2ENMA

Solution structure of the sh3 domain from mouse sorting nexin-9
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
77
structure length
77
Chain Sequence
GSSGSSGMATKARVMYDFAAEPGNNELTVTEGEIITVTNPNVGGGWLEGKNNKGEQGLVPTDYVEILPNDGKDPFSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sorting nexin-9
publication title Solution structure of the SH3 domain from mouse sorting nexin-9
rcsb
source organism Mus musculus
molecule tags Endocytosis
total genus 8
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2enmA00
2FPFA 1YNZA 2JW4A 4CC4B 2RQVA 1S1NA 4CC3A 1X43A 2K3BA 2J7IA 1PRLC 4FSSA 2DBKA 1Z9QA 1A0NB 2DL7A 3THKA 1WX6A 4JPBW 1JU5C 4A63B 2RQRA 1GRIA 1ARKA 1RLQC 4RTWA 1T0JA 2KRMA 4LN2A 1OEBA 2BZ8A 2D8HA 2DILA 3VS7A 2K2MA 2EGAA 3EG1A 2MCNA 2F2XA 2PZ1A 3M0TA 3PVLA 3GBQA 4IIOA 1M30A 5GJVB 1XOVA 1I0CA 3H0HA 3VRZA 1U5SA 2CH4W 3H0FA 5HCKA 1GBRA 2DLPA 3NGPA 2LJ0A 1GCQC 1K9AA 4OMOA 1K0XA 3QWYA 2BTTA 4OMLA 1PRMC 3RBBB 5ECAA 1SEMA 2O9VA 1K0SA 4GLMA 2CREA 2KT1A 3EGUA 2ENMA 2K6DA 2RQTA 1OPKA 2J6OA 2MOXA 2EQIA 2JT4A 2JS0A 2M51A 1KFZA 2RMOA 1NLOC 4J9FA 2EVRA 3M0UA 1GFCA 2L3QA 4ORZA 1ZX6A 2KR3A 3CQTA 4HXJA 1OV3A 5IXBA 1KIKA 2IIMA 1HD3A 2K79A 4IIMA 3VS3A 1CSKA 1M3BA 2LJ1A 3C0CA 1YWOA 3EHQA 2DA9A 3H0IA 4LUDA 2F2WA 1PNJA 2KNBB 2RQWA 2CDTA 1WI7A 2DL4A 4HCKA 2DJQA 2DL8A 1GCPA 4JJDA 1Y0MA 2J05A 3RNJA 1NG2A 4WCIA 4DEYA 2ESWA 1GCQA 4AFQC 1N5ZA 1SRMA 2RF0A 5IXFA 3NPFA 1UJ0A 3VS6A 3UF4A 1W6XA 4LUEA 4HVVA 3EG3A 2HSPA 1AZGB 2EYYA 3EG0A 3M0RA 1X6GA 2AZSA 1ABOA 2FG0A 4QT7A 4JZ3A 3U23A 2K7AA 1UFFA 4RTZA 2D0NA 2OI3A 3M0QA 2FRWA 2DRKA 2DX1A 1MUZA 1JXMA 1WXUA 1PHTA 3TSZA 1AZEA 1HJDA 2ABLA 1E6HA 4JZ4A 1M8MA 2D1XA 1H92A 1YP5A 2LCSA 1YWPA 1E6GA 2M0YA 1X6BA 1T3SA 1UTIA 2J06A 2GTJA 2EGEA 4EIKA 2DMOA 1UHCA 3A98A 2FPDA 3M0SA 2SRCA 2KYBA 1AWXA 1KSWA 1FMKA 3UATA 2LJ3A 2HDAA 2VWFA 1WLPB 2DNUA 3EHRA 1UJYA 2C0OA 3SHWA 2AKKA 4RTUA 5FWBA 1X2QA 1M3CA 2ROLA 1JQQA 2HCKA 1ZLMA 2P4RA 1SPKA 2FPEA 2CT3A 1JXOA 2EGCA 2KROA 1VA7A 2AKLA 2V1QA 5I11A 2W10A 3EG2A 2C0IA 4AFSC 4M4ZA 3VRYA 1YN8A 1NM7A 2A37A 2GGRA 2A36A 1H3HA 1OPLA 2ROTA 3REBB 2KRSA 2LQWA 3REAB 5IHKA 1BU1A 4CC7A 1K1ZA 1UGVA 1AWJA 2LX7A 2C0TA 2MIOA 1NEBA 2CSQA 1UHFA 2JMAA 1WXBA 2DF6A 1QWEA 4JJBA 2RN8A 4R0KA 3UA6A 1NEGA 2ED1A 2EKHA 2JM9A 1JO8A 1MV3A 2LMJA 1IO6A 1LCKA 1UUEA 2GNCA 2VKNA 4OMPA 2PTKA 2X3WD 4AG1C 5IH2A 1AEYA 1KJWA 2KE9A 4RUGA 2LNHB 1QKXA 2L3SA 1VYUA 2FO0A 4J9HA 1EFNA 2OAWA 2L0AA 1W70A 2FRYA 2OJ2A 1WDXA 1Z9ZA 2KYMA 2LZ6B 1ZBJA 5GJWB 4Y92A 1I07A 3ULRB 1WYXA 2ECZA 2DVJA 2KRNA 1TUCA 2E5KA 2JS2A 1GL5A 1PWTA 1WA7A 4F17A 2L2PA 4RTTA 1NLPC 1ZUKA 2A08A 2V1RA 1CKAA 3IQLA 2DYBA 1X69A 3LH5A 4J9DA 4J9GA 2DE0X 3VS5A 1BBZA 1K4US 1UE9A 4Z8AA 1U06A 4GBQA 2KXCA 1ZUUA 1MV0B 1U3OA 3H41A 1NYGA 2JTEA 2HBWA 3VS4A 1BB9A 2YUQA 1WIEA 4LE9A 1SSHA 4E6RA 1AWOA 3TVTA 2SEMA 4X1VA 4CC2A 1ZSGA 1B07A 3QWXX 4RTVA 5FWCA 2PNIA 1B3QA 1SRLA 1AWWA 1UG1A 4HVUA 2HEQA 1X2KA 2CUDA 2EW3A 4D8DA 2O9SA 1HSQA 2I0NA 3O5ZA 5IHIA 2EYWA 1UDLA 1NYFA 4AFZC 2JM8A 2CUBA 1WFWA 3I5RA 2KT8A 2CH4A 1TUDA 3ZL7C 2H8HA 3FJ5A 2YSQA 2F2VA 1M3AA 1YCSB 4ESRA 4DEXA 1WXTA 2GQIA 2ED0A 2O31A 2DM1A 4AFUC 2DL3A 2AK5A 1AVZC 2VVKA 3M0PA 1RUWA 2EPDA 2YT6A 2YUOA 4J9CA 2YDLA 1ABQA 4J9IA 4J9BA 4RTYA 2BZYA 2KXDA 2O2OA 1AD5A 1SHFA 4OMNA 2FEIA 1RI9A 1CKBA 2O88A 5FW9A 2RNAA 2CSIA 1UECA 2EBPA 2CT4A 4F14A 1TG0A 5I22A 2G6FX 1FYNA 2RQUA 3NHNA 1VYTA 2XMFA 2KBTA 4LNPA 2NWMA 1RLPC 1V1CA 4K11A 3R6NA 2DRMA 2J6FA 1BK2A 4JJCA 4F16A 2BZXA 2B86A 2D8JA 2LP5A 1QWFA 5EC7A 1PKSA 4OMMA 1GBQA 2GTOA 2DBMA 1Y57A 1M27C 3TSWA 4ZNXA 1J3TA 4J9EA 2GBQA 1W1FA 2L3PA 4RTXA 2YUPA 2EYXA 1QKWA 4HVWA 3NMZC 2QDLA 2A28A 3PE0A 1I1JA 2X3XD 4D8KA 1GFDA 3I35A 2JMCA 4Z88A 3SEMA 2KGTA 1AOJA 2AZVA 4Z89A 1QCFA 3VS0A 2JXBA 2LQNA 2W0ZA 5IHNA 3I9QA 1ZUYA 2NUZA 1E7OA 1H8KA 1X27A 2RPNA 1G83A 2K9GA 2EYZA 3KFVA 3I5SA 4KRTA 2J6KA 3VS1A 5L23A 1K76A 1G2BA 1T0HA 1JEGA 1PKTA 2DL5A 1T3LA 4AG2C 1OOTA 4OMQA 2YUNA 3PVQA 1QLYA 1VYVA 3VS2A 2KEAA 1SHGA 3UA7A 3JV3A
chains in the Genus database with same CATH superfamily
2FPFA 1YNZA 2JW4A 4XTWA 1YI2A 2QGFB 2E3HA 1WHHA 1Q82U 2OTLA 2J7IA 4FSSA 3JB9J 1S72Q 1Z9QA 4QQDA 5A0DA 4PFZA 2RA2A 1RLQC 2FYKA 4LN2A 2QASA 1XNIA 4N0AA 3PVLA 4OVAA 3GBQA 3ZBDA 1QVFP 5J26A 1W2BP 2VXEA 1KD1R 2WSEE 3OS2A 1XOVA 2VUBA 4MZMA 2LJ0A 2KDSA 2DJZA 4OMOA 5KYYA 1LVKA 2DKGA 4OMLA 4C92G 1R0CB 2BE9B 2QDYB 2QK0A 2O9VA 2RI2A 5CIUA 5GAMh 5KYYB 5AT1B 2K6DA 2RQTA 2J6OA 2EQIA 3CBPA 4Y91A 1KFZA 1BIBA 1NLOC 1V29B 1WZOA 3QIIA 4NL3A 3M0UA 1GFCA 5C6SA 3C94A 3CCUT 5HK3A 4M7DC 2QYZA 1ZX6A 3CQTA 3CCQT 1MNDA 5GMKi 3CC2A 1RI0A 1M3BA 3GF5A 4J6YA 3OYLA 4XTUA 4ZGDB 3E1SA 3CCLT 4LUDA 2F2WA 3JCMf 1VQMQ 4C5GA 4FW2A 2QQSA 4N4HA 3CXCA 1PG5B 2DL4A 2DJQA 4PL6A 1GCPA 2D6FA 1Y0MA 3M56A 3OMCA 1SG5A 1VQ7T 2QG9B 1M2VB 1SRMA 2RF0A 2O4XA 1VUBA 4LDYA 1W6XA 1MMDA 1M2OA 5KYUB 4FCYA 4GLKA 1M90U 1TSFA 5GAMd 1ABOA 2FG0A 4PJOC 3CBOA 1BCMA 2K7AA 1UFFA 3INZA 4RTZA 5GAOn 5GAN5 2Y90A 4HCBA 1JXMA 1Q81C 1HJDA 1VQ5Q 4XU3A 5CKEA 1H92A 2XG8D 1VQ9A 1BCOA 1FXXA 3RUXA 2R57A 1JJ2S 3OYGA 2GTJA 3CC4A 4M7DB 1ZSZC 2DMOA 3CCRT 2KYBA 1KSWA 1OX8A 1RAAB 2OTLT 4OGCA 4ZTJA 2VWFA 1YJWQ 3EHRA 5AYFA 2C0OA 2DTHA 4JS5A 2AKKA 4DOWA 4RMOA 2QEXT 1YHQQ 2ROLA 4TVRA 3CC7A 4D6WA 1JRIA 3QJ6A 3X26B 3DLLA 2KROA 3OB9A 1Y71A 4JRIA 1MHNA 2QA4T 4DBHA 5D6XA 3V7CA 2C0IA 1YN8A 2CZ7B 2GGRA 3TREA 2DEUA 4PJOA 1H3HA 1OPLA 3REBB 2LQWA 3TQ7P 5IHKA 1BU1A 1K1ZA 1UGVA 2Z0WA 1AWJA 3A8HB 2C0TA 2MIOA 4KULA 5LJ3g 2K57A 1NEBA 2DZCA 2CSQA 3VYHB 1S72A 4PJOB 2KMTA 1WXBA 2DF6A 4JJBA 3CD6T 1VQ8A 5FU7C 5GAOl 2JOYA 2E65A 2ED1A 1VQ4Q 4BB7A 1QVPA 1IO6A 4ME7A 4R56A 1ZSZA 3ZEHA 1LCKA 2VKNA 4RCCA 4AG1C 1VQNQ 2COZA 2L3SA 3LGFA 4C5HA 1ZSZB 4C92C 2M16A 2EQUA 3QDRB 1WDXA 1Z9ZA 4PKCC 3OS1A 2LZ6B 1M8VA 4PFOA 1I07A 1WYXA 5IN1A 2DVJA 4E7KA 1WHKA 4XTYA 4F04B 3I55Q 3LWIA 3PMIA 1VQKQ 3CCVQ 1NPPA 3GNGA 5GMKm 4MMLA 3E9GA 1X69A 5GAMf 4M7AA 3MJXA 4RG8A 2KXCA 1U3OA 4E7HA 3H41A 4PJOD 2QQ9A 3G71Q 2PQWA 2X4JA 4LE9A 2CS7A 4E6RA 2PU9B 4N4IA 5LJ3e 1ZSGA 3CPWA 3T9NA 2DXBA 2PNIA 1VQMA 5FU7B 3MEWA 1UG1A 2RJEA 2XD0A 1JB0E 2EW3A 2I0NA 2HZYA 4X34A 1LNXA 4C92A 