2O88A

Crystal structure of the n114a mutant of abl-sh3 domain complexed with a designed high-affinity peptide ligand: implications for sh3-ligand interactions
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
58
structure length
58
Chain Sequence
b'NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSAYITPVNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
publication title Crystallization by capillary counter-diffusion and structure determination of the N114A mutant of the SH3 domain of Abl tyrosine kinase complexed with a high-affinity peptide ligand.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 12
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2006-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2o88A00
1NEBA 2K2MA 2A37A 4ORZA 1AEYA 2OJ2A 4OMOA 2DA9A 1B07A 2H8HA 3U23A 1AWXA 4LE9A 2BZ8A 2CREA 1HSQA 1JO8A 4AFSC 2A36A 4Z88A 5EC7A 1ZLMA 2KGTA 4IIOA 2KXCA 2J6KA 2DRMA 2K7AA 4E6RA 1GBRA 1OEBA 3M0UA 2L3QA 1UHFA 1E6GA 2JM8A 2DL4A 3VS7A 1AVZC 2C0OA 3TSWA 3FJ5A 2CSIA 1VA7A 1RUWA 4AFZC 2KRNA 2ED1A 5IXBA 1S1NA 1AD5A 1PKTA 1H92A 4J9HA 2RQTA 1UUEA 1OV3A 2EPDA 4RTTA 1J3TA 2DX1A 4AFQC 1QKWA 1M3AA 4Z8AA 3R6NA 2FG0A 2EGAA 1MV3A 2ROTA 1KIKA 2BTTA 1BB9A 3REBB 1UTIA 2J05A 5IHNA 4KRTA 2EYWA 2VWFA 2KE9A 1CSKA 2V1QA 2DYBA 2J7IA 2A28A 1X69A 1RLQC 4HVVA 4J9IA 4EIKA 2O88A 2D8HA 2MCNA 1WFWA 2CH4W 4GLMA 3VRZA 2FPFA 1OOTA 3VS5A 1FYNA 2DILA 1PNJA 4J9CA 1BK2A 2MIOA 2KXDA 2DVJA 1K9AA 4JZ4A 2G6FX 2RNAA 5FWBA 1VYUA 1PHTA 1X6BA 1EFNA 1SRMA 1H3HA 4JPBW 4D8KA 2E5KA 1E6HA 1ZX6A 3VS6A 1ZBJA 2KYMA 3JV3A 4JZ3A 2KRMA 1LCKA 3EG3A 2RQUA 2LMJA 2EKHA 2JTEA 3EG1A 1YWOA 1WIEA 3I9QA 2X3XD 4RTYA 1WXUA 2O9SA 2EBPA 3EGUA 2M51A 1ABOA 1G2BA 5IXFA 2RQVA 2EVRA 3EG2A 3QWXX 1GFDA 1W70A 2K6DA 2DJQA 1NLOC 2CDTA 4R0KA 2V1RA 4J9GA 5IH2A 2KYBA 2O31A 3M0PA 5IHKA 4K11A 2VVKA 2DL7A 2DM1A 2JXBA 2YDLA 2HBWA 2JMCA 2NUZA 2AZSA 3VS3A 1NLPC 1MV0B 2BZYA 1YN8A 1SSHA 2W10A 2AKKA 2LJ3A 2ECZA 3H0HA 2L0AA 2AZVA 2EW3A 2RPNA 1V1CA 1GCQC 2P4RA 1TUCA 1BBZA 3EHQA 1NEGA 1OPKA 2EYYA 4HXJA 4RTXA 5L23A 2J6OA 1W1FA 1WLPB 2JS0A 1Y0MA 2ED0A 2LJ0A 2JT4A 4X1VA 1Z9QA 1I1JA 2KEAA 4ZNXA 1M8MA 4JJDA 2HCKA 4OMPA 1T0JA 1K4US 3NPFA 3NHNA 1RLPC 2CT4A 2CH4A 2LJ1A 3H0IA 1QCFA 4M4ZA 5GJVB 2ENMA 1PKSA 4A63B 3C0CA 2GTJA 4JJBA 1TUDA 2K3BA 4J9EA 4WCIA 4RTZA 4ESRA 2O9VA 1UJYA 3UA6A 3QWYA 2PNIA 2KT1A 3ULRB 3RBBB 3I5RA 3VS1A 4QT7A 5I22A 1ZUYA 3SEMA 1U06A 1WX6A 2FO0A 2A08A 2GQIA 1NM7A 2L2PA 2K9GA 1PRMC 2FRYA 2KBTA 2LX7A 4DEYA 3M0TA 1GBQA 2YUOA 1UDLA 2DRKA 2OAWA 4LN2A 1GFCA 4J9FA 3I35A 2DBMA 2YUPA 2DBKA 2M0YA 1T3SA 1BU1A 1W6XA 2YT6A 2KT8A 4GBQA 3LH5A 4CC2A 2LP5A 2L3SA 3ZL7C 1JU5C 2ABLA 2JW4A 1GCQA 2O2OA 3RNJA 2JS2A 2ESWA 2KR3A 1UJ0A 1Y57A 1GL5A 1RI9A 1Z9ZA 1SHFA 2F2XA 3M0SA 1ABQA 2J06A 1WDXA 1CKBA 4J9BA 2DL5A 1GRIA 1X2KA 1XOVA 2RN8A 4JJCA 4AG1C 1SRLA 2HEQA 1AWJA 2LZ6B 3PE0A 2RMOA 1QWEA 1M3CA 1U5SA 3VS4A 4RTVA 1ZSGA 4OMNA 2JM9A 1M30A 3VS0A 1M27C 1QKXA 1I0CA 1QWFA 2LQWA 3REAB 5IHIA 2BZXA 2SRCA 1E7OA 1JXMA 1NYGA 1K76A 1NG2A 5FW9A 2F2WA 3NMZC 2KNBB 2MOXA 1UFFA 2CSQA 1SHGA 2LQNA 4OMMA 2EYZA 2I0NA 4RUGA 5I11A 1KFZA 4HCKA 4RTWA 3VRYA 1K0SA 2NWMA 1SPKA 2PTKA 4AFUC 1YCSB 4LUEA 3NGPA 3VS2A 1FMKA 2GNCA 4AG2C 2GTOA 3IQLA 3M0RA 1NYFA 4LNPA 2FPDA 1YP5A 1X27A 2DL8A 1WXTA 4F17A 5ECAA 1AZGB 2AKLA 1ARKA 2DMOA 2JMAA 1U3OA 3GBQA 2LNHB 3EHRA 1MUZA 2B86A 2YSQA 2HSPA 1OPLA 1AZEA 2CT3A 3UA7A 4IIMA 1H8KA 1QLYA 3TVTA 1WYXA 1YNZA 3PVQA 2L3PA 4HVWA 1K0XA 1X43A 2LCSA 2C0TA 2J6FA 1I07A 4F14A 4RTUA 1CKAA 1G83A 1PWTA 2DNUA 2HDAA 2F2VA 2RQRA 1WA7A 1X6GA 2QDLA 2XMFA 2D0NA 2RQWA 4FSSA 2GGRA 2IIMA 2AK5A 2GBQA 1WXBA 3H0FA 1IO6A 1AOJA 4J9DA 4CC4B 1X2QA 2EGEA 1TG0A 1N5ZA 2W0ZA 1YWPA 2ROLA 5FWCA 3EG0A 4OMLA 2EGCA 4F16A 2OI3A 1KJWA 2D1XA 4OMQA 1VYTA 3A98A 2DF6A 2C0IA 1HJDA 2DLPA 2CUBA 2SEMA 3THKA 2EYXA 1JQQA 3SHWA 1K1ZA 2RF0A 2KROA 3PVLA 2K79A 4DEXA 1T3LA 1B3QA 4Y92A 5GJWB 2D8JA 3H41A 1VYVA 1ZUKA 1UHCA 1AWWA 2X3WD 1UG1A 3O5ZA 2FEIA 3M0QA 1A0NB 2DL3A 2FPEA 3UF4A 2CUDA 1UE9A 2VKNA 1AWOA 1UGVA 2YUQA 4HVUA 4CC7A 1SEMA 3KFVA 2DE0X 1T0HA 4CC3A 3TSZA 1M3BA 1ZUUA 3I5SA 4LUDA 1PRLC 1JEGA 2PZ1A 1HD3A 1WI7A 1KSWA 2YUNA 3UATA 4Z89A 4D8DA 1UECA 1GCPA 1JXOA 2EQIA 2FRWA 2KRSA 3CQTA 5HCKA
chains in the Genus database with same CATH superfamily
4ORZA 1AEYA 2OJ2A 4Z02A 2DA9A 3U23A 2A7YA 4FM4B 2CREA 3GIBA 4KT0E 2A36A 3EGDB 4C92A 4Z88A 1VQ9Q 3OBYA 3CMAA 1OU9A 1JRIA 5AT1B 3CC2A 2J6KA 4ATOA 1YJNA 4E6RA 3JCMc 2ZPBB 2WSCE 3EFOB 4M78C 1QVGA 1RAAB 1OEBA 1UHFA 4ZN3A 2JM8A 5AYFA 2BKDN 3FJ5A 2LT4A 4PKCC 3TEEA 1RUWA 4AFZC 2RM4A 2ED1A 4HKEA 1NJIC 1H92A 4XTXA 2HZYA 4MMLA 1R8OB 2L3RA 2RQTA 2RJCA 5KH6A 1UUEA 3PMIA 3D7SB 5FRNA 2DX1A 1WPYA 1YI2T 1UGRB 3R6NA 3CC7T 3OBWA 2BTTA 4OB1B 2X4XA 3CCET 3FRNA 4KRTA 2KE9A 3QIIA 2DYBA 3EG9A 5LJ3g 2HNIA 4HVVA 2YRVA 3CCSA 2EAYA 4JUVA 3JB9D 3PTAA 1M1KR 5C6SA 2RA2A 2KSSA 2DVJA 2E3HA 1IZ6A 3CC4T 1SG5A 3QZ5B 3M53A 5FWBA 2GQVA 1PHTA 4J8OA 1EFNA 5KYNA 4J5YA 3PIOA 1E6HA 4OB3B 1ZX6A 4X9CA 1VQ5T 5M9OA 2ZPIB 4OMFB 3JV3A 2WACA 1M1KU 4RCBA 3MPUB 1NPPA 3DB4A 4QVZA 1D1AA 4M77G 1O9SA 2IVWA 3I9QA 1WXUA 1PSFA 4M7DG 2EBPA 2KMTA 1YIJQ 4A4FA 3CMEA 5IXFA 5GAOn 2K3XA 2RJEA 5CO7A 4EMKC 1Q81R 4IKFA 3QWXX 2RJFA 1GFDA 1W70A 3E2UA 1NLOC 4GY5A 3V7SA 1K8AR 4BE0A 1D3BB 4NOYA 4XU3A 2XU8A 2QQSA 2JVVA 1U8RA 1Q81U 2YRDA 2EWNA 2RJDA 4HCCA 3VS3A 1VQ7Q 4IUUA 3NTIA 2W10A 2L0AA 1K8AU 1V1CA 2P4RA 3RKWA 1TUCA 1NEGA 1OPKA 1UEBA 4RCCA 2J6OA 2QG9B 2O01E 4LDYA 1G3YA 1RAGB 3BDLA 3G6EQ 2QEXA 5DLQE 2DTIA 4BUGA 3CXCS 4X1VA 2ZPFB 4ZNXA 4JJDA 1VIFA 4OMPA 1T0JA 5GAN3 4BI8B 2Y90A 1RLPC 2EQMA 2FB7A 4A54A 5GANf 2QK0A 1M2VA 5KYWA 1M4ZA 8AT1B 4DBFA 2E65A 3A8MB 3SWNB 4PFPA 2F1LA 1PKSA 2GTJA 2Y4YA 1VQ4Q 4J9EA 3CCRQ 2HL3A 4ESRA 2HSEB 2O9VA 3SD4A 3QWYA 2PNIA 5GAMd 2A0FB 4A4GA 3I5RA 1M8VA 2CP3A 3JCMb 3VS1A 4QT7A 4JLIA 1KHCA 3SEMA 1VQNQ 1WX6A 2GQIA 2XDDA 2JTMA 2K9GA 3BDUA 2FRYA 3RMQA 3EGDA 2X35A 2YUOA 3VUZA 2OAWA 5J26A 2DZ9A 4JRPA 4LXCA 5GAN2 5CCAA 1T3SA 1RACB 3G1JA 3EFOA 3LH5A 5GAN8 2BIVA 2D6FA 2L3SA 3OYIA 3CCJQ 2ABLA 2O2OA 3RNJA 2ESWA 1PCXA 1VQPA 4BDZA 3TREA 3OW2P 3GP8A 4P5NA 3SB2A 4J9BA 2DL5A 1X2KA 3P8BB 4AG1C 