2ENMA

Solution structure of the sh3 domain from mouse sorting nexin-9
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
77
structure length
77
Chain Sequence
GSSGSSGMATKARVMYDFAAEPGNNELTVTEGEIITVTNPNVGGGWLEGKNNKGEQGLVPTDYVEILPNDGKDPFSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis
molecule keywords Sorting nexin-9
publication title Solution structure of the SH3 domain from mouse sorting nexin-9
rcsb
source organism Mus musculus
total genus 8
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2enmA00
5FWCA 1YCSB 2AKKA 2JM9A 4OMOA 1JU5C 2JS0A 2CDTA 1GRIA 2KR3A 3VRYA 1H8KA 4JJCA 1WXUA 4J9DA 4RTVA 2DX1A 4Y92A 2EQIA 4CC4B 2MIOA 2DL8A 4IIMA 4F16A 2SEMA 4RTUA 1AWJA 2IIMA 2YSQA 2SRCA 3NGPA 4HVUA 1M3CA 1WXBA 1YNZA 3C0CA 2EBPA 1H92A 2CSQA 2FEIA 3I5RA 5I11A 1MUZA 2DJQA 3KFVA 2JS2A 2D0NA 2D1XA 1M8MA 2O9SA 4RUGA 4IIOA 2I0NA 3QWYA 2KRSA 1WFWA 3I5SA 2RQRA 2CSIA 1PRLC 1K1ZA 1RLPC 1UECA 2DLPA 1U06A 2G6FX 3O5ZA 4JZ4A 4OMMA 1X69A 2GBQA 2KRMA 2OJ2A 5FWBA 3VS2A 1UJ0A 1NM7A 4HXJA 4R0KA 1KIKA 4E6RA 4AFZC 1WXTA 2A08A 2DILA 1A0NB 1FYNA 2GTJA 4DEXA 1HD3A 2DM1A 1U5SA 2JT4A 2RPNA 1M27C 2VVKA 2O31A 4JPBW 1X6GA 1QWEA 3VS5A 1ZUUA 1GL5A 1JEGA 3TSWA 3UA6A 2L2PA 1QCFA 2D8HA 2KYMA 1AWWA 1GFCA 3I9QA 2JMAA 1X43A 3IQLA 1OPLA 2FPDA 2KNBB 1X2KA 2AZVA 1GFDA 2EYZA 2DE0X 2OAWA 1K9AA 2GGRA 3THKA 4RTWA 3VS3A 1ARKA 1M3AA 2CUBA 3R6NA 5GJVB 1AWOA 1M30A 1JO8A 4HCKA 1PWTA 1M3BA 1QKWA 1KFZA 3UA7A 1JXMA 1PNJA 2DL4A 3REAB 1I07A 4F14A 2KGTA 1ABQA 1UE9A 3PVQA 4GLMA 2EYXA 2K9GA 1E6HA 2NUZA 1OOTA 1T0HA 2DRMA 1PKSA 1WA7A 2DA9A 5ECAA 4J9CA 5IH2A 1YP5A 1CKBA 1ABOA 1PKTA 3H0IA 1BBZA 2M0YA 4LUEA 2LP5A 4X1VA 2O9VA 2EKHA 3EHRA 1ZLMA 2X3WD 5IHIA 3ULRB 2PZ1A 2EPDA 3VRZA 1WI7A 2ED0A 2KEAA 4LN2A 1E7OA 3CQTA 2GTOA 1TG0A 1AEYA 2LZ6B 2J7IA 3U23A 3VS6A 2JTEA 2LJ0A 1PHTA 2CT3A 2RN8A 2EYYA 2RQVA 1SHGA 2EVRA 2K79A 1BB9A 2DF6A 2FPEA 2CH4W 2OI3A 3VS1A 1CKAA 1NLOC 1K0XA 4OMQA 1BK2A 2J6FA 3TSZA 1T0JA 2JXBA 1WYXA 2F2XA 1VA7A 1SHFA 1OPKA 2F2VA 2V1QA 2L3QA 1SRLA 2EW3A 1WLPB 3NPFA 2KT1A 1SPKA 2AZSA 1VYVA 2HBWA 2DL7A 4D8DA 1KJWA 1UDLA 1B3QA 1AVZC 4K11A 2L0AA 1Y57A 3H0FA 1GCQA 3H41A 3VS4A 2K2MA 2CT4A 4OMNA 4Z8AA 4RTXA 1Z9QA 2DYBA 3RNJA 1KSWA 3EGUA 3UF4A 4LNPA 2BTTA 2FO0A 1V1CA 2YUQA 1EFNA 1OV3A 2W0ZA 5I22A 3PVLA 2LX7A 1NEBA 1SEMA 4JZ3A 4WCIA 4ESRA 1CSKA 4J9HA 2CH4A 3EG0A 2J06A 4AFSC 3LH5A 1QLYA 2F2WA 1YWPA 1AWXA 1OEBA 1QKXA 1BU1A 2ESWA 2ROTA 1AZEA 5IXFA 2AKLA 2J6OA 4OMLA 3M0TA 1H3HA 1WDXA 1Z9ZA 2C0TA 1T3LA 1GCPA 2EGCA 1UUEA 2BZ8A 2MCNA 1AZGB 4CC2A 2C0IA 2VWFA 2FRYA 1I1JA 2P4RA 2J6KA 4CC3A 4LUDA 2W10A 1VYUA 1QWFA 1B07A 2DNUA 2AK5A 2DMOA 3M0QA 3FJ5A 1ZSGA 5IXBA 1NG2A 2A28A 1JXOA 4JJDA 4FSSA 1UTIA 2JMCA 2KRNA 2PNIA 2VKNA 4RTTA 2YT6A 2HSPA 1RI9A 2GNCA 4GBQA 2K6DA 5GJWB 1ZUYA 1WX6A 2B86A 1W70A 1RUWA 2FG0A 1W6XA 1TUCA 1YWOA 3GBQA 3M0RA 1UJYA 4QT7A 4CC7A 1JQQA 5IHKA 2YUOA 3EG3A 4EIKA 3EHQA 2RQTA 1UG1A 3SHWA 2JM8A 3VS0A 1WIEA 4J9FA 4M4ZA 3NMZC 2K3BA 5L23A 1U3OA 3VS7A 1X2QA 1E6GA 1HSQA 3REBB 2LMJA 2K7AA 1YN8A 4AFQC 1W1FA 3M0SA 4ORZA 5EC7A 2RMOA 2J05A 2HDAA 1RLQC 2DL5A 1UFFA 2LQNA 2M51A 1Y0MA 2FRWA 1XOVA 2H8HA 3H0HA 1AD5A 2LNHB 2YDLA 4LE9A 4RTZA 3ZL7C 2LQWA 2MOXA 2ECZA 1HJDA 5HCKA 2DBKA 3EG1A 2XMFA 1NYFA 2E5KA 1UHCA 1ZX6A 1IO6A 3M0PA 3A98A 2CREA 4J9EA 2HCKA 1TUDA 5IHNA 1LCKA 2CUDA 2NWMA 2L3SA 2RNAA 2YUPA 4D8KA 1J3TA 2BZYA 2KT8A 1K0SA 1MV3A 1MV0B 4J9IA 2O88A 1G83A 1N5ZA 1UGVA 2LCSA 2X3XD 1S1NA 1UHFA 2A37A 1ZBJA 2KXDA 2PTKA 3EG2A 3I35A 1SRMA 2A36A 1PRMC 2DRKA 2YUNA 2ABLA 2ROLA 1NLPC 2ENMA 1FMKA 4JJBA 4Z88A 4AG1C 2V1RA 3M0UA 3RBBB 4J9GA 2JW4A 2EGAA 2KXCA 3NHNA 2DVJA 2KBTA 4J9BA 1K76A 2GQIA 2EGEA 2LJ3A 4AG2C 2HEQA 1NYGA 1X6BA 4Z89A 4OMPA 1X27A 2ED1A 1K4US 4DEYA 1I0CA 4F17A 3QWXX 2KYBA 2L3PA 1AOJA 3JV3A 3SEMA 3UATA 2O2OA 5FW9A 2KROA 1SSHA 4AFUC 4HVVA 1GCQC 4ZNXA 2DL3A 4KRTA 2FPFA 1NEGA 2QDLA 1GBRA 3PE0A 1GBQA 1G2BA 4RTYA 2DBMA 2D8JA 2RQUA 4A63B 2BZXA 2C0OA 2KE9A 3TVTA 1VYTA 4HVWA 2RF0A 2RQWA 2LJ1A 1T3SA 1ZUKA 2EYWA
chains in the Genus database with same CATH superfamily
5FWCA 3C95A 4ATOA 2ZZDA 4RMOA 2CDTA 2AIRB 2E4HA 4E7HA 1D3BB 3CBMA 1WXUA 4RTVA 2DX1A 3JCMe 1ZSZB 2EQIA 1R77A 3JB9J 3FC3A 1QVGS 1VQOQ 5GAN6 3CC4Q 4F16A 1RI0A 2SEMA 2V8IA 2LRQA 5IT9E 2QQSA 3KXTA 3NGPA 4LDYA 5HKCA 2X4YA 5GAMg 4HVUA 5GANd 3JCMP 3RERA 3M55A 3ER0A 8ATCB 3MEWA 3V8KA 3I5RA 2E1HA 2QTVA 1TXQA 5I2SA 4AMCA 2ZPBB 2D0NA 2HD0A 4RUGA 4E7ZA 2VXEA 5J26A 5LJ5j 2RQRA 4OMFB 4C5HA 1RLPC 1SF9A 3LLRA 2DLPA 4BUGA 2DXTA 4TVRA 2YRDA 1X69A 2GBQA 3JCMb 3CD6Q 4ZN1A 2RK1A 1ZHIA 4AFZC 4E2FB 1Y7XA 1U5SA 2CS7A 3VS5A 3A8GB 4KH0B 3TSWA 2K5LA 4NOYA 3L2RA 4QKUA 2E3HA 1U8RA 1YI2T 2JMAA 1WHHA 1GFDA 2AZVA 4LDUA 3HSBA 3G6EA 2MYSA 3I56A 3CEYA 3VJPA 1YJNQ 2CUBA 1KQSS 1AWOA 2CZ6B 3EFOB 4HCKA 4RG2A 1PWTA 1TTHB 1QKWA 1KFZA 3O8VA 3REAB 4XTYA 1I07A 3DKMA 2KGTA 1UE9A 4GLMA 2CP6A 2OTJA 2NLUA 4OF1A 2LX9A 1S72Q 5CVIA 1T0HA 2FYKA 1VQ8Q 1YBYA 2ZGWA 3S3OA 2RJDA 3META 1BI3A 3L42A 4J9CA 1RACB 3PIPA 2H3EB 4LUEA 1ZLMA 4M77E 2EJ9A 1Y96A 1W2BS 3HRTA 3LGLA 2ED0A 2K57A 2PUKB 1E7OA 2XDBA 2QGGA 1TG0A 4J6XA 3CCQT 3T9NA 5GMKi 4RKUE 3CCMQ 3JCMc 1WJRA 1M4ZA 1PHTA 2LJ0A 2DYIA 3CCRT 5KYYB 4O5VA 1SHGA 3VV0A 1BYMA 5KYXB 2DF6A 3OW2P 4IUVA 3VS1A 1CKAA 1K0XA 4OMQA 2PVOB 4FW2A 2E70A 4BY6C 3V7SA 3OYLA 4FCYA 4M77C 5CKEA 1VA7A 1SHFA 2KAFA 4M77F 3OYEA 2VUBA 3JCMg 2BUDA 3QDFA 2AZSA 3M9QA 3I55A 1VIEA 5GANj 1VQ6T 3CC2A 1D1AA 1UDLA 1IB8A 3OYYA 4FYXB 