2KSSA

Nmr structure of myxococcus xanthus antirepressor cars1
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
86
structure length
86
Chain Sequence
MIQDPSLIICHDVDGAPVRIGAKVKVVPHSEDGTISQRFLGQTGIVVGLVFDDPATQYPDDPLIQVLVEGLGEDLFFPEELELAPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A bacterial antirepressor with SH3 domain topology mimics operator DNA in sequestering the repressor DNA recognition helix.
pubmed doi rcsb
source organism Myxococcus xanthus
molecule tags Transcription regulator
molecule keywords Carotenogenesis protein carS
total genus 4
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2010-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18354 SH3_18 CarS bacterial SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.630 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2kssA01
2KSSA
chains in the Genus database with same CATH superfamily
2CUBA 4M77B 1XQHA 4C92D 3TEEA 1M90R 1NYFA 2YUNA 4E2FB 2MOXA 1YWPA 2E41A 3QJYA 1X2KA 1YHQT 2RA2A 4XTXA 4E7ZA 4M78G 1NE8A 2YT6A 2FZKB 4KT0E 3QWYA 4J83A 3RKXA 2LNVA 1BIAA 1TWBA 3SHWA 1UFFA 1NJIC 1ZQ1A 1K9MU 1NEGA 2MI6A 4F14A 1YJWA 3FB9A 2RH2A 2EQJA 3VS3A 5GAOl 1UJ0A 2XHCA 1WJSA 3M55A 2F2WA 4GLMA 4RTVA 4DEYA 2F2VA 5I22A 3MCAB 4LNPA 2XK0A 5HK3A 1FMKA 3C12A 2GF7A 4M75D 1QQJA 2RQRA 4DBFA 1MV0B 2KI7A 2KK4A 5IH2A 2DVEA 3JCMW 2DIQA 2FG0A 1NJIR 5IAYA 1MGQA 5KYWB 2E12A 2LQNA 3CBOA 2RHIA 3M4YA 1M2VB 1RAFB 2QEXQ 1K73C 5D6WA 1GRIA 3ER0A 3H9NA 5LJ3j 1S72T 2HNIA 3EFSA 2EYXA 2R5MA 5GANj 2OI3A 2DAQA 4FW1A 5CKHA 1RLPC 4PJOC 3QDRB 3AHUA 3MPUB 3OQ5A 1Q82U 4EPCA 2YRCA 3C0CA 2JZ2A 2JMCA 2L3SA 4X1VA 3V7SA 5LJ3e 3CCLA 1AVZC 1M1GA 1IREB 3C4SA 2PVOB 4ZNXA 1YITA 2M16A 2XKOC 5IXFA 4X9CA 4E6RA 1I4K1 2LTOA 2JOYA 4IUQA 4M78D 2LQ8A 2GFAA 4Z88A 1KK7A 2P0QA 1AOJA 1HK9A 3OSSC 1ACMB 1I1JA 1K76A 3VS7A 2PZ1A 2DL3A 4CI0C 4C0DB 3CCEA 1ZLMA 4B6MA 2GNCA 3L2RA 2DFUA 1WHJA 2RI2A 2DPPB 3G4ST 1BI1A 5L23A 1ZSZB 2ZPGB 2D8JA 3KBGA 2E64A 4C92C 3JSCA 3EFOB 2CH4A 1W1FA 2HL5C 2KT1A 2E6NA 1M2OA 2IIMA 3MEUA 2HQXA 2DERA 2ESWA 2J6OA 1XOVA 3OYYA 1KSWA 5LJ5j 2QG9B 3CCST 4GBQA 2M51A 1WJRA 2ENMA 1CSKA 1K8AC 2G6FX 1SRLA 4ORZA 2FVUA 1SRMA 2GBQA 2EWNA 1M90U 4WF2A 4FYVB 3JCMg 2QQRA 4RTZA 4BUGA 2LJ3A 3ME9A 4C5GA 3SDZA 2VXEA 1K0XA 2QA4T 4M7AE 1VQ8A 4NL2A 1RUWA 4M78A 1MNDA 2DBMA 2O9VA 1GFCA 2O9SA 4N4GA 4M7AB 2BKDN 4AFSC 2DO3A 1Q82R 2DTOA 3GOXA 1N5ZA 3PTAA 3EHQA 4HKEA 5GMKe 4E7JA 4DQ2A 1K8AR 3M56A 5GANg 4M75F 1KQSA 5CIUA 4LD6A 2NLUA 5KH6A 2D9TA 2RPNA 2ZPIB 4RCCA 4ZN1A 5CK9A 4C0GA 2AT1B 2KE9A 2DEUA 2K6DA 4N4HA 3JB9J 4A4KA 2GQVA 2MAMA 3MEAA 2ZPHB 1JXOA 2JTEA 2KDSA 3CEYA 3HL8A 2EQKA 3MP1A 2FRWA 4C8QC 3AT1B 5HK0A 1T3SA 1VQ6Q 1X6BA 1D3BA 1ZSZC 1UJYA 1VQOQ 3WVEB 1JJ2P 1VQ5A 5IHIA 1Z9QA 2A3LA 5GAMd 3P8DA 3MKDA 5GAOm 1Q81C 1X27A 3CMAQ 3HRSA 4ME7A 4IKFA 3VS1A 3DLLA 2W10A 3DB4A 1GCQC 1WI7A 3VV0A 1U8RA 1BCOA 1YI2T 2SEMA 1VQLQ 2E65A 4B9WA 4PNOA 2DJQA 3OSVA 3L1AA 3DKMA 4JRIA 3RMQA 2KR3A 1QCNA 1D1BA 1K73U 1KD1C 4RG2A 2FRYA 2D6FA 1ZBXA 2V8JA 1D09B 1ZX6A 1W6XA 5D6XA 2JTMA 2NUTA 3OYDA 4M7DB 3RIRA 1FYNA 3VU3C 4PJMA 1WIEA 1PC0A 1D0ZA 1QLYA 4F7UF 1WHMA 2LQWA 5GAMf 4ELYC 3OMCA 3CCJQ 3U23A 5LJ5h 1YJNA 1I8FA 4EMKC 2DF6A 1VQNA 2HBPA 1TTHB 4PJOF 5GANe 1WHHA 1NPRA 2DXTA 4FT2A 3OYGA 1EIFA 2LDMA 1JXMA 2PQWA 2Y4XA 3RR6A 1EX4A 4PLIA 2C0IA 2DKGA 2LNHB 5CAIA 1VQLT 2EW3A 2ZPEB 2YHTA 2LT1A 1I5LA 4F16A 1QVFP 2HDAA 3SB2A 2ROTA 5GAN2 2HMAA 1HYOA 1T3LA 1VQ4A 4KH0B 4ELZC 4JRQA 1B07A 3CCRT 4M7DC 2ED1A 1KQ2A 1JJ2A 5ECAA 3CCSQ 3JCMh 1PNJA 3QIIA 2Y4YA 2YRVA 2RJDA 2O31A 3JCMb 2EJ9A 2DE0X 4AMCA 2LCLA 2RM4A 1YFNA 1PRMC 1YIJA 2EFIA 1X43A 1S72A 5GAN6 3I55T 3CCRQ 2KXCA 1VQ7Q 2BZYA 1W4SA 2JT4A 3META 1PWTA 1X01A 1EFNA 1M90C 1H3HA 1TU0B 2YUPA 1KQ1A 2FB7A 2BZ8A 5FLXE 1G3WA 4PJOE 1Q95G 4Y91A 2JM9A 2YLBA 3FJ5A 3OW2P 3M0SA 4OB0B 3CCMA 3V8JA 3EGXA 2KAFA 3EG2A 1R0CB 2LQKA 2LP5A 1SPKA 3GPLA 5DLQE 4MZTA 3OYEA 2VV5A 3NTHA 1VQ6T 3UA7A 4LUEA 4ZTFA 1N8RC 4JS4A 2OX7A 3EG0A 3RKWA 2RB6A 3EG1A 4J9EA 3RNJA 2HSEB 4M77A 4RTTA 3HRTA 4DEXA 4WCIA 4ZGJB 2IG0A 2A0FB 3V7CA 2VASA 3EG9A 2VWFA 2ECZA 5GANf 4E7LA 2HAXA 1ABQA 3TVTA 3H0HA 1ZUYA 3P8BB 2DL5A 2FL7A 4PJOD 1Y07A 5KE3A 4OMLA 3CC4T 3QZ9B 4BDYA 4OGEA 4PJOB 2RO0A 8ATCB 2WSFE 4BD3A 1QW1A 1K8AU 3OYNA 4XU3A 1V29B 2EGAA 1Y0MA 1Z9ZA 3M53A 2C0OA 2QQAA 4HCCA 3H0IA 1YJ9T 4M7AD 4JJCA 2XDBA 4C8QB 3IQLA 1YBYA 1VQKQ 5D7UA 2E3IA 2RHYA 1PRLC 3LYIA 4E7SA 1W2BS 3JCMJ 2DXBA 5IHNA 1RAGB 3A8LB 1TG0A 1MMNA 4HXJA 1GCQA 2B86A 2FPFA 2JN0A 5KYXA 4M75C 3OYCA 2QI2A 2KROA 1YNZA 3JV3A 4JPBW 1YJ9A 3CC4A 4RG8A 1M4ZA 1P92A 3VRZA 4M7AA 2JW4A 1OOTA 1RAAB 2ED0A 1RI9A 3G6EA 4V2SA 2ZZDA 1D1CA 2CP2A 3QXEB 1V1CA 4HVWA 4B9XA 2RQUA 2JUFA 2O01E 4FL6A 3JRZA 3OYHA 2DMOA 1RAEB 2MF2A 2ABLA 4C0FA 4JJDA 1WGSA 2EQIA 1WQ7A 3MHXA 1YIJT 1TXQA 2DVJA 2E3HA 1NZ9A 3LWIA 1VQ9A 1KQSS 3EFRA 4EMHA 3EG9B 1NPPA 2RK1A 1M30A 3OYIA 3I35A 3CBPA 2K5IA 2QEXT 1WDXA 2JS0A 2HKNA 3HRUA 2PUOB 4HVUA 3TREA 5CCAA 2RJFA 5C6SA 2DETA 4MDWA 2CYZB 5FRMA 3M0RA 3UA6A 3FDRA 5GAOr 2RHZA 3BW1A 3HSBA 4AT1B 3CCLQ 3CQTA 3VS5A 4GY5A 4M77E 2M02A 3OS2A 1VQMA 2EAYA 1OX9A 3JCMf 1UGVA 1M1KC 4BI3A 3EFOA 2E5KA 4EMGA 1VIFA 4R0KA 2AK5A 2CS7A 3I55A 4F7UG 2X3XD 3MEWA 3OS1A 1X6GA 4LDUA 2JXBA 5CR2A 2DD4A 4M7AF 4OMQA 1QKXA 4XK8E 2VXFA 4EDUA 1LOJA 4M78E 2HCKA 5KYYB 5GJVB 1UUEA 4N0AC 3CCUQ 2FPDA 4FSSA 4OMNA 3CMEQ 1M1KR 1B3QA 4PK4A 3ZBDA 5GAMh 3PIOA 1YI2Q 3F70A 2DD5A 1M1KU 3UATA 4KUDK 1B34A 1UE9A 4WTOB 1FXXA 4OB1B 3LW5E 3NHNA 5GMKj 1M2VA 4BB7A 3CC2A 1W70A 3QUIA 3CCUT 3A5ZB 3THKA 1VOMA 3QO3A 1ZBJA 5GAOn 1NM7A 2AHJB 4KGXB 5D6YA 3PT9A 3G4SQ 1PSFA 1FMVA 2FO0A 1UHFA 2L2PA 2KMTA 5LJ3h 5CQXA 1C0MA 3OS0A 1QCFA 2EKHA 1LJOA 2DEQA 4OVAA 2LCCA 2COZA 3JB9D 4JLIA 2Z0WA 3SWNB 3JCMc 4QQDA 3CXCS 1K73R 2M1HA 2E6ZA 2K4YA 1LPLA 2KEAA 1SSHA 4TVRA 1H3ZA 3RDVA 1JRIA 2CZ1B 2OTJA 4M7DF 1RABB 3EGUA 3KXTA 1O9SA 5A0DA 1QP3A 2OTJT 3EG3A 3H6ZA 2DM1A 3E2UA 4F17A 1UHCA 4F7UB 2QA4Q 3JCMP 3CCET 2MWPA 2DL7A 4KULA 4JZ4A 1RADB 3PMIA 1Y96B 1GBQA 5J26A 2BIVA 4O6JA 1KQSP 5GAN3 1SSFA 2SRCA 3OYAA 1VQ5Q 2H3JA 1XTDA 4C5HA 4FCYA 4F04B 3J7AF 3CMAA 2I2LA 4QKUA 1B34B 2B8AA 3BY7A 1JJ2S 3PFSA 4Y28E 2ATCB 4AG1C 4JS5A 4LN2A 5HKCA 