2LX9A 1SRLA 1AWJA 4C8QG 1TS9A 3LYIA 4XU2A 2HMAA 4PJOD 1NZ9A 3RKXA 4F7UA 2RMOA 4J7IA 2COWA 3VYHB 3MHXA 1PM3A 3VS4A 1M27C 4M75E 2ZGWA 1QKXA 1QWFA 3M9QA 1W2BP 2BZXA 2SRCA 1JXMA 3RKYA 3V8KA 5GANe 4XK8E 2EYQA 1BI1A 3CBMA 3OB9A 1X01A 2KNBB 4M75D 3CCUA 3C94A 4E47A 3CCVA 5FU7B 1GXIE 4C92E 1WHMA 2QA4Q 2KVQG 3EAEA 4KGZB 2EQKA 5LJ3h 3VS2A 2QQRA 3NGPA 2K5LA 4C0ZA 1D1BA 4A4KA 4AG2C 1C0MA 4LDVA 3CCQQ 3OYEA 1YP5A 4KGVB 1VQOQ 2DL8A 1Q7YU 2ZPGB 3DB3A 1TWBA 2AKLA 2NLUA 4NL3A 3KUFA 2DIGA 2LNHB 3EHRA 2DVEA 1OZ3A 2R5AA 2CP0A 2QQBA 3NFCA 1BIAA 1B34B 1WQWA 3MEAA 4IIMA 1QLYA 3M55A 5CKEA 1WYXA 4M75B 4X34A 2JOYA 4M7AG 2L3PA 2X51A 1QVFA 1MMDA 4RTUA 2M16A 1G83A 4CRIA 2HKNA 2HDAA 2RQRA 2G3RA 2D0NA 3BY7A 1VQ7T 4J9DA 2CYZB 1D3BA 2DXUA 2X4YA 2GFUA 4C92B 5GMKm 5GMKh 2PVGB 5FWCA 4DBQA 5LL6S 3EG0A 3CEYA 3S6WA 4J6YA 4OMLA 7AT1B 2OI3A 4C92F 3JB9H 3A98A 1WJRA 1V76A 1VOMA 3G6ET 4V2SA 2DETA 1JQQA 1W4SA 4AMCA 2C06A 5KYYA 2P0QA 4C5EA 3GOXA 2K79A 1BCMA 3OW2A 1VQKQ 5GJWB 1VYVA 4E7HA 1UHCA 2X3WD 4D6WA 2HQXA 4EPCA 1XNIA 1JJ2S 2JNGA 1IHVA 3M59A 1UE9A 1KC8C 2YUQA 4HVUA 4A53A 1T0HA 2AHJB 2DTHA 3MCAB 4CC3A 3OYFA 1M3BA 2PZ1A 3SWNA 4ZGJB 3CCUT 3CCVT 1Q86U 1W2BA 2LTOA 4X9DA 1FX7A 4QVDA 1N8RR 4IUTA 1YI2Q 2KRSA 3OS2A 5HCKA 4C5GA 3CC7Q 4MDXA 3LX7A 2P84A 5FU7C 3HL8A 4OMOA 3L2RA 2PU9B 2ZZDA 2H8HA 4N0AC 1AWXA 2BZ8A 1HSQA 3PNWC 1JO8A 1NPRA 1N8RU 2JZ2A 3OQ5A 5CR2A 2E1HA 4IIOA 3V8JA 4M78G 6AT1B 2JUFA 5GANg 3OYNA 2PVDB 3M0UA 3CCMA 2DAQA 1KG1A 2DL4A 3VS7A 4PLIA 1AVZC 3CBPA 1BI2A 2C0OA 5GMKi 1VQ5Q 1YJ9T 1I5OB 4L59A 2OTJA 5FU6B 2KRNA 1S72A 3RR6A 1S1NA 1D1CA 1PKTA 4Y91A 2A3LA 3M57A 1SF9A 4J9HA 4IUVA 1Q82U 4RTTA 4B9XA 5HK0A 4Z8AA 3LH0A 2CP6A 2LQ8A 5IHNA 4C92C 2GCXA 3FB9A 3MEVA 3CMAQ 1YHQA 3J80E 3HFNA 2A28A 1X69A 4KBMB 2QA4T 1K9MR 4MZPA 1VIEA 1O75A 3HFOA 1WFWA 2CH4W 2BE7D 4GLMA 1ZBXA 3VRZA 1D0XA 4PK4A 1OOTA 3VS5A 1KD1R 1PNJA 4J9CA 3GLXA 3CCQT 4MMKA 1BK2A 1M1KC 4KH1B 2KXDA 1VQOT 2EJ9A 3MEUA 4JZ4A 5CAIA 2CP5A 1VYUA 1SRMA 4JPBW 3RMSA 4E7IA 2E5KA 1K9MU 3E1SA 5GAN5 1FWZA 3WVDB 3HTRA 2CZ7B 2HBPA 4BDYA 2KRMA 1KD1U 5GAN7 3UDCA 2RQUA 1BCOA 1M2VB 4RTYA 5GAMh 2HAXA 3LGLA 2R58A 2O9SA 1B34A 4LDUA 4C0DB 4JRQA 2M51A 3ME9A 1ABOA 4M75A 1KQSP 3OYCA 3DLLA 4F7UE 2LCCA 3CCSQ 1VQLA 1Q81C 2K6DA 2ZCFB 2DJQA 3EGXB 4O5VA 2V1RA 3OYJA 2RI5A 1K8AC 5GANj 3BW1A 2VVKA 2DL7A 2QASA 2NUZA 1NLPC 1MV0B 2OTJT 2AKKA 4NL2A 2LJ3A 1VQKT 1U1TA 5IAYA 1D0ZA 2DK3A 3EHQA 2EYYA 3AT1B 4FU6A 4FYXB 2PUOB 1RABB 1YCYA 1Y0MA 3EH2A 1TSFA 4FL6A 5GAOq 3CMEQ 2LJ0A 1YITT 1BI3A 1Z9QA 2KEAA 3EFRA 5CKBA 2HCKA 4XQ3A 1K4US 4OGEA 3NPFA 2Y4XA 3N5BB 2CH4A 1D09B 2RI3A 3JAME 4JS5A 4F7UB 4FW1A 3X25B 3FIFA 4L6V5 3BFMA 4XU1A 1HYOA 3QYGB 4F7UF 1I81A 2HKQB 1SKUB 4JJBA 3VJPA 1TUDA 4QW2A 4L5GA 4WCIA 3QZ9B 3UA6A 1R0BG 1FMWA 4E7KA 5I22A 3A8OB 3MP1A 3Q1JA 1R0CB 2FO0A 2XKOC 4FCYA 2A08A 2VB6A 1PRMC 3OSVA 2QEXQ 4C5IA 2QTVA 3VUBA 3UT1A 4J9FA 5CKDA 1WNLA 1M9SA 4M77D 2YUPA 2DBKA 2M0YA 3FEOA 3QG1A 1VQMA 1W6XA 4Q5WA 4M7DD 4GBQA 1ZA1B 2P0PA 2L89A 2LP5A 1JU5C 2QI2A 2FL7A 2JW4A 3HPWA 4ZGEB 2RB6A 1Y57A 3WXMB 4C0DC 1Z9ZA 2F2XA 2MWOA 5HKCA 2R5MA 1CKBA 1GRIA 2RN8A 3QO3A 2QXFA 3C95A 4PJMA 3A1PA 3JB9I 3CMAT 2FVUA 1TH7A 3CC2T 3PE0A 4Y28E 4DBRA 1QWEA 1U5SA 4RTVA 1ZSGA 4OMNA 1YJNT 3JB9F 1M30A 5I21A 1OQKA 3META 5IHIA 4ZTJA 2EFIA 4M7DB 3MKDA 2DD4A 1K76A 5FW9A 2LVMA 3C12A 2F2WA 1MHNA 1UFFA 2CSQA 1N9RA 2LQNA 2D0QB 2I0NA 1Q7YC 5KYYB 4RG2A 1KFZA 3RERA 2P4TA 4HCKA 4RTWA 3LW5E 3QDRB 2E5QA 3OSSC 3CXCP 1OX8A 3X20B 4VUBA 4AFUC 1TXQA 1FMKA 2VGNA 1MMGA 1QMCA 2DJZA 3C4SA 1X27A 1M5Q1 5D7UA 1PG5B 2B86A 4PJLA 2E41A 1YJWA 2DO3A 3UA7A 4DOVA 3CCST 3TVTA 1KHIA 1OZ2A 3ZEHA 2E12A 2QYZA 1VQ8A 1IGQA 1X43A 2C0TA 2J6FA 1I07A 4FYYB 1CKAA 3CCUQ 3CCVQ 4HT9A 1OX9A 3G71A 2XMFA 2RQWA 3E9FA 2IIMA 2AK5A 3VKIA 3EGXA 2OAUA 2GBQA 1VQMT 3H0FA 1AOJA 2K5IA 2CKKA 1TG0A 1N5ZA 4ELYC 2ROLA 3P8DA 4E7LA 5KYUB 1KJWA 1X75C 1QVFS 1VYTA 4PFOA 4C8QE 2M1HA 1BYMA 2CUBA 3CMET 3JCMf 2SEMA 2EYXA 2JTFA 3PVLA 4DA4A 2E10A 2H3EB 2EQUA 4C8QD 4PJOE 1B3QA 1ZQ1A 4Y92A 1Q86C 1AWWA 2COZA 3VYGA 3PT9A 3EH1A 2FYKA 1YJ9Q 1A0NB 2DL3A 3G4SA 2FPEA 1AWOA 4ANJA 1UGVA 4CC7A 3KFVA 1H641 2NYSA 3S3NA 3HRTA 3I5SA 2P0KA 1WI7A 2CZ6B 2YUNA 3LLRA 3UATA 3A5ZB 2EQIA 3S3MA 1N8RC 1IXDA 1OI1A 1NEBA 2K2MA 2A37A 2QEXT 3JB9J 3LWIA 5J3BA 5GAOm 1Q7YR 4C8QB 4LE9A 1TTHB 4DOWA 3CXCA 4J6XA 4AFSC 1KQ1A 1HXDA 2RI2A 4ZGDB 3M58A 4M7AE 1MMNA 1VQ4A 1ZLMA 1RI0A 2KGTA 3CCRA 3JRZA 3KXTA 3TQ7P 1YJWT 4PJOB 5A0GA 3ZBDA 1GBRA 2RH2A 1QP2A 3I55A 1EZZB 3CPWS 2DD5A 2L3QA 2WSEE 3CD6A 3T9NA 1VQNA 2H3JA 4M7AD 4XTWA 3J7AF 2VUBA 3SWNC 1VA7A 3G71T 1K73R 4J7FA 2Z0WA 4OVAA 3JCMe 1AD5A 4JRKA 2I2LA 2EPDA 4M75F 1MGQA 4OGCA 5GANd 1J3TA 4AFQC 4BE1A 3M4GA 2QDYB 4C92G 2EGAA 1MV3A 4CI0C 3GNGA 1K73U 1IB8A 3REBB 1UTIA 2J05A 2VWFA 5CVIA 4M77A 2KI7A 3MP6A 4BY6B 4M7DA 1MMAA 5KE3A 1MNEA 1VQPT 4M7AB 2JN0A 1RLQC 3CCMQ 2MMPA 4J9IA 4EIKA 2D8HA 1M90R 2MCNA 1K9MC 2FPFA 4LDWA 2EJGA 3X26B 2K4YA 4HCZA 1KD1C 2OTJQ 1K9AA 1VUBA 2G6FX 2RNAA 2ZAEA 1Q86R 1X6BA 5DY9A 2AIRB 1H3HA 3PIPA 1WHHA 1JJ2P 1M90U 2V8IA 4OF1A 3J81E 3JCMd 3L42A 3EG3A 2LMJA 1YITQ 2EKHA 4R56A 2X3XD 2DZCA 1YHQQ 4C0FA 3L2ZA 2K5FA 4FW2A 4KUDK 4OB0B 3EGUA 3HSBA 4XAXB 4FSXA 4N4GA 2EVRA 3EG2A 4DBHA 1RAHB 3JSCA 2MF2A 4IUQA 2FZCB 2CDTA 2DYIA 4BB7A 4M78D 4R0KA 2HQEA 2KYBA 2QTXA 5KYXA 2O31A 3M0PA 4B9WA 4LD6A 8ATCB 1KK7A 2JXBA 4PJOC 2IG0A 2YDLA 2HBWA 2AZSA 5KYUA 2E6NA 2VGMA 1SSHA 3H0HA 2ECZA 1Q82R 3LGFA 1IHWA 4WF2A 2RPNA 4JJNK 1GCQC 1JBMA 1BBZA 1PD1A 2DXTA 3RDVA 4FYWB 4HXJA 3QSUA 3CCLA 5L23A 5J39A 3GPLA 4XU0A 2ED0A 1I4K1 1V29B 5I2SA 5DM7R 4M75C 4EMGA 3L2UA 1M8MA 4N4IA 1QCOA 1VQLQ 3JCMQ 3NHNA 2RHUA 1X6OA 2HL5C 1QVGS 5HY6A 2F5KA 3H0IA 4M4ZA 3TU4K 1XQHA 2ENMA 5GAOl 2XIDA 4A63B 1XJWB 5D6YA 4BY6C 3FDRA 2K3BA 5GAOp 3CC2Q 2X4WA 3R6OA 3OS5A 1YJNQ 2KT1A 1WJSA 2MK5A 5KCHA 3QUIA 3JCMg 1VQ6A 2E4HA 3JCMJ 4JLGA 3L2WA 4C8QA 3URGA 2L2PA 4TVRA 2KBTA 4DEYA 2OTLA 2LT1A 1GBQA 2KY9A 3ASKA 4A4HA 1UDLA 4PNOA 1QCNA 2VYTA 1JJ2A 2VXFA 3I35A 4PJOA 3CC7A 2QGFB 1D0YA 3QPHA 1RADB 3CCEA 1WQ7A 4LD9K 9ATCB 3X24B 1GCQA 3OS0A 1U1SA 2JS2A 2DFUA 1GL5A 1EIFA 1RI9A 1SHFA 4PJJA 3M0SA 1ABQA 5IT9E 3OYDA 2J06A 1WDXA 1XOVA 1BI0A 1R77A 