2O88A

Crystal structure of the n114a mutant of abl-sh3 domain complexed with a designed high-affinity peptide ligand: implications for sh3-ligand interactions
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
58
structure length
58
Chain Sequence
NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSAYITPVNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
publication title Crystallization by capillary counter-diffusion and structure determination of the N114A mutant of the SH3 domain of Abl tyrosine kinase complexed with a high-affinity peptide ligand.
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2006-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2o88A00
2D1XA 1WXUA 2LJ3A 2LJ1A 2O9VA 2GTOA 1UECA 2ENMA 3PVQA 2K79A 1CKAA 2F2WA 3FJ5A 2X3WD 1JXOA 2DJQA 2DL4A 1U3OA 2LZ6B 1AWJA 1ZBJA 2ED1A 1H8KA 3H0FA 2LQWA 1VYTA 1YCSB 1I07A 2CSIA 2L0AA 1K9AA 1T0JA 1ZLMA 5I11A 1BU1A 4OMLA 2K9GA 2GNCA 4K11A 2KRNA 2LNHB 1NYGA 2AKKA 1AD5A 2EYXA 3M0RA 3M0UA 4JZ3A 3ZL7C 1LCKA 2ROTA 3IQLA 4KRTA 1GCQC 2O2OA 4JJCA 2DL3A 2CUBA 2LX7A 3NMZC 2B86A 1UHFA 2BTTA 2FO0A 3RNJA 1UTIA 1W1FA 5FWBA 1Y0MA 2YUQA 3REBB 1PKSA 1JU5C 3ULRB 2DE0X 1SHFA 2CDTA 2OAWA 2SEMA 2CREA 2L2PA 4M4ZA 5IXFA 4F16A 1SRMA 2EYYA 1T3SA 1I0CA 1NEBA 2F2VA 2KGTA 4J9HA 2J06A 2KXDA 2CH4W 4CC4B 4AG2C 4F17A 1PKTA 2KE9A 5L23A 1GL5A 2DYBA 4LUEA 2EKHA 2KT8A 4ORZA 2MCNA 2YDLA 1QKWA 5HCKA 1ABQA 1ZSGA 2A28A 2H8HA 3VS3A 3QWYA 2G6FX 1BB9A 3VS7A 4EIKA 5I22A 1UUEA 4RTXA 2DL7A 2RQVA 2DNUA 2ESWA 2KYMA 3VS4A 2YUNA 2JMCA 2CH4A 1WIEA 3I5RA 1QWEA 3EHRA 1KJWA 1WLPB 1B07A 1GCQA 3M0TA 1U5SA 1UJYA 2FRYA 5GJWB 2RF0A 1WDXA 1RLQC 1M3BA 1AZGB 1IO6A 1RUWA 2KXCA 2GBQA 2YUPA 1GCPA 2KEAA 1PRLC 1K4US 2NUZA 3H0HA 1VYUA 3H41A 4RTZA 1UG1A 2LCSA 4IIMA 1NLOC 2JM9A 1UFFA 2DMOA 2K6DA 4HVUA 2KRSA 3C0CA 1GFDA 3M0QA 2HSPA 2VKNA 2KROA 1QCFA 1HSQA 1QWFA 3VRYA 2W0ZA 1SPKA 2GGRA 2D8JA 3KFVA 1K76A 2CT3A 2A36A 2ABLA 4HVVA 3R6NA 5IHNA 2W10A 2BZ8A 2EGCA 2LMJA 2YT6A 2J05A 4J9CA 1WYXA 3I9QA 4D8DA 2DL5A 2D8HA 1E6HA 2AK5A 1CSKA 1Z9QA 5EC7A 1PNJA 1M3CA 4AFQC 5IHIA 1A0NB 5GJVB 2O9SA 2YUOA 1NM7A 3REAB 3GBQA 4OMOA 1NLPC 2C0IA 1AVZC 3TSZA 2LQNA 4JJBA 2RQUA 2E5KA 2EPDA 1E7OA 1M27C 2M51A 2O88A 1JXMA 1Z9ZA 2EW3A 2FEIA 2MOXA 2FPFA 4GBQA 1H92A 2EGEA 1RLPC 3VRZA 3EG3A 5IH2A 2V1RA 3UATA 3VS6A 1MV0B 2HEQA 4JJDA 1SHGA 4OMMA 2FRWA 2K7AA 1EFNA 3I5SA 1B3QA 2EVRA 4Y92A 1KSWA 2YSQA 2JT4A 2RMOA 2HBWA 2AZVA 1TG0A 1AEYA 3EHQA 1E6GA 1NYFA 1Y57A 1VYVA 1G83A 1I1JA 3LH5A 2DA9A 1OPKA 1AWOA 2L3PA 4X1VA 2J6OA 1FMKA 2OI3A 2EQIA 3PVLA 2DX1A 5ECAA 1GRIA 2FPEA 4A63B 1NEGA 4Z88A 2KRMA 2A08A 1X69A 2DM1A 1NG2A 3VS0A 1PRMC 4E6RA 1UJ0A 1X2KA 2D0NA 2RPNA 3EG0A 1PWTA 1YN8A 4FSSA 1YP5A 4JPBW 1AWWA 4IIOA 3SEMA 2BZXA 2PTKA 1J3TA 1FYNA 4HVWA 2VVKA 1BK2A 4ESRA 2DBKA 1ZUYA 1X6GA 3O5ZA 2VWFA 3UF4A 3QWXX 2EYWA 3A98A 2KR3A 1WXTA 3NGPA 4OMQA 1YWPA 2DL8A 4QT7A 2JS2A 1ZUUA 1OPLA 2IIMA 4HXJA 2A37A 3EG1A 4CC2A 1ZX6A 3TSWA 1SEMA 4RTTA 2KT1A 2DLPA 3VS5A 1KIKA 3UA7A 2DRKA 2KYBA 1UDLA 1T0HA 1K0SA 2HCKA 4ZNXA 1N5ZA 1OV3A 1WX6A 1JO8A 1S1NA 3NPFA 2CSQA 2RQWA 3UA6A 4DEXA 2I0NA 1X27A 1PHTA 4J9IA 4J9EA 2FG0A 2GTJA 1GBRA 3PE0A 1JQQA 2J7IA 2LJ0A 4RTYA 4AFUC 1KFZA 4RTWA 4AFSC 4Z89A 1OEBA 3JV3A 2C0OA 1ZUKA 2CUDA 2DVJA 2RN8A 4LE9A 4AG1C 2PZ1A 1UHCA 1M30A 1SSHA 3CQTA 1W70A 2AZSA 2SRCA 1WA7A 2O31A 2ED0A 1JEGA 2C0TA 1TUDA 5FW9A 2L3QA 4JZ4A 1HD3A 2X3XD 2JM8A 4Z8AA 4J9FA 2QDLA 1QKXA 1X6BA 2FPDA 2CT4A 1W6XA 2DBMA 2KNBB 1GFCA 4CC3A 4D8KA 2K3BA 1WFWA 2RQTA 2EBPA 2M0YA 2PNIA 2MIOA 2XMFA 1UE9A 1K1ZA 1MUZA 2JMAA 1X43A 3THKA 2ECZA 1RI9A 2V1QA 3EG2A 1AOJA 4AFZC 2J6FA 1XOVA 2LP5A 3VS2A 1GBQA 2HDAA 1OOTA 4CC7A 1AZEA 1K0XA 4LN2A 2DF6A 2EGAA 3NHNA 1ARKA 3M0PA 4J9GA 3RBBB 2L3SA 3M0SA 1TUCA 4F14A 1AWXA 1VA7A 1WXBA 4DEYA 1QLYA 1G2BA 2ROLA 5IHKA 2KBTA 2K2MA 4GLMA 3TVTA 1T3LA 4J9BA 4RTUA 1M3AA 2P4RA 3I35A 4RTVA 3U23A 2EYZA 1ABOA 1MV3A 4OMNA 4LNPA 1CKBA 5FWCA 2GQIA 2JXBA 2OJ2A 3EGUA 1HJDA 2JS0A 2JTEA 2JW4A 3SHWA 3H0IA 2AKLA 4OMPA 1X2QA 2J6KA 4RUGA 2DRMA 2F2XA 4LUDA 1U06A 2DILA 5IXBA 4HCKA 2RQRA 1BBZA 2BZYA 1UGVA 1H3HA 1V1CA 1SRLA 4J9DA 4R0KA 1M8MA 1YNZA 4WCIA 3VS1A 2NWMA 1WI7A 1YWOA 2RNAA
chains in the Genus database with same CATH superfamily
1NZ9A 2RA2A 3X24B 1G8XA 1Q81C 2ENMA 3UDCA 4M78B 4C0DC 5HKCA 4HCZA 3PIPA 2DL4A 4C5HA 1ZBJA 1VQ9Q 2ED1A 1QCNA 3INZA 1IZ6A 2L0AA 1YCSB 1KHIA 1T0JA 4XTWA 2GNCA 1VQ6Q 3CCUT 1AHJB 1AD5A 2RHUA 4Z02A 3M0RA 2EQUA 3MEWA 2OTJQ 2O2OA 2DL3A 4LDYA 3S3OA 1YIJA 1W1FA 2A3LA 4KT0E 3AHUA 1PKSA 4XAXB 3SFMA 3CMET 1X01A 1YJNA 1BI2A 1RABB 4C92C 4M77F 1SRMA 3L2WA 4QW2A 3OYAA 2J06A 2O4XA 2OAUA 2E6NA 1PKTA 2RK2A 2QEXQ 2DYBA 3SWNC 1H3ZA 4LUEA 1Q82C 1VQLA 5CKFA 2KT8A 3RKWA 1Q95G 3V8JA 5LJ3h 2VGMA 5J3BA 4BY6C 1N9RA 2VASA 4FU6A 1ZSGA 1PSFA 3QWYA 3V7SA 1Y71A 4WF2A 5LJ5j 1D0ZA 1YITA 3VS7A 4A4KA 5I22A 2VXEA 4RTXA 4DOVA 3CMAA 2JJ9A 3M57A 2DL7A 2DNUA 1VIFA 2JMCA 2Y90A 3EH2A 4CRIA 1WIEA 1QWEA 4II1A 2RI3A 4PKCC 1WLPB 1B07A 4A53A 1U5SA 1UJYA 2FRYA 2RF0A 3CCUQ 1AZGB 3HKSA 1IO6A 1RUWA 4NS5A 1HYOA 5GMKi 2KEAA 1PRLC 4QKUA 4J83A 4O5VA 2LCSA 4C92F 1I5LA 4IIMA 1NLOC 1D0YA 1Q81R 2DMOA 4E7LA 5GAN7 2K6DA 4ZGEB 4HVUA 3OYNA 4QQDA 1GFDA 2ATCB 2KROA 1VQ9A 3CMEQ 2F5TX 1QWFA 3VRYA 3QIIA 4F7UE 3CCST 1KD1U 2GGRA 2D8JA 4E2FB 2CT3A 4A4FA 1G3YA 4PJOE 1VQ6A 1WHGA 5IHNA 5IT9E 2LMJA 4HKEA 2DXTA 3OYLA 2D8HA 2AK5A 1CSKA 1VIEA 4C0GA 5IHIA 2QAZA 5GJVB 1ZA2B 4ZGJB 3GBQA 2H3EB 4RKUE 4X34A 2GFUA 2Y4XA 4JJBA 2RQUA 2NUTB 3SB2A 3M9QA 4RCCA 1E7OA 1M27C 1P92A 4R55A 1JXMA 1Z9ZA 5DLQE 2LRQA 2MOXA 3RERA 1N6AA 3QYGB 4R56A 4DBQA 3BDLA 2FPFA 4GBQA 1RLPC 7AT1B 2WSEE 2V1RA 1PC0A 3UATA 2QEXA 5FU7C 2X4XA 3CXCS 2MMPA 1Q82R 1SHGA 2XK0A 2FL7A 4PJOB 1B3QA 1D1AA 1LOJA 4KH1B 3HL8A 2GCXA 4M75G 2JT4A 2DTOA 3Q1JA 2AZVA 3EHQA 1E6GA 2K4YA 1MNEA 3QPHA 1NYFA 3JCMQ 2M16A 1VQMT 1WZOA 2JZ2A 2L3PA 5IN1A 5GMKh 1YHQT 1AWOA 3HRUA 3CCSQ 3KBGA 1NBEB 2O01E 2OI3A 2EQIA 3PVLA 2FPEA 3CCUA 1NEGA 2EJFA 1Y96A 3HRTA 4L5GA 4VUBA 3UPUA 3QHSA 2DM1A 4BDYA 1KQ2A 1AT1B 4C5EA 5LL6S 3OMGA 4F04B 3MKDA 1Q7YC 1ZSZC 2DAQA 5CQXA 2F1LA 4JPBW 1AWWA 2WSCE 5GMKm 1QMCA 1G3TA 3DKMA 3EAEA 4ESRA 2MF2A 3E9FA 4IUVA 