2ENMA

Solution structure of the sh3 domain from mouse sorting nexin-9
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
77
structure length
77
Chain Sequence
b'GSSGSSGMATKARVMYDFAAEPGNNELTVTEGEIITVTNPNVGGGWLEGKNNKGEQGLVPTDYVEILPNDGKDPFSC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sorting nexin-9
molecule tags Endocytosis
source organism Mus musculus
publication title Solution structure of the SH3 domain from mouse sorting nexin-9
rcsb
total genus 8
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2enmA00
1YWOA 2A36A 5EC7A 2V1RA 1PRLC 2L3SA 4F14A 2EGCA 2L0AA 2LX7A 3IQLA 1KJWA 2YSQA 3TSZA 4FSSA 2J7IA 3EHQA 1VYTA 2LQNA 1X27A 1RLQC 3UATA 4LUDA 2KBTA 2HDAA 2O31A 2KYBA 3VS6A 2FPDA 2LZ6B 1T3SA 2PZ1A 1MV0B 1HD3A 2RF0A 1QWFA 2G6FX 5I22A 1M27C 4GBQA 2SEMA 3NGPA 5FW9A 2JS2A 1AOJA 2EYXA 3H0HA 4RTTA 1PWTA 5IHKA 1BBZA 4AG2C 4RTVA 3M0UA 2RQUA 5FWCA 4AFSC 4JZ4A 1WI7A 4HVUA 1KFZA 1WA7A 2L3PA 4AFQC 2EPDA 4LN2A 2FPEA 2DYBA 1Y57A 3C0CA 1CSKA 1TG0A 4HCKA 1E6HA 1XOVA 1OOTA 2LJ0A 4Y92A 2RQWA 2YUPA 1UDLA 1WFWA 4CC3A 2PNIA 2DLPA 5IHIA 2DBMA 2KT1A 2CDTA 1M30A 1SSHA 2RQRA 2KE9A 2L3QA 1BU1A 4K11A 1H8KA 2J6KA 2F2XA 2FPFA 3O5ZA 2JW4A 1WXUA 1Z9QA 1CKBA 1UTIA 1YNZA 3TSWA 1NLPC 1K0XA 2FRWA 1JU5C 3EG2A 3QWYA 1JO8A 1RLPC 2KRNA 1TUCA 1YCSB 3A98A 2NUZA 4F17A 2YUQA 2K2MA 2DE0X 2ECZA 3CQTA 3SEMA 1YWPA 1UE9A 3VS7A 1VA7A 3EG3A 4E6RA 1ZSGA 2DBKA 2M0YA 3RBBB 1GCPA 2D1XA 2BZYA 1LCKA 1KIKA 4J9IA 4AG1C 1GBQA 1HJDA 1QWEA 3GBQA 1W70A 4DEYA 2GTJA 2K3BA 2C0TA 1WX6A 4IIMA 1PRMC 1AZEA 2O88A 4J9HA 2DL7A 2KRMA 4RTXA 4Z89A 4J9CA 2KRSA 1RUWA 2JT4A 2AZSA 2DMOA 2O9VA 2LMJA 5FWBA 2I0NA 1K1ZA 4DEXA 2W10A 1QLYA 2D0NA 3SHWA 2GQIA 1V1CA 4F16A 1GL5A 2DL8A 2EQIA 2VWFA 2X3XD 2DF6A 3TVTA 1ZUKA 4QT7A 4J9EA 1NYGA 2KT8A 2D8HA 2K7AA 1A0NB 3VS4A 1UJYA 1N5ZA 2ABLA 2J6FA 2AK5A 2RPNA 4Z88A 4GLMA 4WCIA 2RQVA 4D8DA 1H3HA 1OEBA 3QWXX 4LUEA 4M4ZA 1JQQA 2YT6A 2EYZA 2CUDA 1T0JA 2JXBA 2VVKA 3ULRB 5GJVB 4JJBA 1E7OA 1B3QA 1U5SA 2O2OA 1NYFA 2CREA 1UFFA 2B86A 1K4US 2LP5A 3EGUA 1X6GA 1I07A 2DRMA 2FEIA 2CSIA 2MIOA 1UECA 2KROA 4ESRA 2DJQA 2ED0A 2LJ1A 1Y0MA 3NMZC 1BK2A 4LE9A 2FO0A 2EYYA 5IXFA 2K6DA 2RQTA 1NLOC 2P4RA 1K0SA 2O9SA 1ZX6A 2OJ2A 4JJDA 2JS0A 2DVJA 1OPKA 1Z9ZA 1I1JA 2HBWA 2RN8A 1I0CA 2JTEA 2EVRA 4RTUA 2GGRA 4D8KA 2L2PA 2X3WD 1K9AA 2H8HA 4J9DA 1UGVA 5ECAA 2W0ZA 1ABOA 1OV3A 2A08A 2PTKA 3UA7A 2GTOA 3I5SA 3M0RA 2KGTA 2A37A 2MCNA 4OMQA 4ORZA 1B07A 2J6OA 3PE0A 1CKAA 1PKTA 5L23A 2LNHB 3VS1A 1H92A 1M8MA 1UHCA 2KXCA 3RNJA 2FG0A 1U3OA 1SHGA 1VYUA 4HVWA 2RNAA 2DM1A 2EGEA 4JJCA 4RTWA 2DL4A 1OPLA 2DNUA 1GBRA 1SRMA 1AWJA 3NPFA 2DA9A 4JPBW 2V1QA 2KNBB 3U23A 4AFZC 1UUEA 2ED1A 2ROLA 4CC4B 2EKHA 3I9QA 1MV3A 2JMCA 4OMPA 1J3TA 2KR3A 1PKSA 1GRIA 2BTTA 2C0IA 5GJWB 2AZVA 4JZ3A 4HVVA 1AZGB 4IIOA 1X43A 5I11A 1WIEA 2GNCA 2ROTA 4CC2A 2CSQA 4EIKA 3PVLA 1WYXA 1X6BA 1AEYA 1U06A 2AKKA 1HSQA 4ZNXA 3REBB 1NG2A 2EBPA 2CH4A 2NWMA 2LCSA 2K79A 2AKLA 3UF4A 3I5RA 2RMOA 2DL3A 1S1NA 3VS2A 1M3AA 2HSPA 2CT4A 1K76A 1UHFA 1W6XA 2OI3A 2KYMA 2LQWA 2DRKA 4RUGA 3EG1A 1QKXA 3VS0A 1SPKA 3LH5A 2DILA 2D8JA 2JM8A 1FMKA 2JM9A 1GFDA 4HXJA 5IXBA 3THKA 1RI9A 1ZBJA 1JXOA 1WLPB 1WXTA 1VYVA 4CC7A 2CUBA 2MOXA 4OMLA 4KRTA 4OMNA 1SHFA 3NHNA 2EW3A 4AFUC 1QCFA 3VS3A 1ARKA 1JEGA 1GCQA 3M0PA 4R0KA 1M3BA 4RTZA 3M0QA 1ZLMA 3VRYA 3EHRA 3UA6A 1TUDA 1JXMA 1PHTA 2YUOA 2A28A 1WDXA 1G83A 1T3LA 1IO6A 2ENMA 1KSWA 3JV3A 1NM7A 1YP5A 2KEAA 2CH4W 4OMOA 1M3CA 4OMMA 1FYNA 1ABQA 1W1FA 2HEQA 2YDLA 1UJ0A 2EYWA 2GBQA 2VKNA 3M0TA 1QKWA 1X2KA 1AVZC 2CT3A 3KFVA 1E6GA 3I35A 1MUZA 4X1VA 2HCKA 4A63B 2J06A 5IH2A 1BB9A 1SEMA 1GFCA 2JMAA 2F2WA 3ZL7C 1PNJA 3M0SA 3H0FA 5HCKA 1AWXA 2SRCA 2DL5A 2K9GA 4J9BA 1G2BA 2FRYA 2LJ3A 3REAB 3VRZA 2DX1A 2BZXA 2E5KA 2C0OA 4J9FA 2BZ8A 2EGAA 1SRLA 3H41A 4LNPA 1NEGA 1X69A 1YN8A 3PVQA 4RTYA 1AWOA 2M51A 3R6NA 1AD5A 3H0IA 2QDLA 2F2VA 2J05A 1GCQC 1AWWA 1EFNA 1T0HA 2IIMA 3EG0A 5IHNA 4Z8AA 1X2QA 3VS5A 1UG1A 2YUNA 1NEBA 1ZUUA 4J9GA 2ESWA 2KXDA 3FJ5A 1WXBA 2XMFA 1ZUYA 2OAWA
chains in the Genus database with same CATH superfamily
3OA6A 5FRMA 3X25B 4M7AC 1C0MA 4ELYC 5EC7A 2EIFA 1QP3A 1ZHIA 3L2VA 3UPUA 1QCOA 1Q95G 3TSZA 1JJ2P 3CPWP 3EHQA 1YJWA 5FLXE 1RLQC 4FYVB 2VXEA 3V8LA 2HDAA 1V29B 2KYBA 2LZ6B 4KH0B 1T3SA 2H3EB 1JJ2S 3L2WA 2X4JA 5KYXB 4UC4A 3NGPA 3HL8A 3QDRB 1WJQA 3UWNA 2DD5A 3HRUA 4AG2C 3HHTB 1W4SA 2HD0A 3NTHA 2XD0A 4AFSC 4FM4B 1KK7A 1WI7A 2OTLA 5KYUA 1KFZA 2C06A 1WA7A 2L3PA 2QASA 3QIIA 1X6OA 1XOVA 2LJ0A 1K9MC 4Y92A 2YUPA 2CP7A 1BIBA 2CP0A 4FT4A 3NTKA 4C5IA 2HKQB 2NUTB 5I21A 1LOJA 4FYWB 1XQHA 4RCCA 2DXCA 2RQRA 8ATCB 2J6KA 2FPFA 4A54A 2JW4A 1WXUA 1VUBA 1VQ9Q 3CCET 3TSWA 2E6ZA 1UGPB 3CCEQ 3QWYA 5DLOA 3GNFB 1TUCA 3PFSA 2E65A 4KH1B 2YUQA 2MWPA 2K2MA 3PMTA 3TCJA 4RG8A 1YWPA 1UE9A 2R5AA 3VS7A 3CD6A 5D6WA 1TTHB 2DFUA 3S3OA 4HA8A 5GMKi 4PJOF 2FVUA 2E64A 4FU6A 5CKHA 4J9IA 1GBQA 3GBQA 2GTJA 1RABB 2C0TA 2EQJA 3G4SA 1WX6A 4IURA 1PRMC 2KRMA 2DAQA 4RTXA 3VUZA 4Z89A 2EJFA 3SB2A 3CC2Q 1RUWA 4M75F 2OTJQ 5D7UA 4RMOA 2O9VA 4JJNK 2RH2A 1K1ZA 4PJOB 1QMCA 4DEXA 1FX7A 2W10A 5GAN5 5A0DA 5DLQE 5M9OA 4HCZA 2GQIA 2V8IA 3C95A 3CBOA 3CPFA 4CI0C 3L2ZA 4C92A 3G6ET 1BI2A 2D8HA 2QQAA 3EGXB 3V8JA 4QVCA 1Q86C 1N5ZA 2E70A 5LJ3f 2CZ6B 2RPNA 3CCQA 2DK3A 4LUEA 2RK2A 2YT6A 4M77E 2CUDA 4M78A 5LJ3h 1QVFP 1T0JA 2JXBA 5C6SA 3QXEB 5GJVB 3P8BB 2E4HA 1NYFA 2DD4A 1UB4A 3QHSA 1LPLA 2LP5A 2QI2A 4FSXA 2P0PA 2DERA 1I07A 2CSIA 1YJWQ 3G4ST 2KROA 4ESRA 3HTRA 2ED0A 3JCMe 1JBMA 2Y4YA 1BK2A 3OW2S 3A8MB 4M7AA 4X9CA 2QXFA 1VQLT 3X24B 4MZPA 5KYWA 2RQTA 4BDYA 1G3YA 1K0SA 3FEOA 4PJOA 3CPWS 2OJ2A 1D3BB 2JS0A 2VYTA 3V8KA 3JAME 2MK5A 5CO7A 2A0FB 2JTMA 2HL3A 3VJPA 2HBWA 1D0ZA 1R0CB 3HP9A 4D8KA 3JCMf 3CCQT 2RB6A 4J9DA 5ECAA 1Y96A 2W0ZA 5KYXA 2A08A 1KQSS 3M9QA 4XU3A 2FB7A 3PE0A 1KC8R 4C0GA 2MI6A 5L23A 2MMPA 4M78G 3E1SA 3S3MA 4XTXA 2KXCA 3RNJA 2ZCFB 4IUTA 4HVWA 1SHGA 2DM1A 2LT4A 2YLBA 1EIFA 3OSSC 3AT1B 4QVZA 1LVKA 1AWJA 2FHDA 4ANJA 4ATOA 4AFZC 1UUEA 2ROLA 1KC8C 2EKHA 3I9QA 1MV3A 2JMCA 1K8AC 1VQLA 9ATCB 1V76A 3OBYA 4BE2A 4C92C 1FMVA 2DPPB 4AT1B 3CCJQ 1NPRA 3URGA 1X75C 4M7AG 3CBMA 1N9SA 1X43A 4BE0A 1Q81C 1WQWA 