5FW9A 2AKKA 4IIMA 4HCKA 5GAOq 3CXCA 1WFWA 4IURA 3G71A 2MCNA 6AT1B 3S3MA 1YJWQ 2F69A 3FC3A 2QAZA 2DRKA 2KVQG 2NYSA 2X4XA 3M0TA 4XAXB 4C92F 4R55A 2COYA 1WXBA 2H8HA 2WACA 4OMMA 2K3YA 2NUZA 4JJBA 2RK2A 5CQYA 2ZGWA 2K2MA 3I9QA 4E7IA 4PFPA 3VS2A 3SWNA 3X25B 3UDCA 5GANd 3CC7Q 2LCSA 3REBB 5J39A 1SF9A 4CRIA 3JB9I 2BUDA 4LUDA 1I07A 2E1HA 9ATCB 1QCOA 1JO8A 2CT4A 2L3QA 3E9FA 1PD0A 2RI3A 2QEXA 4HCZA 3CPWP 4J9DA 4OB2B 1Q86R 2M9UA 1B7TA 4C5EA 2CGHA 1WLPB 4E47A 1ZUKA 2LC4A 3VKIA 2E5QA 4M78B 1VQPA 2XIDA 2K3BA 2LRQA 1G3TA 3BE3A 2ZPBB 4QT7A 2YUOA 4OB3B 3G6ET 3M9QA 1NJIU 3SFMA 1KD1U 1AWJA 4J9CA 1YITQ 1J3TA 4C92E 1BYMA 1M9SA 2KQWA 5A2QE 4ANJA 4VUBA 2EYWA 3I56T 4IIOA 3EHRA 5CKDA 3HPWA 2LMJA 1M3AA 5LL6S 1BIBA 1G83A 3CXCP 2FZCB 3X28B 1G2BA 2FZGB 3QSUA 5GAN5 1UGQB 3MO8A 3CCEQ 5GAMj 1S1NA 3M54A 4C8QF 4UC4A 2XU8A 2RQWA 3CCMQ 1IHVA 3NPFA 4AFQC 4IUVA 1KC8U 5DY9A 2YWWA 3MP6A 4J6WA 4FIBA 2DA9A 3CCQA 2PVDB 3SD4A 2RF0A 4HT8A 4PJOA 1BCMA 1I81A 3HTRA 3ULRB 1OZ3A 2E70A 4OGCA 3OYKA 4QVZA 2DZ9A 1KD1R 2QDYB 2NUPA 4C92B 2A28A 2MMPA 3I5RA 3OY9A 2FEIA 1YHQA 2XDDA 2DYIA 2JMAA 4FSXA 2X4WA 2VGMA 3R6OA 4Z89A 2BZXA 4DBHA 1O75A 1AWWA 3TCJA 1U1TA 3A1PA 3JB9G 2BTTA 1OV3A 5KYXB 2IPOB 1YJWT 2P0KA 1M3BA 1OULA 3X20B 1M27C 2AZVA 1OZ2A 2KT8A 3VJPA 3H41A 1PCXA 1JQQA 3I5SA 5KYUA 4MMLA 4XTZA 2GTOA 4KBMB 1MV3A 3CCVT 1VQKA 1FX7A 2J06A 3OW2A 4M7AG 2LX9A 5FWCA 3VUZA 4BI4A 1W2BP 4XTYA 3N5BB 5GMKl 1JU5C 1A0NB 3T9NA 2QK0A 5DM7R 2F1LA 3CPFA 2FPEA 1Q81R 1VA7A 2ZPFB 4M78F 2V1QA 4HVVA 1GBRA 3JCMV 1GL5A 2GTJA 3CC4Q 1WJQA 4DOWA 4JDSA 1ZA1B 3PE0A 2BE7D 3D7SB 3DB3A 1Q7YR 3CCQT 3G6EQ 4GLKA 1IZ6A 1LNXA 1WXTA 2LVMA 4QVCA 3GNFB 1F1BB 4C92G 4PLLA 3SWNC 1VQ6A 4DBRA 3M58A 2JM8A 2LX7A 4LD9K 2V1RA 4AFUC 3VUBA 5DLOA 3I56Q 3LWHA 1I5OB 3M4GA 1OI1A 1VQOA 2L5QA 2DILA 3TU4K 2DBKA 3JCMe 2OTLA 1N8RU 5GAMg 4A4HA 2XMFA 2KSSA 4M4ZA 1WHLA 1D0XA 4FYYB 3GBQA 2YSQA 1VQLA 1QVFA 2DYBA 2G3RA 3FIFA 3GLXA 2EYQA 2CREA 2J6FA 5IHKA 2RHXA 3HFNA 2I0NA 1XJWB 1MMGA 2A08A 1N9SA 3HKSA 4J9HA 1M5Q1 1RLQC 5GJWB 1WHGA 4PFZA 2EIFA 1N8RR 4M75E 3LH0A 1SEMA 3OA6A 5FRNA 1FMWA 2RHUA 4PJOG 3L2WA 2QTVA 1KC8R 1E6HA 1R77A 3G7ZA 4IUPA 1VQNT 5KYWA 5FU6C 1QVGA 1VQMQ 3S6WA 2RD1A 5CO7A 4QVDA 4QQ6A 3CCJA 2CP3A 3VYGA 3NTIA 2FYKA 3PIPA 3V8KA 4MMKA 4Z8AA 3HHTB 2P0PA 1WZOA 3I55Q 1AT1B 2A37A 2P4RA 3M5AA 3ZFJA 4P5NA 4Q5WA 3O5ZA 2DL4A 1W2BA 3CPWS 4XTVA 3DLMA 3A8OB 1VYTA 4LXCA 3WVDB 4D8KA 1VQPT 1QKWA 2D0NA 1H8KA 1MMDA 2PTKA 2DLPA 1GXIE 1Y71A 3TSWA 3KUFA 3L42A 3JCMX 1GCPA 4C8QG 4YTLA 2XG8D 1RL2A 2CZ7B 1D1AA 2HQHA 2GFUA 2K79A 2L3PA 3A98A 3URGA 2O2OA 2PU9B 2PNIA 3EH1A 2CP6A 1OU9A 4RTXA 3FEOA 4ESRA 4FU6A 1U3OA 2HD0A 3S3NA 5LJ3d 4AFZC 1IHWA 5HCKA 1YIJQ 3HP9A 3M57A 1MHNA 2K5FA 1BI3A 3H8ZA 1C1AA 3OS5A 4ZGDB 5GAN4 1QWFA 2H3EB 5AYFA 2LT4A 1H641 3E9GA 3CCRA 3V8LA 3NMZC 5A0LA 5FROA 2KBTA 3SEMA 5KCHA 5KE2A 2VVKA 3PGGA 1U1SA 5I11A 1OEBA 2P4TA 1NLOC 2EGEA 1FWZA 2RJEA 4MDXA 2DXCA 2VGNA 2YRDA 1ARKA 4BE0A 1AEYA 5GAN7 3V7RA 3EGDA 3H0FA 2EGCA 1OQKA 2W0ZA 2QTXA 3R6NA 2O88A 2DX1A 4J8OA 4NOYA 1VQOT 1Y96A 5C0MA 4EIKA 3CD6Q 5CKBA 2V26A 1NEBA 1BBZA 4OP0A 1VQ8T 2DIGA 4RKUE 3QG1A 2XICA 2CZ6B 2AKLA 3KFVA 2QASA 5LJ5d 5FU7C 4RTYA 5IXBA 2RJCA 2KRNA 1M8MA 4A53A 5I2MA 3S3OA 4XU2A 4XQ3A 2LJ1A 4CC7A 2KNBB 2V8IA 4XTWA 3VYHB 3CBMA 2LZ6B 1VQ7T 2M0OA 5GAN8 3QBYA 1AHJB 1SKUB 1WQWA 3JB9H 3QYGB 4ZGEB 3PNWC 1TUCA 4J5YA 2EYZA 1Q86U 2QQ9A 1YWOA 2HQEA 4DBQA 1UDLA 3UWNA 3OYMA 3PMTA 5LJ5e 3FLGA 1BI0A 2RN8A 1PKSA 2F5KA 1U06A 1QMCA 2JS2A 1KHCA 4J6XA 1RACB 1NLPC 1UB4A 4Y92A 4NS5A 3QHSA 3LLRA 5GANh 3LX7A 2X4JA 4EMKA 4F7UE 4KH1B 3ZEHA 1YJ9Q 4J7FA 2JNGA 4C8QA 2O4XA 3GP8A 1KFZA 3LGLA 3BDUA 5KYYA 5LJ5g 3CCVA 4RCBA 1VQKT 3QWXX 1Q82C 2E4HA 1K9AA 4FT4A 2OTLT 1AZEA 2V8KA 4HT9A 3CC7A 1KG1A 3QJ6A 3JAME 4JLGA 4A4FA 4KGZB 1GFDA 2AIRB 1TH7A 4KGVB 4PL6A 2PVGB 4BACA 3CC2T 1CKBA 5GAMe 1MUZA 2X51A 5FU6B 4RTUA 4IUUA 1QVFS 3A8GB 4BE1A 1SG5A 3RESA 3VS4A 4OMPA 4C8QE 1VYUA 2M0YA 1G5VA 1KIKA 3TQ7P 4R56A 5EC7A 3RKYA 4C0DC 1N6AA 1IXDA 2MIOA 1JEGA 4IUTA 2VC8A 1UGPB 3OBYA 1VQPQ 2CP0A 3RMSA 3OYFA 2KRMA 3CCLT 2MWOA 1LCKA 4J7IA 2K7AA 3Q1JA 1DJ7B 2WSCE 1QVGP 4KUIA 4JRKA 4C8QD 3QKJA 2XDPA 4D6WA 1I0CA 2DRMA 4J9IA 3GNGA 1WX6A 4J9FA 1YCYA 2HEQA 1WNLA 1YJNQ 4OMFB 1BKBA 4XU1A 4HCBA 2QQSA 5CVIA 1PD1A 1UGSB 5A0GA 3RERA 2CSQA 2KGTA 1NYGA 4C92A 1AZGB 1LVKA 3NFCA 5IN1A 1RI0A 3M0UA 4BI8B 2EQUA 1ZSGA 4RTWA 2RMOA 2AZSA 1RAIB 3INZA 4NL3A 2X35A 1XNIA 4CC3A 5M9OA 4J9BA 1VQ9T 1YITT 2YXYA 2RNAA 4OMOA 4XTUA 3L2VA 1YN8A 2ZCFB 1K4US 1TSFA 4N0AA 2P84A 3FRNA 3CC2Q 1QVGS 3A8MB 4X9DA 5KYUB 3JCMQ 1VUBA 2K2VA 1WA7A 4E7HA 3ASKA 2RQTA 4LDWA 1PHTA 2D0QB 4FYWB 2R57A 1VQ7A 3A8HB 3C95A 3CCMT 1X2QA 4LE9A 3M0PA 5GMKi 3L2QA 1N9RA 1ZUUA 1KHIA 2DK3A 1V76A 2X3WD 4ZTJA 1N27A 5GMKm 4AG2C 2L3RA 1OPLA 2DXUA 2KY9A 3BFMA 3M0QA 2X9HA 2DNUA 2VKNA 3MJXA 1TUDA 4CC2A 2YLCA 4J9GA 3J80E 1Q86C 4CC4B 1CKAA 2D8HA 3RBBB 4K11A 4LDVA 1OU8A 1KC8C 2HBWA 1BU1A 3CC7T 2OTJQ 3OMGA 3VRYA 4LDYA 4BY6C 3VS6A 1Y7XA 2QQBA 4BDZA 4MZMA 1ZSZA 1X6OA 1IGUA 2CKKA 3EGDB 5LJ3f 1Q81U 4ATOA 2CT3A 1PKTA 1R8OB 2A36A 3QYHB 3CMAT 2EJFA 1WHKA 2DJZA 4J6YA 2L0AA 5CKEA 1TS9A 1ZA2B 1KJWA 1IRXA 2K3XA 2CH4W 1PM3A 1X75C 2QYZA 1VQ8Q 2VYTA 2K57A 5I21A 4F7UA 2HKQB 2FHDA 2OTLQ 2O4XB 2HL3A 1G3SA 1YJNT 2OAUA 2D1XA 1HSQA 2RI5A 2KYBA 1M3CA 1RAHB 3MEVA 4N4IA 2CZ0B 5J3BA 3EAEA 2F2XA 2GGRA 4MZPA 3G71Q 1WYXA 1HXDA 1K1ZA 3LH5A 3P8HA 3OBWA 3FJPA 3G71T 1TOVA 2L8DA 4L5GA 4C0ZA 1M1FA 2ROLA 1ZHIA 1K9MR 4M78C 2EQMA 1IGQA 5HY6A 3G1JA 4II1A 4DOVA 2GQIA 3CD6T 1OX8A 2CUDA 1VQ4T 2KXDA 3CMET 1BI2A 5IT9E 2VUBA 3LGFA 2EJGA 3O8VA 5EG2A 1HJDA 1WPYA 2EBPA 3OB9A 2K5LA 4A4EA 2ZAEA 3CCJT 1MMAA 4JUVA 2EVRA 4C5IA 2QXFA 2L89A 2CP5A 2JVVA 4ZN3A 3NTKA 2DL8A 5FWBA 2J6KA 1UEBA 2EKOA 3M59A 5GAOp 1K9MC 1VQ9Q 1BB9A 1D3BB 3X26B 1M8VA 1IB8A 5CKFA 4M75B 1UGRB 5GMKh 3UPUA 3EH2A 4M77G 4RMOA 1R0BG 4Z02A 1UECA 2KYMA 3OYBA 2EYYA 2BE9B 2MK5A 1D0YA 4QQGA 1SHGA 7AT1B 2DZCA 2OJ2A 3JCMd 4FW2A 2R58A 3EGXB 2RQVA 4FM4B 3UT1A 1EZZB 4JJNK 1E6GA 1VIEA 1TUGB 4BE2A 2CSIA 4XU0A 3J81E 1ABOA 4X34A 2LJ0A 1VQNQ 4E7KA 2J05A 2HZYA 2MYSA 1PG5B 2PUKB 1BK2A 1PSEA 1E7OA 4L6V5 3VS0A 1QWEA 4A63B 4M7DD 2IVWA 3BDLA 4RUGA 2F5TX 1VQ5T 1OPKA 1YCSB 5KYNA 4PKCC 3QZ5B 1QVPA 2XI9A 4M77F 3REAB 1AWOA 2K9GA 2MPXC 1VQMT 4JZ3A 4OF1A 4KRTA 3CCUA 1G8XA 2EPDA 1VQ4Q 1Q7YU 3C94A 2COWA 5I2SA 2VB6A 4M7DE 5KCOA 3CMEA 1VYVA 3CCQQ 1JB0E 3CCSA 3CD6A 1YI2A 4DA4A 3CPWA 4M7AC 3QPHA 1MNEA 4BY6B 4PJNA 1JBMA 3OYJA 3X24B 2QGFB 3RUXA 2WSEE 2KRSA 4PJJA 2YUQA 1YHQQ 2Y90A 4M77D 1YP5A 1S72Q 3JB9F 3WXMB 1T0JA 3MP8A 2DTHA 1X69A 3ZL7C 1Y57A 4M7DG 4L59A 8AT1B 2JJ9A 4M77C 1C6VX 5FU7B 3G4SA 5AT1B 5L8RE 5LJ5f 1OYXA 1IO6A 4M75A 3GIBA 2R5AA 2C0TA 3UF4A 2NUPB 2C06A 1U5SA 4D8DA 1AWXA 4EMKB 1Q7YC 2J7IA 2YDLA 4O5VA 3OW2S 3PVLA 2NWMA 2GCXA 4M75G 1T0HA 1UTIA 5LJ3g 1NG2A 3OYLA 4PFOA 1HD3A 4HA8A 2CP7A 3NGPA 1WXUA 3GF5A 2QDLA 2XD0A 3TSZA 1K0SA 2A7YA 2QGGA 2CDTA 3QDFA 1SHFA 4PJLA 2X4YA 1G3YA 3L2UA 1AD5A 3HFOA 2JTFA 3E19A 1H92A 2OAWA 2QA4A 3CCVQ 4A54A 3PVQA 1NBEB 3E1SA 4LDXA 4JRPA 2HSPA 1QP2A 4QW2A 4FYXB 2DTIA 3I56A 3L2ZA 2E10A 1UG1A 4A4GA 2NUTB 4M7DA
