2O88A

Crystal structure of the n114a mutant of abl-sh3 domain complexed with a designed high-affinity peptide ligand: implications for sh3-ligand interactions
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
58
structure length
58
Chain Sequence
NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSAYITPVNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystallization by capillary counter-diffusion and structure determination of the N114A mutant of the SH3 domain of Abl tyrosine kinase complexed with a high-affinity peptide ligand.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
total genus 12
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2006-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2o88A00
2IIMA 1GCQA 1I1JA 5EC7A 3VS0A 1AVZC 1W70A 2LZ6B 2LNHB 2EGCA 1E7OA 3TSWA 2DILA 1FMKA 2DL4A 2KRNA 4OMNA 1KIKA 3VS2A 3M0SA 1K9AA 4Z89A 1ARKA 2JTEA 4J9GA 1Z9ZA 2EKHA 1X2QA 1XOVA 1ZSGA 3M0UA 1WX6A 4J9IA 2P4RA 2CREA 2JMAA 1RI9A 2SRCA 3CQTA 2DX1A 2GTJA 1HSQA 4AFUC 2FG0A 1A0NB 3H41A 1QKXA 2ED0A 4CC3A 1ABOA 1X6BA 1ZUUA 1YCSB 2EW3A 2A37A 1GBRA 1I0CA 1NLPC 3PVLA 3IQLA 2M51A 4Z88A 4F16A 2HSPA 4DEXA 1WLPB 2O2OA 3ZL7C 2DLPA 4RTUA 1AWWA 3I9QA 2GTOA 1BK2A 1NG2A 3UA7A 3H0FA 1IO6A 1JXOA 2PNIA 3I5SA 4A63B 1X27A 2RF0A 2MIOA 4OMLA 2AZVA 5I22A 2K2MA 2HBWA 4ORZA 2KE9A 2O9SA 3R6NA 2KT1A 2RQVA 2DL8A 1ABQA 3EG2A 2CT3A 3VS3A 2FEIA 1E6HA 1UGVA 1X43A 2EGEA 1AD5A 1CSKA 1ZUKA 4CC4B 1WDXA 1K76A 4RTTA 1M27C 1SRLA 1T0JA 2ABLA 2RQRA 1MV0B 2CUDA 3LH5A 1T3LA 4AFZC 2O31A 1H8KA 3FJ5A 4FSSA 4D8KA 2KYMA 2O9VA 2KGTA 1ZBJA 4F17A 1RUWA 1G83A 4EIKA 4RTWA 2K9GA 2J6FA 2PTKA 2ESWA 1VA7A 1JQQA 2MCNA 1PWTA 2LJ0A 2YSQA 4J9FA 4JJBA 2JS0A 2D8JA 3I5RA 4J9EA 1U3OA 1I07A 4GLMA 3QWYA 1GRIA 2LQNA 1B3QA 1OPKA 1WIEA 2BTTA 2FPDA 3ULRB 4OMPA 1YWOA 4CC7A 2EYYA 3VS6A 2JS2A 2W10A 1WYXA 1K1ZA 2D8HA 2MOXA 3U23A 4RTVA 2DF6A 3SHWA 1S1NA 1Z9QA 2GNCA 4M4ZA 1ZX6A 2KXDA 2D1XA 1AOJA 2J05A 2EVRA 1GL5A 2KRSA 1QLYA 4IIOA 3TSZA 2C0TA 2ENMA 2RQWA 2HEQA 1N5ZA 2LMJA 1PRMC 1UE9A 1UJYA 1X69A 2FRYA 1UG1A 4JZ3A 4OMOA 2C0OA 5GJWB 1OPLA 2A08A 4CC2A 2YUQA 3NHNA 2DL3A 3UF4A 4ZNXA 1AEYA 1SHFA 2EBPA 2KROA 4LUEA 2KXCA 2DRKA 2E5KA 1UHCA 1WXUA 1VYVA 2FRWA 4JZ4A 4KRTA 1UJ0A 4LNPA 4AG2C 4HCKA 3EHRA 2GBQA 1UHFA 2L2PA 1X2KA 1J3TA 1BB9A 2NWMA 2K3BA 1GFDA 1BBZA 3GBQA 1MV3A 1TG0A 5IXBA 1EFNA 3M0RA 1SRMA 3VS7A 1W1FA 2EYWA 2JMCA 3REBB 2GQIA 3REAB 2K7AA 2BZXA 5FWBA 4OMQA 1WXTA 2DBKA 4D8DA 1YP5A 2NUZA 1JU5C 1PNJA 2DBMA 5IHIA 1NEBA 1H92A 4WCIA 5IHKA 4J9DA 1BU1A 2DL7A 4Y92A 3RBBB 4HVUA 3UA6A 2X3XD 3SEMA 3NPFA 1AWOA 2M0YA 2FPFA 1GFCA 1RLQC 4LN2A 2BZ8A 3H0HA 3VS5A 3A98A 2JT4A 4GBQA 2DE0X 1YWPA 2F2WA 1UDLA 1YNZA 1U06A 1WA7A 1QKWA 1X6GA 2DRMA 4JJCA 2O88A 2EGAA 2LJ3A 1TUCA 3KFVA 3QWXX 1ZUYA 1AZEA 2DM1A 2RMOA 2CSQA 4JPBW 1QWEA 4X1VA 1NM7A 2KEAA 1KJWA 3M0PA 1HD3A 2EQIA 4HXJA 5GJVB 4J9CA 1NYFA 2DMOA 1Y0MA 1JXMA 2J6KA 5HCKA 3I35A 2LJ1A 2J7IA 1SEMA 2BZYA 2HDAA 5ECAA 1E6GA 2G6FX 1CKBA 1PKSA 2FPEA 2CDTA 2J06A 1PHTA 1PRLC 4K11A 1K0SA 1V1CA 1K4US 2ROTA 5IHNA 1NEGA 2RQTA 1OOTA 1LCKA 4AG1C 2QDLA 3C0CA 2EPDA 3EHQA 3PE0A 2KR3A 1WFWA 2LP5A 2V1RA 5IXFA 2AK5A 4RTXA 4HVVA 3NGPA 2DNUA 2CSIA 2JW4A 2SEMA 1MUZA 2DL5A 1H3HA 1KSWA 2FO0A 2CH4A 1RLPC 3RNJA 2K79A 3EGUA 2F2XA 2AKKA 2YUNA 1FYNA 2L3SA 5I11A 3UATA 1UECA 5FWCA 1G2BA 2LQWA 3EG0A 1OV3A 3VS4A 4LUDA 3VRYA 1QCFA 2L0AA 1T0HA 2K6DA 1B07A 3VRZA 2D0NA 3M0TA 2VKNA 2EYZA 2I0NA 1KFZA 1CKAA 1OEBA 2KBTA 1GCQC 2GGRA 2YDLA 4RTYA 5L23A 1NLOC 2HCKA 3EG3A 2B86A 2H8HA 3M0QA 1UFFA 1M3AA 4HVWA 4JJDA 2RN8A 4AFSC 1PKTA 4E6RA 1ZLMA 1NYGA 2YUOA 1TUDA 2OJ2A 4R0KA 2CH4W 1SSHA 1VYTA 1JEGA 2XMFA 2YT6A 2LX7A 2OI3A 2AKLA 4RTZA 2YUPA 3PVQA 2KT8A 1GCPA 2W0ZA 1GBQA 2ROLA 3NMZC 1M30A 2EYXA 1VYUA 4Z8AA 4J9BA 1AZGB 2DA9A 2DJQA 1QWFA 2CUBA 2CT4A 4ESRA 2DYBA 4J9HA 4AFQC 1WXBA 3EG1A 4RUGA 1M8MA 3JV3A 1T3SA 2RNAA 2PZ1A 1JO8A 4IIMA 2RQUA 2L3PA 1WI7A 2A36A 2F2VA 1YN8A 1UTIA 4LE9A 1SPKA 2V1QA 2KNBB 2ECZA 3O5ZA 1SHGA 2ED1A 4QT7A 2DVJA 1UUEA 1AWXA 2LCSA 4F14A 2KYBA 1AWJA 4OMMA 3TVTA 2AZSA 1HJDA 2JXBA 2A28A 2JM8A 1W6XA 1U5SA 2RPNA 2C0IA 1K0XA 3THKA 2JM9A 3H0IA 5FW9A 2VVKA 2OAWA 2L3QA 5IH2A 1M3BA 4DEYA 1Y57A 1M3CA 3VS1A 2X3WD 2VWFA 2J6OA 2KRMA
chains in the Genus database with same CATH superfamily
1I1JA 4M77G 1EX4A 2X51A 1MNEA 5CKFA 1W70A 1Q82U 3EG9B 1RADB 2RO0A 5GAMd 3CCRA 2LDMA 1FMKA 3JCMQ 2E5QA 4BD3A 3SB2A 4OMNA 2OTJA 5GAMh 3VS2A 3JCMJ 1K9AA 2Y90A 2JTEA 2QAZA 2XIDA 4J9GA 4M7AD 4GLKA 2F5KA 4ZGEB 1WX6A 4MZTA 3E9GA 2CREA 2L8DA 5LJ3d 3CCLT 2JMAA 2SRCA 2IPOB 5GAOq 4KT0E 2L5QA 4F04B 1WHGA 1A0NB 4BI3A 1BI1A 3PNWC 2ED0A 3DLLA 3G1JA 1H641 2R5MA 1ABOA 5HKCA 2QI2A 3T9NA 1KC8C 2A37A 1GBRA 1Q82C 3VYGA 1I0CA 5I21A 1W2BP 5GANg 3PVLA 3L2VA 3IQLA 4Z88A 2LNVA 2O4XB 4MZPA 3PTAA 1XJWB 1IXDA 3J81E 4RTUA 2EIFA 1AWWA 1TH7A 4WTOB 4JRIA 3TQ7P 3CMEA 3I9QA 3UA7A 1R0CB 3P8DA 3RUXA 2MIOA 1SKUB 2AZVA 5I22A 2HBWA 2KE9A 4C8QD 1YIJA 2DL8A 1ABQA 2V8IA 1E6HA 2E41A 1UGVA 1X43A 1ZSZB 4M78G 1CSKA 4BI4A 1M90C 2FZCB 4M77E 1K76A 2KMTA 4RTTA 4YTLA 1YFNA 1T0JA 2CUDA 1RAGB 3LH5A 1Q7YC 2O31A 1BCMA 2O9VA 2EJFA 1IZ6A 2P0PA 4F17A 4R55A 3CPWP 4EIKA 5LJ5h 4C0ZA 1YI2T 2J6FA 3ME9A 2RHZA 2A7YA 4JJBA 3CMEQ 4IUTA 4RG8A 4F7UE 1RAEB 1I07A 4GLMA 2MYSA 2PU9B 3EH1A 1NJIR 5C6SA 3VS6A 3PMTA 4UC4A 2MOXA 3U23A 3MPUB 4M77B 4RTVA 5KYUA 2FYKA 2DF6A 4C8QF 2GNCA 4EMKC 1TS9A 5KCOA 4RCBA 5IAYA 1AOJA 4N4HA 1X01A 2EVRA 2KRSA 3QZ9B 1QLYA 2X4JA 3RDVA 3TSZA 2EYQA 4JS4A 4BUGA 2LMJA 4XTXA 1U1SA 1Q86C 1UG1A 4JZ3A 2RHYA 4OMOA 1QVFP 2ATCB 1VQ5Q 1G3TA 3RKYA 4CC2A 1VQ5T 3UF4A 3SWNB 4OVAA 1AEYA 2VYTA 2LCCA 4C92D 2E6NA 5D6YA 3WXMB 3LWIA 2RJDA 4L59A 3CC7A 4XTYA 4JZ4A 1VYVA 4BE1A 4A4EA 1M1GA 1KC8R 3BY7A 1M5Q1 2X35A 4HCKA 1WHKA 1J3TA 1G5VA 1B34B 2NWMA 1TG0A 1EFNA 4C92B 1UGQB 4PJOE 2RHUA 4M77F 2F1LA 3HKSA 2EYWA 3G71T 2CKKA 3CC4A 4M75G 5D7UA 4OMQA 1QCNA 1YP5A 5GMKm 5LJ5g 3OS2A 5D6XA 4OB3B 5IHIA 3G4ST 1H92A 4OB1B 6AT1B 1BU1A 2HQEA 3JB9F 4M78B 2X3XD 1UB4A 1PD1A 2FPFA 1GFCA 1YHQQ 4LN2A 2DXCA 9ATCB 4JRQA 4VUBA 2G3RA 1OU9A 1UDLA 3FC3A 2BUDA 1X6GA 3CMAA 2AIRB 4J5YA 2EGAA 1VQPT 1YIJT 1RI0A 1M1KU 4KULA 1YHQA 3X28B 1AZEA 2DM1A 