1B3QA 3V7RA 4K11A 1RAFB 2L0AA 2X51A 3OYMA 1Y57A 1X6OA 4HT8A 2F69A 2ZPGB 3CMEQ 4MDXA 4BI3A 1PSFA 1KSWA 1QVGA 4A4FA 3INZA 2FO0A 2YUQA 1EFNA 1OV3A 2HL5C 4HCCA 2OAUA 3CCVT 1QVPA 2COYA 4HKEA 4BY6B 4C92E 4M77B 3MCAB 1KHCA 4J9HA 3CC4A 1PSEA 1QCOA 3MHXA 1BU1A 2ESWA 2ROTA 1M2OA 2J6OA 4OMLA 4XU3A 1KC8U 1I5OB 2C0TA 2EGCA 1Q81U 1TUGB 2C0IA 4M75D 3RDVA 1I1JA 3CCQQ 4LUDA 2W10A 3CMAT 4IUTA 1QWFA 3OA6A 1B07A 2DNUA 4C92D 2DMOA 3CCRQ 4AT1B 3L2WA 1NJIR 2M9UA 1ZSGA 5IXBA 1KK7A 4FSSA 3SWNA 4C92C 4PJOE 1LNXA 5DM7R 2GNCA 2IG0A 2DEQA 3G7ZA 5GAN7 3V8LA 4ME7A 9ATCB 1K9MR 4DBQA 3CCJT 4KGXB 3OS5A 1EZZB 3EGDB 3RIRA 4QT7A 4DOVA 1JQQA 3A8OB 3QPHA 5IHKA 3EG3A 2PVDB 2EFIA 1TSFA 3M56A 3PGGA 2RQTA 1OX9A 5GAMj 3OYKA 2HQHA 1YIJT 5GANe 1OZ2A 1IHWA 3QJYA 1U3OA 1KC8C 3JRZA 1E6GA 3E19A 3EFOA 4PJOC 3CCVQ 1MMAA 1KQSA 4PJOF 1FXXA 2LMJA 4M78E 4AFQC 1W1FA 3M0SA 5EC7A 1K8AU 3HL8A 2LQNA 3CCLT 1Y0MA 2VASA 1YJNA 5GAOm 1WJSA 2FRWA 4MDWA 2DERA 2BE7D 3BDLA 1MNEA 5D7UA 3ZL7C 3HP9A 2LQWA 2E10A 2PQWA 3F70A 3A8MB 2DBKA 1NYFA 3VYHB 2A7YA 1S72A 4C0GA 3A98A 1VQ8A 3TU4K 1M1GA 2CREA 2E41A 7AT1B 1W2BA 4PJOB 2WSCE 3CMAQ 2NWMA 4M78D 3OYIA 2BZYA 1YJ9T 4J7FA 4FSXA 1AT1B 1PG5B 4M78C 3JCMW 1Q7YR 4E7IA 5KYYA 2LCSA 2X3XD 4PFOA 2Y4XA 3X20B 2A37A 3E9GA 2KXDA 1D0XA 1OULA 3EG2A 3I35A 5KYXA 1FX7A 3OMGA 2YUNA 5FU6C 3CCMA 1I4K1 1QVFP 1FMKA 3JB9D 4PJJA 2NUPB 2RI3A 4J9GA 2JW4A 2KXCA 3JCMX 3V7CA 3HRSA 3GF5A 4J9BA 1K76A 2GQIA 3MO8A 2EGEA 4OB2B 4QQDA 1K8AC 1O75A 4B9WA 1NYGA 1X6BA 1G3TA 1SSFA 3M58A 1M1KR 3LYIA 1G8XA 2L3PA 1BCMA 1AHJB 4J8OA 3UATA 3LWIA 4HVVA 4Y28E 2QEXT 2DL3A 1WGSA 2FPFA 5FU6B 1VQKT 2RJCA 3G71T 1I5LA 2CP5A 3CCLQ 3CCST 1GBQA 1G2BA 3GPLA 1VQPT 2V8KA 1WPYA 3EAEA 2DBMA 2OTLT 3CMEA 3E2UA 2JNGA 5M9OA 1C0MA 1VYTA 4Q5WA 8AT1B 4XAXB 4JUVA 1YJWT 2RQWA 1D09B 2AKKA 4OMOA 2KR3A 2RO0A 3VRYA 1H8KA 4J9DA 2MIOA 1Q82U 1YJ9Q 1M5Q1 3FIFA 1RAIB 2RHXA 4ZGEB 4IUPA 3CCEA 1WXBA 1YNZA 4DA4A 2EBPA 1BI0A 2DD5A 2R5MA 3CCQA 4RCBA 5CAIA 4J7IA 2M02A 4II1A 3QKJA 2YLCA 3CCRA 2D1XA 1M8MA 3UDCA 1PD1A 2IVWA 4IIOA 3QWYA 4FYVB 1I8FA 5GAOp 2KRSA 3C12A 1K1ZA 1BKBA 4IUQA 2G6FX 2KI7A 5GANg 5A0LA 5FWBA 2RJEA 1NM7A 3CC7Q 2KMTA 4E6RA 2QEXQ 1VQNT 3LWHA 3M54A 4JRPA 2X9HA 1FYNA 4DEXA 3G4SQ 2VYTA 1HD3A 2JT4A 1OQKA 2RPNA 1M27C 4C8QG 1PD0A 1JJ2P 5KYUB 2O31A 1YITT 3MP6A 1ZUUA 5DLQE 1GL5A 4A4EA 1JEGA 2FZCB 2L2PA 4PJOG 1QCFA 3DB4A 3SD4A 2QQRA 4RG8A 4A4HA 1XQHA 4M7AF 2RM4A 4KGVB 3OS1A 1M9SA 4C8QA 2KNBB 1X2KA 1KD1U 2XI9A 1NPPA 2EYZA 1G5VA 4KGZB 2GGRA 1VQLQ 2BIVA 1ARKA 1M3AA 3R6NA 4PJOA 3NFCA 2BKDN 2K2VA 1M3BA 2LQKA 2E6ZA 1JXMA 1HXDA 3HHTB 1PNJA 1IHVA 4FU6A 1B7TA 3EGXB 2EYXA 4R55A 2QA4T 3QUIA 1K73U 1BIBA 2E64A 4M7AB 4PFPA 3CMAA 3AHUA 3QBYA 5ECAA 5IH2A 3BW1A 1ABOA 1BBZA 3M5AA 1U1SA 3PFSA 3EHRA 3MKDA 5CK9A 2X3WD 1QP2A 2NUPA 2EPDA 1WI7A 2X4WA 2DKGA 3CPWP 4FT4A 2GTOA 3P8BB 2LZ6B 2J7IA 4HCBA 3QG1A 1FMVA 2JOYA 2R57A 2CT3A 4FT2A 2FZKB 2VGMA 5CR2A 4JDSA 2G3RA 4PJMA 3QO3A 2EVRA 5J39A 3BE3A 1KD1C 1TU0B 4A54A 2FPEA 2CH4W 2E3IA 4QW2A 3X25B 1JRIA 4ZN3A 2RI5A 1QW1A 2HL3A 3OB9A 3A8LB 4EDUA 2WACA 1WYXA 5I2MA 2F2XA 1IGUA 4E7SA 2F2VA 2V1QA 2L3QA 1SRLA 4V2SA 3NPFA 2KT1A 2P0PA 1K73C 3OQ5A 1VYVA 5LJ3d 3M53A 3CCLA 3JCMQ 1KJWA 1VQ7Q 1V29B 1OU9A 3VS4A 4M7DG 1R8OB 3EGUA 1QQJA 2EIFA 1V1CA 2W0ZA 4BACA 5I22A 4XU2A 2QA4Q 5J3BA 2HAXA 4XTWA 3M4GA 3JB9I 3QJ6A 2GQVA 4N0AC 4JZ3A 2RHZA 1VQ4Q 4ESRA 4EMGA 4PJLA 5GMKl 3EG0A 3LH5A 4XTZA 2JN0A 2P0KA 4M7DA 1LOJA 4F7UE 1UEBA 2KSSA 2VV5A 2WSFE 5IXFA 1NPRA 3M0TA 1H3HA 4LXCA 5CQYA 2JTFA 1LVKA 2MCNA 1AZGB 4CC2A 1Q81R 4JS5A 2P4RA 1EIFA 2EQKA 4CC3A 1OYXA 3FRNA 1OX8A 1VYUA 2AK5A 1MGQA 3M0QA 4X34A 2DD4A 4JJDA 1UTIA 4FYWB 2DTIA 5CKFA 2KK4A 3DLLA 3C4SA 2YT6A 1H641 2HSPA 2EJFA 3RKWA 5GJWB 5KYUA 2EJGA 1Q86C 4BD3A 4C0ZA 3CC7A 3CPFA 4F7UF 5KYWB 4PFZA 1HK9A 4C5GA 2XDPA 2QEXA 2FG0A 1YWOA 3GBQA 4C0FA 4CC7A 3G4SA 3EFRA 1YHQT 1KG1A 3PTAA 2QQBA 2M0OA 1UG1A 3TQ7P 4JLGA 2QAZA 4BE2A 1M90R 4M7AG 2K5FA 4J9FA 4M4ZA 3NMZC 4KUIA 4NS5A 4CI0C 4A53A 1QMCA 3RUXA 3OY9A 5GMKh 2K7AA 1YN8A 4F7UB 4N4HA 2D6FA 4KUDK 3EGXA 2XK0A 2YLBA 1PCXA 2DXCA 1UFFA 5GMKe 5FU7C 1VQLA 2CZ7B 3LW5E 3TCJA 3FLGA 3LX7A 1XOVA 2LCCA 4M7AA 1YI2Q 1AD5A 2YWWA 2ZAEA 2YDLA 1IGQA 4XQ3A 2D0QB 3ZBDA 5GAOn 2ZPFB 3EG1A 1D3BA 2DZCA 2XMFA 1UHCA 3QDRB 3M0PA 2CKKA 1ZSZA 2Z0WA 5AYFA 3C94A 2CUDA 4M75E 4XTVA 1N8RR 2ZCFB 2RNAA 1J3TA 5A2QE 1MV0B 1N27A 1VUBA 1O9SA 3WVDB 1RAGB 3DB3A 5KE2A 1UGVA 3VUZA 3OW2S 1VQOA 1S1NA 4KT0E 1ZBJA 3M59A 5HY6A 2A36A 2DRKA 5LJ3j 2ABLA 4XTXA 4JJBA 2X4XA 4AG1C 3PMTA 5FROA 2MAMA 2DVJA 1TOVA 4D6WA 3H9NA 4JJNK 5HK3A 4AG2C 2HEQA 5CIUA 4M75C 3KBGA 1X27A 4M75F 4DEYA 1I0CA 1QP3A 3QWXX 4OB0B 1AOJA 3SEMA 4DQ2A 4C92F 3ME9A 3BY7A 1OU8A 1GCQC 4ZNXA 3OBYA 2XICA 1NEGA 3L2QA 3CD6A 3FDRA 2EKOA 1WQWA 4BE0A 5LJ5f 1VQ7A 5DLOA 3MEAA 2DIGA 4LD6A 2RQUA 4XU1A 2KE9A 4HVWA 1N9RA 2MF2A 4M75B 1VQ6Q 2LJ1A 1T3SA 3Q1JA 2EYWA 4XU0A 1NZ9A 1TH7A 1OZ3A 1JU5C 1UB4A 1GRIA 4J6WA 4C92B 1VQ4A 1G3WA 4RCCA 1X75C 4CC4B 3MPUB 2EQMA 1D0YA 2DL8A 3CXCP 1Q82R 4IIMA 2M16A 1F1BB 4RTUA 1H3ZA 2EQJA 2LC4A 4N0AA 5GAN8 2RB6A 2MK5A 3L1AA 1H92A 4WTOB 2COWA 3R6OA 5I11A 1R0BG 1MUZA 2RHYA 5LJ3h 1XNIA 2JS2A 2K3XA 3HKSA 4L5GA 5CQXA 1NE8A 3H8ZA 3EH1A 5KYWA 3SB2A 2O9SA 2XIDA 4JRIA 2I0NA 5LJ3e 3FB9A 3ZEHA 1WFWA 1PRLC 2LDMA 1UECA 4JZ4A 2KRMA 2OJ2A 5EG2A 2R5AA 4HXJA 4M78F 4R0KA 2MI6A 1YFNA 3HRUA 4R56A 1WXTA 2A08A 5D6YA 2DILA 1A0NB 5CCAA 2L89A 2DM1A 1D0ZA 4F7UA 1WHLA 4Z02A 4EMHA 3CCJQ 1QWEA 