chains in the Genus database with same CATH topology
4J7IA 4M77A 5GAN5 1UGQB 3HRTA 3MO8A 4M77B 4ZGJB 5GAMj 1XQHA 4C92D 3M54A 3TEEA 4C8QF 4UC4A 2XU8A 2IG0A 3Q1JA 1DJ7B 2WSCE 2E41A 3QJYA 3V7CA 4KUIA 1YHQT 4JRKA 4C8QD 2RA2A 3QKJA 5GANf 2XDPA 4XTXA 4D6WA 4E7LA 2HAXA 4M78G 4IUVA 1NE8A 1KC8U 3GNGA 5DY9A 4KT0E 3P8BB 4J83A 3MP6A 3RKXA 2FL7A 4J6WA 1YCYA 4FIBA 4PJOD 2LNVA 1WNLA 1Y07A 5GAOp 1BIAA 4OMFB 1BKBA 3CCQA 2PVDB 3SD4A 4XU1A 5KE3A 3CC4T 3QZ9B 2QQSA 4OGEA 5CVIA 2RO0A 4BDYA 1NJIC 2WSFE 4PJOB 4HT8A 4PJOA 1ZQ1A 1UGSB 4BD3A 1QW1A 1K8AU 1K9MU 3OYNA 1I81A 2MI6A 1YJWA 1VQMA 4XU3A 1OZ3A 2E70A 3FB9A 2RH2A 4OGCA 1V29B 4QVZA 2EQJA 5A0GA 3OYKA 2DZ9A 5GAOl 3M53A 2XHCA 1WJSA 3M55A 2QDYB 2QQAA 4C92B 4HCCA 2MMPA 1YJ9T 4C92A 3OY9A 1YHQA 4M7AD 2XDDA 2XDBA 4C8QB 3MCAB 3NFCA 4FSXA 5IN1A 2XK0A 1RI0A 2X4WA 2VGMA 3R6OA 2EQUA 1YBYA 4BI8B 5HK3A 3C12A 2RHYA 3LYIA 2GF7A 1O75A 4M75D 1W2BS 3INZA 3JCMJ 3TCJA 4NL3A 1U1TA 2DXBA 2X35A 2KK4A 2DVEA 3A8LB 1XNIA 5M9OA 3JCMW 3JB9G 1VQ9T 1YITT 2JN0A 2DIQA 3OYCA 4M75C 1YJWT 2P0KA 2QI2A 4XTUA 3X20B 3L2VA 5IAYA 1YJ9A 3CC4A 1MGQA 1OZ2A 4RG8A 3VJPA 2ZCFB 1M4ZA 1P92A 4N0AA 2E12A 3FRNA 4M7AA 3CBOA 2RHIA 3A8MB 4X9DA 3M4YA 1QVGS 3JCMQ 1VUBA 4MMLA 1K73C 2K2VA 5D6WA 4XTZA 4KBMB 3G6EA 3ER0A 4V2SA 5LJ3j 4E7HA 1S72T 2ZZDA 2HNIA 3ASKA 3EFSA 3CCVT 1VQKA 1FX7A 2R5MA 3QXEB 3OW2A 4LDWA 5GANj 2DAQA 4B9XA 4M7AG 2D0QB 2LX9A 5CKHA 2R57A 3VUZA 2JUFA 3A8HB 3C95A 4XTYA 2O01E 3N5BB 4BI4A 5GMKl 4FL6A 3T9NA 3JRZA 3OYHA 5DM7R 3CCMT 3CPFA 4PJOC 3QDRB 2ZPFB 4M78F 5GMKi 1N9RA 3L2QA 3AHUA 2MF2A 3OQ5A 1KHIA 2DK3A 1Q82U 4C0FA 4EPCA 2JZ2A 4ZTJA 1N27A 3JCMV 5GMKm 1WGSA 1WJQA 3V7SA 2L3RA 4JDSA 4DOWA 5LJ3e 3CCLA 2DXUA 2KY9A 1WQ7A 1M1GA 1IREB 3MHXA 3BFMA 1YIJT 3DB3A 3C4SA 3CCQT 2PVOB 1NZ9A 4GLKA 3LWIA 1IZ6A 1YITA 1VQ9A 1LNXA 1KQSS 2M16A 2XKOC 3EFRA 2LVMA 4QVCA 3GNFB 4X9CA 4C92G 4EMHA 4PLLA 1NPPA 2YLCA 2RK1A 3SWNC 3J80E 1VQ6A 3M58A 1Q86C 3OYIA 3CBPA 1I4K1 2LTOA 2K5IA 2JOYA 4IUQA 2QEXT 4M78D 4LD9K 3HRUA 2LQ8A 2PUOB 2GFAA 3VUBA 5DLOA 3LWHA 3TREA 5CCAA 2P0QA 3M4GA 1OI1A 4LDVA 2RJFA 5C6SA 1VQOA 1HK9A 4MDWA 2CYZB 3OSSC 5FRMA 1KC8C 2L5QA 3FDRA 4CI0C 3CC7T 5GAOr 2RHZA 3OMGA 3BW1A 4C0DB 3CCEA 3TU4K 3HSBA 3JCMe 2OTLA 4LDYA 1N8RU 5GAMg 3L2RA 4BY6C 2RI2A 4A4HA 2DPPB 3G4ST 1Y7XA 1BI1A 2KSSA 4GY5A 2QQBA 4M77E 2ZPGB 3KBGA 2EAYA 3OS2A 2E64A 4BDZA 3JCMf 4C92C 4MZMA 3JSCA 1M1KC 1VQLA 1QVFA 1X6OA 2G3RA 2CKKA 1Q7YC 3FIFA 3GLXA 5LJ3f 2EYQA 4BI3A 1Q81U 4ATOA 1R8OB 2RHXA 3HFNA 4EMGA 1VIFA 3QYHB 2E6NA 3CMAT 2EJFA 3MEUA 2CS7A 2DJZA 2HQXA 4J6YA 1N9SA 3I55A 4F7UG 5CKEA 3HKSA 1M5Q1 3MEWA 2K3XA 3OS1A 1XOVA 2EIFA 4LDUA 1X75C 4M75E 2VYTA 3LH0A 3OA6A 2K57A 5CR2A 5FRNA 2DD4A 4M7AF 3OYYA 2RHUA 4XK8E 4PJOG 2VXFA 4EDUA 5LJ5j 5I21A 4F7UA 3L2WA 3CCST 1LOJA 2FHDA 1WJRA 2O4XB 4M78E 1K8AC 1VQNT 3G7ZA 4IUPA 1G3SA 1YJNT 5FU6C 2OAUA 1QVGA 3S6WA 2FVUA 2RD1A 2RI5A 5CO7A 4QVDA 4N0AC 2EWNA 1M90U 4QQ6A 3CCJA 4WF2A 3MEVA 3NTIA 3VYGA 2FYKA 3PIPA 3JCMg 2QQRA 3V8KA 4MMKA 3HHTB 4N4IA 4BUGA 2P0PA 2CZ0B 3ME9A 5J3BA 3EAEA 4MZPA 3SDZA 3ZBDA 4C5GA 5GAMh 3PIOA 2VXEA 1HXDA 2QA4T 3P8HA 4M7AE 3F70A 3OBWA 2DD5A 3FJPA 3M5AA 3G71T 1M1KU 4KUDK 3ZFJA 4P5NA 1B34A 4NL2A 4Q5WA 1VQ8A 2L8DA 4L5GA 1FXXA 4M78A 4C0ZA 1M1FA 4OB1B 4N4GA 4M7AB 1ZHIA 3LW5E 4M78C 5GMKj 4BB7A 1W2BA 3CC2A 2EQMA 3CPWS 5HY6A 2BKDN 3DLMA 4XTVA 3A8OB 2DO3A 2DTOA 3GOXA 3QUIA 3PTAA 3CCUT 3WVDB 3A5ZB 4II1A 1VQPT 4DOVA 3QO3A 5GAOn 4HKEA 1Y71A 3CD6T 1GXIE 1VQ4T 3KUFA 5GMKe 4E7JA 3L42A 3JCMX 4DQ2A 3CMET 2AHJB 1BI2A 3M56A 5GANg 4M75F 1KQSA 5CIUA 4YTLA 5D6YA 3PT9A 4C8QG 5IT9E 2VUBA 2XG8D 3LGFA 4LD6A 1RL2A 2NLUA 2CZ7B 5KH6A 2D9TA 1PSFA 2EJGA 2GFUA 2ZPIB 3URGA 4OVAA 4RCCA 2PU9B 4ZN1A 3O8VA 5CK9A 5EG2A 1WPYA 4C0GA 3OB9A 2K5LA 2KMTA 5LJ3h 4A4EA 5CQXA 3CCJT 3OS0A 4N4HA 3JB9J 4JUVA 1K9MC 4A4KA 1LJOA 4C5IA 2DEQA 2LCCA 2L89A 2GQVA 2QXFA 3FEOA 4FU6A 2HD0A 2JVVA 2MAMA 3MEAA 5LJ3d 4ZN3A 3S3NA 2ZPHB 3NTKA 3JB9D 3HP9A 2KDSA 3CEYA 3M57A 4JLIA 1UEBA 1MHNA 2EKOA 2K5FA 1BI3A 3H8ZA 3HL8A 3M59A 3OS5A 2EQKA 3MP1A 3SWNB 5AYFA 3JCMc 2LT4A 4ZGDB 5GAN4 4QQDA 1H641 3E9GA 4C8QC 3CXCS 3CCRA 3V8LA 5HK0A 1D3BB 3X26B 5A0LA 2M1HA 1M8VA 5FROA 5CKFA 4M75B 1UGRB 5GMKh 1D3BA 2E6ZA 5KCHA 5KE2A 3UPUA 3PGGA 4M77G 2K4YA 4RMOA 4TVRA 1H3ZA 1U1SA 4Z02A 3WVEB 1JRIA 2CZ1B 3OYBA 2P4TA 1VQ5A 2A3LA 1FWZA 3P8DA 5GAMd 5GAOm 2OTJA 2RJEA 1Q81C 4M7DF 4MDXA 2DXCA 3HRSA 4QQGA 3KXTA 1O9SA 2VGNA 4ME7A 2DZCA 1QP3A 5A0DA 2OTJT 4IKFA 3JCMd 3DLLA 3H6ZA 2R58A 4BE0A 3DB4A 3VV0A 1U8RA 3JCMP 1YI2T 4F7UB 4FM4B 3V7RA 3UT1A 5GAN7 3CCET 4JJNK 2E65A 2MWPA 4B9WA 4PNOA 1VIEA 2QTXA 4BE2A 4KULA 3OSVA 3L1AA 4XU0A 3DKMA 4JRIA 3J81E 4X34A 4J8OA 4NOYA 3RMQA 1VQOT 4E7KA 1Y96A 3PMIA 5C0MA 1K73U 1Y96B 1KD1C 5CKBA 2PUKB 4RG2A 2D6FA 5J26A 1ZBXA 2BIVA 2V8JA 4O6JA 5GAN3 1SSFA 1PSEA 4L6V5 3OYAA 4OP0A 1VQ8T 2H3JA 4M7DD 1XTDA 2IVWA 2DIGA 3BDLA 5D6XA 4C5HA 2JTMA 2F5TX 4RKUE 1VQ5T 3J7AF 3OYDA 3CMAA 3QG1A 4M7DB 2I2LA 2CZ6B 2XICA 3QZ5B 4PKCC 3RIRA 1QVPA 2XI9A 4M77F 1B34B 2B8AA 3BY7A 3VU3C 3PFSA 1JJ2S 4Y28E 5LJ5d 5FU7C 4JS5A 5HKCA 4F7UF 4OF1A 1VQMT 2RJCA 5GAMf 4ELYC 3OMCA 3CCUA 4A53A 1Q7YU 5I2MA 5LJ5h 3C94A 5I2SA 5GAOq 3CXCA 3S3OA 1YJNA 4M7DE 5KCOA 4XU2A 4XQ3A 1I8FA 4EMKC 3CMEA 4IURA 1VQNA 2HBPA 4PJOF 5GANe 1NPRA 1JB0E 3CCSA 