2KSSA

Nmr structure of myxococcus xanthus antirepressor cars1
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
86
structure length
86
Chain Sequence
MIQDPSLIICHDVDGAPVRIGAKVKVVPHSEDGTISQRFLGQTGIVVGLVFDDPATQYPDDPLIQVLVEGLGEDLFFPEELELAPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carotenogenesis protein carS
publication title A bacterial antirepressor with SH3 domain topology mimics operator DNA in sequestering the repressor DNA recognition helix.
pubmed doi rcsb
source organism Myxococcus xanthus
molecule tags Transcription regulator
total genus 4
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2010-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18354 SH3_18 CarS bacterial SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.630 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2kssA01
2KSSA
chains in the Genus database with same CATH superfamily
1K76A 2CYZB 5KCOA 1LNXA 1MV0B 4RCBA 1KD1U 3OW2A 2LJ0A 4M78D 1Q81C 4LE9A 4PJMA 3CCMT 4EMKC 2DF6A 3H8ZA 1PD1A 4F7UE 3CEYA 1W70A 1U1SA 3QBYA 1UJYA 1N6AA 3R6NA 4N4HA 1SSFA 3VKIA 1PC0A 4M7AD 4OB1B 2CKKA 1D3BA 2LCLA 1IHWA 5GAOn 4MDXA 2DJZA 3JCMd 2GF7A 5GMKj 1TUCA 1NYGA 4F7UA 4L6V5 2F5TX 1OQKA 3ME9A 2X4JA 1AWWA 1H641 4FSSA 1KD1C 3EGXA 3HSBA 1VQ8A 1ZLMA 1HK9A 1R77A 2NUTB 4IUPA 1D0ZA 1I5OB 5I2MA 4M75B 2DJQA 2D1XA 4HVWA 1YHQQ 4JJDA 1IGUA 3QJ6A 5DLOA 3A8LB 3EG3A 1GFDA 5KYUA 2DRMA 1M8MA 3OYGA 2HL3A 3A1PA 4M75F 3CCJQ 4E7LA 3JB9I 4LDYA 5KH6A 2OI3A 3EFSA 1KC8U 5KYWA 1T3LA 2RMOA 2ROTA 3M59A 4MMLA 3CC2A 2LQNA 1PSFA 2VXEA 3H41A 2KY9A 3VYHB 5GAN2 4A53A 3TVTA 4HVVA 3E9GA 4C5IA 2MPXC 2W10A 4N4IA 2AT1B 3FIFA 1TSFA 4QQDA 3VS0A 2HZYA 2DIGA 1BIAA 1TG0A 2HQXA 1QW1A 4C8QB 3I55A 1YWOA 2HEQA 4KGZB 1B34A 3OYMA 4BY6B 4AG2C 4R56A 3ZL7C 3CCLQ 1B3QA 2EYWA 5I21A 4C8QF 3OQ5A 2DFUA 2DKGA 2YRDA 4KT0E 2RJCA 4A4GA 1KC8C 5LJ5d 5A2QE 1FMVA 2GFUA 1OZ2A 2XDDA 4BI3A 1VQ7Q 3P8HA 5D6WA 1WXUA 3CMET 5DM7R 4C92E 3MEAA 5GMKl 1X2QA 4J9BA 1M3AA 2MF2A 2QQBA 2RQWA 4PJOE 5AT1B 4JJNK 1VQKA 2RHUA 1ZA1B 1YITA 4MZTA 4BE0A 4PFOA 1HJDA 1WHLA 2VYTA 5ECAA 3QYGB 4C92A 4M7DD 3GPLA 1RI9A 2AKLA 2PU9B 2AKKA 2X4WA 2YHTA 2LQ8A 4PJOA 2E5KA 4KUIA 3KXTA 1FMKA 3OYNA 3QIIA 4J9IA 1RUWA 4K11A 5KYXB 3S3NA 4D8KA 4PLLA 3ZEHA 4E7SA 2X3XD 1UEBA 4OVAA 1YNZA 2BUDA 1CKAA 1OX9A 3BDLA 5CR2A 3MEWA 1X6GA 1O75A 2JTEA 4DEYA 3H9NA 2RNAA 4XU0A 3CXCP 4Q5WA 2KRSA 4MZPA 3HHTB 4QW2A 4ATOA 1HSQA 5FRNA 4OMNA 1WJSA 2E12A 3LWHA 4QKUA 3CBMA 4M77G 5FU6B 4XTVA 3CCRT 1KQSS 2BZ8A 4J6XA 3M56A 1RADB 4C0DB 1M2VA 1VQOT 1OZ3A 1VQ5T 3L2UA 2JZ2A 1AZGB 1M1GA 2GTOA 2LDMA 2FVUA 4JPBW 3TEEA 3CC7T 4FW1A 2MYSA 4ME7A 3CCEQ 4J7FA 1GBQA 2CP0A 2DYBA 3CCST 2A3LA 1BI0A 2DO3A 1VQ9A 1ZSZA 1I8FA 2KYMA 3JCMe 1N8RR 3MP6A 1G5VA 1C6VX 3OYBA 3JCMJ 5KYYA 3QZ9B 3X26B 1PHTA 2CZ0B 4JRPA 1Y71A 1UHFA 1NPRA 1YJNQ 5GMKm 5CK9A 3JCMW 3RMQA 2LNVA 2XI9A 1UB4A 3OY9A 1WPYA 1G3YA 4M78E 2QQRA 5IAYA 1QP2A 1JJ2S 3FJPA 4EMKB 4Z8AA 2J06A 1WJRA 2DZCA 3HP9A 1TOVA 2QQ9A 3EAEA 4WTOB 3CPWP 1TWBA 5LJ3g 1N27A 2KR3A 2ZGWA 2OTLQ 4M7AE 4TVRA 2HD0A 1UGQB 2OTJQ 2E65A 1JEGA 4M78A 2HSEB 4M7DG 3CD6A 4R0KA 3NPFA 1YJWQ 1EZZB 1QQJA 3EFRA 2DL7A 4AFQC 4RTXA 3OW2S 3CBOA 1GXIE 2H3EB 5GMKe 3M58A 5HCKA 2JOYA 4FYYB 4AFZC 4M7AA 2JMAA 1VA7A 1VQ4T 2DTHA 2QGGA 1EIFA 2DVJA 1T0HA 4BDZA 1GL5A 2QDYB 5LJ5e 1RAIB 1NEGA 2KDSA 4RTZA 1LOJA 1KQ1A 4X1VA 1R0BG 1QVGP 2L89A 2QG9B 3CQTA 2A36A 3URGA 5IH2A 1WX6A 4RTYA 1JRIA 1YHQA 3G7ZA 2YT6A 3EFOB 2MWOA 2ED1A 4OB0B 1A0NB 2ZPEB 4Z02A 1PRLC 4E2FB 5GJWB 4J6WA 5CKHA 1KHIA 3OBYA 4A4EA 4BUGA 1YJ9T 2VUBA 3CCUT 2AZSA 2EW3A 1VQNA 2KNBB 2RM4A 3REBB 4C0GA 4J5YA 3H6ZA 4OMLA 2LQWA 3PMIA 5GAMg 3TSWA 3HFNA 3UF4A 4ZGDB 4D6WA 4DEXA 1O9SA 3G71Q 3CXCA 3LH5A 2Z0WA 4O6JA 2RQUA 2DBKA 3I55Q 3KFVA 1VUBA 1I5LA 1GCQC 2LJ3A 4E7KA 3CCLA 1OX8A 4LDUA 1WQ7A 4IUVA 1VQPT 3DLLA 4L5GA 4LUEA 1VYUA 2X4XA 1VQ6T 1WQWA 1RLQC 3MHXA 3AHUA 1K4US 3LGFA 4EDUA 4AT1B 2JMCA 2DL3A 4M7DE 2JW4A 1JO8A 4FYVB 3OYLA 3BY7A 4PJNA 4BDYA 4NS5A 2RPNA 4QVZA 1UDLA 1TTHB 4BY6C 2JTFA 1BCOA 4XU1A 3M53A 1SF9A 1XQHA 3RKYA 1VQKQ 3CC4T 4M7DA 5LJ3j 1VQMQ 2CREA 4XTUA 3OYYA 1XOVA 2CS7A 4M77F 4ZN3A 3LGLA 1G3SA 2C0OA 1E6GA 3CPFA 3EG2A 3HL8A 1WNLA 1VQLT 3CPWA 1KHCA 2FYKA 4F7UG 3CCMQ 1AEYA 2PNIA 1VIEA 1K0SA 2K3XA 2CP3A 3M0RA 3QYHB 4A63B 2Y4YA 2HDAA 3NHNA 3D7SB 5KE3A 3MP8A 1N8RU 5D6XA 2B86A 4HT8A 2HSPA 1H92A 3TCJA 3EGUA 1TU0B 1ARKA 1YFNA 4P5NA 2EYXA 1AWXA 1GFCA 4IUUA 3QZ5B 3PE0A 5LJ3d 3JCMf 2EYYA 3EGDA 5IN1A 3CCVT 3OYCA 2KRNA 3SWNC 1D1AA 5GAN8 1IB8A 2BTTA 2V8IA 2GBQA 1NPPA 3CCEA 2J7IA 4CC2A 3JCMh 4PNOA 2J6KA 1N8RC 3JB9D 1NEBA 1VQ9Q 5L8RE 1QVGA 1S72A 4F17A 1WHKA 2FZKB 4CRIA 4J9CA 3JSCA 4HVUA 2DYIA 4IIMA 2DXTA 2VGMA 1OV3A 1M4ZA 3JCMX 5GAMj 5CKFA 5FW9A 1MMNA 2KI7A 1U06A 1ZBJA 5KCHA 2PTKA 3JCMb 4B6MA 1WXTA 2YDLA 3V8KA 1G8XA 2QYZA 4LN2A 3BFMA 1QLYA 2CUDA 2RQTA 4BI8B 3RDVA 1NJIU 4FM4B 1K73U 3OYHA 2RA2A 2GQIA 2K2VA 2EBPA 3VS4A 3QSUA 5IHKA 2OTJA 1M5Q1 3HRSA 4A4HA 4C0ZA 1G83A 1YJWA 4NOYA 5LJ5f 3M57A 5GMKh 2CT4A 4ELZC 3A8OB 1IO6A 1EX4A 1M3CA 3G4ST 2CH4A 4C92G 3RKXA 4C8QE 1M2OA 2O88A 4PJOG 2KQWA 1IGQA 2HAXA 2FPDA 5D7UA 1NJIC 1V76A 1K73C 5LJ5h 1QCOA 1WDXA 2QASA 2RI2A 3OS1A 5GANg 1JXOA 3VRZA 1PKTA 1SRLA 1WFWA 3C12A 4GLKA 2QA4T 4JZ4A 3VUZA 2L8DA 3LLRA 2P0QA 1BKBA 4BE2A 4J83A 2R57A 3UWNA 2JNGA 2K2MA 1I4K1 4FSXA 4F14A 1M27C 3VYGA 3L2WA 1AVZC 4KRTA 4RUGA 1WHMA 2RHXA 1XNIA 4E7ZA 3OYJA 3C94A 1VIFA 2ZCFB 2X3WD 2H3JA 3I5SA 2ATCB 3JB9G 4FYXB 1SHGA 4QVDA 3JRZA 1VQNQ 2M0OA 1U1TA 4DA4A 1SRMA 4AFSC 1U3OA 4MDWA 3UATA 3CCQT 4AFUC 2YRVA 1PRMC 2XG8D 4II1A 2FPEA 2QDLA 1B7TA 1VQ5Q 3G71A 1ZBXA 1UJ0A 4FT4A 1WZOA 2XICA 4C5HA 1T3SA 4JLGA 2JM8A 1RAAB 3OYIA 2ENMA 2EYZA 4B9XA 3CCSQ 4XTWA 1C0MA 2CDTA 2DD5A 4M78C 4J9EA 3L1AA 1D3BB 3LWIA 5LJ3e 3OS0A 1M1KR 2BE7D 1UGPB 1QVFA 4OB2B 1LCKA 4PK4A 4X9CA 2DERA 3JCMV 2JTMA 2DTIA 3NMZC 4F7UB 3FJ5A 2FRYA 1AWOA 3EGXB 1ABOA 4QT7A 2EWNA 4M78G 1X43A 5CVIA 1ZX6A 3PIOA 2JM9A 4J9DA 1PNJA 2DEQA 5AYFA 4F7UF 1QCFA 4XK8E 1YIJT 2OAWA 4M4ZA 2KYBA 3HFOA 1RLPC 2QGFB 2DXCA 3M0UA 1TUDA 1W6XA 2WSEE 4LNPA 1VQMA 3I56T 2FHDA 3JCMc 3FB9A 4M7AG 1X27A 4PFZA 4LDWA 1OPKA 2YRCA 1IHVA 2P84A 2WSFE 3ULRB 3PVLA 5KYWB 4XTZA 4OMMA 3TSZA 