2ENMA

Solution structure of the sh3 domain from mouse sorting nexin-9
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
77
structure length
77
Chain Sequence
GSSGSSGMATKARVMYDFAAEPGNNELTVTEGEIITVTNPNVGGGWLEGKNNKGEQGLVPTDYVEILPNDGKDPFSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the SH3 domain from mouse sorting nexin-9
rcsb
source organism Mus musculus
molecule tags Endocytosis
molecule keywords Sorting nexin-9
total genus 8
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2enmA00
2KRMA 1ZX6A 1Z9ZA 4JZ4A 3REAB 1JO8A 1VA7A 2A37A 2KT1A 2CUDA 1MV3A 2CREA 1NEGA 2CDTA 2RQTA 1OPLA 3FJ5A 1K0SA 2DNUA 4DEXA 1T3SA 2W10A 2K7AA 1SRMA 2RPNA 1UE9A 3QWXX 4HCKA 3M0UA 5FW9A 1NYFA 3EG2A 1Y57A 3NPFA 1HSQA 1WX6A 2M51A 2KXCA 2J6OA 4J9CA 4KRTA 2BTTA 1RLPC 2AZSA 1YWPA 2J6KA 4X1VA 2GNCA 3IQLA 2OJ2A 1HJDA 4OMNA 1M30A 3EHRA 4ESRA 4IIMA 3EHQA 1GBQA 4OMQA 5ECAA 1TUCA 1JU5C 2EVRA 2GTOA 3R6NA 2DA9A 1M3AA 4AFZC 2YUQA 2DILA 2LX7A 2YUOA 1VYTA 1UHFA 4JJCA 2DL5A 2EBPA 1MV0B 1K4US 2KT8A 4LNPA 1GL5A 2DM1A 4JZ3A 1WFWA 4HXJA 3SEMA 1H92A 2OAWA 2JM8A 1I0CA 2ABLA 1NYGA 1SEMA 2K9GA 4CC7A 2GQIA 1WI7A 4GLMA 1M27C 4Z89A 4RTZA 2RQWA 4J9IA 2LP5A 2AKKA 3THKA 1A0NB 2HBWA 2DJQA 2F2WA 1N5ZA 2JMCA 3VS1A 2DL4A 2ROLA 2DF6A 1GRIA 4J9DA 1RUWA 2BZYA 4RTWA 1SRLA 1V1CA 2A36A 1K9AA 1AZGB 2L3PA 4JJBA 3UF4A 2L0AA 2CH4W 1WXBA 5FWCA 2ENMA 1SSHA 2KBTA 1SHGA 2QDLA 3QWYA 2J05A 3ULRB 2KXDA 3I9QA 2AZVA 5GJVB 2EW3A 1WIEA 1B07A 1YP5A 2K6DA 4HVWA 2GBQA 4M4ZA 1IO6A 1PKTA 2EYWA 1U5SA 1PNJA 1TG0A 2SRCA 4WCIA 5HCKA 2JS2A 1UECA 1PKSA 4RTYA 3EG1A 5EC7A 2JXBA 2DRMA 1E7OA 2DL3A 1NLPC 3M0RA 2D1XA 5IHKA 2FG0A 2HEQA 2CUBA 2KGTA 3H41A 1X43A 1E6GA 2YT6A 4J9HA 2O9SA 4F16A 1UG1A 2D0NA 1H3HA 2KYBA 4DEYA 2FPEA 3RNJA 4RTTA 1AEYA 1WA7A 3H0HA 1KFZA 1T0JA 1AZEA 1M3BA 4A63B 4AFUC 4D8DA 1M8MA 2AK5A 1AWOA 1W1FA 1U3OA 4LN2A 4JJDA 2DX1A 2LJ3A 3EGUA 2C0TA 1E6HA 2LQWA 2PTKA 2O31A 2DRKA 4CC3A 3VS2A 2KEAA 3VS0A 2LZ6B 1K0XA 3PVLA 3U23A 3TSZA 2A08A 1ZUYA 1J3TA 3M0PA 1SPKA 1QWEA 1VYVA 2C0OA 3C0CA 2JS0A 1WDXA 1Y0MA 3I5SA 1JXMA 2GGRA 4LE9A 2HSPA 1CSKA 1FMKA 3TVTA 2G6FX 2EKHA 1G83A 4JPBW 2IIMA 1S1NA 2ED1A 4LUDA 4F14A 2V1QA 2JW4A 1MUZA 2M0YA 1UJ0A 1YN8A 2PNIA 3VS5A 2FRYA 1AVZC 2DL7A 2RF0A 2HDAA 1T0HA 1YWOA 4AG2C 1QKXA 4K11A 1XOVA 1Z9QA 2H8HA 1ABOA 1W6XA 2OI3A 2JT4A 1EFNA 2LMJA 5IH2A 2YUNA 2CSIA 1GCPA 1UDLA 2GTJA 4HVUA 5IXFA 1GFDA 3VS7A 1M3CA 5IXBA 2CT3A 4OMPA 2HCKA 1VYUA 2A28A 4CC2A 2W0ZA 1WYXA 2E5KA 2K3BA 2LJ0A 3UA6A 2EPDA 2NUZA 3UATA 1X27A 2MOXA 4OMMA 2KRSA 3H0FA 1UTIA 2ESWA 2RQRA 4AG1C 2O88A 3H0IA 1UJYA 4AFSC 1CKAA 1RLQC 1NEBA 2DE0X 4J9FA 1UHCA 1KSWA 3A98A 3M0SA 1TUDA 1NLOC 2KROA 2KYMA 2LQNA 3LH5A 1B3QA 2JM9A 1JQQA 1UUEA 2F2XA 1BBZA 1FYNA 1AWWA 2X3XD 1PWTA 2RMOA 3I35A 5FWBA 2EGEA 1BB9A 4CC4B 1AWJA 4Y92A 1GCQC 2EYXA 2DVJA 1I07A 1CKBA 3M0QA 3REBB 2L3QA 2V1RA 2XMFA 2CT4A 3VS4A 1RI9A 2BZ8A 1OV3A 1PHTA 1OPKA 4RTXA 2VVKA 4LUEA 3SHWA 4AFQC 2BZXA 4EIKA 1NM7A 2DBKA 1W70A 3TSWA 2VWFA 2B86A 4GBQA 1ABQA 1ZUUA 2FPFA 3UA7A 2VKNA 2K79A 2D8HA 1QWFA 1ZLMA 4RTUA 1BU1A 2FRWA 2DYBA 1BK2A 2DLPA 3NHNA 2RQVA 4J9BA 1AWXA 3GBQA 4RTVA 2K2MA 5IHNA 2MCNA 1KIKA 2L2PA 4F17A 1QLYA 2ECZA 2DBMA 4OMOA 1GBRA 4ORZA 2LJ1A 4Z8AA 3EG0A 2ED0A 2J06A 2LNHB 2JTEA 1OEBA 4Z88A 1GCQA 2P4RA 3VRZA 2EYZA 1AOJA 1UGVA 2DMOA 2ROTA 1NG2A 1SHFA 1LCKA 4E6RA 3ZL7C 2RNAA 3CQTA 2L3SA 4D8KA 2YUPA 3NGPA 1QKWA 1JEGA 1X69A 1OOTA 3PE0A 1GFCA 4OMLA 3RBBB 1ZBJA 1ZUKA 1X2KA 2KR3A 1KJWA 1K1ZA 1QCFA 1X6BA 4HVVA 3JV3A 3VRYA 1YCSB 1PRMC 1X6GA 1U06A 3PVQA 5I22A 1K76A 2J7IA 2KNBB 1WXTA 1AD5A 5I11A 3EG3A 2C0IA 5L23A 2YDLA 2EYYA 2SEMA 2RN8A 3KFVA 4IIOA 2YSQA 2EQIA 2O9VA 1YNZA 2CH4A 2FPDA 3I5RA 2MIOA 2I0NA 2FEIA 2KRNA 4J9GA 4R0KA 2F2VA 4FSSA 4RUGA 1ARKA 4ZNXA 5GJWB 4QT7A 1PRLC 3VS3A 1H8KA 3VS6A 1WXUA 2RQUA 1ZSGA 2FO0A 1G2BA 2PZ1A 3M0TA 5IHIA 2CSQA 3NMZC 1T3LA 1UFFA 4J9EA 2JMAA 2X3WD 1HD3A 2J6FA 1I1JA 2KE9A 2O2OA 2LCSA 2D8JA 3O5ZA 2EGCA 2DL8A 2EGAA 1WLPB 2NWMA 1X2QA 2AKLA 1JXOA
chains in the Genus database with same CATH superfamily
1EX4A 1D09B 4M75A 4BE2A 4JZ4A 1JO8A 2CP6A 4J7FA 1OPLA 2OTJT 2K5IA 3I55T 2W10A 3CBMA 3AHUA 5CKBA 1QVFS 2ZPGB 3M53A 2A7YA 2M51A 2KXCA 3CC2A 5LJ5h 2Z0WA 5GANh 2E41A 1PCXA 4ESRA 1YJNA 2QDYB 4NS5A 1S72Q 1TUCA 2RHUA 4O6JA 4DBFA 2DA9A 2P4TA 2JNGA 4EMKB 1M1FA 2XDPA 3HP9A 2F5TX 1QCNA 4HT8A 1QVFP 1MMGA 4E2FB 2LX7A 2YUOA 1RAHB 2DL5A 1MV0B 3CCST 5GMKm 2FYKA 4J8OA 3G4SQ 2V8JA 3RMSA 1VQPT 3G6EA 4HXJA 2OAWA 3QYHB 1VQ7A 3HPWA 4YTLA 1OZ3A 1SEMA 2K9GA 1YI2A 2HL5C 4M78G 4GLMA 5LJ3g 2JUFA 1IRXA 4PNOA 1A0NB 2ZGWA 4DA4A 1VQ8T 3C12A 1U1SA 1GRIA 4J6YA 3BFMA 1RUWA 2BZYA 5GAN4 4JJBA 4XTWA 5CVIA 4BY6C 5FWCA 1SHGA 4NOYA 2QDLA 1NPRA 3H8ZA 2KXDA 4JLGA 1U1TA 5LJ3j 1KG1A 2CP2A 1QP2A 2AZVA 4X9DA 4BI3A 4OGEA 4C0DC 4ANJA 1H641 2K5FA 1R0CB 3CC4A 3X25B 1PKTA 1XNIA 1U5SA 3P8HA 3G4SA 1W4SA 1NJIC 1N9SA 1VQMT 1YFNA 3EG1A 5EC7A 2JXBA 3RKYA 3H9NA 4J7IA 1JBMA 1XTDA 5GMKh 4ATOA 4LXCA 3HTRA 1VIFA 1N8RC 1E6GA 2XICA 2DD4A 3JCMd 3PIPA 1YI2Q 2DXBA 2O9SA 2DFUA 2D0NA 3M56A 2WSEE 3M57A 2FPEA 4L6V5 3QZ5B 5A0DA 1N8RU 1WA7A 1QVFA 3RERA 4A53A 1AZEA 1M3BA 4PJMA 4AFUC 2QA4A 4KGVB 1W1FA 1Q86C 2EWNA 3E19A 1BKBA 2MPXC 1M8VA 4QVDA 4N4HA 1R77A 2C0TA 3A8LB 1KD1U 1PD1A 1Q81R 4JRIA 3VS0A 2E6ZA 3PVLA 5C6SA 2ATCB 3MO8A 2RHIA 2Y4YA 1J3TA 2E64A 1QWEA 1MGQA 2C0OA 2JS0A 3JCMh 4A4KA 1FMWA 4PJOB 4LDXA 2MAMA 1FMKA 4XAXB 2G6FX 3RMQA 3GIBA 1D1AA 1LNXA 3CCMT 1YCYA 4M75G 4LUDA 4F14A 1JB0E 3G1JA 5KCHA 1KQ2A 2H3JA 3C94A 2M0YA 3CMAA 2L3RA 3VS5A 5DM7R 3OS2A 3M58A 2BE9B 2CZ6B 2KAFA 2KY9A 2ZCFB 3OW2S 4AG2C 1W2BS 4K11A 4MZPA 2OI3A 1IZ6A 2JJ9A 1M1KU 3PT9A 4IURA 2JT4A 2LMJA 2YUNA 2CSIA 4ELZC 2GTJA 4M7DF 3PGGA 2LX9A 2HKNA 3FRNA 1BCMA 1LJOA 2NUTB 3SWNB 2XKOC 2K3BA 2NUZA 1X27A 2MOXA 4LDYA 4OMMA 3H0FA 3CCVT 2HMAA 2RQRA 5LJ5g 2QG9B 3H0IA 4OP0A 3N5BB 3SDZA 2DE0X 3HL8A 3CMAQ 3JCMV 1Y07A 1NLOC 1B3QA 2QGGA 1FYNA 4FT2A 1U8RA 1BI1A 1PWTA 2RA2A 3OYAA 3I35A 2JTFA 1ZQ1A 4OB1B 5FWBA 2DZCA 1VQLQ 3JB9J 4ZGJB 4M78A 3J7AF 3EGDB 4TVRA 4Y92A 4KH1B 3L2QA 3FLGA 3GNFB 2EYXA 2VXEA 1VQPQ 3PMIA 1CKBA 2XMFA 1BIBA 3VS4A 5GAN6 2BZ8A 2RB6A 2WSFE 1ZHIA 1K8AR 