA 1MMNA 3NHNA 1V76A 4FYVB 2E3HA 1QKXA 1QWEA 2JJ9A 2QAZA 4L5GA 1R0CB 5A0GA 5GJVB 3CCJQ 1YJWT 1I5OB 4M7AD 1VQKA 1YIJT 4KH0B 3GLXA 3OS2A 2HL3A 5CVIA 2RHYA 1M2VA 3G6ET 2DL8A 3UWNA 2DJQA 4QW2A 2A36A 2KMTA 5IHKA 2DA9A 4JJBA 2OTJT 2RHUA 3CCQA 3JCMV 2NWMA 3A8GB 1Q86R 2DK3A 5C6SA 3X28B 2EQKA 3NTIA 1G3YA 1WHHA 2FZCB 1VUBA 1JJ2P 2M16A 2MWOA 1Q86U 3C95A 1EFNA 2EYYA 1GXIE 2O4XB 1OZ2A 1NJIR 1D09B 2E5QA 4C92D 5GAMd 2QASA 1SKUB 4NL3A 4M7AC 1NJIU 5IN1A 1UGQB 2HKNA 2BZ8A 4OMQA 4XU0A 2EPDA 2QQRA 2K5FA 4PJOE 1YWOA 4RTYA 3E2UA 4ZGDB 2LQWA 3ZEHA 4EMKB 2RMOA 1PWTA 3CCEQ 3Q1JA 1VA7A 3A8MB 3X25B 3FRNA 1B34B 1W1FA 2DNUA 1IGQA 1WZOA 5LL6S 2ZPFB 1WJSA 1M1FA 1TXQA 2CP5A 5GANd 3OYBA 4KUIA 1G3TA 2FB7A 2RA2A 5IH2A 1FYNA 4C92C 4X34A 1UDLA 3SFMA 3KXTA 3OBYA 3FLGA 4A4HA 3LGFA 4EPCA 1ABOA 2X4XA 1X27A 1N9SA 3DB3A 2A0FB 4OP0A 4PJOD 1WXUA 2EQIA 1G5VA 4KULA 2L2PA 4M7AF 2YRDA 4V2SA 1S72A 3LYIA 2KDSA 4C8QA 2XU8A 1OX9A 3ZL7C 1ZUUA 2K79A 3JB9J 2DZ9A 2KVQG 4XTUA 5J26A 4R0KA 1T0HA 4B6MA 2AKKA 2DLPA 1Y96A 3TREA 4KH1B 5FROA 1OI1A 4TVRA 1BI0A 2DMOA 4JS5A 5IHNA 3I5RA 1I1JA 1ZSZB 1YITT 2D0QB 5KYWA 1YIJA 4QVZA 3PMIA 5HCKA 3QYGB 3L2VA 4JZ4A 3JCMg 3CMAT 5FWBA 1PRLC 5IT9E 4FT4A 5LJ3f 2ZZDA 2JOYA 2P4TA 1VYUA 4PJOC 5LJ5g 2QTVA 1PNJA 2YSQA 4JJCA 2D8HA 4C0FA 1VYVA 1WHMA 1KQSS 1WDXA 1W2BS 4F17A 5GAN4 3MEAA 4RCBA 2AHJB 2KSSA 3ME9A 4JRKA 3CCLQ 4WCIA 4N4GA 3M0RA 1YJNQ 5KH6A 3MP8A 2CZ1B 1FX7A 3LGLA 3EFRA 2LT4A 1BI2A 2C0OA 4E7IA 1QW1A 2X3WD 2V8JA 2FYKA 1D1CA 2RF0A 3FEOA 3EG0A 4II1A 2M9UA 4X1VA 3G4ST 5GAMf 5GAOl 1QQJA 2DFUA 2ESWA 5IHIA 4X9DA 3RUXA 1X6OA 4JDSA 4LDYA 3AT1B 2LDMA 2JZ2A 4PJOF 5J39A 2A37A 2JMAA 2EJ9A 3QG1A 1H92A 3CCRA 4E7JA 1ZUYA 4HKEA 5KYNA 1IHVA 2VGMA 2EJGA 1O9SA 3CCVA 1UGPB 1P92A 3QBYA 4ATOA 2EKHA 2COYA 2EQUA 2HKQB 2DX1A 2J06A 2YHTA 2ZPEB 3U23A 1NPRA 2Y90A 1YJ9T 2DVEA 3MEWA 4C5EA 2MMPA 2ZGWA 3A8HB 4RCCA 1WHKA 4RUGA 1FWZA 1NZ9A 4M77E 4XU2A 5CQYA 1YN8A 2WSCE 4C5GA 2XD0A 2LX9A 1SSFA 2LT1A 1WI7A 1PC0A 1R0BG 4MZPA 1YCYA 2D1XA 1WQ7A 4E2FB 2RHXA 1B34A 2VC8A 5EG2A 2KXDA 3WVEB 1VQ8Q 4IIMA 1NPPA 1W2BP 2DEUA 2JN0A 2DXUA 3RMSA 3CCUT 5KYYB 1JJ2A 5LJ3j 2LCCA 3NPFA 3OA6A 3HRTA 3CC7A 4PFOA 2CP7A 2VB6A 4M77D 1D0ZA 2YUNA 4JJDA 4EIKA 1N9RA 3G1JA 4F7UE 1VQLA 1Q82R 3RR6A 1GBRA 2FRWA 2NUTB 1U1TA 1IB8A 3C0CA 4IUTA 1T0JA 3I55T 1VQNA 1Q82U 3LLRA 2RJFA 2PZ1A 4C8QE 1BKBA 5M9OA 4M78A 2HBWA 1O75A 2FG0A 2QYZA 2FZGB 4M75A 4ZTJA 1SRMA 2KRMA 2QG9B 4A53A 2X4WA 3EG2A 1ZSZA 2E12A 2XHCA 4MMKA 4HXJA 1XQHA 4FIBA 3RBBB 2KXCA 3META 1GCQA 2IIMA 3CCMQ 4M77C 2RJCA 1VQPQ 2P0PA 2WSEE 3OQ5A 1N8RC 1K9MC 4BUGA 4ELZC 4XQ3A 4OMLA 3OW2S 3QZ9B 4DOVA 1YHQA 1ZSGA 1M9SA 3EH2A 2ROLA 4BI3A 3I9QA 2QA4A 2EVRA 2K3BA 1WHLA 4C8QD 1HXDA 4AT1B 4J8OA 3RESA 1UHCA 5I22A 3CD6Q 4QT7A 2QEXQ 3CCJT 1VQ7A 2ECZA 1PG5B 2AIRB 3H8ZA 2W10A 3VV0A 2RPNA 3FIFA 1PSEA 2IPOB 2X51A 4LXCA 1JEGA 1K8AR 3H0IA 4AFUC 3FC3A 1Y57A 2DD4A 1BIBA 2EIFA 3BY7A 5I2SA 2HCKA 2DYIA 2PVGB 1QLYA 1SHGA 8ATCB 2CP2A 3SWNB 4M77F 1K8AU 1XOVA 2JTFA 2Y4YA 3PMTA 3CC4Q 4DOWA 4XTZA 1UJ0A 5KE2A 1VQ6Q 5GANg 4C8QC 2L3PA 1M1KC 2CDTA 1RI9A 2MOXA 2DYBA 3BDUA 5FWCA 2EGCA 2GFUA 3H0HA 4M4ZA 4AG1C 1U3OA 3OYCA 2HZYA 2CGHA 1JBMA 1VQ9Q 2V1RA 5GAOp 5LJ3e 3VRZA 1XTDA 4C0ZA 2JS0A 3PE0A 3EH1A 3CMEA 1TS9A 5GMKi 1MV3A 3URGA 2DM1A 1E6HA 3JCMd 1D3BB 3NGPA 4JRPA 2EBPA 1ZA1B 3H6ZA 1ZQ1A 2LNHB 2LTOA 3VU3C 3OW2P 2DZCA 3MCAB 3CCET 1AOJA 1OU8A 3HPWA 2K9GA 4F7UF 2KRNA 1OU9A 4FCYA 5FRNA 3A8OB 1WHGA 2DIQA 2XKOC 2DL4A 3R6NA 2DETA 1S1NA 3THKA 1HYOA 4C8QF 5LJ3h 5KYYA 4PFZA 1WGSA 2YLCA 3LH5A 3LX7A 3VS1A 3OS1A 3BDLA 2HBPA 4A4KA 1AHJB 3PIOA 4OMPA 3CPWS 4RG8A 5GAN6 2ED0A 3FJPA 2DRMA 2O01E 1OQKA 2JTEA 3HTRA 3MEVA 5D6YA 2NUTA 4J6YA 1Y07A 3I56Q 3VS4A 2GF7A 3CC2Q 1OULA 1QCFA 5FU7B 3P8BB 2QGFB 4PNOA 1WPYA 3OYGA 4HCKA 3QO3A 4J7IA 1UG1A 3V7CA 4RG2A 1W2BA 4PJNA 2KEAA 3VKIA 3BE3A 5CKBA 5GAMh 1VQOA 2RJDA 5KCHA 4L6V5 5D6XA 4BE1A 4XAXB 2X35A 3M4GA 5CQXA 3OYMA 1X01A 3M58A 3MEUA 1KSWA 2CYZB 4GLKA 3WVDB 1XNIA 1AT1B 3UA6A 3G71Q 1YI2Q 2DXTA 1PKTA 4N0AC 2QDYB 2P4RA 1VOMA 3QZ5B 4M7DA 4M78G 1QWFA 4ESRA 1YJNT 4M75G 4EMKC 1NBEB 2DEQA 2BUDA 3REBB 2J6FA 4HVWA 4PLLA 2FPEA 5KYWB 3O5ZA 2MK5A 1QVFS 2E65A 4RKUE 2A7YA 3F70A 4PJLA 1SRLA 4M7AE 2ENMA 1NEGA 2ZPBB 2M1HA 2LNVA 4LE9A 1VQ4T 3NFCA 3M54A 1E7OA 3CPWP 3SWNA 2JUFA 3OYJA 3JCMf
chains in the Genus database with same CATH topology