5KE2A 2EYWA 3L2UA 1WXTA 1IGQA 1YWPA 4M78D 4FYVB 2JS2A 2V26A 4M78C 2IIMA 1N8RR 4X9DA 3JB9J 2CKKA 3EG1A 2OTLT 1SEMA 4KH0B 4UC4A 3VS5A 1KIKA 2DRKA 2XDPA 1YFNA 2HCKA 4QVDA 1VQOQ 4M7DG 1BI3A 2YRCA 5A2QE 4DQ2A 1TS9A 2XICA 3NPFA 4PFOA 2O4XB 1I8FA 4DEXA 1FMWA 1QVGS 4HT9A 4BUGA 3HFOA 2FG0A 3JCMW 3S3MA 3PE0A 1JQQA 1R77A 4RTYA 4AFUC 1VQMQ 1YHQQ 5A0GA 3JV3A 3JCMV 1NPPA 1ZUKA 2CUDA 2DVJA 2HL3A 3LW5E 2PZ1A 1UHCA 4LD6A 4OVAA 1SSHA 3CQTA 2LQKA 3G6ET 2K3YA 2SRCA 3MPUB 1ZSZA 1R0CB 3RMQA 1WQWA 2RJDA 2L3QA 5GMKj 3JCMX 3MP6A 1Q86C 3UWNA 2JM8A 2CZ0B 4Z8AA 4J9FA 1G3WA 2DD5A 1NJIC 2DBMA 2P84A 4CC3A 2RQTA 2M0YA 3CCSA 4C0ZA 2PNIA 2MIOA 9ATCB 4M78A 5GAMg 3CXCA 1VQKT 2ZCFB 3C94A 1RI9A 3CC7T 2DIGA 2QTXA 4X9CA 2K5FA 2YHTA 3VS2A 1M9SA 3FJPA 1IHVA 3QO3A 1R0BG 1OX8A 1K0XA 4LN2A 3RIRA 2OTLQ 2EGAA 4XQ3A 2HKQB 3RBBB 2L3SA 1TUCA 3L2QA 5CQYA 4BB7A 5GAN3 1VA7A 1K9MR 4JRQA 1WQ7A 3V7CA 3E2UA 1G2BA 1U1TA 4RTUA 4ZN3A 3U23A 1ABOA 1MV3A 1CKBA 2GQIA 1YI2T 3P8BB 2P4TA 2JXBA 2K57A 2AIRB 2JS0A 2JTEA 3SHWA 3CBOA 3NTKA 1X2QA 2J6KA 3VYGA 5KCOA 3G6EQ 2LT4A 3M54A 1I5OB 2RQRA 2ZPBB 5DLOA 4HA8A 3JCMP 1H3HA 1M5Q1 1SSFA 1QW1A 4IUUA 2PU9B 1M8MA 5GAN2 3CCMT 3WVEB 3CXCP 5GANe 2NWMA 4HCCA 4F16A 1VQMA 4ZN1A 2FZGB 1YHQA 2DD4A 2MPXC 1YCYA 1WXUA 2LJ3A 2LJ1A 1VQKQ 1M1FA 1VQLT 2O9VA 3LWHA 2GTOA 2CP6A 4RCBA 3CC7Q 4IUPA 3PVQA 3OS1A 3RUXA 2F2WA 2X3WD 1JXOA 2DJQA 4C8QF 1U3OA 2LZ6B 1AWJA 2I2LA 1VYTA 2CSIA 3A8MB 1FX7A 4M75B 4PLLA 1QVGA 2D9TA 1BU1A 1JJ2P 1WNLA 2KQWA 2KRNA 1NJIR 2EYXA 2JUFA 3ZL7C 1LCKA 3IQLA 1WJSA 1TU0B 4PJOD 1GCQC 1VQ4T 2CUBA 4PJOC 2RI2A 3RKXA 2K3XA 1UHFA 2YLCA 2E64A 2P0QA 1UTIA 4XTXA 1YI2Q 5FWBA 4M7DE 3WVDB 2DEUA 3REBB 2QG9B 2OAWA 3OB9A 3DLMA 2L2PA 1OU9A 5LJ5f 4JLGA 1YIJQ 1KC8C 2OTLA 4LDVA 4D6WA 2HAXA 2ZPEB 2BUDA 1NEBA 2KGTA 3HRSA 1GXIE 3JB9G 1N9SA 1RAHB 3CPWS 4AG2C 2RJEA 1MMAA 4F17A 4ZTFA 1GL5A 4FT2A 2EKHA 2QGGA 4MZMA 4ORZA 2NUTA 2X35A 2YDLA 4CI0C 1QKWA 1V76A 2K5IA 2DZ9A 3M55A 1QP2A 4M7AG 2ZAEA 4OB1B 4FCYA 1VQLQ 2G6FX 2KSSA 3G4ST 3G6EA 1KG1A 1QVGP 2X9HA 2GF7A 2RQVA 2KYMA 3G7ZA 4M7DB 2ZPIB 4F7UA 2BKDN 3I5RA 2LC4A 2K2VA 1KJWA 1GCQA 1YITQ 4PJOA 1KQSS 1WHHA 5GJWB 3CMAQ 3CCQT 2LNVA 3CCET 2P0PA 4N4IA 4NL2A 5GANd 3QZ5B 1VQ4Q 3H41A 4RTZA 1M1KC 1LPLA 4IKFA 1VQKA 1VQ8T 5GAOr 2RHIA 2JM9A 4PJNA 4WTOB 3CC7A 2VKNA 4LXCA 1TH7A 4IUTA 1K73R 1K8AR 1KD1C 4KGZB 5LJ3g 1K76A 4E7KA 3R6NA 2W10A 2BZ8A 2EGCA 2YT6A 2EQKA 4J9CA 3QXEB 3URGA 1M90R 3PFSA 4JDSA 2PQWA 2JVVA 2O9SA 2E12A 1YI2A 2C0IA 1AVZC 2MK5A 2HBPA 3NTHA 2E5KA 3JCMc 1K73U 2EPDA 2O88A 3G4SQ 4PJMA 5GAOm 2KK4A 4B6MA 2EFIA 1G3SA 1YBYA 1H92A 3L1AA 5IH2A 3QJ6A 3LLRA 1M90U 5KYNA 3VS6A 3M58A 2DXBA 4JJDA 4OMMA 3CCQQ 3CCMA 2K7AA 2XKOC 3C95A 4PLIA 4Y92A 1KSWA 3M4GA 4M77G 1VQ8Q 2HBWA 3TQ7P 1TG0A 1AEYA 4QVCA 2HQHA 3ME9A 1Y57A 2CP3A 2E4HA 1OPKA 3A8OB 3CPWA 1WJQA 2J6OA 2QASA 3CBPA 1MMNA 4AMCA 5ECAA 1QVFS 2R58A 2ZZDA 2AT1B 4Z88A 3VJPA 1XTDA 1ACMB 2A08A 1U1SA 4J6XA 1VQ4A 1PRMC 4E6RA 1M1KR 1RACB 2LX9A 4PL6A 2D0NA 2RPNA 3QBYA 1F1BB 5KYXB 1YN8A 4E7IA 4FSSA 1YP5A 4IIOA 1ZHIA 1OYXA 2BZXA 2PTKA 2XIDA 1J3TA 3DB4A 1KQSA 1RADB 2DBKA 2E65A 3VYHB 3UF4A 2M1HA 5GAN4 2KR3A 5D6WA 3QYHB 2PUKB 4M7AE 3OYEA 4C92G 2DPPB 2A37A 5C0MA 3V8LA 3MHXA 2B8AA 1C1AA 1JB0E 1TWBA 4RTTA 4M75D 1KK7A 3UA7A 5I2MA 4M75C 4N4HA 3EGXA 1T0HA 1VQNT 4ZNXA 4RG8A 1S1NA 3JB9H 2HQXA 1RAFB 3CPWP 2E70A 2CSQA 2RQWA 3UA6A 2MWPA 5GANh 1X27A 1Q81U 3G4SA 2QK0A 3CCVT 3X25B 4DBRA 1MMGA 1KFZA 4RTWA 1OEBA 2HZYA 4BI3A 3P8DA 4JRIA 1M30A 1UEBA 3META 3CCQA 4JRKA 3CCEA 3BW1A 1MMDA 1VQ5T 5LJ3j 4KULA 2E10A 1VQ8A 4F7UB 3GNFB 5KCHA 1HD3A 2X3XD 3PTAA 1EZZB 2QDLA 1QKXA 2QQRA 3L2RA 2CT4A 1KQSP 2EQMA 5GMKl 4GY5A 2KNBB 3OBYA 1GFCA 4D8KA 3OYCA 1OULA 3GLXA 2XMFA 2CP7A 2LT1A 1MUZA 1X43A 2ECZA 2LDMA 2V1QA 2J6FA 4B9WA 3HTRA 2LP5A 4M75A 5DM7R 5GAN5 1JJ2S 4M7DD 1QCOA 4M7DC 3NHNA 1ARKA 1Q82U 4J9GA 2CS7A 1PD0A 3M0SA 3BE3A 5GAN6 3OYMA 3GP8A 1VQNQ 1AWXA 1WXBA 2L89A 3S3NA 4JUVA 2M9UA 1VOMA 2PVOB 5IHKA 2KBTA 5FROA 1QVFA 1T3LA 3FB9A 3CCVQ 5FWCA 3JCMe 2OJ2A 4V2SA 3CEYA 4EMHA 5KYWB 4M77E 1M2VB 1LNXA 1N27A 1OX9A 1EIFA 4XU1A 2MYSA 4RUGA 2DJZA 5LJ5e 4FIBA 5GANj 4LUDA 1BYMA 5CK9A 4HCKA 3QDRB 1VQ5Q 1V29B 2V8IA 1V1CA 1SRLA 4KUDK 3UT1A 3ZFJA 2L5QA 4NL3A 1YNZA 4WCIA 5CAIA 4LD9K 1YWOA 3JAME 2RNAA 2HMAA 2K5LA 3CBMA 5A0DA 1KHCA 2EJ9A 2XU8A 4E7SA 4A4GA 1UECA 4M7DA 2K79A 3L2VA 2QXFA 1H8KA 3H0FA 4JS5A 2DIQA 1I07A 1N8RU 1K9AA 1ZLMA 4M77B 5L8RE 5AT1B 4OMLA 1IGUA 4K11A 2LNHB 3E1SA 1QVFP 5CIUA 3X20B 1HK9A 4JZ3A 4MMLA 2ROTA 2L3RA 4C92E 1WHMA 2LX7A 2B86A 3SDZA 2LTOA 3RNJA 2R5MA 2RHZA 4FYXB 3CC4T 1Y0MA 4M78F 1JU5C 3DLLA 1RAGB 2A0FB 5FRNA 4OB0B 4MMKA 5IAYA 5D6YA 3GIBA 4TVRA 2EYYA 1I0CA 2V8JA 1VQNA 2XD0A 2DKGA 5GAMf 2KAFA 2GQVA 2YRVA 4L59A 4XU0A 2CZ1B 4J6YA 1Q7YR 2V8KA 2YWWA 4A54A 3CCVA 3OY9A 2MCNA 2NYSA 1PM3A 2YXYA 1JJ2A 3JCMd 3EGXB 2A28A 3TCJA 1WPYA 3EG9B 1SKUB 2F5KA 4Y91A 4XU3A 5J39A 4PJLA 4EIKA 1UUEA 2HL5C 5LJ5d 3VUZA 2ESWA 3OYIA 1WGSA 1VQ5A 2YUNA 3AT1B 1JBMA 1WDXA 1RLQC 1W2BS 2KXCA 1YJWT 1K9MU 1GCPA 2ZPFB 2NUZA 1K4US 2QDYB 1VYUA 2AHJB 2CP0A 4B9XA 3CD6T 1UFFA 4LDWA 3T9NA 1YJ9A 2KRSA 1S72A 4OB3B 3M0QA 2HSPA 2VXFA 5A0LA 2XDBA 3OS0A 3JB9D 1KQ1A 4C0FA 1D0XA 1SPKA 4BDZA 3KFVA 5CVIA 5KYUB 2ABLA 3MP8A 3J81E 3QDFA 1WYXA 4D8DA 2CP5A 5CCAA 2DL5A 1E6HA 1Z9QA 1H641 4J7FA 2FHDA 5EC7A 5KYXA 1Q86R 1M3CA 4AFQC 4YTLA 3PIOA 1A0NB 4C8QG 2FZKB 4KGVB 2YUOA 4OMOA 1NLPC 3A8HB 2LQNA 4ME7A 3GOXA 5KYYB 5AYFA 2CZ7B 4EPCA 2EW3A 3KUFA 1FWZA 3FC3A 1XNIA 4J8OA 3JCMg 5C6SA 3HHTB 5GAN8 2RB6A 2EGEA 3EG3A 5M9OA 1Q86U 1MV0B 4OMFB 5D7UA 2KY9A 1PSEA 8ATCB 3PT9A 4J6WA 3I5SA 1YJWQ 1NJIU 2DK3A 2EVRA 3GNGA 2JTMA 5CO7A 1RAIB 2RJFA 3HP9A 2YSQA 2PVGB 2RMOA 3OYYA 4PFZA 3I56T 3CD6Q 3CCMQ 2R5AA 3EFSA 1QP3A 1RAEB 1OI1A 1G83A 1I1JA 3LX7A 2IG0A 1D3BB 1TSFA 3G71T 5FU7B 1FMKA 2H3JA 2EYQA 4BACA 2DX1A 4ANJA 1GRIA 4A63B 4F7UF 2PVDB 4JRPA 2LCLA 4BD3A 4M7AA 4RG2A 2KVQG 4PJOF 2JNGA 1NG2A 2QQAA 1B34B 4EMKA 2OTJT 1WHJA 1WHKA 1Y07A 3EG0A 1TTHB 1PWTA 3CC4A 1O75A 3QJYA 1PG5B 5HY6A 1UGQB 4FL6A 3RR6A 3SEMA 2WACA 4JLIA 5CKEA 5FU6B 1FYNA 2VVKA 1C0MA 5GAOl 3G1JA 3JCMh 1ZUYA 1W2BA 1X6GA 3OYGA 2VWFA 3QWXX 3A98A 4E47A 3MEUA 3NGPA 4QT7A 5GAOq 