1VQ9T 1UDLA 2RD1A 3I5RA 2CH4A 1M1FA 2QAZA 4C92B 3CC4T 2EJFA 4FM4B 1D3BA 4QVCA 3ASKA 1PD1A 1M1KR 3PT9A 3HL8A 2DM1A 3P8BB 4X9CA 1AVZC 2YT6A 2QI2A 2YDLA 1ABQA 4J9IA 2V8JA 2DVEA 2KXDA 3FDRA 2FB7A 3DB4A 1AD5A 2CYZB 1SHFA 4JLIA 1VQ5A 4OMNA 1CKBA 4L59A 2KQWA 5GANg 2CSIA 3NTKA 3CC7T 2CT4A 4KBMB 1IHWA 4M7AD 1VYTA 2XMFA 1D09B 3UWNA 5LJ3j 1V1CA 4MZTA 2RO0A 4FU6A 3PFSA 2CKKA 7AT1B 4F16A 2WSCE 2BZXA 2NUTB 4HT9A 3OYCA 1PKSA 4OMMA 3OYMA 1YI2Q 1GBQA 2GTOA 1YJWA 1Q7YR 5DM7R 1S72T 2RK1A 1KHCA 1KK7A 4ZNXA 4ZGJB 1YHQA 2EYXA 4PJJA 3JB9I 1Y96A 4C92D 4EPCA 4IKFA 2RI3A 5KYWA 3NMZC 2XIDA 1Q86U 2QDLA 1TS9A 1PSEA 3PE0A 4M78A 3OYIA 4E7IA 1YCYA 2LCCA 4DOVA 2X3XD 5LJ5g 4PJOE 4M7AF 2JMCA 2E4HA 4IUTA 3SEMA 2KGTA 1C0MA 1KD1C 1AOJA 1JJ2A 1SF9A 1G3TA 4M77A 3GPLA 2DEQA 2QTXA 2JZ2A 2XHCA 3V7SA 3CPWP 3ZFJA 3CBMA 1PKTA 1RAHB 4LDVA 2DFUA 4OMQA 1XJWB 4QQGA 1K73U 1VQ4A 2YUNA 5GMKe 3PVQA 1QLYA 1TOVA 4C8QA 3RDVA 2V8KA 3L2WA 1VIEA 4KH1B 3GIBA 4KUIA 3G4SQ 3FLGA 1VQNA 3G7ZA 4CC4B 3M4GA 3FB9A 2LCLA 2BIVA 3BFMA 1A0NB 2DL7A 1WX6A 1JU5C 1ARKA 2RQRA 1GRIA 4II1A 4NS5A 2KRMA 3AHUA 4C5IA 2K2MA 2EGAA 4MDWA 2X35A 3EG1A 3I55A 2DTOA 2F2XA 2PZ1A 2K3YA 1N8RR 1VQKA 4LDXA 3CCVA 2XDBA 3UDCA 3PMTA 1M30A 4OGEA 5GJVB 2GFUA 4FT2A 4M7AE 3H0FA 5HCKA 3VUBA 2DLPA 4M78D 3NGPA 4KGVB 4M75A 1YIJQ 1K0XA 2BTTA 3FIFA 1HXDA 1PRMC 2RHYA 3G71A 2YHTA 1SEMA 5ECAA 3OW2S 1QVGS 2E6ZA 4AMCA 4M77D 1RAGB 3S6WA 5GMKj 1C1AA 4BI4A 1QCOA 4KGZB 1YFNA 5KH6A 4V2SA 4PK4A 2RHUA 1O75A 1D1BA 2X4XA 4RKUE 2M0OA 2EVRA 1VQ5T 4C92E 4C8QD 2KY9A 2MAMA 3A8LB 1VQ6Q 3JB9F 3OBYA 3ME9A 2L3RA 3OYKA 4IIMA 4M78F 3RMSA 1D1CA 1JJ2P 2QGGA 1JBMA 1YWOA 2H3EB 2ZGWA 1PNJA 2KNBB 4M77F 1K8AR 2MI6A 5KYNA 4HCKA 3QPHA 2RK2A 4WCIA 4DEYA 2KSSA 1EZZB 3L2RA 2ESWA 3D7SB 5IT9E 3S3MA 2AIRB 4FYVB 3MCAB 4C8QF 5IXFA 1M1GA 2FZKB 5FROA 3EG3A 4M75D 3L2VA 2EYYA 3JCMc 2OTJQ 3P8HA 3QHSA 3QSUA 2FRWA 1MUZA 3G6ET 3OYFA 2ABLA 2QTVA 2D1XA 3BDUA 1BIAA 4J6XA 1NBEB 1YWPA 1E6GA 2HQEA 4M7AG 2LQ8A 1VQ4T 2R5MA 2BKDN 1FWZA 2J06A 5I21A 2PUKB 1VQ8Q 1VOMA 2MMPA 3CCSQ 4M78E 2F5TX 1UHCA 5D7UA 2MF2A 4M75F 1NJIR 4M77E 3UATA 3JCMW 1WLPB 2DNUA 3CMET 3SHWA 4RTUA 1HK9A 5FWBA 1M3CA 1JQQA 1ZLMA 3CPWS 1SPKA 2F69A 2CT3A 1XTDA 1JXOA 2HQXA 3I55T 2V1QA 2AKLA 2KK4A 2E6NA 4C8QE 4E7ZA 2W10A 3CCET 3EG2A 2D9TA 2HBPA 1NZ9A 1KC8U 5CCAA 3HRSA 1OU9A 3G4SA 2A37A 1NM7A 3X28B 2A36A 2ROTA 4E7JA 4PFPA 4CC7A 2LX7A 1V76A 3QZ9B 1I5LA 5M9OA 4R0KA 2DERA 2EKHA 2JM9A 1JO8A 1MV3A 4IUUA 4LDUA 1NE8A 2LMJA 2JUFA 1UUEA 2EYQA 2PVOB 1RL2A 3RMQA 5IH2A 1AEYA 2LNHB 1QKXA 3H8ZA 5CKBA 1VYUA 2X4YA 4J9HA 1YJ9Q 2CP2A 3DB3A 4M75E 4PJLA 1TUGB 1P92A 1Q82R 1YIJA 1WQ7A 1VQOT 2KYMA 1SKUB 3QG1A 3I56Q 3KXTA 3ULRB 2ECZA 3CCJT 1UB4A 4XQ3A 1K9MU 4BACA 2E5KA 3LH0A 5L8RE 5D6WA 1WA7A 1M4ZA 4RTTA 1M1KC 1ZUKA 2DETA 2C06A 2V1RA 3UT1A 1CKAA 2O4XB 1BI3A 3V8KA 4C5EA 4J9DA 4J9GA 4M78G 4PNOA 1BBZA 4J83A 3V7RA 1BI2A 5DLQE 1U06A 3J81E 3OBWA 1VQLT 4WTOB 4HCCA 1MV0B 1VQ6A 5KCOA 2V8IA 1NYGA 4LDWA 3PIPA 2YUQA 1WIEA 4M77G 1SSHA 1R8OB 4C0DC 2RHZA 2HMAA 2XICA 1YJNQ 2E41A 2XDDA 5FWCA 3OW2A 4CI0C 1B3QA 3BY7A 1ZA2B 1QVGA 1WPYA 2CP6A 1YI2T 2HEQA 2JNGA 2P0QA 4PJNA 4C8QG 4JS4A 2CUDA 1WHJA 3L2ZA 3LLRA 1Q7YC 2O01E 4RCBA 4AFZC 4E7SA 3A5ZB 3C95A 3FJPA 1G8XA 1RAIB 1PSFA 4ZTFA 1QQJA 1WHGA 4AT1B 2YSQA 1QW1A 2VGMA 5GANh 1YCSB 4B9XA 2RHXA 2GQIA 2ED0A 1PD0A 1G3YA 3EH1A 2OTJA 2AK5A 2CZ0B 2ZPFB 1YBYA 4J9BA 5DY9A 2P4TA 4M7AC 4QVDA 3V8LA 1AT1B 5FW9A 1TG0A 1HYOA 2E5QA 4R55A 2M9UA 3EFOA 4M75G 3CCSA 4LNPA 2FZGB 3EAEA 1BI1A 3G4ST 4JUVA 3R6NA 4FL6A 3CMAQ 2DRMA 3L42A 1BK2A 4JJCA 1M90R 4J7FA 4C0DB 2ZPGB 5FRNA 3JCMJ 3VJPA 4DBFA 5GAMg 2DBMA 1Y57A 3X25B 3JB9H 5LJ5h 4A4FA 1J3TA 4A53A 4FYYB 4JDSA 3CC2T 1BYMA 4HVWA 2ZCFB 4YTLA 3EFRA 3WXMB 1N8RC 1RAFB 1N27A 3HRTA 5GANd 1Q95G 3BDLA 5A0GA 2EQJA 4Z89A 1Q81U 1QCFA 2DIQA 3VS0A 1B34A 4BUGA 4VUBA 5IHNA 2AHJB 2NUZA 1E7OA 4ATOA 2L89A 3KFVA 4ZGEB 1JEGA 5L23A 1G2BA 3SB2A 3EG9A 1T3LA 3OW2P 3HHTB 5CAIA 1QVGP 4M7AB 1RABB 4QW2A 5A2QE 4N4GA 2KEAA 3QKJA 3FEOA 5GAN3 1KQ1A 5GAN2 1Y07A 1WGSA 1UGQB 4F7UF 4HCZA 5D6YA 3NTIA 1X43A 3C12A 1YJ9A 1U8RA 3HTRA 2DBKA 3OYAA 4FIBA 3I56A 2CP3A 5LJ5d 3QJYA 1T0JA 1OEBA 2EJ9A 2DILA 5J3BA 5GAMe 2HKNA 3CCLQ 3VUZA 1N9SA 5GMKl 3M0TA 2RI5A 4M78C 4XU2A 3L2UA 5KYXA 1K8AC 3C4SA 3QXEB 1I0CA 1W4SA 3H0HA 1D3BB 1U5SA 2CH4W 5KE2A 1I8FA 2XU8A 4M77C 1FMVA 1GCQC 1K9AA 5GAOq 1I5OB 4XTVA 1VQPQ 3QWYA 3RBBB 2JJ9A 2LX9A 5CQYA 1K0SA 4GLMA 1F1BB 3UPUA 2CREA 2KT1A 2DIGA 3OYYA 2ENMA 4C8QC 2MOXA 1YJNA 2K5FA 2E3IA 4LD9K 3MHXA 4CRIA 2L3QA 4ORZA 3EGXA 2YRVA 1OV3A 5IXBA 1KIKA 2CZ1B 3X24B 1X01A 2K5IA 3VS3A 1VQ8T 4RG2A 2LJ1A 3TCJA 1N8RU 5GAMj 2VGNA 2BUDA 3EHQA 2E1HA 1WJRA 4KH0B 2RQWA 3URGA 3SD4A 1Y96B 3LWHA 2DL8A 4JJDA 4XU1A 2QQBA 1NJIC 5KYWB 3RNJA 1NG2A 5GANf 9ATCB 4M78B 2QEXQ 3NFCA 1GCQA 4OF1A 4AFQC 4M75C 1QCNA 1N5ZA 3RERA 1H3ZA 3LW5E 4LUEA 2QA4Q 3EFSA 4M77B 1KQSS 1AZGB 3EG0A 3HFOA 2RH2A 2AZSA 3O8VA 5A0LA 3CMAA 4QT7A 4FSXA 3U23A 4E2FB 3ER0A 3PNWC 2OI3A 3M0QA 2FVUA 2DO3A 1PHTA 2XKOC 2QQAA 3TEEA 1E6HA 4C8QB 4JZ4A 2JN0A 1I81A 1OYXA 4OP0A 1YP5A 2LCSA 2WSFE 2CGHA 4IUQA 2DK3A 2M0YA 4DA4A 3CD6Q 1IGQA 2QXFA 1T3SA 3KBGA 1KQ2A 3OYEA 2EGEA 5EG2A 4EIKA 5LJ5f 2FPDA 4J7IA 1VQMT 4PLLA 1YJ9T 3JB9D 2LJ3A 2ZZDA 1UJYA 1XQHA 1X2QA 3PTAA 2K4YA 1Q82C 5GAN6 2JTMA 3OSVA 3A8OB 1GXIE 4F7UG 2AT1B 1G3SA 1N6AA 2EGCA 5HY6A 2YXYA 1Y7XA 1Q86R 4M75B 1H641 3OYDA 4A4GA 4JJNK 2NLUA 2X9HA 5CO7A 4BDZA 2COWA 2LT1A 3H6ZA 2KRSA 4OB2B 1MGQA 3LX7A 4OMFB 4J8OA 4XU0A 1G3WA 1UHFA 2Y4XA 3P8DA 3M5AA 3META 2EWNA 1QWEA 1X75C 4C0GA 1K73R 3CCLA 1OULA 4MMKA 3S3OA 2HAXA 1B7TA 1KD1U 1KJWA 2GQVA 4RUGA 4FW1A 4E47A 3OYHA 3OS5A 1YJWT 1W70A 2LRQA 2FRYA 1R0BG 1VQPA 1YHQT 4JLGA 4Y92A 5GAN8 2KRNA 3OS0A 4QVZA 1PM3A 1PWTA 3A1PA 2L2PA 3VV0A 1NLPC 2LC4A 3CCMQ 3JCMV 2HSEB 2YRCA 5KE3A 3LH5A 3M58A 2JTFA 2DE0X 5CQXA 3VS5A 8ATCB 1K4US 1UGSB 2HD0A 4Z8AA 1MMGA 2DD4A 4DBRA 1UEBA 2M1HA 2DYIA 3QO3A 3CPFA 4PJMA 2JTEA 2VB6A 2ZAEA 1BKBA 1OX9A 1AWOA 5I2MA 3TVTA 4X1VA 2H3JA 3JRZA 4EMHA 1WJSA 3MKDA 3CMAT 4CC2A 3QWXX 2B8AA 1M90C 4RTVA 3MP6A 2MWOA 1VQNT 3RKWA 2ZPEB 1IREB 4D8DA 1HSQA 3O5ZA 4NL2A 4MDXA 2QEXA 2CUBA 1WFWA 3SDZA 