5GAOn 1BI0A 4M77G 4JS5A 4XTXA 4OGEA 5GMKm 5CK9A 1V29B 2F69A 5CAIA 1YI2T 1YITT 2D0QB 3QXEB 3OMCA 4FM4B 3JCMQ 5GAN2 5GAOr 1YIJA 4PLIA 4QVZA 3PMIA 3N5BB 4ZTFA 1K73C 3CEYA 3QKJA 3QYGB 3JB9H 1BIAA 4VUBA 3O8VA 3JCMg 5LJ5f 3L2VA 1WJRA 1KC8U 5A0DA 1VQ9A 3CMAT 2RM4A 4C92E 3P8HA 5IT9E 4FT4A 3GNFB 5LJ3f 4A4EA 5CCAA 2CZ6B 3BW1A 2GCXA 2WACA 3CMET 4OGCA 4ZGEB 2DXBA 2RD1A 3OYEA 4BB7A 2E10A 2X4YA 1VQ5T 2DAQA 1VQMA 1MGQA 4BDZA 1I81A 1QP2A 2M0OA 1NE8A 2ZZDA 1K73U 4EDUA 2JOYA 2P4TA 5GAMe 4PJOC 5LJ5g 3A5ZB 3DKMA 5HK3A 3C4SA 2QTXA 1WJQA 5LJ3g 2LQKA 2MI6A 2PQWA 3OYYA 5DY9A 1D3BA 3M55A 3OYFA 4C0FA 1KQSS 2ZPIB 3ER0A 4A54A 4BD3A 1W2BS 5GAN4 3MEAA 3FB9A 3CBMA 4RCBA 3GPLA 4HT9A 4BACA 2AHJB 3WXMB 2KSSA 3ME9A 4JRKA 4LDWA 4O5VA 1U8RA 4N4GA 2RB6A 5DLQE 4BE2A 1VQNT 4MDXA 4EMGA 5KH6A 2QQBA 2GFAA 3MP8A 2LQ8A 2CZ1B 4PJOA 1FX7A 2NLUA 3LGLA 3GIBA 3EFRA 1KHIA 1KHCA 2CKKA 3GNGA 4GY5A 3L2UA 2LT4A 4F7UG 3OYIA 3CCJA 1BI2A 4E7IA 3ASKA 5FU6B 1VQKT 1QW1A 4HCBA 4Y91A 2L8DA 4KBMB 4KUDK 2V8JA 2FYKA 3HRSA 3FEOA 2IG0A 2R5AA 4IURA 2E6NA 4II1A 4M78E 2M9UA 3HL8A 1KQSA 3UT1A 2DJZA 4CI0C 4XK8E 5GANe 3G4ST 4M75E 1H641 3G7ZA 4C8QG 5GAMf 2RHZA 5GAOl 2VYTA 2Y4XA 3HFOA 4BI4A 5D6WA 3P8DA 3QJYA 2XG8D 3QPHA 4X9DA 1X6OA 4JDSA 3RUXA 3SD4A 3CCQT 2EJFA 3CBOA 2CZ7B 4LDYA 2K2VA 2RO0A 2LDMA 2JZ2A 3T9NA 3PT9A 4C0GA 4XTWA 5CKEA 4O6JA 2OAUA 4PJOF 3OS0A 1QVGA 5GAMg 5J39A 4UC4A 2EJ9A 3NTHA 3QG1A 4ELYC 3CCRA 4E7JA 1X75C 3M56A 4HKEA 3SB2A 2RI2A 4M7AA 4N4IA 2VGMA 2X4JA 2EJGA 3I56A 3OW2A 3X24B 1O9SA 3CCVA 3JB9G 4LDXA 3CC2A 1UGPB 1P92A 3DLLA 3QBYA 4ATOA 3CCLT 2EQUA 2YHTA 1G3SA 3QHSA 2ZPEB 4KT0E 1NPRA 4OB3B 1UEBA 2Y90A 1YJ9T 2DVEA 3MEWA 3V8LA 2K3YA 3ZFJA 2MMPA 2ZGWA 3A8HB 4LD6A 4RCCA 4C5EA 3OYNA 1U1SA 3OSVA 4FU6A 1FWZA 4M78D 3J80E 1VQOT 1NZ9A 4M77E 1VQ4A 2EQMA 4XU2A 5DLOA 1ZHIA 5CQYA 4M75D 5GMKj 4E7LA 2PUOB 2WSCE 5GANh 3CCMT 1VQPT 1JJ2S 4C5GA 2HQXA 2LX9A 4Y28E 1SSFA 2DO3A 3RIRA 2XD0A 3HSBA 2LT1A 2HAXA 4YTLA 4XU1A 4NS5A 1KQ2A 1VIEA 3JSCA 4J6XA 3TU4K 1RL2A 2DPPB 2K4YA 5J3BA 4D6WA 4RMOA 1IZ6A 4BE0A 2QQAA 1BI1A 3OB9A 4MZPA 4XU3A 3CCEA 1W4SA 1YCYA 3PGGA 1WQ7A 2EFIA 3RMQA 4MZMA 4C92A 4Q5WA 2RHXA 2ZCFB 1B34A 4QQGA 3G71A 1LOJA 1YI2A 2VC8A 5EG2A 3WVEB 2E41A 1NPPA 4M78B 2KY9A 5GAOm 1I5LA 4B9WA 2RH2A 2JN0A 5LJ5j 2QQ9A 2DXUA 2MF2A 4NL2A 4M75B 3RMSA 3VUBA 5FLXE 1YJWA 4A4FA 3CCUT 1OYXA 3KBGA 5LJ3j 2QEXT 1JJ2A 2JNGA 4FT2A 4QQDA 3S6WA 2LCCA 2LC4A 3C12A 1VQ5A 3OA6A 3HRTA 3CC7A 4MZTA 1I4K1 5GMKh 1TH7A 4M77D 4OF1A 4M78C 3G6EA 3L2RA 4IUQA 2K3XA 1Q82C 1N9RA 2DIGA 3R6OA 4M75C 1M8VA 3M57A 3MP6A 4F7UE 4R56A 1S72T 3CBPA 4C92F 1VQLA 1Y71A 1LJOA 2OTJA 1WNLA 3PTAA 3E1SA 5LJ5d 3QJ6A 2CZ0B 2VGNA 1U1TA 3JCMJ 3VJPA 4IUTA 2VUBA 5LJ3d 3I55T 1VQNA 2RJEA 3CC4T 4M7AG 1Q82U 3LLRA 5GAN5 2RJFA 4C8QE 2K5LA 1BKBA 5M9OA 1VQ6T 3RERA 2L5QA 1IREB 2F5KA 4M78A 4M7DG 1O75A 2P0QA 4M77B 2IVWA 2DTHA 4M75A 4ZTJA 2RHIA 2DTOA 4QVDA 2EYQA 3S3OA 4A53A 3JCMW 1VQ8T 2X4WA 5IAYA 3INZA 4C0DB 3HKSA 1VQ9T 2E12A 3M4YA 2XHCA 2FHDA 4MMKA 2BIVA 3VYHB 3SDZA 4BI8B 2RK1A 3L2WA 1XQHA 4FIBA 2XICA 1QVGS 5CR2A 1JRIA 3RKXA 3META 3JCMX 3VUZA 2B8AA 4OVAA 1RI0A 2CS7A 4LDUA 1VQMT 4M77C 2RJCA 4IUUA 2P0PA 2WSEE 3OQ5A 4JLIA 1N8RC 1K9MC 2KAFA 4BUGA 4ELZC 2MWPA 3LWHA 2PUKB 4XQ3A 3OW2S 3QZ9B 1BYMA 4DOVA 1YHQA 2VV5A 2BKDN 2XIDA 3OMGA 3KUFA 1KD1C 3M9QA 4C0DC 4LD9K 1OZ3A 4HT8A 2XK0A 4M78F 4DQ2A 1M9SA 4C92G 4ZN1A 3L1AA 1M1GA 4BI3A 4M75F 5FU6C 1UGSB 2R58A 2QA4A 1N8RU 1QVPA 3OY9A 2DD5A 1K9MU 2QXFA 3PFSA 4BY6B 4C8QD 2D6FA 1HXDA 3M5AA 4J8OA 3RESA 2LCLA 1KD1U 4M77A 4JLGA 3CCLA 1I8FA 4N4HA 4QVCA 3QSUA 1EIFA 1YJNA 4IKFA 1QP3A 2FL7A 4ZGJB 3OYHA 3CXCS 3CCJT 1KG1A 4JUVA 1LNXA 4PKCC 5HK0A 1VQ7A 4F7UB 4Z02A 4E7KA 2OTLA 3H8ZA 4J83A 3VV0A 3FIFA 1PSEA 2PVOB 2ZPHB 1BI3A 4FSXA 4P5NA 1G3WA 1K8AC 3CCSA 2JVVA 1N27A 3LWIA 4JRQA 3JB9D 2RI5A 3LH0A 5GMKe 4ME7A 3FC3A 4JS4A 3OBWA 1DJ7B 2DD4A 4C8QB 1BIBA 5GANf 4NOYA 2EIFA 3BY7A 5I2SA 1M4ZA 4HA8A 2PVGB 3UDCA 1K8AU 2L89A 2QI2A 2QQSA 4M77F 1UGRB 4OB1B 3SWNB 5GAOq 4E7HA 1XOVA 2JTFA 4A4GA 3CXCA 2Y4YA 1Y96B 1KQ1A 3PMTA 4E47A 4DOWA 2EWNA 5CKDA 4OB2B 4XTZA 3CCRT 4PL6A 5KE2A 5GANg 3HFNA 1M90C 4C8QC 4R55A 5HKCA 1M1KC 3I56T 3CCVT 4WF2A 3CC2T 3E19A 3BDUA 1Y7XA 2GFUA 4C5IA 2DKGA 3OS5A 4PJOG 4EMHA 3JCMb 3VYGA 5LJ5e 5GAN8 1YITA 3X26B 3OYCA 3SWNC 2CGHA 1JBMA 4IUVA 2GQVA 2PVDB 5AYFA 4F7UA 5GAOp 5LJ3e 3CD6T 3JRZA 3JCMc 5L8RE 3CMAA 1XTDA 3QIIA 4C0ZA 1M90U 1M1KU 4ZN3A 4L59A 2LVMA 4MMLA 4M7DE 3MO8A 4MDWA 4C5HA 3CMEA 3A8LB 4HCZA 1PSFA 2VXFA 3ZBDA 5GMKi 1UB4A 2A3LA 2HNIA 2WSFE 3URGA 3S3MA 1Q7YC 4FL6A 3JCMd 2YLBA 2XI9A 1D3BB 3QDRB 3RKWA 4JRPA 3JAME 3S3NA 1Q81C 2K57A 3H6ZA 1ZQ1A 4CRIA 2LTOA 2MAMA 3VU3C 2EKOA 2DZCA 2G3RA 3MCAB 3CCET 3J81E 2EQJA 2K5IA 2E70A 3C94A 3JCMh 1Q7YU 4J6WA 3V7SA 4X9CA 3HPWA 2R5MA 5GAN7 4F7UF 3AHUA 3G71T 4L5GA 5FRNA 4PJOB 4XTVA 3A8OB 5HY6A 4OB0B 2DIQA 1Q81U 2LRQA 2XKOC 3MHXA 3HHTB 5A0GA 1VQ8A 3LW5E 5A0LA 1YJWT 5LJ5h 4M7AD 4C8QF 1VQKA 2F5TX 2R57A 5LJ3h 1YIJT 4IUPA 4XTYA 3CC7T 1FXXA 4J5YA 1WGSA 3GLXA 4M7DD 4QQ6A 3OS2A 2YLCA 5CVIA 2RHYA 3LX7A 3G6ET 3OS1A 3OYKA 3UWNA 3MP1A 2V8KA 3BDLA 4J7FA 4QW2A 3G4SA 5GAMj 2HBPA 3E9GA 4A4KA 1AHJB 3CPFA 2KMTA 3PIOA 3CPWS 1YBYA 1VQLT 3EFSA 2OTJT 2RHUA 4RG8A 1Q86C 1N6AA 3CCQA 3JCMV 3L2ZA 5GAN6 3L2QA 1VIFA 3A8GB 3FJPA 2DK3A 5C6SA 3X28B 3JB9F 2EQKA 3EAEA 2O01E 1M5Q1 3NTIA 1G3YA 2DXCA 3HRUA 3MEVA 1WQWA 5D6YA 5CIUA 4J6YA 5I2MA 2PU9B 4M7AB 1Y07A 2XDDA 1VUBA 2RK2A 2M16A 2MWOA 2C06A 1NJIC 1Q86U 3C95A 3E9FA 2GF7A 1H3ZA 4B9XA 4M7DB 1GXIE 1JB0E 3QYHB 2O4XB 1OZ2A 5FU7B 3GF5A 3P8BB 1VQ6A 2D9TA 2E5QA 4C92D 5GAMd 4PNOA 1WPYA 3NTKA 4NL3A 3OYGA 3PNWC 3CPWA 1YJ9A 2L3RA 5A2QE 3QO3A 4J7IA 2RI3A 3V7CA 4RG2A 5DM7R 4M7AC 1NJIU 1W2BA 5IN1A 1UGQB 4LDVA 5CKHA 4XU0A 3VKIA 5CKBA 5GAMh 5GANj 1VQOA 4M7DC 5CKFA 