2ENMA

Solution structure of the sh3 domain from mouse sorting nexin-9
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
77
structure length
77
Chain Sequence
GSSGSSGMATKARVMYDFAAEPGNNELTVTEGEIITVTNPNVGGGWLEGKNNKGEQGLVPTDYVEILPNDGKDPFSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the SH3 domain from mouse sorting nexin-9
rcsb
source organism Mus musculus
molecule tags Endocytosis
molecule keywords Sorting nexin-9
total genus 8
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2enmA00
2ESWA 3A98A 4LUEA 2J6OA 1B07A 1E6HA 2G6FX 1M8MA 1UG1A 1NEBA 1K0XA 4RTTA 1G83A 2NWMA 2YUNA 4J9EA 2JM8A 4J9FA 2CT4A 2RPNA 3NHNA 2VKNA 2JM9A 2HDAA 2DL5A 3EG0A 3M0QA 1EFNA 2YDLA 3VS7A 1PRLC 5FWBA 4ESRA 5FW9A 2EKHA 1NG2A 2BZXA 4F17A 1TG0A 2B86A 1GRIA 2A36A 4J9HA 3ULRB 1VYUA 2M0YA 4RTZA 4F16A 2HEQA 1SRMA 3H41A 2J05A 3H0FA 1VA7A 2HSPA 1SRLA 2AKKA 1GFCA 2ED0A 1W6XA 4RTUA 1GCPA 1LCKA 2YT6A 1M27C 2FPFA 3VRYA 4D8DA 5FWCA 2D0NA 4HCKA 2RF0A 3REBB 3M0SA 2L3QA 2E5KA 3R6NA 4CC7A 1AZGB 1NEGA 2JTEA 2SRCA 3PVLA 1QCFA 2JT4A 4Y92A 4JJBA 2ENMA 2YUPA 1WXUA 1JXMA 1ZUUA 2BTTA 3QWXX 1BB9A 2O88A 1M3CA 1K4US 4JJDA 3U23A 1W70A 1T3SA 1G2BA 2OJ2A 2KE9A 3NGPA 1NLOC 1ARKA 1J3TA 1JO8A 2J6FA 2DJQA 3VS4A 1SHGA 1WYXA 1I07A 4JZ3A 4OMQA 4HXJA 4Z8AA 2PZ1A 1W1FA 4RTXA 4CC3A 5IHIA 2FPEA 3M0UA 2XMFA 1BBZA 2ECZA 2CSIA 2W10A 2DMOA 1V1CA 3UATA 1WLPB 3PE0A 3REAB 4RUGA 5L23A 1XOVA 2PNIA 4HVUA 2O31A 1ZSGA 2J06A 2AZVA 2AZSA 1AVZC 1OPKA 3EHRA 3RBBB 2EGCA 2KYMA 2V1RA 2RQWA 4K11A 1ZBJA 2KYBA 1ABQA 4LNPA 4QT7A 2JS0A 4ORZA 2OAWA 2X3WD 1GL5A 4OMOA 2HBWA 5IXFA 1ZLMA 2BZYA 5IH2A 1UHCA 2GTJA 1UJYA 2DBKA 2A37A 1WFWA 2DRKA 2LQWA 2DL3A 2A28A 4ZNXA 4CC2A 2YSQA 3VS1A 4AFZC 4OMMA 2H8HA 3JV3A 1ZX6A 5IHNA 1PRMC 4Z88A 2GNCA 1JEGA 1ZUKA 1YN8A 5GJVB 1A0NB 2DLPA 2P4RA 2DL4A 2KRMA 2KXDA 4LE9A 1T0JA 2DNUA 2RQTA 1OV3A 1I1JA 1X69A 3VS6A 2FRWA 1AOJA 3RNJA 1JU5C 1H3HA 1VYTA 4EIKA 1NLPC 2FPDA 1YWPA 1Z9QA 2A08A 2YUQA 4RTWA 4HVVA 2CSQA 2K2MA 1I0CA 1TUDA 2W0ZA 1FYNA 4DEYA 1HJDA 1HSQA 1UUEA 1T3LA 2KGTA 2EYZA 2KRSA 1SSHA 2D8HA 1WX6A 2L3SA 1CSKA 4F14A 2J7IA 4Z89A 2LP5A 2O9VA 3ZL7C 1MUZA 1NYFA 1UGVA 1H8KA 1MV0B 2KEAA 4LUDA 2GBQA 1ZUYA 1PWTA 1AD5A 2NUZA 2EVRA 3I5RA 3M0RA 3TSWA 2RMOA 1TUCA 2LMJA 1QKWA 1X2QA 1E6GA 4JZ4A 5HCKA 4AFSC 2LX7A 1SEMA 2ROLA 1CKAA 1AWJA 3VS2A 2EGEA 2HCKA 2GTOA 4RTVA 4OMNA 2LZ6B 2KXCA 2MIOA 3UF4A 1AZEA 1RLPC 2RQUA 2D1XA 2RQVA 1OOTA 2DYBA 2V1QA 3LH5A 2MCNA 3VS3A 4J9CA 3SEMA 5IXBA 2K79A 1WA7A 3QWYA 3NMZC 1BU1A 1Y0MA 1NM7A 2KR3A 4A63B 2AK5A 3M0TA 1AWOA 2EPDA 2C0TA 2O2OA 1RLQC 2L2PA 2FEIA 4AG1C 2X3XD 2YUOA 3VRZA 2JW4A 3FJ5A 1KJWA 1HD3A 3H0IA 4WCIA 2L3PA 1WI7A 1GFDA 4J9GA 2FO0A 2IIMA 2J6KA 1QWEA 1GCQA 2CDTA 1WDXA 1JQQA 2GQIA 4GBQA 1YWOA 4OMLA 2EYXA 2LJ1A 3EG2A 1OPLA 3THKA 1X43A 4DEXA 3I5SA 2EYYA 2DBMA 2RQRA 3O5ZA 1E7OA 4J9IA 1PNJA 2GGRA 4CC4B 1X2KA 1PHTA 2JXBA 2VWFA 1VYVA 3VS5A 1N5ZA 3TSZA 1QWFA 2CUBA 1YNZA 1SPKA 3UA7A 2AKLA 2DE0X 1KFZA 2ABLA 2CH4A 2KBTA 1S1NA 4KRTA 1Z9ZA 3EG3A 4OMPA 2ED1A 1OEBA 5EC7A 1UFFA 2KROA 2LNHB 1UJ0A 3GBQA 2RN8A 1WIEA 3KFVA 2DVJA 2FRYA 5IHKA 2KT1A 4FSSA 1UE9A 2F2VA 2M51A 2LJ0A 1CKBA 1M30A 2MOXA 1JXOA 2L0AA 1KSWA 4J9BA 2DA9A 4GLMA 1U06A 2CUDA 2F2XA 2C0OA 4HVWA 3I35A 1T0HA 2JS2A 1YP5A 2O9SA 1PKSA 3UA6A 2RNAA 1UHFA 1X27A 1GBRA 1FMKA 1UECA 1RI9A 2EBPA 2EYWA 3H0HA 2K7AA 3M0PA 1M3BA 2LCSA 4AFQC 1X6BA 1GBQA 4RTYA 4E6RA 1AWXA 1SHFA 1X6GA 4AFUC 5I11A 4D8KA 4J9DA 1U3OA 3VS0A 1B3QA 2F2WA 2OI3A 1K9AA 2K6DA 2K9GA 2CT3A 5I22A 4X1VA 2CREA 3EGUA 3NPFA 1WXTA 3TVTA 2QDLA 1WXBA 4JPBW 1Y57A 1K1ZA 2JMCA 2DM1A 2EGAA 4AG2C 1PKTA 1AWWA 3EG1A 3IQLA 2DX1A 2KNBB 4JJCA 2K3BA 3PVQA 3EHQA 1ABOA 1U5SA 2PTKA 3SHWA 2LQNA 4R0KA 1MV3A 1IO6A 2DILA 4LN2A 2CH4W 1UDLA 2DRMA 5GJWB 2D8JA 3C0CA 2SEMA 4IIMA 1K0SA 2I0NA 1NYGA 2KT8A 1KIKA 2DL8A 2EQIA 2FG0A 2ROTA 2JMAA 1GCQC 1QKXA 2BZ8A 2LJ3A 1RUWA 2KRNA 2DF6A 1H92A 3CQTA 4M4ZA 1BK2A 1UTIA 1K76A 1M3AA 2C0IA 2EW3A 5ECAA 2DL7A 3I9QA 1YCSB 1QLYA 2VVKA 4IIOA 1AEYA
chains in the Genus database with same CATH superfamily
2X4XA 2D9TA 3LGFA 1M8MA 1S72A 1QCOA 1NEBA 1K0XA 4RTTA 5LJ3d 2YUNA 4J9EA 2HNIA 1OU9A 2VKNA 2DXUA 3EG0A 3M0QA 1WHKA 1PRLC 4ESRA 4PFOA 5IAYA 3D7SB 3EFRA 3MEWA 1XTDA 1UEBA 2EKHA 2BZXA 4E7KA 4N0AC 4C8QF 3VV0A 2A36A 3F70A 1D0ZA 4J9HA 3JAME 2H3JA 1YJNT 3ULRB 3NTKA 3CCRA 4BDZA 2M0YA 3MP1A 1YITA 1KK7A 1SRMA 4E7ZA 3LGLA 4RTUA 3OS1A 4A4FA 2V26A 2QQSA 2HQEA 2BKDN 5KYYB 3FB9A 3GNFB 4BE0A 3JB9H 3X24B 3LH0A 4DOWA 2D0NA 3REBB 3M0SA 2E5KA 1NEGA 2QGGA 1N9SA 4ZTJA 2SRCA 1QCFA 2VASA 4Y92A 1KD1C 4FYVB 1M2VA 1MMGA 1ZUUA 4M7DG 2JJ9A 4OGEA 3G71Q 2WSFE 2DIQA 1R0CB 2O88A 4M7DD 3CCSQ 2K4YA 5FU7C 2BE7D 4MMLA 1G2BA 1NLOC 1J3TA 1P92A 2RI5A 1YFNA 4F7UB 2EWNA 3CCLA 1WQWA 1TU0B 3I56Q 2HMAA 3CPWS 3JCMb 3MO8A 3CC4Q 5A0GA 3OA6A 4CC3A 3GOXA 3L42A 4KUDK 2XMFA 1BBZA 1V1CA 3UATA 1WLPB 4Y28E 3CCJT 3M4YA 2PNIA 4HVUA 2EJGA 2O31A 2LT1A 2RI2A 2QEXQ 1AVZC 3CC2Q 3EHRA 1ZA1B 2V1RA 4PLIA 3CCSA 1R8OB 2DXBA 5GAOl 2COWA 5GAN3 1F1BB 8AT1B 4AT1B 4ORZA 5GAMg 2DAQA 3P8BB 3S3MA 2QQ9A 2GQVA 4M75F 1UJYA 2DBKA 4PJNA 2DRKA 5GAOq 4GLKA 4BUGA 4CC2A 3OYDA 2E65A 1HYOA 4OMMA 1ZX6A 5IHNA 1IXDA 2FL7A 2EQMA 3PT9A 1H641 2E6ZA 4M75A 1JEGA 3A8LB 4EPCA 2DL4A 4M7AA 3QJ6A 4C92D 4M77G 2KRMA 1T0JA 3HFOA 1XNIA 4XTXA 1OV3A 2X35A 3CCLQ 3EGXB 4VUBA 1AOJA 3OYGA 4F7UG 2H3EB 1JU5C 4MZTA 4EIKA 1NLPC 1TOVA 2L5QA 4OP0A 3CCST 3JB9F 1YWPA 2PVGB 3META 4HVVA 2OAUA 2K2MA 2RA2A 4HCBA 1OX9A 1IRXA 2KGTA 2KRSA 2QGFB 3CEYA 4OVAA 1RAFB 1SSHA 2L8DA 1UGSB 4NS5A 2L3SA 1RI0A 1Q86C 4JLIA 1VQ5A 3CC4T 2X4YA 1NYFA 1UGVA 4L59A 1VQ8Q 2P0QA 4N0AA 4LUDA 2GBQA 2G3RA 1W2BP 1JJ2P 1K8AR 1PWTA 4BE2A 3CCUA 2NUZA 3JCMV 4ZN3A 3I5RA 1M4ZA 3UT1A 4M75B 2QXFA 4JZ4A 2QEXT 3VUBA 2LX7A 4C8QA 1SEMA 1VQKQ 1AWJA 1U8RA 4OB3B 2HCKA 2KXCA 3EH2A 1HXDA 2RQVA 4DBFA 1OOTA 5CQYA 2DYBA 3LH5A 4J5YA 2IG0A 3SEMA 4EMGA 4M77E 2ZZDA 4ELYC 2KR3A 1NM7A 2AK5A 4ANJA 2C0TA 1RLQC 1R77A 2L2PA 4F7UF 2FEIA 4AG1C 3QDRB 1KQSA 3H0IA 1OU8A 2LRQA 2BE9B 3CMAQ 3H9NA 2NUPA 1GFDA 4J9GA 4DBQA 1TH7A 1VQ4Q 2J6KA 4F04B 1MNEA 1GCQA 4PJOB 1WDXA 3QSUA 2LTOA 5HK0A 2X4JA 3EG2A 4X34A 2XK0A 2EYYA 2QA4Q 1X2KA 