4C8QA 1NM7A 2DBKA 2D6FA 4M77E 3MEWA 5D6YA 5GAN8 3CC2T 5GAOq 2D8HA 4RTUA 2DLPA 2FVUA 4M7DD 2DAQA 3MP6A 2QAZA 1TWBA 4HT9A 4RTVA 2CGHA 3X26B 5LJ3e 2LQKA 2MCNA 1MNDA 5I21A 2EJ9A 2MYSA 2X35A 3C95A 5FU6B 2QTXA 2LJ1A 3EG0A 3CC7A 1YITT 1VQ9Q 1OX9A 2RH2A 2VXFA 1D0XA 4Z88A 2PVDB 4C92B 1GCQA 1YJWQ 3RUXA 1UGVA 2RJEA 2DMOA 4C5EA 1G3YA 1M90C 5CKEA 3CQTA 2L3SA 4DBQA 1H3ZA 1OQKA 1OOTA 4OMLA 3RBBB 1ZBJA 1TXQA 4M7AD 2KR3A 2E65A 1X6BA 3JV3A 5KE3A 3VRYA 1U06A 2GFAA 3OYMA 4E7LA 4C92G 2RI2A 4N4GA 5CIUA 5CKFA 3JCMW 3GP8A 3CC7Q 3JB9F 3URGA 4LDVA 1G3WA 2NUTA 4XU1A 4RKUE 3KFVA 3DKMA 2YSQA 2IVWA 3OYDA 1AHJB 2CH4A 1D3BA 3I56T 3EFOA 4C92C 1VUBA 3JCMb 2I0NA 2FEIA 4J9GA 4R0KA 1JJ2S 4FSSA 5AYFA 3EG9B 1OI1A 3CPFA 5FU6C 1I81A 1PRLC 4OVAA 3VS6A 1B7TA 5LJ5f 1YJNQ 3CCVA 4M77B 2DETA 2IG0A 3L1AA 5C0MA 1T3LA 4ZGDB 1HD3A 3FIFA 4FYWB 3L2VA 2KE9A 2LCSA 1WLPB 1JXOA 1RAGB 2QASA 4L59A 3M9QA 4BE0A 1ZX6A 1Z9ZA 3REAB 2OTLT 1WZOA 1QVGA 2LT1A 3SD4A 1K8AC 2CUDA 2P0PA 2DEQA 4OMFB 1NE8A 2LVMA 1C0MA 3FJ5A 1PSEA 1K0SA 2DNUA 4DEXA 3VV0A 2AT1B 5GAN3 2RPNA 3QWXX 1FXXA 3EG2A 4EMKA 1HSQA 1WX6A 4PLLA 3MEAA 2Y90A 5HY6A 2HNIA 2J6OA 1WJSA 2K4YA 2OTJA 1RLPC 1ZBXA 2EIFA 3KBGA 3TEEA 2AZSA 2FZCB 4X1VA 5CK9A 2GNCA 1HYOA 3VYGA 3RR6A 1HJDA 4OMNA 1LPLA 1M30A 2MWPA 4MZTA 3BW1A 2COYA 4KT0E 1JU5C 5CQXA 3R6NA 2VV5A 3JCMQ 4OF1A 1KQSP 2YUQA 3OSVA 1O9SA 3CCJQ 1RACB 5J3BA 2DILA 4E7SA 2QQSA 4CRIA 4KH0B 3QBYA 2P84A 1GL5A 4LNPA 3QSUA 3D7SB 1D0YA 3M4YA 1NZ9A 3OQ5A 3CCUT 3NTIA 5A0GA 3M55A 1WQWA 3GPLA 2ABLA 4A4HA 1VQMA 1VQ8Q 4Q5WA 3O8VA 1WI7A 3MHXA 2XIDA 1QCOA 2B8AA 2RQWA 2LP5A 4N4IA 3THKA 2K2VA 2JMCA 3VS1A 2RHXA 1I4K1 1YITA 1M90R 2ROLA 3CCUQ 2DF6A 2K3YA 4IUUA 4RTWA 4VUBA 1V1CA 3EG9A 4PL6A 2L3PA 2CH4W 1IGQA 1WXBA 1K9MU 1SSHA 2KBTA 3QWYA 2J05A 1N8RR 5CO7A 2EKOA 2HZYA 3QJYA 5GJVB 4XK8E 1WIEA 3JRZA 4HVWA 4Y91A 1FX7A 1RI0A 2XDDA 5IN1A 1VQPA 3RKXA 3V7RA 4C8QD 3EGDA 1UECA 3NTKA 4RTYA 4F7UA 5GANj 2DRMA 2XDBA 5KYXB 2KGTA 1WHLA 2P0KA 3H41A 3G4ST 4J5YA 3CCSQ 4F16A 2DTOA 1D0ZA 5D6WA 1H3HA 4M7AE 5GMKe 4DEYA 1RABB 2ZPEB 4OGCA 3V8KA 3UWNA 3RNJA 1Q81C 2XG8D 2PVGB 5GAOm 4LDUA 3H0HA 2RO0A 1T0JA 4F7UF 4XTUA 1M8MA 3QJ6A 1AWOA 5GMKi 3M5AA 2DXTA 3CMET 1IHWA 1X01A 2DX1A 2ZPIB 3KXTA 3PMTA 1E6HA 1IB8A 2O31A 2V8IA 4CC3A 5FLXE 5GAOn 2M02A 1MHNA 4M7AA 1C6VX 2LZ6B 4PJNA 3RKWA 1OU8A 3G6ET 2R5MA 3KUFA 5KE2A 5HKCA 2A08A 1KD1C 4XTVA 1ZUYA 3JB9D 4A54A 3I55Q 1RAEB 1VYVA 3QUIA 1JXMA 2GGRA 2JOYA 3MP8A 1RAAB 2LTOA 1CSKA 1FWZA 2JVVA 1EZZB 4PFPA 4BY6B 1ZA1B 3TVTA 4KBMB 5GMKl 2QYZA 2ED1A 4M7AF 2H3EB 3QO3A 3GOXA 2QQ9A 1K73C 1MUZA 3UT1A 2PNIA 3JAME 3JSCA 3OS1A 2L89A 2HDAA 2AHJB 1T0HA 5GMKj 2H8HA 2M9UA 3CCMA 1KHCA 1PSFA 3L42A 4EMHA 1ABOA 5IT9E 1C1AA 2EQKA 3E9GA 3VUBA 2RM4A 1UDLA 2DXCA 4HVUA 2MMPA 5IXFA 1M3CA 4HA8A 5IXBA 3LYIA 2A28A 3PFSA 4CC2A 2DERA 1MNEA 1WYXA 4EMKC 2CYZB 4M78B 2LJ0A 3OYJA 3LGLA 2QQBA 2EPDA 3UATA 4FYVB 5J39A 2KRSA 2ESWA 3V8JA 1QP3A 1B34B 4AG1C 4N0AC 1YI2T 1UJYA 1ZSZA 1NEBA 4RCCA 3CCQT 1UHCA 3M0SA 2FZKB 1TUDA 4C8QE 2F2XA 1BBZA 1X75C 1UGQB 2X3XD 1AWJA 3JB9G 2R58A 3BE3A 2X4WA 2DIQA 1GCQC 5KYUB 3H6ZA 2KK4A 1NBEB 4LD6A 5GAOl 2DVJA 2LDMA 3REBB 3OYNA 3HRSA 3CCJA 2CT4A 2KVQG 2ZZDA 7AT1B 4C0ZA 1OPKA 4IUVA 2VVKA 3SHWA 2LCCA 3Q1JA 4HCZA 4EIKA 1W70A 1UGPB 3TSWA 3HHTB 1ZUUA 4PJLA 1UB4A 1S72T 2HBPA 1QWFA 2FRWA 3J81E 3CCLQ 3GBQA 4UC4A 2L5QA 1Y96A 4JUVA 5CQYA 2VASA 3P8DA 2ECZA 2PQWA 3QDFA 4OMOA 4ORZA 4Z8AA 2LNHB 3RIRA 5KYWA 5EG2A 2CP3A 4ZTFA 4GY5A 2EYZA 4WTOB 2X4YA 2ROTA 1NG2A 2CZ1B 3ZL7C 2RNAA 3NGPA 3DLMA 3PE0A 1GFCA 2PU9B 1KJWA 1QCFA 3QZ9B 4IUTA 2DKGA 4PJOG 3VKIA 3I55A 4M75C 4FW1A 1PRMC 1X6GA 3OYBA 5I22A 1M2OA 4FCYA 4C8QF 3PTAA 1Q95G 3TREA 5I11A 3CD6Q 4M75D 1FMVA 5L23A 2YDLA 2RHYA 2EYYA 5CKHA 3OBWA 4FIBA 1R8OB 1YNZA 2FPDA 1YJNT 1VQNT 3BDUA 3I5RA 4DOWA 1BCOA 5GAMh 1OU9A 5FRNA 4OB0B 2KRNA 2F2VA 1X6OA 4C8QC 4ZNXA 4GLKA 4QT7A 3VS3A 1H8KA 1G2BA 2RHZA 5I2MA 1M1KR 3LH0A 5KCOA 1WHJA 3GLXA 2DTHA 4AT1B 4FSXA 3OYKA 4PJOD 3G71Q 1PC0A 3CC7T 4BDZA 5KYUA 3O5ZA 2QQRA 2A0FB 2EGAA 1X2QA 2AKLA 2A3LA 2GF7A 1WHMA 4Y28E 2KRMA 1RAIB 1VQ8A 1VA7A 2KT1A 1VQ5T 1D1BA 1NEGA 1QVPA 4V2SA 4M78C 2K7AA 1SRMA 1QQJA 3SWNC 3CPWA 4HCKA 5KYYB 2QEXQ 1YHQT 2M0OA 1ZA2B 3M0UA 4OB3B 2RJFA 5FW9A 4KUDK 1VQOA 3X24B 3NPFA 1HXDA 2HL3A 1G8XA 1HK9A 1K73R 4XU2A 4JLIA 4J9CA 4C0GA 4KRTA 2BTTA 3V7CA 4IUQA 2D9TA 1WHKA 2VGMA 3A8GB 1YWPA 1YIJT 4QVZA 2J6KA 3IQLA 4FYYB 1N9RA 5KYWB 4IIMA 3EHQA 3OYYA 1GBQA 3NTHA 1BYMA 5ECAA 5FROA 4M77F 1OYXA 4KUIA 4AFZC 3LWHA 1Q86U 4E7KA 4DBRA 4BI4A 1K9MR 1VYTA 1UHFA 3CBOA 1I8FA 4JJCA 1K4US 3HFOA 4JRPA 1R0BG 4JZ3A 3JB9I 4KGXB 2E6NA 3A8MB 3MCAB 4FT4A 1LVKA 2XU8A 3SEMA 3V7SA 3CC4Q 4QW2A 2JM8A 2RI3A 3V8LA 1NYGA 2QA4T 1M27C 2NUPA 2QI2A 4J9IA 3LX7A 1OZ2A 2DJQA 2F2WA 2QXFA 1N5ZA 4M77D 4E7HA 1VQKA 2DL4A 3FJPA 2GQVA 4WF2A 1G3TA 3CXCP 2QGFB 2BIVA 3OB9A 3HKSA 1B34A 1KC8R 1AZGB 2DK3A 2VUBA 5KH6A 2ENMA 3A8OB 4HKEA 3CCVQ 3ULRB 1IREB 1PD0A 4O5VA 3I9QA 1TU0B 1B07A 2K6DA 4M4ZA 4B9XA 4M75E 3MJXA 2EYWA 5D6XA 4C5GA 1PNJA 4WCIA 2EQMA 2JS2A 2KMTA 1YJ9Q 1E7OA 1MMAA 3M0RA 5IHKA 2HEQA 2CUBA 1IGUA 4C5HA 3CMAT 3G7ZA 4A4FA 1M90U 4J9HA 4CI0C 5LJ3f 1VQKT 2DXUA 1UG1A 2RD1A 8ATCB 2KYBA 1VQ7Q 1G3SA 1VQ4T 4RTTA 1AEYA 3CCJT 4C0DB 3L2UA 2KI7A 4JS4A 5DLOA 3CCMQ 4F7UE 1KQ1A 4LDWA 1WHHA 4LN2A 4F7UG 4PJOF 3RESA 4JJDA 3CCET 1TOVA 4ZN3A 3FB9A 1W2BA 2EYQA 2LQWA 1V29B 2PTKA 2DRKA 1TSFA 2ZPFB 5FU7B 5DLQE 4ELYC 1K0XA 3A1PA 3U23A 3TSZA 1D3BB 5GAN2 4Z02A 3M0PA 3C0CA 3ASKA 1KHIA 2BKDN 4LE9A 3VU3C 2HSPA 2MWOA 1VQ4A 3CEYA 4IKFA 2PUKB 1G83A 3EGXA 4MMKA 4JPBW 2KQWA 4A4GA 2CZ0B 1NJIU 3QDRB 2FL7A 2X4JA 4M7AG 2DL7A 4JDSA 2RF0A 2VB6A 3L2ZA 3OSSC 2PVOB 1LOJA 3EFSA 1ZSZB 4F7UB 1W6XA 3QKJA 1YJ9T 3CMEQ 2D0QB 1VQMQ 5IH2A 1Q82R 4PKCC 3MP1A 3RDVA 1GFDA 3VS7A 4FM4B 2X4XA 2YLBA 2HCKA 4FYXB 1KC8C 2W0ZA 2VYTA 2E5KA 2XD0A 4DBHA 1YJWT 1VQ4Q 3OW2A 2GFUA 4MMLA 3OMGA 2O88A 1IHVA 1VQKQ 4AFSC 1CKAA 4XU0A 1RLQC 2ZPBB 4C8QG 4BE1A 4J9FA 2CP7A 3OA6A 2EJFA 2KROA 3LH5A 1JQQA 4M7DB 5KYYA 4M7DE 4PK4A 2E5QA 2JTMA 4DQ2A 4CC4B 2HD0A 1VQ5A 3GNGA 3M0QA 2V1RA 1OV3A 4M78E 4R55A 1VQLA 2BZXA 1VQOT 5LJ5d 1NPPA 4PFZA 2VWFA 2B86A 1ABQA 2DVEA 3UA7A 