1Q7YR 1EZZB 1WYXA 1VQ4Q 1U06A 5CAIA 2RJDA 4BB7A 1PSFA 3EGDA 2GF7A 4HCCA 5EG2A 2LCSA 4J5YA 2VB6A 1C6VX 2AKLA 1K9MR 1NBEB 3BE3A 2K4YA 1SG5A 1RAEB 5LJ5j 1RAFB 3CC2T 2CT4A 1UHFA 3J7AF 4RUGA 3VS0A 1IREB 3LH5A 2ZPFB 4M75B 3PIPA 3TQ7P 1U1SA 2AHJB 4N0AC 1FMKA 2KQWA 4A4EA 1YJNT 2CGHA 2VXFA 2L3RA 4JRKA 2ZPGB 4F7UB 3DB3A 2QDYB 1VQOQ 1I5OB 3EFOB 1WXTA 1RAHB 1HXDA 1VQ6A 2KDSA 4OMNA 1SHFA 5FRNA 2D6FA 1B34B 5GAOq 4R0KA 1TOVA 1M3BA 4PNOA 4RTZA 3M0QA 4PJNA 3CXCP 1NPPA 5FU7C 2JTFA 4OGEA 1VQ7A 4KUDK 3C4SA 1FXXA 1PHTA 1YHQT 4PFOA 3QZ9B 1PSEA 2NUPB 4DOWA 2ENMA 1PCXA 2V8JA 3CEYA 2E6NA 4KGVB 1TSFA 2KEAA 3G6EQ 4J6WA 1M3CA 4PLLA 2R5MA 4N4GA 2EYWA 3ME9A 1D1CA 2X51A 1Q81U 4JDSA 2DTIA 5LJ5g 2CP3A 2QA4Q 2CT3A 2OTJA 2BUDA 2V26A 3EFSA 3CMAT 3E9FA 4X1VA 5IH2A 4OMFB 1OZ3A 1YI2T 2JMAA 4LD9K 3ZL7C 3M0SA 1H641 4M78E 2EQUA 1WNLA 4IUUA 3JCMd 5LJ5d 1AWXA 1W2BS 1G2BA 3VRZA 2PU9B 3CC4Q 2F5KA 1VQ6Q 4J9FA 4FW1A 2XU8A 2EGAA 1KHIA 1VQ8Q 5HKCA 3DKMA 3OYHA 1AWOA 2QQBA 1OX8A 1VQ9T 4N4IA 4BD3A 3V7SA 2IIMA 3EFRA 3QJYA 2O4XB 2JUFA 2KXDA 1Q86R 2L89A 3FJ5A 2XMFA 2EJGA 1BI0A 2LRQA 3JRZA 3VUBA 5GAN6 1YWOA 2QG9B 2BE7D 1NZ9A 2V1RA 2DJZA 2RHYA 1PRLC 5GMKh 5CR2A 4DBHA 3IQLA 2G3RA 3TU4K 4FSSA 1Q82C 2LQNA 5DM7R 2DKGA 2JJ9A 2JNGA 4C0FA 2P84A 2XKOC 3VS6A 4F7UE 2KSSA 2L8DA 3QG1A 2QYZA 1U1TA 5A0GA 1WPYA 2QA4A 1LJOA 2R58A 5GAMe 1VQMQ 5FW9A 2QTXA 2K5FA 1AOJA 3CCRQ 4MZTA 5IHKA 1BBZA 3JSCA 5GAMj 1VQ7Q 4RTVA 5CKFA 2ZZDA 3CCUT 2ZPIB 4NS5A 3JCMb 1M9SA 2FPEA 1Y57A 3C0CA 3OYDA 1VQPQ 1Q81R 2WSEE 1G3WA 2LDMA 4C5EA 2KY9A 3CCMA 2E5QA 2PNIA 4NL2A 4C8QB 3N5BB 3BFMA 2KT1A 4B9XA 3I56Q 2CDTA 4K11A 1SSHA 2KE9A 2L3QA 1ZSZB 3O5ZA 2CYZB 1Z9QA 2YRDA 4DOVA 2OTLT 4F7UA 4BI4A 2FRWA 2EQMA 2QTVA 2OTLQ 1RLPC 4C8QF 2YHTA 2K2VA 4A53A 3RDVA 4F04B 1WZOA 5CIUA 2NUZA 4F17A 4E7IA 1KD1C 1OQKA 3CQTA 2KAFA 1VA7A 3EG3A 2K5IA 5GANd 3PT9A 2M0YA 1XJWB 1RL2A 2EJ9A 1HJDA 4DEYA 1S72T 3EG9B 4IIMA 4EMKA 1AZEA 2O88A 4LDXA 3NTIA 3QPHA 4J6YA 1I8FA 2NUTA 2DMOA 4GY5A 1YJ9A 1VQ6T 2MYSA 2LMJA 5FWBA 2I0NA 2MAMA 4E7SA 4XTZA 2VV5A 2QEXA 2I2LA 3SHWA 3R6OA 4F16A 3X20B 1VQ8A 2EQIA 2X3XD 2DF6A 4BI8B 2XI9A 4J9EA 1IGQA 3HRTA 2K7AA 3A8LB 1K9MU 4R55A 3NFCA 5KH6A 3CCST 3KBGA 5KCHA 4OF1A 1IXDA 2AK5A 4LDUA 5DY9A 4GLMA 4WCIA 4D8DA 2CZ0B 3M5AA 3OYIA 3QYHB 3JCMX 1JQQA 4X9DA 2EYZA 3OS1A 5KE3A 3VU3C 4JJBA 2F1LA 1QVGP 3DLLA 1BYMA 2RK1A 3P8DA 1BKBA 1BI1A 4AMCA 4ZTJA 1K4US 5GANe 3BY7A 3OYLA 4M77F 4QQ6A 2X35A 2DRMA 2Y90A 3V7CA 2FEIA 4B6MA 5CKDA 1VQ9A 4PL6A 1SKUB 2EWNA 4GLKA 2X4YA 1M2VB 3OYCA 5LJ3d 2E12A 4M77A 4NL3A 1IGUA 2FO0A 1WHJA 2DETA 5IXFA 5FU6B 4MDXA 3CD6Q 4EPCA 1JRIA 2O9SA 2CS7A 1VQ8T 1OPKA 4IUQA 4TVRA 5KYYB 3G71T 1Z9ZA 5GANh 3CC4T 4JRIA 1I0CA 2NLUA 1LNXA 3OYKA 4D6WA 4FL6A 2H8HA 2JN0A 1ABOA 2PTKA 3A8GB 2RHUA 2MWOA 2A37A 3GP8A 3GLXA 3CCMQ 2CP5A 1X01A 2WACA 4XQ3A 2X4XA 2J6OA 3MP8A 2RO0A 3L2QA 4M78F 1CKAA 4OVAA 2QA4T 3CMET 2QQ9A 1UEBA 2FG0A 1VQKA 1U3OA 1VYUA 2FL7A 2RNAA 4XTUA 4JJCA 4RTWA 2DL4A 2EQKA 1GBRA 1SRMA 3NPFA 2BE9B 1D0YA 4Y28E 2V1QA 1KC8U 4X34A 2ED1A 1RI0A 1M90C 4MMKA 2QGGA 2KR3A 4M75C 3VKIA 2BTTA 1QCNA 4Q5WA 3Q1JA 3CC7Q 1AZGB 3CCMT 1WIEA 2ROTA 5GAN7 4CC2A 5GAMh 4L59A 1KG1A 3FB9A 4CRIA 3JB9G 4M75G 1AEYA 4NOYA 2AKKA 5KYYA 3A5ZB 4ZNXA 4F7UF 1PM3A 3CCUA 5LL6S 1VQ5T 2IVWA 2QAZA 2K79A 2B8AA 3I5RA 2RMOA 1YIJA 2HSPA 5GAOr 1G8XA 2HNIA 1W6XA 2NYSA 2OI3A 5CCAA 4M7DB 1MMGA 3JCMW 2LT1A 1OULA 1ZA1B 3CCQQ 4LDWA 3ZEHA 3GNGA 4OP0A 3S6WA 4HXJA 5HK0A 2E3IA 3DLMA 1YJ9T 2EYQA 4JRQA 2QGFB 2CUBA 3NHNA 2EW3A 1JEGA 2XDDA 3JB9H 1SF9A 1PD0A 2ZPHB 2AT1B 4KGZB 2L5QA 1FWZA 4QKUA 1OU9A 4MDWA 3UA6A 4M77C 3CCSA 3JB9J 3SDZA 4BUGA 1NJIU 4OB1B 3CCJT 2KVQG 2IG0A 2A28A 3OYYA 1MMAA 1D09B 4M7DE 3UDCA 1KSWA 1VQ4A 4M75A 1YP5A 2E41A 4JLIA 3F70A 1KQ2A 2RHZA 2CZ1B 1P92A 2CH4W 2QEXT 3RR6A 2XDBA 4PJOD 4OMMA 2RJCA 1W2BA 2VKNA 2DIGA 1YITT 1Y7XA 3KFVA 2HBPA 3I35A 4M77B 4A4FA 4A63B 4M7DA 1MNDA 2DXTA 1GFCA 5CK9A 3OS0A 4BACA 1RAIB 1RAGB 4N4HA 3JCMc 3MKDA 3JB9I 2DL5A 2K9GA 1Q7YC 4J83A 5GANj 4J6XA 3H9NA 2OTJT 2FYKA 1YITA 1X69A 4P5NA 2M51A 2BIVA 1O9SA 2RJEA 3H0IA 2EFIA 5GMKm 1VQLQ 4EDUA 1N8RR 1VQKQ 1UGQB 3EG0A 3FLGA 5IHNA 3I56T 2HQHA 4Z8AA 3I55A 3LYIA 3L42A 3VS5A 2YUNA 4LD6A 3G4SQ 1KQSP 2RI5A 2LX9A 2QQSA 3CC2A 4J7IA 3G6EA 4QVDA 3CC4A 2A36A 4XTVA 2LQKA 1GXIE 5LJ3g 1VQNQ 4FIBA 2XG8D 4F14A 3CCUQ 2EGCA 3ZBDA 2LX7A 4FT2A 2YSQA 3HRSA 1W2BP 2PVDB 2LNVA 1VYTA 1X27A 4LUDA 4ZGJB 4WTOB 3S3NA 4M7AE 3LW5E 1VQOA 4L6V5 3TEEA 4C8QD 4QQGA 2G6FX 1MGQA 4PJMA 3JCMQ 1PG5B 2SEMA 2ZAEA 1KQSA 4ZN3A 2HQEA 2EYXA 4KBMB 1PWTA 1VOMA 1R8OB 2IPOB 5AT1B 2YRVA 2HAXA 2CP6A 1OX9A 2DYIA 2RQUA 3M0UA 5FWCA 3RESA 3V7RA 4JZ4A 5IAYA 3WVDB 3L2UA 5LJ5h 2E10A 4XU1A 4HVUA 1Y71A 1PD1A 4MMLA 3EAEA 4LN2A 1YIJT 3RKYA 1M90U 1TG0A 4HCKA 4PJOE 1E6HA 3CPWA 1OOTA 4M7AB 5LJ5f 1Q82R 1WFWA 4CC3A 2DLPA 5IHIA 2M02A 2DBMA 5KCOA 3MP6A 4MZMA 1WGSA 1M30A 3M58A 1BU1A 1WHMA 3PNWC 3ASKA 3H6ZA 2D0QB 1CKBA 1YI2A 3LGLA 1YNZA 1NLPC 1K0XA 3OS2A 1K73U 3OYMA 4FYYB 2KRNA 2FZKB 5FU6C 1YCSB 4OB0B 1VQOT 1KHCA 2ECZA 1I81A 3SEMA 1R77A 3FDRA 3CMEA 2AIRB 2A7YA 1GCPA 3OYFA 2D1XA 2BZYA 1VQKT 2LTOA 4VUBA 3PIOA 4AG1C 1QWEA 1NE8A 1W70A 3CBPA 4FYXB 2HKNA 2K3BA 5CKEA 5CKBA 1YIJQ 1I5LA 5FU7B 2DL7A 2R57A 4J9CA 3GOXA 2JT4A 3M53A 3JB9F 4O5VA 3CMAQ 2JVVA 3QDFA 2RI3A 3HSBA 1WHKA 1QLYA 2D0NA 3QJ6A 1GL5A 4LDYA 5HK3A 1K73R 3TVTA 1ZUKA 4QT7A 3JCMg 2KT8A 1A0NB 3CCJA 3VS4A 2PUOB 2J6FA 3RKWA 4R56A 4PJJA 4EMKB 1KQ1A 1OEBA 3QWXX 1YHQQ 1YITQ 2GFUA 2DZCA 1Q82U 1MHNA 3HFOA 5LJ5e 3EG9A 5GAOm 1ZBXA 1C1AA 1QQJA 2VVKA 4HCBA 3ULRB 1E7OA 1U5SA 3CXCS 2QEXQ 3JCMV 2CREA 1UFFA 3SWNB 2B86A 3M55A 2LCCA 2DEQA 3EGUA 1X6GA 3SD4A 1YJNA 2M0OA 5KYUB 2GQVA 2MIOA 3RKXA 2DEUA 2LJ1A 3CCLA 3NMZC 3VV0A 3BW1A 5GMKj 2K6DA 3QYGB 1ZX6A 4JJDA 2DVJA 3FJPA 2Y4XA 5I2MA 5A2QE 3J81E 4KUIA 2F69A 1TWBA 4C5GA 4C8QC 1KD1R 3BDLA 5GAN2 1D0XA 3QSUA 1K9AA 1M2VA 3HKSA 1BI3A 1VQ4T 1VQPA 1HK9A 3I5SA 4IUPA 1XTDA 1Y96B 4C92F 2XDPA 2MCNA 4OMQA 1TUGB 1WHHA 1UHCA 4HT8A 1N6AA 2KMTA 3SWNA 4F7UG 1S72A 1ACMB 2HMAA 2P0QA 4KT0E 2YWWA 3OYJA 1BCMA 2COWA 2KNBB 1R0BG 3LWIA 4LXCA 5LJ3e 1VQNA 1XNIA 3EGXA 2C0IA 2HQXA 2P0KA 2LQ8A 2ZPBB 4IIOA 5CVIA 4C8QG 1RAAB 