2VWFA 4N4IA 2Y4YA 3RDVA 4D6WA 2HKQB 5GAN2 4II1A 5I21A 2P0KA 5GAOm 1KFZA 1OYXA 1Z9ZA 4LDVA 3CCVA 2D6FA 4JDSA 3RKYA 2F1LA 2Y90A 2DYIA 3HRUA 2KDSA 3HHTB 1UE9A 1G3TA 4ELZC 2L0AA 1VQ7T 4BDYA 2LVMA 3CC7Q 2CP5A 3A8GB 3I55Q 3VJPA 4PKCC 1T0HA 3P8DA 4JS4A 1PKSA 3UA6A 4QVCA 5C6SA 2DD5A 4X9DA 2DEUA 3M0PA 3CXCP 1BKBA 1X6BA 3G71T 1SHFA 5CCAA 4M78E 3HRSA 1QVFP 4KULA 4JRPA 4J9DA 1YJWT 3LLRA 3QO3A 3CCRQ 2LCLA 2F2WA 3CMAA 3ER0A 2CT3A 1I4K1 3V7CA 2RJDA 1VQOQ 3G6EQ 2LCCA 4JPBW 2PVDB 1K1ZA 3OYMA 4FT2A 4AG2C 2MMPA 4C92C 4O6JA 2E70A 1RL2A 2KNBB 2L89A 3PVQA 1QVPA 1U5SA 2PTKA 1Y96A 4C92A 1IO6A 2XI9A 5J26A 3TREA 1DJ7B 5GJWB 4M78B 2SEMA 1VQ9T 2FZCB 1QW1A 1K0SA 1NYGA 1VQMT 3X28B 2KT8A 3A8OB 2EQIA 2HAXA 2ROTA 1VQNT 1M90U 1VQ7Q 2XU8A 3JCMf 1IHVA 2DF6A 5GAOr 2XDDA 2MWOA 3JCMg 4NL2A 1K76A 1QP2A 2EW3A 5ECAA 1KD1U 5DY9A 1QVFA 3MPUB 2DXCA 3BE3A 3A98A 1E6HA 1ZSZC 1D09B 4M7DF 4J7IA 5GAMj 3QBYA 4QQGA 1IREB 1KHIA 2EFIA 4M77A 3OS2A 2X4WA 4LDYA 3AHUA 4J9FA 2RPNA 3CCMT 5CKHA 4B9XA 1TSFA 1JRIA 3TCJA 2YDLA 5CIUA 5FW9A 2YXYA 2OTLA 1RAIB 3CCJA 5FRNA 2OTLT 1NG2A 1WNLA 4F17A 3OY9A 1GRIA 5IT9E 4PJOE 3G7ZA 1YITQ 3PNWC 3G71A 3OSSC 3H8ZA 5LJ5g 1D0XA 4F16A 2HEQA 3CBOA 2JN0A 3LW5E 3H41A 3OYLA 3H0FA 1OZ2A 4E47A 1VA7A 3QPHA 4J7FA 1KC8C 3CC2A 1W6XA 1GCPA 1EZZB 2MF2A 1U1SA 1M1GA 4TVRA 2DEQA 2RF0A 1AZGB 1VIFA 3JCMJ 1VQ7A 2DTHA 5GMKm 1VQNQ 3PVLA 1M1KR 4MDXA 8ATCB 2ENMA 3M54A 4M78D 2JNGA 3LX7A 3OW2P 2QDYB 3OYYA 3QWXX 4ZGEB 2ATCB 2M9UA 2IVWA 3PGGA 3CCQQ 4DOVA 1BB9A 1M3CA 3OYHA 1VQ4T 3VU3C 1W70A 1N8RR 3WXMB 2KE9A 1KQSS 1OX8A 4BD3A 1ARKA 2F69A 5KYWA 1JO8A 1EX4A 4JLGA 1SHGA 5C0MA 1D1CA 3QJYA 4OMQA 3S3OA 4HXJA 3CD6A 2PZ1A 1PG5B 3OMCA 2FPEA 2QA4T 2DMOA 4R55A 1VQ5T 6AT1B 4IUTA 3QDFA 5GAOn 1ZSGA 2E6NA 2KMTA 1IB8A 2AZSA 3A5ZB 4RMOA 4OGCA 3AT1B 2EGCA 2M16A 3M4GA 2RQWA 4DA4A 1K8AC 3MEUA 2RJEA 3V8KA 2RHIA 3OYEA 4FW2A 2FYKA 3CCEQ 2JS0A 4PFZA 5A0DA 1X6OA 3KUFA 1ZLMA 4RG2A 3RMQA 3I56A 2GTJA 4Z02A 5KE3A 1WFWA 2LQWA 4BI4A 2A28A 4ZNXA 1YI2Q 3T9NA 2EQJA 1QMCA 1PRMC 5HK3A 5KYUA 4Z88A 1QVGA 2OTJQ 2GNCA 5KH6A 3FRNA 1Y71A 4JS5A 1ZUKA 5GJVB 3OQ5A 2RK1A 1I81A 1PSFA 1YJWQ 2KXDA 4LE9A 5LJ5d 3R6OA 1S72Q 1I1JA 4C8QG 2FRWA 2I2LA 1H3HA 4BB7A 4M7AB 4C8QE 4NOYA 1D0YA 2FPDA 4M75C 1Z9QA 2YUQA 5L8RE 1QCNA 2R58A 4N4GA 1Q82U 1PM3A 4XK8E 2O4XA 4C92E 5M9OA 1UUEA 2L3RA 2EYZA 1I8FA 2JTFA 4KBMB 1WX6A 1N6AA 2J7IA 5GAMf 2LP5A 3DLLA 1BCOA 3WVDB 1MUZA 2KEAA 4LD9K 2WACA 3L2WA 4FCYA 1SF9A 4DBRA 2RB6A 3LWIA 1KG1A 2RD1A 5GMKe 2RMOA 1TUCA 1X2QA 3M9QA 1IGUA 1PD0A 4AFSC 3CC2T 1VQ6T 2ROLA 1CKAA 3L2VA 5A0LA 3VS2A 5LJ5h 1BI3A 1D1BA 2HSEB 4M7AG 4B9WA 2LZ6B 4RCBA 2HKNA 4C8QB 4LDUA 4M7AE 1RLPC 2DZ9A 3DB3A 3BW1A 2YRVA 4A4EA 3TU4K 2HBPA 2K79A 4KGZB 1VQLQ 2VUBA 2MI6A 1N27A 3M0TA 3CC4A 5GANf 1AWOA 4QW2A 1VUBA 1BI1A 2EPDA 1FX7A 5GMKh 1NBEB 4FU6A 4C0FA 2L3PA 1VIEA 2K3YA 2FO0A 4C0DC 2IIMA 3VUZA 1QWEA 2CP0A 3G6EA 4E2FB 1S72T 1MMDA 4IUQA 4DQ2A 4J6WA 2CP6A 4OMLA 3E19A 3V8JA 3JCMP 3JCMe 3O5ZA 4J9IA 1PNJA 2OTLQ 1C1AA 1PHTA 2KI7A 1SG5A 2HD0A 2CUBA 3CBMA 5EC7A 5FROA 1K9MR 1UJ0A 1LVKA 3MCAB 3FDRA 4PJJA 2DVJA 2KT1A 5GAMd 2Y4XA 1VQ9A 4IURA 1Y07A 1YJWA 1M30A 2MOXA 3SWNC 1K73R 3EH1A 5GAN5 1LOJA 2CGHA 1U06A 2M1HA 2F2XA 1ZSZA 1VQKT 1FMWA 1YJ9T 2XKOC 5AT1B 2E41A 2O9SA 3CPWP 2QK0A 1M90C 4PK4A 1D3BB 1IZ6A 1RAAB 4EMHA 2EBPA 2HQHA 3EGXA 5LJ3f 3C12A 3OB9A 3MEVA 2NYSA 1Q7YC 4XQ3A 1Q81R 4AFQC 1GBQA 4E6RA 1G3YA 4OB2B 5I11A 2E3IA 4KGXB 1C0MA 1UGPB 1U3OA 2DTIA 2VB6A 1R0BG 5KYUB 2OI3A 4J83A 2K6DA 3CMAT 5GANd 1X75C 2R57A 5J3BA 4X1VA 2CREA 3EGUA 3NPFA 5A2QE 3I55A 1WXTA 2QDLA 1WXBA 1XJWB 2P84A 2QTVA 1OQKA 3J7AF 3E9FA 2EAYA 2JMCA 2DM1A 2R5MA 2EGAA 3JRZA 1PKTA 3EG1A 3RKWA 4O5VA 2D0QB 2LQNA 4M7DA 2DVEA 2DILA 3CCVQ 4HCZA 2CH4W 1UDLA 2DRMA 4P5NA 3CCET 5CKDA 1NJIR 1WHJA 4HT8A 4AMCA 4XU0A 5I2MA 1KC8U 3CD6T 1YJ9A 4LDXA 4ZTFA 2JMAA 2QYZA 1QKXA 3OW2A 3I55T 2NUPB 2BZ8A 3OYFA 1Y7XA 2E5QA 2KRNA 3S6WA 3S3NA 4BI3A 4PFPA 4WF2A 2AT1B 3P8HA 3OYJA 4QQ6A 1OI1A 3JSCA 1NZ9A 1QLYA 4LUEA 3DKMA 5CKEA 1B07A 1UG1A 5J39A 1G83A 4KUIA 1RABB 2RH2A 2JM8A 4CI0C 5GANj 3CCRT 3NTIA 4OB1B 2CT4A 3NHNA 5I2SA 4RKUE 4XTWA 2DL5A 3N5BB 3G6ET 3OS5A 4X9CA 3VS7A 4FM4B 4HA8A 1V29B 5CKBA 1VQ8T 3Q1JA 1TG0A 4PJOF 4E7JA 3OYIA 2CZ7B 2P4TA 3MKDA 3CCUQ 4XU3A 3NTHA 1B7TA 1VYUA 3G4SQ 4RTZA 3RMSA 1VQ6Q 1KQ2A 2YRDA 2J05A 2QG9B 1SSFA 5CQXA 2ED0A 2AKKA 1GFCA 2KQWA 1YHQQ 1LCKA 5EG2A 4FYXB 3VRYA 2EQUA 4J8OA 3JB9G 3CCMA 1VQMQ 3EG9B 3OYNA 2L3QA 4CC7A 1VQLT 2P0PA 2JTEA 4ZGJB 2JT4A 4J6XA 5DM7R 4JJBA 3TQ7P 2YUPA 4KH0B 1WXUA 1JXMA 3HL8A 1N8RU 2NUTB 2CP3A 5GMKl 3CCQA 4M77D 5CKFA 2ZPFB 2DIGA 4EMKA 3G1JA 3SFMA 2RHZA 1K4US 4JJDA 3U23A 2GF7A 2PUOB 2E3HA 4C0DB 3QYGB 3UPUA 3M53A 2MPXC 3M5AA 2RO0A 1Y96B 1WGSA 2DO3A 1I07A 3C95A 4JZ3A 1W1FA 4RTXA 5IHIA 3FC3A 3M0UA 2WSEE 2ECZA 3CPWA 2W10A 2VGMA 4RUGA 1Q86U 5L23A 1XOVA 1BIAA 2A3LA 2J06A 2AZVA 5AYFA 3BDLA 2R5AA 3CXCS 3EG9A 1OPKA 4JUVA 4XTUA 3RBBB 2KYMA 1MMAA 1ZBJA 3OYKA 4QT7A 1BCMA 3G4ST 4BACA 4NL3A 2GFUA 4OMOA 4WTOB 1GL5A 2CZ1B 2LX9A 1RAEB 3OS0A 3EAEA 4B6MA 1YJ9Q 3HPWA 2A37A 1ZQ1A 5GAN4 4M78G 2YSQA 3E9GA 1V76A 2OTJA 3JV3A 1Q81U 3QIIA 1RAHB 3EFSA 1FXXA 1VOMA 2EJFA 1RADB 4KH1B 4PJOD 2FZKB 1ZA2B 5KYXA 3JCMX 2DLPA 2YWWA 4RG8A 1MNDA 2P4RA 4A53A 3QHSA 2Z0WA 4M77B 2RQTA 1IHWA 1X69A 3QYHB 3VS6A 3HSBA 3EFOA 2DFUA 1WQ7A 2A08A 2YRCA 1C6VX 1Q86R 4DEYA 2F5TX 1HSQA 3PMIA 3JCMc 1NJIU 4C0GA 4N4HA 1PCXA 4F14A 4Z89A 2O9VA 2XG8D 2FB7A 2KVQG 1H8KA 1KHCA 1MV0B 1KQ1A 2LT4A 4QKUA 3RERA 1VQPQ 1BI2A 2EVRA 3M0RA 2DTOA 1E6GA 4JJNK 2V8JA 3C4SA 1QVFS 2VV5A 2MAMA 5KYWB 3SWNB 2FHDA 2QTXA 3SB2A 2DETA 2EGEA 1QP3A 4C5HA 5GANe 4RTVA 2B8AA 3UF4A 2BIVA 3M56A 1WZOA 2D1XA 5GAOp 2V1QA 5IXBA 3URGA 3QWYA 1K73C 3NMZC 2HQXA 1BU1A 1Y0MA 4A63B 4FSXA 4IUUA 2RHXA 1VQLA 2CKKA 1SKUB 2K3XA 4M78A 3ZFJA 1IGQA 2EYQA 3J80E 5D6YA 2X3XD 2YUOA 3VRZA 2JW4A 2C06A 2E12A 1KJWA 4WCIA 3SWNA 1K9MU 1D1AA 1WI7A 2EKOA 2JTMA 5KCOA 1WJSA 2ZGWA 3PTAA 2ZPHB 2LC4A 2CDTA 3CCMQ 2GQIA 3RR6A 4GBQA 4PJOA 1M1KC 2DERA 2EYXA 3THKA 1X43A 2VYTA 2M02A 4DEXA 3I5SA 2CP2A 2RQRA 4CC4B 1I5LA 3MP6A 3WVEB 2V8KA 2JXBA 4E7IA 1VYVA 2CP7A 4PJOC 1SPKA 2AKLA 2DE0X 2ABLA 5DLQE 2XIDA 