1IRXA 2KT8A 3FRNA 1TUDA 3ZL7C 2ZPIB 2QA4A 5LJ3h 1BI0A 1D0XA 1ZBXA 4ESRA 3LYIA 4DEXA 4IURA 1VQKT 3CCVT 2O31A 4AFUC 2DPPB 2DL3A 3M57A 3BE3A 2EPDA 3JCMg 4Q5WA 2CP7A 2ZPHB 4XK8E 2X51A 4RTYA 2O2OA 4NOYA 3MP1A 4XAXB 1UECA 1IB8A 3G71T 2P0PA 2G6FX 3AT1B 3CD6A 1PC0A 5FLXE 3FC3A 1PCXA 2DXCA 2A7YA 2EQMA 2NWMA 1RLPC 3OSSC 3OQ5A 2D8JA 4BI8B 1QWFA 5EC7A 2VV5A 5CKHA 1KQSA 3M53A 4EDUA 1ZA1B 1M27C 4HT8A 3TSWA 3OMGA 2YUPA 3TU4K 5IAYA 4HA8A 3GOXA 1QKWA 5I2SA 2HNIA 2EJGA 1OU8A 2A28A 4ZN3A 2E64A 2R5AA 3R6OA 2G3RA 5LJ3d 1I1JA 3I35A 1M2VA 3JB9G 2E12A 1EX4A 2LT4A 2RHIA 3RESA 5KYUA 3Q1JA 1VQPT 3E19A 2EFIA 3I9QA 4ELZC 2K9GA 5HKCA 3I5SA 2OAUA 3QYHB 2VC8A 4KRTA 1K76A 4AG2C 2MK5A 2HQHA 3JCMe 2HL5C 1MMAA 1IXDA 3VS2A 3LGLA 4A4HA 4KUDK 2YRDA 2CP0A 2K3XA 4KGXB 1SHGA 3UA7A 1KC8R 3JCMP 2RQVA 1S1NA 4CC3A 2K3BA 4M7DA 1YITQ 1PRLC 3A8GB 4F7UA 3THKA 2DXUA 1RACB 4JPBW 4A63B 1QMCA 3QZ5B 4RTWA 1EIFA 4L5GA 2BZ8A 5GAOm 2D8HA 3VS7A 5GMKh 2F5KA 4F7UB 2MCNA 3GNFB 1TXQA 2MPXC 4X9DA 3MEUA 3CCMA 4IIOA 2P84A 2VYTA 3PIOA 4A4EA 2GF7A 3VRZA 3J7AF 3HPWA 1GBRA 4IUPA 3GP8A 2PVDB 2DXTA 3GLXA 3JCMb 2VXFA 3HSBA 2L5QA 3EGUA 1K9MR 1KQSP 4QQ6A 1OPKA 3V8JA 1SSFA 2JT4A 2JS0A 2M51A 2DD5A 4A4KA 1UGPB 2LNVA 2RMOA 4J9FA 3G6EQ 3EFOB 2YWWA 3RR6A 4C0ZA 2XK0A 2KR3A 1LPLA 4HXJA 4EMGA 4BY6C 1NPRA 3DLMA 2IIMA 1HD3A 2K79A 2XDPA 2L8DA 1CSKA 1U1TA 3C0CA 3CXCP 2NUPA 3F70A 3M59A 4M7DD 2KI7A 1KG1A 1M1KU 1QVFS 4JRPA 2DA9A 3H0IA 4BE1A 1FX7A 1W2BS 5LL6S 3MEVA 1IHVA 2NUPB 2CDTA 2MYSA 1WI7A 4HKEA 4BE2A 2J05A 5LJ3f 3CMEQ 1OZ3A 2CZ6B 3OYBA 1VIFA 1YIJT 3SFMA 5GAN4 2DZ9A 3OYNA 3E2UA 4A54A 2RB6A 3NPFA 1UJ0A 3VS6A 3UF4A 2BE7D 1B34B 3CEYA 4HVVA 4DQ2A 2HSPA 3HKSA 3CCEQ 3M0RA 1X6GA 1Q86C 4JZ3A 2Y4YA 4M7DF 2D0NA 3EG9B 2DRKA 2DX1A 3VYGA 1TH7A 1Q7YU 1WXUA 3TSZA 1AZEA 4EMKC 1WQWA 1M8MA 1VQ6T 3CCUQ 2D0QB 1C6VX 2HL3A 3QUIA 2IPOB 3CCQQ 3M55A 1X6BA 4UC4A 1UTIA 4ZN1A 2A0FB 1FMWA 2LVMA 4BI3A 4BE0A 2PVGB 3A98A 2LTOA 1K73C 4BY6B 2R58A 4XTXA 4ANJA 3M0SA 2SRCA 4O5VA 1AWXA 3S3NA 5GAOr 3RIRA 4JRKA 3EGDA 3NTHA 5FU6C 3RKXA 2F1LA 2YLBA 1FMKA 4MZPA 2HDAA 3HRUA 5GAOp 1VQOQ 5KYXB 4OB0B 3EGDB 3BW1A 1VQ7Q 2HCKA 2P4RA 5CKDA 2FPEA 4C0FA 3HFNA 1X6OA 3CCJQ 4PJOF 1VA7A 5I11A 1TWBA 2XI9A 3CCMT 3JCMX 4AFSC 4PLIA 4M4ZA 3VRYA 2OTJT 3MO8A 3EH2A 1WHMA 2GFAA 2IVWA 3REAB 3M4YA 3OY9A 1Q81R 4M7DE 5CVIA 1OI1A 1VQLQ 2RJFA 1G5VA 4F7UE 5DLOA 1YITA 4EMKA 2JMAA 1QP3A 3VKIA 2NUTA 2LQKA 2RN8A 4LD6A 3UA6A 1NEGA 4EMKB 3CCST 1DJ7B 2GNCA 3EGXB 4OMPA 2PTKA 2X3WD 2EQKA 1D0YA 3CCRQ 2KE9A 1D0ZA 4LXCA 2FO0A 5FRMA 2DAQA 5CKFA 1EFNA 3KUFA 2OAWA 1UGRB 3SWNC 4QKUA 2L0AA 4E7LA 2OTLQ 2OJ2A 2A3LA 2CP5A 3QYGB 1ZBJA 5GJWB 2E70A 1RADB 3JCMQ 1OZ2A 5FU6B 2E10A 3MP8A 2FL7A 1TUCA 1GL5A 2JS2A 3MPUB 3VU3C 4F17A 4Y28E 2KAFA 1QP2A 2A08A 3IQLA 2DYBA 4KT0E 1WJQA 5KCHA 3G6EA 1UE9A 2FZCB 1R77A 8AT1B 4GBQA 2X4WA 1M9SA 1ZUUA 2VASA 2PUOB 2JVVA 1IGUA 4P5NA 2HBWA 3VS4A 1BB9A 3L1AA 2SEMA 3CXCS 3DKMA 2I2LA 4O6JA 5GANe 1B07A 2K5LA 4Z02A 4C92F 1WNLA 1K8AU 1SRLA 1AWWA 4IUVA 4HVUA 3JSCA 2EAYA 3N5BB 1X2KA 2LDMA 2O9SA 1ZHIA 4FYWB 3SWNA 5IHIA 3X20B 3A8MB 3CMEA 2EYWA 2ATCB 3E9FA 1NYFA 1IZ6A 2COYA 2JM8A 3CC2Q 4B6MA 3I56T 3JCMh 4FYXB 4M7DG 2K2VA 5J39A 3SWNB 2H8HA 2WACA 3FJ5A 3WVDB 4DBQA 1M3AA 2F2VA 3CCEA 1WXTA 4OB3B 6AT1B 2QQRA 2VVKA 3M0PA 1RUWA 2RJCA 5HK0A 2GCXA 4J9CA 2YUOA 3M9QA 1KHIA 5GAN7 2BZYA 1M5Q1 3MEAA 1TU0B 2HKQB 1QVFA 2FEIA 1RI9A 2IG0A 1W2BA 5LJ5e 2O88A 2RNAA 3G1JA 3CCUA 2EBPA 2DTIA 2P0KA 4F14A 5I22A 2EIFA 3CCQA 1FYNA 2OX7A 3RKYA 3PGGA 2RQUA 3NHNA 4WF2A 2V26A 2KBTA 5GANj 4K11A 4FT4A 1YJNT 3HP9A 2J6FA 2RJDA 1KC8C 2B86A 2NYSA 2LP5A 1RAEB 1NJIU 2EKOA 3J80E 1N9RA 4JRQA 1YITT 4PJOG 4ELYC 3H9NA 1VQOA 1VQ9Q 4J9EA 2FHDA 2GBQA 1W1FA 2L3PA 4RTXA 4B9WA 1VQ7A 3QBYA 1MMNA 5CR2A 4L6V5 3OYJA 3WVEB 3CCJA 1U1SA 3JCMd 1ZQ1A 1MNEA 3CC4Q 4N0AC 2M02A 1TTHB 3QDFA 4XTZA 2RM4A 4D8KA 1GFDA 1O9SA 4Z88A 2AZVA 4J5YA 5C0MA 2JXBA 2LQNA 1ACMB 2W0ZA 1LJOA 1LOJA 3OA6A 1VQLA 2KVQG 1ZUYA 1X27A 1H8KA 2RPNA 5LJ5j 1G83A 5CK9A 2YLCA 2EYZA 1AHJB 2J6KA 3VS1A 2MWPA 1D1AA 1T0HA 3CC7Q 2DL5A 2ZPBB 1OOTA 4J6WA 4OB1B 4GY5A 3JAME 3M54A 1VYVA 1WHLA 1K9MC 3L2QA 1I4K1 1OQKA 4BDYA 3JV3A 3CCRA 4BD3A
chains in the Genus database with same CATH topology
2FPFA 1YNZA 2JW4A 4CC4B 2RQVA 1S1NA 4CC3A 1X43A 2K3BA 2J7IA 1PRLC 4FSSA 2DBKA 1Z9QA 1A0NB 2DL7A 3THKA 1WX6A 4JPBW 1JU5C 4A63B 2RQRA 1GRIA 1ARKA 1RLQC 4RTWA 1T0JA 2KRMA 4LN2A 1OEBA 2BZ8A 2D8HA 2DILA 3VS7A 2K2MA 2EGAA 3EG1A 2MCNA 2F2XA 2PZ1A 3M0TA 3PVLA 3GBQA 4IIOA 1M30A 5GJVB 1XOVA 1I0CA 3H0HA 3VRZA 1U5SA 2CH4W 3H0FA 5HCKA 1GBRA 2DLPA 3NGPA 2LJ0A 1GCQC 1K9AA 4OMOA 1K0XA 3QWYA 2BTTA 4OMLA 1PRMC 3RBBB 5ECAA 1SEMA 2O9VA 1K0SA 4GLMA 2CREA 2KT1A 3EGUA 2ENMA 2K6DA 2RQTA 1OPKA 2J6OA 2MOXA 2EQIA 2JT4A 2JS0A 2M51A 1KFZA 2RMOA 1NLOC 4J9FA 2EVRA 3M0UA 1GFCA 2L3QA 4ORZA 1ZX6A 2KR3A 3CQTA 4HXJA 1OV3A 5IXBA 1KIKA 2IIMA 1HD3A 2K79A 4IIMA 3VS3A 1CSKA 1M3BA 2LJ1A 3C0CA 1YWOA 3EHQA 2DA9A 3H0IA 4LUDA 2F2WA 1PNJA 2KNBB 2RQWA 2CDTA 1WI7A 2DL4A 4HCKA 2DJQA 2DL8A 1GCPA 4JJDA 1Y0MA 2J05A 3RNJA 1NG2A 4WCIA 4DEYA 2ESWA 1GCQA 4AFQC 1N5ZA 1SRMA 2RF0A 5IXFA 3NPFA 1UJ0A 3VS6A 3UF4A 1W6XA 4LUEA 4HVVA 3EG3A 2HSPA 1AZGB 2EYYA 3EG0A 3M0RA 1X6GA 2AZSA 1ABOA 2FG0A 4QT7A 4JZ3A 3U23A 2K7AA 1UFFA 4RTZA 2D0NA 2OI3A 3M0QA 2FRWA 2DRKA 2DX1A 1MUZA 1JXMA 1WXUA 1PHTA 3TSZA 1AZEA 1HJDA 2ABLA 1E6HA 4JZ4A 1M8MA 2D1XA 1H92A 1YP5A 2LCSA 1YWPA 1E6GA 2M0YA 1X6BA 1T3SA 1UTIA 2J06A 2GTJA 2EGEA 4EIKA 2DMOA 1UHCA 3A98A 2FPDA 3M0SA 2SRCA 2KYBA 1AWXA 1KSWA 1FMKA 3UATA 2LJ3A 2HDAA 2VWFA 1WLPB 2DNUA 3EHRA 1UJYA 2C0OA 3SHWA 2AKKA 4RTUA 5FWBA 1X2QA 1M3CA 2ROLA 1JQQA 2HCKA 1ZLMA 2P4RA 1SPKA 2FPEA 2CT3A 1JXOA 2EGCA 2KROA 1VA7A 2AKLA 2V1QA 5I11A 2W10A 3EG2A 2C0IA 4AFSC 4M4ZA 3VRYA 1YN8A 1NM7A 2A37A 2GGRA 2A36A 1H3HA 1OPLA 2ROTA 3REBB 2KRSA 2LQWA 3REAB 5IHKA 1BU1A 4CC7A 1K1ZA 1UGVA 1AWJA 2LX7A 2C0TA 2MIOA 1NEBA 2CSQA 1UHFA 2JMAA 1WXBA 2DF6A 1QWEA 4JJBA 2RN8A 4R0KA 3UA6A 1NEGA 2ED1A 2EKHA 2JM9A 1JO8A 1MV3A 2LMJA 1IO6A 1LCKA 1UUEA 2GNCA 2VKNA 4OMPA 2PTKA 2X3WD 4AG1C 5IH2A 1AEYA 1KJWA 2KE9A 4RUGA 2LNHB 1QKXA 2L3SA 1VYUA 2FO0A 4J9HA 1EFNA 2OAWA 2L0AA 1W70A 2FRYA 