4A4KA 4BE1A 3MO8A 2KAFA 5GAN5 5GAOr 3CCMA 1ABQA 2EQJA 2LC4A 2NUZA 3HKSA 4M77C 3SWNB 2XKOC 4BI4A 4RG2A 1X01A 1NLOC 5CIUA 2DMOA 3TREA 1B34B 5GANj 2DAQA 4C5GA 2O4XA 1BIBA 2EGAA 4XQ3A 3GNGA 3EHRA 2M51A 4ZGEB 2GFAA 2CP7A 4QQ6A 4R55A 1YHQT 3C95A 4JS4A 2MIOA 1G2BA 3SB2A 3L2ZA 4AMCA 2G3RA 3OYDA 2I0NA 3CCJT 2RO0A 1DJ7B 2K5LA 1OULA 3M0PA 4RKUE 2HBWA 1KSWA 3H0FA 2KXDA 3OSVA 4C0FA 3META 2F2VA 1RAFB 8ATCB 2HKNA 1QVGS 3DB3A 1S72Q 1WGSA 1ZA2B 1M1FA 1QCNA 4J8OA 4PJLA 5FU7C 1NYFA 3OS2A 1YJ9Q 3CCUQ 4C92B 5GANd 1Q95G 2COZA 3CCLT 1CKBA 2DA9A 3A8HB 4PJOB 1PSEA 1X75C 1H3ZA 4N0AA 2NYSA 1W2BP 4C92F 3QHSA 3NGPA 3ASKA 2LJ1A 2MMPA 3NTKA 3REAB 3L42A 3HPWA 4PJOF 2D8HA 4LUDA 4M7DC 2RJFA 2LQKA 2CP2A 2CUBA 1K9AA 3M9QA 2GNCA 4QQGA 1VQ7T 2CH4W 1GCPA 1BBZA 1YN8A 2RK2A 4L59A 1VQ6Q 5IXBA 4Z89A 3OYEA 2KSSA 5IT9E 2WACA 3EG9A 2QQSA 2A08A 3QXEB 2K6DA 2QK0A 4M75D 1M3BA 5D6YA 1JBMA 3S3MA 3GF5A 2K3YA 2J05A 3CMEA 4JUVA 1Y7XA 4IURA 2HQHA 2L3RA 1WIEA 2VKNA 3FC3A 3UPUA 1MMDA 3HRTA 4OGCA 5CCAA 1NJIR 3J7AF 1KK7A 1K73R 4XU3A 5HK3A 1WXBA 1X6OA 3M4GA 3MEVA 2KEAA 5CKEA 2M0YA 5A0DA 2C0IA 4J9FA 1ZSZB 1Y57A 4N4GA 4QVCA 1KJWA 1D1CA 1M30A 1G3WA 1ZUKA 4AG1C 5KYYB 3GP8A 2J6FA 4C8QD 4PL6A 2NUPA 5GAN4 3A8GB 1MV3A 2AIRB 1VQLQ 2SRCA 4IUQA 1XTDA 3RESA 1QMCA 2DBMA 2KE9A 2O9VA 1W4SA 3CMAT 2CSQA 2CP5A 2L3QA 2RK1A 2D9TA 1RABB 4VUBA 2KRMA 1M1KU 3X20B 3OMGA 3CCRA 4M78B 3CCET 4BB7A 2CZ6B 1M90U 1VQOA 1YI2T 2CT3A 1BI1A 1VQ5A 5LJ3f 2EVRA 2X51A 4M78F 3SEMA 4FYWB 1JJ2P 1OYXA 2MCNA 5GJVB 1K9MR 3NFCA 1KQ2A 2MI6A 4M7AB 1D0YA 3G1JA 1YJNT 3JCMP 4GY5A 1OPLA 2OX7A 2EJFA 3M0TA 4J7IA 1N9SA 1HYOA 3CCSA 5LJ3h 4A54A 4KH1B 2QEXT 3TQ7P 3G6ET 4M7AF 2DILA 4OF1A 3JAME 1M1KC 2LT4A 1QVFS 1YP5A 2HCKA 2G6FX 1M90C 1WYXA 1LPLA 2X4YA 1Y96B 4E7JA 2RH2A 3MP1A 1RAEB 6AT1B 1FWZA 2K5FA 2OTLT 3J80E 2OTJT 2DL8A 3AT1B 1QWEA 3OYKA 3RIRA 3PFSA 2FRWA 4M77B 1U8RA 3I5RA 3WVDB 1FYNA 2DNUA 3A5ZB 2ZPFB 3S6WA 5GANe 2JXBA 1NE8A 5IXFA 1W2BA 2KMTA 3C0CA 1UGVA 2QTXA 2IG0A 2DZ9A 2DXBA 4LDVA 4C8QG 7AT1B 2O9SA 4FIBA 1K1ZA 3EG0A 3QO3A 2BZYA 4DBRA 2H8HA 2V1RA 5GAOp 4GLMA 2DPPB 3WXMB 3UDCA 1VQ4A 3JB9J 2VV5A 2A28A 1MNEA 2RJEA 5GAMf 1VQ8T 2E70A 2EGEA 2B8AA 5A0LA 2NLUA 2EAYA 4XTXA 2EJ9A 2K3BA 5GMKi 1H3HA 4KULA 2RJDA 2AK5A 5EC7A 3MJXA 5FU7B 2E64A 4JRKA 5KYNA 2JUFA 3PGGA 1CSKA 1PG5B 2Y90A 3BE3A 3PIPA 1EFNA 1HXDA 3CC2T 2RI5A 1MGQA 3GIBA 1F1BB 1K8AU 3QJYA 3A8MB 1SKUB 1ZUYA 4M7DB 2ED0A 2DM1A 2PUOB 3F70A 3I55T 1W1FA 3EHQA 1YJ9A 3SDZA 3CCUA 4DBHA 5KE2A 4M7DF 4XAXB 2AHJB 3E19A 4EIKA 2KT8A 2GCXA 3CCQQ 1Q86R 2PVOB 2P0KA 4M75E 3OSSC 2EGCA 1M9SA 2O31A 3OS5A 5GAOl 3H0HA 2CP6A 1QKWA 2E1HA 1K8AC 3E2UA 2E5QA 3J81E 1D09B 2NUTA 4C92C 4JDSA 4RMOA 5J39A 1VQPA 4UC4A 1VQ6A 3U23A 4M75A 1FMWA 1ZHIA 3JB9H 2ABLA 4PJOC 1JXMA 5I22A 3NTHA 2LX9A 2W0ZA 2BIVA 2E6NA 1VQKT 3I9QA 4LD9K 1YITT 3INZA 1VQMT 4IIOA 1AT1B 2FEIA 1GCQA 1S1NA 4E47A 2GGRA 3EGDB 5CAIA 3CMEQ 1Q7YR 1X2KA 2GQVA 2L0AA 3ZFJA 2LT1A 1V1CA 3FRNA 5GAMd 1ZUUA 1YIJQ 5GAN3 2ROLA 3M0QA 1WHHA 5CQYA 2E10A 3CC4A 2E41A 2EQUA 4OGEA 2GTJA 1QVPA 5FWCA 1MUZA 3I56Q 2DD4A 4C8QA 4KBMB 3KBGA 4X34A 5GAN6 4ZGJB 4E7IA 2IVWA 2DXUA 4CC3A 2KROA 4NL2A 2C06A 3C4SA 4ESRA 4DBFA 4BD3A 2BE9B 3HRUA 3MEUA 1UE9A 1VQLA 2XHCA 1K9MU 3OMCA 4Y91A 1ZSZC 2COWA 2QQAA 1KIKA 1WI7A 2HQEA 2F5KA 2A7YA 2HBPA 4JLIA 4OMQA 3RNJA 3JV3A 3RERA 1LVKA 2VXFA 5LJ5j 3CCRQ 1BYMA 3L2RA 3QPHA 5HKCA 4N0AC 2JS2A 5A0GA 3CCVA 3VS1A 1VQ9T 1VQOQ 5C6SA 3VS7A 5GAOm 1UGSB 3IQLA 2DE0X 1PD0A 3CXCS 3DKMA 4M77D 4CI0C 2JT4A 2V8JA 3DB4A 1K9MC 2D8JA 2XD0A 2K57A 2EPDA 2NWMA 2RHZA 3GBQA 3CC7Q 5CKBA 2K9GA 2JVVA 3QWXX 5KYXA 2JN0A 5FWBA 4ZTFA 3RR6A 5EG2A 3N5BB 4WCIA 2R58A 2C0TA 2E4HA 1UECA 2K79A 3QDFA 5FRMA 2FL7A 3SWNA 2ZPBB 1G3TA 2K7AA 2V26A 2A0FB 3MPUB 2ZZDA 1NBEB 1BB9A 3PNWC 4V2SA 1M90R 1Z9ZA 2RHYA 1PWTA 4ZNXA 1AZEA 5DY9A 5GANf 1Y0MA 2FB7A 4E7HA 4M7AC 3UA7A 2FG0A 1JQQA 3T9NA 3X25B 2O2OA 3CD6T 3WVEB 2DL4A 1AHJB 4YTLA 5C0MA 1N9RA 3NTIA 4KH0B 3SFMA 2FZCB 2PQWA 3BW1A 5GANh 1ZSGA 3VUBA 5KYUB 3RBBB 1IREB 2M1HA 2RI3A 2L3PA 2K5IA 2DIQA 1W2BS 3OYFA 2LMJA 2X9HA 2AZVA 5L23A 2SEMA 2HNIA 1TH7A 4Z88A 3TU4K 5FLXE 4ELYC 2XIDA 3G4SA 4RTWA 2DL5A 5HK0A 3CPWS 1HD3A 1MNDA 4HCCA 3V8LA 4IKFA 3QKJA 2EJGA 2YUQA 2ESWA 1SEMA 4RCCA 1P92A 1VQ4Q 2YXYA 4A4FA 3E1SA 1UFFA 2O01E 4JJBA 3SHWA 2RN8A 3RKWA 4NL3A 2P4RA 1GBRA 3KUFA 1C1AA 2IIMA 4EMKA 3FEOA 2QA4A 5FROA 3MCAB 2EKHA 2EQMA 2LCCA 3PT9A 3LX7A 1Q86U 3VS6A 3PTAA 2XU8A 4MZMA 5GAMe 1ZQ1A 4FU6A 2OJ2A 5M9OA 3EH2A 4KGVB 4JRIA 2Y4XA 1VQNT 3RMSA 2E3HA 1QKXA 3GLXA 3VRYA 2RD1A 4ZN1A 3M54A 1U5SA 3SD4A 3CMAQ 3EH1A 5CKDA 4HCZA 1Q82R 4DQ2A 4OMPA 2XK0A 3L2VA 4O5VA 5HY6A 1R8OB 1IRXA 1OI1A 1Q86C 3UA6A 1UHCA 3CCQA 1YI2Q 1R0CB 3QG1A 1Q7YU 2F2WA 2KBTA 3P8DA 4EPCA 4OMOA 4JRQA 3EG1A 2VASA 8AT1B 2EYQA 1I81A 1BI3A 1NM7A 1K8AR 1ACMB 2ZPHB 2O4XB 5CQXA 2LNHB 2M16A 4X9DA 2ECZA 2KVQG 4ANJA 1VQPQ 1Z9QA 1PKSA 2XDPA 1I0CA 2QEXQ 1TS9A 3V7RA 3G6EQ 1TXQA 3EFOA 3V7CA 2DRKA 1B07A 4C5EA 2LZ6B 2D0QB 2FZGB 1WHJA 1M2VB 1YCSB 3JCMQ 1Q7YC 3R6OA 3V7SA 2HKQB 4KGXB 2EIFA 2HL5C 1PCXA 1AD5A 3M5AA 1MMGA 1XJWB 3VS3A 3GOXA 1I1JA 4OMFB 5J3BA 3RUXA 3QUIA 1OU8A 4JS5A 1YIJA 2F69A 2LTOA 1E7OA 3QWYA 3CC4Q 3L2QA 4B9WA 2VWFA 1KQSP 3I56A 3JB9F 2HMAA 1Q81R 5CO7A 2JJ9A 2RQVA 1BU1A 4BACA 4HT9A 3E9FA 4XU2A 2DLPA 2EFIA 1D0XA 3THKA 3VJPA 3CBPA 2F1LA 2P0PA 1BI2A 3M4YA 1D1BA 1WA7A 1VOMA 4OB3B 4J9HA 1SPKA 4RTVA 2KT1A 2L2PA 4M77E 3GNFB 4RTTA 2D6FA 1AOJA 4GBQA 1Y96A 3PVQA 4JZ3A 3M0SA 1N5ZA 2BKDN 1WLPB 2IPOB 1KD1R 2YUOA 2LCSA 1VQ8Q 2QAZA 4LDXA 3VS2A 4IUTA 4M77A 4DOVA 2YWWA 1AWJA 3EG9B 3CCVQ 1S72T 2YLBA 3CCJA 2CZ1B 3UT1A 2ZPGB 3LW5E 3P8BB 1SHFA 3MKDA 1FX7A 1SG5A 3CC7A 4PJJA 1UUEA 4LD6A 3CC2Q 4EMGA 5GAN7 3DLMA 3A98A 4PKCC 4Y92A 3OYAA 3V8JA 2L5QA 4M75C 4FT2A 2PVDB 4RG8A 2FPFA 4FCYA 1MHNA 2KXCA 3OW2P 1YBYA 3OB9A 4XTYA 3JCMg 5J26A 2YLCA 4HXJA 3LH0A 4M75G 2WSCE 4Y28E 2NUPB 2V8KA 4F04B 1J3TA 1NLPC 1QP3A 2ZAEA 2J6OA 3Q1JA 3O8VA 4FL6A 1KC8R 4ORZA 9ATCB 1YJWT 1PM3A 4MMKA 2VB6A 1T0JA 1RI0A 4FW2A 4KUDK 1VQ7A 2L3SA 4C8QC 3ER0A 3OA6A 2LX7A 1BCMA 2PZ1A 1GRIA 2LRQA 4F16A 2KK4A 4CC7A 2K4YA 1UTIA 2DX1A 1MMAA 3M55A 2YUNA 4LXCA 2DEUA 1VYVA 2DK3A 2DETA 2V1QA 1YITQ 2CZ7B 2XDBA 2F2XA 3HTRA 4RTUA 1Y07A 4E6RA 3G4SQ 1JU5C 1OEBA 2FO0A 5I2SA 2MAMA 4HCBA 1X69A 5IHNA 5LL6S 1OU9A 2E6ZA 3O5ZA 1BK2A 3FLGA 5DLQE 2OAUA 1NZ9A 2D0NA 4C92D 4HKEA 1E6HA 3BDUA 1Q82U 4PJOD 2R5MA 2VC8A 1RL2A 2M02A 2P4TA 3VV0A 2PVGB 2QA4Q 5LJ5g 1RACB 2JS0A 2RQRA 3X24B 1JB0E 5GAOq 5GAMh 1YCYA 3ZBDA 3PMTA 2EQKA 1KG1A 4DOWA 3VS5A 4OP0A 2R5AA 4WF2A 2M9UA 1UGRB 1KQSA 3X28B 1OOTA 2ZPIB 2KGTA 1IXDA 2MK5A 2YSQA 3I35A 3CMAA 1TUGB 2RF0A 2RHIA 2CSIA 4D8DA 3G71T 1VYTA 1Q82C 2QXFA 1QVFP 2BZXA 1RAHB 3H0IA 5IHIA 4J9GA 2A37A 4HA8A 1X6BA 3LYIA 2QTVA 1SSHA 2EKOA 1QWFA 1K0XA 5FU6C 4ZTJA 1YI2A 1WHGA 1LJOA 4DBQA 1WJQA 3FDRA 2LVMA 3OBWA 4C0DC 2CGHA 1H8KA 1YJNA 2MWPA 5I11A 2DVEA 1I07A 4EMHA 2DTOA 3QDRB 3VU3C 2QI2A 1Q81U 2QEXA 2VVKA 2MOXA 4J6YA 3G6EA 1UG1A 4CC4B 4PFPA 1JJ2A 2E3IA 2LP5A 2RB6A 2COYA 2I2LA 2YUPA 3S3OA 4PLIA 2X35A 1RAGB 4HCKA 2XMFA 2PUKB 1M8VA 1IZ6A 1NG2A 2OTLA 2EQIA 2VGNA 1YWPA 4JJCA 1KFZA 1V29B 3CD6Q 1FXXA