2CSQA 1M90R 3PVLA 1X6BA 5J3BA 1HSQA 1OZ2A 2ATCB 2E1HA 4ELZC 3X26B 1JB0E 2YRCA 2VC8A 2DTOA 2NWMA 1ZSZC 3UF4A 4LDVA 2DL3A 3CXCA 4DQ2A 1QW1A 1S1NA 1M3AA 1JJ2A 1K76A 2DIQA 2COZA 2KYMA 2LQWA 2DRKA 4HT9A 1SPKA 4ZN1A 5GMKe 3AHUA 2JM9A 1ZA2B 3DB4A 5IXBA 1Q7YU 4II1A 4EMGA 3UT1A 1RI9A 2WSFE 1YJWT 1EX4A 1ZBJA 4FW2A 1VQ5Q 2DXBA 1D3BA 2ZPEB 1G5VA 4O6JA 4PLIA 4KRTA 5AYFA 4XTWA 4AFUC 1QCFA 2LVMA 1GCQA 1MMNA 4C5HA 4QQDA 4ZGEB 3EHRA 1TUDA 2YUOA 1OI1A 1WDXA 4M77D 3M57A 3HFNA 1IO6A 3WVEB 5IN1A 3MEUA 2X4WA 4ZGDB 4RCBA 5HY6A 1QVGA 4PJOG 1OU8A 1FYNA 4M7AD 2HZYA 3CC7A 1ZQ1A 4JS5A 2YDLA 1UJ0A 1YFNA 1X2KA 2VGNA 4FCYA 2XICA 4PFPA 1E6GA 3OMCA 4JS4A 4A4HA 2HCKA 2J06A 1SEMA 4ME7A 2F2WA 1PNJA 3QBYA 1YCYA 3H0FA 5HCKA 3HPWA 3E2UA 1M5Q1 2LC4A 3OY9A 4OB3B 4DBQA 3VYGA 2M1HA 2VASA 4N0AA 1PC0A 2DX1A 4L5GA 3G71Q 2C0OA 2BZ8A 1SRLA 4LNPA 1NEGA 1UGRB 1YN8A 3PVQA 2OX7A 1AD5A 4M75E 1N9RA 4PJOC 2QDLA 1GCQC 3CCVQ 5CQYA 1M1KU 1M1KR 3J80E 1VQ5A 3M59A 3JCMh 3C94A 1Y07A 1NEBA 1ZUUA 3L2RA 4BI3A 4M78B 1FMWA 2CZ7B 4PJLA 1ZUYA 1TS9A 4KGXB 4BDZA 2XK0A 1D1BA 3QUIA 1IRXA 2L3SA 5L8RE 3EH2A 5GAOl 2L0AA 1KJWA 2M9UA 3MJXA 2J7IA 5GAN3 2DXUA 4A4KA 3QO3A 3I56A 3UATA 3PGGA 1M1KC 2KBTA 3OQ5A 2O31A 4PKCC 2FPDA 1BCOA 2PZ1A 1MV0B 2Z0WA 3INZA 3CCSQ 1HD3A 1IB8A 2RF0A 4V2SA 1QWFA 4JLGA 5I22A 1M27C 3OBWA 4GBQA 4DBFA 2XIDA 8AT1B 2JS2A 4Y91A 3H0HA 4RTTA 1VQ7T 1M4ZA 3OYEA 3GPLA 1M1FA 4JRPA 3KXTA 3CCEA 1MMDA 2RA2A 2BKDN 1VQNT 1H3ZA 4AFQC 2EPDA 4EMHA 2DYBA 3M56A 1QVFS 1CSKA 2RQWA 1AT1B 3M54A 4KULA 3G71A 1UDLA 3SWNC 3RMSA 4E7JA 4M78C 4BY6B 2DVEA 4ZTFA 1H8KA 3OS5A 2F2XA 1IZ6A 1UTIA 3D7SB 1JU5C 3EG2A 1JO8A 4C92B 1RACB 3A98A 2X9HA 3LGFA 1QVPA 4DBRA 2DE0X 3M4GA 3MHXA 4E6RA 7AT1B 4XU0A 1ZSGA 2DBKA 5GMKl 3RBBB 1N8RC 3TREA 3G1JA 1B7TA 5FROA 1LCKA 4M7DG 1NJIC 1KIKA 1TH7A 4YTLA 4E7LA 4PK4A 4J9HA 4PFZA 2KRSA 2AZSA 3EGDB 3CCVA 4IKFA 3A8OB 3I55Q 1V1CA 3OYBA 1DJ7B 3OYAA 2DL8A 1VQMT 4C8QE 2VWFA 1MNEA 1NYGA 1I4K1 4B9WA 2PVGB 4DA4A 1UJYA 3MO8A 2ABLA 5LJ3j 1VIFA 4XAXB 1O75A 4Z88A 1IHWA 2RQVA 2K3YA 1H3HA 1TXQA 2ZGWA 5GAMf 4BE1A 4M4ZA 3RERA 3JCMP 5KYWB 4J8OA 3FRNA 3T9NA 5GAOn 2O01E 1B3QA 2O2OA 4IUVA 3O8VA 5KYNA 2LCLA 1B34A 3E9GA 3GF5A 2YXYA 5KE2A 3FC3A 3P8HA 3OSVA 4XU2A 3JB9D 1YJ9Q 4M75D 1UECA 2PQWA 2DJQA 2V8KA 2RHXA 2GFAA 1Y0MA 2QQRA 2P4TA 4LE9A 3MEAA 2EYYA 3CCVT 4C8QA 1SSFA 3QKJA 1NLOC 1K8AR 2P4RA 1U8RA 3L1AA 1ZSZA 2WSCE 1N8RU 5J26A 3RIRA 1QVFA 2K3XA 3LWHA 4M7AF 1M2OA 3META 4M7DD 3H8ZA 1I1JA 2RN8A 5GAMd 4J7FA 1YHQA 2JTEA 2KI7A 2EVRA 2DZ9A 4RTUA 1RADB 2GGRA 3CCLT 4E7ZA 2L2PA 3JCMJ 2X3WD 1KD1U 3KUFA 2RHIA 4QW2A 1UGVA 5J39A 3UA7A 1OV3A 1YI2Q 1VIEA 3ZFJA 2GTOA 3M0RA 3OMGA 5GANg 2KGTA 2HL5C 4ORZA 1B07A 2EAYA 3CC7T 4C92D 1M1GA 1PKTA 2LNHB 2OAUA 3VS1A 1H92A 1M8MA 4HKEA 3RUXA 4C92E 5IT9E 2EGEA 3CMAA 1OPLA 2JOYA 5GAN4 2DNUA 3GIBA 4XTYA 2DA9A 4JPBW 3LLRA 3E19A 4M7DF 3U23A 4JUVA 4CC4B 2FZGB 4OMPA 1J3TA 1PKSA 3PMIA 1GRIA 5GJWB 3WXMB 3CMEQ 2AZVA 4JZ3A 4HVVA 4WF2A 5I11A 2E3HA 1IHVA 2GNCA 1HYOA 2KK4A 5C0MA 2VGMA 1WHGA 4EIKA 5D6YA 3EFOA 2DO3A 2RD1A 5GAN8 3A1PA 3CCLQ 3REBB 1NG2A 2DTHA 2EBPA 3EH1A 1G3TA 2A3LA 3LX7A 3I55T 2CH4A 3G7ZA 1WJRA 1YJNQ 3VS2A 2H3JA 2RI2A 1TU0B 3EG1A 1QKXA 3CD6T 5GAOp 2XHCA 6AT1B 2DILA 2D8JA 2JM8A 3MEVA 4C0DB 1GFDA 3OB9A 2NUPA 4OB2B 3THKA 4RKUE 3OYGA 5I2SA 3RMQA 2FZCB 5CQXA 2PVOB 1JXOA 2K5LA 2CP2A 1WLPB 3SFMA 3OYNA 2GCXA 1VYVA 4CC7A 5GANf 4Z02A 2MOXA 3LH0A 4OMLA 2F5TX 1ARKA 3VS3A 4C92G 3M0PA 1VQMA 5D6XA 3M4YA 3OW2P 4EMKC 1BIAA 3CCRA 1QVGS 1ZLMA 3MP1A 1Q86U 3VRYA 1F1BB 4E2FB 4E7KA 1JXMA 2RJFA 4C0ZA 3QZ5B 1G83A 1T3LA 2D9TA 4M77G 3ER0A 1WQ7A 5GAMg 2VUBA 3JV3A 4A4GA 5A0LA 2YLCA 1NM7A 2RM4A 2PUKB 1VQPT 4XK8E 4OMOA 3MCAB 1ABQA 1K73C 1W1FA 2K57A 2HEQA 4M7DC 2GBQA 3M0TA 1QKWA 2CKKA 3CCRT 1AVZC 3VYHB 2JZ2A 1AHJB 2MF2A 3MPUB 1MUZA 3OW2A 1OYXA 1UGSB 2O4XA 1BB9A 4RG2A 4BY6C 1M8VA 3C12A 1D1AA 1YBYA 3A8HB 1S72Q 4E7HA 2HSEB 3MEWA 2M16A 4OGCA 2SRCA 1K8AU 4J9BA 2FRYA 2LJ3A 3REAB 2MPXC 3FIFA 2BZXA 2E5KA 3H41A 1N27A 4RTYA 3PTAA 3R6NA 4C0DC 4E47A 1NJIR 2F2VA 2J05A 1AWWA 1EFNA 1T0HA 1WHLA 2EKOA 2QK0A 3BDUA 3X28B 1X2QA 1WJSA 1UG1A 4J9GA 2ESWA 1WXBA 1G3SA 4M78D 1QP2A 2OAWA 2COYA
chains in the Genus database with same CATH topology
1YWOA 2A36A 5EC7A 2V1RA 1PRLC 2L3SA 4F14A 2EGCA 2L0AA 2LX7A 3IQLA 1KJWA 2YSQA 3TSZA 4FSSA 2J7IA 3EHQA 1VYTA 2LQNA 1X27A 1RLQC 3UATA 4LUDA 2KBTA 2HDAA 2O31A 2KYBA 3VS6A 2FPDA 2LZ6B 1T3SA 2PZ1A 1MV0B 1HD3A 2RF0A 1QWFA 2G6FX 5I22A 1M27C 4GBQA 2SEMA 3NGPA 5FW9A 2JS2A 1AOJA 2EYXA 3H0HA 4RTTA 1PWTA 5IHKA 1BBZA 4AG2C 4RTVA 3M0UA 2RQUA 5FWCA 4AFSC 4JZ4A 1WI7A 4HVUA 1KFZA 1WA7A 2L3PA 4AFQC 2EPDA 4LN2A 2FPEA 2DYBA 1Y57A 3C0CA 1CSKA 1TG0A 4HCKA 1E6HA 1XOVA 1OOTA 2LJ0A 4Y92A 2RQWA 2YUPA 1UDLA 1WFWA 4CC3A 2PNIA 2DLPA 5IHIA 2DBMA 2KT1A 2CDTA 1M30A 1SSHA 2RQRA 2KE9A 2L3QA 1BU1A 4K11A 1H8KA 2J6KA 2F2XA 2FPFA 3O5ZA 2JW4A 1WXUA 1Z9QA 1CKBA 1UTIA 1YNZA 3TSWA 1NLPC 1K0XA 2FRWA 1JU5C 3EG2A 3QWYA 1JO8A 1RLPC 2KRNA 1TUCA 1YCSB 3A98A 2NUZA 4F17A 2YUQA 2K2MA 2DE0X 2ECZA 3CQTA 3SEMA 1YWPA 1UE9A 3VS7A 1VA7A 3EG3A 4E6RA 1ZSGA 2DBKA 2M0YA 3RBBB 1GCPA 2D1XA 2BZYA 1LCKA 1KIKA 4J9IA 4AG1C 1GBQA 1HJDA 1QWEA 3GBQA 1W70A 4DEYA 2GTJA 2K3BA 2C0TA 1WX6A 4IIMA 1PRMC 1AZEA 2O88A 4J9HA 2DL7A 2KRMA 4RTXA 4Z89A 4J9CA 2KRSA 1RUWA 2JT4A 2AZSA 2DMOA 2O9VA 2LMJA 5FWBA 2I0NA 1K1ZA 4DEXA 2W10A 1QLYA 2D0NA 3SHWA 2GQIA 1V1CA 4F16A 1GL5A 2DL8A 2EQIA 2VWFA 2X3XD 2DF6A 3TVTA 1ZUKA 4QT7A 4J9EA 1NYGA 2KT8A 2D8HA 2K7AA 1A0NB 3VS4A 1UJYA 1N5ZA 2ABLA 2J6FA 2AK5A 2RPNA 4Z88A 4GLMA 4WCIA 2RQVA 4D8DA 1H3HA 1OEBA 3QWXX 4LUEA 4M4ZA 1JQQA 2YT6A 2EYZA 2CUDA 1T0JA 2JXBA 2VVKA 3ULRB 5GJVB 4JJBA 1E7OA 1B3QA 1U5SA 2O2OA 1NYFA 2CREA 1UFFA 2B86A 1K4US 2LP5A 3EGUA 1X6GA 1I07A 2DRMA 2FEIA 2CSIA 2MIOA 1UECA 2KROA 4ESRA 2DJQA 2ED0A 2LJ1A 1Y0MA 3NMZC 1BK2A 4LE9A 2FO0A 2EYYA 5IXFA 2K6DA 2RQTA 1NLOC 2P4RA 1K0SA 2O9SA 1ZX6A 2OJ2A 4JJDA 2JS0A 2DVJA 1OPKA 1Z9ZA 1I1JA 2HBWA 2RN8A 1I0CA 2JTEA 2EVRA 4RTUA 2GGRA 4D8KA 2L2PA 2X3WD 1K9AA 2H8HA 4J9DA 1UGVA 5ECAA 2W0ZA 1ABOA 1OV3A 2A08A 2PTKA 3UA7A 2GTOA 3I5SA 3M0RA 2KGTA 2A37A 2MCNA 4OMQA 4ORZA 1B07A 2J6OA 3PE0A 1CKAA 1PKTA 