2OJ2A 1WDXA 1Z9ZA 2KYMA 2LZ6B 1ZBJA 5GJWB 4Y92A 1I07A 3ULRB 1WYXA 2ECZA 2DVJA 2KRNA 1TUCA 2E5KA 2JS2A 1GL5A 1PWTA 1WA7A 4F17A 2L2PA 4RTTA 1NLPC 1ZUKA 2A08A 2V1RA 1CKAA 3IQLA 2DYBA 1X69A 3LH5A 4J9DA 4J9GA 2DE0X 3VS5A 1BBZA 1K4US 1UE9A 4Z8AA 1U06A 4GBQA 2KXCA 1ZUUA 1MV0B 1U3OA 3H41A 1NYGA 2JTEA 2HBWA 3VS4A 1BB9A 2YUQA 1WIEA 4LE9A 1SSHA 4E6RA 1AWOA 3TVTA 2SEMA 4X1VA 4CC2A 1ZSGA 1B07A 3QWXX 4RTVA 5FWCA 2PNIA 1B3QA 1SRLA 1AWWA 1UG1A 4HVUA 2HEQA 1X2KA 2CUDA 2EW3A 4D8DA 2O9SA 1HSQA 2I0NA 3O5ZA 5IHIA 2EYWA 1UDLA 1NYFA 4AFZC 2JM8A 2CUBA 1WFWA 3I5RA 2KT8A 2CH4A 1TUDA 3ZL7C 2H8HA 3FJ5A 2YSQA 2F2VA 1M3AA 1YCSB 4ESRA 4DEXA 1WXTA 2GQIA 2ED0A 2O31A 2DM1A 4AFUC 2DL3A 2AK5A 1AVZC 2VVKA 3M0PA 1RUWA 2EPDA 2YT6A 2YUOA 4J9CA 2YDLA 1ABQA 4J9IA 4J9BA 4RTYA 2BZYA 2KXDA 2O2OA 1AD5A 1SHFA 4OMNA 2FEIA 1RI9A 1CKBA 2O88A 5FW9A 2RNAA 2CSIA 1UECA 2EBPA 2CT4A 4F14A 1TG0A 5I22A 2G6FX 1FYNA 2RQUA 3NHNA 1VYTA 2XMFA 2KBTA 4LNPA 2NWMA 1RLPC 1V1CA 4K11A 3R6NA 2DRMA 2J6FA 1BK2A 4JJCA 4F16A 2BZXA 2B86A 2D8JA 2LP5A 1QWFA 5EC7A 1PKSA 4OMMA 1GBQA 2GTOA 2DBMA 1Y57A 1M27C 3TSWA 4ZNXA 1J3TA 4J9EA 2GBQA 1W1FA 2L3PA 4RTXA 2YUPA 2EYXA 1QKWA 4HVWA 3NMZC 2QDLA 2A28A 3PE0A 1I1JA 2X3XD 4D8KA 1GFDA 3I35A 2JMCA 4Z88A 3SEMA 2KGTA 1AOJA 2AZVA 4Z89A 1QCFA 3VS0A 2JXBA 2LQNA 2W0ZA 5IHNA 3I9QA 1ZUYA 2NUZA 1E7OA 1H8KA 1X27A 2RPNA 1G83A 2K9GA 2EYZA 3KFVA 3I5SA 4KRTA 2J6KA 3VS1A 5L23A 1K76A 1G2BA 1T0HA 1JEGA 1PKTA 2DL5A 1T3LA 4AG2C 1OOTA 4OMQA 2YUNA 3PVQA 1QLYA 1VYVA 3VS2A 2KEAA 1SHGA 3UA7A 3JV3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FPF A;  1YNZ A;  2JW4 A;  4CC4 B;  2RQV A;  1S1N A;  4CC3 A;  1X43 A;  2K3B A;  2J7I A;  1PRL C;  4FSS A;  2DBK A;  1Z9Q A;  1A0N B;  2DL7 A;  3THK A;  1WX6 A;  4JPB W;  1JU5 C;  4A63 B;  2RQR A;  1GRI A;  1ARK A;  1RLQ C;  4RTW A;  1T0J A;  2KRM A;  4LN2 A;  1OEB A;  2BZ8 A;  2D8H A;  2DIL A;  3VS7 A;  2K2M A;  2EGA A;  3EG1 A;  2MCN A;  2F2X A;  2PZ1 A;  3M0T A;  3PVL A;  3GBQ A;  4IIO A;  1M30 A;  5GJV B;  1XOV A;  1I0C A;  3H0H A;  3VRZ A;  1U5S A;  2CH4 W;  3H0F A;  5HCK A;  1GBR A;  2DLP A;  3NGP A;  2LJ0 A;  1GCQ C;  1K9A A;  4OMO A;  1K0X A;  3QWY A;  2BTT A;  4OML A;  1PRM C;  3RBB B;  5ECA A;  1SEM A;  2O9V A;  1K0S A;  4GLM A;  2CRE A;  2KT1 A;  3EGU A;  2ENM A;  2K6D A;  2RQT A;  1OPK A;  2J6O A;  2MOX A;  2EQI A;  2JT4 A;  2JS0 A;  2M51 A;  1KFZ A;  2RMO A;  1NLO C;  4J9F A;  2EVR A;  3M0U A;  1GFC A;  2L3Q A;  4ORZ A;  1ZX6 A;  2KR3 A;  3CQT A;  4HXJ A;  1OV3 A;  5IXB A;  1KIK A;  2IIM A;  1HD3 A;  2K79 A;  4IIM A;  3VS3 A;  1CSK A;  1M3B A;  2LJ1 A;  3C0C A;  1YWO A;  3EHQ A;  2DA9 A;  3H0I A;  4LUD A;  2F2W A;  1PNJ A;  2KNB B;  2RQW A;  2CDT A;  1WI7 A;  2DL4 A;  4HCK A;  2DJQ A;  2DL8 A;  1GCP A;  4JJD A;  1Y0M A;  2J05 A;  3RNJ A;  1NG2 A;  4WCI A;  4DEY A;  2ESW A;  1GCQ A;  4AFQ C;  1N5Z A;  1SRM A;  2RF0 A;  5IXF A;  3NPF A;  1UJ0 A;  3VS6 A;  3UF4 A;  1W6X A;  4LUE A;  4HVV A;  3EG3 A;  2HSP A;  1AZG B;  2EYY A;  3EG0 A;  3M0R A;  1X6G A;  2AZS A;  1ABO A;  2FG0 A;  4QT7 A;  4JZ3 A;  3U23 A;  2K7A A;  1UFF A;  4RTZ A;  2D0N A;  2OI3 A;  3M0Q A;  2FRW A;  2DRK A;  2DX1 A;  1MUZ A;  1JXM A;  1WXU A;  1PHT A;  3TSZ A;  1AZE A;  1HJD A;  2ABL A;  1E6H A;  4JZ4 A;  1M8M A;  2D1X A;  1H92 A;  1YP5 A;  2LCS A;  1YWP A;  1E6G A;  2M0Y A;  1X6B A;  1T3S A;  1UTI A;  2J06 A;  2GTJ A;  2EGE A;  4EIK A;  2DMO A;  1UHC A;  3A98 A;  2FPD A;  3M0S A;  2SRC A;  2KYB A;  1AWX A;  1KSW A;  1FMK A;  3UAT A;  2LJ3 A;  2HDA A;  2VWF A;  1WLP B;  2DNU A;  3EHR A;  1UJY A;  2C0O A;  3SHW A;  2AKK A;  4RTU A;  5FWB A;  1X2Q A;  1M3C A;  2ROL A;  1JQQ A;  2HCK A;  1ZLM A;  2P4R A;  1SPK A;  2FPE A;  2CT3 A;  1JXO A;  2EGC A;  2KRO A;  1VA7 A;  2AKL A;  2V1Q A;  5I11 A;  2W10 A;  3EG2 A;  2C0I A;  4AFS C;  4M4Z A;  3VRY A;  1YN8 A;  1NM7 A;  2A37 A;  2GGR A;  2A36 A;  1H3H A;  1OPL A;  2ROT A;  3REB B;  2KRS A;  2LQW A;  3REA B;  5IHK A;  1BU1 A;  4CC7 A;  1K1Z A;  1UGV A;  1AWJ A;  2LX7 A;  2C0T A;  2MIO A;  1NEB A;  2CSQ A;  1UHF A;  2JMA A;  1WXB A;  2DF6 A;  1QWE A;  4JJB A;  2RN8 A;  4R0K A;  3UA6 A;  1NEG A;  2ED1 A;  2EKH A;  2JM9 A;  1JO8 A;  1MV3 A;  2LMJ A;  1IO6 A;  1LCK A;  1UUE A;  2GNC A;  2VKN A;  4OMP A;  2PTK A;  2X3W D;  4AG1 C;  5IH2 A;  1AEY A;  1KJW A;  2KE9 A;  4RUG A;  2LNH B;  1QKX A;  2L3S A;  1VYU A;  2FO0 A;  4J9H A;  1EFN A;  2OAW A;  2L0A A;  1W70 A;  2FRY A;  2OJ2 A;  1WDX A;  1Z9Z A;  2KYM A;  2LZ6 B;  1ZBJ A;  5GJW B;  4Y92 A;  1I07 A;  3ULR B;  1WYX A;  2ECZ A;  2DVJ A;  2KRN A;  1TUC A;  2E5K A;  2JS2 A;  1GL5 A;  1PWT A;  1WA7 A;  4F17 A;  2L2P A;  4RTT A;  1NLP C;  1ZUK A;  2A08 A;  2V1R A;  1CKA A;  3IQL A;  2DYB A;  1X69 A;  3LH5 A;  4J9D A;  4J9G A;  2DE0 X;  3VS5 A;  1BBZ A;  1K4U S;  1UE9 A;  4Z8A A;  1U06 A;  4GBQ A;  2KXC A;  1ZUU A;  1MV0 B;  1U3O A;  3H41 A;  1NYG A;  2JTE A;  2HBW A;  3VS4 A;  1BB9 A;  2YUQ A;  1WIE A;  4LE9 A;  1SSH A;  4E6R A;  1AWO A;  3TVT A;  2SEM A;  4X1V A;  4CC2 A;  1ZSG A;  1B07 A;  3QWX X;  4RTV A;  5FWC A;  2PNI A;  1B3Q A;  1SRL A;  1AWW A;  1UG1 A;  4HVU A;  2HEQ A;  1X2K A;  2CUD A;  2EW3 A;  4D8D A;  2O9S A;  1HSQ A;  2I0N A;  3O5Z A;  5IHI A;  2EYW A;  1UDL A;  1NYF A;  4AFZ C;  2JM8 A;  2CUB A;  1WFW A;  3I5R A;  2KT8 A;  2CH4 A;  1TUD A;  3ZL7 C;  2H8H A;  3FJ5 A;  2YSQ A;  2F2V A;  1M3A A;  1YCS B;  4ESR A;  4DEX A;  1WXT A;  2GQI A;  2ED0 A;  2O31 A;  2DM1 A;  4AFU C;  2DL3 A;  2AK5 A;  1AVZ C;  2VVK A;  3M0P A;  1RUW A;  2EPD A;  2YT6 A;  2YUO A;  4J9C A;  2YDL A;  1ABQ A;  4J9I A;  4J9B A;  4RTY A;  2BZY A;  2KXD A;  2O2O A;  1AD5 A;  1SHF A;  4OMN A;  2FEI A;  1RI9 A;  1CKB A;  2O88 A;  5FW9 A;  2RNA A;  2CSI A;  1UEC A;  2EBP A;  2CT4 A;  4F14 A;  1TG0 A;  5I22 A;  2G6F X;  1FYN A;  2RQU A;  3NHN A;  1VYT A;  2XMF A;  2KBT A;  4LNP A;  2NWM A;  1RLP C;  1V1C A;  4K11 A;  3R6N A;  2DRM A;  2J6F A;  1BK2 A;  4JJC A;  4F16 A;  2BZX A;  2B86 A;  2D8J A;  2LP5 A;  1QWF A;  5EC7 A;  1PKS A;  4OMM A;  1GBQ A;  2GTO A;  2DBM A;  1Y57 A;  1M27 C;  3TSW A;  4ZNX A;  1J3T A;  4J9E A;  2GBQ A;  1W1F A;  2L3P A;  4RTX A;  2YUP A;  2EYX A;  1QKW A;  4HVW A;  3NMZ C;  2QDL A;  2A28 A;  3PE0 A;  1I1J A;  2X3X D;  4D8K A;  1GFD A;  3I35 A;  2JMC A;  4Z88 A;  3SEM A;  2KGT A;  1AOJ A;  2AZV A;  4Z89 A;  1QCF A;  3VS0 A;  2JXB A;  2LQN A;  2W0Z A;  5IHN A;  3I9Q A;  1ZUY A;  2NUZ A;  1E7O A;  1H8K A;  1X27 A;  2RPN A;  1G83 A;  2K9G A;  2EYZ A;  3KFV A;  3I5S A;  4KRT A;  2J6K A;  3VS1 A;  5L23 A;  1K76 A;  1G2B A;  1T0H A;  1JEG A;  1PKT A;  2DL5 A;  1T3L A;  4AG2 C;  1OOT A;  4OMQ A;  2YUN A;  3PVQ A;  1QLY A;  1VYV A;  3VS2 A;  2KEA A;  1SHG A;  3UA7 A;  3JV3 A; 