3HRTA 4JPBW 2HKQB 4HKEA 1QWEA 1D0ZA 3QBYA 1KJWA 3M0PA 3VKIA 4E2FB 1LVKA 3GOXA 1UGPB 2DMOA 1JXMA 4ANJA 1VQ4Q 3MEUA 2J7IA 4R56A 2HDAA 2CZ0B 2G6FX 3VUZA 1WHHA 1CKBA 2LT1A 1PKSA 2CDTA 2J06A 1PRLC 2LQ8A 4K11A 3VV0A 4FYWB 1JJ2S 1NEGA 2DVEA 1LCKA 4M78F 2LX9A 3EHQA 2KR3A 1WFWA 4RTXA 1K8AU 2RJCA 5FRNA 3OS1A 5CVIA 3A8LB 2SEMA 1QVFA 2WSEE 2CH4A 3SWNC 3G71A 3EGDA 2K79A 2F2XA 2AKKA 2L3SA 1G3WA 1N27A 4JLIA 1M2VA 3VRYA 3C12A 3OSVA 4LD9K 3JCMP 1YCYA 2I0NA 1WHMA 2LCLA 5KYUB 5KYYA 3QJYA 2DD5A 1H3ZA 1KQ2A 2B86A 4BDZA 1OZ3A 1N8RR 4HVWA 2FL7A 2RN8A 5EG2A 1OX9A 1V76A 3F70A 1F1BB 5KE3A 1YJ9T 5GAMe 2YUOA 2PUKB 4R0KA 4QVDA 4PLLA 1PSFA 3OY9A 1ZA1B 2XMFA 3S6WA 1KHCA 4GY5A 5FROA 1Q81U 4FCYA 2HL5C 1GCPA 2MPXC 2CP5A 2W0ZA 3OYNA 1GBQA 4LDVA 1M8VA 2WSCE 4Z8AA 2E3IA 4FL6A 2DJQA 4PK4A 2QTVA 2XI9A 1Y71A 4AFQC 4RUGA 2QQSA 1Q95G 5FRMA 1M8MA 2VUBA 5FU7B 1NBEB 4B6MA 1JO8A 2D9TA 3M54A 3PT9A 3JRZA 1FWZA 5A2QE 4BDYA 3MCAB 2HZYA 2V1QA 3BW1A 1IB8A 2KAFA 4DBQA 4QT7A 1I5LA 2R58A 4M78C 5L8RE 2LCSA 1RAHB 4F14A 1IRXA 1WJRA 1AWJA 3M4GA 4V2SA 4M7DB 4C8QC 4RCCA 1HJDA 2X4YA 2X4WA 3QO3A 3OYLA 4PJOA 2C0IA 1K0XA 2DTOA 2JM9A 1VQ7Q 5FW9A 3RMQA 3FRNA 4E7HA 2L3QA 3A5ZB 3S3NA 1KHIA 4LDUA 1QVPA 3SEMA 2V26A 5EC7A 2RI2A 5GMKl 2E10A 4M75C 4XU1A 5FU6C 3CCVA 2DILA 2PQWA 1UEBA 2NUPA 1KQ1A 2DL4A 2KRNA 4DBRA 3MHXA 3MEAA 2FHDA 2O4XA 3LX7A 2AT1B 3OMGA 3HFNA 4Z89A 3G4SA 1VQ8T 3V8KA 1ZSGA 3M0UA 1VQNQ 2FVUA 4EDUA 5FLXE 1KQSP 1VQOA 2WSFE 4C8QB 4XQ3A 4FM4B 2GTJA 1HYOA 2FG0A 1WZOA 1VQMT 1QKXA 4CC3A 1X6BA 1XNIA 1YCSB 2EW3A 2L89A 1WJQA 3TEEA 1NLPC 3I55T 4HA8A 2M51A 4F16A 3CXCS 2EJGA 5CIUA 4DEXA 1OU8A 1WLPB 2QXFA 4N0AA 2VGNA 1VQMA 1Q7YR 5GAOm 3NFCA 4M78A 2Y4YA 3H0FA 3QDFA 4A63B 1X27A 2FZKB 3S3MA 3R6NA 2O9SA 1K8AC 3VYHB 2RQVA 5LJ5j 3CCQQ 3EG2A 2CT3A 2RA2A 4E7JA 1IHVA 2EWNA 3J7AF 2EGEA 2XG8D 1FMWA 1AD5A 3JCMh 3LGLA 4OGCA 1ZUKA 1VQ9Q 1OQKA 1UGSB 4C92A 2E64A 1EIFA 2GFUA 1SRLA 2P0QA 4A4FA 2ABLA 2RQRA 4Q5WA 2XKOC 3ZEHA 2DXUA 3FJ5A 4FSSA 4D8KA 5HK3A 4M7AG 1G3YA 2KGTA 4F7UG 8AT1B 3JCMg 4JRKA 2Y4XA 1OULA 4ZN3A 1LJOA 5A0GA 5AYFA 1D3BA 3CCVT 1VA7A 1JQQA 3LWHA 2LJ0A 1NZ9A 2YSQA 1LNXA 3G6EA 1U3OA 2KVQG 3QWYA 1OPKA 1Q86R 2FPDA 1KQSA 4OMPA 4CC7A 3I56A 3PGGA 3X24B 3CCRT 3QYHB 1PCXA 2KK4A 3LH0A 2MMPA 1Y7XA 1U8RA 1Z9QA 4NL2A 2DEUA 1VQ6Q 2D1XA 3PIOA 5GANj 2J05A 1GL5A 2QA4Q 1N9RA 3CCMT 3RESA 4IIOA 2DYIA 3FIFA 4M7DD 4C0FA 1UE9A 1X6OA 4MDWA 5LJ5f 3JCMf 1VQKT 5CKEA 3CCET 4J7FA 5LJ5e 2DZ9A 2MI6A 3NHNA 3JB9D 2VC8A 2VB6A 4N4GA 2EBPA 3RKWA 3EGXA 4BB7A 2GCXA 2DRKA 2QEXA 2E5KA 1WXUA 1UHCA 4IURA 4Y28E 4LNPA 5CQXA 4AG2C 3X20B 1UHFA 2QQBA 3SDZA 1BB9A 2K3BA 3OYDA 4PJOF 2K5LA 3LW5E 4HCCA 3JCMe 5IXBA 4M7AE 3M0RA 2ZPFB 3CCSA 1HXDA 2GQIA 3REAB 1C0MA 3E2UA 2KDSA 1PM3A 2JJ9A 4P5NA 2OTJT 2EFIA 2M1HA 1HK9A 4D8DA 2K4YA 1JU5C 1PNJA 2ZAEA 3AHUA 5D6WA 2VASA 1NEBA 2L3RA 5IHKA 2D6FA 1MMAA 2QG9B 1YJNT 3UA6A 3NPFA 1YJNQ 2M0YA 1RLQC 2QGFB 3H0HA 3A98A 2KSSA 3VU3C 3SD4A 1ZHIA 5A0DA 2YRVA 2F2WA 1U06A 4C92E 2O88A 2DERA 5CKDA 4PJOC 5GANf 2LJ3A 1YJNA 3MEVA 5GAMf 5GAOn 2DXTA 1QW1A 2GFAA 3PMIA 4C8QA 2EQIA 1VQ8A 3N5BB 5GJVB 3RKXA 5DLOA 2J6KA 2EKOA 2DIGA 3AT1B 1K73U 4IUPA 2MAMA 4X9DA 3QYGB 1I5OB 2LJ1A 2Z0WA 4C5IA 1X75C 1TUGB 1Q81C 1SEMA 4F7UF 4JRPA 4N4IA 4PL6A 4NL3A 1K4US 1K0SA 1V1CA 1QVGS 2ROTA 4L5GA 4LD6A 1VIEA 5CKHA 2EQKA 2QDLA 3FLGA 1OI1A 3I56Q 3CBPA 2LP5A 2V1RA 2QDYB 2RB6A 3I56T 1IGQA 4J8OA 3NGPA 2CSIA 2JW4A 1H3HA 2FO0A 2XK0A 3CMAQ 1OYXA 5DM7R 4BE2A 5DY9A 3CMAT 3C95A 2RI3A 3CCJT 1R0BG 3JAME 3UPUA 3V7RA 5I11A 3CCMA 1M90U 4M7AA 1K73C 4FW1A 5KYWB 4IUUA 1MHNA 3FB9A 1WPYA 3VS4A 4LUDA 2L0AA 1T0HA 4OMFB 1N8RU 2D0NA 4KH0B 3M0TA 3JB9J 1G3SA 3OYIA 1KFZA 1OEBA 1GCQC 1RACB 2GGRA 4KGXB 1R77A 5L23A 2K57A 2HCKA 3EG3A 2QGGA 2H8HA 3H6ZA 2E6ZA 1UFFA 5GAMj 1M3AA 3A8OB 3L2RA 1XQHA 2GQVA 2OAUA 3CC4T 2OJ2A 3BDUA 2YT6A 3GNFB 2KT8A 4FSXA 3M55A 2MK5A 3NMZC 3EH2A 2EYXA 2HMAA 4J9BA 3CCUT 1BIAA 2CUBA 4ESRA 2JN0A 1VQ5A 4J9HA 4PJMA 4JJNK 2VGMA 5I2MA 2JOYA 4C5GA 4C92F 1YJWT 4FW2A 1WI7A 2DEQA 1YN8A 1VOMA 1WQ7A 2X9HA 1SHGA 1JB0E 1W4SA 4M75E 4QQGA 4QVCA 3G71Q 2ED1A 1UUEA 2DVJA 1AWXA 3QZ5B 3ZBDA 2O01E 4FYXB 3A8HB 2JXBA 2A28A 2JM8A 1VQOT 2QQ9A 3HP9A 5GAN8 3L2ZA 1M2VB 5CO7A 4EMKA 1BYMA 2PVGB 3V7CA 2DPPB 1VQ7T 2LC4A 4L6V5 3V8LA 2MWOA 2BIVA 3I55A 3QDRB 2WACA 2QEXQ 4ZGDB 2DETA 2IVWA 2V8KA 3VS1A 3FDRA 4M75F 3PE0A 2VWFA 2J6OA 2IIMA 1KQSS 3VS0A 1NPRA 3OYYA 4M78E 1ZBXA 5CK9A 2EGCA 2X4XA 1RAIB 3S3OA 2K2VA 2EJ9A 3CC7T 4FU6A 4NOYA 3MP1A 3M0SA 5DLQE 1RL2A 3EFRA 3EFOA 3NTKA 4LDYA 1Z9ZA 1M1KR 2JTMA 5GAOp 1X2QA 1XOVA 1V29B 3CCVQ 4M7DF 1SSFA 3PIPA 3E1SA 3BDLA 2CZ7B 5GMKh 1QVFS 1O9SA 3TREA 3M59A 4OB0B 3CQTA 3CPWS 1QMCA 4AT1B 3P8HA 3H41A 4EMGA 5LJ3f 4BE0A 4JLGA 5I2SA 5KE2A 2COZA 1ZUUA 1VQPQ 3UT1A 1KK7A 3M56A 2BE9B 2OX7A 4M75D 2JUFA 3DB4A 3OS5A 1VQ6T 1S72T 2HSPA 5LL6S 1K9MR 4RG2A 1S72Q 2JTFA 3TU4K 3H9NA 4C92C 2AHJB 2DLPA 3CCMQ 2DTHA 2HSEB 3L2UA 3CC2Q 2GTOA 1NG2A 2DO3A 1JXOA 2B8AA 1TTHB 3I5SA 2CP3A 3ASKA 4OMLA 2K2MA 4ORZA 2KT1A 1VQOQ 3QJ6A 2FEIA 2DZCA 2M02A 4X9CA 3JCMV 4CC4B 1WDXA 1M27C 3V7SA 5LJ3g 3QSUA 4MMLA 1T3LA 4AFZC 1H8KA 5CCAA 2OTLT 5GAN3 4Y91A 2VXFA 1YJWA 2OTLQ 4RTWA 2K9GA 2KI7A 1QCOA 4A4GA 4DBFA 2YRDA 2MCNA 5KYNA 3QUIA 4ATOA 3OB9A 4CRIA 2RHIA 4J9EA 3LYIA 1GRIA 2LQNA 1B3QA 1JJ2A 5CKBA 3CC7Q 2EYYA 3OMCA 4RMOA 2JS2A 1WYXA 2D8HA 3CPFA 4QKUA 2HQHA 3C4SA 3X25B 1S1NA 1KD1R 2ZPIB 1ZX6A 1YHQT 2D0QB 1W2BS 3OBWA 4C8QE 4DOWA 1QP3A 1JJ2P 5CR2A 2ENMA 3JB9G 1M9SA 3BFMA 1PRMC 1X69A 5GAN7 2CS7A 2R5AA 2ZPGB 1OPLA 3TCJA 2YUQA 2ZPHB 4M7DG 4O5VA 4PKCC 3URGA 1RABB 2XICA 1P92A 2KXCA 2A0FB 2FRWA 4KRTA 1UJ0A 3CC2T 5C0MA 2V8JA 3M5AA 3EHRA 2GBQA 3QKJA 2QQRA 1BBZA 2CP0A 3GBQA 1MV3A 2YXYA 2CZ6B 4XU2A 3JCMX 1VQLQ 2DAQA 5GMKi 1VQLT 2CGHA 1VIFA 3VS7A 1W1FA 1MGQA 1D1BA 4XU3A 2JMCA 3REBB 2K7AA 2IG0A 3CXCP 4EPCA 7AT1B 2DBKA 1M1FA 2BE7D 5LJ3h 3HTRA 2NUZA 3OYMA 1BKBA 2DBMA 3HRUA 1NPPA 5GAN6 3M53A 2RJFA 1M2OA 4J9DA 3QXEB 3RBBB 4FYYB 4HVUA 1SF9A 4BY6B 4A54A 2E65A 1D1CA 3CCUA 2CP7A 2BZ8A 3VJPA 1I4K1 2JT4A 4GBQA 4KGZB 1Q81R 1N6AA 1YWPA 4C8QG 3HRSA 4M7AB 4M7AC 2DRMA 3EGDB 3QWXX 3KFVA 4XK8E 2JNGA 3I55Q 2CSQA 4DA4A 2CP2A 2KEAA 5GAN4 2M0OA 1QVGP 4Z02A 1LPLA 