4PL6A 5LJ5f 1NE8A 3SFMA 5GMKl 2X9HA 4UC4A 2ATCB 4ZTFA 3CC4A 2LZ6B 1Y07A 4XTZA 4C0GA 1M3CA 3INZA 3OS1A 2JM9A 3VS0A 1I0CA 2LQWA 1Y96B 3HP9A 3REAB 3CCMT 4XTUA 2BUDA 4QQGA 1NYGA 3CCLT 3MJXA 1NG2A 4A4EA 5L8RE 1VQMQ 4IUPA 4EMKB 2RHXA 3NMZC 4M7AA 1I8FA 4IURA 3OYKA 1S72T 4OMMA 2EYZA 4RMOA 3PFSA 4RUGA 2PVOB 4ELZC 2KK4A 4J83A 1K0SA 2DXBA 2NWMA 5I2MA 5FU6C 2DEUA 2RHZA 2K57A 1YCSB 2COYA 5GAOr 2GNCA 1BKBA 1RAEB 3RIRA 4F7UG 2FPDA 3QXEB 1YHQT 1M1FA 1ZHIA 1TU0B 1WXTA 5ECAA 3I56A 1AZGB 1ARKA 4GLKA 2M0OA 2JMAA 2XDPA 3E9GA 3GBQA 2NUPA 1VQ6T 4HCBA 1OPLA 2CT3A 4N4HA 1ACMB 4BE2A 3PVQA 4HVWA 2KQWA 5GAMf 2DIQA 3FLGA 4OP0A 4F14A 2OTLT 1PWTA 2DNUA 4FT4A 1X6GA 2QDLA 1QVPA 1ZSZB 2L5QA 4M77E 1IO6A 5LJ5e 1X2QA 4M7DE 4E7JA 4AT1B 1YWPA 2QAZA 1PC0A 1IRXA 3ER0A 2EGCA 3M4YA 4OMQA 3E19A 1YFNA 2DF6A 2C0IA 1HJDA 2YLBA 2DLPA 4B6MA 1RAFB 3V7RA 3KBGA 3SHWA 3JCMX 1K1ZA 2RF0A 2KROA 1YJWQ 2QQ9A 1VQLT 1T3LA 2PUKB 2YWWA 1VQ9A 1VQ8Q 1P92A 2D8JA 3H41A 3JB9G 4RKUE 1KQSA 5GANh 1IGUA 1UG1A 2MPXC 1Y7XA 2FEIA 3M0QA 4JS4A 2QQAA 3TCJA 4M78A 3G71Q 3UF4A 1SEMA 1G8XA 1RAIB 2O4XA 4EDUA 5C0MA 2XD0A 1B7TA 4LUDA 2MYSA 3F70A 1WZOA 1KSWA 5KE2A 4Z89A 4D8DA 3OYGA 1UECA 1GCPA 4M77B 3CQTA 1Q95G 3MEWA 5LJ5d 4M77F 2GF7A 4M7DF 2M9UA 1B07A 5EG2A 4ME7A 3ZFJA 2PQWA 5GAMe 2IPOB 5FRMA 1TOVA 1VQPQ 3I56T 3BE3A 5EC7A 4J6WA 1QQJA 2KXCA 3JCMh 2CGHA 2DRMA 2K7AA 2RK2A 3G4SQ 3VV0A 2DTOA 1G3WA 2KAFA 2MAMA 2VASA 1E6GA 3QDFA 3OYAA 3OYMA 3PGGA 3TSWA 1SSFA 1ZA2B 2CSIA 2VXEA 3QYHB 1Y71A 1NJIR 1TUGB 2NUTA 2XDBA 5IXBA 1K73C 5FLXE 2L8DA 4QQ6A 3OYHA 1M1GA 2HQHA 1OV3A 1DJ7B 3L2VA 1ZSZC 2VC8A 4F04B 1QKWA 1M3AA 2FG0A 2ROTA 2YHTA 1KIKA 2LC4A 1NJIU 1IREB 2VV5A 1BB9A 5KYXB 5LJ3j 3NTHA 2CZ1B 1RL2A 1Y96A 2EYWA 1CSKA 5CKFA 2V1QA 3L1AA 1YIJA 3AHUA 3OMGA 2J7IA 1JB0E 1QVFP 5DLOA 3I55Q 4EMKA 3CD6Q 1N9SA 1VQ9T 2O88A 2WSFE 4FIBA 1AT1B 3SDZA 1UGSB 3VU3C 1M90C 2RHYA 2E6ZA 1FYNA 2DILA 5D6XA 2MIOA 2K3YA 3A8LB 2YXYA 2CP7A 2CP2A 2AT1B 2E3IA 5LJ5g 1KQ2A 3UPUA 1LNXA 4D8KA 4DQ2A 5A2QE 3VS6A 1ZBJA 2E70A 2KYMA 1VQ7A 2YRCA 4JZ3A 3O8VA 3LWHA 1LCKA 3A8GB 3P8HA 4LDXA 3DLMA 3UWNA 1C1AA 2JTEA 3EG1A 5A0DA 1YWOA 4NS5A 1FXXA 1WIEA 5GMKj 2EQJA 4M77C 3GF5A 3G7ZA 3G6EA 4M7DC 1G2BA 3OW2S 2QGGA 2RQVA 3OA6A 2EIFA 4BI4A 1WHLA 2EJFA 1ZSZA 3HHTB 1WJQA 4J9GA 4MDWA 3X28B 5IH2A 2FZGB 5IHKA 4K11A 2JJ9A 3HRUA 4PJOG 3DKMA 4C8QF 1W2BS 4EMHA 1LJOA 2DM1A 2FZKB 2JMCA 2XICA 2BZYA 1YN8A 3CPWP 2K2VA 2ZPHB 4RG8A 2V8JA 4C5HA 3V7CA 2AZVA 2EW3A 4PJOF 3RUXA 1VQ8T 4YTLA 1Q82C 5FROA 4RTXA 4M75G 1W1FA 4KUIA 3L2QA 1WLPB 4E2FB 4R55A 2JS0A 1C6VX 2GFAA 1G5VA 1G3SA 2MI6A 3M56A 5GAMg 2JT4A 4PJNA 2XK0A 3QJYA 1I1JA 4C92D 4WTOB 1LOJA 2CT4A 2LJ1A 1YIJT 2F5TX 3OYLA 1QCFA 3CCJA 5GJVB 2ZPEB 3FJPA 2RD1A 3C0CA 5CQYA 1OYXA 3QJ6A 4RTZA 1EX4A 2FHDA 2RO0A 1UJYA 2B8AA 4E7ZA 3ULRB 3RBBB 4MZTA 1YJ9A 1ZUYA 3H8ZA 1U06A 1OU8A 3V8LA 5GAN4 3CCLQ 4M7AF 1NM7A 2X4JA 1PSEA 5LJ5j 2V8KA 1WHJA 3G4ST 1N27A 2D9TA 2LX7A 3QKJA 3M0TA 1S72Q 2DRKA 4QVCA 4LN2A 1GFCA 1OULA 2DBMA 3CBOA 1BU1A 2YT6A 2KT8A 4BD3A 1UGPB 5LJ3f 2EKOA 4CC2A 1WHKA 3ZL7C 3PMTA 2NUPB 2DXCA 3CPFA 2KR3A 3MP8A 1UJ0A 2QA4A 2LCLA 4FT2A 4M78E 4JJCA 4KH0B 3A8HB 1LPLA 3CCQA 4QQDA 2HEQA 1VQ6Q 3HKSA 1AHJB 1VQOA 1VQ4T 3CCRT 1FMVA 4C8QC 1HK9A 2XG8D 4OB2B 3H9NA 4MZMA 4FYVB 3I55T 2OTLQ 2F69A 1UGQB 3CD6T 2XHCA 1VQNT 1E7OA 5CIUA 2DPPB 3EG9B 3CPWA 3OMCA 3HRSA 2MOXA 3OY9A 3CCEQ 5CQXA 1SHGA 3JCMP 1QP3A 2MWPA 3H6ZA 4JRIA 2E64A 5I11A 5GAMj 5HK3A 4PLLA 3VRYA 5CK9A 1SPKA 2PTKA 4LUEA 3CCJT 3EFSA 4XTVA 2GTOA 3IQLA 3M0RA 1NYFA 4LNPA 3FC3A 3JCMV 3CC4Q 4M78B 3JCMW 4F17A 1QVGP 1UB4A 4II1A 4JDSA 3NTKA 1YBYA 2DMOA 2O4XB 1U3OA 2M02A 4M78F 1F1BB 1MUZA 2YSQA 3OYYA 1I5LA 2HSPA 5LJ5h 1AZEA 1H3ZA 1WGSA 1H8KA 5LJ3e 1YNZA 1M2OA 1WHGA 1VQKA 1K0XA 5CKHA 2LCSA 4KGXB 1BIBA 2RHIA 1PD0A 4M7AC 3GNFB 4ZN1A 2YLCA 2XI9A 2HD0A 2F2VA 3M54A 1WA7A 4PFZA 5IN1A 2V26A 4FSSA 2GGRA 2CZ0B 1YITA 1WXBA 2OX7A 2DKGA 4CC4B 2EGEA 4KULA 4XTYA 4BACA 2LRQA 2W0ZA 1QW1A 4F16A 1YI2A 4BI3A 2D1XA 4O6JA 4HT8A 2RK1A 3QBYA 3I56Q 1N6AA 2CS7A 4QKUA 2DEQA 2BE9B 3THKA 1NBEB 2LNVA 4N0AA 3QHSA 2DERA 4DEXA 2NUTB 5GMKe 1XTDA 5KCOA 1MNDA 2KDSA 1ZUKA 3S3OA 3M5AA 3O5ZA 5A0LA 1KC8R 3WVEB 5LJ3d 2CUDA 2R57A 2VKNA 2LQKA 2DE0X 3MO8A 5KYWB 3TSZA 3RESA 2LDMA 4E7SA 1ZUUA 1LVKA 5GAN6 1PRLC 1JEGA 1HD3A 4HA8A 1VQ5A 1G3TA 3OYBA 1JXOA 2FRWA 5D6WA 1KC8U 1KQSS
chains in the Genus database with same CATH topology
1NEBA 2K2MA 2A37A 4ORZA 1AEYA 2OJ2A 4OMOA 2DA9A 1B07A 2H8HA 3U23A 1AWXA 4LE9A 2BZ8A 2CREA 1HSQA 1JO8A 4AFSC 2A36A 4Z88A 5EC7A 1ZLMA 2KGTA 4IIOA 2KXCA 2J6KA 2DRMA 2K7AA 4E6RA 1GBRA 1OEBA 3M0UA 2L3QA 1UHFA 1E6GA 2JM8A 2DL4A 3VS7A 1AVZC 2C0OA 3TSWA 3FJ5A 2CSIA 1VA7A 1RUWA 4AFZC 2KRNA 2ED1A 5IXBA 1S1NA 1AD5A 1PKTA 1H92A 4J9HA 2RQTA 1UUEA 1OV3A 2EPDA 4RTTA 1J3TA 2DX1A 4AFQC 1QKWA 1M3AA 4Z8AA 3R6NA 2FG0A 2EGAA 1MV3A 2ROTA 1KIKA 2BTTA 1BB9A 3REBB 1UTIA 2J05A 5IHNA 4KRTA 2EYWA 2VWFA 2KE9A 1CSKA 2V1QA 2DYBA 2J7IA 2A28A 1X69A 1RLQC 4HVVA 4J9IA 4EIKA 2O88A 2D8HA 2MCNA 1WFWA 2CH4W 4GLMA 3VRZA 2FPFA 1OOTA 3VS5A 1FYNA 2DILA 1PNJA 4J9CA 1BK2A 2MIOA 2KXDA 2DVJA 1K9AA 4JZ4A 2G6FX 2RNAA 5FWBA 1VYUA 1PHTA 1X6BA 1EFNA 1SRMA 1H3HA 4JPBW 4D8KA 2E5KA 1E6HA 1ZX6A 3VS6A 1ZBJA 2KYMA 3JV3A 4JZ3A 2KRMA 1LCKA 3EG3A 2RQUA 2LMJA 2EKHA 2JTEA 3EG1A 1YWOA 1WIEA 3I9QA 2X3XD 4RTYA 1WXUA 2O9SA 2EBPA 3EGUA 2M51A 1ABOA 1G2BA 5IXFA 2RQVA 2EVRA 3EG2A 3QWXX 1GFDA 1W70A 2K6DA 2DJQA 1NLOC 2CDTA 4R0KA 2V1RA 4J9GA 5IH2A 2KYBA 2O31A 3M0PA 5IHKA 4K11A 2VVKA 2DL7A 2DM1A 2JXBA 2YDLA 2HBWA 2JMCA 2NUZA 2AZSA 3VS3A 1NLPC 1MV0B 2BZYA 1YN8A 1SSHA 2W10A 2AKKA 2LJ3A 2ECZA 3H0HA 2L0AA 2AZVA 2EW3A 2RPNA 1V1CA 1GCQC 2P4RA 1TUCA 1BBZA 3EHQA 1NEGA 1OPKA 2EYYA 4HXJA 4RTXA 5L23A 2J6OA 1W1FA 1WLPB 2JS0A 1Y0MA 2ED0A 2LJ0A 2JT4A 4X1VA 1Z9QA 1I1JA 2KEAA 4ZNXA 1M8MA 4JJDA 2HCKA 4OMPA 1T0JA 1K4US 3NPFA 3NHNA 1RLPC 2CT4A 2CH4A 2LJ1A 3H0IA 1QCFA 4M4ZA 5GJVB 2ENMA 1PKSA 4A63B 3C0CA 2GTJA 4JJBA 1TUDA 2K3BA 4J9EA 4WCIA 4RTZA 4ESRA 2O9VA 1UJYA 3UA6A 3QWYA 2PNIA 2KT1A 3ULRB 3RBBB 3I5RA 3VS1A 4QT7A 5I22A 1ZUYA 3SEMA 1U06A 1WX6A 2FO0A 2A08A 2GQIA 1NM7A 2L2PA 2K9GA 1PRMC 2FRYA 2KBTA 2LX7A 4DEYA 3M0TA 1GBQA 2YUOA 1UDLA 2DRKA 2OAWA 4LN2A 