#chains in the Genus database with same CATH topology
 2FPF A;  1YNZ A;  2JW4 A;  4XTW A;  1YI2 A;  2QGF B;  2E3H A;  1WHH A;  1Q82 U;  2OTL A;  2J7I A;  4FSS A;  3JB9 J;  1S72 Q;  1Z9Q A;  4QQD A;  5A0D A;  4PFZ A;  2RA2 A;  1RLQ C;  2FYK A;  4LN2 A;  2QAS A;  1XNI A;  4N0A A;  3PVL A;  4OVA A;  3GBQ A;  3ZBD A;  1QVF P;  5J26 A;  1W2B P;  2VXE A;  1KD1 R;  2WSE E;  3OS2 A;  1XOV A;  2VUB A;  4MZM A;  2LJ0 A;  2KDS A;  2DJZ A;  4OMO A;  5KYY A;  1LVK A;  2DKG A;  4OML A;  4C92 G;  1R0C B;  2BE9 B;  2QDY B;  2QK0 A;  2O9V A;  2RI2 A;  5CIU A;  5GAM h;  5KYY B;  5AT1 B;  2K6D A;  2RQT A;  2J6O A;  2EQI A;  3CBP A;  4Y91 A;  1KFZ A;  1BIB A;  1NLO C;  1V29 B;  1WZO A;  3QII A;  4NL3 A;  3M0U A;  1GFC A;  5C6S A;  3C94 A;  3CCU T;  5HK3 A;  4M7D C;  2QYZ A;  1ZX6 A;  3CQT A;  3CCQ T;  1MND A;  5GMK i;  3CC2 A;  1RI0 A;  1M3B A;  3GF5 A;  4J6Y A;  3OYL A;  4XTU A;  4ZGD B;  3E1S A;  3CCL T;  4LUD A;  2F2W A;  3JCM f;  1VQM Q;  4C5G A;  4FW2 A;  2QQS A;  4N4H A;  3CXC A;  1PG5 B;  2DL4 A;  2DJQ A;  4PL6 A;  1GCP A;  2D6F A;  1Y0M A;  3M56 A;  3OMC A;  1SG5 A;  1VQ7 T;  2QG9 B;  1M2V B;  1SRM A;  2RF0 A;  2O4X A;  1VUB A;  4LDY A;  1W6X A;  1MMD A;  1M2O A;  5KYU B;  4FCY A;  4GLK A;  1M90 U;  1TSF A;  5GAM d;  1ABO A;  2FG0 A;  4PJO C;  3CBO A;  1BCM A;  2K7A A;  1UFF A;  3INZ A;  4RTZ A;  5GAO n;  5GAN 5;  2Y90 A;  4HCB A;  1JXM A;  1Q81 C;  1HJD A;  1VQ5 Q;  4XU3 A;  5CKE A;  1H92 A;  2XG8 D;  1VQ9 A;  1BCO A;  1FXX A;  3RUX A;  2R57 A;  1JJ2 S;  3OYG A;  2GTJ A;  3CC4 A;  4M7D B;  1ZSZ C;  2DMO A;  3CCR T;  2KYB A;  1KSW A;  1OX8 A;  1RAA B;  2OTL T;  4OGC A;  4ZTJ A;  2VWF A;  1YJW Q;  3EHR A;  5AYF A;  2C0O A;  2DTH A;  4JS5 A;  2AKK A;  4DOW A;  4RMO A;  2QEX T;  1YHQ Q;  2ROL A;  4TVR A;  3CC7 A;  4D6W A;  1JRI A;  3QJ6 A;  3X26 B;  3DLL A;  2KRO A;  3OB9 A;  1Y71 A;  4JRI A;  1MHN A;  2QA4 T;  4DBH A;  5D6X A;  3V7C A;  2C0I A;  1YN8 A;  2CZ7 B;  2GGR A;  3TRE A;  2DEU A;  4PJO A;  1H3H A;  1OPL A;  3REB B;  2LQW A;  3TQ7 P;  5IHK A;  1BU1 A;  1K1Z A;  1UGV A;  2Z0W A;  1AWJ A;  3A8H B;  2C0T A;  2MIO A;  4KUL A;  5LJ3 g;  2K57 A;  1NEB A;  2DZC A;  2CSQ A;  3VYH B;  1S72 A;  4PJO B;  2KMT A;  1WXB A;  2DF6 A;  4JJB A;  3CD6 T;  1VQ8 A;  5FU7 C;  5GAO l;  2JOY A;  2E65 A;  2ED1 A;  1VQ4 Q;  4BB7 A;  1QVP A;  1IO6 A;  4ME7 A;  4R56 A;  1ZSZ A;  3ZEH A;  1LCK A;  2VKN A;  4RCC A;  4AG1 C;  1VQN Q;  2COZ A;  2L3S A;  3LGF A;  4C5H A;  1ZSZ B;  4C92 C;  2M16 A;  2EQU A;  3QDR B;  1WDX A;  1Z9Z A;  4PKC C;  3OS1 A;  2LZ6 B;  1M8V A;  4PFO A;  1I07 A;  1WYX A;  5IN1 A;  2DVJ A;  4E7K A;  1WHK A;  4XTY A;  4F04 B;  3I55 Q;  3LWI A;  3PMI A;  1VQK Q;  3CCV Q;  1NPP A;  3GNG A;  5GMK m;  4MML A;  3E9G A;  1X69 A;  5GAM f;  4M7A A;  3MJX A;  4RG8 A;  2KXC A;  1U3O A;  4E7H A;  3H41 A;  4PJO D;  2QQ9 A;  3G71 Q;  2PQW A;  2X4J A;  4LE9 A;  2CS7 A;  4E6R A;  2PU9 B;  4N4I A;  5LJ3 e;  1ZSG A;  3CPW A;  3T9N A;  2DXB A;  2PNI A;  1VQM A;  5FU7 B;  3MEW A;  1UG1 A;  2RJE A;  2XD0 A;  1JB0 E;  2EW3 A;  2I0N A;  2HZY A;  4X34 A;  1LNX A;  4C92 A;  1VQ9 T;  1UDL A;  2RD1 A;  3I5R A;  2CH4 A;  1M1F A;  2QAZ A;  4C92 B;  3CC4 T;  2EJF A;  4FM4 B;  1D3B A;  4QVC A;  3ASK A;  1PD1 A;  1M1K R;  3PT9 A;  3HL8 A;  2DM1 A;  3P8B B;  4X9C A;  1AVZ C;  2YT6 A;  2QI2 A;  2YDL A;  1ABQ A;  4J9I A;  2V8J A;  2DVE A;  2KXD A;  3FDR A;  2FB7 A;  3DB4 A;  1AD5 A;  2CYZ B;  1SHF A;  4JLI A;  1VQ5 A;  4OMN A;  1CKB A;  4L59 A;  2KQW A;  5GAN g;  2CSI A;  3NTK A;  3CC7 T;  2CT4 A;  4KBM B;  1IHW A;  4M7A D;  1VYT A;  2XMF A;  1D09 B;  3UWN A;  5LJ3 j;  1V1C A;  4MZT A;  2RO0 A;  4FU6 A;  3PFS A;  2CKK A;  7AT1 B;  4F16 A;  2WSC E;  2BZX A;  2NUT B;  4HT9 A;  3OYC A;  1PKS A;  4OMM A;  3OYM A;  1YI2 Q;  1GBQ A;  2GTO A;  1YJW A;  1Q7Y R;  5DM7 R;  1S72 T;  2RK1 A;  1KHC A;  1KK7 A;  4ZNX A;  4ZGJ B;  1YHQ A;  2EYX A;  4PJJ A;  3JB9 I;  1Y96 A;  4C92 D;  4EPC A;  4IKF A;  2RI3 A;  5KYW A;  3NMZ C;  2XID A;  1Q86 U;  2QDL A;  1TS9 A;  1PSE A;  3PE0 A;  4M78 A;  3OYI A;  4E7I A;  1YCY A;  2LCC A;  4DOV A;  2X3X D;  5LJ5 g;  4PJO E;  4M7A F;  2JMC A;  2E4H A;  4IUT A;  3SEM A;  2KGT A;  1C0M A;  1KD1 C;  1AOJ A;  1JJ2 A;  1SF9 A;  1G3T A;  4M77 A;  3GPL A;  2DEQ A;  2QTX A;  2JZ2 A;  2XHC A;  3V7S A;  3CPW P;  3ZFJ A;  3CBM A;  1PKT A;  1RAH B;  4LDV A;  2DFU A;  4OMQ A;  1XJW B;  4QQG A;  1K73 U;  1VQ4 A;  2YUN A;  5GMK e;  3PVQ A;  1QLY A;  1TOV A;  4C8Q A;  3RDV A;  2V8K A;  3L2W A;  1VIE A;  4KH1 B;  3GIB A;  4KUI A;  3G4S Q;  3FLG A;  1VQN A;  3G7Z A;  4CC4 B;  3M4G A;  3FB9 A;  2LCL A;  2BIV A;  3BFM A;  1A0N B;  2DL7 A;  1WX6 A;  1JU5 C;  1ARK A;  2RQR A;  1GRI A;  4II1 A;  4NS5 A;  2KRM A;  3AHU A;  4C5I A;  2K2M A;  2EGA A;  4MDW A;  2X35 A;  3EG1 A;  3I55 A;  2DTO A;  2F2X A;  2PZ1 A;  2K3Y A;  1N8R R;  1VQK A;  4LDX A;  3CCV A;  2XDB A;  3UDC A;  3PMT A;  1M30 A;  4OGE A;  5GJV B;  2GFU A;  4FT2 A;  4M7A E;  3H0F A;  5HCK A;  3VUB A;  2DLP A;  4M78 D;  3NGP A;  4KGV B;  4M75 A;  1YIJ Q;  1K0X A;  2BTT A;  3FIF A;  1HXD A;  1PRM C;  2RHY A;  3G71 A;  2YHT A;  1SEM A;  5ECA A;  3OW2 S;  1QVG S;  2E6Z A;  4AMC A;  4M77 D;  1RAG B;  3S6W A;  5GMK j;  1C1A A;  4BI4 A;  1QCO A;  4KGZ B;  1YFN A;  5KH6 A;  4V2S A;  4PK4 A;  2RHU A;  1O75 A;  1D1B A;  2X4X A;  4RKU E;  2M0O A;  2EVR A;  1VQ5 T;  4C92 E;  4C8Q D;  2KY9 A;  2MAM A;  3A8L B;  