2KQWA 2QQRA 2HD0A 2RJDA 4BY6C 2K5FA 4OMFB 5FU7C 5KCHA 4L6V5 3CCMA 3JB9I 3J7AF 4PJOE 5D6XA 1VQPA 5KE3A 4BE1A 5GMKl 4ZGDB 4DA4A 5C0MA 4XAXB 1YHQT 2X35A 3M4GA 3ZEHA 2VXEA 5CQXA 3X20B 4EMKB 2E64A 3OYMA 1X01A 2YRVA 1HK9A 3M58A 3MEUA 3Q1JA 4C92B 3A8MB 2CYZB 4GLKA 3FRNA 1B34B 3V8KA 3WVDB 1XNIA 3FDRA 3X25B 2QA4T 5GAN3 5LL6S 2DXTA 2V8IA 2ZPFB 4N0AC 1WJSA 2P0KA 3JCMe 1M1FA 2DTIA 2QDYB 2H3JA 3QZ5B 4BDYA 3HP9A 3JCMP 4M78G 4M7DA 5KCOA 2O4XA 5GANd 1YJNT 3OYBA 4KUIA 4M75G 4JRIA 4EMKC 3CD6A 2DEQA 1G3TA 2FB7A 2BUDA 2E1HA 2RA2A 4PLLA 3V8JA 4HCCA 3RKYA 3PIPA 1VQ7T 5CO7A 4C92C 2JTMA 3CCUA 4X34A 2QEXA 3SFMA 3GOXA 2OTLT 2E65A 1QVFS 4RKUE 2A7YA 2I2LA 3F70A 3KXTA 3OBYA 3QUIA 3FLGA 5FRMA 4A4HA 3LGFA 4EPCA 3OYDA 2ZPGB 2FVUA 3L42A 3CCST 2X4XA 3GP8A 4M7AE 1N9SA 3DB3A 4N0AA 3BFMA 4OP0A 2XDBA 2HQEA 4PJOD 2ZPBB 1G5VA 2M1HA 2LNVA 4KULA 1VQ4T 3NFCA 4M7AF 4V2SA 3OYLA 4JJNK 4EMKA 1S72A 3DB4A 2KDSA 3LYIA 3M54A 4C8QA 2XU8A 2E6ZA 4M7DF 3OSSC 2XDPA 3M53A 3JB9J 2DZ9A 2KVQG 3M59A 4XTUA 5J26A 1MHNA 3V7RA 3SWNA 3OYAA 3UPUA 3I55A 1QVFA 2EAYA 3TCJA 2JUFA 3OYJA 3CC4A 1KC8C 1ZBXA 3JCMf 3DLMA 3TREA 1Y96A 3TEEA 1R8OB 2KK4A 5FROA 5I21A 1OI1A 4TVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KSS A; 
#chains in the Genus database with same CATH topology
 2VAS A;  5GAO n;  4D8K A;  4XTX A;  5CK9 A;  1V29 B;  4RTX A;  3QXE B;  4FM4 B;  3JCM Q;  5GAO r;  1ACM B;  1IO6 A;  4ZTF A;  1K73 C;  2MPX C;  4VUB A;  3O8V A;  5LJ5 f;  1MND A;  5A0D A;  1IRX A;  4C92 E;  2NUZ A;  1C6V X;  1T3L A;  2GCX A;  4OGC A;  4ZGE B;  2RD1 A;  6AT1 B;  4BB7 A;  2X4Y A;  1VQ5 T;  1VQM A;  1MGQ A;  1TUD A;  1QP2 A;  1NE8 A;  1OPK A;  4EDU A;  2KR3 A;  3A5Z B;  5HK3 A;  3EG9 B;  3C4S A;  2LQK A;  2C0T A;  1D3B A;  2ZPI B;  3REA B;  3M0T A;  4BD3 A;  1SSH A;  3WXM B;  4O5V A;  2RQW A;  2RB6 A;  1NYF A;  2FEI A;  2M51 A;  2GFA A;  1SG5 A;  2LQ8 A;  3VS3 A;  4GY5 A;  2OTL Q;  1X2K A;  1E6G A;  4KBM B;  4KUD K;  3CCS Q;  2IG0 A;  1QVF P;  4CI0 C;  4Z8A A;  4IIO A;  1Z9Q A;  2VYT A;  5D6W A;  3P8D A;  2XG8 D;  3QPH A;  4J9F A;  3SD4 A;  1X6G A;  2EJF A;  3CBO A;  2LQN A;  1JXM A;  3T9N A;  2KT8 A;  4C0G A;  4J9D A;  2L0A A;  4UC4 A;  1X75 C;  4N4I A;  2X4J A;  3OW2 A;  4LDX A;  3JB9 G;  4Z89 A;  4ZNX A;  2BTT A;  4DBR A;  1G3S A;  2JMC A;  4OB3 B;  2DF6 A;  2NUP B;  1D1A A;  3VS2 A;  3OYN A;  1VQ4 A;  2KE9 A;  2PUO B;  3CCM T;  5D7U A;  1VQP T;  1V1C A;  4Y28 E;  3RIR A;  3HSB A;  4XU1 A;  1ZUK A;  3TU4 K;  4J9C A;  4D6W A;  2J7I A;  3MKD A;  1IZ6 A;  4XU3 A;  2GTO A;  3RMQ A;  4Q5W A;  2ZCF B;  1AD5 A;  1LOJ A;  2E41 A;  2HDA A;  4M78 B;  5GAO m;  1TTH B;  2RH2 A;  1WYX A;  5LJ5 j;  4NL2 A;  4M75 B;  1YJW A;  1VQK Q;  2QEX T;  4QQD A;  3S6W A;  2YDL A;  1VQ5 A;  3VRY A;  1WXB A;  4MZT A;  4DEY A;  1RAI B;  3G6E A;  1RLQ C;  1D1B A;  3R6O A;  2LZ6 B;  1PD0 A;  3MP6 A;  4R56 A;  3CCQ Q;  4C92 F;  1U06 A;  1LJO A;  2OTJ A;  1PD1 A;  1WNL A;  2V1Q A;  3JCM J;  2RJE A;  3CC4 T;  1RAC B;  2CH4 A;  1C0M A;  1VQ6 T;  2L5Q A;  3RER A;  4M7D G;  2P0Q A;  2IVW A;  1K0X A;  1NEB A;  1K4U S;  2L3S A;  3INZ A;  4C0D B;  1VQ9 T;  3L2W A;  5CR2 A;  3RKX A;  3JCM X;  2B8A A;  4OVA A;  1K9A A;  1RI0 A;  8AT1 B;  1NG2 A;  4JLI A;  2MWP A;  2PUK B;  1N8R R;  1K9M R;  2VV5 A;  1KD1 C;  3KUF A;  2DL5 A;  2XK0 A;  3EG9 A;  2FPF A;  1M1G A;  5FU6 C;  1N8R U;  4FYX B;  1K9M U;  3PFS A;  2D6F A;  2LCL A;  1ZLM A;  1AVZ C;  1I8F A;  1LCK A;  1EIF A;  3CXC S;  1LNX A;  3IQL A;  1GCP A;  1WXT A;  2COZ A;  4Z02 A;  2F2W A;  3PVL A;  3M0S A;  2LX7 A;  2ZPH B;  4P5N A;  1Z9Z A;  2JVV A;  1SPK A;  2CSI A;  3LH0 A;  4AFZ C;  4JS4 A;  1MMA A;  1S72 Q;  5GAN f;  4NOY A;  4E7Z A;  3RDV A;  1M4Z A;  1M3A A;  2QQS A;  1PHT A;  4J9H A;  4A4G A;  2CUB A;  4E47 A;  1KQ1 A;  2E5K A;  3TQ7 P;  2EWN A;  3FJ5 A;  2K2M A;  4LN2 A;  2JS2 A;  1M90 C;  2J6O A;  1OOT A;  3I56 T;  3CC2 T;  3E19 A;  1YIJ Q;  1M1K R;  1UE9 A;  1Y7X A;  2AT1 B;  4C5I A;  2DKG A;  4F14 A;  3JCM b;  1A0N B;  5LJ5 e;  5GAN 8;  1YIT A;  3X26 B;  3SWN C;  1KQS P;  2PVD B;  2D0N A;  1YFN A;  3JRZ A;  1K1Z A;  3TSZ A;  3CMA A;  1M1K U;  2NUP A;  4L59 A;  3D7S B;  2QK0 A;  1UB4 A;  2KRS A;  1Q7Y C;  1GBQ A;  4FL6 A;  3EG3 A;  2XI9 A;  2GNC A;  2VWF A;  1Q81 C;  2ZAE A;  2EKO A;  1GFC A;  1W6X A;  3C94 A;  3JCM h;  1BBZ A;  1HD3 A;  4J6W A;  4X9C A;  2YWW A;  4FYY B;  2DIL A;  2R5M A;  5GAN 7;  3G71 T;  4PJO B;  4XTV A;  5HY6 A;  4OB0 B;  3MHX A;  4F04 B;  3HHT B;  3EGD B;  5A0L A;  5LJ5 h;  2YUO A;  1M3B A;  4IUP A;  1FXX A;  2F2X A;  2AK5 A;  1PRM C;  2VVK A;  4QQ6 A;  3OYK A;  3MP1 A;  4J7F A;  3SEM A;  3G4S A;  5GAM j;  2FRY A;  4RTW A;  2HL5 C;  3EFS A;  1N6A A;  1EX4 A;  3L2Z A;  3L2Q A;  2LJ1 A;  1M5Q 1;  3HRU A;  3CCR Q;  1CSK A;  2XDD A;  1RAB B;  1AWJ A;  2HSE B;  3CCV Q;  1KK7 A;  3E9F A;  4B9X A;  4M7D B;  2JM8 A;  1RAH B;  3GF5 A;  2D9T A;  3EFO B;  2V26 A;  3NTK A;  3PNW C;  1YJ9 A;  4AG2 C;  5A2Q E;  4LDV A;  1MMD A;  1H3H A;  5GAN j;  5CKF A;  