chains in the Genus database with same CATH topology
3CMEA 1W2BS 4JUVA 2CYZB 5KCOA 1LNXA 3OYFA 1Y7XA 4RCBA 4XTUA 3OYYA 4IURA 1XOVA 2L3RA 1KD1U 3OW2A 3FC3A 4M78D 3UPUA 2CS7A 1Q81C 2HNIA 4M77F 1TH7A 3HRTA 4OGCA 5CCAA 4ZN3A 4EMKC 3CCMT 3TU4K 3LGLA 3J7AF 5FLXE 4ELYC 4XU3A 3H8ZA 5HK3A 2XIDA 1G3SA 1X6OA 3G4SA 3M4GA 3MEVA 5HK0A 3CPWS 4F7UE 3CEYA 5CKEA 1U1SA 5A0DA 3QBYA 4HCCA 3V8LA 4IKFA 3QKJA 1N6AA 3CPFA 2EJGA 4N4HA 1SSFA 3HL8A 1WNLA 4RCCA 1VQLT 1P92A 3VKIA 1KHCA 3E1SA 4A4FA 4N4GA 2FYKA 4QVCA 3CPWA 4F7UG 4M7AD 4OB1B 2CKKA 1VIEA 1G3WA 2O01E 3GP8A 1D3BA 2K3XA 2LCLA 5GAOn 4MDXA 4C8QD 3RKWA 3QYHB 4PL6A 4NL3A 2Y4YA 2DJZA 3JCMd 3KUFA 5GAN4 2GF7A 3A8GB 5GMKj 4F7UA 4L6V5 4EMKA 2F5TX 5KE3A 3FEOA 3MP8A 3ME9A 2X4JA 5D6XA 1H641 1N8RU 2QA4A 1KD1C 4HT8A 5FROA 3HSBA 3MCAB 2EQMA 4IUQA 1VQ8A 2LCCA 3TCJA 1XTDA 3RESA 3PT9A 3LX7A 1HK9A 1Q86U 4IUPA 1W4SA 4P5NA 3CMAT 3PTAA 2XU8A 4MZMA 5GAMe 1ZQ1A 4IUUA 4M75B 5I2MA 2RK1A 3QZ5B 4FU6A 5LJ3d 3JCMf 5IN1A 5M9OA 2D9TA 3CCVT 3QJ6A 3OYCA 5DLOA 4JRIA 2Y4XA 1VQNT 3A8LB 4VUBA 3RMSA 3SWNC 3GLXA 1M1KU 5GAN8 3OYGA 3X20B 2RD1A 3OMGA 3M54A 4ZN1A 3CCRA 4M75F 4M78B 3SD4A 3CCET 4BB7A 2V8IA 4E7LA 2CZ6B 1M90U 3JB9I 4LDYA 5KH6A 3EFSA 1VQOA 1YI2T 1KC8U 5CKDA 1NPPA 3CCEA 1BI1A 3JCMh 3M59A 4HCZA 4DQ2A 1VQ5A 4MMLA 5LJ3f 3CC2A 4PNOA 4M78F 1PSFA 2VXEA 2XK0A 3L2VA 3JB9D 1N8RC 4O5VA 5L8RE 1QVGA 2KY9A 1S72A 3VYHB 5GAN2 1OYXA 4A53A 5HY6A 3NFCA 1KQ2A 3E9GA 4C5IA 4N4IA 1R8OB 4CRIA 1OI1A 2MI6A 3FIFA 3JSCA 4QQDA 4M7AB 3CCQA 1Q86C 1YJNT 3JCMP 4GY5A 2DIGA 2DXTA 1BIAA 2HQXA 2VGMA 3JCMX 1M4ZA 5GAMj 2EJFA 1QW1A 3QG1A 1N9SA 4J7IA 4C8QB 3I55A 1Q7YU 5CKFA 3P8DA 4EPCA 3CCSA 1B34A 5LJ3h 4A54A 4JRQA 1VQ6T 2QEXT 3OYMA 4BY6B 3G6ET 4M7AF 4OF1A 3JAME 4R56A 2LT4A 1M1KC 5KCHA 2EYQA 1I81A 3JCMb 1BI3A 3V8KA 4C8QF 5I21A 1QVFS 3OQ5A 1M90C 2DKGA 2ZPHB 3BFMA 2O4XB 4KT0E 5CQXA 2RJCA 4A4GA 2X4YA 1Y96B 4E7JA 1KC8C 2M16A 4BI8B 4X9DA 2KVQG 5LJ5d 5A2QE 2RH2A 1NJIU 4FM4B 2GFUA 1K73U 2XDPA 3MP1A 3OYHA 2RA2A 3V7RA 1FWZA 3V7CA 2K5FA 2OTLT 1OZ2A 3J80E 2OTJT 2XDDA 2K2VA 4BI3A 4C5EA 3OYKA 3QSUA 2D0QB 3RIRA 3P8HA 5D6WA 3PFSA 3CMET 2OTJA 5DM7R 1M5Q1 3HRSA 4C92E 1VQ9A 4A4HA 4M77B 1U8RA 4C0ZA 3JCMQ 3MEAA 1Q7YC 5GMKl 3WVDB 1YJWA 3R6OA 3V7SA 4NOYA 2MF2A 2QQBA 5LJ5f 4PJOE 2EIFA 3A5ZB 2ZPFB 3M57A 5GMKh 4JJNK 3S6WA 4ELZC 3M5AA 3A8OB 1VQKA 2RHUA 5GANe 3G4ST 3GOXA 1YITA 4MZTA 4C92G 4OMFB 5J3BA 3RKXA 3RUXA 3QUIA 4C8QE 4JS5A 1YIJA 1NE8A 2F69A 1W2BA 2KMTA 4BE0A 2LTOA 2VYTA 4PJOG 3L2QA 2KQWA 4B9WA 2HAXA 2QTXA 2IG0A 1NJIC 3QYGB 2DZ9A 3JB9F 4C92A 3I56A 2DXBA 1K73C 4M7DD 4LDVA 4C8QG 5LJ5h 3GPLA 5CO7A 2RI2A 3OS1A 2PU9B 2X4WA 4FIBA 2YHTA 2LQ8A 5GANg 4PJOA 3QO3A 3KXTA 4KUIA 4BACA 4HT9A 3E9FA 4XU2A 2EFIA 3VJPA 3QIIA 3OYNA 3CBPA 3S3NA 5GAOp 2DPPB 2P0PA 3WXMB 1BI2A 4PLLA 3C12A 3UDCA 3ZEHA 3M4YA 4GLKA 1VQ4A 3JB9J 1UEBA 2VV5A 4OVAA 2QA4T 2BUDA 2RJEA 5GAMf 1VQ8T 2E70A 3BDLA 3MEWA 4OB3B 5CR2A 3VUZA 2L8DA 1O75A 3LLRA 4M77E 3GNFB 2P0QA 1BKBA 2B8AA 5A0LA 4J83A 4BE2A 2R57A 2NLUA 3UWNA 2D6FA 2EAYA 2JNGA 4XU0A 4Q5WA 1Y96A 4MZPA 4XTXA 3HHTB 2EJ9A 4QW2A 4ATOA 5GMKi 1I4K1 4KULA 2RJDA 4FSXA 5FRNA 1WJSA 2BKDN 2E12A 3LWHA 3CBMA 3VYGA 3L2WA 4M77G 5FU7B 5FU6B 2E64A 4JRKA 4XTVA 2JUFA 3PGGA 3CCRT 1KQSS 2RHXA 4J6XA 4LDXA 1XNIA 3OYJA 3M56A 2Y90A 1VIFA 3C94A 4C0DB 4IUTA 3PIPA 2ZCFB 1VQOT 2H3JA 1OZ3A 3JB9G 4M77A 4DOVA 1HXDA 1VQ5T 3L2UA 3CC2T 2JZ2A 2RI5A 1M1GA 2LDMA 4QVDA 3JRZA 1S72T 1MGQA 3GIBA 2YLBA 2FVUA 1K8AU 2M0OA 3CCJA 3QJYA 3A8MB 2CZ1B 3TEEA 1U1TA 3CC7T 4M7DB 4DA4A 3UT1A 2ZPGB 4MDWA 3CCQT 3LW5E 4ME7A 2YRVA 2PUOB 3P8BB 4J7FA 2XG8D 1FX7A 4II1A 3F70A 3I55T 3CC7A 3CCST 3G71A 2A3LA 4LD6A 1BI0A 2DO3A 3SDZA 1YJ9A 1ZBXA 4EMGA 5GAN7 1I8FA 3DLMA 5KE2A 4PKCC 4FT4A 3JCMe 3CCUA 3OYAA 4XAXB 4M7DF 2AHJB 2XICA 3MP6A 4C5HA 1G5VA 4JLGA 3V8JA 2L5QA 3E19A 4M75C 3OYBA 3JCMJ 4FT2A 2GCXA 3QZ9B 2PVDB 3X26B 4RG8A 2PVOB 3OYIA 2P0KA 4M75E 2CZ0B 4JRPA 1Y71A 3OSSC 1M9SA 1NPRA 3OS5A 4B9XA 5GMKm 4XTWA 1MHNA 2DD5A 5CK9A 3JCMW 3RMQA 2LNVA 1YBYA 3OB9A 4M78C 4XTYA 2XI9A 5J26A 1UB4A 3JCMg 3L1AA 5GAOl 3OY9A 2YLCA 1D3BB 3LH0A 3LWIA 5LJ3e 3OS0A 1WPYA 1G3YA 1UGPB 4M75G 2E1HA 2WSCE 4M78E 4OB2B 4Y28E 1K8AC 1QVFA 2QQRA 4X9CA 2E5QA 5IAYA 3J81E 2V8KA 3JCMV 1QP3A 1QP2A 2DTIA 2JTMA 4F7UB 3FJPA 1JJ2S 4EMKB 3Q1JA 3O8VA 4FL6A 4JDSA 4C92C 5J39A 4RMOA 4UC4A 1WJRA 2DZCA 3HP9A 1VQPA 1YJWT 2QQ9A 1VQ6A 4M75A 3EAEA 1ZHIA 3JB9H 2EWNA 4M78G 4PJOC 5CVIA 4MMKA 3PIOA 3NTHA 5LJ3g 2LX9A 2DEQA 2BIVA 1N27A 2E6NA 1VQKT 5AYFA 2ZGWA 1RI0A 4F7UF 1YITT 4LD9K 4KUDK 1VQ7A 4C8QC 3ER0A 4XK8E 3OA6A 1YIJT 4M7AE 4TVRA 2HD0A 2LRQA 3INZA 1UGQB 1VQMT 2E65A 4M78A 4E47A 2KK4A 3HFOA 2K4YA 5CAIA 4M7DG 3CD6A 2DXCA 2WSEE 1VQMA 3M55A 3EFRA 2FHDA 3JCMc 3I56T 3FB9A 4M7AG 2GQVA 2DK3A 2LT1A 3ZFJA 3OW2S 3FRNA 3CBOA 5GAMd 1GXIE 2CZ7B 4LDWA 5GMKe 2XDBA 3M58A 5GAN3 2WSFE 1Y07A 5CQYA 2E10A 2JOYA 3CC4A 2E41A 4XTZA 4A4KA 4M7AA 2EQUA 4OGEA 4BE1A 1QVPA 1VQ4T 2DTHA 3MO8A 1EIFA 5I2SA 2DD4A 4C8QA 4KBMB 3KBGA 4X34A 2MAMA 5GAN6 4ZGJB 4BDZA 4E7IA 2KAFA 4HCBA 2IVWA 5GAN5 2DXUA 5LL6S 2QDYB 2E6ZA 5GAOr 5LJ5e 3CCMA 3FLGA 2EQJA 2LC4A 3HKSA 4M77C 4NL2A 2OAUA 3C4SA 5DLQE 2C06A 3SWNB 1NZ9A 2XKOC 2KDSA 4BI4A 4RG2A 1X01A 4C92D 4HKEA 1LOJA 4BD3A 5CIUA 1KQ1A 3TREA 1B34B 5GANj 2DAQA 3BDUA 4C5GA 1Q82U 