4HXJA 4J9CA 1YJ9Q 1NYFA 1Y0MA 4C5EA 4BY6C 4PJOB 3EAEA 3I35A 1BCOA 5LJ3e 3A1PA 4LDWA 1UGRB 1Y96A 2LRQA 1W2BA 1KD1C 2KQWA 4D6WA 3M58A 1MMGA 1N8RC 2P4TA 3X26B 4JS5A 1BI3A 1Q7YU 1IGUA 2RK2A 3HHTB 3KXTA 3CCEA 2GF7A 1QQJA 4CI0C 2RQTA 3EG9A 1OOTA 4AG1C 3META 1FX7A 2EPDA 3CCQA 2YRCA 4PJOD 2AK5A 3QG1A 1M90R 2ZPEB 4HVVA 4QQDA 2EQUA 4MDXA 2DL5A 4QW2A 4ME7A 4MZMA 1RLPC 2VV5A 1KC8U 5HK0A 2YUNA 5GAN2 1OZ2A 2QTXA 3CMET 3INZA 3KBGA 2LQWA 4M7DA 1BI0A 3JSCA 1QCFA 2K6DA 1B07A 3VRZA 5GMKj 1SG5A 2VKNA 2EYZA 3C94A 1TXQA 3SFMA 1YBYA 4RTYA 5CQYA 1MNDA 1NLOC 3M0QA 1NE8A 3CD6Q 4MMKA 3G6EQ 4JJDA 2R57A 3OYCA 1VQ4A 1VQNA 2DK3A 2MWPA 3CEYA 1ZSZC 4JDSA 1B7TA 1SSHA 1VYTA 3CC4Q 1TU0B 2M16A 1VQKQ 2OI3A 2AKLA 2YUPA 3GF5A 3H8ZA 2XU8A 1B34A 2YLCA 2ROLA 3NTIA 4OF1A 4XU0A 1M30A 2DA9A 2HD0A 2COWA 1WGSA 2CT4A 2DYBA 3M9QA 4E47A 1RAAB 2YHTA 1WXBA 4ZTFA 3JV3A 3D7SB 4FT4A 4O6JA 2RNAA 2PZ1A 1ACMB 4IIMA 4QQ6A 2A36A 2F2VA 4AMCA 1SPKA 2DJZA 4F7UA 2QA4T 1D3BB 2KNBB 5KYYB 3E19A 3CPWA 1D09B 4J6XA 1VQMQ 2RHXA 3EFSA 3OYAA 2DKGA 1BI2A 3TVTA 4OMMA 2OTJQ 3OYJA 4WF2A 2RM4A 3CCEQ 3DLMA 3L1AA 4XTZA 1U5SA 5KYXB 3OS0A 2RPNA 1MMDA 2BKDN 4KBMB 3THKA 4TVRA 3H0IA 4M77A 4II1A 2YLBA 1D0XA 3CCSQ 4PJNA 4OP0A 3L2WA 3DB3A 1M1KC 3FJPA 1M3CA 4C92G 2X3WD 1GCQA 5GAMg 2LVMA 1AVZC 2XDPA 2LZ6B 2LNHB 4C5HA 1VQLA 2EQJA 2HQXA 3OYGA 1E7OA 4X34A 3TSWA 4PFPA 4XTWA 1KIKA 1K8AR 4C0GA 1OX8A 4XAXB 4DBHA 1ARKA 1Y96B 1YITT 3JCMd 1RAFB 4XTVA 2EAYA 1K9MC 1IHWA 2EKHA 3JCMW 2HL3A 4J9IA 3CCLQ 2P4RA 2PVDB 3E9FA 3JCMc 1RI9A 2DX1A 3MKDA 5GAOr 4J7IA 4HT9A 1HSQA 1VQPA 4AFUC 4PJJA 1JRIA 3HSBA 3P8BB 1AHJB 3HL8A 4C0DC 5KYXA 2LT4A 1TOVA 4RKUE 3UWNA 2FZGB 2HNIA 2HBPA 4IUQA 3OYFA 1KD1U 1C6VX 3WVEB 2O2OA 3ZL7C 2PVOB 3EGXB 3JB9I 4M75B 2XDDA 1VQ4T 5FU6B 1BK2A 1IO6A 2DXBA 1ZQ1A 2PNIA 1GXIE 1EZZB 2RF0A 4HT8A 3VS3A 2E3HA 1PG5B 1Q82R 5J39A 1ZA2B 2H3EB 4C0DB 4M7AF 1XTDA 3RIRA 4EMKB 3L42A 1MV0B 3BE3A 4E7IA 3LGFA 2E70A 4M7DC 2KYMA 4OGEA 1ZBJA 4IUVA 1RUWA 1G83A 1YI2Q 3O8VA 3OQ5A 2NLUA 3OW2S 4PJLA 4E7SA 3VUBA 2PTKA 2ESWA 1MMNA 1PWTA 2EQMA 4J9FA 5GANd 4KH1B 2JS0A 2D8JA 3I5RA 3GNGA 3R6OA 1WIEA 4OB2B 3MP6A 2BTTA 3ULRB 1YWOA 4FT2A 2W10A 1JBMA 1K1ZA 3J80E 2ZGWA 4PNOA 2A3LA 1KG1A 2RD1A 1YITQ 4NS5A 2FB7A 3SHWA 2JZ2A 4M4ZA 4IKFA 1YJ9A 2KXDA 5KH6A 1IREB 4HCBA 1WQWA 3Q1JA 2C0TA 2RQWA 2HEQA 3DKMA 4DOVA 1N5ZA 1PD0A 2LQKA 3MJXA 4J6WA 1UJYA 3MEWA 4EMHA 1WNLA 2FRYA 2NUTA 2C0OA 2LTOA 5GJWB 2HAXA 2A08A 3CCQT 2DL3A 1C1AA 4ZNXA 1SHFA 2KROA 4LUEA 1PSEA 2H3JA 3CCUQ 1S72A 5J26A 1WHJA 5GANe 2L2PA 1X2KA 3M4YA 5GAN5 2JVVA 1GFDA 3RMSA 5KYWA 5LJ3j 1SRMA 4LXCA 1TSFA 3JB9H 1WHLA 2BZXA 5FWBA 2K3XA 3OBYA 1WXTA 1DJ7B 1NJIU 1TWBA 2DD4A 5GAOl 3G4SQ 4M75A 3OA6A 5HY6A 4PFZA 4WCIA 2NYSA 4FIBA 2DL7A 4Y92A 1VQNT 3CCJQ 3G6ET 1AWOA 3L2QA 3GP8A 2RK1A 3VS5A 2QYZA 3LLRA 4J6YA 4E7ZA 2CP6A 1WJSA 2DE0X 4M78D 3CCLA 1YNZA 1U1TA 1WA7A 1QKWA 4JJCA 1YIJQ 1BIBA 1PC0A 2CYZB 4ZTJA 1TUCA 1ZUYA 2RMOA 1Q86U 4BI8B 1K73R 2HKNA 3CD6T 3MO8A 4X1VA 3CBOA 1NM7A 1HD3A 1YITA 4KUDK 3MP8A 1VQ7A 2PUOB 2CZ1B 3V8JA 3OSSC 1VQKA 5HCKA 1VQ8Q 4M77C 2RI5A 2VXEA 2BZYA 2MF2A 3NTHA 5ECAA 1E6GA 1G8XA 2FPEA 4J83A 4PLIA 1FMVA 2E4HA 3A8GB 1PHTA 4BACA 1Y07A 5IN1A 2QK0A 2XHCA 3UDCA 2ZZDA 5IHNA 2DIQA 5IT9E 3C0CA 3ZFJA 8ATCB 5IXFA 1N9SA 4N0AC 1I8FA 1AT1B 2DNUA 1YJWQ 2OTLA 4B9XA 2KY9A 4HCZA 1LOJA 3OW2A 1MUZA 1KSWA 4A4KA 2E1HA 4ZN1A 3HPWA 3GLXA 2ZCFB 3CCST 3RNJA 3EGUA 3EFOB 1VQ9A 1FYNA 4LDXA 5J3BA 3UATA 1UECA 1YI2A 5FWCA 1G2BA 3RERA 3EG0A 1OV3A 3OYKA 3WVDB 2K5FA 2NUPB 3CCRQ 1CKAA 4M77D 2QA4A 2KBTA 2YDLA 4A53A 5A0LA 3OYEA 1VQ6A 3CCJA 1VQ9T 2ZPBB 3CBMA 2P84A 3QIIA 3PFSA 4F7UB 4XTUA 4QVZA 4AFSC 2QEXT 2K3YA 2QASA 1PKTA 4E6RA 2XDBA 1ZLMA 1D1AA 1NYGA 1TUDA 1R8OB 2CH4W 1JEGA 2LX7A 5LJ5d 2F69A 3CD6A 3CXCA 1O75A 4RTZA 3PVQA 2DTIA 2I2LA 5GMKe 3FEOA 4M7DE 3KUFA 3HFOA 1QVGA 4ELYC 4JUVA 2M9UA 3A8MB 1I81A 2F5TX 1VYUA 2RH2A 4KGVB 2C06A 2YWWA 1AZGB 5KCHA 4KUIA 1QWFA 2P0KA 4ZGJB 1M4ZA 3EG1A 2DFUA 1T3SA 2RJEA 3SWNA 4E7KA 2QQAA 2RQUA 5M9OA 2L3PA 1QP2A 3CC2A 2NUTB 1UTIA 4PFOA 4LE9A 3OYHA 3G7ZA 3M57A 4ELZC 5AT1B 4DQ2A 3OYBA 2ECZA 3O5ZA 5CAIA 3QHSA 3RR6A 2COYA 1VUBA 2KYBA 4PJOG 1FXXA 2AZSA 1W6XA 3QPHA 1D0YA 1K9MU 1ZSZA 4B9WA 2E12A 3GIBA 2VVKA 2XD0A 4E7LA 3ER0A 3JCMb 2K5IA 2OAWA 5FU7C 4A4HA 4FYVB 5IH2A 1M3BA 4DEYA 1Y57A 1NJIC 3GPLA 5GANh 3OW2P 2KRMA
chains in the Genus database with same CATH topology
2IIMA 1GCQA 1I1JA 5EC7A 3VS0A 1AVZC 1W70A 2LZ6B 2LNHB 2EGCA 1E7OA 3TSWA 2DILA 1FMKA 2DL4A 2KRNA 4OMNA 1KIKA 3VS2A 3M0SA 1K9AA 4Z89A 1ARKA 2JTEA 4J9GA 1Z9ZA 2EKHA 1X2QA 1XOVA 1ZSGA 3M0UA 1WX6A 4J9IA 2P4RA 2CREA 2JMAA 1RI9A 2SRCA 3CQTA 2DX1A 2GTJA 1HSQA 4AFUC 2FG0A 1A0NB 3H41A 1QKXA 2ED0A 4CC3A 1ABOA 1X6BA 1ZUUA 1YCSB 2EW3A 2A37A 1GBRA 1I0CA 1NLPC 3PVLA 3IQLA 2M51A 4Z88A 4F16A 2HSPA 4DEXA 1WLPB 2O2OA 3ZL7C 2DLPA 4RTUA 1AWWA 3I9QA 2GTOA 1BK2A 1NG2A 3UA7A 3H0FA 1IO6A 1JXOA 2PNIA 3I5SA 4A63B 1X27A 2RF0A 2MIOA 4OMLA 2AZVA 5I22A 2K2MA 2HBWA 4ORZA 2KE9A 2O9SA 3R6NA 2KT1A 2RQVA 2DL8A 1ABQA 3EG2A 2CT3A 3VS3A 2FEIA 1E6HA 1UGVA 1X43A 2EGEA 1AD5A 1CSKA 1ZUKA 4CC4B 1WDXA 1K76A 4RTTA 1M27C 1SRLA 1T0JA 2ABLA 2RQRA 1MV0B 2CUDA 3LH5A 1T3LA 4AFZC 2O31A 1H8KA 3FJ5A 4FSSA 4D8KA 2KYMA 2O9VA 2KGTA 1ZBJA 4F17A 1RUWA 1G83A 4EIKA 4RTWA 2K9GA 2J6FA 2PTKA 2ESWA 1VA7A 1JQQA 2MCNA 1PWTA 2LJ0A 2YSQA 4J9FA 4JJBA 2JS0A 2D8JA 3I5RA 4J9EA 1U3OA 1I07A 4GLMA 3QWYA 1GRIA 2LQNA 1B3QA 1OPKA 1WIEA 2BTTA 2FPDA 3ULRB 4OMPA 1YWOA 4CC7A 2EYYA 3VS6A 2JS2A 2W10A 1WYXA 1K1ZA 2D8HA 2MOXA 3U23A 4RTVA 2DF6A 3SHWA 1S1NA 1Z9QA 2GNCA 4M4ZA 1ZX6A 2KXDA 2D1XA 1AOJA 2J05A 2EVRA 1GL5A 2KRSA 1QLYA 4IIOA 3TSZA 2C0TA 2ENMA 2RQWA 2HEQA 1N5ZA 2LMJA 1PRMC 1UE9A 1UJYA 1X69A 2FRYA 1UG1A 4JZ3A 4OMOA 2C0OA 5GJWB 1OPLA 2A08A 4CC2A 2YUQA 3NHNA 2DL3A 3UF4A 4ZNXA 1AEYA 1SHFA 2EBPA 2KROA 4LUEA 2KXCA 2DRKA 2E5KA 1UHCA 1WXUA 1VYVA 2FRWA 4JZ4A 4KRTA 1UJ0A 4LNPA 4AG2C 4HCKA 3EHRA 2GBQA 1UHFA 2L2PA 1X2KA 1J3TA 1BB9A 2NWMA 2K3BA 1GFDA 1BBZA 3GBQA 1MV3A 1TG0A 5IXBA 1EFNA 3M0RA 1SRMA 3VS7A 1W1FA 2EYWA 2JMCA 3REBB 2GQIA 3REAB 2K7AA 2BZXA 5FWBA 4OMQA 1WXTA 2DBKA 4D8DA 1YP5A 2NUZA 1JU5C 1PNJA 2DBMA 5IHIA 1NEBA 1H92A 4WCIA 5IHKA 4J9DA 1BU1A 2DL7A 