3CC2T 1DJ7B 4OP0A 8AT1B 5LJ5h 3OA6A 2DLPA 4M77D 3OYDA 3HFNA 3CCJT 4AT1B 1WJRA 2KYBA 4M77C 1UDLA 1K0SA 1N5ZA 3M59A 5LJ3f 3QSUA 2BE7D 2Y4YA 3RKYA 2MAMA 3I56Q 4J9EA 2EKOA 5KYWA 1XQHA 3G71Q 4AFSC 3GPLA 1M2VA 2M0OA 2HQEA 1KC8R 1M8VA 4MDWA 3OS2A 3SD4A 1K8AU 2LCCA 2NUPB 2QTVA 2QQBA 1YJWA 2ED0A 4N0AC 2C0TA 4XTYA 1UGRB 3CD6A 1NE8A 2JTFA 2FZCB 3CCEQ 1X6BA 3QUIA 3VUBA 3DB3A 1W6XA 3A8GB 4OGEA 4OF1A 2E3IA 1W2BP 2K3BA 3RDVA 1MGQA 2EBPA 2KDSA 1K1ZA 2JN0A 1KC8U 3OYKA 4C8QE 2ZPHB 4C92D 1XJWB 3THKA 4EMGA 2RI5A 3EG2A 2VC8A 5GANg 3CCLT 4LDXA 1GBQA 4M77A 2HDAA 3TU4K 3CC2Q 5J26A 1OOTA 4CC7A 2DETA 1LVKA 2D0QB 4L6V5 5GANf 3M0PA 3CCJQ 5I2SA 3PMTA 4E7JA 1LJOA 4BI4A 1TOVA 4BE2A 4DEYA 2YLBA 4OB2B 1WHLA 2ROLA 5CKHA 1BIBA 2QA4T 2K2MA 4GLMA 3TVTA 4J9BA 1M3AA 2HKNA 4PFPA 2EYZA 4OMNA 3MEAA 2DFUA 3KXTA 3OYBA 4JJNK 1KD1R 3H0IA 2AKLA 4OMPA 4N0AA 4XTUA 5KH6A 1HXDA 5DY9A 4C8QB 2F2XA 1QQJA 3JCMJ 2XHCA 3QKJA 4ZTJA 3LH0A 5IXBA 3BY7A 3M5AA 1BBZA 2D6FA 1UGVA 1M1KU 3QG1A 2A7YA 4KBMB 2RK1A 5GAMe 3RESA 3I56A 4R0KA 4XU2A 2EIFA 1WI7A 4C92A 4C5GA 1I81A 3G71A 2QGFB 3O8VA 2D1XA 4C5IA 2KMTA 3EG9A 2X4YA 3R6OA 4A4EA 1M4ZA 1CKAA 3SWNA 3FJ5A 3CCLQ 3X26B 3EH1A 2LQWA 3HPWA 3C4SA 2OTJA 1B7TA 1N8RC 3ZBDA 5I11A 2E3HA 2K9GA 1NYGA 3OS5A 2AKKA 4KGXB 3M0UA 3NTIA 4KRTA 3OYFA 4M7AB 4JJCA 3EFOB 2QA4Q 3NMZC 2LQ8A 4EMKB 2BTTA 2FO0A 2EAYA 3VKIA 1IRXA 3EGDB 1IREB 2YUQA 4MZTA 3ULRB 5CR2A 3F70A 2DE0X 4ZGDB 1SHFA 3BDUA 3CC2A 2CDTA 2FYKA 2SEMA 1BCMA 2CREA 5KYUA 1MNDA 1M2OA 2Z0WA 4M4ZA 2JOYA 3FRNA 4M75F 1RI0A 2GFAA 5IXFA 1YJ9T 3J7AF 3A8LB 3CCJA 3H9NA 3OW2S 1T3SA 2F2VA 1VQPT 1S72T 4J9HA 3E19A 3S6WA 2KXDA 2CH4W 3ASKA 4CC4B 4FSXA 1VQOT 5FRMA 2KE9A 3OMCA 1BCOA 5L23A 3BFMA 2QYZA 4LDUA 1D09B 1IB8A 2DTHA 5KYYA 5HCKA 4FT4A 1ABQA 1MHNA 2H8HA 3VS3A 1FMVA 3TEEA 2VV5A 1BB9A 2KI7A 5FU6C 3EFRA 4DBHA 3MJXA 4FYWB 3VS4A 3M56A 3PNWC 2CH4A 4PNOA 2C06A 3EHRA 3M0TA 1EX4A 2R57A 3JCMb 1BI1A 5GAMd 2LVMA 1M3BA 4HCBA 4N4GA 2MWOA 2VUBA 2GBQA 2YUPA 1K9MC 3H0HA 2BIVA 3CMEA 1D1BA 1UG1A 2E6ZA 1D3BA 2EJGA 3C0CA 2RH2A 3CCLA 1X6OA 1QCFA 2XI9A 1HSQA 2PUOB 2XDDA 5GAOp 1NPRA 4M7DF 2W0ZA 4MZPA 3RMSA 4ELYC 3MO8A 1YJ9Q 2VYTA 2A36A 4BE0A 4HT8A 4HVVA 1S72Q 1VQPQ 3I55T 3X28B 1B34A 2J05A 3I9QA 2E1HA 2ZGWA 3QZ9B 3FLGA 4OGCA 4FYYB 1D1CA 1PNJA 1SF9A 2QA4A 1VQ7T 4EDUA 3NFCA 1O9SA 1X75C 1JRIA 3MP1A 1NM7A 3REAB 5GAOn 3JB9I 2DEQA 3TSZA 3D7SB 3J80E 4ELZC 2VGNA 2RHXA 4C0DB 3WXMB 2DZCA 3CCRT 2M51A 4JS4A 2G3RA 2FEIA 2RHYA 2DTIA 2FVUA 5FLXE 4FW2A 3VRZA 1ZQ1A 4DOWA 2FB7A 4XTZA 2HEQA 3L2ZA 2CGHA 2FRWA 3LGLA 4M78G 2IVWA 1EFNA 3PMIA 2COZA 1RAAB 4P5NA 4XK8E 5D6XA 2YRDA 5CKDA 3ER0A 5EG2A 5LJ3e 1Y7XA 2DXUA 5I21A 3OW2A 4O6JA 1VYVA 3LH5A 2DA9A 1UGSB 4XTVA 4C92B 4X1VA 4J7IA 1BI0A 4RMOA 2NUPA 3MEVA 2RD1A 3I55Q 2KRMA 3H8ZA 4C8QD 1X69A 3SWNB 2COWA 4C8QC 2HSEB 3VS0A 2BE9B 1UJ0A 3L42A 1VQ7Q 4Y28E 1BIAA 1X2KA 1Q7YU 1M1GA 2E5QA 4DA4A 4BY6B 3OSVA 2DERA 3LGFA 1IXDA 3OYJA 4IURA 4M75E 1PD1A 1OZ3A 4QVZA 3CCRQ 4HVWA 1YIJT 2COYA 1BK2A 1C6VX 3CC4Q 3O5ZA 1VQPA 2RM4A 2VB6A 4FW1A 4OMQA 2DL8A 1VQOA 1ZUUA 1OPLA 2QQ9A 2X51A 4HXJA 4PK4A 1YJNT 4QQ6A 4CC2A 1ZX6A 3TSWA 3VU3C 2KT1A 3HSBA 2CP2A 2RJCA 5HK0A 3V8KA 1UGPB 3OYHA 1OV3A 1ZA1B 1WX6A 3VV0A 3OW2P 1JO8A 5GAMh 3H6ZA 2L8DA 2WSFE 4M7AD 4FM4B 2I0NA 4J5YA 1SG5A 1PHTA 2P0KA 4J9IA 4M7AC 3TREA 2QQSA 2GTJA 1GBRA 2M02A 2CYZB 2J7IA 2LJ0A 4EMKC 3FEOA 1W4SA 4Z89A 1G5VA 4BI8B 2C0OA 5KE3A 6AT1B 4AG1C 2RN8A 4LE9A 4ATOA 4C8QA 1K73C 3LWIA 2CZ6B 1K8AC 1OZ2A 2DO3A 3M4YA 1YITT 2XG8D 3OBWA 1W70A 2AZSA 3CMAT 1OU8A 1WA7A 2O31A 4MDXA 1JEGA 3ZEHA 1Y96B 2DYIA 2QI2A 2EWNA 1TUDA 3PGGA 5FW9A 1M90C 4JZ4A 1VUBA 1BKBA 3E9GA 2RO0A 5LJ3d 2MI6A 3JCMf 4DBFA 5LJ5g 3A1PA 2FPDA 2E41A 3M53A 2X4WA 3OSSC 2X4JA 1PCXA 1WFWA 4GLKA 3JB9F 4E7ZA 4BE1A 1UE9A 5GMKe 2JMAA 4KUIA 3FDRA 3LYIA 1AOJA 4AFZC 3I55A 3JSCA 1XOVA 1VQ9T 2DXCA 5CKBA 2EQJA 2NLUA 1YJNQ 1AZEA 1VQ7A 2DF6A 4M7AF 3MCAB 2HD0A 1VQ6T 4F14A 3EFOA 2ZPGB 1OQKA 4PJJA 1QLYA 3JRZA 1IHWA 3N5BB 3EGDA 3CCRA 4F7UG 3A5ZB 2IPOB 2P4RA 3I35A 4M78E 1RL2A 4RTVA 5HK3A 4Q5WA 4E7HA 4LNPA 4PJOG 1UB4A 2OX7A 1ZBXA 3EGUA 1HJDA 4NOYA 2DVEA 3P8HA 2HNIA 2JW4A 1FXXA 5GAMj 1R8OB 3C12A 1TXQA 4IUQA 3V7RA 2DRMA 1U06A 2DILA 3GF5A 2F69A 4A4HA 1TUGB 2BZYA 1ZSZB 3CPFA 2QEXT 4J9DA 1U8RA 3FIFA 1I4K1 3OQ5A 1QVPA 4QQGA 3VS1A
chains in the Genus database with same CATH topology
2D1XA 1WXUA 2LJ3A 2LJ1A 2O9VA 2GTOA 1UECA 2ENMA 3PVQA 2K79A 1CKAA 2F2WA 3FJ5A 2X3WD 1JXOA 2DJQA 2DL4A 1U3OA 2LZ6B 1AWJA 1ZBJA 2ED1A 1H8KA 3H0FA 2LQWA 1VYTA 1YCSB 1I07A 2CSIA 2L0AA 1K9AA 1T0JA 1ZLMA 5I11A 1BU1A 4OMLA 2K9GA 2GNCA 4K11A 2KRNA 2LNHB 1NYGA 2AKKA 1AD5A 2EYXA 3M0RA 3M0UA 4JZ3A 3ZL7C 1LCKA 2ROTA 3IQLA 4KRTA 1GCQC 2O2OA 4JJCA 2DL3A 2CUBA 2LX7A 3NMZC 2B86A 1UHFA 2BTTA 2FO0A 3RNJA 1UTIA 1W1FA 5FWBA 1Y0MA 2YUQA 3REBB 1PKSA 1JU5C 3ULRB 2DE0X 1SHFA 2CDTA 2OAWA 2SEMA 2CREA 2L2PA 4M4ZA 5IXFA 4F16A 1SRMA 2EYYA 1T3SA 1I0CA 1NEBA 2F2VA 2KGTA 4J9HA 2J06A 2KXDA 2CH4W 4CC4B 4AG2C 4F17A 1PKTA 2KE9A 5L23A 1GL5A 2DYBA 4LUEA 2EKHA 2KT8A 4ORZA 2MCNA 2YDLA 1QKWA 5HCKA 1ABQA 1ZSGA 2A28A 2H8HA 3VS3A 3QWYA 2G6FX 1BB9A 3VS7A 4EIKA 5I22A 1UUEA 4RTXA 2DL7A 2RQVA 2DNUA 2ESWA 2KYMA 3VS4A 2YUNA 2JMCA 2CH4A 1WIEA 3I5RA 1QWEA 3EHRA 1KJWA 1WLPB 1B07A 1GCQA 3M0TA 1U5SA 1UJYA 2FRYA 5GJWB 2RF0A 1WDXA 1RLQC 1M3BA 1AZGB 1IO6A 1RUWA 2KXCA 2GBQA 2YUPA 1GCPA 2KEAA 1PRLC 1K4US 2NUZA 3H0HA 1VYUA 3H41A 4RTZA 1UG1A 2LCSA 4IIMA 1NLOC 2JM9A 1UFFA 2DMOA 2K6DA 4HVUA 2KRSA 3C0CA 1GFDA 3M0QA 2HSPA 2VKNA 2KROA 1QCFA 1HSQA 1QWFA 3VRYA 2W0ZA 1SPKA 2GGRA 2D8JA 3KFVA 1K76A 2CT3A 2A36A 2ABLA 4HVVA 3R6NA 5IHNA 2W10A 2BZ8A 2EGCA 2LMJA 2YT6A 2J05A 4J9CA 1WYXA 3I9QA 4D8DA 2DL5A 2D8HA 1E6HA 2AK5A 1CSKA 1Z9QA 5EC7A 1PNJA 1M3CA 4AFQC 5IHIA 1A0NB 5GJVB 2O9SA 2YUOA 1NM7A 3REAB 3GBQA 4OMOA 1NLPC 2C0IA 1AVZC 3TSZA 2LQNA 4JJBA 2RQUA 2E5KA 2EPDA 1E7OA 1M27C 2M51A 2O88A 1JXMA 1Z9ZA 2EW3A 2FEIA 2MOXA 2FPFA 4GBQA 1H92A 2EGEA 1RLPC 3VRZA 3EG3A 5IH2A 2V1RA 3UATA 3VS6A 1MV0B 2HEQA 4JJDA 1SHGA 4OMMA 2FRWA 2K7AA 1EFNA 3I5SA 1B3QA 2EVRA 4Y92A 1KSWA 2YSQA 2JT4A 2RMOA 2HBWA 2AZVA 1TG0A 1AEYA 3EHQA 1E6GA 1NYFA 1Y57A 1VYVA 1G83A 1I1JA 3LH5A 2DA9A 1OPKA 1AWOA 2L3PA 