5L23A 2LNHB 3VS1A 1H92A 1M8MA 1UHCA 2KXCA 3RNJA 2FG0A 1U3OA 1SHGA 1VYUA 4HVWA 2RNAA 2DM1A 2EGEA 4JJCA 4RTWA 2DL4A 1OPLA 2DNUA 1GBRA 1SRMA 1AWJA 3NPFA 2DA9A 4JPBW 2V1QA 2KNBB 3U23A 4AFZC 1UUEA 2ED1A 2ROLA 4CC4B 2EKHA 3I9QA 1MV3A 2JMCA 4OMPA 1J3TA 2KR3A 1PKSA 1GRIA 2BTTA 2C0IA 5GJWB 2AZVA 4JZ3A 4HVVA 1AZGB 4IIOA 1X43A 5I11A 1WIEA 2GNCA 2ROTA 4CC2A 2CSQA 4EIKA 3PVLA 1WYXA 1X6BA 1AEYA 1U06A 2AKKA 1HSQA 4ZNXA 3REBB 1NG2A 2EBPA 2CH4A 2NWMA 2LCSA 2K79A 2AKLA 3UF4A 3I5RA 2RMOA 2DL3A 1S1NA 3VS2A 1M3AA 2HSPA 2CT4A 1K76A 1UHFA 1W6XA 2OI3A 2KYMA 2LQWA 2DRKA 4RUGA 3EG1A 1QKXA 3VS0A 1SPKA 3LH5A 2DILA 2D8JA 2JM8A 1FMKA 2JM9A 1GFDA 4HXJA 5IXBA 3THKA 1RI9A 1ZBJA 1JXOA 1WLPB 1WXTA 1VYVA 4CC7A 2CUBA 2MOXA 4OMLA 4KRTA 4OMNA 1SHFA 3NHNA 2EW3A 4AFUC 1QCFA 3VS3A 1ARKA 1JEGA 1GCQA 3M0PA 4R0KA 1M3BA 4RTZA 3M0QA 1ZLMA 3VRYA 3EHRA 3UA6A 1TUDA 1JXMA 1PHTA 2YUOA 2A28A 1WDXA 1G83A 1T3LA 1IO6A 2ENMA 1KSWA 3JV3A 1NM7A 1YP5A 2KEAA 2CH4W 4OMOA 1M3CA 4OMMA 1FYNA 1ABQA 1W1FA 2HEQA 2YDLA 1UJ0A 2EYWA 2GBQA 2VKNA 3M0TA 1QKWA 1X2KA 1AVZC 2CT3A 3KFVA 1E6GA 3I35A 1MUZA 4X1VA 2HCKA 4A63B 2J06A 5IH2A 1BB9A 1SEMA 1GFCA 2JMAA 2F2WA 3ZL7C 1PNJA 3M0SA 3H0FA 5HCKA 1AWXA 2SRCA 2DL5A 2K9GA 4J9BA 1G2BA 2FRYA 2LJ3A 3REAB 3VRZA 2DX1A 2BZXA 2E5KA 2C0OA 4J9FA 2BZ8A 2EGAA 1SRLA 3H41A 4LNPA 1NEGA 1X69A 1YN8A 3PVQA 4RTYA 1AWOA 2M51A 3R6NA 1AD5A 3H0IA 2QDLA 2F2VA 2J05A 1GCQC 1AWWA 1EFNA 1T0HA 2IIMA 3EG0A 5IHNA 4Z8AA 1X2QA 3VS5A 1UG1A 2YUNA 1NEBA 1ZUUA 4J9GA 2ESWA 2KXDA 3FJ5A 1WXBA 2XMFA 1ZUYA 2OAWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YWO A;  2A36 A;  5EC7 A;  2V1R A;  1PRL C;  2L3S A;  4F14 A;  2EGC A;  2L0A A;  2LX7 A;  3IQL A;  1KJW A;  2YSQ A;  3TSZ A;  4FSS A;  2J7I A;  3EHQ A;  1VYT A;  2LQN A;  1X27 A;  1RLQ C;  3UAT A;  4LUD A;  2KBT A;  2HDA A;  2O31 A;  2KYB A;  3VS6 A;  2FPD A;  2LZ6 B;  1T3S A;  2PZ1 A;  1MV0 B;  1HD3 A;  2RF0 A;  1QWF A;  2G6F X;  5I22 A;  1M27 C;  4GBQ A;  2SEM A;  3NGP A;  5FW9 A;  2JS2 A;  1AOJ A;  2EYX A;  3H0H A;  4RTT A;  1PWT A;  5IHK A;  1BBZ A;  4AG2 C;  4RTV A;  3M0U A;  2RQU A;  5FWC A;  4AFS C;  4JZ4 A;  1WI7 A;  4HVU A;  1KFZ A;  1WA7 A;  2L3P A;  4AFQ C;  2EPD A;  4LN2 A;  2FPE A;  2DYB A;  1Y57 A;  3C0C A;  1CSK A;  1TG0 A;  4HCK A;  1E6H A;  1XOV A;  1OOT A;  2LJ0 A;  4Y92 A;  2RQW A;  2YUP A;  1UDL A;  1WFW A;  4CC3 A;  2PNI A;  2DLP A;  5IHI A;  2DBM A;  2KT1 A;  2CDT A;  1M30 A;  1SSH A;  2RQR A;  2KE9 A;  2L3Q A;  1BU1 A;  4K11 A;  1H8K A;  2J6K A;  2F2X A;  2FPF A;  3O5Z A;  2JW4 A;  1WXU A;  1Z9Q A;  1CKB A;  1UTI A;  1YNZ A;  3TSW A;  1NLP C;  1K0X A;  2FRW A;  1JU5 C;  3EG2 A;  3QWY A;  1JO8 A;  1RLP C;  2KRN A;  1TUC A;  1YCS B;  3A98 A;  2NUZ A;  4F17 A;  2YUQ A;  2K2M A;  2DE0 X;  2ECZ A;  3CQT A;  3SEM A;  1YWP A;  1UE9 A;  3VS7 A;  1VA7 A;  3EG3 A;  4E6R A;  1ZSG A;  2DBK A;  2M0Y A;  3RBB B;  1GCP A;  2D1X A;  2BZY A;  1LCK A;  1KIK A;  4J9I A;  4AG1 C;  1GBQ A;  1HJD A;  1QWE A;  3GBQ A;  1W70 A;  4DEY A;  2GTJ A;  2K3B A;  2C0T A;  1WX6 A;  4IIM A;  1PRM C;  1AZE A;  2O88 A;  4J9H A;  2DL7 A;  2KRM A;  4RTX A;  4Z89 A;  4J9C A;  2KRS A;  1RUW A;  2JT4 A;  2AZS A;  2DMO A;  2O9V A;  2LMJ A;  5FWB A;  2I0N A;  1K1Z A;  4DEX A;  2W10 A;  1QLY A;  2D0N A;  3SHW A;  2GQI A;  1V1C A;  4F16 A;  1GL5 A;  2DL8 A;  2EQI A;  2VWF A;  2X3X D;  2DF6 A;  3TVT A;  1ZUK A;  4QT7 A;  4J9E A;  1NYG A;  2KT8 A;  2D8H A;  2K7A A;  1A0N B;  3VS4 A;  1UJY A;  1N5Z A;  2ABL A;  2J6F A;  2AK5 A;  2RPN A;  4Z88 A;  4GLM A;  4WCI A;  2RQV A;  4D8D A;  1H3H A;  1OEB A;  3QWX X;  4LUE A;  4M4Z A;  1JQQ A;  2YT6 A;  2EYZ A;  2CUD A;  1T0J A;  2JXB A;  2VVK A;  3ULR B;  5GJV B;  4JJB A;  1E7O A;  1B3Q A;  1U5S A;  2O2O A;  1NYF A;  2CRE A;  1UFF A;  2B86 A;  1K4U S;  2LP5 A;  3EGU A;  1X6G A;  1I07 A;  2DRM A;  2FEI A;  2CSI A;  2MIO A;  1UEC A;  2KRO A;  4ESR A;  2DJQ A;  2ED0 A;  2LJ1 A;  1Y0M A;  3NMZ C;  1BK2 A;  4LE9 A;  2FO0 A;  2EYY A;  5IXF A;  2K6D A;  2RQT A;  1NLO C;  2P4R A;  1K0S A;  2O9S A;  1ZX6 A;  2OJ2 A;  4JJD A;  2JS0 A;  2DVJ A;  1OPK A;  1Z9Z A;  1I1J A;  2HBW A;  2RN8 A;  1I0C A;  2JTE A;  2EVR A;  4RTU A;  2GGR A;  4D8K A;  2L2P A;  2X3W D;  1K9A A;  2H8H A;  4J9D A;  1UGV A;  5ECA A;  2W0Z A;  1ABO A;  1OV3 A;  2A08 A;  2PTK A;  3UA7 A;  2GTO A;  3I5S A;  3M0R A;  2KGT A;  2A37 A;  2MCN A;  4OMQ A;  4ORZ A;  1B07 A;  2J6O A;  3PE0 A;  1CKA A;  1PKT A;  5L23 A;  2LNH B;  3VS1 A;  1H92 A;  1M8M A;  1UHC A;  2KXC A;  3RNJ A;  2FG0 A;  1U3O A;  1SHG A;  1VYU A;  4HVW A;  2RNA A;  2DM1 A;  2EGE A;  4JJC A;  4RTW A;  2DL4 A;  1OPL A;  2DNU A;  1GBR A;  1SRM A;  1AWJ A;  3NPF A;  2DA9 A;  4JPB W;  2V1Q A;  2KNB B;  3U23 A;  4AFZ C;  1UUE A;  2ED1 A;  2ROL A;  4CC4 B;  2EKH A;  3I9Q A;  1MV3 A;  2JMC A;  4OMP A;  1J3T A;  2KR3 A;  1PKS A;  1GRI A;  2BTT A;  2C0I A;  5GJW B;  2AZV A;  4JZ3 A;  4HVV A;  1AZG B;  4IIO A;  1X43 A;  5I11 A;  1WIE A;  2GNC A;  2ROT A;  4CC2 A;  2CSQ A;  4EIK A;  3PVL A;  1WYX A;  1X6B A;  1AEY A;  1U06 A;  2AKK A;  1HSQ A;  4ZNX A;  3REB B;  1NG2 A;  2EBP A;  2CH4 A;  2NWM A;  2LCS A;  2K79 A;  2AKL A;  3UF4 A;  3I5R A;  2RMO A;  2DL3 A;  1S1N A;  3VS2 A;  1M3A A;  2HSP A;  2CT4 A;  1K76 A;  1UHF A;  1W6X A;  2OI3 A;  2KYM A;  2LQW A;  2DRK A;  4RUG A;  3EG1 A;  1QKX A;  3VS0 A;  1SPK A;  3LH5 A;  2DIL A;  2D8J A;  2JM8 A;  1FMK A;  2JM9 A;  1GFD A;  4HXJ A;  5IXB A;  3THK A;  1RI9 A;  1ZBJ A;  1JXO A;  1WLP B;  1WXT A;  1VYV A;  4CC7 A;  2CUB A;  2MOX A;  4OML A;  4KRT A;  4OMN A;  1SHF A;  3NHN A;  2EW3 A;  4AFU C;  1QCF A;  3VS3 A;  1ARK A;  1JEG A;  1GCQ A;  3M0P A;  4R0K A;  1M3B A;  4RTZ A;  3M0Q A;  1ZLM A;  3VRY A;  3EHR A;  3UA6 A;  1TUD A;  1JXM A;  1PHT A;  2YUO A;  2A28 A;  1WDX A;  1G83 A;  1T3L A;  1IO6 A;  2ENM A;  1KSW A;  3JV3 A;  1NM7 A;  1YP5 A;  2KEA A;  2CH4 W;  4OMO A;  1M3C A;  4OMM A;  1FYN A;  1ABQ A;  1W1F A;  2HEQ A;  2YDL A;  1UJ0 A;  2EYW A;  2GBQ A;  2VKN A;  3M0T A;  1QKW A;  1X2K A;  1AVZ C;  2CT3 A;  3KFV A;  1E6G A;  3I35 A;  1MUZ A;  4X1V A;  2HCK A;  4A63 B;  2J06 A;  5IH2 A;  1BB9 A;  1SEM A;  1GFC A;  2JMA A;  2F2W A;  3ZL7 C;  1PNJ A;  3M0S A;  3H0F A;  5HCK A;  1AWX A;  2SRC A;  2DL5 A;  2K9G A;  4J9B A;  1G2B A;  2FRY A;  2LJ3 A;  3REA B;  3VRZ A;  2DX1 A;  2BZX A;  2E5K A;  2C0O A;  4J9F A;  2BZ8 A;  2EGA A;  1SRL A;  3H41 A;  4LNP A;  1NEG A;  1X69 A;  1YN8 A;  3PVQ A;  4RTY A;  1AWO A;  2M51 A;  3R6N A;  1AD5 A;  3H0I A;  2QDL A;  2F2V A;  2J05 A;  1GCQ C;  1AWW A;  1EFN A;  1T0H A;  2IIM A;  3EG0 A;  5IHN A;  4Z8A A;  1X2Q A;  3VS5 A;  1UG1 A;  2YUN A;  1NEB A;  1ZUU A;  4J9G A;  2ESW A;  2KXD A;  3FJ5 A;  1WXB A;  2XMF A;  1ZUY A;  2OAW A; 
