2ENMA

Solution structure of the sh3 domain from mouse sorting nexin-9
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
77
structure length
77
Chain Sequence
b'GSSGSSGMATKARVMYDFAAEPGNNELTVTEGEIITVTNPNVGGGWLEGKNNKGEQGLVPTDYVEILPNDGKDPFSC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sorting nexin-9
publication title Solution structure of the SH3 domain from mouse sorting nexin-9
rcsb
source organism Mus musculus
molecule tags Endocytosis
total genus 8
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2enmA00
2YUQA 1SRMA 3NHNA 1MUZA 1N5ZA 1SEMA 2KYMA 1J3TA 1EFNA 3EG1A 1XOVA 2DBMA 4E6RA 1KJWA 2DF6A 3M0RA 1JQQA 2O9SA 4D8KA 2D8JA 1M3CA 4OMOA 2C0IA 1M3BA 3H0FA 2B86A 1QKWA 2J6FA 1AWOA 1YWOA 4RTVA 4JZ3A 1WX6A 2RQTA 3O5ZA 1TUDA 2DRMA 1CKAA 2KRSA 1IO6A 2ENMA 4F17A 2JMCA 2J6KA 4X1VA 1E7OA 1OPKA 4RTYA 1YNZA 1ZUUA 1AWXA 1UDLA 3PVLA 1UUEA 2EVRA 1ABOA 3EGUA 3NMZC 2PNIA 4WCIA 2CUBA 1UHFA 1VA7A 3VS5A 2LX7A 2GBQA 2LJ0A 2JM8A 2D0NA 1X2QA 2JS0A 1ABQA 2F2WA 2AKLA 1GFCA 2RNAA 2RN8A 4AFQC 1SSHA 5ECAA 2FEIA 1BB9A 2HCKA 2LQNA 3I9QA 3QWXX 1AWWA 3REAB 3SEMA 1K0SA 5GJWB 1T3SA 2JT4A 2K3BA 1LCKA 3C0CA 3UF4A 4EIKA 4ORZA 4J9IA 3I5RA 3RBBB 1HJDA 1UFFA 4CC2A 4IIMA 3CQTA 2GQIA 1BK2A 1GCQC 2P4RA 2K2MA 4RTXA 1WI7A 1A0NB 2CDTA 2LNHB 2VVKA 1WXTA 2PTKA 2RQRA 2F2VA 4CC3A 2DM1A 1M27C 2DMOA 2VKNA 1PWTA 1FMKA 1KSWA 1H3HA 2LJ1A 2DYBA 3M0SA 5IXFA 3RNJA 3EHQA 1Y57A 2CSQA 5IHIA 2YDLA 1X43A 2CT4A 1YWPA 4J9HA 1UG1A 4LNPA 2X3XD 1I07A 1AD5A 2O2OA 2RF0A 2O88A 1GBRA 4FSSA 3IQLA 1H8KA 2KNBB 1WDXA 1SHGA 4DEYA 1M30A 2EYZA 1GL5A 2GGRA 4J9CA 3U23A 2MOXA 2DA9A 2DL4A 4F14A 2KE9A 5IH2A 1K1ZA 1T0JA 2I0NA 1JXMA 1RI9A 2OI3A 2X3WD 4DEXA 2EW3A 2E5KA 2FPEA 2DBKA 2L2PA 4Z8AA 2GNCA 4RUGA 1H92A 2ED0A 1M3AA 3VRZA 1T3LA 3VS1A 4J9DA 2L3SA 1KFZA 4LUDA 2ABLA 1Z9ZA 3EG0A 2ROTA 2JM9A 1WFWA 1YN8A 2L0AA 3VS3A 2QDLA 2LCSA 1ZBJA 1GRIA 5FWBA 3UA6A 1WXBA 4Y92A 4AG1C 1V1CA 1WA7A 4M4ZA 4IIOA 2L3PA 2AKKA 2FPDA 1HSQA 1YCSB 3M0QA 3M0UA 1ZX6A 3SHWA 2LMJA 1NYGA 1BU1A 1VYTA 2BZ8A 2SEMA 1MV3A 2W10A 2AZSA 5IHNA 1Y0MA 1FYNA 2CH4W 2KRMA 1ZSGA 4KRTA 2EBPA 2KRNA 1AWJA 2V1QA 1U06A 2FO0A 1SPKA 3PE0A 2DJQA 2KT8A 5I22A 1YP5A 1U5SA 2H8HA 2F2XA 1X6BA 2NWMA 1B3QA 2DL5A 3FJ5A 2DILA 3VS0A 2C0TA 1GBQA 3H41A 1G83A 2DVJA 3ULRB 2BTTA 2RQVA 2FG0A 2YT6A 2EYWA 2G6FX 3THKA 4OMLA 2EKHA 1NYFA 4LUEA 3TSZA 1WLPB 2J06A 2KXDA 2ROLA 2OAWA 2IIMA 2CH4A 3EG2A 1G2BA 2JTEA 1QLYA 3VS2A 4JJBA 5HCKA 2DRKA 2ECZA 2YSQA 1RLQC 2FPFA 2RQUA 2M0YA 4LE9A 3PVQA 2CT3A 4AFUC 3NPFA 5FW9A 4HVUA 2HSPA 4CC4B 1UJ0A 3H0HA 1WIEA 2JW4A 2KT1A 2OJ2A 3VS4A 4OMQA 1AVZC 2EGEA 1BBZA 3I35A 3UATA 1W6XA 2JMAA 2M51A 2GTOA 4GBQA 4HCKA 2DNUA 2PZ1A 4QT7A 2O9VA 3REBB 2KXCA 2J6OA 1NLOC 3EHRA 2D1XA 2EGAA 1ARKA 2LQWA 2CSIA 4J9BA 1RLPC 4HVVA 5L23A 3LH5A 1AZEA 4F16A 1PRLC 2KEAA 1W70A 4A63B 4Z89A 3UA7A 2AZVA 1PNJA 4CC7A 5IXBA 4RTTA 1T0HA 2J7IA 3TSWA 2DL8A 3GBQA 2D8HA 1QCFA 4R0KA 2DL7A 1OEBA 4ESRA 1PHTA 2KGTA 1K4US 1ZUYA 1S1NA 1UTIA 2RPNA 2MIOA 2V1RA 2KROA 2A36A 2HBWA 4OMPA 1PKSA 2CUDA 2KBTA 1ZUKA 2MCNA 3I5SA 1UE9A 2L3QA 2BZXA 2XMFA 3JV3A 2KYBA 1CKBA 1K0XA 2HDAA 2FRYA 2RQWA 4RTUA 4JPBW 2JXBA 1E6HA 4RTZA 1SRLA 1NM7A 2C0OA 3VRYA 4AFSC 1KIKA 4J9GA 2A37A 2EPDA 2FRWA 1K76A 2LZ6B 1GFDA 3KFVA 1PKTA 1RUWA 1VYUA 1ZLMA 2RMOA 4J9EA 4AFZC 3ZL7C 2SRCA 3QWYA 2ESWA 2YUNA 1B07A 1OOTA 1MV0B 2A28A 1UJYA 5FWCA 2EYYA 4ZNXA 2EGCA 4RTWA 2DX1A 1UGVA 3R6NA 4D8DA 1JXOA 4OMMA 1TG0A 2A08A 2DLPA 1WYXA 2ED1A 3TVTA 1K9AA 1JO8A 1Z9QA 2JS2A 4K11A 2VWFA 4JZ4A 3NGPA 1QKXA 4JJDA 2LJ3A 4LN2A 2O31A 2BZYA 2EQIA 2K6DA 2YUOA 1TUCA 5IHKA 1E6GA 4JJCA 1OV3A 5GJVB 1M8MA 1VYVA 3M0TA 2W0ZA 4J9FA 2DL3A 2HEQA 1GCQA 1QWEA 1NLPC 1UECA 1PRMC 1CSKA 2AK5A 2KR3A 1AEYA 4OMNA 1X69A 2LP5A 1JU5C 4Z88A 1NEBA 2K7AA 3EG3A 1AZGB 2NUZA 1W1FA 4HXJA 3VS6A 4AG2C 4HVWA 1NG2A 2YUPA 1HD3A 2K79A 1AOJA 1X27A 3VS7A 3A98A 1OPLA 1QWFA 1I0CA 1GCPA 3H0IA 1NEGA 1I1JA 2EYXA 2J05A 3M0PA 1JEGA 2K9GA 4GLMA 1WXUA 5EC7A 1X2KA 2GTJA 5I11A 2CREA 1SHFA 2DE0X 1X6GA 1UHCA 1U3OA
chains in the Genus database with same CATH superfamily
1Q82C 3RIRA 3SWNB 2KYMA 1J3TA 4MDWA 3GLXA 2PUKB 1KJWA 2DF6A 5KYUB 2O9SA 4M7AC 4ZN1A 3CMEA 4FW1A 2C0IA 2K4YA 1MGQA 1OZ3A 2J6FA 1M5Q1 2Y4XA 1VIFA 2V26A 4L6V5 1VQ9Q 2KRSA 3OY9A 1IO6A 2ENMA 4F17A 3CCMQ 1W2BS 4N0AA 2J6KA 1E7OA 4PL6A 3CCQT 1MMDA 1OPKA 2QASA 5GANg 2E3IA 4M78G 2PNIA 2A7YA 4M78D 1K9MR 2COZA 4MDXA 3CCLQ 2GBQA 3MP8A 1VQ4Q 2D0NA 2JS0A 1ABQA 1TSFA 2B8AA 2AKLA 4V2SA 4DOWA 2R57A 3AHUA 1QVFA 3I9QA 1VQ5T 3QWXX 1IREB 3REAB 3SEMA 3OYDA 2AHJB 2K3BA 2EQKA 3OYKA 4J6WA 1OX9A 4ORZA 4F7UF 3RBBB 4M75F 4ZTJA 1UFFA 3URGA 1WQWA 2QAZA 1BI3A 2OTJT 2K2MA 4RTXA 1QVGS 3INZA 1A0NB 2CDTA 3BW1A 5GMKi 2PU9B 4FSXA 3OYFA 3M55A 2RQRA 3JCMg 1PD1A 2F2VA 1QCOA 2HQHA 3R6OA 1K9MU 4QVDA 2P4TA 1FMKA 1KSWA 3QZ9B 2LJ1A 3M0SA 3RNJA 3L2ZA 3M54A 4KGZB 3S3OA 5D6YA 2CSQA 4ELYC 2YDLA 1WJQA 2CT4A 1TH7A 4B6MA 3CXCA 4M7DG 2L89A 4LNPA 4M7DD 4M77C 2O88A 2CP0A 3L2VA 1H8KA 4J83A 2EYZA 4JS5A 2BE7D 1ZA2B 3U23A 1RAEB 4BE2A 2ZPFB 3DLLA 1T0JA 1WQ7A 1B34A 2OI3A 4DEXA 4E7SA 4Y91A 2L3RA 3A8GB 2EW3A 5C0MA 2FPEA 2DBKA 2MK5A 4XTYA 2DTOA 2C06A 1ZBXA 1H92A 3M56A 5GAMf 1KD1C 4A4HA 2L3SA 4LUDA 1QMCA 4MZMA 3HP9A 2MAMA 1P92A 4N0AC 3QUIA 4QQGA 1YN8A 1EZZB 3RKXA 2XHCA 1VQLQ 3HPWA 3SFMA 2L5QA 3LW5E 2ZPBB 1YI2A 2M02A 2OTLT 1HSQA 1V76A 3J7AF 5DLOA 4XU2A 1HK9A 3CCMT 3F70A 1N8RC 8ATCB 4PNOA 4XTZA 1X6OA 2QTXA 2SEMA 1M9SA 2X4XA 4O6JA 4KRTA 3CCLT 1TS9A 2DAQA 2KRNA 1VQ4T 4M78A 1SPKA 1VQMA 2KT8A 2A0FB 4CRIA 3L2WA 5GANd 2F2XA 3TU4K 3ZFJA 3FJ5A 2X9HA 3OYIA 4PJOC 5LJ3f 3L1AA 1QP2A 5CK9A 4FYWB 4A4EA 3ULRB 2PQWA 4JDSA 4KBMB 1VQ7A 2E65A 2RQVA 1NJIC 2FG0A 3EG9A 2KI7A 2G6FX 4OMLA 3HRTA 3L2QA 3P8DA 5GMKj 2K3YA 4JLIA 5IT9E 3S6WA 3OYAA 5D6WA 2MWOA 2ROLA 3FB9A 2ATCB 2CH4A 3EFOA 3OS5A 2JTEA 4JJBA 2E1HA 4ME7A 5HCKA 1YBYA 5KYWA 3QJYA 2FPFA 4LE9A 2JTMA 5GANh 3JCMd 4PLLA 3G4SQ 4CC4B 4RG8A 3QYHB 3CD6A 3VS4A 1VQNQ 1VQ6A 1AVZC 4M7DA 1RAAB 1HYOA 4LD6A 5CVIA 4A4KA 3UATA 4C0ZA 2QQSA 2JMAA 4QQDA 2VXFA 4C8QF 2O9VA 3REBB 2R5MA 2D1XA 1R0CB 3LLRA 2CSIA 1IGUA 2QQ9A 4HVVA 4C5EA 2HSEB 3AT1B 2LCLA 1AZEA 1WJRA 4C5IA 2LX9A 