4X1VA 2J6OA 1FMKA 2OI3A 2EQIA 3PVLA 2DX1A 5ECAA 1GRIA 2FPEA 4A63B 1NEGA 4Z88A 2KRMA 2A08A 1X69A 2DM1A 1NG2A 3VS0A 1PRMC 4E6RA 1UJ0A 1X2KA 2D0NA 2RPNA 3EG0A 1PWTA 1YN8A 4FSSA 1YP5A 4JPBW 1AWWA 4IIOA 3SEMA 2BZXA 2PTKA 1J3TA 1FYNA 4HVWA 2VVKA 1BK2A 4ESRA 2DBKA 1ZUYA 1X6GA 3O5ZA 2VWFA 3UF4A 3QWXX 2EYWA 3A98A 2KR3A 1WXTA 3NGPA 4OMQA 1YWPA 2DL8A 4QT7A 2JS2A 1ZUUA 1OPLA 2IIMA 4HXJA 2A37A 3EG1A 4CC2A 1ZX6A 3TSWA 1SEMA 4RTTA 2KT1A 2DLPA 3VS5A 1KIKA 3UA7A 2DRKA 2KYBA 1UDLA 1T0HA 1K0SA 2HCKA 4ZNXA 1N5ZA 1OV3A 1WX6A 1JO8A 1S1NA 3NPFA 2CSQA 2RQWA 3UA6A 4DEXA 2I0NA 1X27A 1PHTA 4J9IA 4J9EA 2FG0A 2GTJA 1GBRA 3PE0A 1JQQA 2J7IA 2LJ0A 4RTYA 4AFUC 1KFZA 4RTWA 4AFSC 4Z89A 1OEBA 3JV3A 2C0OA 1ZUKA 2CUDA 2DVJA 2RN8A 4LE9A 4AG1C 2PZ1A 1UHCA 1M30A 1SSHA 3CQTA 1W70A 2AZSA 2SRCA 1WA7A 2O31A 2ED0A 1JEGA 2C0TA 1TUDA 5FW9A 2L3QA 4JZ4A 1HD3A 2X3XD 2JM8A 4Z8AA 4J9FA 2QDLA 1QKXA 1X6BA 2FPDA 2CT4A 1W6XA 2DBMA 2KNBB 1GFCA 4CC3A 4D8KA 2K3BA 1WFWA 2RQTA 2EBPA 2M0YA 2PNIA 2MIOA 2XMFA 1UE9A 1K1ZA 1MUZA 2JMAA 1X43A 3THKA 2ECZA 1RI9A 2V1QA 3EG2A 1AOJA 4AFZC 2J6FA 1XOVA 2LP5A 3VS2A 1GBQA 2HDAA 1OOTA 4CC7A 1AZEA 1K0XA 4LN2A 2DF6A 2EGAA 3NHNA 1ARKA 3M0PA 4J9GA 3RBBB 2L3SA 3M0SA 1TUCA 4F14A 1AWXA 1VA7A 1WXBA 4DEYA 1QLYA 1G2BA 2ROLA 5IHKA 2KBTA 2K2MA 4GLMA 3TVTA 1T3LA 4J9BA 4RTUA 1M3AA 2P4RA 3I35A 4RTVA 3U23A 2EYZA 1ABOA 1MV3A 4OMNA 4LNPA 1CKBA 5FWCA 2GQIA 2JXBA 2OJ2A 3EGUA 1HJDA 2JS0A 2JTEA 2JW4A 3SHWA 3H0IA 2AKLA 4OMPA 1X2QA 2J6KA 4RUGA 2DRMA 2F2XA 4LUDA 1U06A 2DILA 5IXBA 4HCKA 2RQRA 1BBZA 2BZYA 1UGVA 1H3HA 1V1CA 1SRLA 4J9DA 4R0KA 1M8MA 1YNZA 4WCIA 3VS1A 2NWMA 1WI7A 1YWOA 2RNAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D1X A;  1WXU A;  2LJ3 A;  2LJ1 A;  2O9V A;  2GTO A;  1UEC A;  2ENM A;  3PVQ A;  2K79 A;  1CKA A;  2F2W A;  3FJ5 A;  2X3W D;  1JXO A;  2DJQ A;  2DL4 A;  1U3O A;  2LZ6 B;  1AWJ A;  1ZBJ A;  2ED1 A;  1H8K A;  3H0F A;  2LQW A;  1VYT A;  1YCS B;  1I07 A;  2CSI A;  2L0A A;  1K9A A;  1T0J A;  1ZLM A;  5I11 A;  1BU1 A;  4OML A;  2K9G A;  2GNC A;  4K11 A;  2KRN A;  2LNH B;  1NYG A;  2AKK A;  1AD5 A;  2EYX A;  3M0R A;  3M0U A;  4JZ3 A;  3ZL7 C;  1LCK A;  2ROT A;  3IQL A;  4KRT A;  1GCQ C;  2O2O A;  4JJC A;  2DL3 A;  2CUB A;  2LX7 A;  3NMZ C;  2B86 A;  1UHF A;  2BTT A;  2FO0 A;  3RNJ A;  1UTI A;  1W1F A;  5FWB A;  1Y0M A;  2YUQ A;  3REB B;  1PKS A;  1JU5 C;  3ULR B;  2DE0 X;  1SHF A;  2CDT A;  2OAW A;  2SEM A;  2CRE A;  2L2P A;  4M4Z A;  5IXF A;  4F16 A;  1SRM A;  2EYY A;  1T3S A;  1I0C A;  1NEB A;  2F2V A;  2KGT A;  4J9H A;  2J06 A;  2KXD A;  2CH4 W;  4CC4 B;  4AG2 C;  4F17 A;  1PKT A;  2KE9 A;  5L23 A;  1GL5 A;  2DYB A;  4LUE A;  2EKH A;  2KT8 A;  4ORZ A;  2MCN A;  2YDL A;  1QKW A;  5HCK A;  1ABQ A;  1ZSG A;  2A28 A;  2H8H A;  3VS3 A;  3QWY A;  2G6F X;  1BB9 A;  3VS7 A;  4EIK A;  5I22 A;  1UUE A;  4RTX A;  2DL7 A;  2RQV A;  2DNU A;  2ESW A;  2KYM A;  3VS4 A;  2YUN A;  2JMC A;  2CH4 A;  1WIE A;  3I5R A;  1QWE A;  3EHR A;  1KJW A;  1WLP B;  1B07 A;  1GCQ A;  3M0T A;  1U5S A;  1UJY A;  2FRY A;  5GJW B;  2RF0 A;  1WDX A;  1RLQ C;  1M3B A;  1AZG B;  1IO6 A;  1RUW A;  2KXC A;  2GBQ A;  2YUP A;  1GCP A;  2KEA A;  1PRL C;  1K4U S;  2NUZ A;  3H0H A;  1VYU A;  3H41 A;  4RTZ A;  1UG1 A;  2LCS A;  4IIM A;  1NLO C;  2JM9 A;  1UFF A;  2DMO A;  2K6D A;  4HVU A;  2KRS A;  3C0C A;  1GFD A;  3M0Q A;  2HSP A;  2VKN A;  2KRO A;  1QCF A;  1HSQ A;  1QWF A;  3VRY A;  2W0Z A;  1SPK A;  2GGR A;  2D8J A;  3KFV A;  1K76 A;  2CT3 A;  2A36 A;  2ABL A;  4HVV A;  3R6N A;  5IHN A;  2W10 A;  2BZ8 A;  2EGC A;  2LMJ A;  2YT6 A;  2J05 A;  4J9C A;  1WYX A;  3I9Q A;  4D8D A;  2DL5 A;  2D8H A;  1E6H A;  2AK5 A;  1CSK A;  1Z9Q A;  5EC7 A;  1PNJ A;  1M3C A;  4AFQ C;  5IHI A;  1A0N B;  5GJV B;  2O9S A;  2YUO A;  1NM7 A;  3REA B;  3GBQ A;  4OMO A;  1NLP C;  2C0I A;  1AVZ C;  3TSZ A;  2LQN A;  4JJB A;  2RQU A;  2E5K A;  2EPD A;  1E7O A;  1M27 C;  2M51 A;  2O88 A;  1JXM A;  1Z9Z A;  2EW3 A;  2FEI A;  2MOX A;  2FPF A;  4GBQ A;  1H92 A;  2EGE A;  1RLP C;  3VRZ A;  3EG3 A;  5IH2 A;  2V1R A;  3UAT A;  3VS6 A;  1MV0 B;  2HEQ A;  4JJD A;  1SHG A;  4OMM A;  2FRW A;  2K7A A;  1EFN A;  3I5S A;  1B3Q A;  2EVR A;  4Y92 A;  1KSW A;  2YSQ A;  2JT4 A;  2RMO A;  2HBW A;  2AZV A;  1TG0 A;  1AEY A;  3EHQ A;  1E6G A;  1NYF A;  1Y57 A;  1VYV A;  1G83 A;  1I1J A;  3LH5 A;  2DA9 A;  1OPK A;  1AWO A;  2L3P A;  4X1V A;  2J6O A;  1FMK A;  2OI3 A;  2EQI A;  3PVL A;  2DX1 A;  5ECA A;  1GRI A;  2FPE A;  4A63 B;  1NEG A;  4Z88 A;  2KRM A;  2A08 A;  1X69 A;  2DM1 A;  1NG2 A;  3VS0 A;  1PRM C;  4E6R A;  1UJ0 A;  1X2K A;  2D0N A;  2RPN A;  3EG0 A;  1PWT A;  1YN8 A;  4FSS A;  1YP5 A;  4JPB W;  1AWW A;  4IIO A;  3SEM A;  2BZX A;  2PTK A;  1J3T A;  1FYN A;  4HVW A;  2VVK A;  1BK2 A;  4ESR A;  2DBK A;  1ZUY A;  1X6G A;  3O5Z A;  2VWF A;  3UF4 A;  3QWX X;  2EYW A;  3A98 A;  2KR3 A;  1WXT A;  3NGP A;  4OMQ A;  1YWP A;  2DL8 A;  4QT7 A;  2JS2 A;  1ZUU A;  1OPL A;  2IIM A;  4HXJ A;  2A37 A;  3EG1 A;  4CC2 A;  1ZX6 A;  3TSW A;  1SEM A;  4RTT A;  2KT1 A;  2DLP A;  3VS5 A;  1KIK A;  3UA7 A;  2DRK A;  2KYB A;  1UDL A;  1T0H A;  1K0S A;  2HCK A;  4ZNX A;  1N5Z A;  1OV3 A;  1WX6 A;  1JO8 A;  1S1N A;  3NPF A;  2CSQ A;  2RQW A;  3UA6 A;  4DEX A;  2I0N A;  1X27 A;  1PHT A;  4J9I A;  4J9E A;  2FG0 A;  2GTJ A;  1GBR A;  3PE0 A;  1JQQ A;  2J7I A;  2LJ0 A;  4RTY A;  4AFU C;  1KFZ A;  4RTW A;  4AFS C;  4Z89 A;  1OEB A;  3JV3 A;  2C0O A;  1ZUK A;  2CUD A;  2DVJ A;  2RN8 A;  4LE9 A;  4AG1 C;  2PZ1 A;  1UHC A;  1M30 A;  1SSH A;  3CQT A;  1W70 A;  2AZS A;  2SRC A;  1WA7 A;  2O31 A;  2ED0 A;  1JEG A;  2C0T A;  1TUD A;  5FW9 A;  2L3Q A;  4JZ4 A;  1HD3 A;  2X3X D;  2JM8 A;  4Z8A A;  4J9F A;  2QDL A;  1QKX A;  1X6B A;  2FPD A;  2CT4 A;  1W6X A;  2DBM A;  2KNB B;  1GFC A;  4CC3 A;  4D8K A;  2K3B A;  1WFW A;  2RQT A;  2EBP A;  2M0Y A;  2PNI A;  2MIO A;  2XMF A;  1UE9 A;  1K1Z A;  1MUZ A;  2JMA A;  1X43 A;  3THK A;  2ECZ A;  1RI9 A;  2V1Q A;  3EG2 A;  1AOJ A;  4AFZ C;  2J6F A;  1XOV A;  2LP5 A;  3VS2 A;  1GBQ A;  2HDA A;  1OOT A;  4CC7 A;  1AZE A;  1K0X A;  4LN2 A;  2DF6 A;  2EGA A;  3NHN A;  1ARK A;  3M0P A;  4J9G A;  3RBB B;  2L3S A;  3M0S A;  1TUC A;  4F14 A;  1AWX A;  1VA7 A;  1WXB A;  4DEY A;  1QLY A;  1G2B A;  2ROL A;  5IHK A;  2KBT A;  2K2M A;  4GLM A;  3TVT A;  1T3L A;  4J9B A;  4RTU A;  1M3A A;  2P4R A;  3I35 A;  4RTV A;  3U23 A;  2EYZ A;  1ABO A;  1MV3 A;  4OMN A;  4LNP A;  1CKB A;  5FWC A;  2GQI A;  2JXB A;  2OJ2 A;  3EGU A;  1HJD A;  2JS0 A;  2JTE A;  2JW4 A;  3SHW A;  3H0I A;  2AKL A;  4OMP A;  1X2Q A;  2J6K A;  4RUG A;  2DRM A;  2F2X A;  4LUD A;  1U06 A;  2DIL A;  5IXB A;  4HCK A;  2RQR A;  1BBZ A;  2BZY A;  1UGV A;  1H3H A;  1V1C A;  1SRL A;  4J9D A;  4R0K A;  1M8M A;  1YNZ A;  4WCI A;  3VS1 A;  2NWM A;  1WI7 A;  1YWO A;  2RNA A; 