1S1NA 4KRTA 3CCUT 3EG3A 2VXEA 2OX7A 1OEBA 3HP9A 2NUTA 1VQKA 1UFFA 2KROA 2LNHB 3BY7A 3GBQA 2RN8A 3KFVA 5GMKi 3JCMd 4M7AD 2FRYA 1PSEA 3BDUA 2QI2A 3KXTA 2M51A 1CKBA 4J9BA 2DA9A 2VXFA 4GLMA 3JB9D 4F7UE 3JCMQ 2CUDA 4HCCA 2C0OA 4HVWA 7AT1B 2ZCFB 4M78F 2RNAA 5LL6S 1UHFA 1NE8A 1UECA 1RI9A 2CYZB 2HZYA 3H0HA 4IKFA 1M3BA 3C94A 2XDBA 3CCQT 3OYCA 3X20B 3OBWA 1PD1A 1B3QA 3VS0A 1ACMB 1VQOA 3MJXA 2K5IA 2JVVA 2K9GA 4C5EA 5I22A 4C8QD 3TVTA 2M0OA 4A4GA 2CZ0B 2AIRB 2COYA 4L6V5 5D6WA 2JOYA 3CBPA 1Q82C 5KCHA 3CMEA 1KD1R 4E7SA 1U1TA 3CMET 2MWPA 2XICA 1BYMA 2V8IA 4L5GA 1K8AU 3SHWA 4R0KA 1MHNA 2RHYA 1B34B 1UB4A 3UDCA 4LN2A 1M1KU 3HKSA 3L1AA 4C92B 1N8RC 3LYIA 4C0ZA 2D8JA 1OZ3A 2ZPIB 3PMTA 2ZAEA 4PJMA 2E10A 1KIKA 3A1PA 3ZEHA 2KY9A 1YI2T 4ZN1A 1YI2A 1Q82R 5GANh 1XQHA 3M59A 1X01A 5LJ5e 1H92A 3CQTA 2RK2A 4M4ZA 3FEOA 1BK2A 2NLUA 3RUXA 1TWBA 2OTJT 1G3WA 1M3AA 1ZHIA 2C0IA 3H6ZA 4XTYA 3I9QA 1YCSB 2DXTA 2QQRA 2RI3A 4C92G 3FIFA 2ZPBB 4BY6B 2E64A 3L2RA 2HL5C 2VVKA 4M78C 3VYGA 4IIOA 1AEYA 2COZA 1YIJT 2ESWA 4JRIA 2J6OA 1I5OB 2XHCA 3J81E 2G6FX 4M75G 4EMKC 2RHUA 2NWMA 2DJZA 3EGDB 2K57A 3KBGA 2X9HA 3PFSA 2JM9A 2HL3A 4FIBA 2HDAA 3CCJQ 1VQMA 3VKIA 1EFNA 5GMKj 5FWBA 1JJ2S 4YTLA 4A4HA 4FL6A 4MDWA 1TUGB 2KSSA 2B86A 4GY5A 1ZSZB 3GP8A 1M1FA 3E1SA 4XU1A 4PJLA 1MMNA 1ZBXA 1D3BA 1WHMA 2EIFA 2HSPA 1SRLA 5FLXE 2JUFA 2YT6A 1M27C 2FPFA 3CC7A 3CC7T 4D8DA 5CAIA 5FWCA 4HCKA 2A0FB 3CD6Q 3R6NA 3JB9J 3PIPA 1YCYA 4OF1A 5LJ3g 3RESA 2QQBA 5CVIA 1EIFA 4IUPA 2BTTA 1TS9A 1G8XA 3FLGA 4XU2A 4OB0B 4V2SA 4UC4A 2K5LA 3CCLT 3OBYA 2F5KA 5FU6C 3ASKA 1Q7YU 2ZPEB 1YIJQ 2VGNA 1T3SA 3HRTA 1MGQA 2OJ2A 1UGQB 3L2ZA 4M75D 3NGPA 3INZA 2J6FA 2DJQA 4XAXB 2PU9B 3VS4A 4M7DB 1WYXA 4FYWB 4RCCA 2ZPGB 5LJ3e 3JB9I 1Q81C 4Z8AA 2A7YA 1QQJA 2CSIA 4ME7A 1VQ8A 3PE0A 4M7DE 3REAB 1NJIC 1G5VA 4PNOA 3A8MB 2DD4A 4LD6A 2VC8A 2CZ6B 9ATCB 4QVZA 2K5FA 2PUKB 4CRIA 4K11A 3HTRA 1RAGB 2KYBA 3VYHB 3G4SA 3OMGA 1ABQA 5LJ3j 2XDPA 4LNPA 2OAWA 2X3WD 4MZMA 4EDUA 4XTVA 2HBWA 5IXFA 1YJNA 1K9MC 1WJQA 2BZYA 5IH2A 1UHCA 1O9SA 4FYYB 3JCMW 2PQWA 3QZ5B 2DL3A 4HKEA 4M7AC 1YHQT 3DB4A 3MEAA 3VS1A 4AFZC 4QVDA 3OW2S 2H8HA 3M58A 4JRQA 4LXCA 5CR2A 2O4XB 1PC0A 2YLCA 1JB0E 2FZGB 1M9SA 1W4SA 1YN8A 1QVGP 2QAZA 2LQ8A 2YHTA 1A0NB 4KGVB 1WJRA 3HFNA 5D6XA 1UGRB 2E4HA 5KYNA 2DNUA 2DZCA 1Q7YR 5KYXB 3RNJA 1VYTA 4R56A 2GFAA 2RJCA 5GAN6 5KYYA 4RTWA 2CSQA 1M90R 5FU6B 1I0CA 1FWZA 1TUDA 1FYNA 2W0ZA 1JJ2A 1HJDA 3MP8A 1OULA 1T3LA 2D8HA 1LJOA 3CMEQ 1GXIE 1CSKA 3QZ9B 4LDWA 2QEXA 4HT9A 3ZL7C 5HY6A 1RACB 1BIBA 3MHXA 3TEEA 1ZUYA 1VQNA 2DK3A 1H3ZA 3CCVT 1AD5A 3O8VA 1Q95G 3TSWA 1AT1B 2LMJA 3QKJA 1QKWA 4OMFB 1YJNQ 5HCKA 4F7UA 1M2OA 1NPRA 1TXQA 1VQ4A 3RKXA 4Y91A 3CXCA 3X26B 3SDZA 4C5IA 2RM4A 4BY6C 1YHQA 2GTOA 2JZ2A 4OMNA 1WHGA 2MIOA 1AZEA 2GCXA 1O75A 2RQUA 1KQSP 2MCNA 1LNXA 3VS3A 2X51A 4J9CA 5GAMe 1WA7A 2XD0A 2LNVA 3GNGA 4M77F 1VQPA 4BE1A 2O2OA 3JCMh 2EQKA 3OSVA 5GAMh 1W2BS 4M7AF 4PLLA 3FJ5A 3A8HB 1HD3A 4A54A 3GLXA 5HKCA 3CCEA 2CS7A 1VQOT 5D7UA 1BI0A 4EMKB 1M8VA 1JQQA 4IUVA 5KE2A 1YWOA 3L2QA 2RJFA 2LJ1A 4FW1A 1OPLA 3I56T 3DLMA 3L2UA 2O01E 5LJ5f 2DBMA 3OYBA 1E7OA 2GGRA 3ME9A 3VS5A 1N5ZA 3TSZA 1QWFA 4JRKA 1VQ5Q 1YNZA 3V7SA 3UA7A 3GIBA 3V8LA 5GANg 2CH4A 2KBTA 4OMPA 3PIOA 4MMKA 2ED1A 2YLBA 1VQPT 1VQ9Q 4C92F 1NPPA 1WIEA 2IPOB 5IHKA 4QQDA 3LWHA 3EFOB 4FSSA 2F2VA 2K2VA 2LJ0A 3M57A 3X25B 3GPLA 1JXOA 1KSWA 1WPYA 4DBHA 2EJ9A 2QQAA 3I35A 5CO7A 2JS2A 1YP5A 4MZPA 2QASA 4ATOA 4C5GA 1X27A 1GBRA 1FMKA 4BI8B 2EYWA 4KT0E 2WSCE 2E1HA 2K7AA 3QG1A 2LCSA 3ZBDA 3EGDA 4PL6A 5DLOA 3FJPA 3CPFA 4RTYA 1AWXA 1X6GA 2LDMA 1WHLA 3QXEB 5LJ5j 4PJOG 4AFUC 4D8KA 2MK5A 1LPLA 5GAN7 5IN1A 4FT4A 1K9AA 1VQ6A 3GF5A 1AHJB 4J6YA 3NFCA 1HK9A 3BFMA 3QUIA 4C8QC 1TTHB 3UWNA 4M75E 1WHHA 4A4KA 4M7DC 1Y57A 3M55A 3RIRA 2DPPB 2KAFA 1AWWA 5CK9A 1JBMA 3IQLA 2DX1A 4E7LA 1YITT 4JJCA 2K3BA 2QA4A 2BUDA 3EHQA 4Q5WA 1ABOA 2LQKA 1YIJA 2DKGA 5LJ3h 3SD4A 1MV3A 1YBYA 4XTZA 2KK4A 2AHJB 1KC8R 1W2BA 3OYAA 3C0CA 4E7HA 2FVUA 4IIMA 2I0NA 2DL8A 1N9RA 1QVGS 2FG0A 1FMVA 5FU7B 1GCQC 2PVOB 2MYSA 3E2UA 1M5Q1 2LJ3A 1RUWA 3V7RA 5GAN8 5FRMA 4ZGDB 1M2VB 1UTIA 1B34A 1G3SA 4M77C 2DL7A 1K73U
chains in the Genus database with same CATH topology
2ESWA 3A98A 4LUEA 2J6OA 1B07A 1E6HA 2G6FX 1M8MA 1UG1A 1NEBA 1K0XA 4RTTA 1G83A 2NWMA 2YUNA 4J9EA 2JM8A 4J9FA 2CT4A 2RPNA 3NHNA 2VKNA 2JM9A 2HDAA 2DL5A 3EG0A 3M0QA 1EFNA 2YDLA 3VS7A 1PRLC 5FWBA 4ESRA 5FW9A 2EKHA 1NG2A 2BZXA 4F17A 1TG0A 2B86A 1GRIA 2A36A 4J9HA 3ULRB 1VYUA 2M0YA 4RTZA 4F16A 2HEQA 1SRMA 3H41A 2J05A 3H0FA 1VA7A 2HSPA 1SRLA 2AKKA 1GFCA 2ED0A 1W6XA 4RTUA 1GCPA 1LCKA 2YT6A 1M27C 2FPFA 3VRYA 4D8DA 5FWCA 2D0NA 4HCKA 2RF0A 3REBB 3M0SA 2L3QA 2E5KA 3R6NA 4CC7A 1AZGB 1NEGA 2JTEA 2SRCA 3PVLA 1QCFA 2JT4A 4Y92A 4JJBA 2ENMA 2YUPA 1WXUA 1JXMA 1ZUUA 2BTTA 3QWXX 1BB9A 2O88A 1M3CA 1K4US 4JJDA 3U23A 1W70A 1T3SA 1G2BA 2OJ2A 2KE9A 3NGPA 1NLOC 1ARKA 1J3TA 1JO8A 2J6FA 2DJQA 3VS4A 1SHGA 1WYXA 1I07A 4JZ3A 4OMQA 4HXJA 4Z8AA 2PZ1A 1W1FA 4RTXA 4CC3A 5IHIA 2FPEA 3M0UA 2XMFA 1BBZA 2ECZA 2CSIA 2W10A 2DMOA 1V1CA 3UATA 1WLPB 3PE0A 3REAB 4RUGA 5L23A 1XOVA 2PNIA 4HVUA 2O31A 1ZSGA 2J06A 2AZVA 2AZSA 1AVZC 1OPKA 3EHRA 3RBBB 2EGCA 2KYMA 2V1RA 2RQWA 4K11A 1ZBJA 2KYBA 1ABQA 4LNPA 4QT7A 2JS0A 4ORZA 2OAWA 2X3WD 1GL5A 4OMOA 2HBWA 5IXFA 1ZLMA 2BZYA 5IH2A 1UHCA 2GTJA 1UJYA 2DBKA 2A37A 1WFWA 2DRKA 2LQWA 2DL3A 2A28A 4ZNXA 4CC2A 2YSQA 3VS1A 4AFZC 4OMMA 2H8HA 3JV3A 1ZX6A 5IHNA 1PRMC 4Z88A 2GNCA 1JEGA 1ZUKA 1YN8A 5GJVB 1A0NB 2DLPA 2P4RA 2DL4A 2KRMA 2KXDA 4LE9A 1T0JA 2DNUA 2RQTA 1OV3A 1I1JA 1X69A 3VS6A 2FRWA 1AOJA 3RNJA 1JU5C 1H3HA 1VYTA 4EIKA 1NLPC 2FPDA 1YWPA 1Z9QA 2A08A 2YUQA 4RTWA 4HVVA 2CSQA 2K2MA 1I0CA 1TUDA 2W0ZA 1FYNA 4DEYA 1HJDA 1HSQA 1UUEA 1T3LA 2KGTA 2EYZA 2KRSA 1SSHA 2D8HA 1WX6A 2L3SA 1CSKA 4F14A 2J7IA 4Z89A 2LP5A 2O9VA 3ZL7C 1MUZA 1NYFA 1UGVA 1H8KA 1MV0B 2KEAA 4LUDA 2GBQA 1ZUYA 1PWTA 1AD5A 2NUZA 2EVRA 3I5RA 3M0RA 3TSWA 2RMOA 1TUCA 2LMJA 1QKWA 1X2QA 1E6GA 4JZ4A 5HCKA 4AFSC 2LX7A 1SEMA 2ROLA 1CKAA 1AWJA 3VS2A 2EGEA 2HCKA 2GTOA 4RTVA 4OMNA 2LZ6B 2KXCA 2MIOA 3UF4A 1AZEA 1RLPC 2RQUA 2D1XA 2RQVA 1OOTA 2DYBA 2V1QA 3LH5A 2MCNA 3VS3A 4J9CA 