4MDXA 2VKNA 2BE7D 2K79A 3OYFA 3QYGB 4E7JA 1ZLMA 4E7ZA 2DPPB 2DYBA 5GAMg 4HCBA 2RQVA 4J9BA 2ZPHB 4XQ3A 1YIJQ 4JRKA 1UEBA 2WSCE 2MK5A 4M75B 3CCQQ 5IHNA 4A4EA 2L2PA 4BB7A 1QLYA 1DJ7B 2DBMA 2I2LA 1GBRA 3OYHA 2F1LA 1VQNA 2NUPB 4M77A 2G3RA 3WVDB 1YHQQ 1UGRB 2E70A 2EQJA 2P4RA 3VRZA 2COZA 1SHFA 1LCKA 2CKKA 5HK3A 4D8KA 1JEGA 1X69A 4JS5A 2YLCA 3F70A 4MDWA 5KYXA 4EDUA 1YCSB 5AT1B 1O75A 1YJWA 5GAMd 2J7IA 2KNBB 3JCMJ 1WXTA 1AD5A 2OAUA 4KULA 3EG3A 1I5LA 2C0IA 1M1KC 2RN8A 3CCRQ 2FHDA 3CCQA 1XQHA 5I2SA 2V26A 2WACA 2EQIA 2O9VA 4QVCA 4PFOA 2OTJQ 2MIOA 1BI3A 4QQ6A 1ARKA 4ZN1A 2RI5A 2CP0A 2E1HA 1YHQA 5GJWB 3CBPA 4PJOA 2GCXA 1WXUA 3ZFJA 1VQNQ 1ZSGA 2FO0A 4C92A 2PZ1A 3I56A 4QKUA 3OY9A 2CSQA 5GANf 3NMZC 1M9SA 3CCSA 2QTVA 1UFFA 3AT1B 4J9EA 1VOMA 1F1BB 2JMAA 3G71T 2DYIA 2J6FA 1TH7A 1WJRA 2MF2A 5LJ3d 2D8JA 4R56A 1QVGP 3JCMg 2NWMA 4HCCA 5GAOp 4BUGA 4ZGEB 1Q81U 1I5OB 4PLIA 4PJJA 2A37A 4NL3A 3CCRA 3CPWP 1MV3A 4RG2A 2CREA 2CDTA 3I56Q 2RQTA 5L8RE 1T3SA 5A0LA 5CR2A 1Q86R 1UE9A 1P92A 1NYFA 6AT1B 3CCRT 1YITQ 4M7AC 1Y57A 3L2RA 3EFOB 3CCEA 1M1GA 1KQSS 2DIGA 2MI6A 3INZA 3META 3CD6T 3BDLA 3BY7A 4RG8A 2LRQA 2YRVA 1QW1A 1Q7YC 1ZSZC 3CCLT 1SSFA 5LL6S 5GAMf 2OJ2A 1WGSA 3EHRA 5GAOr 4OMQA 1JJ2A 2E3IA 1K9MC 2O01E 2XK0A 2LQ8A 2EVRA 2GTOA 5M9OA 1PG5B 3CC2Q 2K5LA 1M3AA 1RAFB 3QHSA 1Q7YR 1VQ9T 1VQ7T 4J6WA 4MZMA 2QEXA 1VQ6Q 4EPCA 4PJOC 1TTHB 2EBPA 3GF5A 1QMCA 3PIOA 3DB4A 2KT8A 2QQAA 3HFNA 2DM1A 1WFWA 2VGNA 2DTIA 1H92A 3E1SA 1I0CA 4P5NA 4KGZB 4CC7A 2GQIA 2E3HA 4IUPA 1MMNA 3MEVA 4Z89A 4RTZA 2AKKA 1BIAA 2HBWA 1QVGS 1YIJA 4PJOE 3LLRA 3UDCA 3SB2A 3X20B 2BUDA 5CAIA 3S3OA 2LNVA 3OYGA 3R6OA 1V76A 4J9DA 1SRLA 4BD3A 5HK0A 2A36A 1K9AA 3QPHA 3UPUA 2YHTA 2L0AA 3UF4A 1KK7A 3TCJA 3OYLA 3OS0A 4XTXA 1XJWB 1WJQA 2EW3A 4M7DA 1IXDA 1TS9A 1YP5A 5KYNA 3EFRA 2GBQA 4XTYA 1IO6A 3WXMB 1KQSA 1WNLA 2CS7A 3A8HB 5FU7C 1TG0A 5HCKA 2SRCA 2QA4Q 1YBYA 3SFMA 3MPUB 1PKSA 2EJGA 2DO3A 2DL3A 1NLPC 3M59A 2D1XA 5LJ5j 1Y96B 2FG0A 1X43A 2YT6A 3JCMf 3FC3A 2C06A 1KC8U 1OX8A 2XI9A 3LGFA 1Q82C 1VQ6T 5CKDA 2LCLA 2K57A 4EMGA 3PNWC 1Y7XA 2YWWA 3OBYA 1KFZA 4QQDA 5GANg 2RJDA 2E12A 4E7IA 4L5GA 2OTLA 4A63B 2FZGB 4D8DA 1W2BP 1ACMB 3TU4K 2AK5A 3JCMe 1U3OA 2RK1A 2JN0A 4ME7A 3G71A 2LJ3A 2EAYA 4BI8B 3EGUA 2HQHA 4FU6A 3OMCA 3ZBDA 4C0FA 3E9FA 4BACA 1M4ZA 3VS2A 2KEAA 3CMEA 3CCLA 2Y4XA 2F5KA 4FW2A 5J26A 1SPKA 1JJ2P 3CCEQ 3I5SA 1Q82U 1WDXA 1Y0MA 2V8KA 5GAMj 1K73U 1BI2A 3EH2A 1D1CA 3LW5E 2EKHA 3JB9H 4QQGA 2L8DA 2IIMA 1S1NA 1VQ9A 3OYCA 1SKUB 3T9NA 2V1QA 2JW4A 3G6EQ 4M78F 1UJ0A 1YN8A 2R57A 2FRYA 1KD1R 1AVZC 4XU3A 3NFCA 2PUOB 1UGSB 1YWOA 3S6WA 5GAN7 1QKXA 3ME9A 1XOVA 1Z9QA 2NYSA 2E10A 4C92D 3CXCS 4II1A 2HAXA 2YRDA 4J6XA 2O4XA 1EFNA 3LWIA 1S72A 2DZ9A 1GCPA 2F69A 2XHCA 3CD6A 4M7AB 2CT3A 4OMPA 2YXYA 1VYUA 5LJ3h 4AMCA 1AT1B 3A5ZB 4E47A 3UA6A 3CCUA 1M5Q1 1UTIA 1NJIR 2FB7A 4J83A 3M4GA 2X9HA 1K8AU 5GAMe 2CZ7B 1BI0A 3ZEHA 1KSWA 3A98A 1OULA 4RCBA 3OYIA 1Y71A 4C92F 2IPOB 2LQNA 2KYMA 2JM9A 1UUEA 3JCMX 1SG5A 2M16A 4N0AA 4RMOA 1AWWA 2EFIA 4NL2A 2RMOA 1JRIA 2LT4A 2EGEA 1GXIE 1BB9A 3SWNA 1EIFA 1N27A 3FDRA 3TQ7P 3EAEA 3QIIA 4XTZA 8AT1B 4ZTJA 4M77C 3E2UA 1VQOQ 2JZ2A 2LC4A 1I07A 1TUGB 2HQEA 2L3QA 2YRCA 1M2VB 1RI9A 4OB2B 1PHTA 1PM3A 4M78D 4RTXA 2DD5A 1M2VA 1N6AA 3ER0A 4LUEA 4AFQC 3QG1A 2RJCA 3S3NA 1VIEA 5GAN5 3EGXB 5CCAA 4GBQA 1MMDA 2FPFA 1Q7YU 3HSBA 5DY9A 1BU1A 2VC8A 1BK2A 3NHNA 5GANe 1AWXA 3CC4T 5LJ5e 2HQXA 2K2MA 1RL2A 4C5IA 3X28B 1KIKA 2NLUA 4JJNK 5D7UA 4F17A 3J80E 3JCMc 2HSEB 2KDSA 3HRTA 4C8QB 2ED0A 2J06A 2EQUA 2JTEA 3L2WA 3DB3A 1OEBA 3FEOA 2QEXT 1WQ7A 3CPWS 2DJZA 5A2QE 2E4HA 1AOJA 2X51A 4E6RA 3QXEB 1WHGA 2YUPA 1VQ5Q 1QKWA 2M1HA 3OW2P 1ZUKA 1X2KA 1VQLT 3WVEB 3OYEA 4LD9K 1K1ZA 3P8BB 4HVVA 2ZAEA 2O4XB 3PVQA 3M54A 1K76A 3S3MA 2K3XA 3VUZA 1SF9A 4X9CA 4C92E 1WPYA 4BDYA 4FL6A 3OS5A 2KSSA 4M77G 2P0QA 4B9WA 2SEMA 2CP5A 3C4SA 4JRQA 4IIOA 2AIRB 3JCMP 5IAYA 4RUGA 3VJPA 3DLLA 2R5AA 2OTLQ 9ATCB 5FRMA 2RQUA 4D6WA 4M75F 3M0TA 5IHIA 2HKQB 3EH1A 5GANd 2OX7A 3CXCA 3HRUA 2COWA 2X3WD 2DEUA 3MKDA 1YJ9A 4B6MA 4F04B 1I1JA 4DOVA 2RK2A 1G5VA 4M7DG 2O2OA 4M7DC 2QK0A 1VQ6A 2EGCA 4X34A 1RADB 2DL8A 3VYHB 3MEUA
chains in the Genus database with same CATH topology
2KRMA 1ZX6A 1Z9ZA 4JZ4A 3REAB 1JO8A 1VA7A 2A37A 2KT1A 2CUDA 1MV3A 2CREA 1NEGA 2CDTA 2RQTA 1OPLA 3FJ5A 1K0SA 2DNUA 4DEXA 1T3SA 2W10A 2K7AA 1SRMA 2RPNA 1UE9A 3QWXX 4HCKA 3M0UA 5FW9A 1NYFA 3EG2A 1Y57A 3NPFA 1HSQA 1WX6A 2M51A 2KXCA 2J6OA 4J9CA 4KRTA 2BTTA 1RLPC 2AZSA 1YWPA 2J6KA 4X1VA 2GNCA 3IQLA 2OJ2A 1HJDA 4OMNA 1M30A 3EHRA 4ESRA 4IIMA 3EHQA 1GBQA 4OMQA 5ECAA 1TUCA 1JU5C 2EVRA 2GTOA 3R6NA 2DA9A 1M3AA 4AFZC 2YUQA 2DILA 2LX7A 2YUOA 1VYTA 1UHFA 4JJCA 2DL5A 2EBPA 1MV0B 1K4US 2KT8A 4LNPA 1GL5A 2DM1A 4JZ3A 1WFWA 4HXJA 3SEMA 1H92A 2OAWA 2JM8A 1I0CA 2ABLA 1NYGA 1SEMA 2K9GA 4CC7A 2GQIA 1WI7A 4GLMA 1M27C 4Z89A 4RTZA 2RQWA 4J9IA 2LP5A 2AKKA 3THKA 1A0NB 2HBWA 2DJQA 2F2WA 1N5ZA 2JMCA 3VS1A 2DL4A 2ROLA 2DF6A 1GRIA 4J9DA 1RUWA 2BZYA 4RTWA 1SRLA 1V1CA 2A36A 1K9AA 1AZGB 2L3PA 4JJBA 3UF4A 2L0AA 2CH4W 1WXBA 5FWCA 2ENMA 1SSHA 2KBTA 1SHGA 2QDLA 3QWYA 2J05A 3ULRB 2KXDA 3I9QA 2AZVA 5GJVB 2EW3A 1WIEA 1B07A 1YP5A 2K6DA 4HVWA 2GBQA 4M4ZA 1IO6A 1PKTA 2EYWA 1U5SA 1PNJA 1TG0A 2SRCA 4WCIA 5HCKA 2JS2A 1UECA 1PKSA 4RTYA 3EG1A 5EC7A 2JXBA 2DRMA 1E7OA 2DL3A 1NLPC 3M0RA 2D1XA 5IHKA 2FG0A 2HEQA 2CUBA 2KGTA 3H41A 1X43A 1E6GA 2YT6A 4J9HA 2O9SA 4F16A 1UG1A 2D0NA 1H3HA 2KYBA 4DEYA 2FPEA 3RNJA 4RTTA 1AEYA 1WA7A 3H0HA 1KFZA 1T0JA 1AZEA 1M3BA 4A63B 4AFUC 4D8DA 1M8MA 2AK5A 1AWOA 1W1FA 1U3OA 4LN2A 4JJDA 2DX1A 2LJ3A 3EGUA 2C0TA 1E6HA 2LQWA 2PTKA 2O31A 2DRKA 4CC3A 3VS2A 2KEAA 3VS0A 2LZ6B 1K0XA 3PVLA 3U23A 3TSZA 2A08A 1ZUYA 1J3TA 3M0PA 1SPKA 1QWEA 1VYVA 2C0OA 3C0CA 2JS0A 1WDXA 1Y0MA 3I5SA 1JXMA 2GGRA 4LE9A 2HSPA 1CSKA 1FMKA 3TVTA 2G6FX 2EKHA 1G83A 4JPBW 2IIMA 1S1NA 2ED1A 4LUDA 4F14A 2V1QA 2JW4A 1MUZA 2M0YA 1UJ0A 1YN8A 2PNIA 3VS5A 2FRYA 1AVZC 2DL7A 2RF0A 2HDAA 1T0HA 1YWOA 4AG2C 1QKXA 4K11A 1XOVA 1Z9QA 2H8HA 1ABOA 1W6XA 2OI3A 2JT4A 1EFNA 2LMJA 5IH2A 2YUNA 2CSIA 1GCPA 1UDLA 2GTJA 4HVUA 5IXFA 1GFDA 3VS7A 1M3CA 5IXBA 2CT3A 4OMPA 2HCKA 1VYUA 2A28A 4CC2A 2W0ZA 