2KQW A;  4BY6 C;  4OMF B;  5FU7 C;  3J7A F;  1SF9 A;  1MMG A;  3JV3 A;  5KE3 A;  5GMK l;  5C0M A;  1KJW A;  1CKB A;  2BE9 B;  3A98 A;  3CQT A;  1GL5 A;  1TWB A;  1HK9 A;  3V8K A;  1EZZ B;  2OAW A;  3FDR A;  5GAN 3;  2V8I A;  2LJ0 A;  1X6B A;  2P0K A;  2H3J A;  4BDY A;  2COW A;  4JRI A;  4HCC A;  2E1H A;  4OMO A;  2YXY A;  3PIP A;  3CCU A;  2JTM A;  1SHF A;  2OTL T;  2I2L A;  3CC7 Q;  1B07 A;  2BZY A;  3QUI A;  5FRM A;  4KGZ B;  3KFV A;  2ZPG B;  2FVU A;  3CCS T;  2P84 A;  2JM9 A;  3GP8 A;  1TG0 A;  4WTO B;  2XDB A;  1BB9 A;  2HQE A;  3A1P A;  2JXB A;  4JPB W;  3VS7 A;  1VQL Q;  4Z88 A;  3OYL A;  4JJN K;  3DB4 A;  3M0Q A;  3OSS C;  3M53 A;  3M59 A;  1VQN Q;  2ATC B;  3V7R A;  1UGV A;  1K76 A;  2JW4 A;  3I55 A;  3TCJ A;  1KC8 C;  3DLM A;  3TEE A;  5I21 A;  2BZX A;  5CAI A;  5GJW B;  5IXB A;  1UUE A;  5GAN 2;  2OX7 A;  3N5B B;  3QKJ A;  1BIA A;  1NM7 A;  1K73 R;  2RM4 A;  1F1B B;  3P8H A;  3GNF B;  4A4E A;  5CCA A;  2CZ6 B;  1M8M A;  2E10 A;  2QDL A;  1X2Q A;  1TUC A;  2XMF A;  1I81 A;  2M0O A;  1K73 U;  1YHQ Q;  5GAM e;  1WJQ A;  5DY9 A;  3OYF A;  2H8H A;  2QA4 Q;  3ER0 A;  4OMM A;  4K11 A;  1CKA A;  3GPL A;  4HT9 A;  4D8D A;  4BAC A;  2LMJ A;  2M0Y A;  4LDW A;  5DLQ E;  4BE2 A;  4MDX A;  4J9E A;  1BCM A;  1TOV A;  2QQB A;  2FZK B;  4PJO A;  4E7S A;  1VQ7 Q;  3GIB A;  1KHI A;  1KHC A;  3L2U A;  3CCJ A;  4ANJ A;  1X43 A;  3EGD A;  1VQK T;  3EG1 A;  3VS6 A;  2CSQ A;  4HCB A;  4Y91 A;  2L8D A;  2PTK A;  1UEC A;  1AWW A;  2R5A A;  1NLP C;  2E6N A;  4M78 E;  1JXO A;  3HL8 A;  9ATC B;  1KQS A;  3UT1 A;  2DJZ A;  4XK8 E;  4AMC A;  5GAN e;  2RQV A;  4M75 E;  1H64 1;  3G7Z A;  2RHZ A;  2Y4X A;  4BI4 A;  2HSP A;  3CCQ T;  2F1L A;  3QDF A;  5CKE A;  2OAU A;  3OS0 A;  4PJJ A;  3NTH A;  1MNE A;  2O88 A;  3DLL A;  3CCL T;  1UEB A;  3EFO A;  1OEB A;  3V8L A;  2MCN A;  3ZFJ A;  4LD6 A;  1KIK A;  2DL7 A;  3CME Q;  4FU6 A;  4M78 D;  3J80 E;  2EQM A;  4M75 D;  5GAN h;  3M0U A;  1JJ2 S;  2HQX A;  2DO3 A;  4NS5 A;  1KQ2 A;  3JSC A;  4J6X A;  1RL2 A;  4RMO A;  4BE0 A;  2QQA A;  1BI1 A;  3OB9 A;  3CCE A;  1W4S A;  1ZBJ A;  4MZM A;  4QQG A;  3UF4 A;  2J6K A;  4B9W A;  2A28 A;  3I35 A;  2MF2 A;  3VUB A;  4A4F A;  4KRT A;  1ABQ A;  3KBG A;  4DBQ A;  2JNG A;  4FT2 A;  1TSF A;  1B3Q A;  2CP3 A;  5GMK h;  4OF1 A;  4M78 C;  1WIE A;  2DBM A;  3L2R A;  2DIG A;  4M75 C;  3M57 A;  1S72 T;  1ZSZ C;  1RUW A;  3VJP A;  2RQT A;  2VUB A;  5LJ3 d;  4M7A G;  1GCQ C;  5GAN 5;  2LCS A;  2E3I A;  1IRE B;  2F5K A;  1Q95 G;  1OV3 A;  2DTH A;  4Y92 A;  2DTO A;  2O9S A;  2RN8 A;  2O2O A;  1YP5 A;  3JCM W;  1VQ8 T;  2I0N A;  1SEM A;  3VYH B;  1VYT A;  2XIC A;  1VQO Q;  1JRI A;  1QVG S;  3VUZ A;  1RAA B;  3RNJ A;  4IUU A;  1JQQ A;  2KGT A;  2KAF A;  1M3C A;  4FSS A;  2XID A;  3M9Q A;  4C0D C;  1OZ3 A;  3EGX B;  1XJW B;  4M78 F;  1KD1 R;  3TSW A;  4C92 G;  1M2O A;  4ZN1 A;  3L1A A;  4M75 F;  1UGS B;  2DD5 A;  2QXF A;  3MJX A;  3M5A A;  1KD1 U;  1PKS A;  4M77 A;  4ORZ A;  1PM3 A;  4JLG A;  3CCL A;  3H41 A;  4QVC A;  1YJN A;  4IKF A;  1QP3 A;  2PNI A;  4JUV A;  4PKC C;  4E7K A;  1LVK A;  4J83 A;  2DL3 A;  2PVO B;  4FSX A;  1BI3 A;  1N27 A;  4JRQ A;  3JB9 D;  1GRI A;  4ME7 A;  1K0S A;  4HA8 A;  2RQR A;  3UDC A;  2QI2 A;  4OB1 B;  1MUZ A;  1WX6 A;  4GLM A;  5CKD A;  3CCR T;  1T3S A;  1OPL A;  4R55 A;  4PFP A;  5HKC A;  1G8X A;  4CC7 A;  4RTU A;  3CCV T;  4RTV A;  1M90 R;  4CC2 A;  1BU1 A;  3OS5 A;  2GGR A;  4PJO G;  3VYG A;  4IUV A;  4F7U A;  3CD6 T;  5EC7 A;  3JCM c;  5L8R E;  1M90 U;  4ZN3 A;  2LVM A;  4MML A;  4M7D E;  3MO8 A;  4MDW A;  4C5H A;  1VQM Q;  1MV0 B;  1PSF A;  3ZBD A;  1I5L A;  2HNI A;  2WSF E;  2E4H A;  1H8K A;  1QVG P;  2EGA A;  1Q7Y R;  2J05 A;  1BCO A;  3QDR B;  2D8J A;  1ZX6 A;  3SHW A;  4CRI A;  5L23 A;  1Q81 R;  2KT1 A;  3J81 E;  2EQJ A;  3MPU B;  3QWX X;  1Q7Y U;  2KRO A;  5ECA A;  3EGU A;  4J9G A;  3H9N A;  3AHU A;  4KGX B;  1Q81 U;  2LRQ A;  1VQ8 A;  3LW5 E;  2Z0W A;  2FO0 A;  2HQH A;  2F5T X;  2R57 A;  4XTY A;  3CC7 T;  4J5Y A;  3I5S A;  1Y0M A;  4M7D D;  2HMA A;  1PCX A;  1UJY A;  2V8K A;  3E9G A;  1AWX A;  3CPF A;  1YBY A;  2AZS A;  1VQL T;  1Q86 C;  2M02 A;  1VIF A;  4AFS C;  1YWP A;  3JB9 F;  3EAE A;  1VQN T;  2DXC A;  1WQW A;  5CIU A;  3EHQ A;  5I2M A;  2PU9 B;  4M7A B;  1AZG B;  2RK2 A;  3ULR B;  1NJI C;  1B7T A;  2C06 A;  2EYZ A;  1JB0 E;  2YUP A;  3QYH B;  4DBH A;  4F16 A;  3VS0 A;  3CPW A;  2L3Q A;  2C0I A;  2L3R A;  2RI3 A;  1RAF B;  5DM7 R;  1VQ4 Q;  2RNA A;  2EYX A;  5CKH A;  4M7D C;  2HD0 A;  2ABL A;  3CCM A;  2O31 A;  3JB9 I;  1HJD A;  1VQP A;  4DA4 A;  1YHQ T;  1ZA2 B;  2VXE A;  3X20 B;  2E64 A;  4CC4 B;  2YRV A;  4C92 B;  1FMW A;  5FW9 A;  3VS5 A;  3EGX A;  2QA4 T;  1KFZ A;  4PJM A;  4J9I A;  3JCM P;  3JCM e;  3S3O A;  2DTI A;  3HP9 A;  5KCO A;  2O4X A;  1J3T A;  2MIO A;  1YJW Q;  4FYW B;  3CD6 A;  3V8J A;  3RKY A;  1VQ7 T;  1M27 C;  5CO7 A;  2QEX A;  3GOX A;  1VQ5 Q;  3OYD A;  3L42 A;  3G6E Q;  4N0A A;  3QWY A;  3BFM A;  