3SEMA 5IXBA 2K79A 1WA7A 3QWYA 3NMZC 1BU1A 1Y0MA 1NM7A 2KR3A 4A63B 2AK5A 3M0TA 1AWOA 2EPDA 2C0TA 2O2OA 1RLQC 2L2PA 2FEIA 4AG1C 2X3XD 2YUOA 3VRZA 2JW4A 3FJ5A 1KJWA 1HD3A 3H0IA 4WCIA 2L3PA 1WI7A 1GFDA 4J9GA 2FO0A 2IIMA 2J6KA 1QWEA 1GCQA 2CDTA 1WDXA 1JQQA 2GQIA 4GBQA 1YWOA 4OMLA 2EYXA 2LJ1A 3EG2A 1OPLA 3THKA 1X43A 4DEXA 3I5SA 2EYYA 2DBMA 2RQRA 3O5ZA 1E7OA 4J9IA 1PNJA 2GGRA 4CC4B 1X2KA 1PHTA 2JXBA 2VWFA 1VYVA 3VS5A 1N5ZA 3TSZA 1QWFA 2CUBA 1YNZA 1SPKA 3UA7A 2AKLA 2DE0X 1KFZA 2ABLA 2CH4A 2KBTA 1S1NA 4KRTA 1Z9ZA 3EG3A 4OMPA 2ED1A 1OEBA 5EC7A 1UFFA 2KROA 2LNHB 1UJ0A 3GBQA 2RN8A 1WIEA 3KFVA 2DVJA 2FRYA 5IHKA 2KT1A 4FSSA 1UE9A 2F2VA 2M51A 2LJ0A 1CKBA 1M30A 2MOXA 1JXOA 2L0AA 1KSWA 4J9BA 2DA9A 4GLMA 1U06A 2CUDA 2F2XA 2C0OA 4HVWA 3I35A 1T0HA 2JS2A 1YP5A 2O9SA 1PKSA 3UA6A 2RNAA 1UHFA 1X27A 1GBRA 1FMKA 1UECA 1RI9A 2EBPA 2EYWA 3H0HA 2K7AA 3M0PA 1M3BA 2LCSA 4AFQC 1X6BA 1GBQA 4RTYA 4E6RA 1AWXA 1SHFA 1X6GA 4AFUC 5I11A 4D8KA 4J9DA 1U3OA 3VS0A 1B3QA 2F2WA 2OI3A 1K9AA 2K6DA 2K9GA 2CT3A 5I22A 4X1VA 2CREA 3EGUA 3NPFA 1WXTA 3TVTA 2QDLA 1WXBA 4JPBW 1Y57A 1K1ZA 2JMCA 2DM1A 2EGAA 4AG2C 1PKTA 1AWWA 3EG1A 3IQLA 2DX1A 2KNBB 4JJCA 2K3BA 3PVQA 3EHQA 1ABOA 1U5SA 2PTKA 3SHWA 2LQNA 4R0KA 1MV3A 1IO6A 2DILA 4LN2A 2CH4W 1UDLA 2DRMA 5GJWB 2D8JA 3C0CA 2SEMA 4IIMA 1K0SA 2I0NA 1NYGA 2KT8A 1KIKA 2DL8A 2EQIA 2FG0A 2ROTA 2JMAA 1GCQC 1QKXA 2BZ8A 2LJ3A 1RUWA 2KRNA 2DF6A 1H92A 3CQTA 4M4ZA 1BK2A 1UTIA 1K76A 1M3AA 2C0IA 2EW3A 5ECAA 2DL7A 3I9QA 1YCSB 1QLYA 2VVKA 4IIOA 1AEYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ESW A;  3A98 A;  4LUE A;  2J6O A;  1B07 A;  1E6H A;  2G6F X;  1M8M A;  1UG1 A;  1NEB A;  1K0X A;  4RTT A;  1G83 A;  2NWM A;  2YUN A;  4J9E A;  2JM8 A;  4J9F A;  2CT4 A;  2RPN A;  3NHN A;  2VKN A;  2JM9 A;  2HDA A;  2DL5 A;  3EG0 A;  3M0Q A;  1EFN A;  2YDL A;  3VS7 A;  1PRL C;  5FWB A;  4ESR A;  5FW9 A;  2EKH A;  1NG2 A;  2BZX A;  4F17 A;  1TG0 A;  2B86 A;  1GRI A;  2A36 A;  4J9H A;  3ULR B;  1VYU A;  2M0Y A;  4RTZ A;  4F16 A;  2HEQ A;  1SRM A;  3H41 A;  2J05 A;  3H0F A;  1VA7 A;  2HSP A;  1SRL A;  2AKK A;  1GFC A;  2ED0 A;  1W6X A;  4RTU A;  1GCP A;  1LCK A;  2YT6 A;  1M27 C;  2FPF A;  3VRY A;  4D8D A;  5FWC A;  2D0N A;  4HCK A;  2RF0 A;  3REB B;  3M0S A;  2L3Q A;  2E5K A;  3R6N A;  4CC7 A;  1AZG B;  1NEG A;  2JTE A;  2SRC A;  3PVL A;  1QCF A;  2JT4 A;  4Y92 A;  4JJB A;  2ENM A;  2YUP A;  1WXU A;  1JXM A;  1ZUU A;  2BTT A;  3QWX X;  1BB9 A;  2O88 A;  1M3C A;  1K4U S;  4JJD A;  3U23 A;  1W70 A;  1T3S A;  1G2B A;  2OJ2 A;  2KE9 A;  3NGP A;  1NLO C;  1ARK A;  1J3T A;  1JO8 A;  2J6F A;  2DJQ A;  3VS4 A;  1SHG A;  1WYX A;  1I07 A;  4JZ3 A;  4OMQ A;  4HXJ A;  4Z8A A;  2PZ1 A;  1W1F A;  4RTX A;  4CC3 A;  5IHI A;  2FPE A;  3M0U A;  2XMF A;  1BBZ A;  2ECZ A;  2CSI A;  2W10 A;  2DMO A;  1V1C A;  3UAT A;  1WLP B;  3PE0 A;  3REA B;  4RUG A;  5L23 A;  1XOV A;  2PNI A;  4HVU A;  2O31 A;  1ZSG A;  2J06 A;  2AZV A;  2AZS A;  1AVZ C;  1OPK A;  3EHR A;  3RBB B;  2EGC A;  2KYM A;  2V1R A;  2RQW A;  4K11 A;  1ZBJ A;  2KYB A;  1ABQ A;  4LNP A;  4QT7 A;  2JS0 A;  4ORZ A;  2OAW A;  2X3W D;  1GL5 A;  4OMO A;  2HBW A;  5IXF A;  1ZLM A;  2BZY A;  5IH2 A;  1UHC A;  2GTJ A;  1UJY A;  2DBK A;  2A37 A;  1WFW A;  2DRK A;  2LQW A;  2DL3 A;  2A28 A;  4ZNX A;  4CC2 A;  2YSQ A;  3VS1 A;  4AFZ C;  4OMM A;  2H8H A;  3JV3 A;  1ZX6 A;  5IHN A;  1PRM C;  4Z88 A;  2GNC A;  1JEG A;  1ZUK A;  1YN8 A;  5GJV B;  1A0N B;  2DLP A;  2P4R A;  2DL4 A;  2KRM A;  2KXD A;  4LE9 A;  1T0J A;  2DNU A;  2RQT A;  1OV3 A;  1I1J A;  1X69 A;  3VS6 A;  2FRW A;  1AOJ A;  3RNJ A;  1JU5 C;  1H3H A;  1VYT A;  4EIK A;  1NLP C;  2FPD A;  1YWP A;  1Z9Q A;  2A08 A;  2YUQ A;  4RTW A;  4HVV A;  2CSQ A;  2K2M A;  1I0C A;  1TUD A;  2W0Z A;  1FYN A;  4DEY A;  1HJD A;  1HSQ A;  1UUE A;  1T3L A;  2KGT A;  2EYZ A;  2KRS A;  1SSH A;  2D8H A;  1WX6 A;  2L3S A;  1CSK A;  4F14 A;  2J7I A;  4Z89 A;  2LP5 A;  2O9V A;  3ZL7 C;  1MUZ A;  1NYF A;  1UGV A;  1H8K A;  1MV0 B;  2KEA A;  4LUD A;  2GBQ A;  1ZUY A;  1PWT A;  1AD5 A;  2NUZ A;  2EVR A;  3I5R A;  3M0R A;  3TSW A;  2RMO A;  1TUC A;  2LMJ A;  1QKW A;  1X2Q A;  1E6G A;  4JZ4 A;  5HCK A;  4AFS C;  2LX7 A;  1SEM A;  2ROL A;  1CKA A;  1AWJ A;  3VS2 A;  2EGE A;  2HCK A;  2GTO A;  4RTV A;  4OMN A;  2LZ6 B;  2KXC A;  2MIO A;  3UF4 A;  1AZE A;  1RLP C;  2RQU A;  2D1X A;  2RQV A;  1OOT A;  2DYB A;  2V1Q A;  3LH5 A;  2MCN A;  3VS3 A;  4J9C A;  3SEM A;  5IXB A;  2K79 A;  1WA7 A;  3QWY A;  3NMZ C;  1BU1 A;  1Y0M A;  1NM7 A;  2KR3 A;  4A63 B;  2AK5 A;  3M0T A;  1AWO A;  2EPD A;  2C0T A;  2O2O A;  1RLQ C;  2L2P A;  2FEI A;  4AG1 C;  2X3X D;  2YUO A;  3VRZ A;  2JW4 A;  3FJ5 A;  1KJW A;  1HD3 A;  3H0I A;  4WCI A;  2L3P A;  1WI7 A;  1GFD A;  4J9G A;  2FO0 A;  2IIM A;  2J6K A;  1QWE A;  1GCQ A;  2CDT A;  1WDX A;  1JQQ A;  2GQI A;  4GBQ A;  1YWO A;  4OML A;  2EYX A;  2LJ1 A;  3EG2 A;  1OPL A;  3THK A;  1X43 A;  4DEX A;  3I5S A;  2EYY A;  2DBM A;  2RQR A;  3O5Z A;  1E7O A;  4J9I A;  1PNJ A;  2GGR A;  4CC4 B;  1X2K A;  1PHT A;  2JXB A;  2VWF A;  1VYV A;  3VS5 A;  1N5Z A;  3TSZ A;  1QWF A;  2CUB A;  1YNZ A;  1SPK A;  3UA7 A;  2AKL A;  2DE0 X;  1KFZ A;  2ABL A;  2CH4 A;  2KBT A;  1S1N A;  4KRT A;  1Z9Z A;  3EG3 A;  4OMP A;  2ED1 A;  1OEB A;  5EC7 A;  1UFF A;  2KRO A;  2LNH B;  1UJ0 A;  3GBQ A;  2RN8 A;  1WIE A;  3KFV A;  2DVJ A;  2FRY A;  5IHK A;  2KT1 A;  4FSS A;  1UE9 A;  2F2V A;  2M51 A;  2LJ0 A;  1CKB A;  1M30 A;  2MOX A;  1JXO A;  2L0A A;  1KSW A;  4J9B A;  2DA9 A;  4GLM A;  1U06 A;  2CUD A;  2F2X A;  2C0O A;  4HVW A;  3I35 A;  1T0H A;  2JS2 A;  1YP5 A;  2O9S A;  1PKS A;  3UA6 A;  2RNA A;  1UHF A;  1X27 A;  1GBR A;  1FMK A;  1UEC A;  1RI9 A;  2EBP A;  2EYW A;  3H0H A;  2K7A A;  3M0P A;  1M3B A;  2LCS A;  4AFQ C;  1X6B A;  1GBQ A;  4RTY A;  4E6R A;  1AWX A;  1SHF A;  1X6G A;  4AFU C;  5I11 A;  4D8K A;  4J9D A;  1U3O A;  3VS0 A;  1B3Q A;  2F2W A;  2OI3 A;  1K9A A;  2K6D A;  2K9G A;  2CT3 A;  5I22 A;  4X1V A;  2CRE A;  3EGU A;  3NPF A;  1WXT A;  3TVT A;  2QDL A;  1WXB A;  4JPB W;  1Y57 A;  1K1Z A;  2JMC A;  2DM1 A;  2EGA A;  4AG2 C;  1PKT A;  1AWW A;  3EG1 A;  3IQL A;  2DX1 A;  2KNB B;  4JJC A;  2K3B A;  3PVQ A;  3EHQ A;  1ABO A;  1U5S A;  2PTK A;  3SHW A;  2LQN A;  4R0K A;  1MV3 A;  1IO6 A;  2DIL A;  4LN2 A;  2CH4 W;  1UDL A;  2DRM A;  5GJW B;  2D8J A;  3C0C A;  2SEM A;  4IIM A;  1K0S A;  2I0N A;  1NYG A;  2KT8 A;  1KIK A;  2DL8 A;  2EQI A;  2FG0 A;  2ROT A;  2JMA A;  1GCQ C;  1QKX A;  2BZ8 A;  2LJ3 A;  1RUW A;  2KRN A;  2DF6 A;  1H92 A;  3CQT A;  4M4Z A;  1BK2 A;  1UTI A;  1K76 A;  1M3A A;  2C0I A;  2EW3 A;  5ECA A;  2DL7 A;  3I9Q A;  1YCS B;  1QLY A;  2VVK A;  4IIO A;  1AEY A; 