1GFCA 4J9FA 3I35A 2DBMA 2YUPA 2DBKA 2M0YA 1T3SA 1BU1A 1W6XA 2YT6A 2KT8A 4GBQA 3LH5A 4CC2A 2LP5A 2L3SA 3ZL7C 1JU5C 2ABLA 2JW4A 1GCQA 2O2OA 3RNJA 2JS2A 2ESWA 2KR3A 1UJ0A 1Y57A 1GL5A 1RI9A 1Z9ZA 1SHFA 2F2XA 3M0SA 1ABQA 2J06A 1WDXA 1CKBA 4J9BA 2DL5A 1GRIA 1X2KA 1XOVA 2RN8A 4JJCA 4AG1C 1SRLA 2HEQA 1AWJA 2LZ6B 3PE0A 2RMOA 1QWEA 1M3CA 1U5SA 3VS4A 4RTVA 1ZSGA 4OMNA 2JM9A 1M30A 3VS0A 1M27C 1QKXA 1I0CA 1QWFA 2LQWA 3REAB 5IHIA 2BZXA 2SRCA 1E7OA 1JXMA 1NYGA 1K76A 1NG2A 5FW9A 2F2WA 3NMZC 2KNBB 2MOXA 1UFFA 2CSQA 1SHGA 2LQNA 4OMMA 2EYZA 2I0NA 4RUGA 5I11A 1KFZA 4HCKA 4RTWA 3VRYA 1K0SA 2NWMA 1SPKA 2PTKA 4AFUC 1YCSB 4LUEA 3NGPA 3VS2A 1FMKA 2GNCA 4AG2C 2GTOA 3IQLA 3M0RA 1NYFA 4LNPA 2FPDA 1YP5A 1X27A 2DL8A 1WXTA 4F17A 5ECAA 1AZGB 2AKLA 1ARKA 2DMOA 2JMAA 1U3OA 3GBQA 2LNHB 3EHRA 1MUZA 2B86A 2YSQA 2HSPA 1OPLA 1AZEA 2CT3A 3UA7A 4IIMA 1H8KA 1QLYA 3TVTA 1WYXA 1YNZA 3PVQA 2L3PA 4HVWA 1K0XA 1X43A 2LCSA 2C0TA 2J6FA 1I07A 4F14A 4RTUA 1CKAA 1G83A 1PWTA 2DNUA 2HDAA 2F2VA 2RQRA 1WA7A 1X6GA 2QDLA 2XMFA 2D0NA 2RQWA 4FSSA 2GGRA 2IIMA 2AK5A 2GBQA 1WXBA 3H0FA 1IO6A 1AOJA 4J9DA 4CC4B 1X2QA 2EGEA 1TG0A 1N5ZA 2W0ZA 1YWPA 2ROLA 5FWCA 3EG0A 4OMLA 2EGCA 4F16A 2OI3A 1KJWA 2D1XA 4OMQA 1VYTA 3A98A 2DF6A 2C0IA 1HJDA 2DLPA 2CUBA 2SEMA 3THKA 2EYXA 1JQQA 3SHWA 1K1ZA 2RF0A 2KROA 3PVLA 2K79A 4DEXA 1T3LA 1B3QA 4Y92A 5GJWB 2D8JA 3H41A 1VYVA 1ZUKA 1UHCA 1AWWA 2X3WD 1UG1A 3O5ZA 2FEIA 3M0QA 1A0NB 2DL3A 2FPEA 3UF4A 2CUDA 1UE9A 2VKNA 1AWOA 1UGVA 2YUQA 4HVUA 4CC7A 1SEMA 3KFVA 2DE0X 1T0HA 4CC3A 3TSZA 1M3BA 1ZUUA 3I5SA 4LUDA 1PRLC 1JEGA 2PZ1A 1HD3A 1WI7A 1KSWA 2YUNA 3UATA 4Z89A 4D8DA 1UECA 1GCPA 1JXOA 2EQIA 2FRWA 2KRSA 3CQTA 5HCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NEB A;  2K2M A;  2A37 A;  4ORZ A;  1AEY A;  2OJ2 A;  4OMO A;  2DA9 A;  1B07 A;  2H8H A;  3U23 A;  1AWX A;  4LE9 A;  2BZ8 A;  2CRE A;  1HSQ A;  1JO8 A;  4AFS C;  2A36 A;  4Z88 A;  5EC7 A;  1ZLM A;  2KGT A;  4IIO A;  2KXC A;  2J6K A;  2DRM A;  2K7A A;  4E6R A;  1GBR A;  1OEB A;  3M0U A;  2L3Q A;  1UHF A;  1E6G A;  2JM8 A;  2DL4 A;  3VS7 A;  1AVZ C;  2C0O A;  3TSW A;  3FJ5 A;  2CSI A;  1VA7 A;  1RUW A;  4AFZ C;  2KRN A;  2ED1 A;  5IXB A;  1S1N A;  1AD5 A;  1PKT A;  1H92 A;  4J9H A;  2RQT A;  1UUE A;  1OV3 A;  2EPD A;  4RTT A;  1J3T A;  2DX1 A;  4AFQ C;  1QKW A;  1M3A A;  4Z8A A;  3R6N A;  2FG0 A;  2EGA A;  1MV3 A;  2ROT A;  1KIK A;  2BTT A;  1BB9 A;  3REB B;  1UTI A;  2J05 A;  5IHN A;  4KRT A;  2EYW A;  2VWF A;  2KE9 A;  1CSK A;  2V1Q A;  2DYB A;  2J7I A;  2A28 A;  1X69 A;  1RLQ C;  4HVV A;  4J9I A;  4EIK A;  2O88 A;  2D8H A;  2MCN A;  1WFW A;  2CH4 W;  4GLM A;  3VRZ A;  2FPF A;  1OOT A;  3VS5 A;  1FYN A;  2DIL A;  1PNJ A;  4J9C A;  1BK2 A;  2MIO A;  2KXD A;  2DVJ A;  1K9A A;  4JZ4 A;  2G6F X;  2RNA A;  5FWB A;  1VYU A;  1PHT A;  1X6B A;  1EFN A;  1SRM A;  1H3H A;  4JPB W;  4D8K A;  2E5K A;  1E6H A;  1ZX6 A;  3VS6 A;  1ZBJ A;  2KYM A;  3JV3 A;  4JZ3 A;  2KRM A;  1LCK A;  3EG3 A;  2RQU A;  2LMJ A;  2EKH A;  2JTE A;  3EG1 A;  1YWO A;  1WIE A;  3I9Q A;  2X3X D;  4RTY A;  1WXU A;  2O9S A;  2EBP A;  3EGU A;  2M51 A;  1ABO A;  1G2B A;  5IXF A;  2RQV A;  2EVR A;  3EG2 A;  3QWX X;  1GFD A;  1W70 A;  2K6D A;  2DJQ A;  1NLO C;  2CDT A;  4R0K A;  2V1R A;  4J9G A;  5IH2 A;  2KYB A;  2O31 A;  3M0P A;  5IHK A;  4K11 A;  2VVK A;  2DL7 A;  2DM1 A;  2JXB A;  2YDL A;  2HBW A;  2JMC A;  2NUZ A;  2AZS A;  3VS3 A;  1NLP C;  1MV0 B;  2BZY A;  1YN8 A;  1SSH A;  2W10 A;  2AKK A;  2LJ3 A;  2ECZ A;  3H0H A;  2L0A A;  2AZV A;  2EW3 A;  2RPN A;  1V1C A;  1GCQ C;  2P4R A;  1TUC A;  1BBZ A;  3EHQ A;  1NEG A;  1OPK A;  2EYY A;  4HXJ A;  4RTX A;  5L23 A;  2J6O A;  1W1F A;  1WLP B;  2JS0 A;  1Y0M A;  2ED0 A;  2LJ0 A;  2JT4 A;  4X1V A;  1Z9Q A;  1I1J A;  2KEA A;  4ZNX A;  1M8M A;  4JJD A;  2HCK A;  4OMP A;  1T0J A;  1K4U S;  3NPF A;  3NHN A;  1RLP C;  2CT4 A;  2CH4 A;  2LJ1 A;  3H0I A;  1QCF A;  4M4Z A;  5GJV B;  2ENM A;  1PKS A;  4A63 B;  3C0C A;  2GTJ A;  4JJB A;  1TUD A;  2K3B A;  4J9E A;  4WCI A;  4RTZ A;  4ESR A;  2O9V A;  1UJY A;  3UA6 A;  3QWY A;  2PNI A;  2KT1 A;  3ULR B;  3RBB B;  3I5R A;  3VS1 A;  4QT7 A;  5I22 A;  1ZUY A;  3SEM A;  1U06 A;  1WX6 A;  2FO0 A;  2A08 A;  2GQI A;  1NM7 A;  2L2P A;  2K9G A;  1PRM C;  2FRY A;  2KBT A;  2LX7 A;  4DEY A;  3M0T A;  1GBQ A;  2YUO A;  1UDL A;  2DRK A;  2OAW A;  4LN2 A;  1GFC A;  4J9F A;  3I35 A;  2DBM A;  2YUP A;  2DBK A;  2M0Y A;  1T3S A;  1BU1 A;  1W6X A;  2YT6 A;  2KT8 A;  4GBQ A;  3LH5 A;  4CC2 A;  2LP5 A;  2L3S A;  3ZL7 C;  1JU5 C;  2ABL A;  2JW4 A;  1GCQ A;  2O2O A;  3RNJ A;  2JS2 A;  2ESW A;  2KR3 A;  1UJ0 A;  1Y57 A;  1GL5 A;  1RI9 A;  1Z9Z A;  1SHF A;  2F2X A;  3M0S A;  1ABQ A;  2J06 A;  1WDX A;  1CKB A;  4J9B A;  2DL5 A;  1GRI A;  1X2K A;  1XOV A;  2RN8 A;  4JJC A;  4AG1 C;  1SRL A;  2HEQ A;  1AWJ A;  2LZ6 B;  3PE0 A;  2RMO A;  1QWE A;  1M3C A;  1U5S A;  3VS4 A;  4RTV A;  1ZSG A;  4OMN A;  2JM9 A;  1M30 A;  3VS0 A;  1M27 C;  1QKX A;  1I0C A;  1QWF A;  2LQW A;  3REA B;  5IHI A;  2BZX A;  2SRC A;  1E7O A;  1JXM A;  1NYG A;  1K76 A;  1NG2 A;  5FW9 A;  2F2W A;  3NMZ C;  2KNB B;  2MOX A;  1UFF A;  2CSQ A;  1SHG A;  2LQN A;  4OMM A;  2EYZ A;  2I0N A;  4RUG A;  5I11 A;  1KFZ A;  4HCK A;  4RTW A;  3VRY A;  1K0S A;  2NWM A;  1SPK A;  2PTK A;  4AFU C;  1YCS B;  4LUE A;  3NGP A;  3VS2 A;  1FMK A;  2GNC A;  4AG2 C;  2GTO A;  3IQL A;  3M0R A;  1NYF A;  4LNP A;  2FPD A;  1YP5 A;  1X27 A;  2DL8 A;  1WXT A;  4F17 A;  5ECA A;  1AZG B;  2AKL A;  1ARK A;  2DMO A;  2JMA A;  1U3O A;  3GBQ A;  2LNH B;  3EHR A;  1MUZ A;  2B86 A;  2YSQ A;  2HSP A;  1OPL A;  1AZE A;  2CT3 A;  3UA7 A;  4IIM A;  1H8K A;  1QLY A;  3TVT A;  1WYX A;  1YNZ A;  3PVQ A;  2L3P A;  4HVW A;  1K0X A;  1X43 A;  2LCS A;  2C0T A;  2J6F A;  1I07 A;  4F14 A;  4RTU A;  1CKA A;  1G83 A;  1PWT A;  2DNU A;  2HDA A;  2F2V A;  2RQR A;  1WA7 A;  1X6G A;  2QDL A;  2XMF A;  2D0N A;  2RQW A;  4FSS A;  2GGR A;  2IIM A;  2AK5 A;  2GBQ A;  1WXB A;  3H0F A;  1IO6 A;  1AOJ A;  4J9D A;  4CC4 B;  1X2Q A;  2EGE A;  1TG0 A;  1N5Z A;  2W0Z A;  1YWP A;  2ROL A;  5FWC A;  3EG0 A;  4OML A;  2EGC A;  4F16 A;  2OI3 A;  1KJW A;  2D1X A;  4OMQ A;  1VYT A;  3A98 A;  2DF6 A;  2C0I A;  1HJD A;  2DLP A;  2CUB A;  2SEM A;  3THK A;  2EYX A;  1JQQ A;  3SHW A;  1K1Z A;  2RF0 A;  2KRO A;  3PVL A;  2K79 A;  4DEX A;  1T3L A;  1B3Q A;  4Y92 A;  5GJW B;  2D8J A;  3H41 A;  1VYV A;  1ZUK A;  1UHC A;  1AWW A;  2X3W D;  1UG1 A;  3O5Z A;  2FEI A;  3M0Q A;  1A0N B;  2DL3 A;  2FPE A;  3UF4 A;  2CUD A;  1UE9 A;  2VKN A;  1AWO A;  1UGV A;  2YUQ A;  4HVU A;  4CC7 A;  1SEM A;  3KFV A;  2DE0 X;  1T0H A;  4CC3 A;  3TSZ A;  1M3B A;  1ZUU A;  3I5S A;  4LUD A;  1PRL C;  1JEG A;  2PZ1 A;  1HD3 A;  1WI7 A;  1KSW A;  2YUN A;  3UAT A;  4Z89 A;  4D8D A;  1UEC A;  1GCP A;  1JXO A;  2EQI A;  2FRW A;  2KRS A;  3CQT A;  5HCK A; 