4CC7A 5I2SA 1EIFA 2D8HA 1QCFA 4E7IA 1VQLT 2EKOA 3JCMh 2RB6A 4F7UB 2KMTA 2WSEE 2X35A 2E64A 4M75B 4M78C 4OMPA 2NUTA 1ZUKA 1WHGA 1CKBA 1KHCA 3V8KA 3M53A 3OYYA 3D7SB 1M1GA 5A0DA 5GAMe 2PVOB 4D6WA 1PM3A 3OYMA 2C0OA 4AFSC 3OSSC 1KC8R 2HMAA 5CQYA 1K76A 3RERA 5KCOA 1VYUA 1Y7XA 3ZL7C 2SRCA 3QWYA 4FM4B 4JRQA 1TUGB 5HY6A 1YCYA 1MV0B 2DD4A 5CQXA 2HQXA 3CCVA 3TEEA 3H6ZA 4BE0A 2EGCA 2IG0A 4RTWA 1JXOA 1VQ8Q 2ED1A 1BIAA 3JCMW 1JB0E 4IUVA 4JJDA 4LN2A 2O31A 4PK4A 2BZYA 2VB6A 3T9NA 2K6DA 1VQPQ 1IXDA 2EYQA 5IHKA 4JJCA 5IN1A 1NE8A 1I5OB 2M0OA 1M8MA 1UEBA 4ZGEB 3I56A 4M7DC 3M57A 4M75D 2HZYA 1KC8U 1Y07A 5A0GA 2DEUA 1AEYA 4OMNA 2LP5A 2EJFA 2K7AA 3LWIA 5CKHA 3G4ST 1U1SA 2K79A 1X27A 3VS7A 5GMKh 3A98A 1G3YA 1VQNT 3CPFA 4BI8B 3CPWS 3G71A 3RKYA 2GTJA 5I11A 3OMGA 1X6GA 4J8OA 5CKDA 5FU6C 1ZA1B 4A53A 1QVFS 1MUZA 4PFZA 1OULA 1K8AC 3LWHA 1QW1A 4DQ2A 2YXYA 2DPPB 3EG1A 3RMQA 4DA4A 3I55T 2RHIA 4EMGA 1Q95G 4C0FA 1KG1A 1SF9A 3EFSA 4N4HA 5J39A 1YWOA 4RTVA 4JZ3A 4FYVB 1WX6A 2CZ0B 1XNIA 1WHKA 2JMCA 4X1VA 3QBYA 5LJ5g 3META 4XAXB 2EJ9A 2WSFE 1ZUUA 1AWXA 1EX4A 1UDLA 3OW2S 2CP5A 2WSCE 2EVRA 5J3BA 3EGUA 2DJZA 4B9WA 3X20B 4UC4A 3CC7T 2CUBA 2RJEA 3G1JA 1VA7A 3CC2T 4BE1A 2DXTA 2ZZDA 3VYHB 4R55A 2LJ0A 2RHZA 3MP1A 4IUTA 4AFQC 3OSVA 2FEIA 1WHHA 2LQNA 4DOVA 2QEXQ 1K0SA 1U1TA 2E70A 3FRNA 2JT4A 1G8XA 3JCMe 4DBFA 1HJDA 2F1LA 3L42A 4C92F 1JBMA 1VQ8T 4PFPA 1IZ6A 4Y28E 1D3BB 4C8QB 3CC4Q 4RCCA 1WXTA 3QO3A 5M9OA 2PTKA 2DD5A 2DM1A 3CCSA 3CCUA 4FIBA 2JN0A 1JJ2S 5IXFA 1NJIU 3EHQA 3CCRQ 1PC0A 3S3NA 1G3WA 1C1AA 3OMCA 1UG1A 4C0GA 1RACB 2X3XD 2RF0A 4QVZA 3QZ5B 2XKOC 6AT1B 2VYTA 3M5AA 3PFSA 1WDXA 4DEYA 5IAYA 1VQOQ 3L2UA 2ZPGB 1KHIA 2E6ZA 2GGRA 5I2MA 1GL5A 4RG2A 2MOXA 3JB9G 3QDFA 2DA9A 1Q86C 4JJNK 2COYA 1K1ZA 1YIJQ 1QP3A 2I0NA 2D0QB 1JXMA 1RI9A 4IUUA 5KH6A 1AHJB 3CCQA 4OP0A 1M3AA 1T3LA 3VS1A 4F7UE 2CP2A 1Q7YC 4M75E 5J26A 1ZSZB 1YJ9A 3HFOA 3CCJQ 3EAEA 1H641 1ZBJA 4IKFA 1GRIA 4J5YA 1WXBA 4Y92A 1LNXA 3G6EQ 4EPCA 3TQ7P 4M4ZA 5GMKe 2L3PA 1YCSB 3M0QA 5KCHA 2FZGB 2DETA 1RAHB 2YLBA 4AT1B 2K3XA 1ZX6A 3GF5A 1BU1A 1VYTA 3HHTB 1MV3A 5IHNA 1UGRB 1M90C 4PJNA 2OTJA 3G7ZA 4XTVA 3A8MB 2CH4W 1OYXA 1ZSGA 1RADB 2JZ2A 4FW2A 2EWNA 1U06A 1UGPB 2FO0A 1WPYA 2DJQA 5I22A 5LJ5d 2E12A 5KYXB 1K73R 2LC4A 3OB9A 2QEXT 3X25B 2OX7A 3JAME 3OQ5A 2XICA 1B3QA 2RHUA 3VS0A 1YI2Q 1Y96B 5GANj 3EGXB 3JB9I 3OYNA 3UPUA 5KYYB 3GPLA 2XDDA 2FHDA 4QKUA 2XDPA 1OU8A 2YT6A 3BE3A 3THKA 1YJNQ 5GAOl 3MHXA 2EKHA 1NYFA 1RAFB 2MMPA 3CC4T 4MMLA 4LUEA 3TSZA 2RI2A 2RK1A 1WHMA 3RMSA 2IIMA 3EG2A 3E9GA 2D6FA 1QLYA 4N4IA 2FB7A 4BDYA 3RESA 2ECZA 2DTHA 4XU1A 2LT4A 4M77F 1RLQC 4XU3A 5LJ5h 3CCRT 1X75C 2CT3A 1PCXA 5FW9A 4HVUA 1K73U 1UGQB 2FZKB 4XQ3A 2QQAA 3H0HA 1VQ7Q 4OMQA 1W4SA 4JLGA 2F5KA 3VUBA 4PLIA 3JCMb 1R0BG 2QQBA 1VQOT 1W6XA 2OTLA 3QXEB 4XTWA 2GTOA 4HCKA 5CAIA 2DNUA 1Q81C 1QVGP 2O4XB 2QTVA 2CZ7B 3FEOA 1YIJT 3CCMA 1WHLA 1BI1A 3OBYA 3H8ZA 2LQWA 5HK0A 4J9BA 3NFCA 1RLPC 2AIRB 2X4WA 3LH5A 2VUBA 2MPXC 4A63B 5DY9A 5FU7C 2QXFA 4PFOA 3UA7A 2AZVA 3CCLA 4RTTA 3CCJT 1T0HA 3WVDB 1H3ZA 1M2VA 4JUVA 3TCJA 3G6ET 1VQ9T 4BDZA 2KGTA 3C12A 1I4K1 1K4US 2RPNA 2MIOA 1OI1A 2A36A 2HBWA 5LJ3d 2MCNA 2YHTA 3JSCA 2QA4A 1XTDA 1K0XA 4C92B 2XIDA 3UT1A 2XDBA 1FMVA 2XG8D 2JVVA 4Z02A 2RM4A 2RQWA 4X9DA 1I5LA 4JPBW 2DZ9A 1M1KR 1MNEA 1IHWA 1NM7A 3QPHA 3OYJA 2PUOB 2EPDA 3OYHA 4EMKA 2V8KA 1GFDA 2EQUA 1NPRA 1ZLMA 4AFZC 4C8QE 4PJOF 4C0DC 1R77A 4WF2A 1VUBA 3OS1A 2CKKA 1YI2T 1YJWQ 4XTXA 4ZNXA 5DLQE 2V8IA 1I8FA 2DX1A 1UGVA 4D8DA 3C4SA 5DM7R 1TG0A 3LX7A 4ZGDB 3SWNA 2A08A 2E6NA 2GQVA 3QG1A 3TREA 4A54A 5GAN7 3OS2A 5LJ3h 1K9AA 3TVTA 3MEUA 5KYUA 1YJNT 1KK7A 4JZ4A 2RI5A 2M16A 2KDSA 1YFNA 2RJDA 1OV3A 2E41A 5GJVB 3CMAA 1M1KU 2JTFA 4E2FB 1VYVA 5CKBA 3J80E 1OZ2A 4M7AB 4JS4A 1Q82R 2DL3A 1S72Q 1BCMA 4FYXB 3UDCA 1GCQA 4KH0B 1UECA 1PRMC 2AK5A 4HA8A 3FIFA 1G3TA 5GAOq 2LDMA 1JU5C 4Z88A 5GAOp 4PKCC 4FT4A 4HXJA 3CCVQ 1N27A 4HVWA 2O01E 2K5IA 2YUPA 1HD3A 4PJLA 1VQLA 1OPLA 2R58A 1GCPA 1WHJA 2J05A 5CIUA 2LVMA 4MZPA 3ME9A 4GLMA 2GFAA 1WXUA 3CBMA 5A0LA 1X2KA 4PJJA 3QKJA 1SHFA 3FC3A 3NTHA 1U3OA 3NHNA 1N5ZA 4MZTA 1EFNA 3CBOA 1BKBA 2ZPHB 4E6RA 3M0RA 5LJ5e 1QVGA 4D8KA 3V8LA 2P0PA 3RUXA 5GAN8 2V8JA 3E19A 5A2QE 1Q82U 1M3CA 3CBPA 4OMOA 1M3BA 3GNGA 3H0FA 3JCMf 1AWOA 4M78F 1QCNA 2DERA 5D6XA 2RQTA 2CS7A 1D0ZA 4X34A 4C5HA 2ZCFB 2BIVA 4EMKC 3V7CA 3RKWA 4RTYA 4BY6C 1MNDA 2G3RA 1ABOA 4BACA 2IPOB 3NMZC 5GAN6 4WCIA 3VS5A 3PMIA 2LX7A 2PVDB 2KVQG 2JM8A 3ZBDA 4J7FA 2DTIA 2F2WA 3PNWC 1GFCA 3SWNC 2LQKA 1SSHA 5ECAA 1AWWA 4LDVA 4C5GA 4M77B 1T3SA 1TU0B 1JRIA 3E2UA 1LCKA 4E7KA 1SKUB 2HL3A 3LH0A 2JUFA 4EIKA 1TXQA 5CKFA 3I5RA 1YJWT 4OB3B 2RD1A 4CC2A 4IIMA 2GQIA 1Y71A 2CP6A 4CI0C 1BK2A 1RABB 3G4SA 3EFRA 4BI4A 3SB2A 1K9MC 1GCQC 4BB7A 3M4YA 4KULA 1VQNA 2K57A 4OVAA 5GMKl 1M4ZA 2VVKA 2EFIA 4M7DF 3V7RA 2QYZA 4GLKA 4F7UG 2NYSA 2QGFB 1UB4A 4M75G 3QIIA 2DMOA 4LXCA 3BFMA 4ZGJB 8AT1B 5FU7B 3JCMV 1KD1R 1S72T 4OF1A 5IHIA 5GAN5 1X43A 2COWA 2HAXA 2K5FA 1YWPA 4E7HA 3I55A 4HCBA 1LVKA 1VQKQ 1AD5A 2LCCA 3CCVT 3OYBA 2HNIA 1PG5B 3O8VA 1M30A 2HQEA 3P8BB 1UGSB 4J9CA 3OYEA 4IUQA 4X9CA 2CZ6B 2E5KA 4M77D 2FZCB 1NBEB 2MWPA 4RUGA 3DB4A 2ED0A 3KXTA 1N8RR 3CCUQ 4J9DA 4KT0E 4EDUA 3NTKA 3E9FA 2IVWA 3CC7A 1Z9ZA 5GANe 3CC2A 3EG0A 4A4FA 4C92E 2ROTA 2VXEA 2LCSA 3ASKA 3EH2A 4PJOB 3LYIA 2K5LA 1KD1U 2P84A 1YITA 1GXIE 2CGHA 2AKKA 1D1BA 2FPDA 3JCMQ 1KQSP 1YHQA 4HCCA 4N4GA 4LDXA 3CPWP 3VUZA 2HKNA 4TVRA 2LMJA 3SHWA 2BZ8A 7AT1B 3CCQQ 5GAOm 2W10A 4HCZA 1NJIR 4B9XA 1Y0MA 4J6XA 3MEWA 3CXCS 1VQ8A 4KUDK 2MI6A 2BUDA 1QVFP 1YJ9Q 2EBPA 3CMEQ 2V1QA 1N8RU 1WJSA 3NTIA 2DKGA 1B34B 5LJ5j 2DILA 1FXXA 4JRKA 3V8JA 1GBQA 1G83A 5GAMg 1XJWB 1LOJA 1FMWA 2RA2A 2I2LA 4JRIA 5CO7A 3BDLA 2VV5A 4DBHA 1VQPT 3CCEA 3OW2P 1TOVA 4PJOD 1RAGB 2J06A 2OAWA 2VGNA 1U8RA 3HKSA 3VS2A 1M8VA 2ZPIB 4F7UA 4II1A 3X26B 2DRKA 4M75A 2DEQA 4E7ZA 2YSQA 2RQUA 2E4HA 2P0KA 4FT2A 1R8OB 3DLMA 3A1PA 1VQKT 5GAN3 2LT1A 1UJ0A 1RAIB 4M78B 1WIEA 2JW4A 2KT1A 2OJ2A 3C94A 3N5BB 3BDUA 4L59A 5GAOr 1I81A 1NZ9A 2RI3A 4KH1B 4ELZC 4OGCA 1IRXA 1IHVA 3A8HB 1D0YA 2EAYA 2J6OA 1NLOC 3EHRA 3M58A 3H9NA 2QI2A 3A5ZB 3M9QA 1G3SA 4RCBA 4IURA 4M7AF 5EG2A 3CCUT 