2GTJ A;  1U5S A;  2OTJ Q;  1W70 A;  4EMK A;  1N5Z A;  1JU5 C;  2E6Z A;  4M7D F;  2XDP A;  1MHN A;  2EGE A;  1NYG A;  3OYA A;  3UPU A;  1QVF A;  3PVQ A;  2EAY A;  4HVU A;  3CC4 A;  1ZBX A;  1R8O B;  2KK4 A;  1WLP B;  4LUD A;  1H3Z A;  1VQ6 A;  1KC8 R;  4M77 G;  4FW2 A;  4E6R A;  4OGE A;  5GMK m;  2K6D A;  2F69 A;  1YI2 T;  4A63 B;  3OMC A;  2EYW A;  4PLI A;  2ED1 A;  3CEY A;  1C1A A;  3JB9 H;  1KC8 U;  1WJR A;  1VQ9 A;  1I0C A;  1RAG B;  3BW1 A;  2WAC A;  3CME T;  3OYE A;  2DXB A;  2DRK A;  2DAQ A;  4BDZ A;  3CXC P;  1YCS B;  3DKM A;  2QTX A;  2CH4 W;  5LJ3 g;  2MI6 A;  1M30 A;  2PQW A;  3OYY A;  3M55 A;  2AKL A;  7AT1 B;  1AZE A;  4A54 A;  3FB9 A;  3CBM A;  1U8R A;  4EMG A;  1IHW A;  1R77 A;  2VKN A;  2NLU A;  2CKK A;  3GNG A;  4F7U G;  3OYI A;  3ASK A;  5FU6 B;  1UFF A;  3HRS A;  4IUR A;  2B86 A;  2MYS A;  2X3X D;  4C8Q G;  2F2V A;  1QCO A;  4AFQ C;  1JO8 A;  4OMN A;  3HFO A;  3QJY A;  2CZ7 B;  1X69 A;  3M0P A;  1HSQ A;  1UHF A;  2K2V A;  2RO0 A;  3PT9 A;  4XTW A;  4O6J A;  4GBQ A;  1QVG A;  5GAM g;  2H3E B;  3UAT A;  4FW1 A;  4ELY C;  1IGU A;  3M56 A;  4LUE A;  1OX8 A;  2HEQ A;  3SB2 A;  2RI2 A;  4M7A A;  2RQU A;  1D0Y A;  2FPD A;  3I56 A;  3X24 B;  4CC3 A;  3EHR A;  1YIT Q;  3CC2 A;  1AEY A;  3QHS A;  2YRC A;  4KT0 E;  3CMA Q;  2K3Y A;  3TVT A;  1U1S A;  3OSV A;  2KI7 A;  2DVJ A;  5KYX B;  1TUG B;  4DBF A;  1VQO T;  5DLO A;  1ZHI A;  5GMK j;  4E7L A;  1QMC A;  1AWO A;  4LNP A;  4KGV B;  2HAX A;  4YTL A;  1VIE A;  5KYU B;  2DPP B;  2K4Y A;  5J3B A;  2CT3 A;  1D0X A;  3PGG A;  2EFI A;  4C92 A;  1WA7 A;  1YNZ A;  1UTI A;  3G71 A;  1YI2 A;  2KY9 A;  2KNB B;  2KYM A;  2QQ9 A;  5FLX E;  5AT1 B;  1RLP C;  1OYX A;  2LC4 A;  3C12 A;  1M2V B;  1I07 A;  1I4K 1;  5IXF A;  1TH7 A;  2LJ3 A;  3GBQ A;  1QKW A;  3G4S Q;  4IUQ A;  2K3X A;  1Q82 C;  1M8V A;  2ROT A;  1G2B A;  1GFD A;  3CBP A;  1Y71 A;  2KYB A;  2GBQ A;  2YUQ A;  2AZV A;  3PTA A;  3E1S A;  5LJ5 d;  2CRE A;  3QJ6 A;  2CZ0 B;  2VGN A;  1FMK A;  3NMZ C;  4QKU A;  2SRC A;  2K5L A;  3H0F A;  2CP0 A;  4HVV A;  4M77 B;  2RHI A;  4DEX A;  4QVD A;  2EYQ A;  1YJ9 Q;  5IAY A;  3HKS A;  3M4Y A;  4J9B A;  2FHD A;  4BI8 B;  2BIV A;  3SDZ A;  1WHJ A;  2RK1 A;  1LPL A;  4PK4 A;  2EW3 A;  2CS7 A;  4LDU A;  1VQM T;  1QCN A;  2G6F X;  3LWH A;  1BYM A;  2BKD N;  4LD9 K;  3OMG A;  2DBK A;  2OJ2 A;  4HT8 A;  2CT4 A;  4DQ2 A;  4RTT A;  2R58 A;  4RTZ A;  1QVP A;  3OY9 A;  4BY6 B;  1NLO C;  2CP6 A;  2GQI A;  2LP5 A;  4N4H A;  3QSU A;  2FL7 A;  4ZGJ B;  3CCU Q;  3OYH A;  1KG1 A;  5HK0 A;  4F7U B;  2DER A;  2OTL A;  2QGG A;  1BK2 A;  2DE0 X;  1G3W A;  1K8A C;  3CCS A;  3LWI A;  2OI3 A;  2K7A A;  2RI5 A;  2KBT A;  5GMK e;  2JT4 A;  3OBW A;  1DJ7 B;  4C8Q B;  2A08 A;  5I11 A;  2CUD A;  2L89 A;  5GAO q;  1RAD B;  1UGR B;  4E7H A;  3CXC A;  3I55 Q;  1Y96 B;  4OB2 B;  4PL6 A;  3HFN A;  1TU0 B;  2O9V A;  4WF2 A;  4EMH A;  1ARK A;  2YT6 A;  5AYF A;  2GQV A;  2W0Z A;  4JZ3 A;  3QII A;  2X9H A;  1WFW A;  3A8L B;  4HCZ A;  1IXD A;  2VXF A;  1FMV A;  2A3L A;  3S3M A;  2BE7 D;  5KYX A;  2YLB A;  3RKW A;  3JAM E;  3S3N A;  2NYS A;  1G83 A;  2K57 A;  2MAM A;  1RAE B;  2G3R A;  3UA7 A;  2SEM A;  2K5I A;  2E70 A;  5KYU A;  3V7S A;  1MMN A;  3NHN A;  1V76 A;  4FYV B;  2E3H A;  1QKX A;  1QWE A;  2JJ9 A;  2QAZ A;  4L5G A;  1R0C B;  5A0G A;  5GJV B;  3CCJ Q;  1YJW T;  1I5O B;  4M7A D;  1VQK A;  1YIJ T;  4KH0 B;  3GLX A;  3OS2 A;  2HL3 A;  5CVI A;  2RHY A;  1M2V A;  3G6E T;  2DL8 A;  3UWN A;  2DJQ A;  4QW2 A;  2A36 A;  2KMT A;  5IHK A;  2DA9 A;  4JJB A;  2OTJ T;  2RHU A;  3CCQ A;  3JCM V;  2NWM A;  3A8G B;  1Q86 R;  2DK3 A;  5C6S A;  3X28 B;  2EQK A;  3NTI A;  1G3Y A;  1WHH A;  2FZC B;  1VUB A;  1JJ2 P;  2M16 A;  2MWO A;  1Q86 U;  3C95 A;  1EFN A;  2EYY A;  1GXI E;  2O4X B;  1OZ2 A;  1NJI R;  1D09 B;  2E5Q A;  4C92 D;  5GAM d;  2QAS A;  1SKU B;  4NL3 A;  4M7A C;  1NJI U;  5IN1 A;  1UGQ B;  2HKN A;  2BZ8 A;  4OMQ A;  4XU0 A;  2EPD A;  2QQR A;  2K5F A;  4PJO E;  1YWO A;  4RTY A;  3E2U A;  4ZGD B;  2LQW A;  3ZEH A;  4EMK B;  2RMO A;  1PWT A;  3CCE Q;  3Q1J A;  1VA7 A;  3A8M B;  3X25 B;  3FRN A;  1B34 B;  1W1F A;  2DNU A;  1IGQ A;  1WZO A;  5LL6 S;  2ZPF B;  1WJS A;  1M1F A;  1TXQ A;  2CP5 A;  5GAN d;  3OYB A;  4KUI A;  1G3T A;  2FB7 A;  2RA2 A;  5IH2 A;  1FYN A;  4C92 C;  4X34 A;  1UDL A;  3SFM A;  3KXT A;  3OBY A;  3FLG A;  4A4H A;  3LGF A;  4EPC A;  1ABO A;  2X4X A;  1X27 A;  1N9S A;  3DB3 A;  2A0F B;  4OP0 A;  4PJO D;  1WXU A;  2EQI A;  1G5V A;  4KUL A;  2L2P A;  4M7A F;  2YRD A;  4V2S A;  1S72 A;  3LYI A;  2KDS A;  4C8Q A;  2XU8 A;  1OX9 A;  3ZL7 C;  1ZUU A;  2K79 A;  3JB9 J;  2DZ9 A;  2KVQ G;  4XTU A;  5J26 A;  4R0K A;  1T0H A;  4B6M A;  2AKK A;  2DLP A;  1Y96 A;  3TRE A;  4KH1 B;  5FRO A;  1OI1 A;  4TVR A;  1BI0 A;  2DMO A;  4JS5 A;  5IHN A;  3I5R A;  1I1J A;  1ZSZ B;  1YIT T;  2D0Q B;  5KYW A;  1YIJ A;  4QVZ A;  3PMI A;  5HCK A;  3QYG B;  3L2V A;  4JZ4 A;  3JCM g;  3CMA T;  5FWB A;  1PRL C;  5IT9 E;  