2O4XA 4PJOD 2R5MA 2VC8A 1BIBA 3HRUA 3MEUA 1RL2A 2P4TA 3GNGA 4XQ3A 2L89A 3VV0A 2PVGB 1VQLA 2XHCA 1K9MU 4ZGEB 3URGA 5LJ5g 2GFAA 4QQ6A 3X24B 1JB0E 5GAOq 3OMCA 4R55A 5GAMh 1YCYA 3ZBDA 3PMTA 1YHQT 3C95A 4Y91A 2EQKA 1JRIA 4JS4A 1KG1A 2QQAA 2HQEA 2F5KA 3SB2A 3L2ZA 2A7YA 2HBPA 3G7ZA 4DOWA 1YHQA 4JLIA 2MWOA 4OP0A 2R5AA 2G3RA 3OYDA 4WF2A 2M9UA 1UGRB 1KQSA 3CCJT 2RO0A 4OB0B 3X28B 3RERA 1DJ7B 2ZPEB 2ZPIB 4Z02A 2K5LA 2VXFA 4RKUE 5LJ5j 4J6WA 5CKHA 1BYMA 3CMAA 1KHIA 3OBYA 3QPHA 4N0AC 4A4EA 5HKCA 3L2RA 4BUGA 2RHIA 3G71T 1YJ9T 5A0GA 3OSVA 2VUBA 3CCUT 3CCVA 1VQ9T 1Q82C 4C0FA 5C6SA 2QXFA 3META 5GAOm 1VQNA 1UGSB 2RM4A 4C0GA 4J5YA 3CXCS 3H6ZA 3DKMA 4M77D 4CI0C 2V8JA 1K9MC 3DB4A 3PMIA 5GAMg 3DB3A 1QVGS 2XD0A 2K57A 1WGSA 4HA8A 1M1FA 2RHZA 3LYIA 3HFNA 4J8OA 2EKOA 4ZGDB 5CKBA 4D6WA 5FU7C 1O9SA 2JVVA 5FU6C 3OS2A 3CXCA 4ZTJA 1YI2A 1LJOA 4O6JA 4C92B 2JN0A 4ZTFA 1WJQA 3FDRA 2LVMA 5GANd 1VUBA 3OBWA 3A8HB 5EG2A 4C0DC 3N5BB 3CCLT 1I5LA 2CGHA 4PJOB 1PSEA 1X75C 1H3ZA 2R58A 4N0AA 4E7KA 2FL7A 3CCLA 5FRMA 3SWNA 2ZPBB 4LDUA 1G3TA 1WQ7A 4C92F 3QHSA 3ASKA 4IUVA 1YJNA 2ZZDA 3DLLA 2MMPA 2MWPA 4L5GA 2X4XA 1VQPT 1WQWA 3NTKA 2DVEA 3L42A 3MHXA 3HPWA 3PNWC 4PJOF 4EMHA 3AHUA 4V2SA 2RHYA 2DTOA 3LGFA 4M7DC 2RJFA 3QDRB 2LQKA 3VU3C 4EDUA 2QI2A 1Q81U 5DY9A 5GANf 3M9QA 2QEXA 4QQGA 4J6YA 3G6EA 1VQ7T 2FB7A 4M7DE 4E7HA 4M7AC 3OYLA 3T9NA 1JJ2A 3BY7A 4BDYA 2RB6A 2I2LA 2RK2A 4NS5A 3X25B 3CD6T 3WVEB 4L59A 3S3OA 1AHJB 4YTLA 4PLIA 5C0MA 1N9RA 2X35A 3NTIA 3OYEA 4QVZA 3SFMA 2KSSA 4BY6C 5IT9E 1M8VA 2PUKB 2PQWA 2WACA 3BW1A 2JTFA 1IZ6A 5GANh 2OTLA 3VUBA 4XU1A 2VGNA 2QQSA 3QXEB 3M53A 1V29B 1XQHA 4M75D 3RKYA 1IREB 2M1HA 5D6YA 1JBMA 3CC4T 3S3MA 4M7DA 5LJ3j 2RI3A 3GF5A 1FXXA 2K5IA 2K3YA 2DIQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KSS A; 
#chains in the Genus database with same CATH topology
 1K76 A;  2CYZ B;  5KCO A;  1LNX A;  1MV0 B;  4RCB A;  1KD1 U;  3OW2 A;  2LJ0 A;  4M78 D;  1Q81 C;  4LE9 A;  4PJM A;  3CCM T;  4EMK C;  2DF6 A;  3H8Z A;  1PD1 A;  4F7U E;  3CEY A;  1W70 A;  1U1S A;  3QBY A;  1UJY A;  1N6A A;  3R6N A;  4N4H A;  1SSF A;  3VKI A;  1PC0 A;  4M7A D;  4OB1 B;  2CKK A;  1D3B A;  2LCL A;  1IHW A;  5GAO n;  4MDX A;  2DJZ A;  3JCM d;  2GF7 A;  5GMK j;  1TUC A;  1NYG A;  4F7U A;  4L6V 5;  2F5T X;  1OQK A;  3ME9 A;  2X4J A;  1AWW A;  1H64 1;  4FSS A;  1KD1 C;  3EGX A;  3HSB A;  1VQ8 A;  1ZLM A;  1HK9 A;  1R77 A;  2NUT B;  4IUP A;  1D0Z A;  1I5O B;  5I2M A;  4M75 B;  2DJQ A;  2D1X A;  4HVW A;  1YHQ Q;  4JJD A;  1IGU A;  3QJ6 A;  5DLO A;  3A8L B;  3EG3 A;  1GFD A;  5KYU A;  2DRM A;  1M8M A;  3OYG A;  2HL3 A;  3A1P A;  4M75 F;  3CCJ Q;  4E7L A;  3JB9 I;  4LDY A;  5KH6 A;  2OI3 A;  3EFS A;  1KC8 U;  5KYW A;  1T3L A;  2RMO A;  2ROT A;  3M59 A;  4MML A;  3CC2 A;  2LQN A;  1PSF A;  2VXE A;  3H41 A;  2KY9 A;  3VYH B;  5GAN 2;  4A53 A;  3TVT A;  4HVV A;  3E9G A;  4C5I A;  2MPX C;  2W10 A;  4N4I A;  2AT1 B;  3FIF A;  1TSF A;  4QQD A;  3VS0 A;  2HZY A;  2DIG A;  1BIA A;  1TG0 A;  2HQX A;  1QW1 A;  4C8Q B;  3I55 A;  1YWO A;  2HEQ A;  4KGZ B;  1B34 A;  3OYM A;  4BY6 B;  4AG2 C;  4R56 A;  3ZL7 C;  3CCL Q;  1B3Q A;  2EYW A;  5I21 A;  4C8Q F;  3OQ5 A;  2DFU A;  2DKG A;  2YRD A;  4KT0 E;  2RJC A;  4A4G A;  1KC8 C;  5LJ5 d;  5A2Q E;  1FMV A;  2GFU A;  1OZ2 A;  2XDD A;  4BI3 A;  1VQ7 Q;  3P8H A;  5D6W A;  1WXU A;  3CME T;  5DM7 R;  4C92 E;  3MEA A;  5GMK l;  1X2Q A;  4J9B A;  1M3A A;  2MF2 A;  2QQB A;  2RQW A;  4PJO E;  5AT1 B;  4JJN K;  1VQK A;  2RHU A;  1ZA1 B;  1YIT A;  4MZT A;  4BE0 A;  4PFO A;  1HJD A;  1WHL A;  2VYT A;  5ECA A;  3QYG B;  4C92 A;  4M7D D;  3GPL A;  1RI9 A;  2AKL A;  2PU9 B;  2AKK A;  2X4W A;  2YHT A;  2LQ8 A;  4PJO A;  2E5K A;  4KUI A;  3KXT A;  1FMK A;  3OYN A;  3QII A;  4J9I A;  1RUW A;  4K11 A;  5KYX B;  3S3N A;  4D8K A;  4PLL A;  3ZEH A;  4E7S A;  2X3X D;  1UEB A;  4OVA A;  1YNZ A;  2BUD A;  1CKA A;  1OX9 A;  3BDL A;  5CR2 A;  3MEW A;  1X6G A;  1O75 A;  2JTE A;  4DEY A;  3H9N A;  2RNA A;  4XU0 A;  3CXC P;  4Q5W A;  2KRS A;  4MZP A;  3HHT B;  4QW2 A;  4ATO A;  1HSQ A;  5FRN A;  4OMN A;  1WJS A;  2E12 A;  3LWH A;  4QKU A;  3CBM A;  4M77 G;  5FU6 B;  4XTV A;  3CCR T;  1KQS S;  2BZ8 A;  4J6X A;  3M56 A;  1RAD B;  4C0D B;  1M2V A;  1VQO T;  1OZ3 A;  1VQ5 T;  3L2U A;  2JZ2 A;  1AZG B;  1M1G A;  2GTO A;  2LDM A;  2FVU A;  4JPB W;  3TEE A;  3CC7 T;  4FW1 A;  2MYS A;  4ME7 A;  3CCE Q;  4J7F A;  1GBQ A;  2CP0 A;  2DYB A;  3CCS T;  2A3L A;  1BI0 A;  2DO3 A;  1VQ9 A;  1ZSZ A;  1I8F A;  2KYM A;  3JCM e;  1N8R R;  3MP6 A;  1G5V A;  1C6V X;  3OYB A;  3JCM J;  5KYY A;  3QZ9 B;  3X26 B;  1PHT A;  2CZ0 B;  4JRP A;  1Y71 A;  1UHF A;  1NPR A;  1YJN Q;  5GMK m;  5CK9 A;  3JCM W;  3RMQ A;  2LNV A;  2XI9 A;  1UB4 A;  3OY9 A;  1WPY A;  1G3Y A;  4M78 E;  2QQR A;  5IAY A;  1QP2 A;  1JJ2 S;  3FJP A;  4EMK B;  4Z8A A;  2J06 A;  1WJR A;  2DZC A;  3HP9 A;  1TOV A;  2QQ9 A;  3EAE A;  4WTO B;  3CPW P;  1TWB A;  5LJ3 g;  1N27 A;  2KR3 A;  2ZGW A;  2OTL Q;  4M7A E;  4TVR A;  2HD0 A;  1UGQ B;  2OTJ Q;  2E65 A;  1JEG A;  4M78 A;  2HSE B;  4M7D G;  3CD6 A;  4R0K A;  3NPF A;  1YJW Q;  1EZZ B;  1QQJ A;  3EFR A;  2DL7 A;  4AFQ C;  4RTX A;  3OW2 S;  3CBO A;  1GXI E;  2H3E B;  5GMK e;  3M58 A;  5HCK A;  2JOY A;  4FYY B;  4AFZ C;  4M7A A;  2JMA A;  1VA7 A;  1VQ4 T;  2DTH A;  2QGG A;  1EIF A;  2DVJ A;  1T0H A;  4BDZ A;  1GL5 A;  2QDY B;  5LJ5 e;  1RAI B;  1NEG A;  2KDS A;  4RTZ A;  1LOJ A;  1KQ1 A;  4X1V A;  1R0B G;  1QVG P;  2L89 A;  2QG9 B;  3CQT A;  2A36 A;  3URG A;  5IH2 A;  1WX6 A;  4RTY A;  1JRI A;  1YHQ A;  3G7Z A;  2YT6 A;  3EFO B;  2MWO A;  2ED1 A;  4OB0 B;  1A0N B;  2ZPE B;  4Z02 A;  1PRL C;  4E2F B;  5GJW B;  4J6W A;  5CKH A;  1KHI A;  3OBY A;  4A4E A;  4BUG A;  1YJ9 T;  2VUB A;  3CCU T;  2AZS A;  2EW3 A;  1VQN A;  2KNB B;  2RM4 A;  3REB B;  4C0G A;  4J5Y A;  3H6Z A;  4OML A;  2LQW A;  3PMI A;  5GAM g;  3TSW A;  3HFN A;  3UF4 A;  4ZGD B;  4D6W A;  4DEX A;  1O9S A;  3G71 Q;  3CXC A;  3LH5 A;  2Z0W A;  4O6J A;  2RQU A;  2DBK A;  3I55 Q;  3KFV A;  1VUB A;  1I5L A;  1GCQ C;  2LJ3 A;  4E7K A;  3CCL A;  1OX8 A;  4LDU A;  1WQ7 A;  4IUV