#chains in the Genus database with same CATH topology
 3OA6 A;  5FRM A;  3X25 B;  4M7A C;  1C0M A;  4ELY C;  5EC7 A;  2EIF A;  1QP3 A;  1ZHI A;  3L2V A;  3UPU A;  1QCO A;  1Q95 G;  3TSZ A;  1JJ2 P;  3CPW P;  3EHQ A;  1YJW A;  5FLX E;  1RLQ C;  4FYV B;  2VXE A;  3V8L A;  2HDA A;  1V29 B;  2KYB A;  2LZ6 B;  4KH0 B;  1T3S A;  2H3E B;  1JJ2 S;  3L2W A;  2X4J A;  5KYX B;  4UC4 A;  3NGP A;  3HL8 A;  3QDR B;  1WJQ A;  3UWN A;  2DD5 A;  3HRU A;  4AG2 C;  3HHT B;  1W4S A;  2HD0 A;  3NTH A;  2XD0 A;  4AFS C;  4FM4 B;  1KK7 A;  1WI7 A;  2OTL A;  5KYU A;  1KFZ A;  2C06 A;  1WA7 A;  2L3P A;  2QAS A;  3QII A;  1X6O A;  1XOV A;  2LJ0 A;  1K9M C;  4Y92 A;  2YUP A;  2CP7 A;  1BIB A;  2CP0 A;  4FT4 A;  3NTK A;  4C5I A;  2HKQ B;  2NUT B;  5I21 A;  1LOJ A;  4FYW B;  1XQH A;  4RCC A;  2DXC A;  2RQR A;  8ATC B;  2J6K A;  2FPF A;  4A54 A;  2JW4 A;  1WXU A;  1VUB A;  1VQ9 Q;  3CCE T;  3TSW A;  2E6Z A;  1UGP B;  3CCE Q;  3QWY A;  5DLO A;  3GNF B;  1TUC A;  3PFS A;  2E65 A;  4KH1 B;  2YUQ A;  2MWP A;  2K2M A;  3PMT A;  3TCJ A;  4RG8 A;  1YWP A;  1UE9 A;  2R5A A;  3VS7 A;  3CD6 A;  5D6W A;  1TTH B;  2DFU A;  3S3O A;  4HA8 A;  5GMK i;  4PJO F;  2FVU A;  2E64 A;  4FU6 A;  5CKH A;  4J9I A;  1GBQ A;  3GBQ A;  2GTJ A;  1RAB B;  2C0T A;  2EQJ A;  3G4S A;  1WX6 A;  4IUR A;  1PRM C;  2KRM A;  2DAQ A;  4RTX A;  3VUZ A;  4Z89 A;  2EJF A;  3SB2 A;  3CC2 Q;  1RUW A;  4M75 F;  2OTJ Q;  5D7U A;  4RMO A;  2O9V A;  4JJN K;  2RH2 A;  1K1Z A;  4PJO B;  1QMC A;  4DEX A;  1FX7 A;  2W10 A;  5GAN 5;  5A0D A;  5DLQ E;  5M9O A;  4HCZ A;  2GQI A;  2V8I A;  3C95 A;  3CBO A;  3CPF A;  4CI0 C;  3L2Z A;  4C92 A;  3G6E T;  1BI2 A;  2D8H A;  2QQA A;  3EGX B;  3V8J A;  4QVC A;  1Q86 C;  1N5Z A;  2E70 A;  5LJ3 f;  2CZ6 B;  2RPN A;  3CCQ A;  2DK3 A;  4LUE A;  2RK2 A;  2YT6 A;  4M77 E;  2CUD A;  4M78 A;  5LJ3 h;  1QVF P;  1T0J A;  2JXB A;  5C6S A;  3QXE B;  5GJV B;  3P8B B;  2E4H A;  1NYF A;  2DD4 A;  1UB4 A;  3QHS A;  1LPL A;  2LP5 A;  2QI2 A;  4FSX A;  2P0P A;  2DER A;  1I07 A;  2CSI A;  1YJW Q;  3G4S T;  2KRO A;  4ESR A;  3HTR A;  2ED0 A;  3JCM e;  1JBM A;  2Y4Y A;  1BK2 A;  3OW2 S;  3A8M B;  4M7A A;  4X9C A;  2QXF A;  1VQL T;  3X24 B;  4MZP A;  5KYW A;  2RQT A;  4BDY A;  1G3Y A;  1K0S A;  3FEO A;  4PJO A;  3CPW S;  2OJ2 A;  1D3B B;  2JS0 A;  2VYT A;  3V8K A;  3JAM E;  2MK5 A;  5CO7 A;  2A0F B;  2JTM A;  2HL3 A;  3VJP A;  2HBW A;  1D0Z A;  1R0C B;  3HP9 A;  4D8K A;  3JCM f;  3CCQ T;  2RB6 A;  4J9D A;  5ECA A;  1Y96 A;  2W0Z A;  5KYX A;  2A08 A;  1KQS S;  3M9Q A;  4XU3 A;  2FB7 A;  3PE0 A;  1KC8 R;  4C0G A;  2MI6 A;  5L23 A;  2MMP A;  4M78 G;  3E1S A;  3S3M A;  4XTX A;  2KXC A;  3RNJ A;  2ZCF B;  4IUT A;  4HVW A;  1SHG A;  2DM1 A;  2LT4 A;  2YLB A;  1EIF A;  3OSS C;  3AT1 B;  4QVZ A;  1LVK A;  1AWJ A;  2FHD A;  4ANJ A;  4ATO A;  4AFZ C;  1UUE A;  2ROL A;  1KC8 C;  2EKH A;  3I9Q A;  1MV3 A;  2JMC A;  1K8A C;  1VQL A;  9ATC B;  1V76 A;  3OBY A;  4BE2 A;  4C92 C;  1FMV A;  2DPP B;  4AT1 B;  3CCJ Q;  1NPR A;  3URG A;  1X75 C;  4M7A G;  3CBM A;  1N9S A;  1X43 A;  4BE0 A;  1Q81 C;  1WQW A;  1Q7Y R;  1EZZ B;  1WYX A;  1VQ4 Q;  1U06 A;  5CAI A;  2RJD A;  4BB7 A;  1PSF A;  3EGD A;  2GF7 A;  4HCC A;  5EG2 A;  2LCS A;  4J5Y A;  2VB6 A;  1C6V X;  2AKL A;  1K9M R;  1NBE B;  3BE3 A;  2K4Y A;  1SG5 A;  1RAE B;  5LJ5 j;  1RAF B;  3CC2 T;  2CT4 A;  1UHF A;  3J7A F;  4RUG A;  3VS0 A;  1IRE B;  3LH5 A;  2ZPF B;  4M75 B;  3PIP A;  3TQ7 P;  1U1S A;  2AHJ B;  4N0A C;  1FMK A;  2KQW A;  4A4E A;  1YJN T;  2CGH A;  2VXF A;  2L3R A;  4JRK A;  2ZPG B;  4F7U B;  3DB3 A;  2QDY B;  1VQO Q;  1I5O B;  3EFO B;  1WXT A;  1RAH B;  1HXD A;  1VQ6 A;  2KDS A;  4OMN A;  1SHF A;  5FRN A;  2D6F A;  1B34 B;  5GAO q;  4R0K A;  1TOV A;  1M3B A;  4PNO A;  4RTZ A;  3M0Q A;  4PJN A;  3CXC P;  1NPP A;  5FU7 C;  2JTF A;  4OGE A;  1VQ7 A;  4KUD K;  3C4S A;  1FXX A;  1PHT A;  1YHQ T;  4PFO A;  3QZ9 B;  1PSE A;  2NUP B;  4DOW A;  2ENM A;  1PCX A;  2V8J A;  3CEY A;  2E6N A;  4KGV B;  1TSF A;  2KEA A;  3G6E Q;  4J6W A;  1M3C A;  4PLL A;  2R5M A;  4N4G A;  2EYW A;  3ME9 A;  1D1C A;  2X51 A;  1Q81 U;  4JDS A;  2DTI A;  5LJ5 g;  2CP3 A;  2QA4 Q;  2CT3 A;  2OTJ A;  2BUD A;  2V26 A;  3EFS A;  3CMA T;  3E9F A;  4X1V A;  5IH2 A;  4OMF B;  1OZ3 A;  1YI2 T;  2JMA A;  4LD9 K;  3ZL7 C;  3M0S A;  1H64 1;  4M78 E;  2EQU A;  1WNL A;  4IUU A;  3JCM d;  5LJ5 d;  1AWX A;  1W2B S;  1G2B A;  3VRZ A;  2PU9 B;  3CC4 Q;  2F5K A;  1VQ6 Q;  4J9F A;  4FW1 A;  2XU8 A;  2EGA A;  1KHI A;  1VQ8 Q;  5HKC A;  3DKM A;  3OYH A;  1AWO A;  2QQB A;  1OX8 A;  1VQ9 T;  4N4I A;  4BD3 A;  3V7S A;  2IIM A;  3EFR A;  3QJY A;  2O4X B;  2JUF A;  2KXD A;  1Q86 R;  2L89 A;  3FJ5 A;  2XMF A;  2EJG A;  1BI0 A;  2LRQ A;  3JRZ A;  3VUB A;  5GAN 6;  1YWO A;  2QG9 B;  2BE7 D;  1NZ9 A;  2V1R A;  2DJZ A;  2RHY A;  1PRL C;  5GMK h;  5CR2 A;  4DBH A;  3IQL A;  2G3R A;  3TU4 K;  4FSS A;  1Q82 C;  2LQN A;  5DM7 R;  2DKG A;  2JJ9 A;  2JNG A;  4C0F A;  2P84 A;  2XKO C;  3VS6 A;  4F7U E;  2KSS A;  2L8D A;  3QG1 A;  2QYZ A;  1U1T A;  5A0G A;  1WPY A;  2QA4 A;  1LJO A;  2R58 A;  5GAM e;  1VQM Q;  5FW9 A;  2QTX A;  2K5F A;  1AOJ A;  3CCR Q;  4MZT A;  5IHK A;  1BBZ A;  3JSC A;  5GAM j;  1VQ7 Q;  4RTV A;  5CKF A;  2ZZD A;  3CCU T;  2ZPI B;  4NS5 A;  3JCM b;  1M9S A;  2FPE A;  1Y57 A;  3C0C A;  3OYD A;  1VQP Q;  1Q81 R;  2WSE E;  1G3W A;  2LDM A;  4C5E A;  2KY9 A;  3CCM A;  2E5Q