5LL6S 5FRMA 3HPWA 1KHIA 2KYMA 1WJQA 4MZPA 1GFCA 3NTHA 3G6ET 3I56T 3JB9F 4KH1B 1N9SA 4M77G 1X43A 4M78B 1OPLA 2FPDA 1YIJQ 4OP0A 2DE0X 2OAWA 1K9AA 4RTWA 2DXBA 1YI2A 2OTJT 5GJVB 3OYBA 2LTOA 3UA7A 3L2VA 2RH2A 2DL4A 3D7SB 4PK4A 2QK0A 4F14A 2HZYA 3PVQA 4M77A 1NJIU 2K3YA 1E6HA 1JBMA 3WXMB 1PKSA 3OYJA 2QYZA 3CBOA 2DTOA 1WA7A 3OW2A 5GANf 2PUOB 2E12A 1PKTA 3H0IA 1VQ5T 1QVFS 3QSUA 3RKXA 2LP5A 1UGPB 4X1VA 2EKHA 4EPCA 4FL6A 3AT1B 1K9MU 4FW1A 1VOMA 4M7DD 3GNGA 4OB3B 2C06A 1AEYA 4ZTFA 1TS9A 3U23A 3VS6A 4WF2A 4QVCA 5C0MA 2RN8A 2NYSA 1VIFA 2RQVA 2VXFA 1UGQB 3TREA 5LJ5d 3N5BB 1BB9A 4JRKA 2OI3A 3QXEB 1OI1A 4C92G 1BK2A 1M1FA 2YRVA 2K4YA 4LD9K 4MZTA 3TSZA 3I55T 1T0JA 3EGDA 3CC2T 1OPKA 3QZ9B 4OB1B 3RESA 2L3RA 3VU3C 2EW3A 4MMKA 2H3JA 2V8JA 3MEVA 1NJIC 4J83A 3P8DA 1DJ7B 2KQWA 2ATCB 2LT4A 2HBWA 4DBHA 4D8DA 5I21A 4C92A 5C6SA 3OSSC 3H0FA 1G3YA 1GCQA 3OS0A 2CT4A 4OMNA 4Z8AA 1VQKQ 4RTXA 4Y91A 3G71Q 1U1TA 3RNJA 1VQ6A 3UF4A 1K9MC 4LNPA 2BTTA 2HQEA 3CCSQ 1ZQ1A 1VQPQ 5A0GA 3RMSA 2P4TA 2OTLQ 2LX7A 2QG9B 2FL7A 4WCIA 1YJWQ 1CSKA 5DY9A 2CH4A 2J06A 3CCVA 4KBMB 1VQ5Q 1QLYA 5GAMf 2E5QA 3X26B 2ZPEB 5LJ3g 4BI8B 5GAN2 1OEBA 2HMAA 1AZEA 2R58A 1Z9ZA 1GCPA 1UUEA 2BZ8A 4B6MA 2FRYA 4IKFA 1QVGP 4QQGA 4OVAA 1C6VX 5GAN3 3CCUT 2A28A 1ZA2B 1HYOA 2RD1A 2HNIA 2KRNA 2PNIA 1JJ2S 4M78G 2JJ9A 4RTTA 2I2LA 1RI9A 4GBQA 3LGFA 1ZUYA 1VQ9T 3I55Q 3EG9B 2F1LA 5IAYA 3OYCA 1RUWA 1TUCA 4KULA 3RKYA 4F04B 4HCZA 1UJYA 2NUTB 6AT1B 2JUFA 1Q7YC 3EHQA 4M78A 3CCJA 2JM8A 3VS0A 1VQNQ 1GXIE 3JB9G 2EAYA 2K3BA 5L23A 2L5QA 1YCYA 2LCLA 2HSEB 3VS7A 5GAN5 1RAHB 1D1CA 1YJNT 1YITQ 2JZ2A 2DETA 4E7KA 2LVMA 1YIJA 1FWZA 3GOXA 1LJOA 2J05A 2HDAA 3JCMV 2DL5A 1B34B 2M51A 3A8HB 4BB7A 1VQMT 1BI1A 1D1BA 1RAEB 2H8HA 3H0HA 1M1KC 1S72T 2LNHB 2MWOA 3SWNC 4QVDA 4LE9A 1VQ8T 4VUBA 3SDZA 4RTZA 4LDXA 2MOXA 2ECZA 2EQUA 1QVFA 4GY5A 5HCKA 2E5KA 1ZX6A 2DEUA 2BE9B 4GLKA 3OYDA 3CPWS 4J9EA 2HCKA 1Q86U 1TUDA 5IHNA 4PKCC 2YUPA 5GMKj 1SG5A 1KQSP 4P5NA 1M2VB 3RMQA 2QXFA 3CCUQ 5GAOr 2QI2A 3CCMT 1IREB 4N4GA 2P0QA 1UHFA 3J80E 5FRNA 2RA2A 3SWNB 2V26A 2COZA 1YJ9A 1SRMA 1VQ9Q 1PRMC 5GAOl 4ZGDB 3J81E 3UPUA 4EMKC 2ROLA 1KC8R 3PT9A 2ENMA 2HQXA 2DVEA 4Z88A 4C5EA 2V1RA 3L2ZA 3M0UA 4CRIA 3NHNA 2FHDA 4J6YA 2KBTA 1ACMB 3GIBA 2LJ3A 1W2BP 2CZ1B 2WSEE 2K5IA 4ELYC 2Y90A 1RABB 4C5IA 4DOWA 2KYBA 2O2OA 5FW9A 2KROA 1SSHA 3JCMf 2AHJB 4NL2A 2DTHA 4EMKB 3CMET 2YXYA 1VQMQ 5GAMd 2CP0A 3KUFA 2D8JA 2RHIA 4A63B 2DIQA 1VQKA 4B9XA 3G71A 4J5YA 1Y07A 4QQ6A 2JTMA 3CCSA 5FLXE 1VQPA 3HFNA 1YCSB 2JM9A 3ZFJA 2JS0A 2DPPB 2OTLA 3SFMA 4JJCA 3OSVA 2YRCA 1IZ6A 1UGSB 1YJWA 5LJ5h 3CCET 4Y92A 5CKDA 4ZGJB 1VQ5A 1BI2A 1WHMA 3MEUA 1MMGA 1AWJA 2IIMA 2VB6A 1QCNA 4PL6A 2YSQA 2SRCA 5LJ5e 5KCHA 1M3CA 3LH0A 1K8AR 3C0CA 4X9DA 3EH2A 5CKHA 3OYGA 2CSQA 1Q95G 2FEIA 4OGCA 4MZMA 1SKUB 4IUUA 2DJQA 3OYHA 3KFVA 3ASKA 3OYFA 1JJ2A 4M77D 3G1JA 3P8HA 3EG9A 3QYHB 2E6NA 3PMIA 2DZ9A 5KCOA 3I5SA 2NUTA 4N4IA 4E47A 2CSIA 4C0DC 2PU9B 3CBPA 3HTRA 1U06A 3O5ZA 4OMMA 3VS2A 3NTKA 1UJ0A 5GAOq 1N6AA 5FU7B 4YTLA 3JAME 4FIBA 1KIKA 4ZTJA 2DFUA 4L6V5 4HT9A 2DAQA 3M57A 2F5KA 4QVZA 2GTJA 3A5ZB 3URGA 2VVKA 2CYZB 4JPBW 1X6GA 1VQNA 3S3NA 3UA6A 1B34A 1YHQQ 2CZ0B 2D8HA 3MP1A 4C0DB 1AWWA 2MPXC 1YITA 1WHKA 4BE1A 3I9QA 4X9CA 3S3MA 1IXDA 3IQLA 3JCMJ 3CCEQ 1XJWB 2OX7A 4BDZA 1C1AA 1WQ7A 3THKA 3L2UA 3VS3A 3QHSA 3MP8A 3JB9H 2XD0A 1WHGA 3JSCA 2IPOB 3CPWA 1M30A 1JO8A 1FMWA 2XG8D 5KE3A 3OMCA 1M2VA 2O4XB 4C8QE 1ABQA 2K9GA 2NUZA 1OOTA 2DRMA 3FJPA 2LQ8A 4IURA 2DA9A 1M8VA 1YP5A 2Y4YA 3E1SA 5KH6A 1CKBA 2QA4A 4PJNA 2B8AA 1JB0E 4HA8A 2M0YA 3OYAA 2O9VA 3CCUA 1PM3A 5IHIA 3ULRB 2PZ1A 3VRZA 2KEAA 4LN2A 1P92A 3UWNA 4JS4A 2QDYB 1VQ9A 3CQTA 5CKBA 4C8QD 5GANh 2FB7A 3JCMd 2JTEA 1M90U 1NBEB 5D6WA 4DBFA 4PJOD 2P84A 4C8QC 2HBPA 2EYYA 4C8QF 2K79A 5GAN4 2CP7A 4EMKA 1Q81C 1NLOC 5GMKm 1RAAB 2J6FA 4JLIA 3OYNA 3VKIA 2JXBA 2GCXA 4E7LA 4F7UG 2KY9A 1BCOA 1WLPB 2A3LA 1RADB 5IN1A 2HKQB 1SPKA 1VQMA 2HKNA 2XU8A 2DL7A 2DJZA 4C8QB 1MNDA 1AVZC 3CXCS 2GF7A 5LJ5g 3MJXA 3H41A 2K2MA 3S6WA 4UC4A 1N8RU 1Z9QA 2DYBA 2QGFB 3OBWA 3PVLA 2M1HA 4DBRA 1NEBA 1SEMA 5D6XA 2YHTA 3GP8A 3VUBA 4AFSC 2F2WA 1M90C 1YWPA 3V8JA 5CO7A 2RHUA 1AWXA 1QKXA 2AKLA 1KD1R 1WDXA 1T3LA 4L59A 2FVUA 2L8DA 2GFAA 2KVQG 2VWFA 5AT1B 3BDUA 2J6KA 2A0FB 1I81A 4M7DE 1IRXA 2JVVA 3WVEB 3M4YA 5GAMh 1WZOA 3X24B 3FJ5A 3OS2A 4ELZC 1V76A 1K73R 1X01A 1NG2A 2LNVA 1JXOA 2MWPA 3CC7T 2JMCA 5GAMe 3DLMA 2MMPA 2VKNA 1W4SA 1R0CB 2K6DA 3G4ST 4MMLA 1WX6A 3GNFB 2B86A 1N8RC 4BI4A 1W70A 2VC8A 1W6XA 2DXUA 2VGNA 3GLXA 1BIAA 3M0RA 2YUOA 4EIKA 2XKOC 2CP2A 4M7DC 4OGEA 3SHWA 4M7DF 1WIEA 1YHQA 4LDWA 3PNWC 4BDYA 2F5TX 4M75G 2CP3A 2O01E 5LJ3f 4XK8E 1X2QA 1VQLT 2LT1A 1HSQA 1MHNA 3REBB 3FEOA 1KQ1A 4ORZA 2O4XA 2RMOA 1MMDA 4NL3A 3UT1A 1LPLA 1RLQC 2XDDA 3X28B 3G6EQ 3I56Q 3A1PA 4PLLA 1XTDA 2EWNA 4M75A 2RJFA 1ZA1B 3H6ZA 4A4GA 4M7DB 2RI2A 4XTUA 1HJDA 4FM4B 2OTJQ 1RL2A 2ZPHB 1IO6A 3E9FA 4E7JA 4ANJA 4M7AE 1Q86R 1G3SA 1LCKA 2KDSA 3RR6A 2L3SA 4D8KA 2XHCA 1VQOT 4JRQA 2KT8A 1K0SA 1MV3A 1Y71A 3CC4T 4J9IA 2O88A 2ZPIB 1G83A 1Q7YU 1N5ZA 2QASA 3TEEA 2X4JA 1UGRB 2QQ9A 2E65A 1WNLA 2QTXA 2GFUA 3HFOA 2PTKA 5L8RE 2RK2A 2QQAA 2CGHA 1TWBA 3NTIA 1NLPC 1Q82C 2D9TA 3J7AF 4M7AD 1Y96B 3RBBB 2EGAA 4PNOA 2DK3A 3VYGA 3QYGB 4A4KA 4M7AC 3EFSA 1PC0A 4FYYB 3PIOA 4Z89A 4PLIA 5A0DA 4OMPA 2ED1A 1K4US 1M1KU 1WHJA 1EX4A 4F17A 3CD6T 3BFMA 2DO3A 4O6JA 3JV3A 5KYNA 5HK0A 3CXCA 4AFUC 1VQ7T 1ZSZC 4KRTA 4LDVA 3QIIA 2PVGB 2QDLA 2X35A 1ZBXA 1GBRA 3PE0A 3CC2Q 2EYQA 4RTYA 2BZXA 2C0OA 3TVTA 2RF0A 1VQ4T 2AT1B 2FZGB 3QZ5B 1MMNA 3JCMh 1ZUKA 1KQ2A