4Y92A 3RBBB 4HVUA 3UA6A 2X3XD 3SEMA 3NPFA 1AWOA 2M0YA 2FPFA 1GFCA 1RLQC 4LN2A 2BZ8A 3H0HA 3VS5A 3A98A 2JT4A 4GBQA 2DE0X 1YWPA 2F2WA 1UDLA 1YNZA 1U06A 1WA7A 1QKWA 1X6GA 2DRMA 4JJCA 2O88A 2EGAA 2LJ3A 1TUCA 3KFVA 3QWXX 1ZUYA 1AZEA 2DM1A 2RMOA 2CSQA 4JPBW 1QWEA 4X1VA 1NM7A 2KEAA 1KJWA 3M0PA 1HD3A 2EQIA 4HXJA 5GJVB 4J9CA 1NYFA 2DMOA 1Y0MA 1JXMA 2J6KA 5HCKA 3I35A 2LJ1A 2J7IA 1SEMA 2BZYA 2HDAA 5ECAA 1E6GA 2G6FX 1CKBA 1PKSA 2FPEA 2CDTA 2J06A 1PHTA 1PRLC 4K11A 1K0SA 1V1CA 1K4US 2ROTA 5IHNA 1NEGA 2RQTA 1OOTA 1LCKA 4AG1C 2QDLA 3C0CA 2EPDA 3EHQA 3PE0A 2KR3A 1WFWA 2LP5A 2V1RA 5IXFA 2AK5A 4RTXA 4HVVA 3NGPA 2DNUA 2CSIA 2JW4A 2SEMA 1MUZA 2DL5A 1H3HA 1KSWA 2FO0A 2CH4A 1RLPC 3RNJA 2K79A 3EGUA 2F2XA 2AKKA 2YUNA 1FYNA 2L3SA 5I11A 3UATA 1UECA 5FWCA 1G2BA 2LQWA 3EG0A 1OV3A 3VS4A 4LUDA 3VRYA 1QCFA 2L0AA 1T0HA 2K6DA 1B07A 3VRZA 2D0NA 3M0TA 2VKNA 2EYZA 2I0NA 1KFZA 1CKAA 1OEBA 2KBTA 1GCQC 2GGRA 2YDLA 4RTYA 5L23A 1NLOC 2HCKA 3EG3A 2B86A 2H8HA 3M0QA 1UFFA 1M3AA 4HVWA 4JJDA 2RN8A 4AFSC 1PKTA 4E6RA 1ZLMA 1NYGA 2YUOA 1TUDA 2OJ2A 4R0KA 2CH4W 1SSHA 1VYTA 1JEGA 2XMFA 2YT6A 2LX7A 2OI3A 2AKLA 4RTZA 2YUPA 3PVQA 2KT8A 1GCPA 2W0ZA 1GBQA 2ROLA 3NMZC 1M30A 2EYXA 1VYUA 4Z8AA 4J9BA 1AZGB 2DA9A 2DJQA 1QWFA 2CUBA 2CT4A 4ESRA 2DYBA 4J9HA 4AFQC 1WXBA 3EG1A 4RUGA 1M8MA 3JV3A 1T3SA 2RNAA 2PZ1A 1JO8A 4IIMA 2RQUA 2L3PA 1WI7A 2A36A 2F2VA 1YN8A 1UTIA 4LE9A 1SPKA 2V1QA 2KNBB 2ECZA 3O5ZA 1SHGA 2ED1A 4QT7A 2DVJA 1UUEA 1AWXA 2LCSA 4F14A 2KYBA 1AWJA 4OMMA 3TVTA 2AZSA 1HJDA 2JXBA 2A28A 2JM8A 1W6XA 1U5SA 2RPNA 2C0IA 1K0XA 3THKA 2JM9A 3H0IA 5FW9A 2VVKA 2OAWA 2L3QA 5IH2A 1M3BA 4DEYA 1Y57A 1M3CA 3VS1A 2X3WD 2VWFA 2J6OA 2KRMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IIM A;  1GCQ A;  1I1J A;  5EC7 A;  3VS0 A;  1AVZ C;  1W70 A;  2LZ6 B;  2LNH B;  2EGC A;  1E7O A;  3TSW A;  2DIL A;  1FMK A;  2DL4 A;  2KRN A;  4OMN A;  1KIK A;  3VS2 A;  3M0S A;  1K9A A;  4Z89 A;  1ARK A;  2JTE A;  4J9G A;  1Z9Z A;  2EKH A;  1X2Q A;  1XOV A;  1ZSG A;  3M0U A;  1WX6 A;  4J9I A;  2P4R A;  2CRE A;  2JMA A;  1RI9 A;  2SRC A;  3CQT A;  2DX1 A;  2GTJ A;  1HSQ A;  4AFU C;  2FG0 A;  1A0N B;  3H41 A;  1QKX A;  2ED0 A;  4CC3 A;  1ABO A;  1X6B A;  1ZUU A;  1YCS B;  2EW3 A;  2A37 A;  1GBR A;  1I0C A;  1NLP C;  3PVL A;  3IQL A;  2M51 A;  4Z88 A;  4F16 A;  2HSP A;  4DEX A;  1WLP B;  2O2O A;  3ZL7 C;  2DLP A;  4RTU A;  1AWW A;  3I9Q A;  2GTO A;  1BK2 A;  1NG2 A;  3UA7 A;  3H0F A;  1IO6 A;  1JXO A;  2PNI A;  3I5S A;  4A63 B;  1X27 A;  2RF0 A;  2MIO A;  4OML A;  2AZV A;  5I22 A;  2K2M A;  2HBW A;  4ORZ A;  2KE9 A;  2O9S A;  3R6N A;  2KT1 A;  2RQV A;  2DL8 A;  1ABQ A;  3EG2 A;  2CT3 A;  3VS3 A;  2FEI A;  1E6H A;  1UGV A;  1X43 A;  2EGE A;  1AD5 A;  1CSK A;  1ZUK A;  4CC4 B;  1WDX A;  1K76 A;  4RTT A;  1M27 C;  1SRL A;  1T0J A;  2ABL A;  2RQR A;  1MV0 B;  2CUD A;  3LH5 A;  1T3L A;  4AFZ C;  2O31 A;  1H8K A;  3FJ5 A;  4FSS A;  4D8K A;  2KYM A;  2O9V A;  2KGT A;  1ZBJ A;  4F17 A;  1RUW A;  1G83 A;  4EIK A;  4RTW A;  2K9G A;  2J6F A;  2PTK A;  2ESW A;  1VA7 A;  1JQQ A;  2MCN A;  1PWT A;  2LJ0 A;  2YSQ A;  4J9F A;  4JJB A;  2JS0 A;  2D8J A;  3I5R A;  4J9E A;  1U3O A;  1I07 A;  4GLM A;  3QWY A;  1GRI A;  2LQN A;  1B3Q A;  1OPK A;  1WIE A;  2BTT A;  2FPD A;  3ULR B;  4OMP A;  1YWO A;  4CC7 A;  2EYY A;  3VS6 A;  2JS2 A;  2W10 A;  1WYX A;  1K1Z A;  2D8H A;  2MOX A;  3U23 A;  4RTV A;  2DF6 A;  3SHW A;  1S1N A;  1Z9Q A;  2GNC A;  4M4Z A;  1ZX6 A;  2KXD A;  2D1X A;  1AOJ A;  2J05 A;  2EVR A;  1GL5 A;  2KRS A;  1QLY A;  4IIO A;  3TSZ A;  2C0T A;  2ENM A;  2RQW A;  2HEQ A;  1N5Z A;  2LMJ A;  1PRM C;  1UE9 A;  1UJY A;  1X69 A;  2FRY A;  1UG1 A;  4JZ3 A;  4OMO A;  2C0O A;  5GJW B;  1OPL A;  2A08 A;  4CC2 A;  2YUQ A;  3NHN A;  2DL3 A;  3UF4 A;  4ZNX A;  1AEY A;  1SHF A;  2EBP A;  2KRO A;  4LUE A;  2KXC A;  2DRK A;  2E5K A;  1UHC A;  1WXU A;  1VYV A;  2FRW A;  4JZ4 A;  4KRT A;  1UJ0 A;  4LNP A;  4AG2 C;  4HCK A;  3EHR A;  2GBQ A;  1UHF A;  2L2P A;  1X2K A;  1J3T A;  1BB9 A;  2NWM A;  2K3B A;  1GFD A;  1BBZ A;  3GBQ A;  1MV3 A;  1TG0 A;  5IXB A;  1EFN A;  3M0R A;  1SRM A;  3VS7 A;  1W1F A;  2EYW A;  2JMC A;  3REB B;  2GQI A;  3REA B;  2K7A A;  2BZX A;  5FWB A;  4OMQ A;  1WXT A;  2DBK A;  4D8D A;  1YP5 A;  2NUZ A;  1JU5 C;  1PNJ A;  2DBM A;  5IHI A;  1NEB A;  1H92 A;  4WCI A;  5IHK A;  4J9D A;  1BU1 A;  2DL7 A;  4Y92 A;  3RBB B;  4HVU A;  3UA6 A;  2X3X D;  3SEM A;  3NPF A;  1AWO A;  2M0Y A;  2FPF A;  1GFC A;  1RLQ C;  4LN2 A;  2BZ8 A;  3H0H A;  3VS5 A;  3A98 A;  2JT4 A;  4GBQ A;  2DE0 X;  1YWP A;  2F2W A;  1UDL A;  1YNZ A;  1U06 A;  1WA7 A;  1QKW A;  1X6G A;  2DRM A;  4JJC A;  2O88 A;  2EGA A;  2LJ3 A;  1TUC A;  3KFV A;  3QWX X;  1ZUY A;  1AZE A;  2DM1 A;  2RMO A;  2CSQ A;  4JPB W;  1QWE A;  4X1V A;  1NM7 A;  2KEA A;  1KJW A;  3M0P A;  1HD3 A;  2EQI A;  4HXJ A;  5GJV B;  4J9C A;  1NYF A;  2DMO A;  1Y0M A;  1JXM A;  2J6K A;  5HCK A;  3I35 A;  2LJ1 A;  2J7I A;  1SEM A;  2BZY A;  2HDA A;  5ECA A;  1E6G A;  2G6F X;  1CKB A;  1PKS A;  2FPE A;  2CDT A;  2J06 A;  1PHT A;  1PRL C;  4K11 A;  1K0S A;  1V1C A;  1K4U S;  2ROT A;  5IHN A;  1NEG A;  2RQT A;  1OOT A;  1LCK A;  4AG1 C;  2QDL A;  3C0C A;  2EPD A;  3EHQ A;  3PE0 A;  2KR3 A;  1WFW A;  2LP5 A;  2V1R A;  5IXF A;  2AK5 A;  4RTX A;  4HVV A;  3NGP A;  2DNU A;  2CSI A;  2JW4 A;  2SEM A;  1MUZ A;  2DL5 A;  1H3H A;  1KSW A;  2FO0 A;  2CH4 A;  1RLP C;  3RNJ A;  2K79 A;  3EGU A;  2F2X A;  2AKK A;  2YUN A;  1FYN A;  2L3S A;  5I11 A;  3UAT A;  1UEC A;  5FWC A;  1G2B A;  2LQW A;  3EG0 A;  1OV3 A;  3VS4 A;  4LUD A;  3VRY A;  1QCF A;  2L0A A;  1T0H A;  2K6D A;  1B07 A;  3VRZ A;  2D0N A;  3M0T A;  2VKN A;  2EYZ A;  2I0N A;  1KFZ A;  1CKA A;  1OEB A;  2KBT A;  1GCQ C;  2GGR A;  2YDL A;  4RTY A;  5L23 A;  1NLO C;  2HCK A;  3EG3 A;  2B86 A;  2H8H A;  3M0Q A;  1UFF A;  1M3A A;  4HVW A;  4JJD A;  2RN8 A;  4AFS C;  1PKT A;  4E6R A;  1ZLM A;  1NYG A;  2YUO A;  1TUD A;  2OJ2 A;  4R0K A;  2CH4 W;  1SSH A;  1VYT A;  1JEG A;  2XMF A;  2YT6 A;  2LX7 A;  2OI3 A;  2AKL A;  4RTZ A;  2YUP A;  3PVQ A;  2KT8 A;  1GCP A;  2W0Z A;  1GBQ A;  2ROL A;  3NMZ C;  1M30 A;  2EYX A;  1VYU A;  4Z8A A;  4J9B A;  1AZG B;  2DA9 A;  2DJQ A;  1QWF A;  2CUB A;  2CT4 A;  4ESR A;  2DYB A;  4J9H A;  4AFQ C;  1WXB A;  3EG1 A;  4RUG A;  1M8M A;  3JV3 A;  1T3S A;  2RNA A;  2PZ1 A;  1JO8 A;  4IIM A;  2RQU A;  2L3P A;  1WI7 A;  2A36 A;  2F2V A;  1YN8 A;  1UTI A;  4LE9 A;  1SPK A;  2V1Q A;  2KNB B;  2ECZ A;  3O5Z A;  1SHG A;  2ED1 A;  4QT7 A;  2DVJ A;  1UUE A;  1AWX A;  2LCS A;  4F14 A;  2KYB A;  1AWJ A;  4OMM A;  3TVT A;  2AZS A;  1HJD A;  2JXB A;  2A28 A;  2JM8 A;  1W6X A;  1U5S A;  2RPN A;  2C0I A;  1K0X A;  3THK A;  2JM9 A;  3H0I A;  5FW9 A;  2VVK A;  2OAW A;  2L3Q A;  5IH2 A;  1M3B A;  4DEY A;  1Y57 A;  1M3C A;  3VS1 A;  2X3W D;  2VWF A;  2J6O A;  2KRM A; 