#chains in the Genus database with same CATH topology
 2X4X A;  2D9T A;  3LGF A;  1M8M A;  1S72 A;  1QCO A;  1NEB A;  1K0X A;  4RTT A;  5LJ3 d;  2YUN A;  4J9E A;  2HNI A;  1OU9 A;  2VKN A;  2DXU A;  3EG0 A;  3M0Q A;  1WHK A;  1PRL C;  4ESR A;  4PFO A;  5IAY A;  3D7S B;  3EFR A;  3MEW A;  1XTD A;  1UEB A;  2EKH A;  2BZX A;  4E7K A;  4N0A C;  4C8Q F;  3VV0 A;  2A36 A;  3F70 A;  1D0Z A;  4J9H A;  3JAM E;  2H3J A;  1YJN T;  3ULR B;  3NTK A;  3CCR A;  4BDZ A;  2M0Y A;  3MP1 A;  1YIT A;  1KK7 A;  1SRM A;  4E7Z A;  3LGL A;  4RTU A;  3OS1 A;  4A4F A;  2V26 A;  2QQS A;  2HQE A;  2BKD N;  5KYY B;  3FB9 A;  3GNF B;  4BE0 A;  3JB9 H;  3X24 B;  3LH0 A;  4DOW A;  2D0N A;  3REB B;  3M0S A;  2E5K A;  1NEG A;  2QGG A;  1N9S A;  4ZTJ A;  2SRC A;  1QCF A;  2VAS A;  4Y92 A;  1KD1 C;  4FYV B;  1M2V A;  1MMG A;  1ZUU A;  4M7D G;  2JJ9 A;  4OGE A;  3G71 Q;  2WSF E;  2DIQ A;  1R0C B;  2O88 A;  4M7D D;  3CCS Q;  2K4Y A;  5FU7 C;  2BE7 D;  4MML A;  1G2B A;  1NLO C;  1J3T A;  1P92 A;  2RI5 A;  1YFN A;  4F7U B;  2EWN A;  3CCL A;  1WQW A;  1TU0 B;  3I56 Q;  2HMA A;  3CPW S;  3JCM b;  3MO8 A;  3CC4 Q;  5A0G A;  3OA6 A;  4CC3 A;  3GOX A;  3L42 A;  4KUD K;  2XMF A;  1BBZ A;  1V1C A;  3UAT A;  1WLP B;  4Y28 E;  3CCJ T;  3M4Y A;  2PNI A;  4HVU A;  2EJG A;  2O31 A;  2LT1 A;  2RI2 A;  2QEX Q;  1AVZ C;  3CC2 Q;  3EHR A;  1ZA1 B;  2V1R A;  4PLI A;  3CCS A;  1R8O B;  2DXB A;  5GAO l;  2COW A;  5GAN 3;  1F1B B;  8AT1 B;  4AT1 B;  4ORZ A;  5GAM g;  2DAQ A;  3P8B B;  3S3M A;  2QQ9 A;  2GQV A;  4M75 F;  1UJY A;  2DBK A;  4PJN A;  2DRK A;  5GAO q;  4GLK A;  4BUG A;  4CC2 A;  3OYD A;  2E65 A;  1HYO A;  4OMM A;  1ZX6 A;  5IHN A;  1IXD A;  2FL7 A;  2EQM A;  3PT9 A;  1H64 1;  2E6Z A;  4M75 A;  1JEG A;  3A8L B;  4EPC A;  2DL4 A;  4M7A A;  3QJ6 A;  4C92 D;  4M77 G;  2KRM A;  1T0J A;  3HFO A;  1XNI A;  4XTX A;  1OV3 A;  2X35 A;  3CCL Q;  3EGX B;  4VUB A;  1AOJ A;  3OYG A;  4F7U G;  2H3E B;  1JU5 C;  4MZT A;  4EIK A;  1NLP C;  1TOV A;  2L5Q A;  4OP0 A;  3CCS T;  3JB9 F;  1YWP A;  2PVG B;  3MET A;  4HVV A;  2OAU A;  2K2M A;  2RA2 A;  4HCB A;  1OX9 A;  1IRX A;  2KGT A;  2KRS A;  2QGF B;  3CEY A;  4OVA A;  1RAF B;  1SSH A;  2L8D A;  1UGS B;  4NS5 A;  2L3S A;  1RI0 A;  1Q86 C;  4JLI A;  1VQ5 A;  3CC4 T;  2X4Y A;  1NYF A;  1UGV A;  4L59 A;  1VQ8 Q;  2P0Q A;  4N0A A;  4LUD A;  2GBQ A;  2G3R A;  1W2B P;  1JJ2 P;  1K8A R;  1PWT A;  4BE2 A;  3CCU A;  2NUZ A;  3JCM V;  4ZN3 A;  3I5R A;  1M4Z A;  3UT1 A;  4M75 B;  2QXF A;  4JZ4 A;  2QEX T;  3VUB A;  2LX7 A;  4C8Q A;  1SEM A;  1VQK Q;  1AWJ A;  1U8R A;  4OB3 B;  2HCK A;  2KXC A;  3EH2 A;  1HXD A;  2RQV A;  4DBF A;  1OOT A;  5CQY A;  2DYB A;  3LH5 A;  4J5Y A;  2IG0 A;  3SEM A;  4EMG A;  4M77 E;  2ZZD A;  4ELY C;  2KR3 A;  1NM7 A;  2AK5 A;  4ANJ A;  2C0T A;  1RLQ C;  1R77 A;  2L2P A;  4F7U F;  2FEI A;  4AG1 C;  3QDR B;  1KQS A;  3H0I A;  1OU8 A;  2LRQ A;  2BE9 B;  3CMA Q;  3H9N A;  2NUP A;  1GFD A;  4J9G A;  4DBQ A;  1TH7 A;  1VQ4 Q;  2J6K A;  4F04 B;  1MNE A;  1GCQ A;  4PJO B;  1WDX A;  3QSU A;  2LTO A;  5HK0 A;  2X4J A;  3EG2 A;  4X34 A;  2XK0 A;  2EYY A;  2QA4 Q;  1X2K A;  2VWF A;  4N4I A;  2Y4Y A;  3RDV A;  4D6W A;  2HKQ B;  5GAN 2;  4II1 A;  5I21 A;  2P0K A;  5GAO m;  1KFZ A;  1OYX A;  1Z9Z A;  4LDV A;  3CCV A;  2D6F A;  4JDS A;  3RKY A;  2F1L A;  2Y90 A;  2DYI A;  3HRU A;  2KDS A;  3HHT B;  1UE9 A;  1G3T A;  4ELZ C;  2L0A A;  1VQ7 T;  4BDY A;  2LVM A;  3CC7 Q;  2CP5 A;  3A8G B;  3I55 Q;  3VJP A;  4PKC C;  1T0H A;  3P8D A;  4JS4 A;  1PKS A;  3UA6 A;  4QVC A;  5C6S A;  2DD5 A;  4X9D A;  2DEU A;  3M0P A;  3CXC P;  1BKB A;  1X6B A;  3G71 T;  1SHF A;  5CCA A;  4M78 E;  3HRS A;  1QVF P;  4KUL A;  4JRP A;  4J9D A;  1YJW T;  3LLR A;  3QO3 A;  3CCR Q;  2LCL A;  2F2W A;  3CMA A;  3ER0 A;  2CT3 A;  1I4K 1;  3V7C A;  2RJD A;  1VQO Q;  3G6E Q;  2LCC A;  4JPB W;  2PVD B;  1K1Z A;  3OYM A;  4FT2 A;  4AG2 C;  2MMP A;  4C92 C;  4O6J A;  2E70 A;  1RL2 A;  2KNB B;  2L89 A;  3PVQ A;  1QVP A;  1U5S A;  2PTK A;  1Y96 A;  4C92 A;  1IO6 A;  2XI9 A;  5J26 A;  3TRE A;  1DJ7 B;  5GJW B;  4M78 B;  2SEM A;  1VQ9 T;  2FZC B;  1QW1 A;  1K0S A;  1NYG A;  1VQM T;  3X28 B;  2KT8 A;  3A8O B;  2EQI A;  2HAX A;  2ROT A;  1VQN T;  1M90 U;  1VQ7 Q;  2XU8 A;  3JCM f;  1IHV A;  2DF6 A;  5GAO r;  2XDD A;  2MWO A;  3JCM g;  4NL2 A;  1K76 A;  1QP2 A;  2EW3 A;  5ECA A;  1KD1 U;  5DY9 A;  1QVF A;  3MPU B;  2DXC A;  3BE3 A;  3A98 A;  1E6H A;  1ZSZ C;  1D09 B;  4M7D F;  4J7I A;  5GAM j;  3QBY A;  4QQG A;  1IRE B;  1KHI A;  2EFI A;  4M77 A;  3OS2 A;  2X4W A;  4LDY A;  3AHU A;  4J9F A;  2RPN A;  3CCM T;  5CKH A;  4B9X A;  1TSF A;  1JRI A;  3TCJ A;  2YDL A;  5CIU A;  5FW9 A;  2YXY A;  2OTL A;  1RAI B;  3CCJ A;  5FRN A;  2OTL T;  1NG2 A;  1WNL A;  4F17 A;  3OY9 A;  1GRI A;  5IT9 E;  4PJO E;  3G7Z A;  1YIT Q;  3PNW C;  3G71 A;  3OSS C;  3H8Z A;  5LJ5 g;  1D0X A;  4F16 A;  2HEQ A;  3CBO A;  2JN0 A;  3LW5 E;  3H41 A;  3OYL A;  3H0F A;  1OZ2 A;  4E47 A;  1VA7 A;  3QPH A;  4J7F A;  1KC8 C;  3CC2 A;  1W6X A;  1GCP A;  1EZZ B;  2MF2 A;  1U1S A;  1M1G A;  4TVR A;  2DEQ A;  2RF0 A;  1AZG B;  1VIF A;  3JCM J;  1VQ7 A;  2DTH A;  5GMK m;  1VQN Q;  3PVL A;  1M1K R;  4MDX A;  8ATC B;  2ENM A;  3M54 A;  4M78 D;  2JNG A;  3LX7 A;  3OW2 P;  2QDY B;  3OYY A;  3QWX X;  4ZGE B;  2ATC B;  2M9U A;  2IVW A;  3PGG A;  3CCQ Q;  4DOV A;  1BB9 A;  1M3C A;  3OYH A;  1VQ4 T;  3VU3 C;  1W70 A;  1N8R