chains in the Genus database with same CATH topology
5FWCA 1YCSB 2AKKA 2JM9A 4OMOA 1JU5C 2JS0A 2CDTA 1GRIA 2KR3A 3VRYA 1H8KA 4JJCA 1WXUA 4J9DA 4RTVA 2DX1A 4Y92A 2EQIA 4CC4B 2MIOA 2DL8A 4IIMA 4F16A 2SEMA 4RTUA 1AWJA 2IIMA 2YSQA 2SRCA 3NGPA 4HVUA 1M3CA 1WXBA 1YNZA 3C0CA 2EBPA 1H92A 2CSQA 2FEIA 3I5RA 5I11A 1MUZA 2DJQA 3KFVA 2JS2A 2D0NA 2D1XA 1M8MA 2O9SA 4RUGA 4IIOA 2I0NA 3QWYA 2KRSA 1WFWA 3I5SA 2RQRA 2CSIA 1PRLC 1K1ZA 1RLPC 1UECA 2DLPA 1U06A 2G6FX 3O5ZA 4JZ4A 4OMMA 1X69A 2GBQA 2KRMA 2OJ2A 5FWBA 3VS2A 1UJ0A 1NM7A 4HXJA 4R0KA 1KIKA 4E6RA 4AFZC 1WXTA 2A08A 2DILA 1A0NB 1FYNA 2GTJA 4DEXA 1HD3A 2DM1A 1U5SA 2JT4A 2RPNA 1M27C 2VVKA 2O31A 4JPBW 1X6GA 1QWEA 3VS5A 1ZUUA 1GL5A 1JEGA 3TSWA 3UA6A 2L2PA 1QCFA 2D8HA 2KYMA 1AWWA 1GFCA 3I9QA 2JMAA 1X43A 3IQLA 1OPLA 2FPDA 2KNBB 1X2KA 2AZVA 1GFDA 2EYZA 2DE0X 2OAWA 1K9AA 2GGRA 3THKA 4RTWA 3VS3A 1ARKA 1M3AA 2CUBA 3R6NA 5GJVB 1AWOA 1M30A 1JO8A 4HCKA 1PWTA 1M3BA 1QKWA 1KFZA 3UA7A 1JXMA 1PNJA 2DL4A 3REAB 1I07A 4F14A 2KGTA 1ABQA 1UE9A 3PVQA 4GLMA 2EYXA 2K9GA 1E6HA 2NUZA 1OOTA 1T0HA 2DRMA 1PKSA 1WA7A 2DA9A 5ECAA 4J9CA 5IH2A 1YP5A 1CKBA 1ABOA 1PKTA 3H0IA 1BBZA 2M0YA 4LUEA 2LP5A 4X1VA 2O9VA 2EKHA 3EHRA 1ZLMA 2X3WD 5IHIA 3ULRB 2PZ1A 2EPDA 3VRZA 1WI7A 2ED0A 2KEAA 4LN2A 1E7OA 3CQTA 2GTOA 1TG0A 1AEYA 2LZ6B 2J7IA 3U23A 3VS6A 2JTEA 2LJ0A 1PHTA 2CT3A 2RN8A 2EYYA 2RQVA 1SHGA 2EVRA 2K79A 1BB9A 2DF6A 2FPEA 2CH4W 2OI3A 3VS1A 1CKAA 1NLOC 1K0XA 4OMQA 1BK2A 2J6FA 3TSZA 1T0JA 2JXBA 1WYXA 2F2XA 1VA7A 1SHFA 1OPKA 2F2VA 2V1QA 2L3QA 1SRLA 2EW3A 1WLPB 3NPFA 2KT1A 1SPKA 2AZSA 1VYVA 2HBWA 2DL7A 4D8DA 1KJWA 1UDLA 1B3QA 1AVZC 4K11A 2L0AA 1Y57A 3H0FA 1GCQA 3H41A 3VS4A 2K2MA 2CT4A 4OMNA 4Z8AA 4RTXA 1Z9QA 2DYBA 3RNJA 1KSWA 3EGUA 3UF4A 4LNPA 2BTTA 2FO0A 1V1CA 2YUQA 1EFNA 1OV3A 2W0ZA 5I22A 3PVLA 2LX7A 1NEBA 1SEMA 4JZ3A 4WCIA 4ESRA 1CSKA 4J9HA 2CH4A 3EG0A 2J06A 4AFSC 3LH5A 1QLYA 2F2WA 1YWPA 1AWXA 1OEBA 1QKXA 1BU1A 2ESWA 2ROTA 1AZEA 5IXFA 2AKLA 2J6OA 4OMLA 3M0TA 1H3HA 1WDXA 1Z9ZA 2C0TA 1T3LA 1GCPA 2EGCA 1UUEA 2BZ8A 2MCNA 1AZGB 4CC2A 2C0IA 2VWFA 2FRYA 1I1JA 2P4RA 2J6KA 4CC3A 4LUDA 2W10A 1VYUA 1QWFA 1B07A 2DNUA 2AK5A 2DMOA 3M0QA 3FJ5A 1ZSGA 5IXBA 1NG2A 2A28A 1JXOA 4JJDA 4FSSA 1UTIA 2JMCA 2KRNA 2PNIA 2VKNA 4RTTA 2YT6A 2HSPA 1RI9A 2GNCA 4GBQA 2K6DA 5GJWB 1ZUYA 1WX6A 2B86A 1W70A 1RUWA 2FG0A 1W6XA 1TUCA 1YWOA 3GBQA 3M0RA 1UJYA 4QT7A 4CC7A 1JQQA 5IHKA 2YUOA 3EG3A 4EIKA 3EHQA 2RQTA 1UG1A 3SHWA 2JM8A 3VS0A 1WIEA 4J9FA 4M4ZA 3NMZC 2K3BA 5L23A 1U3OA 3VS7A 1X2QA 1E6GA 1HSQA 3REBB 2LMJA 2K7AA 1YN8A 4AFQC 1W1FA 3M0SA 4ORZA 5EC7A 2RMOA 2J05A 2HDAA 1RLQC 2DL5A 1UFFA 2LQNA 2M51A 1Y0MA 2FRWA 1XOVA 2H8HA 3H0HA 1AD5A 2LNHB 2YDLA 4LE9A 4RTZA 3ZL7C 2LQWA 2MOXA 2ECZA 1HJDA 5HCKA 2DBKA 3EG1A 2XMFA 1NYFA 2E5KA 1UHCA 1ZX6A 1IO6A 3M0PA 3A98A 2CREA 4J9EA 2HCKA 1TUDA 5IHNA 1LCKA 2CUDA 2NWMA 2L3SA 2RNAA 2YUPA 4D8KA 1J3TA 2BZYA 2KT8A 1K0SA 1MV3A 1MV0B 4J9IA 2O88A 1G83A 1N5ZA 1UGVA 2LCSA 2X3XD 1S1NA 1UHFA 2A37A 1ZBJA 2KXDA 2PTKA 3EG2A 3I35A 1SRMA 2A36A 1PRMC 2DRKA 2YUNA 2ABLA 2ROLA 1NLPC 2ENMA 1FMKA 4JJBA 4Z88A 4AG1C 2V1RA 3M0UA 3RBBB 4J9GA 2JW4A 2EGAA 2KXCA 3NHNA 2DVJA 2KBTA 4J9BA 1K76A 2GQIA 2EGEA 2LJ3A 4AG2C 2HEQA 1NYGA 1X6BA 4Z89A 4OMPA 1X27A 2ED1A 1K4US 4DEYA 1I0CA 4F17A 3QWXX 2KYBA 2L3PA 1AOJA 3JV3A 3SEMA 3UATA 2O2OA 5FW9A 2KROA 1SSHA 4AFUC 4HVVA 1GCQC 4ZNXA 2DL3A 4KRTA 2FPFA 1NEGA 2QDLA 1GBRA 3PE0A 1GBQA 1G2BA 4RTYA 2DBMA 2D8JA 2RQUA 4A63B 2BZXA 2C0OA 2KE9A 3TVTA 1VYTA 4HVWA 2RF0A 2RQWA 2LJ1A 1T3SA 1ZUKA 2EYWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FWC A;  1YCS B;  2AKK A;  2JM9 A;  4OMO A;  1JU5 C;  2JS0 A;  2CDT A;  1GRI A;  2KR3 A;  3VRY A;  1H8K A;  4JJC A;  1WXU A;  4J9D A;  4RTV A;  2DX1 A;  4Y92 A;  2EQI A;  4CC4 B;  2MIO A;  2DL8 A;  4IIM A;  4F16 A;  2SEM A;  4RTU A;  1AWJ A;  2IIM A;  2YSQ A;  2SRC A;  3NGP A;  4HVU A;  1M3C A;  1WXB A;  1YNZ A;  3C0C A;  2EBP A;  1H92 A;  2CSQ A;  2FEI A;  3I5R A;  5I11 A;  1MUZ A;  2DJQ A;  3KFV A;  2JS2 A;  2D0N A;  2D1X A;  1M8M A;  2O9S A;  4RUG A;  4IIO A;  2I0N A;  3QWY A;  2KRS A;  1WFW A;  3I5S A;  2RQR A;  2CSI A;  1PRL C;  1K1Z A;  1RLP C;  1UEC A;  2DLP A;  1U06 A;  2G6F X;  3O5Z A;  4JZ4 A;  4OMM A;  1X69 A;  2GBQ A;  2KRM A;  2OJ2 A;  5FWB A;  3VS2 A;  1UJ0 A;  1NM7 A;  4HXJ A;  4R0K A;  1KIK A;  4E6R A;  4AFZ C;  1WXT A;  2A08 A;  2DIL A;  1A0N B;  1FYN A;  2GTJ A;  4DEX A;  1HD3 A;  2DM1 A;  1U5S A;  2JT4 A;  2RPN A;  1M27 C;  2VVK A;  2O31 A;  4JPB W;  1X6G A;  1QWE A;  3VS5 A;  1ZUU A;  1GL5 A;  1JEG A;  3TSW A;  3UA6 A;  2L2P A;  1QCF A;  2D8H A;  2KYM A;  1AWW A;  1GFC A;  3I9Q A;  2JMA A;  1X43 A;  3IQL A;  1OPL A;  2FPD A;  2KNB B;  1X2K A;  2AZV A;  1GFD A;  2EYZ A;  2DE0 X;  2OAW A;  1K9A A;  2GGR A;  3THK A;  4RTW A;  3VS3 A;  1ARK A;  1M3A A;  2CUB A;  3R6N A;  5GJV B;  1AWO A;  1M30 A;  1JO8 A;  4HCK A;  1PWT A;  1M3B A;  1QKW A;  1KFZ A;  3UA7 A;  1JXM A;  1PNJ A;  2DL4 A;  3REA B;  1I07 A;  4F14 A;  2KGT A;  1ABQ A;  1UE9 A;  3PVQ A;  4GLM A;  2EYX A;  2K9G A;  1E6H A;  2NUZ A;  1OOT A;  1T0H A;  2DRM A;  1PKS A;  1WA7 A;  2DA9 A;  5ECA A;  4J9C A;  5IH2 A;  1YP5 A;  1CKB A;  1ABO A;  1PKT A;  3H0I A;  1BBZ A;  2M0Y A;  4LUE A;  2LP5 A;  4X1V A;  2O9V A;  2EKH A;  3EHR A;  1ZLM A;  2X3W D;  5IHI A;  3ULR B;  2PZ1 A;  2EPD