3EG9B 5LJ3g 3V7SA 1PRLC 2KEAA 1W70A 4Q5WA 4Z89A 1JJ2P 4C8QG 4PJMA 4C8QD 1VQ5A 2YRDA 3TSWA 3VKIA 2DL7A 1BI0A 4F04B 4ESRA 2CP3A 4LDYA 3EFOB 2QEXA 3OA6A 2K2VA 1ZUYA 3MKDA 2V1RA 4J7IA 5KYWB 4NOYA 2KBTA 2OTLQ 1UE9A 2XMFA 2BZXA 2KYBA 1QVPA 2GFUA 4M77E 3JB9H 3E1SA 2QQRA 5LJ3j 2JXBA 4FL6A 1D1AA 1SRLA 2E5QA 2GF7A 3MCAB 3VRYA 4M7DB 3PGGA 3OBWA 1KIKA 1V29B 1KQSA 4J9GA 1YJ9T 3CMET 4ZN3A 3CC4A 3A8OB 2LZ6B 3CPWA 3KFVA 1PKTA 2DVEA 1BYMA 2AT1B 1B07A 1XQHA 2RK2A 1OOTA 2F69A 3CCRA 1UJYA 1W2BP 3R6NA 1F1BB 2QA4Q 2DLPA 1WYXA 4BD3A 3EH1A 3LGLA 4M75C 1JO8A 1Z9QA 1M1FA 2JS2A 2M1HA 2VWFA 2VGMA 1BCOA 5FU6B 1SSFA 4JRPA 1X01A 4OB2B 1VQOA 1KC8C 2LJ3A 1VQMQ 2QDYB 5CCAA 2HL5C 2EQIA 1TUCA 3UWNA 1ZHIA 1WNLA 5GAMd 1YIJA 2NUTB 2JNGA 3M0TA 4PJOA 5AT1B 5LJ5f 4J9FA 1FX7A 3HTRA 4HT9A 3MEAA 4RMOA 2KSSA 3WXMB 1CSKA 3VYGA 3OW2A 1K8AR 4NL3A 1X69A 1OX8A 1AT1B 1NEBA 3EG3A 4AG2C 3CCJA 2DK3A 1MMNA 1NG2A 2LNVA 2BE9B 1HXDA 5KE2A 1QWFA 3H0IA 2Z0WA 4A4GA 4ZTFA 3HSBA 3G6EA 2RHXA 4E47A 3PIOA 1PSFA 2EYXA 1VQ9A 1JEGA 1ZQ1A 3PT9A 4PJOE 1N6AA 2CREA 2DE0X 2QG9B 1KQ2A 2E3HA 3CMAQ 2QK0A 1IGQA 2YUQA 1SRMA 1SEMA 3HRSA 1LPLA 4OMFB 5GAMh 1XOVA 1VQ4A 2DFUA 2F5TX 3MPUB 2DBMA 4ANJA 2DXBA 1JQQA 5GAN4 2XD0A 3CD6Q 3GIBA 2D8JA 1VQ6Q 2B86A 1QKWA 2DIQA 2HBPA 4VUBA 1K8AU 2EJGA 3GNFB 1D3BA 1D09B 2E10A 4C8QA 2CP7A 5CR2A 4MMKA 2P0QA 3O5ZA 1TUDA 2DRMA 1JJ2A 1BIBA 1CKAA 4FCYA 2KK4A 3EGDB 3GOXA 4OGEA 2XI9A 1LJOA 2EQJA 3M4GA 1YNZA 3PVLA 1UUEA 2PVGB 5GMKm 1UHFA 1O75A 3RR6A 2DO3A 1WGSA 1YJNA 2MF2A 4E7JA 1X2QA 5FRNA 2M9UA 2HKQB 2RNAA 1PD0A 2RN8A 1BB9A 2HCKA 2A3LA 3JCMX 1ACMB 2Y4YA 4FU6A 5GJWB 2XK0A 2RH2A 4E7LA 5FRMA 1B7TA 3C0CA 1C0MA 3UF4A 4J9IA 2ZPEB 1KQ1A 2FL7A 3CQTA 1BI2A 2LQ8A 2QA4T 1ZSZA 5KE3A 2P4RA 1SG5A 5HK3A 1WI7A 2LNHB 2RO0A 2R5AA 3HL8A 4M78E 1W2BA 1VQMT 2DZCA 1Q86R 4CC3A 2WACA 3A8LB 5D7UA 1M27C 2JOYA 2VKNA 5GANf 1PWTA 3QSUA 1H3HA 3MJXA 2DYBA 4C92G 4KGXB 4C92D 2MYSA 1IB8A 1Q7YR 4R56A 1Y57A 3JB9F 4YTLA 4O5VA 5HKCA 3CEYA 5GAOn 4J9HA 1I07A 1M2OA 1VQ7T 2O2OA 2NUPB 5GAN2 3LGFA 1GBRA 4FSSA 4LDWA 3FJPA 3OYCA 3IQLA 2D9TA 4LD9K 2KNBB 1SHGA 2QGGA 1D0XA 3DB3A 2DL4A 4F14A 3S3MA 2KE9A 5IH2A 5KYXA 3I56Q 2X3WD 4DBRA 2YRCA 2L2PA 4Z8AA 2GNCA 4C8QC 3CMAT 3VRZA 2LTOA 3FLGA 1KFZA 1Y96A 3HRUA 1Q86U 3EGXA 2ABLA 1M90R 2JJ9A 2YWWA 3PMTA 5FROA 5KYYA 2JM9A 1WFWA 2L0AA 4NL2A 2QDLA 3VS3A 3I55Q 3M59A 5FWBA 5L8RE 3CD6T 1Q7YU 3UA6A 1VQ6T 4M7DE 4AG1C 1V1CA 1WA7A 5KYNA 3HFNA 3G71Q 4M7AG 4IIOA 3Q1JA 4M7AD 3MP6A 3J81E 2EIFA 3MEVA 1G5VA 3M0UA 3JCMJ 1YJWA 2FVUA 2L8DA 1NYGA 1MMGA 2AZSA 2CZ1B 1FYNA 3QDRB 1WZOA 2X4YA 2KRMA 3P8HA 3GP8A 3CC7Q 2DXCA 1O9SA 2XU8A 3CC2Q 1AWJA 1MHNA 2HD0A 3PE0A 4GY5A 2H3EB 1YP5A 1U5SA 1ZSZC 3JRZA 2H8HA 1MMAA 4OB1B 4QVCA 1M90U 3PIPA 1DJ7B 1X6BA 2NWMA 4LDUA 2DL5A 1YITQ 9ATCB 1S72A 2O4XA 2C0TA 3H41A 2DVJA 3KBGA 1YHQQ 3ER0A 2BTTA 3X28B 2EYWA 2EQMA 2GCXA 2DXUA 2RJCA 2KQWA 4J6YA 2Y90A 1WLPB 2KXDA 2X51A 1Q81R 1K73C 1G2BA 2OAUA 4HKEA 1N9SA 3JCMc 4XK8E 4HT8A 2M0YA 3PVQA 2X4JA 4AFUC 3NPFA 4C92A 4L5GA 2HSPA 2ZAEA 1D1CA 3EGDA 3JCMP 3ZEHA 3QJ6A 4EMHA 5LJ3e 2RJFA 3QHSA 4NS5A 2EGEA 1BBZA 3OYLA 3I35A 3OYGA 4KUIA 4M77G 3BY7A 3RDVA 2M51A 1KQSS 3SD4A 4GBQA 2PZ1A 4QT7A 3CCEQ 3DKMA 3CCSQ 2KXCA 2EGAA 1ARKA 3I56T 5L23A 2LRQA 5I21A 4F16A 1Q81U 4C0DB 1PNJA 5IXBA 1QQJA 4OB0B 2J7IA 2DL8A 3GBQA 3L2RA 4R0KA 2RHYA 2DYIA 5CKEA 3X24B 2DIGA 1OEBA 4AMCA 3SDZA 1PHTA 2YRVA 3G71T 1VIEA 1S1NA 1UTIA 2FYKA 2KROA 4WTOB 1PKSA 2CUDA 3I5SA 3JV3A 2L3QA 4FYYB 4QQ6A 4BI3A 4M7AA 2HDAA 3MO8A 2FRYA 4RTUA 1TWBA 3OS0A 1E6HA 4RTZA 1OQKA 1VQPA 3JB9J 2A37A 2KY9A 3FDRA 2FRWA 5AYFA 5FLXE 5C6SA 3VU3C 2KAFA 1PSEA 1VQ5Q 1RUWA 2NUPA 2RMOA 4J9EA 2ESWA 2YUNA 4XU0A 2BKDN 4M7AE 3QYGB 2A28A 1YITT 1OU9A 4IUPA 1C6VX 5FWCA 1RI0A 2EYYA 4DBQA 1N9RA 4BUGA 1YHQT 4OMMA 1VQKA 1M1KC 2OTJQ 4PJOG 3JB9D 4QW2A 3PTAA 2YLCA 1VOMA 1M2VB 1TTHB 3KUFA 4K11A 2H3JA 3NGPA 1QKXA 1RL2A 4C92C 2YUOA 3CXCP 1E6GA 4ATOA 3WVEB 4RKUE 2VC8A 2W0ZA 3VV0A 2HEQA 4XTUA 1FWZA 5GAMj 1QWEA 1NLPC 2KR3A 2ZGWA 1AZGB 2NUZA 1W1FA 3VS6A 1NPPA 3C95A 4EMKB 3VJPA 4KGVB 1AOJA 2NLUA 5LL6S 4P5NA 1I0CA 1NEGA 1I1JA 4BY6B 3M0PA 2K9GA 5EC7A 2CYZB 3CCET 3CCST 1UHCA 2VASA 4M77A
chains in the Genus database with same CATH topology
2YUQA 1SRMA 3NHNA 1MUZA 1N5ZA 1SEMA 2KYMA 1J3TA 1EFNA 3EG1A 1XOVA 2DBMA 4E6RA 1KJWA 2DF6A 3M0RA 1JQQA 2O9SA 4D8KA 2D8JA 1M3CA 4OMOA 2C0IA 1M3BA 3H0FA 2B86A 1QKWA 2J6FA 1AWOA 1YWOA 4RTVA 4JZ3A 1WX6A 2RQTA 3O5ZA 1TUDA 2DRMA 1CKAA 2KRSA 1IO6A 2ENMA 4F17A 2JMCA 2J6KA 4X1VA 1E7OA 1OPKA 4RTYA 1YNZA 1ZUUA 1AWXA 1UDLA 3PVLA 1UUEA 2EVRA 1ABOA 3EGUA 3NMZC 2PNIA 4WCIA 2CUBA 1UHFA 1VA7A 3VS5A 2LX7A 2GBQA 2LJ0A 2JM8A 2D0NA 1X2QA 2JS0A 1ABQA 2F2WA 2AKLA 1GFCA 2RNAA 2RN8A 4AFQC 1SSHA 5ECAA 2FEIA 1BB9A 2HCKA 2LQNA 3I9QA 3QWXX 1AWWA 3REAB 3SEMA 1K0SA 5GJWB 1T3SA 2JT4A 2K3BA 1LCKA 3C0CA 3UF4A 4EIKA 4ORZA 4J9IA 3I5RA 3RBBB 1HJDA 1UFFA 4CC2A 4IIMA 3CQTA 2GQIA 1BK2A 1GCQC 2P4RA 2K2MA 4RTXA 1WI7A 1A0NB 2CDTA 2LNHB 2VVKA 1WXTA 2PTKA 2RQRA 2F2VA 4CC3A 2DM1A 1M27C 2DMOA 2VKNA 1PWTA 1FMKA 1KSWA 1H3HA 2LJ1A 2DYBA 3M0SA 5IXFA 3RNJA 3EHQA 1Y57A 2CSQA 5IHIA 2YDLA 1X43A 2CT4A 1YWPA 4J9HA 1UG1A 4LNPA 2X3XD 1I07A 1AD5A 2O2OA 2RF0A 2O88A 1GBRA 4FSSA 3IQLA 1H8KA 2KNBB 1WDXA 1SHGA 4DEYA 1M30A 2EYZA 1GL5A 2GGRA 4J9CA 3U23A 2MOXA 2DA9A 2DL4A 4F14A 2KE9A 5IH2A 1K1ZA 1T0JA 2I0NA 1JXMA 1RI9A 2OI3A 2X3WD 4DEXA 2EW3A 2E5KA 2FPEA 2DBKA 2L2PA 4Z8AA 2GNCA 4RUGA 1H92A 2ED0A 1M3AA 3VRZA 1T3LA 3VS1A 4J9DA 2L3SA 1KFZA 4LUDA 2ABLA 1Z9ZA 3EG0A 2ROTA 2JM9A 1WFWA 1YN8A 2L0AA 3VS3A 2QDLA 2LCSA 1ZBJA 1GRIA 5FWBA 3UA6A 1WXBA 4Y92A 4AG1C 1V1CA 1WA7A 4M4ZA 4IIOA 2L3PA 2AKKA 2FPDA 1HSQA 1YCSB 3M0QA 3M0UA 1ZX6A 3SHWA 2LMJA 1NYGA 1BU1A 1VYTA 2BZ8A 2SEMA 1MV3A 2W10A 2AZSA 5IHNA 1Y0MA 1FYNA 2CH4W 2KRMA 1ZSGA 4KRTA 2EBPA 2KRNA 1AWJA 2V1QA 1U06A 2FO0A 1SPKA 3PE0A 2DJQA 2KT8A 5I22A 1YP5A 1U5SA 2H8HA 2F2XA 1X6BA 2NWMA 1B3QA 2DL5A 3FJ5A 2DILA 3VS0A 2C0TA 1GBQA 3H41A 1G83A 2DVJA 3ULRB 2BTTA 2RQVA 2FG0A 2YT6A 2EYWA 2G6FX 3THKA 4OMLA 2EKHA 1NYFA 4LUEA 3TSZA 1WLPB 2J06A 2KXDA 2ROLA 2OAWA 2IIMA 2CH4A 3EG2A 1G2BA 2JTEA 1QLYA 3VS2A 4JJBA 5HCKA 2DRKA 2ECZA 2YSQA 