A;  1VQP T;  3DLL A;  4L5G A;  4LUE A;  1VYU A;  2X4X A;  1VQ6 T;  1WQW A;  1RLQ C;  3MHX A;  3AHU A;  1K4U S;  3LGF A;  4EDU A;  4AT1 B;  2JMC A;  2DL3 A;  4M7D E;  2JW4 A;  1JO8 A;  4FYV B;  3OYL A;  3BY7 A;  4PJN A;  4BDY A;  4NS5 A;  2RPN A;  4QVZ A;  1UDL A;  1TTH B;  4BY6 C;  2JTF A;  1BCO A;  4XU1 A;  3M53 A;  1SF9 A;  1XQH A;  3RKY A;  1VQK Q;  3CC4 T;  4M7D A;  5LJ3 j;  1VQM Q;  2CRE A;  4XTU A;  3OYY A;  1XOV A;  2CS7 A;  4M77 F;  4ZN3 A;  3LGL A;  1G3S A;  2C0O A;  1E6G A;  3CPF A;  3EG2 A;  3HL8 A;  1WNL A;  1VQL T;  3CPW A;  1KHC A;  2FYK A;  4F7U G;  3CCM Q;  1AEY A;  2PNI A;  1VIE A;  1K0S A;  2K3X A;  2CP3 A;  3M0R A;  3QYH B;  4A63 B;  2Y4Y A;  2HDA A;  3NHN A;  3D7S B;  5KE3 A;  3MP8 A;  1N8R U;  5D6X A;  2B86 A;  4HT8 A;  2HSP A;  1H92 A;  3TCJ A;  3EGU A;  1TU0 B;  1ARK A;  1YFN A;  4P5N A;  2EYX A;  1AWX A;  1GFC A;  4IUU A;  3QZ5 B;  3PE0 A;  5LJ3 d;  3JCM f;  2EYY A;  3EGD A;  5IN1 A;  3CCV T;  3OYC A;  2KRN A;  3SWN C;  1D1A A;  5GAN 8;  1IB8 A;  2BTT A;  2V8I A;  2GBQ A;  1NPP A;  3CCE A;  2J7I A;  4CC2 A;  3JCM h;  4PNO A;  2J6K A;  1N8R C;  3JB9 D;  1NEB A;  1VQ9 Q;  5L8R E;  1QVG A;  1S72 A;  4F17 A;  1WHK A;  2FZK B;  4CRI A;  4J9C A;  3JSC A;  4HVU A;  2DYI A;  4IIM A;  2DXT A;  2VGM A;  1OV3 A;  1M4Z A;  3JCM X;  5GAM j;  5CKF A;  5FW9 A;  1MMN A;  2KI7 A;  1U06 A;  1ZBJ A;  5KCH A;  2PTK A;  3JCM b;  4B6M A;  1WXT A;  2YDL A;  3V8K A;  1G8X A;  2QYZ A;  4LN2 A;  3BFM A;  1QLY A;  2CUD A;  2RQT A;  4BI8 B;  3RDV A;  1NJI U;  4FM4 B;  1K73 U;  3OYH A;  2RA2 A;  2GQI A;  2K2V A;  2EBP A;  3VS4 A;  3QSU A;  5IHK A;  2OTJ A;  1M5Q 1;  3HRS A;  4A4H A;  4C0Z A;  1G83 A;  1YJW A;  4NOY A;  5LJ5 f;  3M57 A;  5GMK h;  2CT4 A;  4ELZ C;  3A8O B;  1IO6 A;  1EX4 A;  1M3C A;  3G4S T;  2CH4 A;  4C92 G;  3RKX A;  4C8Q E;  1M2O A;  2O88 A;  4PJO G;  2KQW A;  1IGQ A;  2HAX A;  2FPD A;  5D7U A;  1NJI C;  1V76 A;  1K73 C;  5LJ5 h;  1QCO A;  1WDX A;  2QAS A;  2RI2 A;  3OS1 A;  5GAN g;  1JXO A;  3VRZ A;  1PKT A;  1SRL A;  1WFW A;  3C12 A;  4GLK A;  2QA4 T;  4JZ4 A;  3VUZ A;  2L8D A;  3LLR A;  2P0Q A;  1BKB A;  4BE2 A;  4J83 A;  2R57 A;  3UWN A;  2JNG A;  2K2M A;  1I4K 1;  4FSX A;  4F14 A;  1M27 C;  3VYG A;  3L2W A;  1AVZ C;  4KRT A;  4RUG A;  1WHM A;  2RHX A;  1XNI A;  4E7Z A;  3OYJ A;  3C94 A;  1VIF A;  2ZCF B;  2X3W D;  2H3J A;  3I5S A;  2ATC B;  3JB9 G;  4FYX B;  1SHG A;  4QVD A;  3JRZ A;  1VQN Q;  2M0O A;  1U1T A;  4DA4 A;  1SRM A;  4AFS C;  1U3O A;  4MDW A;  3UAT A;  3CCQ T;  4AFU C;  2YRV A;  1PRM C;  2XG8 D;  4II1 A;  2FPE A;  2QDL A;  1B7T A;  1VQ5 Q;  3G71 A;  1ZBX A;  1UJ0 A;  4FT4 A;  1WZO A;  2XIC A;  4C5H A;  1T3S A;  4JLG A;  2JM8 A;  1RAA B;  3OYI A;  2ENM A;  2EYZ A;  4B9X A;  3CCS Q;  4XTW A;  1C0M A;  2CDT A;  2DD5 A;  4M78 C;  4J9E A;  3L1A A;  1D3B B;  3LWI A;  5LJ3 e;  3OS0 A;  1M1K R;  2BE7 D;  1UGP B;  1QVF A;  4OB2 B;  1LCK A;  4PK4 A;  4X9C A;  2DER A;  3JCM V;  2JTM A;  2DTI A;  3NMZ C;  4F7U B;  3FJ5 A;  2FRY A;  1AWO A;  3EGX B;  1ABO A;  4QT7 A;  2EWN A;  4M78 G;  1X43 A;  5CVI A;  1ZX6 A;  3PIO A;  2JM9 A;  4J9D A;  1PNJ A;  2DEQ A;  5AYF A;  4F7U F;  1QCF A;  4XK8 E;  1YIJ T;  2OAW A;  4M4Z A;  2KYB A;  3HFO A;  1RLP C;  2QGF B;  2DXC A;  3M0U A;  1TUD A;  1W6X A;  2WSE E;  4LNP A;  1VQM A;  3I56 T;  2FHD A;  3JCM c;  3FB9 A;  4M7A G;  1X27 A;  4PFZ A;  4LDW A;  1OPK A;  2YRC A;  1IHV A;  2P84 A;  2WSF E;  3ULR B;  3PVL A;  5KYW B;  4XTZ A;  4OMM A;  3TSZ A;  4A4K A;  4BE1 A;  3MO8 A;  2KAF A;  5GAN 5;  5GAO r;  3CCM A;  1ABQ A;  2EQJ A;  2LC4 A;  2NUZ A;  3HKS A;  4M77 C;  3SWN B;  2XKO C;  4BI4 A;  4RG2 A;  1X01 A;  1NLO C;  5CIU A;  2DMO A;  3TRE A;  1B34 B;  5GAN j;  2DAQ A;  4C5G A;  2O4X A;  1BIB A;  2EGA A;  4XQ3 A;  3GNG A;  3EHR A;  2M51 A;  4ZGE B;  2GFA A;  2CP7 A;  4QQ6 A;  4R55 A;  1YHQ T;  3C95 A;  4JS4 A;  2MIO A;  1G2B A;  3SB2 A;  3L2Z A;  4AMC A;  2G3R A;  3OYD A;  2I0N A;  3CCJ T;  2RO0 A;  1DJ7 B;  2K5L A;  1OUL A;  3M0P A;  4RKU E;  2HBW A;  1KSW A;  3H0F A;  2KXD A;  3OSV A;  4C0F A;  3MET A;  2F2V A;  1RAF B;  8ATC B;  2HKN A;  1QVG S;  3DB3 A;  1S72 Q;  1WGS A;  1ZA2 B;  1M1F A;  1QCN A;  4J8O A;  4PJL A;  5FU7 C;  1NYF A;  3OS2 A;  1YJ9 Q;  3CCU Q;  4C92 B;  5GAN d;  1Q95 G;  2COZ A;  3CCL T;  1CKB A;  2DA9 A;  3A8H B;  4PJO B;  1PSE A;  1X75 C;  1H3Z A;  4N0A A;  2NYS A;  1W2B P;  4C92 F;  3QHS A;  3NGP A;  3ASK A;  2LJ1 A;  2MMP A;  3NTK A;  3REA B;  3L42 A;  3HPW A;  4PJO F;  2D8H A;  4LUD A;  4M7D C;  2RJF A;  2LQK A;  2CP2 A;  2CUB A;  1K9A A;  3M9Q A;  2GNC A;  4QQG A;  1VQ7 T;  2CH4 W;  1GCP A;  1BBZ A;  1YN8 A;  2RK2 A;  4L59 A;  1VQ6 Q;  5IXB A;  4Z89 A;  3OYE A;  2KSS A;  5IT9 E;  2WAC A;  3EG9 A;  2QQS A;  2A08 A;  3QXE B;  2K6D A;  2QK0 A;  4M75 D;  1M3B A;  5D6Y A;  1JBM A;  3S3M A;  3GF5 A;  2K3Y A;  2J05 A;  3CME A;  4JUV A;  1Y7X A;  4IUR A;  2HQH A;  2L3R A;  1WIE A;  2VKN A;  3FC3 A;  3UPU A;  1MMD A;  3HRT A;  4OGC A;  5CCA A;  1NJI R;  3J7A F;  1KK7 A;  1K73 R;  4XU3 A;  5HK3 A;  1WXB A;  1X6O A;  3M4G A;  3MEV A;  2KEA A;  5CKE A;  2M0Y A;  5A0D A;  2C0I A;  4J9F A;  1ZSZ B;  1Y57 A;  4N4G A;  4QVC A;  1KJW A;  1D1C A;  1M30 A;  1G3W A;  1ZUK A;  4AG1 C;  5KYY B;  3GP8 A;  2J6F A;  4C8Q D;  4PL6 A;  2NUP A;  5GAN 4;  3A8G B;  1MV3 A;  2AIR B;  1VQL Q;  2SRC A;  4IUQ A;  1XTD A;  3RES A;  1QMC A;  2DBM A;  2KE9 A;  2O9V A;  1W4S A;  3CMA T;  2CSQ A;  2CP5 A;  2L3Q A;  2RK1 A;  2D9T A;  1RAB B;  4VUB A;  2KRM A;  1M1K U;  3X20 B;  3OMG A;  3CCR A;  4M78 B;  3CCE T;  4BB7 A;  2CZ6 B;  1M90 U;  1VQO A;  1YI2 T;  2CT3 A;  1BI1 A;  1VQ5 A;  5LJ3 f;  2EVR A;  2X51 A;  4M78 F;  3SEM A;  4FYW B;  1JJ2 P;  1OYX A;  2MCN A;  5GJV B;  1K9M R;  3NFC A;  1KQ2 A;  2MI6 A;  4M7A B;  1D0Y A;  3G1J A;  1YJN T;  3JCM P;  4GY5 A;  1OPL A;  2OX7 A;  2EJF A;  3M0T A;  4J7I A;  1N9S A;  1HYO A;  3CCS A;  5LJ3 h;  4A54 A;  4KH1 B;  2QEX T;  3TQ7 P;  3G6E T;  4M7A F;  2DIL A;  4OF1 A;  3JAM E;  1M1K C;  2LT4 A;  1QVF S;  1YP5 A;  2HCK A;  2G6F X;  1M90 C;  1WYX A;  1LPL A;  2X4Y A;  1Y96 