#chains in the Genus database with same CATH topology
 1NZ9 A;  2RA2 A;  3X24 B;  1G8X A;  1Q81 C;  2ENM A;  3UDC A;  4M78 B;  4C0D C;  5HKC A;  4HCZ A;  3PIP A;  2DL4 A;  4C5H A;  1ZBJ A;  1VQ9 Q;  2ED1 A;  1QCN A;  3INZ A;  1IZ6 A;  2L0A A;  1YCS B;  1KHI A;  1T0J A;  4XTW A;  2GNC A;  1VQ6 Q;  3CCU T;  1AHJ B;  1AD5 A;  2RHU A;  4Z02 A;  3M0R A;  2EQU A;  3MEW A;  2OTJ Q;  2O2O A;  2DL3 A;  4LDY A;  3S3O A;  1YIJ A;  1W1F A;  2A3L A;  4KT0 E;  3AHU A;  1PKS A;  4XAX B;  3SFM A;  3CME T;  1X01 A;  1YJN A;  1BI2 A;  1RAB B;  4C92 C;  4M77 F;  1SRM A;  3L2W A;  4QW2 A;  3OYA A;  2J06 A;  2O4X A;  2OAU A;  2E6N A;  1PKT A;  2RK2 A;  2QEX Q;  2DYB A;  3SWN C;  1H3Z A;  4LUE A;  1Q82 C;  1VQL A;  5CKF A;  2KT8 A;  3RKW A;  1Q95 G;  3V8J A;  5LJ3 h;  2VGM A;  5J3B A;  4BY6 C;  1N9R A;  2VAS A;  4FU6 A;  1ZSG A;  1PSF A;  3QWY A;  3V7S A;  1Y71 A;  4WF2 A;  5LJ5 j;  1D0Z A;  1YIT A;  3VS7 A;  4A4K A;  5I22 A;  2VXE A;  4RTX A;  4DOV A;  3CMA A;  2JJ9 A;  3M57 A;  2DL7 A;  2DNU A;  1VIF A;  2JMC A;  2Y90 A;  3EH2 A;  4CRI A;  1WIE A;  1QWE A;  4II1 A;  2RI3 A;  4PKC C;  1WLP B;  1B07 A;  4A53 A;  1U5S A;  1UJY A;  2FRY A;  2RF0 A;  3CCU Q;  1AZG B;  3HKS A;  1IO6 A;  1RUW A;  4NS5 A;  1HYO A;  5GMK i;  2KEA A;  1PRL C;  4QKU A;  4J83 A;  4O5V A;  2LCS A;  4C92 F;  1I5L A;  4IIM A;  1NLO C;  1D0Y A;  1Q81 R;  2DMO A;  4E7L A;  5GAN 7;  2K6D A;  4ZGE B;  4HVU A;  3OYN A;  4QQD A;  1GFD A;  2ATC B;  2KRO A;  1VQ9 A;  3CME Q;  2F5T X;  1QWF A;  3VRY A;  3QII A;  4F7U E;  3CCS T;  1KD1 U;  2GGR A;  2D8J A;  4E2F B;  2CT3 A;  4A4F A;  1G3Y A;  4PJO E;  1VQ6 A;  1WHG A;  5IHN A;  5IT9 E;  2LMJ A;  4HKE A;  2DXT A;  3OYL A;  2D8H A;  2AK5 A;  1CSK A;  1VIE A;  4C0G A;  5IHI A;  2QAZ A;  5GJV B;  1ZA2 B;  4ZGJ B;  3GBQ A;  2H3E B;  4RKU E;  4X34 A;  2GFU A;  2Y4X A;  4JJB A;  2RQU A;  2NUT B;  3SB2 A;  3M9Q A;  4RCC A;  1E7O A;  1M27 C;  1P92 A;  4R55 A;  1JXM A;  1Z9Z A;  5DLQ E;  2LRQ A;  2MOX A;  3RER A;  1N6A A;  3QYG B;  4R56 A;  4DBQ A;  3BDL A;  2FPF A;  4GBQ A;  1RLP C;  7AT1 B;  2WSE E;  2V1R A;  1PC0 A;  3UAT A;  2QEX A;  5FU7 C;  2X4X A;  3CXC S;  2MMP A;  1Q82 R;  1SHG A;  2XK0 A;  2FL7 A;  4PJO B;  1B3Q A;  1D1A A;  1LOJ A;  4KH1 B;  3HL8 A;  2GCX A;  4M75 G;  2JT4 A;  2DTO A;  3Q1J A;  2AZV A;  3EHQ A;  1E6G A;  2K4Y A;  1MNE A;  3QPH A;  1NYF A;  3JCM Q;  2M16 A;  1VQM T;  1WZO A;  2JZ2 A;  2L3P A;  5IN1 A;  5GMK h;  1YHQ T;  1AWO A;  3HRU A;  3CCS Q;  3KBG A;  1NBE B;  2O01 E;  2OI3 A;  2EQI A;  3PVL A;  2FPE A;  3CCU A;  1NEG A;  2EJF A;  1Y96 A;  3HRT A;  4L5G A;  4VUB A;  3UPU A;  3QHS A;  2DM1 A;  4BDY A;  1KQ2 A;  1AT1 B;  4C5E A;  5LL6 S;  3OMG A;  4F04 B;  3MKD A;  1Q7Y C;  1ZSZ C;  2DAQ A;  5CQX A;  2F1L A;  4JPB W;  1AWW A;  2WSC E;  5GMK m;  1QMC A;  1G3T A;  3DKM A;  3EAE A;  4ESR A;  2MF2 A;  3E9F A;  4IUV A;  5KE2 A;  2EYW A;  3L2U A;  1WXT A;  1IGQ A;  1YWP A;  4M78 D;  4FYV B;  2JS2 A;  2V26 A;  4M78 C;  2IIM A;  1N8R R;  4X9D A;  3JB9 J;  2CKK A;  3EG1 A;  2OTL T;  1SEM A;  4KH0 B;  4UC4 A;  3VS5 A;  1KIK A;  2DRK A;  2XDP A;  1YFN A;  2HCK A;  4QVD A;  1VQO Q;  4M7D G;  1BI3 A;  2YRC A;  5A2Q E;  4DQ2 A;  1TS9 A;  2XIC A;  3NPF A;  4PFO A;  2O4X B;  1I8F A;  4DEX A;  1FMW A;  1QVG S;  4HT9 A;  4BUG A;  3HFO A;  2FG0 A;  3JCM W;  3S3M A;  3PE0 A;  1JQQ A;  1R77 A;  4RTY A;  4AFU C;  1VQM Q;  1YHQ Q;  5A0G A;  3JV3 A;  3JCM V;  1NPP A;  1ZUK A;  2CUD A;  2DVJ A;  2HL3 A;  3LW5 E;  2PZ1 A;  1UHC A;  4LD6 A;  4OVA A;  1SSH A;  3CQT A;  2LQK A;  3G6E T;  2K3Y A;  2SRC A;  3MPU B;  1ZSZ A;  1R0C B;  3RMQ A;  1WQW A;  2RJD A;  2L3Q A;  5GMK j;  3JCM X;  3MP6 A;  1Q86 C;  3UWN A;  2JM8 A;  2CZ0 B;  4Z8A A;  4J9F A;  1G3W A;  2DD5 A;  1NJI C;  2DBM A;  2P84 A;  4CC3 A;  2RQT A;  2M0Y A;  3CCS A;  4C0Z A;  2PNI A;  2MIO A;  9ATC B;  4M78 A;  5GAM g;  3CXC A;  1VQK T;  2ZCF B;  3C94 A;  1RI9 A;  3CC7 T;  2DIG A;  2QTX A;  4X9C A;  2K5F A;  2YHT A;  3VS2 A;  1M9S A;  3FJP A;  1IHV A;  3QO3 A;  1R0B G;  1OX8 A;  1K0X A;  4LN2 A;  3RIR A;  2OTL Q;  2EGA A;  4XQ3 A;  2HKQ B;  3RBB B;  2L3S A;  1TUC A;  3L2Q A;  5CQY A;  4BB7 A;  5GAN 3;  1VA7 A;  1K9M R;  4JRQ A;  1WQ7 A;  3V7C A;  3E2U A;  1G2B A;  1U1T A;  4RTU A;  4ZN3 A;  3U23 A;  1ABO A;  1MV3 A;  1CKB A;  2GQI A;  1YI2 T;  3P8B B;  2P4T A;  2JXB A;  2K57 A;  2AIR B;  2JS0 A;  2JTE A;  3SHW A;  3CBO A;  3NTK A;  1X2Q A;  2J6K A;  3VYG A;  5KCO A;  3G6E Q;  2LT4 A;  3M54 A;  1I5O B;  2RQR A;  2ZPB B;  5DLO A;  4HA8 A;  3JCM P;  1H3H A;  1M5Q 1;  1SSF A;  1QW1 A;  4IUU A;  2PU9 B;  1M8M A;  5GAN 2;  3CCM T;  3WVE B;  3CXC P;  5GAN e;  2NWM A;  4HCC A;  4F16 A;  1VQM A;  4ZN1 A;  2FZG B;  1YHQ A;  2DD4 A;  2MPX C;  1YCY A;  1WXU A;  2LJ3 A;  2LJ1 A;  1VQK Q;  1M1F A;  1VQL T;  2O9V A;  3LWH A;  2GTO A;  2CP6 A;  4RCB A;  3CC7 Q;  4IUP A;  3PVQ A;  3OS1 A;  3RUX A;  2F2W A;  2X3W D;  1JXO A;  2DJQ A;  4C8Q F;  1U3O A;  2LZ6 B;  1AWJ A;  2I2L A;  1VYT A;  2CSI A;  3A8M B;  1FX7 A;  4M75 B;  4PLL A;  1QVG A;  2D9T A;  1BU1 A;  1JJ2 P;  1WNL A;  2KQW A;  2KRN A;  1NJI R;  2EYX A;  2JUF A;  3ZL7 C;  1LCK A;  3IQL A;  1WJS A;  1TU0 B;  4PJO D;  1GCQ C;  1VQ4 T;  2CUB A;  4PJO C;  2RI2 A;  3RKX A;  2K3X A;  1UHF A;  2YLC A;  2E64 A;  2P0Q A;  1UTI A;  4XTX A;  1YI2 Q;  5FWB A;  4M7D E;  3WVD B;  