1WYXA 2E5KA 2K3BA 2LJ0A 3UA6A 2EPDA 2NUZA 3UATA 1X27A 2MOXA 4OMMA 2KRSA 3H0FA 1UTIA 2ESWA 2RQRA 4AG1C 2O88A 3H0IA 1UJYA 4AFSC 1CKAA 1RLQC 1NEBA 2DE0X 4J9FA 1UHCA 1KSWA 3A98A 3M0SA 1TUDA 1NLOC 2KROA 2KYMA 2LQNA 3LH5A 1B3QA 2JM9A 1JQQA 1UUEA 2F2XA 1BBZA 1FYNA 1AWWA 2X3XD 1PWTA 2RMOA 3I35A 5FWBA 2EGEA 1BB9A 4CC4B 1AWJA 4Y92A 1GCQC 2EYXA 2DVJA 1I07A 1CKBA 3M0QA 3REBB 2L3QA 2V1RA 2XMFA 2CT4A 3VS4A 1RI9A 2BZ8A 1OV3A 1PHTA 1OPKA 4RTXA 2VVKA 4LUEA 3SHWA 4AFQC 2BZXA 4EIKA 1NM7A 2DBKA 1W70A 3TSWA 2VWFA 2B86A 4GBQA 1ABQA 1ZUUA 2FPFA 3UA7A 2VKNA 2K79A 2D8HA 1QWFA 1ZLMA 4RTUA 1BU1A 2FRWA 2DYBA 1BK2A 2DLPA 3NHNA 2RQVA 4J9BA 1AWXA 3GBQA 4RTVA 2K2MA 5IHNA 2MCNA 1KIKA 2L2PA 4F17A 1QLYA 2ECZA 2DBMA 4OMOA 1GBRA 4ORZA 2LJ1A 4Z8AA 3EG0A 2ED0A 2J06A 2LNHB 2JTEA 1OEBA 4Z88A 1GCQA 2P4RA 3VRZA 2EYZA 1AOJA 1UGVA 2DMOA 2ROTA 1NG2A 1SHFA 1LCKA 4E6RA 3ZL7C 2RNAA 3CQTA 2L3SA 4D8KA 2YUPA 3NGPA 1QKWA 1JEGA 1X69A 1OOTA 3PE0A 1GFCA 4OMLA 3RBBB 1ZBJA 1ZUKA 1X2KA 2KR3A 1KJWA 1K1ZA 1QCFA 1X6BA 4HVVA 3JV3A 3VRYA 1YCSB 1PRMC 1X6GA 1U06A 3PVQA 5I22A 1K76A 2J7IA 2KNBB 1WXTA 1AD5A 5I11A 3EG3A 2C0IA 5L23A 2YDLA 2EYYA 2SEMA 2RN8A 3KFVA 4IIOA 2YSQA 2EQIA 2O9VA 1YNZA 2CH4A 2FPDA 3I5RA 2MIOA 2I0NA 2FEIA 2KRNA 4J9GA 4R0KA 2F2VA 4FSSA 4RUGA 1ARKA 4ZNXA 5GJWB 4QT7A 1PRLC 3VS3A 1H8KA 3VS6A 1WXUA 2RQUA 1ZSGA 2FO0A 1G2BA 2PZ1A 3M0TA 5IHIA 2CSQA 3NMZC 1T3LA 1UFFA 4J9EA 2JMAA 2X3WD 1HD3A 2J6FA 1I1JA 2KE9A 2O2OA 2LCSA 2D8JA 3O5ZA 2EGCA 2DL8A 2EGAA 1WLPB 2NWMA 1X2QA 2AKLA 1JXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KRM A;  1ZX6 A;  1Z9Z A;  4JZ4 A;  3REA B;  1JO8 A;  1VA7 A;  2A37 A;  2KT1 A;  2CUD A;  1MV3 A;  2CRE A;  1NEG A;  2CDT A;  2RQT A;  1OPL A;  3FJ5 A;  1K0S A;  2DNU A;  4DEX A;  1T3S A;  2W10 A;  2K7A A;  1SRM A;  2RPN A;  1UE9 A;  3QWX X;  4HCK A;  3M0U A;  5FW9 A;  1NYF A;  3EG2 A;  1Y57 A;  3NPF A;  1HSQ A;  1WX6 A;  2M51 A;  2KXC A;  2J6O A;  4J9C A;  4KRT A;  2BTT A;  1RLP C;  2AZS A;  1YWP A;  2J6K A;  4X1V A;  2GNC A;  3IQL A;  2OJ2 A;  1HJD A;  4OMN A;  1M30 A;  3EHR A;  4ESR A;  4IIM A;  3EHQ A;  1GBQ A;  4OMQ A;  5ECA A;  1TUC A;  1JU5 C;  2EVR A;  2GTO A;  3R6N A;  2DA9 A;  1M3A A;  4AFZ C;  2YUQ A;  2DIL A;  2LX7 A;  2YUO A;  1VYT A;  1UHF A;  4JJC A;  2DL5 A;  2EBP A;  1MV0 B;  1K4U S;  2KT8 A;  4LNP A;  1GL5 A;  2DM1 A;  4JZ3 A;  1WFW A;  4HXJ A;  3SEM A;  1H92 A;  2OAW A;  2JM8 A;  1I0C A;  2ABL A;  1NYG A;  1SEM A;  2K9G A;  4CC7 A;  2GQI A;  1WI7 A;  4GLM A;  1M27 C;  4Z89 A;  4RTZ A;  2RQW A;  4J9I A;  2LP5 A;  2AKK A;  3THK A;  1A0N B;  2HBW A;  2DJQ A;  2F2W A;  1N5Z A;  2JMC A;  3VS1 A;  2DL4 A;  2ROL A;  2DF6 A;  1GRI A;  4J9D A;  1RUW A;  2BZY A;  4RTW A;  1SRL A;  1V1C A;  2A36 A;  1K9A A;  1AZG B;  2L3P A;  4JJB A;  3UF4 A;  2L0A A;  2CH4 W;  1WXB A;  5FWC A;  2ENM A;  1SSH A;  2KBT A;  1SHG A;  2QDL A;  3QWY A;  2J05 A;  3ULR B;  2KXD A;  3I9Q A;  2AZV A;  5GJV B;  2EW3 A;  1WIE A;  1B07 A;  1YP5 A;  2K6D A;  4HVW A;  2GBQ A;  4M4Z A;  1IO6 A;  1PKT A;  2EYW A;  1U5S A;  1PNJ A;  1TG0 A;  2SRC A;  4WCI A;  5HCK A;  2JS2 A;  1UEC A;  1PKS A;  4RTY A;  3EG1 A;  5EC7 A;  2JXB A;  2DRM A;  1E7O A;  2DL3 A;  1NLP C;  3M0R A;  2D1X A;  5IHK A;  2FG0 A;  2HEQ A;  2CUB A;  2KGT A;  3H41 A;  1X43 A;  1E6G A;  2YT6 A;  4J9H A;  2O9S A;  4F16 A;  1UG1 A;  2D0N A;  1H3H A;  2KYB A;  4DEY A;  2FPE A;  3RNJ A;  4RTT A;  1AEY A;  1WA7 A;  3H0H A;  1KFZ A;  1T0J A;  1AZE A;  1M3B A;  4A63 B;  4AFU C;  4D8D A;  1M8M A;  2AK5 A;  1AWO A;  1W1F A;  1U3O A;  4LN2 A;  4JJD A;  2DX1 A;  2LJ3 A;  3EGU A;  2C0T A;  1E6H A;  2LQW A;  2PTK A;  2O31 A;  2DRK A;  4CC3 A;  3VS2 A;  2KEA A;  3VS0 A;  2LZ6 B;  1K0X A;  3PVL A;  3U23 A;  3TSZ A;  2A08 A;  1ZUY A;  1J3T A;  3M0P A;  1SPK A;  1QWE A;  1VYV A;  2C0O A;  3C0C A;  2JS0 A;  1WDX A;  1Y0M A;  3I5S A;  1JXM A;  2GGR A;  4LE9 A;  2HSP A;  1CSK A;  1FMK A;  3TVT A;  2G6F X;  2EKH A;  1G83 A;  4JPB W;  2IIM A;  1S1N A;  2ED1 A;  4LUD A;  4F14 A;  2V1Q A;  2JW4 A;  1MUZ A;  2M0Y A;  1UJ0 A;  1YN8 A;  2PNI A;  3VS5 A;  2FRY A;  1AVZ C;  2DL7 A;  2RF0 A;  2HDA A;  1T0H A;  1YWO A;  4AG2 C;  1QKX A;  4K11 A;  1XOV A;  1Z9Q A;  2H8H A;  1ABO A;  1W6X A;  2OI3 A;  2JT4 A;  1EFN A;  2LMJ A;  5IH2 A;  2YUN A;  2CSI A;  1GCP A;  1UDL A;  2GTJ A;  4HVU A;  5IXF A;  1GFD A;  3VS7 A;  1M3C A;  5IXB A;  2CT3 A;  4OMP A;  2HCK A;  1VYU A;  2A28 A;  4CC2 A;  2W0Z A;  1WYX A;  2E5K A;  2K3B A;  2LJ0 A;  3UA6 A;  2EPD A;  2NUZ A;  3UAT A;  1X27 A;  2MOX A;  4OMM A;  2KRS A;  3H0F A;  1UTI A;  2ESW A;  2RQR A;  4AG1 C;  2O88 A;  3H0I A;  1UJY A;  4AFS C;  1CKA A;  1RLQ C;  1NEB A;  2DE0 X;  4J9F A;  1UHC A;  1KSW A;  3A98 A;  3M0S A;  1TUD A;  1NLO C;  2KRO A;  2KYM A;  2LQN A;  3LH5 A;  1B3Q A;  2JM9 A;  1JQQ A;  1UUE A;  2F2X A;  1BBZ A;  1FYN A;  1AWW A;  2X3X D;  1PWT A;  2RMO A;  3I35 A;  5FWB A;  2EGE A;  1BB9 A;  4CC4 B;  1AWJ A;  4Y92 A;  1GCQ C;  2EYX A;  2DVJ A;  1I07 A;  1CKB A;  3M0Q A;  3REB B;  2L3Q A;  2V1R A;  2XMF A;  2CT4 A;  3VS4 A;  1RI9 A;  2BZ8 A;  1OV3 A;  1PHT A;  1OPK A;  4RTX A;  2VVK A;  4LUE A;  3SHW A;  4AFQ C;  2BZX A;  4EIK A;  1NM7 A;  2DBK A;  1W70 A;  3TSW A;  2VWF A;  2B86 A;  4GBQ A;  1ABQ A;  1ZUU A;  2FPF A;  3UA7 A;  2VKN A;  2K79 A;  2D8H A;  1QWF A;  1ZLM A;  4RTU A;  1BU1 A;  2FRW A;  2DYB A;  1BK2 A;  2DLP A;  3NHN A;  2RQV A;  4J9B A;  1AWX A;  3GBQ A;  4RTV A;  2K2M A;  5IHN A;  2MCN A;  1KIK A;  2L2P A;  4F17 A;  1QLY A;  2ECZ A;  2DBM A;  4OMO A;  1GBR A;  4ORZ A;  2LJ1 A;  4Z8A A;  3EG0 A;  2ED0 A;  2J06 A;  2LNH B;  2JTE A;  1OEB A;  4Z88 A;  1GCQ A;  2P4R A;  3VRZ A;  2EYZ A;  1AOJ A;  1UGV A;  2DMO A;  2ROT A;  1NG2 A;  1SHF A;  1LCK A;  4E6R A;  3ZL7 C;  2RNA A;  3CQT A;  2L3S A;  4D8K A;  2YUP A;  3NGP A;  1QKW A;  1JEG A;  1X69 A;  1OOT A;  3PE0 A;  1GFC A;  4OML A;  3RBB B;  1ZBJ A;  1ZUK A;  1X2K A;  2KR3 A;  1KJW A;  1K1Z A;  1QCF A;  1X6B A;  4HVV A;  3JV3 A;  3VRY A;  1YCS B;  1PRM C;  1X6G A;  1U06 A;  3PVQ A;  5I22 A;  1K76 A;  2J7I A;  2KNB B;  1WXT A;  1AD5 A;  5I11 A;  3EG3 A;  2C0I A;  5L23 A;  2YDL A;  2EYY A;  2SEM A;  2RN8 A;  3KFV A;  4IIO A;  2YSQ A;  2EQI A;  2O9V A;  1YNZ A;  2CH4 A;  2FPD A;  3I5R A;  2MIO A;  2I0N A;  2FEI A;  2KRN A;  4J9G A;  4R0K A;  2F2V A;  4FSS A;  4RUG A;  1ARK A;  4ZNX A;  5GJW B;  4QT7 A;  1PRL C;  3VS3 A;  1H8K A;  3VS6 A;  1WXU A;  2RQU A;  1ZSG A;  2FO0 A;  1G2B A;  2PZ1 A;  3M0T A;  5IHI A;  2CSQ A;  3NMZ C;  1T3L A;  1UFF A;  4J9E A;  2JMA A;  2X3W D;  1HD3 A;  2J6F A;  1I1J A;  2KE9 A;  2O2O A;  2LCS A;  2D8J A;  3O5Z A;  2EGC A;  2DL8 A;  2EGA A;  1WLP B;  2NWM A;  1X2Q A;  2AKL A;  1JXO A; 