3G71A 3CD6A 2V8IA 2DXTA 1YI2A 4XTWA 3VYHB 3S3MA 4DA4A 4FT2A 3CBMA 3OYGA 3CPWA 1EIFA 2F69A 2LDMA 2M0OA 5GAN8 3FC3A 1VQ7T 4M7AC 2PQWA 1AHJB 2Y4XA 3QBYA 3QPHA 4PLIA 1WQWA 4BY6B 3JB9H 2KVQG 3QYGB 1JBMA 3PNWC 2X4XA 3X24B 4ZGEB 3OYJA 2DKGA 4XAXB 3RUXA 5CAIA 4J5YA 4C92F 2WSEE 4R55A 1VQLT 2WACA 2YHTA 2LT1A 2ZPEB 2QQ9A 1Q86U 1I5LA 2HQEA 2Y90A 2K3YA 4M77D 3RERA 3UWNA 3OYMA 3JB9F 3SB2A 2RK2A 3PMTA 3FLGA 5CQYA 1BI0A 3WXMB 3MP8A 5LJ5e 2ZGWA 5GAN2 2DTHA 2F5KA 4E7IA 4M7DG 4L59A 1VQ4A 3SWNA 4M77C 3X25B 4ELZC 4JRQA 1KHCA 3UDCA 4J6XA 3CCRT 5GANd 3G4SA 5FU7B 4M7DC 5L8RE 1KQ2A 1UB4A 5J39A 5LJ5f 1OYXA 4CRIA 3JB9I 2BUDA 1JJ2A 4M75A 3GIBA 2R5AA 4NS5A 3QHSA 2E1HA 3LLRA 3JCMh 5GANh 2C06A 3LX7A 2X4JA 3QIIA 4EMKA 2Y4YA 2YRVA 4F7UE 2RJDA 3ZEHA 4J7FA 2JNGA 3E9FA 4C8QA 2O4XA 4EMKB 4O5VA 3JCMb 3LGLA 2EJ9A 3GP8A 3OW2S 3BDUA 2LCLA 2GCXA 2RM4A 5LJ5g 4M75G 2RI3A 2QEXA 1YIJA 2EFIA 4HCZA 3CCVA 4RCBA 1VQKT 5LJ3g 4OB2B 1S72A 5GAN6 3I55T 3OYLA 1Q82C 2M9UA 4HA8A 4C5EA 4FT4A 2OTLT 2CGHA 2V8KA 4E47A 3GF5A 1W4SA 2LC4A 3CC7A 4HT9A 3QJ6A 3JAME 1KG1A 4JLGA 3VKIA 4A4FA 3META 1X01A 2E5QA 4M78B 1TH7A 1VQPA 2XD0A 2XIDA 2LRQA 4PL6A 2A7YA 2PVGB 1G3TA 1M90C 4BACA 3CC2T 2ZPBB 1KQ1A 2FB7A 5FLXE 5GAMe 1G3WA 5FU6B 4PJOE 4IUUA 2YLBA 4Y91A 2X4YA 1G3YA 3L2UA 4OB3B 1QVFS 4OB0B 3CCMA 3A8GB 3M9QA 3V8JA 3G6ET 3HFOA 2JTFA 3SFMA 4BE1A 3E19A 2KAFA 1NJIU 1KD1U 2LQKA 3RESA 2QA4A 4C8QE 3GPLA 5DLQE 4A54A 1G5VA 4MZTA 3OYEA 4HCBA 4C92E 1BYMA 1M9SA 4R56A 2VV5A 3E1SA 3NTHA 1VQ7A 2KQWA 4LDXA 3RKYA 5A2QE 4C0DC 1VQ6T 4JRPA 1N6AA 4VUBA 3I56T 1QP2A 4ZTFA 4QW2A 1N8RC 4JS4A 5CKDA 2DTIA 4IUTA 3I56A 3HPWA 2VC8A 3L2ZA 5LL6S 1UGPB 2E10A 1BIBA 3OBYA 3RMSA 3X28B 3OYFA 3RKWA 2RB6A 4A4GA 4M7DA 3CCLT 3QSUA 2MWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KSS A; 
#chains in the Genus database with same CATH topology
 2CUB A;  4M77 B;  1XQH A;  4C92 D;  3TEE A;  1M90 R;  1NYF A;  2YUN A;  4E2F B;  2MOX A;  1YWP A;  2E41 A;  3QJY A;  1X2K A;  1YHQ T;  2RA2 A;  4XTX A;  4E7Z A;  4M78 G;  1NE8 A;  2YT6 A;  2FZK B;  4KT0 E;  3QWY A;  4J83 A;  3RKX A;  2LNV A;  1BIA A;  1TWB A;  3SHW A;  1UFF A;  1NJI C;  1ZQ1 A;  1K9M U;  1NEG A;  2MI6 A;  4F14 A;  1YJW A;  3FB9 A;  2RH2 A;  2EQJ A;  3VS3 A;  5GAO l;  1UJ0 A;  2XHC A;  1WJS A;  3M55 A;  2F2W A;  4GLM A;  4RTV A;  4DEY A;  2F2V A;  5I22 A;  3MCA B;  4LNP A;  2XK0 A;  5HK3 A;  1FMK A;  3C12 A;  2GF7 A;  4M75 D;  1QQJ A;  2RQR A;  4DBF A;  1MV0 B;  2KI7 A;  2KK4 A;  5IH2 A;  2DVE A;  3JCM W;  2DIQ A;  2FG0 A;  1NJI R;  5IAY A;  1MGQ A;  5KYW B;  2E12 A;  2LQN A;  3CBO A;  2RHI A;  3M4Y A;  1M2V B;  1RAF B;  2QEX Q;  1K73 C;  5D6W A;  1GRI A;  3ER0 A;  3H9N A;  5LJ3 j;  1S72 T;  2HNI A;  3EFS A;  2EYX A;  2R5M A;  5GAN j;  2OI3 A;  2DAQ A;  4FW1 A;  5CKH A;  1RLP C;  4PJO C;  3QDR B;  3AHU A;  3MPU B;  3OQ5 A;  1Q82 U;  4EPC A;  2YRC A;  3C0C A;  2JZ2 A;  2JMC A;  2L3S A;  4X1V A;  3V7S A;  5LJ3 e;  3CCL A;  1AVZ C;  1M1G A;  1IRE B;  3C4S A;  2PVO B;  4ZNX A;  1YIT A;  2M16 A;  2XKO C;  5IXF A;  4X9C A;  4E6R A;  1I4K 1;  2LTO A;  2JOY A;  4IUQ A;  4M78 D;  2LQ8 A;  2GFA A;  4Z88 A;  1KK7 A;  2P0Q A;  1AOJ A;  1HK9 A;  3OSS C;  1ACM B;  1I1J A;  1K76 A;  3VS7 A;  2PZ1 A;  2DL3 A;  4CI0 C;  4C0D B;  3CCE A;  1ZLM A;  4B6M A;  2GNC A;  3L2R A;  2DFU A;  1WHJ A;  2RI2 A;  2DPP B;  3G4S T;  1BI1 A;  5L23 A;  1ZSZ B;  2ZPG B;  2D8J A;  3KBG A;  2E64 A;  4C92 C;  3JSC A;  3EFO B;  2CH4 A;  1W1F A;  2HL5 C;  2KT1 A;  2E6N A;  1M2O A;  2IIM A;  3MEU A;  2HQX A;  2DER A;  2ESW A;  2J6O A;  1XOV A;  3OYY A;  1KSW A;  5LJ5 j;  2QG9 B;  3CCS T;  4GBQ A;  2M51 A;  1WJR A;  2ENM A;  1CSK A;  1K8A C;  2G6F X;  1SRL A;  4ORZ A;  2FVU A;  1SRM A;  2GBQ A;  2EWN A;  1M90 U;  4WF2 A;  4FYV B;  3JCM g;  2QQR A;  4RTZ A;  4BUG A;  2LJ3 A;  3ME9 A;  4C5G A;  3SDZ A;  2VXE A;  1K0X A;  2QA4 T;  4M7A E;  1VQ8 A;  4NL2 A;  1RUW A;  4M78 A;  1MND A;  2DBM A;  2O9V A;  1GFC A;  2O9S A;  4N4G A;  4M7A B;  2BKD N;  4AFS C;  2DO3 A;  1Q82 R;  2DTO A;  3GOX A;  1N5Z A;  3PTA A;  3EHQ A;  4HKE A;  5GMK e;  4E7J A;  4DQ2 A;  1K8A R;  3M56 A;  5GAN g;  4M75 F;  1KQS A;  5CIU A;  4LD6 A;  2NLU A;  5KH6 A;  2D9T A;  2RPN A;  2ZPI B;  4RCC A;  4ZN1 A;  5CK9 A;  4C0G A;  2AT1 B;  2KE9 A;  2DEU A;  2K6D A;  4N4H A;  3JB9 J;  4A4K A;  2GQV A;  2MAM A;  3MEA A;  2ZPH B;  1JXO A;  2JTE A;  2KDS A;  3CEY A;  3HL8 A;  2EQK A;  3MP1 A;  2FRW A;  4C8Q C;  3AT1 B;  5HK0 A;  1T3S A;  1VQ6 Q;  1X6B A;  1D3B A;  1ZSZ C;  1UJY A;  1VQO Q;  3WVE B;  1JJ2 P;  1VQ5 A;  5IHI A;  1Z9Q A;  2A3L A;  5GAM d;  3P8D A;  3MKD A;  5GAO m;  1Q81 C;  1X27 A;  3CMA Q;  3HRS A;  4ME7 A;  4IKF A;  3VS1 A;  3DLL A;  2W10 A;  3DB4 A;  1GCQ C;  1WI7 A;  3VV0 A;  1U8R A;  1BCO A;  1YI2 T;  2SEM A;  1VQL Q;  2E65 A;  4B9W A;  4PNO A;  2DJQ A;  3OSV A;  3L1A A;  3DKM A;  4JRI A;  3RMQ A;  2KR3 A;  1QCN A;  1D1B A;  1K73 U;  1KD1 C;  4RG2 A;  2FRY A;  2D6F A;  1ZBX A;  2V8J A;  1D09 B;  1ZX6 A;  1W6X A;  5D6X A;  2JTM A;  2NUT A;  3OYD A;  4M7D B;  3RIR A;  1FYN A;  3VU3 C;  4PJM A;  1WIE A;  1PC0 A;  1D0Z A;  1QLY A;  4F7U F;  1WHM A;  2LQW A;  5GAM f;  4ELY C;  3OMC A;  3CCJ Q;  3U23 A;  5LJ5 h;  1YJN A;  1I8F A;  4EMK C;  2DF6 A;  1VQN A;  2HBP A;  1TTH B;  4PJO F;  5GAN e;  1WHH A;  1NPR A;  2DXT A;  4FT2 A;  3OYG A;  1EIF A;  2LDM A;  1JXM A;  2PQW A;  2Y4X A;  3RR6 A;  1EX4 A;  4PLI A;  2C0I A;  2DKG A;  2LNH B;  5CAI A;  1VQL T;  2EW3 A;  2ZPE B;  2YHT A;  2LT1 A;  1I5L A;  4F16 A;  1QVF P;  2HDA A;  3SB2 A;  2ROT A;  5GAN 2;  2HMA A;  1HYO A;  1T3L A;  1VQ4 A;  4KH0 B;  4ELZ C;  4JRQ A;  1B07 A;  3CCR T;  4M7D C;  2ED1 A;  1KQ2 A;  1JJ2 A;  5ECA A;  3CCS Q;  3JCM h;  1PNJ A;  3QII A;  2Y4Y A;  2YRV A;  2RJD A;  2O31 A;  3JCM b;  2EJ9 A;  2DE0 X;  4AMC A;  2LCL A;  2RM4 A;  1YFN A;  1PRM C;  1YIJ A;  2EFI A;  1X43 A;  1S72 A;  5GAN 6;  3I55 T;  3CCR Q;  2KXC A;  1VQ7 Q;  2BZY A;  1W4S A;  2JT4 A;  3MET A;  1PWT A;  1X01 A;  1EFN A;  1M90 C;  1H3H A;  1TU0 B;  2YUP A;  1KQ1 A;  2FB7 A;  2BZ8 A;  5FLX E;  1G3W A;  4PJO E;  1Q95 G;  4Y91 A;  2JM9 A;  2YLB A;  3FJ5 