2DEU A;  3REB B;  2QG9 B;  2OAW A;  3OB9 A;  3DLM A;  2L2P A;  1OU9 A;  5LJ5 f;  4JLG A;  1YIJ Q;  1KC8 C;  2OTL A;  4LDV A;  4D6W A;  2HAX A;  2ZPE B;  2BUD A;  1NEB A;  2KGT A;  3HRS A;  1GXI E;  3JB9 G;  1N9S A;  1RAH B;  3CPW S;  4AG2 C;  2RJE A;  1MMA A;  4F17 A;  4ZTF A;  1GL5 A;  4FT2 A;  2EKH A;  2QGG A;  4MZM A;  4ORZ A;  2NUT A;  2X35 A;  2YDL A;  4CI0 C;  1QKW A;  1V76 A;  2K5I A;  2DZ9 A;  3M55 A;  1QP2 A;  4M7A G;  2ZAE A;  4OB1 B;  4FCY A;  1VQL Q;  2G6F X;  2KSS A;  3G4S T;  3G6E A;  1KG1 A;  1QVG P;  2X9H A;  2GF7 A;  2RQV A;  2KYM A;  3G7Z A;  4M7D B;  2ZPI B;  4F7U A;  2BKD N;  3I5R A;  2LC4 A;  2K2V A;  1KJW A;  1GCQ A;  1YIT Q;  4PJO A;  1KQS S;  1WHH A;  5GJW B;  3CMA Q;  3CCQ T;  2LNV A;  3CCE T;  2P0P A;  4N4I A;  4NL2 A;  5GAN d;  3QZ5 B;  1VQ4 Q;  3H41 A;  4RTZ A;  1M1K C;  1LPL A;  4IKF A;  1VQK A;  1VQ8 T;  5GAO r;  2RHI A;  2JM9 A;  4PJN A;  4WTO B;  3CC7 A;  2VKN A;  4LXC A;  1TH7 A;  4IUT A;  1K73 R;  1K8A R;  1KD1 C;  4KGZ B;  5LJ3 g;  1K76 A;  4E7K A;  3R6N A;  2W10 A;  2BZ8 A;  2EGC A;  2YT6 A;  2EQK A;  4J9C A;  3QXE B;  3URG A;  1M90 R;  3PFS A;  4JDS A;  2PQW A;  2JVV A;  2O9S A;  2E12 A;  1YI2 A;  2C0I A;  1AVZ C;  2MK5 A;  2HBP A;  3NTH A;  2E5K A;  3JCM c;  1K73 U;  2EPD A;  2O88 A;  3G4S Q;  4PJM A;  5GAO m;  2KK4 A;  4B6M A;  2EFI A;  1G3S A;  1YBY A;  1H92 A;  3L1A A;  5IH2 A;  3QJ6 A;  3LLR A;  1M90 U;  5KYN A;  3VS6 A;  3M58 A;  2DXB A;  4JJD A;  4OMM A;  3CCQ Q;  3CCM A;  2K7A A;  2XKO C;  3C95 A;  4PLI A;  4Y92 A;  1KSW A;  3M4G A;  4M77 G;  1VQ8 Q;  2HBW A;  3TQ7 P;  1TG0 A;  1AEY A;  4QVC A;  2HQH A;  3ME9 A;  1Y57 A;  2CP3 A;  2E4H A;  1OPK A;  3A8O B;  3CPW A;  1WJQ A;  2J6O A;  2QAS A;  3CBP A;  1MMN A;  4AMC A;  5ECA A;  1QVF S;  2R58 A;  2ZZD A;  2AT1 B;  4Z88 A;  3VJP A;  1XTD A;  1ACM B;  2A08 A;  1U1S A;  4J6X A;  1VQ4 A;  1PRM C;  4E6R A;  1M1K R;  1RAC B;  2LX9 A;  4PL6 A;  2D0N A;  2RPN A;  3QBY A;  1F1B B;  5KYX B;  1YN8 A;  4E7I A;  4FSS A;  1YP5 A;  4IIO A;  1ZHI A;  1OYX A;  2BZX A;  2PTK A;  2XID A;  1J3T A;  3DB4 A;  1KQS A;  1RAD B;  2DBK A;  2E65 A;  3VYH B;  3UF4 A;  2M1H A;  5GAN 4;  2KR3 A;  5D6W A;  3QYH B;  2PUK B;  4M7A E;  3OYE A;  4C92 G;  2DPP B;  2A37 A;  5C0M A;  3V8L A;  3MHX A;  2B8A A;  1C1A A;  1JB0 E;  1TWB A;  4RTT A;  4M75 D;  1KK7 A;  3UA7 A;  5I2M A;  4M75 C;  4N4H A;  3EGX A;  1T0H A;  1VQN T;  4ZNX A;  4RG8 A;  1S1N A;  3JB9 H;  2HQX A;  1RAF B;  3CPW P;  2E70 A;  2CSQ A;  2RQW A;  3UA6 A;  2MWP A;  5GAN h;  1X27 A;  1Q81 U;  3G4S A;  2QK0 A;  3CCV T;  3X25 B;  4DBR A;  1MMG A;  1KFZ A;  4RTW A;  1OEB A;  2HZY A;  4BI3 A;  3P8D A;  4JRI A;  1M30 A;  1UEB A;  3MET A;  3CCQ A;  4JRK A;  3CCE A;  3BW1 A;  1MMD A;  1VQ5 T;  5LJ3 j;  4KUL A;  2E10 A;  1VQ8 A;  4F7U B;  3GNF B;  5KCH A;  1HD3 A;  2X3X D;  3PTA A;  1EZZ B;  2QDL A;  1QKX A;  2QQR A;  3L2R A;  2CT4 A;  1KQS P;  2EQM A;  5GMK l;  4GY5 A;  2KNB B;  3OBY A;  1GFC A;  4D8K A;  3OYC A;  1OUL A;  3GLX A;  2XMF A;  2CP7 A;  2LT1 A;  1MUZ A;  1X43 A;  2ECZ A;  2LDM A;  2V1Q A;  2J6F A;  4B9W A;  3HTR A;  2LP5 A;  4M75 A;  5DM7 R;  5GAN 5;  1JJ2 S;  4M7D D;  1QCO A;  4M7D C;  3NHN A;  1ARK A;  1Q82 U;  4J9G A;  2CS7 A;  1PD0 A;  3M0S A;  3BE3 A;  5GAN 6;  3OYM A;  3GP8 A;  1VQN Q;  1AWX A;  1WXB A;  2L89 A;  3S3N A;  4JUV A;  2M9U A;  1VOM A;  2PVO B;  5IHK A;  2KBT A;  5FRO A;  1QVF A;  1T3L A;  3FB9 A;  3CCV Q;  5FWC A;  3JCM e;  2OJ2 A;  4V2S A;  3CEY A;  4EMH A;  5KYW B;  4M77 E;  1M2V B;  1LNX A;  1N27 A;  1OX9 A;  1EIF A;  4XU1 A;  2MYS A;  4RUG A;  2DJZ A;  5LJ5 e;  4FIB A;  5GAN j;  4LUD A;  1BYM A;  5CK9 A;  4HCK A;  3QDR B;  1VQ5 Q;  1V29 B;  2V8I A;  1V1C A;  1SRL A;  4KUD K;  3UT1 A;  3ZFJ A;  2L5Q A;  4NL3 A;  1YNZ A;  4WCI A;  5CAI A;  4LD9 K;  1YWO A;  3JAM E;  2RNA A;  2HMA A;  2K5L A;  3CBM A;  5A0D A;  1KHC A;  2EJ9 A;  2XU8 A;  4E7S A;  4A4G A;  1UEC A;  4M7D A;  2K79 A;  3L2V A;  2QXF A;  1H8K A;  3H0F A;  4JS5 A;  2DIQ A;  1I07 A;  1N8R U;  1K9A A;  1ZLM A;  4M77 B;  5L8R E;  5AT1 B;  4OML A;  1IGU A;  4K11 A;  2LNH B;  3E1S A;  1QVF P;  5CIU A;  3X20 B;  1HK9 A;  4JZ3 A;  4MML A;  2ROT A;  2L3R A;  4C92 E;  1WHM A;  2LX7 A;  2B86 A;  3SDZ A;  2LTO A;  3RNJ A;  2R5M A;  2RHZ A;  4FYX B;  3CC4 T;  1Y0M A;  4M78 F;  1JU5 C;  3DLL A;  1RAG B;  2A0F B;  5FRN A;  4OB0 B;  4MMK A;  5IAY A;  5D6Y A;  3GIB A;  4TVR A;  2EYY A;  1I0C A;  2V8J A;  1VQN A;  2XD0 A;  2DKG A;  5GAM f;  2KAF A;  2GQV A;  2YRV A;  4L59 A;  4XU0 A;  2CZ1 B;  4J6Y A;  1Q7Y R;  2V8K A;  2YWW A;  4A54 A;  3CCV A;  3OY9 A;  2MCN A;  2NYS A;  1PM3 A;  2YXY A;  1JJ2 A;  3JCM d;  3EGX B;  2A28 A;  3TCJ A;  1WPY A;  3EG9 B;  1SKU B;  2F5K A;  4Y91 A;  4XU3 A;  5J39 A;  4PJL A;  4EIK A;  1UUE A;  2HL5 C;  5LJ5 d;  3VUZ A;  2ESW A;  3OYI A;  1WGS A;  1VQ5 A;  2YUN A;  3AT1 B;  1JBM A;  1WDX A;  1RLQ C;  1W2B S;  2KXC A;  1YJW T;  1K9M U;  1GCP A;  2ZPF B;  2NUZ A;  1K4U S;  2QDY B;  1VYU A;  2AHJ B;  2CP0 A;  4B9X A;  3CD6 T;  1UFF A;  4LDW A;  3T9N A;  1YJ9 A;  2KRS A;  1S72 A;  4OB3 B;  3M0Q A;  2HSP A;  2VXF A;  5A0L A;  2XDB A;  3OS0 A;  3JB9 D;  1KQ1 A;  4C0F A;  1D0X A;  1SPK A;  4BDZ A;  3KFV A;  5CVI A;  5KYU B;  2ABL A;  3MP8 A;  3J81 E;  3QDF A;  1WYX A;  4D8D A;  2CP5 A;  5CCA A;  2DL5 A;  1E6H A;  1Z9Q A;  1H64 1;  4J7F A;  2FHD A;  5EC7 A;  5KYX A;  1Q86 R;  1M3C A;  4AFQ C;  4YTL A;  3PIO A;  1A0N B;  4C8Q G;  2FZK B;  4KGV B;  2YUO A;  4OMO A;  1NLP C;  3A8H B;  2LQN A;  4ME7 A;  3GOX A;  5KYY B;  5AYF A;  2CZ7 B;  4EPC A;  2EW3 A;  3KUF A;  1FWZ A;  3FC3 A;  1XNI A;  4J8O A;  3JCM g;  5C6S A;  3HHT B;  5GAN 8;  2RB6 A;  2EGE A;  3EG3 A;  5M9O A;  1Q86 U;  1MV0 B;  4OMF B;  5D7U A;  2KY9 A;  1PSE A;  8ATC B;  3PT9 A;  4J6W A;  3I5S A;  1YJW Q;  1NJI U;  2DK3 A;  2EVR A;  3GNG A;  2JTM A;  5CO7 A;  1RAI B;  2RJF A;  3HP9 A;  2YSQ A;  2PVG B;  2RMO A;  3OYY A;  4PFZ A;  3I56 T;  3CD6 Q;  3CCM Q;  2R5A A;  3EFS A;  1QP3 A;  1RAE B;  1OI1 A;  1G83 A;  1I1J A;  3LX7 A;  2IG0 A;  1D3B B;  1TSF A;  3G71 