A;  2PNI A;  4NL2 A;  4C8Q B;  3N5B B;  3BFM A;  2KT1 A;  4B9X A;  3I56 Q;  2CDT A;  4K11 A;  1SSH A;  2KE9 A;  2L3Q A;  1ZSZ B;  3O5Z A;  2CYZ B;  1Z9Q A;  2YRD A;  4DOV A;  2OTL T;  4F7U A;  4BI4 A;  2FRW A;  2EQM A;  2QTV A;  2OTL Q;  1RLP C;  4C8Q F;  2YHT A;  2K2V A;  4A53 A;  3RDV A;  4F04 B;  1WZO A;  5CIU A;  2NUZ A;  4F17 A;  4E7I A;  1KD1 C;  1OQK A;  3CQT A;  2KAF A;  1VA7 A;  3EG3 A;  2K5I A;  5GAN d;  3PT9 A;  2M0Y A;  1XJW B;  1RL2 A;  2EJ9 A;  1HJD A;  4DEY A;  1S72 T;  3EG9 B;  4IIM A;  4EMK A;  1AZE A;  2O88 A;  4LDX A;  3NTI A;  3QPH A;  4J6Y A;  1I8F A;  2NUT A;  2DMO A;  4GY5 A;  1YJ9 A;  1VQ6 T;  2MYS A;  2LMJ A;  5FWB A;  2I0N A;  2MAM A;  4E7S A;  4XTZ A;  2VV5 A;  2QEX A;  2I2L A;  3SHW A;  3R6O A;  4F16 A;  3X20 B;  1VQ8 A;  2EQI A;  2X3X D;  2DF6 A;  4BI8 B;  2XI9 A;  4J9E A;  1IGQ A;  3HRT A;  2K7A A;  3A8L B;  1K9M U;  4R55 A;  3NFC A;  5KH6 A;  3CCS T;  3KBG A;  5KCH A;  4OF1 A;  1IXD A;  2AK5 A;  4LDU A;  5DY9 A;  4GLM A;  4WCI A;  4D8D A;  2CZ0 B;  3M5A A;  3OYI A;  3QYH B;  3JCM X;  1JQQ A;  4X9D A;  2EYZ A;  3OS1 A;  5KE3 A;  3VU3 C;  4JJB A;  2F1L A;  1QVG P;  3DLL A;  1BYM A;  2RK1 A;  3P8D A;  1BKB A;  1BI1 A;  4AMC A;  4ZTJ A;  1K4U S;  5GAN e;  3BY7 A;  3OYL A;  4M77 F;  4QQ6 A;  2X35 A;  2DRM A;  2Y90 A;  3V7C A;  2FEI A;  4B6M A;  5CKD A;  1VQ9 A;  4PL6 A;  1SKU B;  2EWN A;  4GLK A;  2X4Y A;  1M2V B;  3OYC A;  5LJ3 d;  2E12 A;  4M77 A;  4NL3 A;  1IGU A;  2FO0 A;  1WHJ A;  2DET A;  5IXF A;  5FU6 B;  4MDX A;  3CD6 Q;  4EPC A;  1JRI A;  2O9S A;  2CS7 A;  1VQ8 T;  1OPK A;  4IUQ A;  4TVR A;  5KYY B;  3G71 T;  1Z9Z A;  5GAN h;  3CC4 T;  4JRI A;  1I0C A;  2NLU A;  1LNX A;  3OYK A;  4D6W A;  4FL6 A;  2H8H A;  2JN0 A;  1ABO A;  2PTK A;  3A8G B;  2RHU A;  2MWO A;  2A37 A;  3GP8 A;  3GLX A;  3CCM Q;  2CP5 A;  1X01 A;  2WAC A;  4XQ3 A;  2X4X A;  2J6O A;  3MP8 A;  2RO0 A;  3L2Q A;  4M78 F;  1CKA A;  4OVA A;  2QA4 T;  3CME T;  2QQ9 A;  1UEB A;  2FG0 A;  1VQK A;  1U3O A;  1VYU A;  2FL7 A;  2RNA A;  4XTU A;  4JJC A;  4RTW A;  2DL4 A;  2EQK A;  1GBR A;  1SRM A;  3NPF A;  2BE9 B;  1D0Y A;  4Y28 E;  2V1Q A;  1KC8 U;  4X34 A;  2ED1 A;  1RI0 A;  1M90 C;  4MMK A;  2QGG A;  2KR3 A;  4M75 C;  3VKI A;  2BTT A;  1QCN A;  4Q5W A;  3Q1J A;  3CC7 Q;  1AZG B;  3CCM T;  1WIE A;  2ROT A;  5GAN 7;  4CC2 A;  5GAM h;  4L59 A;  1KG1 A;  3FB9 A;  4CRI A;  3JB9 G;  4M75 G;  1AEY A;  4NOY A;  2AKK A;  5KYY A;  3A5Z B;  4ZNX A;  4F7U F;  1PM3 A;  3CCU A;  5LL6 S;  1VQ5 T;  2IVW A;  2QAZ A;  2K79 A;  2B8A A;  3I5R A;  2RMO A;  1YIJ A;  2HSP A;  5GAO r;  1G8X A;  2HNI A;  1W6X A;  2NYS A;  2OI3 A;  5CCA A;  4M7D B;  1MMG A;  3JCM W;  2LT1 A;  1OUL A;  1ZA1 B;  3CCQ Q;  4LDW A;  3ZEH A;  3GNG A;  4OP0 A;  3S6W A;  4HXJ A;  5HK0 A;  2E3I A;  3DLM A;  1YJ9 T;  2EYQ A;  4JRQ A;  2QGF B;  2CUB A;  3NHN A;  2EW3 A;  1JEG A;  2XDD A;  3JB9 H;  1SF9 A;  1PD0 A;  2ZPH B;  2AT1 B;  4KGZ B;  2L5Q A;  1FWZ A;  4QKU A;  1OU9 A;  4MDW A;  3UA6 A;  4M77 C;  3CCS A;  3JB9 J;  3SDZ A;  4BUG A;  1NJI U;  4OB1 B;  3CCJ T;  2KVQ G;  2IG0 A;  2A28 A;  3OYY A;  1MMA A;  1D09 B;  4M7D E;  3UDC A;  1KSW A;  1VQ4 A;  4M75 A;  1YP5 A;  2E41 A;  4JLI A;  3F70 A;  1KQ2 A;  2RHZ A;  2CZ1 B;  1P92 A;  2CH4 W;  2QEX T;  3RR6 A;  2XDB A;  4PJO D;  4OMM A;  2RJC A;  1W2B A;  2VKN A;  2DIG A;  1YIT T;  1Y7X A;  3KFV A;  2HBP A;  3I35 A;  4M77 B;  4A4F A;  4A63 B;  4M7D A;  1MND A;  2DXT A;  1GFC A;  5CK9 A;  3OS0 A;  4BAC A;  1RAI B;  1RAG B;  4N4H A;  3JCM c;  3MKD A;  3JB9 I;  2DL5 A;  2K9G A;  1Q7Y C;  4J83 A;  5GAN j;  4J6X A;  3H9N A;  2OTJ T;  2FYK A;  1YIT A;  1X69 A;  4P5N A;  2M51 A;  2BIV A;  1O9S A;  2RJE A;  3H0I A;  2EFI A;  5GMK m;  1VQL Q;  4EDU A;  1N8R R;  1VQK Q;  1UGQ B;  3EG0 A;  3FLG A;  5IHN A;  3I56 T;  2HQH A;  4Z8A A;  3I55 A;  3LYI A;  3L42 A;  3VS5 A;  2YUN A;  4LD6 A;  3G4S Q;  1KQS P;  2RI5 A;  2LX9 A;  2QQS A;  3CC2 A;  4J7I A;  3G6E A;  4QVD A;  3CC4 A;  2A36 A;  4XTV A;  2LQK A;  1GXI E;  5LJ3 g;  1VQN Q;  4FIB A;  2XG8 D;  4F14 A;  3CCU Q;  2EGC A;  3ZBD A;  2LX7 A;  4FT2 A;  2YSQ A;  3HRS A;  1W2B P;  2PVD B;  2LNV A;  1VYT A;  1X27 A;  4LUD A;  4ZGJ B;  4WTO B;  3S3N A;  4M7A E;  3LW5 E;  1VQO A;  4L6V 5;  3TEE A;  4C8Q D;  4QQG A;  2G6F X;  1MGQ A;  4PJM A;  3JCM Q;  1PG5 B;  2SEM A;  2ZAE A;  1KQS A;  4ZN3 A;  2HQE A;  2EYX A;  4KBM B;  1PWT A;  1VOM A;  1R8O B;  2IPO B;  5AT1 B;  2YRV A;  2HAX A;  2CP6 A;  1OX9 A;  2DYI A;  2RQU A;  3M0U A;  5FWC A;  3RES A;  3V7R A;  4JZ4 A;  5IAY A;  3WVD B;  3L2U A;  5LJ5 h;  2E10 A;  4XU1 A;  4HVU A;  1Y71 A;  1PD1 A;  4MML A;  3EAE A;  4LN2 A;  1YIJ T;  3RKY A;  1M90 U;  1TG0 A;  4HCK A;  4PJO E;  1E6H A;  3CPW A;  1OOT A;  4M7A B;  5LJ5 f;  1Q82 R;  1WFW A;  4CC3 A;  2DLP A;  5IHI A;  2M02 A;  2DBM A;  5KCO A;  3MP6 A;  4MZM A;  1WGS A;  1M30 A;  3M58 A;  1BU1 A;  1WHM A;  3PNW C;  3ASK A;  3H6Z A;  2D0Q B;  1CKB A;  1YI2 A;  3LGL A;  1YNZ A;  1NLP C;  1K0X A;  3OS2 A;  1K73 U;  3OYM A;  4FYY B;  2KRN A;  2FZK B;  5FU6 C;  1YCS B;  4OB0 B;  1VQO T;  1KHC A;  2ECZ A;  1I81 A;  3SEM A;  1R77 A;  3FDR A;  3CME A;  2AIR B;  2A7Y A;  1GCP A;  3OYF A;  2D1X A;  2BZY A;  1VQK T;  2LTO A;  4VUB A;  3PIO A;  4AG1 C;  1QWE A;  1NE8 A;  1W70 A;  3CBP A;  4FYX B;  2HKN A;  2K3B A;  5CKE A;  5CKB A;  1YIJ Q;  1I5L A;  5FU7 B;  2DL7 A;  2R57 A;  4J9C A;  3GOX A;  2JT4 A;  3M53 A;  3JB9 F;  4O5V A;  3CMA Q;  2JVV A;  3QDF A;  2RI3 A;  3HSB A;  1WHK A;  1QLY A;  2D0N A;  3QJ6 A;  1GL5 A;  4LDY A;  5HK3 A;  1K73 R;  3TVT A;  1ZUK A;  4QT7 A;  3JCM g;  2KT8 A;  1A0N B;  3CCJ A;  3VS4 A;  2PUO B;  2J6F A;  3RKW A;  4R56 A;  4PJJ A;  4EMK B;  1KQ1 A;  1OEB A;  3QWX X;  1YHQ Q;  1YIT Q;  2GFU A;  2DZC A;  1Q82 U;  1MHN A;  3HFO A;  5LJ5 e;  3EG9 A;  5GAO m;  1ZBX A;  1C1A A;  1QQJ A;  2VVK A;  4HCB A;  3ULR B;  1E7O A;  1U5S A;  3CXC S;  2QEX Q;  3JCM V;  2CRE A;  1UFF A;  3SWN B;  2B86 A;  3M55 A;  2LCC A;  2DEQ A;  3EGU A;  1X6G A;  3SD4 A;  1YJN A;  2M0O A;  5KYU B;  2GQV A;  2MIO A;  