1RLQC 2FPFA 2RQUA 2M0YA 4LE9A 3PVQA 2CT3A 4AFUC 3NPFA 5FW9A 4HVUA 2HSPA 4CC4B 1UJ0A 3H0HA 1WIEA 2JW4A 2KT1A 2OJ2A 3VS4A 4OMQA 1AVZC 2EGEA 1BBZA 3I35A 3UATA 1W6XA 2JMAA 2M51A 2GTOA 4GBQA 4HCKA 2DNUA 2PZ1A 4QT7A 2O9VA 3REBB 2KXCA 2J6OA 1NLOC 3EHRA 2D1XA 2EGAA 1ARKA 2LQWA 2CSIA 4J9BA 1RLPC 4HVVA 5L23A 3LH5A 1AZEA 4F16A 1PRLC 2KEAA 1W70A 4A63B 4Z89A 3UA7A 2AZVA 1PNJA 4CC7A 5IXBA 4RTTA 1T0HA 2J7IA 3TSWA 2DL8A 3GBQA 2D8HA 1QCFA 4R0KA 2DL7A 1OEBA 4ESRA 1PHTA 2KGTA 1K4US 1ZUYA 1S1NA 1UTIA 2RPNA 2MIOA 2V1RA 2KROA 2A36A 2HBWA 4OMPA 1PKSA 2CUDA 2KBTA 1ZUKA 2MCNA 3I5SA 1UE9A 2L3QA 2BZXA 2XMFA 3JV3A 2KYBA 1CKBA 1K0XA 2HDAA 2FRYA 2RQWA 4RTUA 4JPBW 2JXBA 1E6HA 4RTZA 1SRLA 1NM7A 2C0OA 3VRYA 4AFSC 1KIKA 4J9GA 2A37A 2EPDA 2FRWA 1K76A 2LZ6B 1GFDA 3KFVA 1PKTA 1RUWA 1VYUA 1ZLMA 2RMOA 4J9EA 4AFZC 3ZL7C 2SRCA 3QWYA 2ESWA 2YUNA 1B07A 1OOTA 1MV0B 2A28A 1UJYA 5FWCA 2EYYA 4ZNXA 2EGCA 4RTWA 2DX1A 1UGVA 3R6NA 4D8DA 1JXOA 4OMMA 1TG0A 2A08A 2DLPA 1WYXA 2ED1A 3TVTA 1K9AA 1JO8A 1Z9QA 2JS2A 4K11A 2VWFA 4JZ4A 3NGPA 1QKXA 4JJDA 2LJ3A 4LN2A 2O31A 2BZYA 2EQIA 2K6DA 2YUOA 1TUCA 5IHKA 1E6GA 4JJCA 1OV3A 5GJVB 1M8MA 1VYVA 3M0TA 2W0ZA 4J9FA 2DL3A 2HEQA 1GCQA 1QWEA 1NLPC 1UECA 1PRMC 1CSKA 2AK5A 2KR3A 1AEYA 4OMNA 1X69A 2LP5A 1JU5C 4Z88A 1NEBA 2K7AA 3EG3A 1AZGB 2NUZA 1W1FA 4HXJA 3VS6A 4AG2C 4HVWA 1NG2A 2YUPA 1HD3A 2K79A 1AOJA 1X27A 3VS7A 3A98A 1OPLA 1QWFA 1I0CA 1GCPA 3H0IA 1NEGA 1I1JA 2EYXA 2J05A 3M0PA 1JEGA 2K9GA 4GLMA 1WXUA 5EC7A 1X2KA 2GTJA 5I11A 2CREA 1SHFA 2DE0X 1X6GA 1UHCA 1U3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YUQ A;  1SRM A;  3NHN A;  1MUZ A;  1N5Z A;  1SEM A;  2KYM A;  1J3T A;  1EFN A;  3EG1 A;  1XOV A;  2DBM A;  4E6R A;  1KJW A;  2DF6 A;  3M0R A;  1JQQ A;  2O9S A;  4D8K A;  2D8J A;  1M3C A;  4OMO A;  2C0I A;  1M3B A;  3H0F A;  2B86 A;  1QKW A;  2J6F A;  1AWO A;  1YWO A;  4RTV A;  4JZ3 A;  1WX6 A;  2RQT A;  3O5Z A;  1TUD A;  2DRM A;  1CKA A;  2KRS A;  1IO6 A;  2ENM A;  4F17 A;  2JMC A;  2J6K A;  4X1V A;  1E7O A;  1OPK A;  4RTY A;  1YNZ A;  1ZUU A;  1AWX A;  1UDL A;  3PVL A;  1UUE A;  2EVR A;  1ABO A;  3EGU A;  3NMZ C;  2PNI A;  4WCI A;  2CUB A;  1UHF A;  1VA7 A;  3VS5 A;  2LX7 A;  2GBQ A;  2LJ0 A;  2JM8 A;  2D0N A;  1X2Q A;  2JS0 A;  1ABQ A;  2F2W A;  2AKL A;  1GFC A;  2RNA A;  2RN8 A;  4AFQ C;  1SSH A;  5ECA A;  2FEI A;  1BB9 A;  2HCK A;  2LQN A;  3I9Q A;  3QWX X;  1AWW A;  3REA B;  3SEM A;  1K0S A;  5GJW B;  1T3S A;  2JT4 A;  2K3B A;  1LCK A;  3C0C A;  3UF4 A;  4EIK A;  4ORZ A;  4J9I A;  3I5R A;  3RBB B;  1HJD A;  1UFF A;  4CC2 A;  4IIM A;  3CQT A;  2GQI A;  1BK2 A;  1GCQ C;  2P4R A;  2K2M A;  4RTX A;  1WI7 A;  1A0N B;  2CDT A;  2LNH B;  2VVK A;  1WXT A;  2PTK A;  2RQR A;  2F2V A;  4CC3 A;  2DM1 A;  1M27 C;  2DMO A;  2VKN A;  1PWT A;  1FMK A;  1KSW A;  1H3H A;  2LJ1 A;  2DYB A;  3M0S A;  5IXF A;  3RNJ A;  3EHQ A;  1Y57 A;  2CSQ A;  5IHI A;  2YDL A;  1X43 A;  2CT4 A;  1YWP A;  4J9H A;  1UG1 A;  4LNP A;  2X3X D;  1I07 A;  1AD5 A;  2O2O A;  2RF0 A;  2O88 A;  1GBR A;  4FSS A;  3IQL A;  1H8K A;  2KNB B;  1WDX A;  1SHG A;  4DEY A;  1M30 A;  2EYZ A;  1GL5 A;  2GGR A;  4J9C A;  3U23 A;  2MOX A;  2DA9 A;  2DL4 A;  4F14 A;  2KE9 A;  5IH2 A;  1K1Z A;  1T0J A;  2I0N A;  1JXM A;  1RI9 A;  2OI3 A;  2X3W D;  4DEX A;  2EW3 A;  2E5K A;  2FPE A;  2DBK A;  2L2P A;  4Z8A A;  2GNC A;  4RUG A;  1H92 A;  2ED0 A;  1M3A A;  3VRZ A;  1T3L A;  3VS1 A;  4J9D A;  2L3S A;  1KFZ A;  4LUD A;  2ABL A;  1Z9Z A;  3EG0 A;  2ROT A;  2JM9 A;  1WFW A;  1YN8 A;  2L0A A;  3VS3 A;  2QDL A;  2LCS A;  1ZBJ A;  1GRI A;  5FWB A;  3UA6 A;  1WXB A;  4Y92 A;  4AG1 C;  1V1C A;  1WA7 A;  4M4Z A;  4IIO A;  2L3P A;  2AKK A;  2FPD A;  1HSQ A;  1YCS B;  3M0Q A;  3M0U A;  1ZX6 A;  3SHW A;  2LMJ A;  1NYG A;  1BU1 A;  1VYT A;  2BZ8 A;  2SEM A;  1MV3 A;  2W10 A;  2AZS A;  5IHN A;  1Y0M A;  1FYN A;  2CH4 W;  2KRM A;  1ZSG A;  4KRT A;  2EBP A;  2KRN A;  1AWJ A;  2V1Q A;  1U06 A;  2FO0 A;  1SPK A;  3PE0 A;  2DJQ A;  2KT8 A;  5I22 A;  1YP5 A;  1U5S A;  2H8H A;  2F2X A;  1X6B A;  2NWM A;  1B3Q A;  2DL5 A;  3FJ5 A;  2DIL A;  3VS0 A;  2C0T A;  1GBQ A;  3H41 A;  1G83 A;  2DVJ A;  3ULR B;  2BTT A;  2RQV A;  2FG0 A;  2YT6 A;  2EYW A;  2G6F X;  3THK A;  4OML A;  2EKH A;  1NYF A;  4LUE A;  3TSZ A;  1WLP B;  2J06 A;  2KXD A;  2ROL A;  2OAW A;  2IIM A;  2CH4 A;  3EG2 A;  1G2B A;  2JTE A;  1QLY A;  3VS2 A;  4JJB A;  5HCK A;  2DRK A;  2ECZ A;  2YSQ A;  1RLQ C;  2FPF A;  2RQU A;  2M0Y A;  4LE9 A;  3PVQ A;  2CT3 A;  4AFU C;  3NPF A;  5FW9 A;  4HVU A;  2HSP A;  4CC4 B;  1UJ0 A;  3H0H A;  1WIE A;  2JW4 A;  2KT1 A;  2OJ2 A;  3VS4 A;  4OMQ A;  1AVZ C;  2EGE A;  1BBZ A;  3I35 A;  3UAT A;  1W6X A;  2JMA A;  2M51 A;  2GTO A;  4GBQ A;  4HCK A;  2DNU A;  2PZ1 A;  4QT7 A;  2O9V A;  3REB B;  2KXC A;  2J6O A;  1NLO C;  3EHR A;  2D1X A;  2EGA A;  1ARK A;  2LQW A;  2CSI A;  4J9B A;  1RLP C;  4HVV A;  5L23 A;  3LH5 A;  1AZE A;  4F16 A;  1PRL C;  2KEA A;  1W70 A;  4A63 B;  4Z89 A;  3UA7 A;  2AZV A;  1PNJ A;  4CC7 A;  5IXB A;  4RTT A;  1T0H A;  2J7I A;  3TSW A;  2DL8 A;  3GBQ A;  2D8H A;  1QCF A;  4R0K A;  2DL7 A;  1OEB A;  4ESR A;  1PHT A;  2KGT A;  1K4U S;  1ZUY A;  1S1N A;  1UTI A;  2RPN A;  2MIO A;  2V1R A;  2KRO A;  2A36 A;  2HBW A;  4OMP A;  1PKS A;  2CUD A;  2KBT A;  1ZUK A;  2MCN A;  3I5S A;  1UE9 A;  2L3Q A;  2BZX A;  2XMF A;  3JV3 A;  2KYB A;  1CKB A;  1K0X A;  2HDA A;  2FRY A;  2RQW A;  4RTU A;  4JPB W;  2JXB A;  1E6H A;  4RTZ A;  1SRL A;  1NM7 A;  2C0O A;  3VRY A;  4AFS C;  1KIK A;  4J9G A;  2A37 A;  2EPD A;  2FRW A;  1K76 A;  2LZ6 B;  1GFD A;  3KFV A;  1PKT A;  1RUW A;  1VYU A;  1ZLM A;  2RMO A;  4J9E A;  4AFZ C;  3ZL7 C;  2SRC A;  3QWY A;  2ESW A;  2YUN A;  1B07 A;  1OOT A;  1MV0 B;  2A28 A;  1UJY A;  5FWC A;  2EYY A;  4ZNX A;  2EGC A;  4RTW A;  2DX1 A;  1UGV A;  3R6N A;  4D8D A;  1JXO A;  4OMM A;  1TG0 A;  2A08 A;  2DLP A;  1WYX A;  2ED1 A;  3TVT A;  1K9A A;  1JO8 A;  1Z9Q A;  2JS2 A;  4K11 A;  2VWF A;  4JZ4 A;  3NGP A;  1QKX A;  4JJD A;  2LJ3 A;  4LN2 A;  2O31 A;  2BZY A;  2EQI A;  2K6D A;  2YUO A;  1TUC A;  5IHK A;  1E6G A;  4JJC A;  1OV3 A;  5GJV B;  1M8M A;  1VYV A;  3M0T A;  2W0Z A;  4J9F A;  2DL3 A;  2HEQ A;  1GCQ A;  1QWE A;  1NLP C;  1UEC A;  1PRM C;  1CSK A;  2AK5 A;  2KR3 A;  1AEY A;  4OMN A;  1X69 A;  2LP5 A;  1JU5 C;  4Z88 A;  1NEB A;  2K7A A;  3EG3 A;  1AZG B;  2NUZ A;  1W1F A;  4HXJ A;  3VS6 A;  4AG2 C;  4HVW A;  1NG2 A;  2YUP A;  1HD3 A;  2K79 A;  1AOJ A;  1X27 A;  3VS7 A;  3A98 A;  1OPL A;  1QWF A;  1I0C A;  1GCP A;  3H0I A;  1NEG A;  1I1J A;  2EYX A;  2J05 A;  3M0P A;  1JEG A;  2K9G A;  4GLM A;  1WXU A;  5EC7 A;  1X2K A;  2GTJ A;  5I11 A;  2CRE A;  1SHF A;  2DE0 X;  1X6G A;  1UHC A;  1U3O A; 