#chains in the Genus database with same CATH topology
 1EX4 A;  1D09 B;  4M75 A;  4BE2 A;  4JZ4 A;  1JO8 A;  2CP6 A;  4J7F A;  1OPL A;  2OTJ T;  2K5I A;  3I55 T;  2W10 A;  3CBM A;  3AHU A;  5CKB A;  1QVF S;  2ZPG B;  3M53 A;  2A7Y A;  2M51 A;  2KXC A;  3CC2 A;  5LJ5 h;  2Z0W A;  5GAN h;  2E41 A;  1PCX A;  4ESR A;  1YJN A;  2QDY B;  4NS5 A;  1S72 Q;  1TUC A;  2RHU A;  4O6J A;  4DBF A;  2DA9 A;  2P4T A;  2JNG A;  4EMK B;  1M1F A;  2XDP A;  3HP9 A;  2F5T X;  1QCN A;  4HT8 A;  1QVF P;  1MMG A;  4E2F B;  2LX7 A;  2YUO A;  1RAH B;  2DL5 A;  1MV0 B;  3CCS T;  5GMK m;  2FYK A;  4J8O A;  3G4S Q;  2V8J A;  3RMS A;  1VQP T;  3G6E A;  4HXJ A;  2OAW A;  3QYH B;  1VQ7 A;  3HPW A;  4YTL A;  1OZ3 A;  1SEM A;  2K9G A;  1YI2 A;  2HL5 C;  4M78 G;  4GLM A;  5LJ3 g;  2JUF A;  1IRX A;  4PNO A;  1A0N B;  2ZGW A;  4DA4 A;  1VQ8 T;  3C12 A;  1U1S A;  1GRI A;  4J6Y A;  3BFM A;  1RUW A;  2BZY A;  5GAN 4;  4JJB A;  4XTW A;  5CVI A;  4BY6 C;  5FWC A;  1SHG A;  4NOY A;  2QDL A;  1NPR A;  3H8Z A;  2KXD A;  4JLG A;  1U1T A;  5LJ3 j;  1KG1 A;  2CP2 A;  1QP2 A;  2AZV A;  4X9D A;  4BI3 A;  4OGE A;  4C0D C;  4ANJ A;  1H64 1;  2K5F A;  1R0C B;  3CC4 A;  3X25 B;  1PKT A;  1XNI A;  1U5S A;  3P8H A;  3G4S A;  1W4S A;  1NJI C;  1N9S A;  1VQM T;  1YFN A;  3EG1 A;  5EC7 A;  2JXB A;  3RKY A;  3H9N A;  4J7I A;  1JBM A;  1XTD A;  5GMK h;  4ATO A;  4LXC A;  3HTR A;  1VIF A;  1N8R C;  1E6G A;  2XIC A;  2DD4 A;  3JCM d;  3PIP A;  1YI2 Q;  2DXB A;  2O9S A;  2DFU A;  2D0N A;  3M56 A;  2WSE E;  3M57 A;  2FPE A;  4L6V 5;  3QZ5 B;  5A0D A;  1N8R U;  1WA7 A;  1QVF A;  3RER A;  4A53 A;  1AZE A;  1M3B A;  4PJM A;  4AFU C;  2QA4 A;  4KGV B;  1W1F A;  1Q86 C;  2EWN A;  3E19 A;  1BKB A;  2MPX C;  1M8V A;  4QVD A;  4N4H A;  1R77 A;  2C0T A;  3A8L B;  1KD1 U;  1PD1 A;  1Q81 R;  4JRI A;  3VS0 A;  2E6Z A;  3PVL A;  5C6S A;  2ATC B;  3MO8 A;  2RHI A;  2Y4Y A;  1J3T A;  2E64 A;  1QWE A;  1MGQ A;  2C0O A;  2JS0 A;  3JCM h;  4A4K A;  1FMW A;  4PJO B;  4LDX A;  2MAM A;  1FMK A;  4XAX B;  2G6F X;  3RMQ A;  3GIB A;  1D1A A;  1LNX A;  3CCM T;  1YCY A;  4M75 G;  4LUD A;  4F14 A;  1JB0 E;  3G1J A;  5KCH A;  1KQ2 A;  2H3J A;  3C94 A;  2M0Y A;  3CMA A;  2L3R A;  3VS5 A;  5DM7 R;  3OS2 A;  3M58 A;  2BE9 B;  2CZ6 B;  2KAF A;  2KY9 A;  2ZCF B;  3OW2 S;  4AG2 C;  1W2B S;  4K11 A;  4MZP A;  2OI3 A;  1IZ6 A;  2JJ9 A;  1M1K U;  3PT9 A;  4IUR A;  2JT4 A;  2LMJ A;  2YUN A;  2CSI A;  4ELZ C;  2GTJ A;  4M7D F;  3PGG A;  2LX9 A;  2HKN A;  3FRN A;  1BCM A;  1LJO A;  2NUT B;  3SWN B;  2XKO C;  2K3B A;  2NUZ A;  1X27 A;  2MOX A;  4LDY A;  4OMM A;  3H0F A;  3CCV T;  2HMA A;  2RQR A;  5LJ5 g;  2QG9 B;  3H0I A;  4OP0 A;  3N5B B;  3SDZ A;  2DE0 X;  3HL8 A;  3CMA Q;  3JCM V;  1Y07 A;  1NLO C;  1B3Q A;  2QGG A;  1FYN A;  4FT2 A;  1U8R A;  1BI1 A;  1PWT A;  2RA2 A;  3OYA A;  3I35 A;  2JTF A;  1ZQ1 A;  4OB1 B;  5FWB A;  2DZC A;  1VQL Q;  3JB9 J;  4ZGJ B;  4M78 A;  3J7A F;  3EGD B;  4TVR A;  4Y92 A;  4KH1 B;  3L2Q A;  3FLG A;  3GNF B;  2EYX A;  2VXE A;  1VQP Q;  3PMI A;  1CKB A;  2XMF A;  1BIB A;  3VS4 A;  5GAN 6;  2BZ8 A;  2RB6 A;  2WSF E;  1ZHI A;  1K8A R;  4C8Q A;  1NM7 A;  2DBK A;  2D6F A;  4M77 E;  3MEW A;  5D6Y A;  5GAN 8;  3CC2 T;  5GAO q;  2D8H A;  4RTU A;  2DLP A;  2FVU A;  4M7D D;  2DAQ A;  3MP6 A;  2QAZ A;  1TWB A;  4HT9 A;  4RTV A;  2CGH A;  3X26 B;  5LJ3 e;  2LQK A;  2MCN A;  1MND A;  5I21 A;  2EJ9 A;  2MYS A;  2X35 A;  3C95 A;  5FU6 B;  2QTX A;  2LJ1 A;  3EG0 A;  3CC7 A;  1YIT T;  1VQ9 Q;  1OX9 A;  2RH2 A;  2VXF A;  1D0X A;  4Z88 A;  2PVD B;  4C92 B;  1GCQ A;  1YJW Q;  3RUX A;  1UGV A;  2RJE A;  2DMO A;  4C5E A;  1G3Y A;  1M90 C;  5CKE A;  3CQT A;  2L3S A;  4DBQ A;  1H3Z A;  1OQK A;  1OOT A;  4OML A;  3RBB B;  1ZBJ A;  1TXQ A;  4M7A D;  2KR3 A;  2E65 A;  1X6B A;  3JV3 A;  5KE3 A;  3VRY A;  1U06 A;  2GFA A;  3OYM A;  4E7L A;  4C92 G;  2RI2 A;  4N4G A;  5CIU A;  5CKF A;  3JCM W;  3GP8 A;  3CC7 Q;  3JB9 F;  3URG A;  4LDV A;  1G3W A;  2NUT A;  4XU1 A;  4RKU E;  3KFV A;  3DKM A;  2YSQ A;  2IVW A;  3OYD A;  1AHJ B;  2CH4 A;  1D3B A;  3I56 T;  3EFO A;  4C92 C;  1VUB A;  3JCM b;  2I0N A;  2FEI A;  4J9G A;  4R0K A;  1JJ2 S;  4FSS A;  5AYF A;  3EG9 B;  1OI1 A;  3CPF A;  5FU6 C;  1I81 A;  1PRL C;  4OVA A;  3VS6 A;  1B7T A;  5LJ5 f;  1YJN Q;  3CCV A;  4M77 B;  2DET A;  2IG0 A;  3L1A A;  5C0M A;  1T3L A;  4ZGD B;  1HD3 A;  3FIF A;  4FYW B;  3L2V A;  2KE9 A;  2LCS A;  1WLP B;  1JXO A;  1RAG B;  2QAS A;  4L59 A;  3M9Q A;  4BE0 A;  1ZX6 A;  1Z9Z A;  3REA B;  2OTL T;  1WZO A;  1QVG A;  2LT1 A;  3SD4 A;  1K8A C;  2CUD A;  2P0P A;  2DEQ A;  4OMF B;  1NE8 A;  2LVM A;  1C0M A;  3FJ5 A;  1PSE A;  1K0S A;  2DNU A;  4DEX A;  3VV0 A;  2AT1 B;  5GAN 3;  2RPN A;  3QWX X;  1FXX A;  3EG2 A;  4EMK A;  1HSQ A;  1WX6 A;  4PLL A;  3MEA A;  2Y90 A;  5HY6 A;  2HNI A;  2J6O A;  1WJS A;  2K4Y A;  2OTJ A;  1RLP C;  1ZBX A;  2EIF A;  3KBG A;  3TEE A;  2AZS A;  2FZC B;  4X1V A;  5CK9 A;  2GNC A;  1HYO A;  3VYG A;  3RR6 A;  1HJD A;  4OMN A;  1LPL A;  1M30 A;  2MWP A;  4MZT A;  3BW1 A;  2COY A;  4KT0 E;  1JU5 C;  5CQX A;  3R6N A;  2VV5 A;  3JCM Q;  4OF1 A;  1KQS P;  2YUQ A;  3OSV A;  1O9S A;  3CCJ Q;  1RAC B;  5J3B A;  2DIL A;  4E7S A;  2QQS A;  4CRI A;  4KH0 B;  3QBY A;  2P84 A;  1GL5 A;  4LNP A;  3QSU A;  3D7S B;  1D0Y A;  3M4Y A;  1NZ9 A;  3OQ5 A;  3CCU T;  3NTI A;  5A0G A;  3M55 A;  1WQW A;  3GPL A;  2ABL A;  4A4H A;  1VQM A;  1VQ8 