R;  3WXM B;  2KE9 A;  1KQS S;  1OX8 A;  4BD3 A;  1ARK A;  2F69 A;  5KYW A;  1JO8 A;  1EX4 A;  4JLG A;  1SHG A;  5C0M A;  1D1C A;  3QJY A;  4OMQ A;  3S3O A;  4HXJ A;  3CD6 A;  2PZ1 A;  1PG5 B;  3OMC A;  2FPE A;  2QA4 T;  2DMO A;  4R55 A;  1VQ5 T;  6AT1 B;  4IUT A;  3QDF A;  5GAO n;  1ZSG A;  2E6N A;  2KMT A;  1IB8 A;  2AZS A;  3A5Z B;  4RMO A;  4OGC A;  3AT1 B;  2EGC A;  2M16 A;  3M4G A;  2RQW A;  4DA4 A;  1K8A C;  3MEU A;  2RJE A;  3V8K A;  2RHI A;  3OYE A;  4FW2 A;  2FYK A;  3CCE Q;  2JS0 A;  4PFZ A;  5A0D A;  1X6O A;  3KUF A;  1ZLM A;  4RG2 A;  3RMQ A;  3I56 A;  2GTJ A;  4Z02 A;  5KE3 A;  1WFW A;  2LQW A;  4BI4 A;  2A28 A;  4ZNX A;  1YI2 Q;  3T9N A;  2EQJ A;  1QMC A;  1PRM C;  5HK3 A;  5KYU A;  4Z88 A;  1QVG A;  2OTJ Q;  2GNC A;  5KH6 A;  3FRN A;  1Y71 A;  4JS5 A;  1ZUK A;  5GJV B;  3OQ5 A;  2RK1 A;  1I81 A;  1PSF A;  1YJW Q;  2KXD A;  4LE9 A;  5LJ5 d;  3R6O A;  1S72 Q;  1I1J A;  4C8Q G;  2FRW A;  2I2L A;  1H3H A;  4BB7 A;  4M7A B;  4C8Q E;  4NOY A;  1D0Y A;  2FPD A;  4M75 C;  1Z9Q A;  2YUQ A;  5L8R E;  1QCN A;  2R58 A;  4N4G A;  1Q82 U;  1PM3 A;  4XK8 E;  2O4X A;  4C92 E;  5M9O A;  1UUE A;  2L3R A;  2EYZ A;  1I8F A;  2JTF A;  4KBM B;  1WX6 A;  1N6A A;  2J7I A;  5GAM f;  2LP5 A;  3DLL A;  1BCO A;  3WVD B;  1MUZ A;  2KEA A;  4LD9 K;  2WAC A;  3L2W A;  4FCY A;  1SF9 A;  4DBR A;  2RB6 A;  3LWI A;  1KG1 A;  2RD1 A;  5GMK e;  2RMO A;  1TUC A;  1X2Q A;  3M9Q A;  1IGU A;  1PD0 A;  4AFS C;  3CC2 T;  1VQ6 T;  2ROL A;  1CKA A;  3L2V A;  5A0L A;  3VS2 A;  5LJ5 h;  1BI3 A;  1D1B A;  2HSE B;  4M7A G;  4B9W A;  2LZ6 B;  4RCB A;  2HKN A;  4C8Q B;  4LDU A;  4M7A E;  1RLP C;  2DZ9 A;  3DB3 A;  3BW1 A;  2YRV A;  4A4E A;  3TU4 K;  2HBP A;  2K79 A;  4KGZ B;  1VQL Q;  2VUB A;  2MI6 A;  1N27 A;  3M0T A;  3CC4 A;  5GAN f;  1AWO A;  4QW2 A;  1VUB A;  1BI1 A;  2EPD A;  1FX7 A;  5GMK h;  1NBE B;  4FU6 A;  4C0F A;  2L3P A;  1VIE A;  2K3Y A;  2FO0 A;  4C0D C;  2IIM A;  3VUZ A;  1QWE A;  2CP0 A;  3G6E A;  4E2F B;  1S72 T;  1MMD A;  4IUQ A;  4DQ2 A;  4J6W A;  2CP6 A;  4OML A;  3E19 A;  3V8J A;  3JCM P;  3JCM e;  3O5Z A;  4J9I A;  1PNJ A;  2OTL Q;  1C1A A;  1PHT A;  2KI7 A;  1SG5 A;  2HD0 A;  2CUB A;  3CBM A;  5EC7 A;  5FRO A;  1K9M R;  1UJ0 A;  1LVK A;  3MCA B;  3FDR A;  4PJJ A;  2DVJ A;  2KT1 A;  5GAM d;  2Y4X A;  1VQ9 A;  4IUR A;  1Y07 A;  1YJW A;  1M30 A;  2MOX A;  3SWN C;  1K73 R;  3EH1 A;  5GAN 5;  1LOJ A;  2CGH A;  1U06 A;  2M1H A;  2F2X A;  1ZSZ A;  1VQK T;  1FMW A;  1YJ9 T;  2XKO C;  5AT1 B;  2E41 A;  2O9S A;  3CPW P;  2QK0 A;  1M90 C;  4PK4 A;  1D3B B;  1IZ6 A;  1RAA B;  4EMH A;  2EBP A;  2HQH A;  3EGX A;  5LJ3 f;  3C12 A;  3OB9 A;  3MEV A;  2NYS A;  1Q7Y C;  4XQ3 A;  1Q81 R;  4AFQ C;  1GBQ A;  4E6R A;  1G3Y A;  4OB2 B;  5I11 A;  2E3I A;  4KGX B;  1C0M A;  1UGP B;  1U3O A;  2DTI A;  2VB6 A;  1R0B G;  5KYU B;  2OI3 A;  4J83 A;  2K6D A;  3CMA T;  5GAN d;  1X75 C;  2R57 A;  5J3B A;  4X1V A;  2CRE A;  3EGU A;  3NPF A;  5A2Q E;  3I55 A;  1WXT A;  2QDL A;  1WXB A;  1XJW B;  2P84 A;  2QTV A;  1OQK A;  3J7A F;  3E9F A;  2EAY A;  2JMC A;  2DM1 A;  2R5M A;  2EGA A;  3JRZ A;  1PKT A;  3EG1 A;  3RKW A;  4O5V A;  2D0Q B;  2LQN A;  4M7D A;  2DVE A;  2DIL A;  3CCV Q;  4HCZ A;  2CH4 W;  1UDL A;  2DRM A;  4P5N A;  3CCE T;  5CKD A;  1NJI R;  1WHJ A;  4HT8 A;  4AMC A;  4XU0 A;  5I2M A;  1KC8 U;  3CD6 T;  1YJ9 A;  4LDX A;  4ZTF A;  2JMA A;  2QYZ A;  1QKX A;  3OW2 A;  3I55 T;  2NUP B;  2BZ8 A;  3OYF A;  1Y7X A;  2E5Q A;  2KRN A;  3S6W A;  3S3N A;  4BI3 A;  4PFP A;  4WF2 A;  2AT1 B;  3P8H A;  3OYJ A;  4QQ6 A;  1OI1 A;  3JSC A;  1NZ9 A;  1QLY A;  4LUE A;  3DKM A;  5CKE A;  1B07 A;  1UG1 A;  5J39 A;  1G83 A;  4KUI A;  1RAB B;  2RH2 A;  2JM8 A;  4CI0 C;  5GAN j;  3CCR T;  3NTI A;  4OB1 B;  2CT4 A;  3NHN A;  5I2S A;  4RKU E;  4XTW A;  2DL5 A;  3N5B B;  3G6E T;  3OS5 A;  4X9C A;  3VS7 A;  4FM4 B;  4HA8 A;  1V29 B;  5CKB A;  1VQ8 T;  3Q1J A;  1TG0 A;  4PJO F;  4E7J A;  3OYI A;  2CZ7 B;  2P4T A;  3MKD A;  3CCU Q;  4XU3 A;  3NTH A;  1B7T A;  1VYU A;  3G4S Q;  4RTZ A;  3RMS A;  1VQ6 Q;  1KQ2 A;  2YRD A;  2J05 A;  2QG9 B;  1SSF A;  5CQX A;  2ED0 A;  2AKK A;  1GFC A;  2KQW A;  1YHQ Q;  1LCK A;  5EG2 A;  4FYX B;  3VRY A;  2EQU A;  4J8O A;  3JB9 G;  3CCM A;  1VQM Q;  3EG9 B;  3OYN A;  2L3Q A;  4CC7 A;  1VQL T;  2P0P A;  2JTE A;  4ZGJ B;  2JT4 A;  4J6X A;  5DM7 R;  4JJB A;  3TQ7 P;  2YUP A;  4KH0 B;  1WXU A;  1JXM A;  3HL8 A;  1N8R U;  2NUT B;  2CP3 A;  5GMK l;  3CCQ A;  4M77 D;  5CKF A;  2ZPF B;  2DIG A;  4EMK A;  3G1J A;  3SFM A;  2RHZ A;  1K4U S;  4JJD A;  3U23 A;  2GF7 A;  2PUO B;  2E3H A;  4C0D B;  3QYG B;  3UPU A;  3M53 A;  2MPX C;  3M5A A;  2RO0 A;  1Y96 B;  1WGS A;  2DO3 A;  1I07 A;  3C95 A;  4JZ3 A;  1W1F A;  4RTX A;  5IHI A;  3FC3 A;  3M0U A;  2WSE E;  2ECZ A;  3CPW A;  2W10 A;  2VGM A;  4RUG A;  1Q86 U;  5L23 A;  1XOV A;  1BIA A;  2A3L A;  2J06 A;  2AZV A;  5AYF A;  3BDL A;  2R5A A;  3CXC S;  3EG9 A;  1OPK A;  4JUV A;  4XTU A;  3RBB B;  2KYM A;  1MMA A;  1ZBJ A;  3OYK A;  4QT7 A;  1BCM A;  3G4S T;  4BAC A;  4NL3 A;  2GFU A;  4OMO A;  4WTO B;  1GL5 A;  2CZ1 B;  2LX9 A;  1RAE B;  3OS0 A;  3EAE A;  4B6M A;  1YJ9 Q;  3HPW A;  2A37 A;  1ZQ1 A;  5GAN 4;  4M78 G;  2YSQ A;  3E9G A;  1V76 A;  2OTJ A;  3JV3 A;  1Q81 U;  3QII A;  1RAH B;  3EFS A;  1FXX A;  1VOM A;  2EJF A;  1RAD B;  4KH1 B;  4PJO D;  2FZK B;  1ZA2 B;  5KYX A;  3JCM X;  2DLP A;  2YWW A;  4RG8 A;  1MND A;  2P4R A;  4A53 A;  3QHS A;  2Z0W A;  4M77 B;  2RQT A;  1IHW A;  1X69 A;  3QYH B;  3VS6 A;  3HSB A;  3EFO A;  2DFU A;  1WQ7 A;  2A08 A;  2YRC A;  1C6V X;  1Q86 R;  4DEY A;  2F5T X;  1HSQ A;  3PMI A;  3JCM c;  1NJI U;  4C0G A;  4N4H A;  1PCX A;  4F14 A;  4Z89 A;  2O9V A;  2XG8 D;  2FB7 A;  2KVQ G;  1H8K A;  1KHC A;  1MV0 B;  1KQ1 A;  2LT4 A;  4QKU A;  3RER A;  1VQP Q;  1BI2 A;  2EVR A;  3M0R A;  2DTO A;  1E6G A;  4JJN K;  2V8J A;  3C4S A;  1QVF S;  2VV5 A;  2MAM A;  5KYW B;  3SWN B;  2FHD A;  2QTX A;  3SB2 A;  2DET A;  2EGE A;  1QP3 A;  4C5H A;  5GAN e;  4RTV A;  2B8A A;  3UF4 A;  2BIV A;  3M56 