#chains in the Genus database with same CATH topology
 1Q82 C;  3RIR A;  3SWN B;  2KYM A;  1J3T A;  4MDW A;  3GLX A;  2PUK B;  1KJW A;  2DF6 A;  5KYU B;  2O9S A;  4M7A C;  4ZN1 A;  3CME A;  4FW1 A;  2C0I A;  2K4Y A;  1MGQ A;  1OZ3 A;  2J6F A;  1M5Q 1;  2Y4X A;  1VIF A;  2V26 A;  4L6V 5;  1VQ9 Q;  2KRS A;  3OY9 A;  1IO6 A;  2ENM A;  4F17 A;  3CCM Q;  1W2B S;  4N0A A;  2J6K A;  1E7O A;  4PL6 A;  3CCQ T;  1MMD A;  1OPK A;  2QAS A;  5GAN g;  2E3I A;  4M78 G;  2PNI A;  2A7Y A;  4M78 D;  1K9M R;  2COZ A;  4MDX A;  3CCL Q;  2GBQ A;  3MP8 A;  1VQ4 Q;  2D0N A;  2JS0 A;  1ABQ A;  1TSF A;  2B8A A;  2AKL A;  4V2S A;  4DOW A;  2R57 A;  3AHU A;  1QVF A;  3I9Q A;  1VQ5 T;  3QWX X;  1IRE B;  3REA B;  3SEM A;  3OYD A;  2AHJ B;  2K3B A;  2EQK A;  3OYK A;  4J6W A;  1OX9 A;  4ORZ A;  4F7U F;  3RBB B;  4M75 F;  4ZTJ A;  1UFF A;  3URG A;  1WQW A;  2QAZ A;  1BI3 A;  2OTJ T;  2K2M A;  4RTX A;  1QVG S;  3INZ A;  1A0N B;  2CDT A;  3BW1 A;  5GMK i;  2PU9 B;  4FSX A;  3OYF A;  3M55 A;  2RQR A;  3JCM g;  1PD1 A;  2F2V A;  1QCO A;  2HQH A;  3R6O A;  1K9M U;  4QVD A;  2P4T A;  1FMK A;  1KSW A;  3QZ9 B;  2LJ1 A;  3M0S A;  3RNJ A;  3L2Z A;  3M54 A;  4KGZ B;  3S3O A;  5D6Y A;  2CSQ A;  4ELY C;  2YDL A;  1WJQ A;  2CT4 A;  1TH7 A;  4B6M A;  3CXC A;  4M7D G;  2L89 A;  4LNP A;  4M7D D;  4M77 C;  2O88 A;  2CP0 A;  3L2V A;  1H8K A;  4J83 A;  2EYZ A;  4JS5 A;  2BE7 D;  1ZA2 B;  3U23 A;  1RAE B;  4BE2 A;  2ZPF B;  3DLL A;  1T0J A;  1WQ7 A;  1B34 A;  2OI3 A;  4DEX A;  4E7S A;  4Y91 A;  2L3R A;  3A8G B;  2EW3 A;  5C0M A;  2FPE A;  2DBK A;  2MK5 A;  4XTY A;  2DTO A;  2C06 A;  1ZBX A;  1H92 A;  3M56 A;  5GAM f;  1KD1 C;  4A4H A;  2L3S A;  4LUD A;  1QMC A;  4MZM A;  3HP9 A;  2MAM A;  1P92 A;  4N0A C;  3QUI A;  4QQG A;  1YN8 A;  1EZZ B;  3RKX A;  2XHC A;  1VQL Q;  3HPW A;  3SFM A;  2L5Q A;  3LW5 E;  2ZPB B;  1YI2 A;  2M02 A;  2OTL T;  1HSQ A;  1V76 A;  3J7A F;  5DLO A;  4XU2 A;  1HK9 A;  3CCM T;  3F70 A;  1N8R C;  8ATC B;  4PNO A;  4XTZ A;  1X6O A;  2QTX A;  2SEM A;  1M9S A;  2X4X A;  4O6J A;  4KRT A;  3CCL T;  1TS9 A;  2DAQ A;  2KRN A;  1VQ4 T;  4M78 A;  1SPK A;  1VQM A;  2KT8 A;  2A0F B;  4CRI A;  3L2W A;  5GAN d;  2F2X A;  3TU4 K;  3ZFJ A;  3FJ5 A;  2X9H A;  3OYI A;  4PJO C;  5LJ3 f;  3L1A A;  1QP2 A;  5CK9 A;  4FYW B;  4A4E A;  3ULR B;  2PQW A;  4JDS A;  4KBM B;  1VQ7 A;  2E65 A;  2RQV A;  1NJI C;  2FG0 A;  3EG9 A;  2KI7 A;  2G6F X;  4OML A;  3HRT A;  3L2Q A;  3P8D A;  5GMK j;  2K3Y A;  4JLI A;  5IT9 E;  3S6W A;  3OYA A;  5D6W A;  2MWO A;  2ROL A;  3FB9 A;  2ATC B;  2CH4 A;  3EFO A;  3OS5 A;  2JTE A;  4JJB A;  2E1H A;  4ME7 A;  5HCK A;  1YBY A;  5KYW A;  3QJY A;  2FPF A;  4LE9 A;  2JTM A;  5GAN h;  3JCM d;  4PLL A;  3G4S Q;  4CC4 B;  4RG8 A;  3QYH B;  3CD6 A;  3VS4 A;  1VQN Q;  1VQ6 A;  1AVZ C;  4M7D A;  1RAA B;  1HYO A;  4LD6 A;  5CVI A;  4A4K A;  3UAT A;  4C0Z A;  2QQS A;  2JMA A;  4QQD A;  2VXF A;  4C8Q F;  2O9V A;  3REB B;  2R5M A;  2D1X A;  1R0C B;  3LLR A;  2CSI A;  1IGU A;  2QQ9 A;  4HVV A;  4C5E A;  2HSE B;  3AT1 B;  2LCL A;  1AZE A;  1WJR A;  4C5I A;  2LX9 A;  4CC7 A;  5I2S A;  1EIF A;  2D8H A;  1QCF A;  4E7I A;  1VQL T;  2EKO A;  3JCM h;  2RB6 A;  4F7U B;  2KMT A;  2WSE E;  2X35 A;  2E64 A;  4M75 B;  4M78 C;  4OMP A;  2NUT A;  1ZUK A;  1WHG A;  1CKB A;  1KHC A;  3V8K A;  3M53 A;  3OYY A;  3D7S B;  1M1G A;  5A0D A;  5GAM e;  2PVO B;  4D6W A;  1PM3 A;  3OYM A;  2C0O A;  4AFS C;  3OSS C;  1KC8 R;  2HMA A;  5CQY A;  1K76 A;  3RER A;  5KCO A;  1VYU A;  1Y7X A;  3ZL7 C;  2SRC A;  3QWY A;  4FM4 B;  4JRQ A;  1TUG B;  5HY6 A;  1YCY A;  1MV0 B;  2DD4 A;  5CQX A;  2HQX A;  3CCV A;  3TEE A;  3H6Z A;  4BE0 A;  2EGC A;  2IG0 A;  4RTW A;  1JXO A;  1VQ8 Q;  2ED1 A;  1BIA A;  3JCM W;  1JB0 E;  4IUV A;  4JJD A;  4LN2 A;  2O31 A;  4PK4 A;  2BZY A;  2VB6 A;  3T9N A;  2K6D A;  1VQP Q;  1IXD A;  2EYQ A;  5IHK A;  4JJC A;  5IN1 A;  1NE8 A;  1I5O B;  2M0O A;  1M8M A;  1UEB A;  4ZGE B;  3I56 A;  4M7D C;  3M57 A;  4M75 D;  2HZY A;  1KC8 U;  1Y07 A;  5A0G A;  2DEU A;  1AEY A;  4OMN A;  2LP5 A;  2EJF A;  2K7A A;  3LWI A;  5CKH A;  3G4S T;  1U1S A;  2K79 A;  1X27 A;  3VS7 A;  5GMK h;  3A98 A;  1G3Y A;  1VQN T;  3CPF A;  4BI8 B;  3CPW S;  3G71 A;  3RKY A;  2GTJ A;  5I11 A;  3OMG A;  1X6G A;  4J8O A;  5CKD A;  5FU6 C;  1ZA1 B;  4A53 A;  1QVF S;  1MUZ A;  4PFZ A;  1OUL A;  1K8A C;  3LWH A;  1QW1 A;  4DQ2 A;  2YXY A;  2DPP B;  3EG1 A;  3RMQ A;  4DA4 A;  3I55 T;  2RHI A;  4EMG A;  1Q95 G;  4C0F A;  1KG1 A;  1SF9 A;  3EFS A;  4N4H A;  5J39 A;  1YWO A;  4RTV A;  4JZ3 A;  4FYV B;  1WX6 A;  2CZ0 B;  1XNI A;  1WHK A;  2JMC A;  4X1V A;  3QBY A;  5LJ5 g;  3MET A;  4XAX B;  2EJ9 A;  2WSF E;  1ZUU A;  1AWX A;  1EX4 A;  1UDL A;  3OW2 S;  2CP5 A;  2WSC E;  2EVR A;  5J3B A;  3EGU A;  2DJZ A;  4B9W A;  3X20 B;  4UC4 A;  3CC7 T;  2CUB A;  2RJE A;  3G1J A;  1VA7 A;  3CC2 T;  4BE1 A;  2DXT A;  2ZZD A;  3VYH B;  4R55 A;  2LJ0 A;  2RHZ A;  3MP1 A;  4IUT A;  4AFQ C;  3OSV A;  2FEI A;  1WHH A;  2LQN A;  4DOV A;  2QEX Q;  1K0S A;  1U1T A;  2E70 A;  3FRN A;  2JT4 A;  1G8X A;  3JCM e;  4DBF A;  1HJD A;  2F1L A;  3L42 A;  4C92 F;  1JBM A;  1VQ8 T;  4PFP A;  1IZ6 A;  4Y28 E;  1D3B B;  4C8Q B;  3CC4 Q;  4RCC A;  1WXT A;  3QO3 A;  5M9O A;  2PTK A;  2DD5 A;  2DM1 A;  3CCS A;  3CCU A;  4FIB A;  2JN0 A;  1JJ2 S;  5IXF A;  1NJI U;  3EHQ A;  3CCR Q;  1PC0 A;  3S3N A;  1G3W A;  1C1A A;  3OMC A;  1UG1 