Q;  4Q5W A;  3O8V A;  1WI7 A;  3MHX A;  2XID A;  1QCO A;  2B8A A;  2RQW A;  2LP5 A;  4N4I A;  3THK A;  2K2V A;  2JMC A;  3VS1 A;  2RHX A;  1I4K 1;  1YIT A;  1M90 R;  2ROL A;  3CCU Q;  2DF6 A;  2K3Y A;  4IUU A;  4RTW A;  4VUB A;  1V1C A;  3EG9 A;  4PL6 A;  2L3P A;  2CH4 W;  1IGQ A;  1WXB A;  1K9M U;  1SSH A;  2KBT A;  3QWY A;  2J05 A;  1N8R R;  5CO7 A;  2EKO A;  2HZY A;  3QJY A;  5GJV B;  4XK8 E;  1WIE A;  3JRZ A;  4HVW A;  4Y91 A;  1FX7 A;  1RI0 A;  2XDD A;  5IN1 A;  1VQP A;  3RKX A;  3V7R A;  4C8Q D;  3EGD A;  1UEC A;  3NTK A;  4RTY A;  4F7U A;  5GAN j;  2DRM A;  2XDB A;  5KYX B;  2KGT A;  1WHL A;  2P0K A;  3H41 A;  3G4S T;  4J5Y A;  3CCS Q;  4F16 A;  2DTO A;  1D0Z A;  5D6W A;  1H3H A;  4M7A E;  5GMK e;  4DEY A;  1RAB B;  2ZPE B;  4OGC A;  3V8K A;  3UWN A;  3RNJ A;  1Q81 C;  2XG8 D;  2PVG B;  5GAO m;  4LDU A;  3H0H A;  2RO0 A;  1T0J A;  4F7U F;  4XTU A;  1M8M A;  3QJ6 A;  1AWO A;  5GMK i;  3M5A A;  2DXT A;  3CME T;  1IHW A;  1X01 A;  2DX1 A;  2ZPI B;  3KXT A;  3PMT A;  1E6H A;  1IB8 A;  2O31 A;  2V8I A;  4CC3 A;  5FLX E;  5GAO n;  2M02 A;  1MHN A;  4M7A A;  1C6V X;  2LZ6 B;  4PJN A;  3RKW A;  1OU8 A;  3G6E T;  2R5M A;  3KUF A;  5KE2 A;  5HKC A;  2A08 A;  1KD1 C;  4XTV A;  1ZUY A;  3JB9 D;  4A54 A;  3I55 Q;  1RAE B;  1VYV A;  3QUI A;  1JXM A;  2GGR A;  2JOY A;  3MP8 A;  1RAA B;  2LTO A;  1CSK A;  1FWZ A;  2JVV A;  1EZZ B;  4PFP A;  4BY6 B;  1ZA1 B;  3TVT A;  4KBM B;  5GMK l;  2QYZ A;  2ED1 A;  4M7A F;  2H3E B;  3QO3 A;  3GOX A;  2QQ9 A;  1K73 C;  1MUZ A;  3UT1 A;  2PNI A;  3JAM E;  3JSC A;  3OS1 A;  2L89 A;  2HDA A;  2AHJ B;  1T0H A;  5GMK j;  2H8H A;  2M9U A;  3CCM A;  1KHC A;  1PSF A;  3L42 A;  4EMH A;  1ABO A;  5IT9 E;  1C1A A;  2EQK A;  3E9G A;  3VUB A;  2RM4 A;  1UDL A;  2DXC A;  4HVU A;  2MMP A;  5IXF A;  1M3C A;  4HA8 A;  5IXB A;  3LYI A;  2A28 A;  3PFS A;  4CC2 A;  2DER A;  1MNE A;  1WYX A;  4EMK C;  2CYZ B;  4M78 B;  2LJ0 A;  3OYJ A;  3LGL A;  2QQB A;  2EPD A;  3UAT A;  4FYV B;  5J39 A;  2KRS A;  2ESW A;  3V8J A;  1QP3 A;  1B34 B;  4AG1 C;  4N0A C;  1YI2 T;  1UJY A;  1ZSZ A;  1NEB A;  4RCC A;  3CCQ T;  1UHC A;  3M0S A;  2FZK B;  1TUD A;  4C8Q E;  2F2X A;  1BBZ A;  1X75 C;  1UGQ B;  2X3X D;  1AWJ A;  3JB9 G;  2R58 A;  3BE3 A;  2X4W A;  2DIQ A;  1GCQ C;  5KYU B;  3H6Z A;  2KK4 A;  1NBE B;  4LD6 A;  5GAO l;  2DVJ A;  2LDM A;  3REB B;  3OYN A;  3HRS A;  3CCJ A;  2CT4 A;  2KVQ G;  2ZZD A;  7AT1 B;  4C0Z A;  1OPK A;  4IUV A;  2VVK A;  3SHW A;  2LCC A;  3Q1J A;  4HCZ A;  4EIK A;  1W70 A;  1UGP B;  3TSW A;  3HHT B;  1ZUU A;  4PJL A;  1UB4 A;  1S72 T;  2HBP A;  1QWF A;  2FRW A;  3J81 E;  3CCL Q;  3GBQ A;  4UC4 A;  2L5Q A;  1Y96 A;  4JUV A;  5CQY A;  2VAS A;  3P8D A;  2ECZ A;  2PQW A;  3QDF A;  4OMO A;  4ORZ A;  4Z8A A;  2LNH B;  3RIR A;  5KYW A;  5EG2 A;  2CP3 A;  4ZTF A;  4GY5 A;  2EYZ A;  4WTO B;  2X4Y A;  2ROT A;  1NG2 A;  2CZ1 B;  3ZL7 C;  2RNA A;  3NGP A;  3DLM A;  3PE0 A;  1GFC A;  2PU9 B;  1KJW A;  1QCF A;  3QZ9 B;  4IUT A;  2DKG A;  4PJO G;  3VKI A;  3I55 A;  4M75 C;  4FW1 A;  1PRM C;  1X6G A;  3OYB A;  5I22 A;  1M2O A;  4FCY A;  4C8Q F;  3PTA A;  1Q95 G;  3TRE A;  5I11 A;  3CD6 Q;  4M75 D;  1FMV A;  5L23 A;  2YDL A;  2RHY A;  2EYY A;  5CKH A;  3OBW A;  4FIB A;  1R8O B;  1YNZ A;  2FPD A;  1YJN T;  1VQN T;  3BDU A;  3I5R A;  4DOW A;  1BCO A;  5GAM h;  1OU9 A;  5FRN A;  4OB0 B;  2KRN A;  2F2V A;  1X6O A;  4C8Q C;  4ZNX A;  4GLK A;  4QT7 A;  3VS3 A;  1H8K A;  1G2B A;  2RHZ A;  5I2M A;  1M1K R;  3LH0 A;  5KCO A;  1WHJ A;  3GLX A;  2DTH A;  4AT1 B;  4FSX A;  3OYK A;  4PJO D;  3G71 Q;  1PC0 A;  3CC7 T;  4BDZ A;  5KYU A;  3O5Z A;  2QQR A;  2A0F B;  2EGA A;  1X2Q A;  2AKL A;  2A3L A;  2GF7 A;  1WHM A;  4Y28 E;  2KRM A;  1RAI B;  1VQ8 A;  1VA7 A;  2KT1 A;  1VQ5 T;  1D1B A;  1NEG A;  1QVP A;  4V2S A;  4M78 C;  2K7A A;  1SRM A;  1QQJ A;  3SWN C;  3CPW A;  4HCK A;  5KYY B;  2QEX Q;  1YHQ T;  2M0O A;  1ZA2 B;  3M0U A;  4OB3 B;  2RJF A;  5FW9 A;  4KUD K;  1VQO A;  3X24 B;  3NPF A;  1HXD A;  2HL3 A;  1G8X A;  1HK9 A;  1K73 R;  4XU2 A;  4JLI A;  4J9C A;  4C0G A;  4KRT A;  2BTT A;  3V7C A;  4IUQ A;  2D9T A;  1WHK A;  2VGM A;  3A8G B;  1YWP A;  1YIJ T;  4QVZ A;  2J6K A;  3IQL A;  4FYY B;  1N9R A;  5KYW B;  4IIM A;  3EHQ A;  3OYY A;  1GBQ A;  3NTH A;  1BYM A;  5ECA A;  5FRO A;  4M77 F;  1OYX A;  4KUI A;  4AFZ C;  3LWH A;  1Q86 U;  4E7K A;  4DBR A;  4BI4 A;  1K9M R;  1VYT A;  1UHF A;  3CBO A;  1I8F A;  4JJC A;  1K4U S;  3HFO A;  4JRP A;  1R0B G;  4JZ3 A;  3JB9 I;  4KGX B;  2E6N A;  3A8M B;  3MCA B;  4FT4 A;  1LVK A;  2XU8 A;  3SEM A;  3V7S A;  3CC4 Q;  4QW2 A;  2JM8 A;  2RI3 A;  3V8L A;  1NYG A;  2QA4 T;  1M27 C;  2NUP A;  2QI2 A;  4J9I A;  3LX7 A;  1OZ2 A;  2DJQ A;  2F2W A;  2QXF A;  1N5Z A;  4M77 D;  4E7H A;  1VQK A;  2DL4 A;  3FJP A;  2GQV A;  4WF2 A;  1G3T A;  3CXC P;  2QGF B;  2BIV A;  3OB9 A;  3HKS A;  1B34 A;  1KC8 R;  1AZG B;  2DK3 A;  2VUB A;  5KH6 A;  2ENM A;  3A8O B;  4HKE A;  3CCV Q;  3ULR B;  1IRE B;  1PD0 A;  4O5V A;  3I9Q A;  1TU0 B;  1B07 A;  2K6D A;  4M4Z A;  4B9X A;  4M75 E;  3MJX A;  2EYW A;  5D6X A;  4C5G A;  1PNJ A;  4WCI A;  2EQM A;  2JS2 A;  2KMT A;  1YJ9 Q;  1E7O A;  1MMA A;  3M0R A;  5IHK A;  2HEQ A;  2CUB A;  1IGU A;  4C5H A;  3CMA T;  3G7Z A;  4A4F A;  1M90 U;  4J9H A;  4CI0 C;  5LJ3 f;  1VQK T;  2DXU A;  1UG1 A;  2RD1 A;  8ATC B;  2KYB A;  1VQ7 Q;  1G3S A;  1VQ4 T;  4RTT A;  1AEY A;  3CCJ T;  4C0D B;  3L2U A;  2KI7 A;  4JS4 A;  5DLO A;  3CCM Q;  4F7U E;  1KQ1 A;  4LDW A;  1WHH A;  4LN2 A;  4F7U G;  4PJO F;  3RES A;  4JJD A;  3CCE T;  1TOV A;  4ZN3 A;  3FB9 A;  1W2B A;  2EYQ A;  2LQW A;  1V29 B;  2PTK A;  2DRK A;  1TSF A;  2ZPF B;  5FU7 B;  5DLQ E;  4ELY C;  1K0X A;  3A1P A;  3U23 A;  3TSZ A;  1D3B B;  5GAN 2;  4Z02 A;  3M0P A;  3C0C A;  3ASK A;  1KHI A;  2BKD N;  4LE9 A;  3VU3 C;  2HSP A;  2MWO A;  1VQ4 A;  3CEY A;  4IKF A;  2PUK B;  1G83 A;  3EGX A;  4MMK A;  4JPB W;  2KQW A;  4A4G A;  2CZ0 B;  1NJI U;  3QDR B;  2FL7 A;  2X4J A;  4M7A G;  2DL7 A;  4JDS A;  2RF0 A;  2VB6 A;  3L2Z A;  3OSS