#chains in the Genus database with same CATH topology
 4ORZ A;  1AEY A;  2OJ2 A;  4Z02 A;  2DA9 A;  3U23 A;  2A7Y A;  4FM4 B;  2CRE A;  3GIB A;  4KT0 E;  2A36 A;  3EGD B;  4C92 A;  4Z88 A;  1VQ9 Q;  3OBY A;  3CMA A;  1OU9 A;  1JRI A;  5AT1 B;  3CC2 A;  2J6K A;  4ATO A;  1YJN A;  4E6R A;  3JCM c;  2ZPB B;  2WSC E;  3EFO B;  4M78 C;  1QVG A;  1RAA B;  1OEB A;  1UHF A;  4ZN3 A;  2JM8 A;  5AYF A;  2BKD N;  3FJ5 A;  2LT4 A;  4PKC C;  3TEE A;  1RUW A;  4AFZ C;  2RM4 A;  2ED1 A;  4HKE A;  1NJI C;  1H92 A;  4XTX A;  2HZY A;  4MML A;  1R8O B;  2L3R A;  2RQT A;  2RJC A;  5KH6 A;  1UUE A;  3PMI A;  3D7S B;  5FRN A;  2DX1 A;  1WPY A;  1YI2 T;  1UGR B;  3R6N A;  3CC7 T;  3OBW A;  2BTT A;  4OB1 B;  2X4X A;  3CCE T;  3FRN A;  4KRT A;  2KE9 A;  3QII A;  2DYB A;  3EG9 A;  5LJ3 g;  2HNI A;  4HVV A;  2YRV A;  3CCS A;  2EAY A;  4JUV A;  3JB9 D;  3PTA A;  1M1K R;  5C6S A;  2RA2 A;  2KSS A;  2DVJ A;  2E3H A;  1IZ6 A;  3CC4 T;  1SG5 A;  3QZ5 B;  3M53 A;  5FWB A;  2GQV A;  1PHT A;  4J8O A;  1EFN A;  5KYN A;  4J5Y A;  3PIO A;  1E6H A;  4OB3 B;  1ZX6 A;  4X9C A;  1VQ5 T;  5M9O A;  2ZPI B;  4OMF B;  3JV3 A;  2WAC A;  1M1K U;  4RCB A;  3MPU B;  1NPP A;  3DB4 A;  4QVZ A;  1D1A A;  4M77 G;  1O9S A;  2IVW A;  3I9Q A;  1WXU A;  1PSF A;  4M7D G;  2EBP A;  2KMT A;  1YIJ Q;  4A4F A;  3CME A;  5IXF A;  5GAO n;  2K3X A;  2RJE A;  5CO7 A;  4EMK C;  1Q81 R;  4IKF A;  3QWX X;  2RJF A;  1GFD A;  1W70 A;  3E2U A;  1NLO C;  4GY5 A;  3V7S A;  1K8A R;  4BE0 A;  1D3B B;  4NOY A;  4XU3 A;  2XU8 A;  2QQS A;  2JVV A;  1U8R A;  1Q81 U;  2YRD A;  2EWN A;  2RJD A;  4HCC A;  3VS3 A;  1VQ7 Q;  4IUU A;  3NTI A;  2W10 A;  2L0A A;  1K8A U;  1V1C A;  2P4R A;  3RKW A;  1TUC A;  1NEG A;  1OPK A;  1UEB A;  4RCC A;  2J6O A;  2QG9 B;  2O01 E;  4LDY A;  1G3Y A;  1RAG B;  3BDL A;  3G6E Q;  2QEX A;  5DLQ E;  2DTI A;  4BUG A;  3CXC S;  4X1V A;  2ZPF B;  4ZNX A;  4JJD A;  1VIF A;  4OMP A;  1T0J A;  5GAN 3;  4BI8 B;  2Y90 A;  1RLP C;  2EQM A;  2FB7 A;  4A54 A;  5GAN f;  2QK0 A;  1M2V A;  5KYW A;  1M4Z A;  8AT1 B;  4DBF A;  2E65 A;  3A8M B;  3SWN B;  4PFP A;  2F1L A;  1PKS A;  2GTJ A;  2Y4Y A;  1VQ4 Q;  4J9E A;  3CCR Q;  2HL3 A;  4ESR A;  2HSE B;  2O9V A;  3SD4 A;  3QWY A;  2PNI A;  5GAM d;  2A0F B;  4A4G A;  3I5R A;  1M8V A;  2CP3 A;  3JCM b;  3VS1 A;  4QT7 A;  4JLI A;  1KHC A;  3SEM A;  1VQN Q;  1WX6 A;  2GQI A;  2XDD A;  2JTM A;  2K9G A;  3BDU A;  2FRY A;  3RMQ A;  3EGD A;  2X35 A;  2YUO A;  3VUZ A;  2OAW A;  5J26 A;  2DZ9 A;  4JRP A;  4LXC A;  5GAN 2;  5CCA A;  1T3S A;  1RAC B;  3G1J A;  3EFO A;  3LH5 A;  5GAN 8;  2BIV A;  2D6F A;  2L3S A;  3OYI A;  3CCJ Q;  2ABL A;  2O2O A;  3RNJ A;  2ESW A;  1PCX A;  1VQP A;  4BDZ A;  3TRE A;  3OW2 P;  3GP8 A;  4P5N A;  3SB2 A;  4J9B A;  2DL5 A;  1X2K A;  3P8B B;  4AG1 C;  2LX9 A;  1SRL A;  1AWJ A;  4C8Q G;  1TS9 A;  3LYI A;  4XU2 A;  2HMA A;  4PJO D;  1NZ9 A;  3RKX A;  4F7U A;  2RMO A;  4J7I A;  2COW A;  3VYH B;  3MHX A;  1PM3 A;  3VS4 A;  1M27 C;  4M75 E;  2ZGW A;  1QKX A;  1QWF A;  3M9Q A;  1W2B P;  2BZX A;  2SRC A;  1JXM A;  3RKY A;  3V8K A;  5GAN e;  4XK8 E;  2EYQ A;  1BI1 A;  3CBM A;  3OB9 A;  1X01 A;  2KNB B;  4M75 D;  3CCU A;  3C94 A;  4E47 A;  3CCV A;  5FU7 B;  1GXI E;  4C92 E;  1WHM A;  2QA4 Q;  2KVQ G;  3EAE A;  4KGZ B;  2EQK A;  5LJ3 h;  3VS2 A;  2QQR A;  3NGP A;  2K5L A;  4C0Z A;  1D1B A;  4A4K A;  4AG2 C;  1C0M A;  4LDV A;  3CCQ Q;  3OYE A;  1YP5 A;  4KGV B;  1VQO Q;  2DL8 A;  1Q7Y U;  2ZPG B;  3DB3 A;  1TWB A;  2AKL A;  2NLU A;  4NL3 A;  3KUF A;  2DIG A;  2LNH B;  3EHR A;  2DVE A;  1OZ3 A;  2R5A A;  2CP0 A;  2QQB A;  3NFC A;  1BIA A;  1B34 B;  1WQW A;  3MEA A;  4IIM A;  1QLY A;  3M55 A;  5CKE A;  1WYX A;  4M75 B;  4X34 A;  2JOY A;  4M7A G;  2L3P A;  2X51 A;  1QVF A;  1MMD A;  4RTU A;  2M16 A;  1G83 A;  4CRI A;  2HKN A;  2HDA A;  2RQR A;  2G3R A;  2D0N A;  3BY7 A;  1VQ7 T;  4J9D A;  2CYZ B;  1D3B A;  2DXU A;  2X4Y A;  2GFU A;  4C92 B;  5GMK m;  5GMK h;  2PVG B;  5FWC A;  4DBQ A;  5LL6 S;  3EG0 A;  3CEY A;  3S6W A;  4J6Y A;  4OML A;  7AT1 B;  2OI3 A;  4C92 F;  3JB9 H;  3A98 A;  1WJR A;  1V76 A;  1VOM A;  3G6E T;  4V2S A;  2DET A;  1JQQ A;  1W4S A;  4AMC A;  2C06 A;  5KYY A;  2P0Q A;  4C5E A;  3GOX A;  2K79 A;  1BCM A;  3OW2 A;  1VQK Q;  5GJW B;  1VYV A;  4E7H A;  1UHC A;  2X3W D;  4D6W A;  2HQX A;  4EPC A;  1XNI A;  1JJ2 S;  2JNG A;  1IHV A;  3M59 A;  1UE9 A;  1KC8 C;  2YUQ A;  4HVU A;  4A53 A;  1T0H A;  2AHJ B;  2DTH A;  3MCA B;  4CC3 A;  3OYF A;  1M3B A;  2PZ1 A;  3SWN A;  4ZGJ B;  3CCU T;  3CCV T;  1Q86 U;  1W2B A;  2LTO A;  4X9D A;  1FX7 A;  4QVD A;  1N8R R;  4IUT A;  1YI2 Q;  2KRS A;  3OS2 A;  5HCK A;  4C5G A;  3CC7 Q;  4MDX A;  3LX7 A;  2P84 A;  5FU7 C;  3HL8 A;  4OMO A;  3L2R A;  2PU9 B;  2ZZD A;  2H8H A;  4N0A C;  1AWX A;  2BZ8 A;  1HSQ A;  3PNW C;  1JO8 A;  1NPR A;  1N8R U;  2JZ2 A;  3OQ5 A;  5CR2 A;  2E1H A;  4IIO A;  3V8J A;  4M78 G;  6AT1 B;  2JUF A;  5GAN g;  3OYN A;  2PVD B;  3M0U A;  3CCM A;  2DAQ A;  1KG1 A;  2DL4 A;  3VS7 A;  4PLI A;  1AVZ C;  3CBP A;  1BI2 A;  2C0O A;  5GMK i;  1VQ5 Q;  1YJ9 T;  1I5O B;  4L59 A;  2OTJ A;  5FU6 B;  2KRN A;  1S72 A;  3RR6 A;  1S1N A;  1D1C A;  1PKT A;  4Y91 A;  2A3L A;  3M57 A;  1SF9 A;  4J9H A;  4IUV A;  1Q82 U;  4RTT A;  4B9X A;  5HK0 A;  4Z8A A;  3LH0 A;  2CP6 A;  2LQ8 A;  5IHN A;  4C92 