3RKX A;  2DEU A;  2LJ1 A;  3CCL A;  3NMZ C;  3VV0 A;  3BW1 A;  5GMK j;  2K6D A;  3QYG B;  1ZX6 A;  4JJD A;  2DVJ A;  3FJP A;  2Y4X A;  5I2M A;  5A2Q E;  3J81 E;  4KUI A;  2F69 A;  1TWB A;  4C5G A;  4C8Q C;  1KD1 R;  3BDL A;  5GAN 2;  1D0X A;  3QSU A;  1K9A A;  1M2V A;  3HKS A;  1BI3 A;  1VQ4 T;  1VQP A;  1HK9 A;  3I5S A;  4IUP A;  1XTD A;  1Y96 B;  4C92 F;  2XDP A;  2MCN A;  4OMQ A;  1TUG B;  1WHH A;  1UHC A;  4HT8 A;  1N6A A;  2KMT A;  3SWN A;  4F7U G;  1S72 A;  1ACM B;  2HMA A;  2P0Q A;  4KT0 E;  2YWW A;  3OYJ A;  1BCM A;  2COW A;  2KNB B;  1R0B G;  3LWI A;  4LXC A;  5LJ3 e;  1VQN A;  1XNI A;  3EGX A;  2C0I A;  2HQX A;  2P0K A;  2LQ8 A;  2ZPB B;  4IIO A;  5CVI A;  4C8Q G;  1RAA B;  2CSQ A;  1M90 R;  3PVL A;  1X6B A;  5J3B A;  1HSQ A;  1OZ2 A;  2ATC B;  2E1H A;  4ELZ C;  3X26 B;  1JB0 E;  2YRC A;  2VC8 A;  2DTO A;  2NWM A;  1ZSZ C;  3UF4 A;  4LDV A;  2DL3 A;  3CXC A;  4DQ2 A;  1QW1 A;  1S1N A;  1M3A A;  1JJ2 A;  1K76 A;  2DIQ A;  2COZ A;  2KYM A;  2LQW A;  2DRK A;  4HT9 A;  1SPK A;  4ZN1 A;  5GMK e;  3AHU A;  2JM9 A;  1ZA2 B;  3DB4 A;  5IXB A;  1Q7Y U;  4II1 A;  4EMG A;  3UT1 A;  1RI9 A;  2WSF E;  1YJW T;  1EX4 A;  1ZBJ A;  4FW2 A;  1VQ5 Q;  2DXB A;  1D3B A;  2ZPE B;  1G5V A;  4O6J A;  4PLI A;  4KRT A;  5AYF A;  4XTW A;  4AFU C;  1QCF A;  2LVM A;  1GCQ A;  1MMN A;  4C5H A;  4QQD A;  4ZGE B;  3EHR A;  1TUD A;  2YUO A;  1OI1 A;  1WDX A;  4M77 D;  3M57 A;  3HFN A;  1IO6 A;  3WVE B;  5IN1 A;  3MEU A;  2X4W A;  4ZGD B;  4RCB A;  5HY6 A;  1QVG A;  4PJO G;  1OU8 A;  1FYN A;  4M7A D;  2HZY A;  3CC7 A;  1ZQ1 A;  4JS5 A;  2YDL A;  1UJ0 A;  1YFN A;  1X2K A;  2VGN A;  4FCY A;  2XIC A;  4PFP A;  1E6G A;  3OMC A;  4JS4 A;  4A4H A;  2HCK A;  2J06 A;  1SEM A;  4ME7 A;  2F2W A;  1PNJ A;  3QBY A;  1YCY A;  3H0F A;  5HCK A;  3HPW A;  3E2U A;  1M5Q 1;  2LC4 A;  3OY9 A;  4OB3 B;  4DBQ A;  3VYG A;  2M1H A;  2VAS A;  4N0A A;  1PC0 A;  2DX1 A;  4L5G A;  3G71 Q;  2C0O A;  2BZ8 A;  1SRL A;  4LNP A;  1NEG A;  1UGR B;  1YN8 A;  3PVQ A;  2OX7 A;  1AD5 A;  4M75 E;  1N9R A;  4PJO C;  2QDL A;  1GCQ C;  3CCV Q;  5CQY A;  1M1K U;  1M1K R;  3J80 E;  1VQ5 A;  3M59 A;  3JCM h;  3C94 A;  1Y07 A;  1NEB A;  1ZUU A;  3L2R A;  4BI3 A;  4M78 B;  1FMW A;  2CZ7 B;  4PJL A;  1ZUY A;  1TS9 A;  4KGX B;  4BDZ A;  2XK0 A;  1D1B A;  3QUI A;  1IRX A;  2L3S A;  5L8R E;  3EH2 A;  5GAO l;  2L0A A;  1KJW A;  2M9U A;  3MJX A;  2J7I A;  5GAN 3;  2DXU A;  4A4K A;  3QO3 A;  3I56 A;  3UAT A;  3PGG A;  1M1K C;  2KBT A;  3OQ5 A;  2O31 A;  4PKC C;  2FPD A;  1BCO A;  2PZ1 A;  1MV0 B;  2Z0W A;  3INZ A;  3CCS Q;  1HD3 A;  1IB8 A;  2RF0 A;  4V2S A;  1QWF A;  4JLG A;  5I22 A;  1M27 C;  3OBW A;  4GBQ A;  4DBF A;  2XID A;  8AT1 B;  2JS2 A;  4Y91 A;  3H0H A;  4RTT A;  1VQ7 T;  1M4Z A;  3OYE A;  3GPL A;  1M1F A;  4JRP A;  3KXT A;  3CCE A;  1MMD A;  2RA2 A;  2BKD N;  1VQN T;  1H3Z A;  4AFQ C;  2EPD A;  4EMH A;  2DYB A;  3M56 A;  1QVF S;  1CSK A;  2RQW A;  1AT1 B;  3M54 A;  4KUL A;  3G71 A;  1UDL A;  3SWN C;  3RMS A;  4E7J A;  4M78 C;  4BY6 B;  2DVE A;  4ZTF A;  1H8K A;  3OS5 A;  2F2X A;  1IZ6 A;  1UTI A;  3D7S B;  1JU5 C;  3EG2 A;  1JO8 A;  4C92 B;  1RAC B;  3A98 A;  2X9H A;  3LGF A;  1QVP A;  4DBR A;  2DE0 X;  3M4G A;  3MHX A;  4E6R A;  7AT1 B;  4XU0 A;  1ZSG A;  2DBK A;  5GMK l;  3RBB B;  1N8R C;  3TRE A;  3G1J A;  1B7T A;  5FRO A;  1LCK A;  4M7D G;  1NJI C;  1KIK A;  1TH7 A;  4YTL A;  4E7L A;  4PK4 A;  4J9H A;  4PFZ A;  2KRS A;  2AZS A;  3EGD B;  3CCV A;  4IKF A;  3A8O B;  3I55 Q;  1V1C A;  3OYB A;  1DJ7 B;  3OYA A;  2DL8 A;  1VQM T;  4C8Q E;  2VWF A;  1MNE A;  1NYG A;  1I4K 1;  4B9W A;  2PVG B;  4DA4 A;  1UJY A;  3MO8 A;  2ABL A;  5LJ3 j;  1VIF A;  4XAX B;  1O75 A;  4Z88 A;  1IHW A;  2RQV A;  2K3Y A;  1H3H A;  1TXQ A;  2ZGW A;  5GAM f;  4BE1 A;  4M4Z A;  3RER A;  3JCM P;  5KYW B;  4J8O A;  3FRN A;  3T9N A;  5GAO n;  2O01 E;  1B3Q A;  2O2O A;  4IUV A;  3O8V A;  5KYN A;  2LCL A;  1B34 A;  3E9G A;  3GF5 A;  2YXY A;  5KE2 A;  3FC3 A;  3P8H A;  3OSV A;  4XU2 A;  3JB9 D;  1YJ9 Q;  4M75 D;  1UEC A;  2PQW A;  2DJQ A;  2V8K A;  2RHX A;  2GFA A;  1Y0M A;  2QQR A;  2P4T A;  4LE9 A;  3MEA A;  2EYY A;  3CCV T;  4C8Q A;  1SSF A;  3QKJ A;  1NLO C;  1K8A R;  2P4R A;  1U8R A;  3L1A A;  1ZSZ A;  2WSC E;  1N8R U;  5J26 A;  3RIR A;  1QVF A;  2K3X A;  3LWH A;  4M7A F;  1M2O A;  3MET A;  4M7D D;  3H8Z A;  1I1J A;  2RN8 A;  5GAM d;  4J7F A;  1YHQ A;  2JTE A;  2KI7 A;  2EVR A;  2DZ9 A;  4RTU A;  1RAD B;  2GGR A;  3CCL T;  4E7Z A;  2L2P A;  3JCM J;  2X3W D;  1KD1 U;  3KUF A;  2RHI A;  4QW2 A;  1UGV A;  5J39 A;  3UA7 A;  1OV3 A;  1YI2 Q;  1VIE A;  3ZFJ A;  2GTO A;  3M0R A;  3OMG A;  5GAN g;  2KGT A;  2HL5 C;  4ORZ A;  1B07 A;  2EAY A;  3CC7 T;  4C92 D;  1M1G A;  1PKT A;  2LNH B;  2OAU A;  3VS1 A;  1H92 A;  1M8M A;  4HKE A;  3RUX A;  4C92 E;  5IT9 E;  2EGE A;  3CMA A;  1OPL A;  2JOY A;  5GAN 4;  2DNU A;  3GIB A;  4XTY A;  2DA9 A;  4JPB W;  3LLR A;  3E19 A;  4M7D F;  3U23 A;  4JUV A;  4CC4 B;  2FZG B;  4OMP A;  1J3T A;  1PKS A;  3PMI A;  1GRI A;  5GJW B;  3WXM B;  3CME Q;  2AZV A;  4JZ3 A;  4HVV A;  4WF2 A;  5I11 A;  2E3H A;  1IHV A;  2GNC A;  1HYO A;  2KK4 A;  5C0M A;  2VGM A;  1WHG A;  4EIK A;  5D6Y A;  3EFO A;  2DO3 A;  2RD1 A;  5GAN 8;  3A1P A;  3CCL Q;  3REB B;  1NG2 A;  2DTH A;  2EBP A;  3EH1 A;  1G3T A;  2A3L A;  3LX7 A;  3I55 T;  2CH4 A;  3G7Z A;  1WJR A;  1YJN Q;  3VS2 A;  2H3J A;  2RI2 A;  1TU0 B;  3EG1 A;  1QKX A;  3CD6 T;  5GAO p;  2XHC A;  6AT1 B;  2DIL A;  2D8J A;  2JM8 A;  3MEV A;  4C0D B;  1GFD A;  3OB9 A;  2NUP A;  4OB2 B;  3THK A;  4RKU E;  3OYG A;  5I2S A;  3RMQ A;  2FZC B;  5CQX A;  2PVO B;  1JXO A;  2K5L A;  2CP2 A;  1WLP B;  3SFM A;  3OYN A;  2GCX A;  1VYV A;  4CC7 A;  5GAN f;  4Z02 A;  2MOX A;  3LH0 A;  4OML A;  2F5T X;  1ARK A;  3VS3 A;  4C92 G;  3M0P A;  1VQM A;  5D6X A;  3M4Y A;  3OW2 P;  4EMK C;  1BIA A;  3CCR A;  1QVG S;  1ZLM A;  3MP1 A;  1Q86 U;  3VRY A;  1F1B B;  4E2F B;  4E7K A;  1JXM A;  2RJF A;  4C0Z A;  3QZ5 B;  1G83 A;  1T3L A;  2D9T A;  4M77 G;  3ER0 A;  1WQ7 A;  5GAM g;  2VUB A;  3JV3 A;  4A4G A;  5A0L A;  2YLC A;  1NM7 A;  2RM4 A;  2PUK B;  1VQP T;  4XK8 E;  4OMO A;  3MCA B;  1ABQ A;  1K73 C;  1W1F A;  2K57 A;  2HEQ A;  4M7D C;  2GBQ A;  3M0T A;  1QKW A;  2CKK A;  3CCR T;  1AVZ C;  3VYH B;  2JZ2 A;  1AHJ B;  2MF2 A;  3MPU B;  1MUZ A;  3OW2 A;  1OYX A;  1UGS B;  2O4X A;  1BB9 A;  4RG2 A;  4BY6 C;  1M8V A;  3C12 A;  1D1A A;  1YBY A;  3A8H B;  1S72 Q;  4E7H A;  2HSE B;  3MEW A;  2M16 A;  4OGC A;  2SRC A;  1K8A U;  4J9B A;  2FRY A;  2LJ3 A;  3REA B;  2MPX C;  3FIF A;  2BZX A;  2E5K A;  3H41 A;  1N27 A;  4RTY A;  3PTA A;  3R6N A;  4C0D C;  4E47 A;  1NJI R;  2F2V A;  2J05 A;  1AWW A;  1EFN A;  1T0H A;  1WHL A;  2EKO A;  2QK0 A;  3BDU A;  3X28 B;  1X2Q A;  1WJS A;  1UG1 A;  4J9G A;  2ESW A;  1WXB A;  1G3S A;  4M78 D;  1QP2 A;  2OAW A;  2COY A; 