#chains in the Genus database with same CATH topology
 1I1J A;  4M77 G;  1EX4 A;  2X51 A;  1MNE A;  5CKF A;  1W70 A;  1Q82 U;  3EG9 B;  1RAD B;  2RO0 A;  5GAM d;  3CCR A;  2LDM A;  1FMK A;  3JCM Q;  2E5Q A;  4BD3 A;  3SB2 A;  4OMN A;  2OTJ A;  5GAM h;  3VS2 A;  3JCM J;  1K9A A;  2Y90 A;  2JTE A;  2QAZ A;  2XID A;  4J9G A;  4M7A D;  4GLK A;  2F5K A;  4ZGE B;  1WX6 A;  4MZT A;  3E9G A;  2CRE A;  2L8D A;  5LJ3 d;  3CCL T;  2JMA A;  2SRC A;  2IPO B;  5GAO q;  4KT0 E;  2L5Q A;  4F04 B;  1WHG A;  1A0N B;  4BI3 A;  1BI1 A;  3PNW C;  2ED0 A;  3DLL A;  3G1J A;  1H64 1;  2R5M A;  1ABO A;  5HKC A;  2QI2 A;  3T9N A;  1KC8 C;  2A37 A;  1GBR A;  1Q82 C;  3VYG A;  1I0C A;  5I21 A;  1W2B P;  5GAN g;  3PVL A;  3L2V A;  3IQL A;  4Z88 A;  2LNV A;  2O4X B;  4MZP A;  3PTA A;  1XJW B;  1IXD A;  3J81 E;  4RTU A;  2EIF A;  1AWW A;  1TH7 A;  4WTO B;  4JRI A;  3TQ7 P;  3CME A;  3I9Q A;  3UA7 A;  1R0C B;  3P8D A;  3RUX A;  2MIO A;  1SKU B;  2AZV A;  5I22 A;  2HBW A;  2KE9 A;  4C8Q D;  1YIJ A;  2DL8 A;  1ABQ A;  2V8I A;  1E6H A;  2E41 A;  1UGV A;  1X43 A;  1ZSZ B;  4M78 G;  1CSK A;  4BI4 A;  1M90 C;  2FZC B;  4M77 E;  1K76 A;  2KMT A;  4RTT A;  4YTL A;  1YFN A;  1T0J A;  2CUD A;  1RAG B;  3LH5 A;  1Q7Y C;  2O31 A;  1BCM A;  2O9V A;  2EJF A;  1IZ6 A;  2P0P A;  4F17 A;  4R55 A;  3CPW P;  4EIK A;  5LJ5 h;  4C0Z A;  1YI2 T;  2J6F A;  3ME9 A;  2RHZ A;  2A7Y A;  4JJB A;  3CME Q;  4IUT A;  4RG8 A;  4F7U E;  1RAE B;  1I07 A;  4GLM A;  2MYS A;  2PU9 B;  3EH1 A;  1NJI R;  5C6S A;  3VS6 A;  3PMT A;  4UC4 A;  2MOX A;  3U23 A;  3MPU B;  4M77 B;  4RTV A;  5KYU A;  2FYK A;  2DF6 A;  4C8Q F;  2GNC A;  4EMK C;  1TS9 A;  5KCO A;  4RCB A;  5IAY A;  1AOJ A;  4N4H A;  1X01 A;  2EVR A;  2KRS A;  3QZ9 B;  1QLY A;  2X4J A;  3RDV A;  3TSZ A;  2EYQ A;  4JS4 A;  4BUG A;  2LMJ A;  4XTX A;  1U1S A;  1Q86 C;  1UG1 A;  4JZ3 A;  2RHY A;  4OMO A;  1QVF P;  2ATC B;  1VQ5 Q;  1G3T A;  3RKY A;  4CC2 A;  1VQ5 T;  3UF4 A;  3SWN B;  4OVA A;  1AEY A;  2VYT A;  2LCC A;  4C92 D;  2E6N A;  5D6Y A;  3WXM B;  3LWI A;  2RJD A;  4L59 A;  3CC7 A;  4XTY A;  4JZ4 A;  1VYV A;  4BE1 A;  4A4E A;  1M1G A;  1KC8 R;  3BY7 A;  1M5Q 1;  2X35 A;  4HCK A;  1WHK A;  1J3T A;  1G5V A;  1B34 B;  2NWM A;  1TG0 A;  1EFN A;  4C92 B;  1UGQ B;  4PJO E;  2RHU A;  4M77 F;  2F1L A;  3HKS A;  2EYW A;  3G71 T;  2CKK A;  3CC4 A;  4M75 G;  5D7U A;  4OMQ A;  1QCN A;  1YP5 A;  5GMK m;  5LJ5 g;  3OS2 A;  5D6X A;  4OB3 B;  5IHI A;  3G4S T;  1H92 A;  4OB1 B;  6AT1 B;  1BU1 A;  2HQE A;  3JB9 F;  4M78 B;  2X3X D;  1UB4 A;  1PD1 A;  2FPF A;  1GFC A;  1YHQ Q;  4LN2 A;  2DXC A;  9ATC B;  4JRQ A;  4VUB A;  2G3R A;  1OU9 A;  1UDL A;  3FC3 A;  2BUD A;  1X6G A;  3CMA A;  2AIR B;  4J5Y A;  2EGA A;  1VQP T;  1YIJ T;  1RI0 A;  1M1K U;  4KUL A;  1YHQ A;  3X28 B;  1AZE A;  2DM1 A;  3HRT A;  4JPB W;  2HKQ B;  4HKE A;  1QWE A;  1D0Z A;  3QBY A;  1KJW A;  3M0P A;  3VKI A;  4E2F B;  1LVK A;  3GOX A;  1UGP B;  2DMO A;  1JXM A;  4ANJ A;  1VQ4 Q;  3MEU A;  2J7I A;  4R56 A;  2HDA A;  2CZ0 B;  2G6F X;  3VUZ A;  1WHH A;  1CKB A;  2LT1 A;  1PKS A;  2CDT A;  2J06 A;  1PRL C;  2LQ8 A;  4K11 A;  3VV0 A;  4FYW B;  1JJ2 S;  1NEG A;  2DVE A;  1LCK A;  4M78 F;  2LX9 A;  3EHQ A;  2KR3 A;  1WFW A;  4RTX A;  1K8A U;  2RJC A;  5FRN A;  3OS1 A;  5CVI A;  3A8L B;  2SEM A;  1QVF A;  2WSE E;  2CH4 A;  3SWN C;  3G71 A;  3EGD A;  2K79 A;  2F2X A;  2AKK A;  2L3S A;  1G3W A;  1N27 A;  4JLI A;  1M2V A;  3VRY A;  3C12 A;  3OSV A;  4LD9 K;  3JCM P;  1YCY A;  2I0N A;  1WHM A;  2LCL A;  5KYU B;  5KYY A;  3QJY A;  2DD5 A;  1H3Z A;  1KQ2 A;  2B86 A;  4BDZ A;  1OZ3 A;  1N8R R;  4HVW A;  2FL7 A;  2RN8 A;  5EG2 A;  1OX9 A;  1V76 A;  3F70 A;  1F1B B;  5KE3 A;  1YJ9 T;  5GAM e;  2YUO A;  2PUK B;  4R0K A;  4QVD A;  4PLL A;  1PSF A;  3OY9 A;  1ZA1 B;  2XMF A;  3S6W A;  1KHC A;  4GY5 A;  5FRO A;  1Q81 U;  4FCY A;  2HL5 C;  1GCP A;  2MPX C;  2CP5 A;  2W0Z A;  3OYN A;  1GBQ A;  4LDV A;  1M8V A;  2WSC E;  4Z8A A;  2E3I A;  4FL6 A;  2DJQ A;  4PK4 A;  2QTV A;  2XI9 A;  1Y71 A;  4AFQ C;  4RUG A;  2QQS A;  1Q95 G;  5FRM A;  1M8M A;  2VUB A;  5FU7 B;  1NBE B;  4B6M A;  1JO8 A;  2D9T A;  3M54 A;  3PT9 A;  3JRZ A;  1FWZ A;  5A2Q E;  4BDY A;  3MCA B;  2HZY A;  2V1Q A;  3BW1 A;  1IB8 A;  2KAF A;  4DBQ A;  4QT7 A;  1I5L A;  2R58 A;  4M78 C;  5L8R E;  2LCS A;  1RAH B;  4F14 A;  1IRX A;  1WJR A;  1AWJ A;  3M4G A;  4V2S A;  4M7D B;  4C8Q C;  4RCC A;  1HJD A;  2X4Y A;  2X4W A;  3QO3 A;  3OYL A;  4PJO A;  2C0I A;  1K0X A;  2DTO A;  2JM9 A;  1VQ7 Q;  5FW9 A;  3RMQ A;  3FRN A;  4E7H A;  2L3Q A;  3A5Z B;  3S3N A;  1KHI A;  4LDU A;  1QVP A;  3SEM A;  2V26 A;  5EC7 A;  2RI2 A;  5GMK l;  2E10 A;  4M75 C;  4XU1 A;  5FU6 C;  3CCV A;  2DIL A;  2PQW A;  1UEB A;  2NUP A;  1KQ1 A;  2DL4 A;  2KRN A;  4DBR A;  3MHX A;  3MEA A;  2FHD A;  2O4X A;  3LX7 A;  2AT1 B;  3OMG A;  3HFN A;  4Z89 A;  3G4S A;  1VQ8 T;  3V8K A;  1ZSG A;  3M0U A;  1VQN Q;  2FVU A;  4EDU A;  5FLX E;  1KQS P;  1VQO A;  2WSF E;  4C8Q B;  4XQ3 A;  4FM4 B;  2GTJ A;  1HYO A;  2FG0 A;  1WZO A;  1VQM T;  1QKX A;  4CC3 A;  1X6B A;  1XNI A;  1YCS B;  2EW3 A;  2L89 A;  1WJQ A;  3TEE A;  1NLP C;  3I55 T;  4HA8 A;  2M51 A;  4F16 A;  3CXC S;  2EJG A;  5CIU A;  4DEX A;  1OU8 A;  1WLP B;  2QXF A;  4N0A A;  2VGN A;  1VQM A;  1Q7Y R;  5GAO m;  3NFC A;  4M78 A;  2Y4Y A;  