A;  1WZO A;  2D1X A;  5GAO p;  2V1Q A;  5IXB A;  3URG A;  3QWY A;  1K73 C;  3NMZ C;  2HQX A;  1BU1 A;  1Y0M A;  4A63 B;  4FSX A;  4IUU A;  2RHX A;  1VQL A;  2CKK A;  1SKU B;  2K3X A;  4M78 A;  3ZFJ A;  1IGQ A;  2EYQ A;  3J80 E;  5D6Y A;  2X3X D;  2YUO A;  3VRZ A;  2JW4 A;  2C06 A;  2E12 A;  1KJW A;  4WCI A;  3SWN A;  1K9M U;  1D1A A;  1WI7 A;  2EKO A;  2JTM A;  5KCO A;  1WJS A;  2ZGW A;  3PTA A;  2ZPH B;  2LC4 A;  2CDT A;  3CCM Q;  2GQI A;  3RR6 A;  4GBQ A;  4PJO A;  1M1K C;  2DER A;  2EYX A;  3THK A;  1X43 A;  2VYT A;  2M02 A;  4DEX A;  3I5S A;  2CP2 A;  2RQR A;  4CC4 B;  1I5L A;  3MP6 A;  3WVE B;  2V8K A;  2JXB A;  4E7I A;  1VYV A;  2CP7 A;  4PJO C;  1SPK A;  2AKL A;  2DE0 X;  2ABL A;  5DLQ E;  2XID A;  1S1N A;  4KRT A;  3CCU T;  3EG3 A;  2VXE A;  2OX7 A;  1OEB A;  3HP9 A;  2NUT A;  1VQK A;  1UFF A;  2KRO A;  2LNH B;  3BY7 A;  3GBQ A;  2RN8 A;  3KFV A;  5GMK i;  3JCM d;  4M7A D;  2FRY A;  1PSE A;  3BDU A;  2QI2 A;  3KXT A;  2M51 A;  1CKB A;  4J9B A;  2DA9 A;  2VXF A;  4GLM A;  3JB9 D;  4F7U E;  3JCM Q;  2CUD A;  4HCC A;  2C0O A;  4HVW A;  7AT1 B;  2ZCF B;  4M78 F;  2RNA A;  5LL6 S;  1UHF A;  1NE8 A;  1UEC A;  1RI9 A;  2CYZ B;  2HZY A;  3H0H A;  4IKF A;  1M3B A;  3C94 A;  2XDB A;  3CCQ T;  3OYC A;  3X20 B;  3OBW A;  1PD1 A;  1B3Q A;  3VS0 A;  1ACM B;  1VQO A;  3MJX A;  2K5I A;  2JVV A;  2K9G A;  4C5E A;  5I22 A;  4C8Q D;  3TVT A;  2M0O A;  4A4G A;  2CZ0 B;  2AIR B;  2COY A;  4L6V 5;  5D6W A;  2JOY A;  3CBP A;  1Q82 C;  5KCH A;  3CME A;  1KD1 R;  4E7S A;  1U1T A;  3CME T;  2MWP A;  2XIC A;  1BYM A;  2V8I A;  4L5G A;  1K8A U;  3SHW A;  4R0K A;  1MHN A;  2RHY A;  1B34 B;  1UB4 A;  3UDC A;  4LN2 A;  1M1K U;  3HKS A;  3L1A A;  4C92 B;  1N8R C;  3LYI A;  4C0Z A;  2D8J A;  1OZ3 A;  2ZPI B;  3PMT A;  2ZAE A;  4PJM A;  2E10 A;  1KIK A;  3A1P A;  3ZEH A;  2KY9 A;  1YI2 T;  4ZN1 A;  1YI2 A;  1Q82 R;  5GAN h;  1XQH A;  3M59 A;  1X01 A;  5LJ5 e;  1H92 A;  3CQT A;  2RK2 A;  4M4Z A;  3FEO A;  1BK2 A;  2NLU A;  3RUX A;  1TWB A;  2OTJ T;  1G3W A;  1M3A A;  1ZHI A;  2C0I A;  3H6Z A;  4XTY A;  3I9Q A;  1YCS B;  2DXT A;  2QQR A;  2RI3 A;  4C92 G;  3FIF A;  2ZPB B;  4BY6 B;  2E64 A;  3L2R A;  2HL5 C;  2VVK A;  4M78 C;  3VYG A;  4IIO A;  1AEY A;  2COZ A;  1YIJ T;  2ESW A;  4JRI A;  2J6O A;  1I5O B;  2XHC A;  3J81 E;  2G6F X;  4M75 G;  4EMK C;  2RHU A;  2NWM A;  2DJZ A;  3EGD B;  2K57 A;  3KBG A;  2X9H A;  3PFS A;  2JM9 A;  2HL3 A;  4FIB A;  2HDA A;  3CCJ Q;  1VQM A;  3VKI A;  1EFN A;  5GMK j;  5FWB A;  1JJ2 S;  4YTL A;  4A4H A;  4FL6 A;  4MDW A;  1TUG B;  2KSS A;  2B86 A;  4GY5 A;  1ZSZ B;  3GP8 A;  1M1F A;  3E1S A;  4XU1 A;  4PJL A;  1MMN A;  1ZBX A;  1D3B A;  1WHM A;  2EIF A;  2HSP A;  1SRL A;  5FLX E;  2JUF A;  2YT6 A;  1M27 C;  2FPF A;  3CC7 A;  3CC7 T;  4D8D A;  5CAI A;  5FWC A;  4HCK A;  2A0F B;  3CD6 Q;  3R6N A;  3JB9 J;  3PIP A;  1YCY A;  4OF1 A;  5LJ3 g;  3RES A;  2QQB A;  5CVI A;  1EIF A;  4IUP A;  2BTT A;  1TS9 A;  1G8X A;  3FLG A;  4XU2 A;  4OB0 B;  4V2S A;  4UC4 A;  2K5L A;  3CCL T;  3OBY A;  2F5K A;  5FU6 C;  3ASK A;  1Q7Y U;  2ZPE B;  1YIJ Q;  2VGN A;  1T3S A;  3HRT A;  1MGQ A;  2OJ2 A;  1UGQ B;  3L2Z A;  4M75 D;  3NGP A;  3INZ A;  2J6F A;  2DJQ A;  4XAX B;  2PU9 B;  3VS4 A;  4M7D B;  1WYX A;  4FYW B;  4RCC A;  2ZPG B;  5LJ3 e;  3JB9 I;  1Q81 C;  4Z8A A;  2A7Y A;  1QQJ A;  2CSI A;  4ME7 A;  1VQ8 A;  3PE0 A;  4M7D E;  3REA B;  1NJI C;  1G5V A;  4PNO A;  3A8M B;  2DD4 A;  4LD6 A;  2VC8 A;  2CZ6 B;  9ATC B;  4QVZ A;  2K5F A;  2PUK B;  4CRI A;  4K11 A;  3HTR A;  1RAG B;  2KYB A;  3VYH B;  3G4S A;  3OMG A;  1ABQ A;  5LJ3 j;  2XDP A;  4LNP A;  2OAW A;  2X3W D;  4MZM A;  4EDU A;  4XTV A;  2HBW A;  5IXF A;  1YJN A;  1K9M C;  1WJQ A;  2BZY A;  5IH2 A;  1UHC A;  1O9S A;  4FYY B;  3JCM W;  2PQW A;  3QZ5 B;  2DL3 A;  4HKE A;  4M7A C;  1YHQ T;  3DB4 A;  3MEA A;  3VS1 A;  4AFZ C;  4QVD A;  3OW2 S;  2H8H A;  3M58 A;  4JRQ A;  4LXC A;  5CR2 A;  2O4X B;  1PC0 A;  2YLC A;  1JB0 E;  2FZG B;  1M9S A;  1W4S A;  1YN8 A;  1QVG P;  2QAZ A;  2LQ8 A;  2YHT A;  1A0N B;  4KGV B;  1WJR A;  3HFN A;  5D6X A;  1UGR B;  2E4H A;  5KYN A;  2DNU A;  2DZC A;  1Q7Y R;  5KYX B;  3RNJ A;  1VYT A;  4R56 A;  2GFA A;  2RJC A;  5GAN 6;  5KYY A;  4RTW A;  2CSQ A;  1M90 R;  5FU6 B;  1I0C A;  1FWZ A;  1TUD A;  1FYN A;  2W0Z A;  1JJ2 A;  1HJD A;  3MP8 A;  1OUL A;  1T3L A;  2D8H A;  1LJO A;  3CME Q;  1GXI E;  1CSK A;  3QZ9 B;  4LDW A;  2QEX A;  4HT9 A;  3ZL7 C;  5HY6 A;  1RAC B;  1BIB A;  3MHX A;  3TEE A;  1ZUY A;  1VQN A;  2DK3 A;  1H3Z A;  3CCV T;  1AD5 A;  3O8V A;  1Q95 G;  3TSW A;  1AT1 B;  2LMJ A;  3QKJ A;  1QKW A;  4OMF B;  1YJN Q;  5HCK A;  4F7U A;  1M2O A;  1NPR A;  1TXQ A;  1VQ4 A;  3RKX A;  4Y91 A;  3CXC A;  3X26 B;  3SDZ A;  4C5I A;  2RM4 A;  4BY6 C;  1YHQ A;  2GTO A;  2JZ2 A;  4OMN A;  1WHG A;  2MIO A;  1AZE A;  2GCX A;  1O75 A;  2RQU A;  1KQS P;  2MCN A;  1LNX A;  3VS3 A;  2X51 A;  4J9C A;  5GAM e;  1WA7 A;  2XD0 A;  2LNV A;  3GNG A;  4M77 F;  1VQP A;  4BE1 A;  2O2O A;  3JCM h;  2EQK A;  3OSV A;  5GAM h;  1W2B S;  4M7A F;  4PLL A;  3FJ5 A;  3A8H B;  1HD3 A;  4A54 A;  3GLX A;  5HKC A;  3CCE A;  2CS7 A;  1VQO T;  5D7U A;  1BI0 A;  4EMK B;  1M8V A;  1JQQ A;  4IUV A;  5KE2 A;  1YWO A;  3L2Q A;  2RJF A;  2LJ1 A;  4FW1 A;  1OPL A;  3I56 T;  3DLM A;  3L2U A;  2O01 E;  5LJ5 f;  2DBM A;  3OYB A;  1E7O A;  2GGR A;  3ME9 A;  3VS5 A;  1N5Z A;  3TSZ A;  1QWF A;  4JRK A;  1VQ5 Q;  1YNZ A;  3V7S A;  3UA7 A;  3GIB A;  3V8L A;  5GAN g;  2CH4 A;  2KBT A;  4OMP A;  3PIO A;  4MMK A;  2ED1 A;  2YLB A;  1VQP T;  1VQ9 Q;  4C92 F;  1NPP A;  1WIE A;  2IPO B;  5IHK A;  4QQD A;  3LWH A;  3EFO B;  4FSS A;  2F2V A;  2K2V A;  2LJ0 A;  3M57 A;  3X25 B;  3GPL A;  1JXO A;  1KSW A;  1WPY A;  4DBH A;  2EJ9 A;  2QQA A;  3I35 A;  5CO7 A;  2JS2 A;  1YP5 A;  4MZP A;  2QAS A;  4ATO A;  4C5G A;  1X27 A;  1GBR A;  1FMK A;  4BI8 B;  2EYW A;  4KT0 E;  2WSC E;  2E1H A;  2K7A A;  3QG1 A;  2LCS A;  3ZBD A;  3EGD A;  4PL6 A;  5DLO A;  3FJP A;  3CPF A;  4RTY A;  1AWX A;  1X6G A;  2LDM A;  1WHL A;  3QXE B;  5LJ5 j;  4PJO G;  4AFU C;  4D8K A;  2MK5 A;  1LPL A;  5GAN 7;  5IN1 A;  4FT4 A;  1K9A A;  1VQ6 A;  3GF5 A;  1AHJ B;  4J6Y A;  3NFC A;  1HK9 A;  3BFM A;  3QUI A;  4C8Q C;  1TTH B;  3UWN A;  4M75 E;  1WHH A;  4A4K A;  4M7D C;  1Y57 A;  3M55 A;  3RIR A;  2DPP B;  2KAF A;  1AWW A;  5CK9 A;  1JBM A;  3IQL A;  2DX1 A;  4E7L A;  1YIT T;  4JJC A;  2K3B A;  2QA4 A;  2BUD A;  3EHQ A;  4Q5W A;  1ABO A;  2LQK A;  1YIJ A;  2DKG A;  5LJ3 h;  3SD4 A;  1MV3 A;  1YBY A;  4XTZ A;  2KK4 A;  2AHJ B;  1KC8 R;  1W2B A;  3OYA A;  3C0C A;  4E7H A;  2FVU A;  4IIM A;  2I0N A;  2DL8 A;  1N9R A;  1QVG S;  2FG0 A;  1FMV A;  5FU7 B;  1GCQ C;  2PVO B;  2MYS A;  3E2U A;  1M5Q 1;  2LJ3 A;  1RUW A;  3V7R A;  5GAN 8;  5FRM A;  4ZGD B;  1M2V B;  1UTI A;  1B34 A;  1G3S A;  4M77 C;  2DL7 A;  1K73 U; 