4FT4 A;  5LJ3 f;  2ZZD A;  2JOY A;  2P4T A;  1VYU A;  4PJO C;  5LJ5 g;  2QTV A;  1PNJ A;  2YSQ A;  4JJC A;  2D8H A;  4C0F A;  1VYV A;  1WHM A;  1KQS S;  1WDX A;  1W2B S;  4F17 A;  5GAN 4;  3MEA A;  4RCB A;  2AHJ B;  2KSS A;  3ME9 A;  4JRK A;  3CCL Q;  4WCI A;  4N4G A;  3M0R A;  1YJN Q;  5KH6 A;  3MP8 A;  2CZ1 B;  1FX7 A;  3LGL A;  3EFR A;  2LT4 A;  1BI2 A;  2C0O A;  4E7I A;  1QW1 A;  2X3W D;  2V8J A;  2FYK A;  1D1C A;  2RF0 A;  3FEO A;  3EG0 A;  4II1 A;  2M9U A;  4X1V A;  3G4S T;  5GAM f;  5GAO l;  1QQJ A;  2DFU A;  2ESW A;  5IHI A;  4X9D A;  3RUX A;  1X6O A;  4JDS A;  4LDY A;  3AT1 B;  2LDM A;  2JZ2 A;  4PJO F;  5J39 A;  2A37 A;  2JMA A;  2EJ9 A;  3QG1 A;  1H92 A;  3CCR A;  4E7J A;  1ZUY A;  4HKE A;  5KYN A;  1IHV A;  2VGM A;  2EJG A;  1O9S A;  3CCV A;  1UGP B;  1P92 A;  3QBY A;  4ATO A;  2EKH A;  2COY A;  2EQU A;  2HKQ B;  2DX1 A;  2J06 A;  2YHT A;  2ZPE B;  3U23 A;  1NPR A;  2Y90 A;  1YJ9 T;  2DVE A;  3MEW A;  4C5E A;  2MMP A;  2ZGW A;  3A8H B;  4RCC A;  1WHK A;  4RUG A;  1FWZ A;  1NZ9 A;  4M77 E;  4XU2 A;  5CQY A;  1YN8 A;  2WSC E;  4C5G A;  2XD0 A;  2LX9 A;  1SSF A;  2LT1 A;  1WI7 A;  1PC0 A;  1R0B G;  4MZP A;  1YCY A;  2D1X A;  1WQ7 A;  4E2F B;  2RHX A;  1B34 A;  2VC8 A;  5EG2 A;  2KXD A;  3WVE B;  1VQ8 Q;  4IIM A;  1NPP A;  1W2B P;  2DEU A;  2JN0 A;  2DXU A;  3RMS A;  3CCU T;  5KYY B;  1JJ2 A;  5LJ3 j;  2LCC A;  3NPF A;  3OA6 A;  3HRT A;  3CC7 A;  4PFO A;  2CP7 A;  2VB6 A;  4M77 D;  1D0Z A;  2YUN A;  4JJD A;  4EIK A;  1N9R A;  3G1J A;  4F7U E;  1VQL A;  1Q82 R;  3RR6 A;  1GBR A;  2FRW A;  2NUT B;  1U1T A;  1IB8 A;  3C0C A;  4IUT A;  1T0J A;  3I55 T;  1VQN A;  1Q82 U;  3LLR A;  2RJF A;  2PZ1 A;  4C8Q E;  1BKB A;  5M9O A;  4M78 A;  2HBW A;  1O75 A;  2FG0 A;  2QYZ A;  2FZG B;  4M75 A;  4ZTJ A;  1SRM A;  2KRM A;  2QG9 B;  4A53 A;  2X4W A;  3EG2 A;  1ZSZ A;  2E12 A;  2XHC A;  4MMK A;  4HXJ A;  1XQH A;  4FIB A;  3RBB B;  2KXC A;  3MET A;  1GCQ A;  2IIM A;  3CCM Q;  4M77 C;  2RJC A;  1VQP Q;  2P0P A;  2WSE E;  3OQ5 A;  1N8R C;  1K9M C;  4BUG A;  4ELZ C;  4XQ3 A;  4OML A;  3OW2 S;  3QZ9 B;  4DOV A;  1YHQ A;  1ZSG A;  1M9S A;  3EH2 A;  2ROL A;  4BI3 A;  3I9Q A;  2QA4 A;  2EVR A;  2K3B A;  1WHL A;  4C8Q D;  1HXD A;  4AT1 B;  4J8O A;  3RES A;  1UHC A;  5I22 A;  3CD6 Q;  4QT7 A;  2QEX Q;  3CCJ T;  1VQ7 A;  2ECZ A;  1PG5 B;  2AIR B;  3H8Z A;  2W10 A;  3VV0 A;  2RPN A;  3FIF A;  1PSE A;  2IPO B;  2X51 A;  4LXC A;  1JEG A;  1K8A R;  3H0I A;  4AFU C;  3FC3 A;  1Y57 A;  2DD4 A;  1BIB A;  2EIF A;  3BY7 A;  5I2S A;  2HCK A;  2DYI A;  2PVG B;  1QLY A;  1SHG A;  8ATC B;  2CP2 A;  3SWN B;  4M77 F;  1K8A U;  1XOV A;  2JTF A;  2Y4Y A;  3PMT A;  3CC4 Q;  4DOW A;  4XTZ A;  1UJ0 A;  5KE2 A;  1VQ6 Q;  5GAN g;  4C8Q C;  2L3P A;  1M1K C;  2CDT A;  1RI9 A;  2MOX A;  2DYB A;  3BDU A;  5FWC A;  2EGC A;  2GFU A;  3H0H A;  4M4Z A;  4AG1 C;  1U3O A;  3OYC A;  2HZY A;  2CGH A;  1JBM A;  1VQ9 Q;  2V1R A;  5GAO p;  5LJ3 e;  3VRZ A;  1XTD A;  4C0Z A;  2JS0 A;  3PE0 A;  3EH1 A;  3CME A;  1TS9 A;  5GMK i;  1MV3 A;  3URG A;  2DM1 A;  1E6H A;  3JCM d;  1D3B B;  3NGP A;  4JRP A;  2EBP A;  1ZA1 B;  3H6Z A;  1ZQ1 A;  2LNH B;  2LTO A;  3VU3 C;  3OW2 P;  2DZC A;  3MCA B;  3CCE T;  1AOJ A;  1OU8 A;  3HPW A;  2K9G A;  4F7U F;  2KRN A;  1OU9 A;  4FCY A;  5FRN A;  3A8O B;  1WHG A;  2DIQ A;  2XKO C;  2DL4 A;  3R6N A;  2DET A;  1S1N A;  3THK A;  1HYO A;  4C8Q F;  5LJ3 h;  5KYY A;  4PFZ A;  1WGS A;  2YLC A;  3LH5 A;  3LX7 A;  3VS1 A;  3OS1 A;  3BDL A;  2HBP A;  4A4K A;  1AHJ B;  3PIO A;  4OMP A;  3CPW S;  4RG8 A;  5GAN 6;  2ED0 A;  3FJP A;  2DRM A;  2O01 E;  1OQK A;  2JTE A;  3HTR A;  3MEV A;  5D6Y A;  2NUT A;  4J6Y A;  1Y07 A;  3I56 Q;  3VS4 A;  2GF7 A;  3CC2 Q;  1OUL A;  1QCF A;  5FU7 B;  3P8B B;  2QGF B;  4PNO A;  1WPY A;  3OYG A;  4HCK A;  3QO3 A;  4J7I A;  1UG1 A;  3V7C A;  4RG2 A;  1W2B A;  4PJN A;  2KEA A;  3VKI A;  3BE3 A;  5CKB A;  5GAM h;  1VQO A;  2RJD A;  5KCH A;  4L6V 5;  5D6X A;  4BE1 A;  4XAX B;  2X35 A;  3M4G A;  5CQX A;  3OYM A;  1X01 A;  3M58 A;  3MEU A;  1KSW A;  2CYZ B;  4GLK A;  3WVD B;  1XNI A;  1AT1 B;  3UA6 A;  3G71 Q;  1YI2 Q;  2DXT A;  1PKT A;  4N0A C;  2QDY B;  2P4R A;  1VOM A;  3QZ5 B;  4M7D A;  4M78 G;  1QWF A;  4ESR A;  1YJN T;  4M75 G;  4EMK C;  1NBE B;  2DEQ A;  2BUD A;  3REB B;  2J6F A;  4HVW A;  4PLL A;  2FPE A;  5KYW B;  3O5Z A;  2MK5 A;  1QVF S;  2E65 A;  4RKU E;  2A7Y A;  3F70 A;  4PJL A;  1SRL A;  4M7A E;  2ENM A;  1NEG A;  2ZPB B;  2M1H A;  2LNV A;  4LE9 A;  1VQ4 T;  3NFC A;  3M54 A;  1E7O A;  3CPW P;  3SWN A;  2JUF A;  3OYJ A;  3JCM f; 
#chains in the Genus database with same CATH homology