A;  4C0G A;  1RAC B;  2X3X D;  2RF0 A;  4QVZ A;  3QZ5 B;  2XKO C;  6AT1 B;  2VYT A;  3M5A A;  3PFS A;  1WDX A;  4DEY A;  5IAY A;  1VQO Q;  3L2U A;  2ZPG B;  1KHI A;  2E6Z A;  2GGR A;  5I2M A;  1GL5 A;  4RG2 A;  2MOX A;  3JB9 G;  3QDF A;  2DA9 A;  1Q86 C;  4JJN K;  2COY A;  1K1Z A;  1YIJ Q;  1QP3 A;  2I0N A;  2D0Q B;  1JXM A;  1RI9 A;  4IUU A;  5KH6 A;  1AHJ B;  3CCQ A;  4OP0 A;  1M3A A;  1T3L A;  3VS1 A;  4F7U E;  2CP2 A;  1Q7Y C;  4M75 E;  5J26 A;  1ZSZ B;  1YJ9 A;  3HFO A;  3CCJ Q;  3EAE A;  1H64 1;  1ZBJ A;  4IKF A;  1GRI A;  4J5Y A;  1WXB A;  4Y92 A;  1LNX A;  3G6E Q;  4EPC A;  3TQ7 P;  4M4Z A;  5GMK e;  2L3P A;  1YCS B;  3M0Q A;  5KCH A;  2FZG B;  2DET A;  1RAH B;  2YLB A;  4AT1 B;  2K3X A;  1ZX6 A;  3GF5 A;  1BU1 A;  1VYT A;  3HHT B;  1MV3 A;  5IHN A;  1UGR B;  1M90 C;  4PJN A;  2OTJ A;  3G7Z A;  4XTV A;  3A8M B;  2CH4 W;  1OYX A;  1ZSG A;  1RAD B;  2JZ2 A;  4FW2 A;  2EWN A;  1U06 A;  1UGP B;  2FO0 A;  1WPY A;  2DJQ A;  5I22 A;  5LJ5 d;  2E12 A;  5KYX B;  1K73 R;  2LC4 A;  3OB9 A;  2QEX T;  3X25 B;  2OX7 A;  3JAM E;  3OQ5 A;  2XIC A;  1B3Q A;  2RHU A;  3VS0 A;  1YI2 Q;  1Y96 B;  5GAN j;  3EGX B;  3JB9 I;  3OYN A;  3UPU A;  5KYY B;  3GPL A;  2XDD A;  2FHD A;  4QKU A;  2XDP A;  1OU8 A;  2YT6 A;  3BE3 A;  3THK A;  1YJN Q;  5GAO l;  3MHX A;  2EKH A;  1NYF A;  1RAF B;  2MMP A;  3CC4 T;  4MML A;  4LUE A;  3TSZ A;  2RI2 A;  2RK1 A;  1WHM A;  3RMS A;  2IIM A;  3EG2 A;  3E9G A;  2D6F A;  1QLY A;  4N4I A;  2FB7 A;  4BDY A;  3RES A;  2ECZ A;  2DTH A;  4XU1 A;  2LT4 A;  4M77 F;  1RLQ C;  4XU3 A;  5LJ5 h;  3CCR T;  1X75 C;  2CT3 A;  1PCX A;  5FW9 A;  4HVU A;  1K73 U;  1UGQ B;  2FZK B;  4XQ3 A;  2QQA A;  3H0H A;  1VQ7 Q;  4OMQ A;  1W4S A;  4JLG A;  2F5K A;  3VUB A;  4PLI A;  3JCM b;  1R0B G;  2QQB A;  1VQO T;  1W6X A;  2OTL A;  3QXE B;  4XTW A;  2GTO A;  4HCK A;  5CAI A;  2DNU A;  1Q81 C;  1QVG P;  2O4X B;  2QTV A;  2CZ7 B;  3FEO A;  1YIJ T;  3CCM A;  1WHL A;  1BI1 A;  3OBY A;  3H8Z A;  2LQW A;  5HK0 A;  4J9B A;  3NFC A;  1RLP C;  2AIR B;  2X4W A;  3LH5 A;  2VUB A;  2MPX C;  4A63 B;  5DY9 A;  5FU7 C;  2QXF A;  4PFO A;  3UA7 A;  2AZV A;  3CCL A;  4RTT A;  3CCJ T;  1T0H A;  3WVD B;  1H3Z A;  1M2V A;  4JUV A;  3TCJ A;  3G6E T;  1VQ9 T;  4BDZ A;  2KGT A;  3C12 A;  1I4K 1;  1K4U S;  2RPN A;  2MIO A;  1OI1 A;  2A36 A;  2HBW A;  5LJ3 d;  2MCN A;  2YHT A;  3JSC A;  2QA4 A;  1XTD A;  1K0X A;  4C92 B;  2XID A;  3UT1 A;  2XDB A;  1FMV A;  2XG8 D;  2JVV A;  4Z02 A;  2RM4 A;  2RQW A;  4X9D A;  1I5L A;  4JPB W;  2DZ9 A;  1M1K R;  1MNE A;  1IHW A;  1NM7 A;  3QPH A;  3OYJ A;  2PUO B;  2EPD A;  3OYH A;  4EMK A;  2V8K A;  1GFD A;  2EQU A;  1NPR A;  1ZLM A;  4AFZ C;  4C8Q E;  4PJO F;  4C0D C;  1R77 A;  4WF2 A;  1VUB A;  3OS1 A;  2CKK A;  1YI2 T;  1YJW Q;  4XTX A;  4ZNX A;  5DLQ E;  2V8I A;  1I8F A;  2DX1 A;  1UGV A;  4D8D A;  3C4S A;  5DM7 R;  1TG0 A;  3LX7 A;  4ZGD B;  3SWN A;  2A08 A;  2E6N A;  2GQV A;  3QG1 A;  3TRE A;  4A54 A;  5GAN 7;  3OS2 A;  5LJ3 h;  1K9A A;  3TVT A;  3MEU A;  5KYU A;  1YJN T;  1KK7 A;  4JZ4 A;  2RI5 A;  2M16 A;  2KDS A;  1YFN A;  2RJD A;  1OV3 A;  2E41 A;  5GJV B;  3CMA A;  1M1K U;  2JTF A;  4E2F B;  1VYV A;  5CKB A;  3J80 E;  1OZ2 A;  4M7A B;  4JS4 A;  1Q82 R;  2DL3 A;  1S72 Q;  1BCM A;  4FYX B;  3UDC A;  1GCQ A;  4KH0 B;  1UEC A;  1PRM C;  2AK5 A;  4HA8 A;  3FIF A;  1G3T A;  5GAO q;  2LDM A;  1JU5 C;  4Z88 A;  5GAO p;  4PKC C;  4FT4 A;  4HXJ A;  3CCV Q;  1N27 A;  4HVW A;  2O01 E;  2K5I A;  2YUP A;  1HD3 A;  4PJL A;  1VQL A;  1OPL A;  2R58 A;  1GCP A;  1WHJ A;  2J05 A;  5CIU A;  2LVM A;  4MZP A;  3ME9 A;  4GLM A;  2GFA A;  1WXU A;  3CBM A;  5A0L A;  1X2K A;  4PJJ A;  3QKJ A;  1SHF A;  3FC3 A;  3NTH A;  1U3O A;  3NHN A;  1N5Z A;  4MZT A;  1EFN A;  3CBO A;  1BKB A;  2ZPH B;  4E6R A;  3M0R A;  5LJ5 e;  1QVG A;  4D8K A;  3V8L A;  2P0P A;  3RUX A;  5GAN 8;  2V8J A;  3E19 A;  5A2Q E;  1Q82 U;  1M3C A;  3CBP A;  4OMO A;  1M3B A;  3GNG A;  3H0F A;  3JCM f;  1AWO A;  4M78 F;  1QCN A;  2DER A;  5D6X A;  2RQT A;  2CS7 A;  1D0Z A;  4X34 A;  4C5H A;  2ZCF B;  2BIV A;  4EMK C;  3V7C A;  3RKW A;  4RTY A;  4BY6 C;  1MND A;  2G3R A;  1ABO A;  4BAC A;  2IPO B;  3NMZ C;  5GAN 6;  4WCI A;  3VS5 A;  3PMI A;  2LX7 A;  2PVD B;  2KVQ G;  2JM8 A;  3ZBD A;  4J7F A;  2DTI A;  2F2W A;  3PNW C;  1GFC A;  3SWN C;  2LQK A;  1SSH A;  5ECA A;  1AWW A;  4LDV A;  4C5G A;  4M77 B;  1T3S A;  1TU0 B;  1JRI A;  3E2U A;  1LCK A;  4E7K A;  1SKU B;  2HL3 A;  3LH0 A;  2JUF A;  4EIK A;  1TXQ A;  5CKF A;  3I5R A;  1YJW T;  4OB3 B;  2RD1 A;  4CC2 A;  4IIM A;  2GQI A;  1Y71 A;  2CP6 A;  4CI0 C;  1BK2 A;  1RAB B;  3G4S A;  3EFR A;  4BI4 A;  3SB2 A;  1K9M C;  1GCQ C;  4BB7 A;  3M4Y A;  4KUL A;  1VQN A;  2K57 A;  4OVA A;  5GMK l;  1M4Z A;  2VVK A;  2EFI A;  4M7D F;  3V7R A;  2QYZ A;  4GLK A;  4F7U G;  2NYS A;  2QGF B;  1UB4 A;  4M75 G;  3QII A;  2DMO A;  4LXC A;  3BFM A;  4ZGJ B;  8AT1 B;  5FU7 B;  3JCM V;  1KD1 R;  1S72 T;  4OF1 A;  5IHI A;  5GAN 5;  1X43 A;  2COW A;  2HAX A;  2K5F A;  1YWP A;  4E7H A;  3I55 A;  4HCB A;  1LVK A;  1VQK Q;  1AD5 A;  2LCC A;  3CCV T;  3OYB A;  2HNI A;  1PG5 B;  3O8V A;  1M30 A;  2HQE A;  3P8B B;  1UGS B;  4J9C A;  3OYE A;  4IUQ A;  4X9C A;  2CZ6 B;  2E5K A;  4M77 D;  2FZC B;  1NBE B;  2MWP A;  4RUG A;  3DB4 A;  2ED0 A;  3KXT A;  1N8R R;  3CCU Q;  4J9D A;  4KT0 E;  4EDU A;  3NTK A;  3E9F A;  2IVW A;  3CC7 A;  1Z9Z A;  5GAN e;  3CC2 A;  3EG0 A;  4A4F A;  4C92 E;  2ROT A;  2VXE A;  2LCS A;  3ASK A;  3EH2 A;  4PJO B;  3LYI A;  2K5L A;  1KD1 U;  2P84 A;  1YIT A;  1GXI E;  2CGH A;  2AKK A;  1D1B A;  2FPD A;  3JCM Q;  1KQS P;  1YHQ A;  4HCC A;  4N4G A;  4LDX A;  3CPW P;  3VUZ A;  2HKN A;  4TVR A;  2LMJ A;  3SHW A;  2BZ8 A;  7AT1 B;  3CCQ Q;  5GAO m;  2W10 A;  4HCZ A;  1NJI R;  4B9X A;  1Y0M A;  4J6X A;  3MEW A;  3CXC S;  1VQ8 A;  4KUD K;  2MI6 A;  2BUD A;  1QVF P;  1YJ9 Q;  2EBP A;  3CME Q;  2V1Q A;  1N8R U;  1WJS A;  3NTI A;  2DKG A;  1B34 B;  5LJ5 j;  2DIL A;  1FXX A;  4JRK A;  3V8J A;  1GBQ A;  1G83 A;  5GAM g;  1XJW B;  1LOJ A;  