B;  4E7J A;  2RH2 A;  3MP1 A;  1RAE B;  6AT1 B;  1FWZ A;  2K5F A;  2OTL T;  3J80 E;  2OTJ T;  2DL8 A;  3AT1 B;  1QWE A;  3OYK A;  3RIR A;  3PFS A;  2FRW A;  4M77 B;  1U8R A;  3I5R A;  3WVD B;  1FYN A;  2DNU A;  3A5Z B;  2ZPF B;  3S6W A;  5GAN e;  2JXB A;  1NE8 A;  5IXF A;  1W2B A;  2KMT A;  3C0C A;  1UGV A;  2QTX A;  2IG0 A;  2DZ9 A;  2DXB A;  4LDV A;  4C8Q G;  7AT1 B;  2O9S A;  4FIB A;  1K1Z A;  3EG0 A;  3QO3 A;  2BZY A;  4DBR A;  2H8H A;  2V1R A;  5GAO p;  4GLM A;  2DPP B;  3WXM B;  3UDC A;  1VQ4 A;  3JB9 J;  2VV5 A;  2A28 A;  1MNE A;  2RJE A;  5GAM f;  1VQ8 T;  2E70 A;  2EGE A;  2B8A A;  5A0L A;  2NLU A;  2EAY A;  4XTX A;  2EJ9 A;  2K3B A;  5GMK i;  1H3H A;  4KUL A;  2RJD A;  2AK5 A;  5EC7 A;  3MJX A;  5FU7 B;  2E64 A;  4JRK A;  5KYN A;  2JUF A;  3PGG A;  1CSK A;  1PG5 B;  2Y90 A;  3BE3 A;  3PIP A;  1EFN A;  1HXD A;  3CC2 T;  2RI5 A;  1MGQ A;  3GIB A;  1F1B B;  1K8A U;  3QJY A;  3A8M B;  1SKU B;  1ZUY A;  4M7D B;  2ED0 A;  2DM1 A;  2PUO B;  3F70 A;  3I55 T;  1W1F A;  3EHQ A;  1YJ9 A;  3SDZ A;  3CCU A;  4DBH A;  5KE2 A;  4M7D F;  4XAX B;  2AHJ B;  3E19 A;  4EIK A;  2KT8 A;  2GCX A;  3CCQ Q;  1Q86 R;  2PVO B;  2P0K A;  4M75 E;  3OSS C;  2EGC A;  1M9S A;  2O31 A;  3OS5 A;  5GAO l;  3H0H A;  2CP6 A;  1QKW A;  2E1H A;  1K8A C;  3E2U A;  2E5Q A;  3J81 E;  1D09 B;  2NUT A;  4C92 C;  4JDS A;  4RMO A;  5J39 A;  1VQP A;  4UC4 A;  1VQ6 A;  3U23 A;  4M75 A;  1FMW A;  1ZHI A;  3JB9 H;  2ABL A;  4PJO C;  1JXM A;  5I22 A;  3NTH A;  2LX9 A;  2W0Z A;  2BIV A;  2E6N A;  1VQK T;  3I9Q A;  4LD9 K;  1YIT T;  3INZ A;  1VQM T;  4IIO A;  1AT1 B;  2FEI A;  1GCQ A;  1S1N A;  4E47 A;  2GGR A;  3EGD B;  5CAI A;  3CME Q;  1Q7Y R;  1X2K A;  2GQV A;  2L0A A;  3ZFJ A;  2LT1 A;  1V1C A;  3FRN A;  5GAM d;  1ZUU A;  1YIJ Q;  5GAN 3;  2ROL A;  3M0Q A;  1WHH A;  5CQY A;  2E10 A;  3CC4 A;  2E41 A;  2EQU A;  4OGE A;  2GTJ A;  1QVP A;  5FWC A;  1MUZ A;  3I56 Q;  2DD4 A;  4C8Q A;  4KBM B;  3KBG A;  4X34 A;  5GAN 6;  4ZGJ B;  4E7I A;  2IVW A;  2DXU A;  4CC3 A;  2KRO A;  4NL2 A;  2C06 A;  3C4S A;  4ESR A;  4DBF A;  4BD3 A;  2BE9 B;  3HRU A;  3MEU A;  1UE9 A;  1VQL A;  2XHC A;  1K9M U;  3OMC A;  4Y91 A;  1ZSZ C;  2COW A;  2QQA A;  1KIK A;  1WI7 A;  2HQE A;  2F5K A;  2A7Y A;  2HBP A;  4JLI A;  4OMQ A;  3RNJ A;  3JV3 A;  3RER A;  1LVK A;  2VXF A;  5LJ5 j;  3CCR Q;  1BYM A;  3L2R A;  3QPH A;  5HKC A;  4N0A C;  2JS2 A;  5A0G A;  3CCV A;  3VS1 A;  1VQ9 T;  1VQO Q;  5C6S A;  3VS7 A;  5GAO m;  1UGS B;  3IQL A;  2DE0 X;  1PD0 A;  3CXC S;  3DKM A;  4M77 D;  4CI0 C;  2JT4 A;  2V8J A;  3DB4 A;  1K9M C;  2D8J A;  2XD0 A;  2K57 A;  2EPD A;  2NWM A;  2RHZ A;  3GBQ A;  3CC7 Q;  5CKB A;  2K9G A;  2JVV A;  3QWX X;  5KYX A;  2JN0 A;  5FWB A;  4ZTF A;  3RR6 A;  5EG2 A;  3N5B B;  4WCI A;  2R58 A;  2C0T A;  2E4H A;  1UEC A;  2K79 A;  3QDF A;  5FRM A;  2FL7 A;  3SWN A;  2ZPB B;  1G3T A;  2K7A A;  2V26 A;  2A0F B;  3MPU B;  2ZZD A;  1NBE B;  1BB9 A;  3PNW C;  4V2S A;  1M90 R;  1Z9Z A;  2RHY A;  1PWT A;  4ZNX A;  1AZE A;  5DY9 A;  5GAN f;  1Y0M A;  2FB7 A;  4E7H A;  4M7A C;  3UA7 A;  2FG0 A;  1JQQ A;  3T9N A;  3X25 B;  2O2O A;  3CD6 T;  3WVE B;  2DL4 A;  1AHJ B;  4YTL A;  5C0M A;  1N9R A;  3NTI A;  4KH0 B;  3SFM A;  2FZC B;  2PQW A;  3BW1 A;  5GAN h;  1ZSG A;  3VUB A;  5KYU B;  3RBB B;  1IRE B;  2M1H A;  2RI3 A;  2L3P A;  2K5I A;  2DIQ A;  1W2B S;  3OYF A;  2LMJ A;  2X9H A;  2AZV A;  5L23 A;  2SEM A;  2HNI A;  1TH7 A;  4Z88 A;  3TU4 K;  5FLX E;  4ELY C;  2XID A;  3G4S A;  4RTW A;  2DL5 A;  5HK0 A;  3CPW S;  1HD3 A;  1MND A;  4HCC A;  3V8L A;  4IKF A;  3QKJ A;  2EJG A;  2YUQ A;  2ESW A;  1SEM A;  4RCC A;  1P92 A;  1VQ4 Q;  2YXY A;  4A4F A;  3E1S A;  1UFF A;  2O01 E;  4JJB A;  3SHW A;  2RN8 A;  3RKW A;  4NL3 A;  2P4R A;  1GBR A;  3KUF A;  1C1A A;  2IIM A;  4EMK A;  3FEO A;  2QA4 A;  5FRO A;  3MCA B;  2EKH A;  2EQM A;  2LCC A;  3PT9 A;  3LX7 A;  1Q86 U;  3VS6 A;  3PTA A;  2XU8 A;  4MZM A;  5GAM e;  1ZQ1 A;  4FU6 A;  2OJ2 A;  5M9O A;  3EH2 A;  4KGV B;  4JRI A;  2Y4X A;  1VQN T;  3RMS A;  2E3H A;  1QKX A;  3GLX A;  3VRY A;  2RD1 A;  4ZN1 A;  3M54 A;  1U5S A;  3SD4 A;  3CMA Q;  3EH1 A;  5CKD A;  4HCZ A;  1Q82 R;  4DQ2 A;  4OMP A;  2XK0 A;  3L2V A;  4O5V A;  5HY6 A;  1R8O B;  1IRX A;  1OI1 A;  1Q86 C;  3UA6 A;  1UHC A;  3CCQ A;  1YI2 Q;  1R0C B;  3QG1 A;  1Q7Y U;  2F2W A;  2KBT A;  3P8D A;  4EPC A;  4OMO A;  4JRQ A;  3EG1 A;  2VAS A;  8AT1 B;  2EYQ A;  1I81 A;  1BI3 A;  1NM7 A;  1K8A R;  1ACM B;  2ZPH B;  2O4X B;  5CQX A;  2LNH B;  2M16 A;  4X9D A;  2ECZ A;  2KVQ G;  4ANJ A;  1VQP Q;  1Z9Q A;  1PKS A;  2XDP A;  1I0C A;  2QEX Q;  1TS9 A;  3V7R A;  3G6E Q;  1TXQ A;  3EFO A;  3V7C A;  2DRK A;  1B07 A;  4C5E A;  2LZ6 B;  2D0Q B;  2FZG B;  1WHJ A;  1M2V B;  1YCS B;  3JCM Q;  1Q7Y C;  3R6O A;  3V7S A;  2HKQ B;  4KGX B;  2EIF A;  2HL5 C;  1PCX A;  1AD5 A;  3M5A A;  1MMG A;  1XJW B;  3VS3 A;  3GOX A;  1I1J A;  4OMF B;  5J3B A;  3RUX A;  3QUI A;  1OU8 A;  4JS5 A;  1YIJ A;  2F69 A;  2LTO A;  1E7O A;  3QWY A;  3CC4 Q;  3L2Q A;  4B9W A;  2VWF A;  1KQS P;  3I56 A;  3JB9 F;  2HMA A;  1Q81 R;  5CO7 A;  2JJ9 A;  2RQV A;  1BU1 A;  4BAC A;  4HT9 A;  3E9F A;  4XU2 A;  2DLP A;  2EFI A;  1D0X A;  3THK A;  3VJP A;  3CBP A;  2F1L A;  2P0P A;  1BI2 A;  3M4Y A;  1D1B A;  1WA7 A;  1VOM A;  4OB3 B;  4J9H A;  1SPK A;  4RTV A;  2KT1 A;  2L2P A;  4M77 E;  3GNF B;  4RTT A;  2D6F A;  1AOJ A;  4GBQ A;  1Y96 A;  3PVQ A;  4JZ3 A;  3M0S A;  1N5Z A;  2BKD N;  1WLP B;  2IPO B;  1KD1 R;  2YUO A;  2LCS A;  1VQ8 Q;  2QAZ A;  4LDX A;  3VS2 A;  4IUT A;  4M77 A;  4DOV A;  2YWW A;  1AWJ A;  3EG9 B;  3CCV Q;  1S72 T;  2YLB A;  3CCJ A;  2CZ1 B;  3UT1 A;  2ZPG B;  3LW5 E;  3P8B B;  1SHF A;  3MKD A;  1FX7 A;  1SG5 A;  3CC7 A;  4PJJ A;  1UUE A;  4LD6 A;  3CC2 Q;  4EMG A;  5GAN 7;  3DLM A;  3A98 A;  4PKC C;  4Y92 A;  3OYA A;  3V8J A;  2L5Q A;  4M75 C;  4FT2 A;  2PVD B;  4RG8 A;  2FPF A;  4FCY A;  1MHN A;  2KXC A;  3OW2 P;  1YBY A;  3OB9 A;  4XTY A;  3JCM g;  5J26 A;  2YLC A;  4HXJ A;  3LH0 A;  4M75 G;  2WSC E;  4Y28 E;  2NUP B;  2V8K A;  4F04 B;  1J3T A;  1NLP C;  1QP3 A;  