 5GAO n;  1BI0 A;  4M77 G;  4JS5 A;  4XTX A;  4OGE A;  5GMK m;  5CK9 A;  1V29 B;  2F69 A;  5CAI A;  1YI2 T;  1YIT T;  2D0Q B;  3QXE B;  3OMC A;  4FM4 B;  3JCM Q;  5GAN 2;  5GAO r;  1YIJ A;  4PLI A;  4QVZ A;  3PMI A;  3N5B B;  4ZTF A;  1K73 C;  3CEY A;  3QKJ A;  3QYG B;  3JB9 H;  1BIA A;  4VUB A;  3O8V A;  3JCM g;  5LJ5 f;  3L2V A;  1WJR A;  1KC8 U;  5A0D A;  1VQ9 A;  3CMA T;  2RM4 A;  4C92 E;  3P8H A;  5IT9 E;  4FT4 A;  3GNF B;  5LJ3 f;  4A4E A;  5CCA A;  2CZ6 B;  3BW1 A;  2GCX A;  2WAC A;  3CME T;  4OGC A;  4ZGE B;  2DXB A;  2RD1 A;  3OYE A;  4BB7 A;  2E10 A;  2X4Y A;  1VQ5 T;  2DAQ A;  1VQM A;  1MGQ A;  4BDZ A;  1I81 A;  1QP2 A;  2M0O A;  1NE8 A;  2ZZD A;  1K73 U;  4EDU A;  2JOY A;  2P4T A;  5GAM e;  4PJO C;  5LJ5 g;  3A5Z B;  3DKM A;  5HK3 A;  3C4S A;  2QTX A;  1WJQ A;  5LJ3 g;  2LQK A;  2MI6 A;  2PQW A;  3OYY A;  5DY9 A;  1D3B A;  3M55 A;  3OYF A;  4C0F A;  1KQS S;  2ZPI B;  3ER0 A;  4A54 A;  4BD3 A;  1W2B S;  5GAN 4;  3MEA A;  3FB9 A;  3CBM A;  4RCB A;  3GPL A;  4HT9 A;  4BAC A;  2AHJ B;  3WXM B;  2KSS A;  3ME9 A;  4JRK A;  4LDW A;  4O5V A;  1U8R A;  4N4G A;  2RB6 A;  5DLQ E;  4BE2 A;  1VQN T;  4MDX A;  4EMG A;  5KH6 A;  2QQB A;  2GFA A;  3MP8 A;  2LQ8 A;  2CZ1 B;  4PJO A;  1FX7 A;  2NLU A;  3LGL A;  3GIB A;  3EFR A;  1KHI A;  1KHC A;  2CKK A;  3GNG A;  4GY5 A;  3L2U A;  2LT4 A;  4F7U G;  3OYI A;  3CCJ A;  1BI2 A;  4E7I A;  3ASK A;  5FU6 B;  1VQK T;  1QW1 A;  4HCB A;  4Y91 A;  2L8D A;  4KBM B;  4KUD K;  2V8J A;  2FYK A;  3HRS A;  3FEO A;  2IG0 A;  2R5A A;  4IUR A;  2E6N A;  4II1 A;  4M78 E;  2M9U A;  3HL8 A;  1KQS A;  3UT1 A;  2DJZ A;  4CI0 C;  4XK8 E;  5GAN e;  3G4S T;  4M75 E;  1H64 1;  3G7Z A;  4C8Q G;  5GAM f;  2RHZ A;  5GAO l;  2VYT A;  2Y4X A;  3HFO A;  4BI4 A;  5D6W A;  3P8D A;  3QJY A;  2XG8 D;  3QPH A;  4X9D A;  1X6O A;  4JDS A;  3RUX A;  3SD4 A;  3CCQ T;  2EJF A;  3CBO A;  2CZ7 B;  4LDY A;  2K2V A;  2RO0 A;  2LDM A;  2JZ2 A;  3T9N A;  3PT9 A;  4C0G A;  4XTW A;  5CKE A;  4O6J A;  2OAU A;  4PJO F;  3OS0 A;  1QVG A;  5GAM g;  5J39 A;  4UC4 A;  2EJ9 A;  3NTH A;  3QG1 A;  4ELY C;  3CCR A;  4E7J A;  1X75 C;  3M56 A;  4HKE A;  3SB2 A;  2RI2 A;  4M7A A;  4N4I A;  2VGM A;  2X4J A;  2EJG A;  3I56 A;  3OW2 A;  3X24 B;  1O9S A;  3CCV A;  3JB9 G;  4LDX A;  3CC2 A;  1UGP B;  1P92 A;  3DLL A;  3QBY A;  4ATO A;  3CCL T;  2EQU A;  2YHT A;  1G3S A;  3QHS A;  2ZPE B;  4KT0 E;  1NPR A;  4OB3 B;  1UEB A;  2Y90 A;  1YJ9 T;  2DVE A;  3MEW A;  3V8L A;  2K3Y A;  3ZFJ A;  2MMP A;  2ZGW A;  3A8H B;  4LD6 A;  4RCC A;  4C5E A;  3OYN A;  1U1S A;  3OSV A;  4FU6 A;  1FWZ A;  4M78 D;  3J80 E;  1VQO T;  1NZ9 A;  4M77 E;  1VQ4 A;  2EQM A;  4XU2 A;  5DLO A;  1ZHI A;  5CQY A;  4M75 D;  5GMK j;  4E7L A;  2PUO B;  2WSC E;  5GAN h;  3CCM T;  1VQP T;  1JJ2 S;  4C5G A;  2HQX A;  2LX9 A;  4Y28 E;  1SSF A;  2DO3 A;  3RIR A;  2XD0 A;  3HSB A;  2LT1 A;  2HAX A;  4YTL A;  4XU1 A;  4NS5 A;  1KQ2 A;  1VIE A;  3JSC A;  4J6X A;  3TU4 K;  1RL2 A;  2DPP B;  2K4Y A;  5J3B A;  4D6W A;  4RMO A;  1IZ6 A;  4BE0 A;  2QQA A;  1BI1 A;  3OB9 A;  4MZP A;  4XU3 A;  3CCE A;  1W4S A;  1YCY A;  3PGG A;  1WQ7 A;  2EFI A;  3RMQ A;  4MZM A;  4C92 A;  4Q5W A;  2RHX A;  2ZCF B;  1B34 A;  4QQG A;  3G71 A;  1LOJ A;  1YI2 A;  2VC8 A;  5EG2 A;  3WVE B;  2E41 A;  1NPP A;  4M78 B;  2KY9 A;  5GAO m;  1I5L A;  4B9W A;  2RH2 A;  2JN0 A;  5LJ5 j;  2QQ9 A;  2DXU A;  2MF2 A;  4NL2 A;  4M75 B;  3RMS A;  3VUB A;  5FLX E;  1YJW A;  4A4F A;  3CCU T;  1OYX A;  3KBG A;  5LJ3 j;  2QEX T;  1JJ2 A;  2JNG A;  4FT2 A;  4QQD A;  3S6W A;  2LCC A;  2LC4 A;  3C12 A;  1VQ5 A;  3OA6 A;  3HRT A;  3CC7 A;  4MZT A;  1I4K 1;  5GMK h;  1TH7 A;  4M77 D;  4OF1 A;  4M78 C;  3G6E A;  3L2R A;  4IUQ A;  2K3X A;  1Q82 C;  1N9R A;  2DIG A;  3R6O A;  4M75 C;  1M8V A;  3M57 A;  3MP6 A;  4F7U E;  4R56 A;  1S72 T;  3CBP A;  4C92 F;  1VQL A;  1Y71 A;  1LJO A;  2OTJ A;  1WNL A;  3PTA A;  3E1S A;  5LJ5 d;  3QJ6 A;  2CZ0 B;  2VGN A;  1U1T A;  3JCM J;  3VJP A;  4IUT A;  2VUB A;  5LJ3 d;  3I55 T;  1VQN A;  2RJE A;  3CC4 T;  4M7A G;  1Q82 U;  3LLR A;  5GAN 5;  2RJF A;  4C8Q E;  2K5L A;  1BKB A;  5M9O A;  1VQ6 T;  3RER A;  2L5Q A;  1IRE B;  2F5K A;  4M78 A;  4M7D G;  1O75 A;  2P0Q A;  4M77 B;  2IVW A;  2DTH A;  4M75 A;  4ZTJ A;  2RHI A;  2DTO A;  4QVD A;  2EYQ A;  3S3O A;  4A53 A;  3JCM W;  1VQ8 T;  2X4W A;  5IAY A;  3INZ A;  4C0D B;  3HKS A;  1VQ9 T;  2E12 A;  3M4Y A;  2XHC A;  2FHD A;  4MMK A;  2BIV A;  3VYH B;  3SDZ A;  4BI8 B;  2RK1 A;  3L2W A;  1XQH A;  4FIB A;  2XIC A;  1QVG S;  5CR2 A;  1JRI A;  3RKX A;  3MET A;  3JCM X;  3VUZ A;  2B8A A;  4OVA A;  1RI0 A;  2CS7 A;  4LDU A;  1VQM T;  4M77 C;  2RJC A;  4IUU A;  2P0P A;  2WSE E;  3OQ5 A;  4JLI A;  1N8R C;  1K9M C;  2KAF A;  4BUG A;  4ELZ C;  2MWP A;  3LWH A;  2PUK B;  4XQ3 A;  3OW2 S;  3QZ9 B;  1BYM A;  4DOV A;  1YHQ A;  2VV5 A;  2BKD N;  2XID A;  3OMG A;  3KUF A;  1KD1 C;  3M9Q A;  4C0D C;  4LD9 K;  1OZ3 A;  4HT8 A;  2XK0 A;  4M78 F;  4DQ2 A;  1M9S A;  4C92 G;  4ZN1 A;  3L1A A;  1M1G A;  4BI3 A;  4M75 F;  5FU6 C;  1UGS B;  2R58 A;  2QA4 A;  1N8R U;  1QVP A;  3OY9 A;  2DD5 A;  1K9M U;  2QXF A;  3PFS A;  4BY6 B;  4C8Q D;  2D6F A;  1HXD A;  3M5A A;  4J8O A;  3RES A;  2LCL A;  1KD1 U;  4M77 A;  4JLG A;  3CCL A;  1I8F A;  4N4H A;  4QVC A;  3QSU A;  1EIF A;  1YJN A;  4IKF A;  1QP3 A;  2FL7 