3H0F A;  3QDF A;  4A63 B;  1X27 A;  2FZK B;  3S3M A;  3R6N A;  2O9S A;  1K8A C;  3VYH B;  2RQV A;  5LJ5 j;  3CCQ Q;  3EG2 A;  2CT3 A;  2RA2 A;  4E7J A;  1IHV A;  2EWN A;  3J7A F;  2EGE A;  2XG8 D;  1FMW A;  1AD5 A;  3JCM h;  3LGL A;  4OGC A;  1ZUK A;  1VQ9 Q;  1OQK A;  1UGS B;  4C92 A;  2E64 A;  1EIF A;  2GFU A;  1SRL A;  2P0Q A;  4A4F A;  2ABL A;  2RQR A;  4Q5W A;  2XKO C;  3ZEH A;  2DXU A;  3FJ5 A;  4FSS A;  4D8K A;  5HK3 A;  4M7A G;  1G3Y A;  2KGT A;  4F7U G;  8AT1 B;  3JCM g;  4JRK A;  2Y4X A;  1OUL A;  4ZN3 A;  1LJO A;  5A0G A;  5AYF A;  1D3B A;  3CCV T;  1VA7 A;  1JQQ A;  3LWH A;  2LJ0 A;  1NZ9 A;  2YSQ A;  1LNX A;  3G6E A;  1U3O A;  2KVQ G;  3QWY A;  1OPK A;  1Q86 R;  2FPD A;  1KQS A;  4OMP A;  4CC7 A;  3I56 A;  3PGG A;  3X24 B;  3CCR T;  3QYH B;  1PCX A;  2KK4 A;  3LH0 A;  2MMP A;  1Y7X A;  1U8R A;  1Z9Q A;  4NL2 A;  2DEU A;  1VQ6 Q;  2D1X A;  3PIO A;  5GAN j;  2J05 A;  1GL5 A;  2QA4 Q;  1N9R A;  3CCM T;  3RES A;  4IIO A;  2DYI A;  3FIF A;  4M7D D;  4C0F A;  1UE9 A;  1X6O A;  4MDW A;  5LJ5 f;  3JCM f;  1VQK T;  5CKE A;  3CCE T;  4J7F A;  5LJ5 e;  2DZ9 A;  2MI6 A;  3NHN A;  3JB9 D;  2VC8 A;  2VB6 A;  4N4G A;  2EBP A;  3RKW A;  3EGX A;  4BB7 A;  2GCX A;  2DRK A;  2QEX A;  2E5K A;  1WXU A;  1UHC A;  4IUR A;  4Y28 E;  4LNP A;  5CQX A;  4AG2 C;  3X20 B;  1UHF A;  2QQB A;  3SDZ A;  1BB9 A;  2K3B A;  3OYD A;  4PJO F;  2K5L A;  3LW5 E;  4HCC A;  3JCM e;  5IXB A;  4M7A E;  3M0R A;  2ZPF B;  3CCS A;  1HXD A;  2GQI A;  3REA B;  1C0M A;  3E2U A;  2KDS A;  1PM3 A;  2JJ9 A;  4P5N A;  2OTJ T;  2EFI A;  2M1H A;  1HK9 A;  4D8D A;  2K4Y A;  1JU5 C;  1PNJ A;  2ZAE A;  3AHU A;  5D6W A;  2VAS A;  1NEB A;  2L3R A;  5IHK A;  2D6F A;  1MMA A;  2QG9 B;  1YJN T;  3UA6 A;  3NPF A;  1YJN Q;  2M0Y A;  1RLQ C;  2QGF B;  3H0H A;  3A98 A;  2KSS A;  3VU3 C;  3SD4 A;  1ZHI A;  5A0D A;  2YRV A;  2F2W A;  1U06 A;  4C92 E;  2O88 A;  2DER A;  5CKD A;  4PJO C;  5GAN f;  2LJ3 A;  1YJN A;  3MEV A;  5GAM f;  5GAO n;  2DXT A;  1QW1 A;  2GFA A;  3PMI A;  4C8Q A;  2EQI A;  1VQ8 A;  3N5B B;  5GJV B;  3RKX A;  5DLO A;  2J6K A;  2EKO A;  2DIG A;  3AT1 B;  1K73 U;  4IUP A;  2MAM A;  4X9D A;  3QYG B;  1I5O B;  2LJ1 A;  2Z0W A;  4C5I A;  1X75 C;  1TUG B;  1Q81 C;  1SEM A;  4F7U F;  4JRP A;  4N4I A;  4PL6 A;  4NL3 A;  1K4U S;  1K0S A;  1V1C A;  1QVG S;  2ROT A;  4L5G A;  4LD6 A;  1VIE A;  5CKH A;  2EQK A;  2QDL A;  3FLG A;  1OI1 A;  3I56 Q;  3CBP A;  2LP5 A;  2V1R A;  2QDY B;  2RB6 A;  3I56 T;  1IGQ A;  4J8O A;  3NGP A;  2CSI A;  2JW4 A;  1H3H A;  2FO0 A;  2XK0 A;  3CMA Q;  1OYX A;  5DM7 R;  4BE2 A;  5DY9 A;  3CMA T;  3C95 A;  2RI3 A;  3CCJ T;  1R0B G;  3JAM E;  3UPU A;  3V7R A;  5I11 A;  3CCM A;  1M90 U;  4M7A A;  1K73 C;  4FW1 A;  5KYW B;  4IUU A;  1MHN A;  3FB9 A;  1WPY A;  3VS4 A;  4LUD A;  2L0A A;  1T0H A;  4OMF B;  1N8R U;  2D0N A;  4KH0 B;  3M0T A;  3JB9 J;  1G3S A;  3OYI A;  1KFZ A;  1OEB A;  1GCQ C;  1RAC B;  2GGR A;  4KGX B;  1R77 A;  5L23 A;  2K57 A;  2HCK A;  3EG3 A;  2QGG A;  2H8H A;  3H6Z A;  2E6Z A;  1UFF A;  5GAM j;  1M3A A;  3A8O B;  3L2R A;  1XQH A;  2GQV A;  2OAU A;  3CC4 T;  2OJ2 A;  3BDU A;  2YT6 A;  3GNF B;  2KT8 A;  4FSX A;  3M55 A;  2MK5 A;  3NMZ C;  3EH2 A;  2EYX A;  2HMA A;  4J9B A;  3CCU T;  1BIA A;  2CUB A;  4ESR A;  2JN0 A;  1VQ5 A;  4J9H A;  4PJM A;  4JJN K;  2VGM A;  5I2M A;  2JOY A;  4C5G A;  4C92 F;  1YJW T;  4FW2 A;  1WI7 A;  2DEQ A;  1YN8 A;  1VOM A;  1WQ7 A;  2X9H A;  1SHG A;  1JB0 E;  1W4S A;  4M75 E;  4QQG A;  4QVC A;  3G71 Q;  2ED1 A;  1UUE A;  2DVJ A;  1AWX A;  3QZ5 B;  3ZBD A;  2O01 E;  4FYX B;  3A8H B;  2JXB A;  2A28 A;  2JM8 A;  1VQO T;  2QQ9 A;  3HP9 A;  5GAN 8;  3L2Z A;  1M2V B;  5CO7 A;  4EMK A;  1BYM A;  2PVG B;  3V7C A;  2DPP B;  1VQ7 T;  2LC4 A;  4L6V 5;  3V8L A;  2MWO A;  2BIV A;  3I55 A;  3QDR B;  2WAC A;  2QEX Q;  4ZGD B;  2DET A;  2IVW A;  2V8K A;  3VS1 A;  3FDR A;  4M75 F;  3PE0 A;  2VWF A;  2J6O A;  2IIM A;  1KQS S;  3VS0 A;  1NPR A;  3OYY A;  4M78 E;  1ZBX A;  5CK9 A;  2EGC A;  2X4X A;  1RAI B;  3S3O A;  2K2V A;  2EJ9 A;  3CC7 T;  4FU6 A;  4NOY A;  3MP1 A;  3M0S A;  5DLQ E;  1RL2 A;  3EFR A;  3EFO A;  3NTK A;  4LDY A;  1Z9Z A;  1M1K R;  2JTM A;  5GAO p;  1X2Q A;  1XOV A;  1V29 B;  3CCV Q;  4M7D F;  1SSF A;  3PIP A;  3E1S A;  3BDL A;  2CZ7 B;  5GMK h;  1QVF S;  1O9S A;  3TRE A;  3M59 A;  4OB0 B;  3CQT A;  3CPW S;  1QMC A;  4AT1 B;  3P8H A;  3H41 A;  4EMG A;  5LJ3 f;  4BE0 A;  4JLG A;  5I2S A;  5KE2 A;  2COZ A;  1ZUU A;  1VQP Q;  3UT1 A;  1KK7 A;  3M56 A;  2BE9 B;  2OX7 A;  4M75 D;  2JUF A;  3DB4 A;  3OS5 A;  1VQ6 T;  1S72 T;  2HSP A;  5LL6 S;  1K9M R;  4RG2 A;  1S72 Q;  2JTF A;  3TU4 K;  3H9N A;  4C92 C;  2AHJ B;  2DLP A;  3CCM Q;  2DTH A;  2HSE B;  3L2U A;  3CC2 Q;  2GTO A;  1NG2 A;  2DO3 A;  1JXO A;  2B8A A;  1TTH B;  3I5S A;  2CP3 A;  3ASK A;  4OML A;  2K2M A;  4ORZ A;  2KT1 A;  1VQO Q;  3QJ6 A;  2FEI A;  2DZC A;  2M02 A;  4X9C A;  3JCM V;  4CC4 B;  1WDX A;  1M27 C;  3V7S A;  5LJ3 g;  3QSU A;  4MML A;  1T3L A;  4AFZ C;  1H8K A;  5CCA A;  2OTL T;  5GAN 3;  4Y91 A;  2VXF A;  1YJW A;  2OTL Q;  4RTW A;  2K9G A;  2KI7 A;  1QCO A;  4A4G A;  4DBF A;  2YRD A;  2MCN A;  5KYN A;  3QUI A;  4ATO A;  3OB9 A;  4CRI A;  2RHI A;  4J9E A;  3LYI A;  1GRI A;  2LQN A;  1B3Q A;  1JJ2 A;  5CKB A;  3CC7 Q;  2EYY A;  3OMC A;  4RMO A;  2JS2 A;  1WYX A;  2D8H A;  3CPF A;  4QKU A;  2HQH A;  3C4S A;  3X25 B;  1S1N A;  1KD1 R;  2ZPI B;  1ZX6 A;  1YHQ T;  2D0Q B;  1W2B S;  3OBW A;  4C8Q E;  4DOW A;  1QP3 A;  1JJ2 P;  5CR2 A;  2ENM A;  3JB9 G;  1M9S A;  3BFM A;  1PRM C;  1X69 A;  5GAN 7;  2CS7 A;  2R5A A;  2ZPG B;  1OPL A;  3TCJ A;  2YUQ A;  2ZPH B;  4M7D G;  4O5V A;  4PKC C;  3URG A;  1RAB B;  2XIC A;  1P92 A;  2KXC A;  2A0F B;  2FRW A;  4KRT A;  1UJ0 A;  3CC2 T;  5C0M A;  2V8J A;  3M5A A;  3EHR A;  2GBQ A;  3QKJ A;  2QQR A;  1BBZ A;  2CP0 A;  3GBQ A;  1MV3 A;  2YXY A;  2CZ6 B;  4XU2 A;  3JCM X;  1VQL Q;  2DAQ A;  5GMK i;  1VQL T;  2CGH A;  1VIF A;  3VS7 A;  1W1F A;  1MGQ A;  1D1B A;  4XU3 A;  2JMC A;  3REB B;  2K7A A;  2IG0 A;  3CXC P;  4EPC A;  7AT1 