T;  5FU7 B;  1FMK A;  2H3J A;  2EYQ A;  4BAC A;  2DX1 A;  4ANJ A;  1GRI A;  4A63 B;  4F7U F;  2PVD B;  4JRP A;  2LCL A;  4BD3 A;  4M7A A;  4RG2 A;  2KVQ G;  4PJO F;  2JNG A;  1NG2 A;  2QQA A;  1B34 B;  4EMK A;  2OTJ T;  1WHJ A;  1WHK A;  1Y07 A;  3EG0 A;  1TTH B;  1PWT A;  3CC4 A;  1O75 A;  3QJY A;  1PG5 B;  5HY6 A;  1UGQ B;  4FL6 A;  3RR6 A;  3SEM A;  2WAC A;  4JLI A;  5CKE A;  5FU6 B;  1FYN A;  2VVK A;  1C0M A;  5GAO l;  3G1J A;  3JCM h;  1ZUY A;  1W2B A;  1X6G A;  3OYG A;  2VWF A;  3QWX X;  3A98 A;  4E47 A;  3MEU A;  3NGP A;  4QT7 A;  5GAO q;  3CC2 T;  1DJ7 B;  4OP0 A;  8AT1 B;  5LJ5 h;  3OA6 A;  2DLP A;  4M77 D;  3OYD A;  3HFN A;  3CCJ T;  4AT1 B;  1WJR A;  2KYB A;  4M77 C;  1UDL A;  1K0S A;  1N5Z A;  3M59 A;  5LJ3 f;  3QSU A;  2BE7 D;  2Y4Y A;  3RKY A;  2MAM A;  3I56 Q;  4J9E A;  2EKO A;  5KYW A;  1XQH A;  3G71 Q;  4AFS C;  3GPL A;  1M2V A;  2M0O A;  2HQE A;  1KC8 R;  1M8V A;  4MDW A;  3OS2 A;  3SD4 A;  1K8A U;  2LCC A;  2NUP B;  2QTV A;  2QQB A;  1YJW A;  2ED0 A;  4N0A C;  2C0T A;  4XTY A;  1UGR B;  3CD6 A;  1NE8 A;  2JTF A;  2FZC B;  3CCE Q;  1X6B A;  3QUI A;  3VUB A;  3DB3 A;  1W6X A;  3A8G B;  4OGE A;  4OF1 A;  2E3I A;  1W2B P;  2K3B A;  3RDV A;  1MGQ A;  2EBP A;  2KDS A;  1K1Z A;  2JN0 A;  1KC8 U;  3OYK A;  4C8Q E;  2ZPH B;  4C92 D;  1XJW B;  3THK A;  4EMG A;  2RI5 A;  3EG2 A;  2VC8 A;  5GAN g;  3CCL T;  4LDX A;  1GBQ A;  4M77 A;  2HDA A;  3TU4 K;  3CC2 Q;  5J26 A;  1OOT A;  4CC7 A;  2DET A;  1LVK A;  2D0Q B;  4L6V 5;  5GAN f;  3M0P A;  3CCJ Q;  5I2S A;  3PMT A;  4E7J A;  1LJO A;  4BI4 A;  1TOV A;  4BE2 A;  4DEY A;  2YLB A;  4OB2 B;  1WHL A;  2ROL A;  5CKH A;  1BIB A;  2QA4 T;  2K2M A;  4GLM A;  3TVT A;  4J9B A;  1M3A A;  2HKN A;  4PFP A;  2EYZ A;  4OMN A;  3MEA A;  2DFU A;  3KXT A;  3OYB A;  4JJN K;  1KD1 R;  3H0I A;  2AKL A;  4OMP A;  4N0A A;  4XTU A;  5KH6 A;  1HXD A;  5DY9 A;  4C8Q B;  2F2X A;  1QQJ A;  3JCM J;  2XHC A;  3QKJ A;  4ZTJ A;  3LH0 A;  5IXB A;  3BY7 A;  3M5A A;  1BBZ A;  2D6F A;  1UGV A;  1M1K U;  3QG1 A;  2A7Y A;  4KBM B;  2RK1 A;  5GAM e;  3RES A;  3I56 A;  4R0K A;  4XU2 A;  2EIF A;  1WI7 A;  4C92 A;  4C5G A;  1I81 A;  3G71 A;  2QGF B;  3O8V A;  2D1X A;  4C5I A;  2KMT A;  3EG9 A;  2X4Y A;  3R6O A;  4A4E A;  1M4Z A;  1CKA A;  3SWN A;  3FJ5 A;  3CCL Q;  3X26 B;  3EH1 A;  2LQW A;  3HPW A;  3C4S A;  2OTJ A;  1B7T A;  1N8R C;  3ZBD A;  5I11 A;  2E3H A;  2K9G A;  1NYG A;  3OS5 A;  2AKK A;  4KGX B;  3M0U A;  3NTI A;  4KRT A;  3OYF A;  4M7A B;  4JJC A;  3EFO B;  2QA4 Q;  3NMZ C;  2LQ8 A;  4EMK B;  2BTT A;  2FO0 A;  2EAY A;  3VKI A;  1IRX A;  3EGD B;  1IRE B;  2YUQ A;  4MZT A;  3ULR B;  5CR2 A;  3F70 A;  2DE0 X;  4ZGD B;  1SHF A;  3BDU A;  3CC2 A;  2CDT A;  2FYK A;  2SEM A;  1BCM A;  2CRE A;  5KYU A;  1MND A;  1M2O A;  2Z0W A;  4M4Z A;  2JOY A;  3FRN A;  4M75 F;  1RI0 A;  2GFA A;  5IXF A;  1YJ9 T;  3J7A F;  3A8L B;  3CCJ A;  3H9N A;  3OW2 S;  1T3S A;  2F2V A;  1VQP T;  1S72 T;  4J9H A;  3E19 A;  3S6W A;  2KXD A;  2CH4 W;  3ASK A;  4CC4 B;  4FSX A;  1VQO T;  5FRM A;  2KE9 A;  3OMC A;  1BCO A;  5L23 A;  3BFM A;  2QYZ A;  4LDU A;  1D09 B;  1IB8 A;  2DTH A;  5KYY A;  5HCK A;  4FT4 A;  1ABQ A;  1MHN A;  2H8H A;  3VS3 A;  1FMV A;  3TEE A;  2VV5 A;  1BB9 A;  2KI7 A;  5FU6 C;  3EFR A;  4DBH A;  3MJX A;  4FYW B;  3VS4 A;  3M56 A;  3PNW C;  2CH4 A;  4PNO A;  2C06 A;  3EHR A;  3M0T A;  1EX4 A;  2R57 A;  3JCM b;  1BI1 A;  5GAM d;  2LVM A;  1M3B A;  4HCB A;  4N4G A;  2MWO A;  2VUB A;  2GBQ A;  2YUP A;  1K9M C;  3H0H A;  2BIV A;  3CME A;  1D1B A;  1UG1 A;  2E6Z A;  1D3B A;  2EJG A;  3C0C A;  2RH2 A;  3CCL A;  1X6O A;  1QCF A;  2XI9 A;  1HSQ A;  2PUO B;  2XDD A;  5GAO p;  1NPR A;  4M7D F;  2W0Z A;  4MZP A;  3RMS A;  4ELY C;  3MO8 A;  1YJ9 Q;  2VYT A;  2A36 A;  4BE0 A;  4HT8 A;  4HVV A;  1S72 Q;  1VQP Q;  3I55 T;  3X28 B;  1B34 A;  2J05 A;  3I9Q A;  2E1H A;  2ZGW A;  3QZ9 B;  3FLG A;  4OGC A;  4FYY B;  1D1C A;  1PNJ A;  1SF9 A;  2QA4 A;  1VQ7 T;  4EDU A;  3NFC A;  1O9S A;  1X75 C;  1JRI A;  3MP1 A;  1NM7 A;  3REA B;  5GAO n;  3JB9 I;  2DEQ A;  3TSZ A;  3D7S B;  3J80 E;  4ELZ C;  2VGN A;  2RHX A;  4C0D B;  3WXM B;  2DZC A;  3CCR T;  2M51 A;  4JS4 A;  2G3R A;  2FEI A;  2RHY A;  2DTI A;  2FVU A;  5FLX E;  4FW2 A;  3VRZ A;  1ZQ1 A;  4DOW A;  2FB7 A;  4XTZ A;  2HEQ A;  3L2Z A;  2CGH A;  2FRW A;  3LGL A;  4M78 G;  2IVW A;  1EFN A;  3PMI A;  2COZ A;  1RAA B;  4P5N A;  4XK8 E;  5D6X A;  2YRD A;  5CKD A;  3ER0 A;  5EG2 A;  5LJ3 e;  1Y7X A;  2DXU A;  5I21 A;  3OW2 A;  4O6J A;  1VYV A;  3LH5 A;  2DA9 A;  1UGS B;  4XTV A;  4C92 B;  4X1V A;  4J7I A;  1BI0 A;  4RMO A;  2NUP A;  3MEV A;  2RD1 A;  3I55 Q;  2KRM A;  3H8Z A;  4C8Q D;  1X69 A;  3SWN B;  2COW A;  4C8Q C;  2HSE B;  3VS0 A;  2BE9 B;  1UJ0 A;  3L42 A;  1VQ7 Q;  4Y28 E;  1BIA A;  1X2K A;  1Q7Y U;  1M1G A;  2E5Q A;  4DA4 A;  4BY6 B;  3OSV A;  2DER A;  3LGF A;  1IXD A;  3OYJ A;  4IUR A;  4M75 E;  1PD1 A;  1OZ3 A;  4QVZ A;  3CCR Q;  4HVW A;  1YIJ T;  2COY A;  1BK2 A;  1C6V X;  3CC4 Q;  3O5Z A;  1VQP A;  2RM4 A;  2VB6 A;  4FW1 A;  4OMQ A;  2DL8 A;  1VQO A;  1ZUU A;  1OPL A;  2QQ9 A;  2X51 A;  4HXJ A;  4PK4 A;  1YJN T;  4QQ6 A;  4CC2 A;  1ZX6 A;  3TSW A;  3VU3 C;  2KT1 A;  3HSB A;  2CP2 A;  2RJC A;  5HK0 A;  3V8K A;  1UGP B;  3OYH A;  1OV3 A;  1ZA1 B;  1WX6 A;  3VV0 A;  3OW2 P;  1JO8 A;  5GAM h;  3H6Z A;  2L8D A;  2WSF E;  4M7A D;  4FM4 B;  2I0N A;  4J5Y A;  1SG5 A;  1PHT A;  2P0K A;  4J9I A;  4M7A C;  3TRE A;  2QQS A;  2GTJ A;  1GBR A;  2M02 A;  2CYZ B;  2J7I A;  2LJ0 A;  4EMK C;  3FEO A;  1W4S A;  4Z89 A;  1G5V A;  4BI8 B;  2C0O A;  5KE3 A;  6AT1 B;  4AG1 C;  2RN8 A;  4LE9 A;  4ATO A;  4C8Q A;  1K73 C;  3LWI A;  2CZ6 B;  1K8A C;  1OZ2 A;  2DO3 A;  3M4Y A;  1YIT T;  2XG8 D;  3OBW A;  1W70 A;  2AZS A;  3CMA T;  1OU8 A;  1WA7 A;  2O31 A;  4MDX A;  1JEG A;  3ZEH A;  1Y96 B;  2DYI A;  2QI2 A;  2EWN A;  1TUD A;  3PGG A;  5FW9 A;  1M90 C;  4JZ4 A;  1VUB A;  1BKB A;  3E9G A;  2RO0 A;  5LJ3 d;  2MI6 A;  3JCM f;  4DBF A;  5LJ5 g;  3A1P A;  2FPD A;  2E41 A;  3M53 A;  2X4W A;  3OSS C;  2X4J A;  1PCX A;  1WFW A;  4GLK A;  3JB9 F;  4E7Z A;  4BE1 A;  1UE9 A;  5GMK e;  2JMA A;  4KUI A;  3FDR A;  3LYI A;  1AOJ A;  4AFZ C;  3I55 A;  3JSC A;  1XOV A;  1VQ9 T;  2DXC A;  5CKB A;  2EQJ A;  2NLU A;  1YJN Q;  1AZE A;  1VQ7 A;  2DF6 A;  4M7A F;  3MCA B;  2HD0 A;  1VQ6 T;  4F14 A;  3EFO A;  2ZPG B;  1OQK A;  4PJJ A;  1QLY A;  3JRZ A;  1IHW A;  3N5B B;  3EGD A;  3CCR A;  4F7U G;  3A5Z B;  2IPO B;  2P4R A;  3I35 A;  4M78 E;  1RL2 A;  4RTV A;  5HK3 A;  4Q5W A;  4E7H A;  4LNP A;  4PJO G;  1UB4 A;  2OX7 A;  1ZBX A;  3EGU A;  1HJD A;  4NOY A;  2DVE A;  3P8H A;  2HNI A;  2JW4 A;  1FXX A;  5GAM j;  1R8O B;  3C12 A;  1TXQ A;  4IUQ A;  3V7R A;  2DRM A;  1U06 A;  2DIL A;  3GF5 A;  2F69 A;  4A4H A;  1TUG B;  2BZY A;  1ZSZ B;  3CPF A;  2QEX T;  4J9D A;  1U8R A;  3FIF A;  1I4K 1;  3OQ5 A;  1QVP A;  4QQG A;  3VS1 A; 