A;  3OW2 P;  3M0S A;  4OB0 B;  3CCM A;  3V8J A;  3EGX A;  2KAF A;  3EG2 A;  1R0C B;  2LQK A;  2LP5 A;  1SPK A;  3GPL A;  5DLQ E;  4MZT A;  3OYE A;  2VV5 A;  3NTH A;  1VQ6 T;  3UA7 A;  4LUE A;  4ZTF A;  1N8R C;  4JS4 A;  2OX7 A;  3EG0 A;  3RKW A;  2RB6 A;  3EG1 A;  4J9E A;  3RNJ A;  2HSE B;  4M77 A;  4RTT A;  3HRT A;  4DEX A;  4WCI A;  4ZGJ B;  2IG0 A;  2A0F B;  3V7C A;  2VAS A;  3EG9 A;  2VWF A;  2ECZ A;  5GAN f;  4E7L A;  2HAX A;  1ABQ A;  3TVT A;  3H0H A;  1ZUY A;  3P8B B;  2DL5 A;  2FL7 A;  4PJO D;  1Y07 A;  5KE3 A;  4OML A;  3CC4 T;  3QZ9 B;  4BDY A;  4OGE A;  4PJO B;  2RO0 A;  8ATC B;  2WSF E;  4BD3 A;  1QW1 A;  1K8A U;  3OYN A;  4XU3 A;  1V29 B;  2EGA A;  1Y0M A;  1Z9Z A;  3M53 A;  2C0O A;  2QQA A;  4HCC A;  3H0I A;  1YJ9 T;  4M7A D;  4JJC A;  2XDB A;  4C8Q B;  3IQL A;  1YBY A;  1VQK Q;  5D7U A;  2E3I A;  2RHY A;  1PRL C;  3LYI A;  4E7S A;  1W2B S;  3JCM J;  2DXB A;  5IHN A;  1RAG B;  3A8L B;  1TG0 A;  1MMN A;  4HXJ A;  1GCQ A;  2B86 A;  2FPF A;  2JN0 A;  5KYX A;  4M75 C;  3OYC A;  2QI2 A;  2KRO A;  1YNZ A;  3JV3 A;  4JPB W;  1YJ9 A;  3CC4 A;  4RG8 A;  1M4Z A;  1P92 A;  3VRZ A;  4M7A A;  2JW4 A;  1OOT A;  1RAA B;  2ED0 A;  1RI9 A;  3G6E A;  4V2S A;  2ZZD A;  1D1C A;  2CP2 A;  3QXE B;  1V1C A;  4HVW A;  4B9X A;  2RQU A;  2JUF A;  2O01 E;  4FL6 A;  3JRZ A;  3OYH A;  2DMO A;  1RAE B;  2MF2 A;  2ABL A;  4C0F A;  4JJD A;  1WGS A;  2EQI A;  1WQ7 A;  3MHX A;  1YIJ T;  1TXQ A;  2DVJ A;  2E3H A;  1NZ9 A;  3LWI A;  1VQ9 A;  1KQS S;  3EFR A;  4EMH A;  3EG9 B;  1NPP A;  2RK1 A;  1M30 A;  3OYI A;  3I35 A;  3CBP A;  2K5I A;  2QEX T;  1WDX A;  2JS0 A;  2HKN A;  3HRU A;  2PUO B;  4HVU A;  3TRE A;  5CCA A;  2RJF A;  5C6S A;  2DET A;  4MDW A;  2CYZ B;  5FRM A;  3M0R A;  3UA6 A;  3FDR A;  5GAO r;  2RHZ A;  3BW1 A;  3HSB A;  4AT1 B;  3CCL Q;  3CQT A;  3VS5 A;  4GY5 A;  4M77 E;  2M02 A;  3OS2 A;  1VQM A;  2EAY A;  1OX9 A;  3JCM f;  1UGV A;  1M1K C;  4BI3 A;  3EFO A;  2E5K A;  4EMG A;  1VIF A;  4R0K A;  2AK5 A;  2CS7 A;  3I55 A;  4F7U G;  2X3X D;  3MEW A;  3OS1 A;  1X6G A;  4LDU A;  2JXB A;  5CR2 A;  2DD4 A;  4M7A F;  4OMQ A;  1QKX A;  4XK8 E;  2VXF A;  4EDU A;  1LOJ A;  4M78 E;  2HCK A;  5KYY B;  5GJV B;  1UUE A;  4N0A C;  3CCU Q;  2FPD A;  4FSS A;  4OMN A;  3CME Q;  1M1K R;  1B3Q A;  4PK4 A;  3ZBD A;  5GAM h;  3PIO A;  1YI2 Q;  3F70 A;  2DD5 A;  1M1K U;  3UAT A;  4KUD K;  1B34 A;  1UE9 A;  4WTO B;  1FXX A;  4OB1 B;  3LW5 E;  3NHN A;  5GMK j;  1M2V A;  4BB7 A;  3CC2 A;  1W70 A;  3QUI A;  3CCU T;  3A5Z B;  3THK A;  1VOM A;  3QO3 A;  1ZBJ A;  5GAO n;  1NM7 A;  2AHJ B;  4KGX B;  5D6Y A;  3PT9 A;  3G4S Q;  1PSF A;  1FMV A;  2FO0 A;  1UHF A;  2L2P A;  2KMT A;  5LJ3 h;  5CQX A;  1C0M A;  3OS0 A;  1QCF A;  2EKH A;  1LJO A;  2DEQ A;  4OVA A;  2LCC A;  2COZ A;  3JB9 D;  4JLI A;  2Z0W A;  3SWN B;  3JCM c;  4QQD A;  3CXC S;  1K73 R;  2M1H A;  2E6Z A;  2K4Y A;  1LPL A;  2KEA A;  1SSH A;  4TVR A;  1H3Z A;  3RDV A;  1JRI A;  2CZ1 B;  2OTJ A;  4M7D F;  1RAB B;  3EGU A;  3KXT A;  1O9S A;  5A0D A;  1QP3 A;  2OTJ T;  3EG3 A;  3H6Z A;  2DM1 A;  3E2U A;  4F17 A;  1UHC A;  4F7U B;  2QA4 Q;  3JCM P;  3CCE T;  2MWP A;  2DL7 A;  4KUL A;  4JZ4 A;  1RAD B;  3PMI A;  1Y96 B;  1GBQ A;  5J26 A;  2BIV A;  4O6J A;  1KQS P;  5GAN 3;  1SSF A;  2SRC A;  3OYA A;  1VQ5 Q;  2H3J A;  1XTD A;  4C5H A;  4FCY A;  4F04 B;  3J7A F;  3CMA A;  2I2L A;  4QKU A;  1B34 B;  2B8A A;  3BY7 A;  1JJ2 S;  3PFS A;  4Y28 E;  2ATC B;  4AG1 C;  4JS5 A;  4LN2 A;  5HKC A;  5FW9 A;  2AKK A;  4IIM A;  4HCK A;  5GAO q;  3CXC A;  1WFW A;  4IUR A;  3G71 A;  2MCN A;  6AT1 B;  3S3M A;  1YJW Q;  2F69 A;  3FC3 A;  2QAZ A;  2DRK A;  2KVQ G;  2NYS A;  2X4X A;  3M0T A;  4XAX B;  4C92 F;  4R55 A;  2COY A;  1WXB A;  2H8H A;  2WAC A;  4OMM A;  2K3Y A;  2NUZ A;  4JJB A;  2RK2 A;  5CQY A;  2ZGW A;  2K2M A;  3I9Q A;  4E7I A;  4PFP A;  3VS2 A;  3SWN A;  3X25 B;  3UDC A;  5GAN d;  3CC7 Q;  2LCS A;  3REB B;  5J39 A;  1SF9 A;  4CRI A;  3JB9 I;  2BUD A;  4LUD A;  1I07 A;  2E1H A;  9ATC B;  1QCO A;  1JO8 A;  2CT4 A;  2L3Q A;  3E9F A;  1PD0 A;  2RI3 A;  2QEX A;  4HCZ A;  3CPW P;  4J9D A;  4OB2 B;  1Q86 R;  2M9U A;  1B7T A;  4C5E A;  2CGH A;  1WLP B;  4E47 A;  1ZUK A;  2LC4 A;  3VKI A;  2E5Q A;  4M78 B;  1VQP A;  2XID A;  2K3B A;  2LRQ A;  1G3T A;  3BE3 A;  2ZPB B;  4QT7 A;  2YUO A;  4OB3 B;  3G6E T;  3M9Q A;  1NJI U;  3SFM A;  1KD1 U;  1AWJ A;  4J9C A;  1YIT Q;  1J3T A;  4C92 E;  1BYM A;  1M9S A;  2KQW A;  5A2Q E;  4ANJ A;  4VUB A;  2EYW A;  3I56 T;  4IIO A;  3EHR A;  5CKD A;  3HPW A;  2LMJ A;  1M3A A;  5LL6 S;  1BIB A;  1G83 A;  3CXC P;  2FZC B;  3X28 B;  1G2B A;  2FZG B;  3QSU A;  5GAN 5;  1UGQ B;  3MO8 A;  3CCE Q;  5GAM j;  1S1N A;  3M54 A;  4C8Q F;  4UC4 A;  2XU8 A;  2RQW A;  3CCM Q;  1IHV A;  3NPF A;  4AFQ C;  4IUV A;  1KC8 U;  5DY9 A;  2YWW A;  3MP6 A;  4J6W A;  4FIB A;  2DA9 A;  3CCQ A;  2PVD B;  3SD4 A;  2RF0 A;  4HT8 A;  4PJO A;  1BCM A;  1I81 A;  3HTR A;  3ULR B;  1OZ3 A;  2E70 A;  4OGC A;  3OYK A;  4QVZ A;  2DZ9 A;  1KD1 R;  2QDY B;  2NUP A;  4C92 B;  2A28 A;  2MMP A;  3I5R A;  3OY9 A;  2FEI A;  1YHQ A;  2XDD A;  2DYI A;  2JMA A;  4FSX A;  2X4W A;  2VGM A;  3R6O A;  4Z89 A;  2BZX A;  4DBH A;  1O75 A;  1AWW A;  3TCJ A;  1U1T A;  3A1P A;  3JB9 G;  2BTT A;  1OV3 A;  5KYX B;  2IPO B;  1YJW T;  2P0K A;  1M3B A;  1OUL A;  3X20 B;  1M27 C;  2AZV A;  1OZ2 A;  2KT8 A;  3VJP A;  3H41 A;  1PCX A;  1JQQ A;  3I5S A;  5KYU A;  4MML A;  4XTZ A;  2GTO A;  4KBM B;  1MV3 A;  3CCV T;  1VQK A;  1FX7 A;  2J06 A;  3OW2 A;  4M7A G;  2LX9 A;  5FWC A;  3VUZ A;  4BI4 A;  1W2B P;  4XTY A;  3N5B B;  5GMK l;  1JU5 C;  1A0N B;  3T9N A;  2QK0 A;  5DM7 R;  2F1L A;  3CPF A;  2FPE A;  1Q81 R;  1VA7 A;  2ZPF B;  4M78 F;  2V1Q A;  4HVV A;  1GBR A;  3JCM V;  1GL5 A;  2GTJ A;  3CC4 Q;  1WJQ A;  4DOW A;  4JDS A;  1ZA1 B;  3PE0 A;  2BE7 D;  3D7S B;  3DB3 A;  1Q7Y R;  3CCQ T;  3G6E Q;  4GLK A;  1IZ6 A;  1LNX A;  1WXT A;  2LVM A;  4QVC A;  3GNF B;  1F1B B;  4C92 G;  4PLL A;  3SWN C;  1VQ6 A;  4DBR A;  3M58 A;  2JM8 A;  2LX7 A;  4LD9 K;  2V1R A;  4AFU C;  3VUB A;  5DLO A;  3I56 