A;  3VRZ A;  1WI7 A;  2ED0 A;  2KEA A;  4LN2 A;  1E7O A;  3CQT A;  2GTO A;  1TG0 A;  1AEY A;  2LZ6 B;  2J7I A;  3U23 A;  3VS6 A;  2JTE A;  2LJ0 A;  1PHT A;  2CT3 A;  2RN8 A;  2EYY A;  2RQV A;  1SHG A;  2EVR A;  2K79 A;  1BB9 A;  2DF6 A;  2FPE A;  2CH4 W;  2OI3 A;  3VS1 A;  1CKA A;  1NLO C;  1K0X A;  4OMQ A;  1BK2 A;  2J6F A;  3TSZ A;  1T0J A;  2JXB A;  1WYX A;  2F2X A;  1VA7 A;  1SHF A;  1OPK A;  2F2V A;  2V1Q A;  2L3Q A;  1SRL A;  2EW3 A;  1WLP B;  3NPF A;  2KT1 A;  1SPK A;  2AZS A;  1VYV A;  2HBW A;  2DL7 A;  4D8D A;  1KJW A;  1UDL A;  1B3Q A;  1AVZ C;  4K11 A;  2L0A A;  1Y57 A;  3H0F A;  1GCQ A;  3H41 A;  3VS4 A;  2K2M A;  2CT4 A;  4OMN A;  4Z8A A;  4RTX A;  1Z9Q A;  2DYB A;  3RNJ A;  1KSW A;  3EGU A;  3UF4 A;  4LNP A;  2BTT A;  2FO0 A;  1V1C A;  2YUQ A;  1EFN A;  1OV3 A;  2W0Z A;  5I22 A;  3PVL A;  2LX7 A;  1NEB A;  1SEM A;  4JZ3 A;  4WCI A;  4ESR A;  1CSK A;  4J9H A;  2CH4 A;  3EG0 A;  2J06 A;  4AFS C;  3LH5 A;  1QLY A;  2F2W A;  1YWP A;  1AWX A;  1OEB A;  1QKX A;  1BU1 A;  2ESW A;  2ROT A;  1AZE A;  5IXF A;  2AKL A;  2J6O A;  4OML A;  3M0T A;  1H3H A;  1WDX A;  1Z9Z A;  2C0T A;  1T3L A;  1GCP A;  2EGC A;  1UUE A;  2BZ8 A;  2MCN A;  1AZG B;  4CC2 A;  2C0I A;  2VWF A;  2FRY A;  1I1J A;  2P4R A;  2J6K A;  4CC3 A;  4LUD A;  2W10 A;  1VYU A;  1QWF A;  1B07 A;  2DNU A;  2AK5 A;  2DMO A;  3M0Q A;  3FJ5 A;  1ZSG A;  5IXB A;  1NG2 A;  2A28 A;  1JXO A;  4JJD A;  4FSS A;  1UTI A;  2JMC A;  2KRN A;  2PNI A;  2VKN A;  4RTT A;  2YT6 A;  2HSP A;  1RI9 A;  2GNC A;  4GBQ A;  2K6D A;  5GJW B;  1ZUY A;  1WX6 A;  2B86 A;  1W70 A;  1RUW A;  2FG0 A;  1W6X A;  1TUC A;  1YWO A;  3GBQ A;  3M0R A;  1UJY A;  4QT7 A;  4CC7 A;  1JQQ A;  5IHK A;  2YUO A;  3EG3 A;  4EIK A;  3EHQ A;  2RQT A;  1UG1 A;  3SHW A;  2JM8 A;  3VS0 A;  1WIE A;  4J9F A;  4M4Z A;  3NMZ C;  2K3B A;  5L23 A;  1U3O A;  3VS7 A;  1X2Q A;  1E6G A;  1HSQ A;  3REB B;  2LMJ A;  2K7A A;  1YN8 A;  4AFQ C;  1W1F A;  3M0S A;  4ORZ A;  5EC7 A;  2RMO A;  2J05 A;  2HDA A;  1RLQ C;  2DL5 A;  1UFF A;  2LQN A;  2M51 A;  1Y0M A;  2FRW A;  1XOV A;  2H8H A;  3H0H A;  1AD5 A;  2LNH B;  2YDL A;  4LE9 A;  4RTZ A;  3ZL7 C;  2LQW A;  2MOX A;  2ECZ A;  1HJD A;  5HCK A;  2DBK A;  3EG1 A;  2XMF A;  1NYF A;  2E5K A;  1UHC A;  1ZX6 A;  1IO6 A;  3M0P A;  3A98 A;  2CRE A;  4J9E A;  2HCK A;  1TUD A;  5IHN A;  1LCK A;  2CUD A;  2NWM A;  2L3S A;  2RNA A;  2YUP A;  4D8K A;  1J3T A;  2BZY A;  2KT8 A;  1K0S A;  1MV3 A;  1MV0 B;  4J9I A;  2O88 A;  1G83 A;  1N5Z A;  1UGV A;  2LCS A;  2X3X D;  1S1N A;  1UHF A;  2A37 A;  1ZBJ A;  2KXD A;  2PTK A;  3EG2 A;  3I35 A;  1SRM A;  2A36 A;  1PRM C;  2DRK A;  2YUN A;  2ABL A;  2ROL A;  1NLP C;  2ENM A;  1FMK A;  4JJB A;  4Z88 A;  4AG1 C;  2V1R A;  3M0U A;  3RBB B;  4J9G A;  2JW4 A;  2EGA A;  2KXC A;  3NHN A;  2DVJ A;  2KBT A;  4J9B A;  1K76 A;  2GQI A;  2EGE A;  2LJ3 A;  4AG2 C;  2HEQ A;  1NYG A;  1X6B A;  4Z89 A;  4OMP A;  1X27 A;  2ED1 A;  1K4U S;  4DEY A;  1I0C A;  4F17 A;  3QWX X;  2KYB A;  2L3P A;  1AOJ A;  3JV3 A;  3SEM A;  3UAT A;  2O2O A;  5FW9 A;  2KRO A;  1SSH A;  4AFU C;  4HVV A;  1GCQ C;  4ZNX A;  2DL3 A;  4KRT A;  2FPF A;  1NEG A;  2QDL A;  1GBR A;  3PE0 A;  1GBQ A;  1G2B A;  4RTY A;  2DBM A;  2D8J A;  2RQU A;  4A63 B;  2BZX A;  2C0O A;  2KE9 A;  3TVT A;  1VYT A;  4HVW A;  2RF0 A;  2RQW A;  2LJ1 A;  1T3S A;  1ZUK A;  2EYW A; 
#chains in the Genus database with same CATH topology
 5FWC A;  3C95 A;  4ATO A;  2ZZD A;  4RMO A;  2CDT A;  2AIR B;  2E4H A;  4E7H A;  1D3B B;  3CBM A;  1WXU A;  4RTV A;  2DX1 A;  3JCM e;  1ZSZ B;  2EQI A;  1R77 A;  3JB9 J;  3FC3 A;  1QVG S;  1VQO Q;  5GAN 6;  3CC4 Q;  4F16 A;  1RI0 A;  2SEM A;  2V8I A;  2LRQ A;  5IT9 E;  2QQS A;  3KXT A;  3NGP A;  4LDY A;  5HKC A;  2X4Y A;  5GAM g;  4HVU A;  5GAN d;  3JCM P;  3RER A;  3M55 A;  3ER0 A;  8ATC B;  3MEW A;  3V8K A;  3I5R A;  2E1H A;  2QTV A;  1TXQ A;  5I2S A;  4AMC A;  2ZPB B;  2D0N A;  2HD0 A;  4RUG A;  4E7Z A;  2VXE A;  5J26 A;  5LJ5 j;  2RQR A;  4OMF B;  4C5H A;  1RLP C;  1SF9 A;  3LLR A;  2DLP A;  4BUG A;  2DXT A;  4TVR A;  2YRD A;  1X69 A;  2GBQ A;  3JCM b;  3CD6 Q;  4ZN1 A;  2RK1 A;  1ZHI A;  4AFZ C;  4E2F B;  1Y7X A;  1U5S A;  2CS7 A;  3VS5 A;  3A8G B;  4KH0 B;  3TSW A;  2K5L A;  4NOY A;  3L2R A;  4QKU A;  2E3H A;  1U8R A;  1YI2 T;  2JMA A;  1WHH A;  1GFD A;  2AZV A;  4LDU A;  3HSB A;  3G6E A;  2MYS A;  3I56 A;  3CEY A;  3VJP A;  1YJN Q;  2CUB A;  1KQS S;  1AWO A;  2CZ6 B;  3EFO B;  4HCK A;  4RG2 A;  1PWT A;  1TTH B;  1QKW A;  1KFZ A;  3O8V A;  3REA B;  4XTY A;  1I07 A;  3DKM A;  2KGT A;  1UE9 A;  4GLM A;  2CP6 A;  2OTJ A;  2NLU A;  4OF1 A;  2LX9 A;  1S72 Q;  5CVI A;  1T0H A;  2FYK A;  1VQ8 Q;  1YBY A;  2ZGW A;  3S3O A;  2RJD A;  3MET A;  1BI3 A;  3L42 A;  4J9C A;  1RAC B;  3PIP A;  2H3E B;  4LUE A;  1ZLM A;  4M77 E;  2EJ9 A;  1Y96 A;  1W2B S;  3HRT A;  3LGL A;  2ED0 A;  2K57 A;  2PUK B;  1E7O A;  2XDB A;  2QGG A;  1TG0 A;  4J6X A;  3CCQ T;  3T9N A;  5GMK i;  4RKU E;  3CCM Q;  3JCM c;  1WJR A;  1M4Z A;  1PHT A;  2LJ0 A;  2DYI A;  3CCR T;  5KYY B;  4O5V A;  1SHG A;  3VV0 A;  1BYM A;  5KYX B;  2DF6 A;  3OW2 P;  4IUV A;  3VS1 A;  1CKA A;  1K0X A;  4OMQ A;  2PVO B;  4FW2 A;  2E70 A;  4BY6 C;  3V7S A;  3OYL A;  4FCY A;  4M77 C;  5CKE A;  1VA7 A;  1SHF A;  2KAF A;  4M77 F;  3OYE A;  2VUB A;  3JCM g;  2BUD A;  3QDF A;  2AZS A;  3M9Q