#chains in the Genus database with same CATH homology
 1YWO A;  2A36 A;  5EC7 A;  2V1R A;  1PRL C;  2L3S A;  4F14 A;  2EGC A;  2L0A A;  2LX7 A;  3IQL A;  1KJW A;  2YSQ A;  3TSZ A;  4FSS A;  2J7I A;  3EHQ A;  1VYT A;  2LQN A;  1X27 A;  1RLQ C;  3UAT A;  4LUD A;  2KBT A;  2HDA A;  2O31 A;  2KYB A;  3VS6 A;  2FPD A;  2LZ6 B;  1T3S A;  2PZ1 A;  1MV0 B;  1HD3 A;  2RF0 A;  1QWF A;  2G6F X;  5I22 A;  1M27 C;  4GBQ A;  2SEM A;  3NGP A;  5FW9 A;  2JS2 A;  1AOJ A;  2EYX A;  3H0H A;  4RTT A;  1PWT A;  5IHK A;  1BBZ A;  4AG2 C;  4RTV A;  3M0U A;  2RQU A;  5FWC A;  4AFS C;  4JZ4 A;  1WI7 A;  4HVU A;  1KFZ A;  1WA7 A;  2L3P A;  4AFQ C;  2EPD A;  4LN2 A;  2FPE A;  2DYB A;  1Y57 A;  3C0C A;  1CSK A;  1TG0 A;  4HCK A;  1E6H A;  1XOV A;  1OOT A;  2LJ0 A;  4Y92 A;  2RQW A;  2YUP A;  1UDL A;  1WFW A;  4CC3 A;  2PNI A;  2DLP A;  5IHI A;  2DBM A;  2KT1 A;  2CDT A;  1M30 A;  1SSH A;  2RQR A;  2KE9 A;  2L3Q A;  1BU1 A;  4K11 A;  1H8K A;  2J6K A;  2F2X A;  2FPF A;  3O5Z A;  2JW4 A;  1WXU A;  1Z9Q A;  1CKB A;  1UTI A;  1YNZ A;  3TSW A;  1NLP C;  1K0X A;  2FRW A;  1JU5 C;  3EG2 A;  3QWY A;  1JO8 A;  1RLP C;  2KRN A;  1TUC A;  1YCS B;  3A98 A;  2NUZ A;  4F17 A;  2YUQ A;  2K2M A;  2DE0 X;  2ECZ A;  3CQT A;  3SEM A;  1YWP A;  1UE9 A;  3VS7 A;  1VA7 A;  3EG3 A;  4E6R A;  1ZSG A;  2DBK A;  2M0Y A;  3RBB B;  1GCP A;  2D1X A;  2BZY A;  1LCK A;  1KIK A;  4J9I A;  4AG1 C;  1GBQ A;  1HJD A;  1QWE A;  3GBQ A;  1W70 A;  4DEY A;  2GTJ A;  2K3B A;  2C0T A;  1WX6 A;  4IIM A;  1PRM C;  1AZE A;  2O88 A;  4J9H A;  2DL7 A;  2KRM A;  4RTX A;  4Z89 A;  4J9C A;  2KRS A;  1RUW A;  2JT4 A;  2AZS A;  2DMO A;  2O9V A;  2LMJ A;  5FWB A;  2I0N A;  1K1Z A;  4DEX A;  2W10 A;  1QLY A;  2D0N A;  3SHW A;  2GQI A;  1V1C A;  4F16 A;  1GL5 A;  2DL8 A;  2EQI A;  2VWF A;  2X3X D;  2DF6 A;  3TVT A;  1ZUK A;  4QT7 A;  4J9E A;  1NYG A;  2KT8 A;  2D8H A;  2K7A A;  1A0N B;  3VS4 A;  1UJY A;  1N5Z A;  2ABL A;  2J6F A;  2AK5 A;  2RPN A;  4Z88 A;  4GLM A;  4WCI A;  2RQV A;  4D8D A;  1H3H A;  1OEB A;  3QWX X;  4LUE A;  4M4Z A;  1JQQ A;  2YT6 A;  2EYZ A;  2CUD A;  1T0J A;  2JXB A;  2VVK A;  3ULR B;  5GJV B;  4JJB A;  1E7O A;  1B3Q A;  1U5S A;  2O2O A;  1NYF A;  2CRE A;  1UFF A;  2B86 A;  1K4U S;  2LP5 A;  3EGU A;  1X6G A;  1I07 A;  2DRM A;  2FEI A;  2CSI A;  2MIO A;  1UEC A;  2KRO A;  4ESR A;  2DJQ A;  2ED0 A;  2LJ1 A;  1Y0M A;  3NMZ C;  1BK2 A;  4LE9 A;  2FO0 A;  2EYY A;  5IXF A;  2K6D A;  2RQT A;  1NLO C;  2P4R A;  1K0S A;  2O9S A;  1ZX6 A;  2OJ2 A;  4JJD A;  2JS0 A;  2DVJ A;  1OPK A;  1Z9Z A;  1I1J A;  2HBW A;  2RN8 A;  1I0C A;  2JTE A;  2EVR A;  4RTU A;  2GGR A;  4D8K A;  2L2P A;  2X3W D;  1K9A A;  2H8H A;  4J9D A;  1UGV A;  5ECA A;  2W0Z A;  1ABO A;  1OV3 A;  2A08 A;  2PTK A;  3UA7 A;  2GTO A;  3I5S A;  3M0R A;  2KGT A;  2A37 A;  2MCN A;  4OMQ A;  4ORZ A;  1B07 A;  2J6O A;  3PE0 A;  1CKA A;  1PKT A;  5L23 A;  2LNH B;  3VS1 A;  1H92 A;  1M8M A;  1UHC A;  2KXC A;  3RNJ A;  2FG0 A;  1U3O A;  1SHG A;  1VYU A;  4HVW A;  2RNA A;  2DM1 A;  2EGE A;  4JJC A;  4RTW A;  2DL4 A;  1OPL A;  2DNU A;  1GBR A;  1SRM A;  1AWJ A;  3NPF A;  2DA9 A;  4JPB W;  2V1Q A;  2KNB B;  3U23 A;  4AFZ C;  1UUE A;  2ED1 A;  2ROL A;  4CC4 B;  2EKH A;  3I9Q A;  1MV3 A;  2JMC A;  4OMP A;  1J3T A;  2KR3 A;  1PKS A;  1GRI A;  2BTT A;  2C0I A;  5GJW B;  2AZV A;  4JZ3 A;  4HVV A;  1AZG B;  4IIO A;  1X43 A;  5I11 A;  1WIE A;  2GNC A;  2ROT A;  4CC2 A;  2CSQ A;  4EIK A;  3PVL A;  1WYX A;  1X6B A;  1AEY A;  1U06 A;  2AKK A;  1HSQ A;  4ZNX A;  3REB B;  1NG2 A;  2EBP A;  2CH4 A;  2NWM A;  2LCS A;  2K79 A;  2AKL A;  3UF4 A;  3I5R A;  2RMO A;  2DL3 A;  1S1N A;  3VS2 A;  1M3A A;  2HSP A;  2CT4 A;  1K76 A;  1UHF A;  1W6X A;  2OI3 A;  2KYM A;  2LQW A;  2DRK A;  4RUG A;  3EG1 A;  1QKX A;  3VS0 A;  1SPK A;  3LH5 A;  2DIL A;  2D8J A;  2JM8 A;  1FMK A;  2JM9 A;  1GFD A;  4HXJ A;  5IXB A;  3THK A;  1RI9 A;  1ZBJ A;  1JXO A;  1WLP B;  1WXT A;  1VYV A;  4CC7 A;  2CUB A;  2MOX A;  4OML A;  4KRT A;  4OMN A;  1SHF A;  3NHN A;  2EW3 A;  4AFU C;  1QCF A;  3VS3 A;  1ARK A;  1JEG A;  1GCQ A;  3M0P A;  4R0K A;  1M3B A;  4RTZ A;  3M0Q A;  1ZLM A;  3VRY A;  3EHR A;  3UA6 A;  1TUD A;  1JXM A;  1PHT A;  2YUO A;  2A28 A;  1WDX A;  1G83 A;  1T3L A;  1IO6 A;  2ENM A;  1KSW A;  3JV3 A;  1NM7 A;  1YP5 A;  2KEA A;  2CH4 W;  4OMO A;  1M3C A;  4OMM A;  1FYN A;  1ABQ A;  1W1F A;  2HEQ A;  2YDL A;  1UJ0 A;  2EYW A;  2GBQ A;  2VKN A;  3M0T A;  1QKW A;  1X2K A;  1AVZ C;  2CT3 A;  3KFV A;  1E6G A;  3I35 A;  1MUZ A;  4X1V A;  2HCK A;  4A63 B;  2J06 A;  5IH2 A;  1BB9 A;  1SEM A;  1GFC A;  2JMA A;  2F2W A;  3ZL7 C;  1PNJ A;  3M0S A;  3H0F A;  5HCK A;  1AWX A;  2SRC A;  2DL5 A;  2K9G A;  4J9B A;  1G2B A;  2FRY A;  2LJ3 A;  3REA B;  3VRZ A;  2DX1 A;  2BZX A;  2E5K A;  2C0O A;  4J9F A;  2BZ8 A;  2EGA A;  1SRL A;  3H41 A;  4LNP A;  1NEG A;  1X69 A;  1YN8 A;  3PVQ A;  4RTY A;  1AWO A;  2M51 A;  3R6N A;  1AD5 A;  3H0I A;  2QDL A;  2F2V A;  2J05 A;  1GCQ C;  1AWW A;  1EFN A;  1T0H A;  2IIM A;  3EG0 A;  5IHN A;  4Z8A A;  1X2Q A;  3VS5 A;  1UG1 A;  2YUN A;  1NEB A;  1ZUU A;  4J9G A;  2ESW A;  2KXD A;  3FJ5 A;  1WXB A;  2XMF A;  1ZUY A;  2OAW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...