1VQ6 Q;  3JB9 F;  3OBY A;  3ME9 A;  2L3R A;  3OYK A;  4IIM A;  4M78 F;  3RMS A;  1D1C A;  1JJ2 P;  2QGG A;  1JBM A;  1YWO A;  2H3E B;  2ZGW A;  1PNJ A;  2KNB B;  4M77 F;  1K8A R;  2MI6 A;  5KYN A;  4HCK A;  3QPH A;  2RK2 A;  4WCI A;  4DEY A;  2KSS A;  1EZZ B;  3L2R A;  2ESW A;  3D7S B;  5IT9 E;  3S3M A;  2AIR B;  4FYV B;  3MCA B;  4C8Q F;  5IXF A;  1M1G A;  2FZK B;  5FRO A;  3EG3 A;  4M75 D;  3L2V A;  2EYY A;  3JCM c;  2OTJ Q;  3P8H A;  3QHS A;  3QSU A;  2FRW A;  1MUZ A;  3G6E T;  3OYF A;  2ABL A;  2QTV A;  2D1X A;  3BDU A;  1BIA A;  4J6X A;  1NBE B;  1YWP A;  1E6G A;  2HQE A;  4M7A G;  2LQ8 A;  1VQ4 T;  2R5M A;  2BKD N;  1FWZ A;  2J06 A;  5I21 A;  2PUK B;  1VQ8 Q;  1VOM A;  2MMP A;  3CCS Q;  4M78 E;  2F5T X;  1UHC A;  5D7U A;  2MF2 A;  4M75 F;  1NJI R;  4M77 E;  3UAT A;  3JCM W;  1WLP B;  2DNU A;  3CME T;  3SHW A;  4RTU A;  1HK9 A;  5FWB A;  1M3C A;  1JQQ A;  1ZLM A;  3CPW S;  1SPK A;  2F69 A;  2CT3 A;  1XTD A;  1JXO A;  2HQX A;  3I55 T;  2V1Q A;  2AKL A;  2KK4 A;  2E6N A;  4C8Q E;  4E7Z A;  2W10 A;  3CCE T;  3EG2 A;  2D9T A;  2HBP A;  1NZ9 A;  1KC8 U;  5CCA A;  3HRS A;  1OU9 A;  3G4S A;  2A37 A;  1NM7 A;  3X28 B;  2A36 A;  2ROT A;  4E7J A;  4PFP A;  4CC7 A;  2LX7 A;  1V76 A;  3QZ9 B;  1I5L A;  5M9O A;  4R0K A;  2DER A;  2EKH A;  2JM9 A;  1JO8 A;  1MV3 A;  4IUU A;  4LDU A;  1NE8 A;  2LMJ A;  2JUF A;  1UUE A;  2EYQ A;  2PVO B;  1RL2 A;  3RMQ A;  5IH2 A;  1AEY A;  2LNH B;  1QKX A;  3H8Z A;  5CKB A;  1VYU A;  2X4Y A;  4J9H A;  1YJ9 Q;  2CP2 A;  3DB3 A;  4M75 E;  4PJL A;  1TUG B;  1P92 A;  1Q82 R;  1YIJ A;  1WQ7 A;  1VQO T;  2KYM A;  1SKU B;  3QG1 A;  3I56 Q;  3KXT A;  3ULR B;  2ECZ A;  3CCJ T;  1UB4 A;  4XQ3 A;  1K9M U;  4BAC A;  2E5K A;  3LH0 A;  5L8R E;  5D6W A;  1WA7 A;  1M4Z A;  4RTT A;  1M1K C;  1ZUK A;  2DET A;  2C06 A;  2V1R A;  3UT1 A;  1CKA A;  2O4X B;  1BI3 A;  3V8K A;  4C5E A;  4J9D A;  4J9G A;  4M78 G;  4PNO A;  1BBZ A;  4J83 A;  3V7R A;  1BI2 A;  5DLQ E;  1U06 A;  3J81 E;  3OBW A;  1VQL T;  4WTO B;  4HCC A;  1MV0 B;  1VQ6 A;  5KCO A;  2V8I A;  1NYG A;  4LDW A;  3PIP A;  2YUQ A;  1WIE A;  4M77 G;  1SSH A;  1R8O B;  4C0D C;  2RHZ A;  2HMA A;  2XIC A;  1YJN Q;  2E41 A;  2XDD A;  5FWC A;  3OW2 A;  4CI0 C;  1B3Q A;  3BY7 A;  1ZA2 B;  1QVG A;  1WPY A;  2CP6 A;  1YI2 T;  2HEQ A;  2JNG A;  2P0Q A;  4PJN A;  4C8Q G;  4JS4 A;  2CUD A;  1WHJ A;  3L2Z A;  3LLR A;  1Q7Y C;  2O01 E;  4RCB A;  4AFZ C;  4E7S A;  3A5Z B;  3C95 A;  3FJP A;  1G8X A;  1RAI B;  1PSF A;  4ZTF A;  1QQJ A;  1WHG A;  4AT1 B;  2YSQ A;  1QW1 A;  2VGM A;  5GAN h;  1YCS B;  4B9X A;  2RHX A;  2GQI A;  2ED0 A;  1PD0 A;  1G3Y A;  3EH1 A;  2OTJ A;  2AK5 A;  2CZ0 B;  2ZPF B;  1YBY A;  4J9B A;  5DY9 A;  2P4T A;  4M7A C;  4QVD A;  3V8L A;  1AT1 B;  5FW9 A;  1TG0 A;  1HYO A;  2E5Q A;  4R55 A;  2M9U A;  3EFO A;  4M75 G;  3CCS A;  4LNP A;  2FZG B;  3EAE A;  1BI1 A;  3G4S T;  4JUV A;  3R6N A;  4FL6 A;  3CMA Q;  2DRM A;  3L42 A;  1BK2 A;  4JJC A;  1M90 R;  4J7F A;  4C0D B;  2ZPG B;  5FRN A;  3JCM J;  3VJP A;  4DBF A;  5GAM g;  2DBM A;  1Y57 A;  3X25 B;  3JB9 H;  5LJ5 h;  4A4F A;  1J3T A;  4A53 A;  4FYY B;  4JDS A;  3CC2 T;  1BYM A;  4HVW A;  2ZCF B;  4YTL A;  3EFR A;  3WXM B;  1N8R C;  1RAF B;  1N27 A;  3HRT A;  5GAN d;  1Q95 G;  3BDL A;  5A0G A;  2EQJ A;  4Z89 A;  1Q81 U;  1QCF A;  2DIQ A;  3VS0 A;  1B34 A;  4BUG A;  4VUB A;  5IHN A;  2AHJ B;  2NUZ A;  1E7O A;  4ATO A;  2L89 A;  3KFV A;  4ZGE B;  1JEG A;  5L23 A;  1G2B A;  3SB2 A;  3EG9 A;  1T3L A;  3OW2 P;  3HHT B;  5CAI A;  1QVG P;  4M7A B;  1RAB B;  4QW2 A;  5A2Q E;  4N4G A;  2KEA A;  3QKJ A;  3FEO A;  5GAN 3;  1KQ1 A;  5GAN 2;  1Y07 A;  1WGS A;  1UGQ B;  4F7U F;  4HCZ A;  5D6Y A;  3NTI A;  1X43 A;  3C12 A;  1YJ9 A;  1U8R A;  3HTR A;  2DBK A;  3OYA A;  4FIB A;  3I56 A;  2CP3 A;  5LJ5 d;  3QJY A;  1T0J A;  1OEB A;  2EJ9 A;  2DIL A;  5J3B A;  5GAM e;  2HKN A;  3CCL Q;  3VUZ A;  1N9S A;  5GMK l;  3M0T A;  2RI5 A;  4M78 C;  4XU2 A;  3L2U A;  5KYX A;  1K8A C;  3C4S A;  3QXE B;  1I0C A;  1W4S A;  3H0H A;  1D3B B;  1U5S A;  2CH4 W;  5KE2 A;  1I8F A;  2XU8 A;  4M77 C;  1FMV A;  1GCQ C;  1K9A A;  5GAO q;  1I5O B;  4XTV A;  1VQP Q;  3QWY A;  3RBB B;  2JJ9 A;  2LX9 A;  5CQY A;  1K0S A;  4GLM A;  1F1B B;  3UPU A;  2CRE A;  2KT1 A;  2DIG A;  3OYY A;  2ENM A;  4C8Q C;  2MOX A;  1YJN A;  2K5F A;  2E3I A;  4LD9 K;  3MHX A;  4CRI A;  2L3Q A;  4ORZ A;  3EGX A;  2YRV A;  1OV3 A;  5IXB A;  1KIK A;  2CZ1 B;  3X24 B;  1X01 A;  2K5I A;  3VS3 A;  1VQ8 T;  4RG2 A;  2LJ1 A;  3TCJ A;  1N8R U;  5GAM j;  2VGN A;  2BUD A;  3EHQ A;  2E1H A;  1WJR A;  4KH0 B;  2RQW A;  3URG A;  3SD4 A;  1Y96 B;  3LWH A;  2DL8 A;  4JJD A;  4XU1 A;  2QQB A;  1NJI C;  5KYW B;  3RNJ A;  1NG2 A;  5GAN f;  9ATC B;  4M78 B;  2QEX Q;  3NFC A;  1GCQ A;  4OF1 A;  4AFQ C;  4M75 C;  1QCN A;  1N5Z A;  3RER A;  1H3Z A;  3LW5 E;  4LUE A;  2QA4 Q;  3EFS A;  4M77 B;  1KQS S;  1AZG B;  3EG0 A;  3HFO A;  2RH2 A;  2AZS A;  3O8V A;  5A0L A;  3CMA A;  4QT7 A;  4FSX A;  3U23 A;  4E2F B;  3ER0 A;  3PNW C;  2OI3 A;  3M0Q A;  2FVU A;  2DO3 A;  1PHT A;  2XKO C;  2QQA A;  3TEE A;  1E6H A;  4C8Q B;  4JZ4 A;  2JN0 A;  1I81 A;  1OYX A;  4OP0 A;  1YP5 A;  2LCS A;  2WSF E;  2CGH A;  4IUQ A;  2DK3 A;  2M0Y A;  4DA4 A;  3CD6 Q;  1IGQ A;  2QXF A;  1T3S A;  3KBG A;  1KQ2 A;  3OYE A;  2EGE A;  5EG2 A;  4EIK A;  5LJ5 f;  2FPD A;  4J7I A;  1VQM T;  4PLL A;  1YJ9 T;  3JB9 D;  2LJ3 A;  2ZZD A;  1UJY A;  1XQH A;  1X2Q A;  3PTA A;  2K4Y A;  1Q82 C;  5GAN 6;  2JTM A;  3OSV A;  3A8O B;  1GXI E;  4F7U G;  2AT1 B;  1G3S A;  1N6A A;  2EGC A;  5HY6 A;  2YXY A;  1Y7X A;  1Q86 R;  4M75 B;  1H64 1;  3OYD A;  4A4G A;  4JJN K;  2NLU A;  2X9H A;  5CO7 A;  4BDZ A;  2COW A;  2LT1 A;  3H6Z A;  2KRS A;  4OB2 B;  1MGQ A;  3LX7 A;  4OMF B;  4J8O A;  4XU0 A;  1G3W A;  1UHF A;  2Y4X A;  3P8D A;  3M5A A;  3MET A;  2EWN A;  1QWE A;  1X75 C;  4C0G A;  1K73 R;  3CCL A;  1OUL A;  4MMK A;  3S3O A;  2HAX A;  1B7T A;  1KD1 U;  1KJW A;  2GQV A;  4RUG A;  4FW1 A;  4E47 A;  3OYH A;  3OS5 A;  1YJW T;  1W70 A;  2LRQ A;  