A;  3I55 A;  1VIE A;  5GAN j;  1VQ6 T;  3CC2 A;  1D1A A;  1UDL A;  1IB8 A;  3OYY A;  4FYX B;  1B3Q A;  3V7R A;  4K11 A;  1RAF B;  2L0A A;  2X51 A;  3OYM A;  1Y57 A;  1X6O A;  4HT8 A;  2F69 A;  2ZPG B;  3CME Q;  4MDX A;  4BI3 A;  1PSF A;  1KSW A;  1QVG A;  4A4F A;  3INZ A;  2FO0 A;  2YUQ A;  1EFN A;  1OV3 A;  2HL5 C;  4HCC A;  2OAU A;  3CCV T;  1QVP A;  2COY A;  4HKE A;  4BY6 B;  4C92 E;  4M77 B;  3MCA B;  1KHC A;  4J9H A;  3CC4 A;  1PSE A;  1QCO A;  3MHX A;  1BU1 A;  2ESW A;  2ROT A;  1M2O A;  2J6O A;  4OML A;  4XU3 A;  1KC8 U;  1I5O B;  2C0T A;  2EGC A;  1Q81 U;  1TUG B;  2C0I A;  4M75 D;  3RDV A;  1I1J A;  3CCQ Q;  4LUD A;  2W10 A;  3CMA T;  4IUT A;  1QWF A;  3OA6 A;  1B07 A;  2DNU A;  4C92 D;  2DMO A;  3CCR Q;  4AT1 B;  3L2W A;  1NJI R;  2M9U A;  1ZSG A;  5IXB A;  1KK7 A;  4FSS A;  3SWN A;  4C92 C;  4PJO E;  1LNX A;  5DM7 R;  2GNC A;  2IG0 A;  2DEQ A;  3G7Z A;  5GAN 7;  3V8L A;  4ME7 A;  9ATC B;  1K9M R;  4DBQ A;  3CCJ T;  4KGX B;  3OS5 A;  1EZZ B;  3EGD B;  3RIR A;  4QT7 A;  4DOV A;  1JQQ A;  3A8O B;  3QPH A;  5IHK A;  3EG3 A;  2PVD B;  2EFI A;  1TSF A;  3M56 A;  3PGG A;  2RQT A;  1OX9 A;  5GAM j;  3OYK A;  2HQH A;  1YIJ T;  5GAN e;  1OZ2 A;  1IHW A;  3QJY A;  1U3O A;  1KC8 C;  3JRZ A;  1E6G A;  3E19 A;  3EFO A;  4PJO C;  3CCV Q;  1MMA A;  1KQS A;  4PJO F;  1FXX A;  2LMJ A;  4M78 E;  4AFQ C;  1W1F A;  3M0S A;  5EC7 A;  1K8A U;  3HL8 A;  2LQN A;  3CCL T;  1Y0M A;  2VAS A;  1YJN A;  5GAO m;  1WJS A;  2FRW A;  4MDW A;  2DER A;  2BE7 D;  3BDL A;  1MNE A;  5D7U A;  3ZL7 C;  3HP9 A;  2LQW A;  2E10 A;  2PQW A;  3F70 A;  3A8M B;  2DBK A;  1NYF A;  3VYH B;  2A7Y A;  1S72 A;  4C0G A;  3A98 A;  1VQ8 A;  3TU4 K;  1M1G A;  2CRE A;  2E41 A;  7AT1 B;  1W2B A;  4PJO B;  2WSC E;  3CMA Q;  2NWM A;  4M78 D;  3OYI A;  2BZY A;  1YJ9 T;  4J7F A;  4FSX A;  1AT1 B;  1PG5 B;  4M78 C;  3JCM W;  1Q7Y R;  4E7I A;  5KYY A;  2LCS A;  2X3X D;  4PFO A;  2Y4X A;  3X20 B;  2A37 A;  3E9G A;  2KXD A;  1D0X A;  1OUL A;  3EG2 A;  3I35 A;  5KYX A;  1FX7 A;  3OMG A;  2YUN A;  5FU6 C;  3CCM A;  1I4K 1;  1QVF P;  1FMK A;  3JB9 D;  4PJJ A;  2NUP B;  2RI3 A;  4J9G A;  2JW4 A;  2KXC A;  3JCM X;  3V7C A;  3HRS A;  3GF5 A;  4J9B A;  1K76 A;  2GQI A;  3MO8 A;  2EGE A;  4OB2 B;  4QQD A;  1K8A C;  1O75 A;  4B9W A;  1NYG A;  1X6B A;  1G3T A;  1SSF A;  3M58 A;  1M1K R;  3LYI A;  1G8X A;  2L3P A;  1BCM A;  1AHJ B;  4J8O A;  3UAT A;  3LWI A;  4HVV A;  4Y28 E;  2QEX T;  2DL3 A;  1WGS A;  2FPF A;  5FU6 B;  1VQK T;  2RJC A;  3G71 T;  1I5L A;  2CP5 A;  3CCL Q;  3CCS T;  1GBQ A;  1G2B A;  3GPL A;  1VQP T;  2V8K A;  1WPY A;  3EAE A;  2DBM A;  2OTL T;  3CME A;  3E2U A;  2JNG A;  5M9O A;  1C0M A;  1VYT A;  4Q5W A;  8AT1 B;  4XAX B;  4JUV A;  1YJW T;  2RQW A;  1D09 B;  2AKK A;  4OMO A;  2KR3 A;  2RO0 A;  3VRY A;  1H8K A;  4J9D A;  2MIO A;  1Q82 U;  1YJ9 Q;  1M5Q 1;  3FIF A;  1RAI B;  2RHX A;  4ZGE B;  4IUP A;  3CCE A;  1WXB A;  1YNZ A;  4DA4 A;  2EBP A;  1BI0 A;  2DD5 A;  2R5M A;  3CCQ A;  4RCB A;  5CAI A;  4J7I A;  2M02 A;  4II1 A;  3QKJ A;  2YLC A;  3CCR A;  2D1X A;  1M8M A;  3UDC A;  1PD1 A;  2IVW A;  4IIO A;  3QWY A;  4FYV B;  1I8F A;  5GAO p;  2KRS A;  3C12 A;  1K1Z A;  1BKB A;  4IUQ A;  2G6F X;  2KI7 A;  5GAN g;  5A0L A;  5FWB A;  2RJE A;  1NM7 A;  3CC7 Q;  2KMT A;  4E6R A;  2QEX Q;  1VQN T;  3LWH A;  3M54 A;  4JRP A;  2X9H A;  1FYN A;  4DEX A;  3G4S Q;  2VYT A;  1HD3 A;  2JT4 A;  1OQK A;  2RPN A;  1M27 C;  4C8Q G;  1PD0 A;  1JJ2 P;  5KYU B;  2O31 A;  1YIT T;  3MP6 A;  1ZUU A;  5DLQ E;  1GL5 A;  4A4E A;  1JEG A;  2FZC B;  2L2P A;  4PJO G;  1QCF A;  3DB4 A;  3SD4 A;  2QQR A;  4RG8 A;  4A4H A;  1XQH A;  4M7A F;  2RM4 A;  4KGV B;  3OS1 A;  1M9S A;  4C8Q A;  2KNB B;  1X2K A;  1KD1 U;  2XI9 A;  1NPP A;  2EYZ A;  1G5V A;  4KGZ B;  2GGR A;  1VQL Q;  2BIV A;  1ARK A;  1M3A A;  3R6N A;  4PJO A;  3NFC A;  2BKD N;  2K2V A;  1M3B A;  2LQK A;  2E6Z A;  1JXM A;  1HXD A;  3HHT B;  1PNJ A;  1IHV A;  4FU6 A;  1B7T A;  3EGX B;  2EYX A;  4R55 A;  2QA4 T;  3QUI A;  1K73 U;  1BIB A;  2E64 A;  4M7A B;  4PFP A;  3CMA A;  3AHU A;  3QBY A;  5ECA A;  5IH2 A;  3BW1 A;  1ABO A;  1BBZ A;  3M5A A;  1U1S A;  3PFS A;  3EHR A;  3MKD A;  5CK9 A;  2X3W D;  1QP2 A;  2NUP A;  2EPD A;  1WI7 A;  2X4W A;  2DKG A;  3CPW P;  4FT4 A;  2GTO A;  3P8B B;  2LZ6 B;  2J7I A;  4HCB A;  3QG1 A;  1FMV A;  2JOY A;  2R57 A;  2CT3 A;  4FT2 A;  2FZK B;  2VGM A;  5CR2 A;  4JDS A;  2G3R A;  4PJM A;  3QO3 A;  2EVR A;  5J39 A;  3BE3 A;  1KD1 C;  1TU0 B;  4A54 A;  2FPE A;  2CH4 W;  2E3I A;  4QW2 A;  3X25 B;  1JRI A;  4ZN3 A;  2RI5 A;  1QW1 A;  2HL3 A;  3OB9 A;  3A8L B;  4EDU A;  2WAC A;  1WYX A;  5I2M A;  2F2X A;  1IGU A;  4E7S A;  2F2V A;  2V1Q A;  2L3Q A;  1SRL A;  4V2S A;  3NPF A;  2KT1 A;  2P0P A;  1K73 C;  3OQ5 A;  1VYV A;  5LJ3 d;  3M53 A;  3CCL A;  3JCM Q;  1KJW A;  1VQ7 Q;  1V29 B;  1OU9 A;  3VS4 A;  4M7D G;  1R8O B;  3EGU A;  1QQJ A;  2EIF A;  1V1C A;  2W0Z A;  4BAC A;  5I22 A;  4XU2 A;  2QA4 Q;  5J3B A;  2HAX A;  4XTW A;  3M4G A;  3JB9 I;  3QJ6 A;  2GQV A;  4N0A C;  4JZ3 A;  2RHZ A;  1VQ4 Q;  4ESR A;  4EMG A;  4PJL A;  5GMK l;  3EG0 A;  3LH5 A;  4XTZ A;  2JN0 A;  2P0K A;  4M7D A;  1LOJ A;  4F7U E;  1UEB A;  2KSS A;  2VV5 A;  2WSF E;  5IXF A;  1NPR A;  3M0T A;  1H3H A;  4LXC A;  5CQY A;  2JTF A;  1LVK A;  2MCN A;  1AZG B;  4CC2 A;  1Q81 R;  4JS5 A;  2P4R A;  1EIF