B;  2DBK A;  1M1F A;  2BE7 D;  5LJ3 h;  3HTR A;  2NUZ A;  3OYM A;  1BKB A;  2DBM A;  3HRU A;  1NPP A;  5GAN 6;  3M53 A;  2RJF A;  1M2O A;  4J9D A;  3QXE B;  3RBB B;  4FYY B;  4HVU A;  1SF9 A;  4BY6 B;  4A54 A;  2E65 A;  1D1C A;  3CCU A;  2CP7 A;  2BZ8 A;  3VJP A;  1I4K 1;  2JT4 A;  4GBQ A;  4KGZ B;  1Q81 R;  1N6A A;  1YWP A;  4C8Q G;  3HRS A;  4M7A B;  4M7A C;  2DRM A;  3EGD B;  3QWX X;  3KFV A;  4XK8 E;  2JNG A;  3I55 Q;  2CSQ A;  4DA4 A;  2CP2 A;  2KEA A;  5GAN 4;  2M0O A;  1QVG P;  4Z02 A;  1LPL A;  4HXJ A;  4J9C A;  1YJ9 Q;  1NYF A;  1Y0M A;  4C5E A;  4BY6 C;  4PJO B;  3EAE A;  3I35 A;  1BCO A;  5LJ3 e;  3A1P A;  4LDW A;  1UGR B;  1Y96 A;  2LRQ A;  1W2B A;  1KD1 C;  2KQW A;  4D6W A;  3M58 A;  1MMG A;  1N8R C;  2P4T A;  3X26 B;  4JS5 A;  1BI3 A;  1Q7Y U;  1IGU A;  2RK2 A;  3HHT B;  3KXT A;  3CCE A;  2GF7 A;  1QQJ A;  4CI0 C;  2RQT A;  3EG9 A;  1OOT A;  4AG1 C;  3MET A;  1FX7 A;  2EPD A;  3CCQ A;  2YRC A;  4PJO D;  2AK5 A;  3QG1 A;  1M90 R;  2ZPE B;  4HVV A;  4QQD A;  2EQU A;  4MDX A;  2DL5 A;  4QW2 A;  4ME7 A;  4MZM A;  1RLP C;  2VV5 A;  1KC8 U;  5HK0 A;  2YUN A;  5GAN 2;  1OZ2 A;  2QTX A;  3CME T;  3INZ A;  3KBG A;  2LQW A;  4M7D A;  1BI0 A;  3JSC A;  1QCF A;  2K6D A;  1B07 A;  3VRZ A;  5GMK j;  1SG5 A;  2VKN A;  2EYZ A;  3C94 A;  1TXQ A;  3SFM A;  1YBY A;  4RTY A;  5CQY A;  1MND A;  1NLO C;  3M0Q A;  1NE8 A;  3CD6 Q;  4MMK A;  3G6E Q;  4JJD A;  2R57 A;  3OYC A;  1VQ4 A;  1VQN A;  2DK3 A;  2MWP A;  3CEY A;  1ZSZ C;  4JDS A;  1B7T A;  1SSH A;  1VYT A;  3CC4 Q;  1TU0 B;  2M16 A;  1VQK Q;  2OI3 A;  2AKL A;  2YUP A;  3GF5 A;  3H8Z A;  2XU8 A;  1B34 A;  2YLC A;  2ROL A;  3NTI A;  4OF1 A;  4XU0 A;  1M30 A;  2DA9 A;  2HD0 A;  2COW A;  1WGS A;  2CT4 A;  2DYB A;  3M9Q A;  4E47 A;  1RAA B;  2YHT A;  1WXB A;  4ZTF A;  3JV3 A;  3D7S B;  4FT4 A;  4O6J A;  2RNA A;  2PZ1 A;  1ACM B;  4IIM A;  4QQ6 A;  2A36 A;  2F2V A;  4AMC A;  1SPK A;  2DJZ A;  4F7U A;  2QA4 T;  1D3B B;  2KNB B;  5KYY B;  3E19 A;  3CPW A;  1D09 B;  4J6X A;  1VQM Q;  2RHX A;  3EFS A;  3OYA A;  2DKG A;  1BI2 A;  3TVT A;  4OMM A;  2OTJ Q;  3OYJ A;  4WF2 A;  2RM4 A;  3CCE Q;  3DLM A;  3L1A A;  4XTZ A;  1U5S A;  5KYX B;  3OS0 A;  2RPN A;  1MMD A;  2BKD N;  4KBM B;  3THK A;  4TVR A;  3H0I A;  4M77 A;  4II1 A;  2YLB A;  1D0X A;  3CCS Q;  4PJN A;  4OP0 A;  3L2W A;  3DB3 A;  1M1K C;  3FJP A;  1M3C A;  4C92 G;  2X3W D;  1GCQ A;  5GAM g;  2LVM A;  1AVZ C;  2XDP A;  2LZ6 B;  2LNH B;  4C5H A;  1VQL A;  2EQJ A;  2HQX A;  3OYG A;  1E7O A;  4X34 A;  3TSW A;  4PFP A;  4XTW A;  1KIK A;  1K8A R;  4C0G A;  1OX8 A;  4XAX B;  4DBH A;  1ARK A;  1Y96 B;  1YIT T;  3JCM d;  1RAF B;  4XTV A;  2EAY A;  1K9M C;  1IHW A;  2EKH A;  3JCM W;  2HL3 A;  4J9I A;  3CCL Q;  2P4R A;  2PVD B;  3E9F A;  3JCM c;  1RI9 A;  2DX1 A;  3MKD A;  5GAO r;  4J7I A;  4HT9 A;  1HSQ A;  1VQP A;  4AFU C;  4PJJ A;  1JRI A;  3HSB A;  3P8B B;  1AHJ B;  3HL8 A;  4C0D C;  5KYX A;  2LT4 A;  1TOV A;  4RKU E;  3UWN A;  2FZG B;  2HNI A;  2HBP A;  4IUQ A;  3OYF A;  1KD1 U;  1C6V X;  3WVE B;  2O2O A;  3ZL7 C;  2PVO B;  3EGX B;  3JB9 I;  4M75 B;  2XDD A;  1VQ4 T;  5FU6 B;  1BK2 A;  1IO6 A;  2DXB A;  1ZQ1 A;  2PNI A;  1GXI E;  1EZZ B;  2RF0 A;  4HT8 A;  3VS3 A;  2E3H A;  1PG5 B;  1Q82 R;  5J39 A;  1ZA2 B;  2H3E B;  4C0D B;  4M7A F;  1XTD A;  3RIR A;  4EMK B;  3L42 A;  1MV0 B;  3BE3 A;  4E7I A;  3LGF A;  2E70 A;  4M7D C;  2KYM A;  4OGE A;  1ZBJ A;  4IUV A;  1RUW A;  1G83 A;  1YI2 Q;  3O8V A;  3OQ5 A;  2NLU A;  3OW2 S;  4PJL A;  4E7S A;  3VUB A;  2PTK A;  2ESW A;  1MMN A;  1PWT A;  2EQM A;  4J9F A;  5GAN d;  4KH1 B;  2JS0 A;  2D8J A;  3I5R A;  3GNG A;  3R6O A;  1WIE A;  4OB2 B;  3MP6 A;  2BTT A;  3ULR B;  1YWO A;  4FT2 A;  2W10 A;  1JBM A;  1K1Z A;  3J80 E;  2ZGW A;  4PNO A;  2A3L A;  1KG1 A;  2RD1 A;  1YIT Q;  4NS5 A;  2FB7 A;  3SHW A;  2JZ2 A;  4M4Z A;  4IKF A;  1YJ9 A;  2KXD A;  5KH6 A;  1IRE B;  4HCB A;  1WQW A;  3Q1J A;  2C0T A;  2RQW A;  2HEQ A;  3DKM A;  4DOV A;  1N5Z A;  1PD0 A;  2LQK A;  3MJX A;  4J6W A;  1UJY A;  3MEW A;  4EMH A;  1WNL A;  2FRY A;  2NUT A;  2C0O A;  2LTO A;  5GJW B;  2HAX A;  2A08 A;  3CCQ T;  2DL3 A;  1C1A A;  4ZNX A;  1SHF A;  2KRO A;  4LUE A;  1PSE A;  2H3J A;  3CCU Q;  1S72 A;  5J26 A;  1WHJ A;  5GAN e;  2L2P A;  1X2K A;  3M4Y A;  5GAN 5;  2JVV A;  1GFD A;  3RMS A;  5KYW A;  5LJ3 j;  1SRM A;  4LXC A;  1TSF A;  3JB9 H;  1WHL A;  2BZX A;  5FWB A;  2K3X A;  3OBY A;  1WXT A;  1DJ7 B;  1NJI U;  1TWB A;  2DD4 A;  5GAO l;  3G4S Q;  4M75 A;  3OA6 A;  5HY6 A;  4PFZ A;  4WCI A;  2NYS A;  4FIB A;  2DL7 A;  4Y92 A;  1VQN T;  3CCJ Q;  3G6E T;  1AWO A;  3L2Q A;  3GP8 A;  2RK1 A;  3VS5 A;  2QYZ A;  3LLR A;  4J6Y A;  4E7Z A;  2CP6 A;  1WJS A;  2DE0 X;  4M78 D;  3CCL A;  1YNZ A;  1U1T A;  1WA7 A;  1QKW A;  4JJC A;  1YIJ Q;  1BIB A;  1PC0 A;  2CYZ B;  4ZTJ A;  1TUC A;  1ZUY A;  2RMO A;  1Q86 U;  4BI8 B;  1K73 R;  2HKN A;  3CD6 T;  3MO8 A;  4X1V A;  3CBO A;  1NM7 A;  1HD3 A;  1YIT A;  4KUD K;  3MP8 A;  1VQ7 A;  2PUO B;  2CZ1 B;  3V8J A;  3OSS C;  1VQK A;  5HCK A;  1VQ8 Q;  4M77 C;  2RI5 A;  2VXE A;  2BZY A;  2MF2 A;  3NTH A;  5ECA A;  1E6G A;  1G8X A;  2FPE A;  4J83 A;  4PLI A;  1FMV A;  2E4H A;  3A8G B;  1PHT A;  4BAC A;  1Y07 A;  5IN1 A;  2QK0 A;  2XHC A;  3UDC A;  2ZZD A;  5IHN A;  2DIQ A;  5IT9 E;  3C0C A;  3ZFJ A;  8ATC B;  5IXF A;  1N9S A;  4N0A C;  1I8F A;  1AT1 B;  2DNU A;  1YJW Q;  2OTL A;  4B9X A;  2KY9 A;  4HCZ A;  1LOJ A;  3OW2 A;  1MUZ A;  1KSW A;  4A4K A;  2E1H A;  4ZN1 A;  3HPW A;  3GLX A;  2ZCF B;  3CCS T;  3RNJ A;  3EGU A;  3EFO B;  1VQ9 A;  1FYN A;  4LDX A;  5J3B A;  3UAT A;  1UEC A;  1YI2 A;  5FWC A;  1G2B A;  3RER A;  3EG0 A;  1OV3 A;  3OYK A;  3WVD B;  2K5F A;  2NUP B;  3CCR Q;  1CKA A;  4M77 D;  2QA4 A;  2KBT A;  2YDL A;  4A53 A;  5A0L A;  3OYE A;  1VQ6 A;  3CCJ A;  1VQ9 T;  2ZPB B;  3CBM A;  2P84 A;  3QII A;  3PFS A;  4F7U B;  4XTU A;  4QVZ A;  4AFS C;  2QEX T;  2K3Y A;  2QAS A;  1PKT A;  4E6R A;  2XDB A;  1ZLM A;  1D1A A;  1NYG A;  1TUD A;  1R8O B;  2CH4 W;  1JEG A;  2LX7 A;  5LJ5 d;  2F69 A;  3CD6 A;  3CXC A;  1O75 A;  4RTZ A;  3PVQ A;  2DTI A;  2I2L A;  5GMK e;  3FEO A;  4M7D E;  3KUF A;  3HFO A;  1QVG A;  4ELY C;  4JUV A;  2M9U A;  3A8M B;  1I81 A;  2F5T X;  1VYU A;  2RH2 A;  4KGV B;  2C06 A;  2YWW A;  1AZG B;  5KCH A;  4KUI A;  1QWF A;  2P0K A;  4ZGJ B;  1M4Z A;  3EG1 A;  2DFU A;  1T3S A;  2RJE A;  3SWN A;  4E7K A;  2QQA A;  2RQU A;  5M9O A;  2L3P A;  1QP2 A;  3CC2 A;  2NUT B;  1UTI A;  4PFO A;  4LE9 A;  3OYH A;  3G7Z A;  3M57 A;  4ELZ C;  5AT1 B;  4DQ2 A;  3OYB A;  2ECZ A;  3O5Z A;  5CAI A;  3QHS A;  3RR6 A;  2COY A;  1VUB A;  2KYB A;  4PJO G;  1FXX A;  2AZS A;  1W6X A;  3QPH A;  1D0Y A;  1K9M U;  1ZSZ A;  4B9W A;  2E12 A;  3GIB A;  2VVK A;  2XD0 A;  4E7L A;  3ER0 A;  3JCM b;  2K5I A;  2OAW A;  5FU7 C;  4A4H A;  4FYV B;  5IH2 A;  1M3B A;  4DEY A;  1Y57 A;  1NJI C;  3GPL A;  5GAN h;  3OW2 P;  2KRM A; 