Q;  3LWH A;  1I5O B;  3M4G A;  1OI1 A;  1VQO A;  2L5Q A;  2DIL A;  3TU4 K;  2DBK A;  3JCM e;  2OTL A;  1N8R U;  5GAM g;  4A4H A;  2XMF A;  2KSS A;  4M4Z A;  1WHL A;  1D0X A;  4FYY B;  3GBQ A;  2YSQ A;  1VQL A;  1QVF A;  2DYB A;  2G3R A;  3FIF A;  3GLX A;  2EYQ A;  2CRE A;  2J6F A;  5IHK A;  2RHX A;  3HFN A;  2I0N A;  1XJW B;  1MMG A;  2A08 A;  1N9S A;  3HKS A;  4J9H A;  1M5Q 1;  1RLQ C;  5GJW B;  1WHG A;  4PFZ A;  2EIF A;  1N8R R;  4M75 E;  3LH0 A;  1SEM A;  3OA6 A;  5FRN A;  1FMW A;  2RHU A;  4PJO G;  3L2W A;  2QTV A;  1KC8 R;  1E6H A;  1R77 A;  3G7Z A;  4IUP A;  1VQN T;  5KYW A;  5FU6 C;  1QVG A;  1VQM Q;  3S6W A;  2RD1 A;  5CO7 A;  4QVD A;  4QQ6 A;  3CCJ A;  2CP3 A;  3VYG A;  3NTI A;  2FYK A;  3PIP A;  3V8K A;  4MMK A;  4Z8A A;  3HHT B;  2P0P A;  1WZO A;  3I55 Q;  1AT1 B;  2A37 A;  2P4R A;  3M5A A;  3ZFJ A;  4P5N A;  4Q5W A;  3O5Z A;  2DL4 A;  1W2B A;  3CPW S;  4XTV A;  3DLM A;  3A8O B;  1VYT A;  4LXC A;  3WVD B;  4D8K A;  1VQP T;  1QKW A;  2D0N A;  1H8K A;  1MMD A;  2PTK A;  2DLP A;  1GXI E;  1Y71 A;  3TSW A;  3KUF A;  3L42 A;  3JCM X;  1GCP A;  4C8Q G;  4YTL A;  2XG8 D;  1RL2 A;  2CZ7 B;  1D1A A;  2HQH A;  2GFU A;  2K79 A;  2L3P A;  3A98 A;  3URG A;  2O2O A;  2PU9 B;  2PNI A;  3EH1 A;  2CP6 A;  1OU9 A;  4RTX A;  3FEO A;  4ESR A;  4FU6 A;  1U3O A;  2HD0 A;  3S3N A;  5LJ3 d;  4AFZ C;  1IHW A;  5HCK A;  1YIJ Q;  3HP9 A;  3M57 A;  1MHN A;  2K5F A;  1BI3 A;  3H8Z A;  1C1A A;  3OS5 A;  4ZGD B;  5GAN 4;  1QWF A;  2H3E B;  5AYF A;  2LT4 A;  1H64 1;  3E9G A;  3CCR A;  3V8L A;  3NMZ C;  5A0L A;  5FRO A;  2KBT A;  3SEM A;  5KCH A;  5KE2 A;  2VVK A;  3PGG A;  1U1S A;  5I11 A;  1OEB A;  2P4T A;  1NLO C;  2EGE A;  1FWZ A;  2RJE A;  4MDX A;  2DXC A;  2VGN A;  2YRD A;  1ARK A;  4BE0 A;  1AEY A;  5GAN 7;  3V7R A;  3EGD A;  3H0F A;  2EGC A;  1OQK A;  2W0Z A;  2QTX A;  3R6N A;  2O88 A;  2DX1 A;  4J8O A;  4NOY A;  1VQO T;  1Y96 A;  5C0M A;  4EIK A;  3CD6 Q;  5CKB A;  2V26 A;  1NEB A;  1BBZ A;  4OP0 A;  1VQ8 T;  2DIG A;  4RKU E;  3QG1 A;  2XIC A;  2CZ6 B;  2AKL A;  3KFV A;  2QAS A;  5LJ5 d;  5FU7 C;  4RTY A;  5IXB A;  2RJC A;  2KRN A;  1M8M A;  4A53 A;  5I2M A;  3S3O A;  4XU2 A;  4XQ3 A;  2LJ1 A;  4CC7 A;  2KNB B;  2V8I A;  4XTW A;  3VYH B;  3CBM A;  2LZ6 B;  1VQ7 T;  2M0O A;  5GAN 8;  3QBY A;  1AHJ B;  1SKU B;  1WQW A;  3JB9 H;  3QYG B;  4ZGE B;  3PNW C;  1TUC A;  4J5Y A;  2EYZ A;  1Q86 U;  2QQ9 A;  1YWO A;  2HQE A;  4DBQ A;  1UDL A;  3UWN A;  3OYM A;  3PMT A;  5LJ5 e;  3FLG A;  1BI0 A;  2RN8 A;  1PKS A;  2F5K A;  1U06 A;  1QMC A;  2JS2 A;  1KHC A;  4J6X A;  1RAC B;  1NLP C;  1UB4 A;  4Y92 A;  4NS5 A;  3QHS A;  3LLR A;  5GAN h;  3LX7 A;  2X4J A;  4EMK A;  4F7U E;  4KH1 B;  3ZEH A;  1YJ9 Q;  4J7F A;  2JNG A;  4C8Q A;  2O4X A;  3GP8 A;  1KFZ A;  3LGL A;  3BDU A;  5KYY A;  5LJ5 g;  3CCV A;  4RCB A;  1VQK T;  3QWX X;  1Q82 C;  2E4H A;  1K9A A;  4FT4 A;  2OTL T;  1AZE A;  2V8K A;  4HT9 A;  3CC7 A;  1KG1 A;  3QJ6 A;  3JAM E;  4JLG A;  4A4F A;  4KGZ B;  1GFD A;  2AIR B;  1TH7 A;  4KGV B;  4PL6 A;  2PVG B;  4BAC A;  3CC2 T;  1CKB A;  5GAM e;  1MUZ A;  2X51 A;  5FU6 B;  4RTU A;  4IUU A;  1QVF S;  3A8G B;  4BE1 A;  1SG5 A;  3RES A;  3VS4 A;  4OMP A;  4C8Q E;  1VYU A;  2M0Y A;  1G5V A;  1KIK A;  3TQ7 P;  4R56 A;  5EC7 A;  3RKY A;  4C0D C;  1N6A A;  1IXD A;  2MIO A;  1JEG A;  4IUT A;  2VC8 A;  1UGP B;  3OBY A;  1VQP Q;  2CP0 A;  3RMS A;  3OYF A;  2KRM A;  3CCL T;  2MWO A;  1LCK A;  4J7I A;  2K7A A;  3Q1J A;  1DJ7 B;  2WSC E;  1QVG P;  4KUI A;  4JRK A;  4C8Q D;  3QKJ A;  2XDP A;  4D6W A;  1I0C A;  2DRM A;  4J9I A;  3GNG A;  1WX6 A;  4J9F A;  1YCY A;  2HEQ A;  1WNL A;  1YJN Q;  4OMF B;  1BKB A;  4XU1 A;  4HCB A;  2QQS A;  5CVI A;  1PD1 A;  1UGS B;  5A0G A;  3RER A;  2CSQ A;  2KGT A;  1NYG A;  4C92 A;  1AZG B;  1LVK A;  3NFC A;  5IN1 A;  1RI0 A;  3M0U A;  4BI8 B;  2EQU A;  1ZSG A;  4RTW A;  2RMO A;  2AZS A;  1RAI B;  3INZ A;  4NL3 A;  2X35 A;  1XNI A;  4CC3 A;  5M9O A;  4J9B A;  1VQ9 T;  1YIT T;  2YXY A;  2RNA A;  4OMO A;  4XTU A;  3L2V A;  1YN8 A;  2ZCF B;  1K4U S;  1TSF A;  4N0A A;  2P84 A;  3FRN A;  3CC2 Q;  1QVG S;  3A8M B;  4X9D A;  5KYU B;  3JCM Q;  1VUB A;  2K2V A;  1WA7 A;  4E7H A;  3ASK A;  2RQT A;  4LDW A;  1PHT A;  2D0Q B;  4FYW B;  2R57 A;  1VQ7 A;  3A8H B;  3C95 A;  3CCM T;  1X2Q A;  4LE9 A;  3M0P A;  5GMK i;  3L2Q A;  1N9R A;  1ZUU A;  1KHI A;  2DK3 A;  1V76 A;  2X3W D;  4ZTJ A;  1N27 A;  5GMK m;  4AG2 C;  2L3R A;  1OPL A;  2DXU A;  2KY9 A;  3BFM A;  3M0Q A;  2X9H A;  2DNU A;  2VKN A;  3MJX A;  1TUD A;  4CC2 A;  2YLC A;  4J9G A;  3J80 E;  1Q86 C;  4CC4 B;  1CKA A;  2D8H A;  3RBB B;  4K11 A;  4LDV A;  1OU8 A;  1KC8 C;  2HBW A;  1BU1 A;  3CC7 T;  2OTJ Q;  3OMG A;  3VRY A;  4LDY A;  4BY6 C;  3VS6 A;  1Y7X A;  2QQB A;  4BDZ A;  4MZM A;  1ZSZ A;  1X6O A;  1IGU A;  2CKK A;  3EGD B;  5LJ3 f;  1Q81 U;  4ATO A;  2CT3 A;  1PKT A;  1R8O B;  2A36 A;  3QYH B;  3CMA T;  2EJF A;  1WHK A;  2DJZ A;  4J6Y A;  2L0A A;  5CKE A;  1TS9 A;  1ZA2 B;  1KJW A;  1IRX A;  2K3X A;  2CH4 W;  1PM3 A;  1X75 C;  2QYZ A;  1VQ8 Q;  2VYT A;  2K57 A;  5I21 A;  4F7U A;  2HKQ B;  2FHD A;  2OTL Q;  2O4X B;  2HL3 A;  1G3S A;  1YJN T;  2OAU A;  2D1X A;  1HSQ A;  2RI5 A;  2KYB A;  1M3C A;  1RAH B;  3MEV A;  4N4I A;  2CZ0 B;  5J3B A;  3EAE A;  2F2X A;  2GGR A;  4MZP A;  3G71 Q;  1WYX A;  1HXD A;  1K1Z A;  3LH5 A;  3P8H A;  3OBW A;  3FJP A;  3G71 T;  1TOV A;  2L8D A;  4L5G A;  4C0Z A;  1M1F A;  2ROL A;  1ZHI A;  1K9M R;  4M78 C;  2EQM A;  1IGQ A;  5HY6 A;  3G1J A;  4II1 A;  4DOV A;  2GQI A;  3CD6 T;  1OX8 A;  2CUD A;  1VQ4 T;  2KXD A;  3CME T;  1BI2 A;  5IT9 E;  2VUB A;  3LGF A;  2EJG A;  3O8V A;  5EG2 A;  1HJD A;  1WPY A;  2EBP A;  3OB9 A;  2K5L A;  4A4E A;  2ZAE A;  3CCJ T;  1MMA A;  4JUV A;  2EVR A;  4C5I A;  2QXF A;  2L89 A;  2CP5 A;  2JVV A;  4ZN3 A;  3NTK A;  2DL8 A;  5FWB A;  2J6K A;  1UEB A;  2EKO A;  3M59 A;  5GAO p;  1K9M C;  1VQ9 Q;  1BB9 A;  1D3B B;  3X26 B;  1M8V A;  1IB8 A;  5CKF A;  4M75 B;  1UGR B;  5GMK h;  3UPU A;  3EH2 A;  4M77 G;  4RMO A;  1R0B G;  4Z02 A;  1UEC A;  2KYM A;  3OYB A;  2EYY A;  