#chains in the Genus database with same CATH homology
 2D1X A;  1WXU A;  2LJ3 A;  2LJ1 A;  2O9V A;  2GTO A;  1UEC A;  2ENM A;  3PVQ A;  2K79 A;  1CKA A;  2F2W A;  3FJ5 A;  2X3W D;  1JXO A;  2DJQ A;  2DL4 A;  1U3O A;  2LZ6 B;  1AWJ A;  1ZBJ A;  2ED1 A;  1H8K A;  3H0F A;  2LQW A;  1VYT A;  1YCS B;  1I07 A;  2CSI A;  2L0A A;  1K9A A;  1T0J A;  1ZLM A;  5I11 A;  1BU1 A;  4OML A;  2K9G A;  2GNC A;  4K11 A;  2KRN A;  2LNH B;  1NYG A;  2AKK A;  1AD5 A;  2EYX A;  3M0R A;  3M0U A;  4JZ3 A;  3ZL7 C;  1LCK A;  2ROT A;  3IQL A;  4KRT A;  1GCQ C;  2O2O A;  4JJC A;  2DL3 A;  2CUB A;  2LX7 A;  3NMZ C;  2B86 A;  1UHF A;  2BTT A;  2FO0 A;  3RNJ A;  1UTI A;  1W1F A;  5FWB A;  1Y0M A;  2YUQ A;  3REB B;  1PKS A;  1JU5 C;  3ULR B;  2DE0 X;  1SHF A;  2CDT A;  2OAW A;  2SEM A;  2CRE A;  2L2P A;  4M4Z A;  5IXF A;  4F16 A;  1SRM A;  2EYY A;  1T3S A;  1I0C A;  1NEB A;  2F2V A;  2KGT A;  4J9H A;  2J06 A;  2KXD A;  2CH4 W;  4CC4 B;  4AG2 C;  4F17 A;  1PKT A;  2KE9 A;  5L23 A;  1GL5 A;  2DYB A;  4LUE A;  2EKH A;  2KT8 A;  4ORZ A;  2MCN A;  2YDL A;  1QKW A;  5HCK A;  1ABQ A;  1ZSG A;  2A28 A;  2H8H A;  3VS3 A;  3QWY A;  2G6F X;  1BB9 A;  3VS7 A;  4EIK A;  5I22 A;  1UUE A;  4RTX A;  2DL7 A;  2RQV A;  2DNU A;  2ESW A;  2KYM A;  3VS4 A;  2YUN A;  2JMC A;  2CH4 A;  1WIE A;  3I5R A;  1QWE A;  3EHR A;  1KJW A;  1WLP B;  1B07 A;  1GCQ A;  3M0T A;  1U5S A;  1UJY A;  2FRY A;  5GJW B;  2RF0 A;  1WDX A;  1RLQ C;  1M3B A;  1AZG B;  1IO6 A;  1RUW A;  2KXC A;  2GBQ A;  2YUP A;  1GCP A;  2KEA A;  1PRL C;  1K4U S;  2NUZ A;  3H0H A;  1VYU A;  3H41 A;  4RTZ A;  1UG1 A;  2LCS A;  4IIM A;  1NLO C;  2JM9 A;  1UFF A;  2DMO A;  2K6D A;  4HVU A;  2KRS A;  3C0C A;  1GFD A;  3M0Q A;  2HSP A;  2VKN A;  2KRO A;  1QCF A;  1HSQ A;  1QWF A;  3VRY A;  2W0Z A;  1SPK A;  2GGR A;  2D8J A;  3KFV A;  1K76 A;  2CT3 A;  2A36 A;  2ABL A;  4HVV A;  3R6N A;  5IHN A;  2W10 A;  2BZ8 A;  2EGC A;  2LMJ A;  2YT6 A;  2J05 A;  4J9C A;  1WYX A;  3I9Q A;  4D8D A;  2DL5 A;  2D8H A;  1E6H A;  2AK5 A;  1CSK A;  1Z9Q A;  5EC7 A;  1PNJ A;  1M3C A;  4AFQ C;  5IHI A;  1A0N B;  5GJV B;  2O9S A;  2YUO A;  1NM7 A;  3REA B;  3GBQ A;  4OMO A;  1NLP C;  2C0I A;  1AVZ C;  3TSZ A;  2LQN A;  4JJB A;  2RQU A;  2E5K A;  2EPD A;  1E7O A;  1M27 C;  2M51 A;  2O88 A;  1JXM A;  1Z9Z A;  2EW3 A;  2FEI A;  2MOX A;  2FPF A;  4GBQ A;  1H92 A;  2EGE A;  1RLP C;  3VRZ A;  3EG3 A;  5IH2 A;  2V1R A;  3UAT A;  3VS6 A;  1MV0 B;  2HEQ A;  4JJD A;  1SHG A;  4OMM A;  2FRW A;  2K7A A;  1EFN A;  3I5S A;  1B3Q A;  2EVR A;  4Y92 A;  1KSW A;  2YSQ A;  2JT4 A;  2RMO A;  2HBW A;  2AZV A;  1TG0 A;  1AEY A;  3EHQ A;  1E6G A;  1NYF A;  1Y57 A;  1VYV A;  1G83 A;  1I1J A;  3LH5 A;  2DA9 A;  1OPK A;  1AWO A;  2L3P A;  4X1V A;  2J6O A;  1FMK A;  2OI3 A;  2EQI A;  3PVL A;  2DX1 A;  5ECA A;  1GRI A;  2FPE A;  4A63 B;  1NEG A;  4Z88 A;  2KRM A;  2A08 A;  1X69 A;  2DM1 A;  1NG2 A;  3VS0 A;  1PRM C;  4E6R A;  1UJ0 A;  1X2K A;  2D0N A;  2RPN A;  3EG0 A;  1PWT A;  1YN8 A;  4FSS A;  1YP5 A;  4JPB W;  1AWW A;  4IIO A;  3SEM A;  2BZX A;  2PTK A;  1J3T A;  1FYN A;  4HVW A;  2VVK A;  1BK2 A;  4ESR A;  2DBK A;  1ZUY A;  1X6G A;  3O5Z A;  2VWF A;  3UF4 A;  3QWX X;  2EYW A;  3A98 A;  2KR3 A;  1WXT A;  3NGP A;  4OMQ A;  1YWP A;  2DL8 A;  4QT7 A;  2JS2 A;  1ZUU A;  1OPL A;  2IIM A;  4HXJ A;  2A37 A;  3EG1 A;  4CC2 A;  1ZX6 A;  3TSW A;  1SEM A;  4RTT A;  2KT1 A;  2DLP A;  3VS5 A;  1KIK A;  3UA7 A;  2DRK A;  2KYB A;  1UDL A;  1T0H A;  1K0S A;  2HCK A;  4ZNX A;  1N5Z A;  1OV3 A;  1WX6 A;  1JO8 A;  1S1N A;  3NPF A;  2CSQ A;  2RQW A;  3UA6 A;  4DEX A;  2I0N A;  1X27 A;  1PHT A;  4J9I A;  4J9E A;  2FG0 A;  2GTJ A;  1GBR A;  3PE0 A;  1JQQ A;  2J7I A;  2LJ0 A;  4RTY A;  4AFU C;  1KFZ A;  4RTW A;  4AFS C;  4Z89 A;  1OEB A;  3JV3 A;  2C0O A;  1ZUK A;  2CUD A;  2DVJ A;  2RN8 A;  4LE9 A;  4AG1 C;  2PZ1 A;  1UHC A;  1M30 A;  1SSH A;  3CQT A;  1W70 A;  2AZS A;  2SRC A;  1WA7 A;  2O31 A;  2ED0 A;  1JEG A;  2C0T A;  1TUD A;  5FW9 A;  2L3Q A;  4JZ4 A;  1HD3 A;  2X3X D;  2JM8 A;  4Z8A A;  4J9F A;  2QDL A;  1QKX A;  1X6B A;  2FPD A;  2CT4 A;  1W6X A;  2DBM A;  2KNB B;  1GFC A;  4CC3 A;  4D8K A;  2K3B A;  1WFW A;  2RQT A;  2EBP A;  2M0Y A;  2PNI A;  2MIO A;  2XMF A;  1UE9 A;  1K1Z A;  1MUZ A;  2JMA A;  1X43 A;  3THK A;  2ECZ A;  1RI9 A;  2V1Q A;  3EG2 A;  1AOJ A;  4AFZ C;  2J6F A;  1XOV A;  2LP5 A;  3VS2 A;  1GBQ A;  2HDA A;  1OOT A;  4CC7 A;  1AZE A;  1K0X A;  4LN2 A;  2DF6 A;  2EGA A;  3NHN A;  1ARK A;  3M0P A;  4J9G A;  3RBB B;  2L3S A;  3M0S A;  1TUC A;  4F14 A;  1AWX A;  1VA7 A;  1WXB A;  4DEY A;  1QLY A;  1G2B A;  2ROL A;  5IHK A;  2KBT A;  2K2M A;  4GLM A;  3TVT A;  1T3L A;  4J9B A;  4RTU A;  1M3A A;  2P4R A;  3I35 A;  4RTV A;  3U23 A;  2EYZ A;  1ABO A;  1MV3 A;  4OMN A;  4LNP A;  1CKB A;  5FWC A;  2GQI A;  2JXB A;  2OJ2 A;  3EGU A;  1HJD A;  2JS0 A;  2JTE A;  2JW4 A;  3SHW A;  3H0I A;  2AKL A;  4OMP A;  1X2Q A;  2J6K A;  4RUG A;  2DRM A;  2F2X A;  4LUD A;  1U06 A;  2DIL A;  5IXB A;  4HCK A;  2RQR A;  1BBZ A;  2BZY A;  1UGV A;  1H3H A;  1V1C A;  1SRL A;  4J9D A;  4R0K A;  1M8M A;  1YNZ A;  4WCI A;  3VS1 A;  2NWM A;  1WI7 A;  1YWO A;  2RNA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...