#chains in the Genus database with same CATH homology
 2IIM A;  1GCQ A;  1I1J A;  5EC7 A;  3VS0 A;  1AVZ C;  1W70 A;  2LZ6 B;  2LNH B;  2EGC A;  1E7O A;  3TSW A;  2DIL A;  1FMK A;  2DL4 A;  2KRN A;  4OMN A;  1KIK A;  3VS2 A;  3M0S A;  1K9A A;  4Z89 A;  1ARK A;  2JTE A;  4J9G A;  1Z9Z A;  2EKH A;  1X2Q A;  1XOV A;  1ZSG A;  3M0U A;  1WX6 A;  4J9I A;  2P4R A;  2CRE A;  2JMA A;  1RI9 A;  2SRC A;  3CQT A;  2DX1 A;  2GTJ A;  1HSQ A;  4AFU C;  2FG0 A;  1A0N B;  3H41 A;  1QKX A;  2ED0 A;  4CC3 A;  1ABO A;  1X6B A;  1ZUU A;  1YCS B;  2EW3 A;  2A37 A;  1GBR A;  1I0C A;  1NLP C;  3PVL A;  3IQL A;  2M51 A;  4Z88 A;  4F16 A;  2HSP A;  4DEX A;  1WLP B;  2O2O A;  3ZL7 C;  2DLP A;  4RTU A;  1AWW A;  3I9Q A;  2GTO A;  1BK2 A;  1NG2 A;  3UA7 A;  3H0F A;  1IO6 A;  1JXO A;  2PNI A;  3I5S A;  4A63 B;  1X27 A;  2RF0 A;  2MIO A;  4OML A;  2AZV A;  5I22 A;  2K2M A;  2HBW A;  4ORZ A;  2KE9 A;  2O9S A;  3R6N A;  2KT1 A;  2RQV A;  2DL8 A;  1ABQ A;  3EG2 A;  2CT3 A;  3VS3 A;  2FEI A;  1E6H A;  1UGV A;  1X43 A;  2EGE A;  1AD5 A;  1CSK A;  1ZUK A;  4CC4 B;  1WDX A;  1K76 A;  4RTT A;  1M27 C;  1SRL A;  1T0J A;  2ABL A;  2RQR A;  1MV0 B;  2CUD A;  3LH5 A;  1T3L A;  4AFZ C;  2O31 A;  1H8K A;  3FJ5 A;  4FSS A;  4D8K A;  2KYM A;  2O9V A;  2KGT A;  1ZBJ A;  4F17 A;  1RUW A;  1G83 A;  4EIK A;  4RTW A;  2K9G A;  2J6F A;  2PTK A;  2ESW A;  1VA7 A;  1JQQ A;  2MCN A;  1PWT A;  2LJ0 A;  2YSQ A;  4J9F A;  4JJB A;  2JS0 A;  2D8J A;  3I5R A;  4J9E A;  1U3O A;  1I07 A;  4GLM A;  3QWY A;  1GRI A;  2LQN A;  1B3Q A;  1OPK A;  1WIE A;  2BTT A;  2FPD A;  3ULR B;  4OMP A;  1YWO A;  4CC7 A;  2EYY A;  3VS6 A;  2JS2 A;  2W10 A;  1WYX A;  1K1Z A;  2D8H A;  2MOX A;  3U23 A;  4RTV A;  2DF6 A;  3SHW A;  1S1N A;  1Z9Q A;  2GNC A;  4M4Z A;  1ZX6 A;  2KXD A;  2D1X A;  1AOJ A;  2J05 A;  2EVR A;  1GL5 A;  2KRS A;  1QLY A;  4IIO A;  3TSZ A;  2C0T A;  2ENM A;  2RQW A;  2HEQ A;  1N5Z A;  2LMJ A;  1PRM C;  1UE9 A;  1UJY A;  1X69 A;  2FRY A;  1UG1 A;  4JZ3 A;  4OMO A;  2C0O A;  5GJW B;  1OPL A;  2A08 A;  4CC2 A;  2YUQ A;  3NHN A;  2DL3 A;  3UF4 A;  4ZNX A;  1AEY A;  1SHF A;  2EBP A;  2KRO A;  4LUE A;  2KXC A;  2DRK A;  2E5K A;  1UHC A;  1WXU A;  1VYV A;  2FRW A;  4JZ4 A;  4KRT A;  1UJ0 A;  4LNP A;  4AG2 C;  4HCK A;  3EHR A;  2GBQ A;  1UHF A;  2L2P A;  1X2K A;  1J3T A;  1BB9 A;  2NWM A;  2K3B A;  1GFD A;  1BBZ A;  3GBQ A;  1MV3 A;  1TG0 A;  5IXB A;  1EFN A;  3M0R A;  1SRM A;  3VS7 A;  1W1F A;  2EYW A;  2JMC A;  3REB B;  2GQI A;  3REA B;  2K7A A;  2BZX A;  5FWB A;  4OMQ A;  1WXT A;  2DBK A;  4D8D A;  1YP5 A;  2NUZ A;  1JU5 C;  1PNJ A;  2DBM A;  5IHI A;  1NEB A;  1H92 A;  4WCI A;  5IHK A;  4J9D A;  1BU1 A;  2DL7 A;  4Y92 A;  3RBB B;  4HVU A;  3UA6 A;  2X3X D;  3SEM A;  3NPF A;  1AWO A;  2M0Y A;  2FPF A;  1GFC A;  1RLQ C;  4LN2 A;  2BZ8 A;  3H0H A;  3VS5 A;  3A98 A;  2JT4 A;  4GBQ A;  2DE0 X;  1YWP A;  2F2W A;  1UDL A;  1YNZ A;  1U06 A;  1WA7 A;  1QKW A;  1X6G A;  2DRM A;  4JJC A;  2O88 A;  2EGA A;  2LJ3 A;  1TUC A;  3KFV A;  3QWX X;  1ZUY A;  1AZE A;  2DM1 A;  2RMO A;  2CSQ A;  4JPB W;  1QWE A;  4X1V A;  1NM7 A;  2KEA A;  1KJW A;  3M0P A;  1HD3 A;  2EQI A;  4HXJ A;  5GJV B;  4J9C A;  1NYF A;  2DMO A;  1Y0M A;  1JXM A;  2J6K A;  5HCK A;  3I35 A;  2LJ1 A;  2J7I A;  1SEM A;  2BZY A;  2HDA A;  5ECA A;  1E6G A;  2G6F X;  1CKB A;  1PKS A;  2FPE A;  2CDT A;  2J06 A;  1PHT A;  1PRL C;  4K11 A;  1K0S A;  1V1C A;  1K4U S;  2ROT A;  5IHN A;  1NEG A;  2RQT A;  1OOT A;  1LCK A;  4AG1 C;  2QDL A;  3C0C A;  2EPD A;  3EHQ A;  3PE0 A;  2KR3 A;  1WFW A;  2LP5 A;  2V1R A;  5IXF A;  2AK5 A;  4RTX A;  4HVV A;  3NGP A;  2DNU A;  2CSI A;  2JW4 A;  2SEM A;  1MUZ A;  2DL5 A;  1H3H A;  1KSW A;  2FO0 A;  2CH4 A;  1RLP C;  3RNJ A;  2K79 A;  3EGU A;  2F2X A;  2AKK A;  2YUN A;  1FYN A;  2L3S A;  5I11 A;  3UAT A;  1UEC A;  5FWC A;  1G2B A;  2LQW A;  3EG0 A;  1OV3 A;  3VS4 A;  4LUD A;  3VRY A;  1QCF A;  2L0A A;  1T0H A;  2K6D A;  1B07 A;  3VRZ A;  2D0N A;  3M0T A;  2VKN A;  2EYZ A;  2I0N A;  1KFZ A;  1CKA A;  1OEB A;  2KBT A;  1GCQ C;  2GGR A;  2YDL A;  4RTY A;  5L23 A;  1NLO C;  2HCK A;  3EG3 A;  2B86 A;  2H8H A;  3M0Q A;  1UFF A;  1M3A A;  4HVW A;  4JJD A;  2RN8 A;  4AFS C;  1PKT A;  4E6R A;  1ZLM A;  1NYG A;  2YUO A;  1TUD A;  2OJ2 A;  4R0K A;  2CH4 W;  1SSH A;  1VYT A;  1JEG A;  2XMF A;  2YT6 A;  2LX7 A;  2OI3 A;  2AKL A;  4RTZ A;  2YUP A;  3PVQ A;  2KT8 A;  1GCP A;  2W0Z A;  1GBQ A;  2ROL A;  3NMZ C;  1M30 A;  2EYX A;  1VYU A;  4Z8A A;  4J9B A;  1AZG B;  2DA9 A;  2DJQ A;  1QWF A;  2CUB A;  2CT4 A;  4ESR A;  2DYB A;  4J9H A;  4AFQ C;  1WXB A;  3EG1 A;  4RUG A;  1M8M A;  3JV3 A;  1T3S A;  2RNA A;  2PZ1 A;  1JO8 A;  4IIM A;  2RQU A;  2L3P A;  1WI7 A;  2A36 A;  2F2V A;  1YN8 A;  1UTI A;  4LE9 A;  1SPK A;  2V1Q A;  2KNB B;  2ECZ A;  3O5Z A;  1SHG A;  2ED1 A;  4QT7 A;  2DVJ A;  1UUE A;  1AWX A;  2LCS A;  4F14 A;  2KYB A;  1AWJ A;  4OMM A;  3TVT A;  2AZS A;  1HJD A;  2JXB A;  2A28 A;  2JM8 A;  1W6X A;  1U5S A;  2RPN A;  2C0I A;  1K0X A;  3THK A;  2JM9 A;  3H0I A;  5FW9 A;  2VVK A;  2OAW A;  2L3Q A;  5IH2 A;  1M3B A;  4DEY A;  1Y57 A;  1M3C A;  3VS1 A;  2X3W D;  2VWF A;  2J6O A;  2KRM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...