A;  2EQK A;  4CC3 A;  1OYX A;  3FRN A;  1OX8 A;  1VYU A;  2AK5 A;  1MGQ A;  3M0Q A;  4X34 A;  2DD4 A;  4JJD A;  1UTI A;  4FYW B;  2DTI A;  5CKF A;  2KK4 A;  3DLL A;  3C4S A;  2YT6 A;  1H64 1;  2HSP A;  2EJF A;  3RKW A;  5GJW B;  5KYU A;  2EJG A;  1Q86 C;  4BD3 A;  4C0Z A;  3CC7 A;  3CPF A;  4F7U F;  5KYW B;  4PFZ A;  1HK9 A;  4C5G A;  2XDP A;  2QEX A;  2FG0 A;  1YWO A;  3GBQ A;  4C0F A;  4CC7 A;  3G4S A;  3EFR A;  1YHQ T;  1KG1 A;  3PTA A;  2QQB A;  2M0O A;  1UG1 A;  3TQ7 P;  4JLG A;  2QAZ A;  4BE2 A;  1M90 R;  4M7A G;  2K5F A;  4J9F A;  4M4Z A;  3NMZ C;  4KUI A;  4NS5 A;  4CI0 C;  4A53 A;  1QMC A;  3RUX A;  3OY9 A;  5GMK h;  2K7A A;  1YN8 A;  4F7U B;  4N4H A;  2D6F A;  4KUD K;  3EGX A;  2XK0 A;  2YLB A;  1PCX A;  2DXC A;  1UFF A;  5GMK e;  5FU7 C;  1VQL A;  2CZ7 B;  3LW5 E;  3TCJ A;  3FLG A;  3LX7 A;  1XOV A;  2LCC A;  4M7A A;  1YI2 Q;  1AD5 A;  2YWW A;  2ZAE A;  2YDL A;  1IGQ A;  4XQ3 A;  2D0Q B;  3ZBD A;  5GAO n;  2ZPF B;  3EG1 A;  1D3B A;  2DZC A;  2XMF A;  1UHC A;  3QDR B;  3M0P A;  2CKK A;  1ZSZ A;  2Z0W A;  5AYF A;  3C94 A;  2CUD A;  4M75 E;  4XTV A;  1N8R R;  2ZCF B;  2RNA A;  1J3T A;  5A2Q E;  1MV0 B;  1N27 A;  1VUB A;  1O9S A;  3WVD B;  1RAG B;  3DB3 A;  5KE2 A;  1UGV A;  3VUZ A;  3OW2 S;  1VQO A;  1S1N A;  4KT0 E;  1ZBJ A;  3M59 A;  5HY6 A;  2A36 A;  2DRK A;  5LJ3 j;  2ABL A;  4XTX A;  4JJB A;  2X4X A;  4AG1 C;  3PMT A;  5FRO A;  2MAM A;  2DVJ A;  1TOV A;  4D6W A;  3H9N A;  4JJN K;  5HK3 A;  4AG2 C;  2HEQ A;  5CIU A;  4M75 C;  3KBG A;  1X27 A;  4M75 F;  4DEY A;  1I0C A;  1QP3 A;  3QWX X;  4OB0 B;  1AOJ A;  3SEM A;  4DQ2 A;  4C92 F;  3ME9 A;  3BY7 A;  1OU8 A;  1GCQ C;  4ZNX A;  3OBY A;  2XIC A;  1NEG A;  3L2Q A;  3CD6 A;  3FDR A;  2EKO A;  1WQW A;  4BE0 A;  5LJ5 f;  1VQ7 A;  5DLO A;  3MEA A;  2DIG A;  4LD6 A;  2RQU A;  4XU1 A;  2KE9 A;  4HVW A;  1N9R A;  2MF2 A;  4M75 B;  1VQ6 Q;  2LJ1 A;  1T3S A;  3Q1J A;  2EYW A;  4XU0 A;  1NZ9 A;  1TH7 A;  1OZ3 A;  1JU5 C;  1UB4 A;  1GRI A;  4J6W A;  4C92 B;  1VQ4 A;  1G3W A;  4RCC A;  1X75 C;  4CC4 B;  3MPU B;  2EQM A;  1D0Y A;  2DL8 A;  3CXC P;  1Q82 R;  4IIM A;  2M16 A;  1F1B B;  4RTU A;  1H3Z A;  2EQJ A;  2LC4 A;  4N0A A;  5GAN 8;  2RB6 A;  2MK5 A;  3L1A A;  1H92 A;  4WTO B;  2COW A;  3R6O A;  5I11 A;  1R0B G;  1MUZ A;  2RHY A;  5LJ3 h;  1XNI A;  2JS2 A;  2K3X A;  3HKS A;  4L5G A;  5CQX A;  1NE8 A;  3H8Z A;  3EH1 A;  5KYW A;  3SB2 A;  2O9S A;  2XID A;  4JRI A;  2I0N A;  5LJ3 e;  3FB9 A;  3ZEH A;  1WFW A;  1PRL C;  2LDM A;  1UEC A;  4JZ4 A;  2KRM A;  2OJ2 A;  5EG2 A;  2R5A A;  4HXJ A;  4M78 F;  4R0K A;  2MI6 A;  1YFN A;  3HRU A;  4R56 A;  1WXT A;  2A08 A;  5D6Y A;  2DIL A;  1A0N B;  5CCA A;  2L89 A;  2DM1 A;  1D0Z A;  4F7U A;  1WHL A;  4Z02 A;  4EMH A;  3CCJ Q;  1QWE A;  5LL6 S;  5FRM A;  3HPW A;  1KHI A;  2KYM A;  1WJQ A;  4MZP A;  1GFC A;  3NTH A;  3G6E T;  3I56 T;  3JB9 F;  4KH1 B;  1N9S A;  4M77 G;  1X43 A;  4M78 B;  1OPL A;  2FPD A;  1YIJ Q;  4OP0 A;  2DE0 X;  2OAW A;  1K9A A;  4RTW A;  2DXB A;  1YI2 A;  2OTJ T;  5GJV B;  3OYB A;  2LTO A;  3UA7 A;  3L2V A;  2RH2 A;  2DL4 A;  3D7S B;  4PK4 A;  2QK0 A;  4F14 A;  2HZY A;  3PVQ A;  4M77 A;  1NJI U;  2K3Y A;  1E6H A;  1JBM A;  3WXM B;  1PKS A;  3OYJ A;  2QYZ A;  3CBO A;  2DTO A;  1WA7 A;  3OW2 A;  5GAN f;  2PUO B;  2E12 A;  1PKT A;  3H0I A;  1VQ5 T;  1QVF S;  3QSU A;  3RKX A;  2LP5 A;  1UGP B;  4X1V A;  2EKH A;  4EPC A;  4FL6 A;  3AT1 B;  1K9M U;  4FW1 A;  1VOM A;  4M7D D;  3GNG A;  4OB3 B;  2C06 A;  1AEY A;  4ZTF A;  1TS9 A;  3U23 A;  3VS6 A;  4WF2 A;  4QVC A;  5C0M A;  2RN8 A;  2NYS A;  1VIF A;  2RQV A;  2VXF A;  1UGQ B;  3TRE A;  5LJ5 d;  3N5B B;  1BB9 A;  4JRK A;  2OI3 A;  3QXE B;  1OI1 A;  4C92 G;  1BK2 A;  1M1F A;  2YRV A;  2K4Y A;  4LD9 K;  4MZT A;  3TSZ A;  3I55 T;  1T0J A;  3EGD A;  3CC2 T;  1OPK A;  3QZ9 B;  4OB1 B;  3RES A;  2L3R A;  3VU3 C;  2EW3 A;  4MMK A;  2H3J A;  2V8J A;  3MEV A;  1NJI C;  4J83 A;  3P8D A;  1DJ7 B;  2KQW A;  2ATC B;  2LT4 A;  2HBW A;  4DBH A;  4D8D A;  5I21 A;  4C92 A;  5C6S A;  3OSS C;  3H0F A;  1G3Y A;  1GCQ A;  3OS0 A;  2CT4 A;  4OMN A;  4Z8A A;  1VQK Q;  4RTX A;  4Y91 A;  3G71 Q;  1U1T A;  3RNJ A;  1VQ6 A;  3UF4 A;  1K9M C;  4LNP A;  2BTT A;  2HQE A;  3CCS Q;  1ZQ1 A;  1VQP Q;  5A0G A;  3RMS A;  2P4T A;  2OTL Q;  2LX7 A;  2QG9 B;  2FL7 A;  4WCI A;  1YJW Q;  1CSK A;  5DY9 A;  2CH4 A;  2J06 A;  3CCV A;  4KBM B;  1VQ5 Q;  1QLY A;  5GAM f;  2E5Q A;  3X26 B;  2ZPE B;  5LJ3 g;  4BI8 B;  5GAN 2;  1OEB A;  2HMA A;  1AZE A;  2R58 A;  1Z9Z A;  1GCP A;  1UUE A;  2BZ8 A;  4B6M A;  2FRY A;  4IKF A;  1QVG P;  4QQG A;  4OVA A;  1C6V X;  5GAN 3;  3CCU T;  2A28 A;  1ZA2 B;  1HYO A;  2RD1 A;  2HNI A;  2KRN A;  2PNI A;  1JJ2 S;  4M78 G;  2JJ9 A;  4RTT A;  2I2L A;  1RI9 A;  4GBQ A;  3LGF A;  1ZUY A;  1VQ9 T;  3I55 Q;  3EG9 B;  2F1L A;  5IAY A;  3OYC A;  1RUW A;  1TUC A;  4KUL A;  3RKY A;  4F04 B;  4HCZ A;  1UJY A;  2NUT B;  6AT1 B;  2JUF A;  1Q7Y C;  3EHQ A;  4M78 A;  3CCJ A;  2JM8 A;  3VS0 A;  1VQN Q;  1GXI E;  3JB9 G;  2EAY A;  2K3B A;  5L23 A;  2L5Q A;  1YCY A;  2LCL A;  2HSE B;  3VS7 A;  5GAN 5;  1RAH B;  1D1C A;  1YJN T;  1YIT Q;  2JZ2 A;  2DET A;  4E7K A;  2LVM A;  1YIJ A;  1FWZ A;  3GOX A;  1LJO A;  2J05 A;  2HDA A;  3JCM V;  2DL5 A;  1B34 B;  2M51 A;  3A8H B;  4BB7 A;  1VQM T;  1BI1 A;  1D1B A;  1RAE B;  2H8H A;  3H0H A;  1M1K C;  1S72 T;  