A;  4ZGJ B;  3OYH A;  3CXC S;  3CCJ T;  1KG1 A;  4JUV A;  1LNX A;  4PKC C;  5HK0 A;  1VQ7 A;  4F7U B;  4Z02 A;  4E7K A;  2OTL A;  3H8Z A;  4J83 A;  3VV0 A;  3FIF A;  1PSE A;  2PVO B;  2ZPH B;  1BI3 A;  4FSX A;  4P5N A;  1G3W A;  1K8A C;  3CCS A;  2JVV A;  1N27 A;  3LWI A;  4JRQ A;  3JB9 D;  2RI5 A;  3LH0 A;  5GMK e;  4ME7 A;  3FC3 A;  4JS4 A;  3OBW A;  1DJ7 B;  2DD4 A;  4C8Q B;  1BIB A;  5GAN f;  4NOY A;  2EIF A;  3BY7 A;  5I2S A;  1M4Z A;  4HA8 A;  2PVG B;  3UDC A;  1K8A U;  2L89 A;  2QI2 A;  2QQS A;  4M77 F;  1UGR B;  4OB1 B;  3SWN B;  5GAO q;  4E7H A;  1XOV A;  2JTF A;  4A4G A;  3CXC A;  2Y4Y A;  1Y96 B;  1KQ1 A;  3PMT A;  4E47 A;  4DOW A;  2EWN A;  5CKD A;  4OB2 B;  4XTZ A;  3CCR T;  4PL6 A;  5KE2 A;  5GAN g;  3HFN A;  1M90 C;  4C8Q C;  4R55 A;  5HKC A;  1M1K C;  3I56 T;  3CCV T;  4WF2 A;  3CC2 T;  3E19 A;  3BDU A;  1Y7X A;  2GFU A;  4C5I A;  2DKG A;  3OS5 A;  4PJO G;  4EMH A;  3JCM b;  3VYG A;  5LJ5 e;  5GAN 8;  1YIT A;  3X26 B;  3OYC A;  3SWN C;  2CGH A;  1JBM A;  4IUV A;  2GQV A;  2PVD B;  5AYF A;  4F7U A;  5GAO p;  5LJ3 e;  3CD6 T;  3JRZ A;  3JCM c;  5L8R E;  3CMA A;  1XTD A;  3QII A;  4C0Z A;  1M90 U;  1M1K U;  4ZN3 A;  4L59 A;  2LVM A;  4MML A;  4M7D E;  3MO8 A;  4MDW A;  4C5H A;  3CME A;  3A8L B;  4HCZ A;  1PSF A;  2VXF A;  3ZBD A;  5GMK i;  1UB4 A;  2A3L A;  2HNI A;  2WSF E;  3URG A;  3S3M A;  1Q7Y C;  4FL6 A;  3JCM d;  2YLB A;  2XI9 A;  1D3B B;  3QDR B;  3RKW A;  4JRP A;  3JAM E;  3S3N A;  1Q81 C;  2K57 A;  3H6Z A;  1ZQ1 A;  4CRI A;  2LTO A;  2MAM A;  3VU3 C;  2EKO A;  2DZC A;  2G3R A;  3MCA B;  3CCE T;  3J81 E;  2EQJ A;  2K5I A;  2E70 A;  3C94 A;  3JCM h;  1Q7Y U;  4J6W A;  3V7S A;  4X9C A;  3HPW A;  2R5M A;  5GAN 7;  4F7U F;  3AHU A;  3G71 T;  4L5G A;  5FRN A;  4PJO B;  4XTV A;  3A8O B;  5HY6 A;  4OB0 B;  2DIQ A;  1Q81 U;  2LRQ A;  2XKO C;  3MHX A;  3HHT B;  5A0G A;  1VQ8 A;  3LW5 E;  5A0L A;  1YJW T;  5LJ5 h;  4M7A D;  4C8Q F;  1VQK A;  2F5T X;  2R57 A;  5LJ3 h;  1YIJ T;  4IUP A;  4XTY A;  3CC7 T;  1FXX A;  4J5Y A;  1WGS A;  3GLX A;  4M7D D;  4QQ6 A;  3OS2 A;  2YLC A;  5CVI A;  2RHY A;  3LX7 A;  3G6E T;  3OS1 A;  3OYK A;  3UWN A;  3MP1 A;  2V8K A;  3BDL A;  4J7F A;  4QW2 A;  3G4S A;  5GAM j;  2HBP A;  3E9G A;  4A4K A;  1AHJ B;  3CPF A;  2KMT A;  3PIO A;  3CPW S;  1YBY A;  1VQL T;  3EFS A;  2OTJ T;  2RHU A;  4RG8 A;  1Q86 C;  1N6A A;  3CCQ A;  3JCM V;  3L2Z A;  5GAN 6;  3L2Q A;  1VIF A;  3A8G B;  3FJP A;  2DK3 A;  5C6S A;  3X28 B;  3JB9 F;  2EQK A;  3EAE A;  2O01 E;  1M5Q 1;  3NTI A;  1G3Y A;  2DXC A;  3HRU A;  3MEV A;  1WQW A;  5D6Y A;  5CIU A;  4J6Y A;  5I2M A;  2PU9 B;  4M7A B;  1Y07 A;  2XDD A;  1VUB A;  2RK2 A;  2M16 A;  2MWO A;  2C06 A;  1NJI C;  1Q86 U;  3C95 A;  3E9F A;  2GF7 A;  1H3Z A;  4B9X A;  4M7D B;  1GXI E;  1JB0 E;  3QYH B;  2O4X B;  1OZ2 A;  5FU7 B;  3GF5 A;  3P8B B;  1VQ6 A;  2D9T A;  2E5Q A;  4C92 D;  5GAM d;  4PNO A;  1WPY A;  3NTK A;  4NL3 A;  3OYG A;  3PNW C;  3CPW A;  1YJ9 A;  2L3R A;  5A2Q E;  3QO3 A;  4J7I A;  2RI3 A;  3V7C A;  4RG2 A;  5DM7 R;  4M7A C;  1NJI U;  1W2B A;  5IN1 A;  1UGQ B;  4LDV A;  5CKH A;  4XU0 A;  3VKI A;  5CKB A;  5GAM h;  5GAN j;  1VQO A;  4M7D C;  5CKF A;  2KQW A;  2QQR A;  2HD0 A;  2RJD A;  4BY6 C;  2K5F A;  4OMF B;  5FU7 C;  5KCH A;  4L6V 5;  3CCM A;  3JB9 I;  3J7A F;  4PJO E;  5D6X A;  1VQP A;  5KE3 A;  4BE1 A;  5GMK l;  4ZGD B;  4DA4 A;  5C0M A;  4XAX B;  1YHQ T;  2X35 A;  3M4G A;  3ZEH A;  2VXE A;  5CQX A;  3X20 B;  4EMK B;  2E64 A;  3OYM A;  1X01 A;  2YRV A;  1HK9 A;  3M58 A;  3MEU A;  3Q1J A;  4C92 B;  3A8M B;  2CYZ B;  4GLK A;  3FRN A;  1B34 B;  3V8K A;  3WVD B;  1XNI A;  3FDR A;  3X25 B;  2QA4 T;  5GAN 3;  5LL6 S;  2DXT A;  2V8I A;  2ZPF B;  4N0A C;  1WJS A;  2P0K A;  3JCM e;  1M1F A;  2DTI A;  2QDY B;  2H3J A;  3QZ5 B;  4BDY A;  3HP9 A;  3JCM P;  4M78 G;  4M7D A;  5KCO A;  2O4X A;  5GAN d;  1YJN T;  3OYB A;  4KUI A;  4M75 G;  4JRI A;  4EMK C;  3CD6 A;  2DEQ A;  1G3T A;  2FB7 A;  2BUD A;  2E1H A;  2RA2 A;  4PLL A;  3V8J A;  4HCC A;  3RKY A;  3PIP A;  1VQ7 T;  5CO7 A;  4C92 C;  2JTM A;  3CCU A;  4X34 A;  2QEX A;  3SFM A;  3GOX A;  2OTL T;  2E65 A;  1QVF S;  4RKU E;  2A7Y A;  2I2L A;  3F70 A;  3KXT A;  3OBY A;  3QUI A;  3FLG A;  5FRM A;  4A4H A;  3LGF A;  4EPC A;  3OYD A;  2ZPG B;  2FVU A;  3L42 A;  3CCS T;  2X4X A;  3GP8 A;  4M7A E;  1N9S A;  3DB3 A;  4N0A A;  3BFM A;  4OP0 A;  2XDB A;  2HQE A;  4PJO D;  2ZPB B;  1G5V A;  2M1H A;  2LNV A;  4KUL A;  1VQ4 T;  3NFC A;  4M7A F;  4V2S A;  3OYL A;  4JJN K;  4EMK A;  1S72 A;  3DB4 A;  2KDS A;  3LYI A;  3M54 A;  4C8Q A;  2XU8 A;  2E6Z A;  4M7D F;  3OSS C;  2XDP A;  3M53 A;  3JB9 J;  2DZ9 A;  2KVQ G;  3M59 A;  4XTU A;  5J26 A;  1MHN A;  3V7R A;  3SWN A;  3OYA A;  3UPU A;  3I55 A;  1QVF A;  2EAY A;  3TCJ A;  2JUF A;  3OYJ A;  3CC4 A;  1KC8 C;  1ZBX A;  3JCM f;  3DLM A;  3TRE A;  1Y96 A;  3TEE A;  1R8O B;  2KK4 A;  5FRO A;  5I21 A;  1OI1 A;  4TVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...