C;  2GCX A;  3FB9 A;  3MEV A;  3CMA Q;  1YHQ A;  3J80 E;  3HFN A;  2A28 A;  1X69 A;  4KBM B;  2QA4 T;  1K9M R;  4MZP A;  1VIE A;  1O75 A;  3HFO A;  1WFW A;  2CH4 W;  2BE7 D;  4GLM A;  1ZBX A;  3VRZ A;  1D0X A;  4PK4 A;  1OOT A;  3VS5 A;  1KD1 R;  1PNJ A;  4J9C A;  3GLX A;  3CCQ T;  4MMK A;  1BK2 A;  1M1K C;  4KH1 B;  2KXD A;  1VQO T;  2EJ9 A;  3MEU A;  4JZ4 A;  5CAI A;  2CP5 A;  1VYU A;  1SRM A;  4JPB W;  3RMS A;  4E7I A;  2E5K A;  1K9M U;  3E1S A;  5GAN 5;  1FWZ A;  3WVD B;  3HTR A;  2CZ7 B;  2HBP A;  4BDY A;  2KRM A;  1KD1 U;  5GAN 7;  3UDC A;  2RQU A;  1BCO A;  1M2V B;  4RTY A;  5GAM h;  2HAX A;  3LGL A;  2R58 A;  2O9S A;  1B34 A;  4LDU A;  4C0D B;  4JRQ A;  2M51 A;  3ME9 A;  1ABO A;  4M75 A;  1KQS P;  3OYC A;  3DLL A;  4F7U E;  2LCC A;  3CCS Q;  1VQL A;  1Q81 C;  2K6D A;  2ZCF B;  2DJQ A;  3EGX B;  4O5V A;  2V1R A;  3OYJ A;  2RI5 A;  1K8A C;  5GAN j;  3BW1 A;  2VVK A;  2DL7 A;  2QAS A;  2NUZ A;  1NLP C;  1MV0 B;  2OTJ T;  2AKK A;  4NL2 A;  2LJ3 A;  1VQK T;  1U1T A;  5IAY A;  1D0Z A;  2DK3 A;  3EHQ A;  2EYY A;  3AT1 B;  4FU6 A;  4FYX B;  2PUO B;  1RAB B;  1YCY A;  1Y0M A;  3EH2 A;  1TSF A;  4FL6 A;  5GAO q;  3CME Q;  2LJ0 A;  1YIT T;  1BI3 A;  1Z9Q A;  2KEA A;  3EFR A;  5CKB A;  2HCK A;  4XQ3 A;  1K4U S;  4OGE A;  3NPF A;  2Y4X A;  3N5B B;  2CH4 A;  1D09 B;  2RI3 A;  3JAM E;  4JS5 A;  4F7U B;  4FW1 A;  3X25 B;  3FIF A;  4L6V 5;  3BFM A;  4XU1 A;  1HYO A;  3QYG B;  4F7U F;  1I81 A;  2HKQ B;  1SKU B;  4JJB A;  3VJP A;  1TUD A;  4QW2 A;  4L5G A;  4WCI A;  3QZ9 B;  3UA6 A;  1R0B G;  1FMW A;  4E7K A;  5I22 A;  3A8O B;  3MP1 A;  3Q1J A;  1R0C B;  2FO0 A;  2XKO C;  4FCY A;  2A08 A;  2VB6 A;  1PRM C;  3OSV A;  2QEX Q;  4C5I A;  2QTV A;  3VUB A;  3UT1 A;  4J9F A;  5CKD A;  1WNL A;  1M9S A;  4M77 D;  2YUP A;  2DBK A;  2M0Y A;  3FEO A;  3QG1 A;  1VQM A;  1W6X A;  4Q5W A;  4M7D D;  4GBQ A;  1ZA1 B;  2P0P A;  2L89 A;  2LP5 A;  1JU5 C;  2QI2 A;  2FL7 A;  2JW4 A;  3HPW A;  4ZGE B;  2RB6 A;  1Y57 A;  3WXM B;  4C0D C;  1Z9Z A;  2F2X A;  2MWO A;  5HKC A;  2R5M A;  1CKB A;  1GRI A;  2RN8 A;  3QO3 A;  2QXF A;  3C95 A;  4PJM A;  3A1P A;  3JB9 I;  3CMA T;  2FVU A;  1TH7 A;  3CC2 T;  3PE0 A;  4Y28 E;  4DBR A;  1QWE A;  1U5S A;  4RTV A;  1ZSG A;  4OMN A;  1YJN T;  3JB9 F;  1M30 A;  5I21 A;  1OQK A;  3MET A;  5IHI A;  4ZTJ A;  2EFI A;  4M7D B;  3MKD A;  2DD4 A;  1K76 A;  5FW9 A;  2LVM A;  3C12 A;  2F2W A;  1MHN A;  1UFF A;  2CSQ A;  1N9R A;  2LQN A;  2D0Q B;  2I0N A;  1Q7Y C;  5KYY B;  4RG2 A;  1KFZ A;  3RER A;  2P4T A;  4HCK A;  4RTW A;  3LW5 E;  3QDR B;  2E5Q A;  3OSS C;  3CXC P;  1OX8 A;  3X20 B;  4VUB A;  4AFU C;  1TXQ A;  1FMK A;  2VGN A;  1MMG A;  1QMC A;  2DJZ A;  3C4S A;  1X27 A;  1M5Q 1;  5D7U A;  1PG5 B;  2B86 A;  4PJL A;  2E41 A;  1YJW A;  2DO3 A;  3UA7 A;  4DOV A;  3CCS T;  3TVT A;  1KHI A;  1OZ2 A;  3ZEH A;  2E12 A;  2QYZ A;  1VQ8 A;  1IGQ A;  1X43 A;  2C0T A;  2J6F A;  1I07 A;  4FYY B;  1CKA A;  3CCU Q;  3CCV Q;  4HT9 A;  1OX9 A;  3G71 A;  2XMF A;  2RQW A;  3E9F A;  2IIM A;  2AK5 A;  3VKI A;  3EGX A;  2OAU A;  2GBQ A;  1VQM T;  3H0F A;  1AOJ A;  2K5I A;  2CKK A;  1TG0 A;  1N5Z A;  4ELY C;  2ROL A;  3P8D A;  4E7L A;  5KYU B;  1KJW A;  1X75 C;  1QVF S;  1VYT A;  4PFO A;  4C8Q E;  2M1H A;  1BYM A;  2CUB A;  3CME T;  3JCM f;  2SEM A;  2EYX A;  2JTF A;  3PVL A;  4DA4 A;  2E10 A;  2H3E B;  2EQU A;  4C8Q D;  4PJO E;  1B3Q A;  1ZQ1 A;  4Y92 A;  1Q86 C;  1AWW A;  2COZ A;  3VYG A;  3PT9 A;  3EH1 A;  2FYK A;  1YJ9 Q;  1A0N B;  2DL3 A;  3G4S A;  2FPE A;  1AWO A;  4ANJ A;  1UGV A;  4CC7 A;  3KFV A;  1H64 1;  2NYS A;  3S3N A;  3HRT A;  3I5S A;  2P0K A;  1WI7 A;  2CZ6 B;  2YUN A;  3LLR A;  3UAT A;  3A5Z B;  2EQI A;  3S3M A;  1N8R C;  1IXD A;  1OI1 A;  1NEB A;  2K2M A;  2A37 A;  2QEX T;  3JB9 J;  3LWI A;  5J3B A;  5GAO m;  1Q7Y R;  4C8Q B;  4LE9 A;  1TTH B;  4DOW A;  3CXC A;  4J6X A;  4AFS C;  1KQ1 A;  1HXD A;  2RI2 A;  4ZGD B;  3M58 A;  4M7A E;  1MMN A;  1VQ4 A;  1ZLM A;  1RI0 A;  2KGT A;  3CCR A;  3JRZ A;  3KXT A;  3TQ7 P;  1YJW T;  4PJO B;  5A0G A;  3ZBD A;  1GBR A;  2RH2 A;  1QP2 A;  3I55 A;  1EZZ B;  3CPW S;  2DD5 A;  2L3Q A;  2WSE E;  3CD6 A;  3T9N A;  1VQN A;  2H3J A;  4M7A D;  4XTW A;  3J7A F;  2VUB A;  3SWN C;  1VA7 A;  3G71 T;  1K73 R;  4J7F A;  2Z0W A;  4OVA A;  3JCM e;  1AD5 A;  4JRK A;  2I2L A;  2EPD A;  4M75 F;  1MGQ A;  4OGC A;  5GAN d;  1J3T A;  4AFQ C;  4BE1 A;  3M4G A;  2QDY B;  4C92 G;  2EGA A;  1MV3 A;  4CI0 C;  3GNG A;  1K73 U;  1IB8 A;  3REB B;  1UTI A;  2J05 A;  2VWF A;  5CVI A;  4M77 A;  2KI7 A;  3MP6 A;  4BY6 B;  4M7D A;  1MMA A;  5KE3 A;  1MNE A;  1VQP T;  4M7A B;  2JN0 A;  1RLQ C;  3CCM Q;  2MMP A;  4J9I A;  4EIK A;  2D8H A;  1M90 R;  2MCN A;  1K9M C;  2FPF A;  4LDW A;  2EJG A;  3X26 B;  2K4Y A;  4HCZ A;  1KD1 C;  2OTJ Q;  1K9A A;  1VUB A;  2G6F X;  2RNA A;  2ZAE A;  1Q86 R;  1X6B A;  5DY9 A;  2AIR B;  1H3H A;  3PIP A;  1WHH A;  1JJ2 P;  1M90 U;  2V8I A;  4OF1 A;  3J81 E;  3JCM d;  3L42 A;  3EG3 A;  2LMJ A;  1YIT Q;  2EKH A;  4R56 A;  2X3X D;  2DZC A;  1YHQ Q;  4C0F A;  3L2Z A;  2K5F A;  4FW2 A;  4KUD K;  4OB0 B;  3EGU A;  3HSB A;  4XAX B;  4FSX A;  4N4G A;  2EVR A;  3EG2 A;  4DBH A;  1RAH B;  3JSC A;  2MF2 A;  4IUQ A;  2FZC B;  2CDT A;  2DYI A;  4BB7 A;  4M78 D;  4R0K A;  2HQE A;  2KYB A;  2QTX A;  5KYX A;  2O31 A;  3M0P A;  4B9W A;  4LD6 A;  8ATC B;  1KK7 A;  2JXB A;  4PJO C;  2IG0 A;  2YDL A;  2HBW A;  2AZS A;  5KYU A;  2E6N A;  2VGM A;  1SSH A;  3H0H A;  2ECZ A;  1Q82 R;  3LGF A;  1IHW A;  4WF2 A;  2RPN A;  4JJN K;  1GCQ C;  1JBM A;  1BBZ A;  1PD1 A;  2DXT A;  3RDV A;  4FYW B;  4HXJ A;  3QSU A;  3CCL A;  5L23 A;  5J39 A;  3GPL A;  4XU0 A;  2ED0 A;  1I4K 1;  1V29 B;  5I2S A;  5DM7 R;  4M75 C;  4EMG A;  3L2U A;  1M8M A;  4N4I A;  1QCO A;  1VQL Q;  3JCM Q;  3NHN A;  2RHU A;  1X6O A;  2HL5 C;  1QVG S;  5HY6 A;  2F5K A;  3H0I A;  4M4Z A;  3TU4 K;  1XQH A;  2ENM A;  5GAO l;  2XID A;  4A63 B;  1XJW B;  5D6Y A;  4BY6 C;  3FDR A;  2K3B A;  5GAO p;  3CC2 Q;  2X4W A;  3R6O A;  3OS5 A;  1YJN Q;  2KT1 A;  1WJS A;  2MK5 A;  5KCH A;  3QUI A;  