C;  2PVO B;  1LOJ A;  3EFS A;  1ZSZ B;  4F7U B;  1W6X A;  3QKJ A;  1YJ9 T;  3CME Q;  2D0Q B;  1VQM Q;  5IH2 A;  1Q82 R;  4PKC C;  3MP1 A;  3RDV A;  1GFD A;  3VS7 A;  4FM4 B;  2X4X A;  2YLB A;  2HCK A;  4FYX B;  1KC8 C;  2W0Z A;  2VYT A;  2E5K A;  2XD0 A;  4DBH A;  1YJW T;  1VQ4 Q;  3OW2 A;  2GFU A;  4MML A;  3OMG A;  2O88 A;  1IHV A;  1VQK Q;  4AFS C;  1CKA A;  4XU0 A;  1RLQ C;  2ZPB B;  4C8Q G;  4BE1 A;  4J9F A;  2CP7 A;  3OA6 A;  2EJF A;  2KRO A;  3LH5 A;  1JQQ A;  4M7D B;  5KYY A;  4M7D E;  4PK4 A;  2E5Q A;  2JTM A;  4DQ2 A;  4CC4 B;  2HD0 A;  1VQ5 A;  3GNG A;  3M0Q A;  2V1R A;  1OV3 A;  4M78 E;  4R55 A;  1VQL A;  2BZX A;  1VQO T;  5LJ5 d;  1NPP A;  4PFZ A;  2VWF A;  2B86 A;  1ABQ A;  2DVE A;  3UA7 A;  4MDX A;  2VKN A;  2BE7 D;  2K79 A;  3OYF A;  3QYG B;  4E7J A;  1ZLM A;  4E7Z A;  2DPP B;  2DYB A;  5GAM g;  4HCB A;  2RQV A;  4J9B A;  2ZPH B;  4XQ3 A;  1YIJ Q;  4JRK A;  1UEB A;  2WSC E;  2MK5 A;  4M75 B;  3CCQ Q;  5IHN A;  4A4E A;  2L2P A;  4BB7 A;  1QLY A;  1DJ7 B;  2DBM A;  2I2L A;  1GBR A;  3OYH A;  2F1L A;  1VQN A;  2NUP B;  4M77 A;  2G3R A;  3WVD B;  1YHQ Q;  1UGR B;  2E70 A;  2EQJ A;  2P4R A;  3VRZ A;  2COZ A;  1SHF A;  1LCK A;  2CKK A;  5HK3 A;  4D8K A;  1JEG A;  1X69 A;  4JS5 A;  2YLC A;  3F70 A;  4MDW A;  5KYX A;  4EDU A;  1YCS B;  5AT1 B;  1O75 A;  1YJW A;  5GAM d;  2J7I A;  2KNB B;  3JCM J;  1WXT A;  1AD5 A;  2OAU A;  4KUL A;  3EG3 A;  1I5L A;  2C0I A;  1M1K C;  2RN8 A;  3CCR Q;  2FHD A;  3CCQ A;  1XQH A;  5I2S A;  2V26 A;  2WAC A;  2EQI A;  2O9V A;  4QVC A;  4PFO A;  2OTJ Q;  2MIO A;  1BI3 A;  4QQ6 A;  1ARK A;  4ZN1 A;  2RI5 A;  2CP0 A;  2E1H A;  1YHQ A;  5GJW B;  3CBP A;  4PJO A;  2GCX A;  1WXU A;  3ZFJ A;  1VQN Q;  1ZSG A;  2FO0 A;  4C92 A;  2PZ1 A;  3I56 A;  4QKU A;  3OY9 A;  2CSQ A;  5GAN f;  3NMZ C;  1M9S A;  3CCS A;  2QTV A;  1UFF A;  3AT1 B;  4J9E A;  1VOM A;  1F1B B;  2JMA A;  3G71 T;  2DYI A;  2J6F A;  1TH7 A;  1WJR A;  2MF2 A;  5LJ3 d;  2D8J A;  4R56 A;  1QVG P;  3JCM g;  2NWM A;  4HCC A;  5GAO p;  4BUG A;  4ZGE B;  1Q81 U;  1I5O B;  4PLI A;  4PJJ A;  2A37 A;  4NL3 A;  3CCR A;  3CPW P;  1MV3 A;  4RG2 A;  2CRE A;  2CDT A;  3I56 Q;  2RQT A;  5L8R E;  1T3S A;  5A0L A;  5CR2 A;  1Q86 R;  1UE9 A;  1P92 A;  1NYF A;  6AT1 B;  3CCR T;  1YIT Q;  4M7A C;  1Y57 A;  3L2R A;  3EFO B;  3CCE A;  1M1G A;  1KQS S;  2DIG A;  2MI6 A;  3INZ A;  3MET A;  3CD6 T;  3BDL A;  3BY7 A;  4RG8 A;  2LRQ A;  2YRV A;  1QW1 A;  1Q7Y C;  1ZSZ C;  3CCL T;  1SSF A;  5LL6 S;  5GAM f;  2OJ2 A;  1WGS A;  3EHR A;  5GAO r;  4OMQ A;  1JJ2 A;  2E3I A;  1K9M C;  2O01 E;  2XK0 A;  2LQ8 A;  2EVR A;  2GTO A;  5M9O A;  1PG5 B;  3CC2 Q;  2K5L A;  1M3A A;  1RAF B;  3QHS A;  1Q7Y R;  1VQ9 T;  1VQ7 T;  4J6W A;  4MZM A;  2QEX A;  1VQ6 Q;  4EPC A;  4PJO C;  1TTH B;  2EBP A;  3GF5 A;  1QMC A;  3PIO A;  3DB4 A;  2KT8 A;  2QQA A;  3HFN A;  2DM1 A;  1WFW A;  2VGN A;  2DTI A;  1H92 A;  3E1S A;  1I0C A;  4P5N A;  4KGZ B;  4CC7 A;  2GQI A;  2E3H A;  4IUP A;  1MMN A;  3MEV A;  4Z89 A;  4RTZ A;  2AKK A;  1BIA A;  2HBW A;  1QVG S;  1YIJ A;  4PJO E;  3LLR A;  3UDC A;  3SB2 A;  3X20 B;  2BUD A;  5CAI A;  3S3O A;  2LNV A;  3OYG A;  3R6O A;  1V76 A;  4J9D A;  1SRL A;  4BD3 A;  5HK0 A;  2A36 A;  1K9A A;  3QPH A;  3UPU A;  2YHT A;  2L0A A;  3UF4 A;  1KK7 A;  3TCJ A;  3OYL A;  3OS0 A;  4XTX A;  1XJW B;  1WJQ A;  2EW3 A;  4M7D A;  1IXD A;  1TS9 A;  1YP5 A;  5KYN A;  3EFR A;  2GBQ A;  4XTY A;  1IO6 A;  3WXM B;  1KQS A;  1WNL A;  2CS7 A;  3A8H B;  5FU7 C;  1TG0 A;  5HCK A;  2SRC A;  2QA4 Q;  1YBY A;  3SFM A;  3MPU B;  1PKS A;  2EJG A;  2DO3 A;  2DL3 A;  1NLP C;  3M59 A;  2D1X A;  5LJ5 j;  1Y96 B;  2FG0 A;  1X43 A;  2YT6 A;  3JCM f;  3FC3 A;  2C06 A;  1KC8 U;  1OX8 A;  2XI9 A;  3LGF A;  1Q82 C;  1VQ6 T;  5CKD A;  2LCL A;  2K57 A;  4EMG A;  3PNW C;  1Y7X A;  2YWW A;  3OBY A;  1KFZ A;  4QQD A;  5GAN g;  2RJD A;  2E12 A;  4E7I A;  4L5G A;  2OTL A;  4A63 B;  2FZG B;  4D8D A;  1W2B P;  1ACM B;  3TU4 K;  2AK5 A;  3JCM e;  1U3O A;  2RK1 A;  2JN0 A;  4ME7 A;  3G71 A;  2LJ3 A;  2EAY A;  4BI8 B;  3EGU A;  2HQH A;  4FU6 A;  3OMC A;  3ZBD A;  4C0F A;  3E9F A;  4BAC A;  1M4Z A;  3VS2 A;  2KEA A;  3CME A;  3CCL A;  2Y4X A;  2F5K A;  4FW2 A;  5J26 A;  1SPK A;  1JJ2 P;  3CCE Q;  3I5S A;  1Q82 U;  1WDX A;  1Y0M A;  2V8K A;  5GAM j;  1K73 U;  1BI2 A;  3EH2 A;  1D1C A;  3LW5 E;  2EKH A;  3JB9 H;  4QQG A;  2L8D A;  2IIM A;  1S1N A;  1VQ9 A;  3OYC A;  1SKU B;  3T9N A;  2V1Q A;  2JW4 A;  3G6E Q;  4M78 F;  1UJ0 A;  1YN8 A;  2R57 A;  2FRY A;  1KD1 R;  1AVZ C;  4XU3 A;  3NFC A;  2PUO B;  1UGS B;  1YWO A;  3S6W A;  5GAN 7;  1QKX A;  3ME9 A;  1XOV A;  1Z9Q A;  2NYS A;  2E10 A;  4C92 D;  3CXC S;  4II1 A;  2HAX A;  2YRD A;  4J6X A;  2O4X A;  1EFN A;  3LWI A;  1S72 A;  2DZ9 A;  1GCP A;  2F69 A;  2XHC A;  3CD6 A;  4M7A B;  2CT3 A;  4OMP A;  2YXY A;  1VYU A;  5LJ3 h;  4AMC A;  1AT1 B;  3A5Z B;  4E47 A;  3UA6 A;  3CCU A;  1M5Q 1;  1UTI A;  1NJI R;  2FB7 A;  4J83 A;  3M4G A;  2X9H A;  1K8A U;  5GAM e;  2CZ7 B;  1BI0 A;  3ZEH A;  1KSW A;  3A98 A;  1OUL A;  4RCB A;  3OYI A;  1Y71 A;  4C92 F;  2IPO B;  2LQN A;  2KYM A;  2JM9 A;  1UUE A;  3JCM X;  1SG5 A;  2M16 A;  4N0A A;  4RMO A;  1AWW A;  2EFI A;  4NL2 A;  2RMO A;  1JRI A;  2LT4 A;  2EGE A;  1GXI E;  1BB9 A;  3SWN A;  1EIF A;  1N27 A;  3FDR A;  3TQ7 P;  3EAE A;  3QII A;  4XTZ A;  8AT1 B;  4ZTJ A;  4M77 C;  3E2U A;  1VQO Q;  2JZ2 A;  2LC4 A;  1I07 A;  1TUG B;  2HQE A;  2L3Q A;  2YRC A;  1M2V B;  1RI9 A;  4OB2 B;  1PHT A;  1PM3 A;  4M78 D;  4RTX A;  2DD5 A;  1M2V A;  1N6A A;  3ER0 A;  4LUE A;  4AFQ C;  3QG1 A;  2RJC A;  3S3N A;  1VIE A;  5GAN 5;  3EGX B;  5CCA A;  4GBQ A;  1MMD A;  2FPF A;  1Q7Y U;  3HSB A;  5DY9 A;  1BU1 A;  2VC8 A;  1BK2 A;  3NHN A;  5GAN e;  1AWX A;  3CC4 T;  5LJ5 e;  2HQX A;  2K2M A;  1RL2 A;  4C5I A;  3X28 B;  1KIK A;  2NLU A;  4JJN K;  5D7U A;  4F17 A;  3J80 E;  3JCM c;  2HSE B;  2KDS A;  3HRT A;  4C8Q B;  2ED0 A;  2J06 A;  2EQU A;  2JTE A;  3L2W A;  3DB3 A;  1OEB A;  3FEO A;  2QEX T;  1WQ7 A;  3CPW S;  2DJZ A;  5A2Q E;  2E4H A;  1AOJ A;  2X51 A;  4E6R A;  3QXE B;  1WHG A;  2YUP A;  1VQ5 Q;  1QKW A;  2M1H A;  3OW2 P;  1ZUK A;  1X2K A;  1VQL T;  3WVE B;  3OYE A;  4LD9 K;  1K1Z A;  3P8B B;  4HVV A;  2ZAE A;  2O4X B;  3PVQ A;  3M54 A;  1K76 A;  3S3M A;  2K3X A;  3VUZ A;  1SF9 A;  4X9C A;  4C92 E;  1WPY A;  4BDY A;  4FL6 A;  3OS5 A;  2KSS A;  4M77 G;  2P0Q A;  4B9W A;  2SEM A;  2CP5 A;  3C4S A;  4JRQ A;  4IIO A;  2AIR B;  3JCM P;  5IAY A;  4RUG A;  3VJP A;  3DLL A;  2R5A A;  2OTL Q;  9ATC B;  5FRM A;  2RQU A;  4D6W A;  4M75 F;  3M0T A;  5IHI A;  2HKQ B;  3EH1 A;  5GAN d;  2OX7 A;  3CXC A;  3HRU A;  2COW A;  2X3W D;  2DEU A;  3MKD A;  1YJ9 A;  4B6M A;  4F04 B;  1I1J A;  4DOV A;  2RK2 A;  1G5V A;  4M7D G;  2O2O A;  4M7D C;  2QK0 A;  1VQ6 A;  2EGC A;  4X34 A;  1RAD B;  2DL8 A;  3VYH B;  3MEU A; 