2ZAE A;  2J6O A;  3Q1J A;  3O8V A;  4FL6 A;  1KC8 R;  4ORZ A;  9ATC B;  1YJW T;  1PM3 A;  4MMK A;  2VB6 A;  1T0J A;  1RI0 A;  4FW2 A;  4KUD K;  1VQ7 A;  2L3S A;  4C8Q C;  3ER0 A;  3OA6 A;  2LX7 A;  1BCM A;  2PZ1 A;  1GRI A;  2LRQ A;  4F16 A;  2KK4 A;  4CC7 A;  2K4Y A;  1UTI A;  2DX1 A;  1MMA A;  3M55 A;  2YUN A;  4LXC A;  2DEU A;  1VYV A;  2DK3 A;  2DET A;  2V1Q A;  1YIT Q;  2CZ7 B;  2XDB A;  2F2X A;  3HTR A;  4RTU A;  1Y07 A;  4E6R A;  3G4S Q;  1JU5 C;  1OEB A;  2FO0 A;  5I2S A;  2MAM A;  4HCB A;  1X69 A;  5IHN A;  5LL6 S;  1OU9 A;  2E6Z A;  3O5Z A;  1BK2 A;  3FLG A;  5DLQ E;  2OAU A;  1NZ9 A;  2D0N A;  4C92 D;  4HKE A;  1E6H A;  3BDU A;  1Q82 U;  4PJO D;  2R5M A;  2VC8 A;  1RL2 A;  2M02 A;  2P4T A;  3VV0 A;  2PVG B;  2QA4 Q;  5LJ5 g;  1RAC B;  2JS0 A;  2RQR A;  3X24 B;  1JB0 E;  5GAO q;  5GAM h;  1YCY A;  3ZBD A;  3PMT A;  2EQK A;  1KG1 A;  4DOW A;  3VS5 A;  4OP0 A;  2R5A A;  4WF2 A;  2M9U A;  1UGR B;  1KQS A;  3X28 B;  1OOT A;  2ZPI B;  2KGT A;  1IXD A;  2MK5 A;  2YSQ A;  3I35 A;  3CMA A;  1TUG B;  2RF0 A;  2RHI A;  2CSI A;  4D8D A;  3G71 T;  1VYT A;  1Q82 C;  2QXF A;  1QVF P;  2BZX A;  1RAH B;  3H0I A;  5IHI A;  4J9G A;  2A37 A;  4HA8 A;  1X6B A;  3LYI A;  2QTV A;  1SSH A;  2EKO A;  1QWF A;  1K0X A;  5FU6 C;  4ZTJ A;  1YI2 A;  1WHG A;  1LJO A;  4DBQ A;  1WJQ A;  3FDR A;  2LVM A;  3OBW A;  4C0D C;  2CGH A;  1H8K A;  1YJN A;  2MWP A;  5I11 A;  2DVE A;  1I07 A;  4EMH A;  2DTO A;  3QDR B;  3VU3 C;  2QI2 A;  1Q81 U;  2QEX A;  2VVK A;  2MOX A;  4J6Y A;  3G6E A;  1UG1 A;  4CC4 B;  4PFP A;  1JJ2 A;  2E3I A;  2LP5 A;  2RB6 A;  2COY A;  2I2L A;  2YUP A;  3S3O A;  4PLI A;  2X35 A;  1RAG B;  4HCK A;  2XMF A;  2PUK B;  1M8V A;  1IZ6 A;  1NG2 A;  2OTL A;  2EQI A;  2VGN A;  1YWP A;  4JJC A;  1KFZ A;  1V29 B;  3CD6 Q;  1FXX A; 
#chains in the Genus database with same CATH homology
 3CME A;  1W2B S;  4JUV A;  2CYZ B;  5KCO A;  1LNX A;  3OYF A;  1Y7X A;  4RCB A;  4XTU A;  3OYY A;  4IUR A;  1XOV A;  2L3R A;  1KD1 U;  3OW2 A;  3FC3 A;  4M78 D;  3UPU A;  2CS7 A;  1Q81 C;  2HNI A;  4M77 F;  1TH7 A;  3HRT A;  4OGC A;  5CCA A;  4ZN3 A;  4EMK C;  3CCM T;  3TU4 K;  3LGL A;  3J7A F;  5FLX E;  4ELY C;  4XU3 A;  3H8Z A;  5HK3 A;  2XID A;  1G3S A;  1X6O A;  3G4S A;  3M4G A;  3MEV A;  5HK0 A;  3CPW S;  4F7U E;  3CEY A;  5CKE A;  1U1S A;  5A0D A;  3QBY A;  4HCC A;  3V8L A;  4IKF A;  3QKJ A;  1N6A A;  3CPF A;  2EJG A;  4N4H A;  1SSF A;  3HL8 A;  1WNL A;  4RCC A;  1VQL T;  1P92 A;  3VKI A;  1KHC A;  3E1S A;  4A4F A;  4N4G A;  2FYK A;  4QVC A;  3CPW A;  4F7U G;  4M7A D;  4OB1 B;  2CKK A;  1VIE A;  1G3W A;  2O01 E;  3GP8 A;  1D3B A;  2K3X A;  2LCL A;  5GAO n;  4MDX A;  4C8Q D;  3RKW A;  3QYH B;  4PL6 A;  4NL3 A;  2Y4Y A;  2DJZ A;  3JCM d;  3KUF A;  5GAN 4;  2GF7 A;  3A8G B;  5GMK j;  4F7U A;  4L6V 5;  4EMK A;  2F5T X;  5KE3 A;  3FEO A;  3MP8 A;  3ME9 A;  2X4J A;  5D6X A;  1H64 1;  1N8R U;  2QA4 A;  1KD1 C;  4HT8 A;  5FRO A;  3HSB A;  3MCA B;  2EQM A;  4IUQ A;  1VQ8 A;  2LCC A;  3TCJ A;  1XTD A;  3RES A;  3PT9 A;  3LX7 A;  1HK9 A;  1Q86 U;  4IUP A;  1W4S A;  4P5N A;  3CMA T;  3PTA A;  2XU8 A;  4MZM A;  5GAM e;  1ZQ1 A;  4IUU A;  4M75 B;  5I2M A;  2RK1 A;  3QZ5 B;  4FU6 A;  5LJ3 d;  3JCM f;  5IN1 A;  5M9O A;  2D9T A;  3CCV T;  3QJ6 A;  3OYC A;  5DLO A;  4JRI A;  2Y4X A;  1VQN T;  3A8L B;  4VUB A;  3RMS A;  3SWN C;  3GLX A;  1M1K U;  5GAN 8;  3OYG A;  3X20 B;  2RD1 A;  3OMG A;  3M54 A;  4ZN1 A;  3CCR A;  4M75 F;  4M78 B;  3SD4 A;  3CCE T;  4BB7 A;  2V8I A;  4E7L A;  2CZ6 B;  1M90 U;  3JB9 I;  4LDY A;  5KH6 A;  3EFS A;  1VQO A;  1YI2 T;  1KC8 U;  5CKD A;  1NPP A;  3CCE A;  1BI1 A;  3JCM h;  3M59 A;  4HCZ A;  4DQ2 A;  1VQ5 A;  4MML A;  5LJ3 f;  3CC2 A;  4PNO A;  4M78 F;  1PSF A;  2VXE A;  2XK0 A;  3L2V A;  3JB9 D;  1N8R C;  4O5V A;  5L8R E;  1QVG A;  2KY9 A;  1S72 A;  3VYH B;  5GAN 2;  1OYX A;  4A53 A;  5HY6 A;  3NFC A;  1KQ2 A;  3E9G A;  4C5I A;  4N4I A;  1R8O B;  4CRI A;  1OI1 A;  2MI6 A;  3FIF A;  3JSC A;  4QQD A;  4M7A B;  3CCQ A;  1Q86 C;  1YJN T;  3JCM P;  4GY5 A;  2DIG A;  2DXT A;  1BIA A;  2HQX A;  2VGM A;  3JCM X;  1M4Z A;  5GAM j;  2EJF A;  1QW1 A;  3QG1 A;  1N9S A;  4J7I A;  4C8Q B;  3I55 A;  1Q7Y U;  5CKF A;  3P8D A;  4EPC A;  3CCS A;  1B34 A;  5LJ3 h;  4A54 A;  4JRQ A;  1VQ6 T;  2QEX T;  3OYM A;  4BY6 B;  3G6E T;  4M7A F;  4OF1 A;  3JAM E;  4R56 A;  2LT4 A;  1M1K C;  5KCH A;  2EYQ A;  1I81 A;  3JCM b;  1BI3 A;  3V8K A;  4C8Q F;  5I21 A;  1QVF S;  3OQ5 A;  1M90 C;  2DKG A;  2ZPH B;  3BFM A;  2O4X B;  4KT0 E;  5CQX A;  2RJC A;  4A4G A;  2X4Y A;  1Y96 B;  4E7J A;  1KC8 C;  2M16 A;  4BI8 B;  4X9D A;  2KVQ G;  5LJ5 d;  5A2Q E;  2RH2 A;  1NJI U;  4FM4 B;  2GFU A;  1K73 U;  2XDP A;  3MP1 A;  3OYH A;  2RA2 A;  3V7R A;  1FWZ A;  3V7C A;  2K5F A;  2OTL T;  1OZ2 A;  3J80 E;  2OTJ T;  2XDD A;  2K2V A;  4BI3 A;  4C5E A;  3OYK A;  3QSU A;  2D0Q B;  3RIR A;  3P8H A;  5D6W A;  3PFS A;  3CME T;  2OTJ A;  5DM7 R;  1M5Q 1;  3HRS A;  4C92 E;  1VQ9 A;  4A4H A;  4M77 B;  1U8R A;  4C0Z A;  3JCM Q;  3MEA A;  1Q7Y C;  5GMK l;  3WVD B;  1YJW A;  3R6O A;  3V7S A;  4NOY A;  2MF2 A;  2QQB A;  5LJ5 f;  4PJO E;  2EIF A;  3A5Z B;  2ZPF B;  3M57 A;  5GMK h;  4JJN K;  3S6W A;  4ELZ C;  3M5A A;  3A8O B;  1VQK A;  2RHU A;  5GAN e;  3G4S T;  3GOX A;  1YIT A;  4MZT A;  4C92 G;  4OMF B;  5J3B A;  3RKX A;  3RUX A;  3QUI A;  4C8Q E;  4JS5 A;  1YIJ A;  1NE8 A;  2F69 A;  1W2B A;  2KMT A;  4BE0 A;  2LTO A;  2VYT A;  4PJO G;  3L2Q A;  2KQW A;  4B9W A;  2HAX A;  2QTX A;  2IG0 A;  1NJI C;  3QYG B;  2DZ9 A;  3JB9 F;  4C92 A;  3I56 A;  2DXB A;  1K73 C;  4M7D D;  4LDV A;  4C8Q G;  5LJ5 h;  3GPL A;  5CO7 A;  2RI2 A;  3OS1 A;  2PU9 B;  2X4W A;  4FIB A;  2YHT A;  2LQ8 A;  5GAN g;  4PJO A;  3QO3 A;  3KXT A;  4KUI A;  4BAC A;  4HT9 A;  3E9F A;  4XU2 A;  2EFI A;  3VJP A;  3QII A;  3OYN A;  3CBP A;  3S3N A;  5GAO p;  2DPP B;  2P0P A;  3WXM B;  1BI2 A;  4PLL A;  3C12 A;  3UDC A;  3ZEH A;  3M4Y A;  4GLK A;  1VQ4 A;  3JB9 J;  1UEB A;  2VV5 A;  4OVA A;  2QA4 T;  2BUD A;  2RJE A;  5GAM f;  1VQ8 T;  2E70 A;  3BDL A;  3MEW A;  4OB3 B;  5CR2 