1FMW A;  2RA2 A;  2I2L A;  4JRI A;  5CO7 A;  3BDL A;  2VV5 A;  4DBH A;  1VQP T;  3CCE A;  3OW2 P;  1TOV A;  4PJO D;  1RAG B;  2J06 A;  2OAW A;  2VGN A;  1U8R A;  3HKS A;  3VS2 A;  1M8V A;  2ZPI B;  4F7U A;  4II1 A;  3X26 B;  2DRK A;  4M75 A;  2DEQ A;  4E7Z A;  2YSQ A;  2RQU A;  2E4H A;  2P0K A;  4FT2 A;  1R8O B;  3DLM A;  3A1P A;  1VQK T;  5GAN 3;  2LT1 A;  1UJ0 A;  1RAI B;  4M78 B;  1WIE A;  2JW4 A;  2KT1 A;  2OJ2 A;  3C94 A;  3N5B B;  3BDU A;  4L59 A;  5GAO r;  1I81 A;  1NZ9 A;  2RI3 A;  4KH1 B;  4ELZ C;  4OGC A;  1IRX A;  1IHV A;  3A8H B;  1D0Y A;  2EAY A;  2J6O A;  1NLO C;  3EHR A;  3M58 A;  3H9N A;  2QI2 A;  3A5Z B;  3M9Q A;  1G3S A;  4RCB A;  4IUR A;  4M7A F;  5EG2 A;  3CCU T;  3EG9 B;  5LJ3 g;  3V7S A;  1PRL C;  2KEA A;  1W70 A;  4Q5W A;  4Z89 A;  1JJ2 P;  4C8Q G;  4PJM A;  4C8Q D;  1VQ5 A;  2YRD A;  3TSW A;  3VKI A;  2DL7 A;  1BI0 A;  4F04 B;  4ESR A;  2CP3 A;  4LDY A;  3EFO B;  2QEX A;  3OA6 A;  2K2V A;  1ZUY A;  3MKD A;  2V1R A;  4J7I A;  5KYW B;  4NOY A;  2KBT A;  2OTL Q;  1UE9 A;  2XMF A;  2BZX A;  2KYB A;  1QVP A;  2GFU A;  4M77 E;  3JB9 H;  3E1S A;  2QQR A;  5LJ3 j;  2JXB A;  4FL6 A;  1D1A A;  1SRL A;  2E5Q A;  2GF7 A;  3MCA B;  3VRY A;  4M7D B;  3PGG A;  3OBW A;  1KIK A;  1V29 B;  1KQS A;  4J9G A;  1YJ9 T;  3CME T;  4ZN3 A;  3CC4 A;  3A8O B;  2LZ6 B;  3CPW A;  3KFV A;  1PKT A;  2DVE A;  1BYM A;  2AT1 B;  1B07 A;  1XQH A;  2RK2 A;  1OOT A;  2F69 A;  3CCR A;  1UJY A;  1W2B P;  3R6N A;  1F1B B;  2QA4 Q;  2DLP A;  1WYX A;  4BD3 A;  3EH1 A;  3LGL A;  4M75 C;  1JO8 A;  1Z9Q A;  1M1F A;  2JS2 A;  2M1H A;  2VWF A;  2VGM A;  1BCO A;  5FU6 B;  1SSF A;  4JRP A;  1X01 A;  4OB2 B;  1VQO A;  1KC8 C;  2LJ3 A;  1VQM Q;  2QDY B;  5CCA A;  2HL5 C;  2EQI A;  1TUC A;  3UWN A;  1ZHI A;  1WNL A;  5GAM d;  1YIJ A;  2NUT B;  2JNG A;  3M0T A;  4PJO A;  5AT1 B;  5LJ5 f;  4J9F A;  1FX7 A;  3HTR A;  4HT9 A;  3MEA A;  4RMO A;  2KSS A;  3WXM B;  1CSK A;  3VYG A;  3OW2 A;  1K8A R;  4NL3 A;  1X69 A;  1OX8 A;  1AT1 B;  1NEB A;  3EG3 A;  4AG2 C;  3CCJ A;  2DK3 A;  1MMN A;  1NG2 A;  2LNV A;  2BE9 B;  1HXD A;  5KE2 A;  1QWF A;  3H0I A;  2Z0W A;  4A4G A;  4ZTF A;  3HSB A;  3G6E A;  2RHX A;  4E47 A;  3PIO A;  1PSF A;  2EYX A;  1VQ9 A;  1JEG A;  1ZQ1 A;  3PT9 A;  4PJO E;  1N6A A;  2CRE A;  2DE0 X;  2QG9 B;  1KQ2 A;  2E3H A;  3CMA Q;  2QK0 A;  1IGQ A;  2YUQ A;  1SRM A;  1SEM A;  3HRS A;  1LPL A;  4OMF B;  5GAM h;  1XOV A;  1VQ4 A;  2DFU A;  2F5T X;  3MPU B;  2DBM A;  4ANJ A;  2DXB A;  1JQQ A;  5GAN 4;  2XD0 A;  3CD6 Q;  3GIB A;  2D8J A;  1VQ6 Q;  2B86 A;  1QKW A;  2DIQ A;  2HBP A;  4VUB A;  1K8A U;  2EJG A;  3GNF B;  1D3B A;  1D09 B;  2E10 A;  4C8Q A;  2CP7 A;  5CR2 A;  4MMK A;  2P0Q A;  3O5Z A;  1TUD A;  2DRM A;  1JJ2 A;  1BIB A;  1CKA A;  4FCY A;  2KK4 A;  3EGD B;  3GOX A;  4OGE A;  2XI9 A;  1LJO A;  2EQJ A;  3M4G A;  1YNZ A;  3PVL A;  1UUE A;  2PVG B;  5GMK m;  1UHF A;  1O75 A;  3RR6 A;  2DO3 A;  1WGS A;  1YJN A;  2MF2 A;  4E7J A;  1X2Q A;  5FRN A;  2M9U A;  2HKQ B;  2RNA A;  1PD0 A;  2RN8 A;  1BB9 A;  2HCK A;  2A3L A;  3JCM X;  1ACM B;  2Y4Y A;  4FU6 A;  5GJW B;  2XK0 A;  2RH2 A;  4E7L A;  5FRM A;  1B7T A;  3C0C A;  1C0M A;  3UF4 A;  4J9I A;  2ZPE B;  1KQ1 A;  2FL7 A;  3CQT A;  1BI2 A;  2LQ8 A;  2QA4 T;  1ZSZ A;  5KE3 A;  2P4R A;  1SG5 A;  5HK3 A;  1WI7 A;  2LNH B;  2RO0 A;  2R5A A;  3HL8 A;  4M78 E;  1W2B A;  1VQM T;  2DZC A;  1Q86 R;  4CC3 A;  2WAC A;  3A8L B;  5D7U A;  1M27 C;  2JOY A;  2VKN A;  5GAN f;  1PWT A;  3QSU A;  1H3H A;  3MJX A;  2DYB A;  4C92 G;  4KGX B;  4C92 D;  2MYS A;  1IB8 A;  1Q7Y R;  4R56 A;  1Y57 A;  3JB9 F;  4YTL A;  4O5V A;  5HKC A;  3CEY A;  5GAO n;  4J9H A;  1I07 A;  1M2O A;  1VQ7 T;  2O2O A;  2NUP B;  5GAN 2;  3LGF A;  1GBR A;  4FSS A;  4LDW A;  3FJP A;  3OYC A;  3IQL A;  2D9T A;  4LD9 K;  2KNB B;  1SHG A;  2QGG A;  1D0X A;  3DB3 A;  2DL4 A;  4F14 A;  3S3M A;  2KE9 A;  5IH2 A;  5KYX A;  3I56 Q;  2X3W D;  4DBR A;  2YRC A;  2L2P A;  4Z8A A;  2GNC A;  4C8Q C;  3CMA T;  3VRZ A;  2LTO A;  3FLG A;  1KFZ A;  1Y96 A;  3HRU A;  1Q86 U;  3EGX A;  2ABL A;  1M90 R;  2JJ9 A;  2YWW A;  3PMT A;  5FRO A;  5KYY A;  2JM9 A;  1WFW A;  2L0A A;  4NL2 A;  2QDL A;  3VS3 A;  3I55 Q;  3M59 A;  5FWB A;  5L8R E;  3CD6 T;  1Q7Y U;  3UA6 A;  1VQ6 T;  4M7D E;  4AG1 C;  1V1C A;  1WA7 A;  5KYN A;  3HFN A;  3G71 Q;  4M7A G;  4IIO A;  3Q1J A;  4M7A D;  3MP6 A;  3J81 E;  2EIF A;  3MEV A;  1G5V A;  3M0U A;  3JCM J;  1YJW A;  2FVU A;  2L8D A;  1NYG A;  1MMG A;  2AZS A;  2CZ1 B;  1FYN A;  3QDR B;  1WZO A;  2X4Y A;  2KRM A;  3P8H A;  3GP8 A;  3CC7 Q;  2DXC A;  1O9S A;  2XU8 A;  3CC2 Q;  1AWJ A;  1MHN A;  2HD0 A;  3PE0 A;  4GY5 A;  2H3E B;  1YP5 A;  1U5S A;  1ZSZ C;  3JRZ A;  2H8H A;  1MMA A;  4OB1 B;  4QVC A;  1M90 U;  3PIP A;  1DJ7 B;  1X6B A;  2NWM A;  4LDU A;  2DL5 A;  1YIT Q;  9ATC B;  1S72 A;  2O4X A;  2C0T A;  3H41 A;  2DVJ A;  3KBG A;  1YHQ Q;  3ER0 A;  2BTT A;  3X28 B;  2EYW A;  2EQM A;  2GCX A;  2DXU A;  2RJC A;  2KQW A;  4J6Y A;  2Y90 A;  1WLP B;  2KXD A;  2X51 A;  1Q81 R;  1K73 C;  1G2B A;  2OAU A;  4HKE A;  1N9S A;  3JCM c;  4XK8 E;  4HT8 A;  2M0Y A;  3PVQ A;  2X4J A;  4AFU C;  3NPF A;  4C92 A;  4L5G A;  2HSP A;  2ZAE A;  1D1C A;  3EGD A;  3JCM P;  3ZEH A;  3QJ6 A;  4EMH A;  5LJ3 e;  2RJF A;  3QHS A;  4NS5 A;  2EGE A;  1BBZ A;  3OYL A;  3I35 A;  3OYG A;  4KUI A;  4M77 G;  3BY7 A;  3RDV A;  2M51 A;  1KQS S;  3SD4 A;  4GBQ A;  2PZ1 A;  4QT7 A;  3CCE Q;  3DKM A;  3CCS Q;  2KXC A;  2EGA A;  1ARK A;  3I56 T;  5L23 A;  2LRQ A;  5I21 A;  4F16 A;  1Q81 U;  4C0D B;  1PNJ A;  5IXB A;  1QQJ A;  4OB0 B;  2J7I A;  2DL8 A;  3GBQ A;  3L2R A;  4R0K A;  2RHY A;  2DYI A;  5CKE A;  3X24 B;  2DIG A;  1OEB A;  4AMC A;  3SDZ A;  1PHT A;  2YRV A;  3G71 T;  1VIE A;  1S1N A;  1UTI A;  2FYK A;  2KRO A;  4WTO B;  1PKS A;  2CUD A;  3I5S A;  3JV3 A;  2L3Q A;  4FYY B;  4QQ6 A;  4BI3 A;  4M7A A;  2HDA A;  3MO8 A;  2FRY A;  4RTU A;  1TWB A;  3OS0 A;  1E6H A;  4RTZ A;  1OQK A;  1VQP A;  3JB9 J;  2A37 A;  2KY9 A;  3FDR A;  2FRW A;  5AYF A;  5FLX E;  5C6S A;  3VU3 C;  2KAF A;  1PSE A;  1VQ5 Q;  1RUW A;  2NUP A;  2RMO A;  4J9E A;  2ESW A;  2YUN A;  4XU0 A;  2BKD N;  4M7A E;  3QYG B;  2A28 A;  1YIT T;  1OU9 A;  4IUP A;  1C6V X;  5FWC A;  1RI0 A;  2EYY A;  4DBQ A;  1N9R A;  4BUG A;  1YHQ T;  4OMM A;  1VQK A;  1M1K C;  2OTJ Q;  4PJO G;  3JB9 D;  4QW2 A;  3PTA A;  2YLC A;  1VOM A;  1M2V B;  1TTH B;  3KUF A;  4K11 A;  2H3J A;  3NGP A;  1QKX A;  1RL2 A;  4C92 C;  2YUO A;  3CXC P;  1E6G A;  4ATO A;  3WVE B;  4RKU E;  2VC8 A;  2W0Z A;  3VV0 A;  2HEQ A;  4XTU A;  1FWZ A;  5GAM j;  1QWE A;  1NLP C;  2KR3 A;  2ZGW A;  1AZG B;  2NUZ A;  1W1F A;  3VS6 A;  1NPP A;  3C95 A;  4EMK B;  3VJP A;  4KGV B;  1AOJ A;  2NLU A;  5LL6 S;  4P5N A;  1I0C A;  1NEG A;  1I1J A;  4BY6 B;  3M0P A;  2K9G A;  5EC7 A;  2CYZ B;  3CCE T;  3CCS T;  1UHC A;  2VAS A;  4M77 A; 