3JCM g;  1VQ6 A;  2E4H A;  3JCM J;  4JLG A;  3L2W A;  4C8Q A;  3URG A;  2L2P A;  4TVR A;  2KBT A;  4DEY A;  2OTL A;  2LT1 A;  1GBQ A;  2KY9 A;  3ASK A;  4A4H A;  1UDL A;  4PNO A;  1QCN A;  2VYT A;  1JJ2 A;  2VXF A;  3I35 A;  4PJO A;  3CC7 A;  2QGF B;  1D0Y A;  3QPH A;  1RAD B;  3CCE A;  1WQ7 A;  4LD9 K;  9ATC B;  3X24 B;  1GCQ A;  3OS0 A;  1U1S A;  2JS2 A;  2DFU A;  1GL5 A;  1EIF A;  1RI9 A;  1SHF A;  4PJJ A;  3M0S A;  1ABQ A;  5IT9 E;  3OYD A;  2J06 A;  1WDX A;  1XOV A;  1BI0 A;  1R77 A;  4PL6 A;  5LJ5 f;  1NE8 A;  3SFM A;  5GMK l;  2X9H A;  4UC4 A;  2ATC B;  4ZTF A;  3CC4 A;  2LZ6 B;  1Y07 A;  4XTZ A;  4C0G A;  1M3C A;  3INZ A;  3OS1 A;  2JM9 A;  3VS0 A;  1I0C A;  2LQW A;  1Y96 B;  3HP9 A;  3REA B;  3CCM T;  4XTU A;  2BUD A;  4QQG A;  1NYG A;  3CCL T;  3MJX A;  1NG2 A;  4A4E A;  5L8R E;  1VQM Q;  4IUP A;  4EMK B;  2RHX A;  3NMZ C;  4M7A A;  1I8F A;  4IUR A;  3OYK A;  1S72 T;  4OMM A;  2EYZ A;  4RMO A;  3PFS A;  4RUG A;  2PVO B;  4ELZ C;  2KK4 A;  4J83 A;  1K0S A;  2DXB A;  2NWM A;  5I2M A;  5FU6 C;  2DEU A;  2RHZ A;  2K57 A;  1YCS B;  2COY A;  5GAO r;  2GNC A;  1BKB A;  1RAE B;  3RIR A;  4F7U G;  2FPD A;  3QXE B;  1YHQ T;  1M1F A;  1ZHI A;  1TU0 B;  1WXT A;  5ECA A;  3I56 A;  1AZG B;  1ARK A;  4GLK A;  2M0O A;  2JMA A;  2XDP A;  3E9G A;  3GBQ A;  2NUP A;  1VQ6 T;  4HCB A;  1OPL A;  2CT3 A;  4N4H A;  1ACM B;  4BE2 A;  3PVQ A;  4HVW A;  2KQW A;  5GAM f;  2DIQ A;  3FLG A;  4OP0 A;  4F14 A;  2OTL T;  1PWT A;  2DNU A;  4FT4 A;  1X6G A;  2QDL A;  1QVP A;  1ZSZ B;  2L5Q A;  4M77 E;  1IO6 A;  5LJ5 e;  1X2Q A;  4M7D E;  4E7J A;  4AT1 B;  1YWP A;  2QAZ A;  1PC0 A;  1IRX A;  3ER0 A;  2EGC A;  3M4Y A;  4OMQ A;  3E19 A;  1YFN A;  2DF6 A;  2C0I A;  1HJD A;  2YLB A;  2DLP A;  4B6M A;  1RAF B;  3V7R A;  3KBG A;  3SHW A;  3JCM X;  1K1Z A;  2RF0 A;  2KRO A;  1YJW Q;  2QQ9 A;  1VQL T;  1T3L A;  2PUK B;  2YWW A;  1VQ9 A;  1VQ8 Q;  1P92 A;  2D8J A;  3H41 A;  3JB9 G;  4RKU E;  1KQS A;  5GAN h;  1IGU A;  1UG1 A;  2MPX C;  1Y7X A;  2FEI A;  3M0Q A;  4JS4 A;  2QQA A;  3TCJ A;  4M78 A;  3G71 Q;  3UF4 A;  1SEM A;  1G8X A;  1RAI B;  2O4X A;  4EDU A;  5C0M A;  2XD0 A;  1B7T A;  4LUD A;  2MYS A;  3F70 A;  1WZO A;  1KSW A;  5KE2 A;  4Z89 A;  4D8D A;  3OYG A;  1UEC A;  1GCP A;  4M77 B;  3CQT A;  1Q95 G;  3MEW A;  5LJ5 d;  4M77 F;  2GF7 A;  4M7D F;  2M9U A;  1B07 A;  5EG2 A;  4ME7 A;  3ZFJ A;  2PQW A;  5GAM e;  2IPO B;  5FRM A;  1TOV A;  1VQP Q;  3I56 T;  3BE3 A;  5EC7 A;  4J6W A;  1QQJ A;  2KXC A;  3JCM h;  2CGH A;  2DRM A;  2K7A A;  2RK2 A;  3G4S Q;  3VV0 A;  2DTO A;  1G3W A;  2KAF A;  2MAM A;  2VAS A;  1E6G A;  3QDF A;  3OYA A;  3OYM A;  3PGG A;  3TSW A;  1SSF A;  1ZA2 B;  2CSI A;  2VXE A;  3QYH B;  1Y71 A;  1NJI R;  1TUG B;  2NUT A;  2XDB A;  5IXB A;  1K73 C;  5FLX E;  2L8D A;  4QQ6 A;  3OYH A;  1M1G A;  2HQH A;  1OV3 A;  1DJ7 B;  3L2V A;  1ZSZ C;  2VC8 A;  4F04 B;  1QKW A;  1M3A A;  2FG0 A;  2ROT A;  2YHT A;  1KIK A;  2LC4 A;  1NJI U;  1IRE B;  2VV5 A;  1BB9 A;  5KYX B;  5LJ3 j;  3NTH A;  2CZ1 B;  1RL2 A;  1Y96 A;  2EYW A;  1CSK A;  5CKF A;  2V1Q A;  3L1A A;  1YIJ A;  3AHU A;  3OMG A;  2J7I A;  1JB0 E;  1QVF P;  5DLO A;  3I55 Q;  4EMK A;  3CD6 Q;  1N9S A;  1VQ9 T;  2O88 A;  2WSF E;  4FIB A;  1AT1 B;  3SDZ A;  1UGS B;  3VU3 C;  1M90 C;  2RHY A;  2E6Z A;  1FYN A;  2DIL A;  5D6X A;  2MIO A;  2K3Y A;  3A8L B;  2YXY A;  2CP7 A;  2CP2 A;  2AT1 B;  2E3I A;  5LJ5 g;  1KQ2 A;  3UPU A;  1LNX A;  4D8K A;  4DQ2 A;  5A2Q E;  3VS6 A;  1ZBJ A;  2E70 A;  2KYM A;  1VQ7 A;  2YRC A;  4JZ3 A;  3O8V A;  3LWH A;  1LCK A;  3A8G B;  3P8H A;  4LDX A;  3DLM A;  3UWN A;  1C1A A;  2JTE A;  3EG1 A;  5A0D A;  1YWO A;  4NS5 A;  1FXX A;  1WIE A;  5GMK j;  2EQJ A;  4M77 C;  3GF5 A;  3G7Z A;  3G6E A;  4M7D C;  1G2B A;  3OW2 S;  2QGG A;  2RQV A;  3OA6 A;  2EIF A;  4BI4 A;  1WHL A;  2EJF A;  1ZSZ A;  3HHT B;  1WJQ A;  4J9G A;  4MDW A;  3X28 B;  5IH2 A;  2FZG B;  5IHK A;  4K11 A;  2JJ9 A;  3HRU A;  4PJO G;  3DKM A;  4C8Q F;  1W2B S;  4EMH A;  1LJO A;  2DM1 A;  2FZK B;  2JMC A;  2XIC A;  2BZY A;  1YN8 A;  3CPW P;  2K2V A;  2ZPH B;  4RG8 A;  2V8J A;  4C5H A;  3V7C A;  2AZV A;  2EW3 A;  4PJO F;  3RUX A;  1VQ8 T;  4YTL A;  1Q82 C;  5FRO A;  4RTX A;  4M75 G;  1W1F A;  4KUI A;  3L2Q A;  1WLP B;  4E2F B;  4R55 A;  2JS0 A;  1C6V X;  2GFA A;  1G5V A;  1G3S A;  2MI6 A;  3M56 A;  5GAM g;  2JT4 A;  4PJN A;  2XK0 A;  3QJY A;  1I1J A;  4C92 D;  4WTO B;  1LOJ A;  2CT4 A;  2LJ1 A;  1YIJ T;  2F5T X;  3OYL A;  1QCF A;  3CCJ A;  5GJV B;  2ZPE B;  3FJP A;  2RD1 A;  3C0C A;  5CQY A;  1OYX A;  3QJ6 A;  4RTZ A;  1EX4 A;  2FHD A;  2RO0 A;  1UJY A;  2B8A A;  4E7Z A;  3ULR B;  3RBB B;  4MZT A;  1YJ9 A;  1ZUY A;  3H8Z A;  1U06 A;  1OU8 A;  3V8L A;  5GAN 4;  3CCL Q;  4M7A F;  1NM7 A;  2X4J A;  1PSE A;  5LJ5 j;  2V8K A;  1WHJ A;  3G4S T;  1N27 A;  2D9T A;  2LX7 A;  3QKJ A;  3M0T A;  1S72 Q;  2DRK A;  4QVC A;  4LN2 A;  1GFC A;  1OUL A;  2DBM A;  3CBO A;  1BU1 A;  2YT6 A;  2KT8 A;  4BD3 A;  1UGP B;  5LJ3 f;  2EKO A;  4CC2 A;  1WHK A;  3ZL7 C;  3PMT A;  2NUP B;  2DXC A;  3CPF A;  2KR3 A;  3MP8 A;  1UJ0 A;  2QA4 A;  2LCL A;  4FT2 A;  4M78 E;  4JJC A;  4KH0 B;  3A8H B;  1LPL A;  3CCQ A;  4QQD A;  2HEQ A;  1VQ6 Q;  3HKS A;  1AHJ B;  1VQO A;  1VQ4 T;  3CCR T;  1FMV A;  4C8Q C;  1HK9 A;  2XG8 D;  4OB2 B;  3H9N A;  4MZM A;  4FYV B;  3I55 T;  2OTL Q;  2F69 A;  1UGQ B;  3CD6 T;  2XHC A;  1VQN T;  1E7O A;  5CIU A;  2DPP B;  3EG9 B;  3CPW A;  3OMC A;  3HRS A;  2MOX A;  3OY9 A;  3CCE Q;  5CQX A;  1SHG A;  3JCM P;  1QP3 A;  2MWP A;  3H6Z A;  4JRI A;  2E64 A;  5I11 A;  5GAM j;  5HK3 A;  4PLL A;  3VRY A;  5CK9 A;  1SPK A;  2PTK A;  4LUE A;  3CCJ T;  3EFS A;  4XTV A;  2GTO A;  3IQL A;  3M0R A;  1NYF A;  4LNP A;  3FC3 A;  3JCM V;  3CC4 Q;  4M78 B;  3JCM W;  4F17 A;  1QVG P;  1UB4 A;  4II1 A;  4JDS A;  3NTK A;  1YBY A;  2DMO A;  2O4X B;  1U3O A;  2M02 A;  4M78 F;  1F1B B;  1MUZ A;  2YSQ A;  3OYY A;  1I5L A;  2HSP A;  5LJ5 h;  1AZE A;  1H3Z A;  1WGS A;  1H8K A;  5LJ3 e;  1YNZ A;  1M2O A;  1WHG A;  1VQK A;  1K0X A;  5CKH A;  2LCS A;  4KGX B;  1BIB A;  2RHI A;  1PD0 A;  4M7A C;  3GNF B;  4ZN1 A;  2YLC A;  2XI9 A;  2HD0 A;  2F2V A;  3M54 A;  1WA7 A;  4PFZ A;  5IN1 A;  2V26 A;  4FSS A;  2GGR A;  2CZ0 B;  1YIT A;  1WXB A;  2OX7 A;  2DKG A;  4CC4 B;  2EGE A;  4KUL A;  4XTY A;  4BAC A;  2LRQ A;  2W0Z A;  1QW1 A;  4F16 A;  1YI2 A;  4BI3 A;  2D1X A;  4O6J A;  4HT8 A;  2RK1 A;  3QBY A;  3I56 Q;  1N6A A;  2CS7 A;  4QKU A;  2DEQ A;  2BE9 B;  3THK A;  1NBE B;  2LNV A;  4N0A A;  3QHS A;  2DER A;  4DEX A;  2NUT B;  5GMK e;  1XTD A;  5KCO A;  1MND A;  2KDS A;  1ZUK A;  3S3O A;  3M5A A;  3O5Z A;  5A0L A;  1KC8 R;  3WVE B;  5LJ3 d;  2CUD A;  2R57 A;  2VKN A;  2LQK A;  2DE0 X;  3MO8 A;  5KYW B;  3TSZ A;  3RES A;  2LDM A;  4E7S A;  1ZUU A;  1LVK A;  5GAN 6;  1PRL C;  1JEG A;  1HD3 A;  4HA8 A;  1VQ5 A;  1G3T A;  3OYB A;  1JXO A;  2FRW A;  5D6W A;  1KC8 U;  1KQS S; 