#chains in the Genus database with same CATH homology
 2ESW A;  3A98 A;  4LUE A;  2J6O A;  1B07 A;  1E6H A;  2G6F X;  1M8M A;  1UG1 A;  1NEB A;  1K0X A;  4RTT A;  1G83 A;  2NWM A;  2YUN A;  4J9E A;  2JM8 A;  4J9F A;  2CT4 A;  2RPN A;  3NHN A;  2VKN A;  2JM9 A;  2HDA A;  2DL5 A;  3EG0 A;  3M0Q A;  1EFN A;  2YDL A;  3VS7 A;  1PRL C;  5FWB A;  4ESR A;  5FW9 A;  2EKH A;  1NG2 A;  2BZX A;  4F17 A;  1TG0 A;  2B86 A;  1GRI A;  2A36 A;  4J9H A;  3ULR B;  1VYU A;  2M0Y A;  4RTZ A;  4F16 A;  2HEQ A;  1SRM A;  3H41 A;  2J05 A;  3H0F A;  1VA7 A;  2HSP A;  1SRL A;  2AKK A;  1GFC A;  2ED0 A;  1W6X A;  4RTU A;  1GCP A;  1LCK A;  2YT6 A;  1M27 C;  2FPF A;  3VRY A;  4D8D A;  5FWC A;  2D0N A;  4HCK A;  2RF0 A;  3REB B;  3M0S A;  2L3Q A;  2E5K A;  3R6N A;  4CC7 A;  1AZG B;  1NEG A;  2JTE A;  2SRC A;  3PVL A;  1QCF A;  2JT4 A;  4Y92 A;  4JJB A;  2ENM A;  2YUP A;  1WXU A;  1JXM A;  1ZUU A;  2BTT A;  3QWX X;  1BB9 A;  2O88 A;  1M3C A;  1K4U S;  4JJD A;  3U23 A;  1W70 A;  1T3S A;  1G2B A;  2OJ2 A;  2KE9 A;  3NGP A;  1NLO C;  1ARK A;  1J3T A;  1JO8 A;  2J6F A;  2DJQ A;  3VS4 A;  1SHG A;  1WYX A;  1I07 A;  4JZ3 A;  4OMQ A;  4HXJ A;  4Z8A A;  2PZ1 A;  1W1F A;  4RTX A;  4CC3 A;  5IHI A;  2FPE A;  3M0U A;  2XMF A;  1BBZ A;  2ECZ A;  2CSI A;  2W10 A;  2DMO A;  1V1C A;  3UAT A;  1WLP B;  3PE0 A;  3REA B;  4RUG A;  5L23 A;  1XOV A;  2PNI A;  4HVU A;  2O31 A;  1ZSG A;  2J06 A;  2AZV A;  2AZS A;  1AVZ C;  1OPK A;  3EHR A;  3RBB B;  2EGC A;  2KYM A;  2V1R A;  2RQW A;  4K11 A;  1ZBJ A;  2KYB A;  1ABQ A;  4LNP A;  4QT7 A;  2JS0 A;  4ORZ A;  2OAW A;  2X3W D;  1GL5 A;  4OMO A;  2HBW A;  5IXF A;  1ZLM A;  2BZY A;  5IH2 A;  1UHC A;  2GTJ A;  1UJY A;  2DBK A;  2A37 A;  1WFW A;  2DRK A;  2LQW A;  2DL3 A;  2A28 A;  4ZNX A;  4CC2 A;  2YSQ A;  3VS1 A;  4AFZ C;  4OMM A;  2H8H A;  3JV3 A;  1ZX6 A;  5IHN A;  1PRM C;  4Z88 A;  2GNC A;  1JEG A;  1ZUK A;  1YN8 A;  5GJV B;  1A0N B;  2DLP A;  2P4R A;  2DL4 A;  2KRM A;  2KXD A;  4LE9 A;  1T0J A;  2DNU A;  2RQT A;  1OV3 A;  1I1J A;  1X69 A;  3VS6 A;  2FRW A;  1AOJ A;  3RNJ A;  1JU5 C;  1H3H A;  1VYT A;  4EIK A;  1NLP C;  2FPD A;  1YWP A;  1Z9Q A;  2A08 A;  2YUQ A;  4RTW A;  4HVV A;  2CSQ A;  2K2M A;  1I0C A;  1TUD A;  2W0Z A;  1FYN A;  4DEY A;  1HJD A;  1HSQ A;  1UUE A;  1T3L A;  2KGT A;  2EYZ A;  2KRS A;  1SSH A;  2D8H A;  1WX6 A;  2L3S A;  1CSK A;  4F14 A;  2J7I A;  4Z89 A;  2LP5 A;  2O9V A;  3ZL7 C;  1MUZ A;  1NYF A;  1UGV A;  1H8K A;  1MV0 B;  2KEA A;  4LUD A;  2GBQ A;  1ZUY A;  1PWT A;  1AD5 A;  2NUZ A;  2EVR A;  3I5R A;  3M0R A;  3TSW A;  2RMO A;  1TUC A;  2LMJ A;  1QKW A;  1X2Q A;  1E6G A;  4JZ4 A;  5HCK A;  4AFS C;  2LX7 A;  1SEM A;  2ROL A;  1CKA A;  1AWJ A;  3VS2 A;  2EGE A;  2HCK A;  2GTO A;  4RTV A;  4OMN A;  2LZ6 B;  2KXC A;  2MIO A;  3UF4 A;  1AZE A;  1RLP C;  2RQU A;  2D1X A;  2RQV A;  1OOT A;  2DYB A;  2V1Q A;  3LH5 A;  2MCN A;  3VS3 A;  4J9C A;  3SEM A;  5IXB A;  2K79 A;  1WA7 A;  3QWY A;  3NMZ C;  1BU1 A;  1Y0M A;  1NM7 A;  2KR3 A;  4A63 B;  2AK5 A;  3M0T A;  1AWO A;  2EPD A;  2C0T A;  2O2O A;  1RLQ C;  2L2P A;  2FEI A;  4AG1 C;  2X3X D;  2YUO A;  3VRZ A;  2JW4 A;  3FJ5 A;  1KJW A;  1HD3 A;  3H0I A;  4WCI A;  2L3P A;  1WI7 A;  1GFD A;  4J9G A;  2FO0 A;  2IIM A;  2J6K A;  1QWE A;  1GCQ A;  2CDT A;  1WDX A;  1JQQ A;  2GQI A;  4GBQ A;  1YWO A;  4OML A;  2EYX A;  2LJ1 A;  3EG2 A;  1OPL A;  3THK A;  1X43 A;  4DEX A;  3I5S A;  2EYY A;  2DBM A;  2RQR A;  3O5Z A;  1E7O A;  4J9I A;  1PNJ A;  2GGR A;  4CC4 B;  1X2K A;  1PHT A;  2JXB A;  2VWF A;  1VYV A;  3VS5 A;  1N5Z A;  3TSZ A;  1QWF A;  2CUB A;  1YNZ A;  1SPK A;  3UA7 A;  2AKL A;  2DE0 X;  1KFZ A;  2ABL A;  2CH4 A;  2KBT A;  1S1N A;  4KRT A;  1Z9Z A;  3EG3 A;  4OMP A;  2ED1 A;  1OEB A;  5EC7 A;  1UFF A;  2KRO A;  2LNH B;  1UJ0 A;  3GBQ A;  2RN8 A;  1WIE A;  3KFV A;  2DVJ A;  2FRY A;  5IHK A;  2KT1 A;  4FSS A;  1UE9 A;  2F2V A;  2M51 A;  2LJ0 A;  1CKB A;  1M30 A;  2MOX A;  1JXO A;  2L0A A;  1KSW A;  4J9B A;  2DA9 A;  4GLM A;  1U06 A;  2CUD A;  2F2X A;  2C0O A;  4HVW A;  3I35 A;  1T0H A;  2JS2 A;  1YP5 A;  2O9S A;  1PKS A;  3UA6 A;  2RNA A;  1UHF A;  1X27 A;  1GBR A;  1FMK A;  1UEC A;  1RI9 A;  2EBP A;  2EYW A;  3H0H A;  2K7A A;  3M0P A;  1M3B A;  2LCS A;  4AFQ C;  1X6B A;  1GBQ A;  4RTY A;  4E6R A;  1AWX A;  1SHF A;  1X6G A;  4AFU C;  5I11 A;  4D8K A;  4J9D A;  1U3O A;  3VS0 A;  1B3Q A;  2F2W A;  2OI3 A;  1K9A A;  2K6D A;  2K9G A;  2CT3 A;  5I22 A;  4X1V A;  2CRE A;  3EGU A;  3NPF A;  1WXT A;  3TVT A;  2QDL A;  1WXB A;  4JPB W;  1Y57 A;  1K1Z A;  2JMC A;  2DM1 A;  2EGA A;  4AG2 C;  1PKT A;  1AWW A;  3EG1 A;  3IQL A;  2DX1 A;  2KNB B;  4JJC A;  2K3B A;  3PVQ A;  3EHQ A;  1ABO A;  1U5S A;  2PTK A;  3SHW A;  2LQN A;  4R0K A;  1MV3 A;  1IO6 A;  2DIL A;  4LN2 A;  2CH4 W;  1UDL A;  2DRM A;  5GJW B;  2D8J A;  3C0C A;  2SEM A;  4IIM A;  1K0S A;  2I0N A;  1NYG A;  2KT8 A;  1KIK A;  2DL8 A;  2EQI A;  2FG0 A;  2ROT A;  2JMA A;  1GCQ C;  1QKX A;  2BZ8 A;  2LJ3 A;  1RUW A;  2KRN A;  2DF6 A;  1H92 A;  3CQT A;  4M4Z A;  1BK2 A;  1UTI A;  1K76 A;  1M3A A;  2C0I A;  2EW3 A;  5ECA A;  2DL7 A;  3I9Q A;  1YCS B;  1QLY A;  2VVK A;  4IIO A;  1AEY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...