#chains in the Genus database with same CATH homology
 2KRM A;  1ZX6 A;  1Z9Z A;  4JZ4 A;  3REA B;  1JO8 A;  1VA7 A;  2A37 A;  2KT1 A;  2CUD A;  1MV3 A;  2CRE A;  1NEG A;  2CDT A;  2RQT A;  1OPL A;  3FJ5 A;  1K0S A;  2DNU A;  4DEX A;  1T3S A;  2W10 A;  2K7A A;  1SRM A;  2RPN A;  1UE9 A;  3QWX X;  4HCK A;  3M0U A;  5FW9 A;  1NYF A;  3EG2 A;  1Y57 A;  3NPF A;  1HSQ A;  1WX6 A;  2M51 A;  2KXC A;  2J6O A;  4J9C A;  4KRT A;  2BTT A;  1RLP C;  2AZS A;  1YWP A;  2J6K A;  4X1V A;  2GNC A;  3IQL A;  2OJ2 A;  1HJD A;  4OMN A;  1M30 A;  3EHR A;  4ESR A;  4IIM A;  3EHQ A;  1GBQ A;  4OMQ A;  5ECA A;  1TUC A;  1JU5 C;  2EVR A;  2GTO A;  3R6N A;  2DA9 A;  1M3A A;  4AFZ C;  2YUQ A;  2DIL A;  2LX7 A;  2YUO A;  1VYT A;  1UHF A;  4JJC A;  2DL5 A;  2EBP A;  1MV0 B;  1K4U S;  2KT8 A;  4LNP A;  1GL5 A;  2DM1 A;  4JZ3 A;  1WFW A;  4HXJ A;  3SEM A;  1H92 A;  2OAW A;  2JM8 A;  1I0C A;  2ABL A;  1NYG A;  1SEM A;  2K9G A;  4CC7 A;  2GQI A;  1WI7 A;  4GLM A;  1M27 C;  4Z89 A;  4RTZ A;  2RQW A;  4J9I A;  2LP5 A;  2AKK A;  3THK A;  1A0N B;  2HBW A;  2DJQ A;  2F2W A;  1N5Z A;  2JMC A;  3VS1 A;  2DL4 A;  2ROL A;  2DF6 A;  1GRI A;  4J9D A;  1RUW A;  2BZY A;  4RTW A;  1SRL A;  1V1C A;  2A36 A;  1K9A A;  1AZG B;  2L3P A;  4JJB A;  3UF4 A;  2L0A A;  2CH4 W;  1WXB A;  5FWC A;  2ENM A;  1SSH A;  2KBT A;  1SHG A;  2QDL A;  3QWY A;  2J05 A;  3ULR B;  2KXD A;  3I9Q A;  2AZV A;  5GJV B;  2EW3 A;  1WIE A;  1B07 A;  1YP5 A;  2K6D A;  4HVW A;  2GBQ A;  4M4Z A;  1IO6 A;  1PKT A;  2EYW A;  1U5S A;  1PNJ A;  1TG0 A;  2SRC A;  4WCI A;  5HCK A;  2JS2 A;  1UEC A;  1PKS A;  4RTY A;  3EG1 A;  5EC7 A;  2JXB A;  2DRM A;  1E7O A;  2DL3 A;  1NLP C;  3M0R A;  2D1X A;  5IHK A;  2FG0 A;  2HEQ A;  2CUB A;  2KGT A;  3H41 A;  1X43 A;  1E6G A;  2YT6 A;  4J9H A;  2O9S A;  4F16 A;  1UG1 A;  2D0N A;  1H3H A;  2KYB A;  4DEY A;  2FPE A;  3RNJ A;  4RTT A;  1AEY A;  1WA7 A;  3H0H A;  1KFZ A;  1T0J A;  1AZE A;  1M3B A;  4A63 B;  4AFU C;  4D8D A;  1M8M A;  2AK5 A;  1AWO A;  1W1F A;  1U3O A;  4LN2 A;  4JJD A;  2DX1 A;  2LJ3 A;  3EGU A;  2C0T A;  1E6H A;  2LQW A;  2PTK A;  2O31 A;  2DRK A;  4CC3 A;  3VS2 A;  2KEA A;  3VS0 A;  2LZ6 B;  1K0X A;  3PVL A;  3U23 A;  3TSZ A;  2A08 A;  1ZUY A;  1J3T A;  3M0P A;  1SPK A;  1QWE A;  1VYV A;  2C0O A;  3C0C A;  2JS0 A;  1WDX A;  1Y0M A;  3I5S A;  1JXM A;  2GGR A;  4LE9 A;  2HSP A;  1CSK A;  1FMK A;  3TVT A;  2G6F X;  2EKH A;  1G83 A;  4JPB W;  2IIM A;  1S1N A;  2ED1 A;  4LUD A;  4F14 A;  2V1Q A;  2JW4 A;  1MUZ A;  2M0Y A;  1UJ0 A;  1YN8 A;  2PNI A;  3VS5 A;  2FRY A;  1AVZ C;  2DL7 A;  2RF0 A;  2HDA A;  1T0H A;  1YWO A;  4AG2 C;  1QKX A;  4K11 A;  1XOV A;  1Z9Q A;  2H8H A;  1ABO A;  1W6X A;  2OI3 A;  2JT4 A;  1EFN A;  2LMJ A;  5IH2 A;  2YUN A;  2CSI A;  1GCP A;  1UDL A;  2GTJ A;  4HVU A;  5IXF A;  1GFD A;  3VS7 A;  1M3C A;  5IXB A;  2CT3 A;  4OMP A;  2HCK A;  1VYU A;  2A28 A;  4CC2 A;  2W0Z A;  1WYX A;  2E5K A;  2K3B A;  2LJ0 A;  3UA6 A;  2EPD A;  2NUZ A;  3UAT A;  1X27 A;  2MOX A;  4OMM A;  2KRS A;  3H0F A;  1UTI A;  2ESW A;  2RQR A;  4AG1 C;  2O88 A;  3H0I A;  1UJY A;  4AFS C;  1CKA A;  1RLQ C;  1NEB A;  2DE0 X;  4J9F A;  1UHC A;  1KSW A;  3A98 A;  3M0S A;  1TUD A;  1NLO C;  2KRO A;  2KYM A;  2LQN A;  3LH5 A;  1B3Q A;  2JM9 A;  1JQQ A;  1UUE A;  2F2X A;  1BBZ A;  1FYN A;  1AWW A;  2X3X D;  1PWT A;  2RMO A;  3I35 A;  5FWB A;  2EGE A;  1BB9 A;  4CC4 B;  1AWJ A;  4Y92 A;  1GCQ C;  2EYX A;  2DVJ A;  1I07 A;  1CKB A;  3M0Q A;  3REB B;  2L3Q A;  2V1R A;  2XMF A;  2CT4 A;  3VS4 A;  1RI9 A;  2BZ8 A;  1OV3 A;  1PHT A;  1OPK A;  4RTX A;  2VVK A;  4LUE A;  3SHW A;  4AFQ C;  2BZX A;  4EIK A;  1NM7 A;  2DBK A;  1W70 A;  3TSW A;  2VWF A;  2B86 A;  4GBQ A;  1ABQ A;  1ZUU A;  2FPF A;  3UA7 A;  2VKN A;  2K79 A;  2D8H A;  1QWF A;  1ZLM A;  4RTU A;  1BU1 A;  2FRW A;  2DYB A;  1BK2 A;  2DLP A;  3NHN A;  2RQV A;  4J9B A;  1AWX A;  3GBQ A;  4RTV A;  2K2M A;  5IHN A;  2MCN A;  1KIK A;  2L2P A;  4F17 A;  1QLY A;  2ECZ A;  2DBM A;  4OMO A;  1GBR A;  4ORZ A;  2LJ1 A;  4Z8A A;  3EG0 A;  2ED0 A;  2J06 A;  2LNH B;  2JTE A;  1OEB A;  4Z88 A;  1GCQ A;  2P4R A;  3VRZ A;  2EYZ A;  1AOJ A;  1UGV A;  2DMO A;  2ROT A;  1NG2 A;  1SHF A;  1LCK A;  4E6R A;  3ZL7 C;  2RNA A;  3CQT A;  2L3S A;  4D8K A;  2YUP A;  3NGP A;  1QKW A;  1JEG A;  1X69 A;  1OOT A;  3PE0 A;  1GFC A;  4OML A;  3RBB B;  1ZBJ A;  1ZUK A;  1X2K A;  2KR3 A;  1KJW A;  1K1Z A;  1QCF A;  1X6B A;  4HVV A;  3JV3 A;  3VRY A;  1YCS B;  1PRM C;  1X6G A;  1U06 A;  3PVQ A;  5I22 A;  1K76 A;  2J7I A;  2KNB B;  1WXT A;  1AD5 A;  5I11 A;  3EG3 A;  2C0I A;  5L23 A;  2YDL A;  2EYY A;  2SEM A;  2RN8 A;  3KFV A;  4IIO A;  2YSQ A;  2EQI A;  2O9V A;  1YNZ A;  2CH4 A;  2FPD A;  3I5R A;  2MIO A;  2I0N A;  2FEI A;  2KRN A;  4J9G A;  4R0K A;  2F2V A;  4FSS A;  4RUG A;  1ARK A;  4ZNX A;  5GJW B;  4QT7 A;  1PRL C;  3VS3 A;  1H8K A;  3VS6 A;  1WXU A;  2RQU A;  1ZSG A;  2FO0 A;  1G2B A;  2PZ1 A;  3M0T A;  5IHI A;  2CSQ A;  3NMZ C;  1T3L A;  1UFF A;  4J9E A;  2JMA A;  2X3W D;  1HD3 A;  2J6F A;  1I1J A;  2KE9 A;  2O2O A;  2LCS A;  2D8J A;  3O5Z A;  2EGC A;  2DL8 A;  2EGA A;  1WLP B;  2NWM A;  1X2Q A;  2AKL A;  1JXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...