A;  3VUZ A;  2L8D A;  1O75 A;  3LLR A;  4M77 E;  3GNF B;  2P0Q A;  1BKB A;  2B8A A;  5A0L A;  4J83 A;  4BE2 A;  2R57 A;  2NLU A;  3UWN A;  2D6F A;  2EAY A;  2JNG A;  4XU0 A;  4Q5W A;  1Y96 A;  4MZP A;  4XTX A;  3HHT B;  2EJ9 A;  4QW2 A;  4ATO A;  5GMK i;  1I4K 1;  4KUL A;  2RJD A;  4FSX A;  5FRN A;  1WJS A;  2BKD N;  2E12 A;  3LWH A;  3CBM A;  3VYG A;  3L2W A;  4M77 G;  5FU7 B;  5FU6 B;  2E64 A;  4JRK A;  4XTV A;  2JUF A;  3PGG A;  3CCR T;  1KQS S;  2RHX A;  4J6X A;  4LDX A;  1XNI A;  3OYJ A;  3M56 A;  2Y90 A;  1VIF A;  3C94 A;  4C0D B;  4IUT A;  3PIP A;  2ZCF B;  1VQO T;  2H3J A;  1OZ3 A;  3JB9 G;  4M77 A;  4DOV A;  1HXD A;  1VQ5 T;  3L2U A;  3CC2 T;  2JZ2 A;  2RI5 A;  1M1G A;  2LDM A;  4QVD A;  3JRZ A;  1S72 T;  1MGQ A;  3GIB A;  2YLB A;  2FVU A;  1K8A U;  2M0O A;  3CCJ A;  3QJY A;  3A8M B;  2CZ1 B;  3TEE A;  1U1T A;  3CC7 T;  4M7D B;  4DA4 A;  3UT1 A;  2ZPG B;  4MDW A;  3CCQ T;  3LW5 E;  4ME7 A;  2YRV A;  2PUO B;  3P8B B;  4J7F A;  2XG8 D;  1FX7 A;  4II1 A;  3F70 A;  3I55 T;  3CC7 A;  3CCS T;  3G71 A;  2A3L A;  4LD6 A;  1BI0 A;  2DO3 A;  3SDZ A;  1YJ9 A;  1ZBX A;  4EMG A;  5GAN 7;  1I8F A;  3DLM A;  5KE2 A;  4PKC C;  4FT4 A;  3JCM e;  3CCU A;  3OYA A;  4XAX B;  4M7D F;  2AHJ B;  2XIC A;  3MP6 A;  4C5H A;  1G5V A;  4JLG A;  3V8J A;  2L5Q A;  3E19 A;  4M75 C;  3OYB A;  3JCM J;  4FT2 A;  2GCX A;  3QZ9 B;  2PVD B;  3X26 B;  4RG8 A;  2PVO B;  3OYI A;  2P0K A;  4M75 E;  2CZ0 B;  4JRP A;  1Y71 A;  3OSS C;  1M9S A;  1NPR A;  3OS5 A;  4B9X A;  5GMK m;  4XTW A;  1MHN A;  2DD5 A;  5CK9 A;  3JCM W;  3RMQ A;  2LNV A;  1YBY A;  3OB9 A;  4M78 C;  4XTY A;  2XI9 A;  5J26 A;  1UB4 A;  3JCM g;  3L1A A;  5GAO l;  3OY9 A;  2YLC A;  1D3B B;  3LH0 A;  3LWI A;  5LJ3 e;  3OS0 A;  1WPY A;  1G3Y A;  1UGP B;  4M75 G;  2E1H A;  2WSC E;  4M78 E;  4OB2 B;  4Y28 E;  1K8A C;  1QVF A;  2QQR A;  4X9C A;  2E5Q A;  5IAY A;  3J81 E;  2V8K A;  3JCM V;  1QP3 A;  1QP2 A;  2DTI A;  2JTM A;  4F7U B;  3FJP A;  1JJ2 S;  4EMK B;  3Q1J A;  3O8V A;  4FL6 A;  4JDS A;  4C92 C;  5J39 A;  4RMO A;  4UC4 A;  1WJR A;  2DZC A;  3HP9 A;  1VQP A;  1YJW T;  2QQ9 A;  1VQ6 A;  4M75 A;  3EAE A;  1ZHI A;  3JB9 H;  2EWN A;  4M78 G;  4PJO C;  5CVI A;  4MMK A;  3PIO A;  3NTH A;  5LJ3 g;  2LX9 A;  2DEQ A;  2BIV A;  1N27 A;  2E6N A;  1VQK T;  5AYF A;  2ZGW A;  1RI0 A;  4F7U F;  1YIT T;  4LD9 K;  4KUD K;  1VQ7 A;  4C8Q C;  3ER0 A;  4XK8 E;  3OA6 A;  1YIJ T;  4M7A E;  4TVR A;  2HD0 A;  2LRQ A;  3INZ A;  1UGQ B;  1VQM T;  2E65 A;  4M78 A;  4E47 A;  2KK4 A;  3HFO A;  2K4Y A;  5CAI A;  4M7D G;  3CD6 A;  2DXC A;  2WSE E;  1VQM A;  3M55 A;  3EFR A;  2FHD A;  3JCM c;  3I56 T;  3FB9 A;  4M7A G;  2GQV A;  2DK3 A;  2LT1 A;  3ZFJ A;  3OW2 S;  3FRN A;  3CBO A;  5GAM d;  1GXI E;  2CZ7 B;  4LDW A;  5GMK e;  2XDB A;  3M58 A;  5GAN 3;  2WSF E;  1Y07 A;  5CQY A;  2E10 A;  2JOY A;  3CC4 A;  2E41 A;  4XTZ A;  4A4K A;  4M7A A;  2EQU A;  4OGE A;  4BE1 A;  1QVP A;  1VQ4 T;  2DTH A;  3MO8 A;  1EIF A;  5I2S A;  2DD4 A;  4C8Q A;  4KBM B;  3KBG A;  4X34 A;  2MAM A;  5GAN 6;  4ZGJ B;  4BDZ A;  4E7I A;  2KAF A;  4HCB A;  2IVW A;  5GAN 5;  2DXU A;  5LL6 S;  2QDY B;  2E6Z A;  5GAO r;  5LJ5 e;  3CCM A;  3FLG A;  2EQJ A;  2LC4 A;  3HKS A;  4M77 C;  4NL2 A;  2OAU A;  3C4S A;  5DLQ E;  2C06 A;  3SWN B;  1NZ9 A;  2XKO C;  2KDS A;  4BI4 A;  4RG2 A;  1X01 A;  4C92 D;  4HKE A;  1LOJ A;  4BD3 A;  5CIU A;  1KQ1 A;  3TRE A;  1B34 B;  5GAN j;  2DAQ A;  3BDU A;  4C5G A;  1Q82 U;  2O4X A;  4PJO D;  2R5M A;  2VC8 A;  1BIB A;  3HRU A;  3MEU A;  1RL2 A;  2P4T A;  3GNG A;  4XQ3 A;  2L89 A;  3VV0 A;  2PVG B;  1VQL A;  2XHC A;  1K9M U;  4ZGE B;  3URG A;  5LJ5 g;  2GFA A;  4QQ6 A;  3X24 B;  1JB0 E;  5GAO q;  3OMC A;  4R55 A;  5GAM h;  1YCY A;  3ZBD A;  3PMT A;  1YHQ T;  3C95 A;  4Y91 A;  2EQK A;  1JRI A;  4JS4 A;  1KG1 A;  2QQA A;  2HQE A;  2F5K A;  3SB2 A;  3L2Z A;  2A7Y A;  2HBP A;  3G7Z A;  4DOW A;  1YHQ A;  4JLI A;  2MWO A;  4OP0 A;  2R5A A;  2G3R A;  3OYD A;  4WF2 A;  2M9U A;  1UGR B;  1KQS A;  3CCJ T;  2RO0 A;  4OB0 B;  3X28 B;  3RER A;  1DJ7 B;  2ZPE B;  2ZPI B;  4Z02 A;  2K5L A;  2VXF A;  4RKU E;  5LJ5 j;  4J6W A;  5CKH A;  1BYM A;  3CMA A;  1KHI A;  3OBY A;  3QPH A;  4N0A C;  4A4E A;  5HKC A;  3L2R A;  4BUG A;  2RHI A;  3G71 T;  1YJ9 T;  5A0G A;  3OSV A;  2VUB A;  3CCU T;  3CCV A;  1VQ9 T;  1Q82 C;  4C0F A;  5C6S A;  2QXF A;  3MET A;  5GAO m;  1VQN A;  1UGS B;  2RM4 A;  4C0G A;  4J5Y A;  3CXC S;  3H6Z A;  3DKM A;  4M77 D;  4CI0 C;  2V8J A;  1K9M C;  3DB4 A;  3PMI A;  5GAM g;  3DB3 A;  1QVG S;  2XD0 A;  2K57 A;  1WGS A;  4HA8 A;  1M1F A;  2RHZ A;  3LYI A;  3HFN A;  4J8O A;  2EKO A;  4ZGD B;  5CKB A;  4D6W A;  5FU7 C;  1O9S A;  2JVV A;  5FU6 C;  3OS2 A;  3CXC A;  4ZTJ A;  1YI2 A;  1LJO A;  4O6J A;  4C92 B;  2JN0 A;  4ZTF A;  1WJQ A;  3FDR A;  2LVM A;  5GAN d;  1VUB A;  3OBW A;  3A8H B;  5EG2 A;  4C0D C;  3N5B B;  3CCL T;  1I5L A;  2CGH A;  4PJO B;  1PSE A;  1X75 C;  1H3Z A;  2R58 A;  4N0A A;  4E7K A;  2FL7 A;  3CCL A;  5FRM A;  3SWN A;  2ZPB B;  4LDU A;  1G3T A;  1WQ7 A;  4C92 F;  3QHS A;  3ASK A;  4IUV A;  1YJN A;  2ZZD A;  3DLL A;  2MMP A;  2MWP A;  4L5G A;  2X4X A;  1VQP T;  1WQW A;  3NTK A;  2DVE A;  3L42 A;  3MHX A;  3HPW A;  3PNW C;  4PJO F;  4EMH A;  3AHU A;  4V2S A;  2RHY A;  2DTO A;  3LGF A;  4M7D C;  2RJF A;  3QDR B;  2LQK A;  3VU3 C;  4EDU A;  2QI2 A;  1Q81 U;  5DY9 A;  5GAN f;  3M9Q A;  2QEX A;  4QQG A;  4J6Y A;  3G6E A;  1VQ7 T;  2FB7 A;  4M7D E;  4E7H A;  4M7A C;  3OYL A;  3T9N A;  1JJ2 A;  3BY7 A;  4BDY A;  2RB6 A;  2I2L A;  2RK2 A;  4NS5 A;  3X25 B;  3CD6 T;  3WVE B;  4L59 A;  3S3O A;  1AHJ B;  4YTL A;  4PLI A;  5C0M A;  1N9R A;  2X35 A;  3NTI A;  3OYE A;  4QVZ A;  3SFM A;  2KSS A;  4BY6 C;  5IT9 E;  1M8V A;  2PUK B;  2PQW A;  2WAC A;  3BW1 A;  2JTF A;  1IZ6 A;  5GAN h;  2OTL A;  3VUB A;  4XU1 A;  2VGN A;  2QQS A;  3QXE B;  3M53 A;  1V29 B;  1XQH A;  4M75 D;  3RKY A;  1IRE B;  2M1H A;  5D6Y A;  1JBM A;  3CC4 T;  3S3M A;  4M7D A;  5LJ3 j;  2RI3 A;  3GF5 A;  1FXX A;  2K5I A;  2K3Y A;  2DIQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...