2FRY A;  1R0B G;  1VQP A;  1YHQ T;  4JLG A;  4Y92 A;  5GAN 8;  2KRN A;  3OS0 A;  4QVZ A;  1PM3 A;  1PWT A;  3A1P A;  2L2P A;  3VV0 A;  1NLP C;  2LC4 A;  3CCM Q;  3JCM V;  2HSE B;  2YRC A;  5KE3 A;  3LH5 A;  3M58 A;  2JTF A;  2DE0 X;  5CQX A;  3VS5 A;  8ATC B;  1K4U S;  1UGS B;  2HD0 A;  4Z8A A;  1MMG A;  2DD4 A;  4DBR A;  1UEB A;  2M1H A;  2DYI A;  3QO3 A;  3CPF A;  4PJM A;  2JTE A;  2VB6 A;  2ZAE A;  1BKB A;  1OX9 A;  1AWO A;  5I2M A;  3TVT A;  4X1V A;  2H3J A;  3JRZ A;  4EMH A;  1WJS A;  3MKD A;  3CMA T;  4CC2 A;  3QWX X;  2B8A A;  1M90 C;  4RTV A;  3MP6 A;  2MWO A;  1VQN T;  3RKW A;  2ZPE B;  1IRE B;  4D8D A;  1HSQ A;  3O5Z A;  4NL2 A;  4MDX A;  2QEX A;  2CUB A;  1WFW A;  3SDZ A;  1IRX A;  2KT8 A;  3FRN A;  1TUD A;  3ZL7 C;  2ZPI B;  2QA4 A;  5LJ3 h;  1BI0 A;  1D0X A;  1ZBX A;  4ESR A;  3LYI A;  4DEX A;  4IUR A;  1VQK T;  3CCV T;  2O31 A;  4AFU C;  2DPP B;  2DL3 A;  3M57 A;  3BE3 A;  2EPD A;  3JCM g;  4Q5W A;  2CP7 A;  2ZPH B;  4XK8 E;  2X51 A;  4RTY A;  2O2O A;  4NOY A;  3MP1 A;  4XAX B;  1UEC A;  1IB8 A;  3G71 T;  2P0P A;  2G6F X;  3AT1 B;  3CD6 A;  1PC0 A;  5FLX E;  3FC3 A;  1PCX A;  2DXC A;  2A7Y A;  2EQM A;  2NWM A;  1RLP C;  3OSS C;  3OQ5 A;  2D8J A;  4BI8 B;  1QWF A;  5EC7 A;  2VV5 A;  5CKH A;  1KQS A;  3M53 A;  4EDU A;  1ZA1 B;  1M27 C;  4HT8 A;  3TSW A;  3OMG A;  2YUP A;  3TU4 K;  5IAY A;  4HA8 A;  3GOX A;  1QKW A;  5I2S A;  2HNI A;  2EJG A;  1OU8 A;  2A28 A;  4ZN3 A;  2E64 A;  2R5A A;  3R6O A;  2G3R A;  5LJ3 d;  1I1J A;  3I35 A;  1M2V A;  3JB9 G;  2E12 A;  1EX4 A;  2LT4 A;  2RHI A;  3RES A;  5KYU A;  3Q1J A;  1VQP T;  3E19 A;  2EFI A;  3I9Q A;  4ELZ C;  2K9G A;  5HKC A;  3I5S A;  2OAU A;  3QYH B;  2VC8 A;  4KRT A;  1K76 A;  4AG2 C;  2MK5 A;  2HQH A;  3JCM e;  2HL5 C;  1MMA A;  1IXD A;  3VS2 A;  3LGL A;  4A4H A;  4KUD K;  2YRD A;  2CP0 A;  2K3X A;  4KGX B;  1SHG A;  3UA7 A;  1KC8 R;  3JCM P;  2RQV A;  1S1N A;  4CC3 A;  2K3B A;  4M7D A;  1YIT Q;  1PRL C;  3A8G B;  4F7U A;  3THK A;  2DXU A;  1RAC B;  4JPB W;  4A63 B;  1QMC A;  3QZ5 B;  4RTW A;  1EIF A;  4L5G A;  2BZ8 A;  5GAO m;  2D8H A;  3VS7 A;  5GMK h;  2F5K A;  4F7U B;  2MCN A;  3GNF B;  1TXQ A;  2MPX C;  4X9D A;  3MEU A;  3CCM A;  4IIO A;  2P84 A;  2VYT A;  3PIO A;  4A4E A;  2GF7 A;  3VRZ A;  3J7A F;  3HPW A;  1GBR A;  4IUP A;  3GP8 A;  2PVD B;  2DXT A;  3GLX A;  3JCM b;  2VXF A;  3HSB A;  2L5Q A;  3EGU A;  1K9M R;  1KQS P;  4QQ6 A;  1OPK A;  3V8J A;  1SSF A;  2JT4 A;  2JS0 A;  2M51 A;  2DD5 A;  4A4K A;  1UGP B;  2LNV A;  2RMO A;  4J9F A;  3G6E Q;  3EFO B;  2YWW A;  3RR6 A;  4C0Z A;  2XK0 A;  2KR3 A;  1LPL A;  4HXJ A;  4EMG A;  4BY6 C;  1NPR A;  3DLM A;  2IIM A;  1HD3 A;  2K79 A;  2XDP A;  2L8D A;  1CSK A;  1U1T A;  3C0C A;  3CXC P;  2NUP A;  3F70 A;  3M59 A;  4M7D D;  2KI7 A;  1KG1 A;  1M1K U;  1QVF S;  4JRP A;  2DA9 A;  3H0I A;  4BE1 A;  1FX7 A;  1W2B S;  5LL6 S;  3MEV A;  1IHV A;  2NUP B;  2CDT A;  2MYS A;  1WI7 A;  4HKE A;  4BE2 A;  2J05 A;  5LJ3 f;  3CME Q;  1OZ3 A;  2CZ6 B;  3OYB A;  1VIF A;  1YIJ T;  3SFM A;  5GAN 4;  2DZ9 A;  3OYN A;  3E2U A;  4A54 A;  2RB6 A;  3NPF A;  1UJ0 A;  3VS6 A;  3UF4 A;  2BE7 D;  1B34 B;  3CEY A;  4HVV A;  4DQ2 A;  2HSP A;  3HKS A;  3CCE Q;  3M0R A;  1X6G A;  1Q86 C;  4JZ3 A;  2Y4Y A;  4M7D F;  2D0N A;  3EG9 B;  2DRK A;  2DX1 A;  3VYG A;  1TH7 A;  1Q7Y U;  1WXU A;  3TSZ A;  1AZE A;  4EMK C;  1WQW A;  1M8M A;  1VQ6 T;  3CCU Q;  2D0Q B;  1C6V X;  2HL3 A;  3QUI A;  2IPO B;  3CCQ Q;  3M55 A;  1X6B A;  4UC4 A;  1UTI A;  4ZN1 A;  2A0F B;  1FMW A;  2LVM A;  4BI3 A;  4BE0 A;  2PVG B;  3A98 A;  2LTO A;  1K73 C;  4BY6 B;  2R58 A;  4XTX A;  4ANJ A;  3M0S A;  2SRC A;  4O5V A;  1AWX A;  3S3N A;  5GAO r;  3RIR A;  4JRK A;  3EGD A;  3NTH A;  5FU6 C;  3RKX A;  2F1L A;  2YLB A;  1FMK A;  4MZP A;  2HDA A;  3HRU A;  5GAO p;  1VQO Q;  5KYX B;  4OB0 B;  3EGD B;  3BW1 A;  1VQ7 Q;  2HCK A;  2P4R A;  5CKD A;  2FPE A;  4C0F A;  3HFN A;  1X6O A;  3CCJ Q;  4PJO F;  1VA7 A;  5I11 A;  1TWB A;  2XI9 A;  3CCM T;  3JCM X;  4AFS C;  4PLI A;  4M4Z A;  3VRY A;  2OTJ T;  3MO8 A;  3EH2 A;  1WHM A;  2GFA A;  2IVW A;  3REA B;  3M4Y A;  3OY9 A;  1Q81 R;  4M7D E;  5CVI A;  1OI1 A;  1VQL Q;  2RJF A;  1G5V A;  4F7U E;  5DLO A;  1YIT A;  4EMK A;  2JMA A;  1QP3 A;  3VKI A;  2NUT A;  2LQK A;  2RN8 A;  4LD6 A;  3UA6 A;  1NEG A;  4EMK B;  3CCS T;  1DJ7 B;  2GNC A;  3EGX B;  4OMP A;  2PTK A;  2X3W D;  2EQK A;  1D0Y A;  3CCR Q;  2KE9 A;  1D0Z A;  4LXC A;  2FO0 A;  5FRM A;  2DAQ A;  5CKF A;  1EFN A;  3KUF A;  2OAW A;  1UGR B;  3SWN C;  4QKU A;  2L0A A;  4E7L A;  2OTL Q;  2OJ2 A;  2A3L A;  2CP5 A;  3QYG B;  1ZBJ A;  5GJW B;  2E70 A;  1RAD B;  3JCM Q;  1OZ2 A;  5FU6 B;  2E10 A;  3MP8 A;  2FL7 A;  1TUC A;  1GL5 A;  2JS2 A;  3MPU B;  3VU3 C;  4F17 A;  4Y28 E;  2KAF A;  1QP2 A;  2A08 A;  3IQL A;  2DYB A;  4KT0 E;  1WJQ A;  5KCH A;  3G6E A;  1UE9 A;  2FZC B;  1R77 A;  8AT1 B;  4GBQ A;  2X4W A;  1M9S A;  1ZUU A;  2VAS A;  2PUO B;  2JVV A;  1IGU A;  4P5N A;  2HBW A;  3VS4 A;  1BB9 A;  3L1A A;  2SEM A;  3CXC S;  3DKM A;  2I2L A;  4O6J A;  5GAN e;  1B07 A;  2K5L A;  4Z02 A;  4C92 F;  1WNL A;  1K8A U;  1SRL A;  1AWW A;  4IUV A;  4HVU A;  3JSC A;  2EAY A;  3N5B B;  1X2K A;  2LDM A;  2O9S A;  1ZHI A;  4FYW B;  3SWN A;  5IHI A;  3X20 B;  3A8M B;  3CME A;  2EYW A;  2ATC B;  3E9F A;  1NYF A;  1IZ6 A;  2COY A;  2JM8 A;  3CC2 Q;  4B6M A;  3I56 T;  3JCM h;  4FYX B;  4M7D G;  2K2V A;  5J39 A;  3SWN B;  2H8H A;  2WAC A;  3FJ5 A;  3WVD B;  4DBQ A;  1M3A A;  2F2V A;  3CCE A;  1WXT A;  4OB3 B;  6AT1 B;  2QQR A;  2VVK A;  3M0P A;  1RUW A;  2RJC A;  5HK0 A;  2GCX A;  4J9C A;  2YUO A;  3M9Q A;  1KHI A;  5GAN 7;  2BZY A;  1M5Q 1;  3MEA A;  1TU0 B;  2HKQ B;  1QVF A;  2FEI A;  1RI9 A;  2IG0 A;  1W2B A;  5LJ5 e;  2O88 A;  2RNA A;  3G1J A;  3CCU A;  2EBP A;  2DTI A;  2P0K A;  4F14 A;  5I22 A;  2EIF A;  3CCQ A;  1FYN A;  2OX7 A;  3RKY A;  3PGG A;  2RQU A;  3NHN A;  4WF2 A;  2V26 A;  2KBT A;  5GAN j;  4K11 A;  4FT4 A;  1YJN T;  3HP9 A;  2J6F A;  2RJD A;  1KC8 C;  2B86 A;  2NYS A;  2LP5 A;  1RAE B;  1NJI U;  2EKO A;  3J80 E;  1N9R A;  4JRQ A;  1YIT T;  4PJO G;  4ELY C;  3H9N A;  1VQO A;  1VQ9 Q;  4J9E A;  2FHD A;  2GBQ A;  1W1F A;  2L3P A;  4RTX A;  4B9W A;  1VQ7 A;  3QBY A;  1MMN A;  5CR2 A;  4L6V 5;  3OYJ A;  3WVE B;  3CCJ A;  1U1S A;  3JCM d;  1ZQ1 A;  1MNE A;  3CC4 Q;  4N0A C;  2M02 A;  1TTH B;  3QDF A;  4XTZ A;  2RM4 A;  4D8K A;  1GFD A;  1O9S A;  4Z88 A;  2AZV A;  4J5Y A;  5C0M A;  2JXB A;  2LQN A;  1ACM B;  2W0Z A;  1LJO A;  1LOJ A;  3OA6 A;  1VQL A;  2KVQ G;  1ZUY A;  1X27 A;  1H8K A;  2RPN A;  5LJ5 j;  1G83 A;  5CK9 A;  2YLC A;  2EYZ A;  1AHJ B;  2J6K A;  3VS1 A;  2MWP A;  1D1A A;  1T0H A;  3CC7 Q;  2DL5 A;  2ZPB B;  1OOT A;  4J6W A;  4OB1 B;  4GY5 A;  3JAM E;  3M54 A;  1VYV A;  1WHL A;  1K9M C;  3L2Q A;  1I4K 1;  1OQK A;  4BDY A;  3JV3 A;  3CCR A;  4BD3 A; 