2BE9 B;  2MK5 A;  1D0Y A;  4QQG A;  1SHG A;  7AT1 B;  2DZC A;  2OJ2 A;  3JCM d;  4FW2 A;  2R58 A;  3EGX B;  2RQV A;  4FM4 B;  3UT1 A;  1EZZ B;  4JJN K;  1E6G A;  1VIE A;  1TUG B;  4BE2 A;  2CSI A;  4XU0 A;  3J81 E;  1ABO A;  4X34 A;  2LJ0 A;  1VQN Q;  4E7K A;  2J05 A;  2HZY A;  2MYS A;  1PG5 B;  2PUK B;  1BK2 A;  1PSE A;  1E7O A;  4L6V 5;  3VS0 A;  1QWE A;  4A63 B;  4M7D D;  2IVW A;  3BDL A;  4RUG A;  2F5T X;  1VQ5 T;  1OPK A;  1YCS B;  5KYN A;  4PKC C;  3QZ5 B;  1QVP A;  2XI9 A;  4M77 F;  3REA B;  1AWO A;  2K9G A;  2MPX C;  1VQM T;  4JZ3 A;  4OF1 A;  4KRT A;  3CCU A;  1G8X A;  2EPD A;  1VQ4 Q;  1Q7Y U;  3C94 A;  2COW A;  5I2S A;  2VB6 A;  4M7D E;  5KCO A;  3CME A;  1VYV A;  3CCQ Q;  1JB0 E;  3CCS A;  3CD6 A;  1YI2 A;  4DA4 A;  3CPW A;  4M7A C;  3QPH A;  1MNE A;  4BY6 B;  4PJN A;  1JBM A;  3OYJ A;  3X24 B;  2QGF B;  3RUX A;  2WSE E;  2KRS A;  4PJJ A;  2YUQ A;  1YHQ Q;  2Y90 A;  4M77 D;  1YP5 A;  1S72 Q;  3JB9 F;  3WXM B;  1T0J A;  3MP8 A;  2DTH A;  1X69 A;  3ZL7 C;  1Y57 A;  4M7D G;  4L59 A;  8AT1 B;  2JJ9 A;  4M77 C;  1C6V X;  5FU7 B;  3G4S A;  5AT1 B;  5L8R E;  5LJ5 f;  1OYX A;  1IO6 A;  4M75 A;  3GIB A;  2R5A A;  2C0T A;  3UF4 A;  2NUP B;  2C06 A;  1U5S A;  4D8D A;  1AWX A;  4EMK B;  1Q7Y C;  2J7I A;  2YDL A;  4O5V A;  3OW2 S;  3PVL A;  2NWM A;  2GCX A;  4M75 G;  1T0H A;  1UTI A;  5LJ3 g;  1NG2 A;  3OYL A;  4PFO A;  1HD3 A;  4HA8 A;  2CP7 A;  3NGP A;  1WXU A;  3GF5 A;  2QDL A;  2XD0 A;  3TSZ A;  1K0S A;  2A7Y A;  2QGG A;  2CDT A;  3QDF A;  1SHF A;  4PJL A;  2X4Y A;  1G3Y A;  3L2U A;  1AD5 A;  3HFO A;  2JTF A;  3E19 A;  1H92 A;  2OAW A;  2QA4 A;  3CCV Q;  4A54 A;  3PVQ A;  1NBE B;  3E1S A;  4LDX A;  4JRP A;  2HSP A;  1QP2 A;  4QW2 A;  4FYX B;  2DTI A;  3I56 A;  3L2Z A;  2E10 A;  1UG1 A;  4A4G A;  2NUT B;  4M7D A; 
#chains in the Genus database with same CATH homology
 4J7I A;  4M77 A;  5GAN 5;  1UGQ B;  3HRT A;  3MO8 A;  4M77 B;  4ZGJ B;  5GAM j;  1XQH A;  4C92 D;  3M54 A;  3TEE A;  4C8Q F;  4UC4 A;  2XU8 A;  2IG0 A;  3Q1J A;  1DJ7 B;  2WSC E;  2E41 A;  3QJY A;  3V7C A;  4KUI A;  1YHQ T;  4JRK A;  4C8Q D;  2RA2 A;  3QKJ A;  5GAN f;  2XDP A;  4XTX A;  4D6W A;  4E7L A;  2HAX A;  4M78 G;  4IUV A;  1NE8 A;  1KC8 U;  3GNG A;  5DY9 A;  4KT0 E;  3P8B B;  4J83 A;  3MP6 A;  3RKX A;  2FL7 A;  4J6W A;  1YCY A;  4FIB A;  4PJO D;  2LNV A;  1WNL A;  1Y07 A;  5GAO p;  1BIA A;  4OMF B;  1BKB A;  3CCQ A;  2PVD B;  3SD4 A;  4XU1 A;  5KE3 A;  3CC4 T;  3QZ9 B;  2QQS A;  4OGE A;  5CVI A;  2RO0 A;  4BDY A;  1NJI C;  2WSF E;  4PJO B;  4HT8 A;  4PJO A;  1ZQ1 A;  1UGS B;  4BD3 A;  1QW1 A;  1K8A U;  1K9M U;  3OYN A;  1I81 A;  2MI6 A;  1YJW A;  1VQM A;  4XU3 A;  1OZ3 A;  2E70 A;  3FB9 A;  2RH2 A;  4OGC A;  1V29 B;  4QVZ A;  2EQJ A;  5A0G A;  3OYK A;  2DZ9 A;  5GAO l;  3M53 A;  2XHC A;  1WJS A;  3M55 A;  2QDY B;  2QQA A;  4C92 B;  4HCC A;  2MMP A;  1YJ9 T;  4C92 A;  3OY9 A;  1YHQ A;  4M7A D;  2XDD A;  2XDB A;  4C8Q B;  3MCA B;  3NFC A;  4FSX A;  5IN1 A;  2XK0 A;  1RI0 A;  2X4W A;  2VGM A;  3R6O A;  2EQU A;  1YBY A;  4BI8 B;  5HK3 A;  3C12 A;  2RHY A;  3LYI A;  2GF7 A;  1O75 A;  4M75 D;  1W2B S;  3INZ A;  3JCM J;  3TCJ A;  4NL3 A;  1U1T A;  2DXB A;  2X35 A;  2KK4 A;  2DVE A;  3A8L B;  1XNI A;  5M9O A;  3JCM W;  3JB9 G;  1VQ9 T;  1YIT T;  2JN0 A;  2DIQ A;  3OYC A;  4M75 C;  1YJW T;  2P0K A;  2QI2 A;  4XTU A;  3X20 B;  3L2V A;  5IAY A;  1YJ9 A;  3CC4 A;  1MGQ A;  1OZ2 A;  4RG8 A;  3VJP A;  2ZCF B;  1M4Z A;  1P92 A;  4N0A A;  2E12 A;  3FRN A;  4M7A A;  3CBO A;  2RHI A;  3A8M B;  4X9D A;  3M4Y A;  1QVG S;  3JCM Q;  1VUB A;  4MML A;  1K73 C;  2K2V A;  5D6W A;  4XTZ A;  4KBM B;  3G6E A;  3ER0 A;  4V2S A;  5LJ3 j;  4E7H A;  1S72 T;  2ZZD A;  2HNI A;  3ASK A;  3EFS A;  3CCV T;  1VQK A;  1FX7 A;  2R5M A;  3QXE B;  3OW2 A;  4LDW A;  5GAN j;  2DAQ A;  4B9X A;  4M7A G;  2D0Q B;  2LX9 A;  5CKH A;  2R57 A;  3VUZ A;  2JUF A;  3A8H B;  3C95 A;  4XTY A;  2O01 E;  3N5B B;  4BI4 A;  5GMK l;  4FL6 A;  3T9N A;  3JRZ A;  3OYH A;  5DM7 R;  3CCM T;  3CPF A;  4PJO C;  3QDR B;  2ZPF B;  4M78 F;  5GMK i;  1N9R A;  3L2Q A;  3AHU A;  2MF2 A;  3OQ5 A;  1KHI A;  2DK3 A;  1Q82 U;  4C0F A;  4EPC A;  2JZ2 A;  4ZTJ A;  1N27 A;  3JCM V;  5GMK m;  1WGS A;  1WJQ A;  3V7S A;  2L3R A;  4JDS A;  4DOW A;  5LJ3 e;  3CCL A;  2DXU A;  2KY9 A;  1WQ7 A;  1M1G A;  1IRE B;  3MHX A;  3BFM A;  1YIJ T;  3DB3 A;  3C4S A;  3CCQ T;  2PVO B;  1NZ9 A;  4GLK A;  3LWI A;  1IZ6 A;  1YIT A;  1VQ9 A;  1LNX A;  1KQS S;  2M16 A;  2XKO C;  3EFR A;  2LVM A;  4QVC A;  3GNF B;  4X9C A;  4C92 G;  4EMH A;  4PLL A;  1NPP A;  2YLC A;  2RK1 A;  3SWN C;  3J80 E;  1VQ6 A;  3M58 A;  1Q86 C;  3OYI A;  3CBP A;  1I4K 1;  2LTO A;  2K5I A;  2JOY A;  4IUQ A;  2QEX T;  4M78 D;  4LD9 K;  3HRU A;  2LQ8 A;  2PUO B;  2GFA A;  3VUB A;  5DLO A;  3LWH A;  3TRE A;  5CCA A;  2P0Q A;  3M4G A;  1OI1 A;  4LDV A;  2RJF A;  5C6S A;  1VQO A;  1HK9 A;  4MDW A;  2CYZ B;  3OSS C;  5FRM A;  1KC8 C;  2L5Q A;  3FDR A;  4CI0 C;  3CC7 T;  5GAO r;  2RHZ A;  3OMG A;  3BW1 A;  4C0D B;  3CCE A;  3TU4 K;  3HSB A;  3JCM e;  2OTL A;  4LDY A;  1N8R U;  5GAM g;  3L2R A;  4BY6 C;  2RI2 A;  4A4H A;  2DPP B;  3G4S T;  1Y7X A;  1BI1 A;  2KSS A;  4GY5 A;  2QQB A;  4M77 E;  2ZPG B;  3KBG A;  2EAY A;  3OS2 A;  2E64 A;  4BDZ A;  3JCM f;  4C92 C;  4MZM A;  3JSC A;  1M1K C;  1VQL A;  1QVF A;  1X6O A;  2G3R A;  2CKK A;  1Q7Y C;  3FIF A;  3GLX A;  5LJ3 f;  2EYQ A;  4BI3 A;  1Q81 U;  4ATO A;  1R8O B;  2RHX A;  3HFN A;  4EMG A;  1VIF A;  3QYH B;  2E6N A;  3CMA T;  2EJF A;  3MEU A;  2CS7 A;  2DJZ A;  2HQX A;  4J6Y A;  1N9S A;  3I55 A;  4F7U G;  5CKE A;  3HKS A;  1M5Q 1;  3MEW A;  2K3X A;  3OS1 A;  1XOV A;  2EIF A;  4LDU A;  1X75 C;  4M75 E;  2VYT A;  3LH0 A;  3OA6 A;  2K57 A;  5CR2 A;  5FRN A;  2DD4 A;  4M7A F;  3OYY A;  2RHU A;  4XK8 E;  4PJO G;  2VXF A;  4EDU A;  5LJ5 j;  5I21 A;  4F7U A;  3L2W A;  3CCS T;  1LOJ A;  2FHD A;  1WJR A;  2O4X B;  4M78 E;  1K8A C;  1VQN T;  3G7Z A;  4IUP A;  1G3S A;  1YJN T;  5FU6 C;  2OAU A;  1QVG A;  3S6W A;  2FVU A;  2RD1 A;  2RI5 A;  5CO7 A;  4QVD A;  4N0A C;  2EWN A;  