#chains in the Genus database with same CATH homology
 2YUQ A;  1SRM A;  3NHN A;  1MUZ A;  1N5Z A;  1SEM A;  2KYM A;  1J3T A;  1EFN A;  3EG1 A;  1XOV A;  2DBM A;  4E6R A;  1KJW A;  2DF6 A;  3M0R A;  1JQQ A;  2O9S A;  4D8K A;  2D8J A;  1M3C A;  4OMO A;  2C0I A;  1M3B A;  3H0F A;  2B86 A;  1QKW A;  2J6F A;  1AWO A;  1YWO A;  4RTV A;  4JZ3 A;  1WX6 A;  2RQT A;  3O5Z A;  1TUD A;  2DRM A;  1CKA A;  2KRS A;  1IO6 A;  2ENM A;  4F17 A;  2JMC A;  2J6K A;  4X1V A;  1E7O A;  1OPK A;  4RTY A;  1YNZ A;  1ZUU A;  1AWX A;  1UDL A;  3PVL A;  1UUE A;  2EVR A;  1ABO A;  3EGU A;  3NMZ C;  2PNI A;  4WCI A;  2CUB A;  1UHF A;  1VA7 A;  3VS5 A;  2LX7 A;  2GBQ A;  2LJ0 A;  2JM8 A;  2D0N A;  1X2Q A;  2JS0 A;  1ABQ A;  2F2W A;  2AKL A;  1GFC A;  2RNA A;  2RN8 A;  4AFQ C;  1SSH A;  5ECA A;  2FEI A;  1BB9 A;  2HCK A;  2LQN A;  3I9Q A;  3QWX X;  1AWW A;  3REA B;  3SEM A;  1K0S A;  5GJW B;  1T3S A;  2JT4 A;  2K3B A;  1LCK A;  3C0C A;  3UF4 A;  4EIK A;  4ORZ A;  4J9I A;  3I5R A;  3RBB B;  1HJD A;  1UFF A;  4CC2 A;  4IIM A;  3CQT A;  2GQI A;  1BK2 A;  1GCQ C;  2P4R A;  2K2M A;  4RTX A;  1WI7 A;  1A0N B;  2CDT A;  2LNH B;  2VVK A;  1WXT A;  2PTK A;  2RQR A;  2F2V A;  4CC3 A;  2DM1 A;  1M27 C;  2DMO A;  2VKN A;  1PWT A;  1FMK A;  1KSW A;  1H3H A;  2LJ1 A;  2DYB A;  3M0S A;  5IXF A;  3RNJ A;  3EHQ A;  1Y57 A;  2CSQ A;  5IHI A;  2YDL A;  1X43 A;  2CT4 A;  1YWP A;  4J9H A;  1UG1 A;  4LNP A;  2X3X D;  1I07 A;  1AD5 A;  2O2O A;  2RF0 A;  2O88 A;  1GBR A;  4FSS A;  3IQL A;  1H8K A;  2KNB B;  1WDX A;  1SHG A;  4DEY A;  1M30 A;  2EYZ A;  1GL5 A;  2GGR A;  4J9C A;  3U23 A;  2MOX A;  2DA9 A;  2DL4 A;  4F14 A;  2KE9 A;  5IH2 A;  1K1Z A;  1T0J A;  2I0N A;  1JXM A;  1RI9 A;  2OI3 A;  2X3W D;  4DEX A;  2EW3 A;  2E5K A;  2FPE A;  2DBK A;  2L2P A;  4Z8A A;  2GNC A;  4RUG A;  1H92 A;  2ED0 A;  1M3A A;  3VRZ A;  1T3L A;  3VS1 A;  4J9D A;  2L3S A;  1KFZ A;  4LUD A;  2ABL A;  1Z9Z A;  3EG0 A;  2ROT A;  2JM9 A;  1WFW A;  1YN8 A;  2L0A A;  3VS3 A;  2QDL A;  2LCS A;  1ZBJ A;  1GRI A;  5FWB A;  3UA6 A;  1WXB A;  4Y92 A;  4AG1 C;  1V1C A;  1WA7 A;  4M4Z A;  4IIO A;  2L3P A;  2AKK A;  2FPD A;  1HSQ A;  1YCS B;  3M0Q A;  3M0U A;  1ZX6 A;  3SHW A;  2LMJ A;  1NYG A;  1BU1 A;  1VYT A;  2BZ8 A;  2SEM A;  1MV3 A;  2W10 A;  2AZS A;  5IHN A;  1Y0M A;  1FYN A;  2CH4 W;  2KRM A;  1ZSG A;  4KRT A;  2EBP A;  2KRN A;  1AWJ A;  2V1Q A;  1U06 A;  2FO0 A;  1SPK A;  3PE0 A;  2DJQ A;  2KT8 A;  5I22 A;  1YP5 A;  1U5S A;  2H8H A;  2F2X A;  1X6B A;  2NWM A;  1B3Q A;  2DL5 A;  3FJ5 A;  2DIL A;  3VS0 A;  2C0T A;  1GBQ A;  3H41 A;  1G83 A;  2DVJ A;  3ULR B;  2BTT A;  2RQV A;  2FG0 A;  2YT6 A;  2EYW A;  2G6F X;  3THK A;  4OML A;  2EKH A;  1NYF A;  4LUE A;  3TSZ A;  1WLP B;  2J06 A;  2KXD A;  2ROL A;  2OAW A;  2IIM A;  2CH4 A;  3EG2 A;  1G2B A;  2JTE A;  1QLY A;  3VS2 A;  4JJB A;  5HCK A;  2DRK A;  2ECZ A;  2YSQ A;  1RLQ C;  2FPF A;  2RQU A;  2M0Y A;  4LE9 A;  3PVQ A;  2CT3 A;  4AFU C;  3NPF A;  5FW9 A;  4HVU A;  2HSP A;  4CC4 B;  1UJ0 A;  3H0H A;  1WIE A;  2JW4 A;  2KT1 A;  2OJ2 A;  3VS4 A;  4OMQ A;  1AVZ C;  2EGE A;  1BBZ A;  3I35 A;  3UAT A;  1W6X A;  2JMA A;  2M51 A;  2GTO A;  4GBQ A;  4HCK A;  2DNU A;  2PZ1 A;  4QT7 A;  2O9V A;  3REB B;  2KXC A;  2J6O A;  1NLO C;  3EHR A;  2D1X A;  2EGA A;  1ARK A;  2LQW A;  2CSI A;  4J9B A;  1RLP C;  4HVV A;  5L23 A;  3LH5 A;  1AZE A;  4F16 A;  1PRL C;  2KEA A;  1W70 A;  4A63 B;  4Z89 A;  3UA7 A;  2AZV A;  1PNJ A;  4CC7 A;  5IXB A;  4RTT A;  1T0H A;  2J7I A;  3TSW A;  2DL8 A;  3GBQ A;  2D8H A;  1QCF A;  4R0K A;  2DL7 A;  1OEB A;  4ESR A;  1PHT A;  2KGT A;  1K4U S;  1ZUY A;  1S1N A;  1UTI A;  2RPN A;  2MIO A;  2V1R A;  2KRO A;  2A36 A;  2HBW A;  4OMP A;  1PKS A;  2CUD A;  2KBT A;  1ZUK A;  2MCN A;  3I5S A;  1UE9 A;  2L3Q A;  2BZX A;  2XMF A;  3JV3 A;  2KYB A;  1CKB A;  1K0X A;  2HDA A;  2FRY A;  2RQW A;  4RTU A;  4JPB W;  2JXB A;  1E6H A;  4RTZ A;  1SRL A;  1NM7 A;  2C0O A;  3VRY A;  4AFS C;  1KIK A;  4J9G A;  2A37 A;  2EPD A;  2FRW A;  1K76 A;  2LZ6 B;  1GFD A;  3KFV A;  1PKT A;  1RUW A;  1VYU A;  1ZLM A;  2RMO A;  4J9E A;  4AFZ C;  3ZL7 C;  2SRC A;  3QWY A;  2ESW A;  2YUN A;  1B07 A;  1OOT A;  1MV0 B;  2A28 A;  1UJY A;  5FWC A;  2EYY A;  4ZNX A;  2EGC A;  4RTW A;  2DX1 A;  1UGV A;  3R6N A;  4D8D A;  1JXO A;  4OMM A;  1TG0 A;  2A08 A;  2DLP A;  1WYX A;  2ED1 A;  3TVT A;  1K9A A;  1JO8 A;  1Z9Q A;  2JS2 A;  4K11 A;  2VWF A;  4JZ4 A;  3NGP A;  1QKX A;  4JJD A;  2LJ3 A;  4LN2 A;  2O31 A;  2BZY A;  2EQI A;  2K6D A;  2YUO A;  1TUC A;  5IHK A;  1E6G A;  4JJC A;  1OV3 A;  5GJV B;  1M8M A;  1VYV A;  3M0T A;  2W0Z A;  4J9F A;  2DL3 A;  2HEQ A;  1GCQ A;  1QWE A;  1NLP C;  1UEC A;  1PRM C;  1CSK A;  2AK5 A;  2KR3 A;  1AEY A;  4OMN A;  1X69 A;  2LP5 A;  1JU5 C;  4Z88 A;  1NEB A;  2K7A A;  3EG3 A;  1AZG B;  2NUZ A;  1W1F A;  4HXJ A;  3VS6 A;  4AG2 C;  4HVW A;  1NG2 A;  2YUP A;  1HD3 A;  2K79 A;  1AOJ A;  1X27 A;  3VS7 A;  3A98 A;  1OPL A;  1QWF A;  1I0C A;  1GCP A;  3H0I A;  1NEG A;  1I1J A;  2EYX A;  2J05 A;  3M0P A;  1JEG A;  2K9G A;  4GLM A;  1WXU A;  5EC7 A;  1X2K A;  2GTJ A;  5I11 A;  2CRE A;  1SHF A;  2DE0 X;  1X6G A;  1UHC A;  1U3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...