#chains in the Genus database with same CATH homology
 2FPF A;  1YNZ A;  2JW4 A;  4CC4 B;  2RQV A;  1S1N A;  4CC3 A;  1X43 A;  2K3B A;  2J7I A;  1PRL C;  4FSS A;  2DBK A;  1Z9Q A;  1A0N B;  2DL7 A;  3THK A;  1WX6 A;  4JPB W;  1JU5 C;  4A63 B;  2RQR A;  1GRI A;  1ARK A;  1RLQ C;  4RTW A;  1T0J A;  2KRM A;  4LN2 A;  1OEB A;  2BZ8 A;  2D8H A;  2DIL A;  3VS7 A;  2K2M A;  2EGA A;  3EG1 A;  2MCN A;  2F2X A;  2PZ1 A;  3M0T A;  3PVL A;  3GBQ A;  4IIO A;  1M30 A;  5GJV B;  1XOV A;  1I0C A;  3H0H A;  3VRZ A;  1U5S A;  2CH4 W;  3H0F A;  5HCK A;  1GBR A;  2DLP A;  3NGP A;  2LJ0 A;  1GCQ C;  1K9A A;  4OMO A;  1K0X A;  3QWY A;  2BTT A;  4OML A;  1PRM C;  3RBB B;  5ECA A;  1SEM A;  2O9V A;  1K0S A;  4GLM A;  2CRE A;  2KT1 A;  3EGU A;  2ENM A;  2K6D A;  2RQT A;  1OPK A;  2J6O A;  2MOX A;  2EQI A;  2JT4 A;  2JS0 A;  2M51 A;  1KFZ A;  2RMO A;  1NLO C;  4J9F A;  2EVR A;  3M0U A;  1GFC A;  2L3Q A;  4ORZ A;  1ZX6 A;  2KR3 A;  3CQT A;  4HXJ A;  1OV3 A;  5IXB A;  1KIK A;  2IIM A;  1HD3 A;  2K79 A;  4IIM A;  3VS3 A;  1CSK A;  1M3B A;  2LJ1 A;  3C0C A;  1YWO A;  3EHQ A;  2DA9 A;  3H0I A;  4LUD A;  2F2W A;  1PNJ A;  2KNB B;  2RQW A;  2CDT A;  1WI7 A;  2DL4 A;  4HCK A;  2DJQ A;  2DL8 A;  1GCP A;  4JJD A;  1Y0M A;  2J05 A;  3RNJ A;  1NG2 A;  4WCI A;  4DEY A;  2ESW A;  1GCQ A;  4AFQ C;  1N5Z A;  1SRM A;  2RF0 A;  5IXF A;  3NPF A;  1UJ0 A;  3VS6 A;  3UF4 A;  1W6X A;  4LUE A;  4HVV A;  3EG3 A;  2HSP A;  1AZG B;  2EYY A;  3EG0 A;  3M0R A;  1X6G A;  2AZS A;  1ABO A;  2FG0 A;  4QT7 A;  4JZ3 A;  3U23 A;  2K7A A;  1UFF A;  4RTZ A;  2D0N A;  2OI3 A;  3M0Q A;  2FRW A;  2DRK A;  2DX1 A;  1MUZ A;  1JXM A;  1WXU A;  1PHT A;  3TSZ A;  1AZE A;  1HJD A;  2ABL A;  1E6H A;  4JZ4 A;  1M8M A;  2D1X A;  1H92 A;  1YP5 A;  2LCS A;  1YWP A;  1E6G A;  2M0Y A;  1X6B A;  1T3S A;  1UTI A;  2J06 A;  2GTJ A;  2EGE A;  4EIK A;  2DMO A;  1UHC A;  3A98 A;  2FPD A;  3M0S A;  2SRC A;  2KYB A;  1AWX A;  1KSW A;  1FMK A;  3UAT A;  2LJ3 A;  2HDA A;  2VWF A;  1WLP B;  2DNU A;  3EHR A;  1UJY A;  2C0O A;  3SHW A;  2AKK A;  4RTU A;  5FWB A;  1X2Q A;  1M3C A;  2ROL A;  1JQQ A;  2HCK A;  1ZLM A;  2P4R A;  1SPK A;  2FPE A;  2CT3 A;  1JXO A;  2EGC A;  2KRO A;  1VA7 A;  2AKL A;  2V1Q A;  5I11 A;  2W10 A;  3EG2 A;  2C0I A;  4AFS C;  4M4Z A;  3VRY A;  1YN8 A;  1NM7 A;  2A37 A;  2GGR A;  2A36 A;  1H3H A;  1OPL A;  2ROT A;  3REB B;  2KRS A;  2LQW A;  3REA B;  5IHK A;  1BU1 A;  4CC7 A;  1K1Z A;  1UGV A;  1AWJ A;  2LX7 A;  2C0T A;  2MIO A;  1NEB A;  2CSQ A;  1UHF A;  2JMA A;  1WXB A;  2DF6 A;  1QWE A;  4JJB A;  2RN8 A;  4R0K A;  3UA6 A;  1NEG A;  2ED1 A;  2EKH A;  2JM9 A;  1JO8 A;  1MV3 A;  2LMJ A;  1IO6 A;  1LCK A;  1UUE A;  2GNC A;  2VKN A;  4OMP A;  2PTK A;  2X3W D;  4AG1 C;  5IH2 A;  1AEY A;  1KJW A;  2KE9 A;  4RUG A;  2LNH B;  1QKX A;  2L3S A;  1VYU A;  2FO0 A;  4J9H A;  1EFN A;  2OAW A;  2L0A A;  1W70 A;  2FRY A;  2OJ2 A;  1WDX A;  1Z9Z A;  2KYM A;  2LZ6 B;  1ZBJ A;  5GJW B;  4Y92 A;  1I07 A;  3ULR B;  1WYX A;  2ECZ A;  2DVJ A;  2KRN A;  1TUC A;  2E5K A;  2JS2 A;  1GL5 A;  1PWT A;  1WA7 A;  4F17 A;  2L2P A;  4RTT A;  1NLP C;  1ZUK A;  2A08 A;  2V1R A;  1CKA A;  3IQL A;  2DYB A;  1X69 A;  3LH5 A;  4J9D A;  4J9G A;  2DE0 X;  3VS5 A;  1BBZ A;  1K4U S;  1UE9 A;  4Z8A A;  1U06 A;  4GBQ A;  2KXC A;  1ZUU A;  1MV0 B;  1U3O A;  3H41 A;  1NYG A;  2JTE A;  2HBW A;  3VS4 A;  1BB9 A;  2YUQ A;  1WIE A;  4LE9 A;  1SSH A;  4E6R A;  1AWO A;  3TVT A;  2SEM A;  4X1V A;  4CC2 A;  1ZSG A;  1B07 A;  3QWX X;  4RTV A;  5FWC A;  2PNI A;  1B3Q A;  1SRL A;  1AWW A;  1UG1 A;  4HVU A;  2HEQ A;  1X2K A;  2CUD A;  2EW3 A;  4D8D A;  2O9S A;  1HSQ A;  2I0N A;  3O5Z A;  5IHI A;  2EYW A;  1UDL A;  1NYF A;  4AFZ C;  2JM8 A;  2CUB A;  1WFW A;  3I5R A;  2KT8 A;  2CH4 A;  1TUD A;  3ZL7 C;  2H8H A;  3FJ5 A;  2YSQ A;  2F2V A;  1M3A A;  1YCS B;  4ESR A;  4DEX A;  1WXT A;  2GQI A;  2ED0 A;  2O31 A;  2DM1 A;  4AFU C;  2DL3 A;  2AK5 A;  1AVZ C;  2VVK A;  3M0P A;  1RUW A;  2EPD A;  2YT6 A;  2YUO A;  4J9C A;  2YDL A;  1ABQ A;  4J9I A;  4J9B A;  4RTY A;  2BZY A;  2KXD A;  2O2O A;  1AD5 A;  1SHF A;  4OMN A;  2FEI A;  1RI9 A;  1CKB A;  2O88 A;  5FW9 A;  2RNA A;  2CSI A;  1UEC A;  2EBP A;  2CT4 A;  4F14 A;  1TG0 A;  5I22 A;  2G6F X;  1FYN A;  2RQU A;  3NHN A;  1VYT A;  2XMF A;  2KBT A;  4LNP A;  2NWM A;  1RLP C;  1V1C A;  4K11 A;  3R6N A;  2DRM A;  2J6F A;  1BK2 A;  4JJC A;  4F16 A;  2BZX A;  2B86 A;  2D8J A;  2LP5 A;  1QWF A;  5EC7 A;  1PKS A;  4OMM A;  1GBQ A;  2GTO A;  2DBM A;  1Y57 A;  1M27 C;  3TSW A;  4ZNX A;  1J3T A;  4J9E A;  2GBQ A;  1W1F A;  2L3P A;  4RTX A;  2YUP A;  2EYX A;  1QKW A;  4HVW A;  3NMZ C;  2QDL A;  2A28 A;  3PE0 A;  1I1J A;  2X3X D;  4D8K A;  1GFD A;  3I35 A;  2JMC A;  4Z88 A;  3SEM A;  2KGT A;  1AOJ A;  2AZV A;  4Z89 A;  1QCF A;  3VS0 A;  2JXB A;  2LQN A;  2W0Z A;  5IHN A;  3I9Q A;  1ZUY A;  2NUZ A;  1E7O A;  1H8K A;  1X27 A;  2RPN A;  1G83 A;  2K9G A;  2EYZ A;  3KFV A;  3I5S A;  4KRT A;  2J6K A;  3VS1 A;  5L23 A;  1K76 A;  1G2B A;  1T0H A;  1JEG A;  1PKT A;  2DL5 A;  1T3L A;  4AG2 C;  1OOT A;  4OMQ A;  2YUN A;  3PVQ A;  1QLY A;  1VYV A;  3VS2 A;  2KEA A;  1SHG A;  3UA7 A;  3JV3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...