1M90 U;  4QQ6 A;  3CCJ A;  4WF2 A;  3MEV A;  3NTI A;  3VYG A;  2FYK A;  3PIP A;  3JCM g;  2QQR A;  3V8K A;  4MMK A;  3HHT B;  4N4I A;  4BUG A;  2P0P A;  2CZ0 B;  3ME9 A;  5J3B A;  3EAE A;  4MZP A;  3SDZ A;  3ZBD A;  4C5G A;  5GAM h;  3PIO A;  2VXE A;  1HXD A;  2QA4 T;  3P8H A;  4M7A E;  3F70 A;  3OBW A;  2DD5 A;  3FJP A;  3M5A A;  3G71 T;  1M1K U;  4KUD K;  3ZFJ A;  4P5N A;  1B34 A;  4NL2 A;  4Q5W A;  1VQ8 A;  2L8D A;  4L5G A;  1FXX A;  4M78 A;  4C0Z A;  1M1F A;  4OB1 B;  4N4G A;  4M7A B;  1ZHI A;  3LW5 E;  4M78 C;  5GMK j;  4BB7 A;  1W2B A;  3CC2 A;  2EQM A;  3CPW S;  5HY6 A;  2BKD N;  3DLM A;  4XTV A;  3A8O B;  2DO3 A;  2DTO A;  3GOX A;  3QUI A;  3PTA A;  3CCU T;  3WVD B;  3A5Z B;  4II1 A;  1VQP T;  4DOV A;  3QO3 A;  5GAO n;  4HKE A;  1Y71 A;  3CD6 T;  1GXI E;  1VQ4 T;  3KUF A;  5GMK e;  4E7J A;  3L42 A;  3JCM X;  4DQ2 A;  3CME T;  2AHJ B;  1BI2 A;  3M56 A;  5GAN g;  4M75 F;  1KQS A;  5CIU A;  4YTL A;  5D6Y A;  3PT9 A;  4C8Q G;  5IT9 E;  2VUB A;  2XG8 D;  3LGF A;  4LD6 A;  1RL2 A;  2NLU A;  2CZ7 B;  5KH6 A;  2D9T A;  1PSF A;  2EJG A;  2GFU A;  2ZPI B;  3URG A;  4OVA A;  4RCC A;  2PU9 B;  4ZN1 A;  3O8V A;  5CK9 A;  5EG2 A;  1WPY A;  4C0G A;  3OB9 A;  2K5L A;  2KMT A;  5LJ3 h;  4A4E A;  5CQX A;  3CCJ T;  3OS0 A;  4N4H A;  3JB9 J;  4JUV A;  1K9M C;  4A4K A;  1LJO A;  4C5I A;  2DEQ A;  2LCC A;  2L89 A;  2GQV A;  2QXF A;  3FEO A;  4FU6 A;  2HD0 A;  2JVV A;  2MAM A;  3MEA A;  5LJ3 d;  4ZN3 A;  3S3N A;  2ZPH B;  3NTK A;  3JB9 D;  3HP9 A;  2KDS A;  3CEY A;  3M57 A;  4JLI A;  1UEB A;  1MHN A;  2EKO A;  2K5F A;  1BI3 A;  3H8Z A;  3HL8 A;  3M59 A;  3OS5 A;  2EQK A;  3MP1 A;  3SWN B;  5AYF A;  3JCM c;  2LT4 A;  4ZGD B;  5GAN 4;  4QQD A;  1H64 1;  3E9G A;  4C8Q C;  3CXC S;  3CCR A;  3V8L A;  5HK0 A;  1D3B B;  3X26 B;  5A0L A;  2M1H A;  1M8V A;  5FRO A;  5CKF A;  4M75 B;  1UGR B;  5GMK h;  1D3B A;  2E6Z A;  5KCH A;  5KE2 A;  3UPU A;  3PGG A;  4M77 G;  2K4Y A;  4RMO A;  4TVR A;  1H3Z A;  1U1S A;  4Z02 A;  3WVE B;  1JRI A;  2CZ1 B;  3OYB A;  2P4T A;  1VQ5 A;  2A3L A;  1FWZ A;  3P8D A;  5GAM d;  5GAO m;  2OTJ A;  2RJE A;  1Q81 C;  4M7D F;  4MDX A;  2DXC A;  3HRS A;  4QQG A;  3KXT A;  1O9S A;  2VGN A;  4ME7 A;  2DZC A;  1QP3 A;  5A0D A;  2OTJ T;  4IKF A;  3JCM d;  3DLL A;  3H6Z A;  2R58 A;  4BE0 A;  3DB4 A;  3VV0 A;  1U8R A;  3JCM P;  1YI2 T;  4F7U B;  4FM4 B;  3V7R A;  3UT1 A;  5GAN 7;  3CCE T;  4JJN K;  2E65 A;  2MWP A;  4B9W A;  4PNO A;  1VIE A;  2QTX A;  4BE2 A;  4KUL A;  3OSV A;  3L1A A;  4XU0 A;  3DKM A;  4JRI A;  3J81 E;  4X34 A;  4J8O A;  4NOY A;  3RMQ A;  1VQO T;  4E7K A;  1Y96 A;  3PMI A;  5C0M A;  1K73 U;  1Y96 B;  1KD1 C;  5CKB A;  2PUK B;  4RG2 A;  2D6F A;  5J26 A;  1ZBX A;  2BIV A;  2V8J A;  4O6J A;  5GAN 3;  1SSF A;  1PSE A;  4L6V 5;  3OYA A;  4OP0 A;  1VQ8 T;  2H3J A;  4M7D D;  1XTD A;  2IVW A;  2DIG A;  3BDL A;  5D6X A;  4C5H A;  2JTM A;  2F5T X;  4RKU E;  1VQ5 T;  3J7A F;  3OYD A;  3CMA A;  3QG1 A;  4M7D B;  2I2L A;  2CZ6 B;  2XIC A;  3QZ5 B;  4PKC C;  3RIR A;  1QVP A;  2XI9 A;  4M77 F;  1B34 B;  2B8A A;  3BY7 A;  3VU3 C;  3PFS A;  1JJ2 S;  4Y28 E;  5LJ5 d;  5FU7 C;  4JS5 A;  5HKC A;  4F7U F;  4OF1 A;  1VQM T;  2RJC A;  5GAM f;  4ELY C;  3OMC A;  3CCU A;  4A53 A;  1Q7Y U;  5I2M A;  5LJ5 h;  3C94 A;  5I2S A;  5GAO q;  3CXC A;  3S3O A;  1YJN A;  4M7D E;  5KCO A;  4XU2 A;  4XQ3 A;  1I8F A;  4EMK C;  3CME A;  4IUR A;  1VQN A;  2HBP A;  4PJO F;  5GAN e;  1NPR A;  1JB0 E;  3CCS A;  3G71 A;  3CD6 A;  2V8I A;  2DXT A;  1YI2 A;  4XTW A;  3VYH B;  3S3M A;  4DA4 A;  4FT2 A;  3CBM A;  3OYG A;  3CPW A;  1EIF A;  2F69 A;  2LDM A;  2M0O A;  5GAN 8;  3FC3 A;  1VQ7 T;  4M7A C;  2PQW A;  1AHJ B;  2Y4X A;  3QBY A;  3QPH A;  4PLI A;  1WQW A;  4BY6 B;  3JB9 H;  2KVQ G;  3QYG B;  1JBM A;  3PNW C;  2X4X A;  3X24 B;  4ZGE B;  3OYJ A;  2DKG A;  4XAX B;  3RUX A;  5CAI A;  4J5Y A;  4C92 F;  2WSE E;  4R55 A;  1VQL T;  2WAC A;  2YHT A;  2LT1 A;  2ZPE B;  2QQ9 A;  1Q86 U;  1I5L A;  2HQE A;  2Y90 A;  2K3Y A;  4M77 D;  3RER A;  3UWN A;  3OYM A;  3JB9 F;  3SB2 A;  2RK2 A;  3PMT A;  3FLG A;  5CQY A;  1BI0 A;  3WXM B;  3MP8 A;  5LJ5 e;  2ZGW A;  5GAN 2;  2DTH A;  2F5K A;  4E7I A;  4M7D G;  4L59 A;  1VQ4 A;  3SWN A;  4M77 C;  3X25 B;  4ELZ C;  4JRQ A;  1KHC A;  3UDC A;  4J6X A;  3CCR T;  5GAN d;  3G4S A;  5FU7 B;  4M7D C;  5L8R E;  1KQ2 A;  1UB4 A;  5J39 A;  5LJ5 f;  1OYX A;  4CRI A;  3JB9 I;  2BUD A;  1JJ2 A;  4M75 A;  3GIB A;  2R5A A;  4NS5 A;  3QHS A;  2E1H A;  3LLR A;  3JCM h;  5GAN h;  2C06 A;  3LX7 A;  2X4J A;  3QII A;  4EMK A;  2Y4Y A;  2YRV A;  4F7U E;  2RJD A;  3ZEH A;  4J7F A;  2JNG A;  3E9F A;  4C8Q A;  2O4X A;  4EMK B;  4O5V A;  3JCM b;  3LGL A;  2EJ9 A;  3GP8 A;  3OW2 S;  3BDU A;  2LCL A;  2GCX A;  2RM4 A;  5LJ5 g;  4M75 G;  2RI3 A;  2QEX A;  1YIJ A;  2EFI A;  4HCZ A;  3CCV A;  4RCB A;  1VQK T;  5LJ3 g;  4OB2 B;  1S72 A;  5GAN 6;  3I55 T;  3OYL A;  1Q82 C;  2M9U A;  4HA8 A;  4C5E A;  4FT4 A;  2OTL T;  2CGH A;  2V8K A;  4E47 A;  3GF5 A;  1W4S A;  2LC4 A;  3CC7 A;  4HT9 A;  3QJ6 A;  3JAM E;  1KG1 A;  4JLG A;  3VKI A;  4A4F A;  3MET A;  1X01 A;  2E5Q A;  4M78 B;  1TH7 A;  1VQP A;  2XD0 A;  2XID A;  2LRQ A;  4PL6 A;  2A7Y A;  2PVG B;  1G3T A;  1M90 C;  4BAC A;  3CC2 T;  2ZPB B;  1KQ1 A;  2FB7 A;  5FLX E;  5GAM e;  1G3W A;  5FU6 B;  4PJO E;  4IUU A;  2YLB A;  4Y91 A;  2X4Y A;  1G3Y A;  3L2U A;  4OB3 B;  1QVF S;  4OB0 B;  3CCM A;  3A8G B;  3M9Q A;  3V8J A;  3G6E T;  3HFO A;  2JTF A;  3SFM A;  4BE1 A;  3E19 A;  2KAF A;  1NJI U;  1KD1 U;  2LQK A;  3RES A;  2QA4 A;  4C8Q E;  3GPL A;  5DLQ E;  4A54 A;  1G5V A;  4MZT A;  3OYE A;  4HCB A;  4C92 E;  1BYM A;  1M9S A;  4R56 A;  2VV5 A;  3E1S A;  3NTH A;  1VQ7 A;  2KQW A;  4LDX A;  3RKY A;  5A2Q E;  4C0D C;  1VQ6 T;  4JRP A;  1N6A A;  4VUB A;  3I56 T;  1QP2 A;  4ZTF A;  4QW2 A;  1N8R C;  4JS4 A;  5CKD A;  2DTI A;  4IUT A;  3I56 A;  3HPW A;  2VC8 A;  3L2Z A;  5LL6 S;  1UGP B;  2E10 A;  1BIB A;  3OBY A;  3RMS A;  3X28 B;  3OYF A;  3RKW A;  2RB6 A;  4A4G A;  4M7D A;  3CCL T;  3QSU A;  2MWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...