#chains in the Genus database with same CATH homology
 1NEB A;  2K2M A;  2A37 A;  4ORZ A;  1AEY A;  2OJ2 A;  4OMO A;  2DA9 A;  1B07 A;  2H8H A;  3U23 A;  1AWX A;  4LE9 A;  2BZ8 A;  2CRE A;  1HSQ A;  1JO8 A;  4AFS C;  2A36 A;  4Z88 A;  5EC7 A;  1ZLM A;  2KGT A;  4IIO A;  2KXC A;  2J6K A;  2DRM A;  2K7A A;  4E6R A;  1GBR A;  1OEB A;  3M0U A;  2L3Q A;  1UHF A;  1E6G A;  2JM8 A;  2DL4 A;  3VS7 A;  1AVZ C;  2C0O A;  3TSW A;  3FJ5 A;  2CSI A;  1VA7 A;  1RUW A;  4AFZ C;  2KRN A;  2ED1 A;  5IXB A;  1S1N A;  1AD5 A;  1PKT A;  1H92 A;  4J9H A;  2RQT A;  1UUE A;  1OV3 A;  2EPD A;  4RTT A;  1J3T A;  2DX1 A;  4AFQ C;  1QKW A;  1M3A A;  4Z8A A;  3R6N A;  2FG0 A;  2EGA A;  1MV3 A;  2ROT A;  1KIK A;  2BTT A;  1BB9 A;  3REB B;  1UTI A;  2J05 A;  5IHN A;  4KRT A;  2EYW A;  2VWF A;  2KE9 A;  1CSK A;  2V1Q A;  2DYB A;  2J7I A;  2A28 A;  1X69 A;  1RLQ C;  4HVV A;  4J9I A;  4EIK A;  2O88 A;  2D8H A;  2MCN A;  1WFW A;  2CH4 W;  4GLM A;  3VRZ A;  2FPF A;  1OOT A;  3VS5 A;  1FYN A;  2DIL A;  1PNJ A;  4J9C A;  1BK2 A;  2MIO A;  2KXD A;  2DVJ A;  1K9A A;  4JZ4 A;  2G6F X;  2RNA A;  5FWB A;  1VYU A;  1PHT A;  1X6B A;  1EFN A;  1SRM A;  1H3H A;  4JPB W;  4D8K A;  2E5K A;  1E6H A;  1ZX6 A;  3VS6 A;  1ZBJ A;  2KYM A;  3JV3 A;  4JZ3 A;  2KRM A;  1LCK A;  3EG3 A;  2RQU A;  2LMJ A;  2EKH A;  2JTE A;  3EG1 A;  1YWO A;  1WIE A;  3I9Q A;  2X3X D;  4RTY A;  1WXU A;  2O9S A;  2EBP A;  3EGU A;  2M51 A;  1ABO A;  1G2B A;  5IXF A;  2RQV A;  2EVR A;  3EG2 A;  3QWX X;  1GFD A;  1W70 A;  2K6D A;  2DJQ A;  1NLO C;  2CDT A;  4R0K A;  2V1R A;  4J9G A;  5IH2 A;  2KYB A;  2O31 A;  3M0P A;  5IHK A;  4K11 A;  2VVK A;  2DL7 A;  2DM1 A;  2JXB A;  2YDL A;  2HBW A;  2JMC A;  2NUZ A;  2AZS A;  3VS3 A;  1NLP C;  1MV0 B;  2BZY A;  1YN8 A;  1SSH A;  2W10 A;  2AKK A;  2LJ3 A;  2ECZ A;  3H0H A;  2L0A A;  2AZV A;  2EW3 A;  2RPN A;  1V1C A;  1GCQ C;  2P4R A;  1TUC A;  1BBZ A;  3EHQ A;  1NEG A;  1OPK A;  2EYY A;  4HXJ A;  4RTX A;  5L23 A;  2J6O A;  1W1F A;  1WLP B;  2JS0 A;  1Y0M A;  2ED0 A;  2LJ0 A;  2JT4 A;  4X1V A;  1Z9Q A;  1I1J A;  2KEA A;  4ZNX A;  1M8M A;  4JJD A;  2HCK A;  4OMP A;  1T0J A;  1K4U S;  3NPF A;  3NHN A;  1RLP C;  2CT4 A;  2CH4 A;  2LJ1 A;  3H0I A;  1QCF A;  4M4Z A;  5GJV B;  2ENM A;  1PKS A;  4A63 B;  3C0C A;  2GTJ A;  4JJB A;  1TUD A;  2K3B A;  4J9E A;  4WCI A;  4RTZ A;  4ESR A;  2O9V A;  1UJY A;  3UA6 A;  3QWY A;  2PNI A;  2KT1 A;  3ULR B;  3RBB B;  3I5R A;  3VS1 A;  4QT7 A;  5I22 A;  1ZUY A;  3SEM A;  1U06 A;  1WX6 A;  2FO0 A;  2A08 A;  2GQI A;  1NM7 A;  2L2P A;  2K9G A;  1PRM C;  2FRY A;  2KBT A;  2LX7 A;  4DEY A;  3M0T A;  1GBQ A;  2YUO A;  1UDL A;  2DRK A;  2OAW A;  4LN2 A;  1GFC A;  4J9F A;  3I35 A;  2DBM A;  2YUP A;  2DBK A;  2M0Y A;  1T3S A;  1BU1 A;  1W6X A;  2YT6 A;  2KT8 A;  4GBQ A;  3LH5 A;  4CC2 A;  2LP5 A;  2L3S A;  3ZL7 C;  1JU5 C;  2ABL A;  2JW4 A;  1GCQ A;  2O2O A;  3RNJ A;  2JS2 A;  2ESW A;  2KR3 A;  1UJ0 A;  1Y57 A;  1GL5 A;  1RI9 A;  1Z9Z A;  1SHF A;  2F2X A;  3M0S A;  1ABQ A;  2J06 A;  1WDX A;  1CKB A;  4J9B A;  2DL5 A;  1GRI A;  1X2K A;  1XOV A;  2RN8 A;  4JJC A;  4AG1 C;  1SRL A;  2HEQ A;  1AWJ A;  2LZ6 B;  3PE0 A;  2RMO A;  1QWE A;  1M3C A;  1U5S A;  3VS4 A;  4RTV A;  1ZSG A;  4OMN A;  2JM9 A;  1M30 A;  3VS0 A;  1M27 C;  1QKX A;  1I0C A;  1QWF A;  2LQW A;  3REA B;  5IHI A;  2BZX A;  2SRC A;  1E7O A;  1JXM A;  1NYG A;  1K76 A;  1NG2 A;  5FW9 A;  2F2W A;  3NMZ C;  2KNB B;  2MOX A;  1UFF A;  2CSQ A;  1SHG A;  2LQN A;  4OMM A;  2EYZ A;  2I0N A;  4RUG A;  5I11 A;  1KFZ A;  4HCK A;  4RTW A;  3VRY A;  1K0S A;  2NWM A;  1SPK A;  2PTK A;  4AFU C;  1YCS B;  4LUE A;  3NGP A;  3VS2 A;  1FMK A;  2GNC A;  4AG2 C;  2GTO A;  3IQL A;  3M0R A;  1NYF A;  4LNP A;  2FPD A;  1YP5 A;  1X27 A;  2DL8 A;  1WXT A;  4F17 A;  5ECA A;  1AZG B;  2AKL A;  1ARK A;  2DMO A;  2JMA A;  1U3O A;  3GBQ A;  2LNH B;  3EHR A;  1MUZ A;  2B86 A;  2YSQ A;  2HSP A;  1OPL A;  1AZE A;  2CT3 A;  3UA7 A;  4IIM A;  1H8K A;  1QLY A;  3TVT A;  1WYX A;  1YNZ A;  3PVQ A;  2L3P A;  4HVW A;  1K0X A;  1X43 A;  2LCS A;  2C0T A;  2J6F A;  1I07 A;  4F14 A;  4RTU A;  1CKA A;  1G83 A;  1PWT A;  2DNU A;  2HDA A;  2F2V A;  2RQR A;  1WA7 A;  1X6G A;  2QDL A;  2XMF A;  2D0N A;  2RQW A;  4FSS A;  2GGR A;  2IIM A;  2AK5 A;  2GBQ A;  1WXB A;  3H0F A;  1IO6 A;  1AOJ A;  4J9D A;  4CC4 B;  1X2Q A;  2EGE A;  1TG0 A;  1N5Z A;  2W0Z A;  1YWP A;  2ROL A;  5FWC A;  3EG0 A;  4OML A;  2EGC A;  4F16 A;  2OI3 A;  1KJW A;  2D1X A;  4OMQ A;  1VYT A;  3A98 A;  2DF6 A;  2C0I A;  1HJD A;  2DLP A;  2CUB A;  2SEM A;  3THK A;  2EYX A;  1JQQ A;  3SHW A;  1K1Z A;  2RF0 A;  2KRO A;  3PVL A;  2K79 A;  4DEX A;  1T3L A;  1B3Q A;  4Y92 A;  5GJW B;  2D8J A;  3H41 A;  1VYV A;  1ZUK A;  1UHC A;  1AWW A;  2X3W D;  1UG1 A;  3O5Z A;  2FEI A;  3M0Q A;  1A0N B;  2DL3 A;  2FPE A;  3UF4 A;  2CUD A;  1UE9 A;  2VKN A;  1AWO A;  1UGV A;  2YUQ A;  4HVU A;  4CC7 A;  1SEM A;  3KFV A;  2DE0 X;  1T0H A;  4CC3 A;  3TSZ A;  1M3B A;  1ZUU A;  3I5S A;  4LUD A;  1PRL C;  1JEG A;  2PZ1 A;  1HD3 A;  1WI7 A;  1KSW A;  2YUN A;  3UAT A;  4Z89 A;  4D8D A;  1UEC A;  1GCP A;  1JXO A;  2EQI A;  2FRW A;  2KRS A;  3CQT A;  5HCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...