2LNH B;  2MWO A;  3SWN C;  4QVD A;  4LE9 A;  1VQ8 T;  4VUB A;  3SDZ A;  4RTZ A;  4LDX A;  2MOX A;  2ECZ A;  2EQU A;  1QVF A;  4GY5 A;  5HCK A;  2E5K A;  1ZX6 A;  2DEU A;  2BE9 B;  4GLK A;  3OYD A;  3CPW S;  4J9E A;  2HCK A;  1Q86 U;  1TUD A;  5IHN A;  4PKC C;  2YUP A;  5GMK j;  1SG5 A;  1KQS P;  4P5N A;  1M2V B;  3RMQ A;  2QXF A;  3CCU Q;  5GAO r;  2QI2 A;  3CCM T;  1IRE B;  4N4G A;  2P0Q A;  1UHF A;  3J80 E;  5FRN A;  2RA2 A;  3SWN B;  2V26 A;  2COZ A;  1YJ9 A;  1SRM A;  1VQ9 Q;  1PRM C;  5GAO l;  4ZGD B;  3J81 E;  3UPU A;  4EMK C;  2ROL A;  1KC8 R;  3PT9 A;  2ENM A;  2HQX A;  2DVE A;  4Z88 A;  4C5E A;  2V1R A;  3L2Z A;  3M0U A;  4CRI A;  3NHN A;  2FHD A;  4J6Y A;  2KBT A;  1ACM B;  3GIB A;  2LJ3 A;  1W2B P;  2CZ1 B;  2WSE E;  2K5I A;  4ELY C;  2Y90 A;  1RAB B;  4C5I A;  4DOW A;  2KYB A;  2O2O A;  5FW9 A;  2KRO A;  1SSH A;  3JCM f;  2AHJ B;  4NL2 A;  2DTH A;  4EMK B;  3CME T;  2YXY A;  1VQM Q;  5GAM d;  2CP0 A;  3KUF A;  2D8J A;  2RHI A;  4A63 B;  2DIQ A;  1VQK A;  4B9X A;  3G71 A;  4J5Y A;  1Y07 A;  4QQ6 A;  2JTM A;  3CCS A;  5FLX E;  1VQP A;  3HFN A;  1YCS B;  2JM9 A;  3ZFJ A;  2JS0 A;  2DPP B;  2OTL A;  3SFM A;  4JJC A;  3OSV A;  2YRC A;  1IZ6 A;  1UGS B;  1YJW A;  5LJ5 h;  3CCE T;  4Y92 A;  5CKD A;  4ZGJ B;  1VQ5 A;  1BI2 A;  1WHM A;  3MEU A;  1MMG A;  1AWJ A;  2IIM A;  2VB6 A;  1QCN A;  4PL6 A;  2YSQ A;  2SRC A;  5LJ5 e;  5KCH A;  1M3C A;  3LH0 A;  1K8A R;  3C0C A;  4X9D A;  3EH2 A;  5CKH A;  3OYG A;  2CSQ A;  1Q95 G;  2FEI A;  4OGC A;  4MZM A;  1SKU B;  4IUU A;  2DJQ A;  3OYH A;  3KFV A;  3ASK A;  3OYF A;  1JJ2 A;  4M77 D;  3G1J A;  3P8H A;  3EG9 A;  3QYH B;  2E6N A;  3PMI A;  2DZ9 A;  5KCO A;  3I5S A;  2NUT A;  4N4I A;  4E47 A;  2CSI A;  4C0D C;  2PU9 B;  3CBP A;  3HTR A;  1U06 A;  3O5Z A;  4OMM A;  3VS2 A;  3NTK A;  1UJ0 A;  5GAO q;  1N6A A;  5FU7 B;  4YTL A;  3JAM E;  4FIB A;  1KIK A;  4ZTJ A;  2DFU A;  4L6V 5;  4HT9 A;  2DAQ A;  3M57 A;  2F5K A;  4QVZ A;  2GTJ A;  3A5Z B;  3URG A;  2VVK A;  2CYZ B;  4JPB W;  1X6G A;  1VQN A;  3S3N A;  3UA6 A;  1B34 A;  1YHQ Q;  2CZ0 B;  2D8H A;  3MP1 A;  4C0D B;  1AWW A;  2MPX C;  1YIT A;  1WHK A;  4BE1 A;  3I9Q A;  4X9C A;  3S3M A;  1IXD A;  3IQL A;  3JCM J;  3CCE Q;  1XJW B;  2OX7 A;  4BDZ A;  1C1A A;  1WQ7 A;  3THK A;  3L2U A;  3VS3 A;  3QHS A;  3MP8 A;  3JB9 H;  2XD0 A;  1WHG A;  3JSC A;  2IPO B;  3CPW A;  1M30 A;  1JO8 A;  1FMW A;  2XG8 D;  5KE3 A;  3OMC A;  1M2V A;  2O4X B;  4C8Q E;  1ABQ A;  2K9G A;  2NUZ A;  1OOT A;  2DRM A;  3FJP A;  2LQ8 A;  4IUR A;  2DA9 A;  1M8V A;  1YP5 A;  2Y4Y A;  3E1S A;  5KH6 A;  1CKB A;  2QA4 A;  4PJN A;  2B8A A;  1JB0 E;  4HA8 A;  2M0Y A;  3OYA A;  2O9V A;  3CCU A;  1PM3 A;  5IHI A;  3ULR B;  2PZ1 A;  3VRZ A;  2KEA A;  4LN2 A;  1P92 A;  3UWN A;  4JS4 A;  2QDY B;  1VQ9 A;  3CQT A;  5CKB A;  4C8Q D;  5GAN h;  2FB7 A;  3JCM d;  2JTE A;  1M90 U;  1NBE B;  5D6W A;  4DBF A;  4PJO D;  2P84 A;  4C8Q C;  2HBP A;  2EYY A;  4C8Q F;  2K79 A;  5GAN 4;  2CP7 A;  4EMK A;  1Q81 C;  1NLO C;  5GMK m;  1RAA B;  2J6F A;  4JLI A;  3OYN A;  3VKI A;  2JXB A;  2GCX A;  4E7L A;  4F7U G;  2KY9 A;  1BCO A;  1WLP B;  2A3L A;  1RAD B;  5IN1 A;  2HKQ B;  1SPK A;  1VQM A;  2HKN A;  2XU8 A;  2DL7 A;  2DJZ A;  4C8Q B;  1MND A;  1AVZ C;  3CXC S;  2GF7 A;  5LJ5 g;  3MJX A;  3H41 A;  2K2M A;  3S6W A;  4UC4 A;  1N8R U;  1Z9Q A;  2DYB A;  2QGF B;  3OBW A;  3PVL A;  2M1H A;  4DBR A;  1NEB A;  1SEM A;  5D6X A;  2YHT A;  3GP8 A;  3VUB A;  4AFS C;  2F2W A;  1M90 C;  1YWP A;  3V8J A;  5CO7 A;  2RHU A;  1AWX A;  1QKX A;  2AKL A;  1KD1 R;  1WDX A;  1T3L A;  4L59 A;  2FVU A;  2L8D A;  2GFA A;  2KVQ G;  2VWF A;  5AT1 B;  3BDU A;  2J6K A;  2A0F B;  1I81 A;  4M7D E;  1IRX A;  2JVV A;  3WVE B;  3M4Y A;  5GAM h;  1WZO A;  3X24 B;  3FJ5 A;  3OS2 A;  4ELZ C;  1V76 A;  1K73 R;  1X01 A;  1NG2 A;  2LNV A;  1JXO A;  2MWP A;  3CC7 T;  2JMC A;  5GAM e;  3DLM A;  2MMP A;  2VKN A;  1W4S A;  1R0C B;  2K6D A;  3G4S T;  4MML A;  1WX6 A;  3GNF B;  2B86 A;  1N8R C;  4BI4 A;  1W70 A;  2VC8 A;  1W6X A;  2DXU A;  2VGN A;  3GLX A;  1BIA A;  3M0R A;  2YUO A;  4EIK A;  2XKO C;  2CP2 A;  4M7D C;  4OGE A;  3SHW A;  4M7D F;  1WIE A;  1YHQ A;  4LDW A;  3PNW C;  4BDY A;  2F5T X;  4M75 G;  2CP3 A;  2O01 E;  5LJ3 f;  4XK8 E;  1X2Q A;  1VQL T;  2LT1 A;  1HSQ A;  1MHN A;  3REB B;  3FEO A;  1KQ1 A;  4ORZ A;  2O4X A;  2RMO A;  1MMD A;  4NL3 A;  3UT1 A;  1LPL A;  1RLQ C;  2XDD A;  3X28 B;  3G6E Q;  3I56 Q;  3A1P A;  4PLL A;  1XTD A;  2EWN A;  4M75 A;  2RJF A;  1ZA1 B;  3H6Z A;  4A4G A;  4M7D B;  2RI2 A;  4XTU A;  1HJD A;  4FM4 B;  2OTJ Q;  1RL2 A;  2ZPH B;  1IO6 A;  3E9F A;  4E7J A;  4ANJ A;  4M7A E;  1Q86 R;  1G3S A;  1LCK A;  2KDS A;  3RR6 A;  2L3S A;  4D8K A;  2XHC A;  1VQO T;  4JRQ A;  2KT8 A;  1K0S A;  1MV3 A;  1Y71 A;  3CC4 T;  4J9I A;  2O88 A;  2ZPI B;  1G83 A;  1Q7Y U;  1N5Z A;  2QAS A;  3TEE A;  2X4J A;  1UGR B;  2QQ9 A;  2E65 A;  1WNL A;  2QTX A;  2GFU A;  3HFO A;  2PTK A;  5L8R E;  2RK2 A;  2QQA A;  2CGH A;  1TWB A;  3NTI A;  1NLP C;  1Q82 C;  2D9T A;  3J7A F;  4M7A D;  1Y96 B;  3RBB B;  2EGA A;  4PNO A;  2DK3 A;  3VYG A;  3QYG B;  4A4K A;  4M7A C;  3EFS A;  1PC0 A;  4FYY B;  3PIO A;  4Z89 A;  4PLI A;  5A0D A;  4OMP A;  2ED1 A;  1K4U S;  1M1K U;  1WHJ A;  1EX4 A;  4F17 A;  3CD6 T;  3BFM A;  2DO3 A;  4O6J A;  3JV3 A;  5KYN A;  5HK0 A;  3CXC A;  4AFU C;  1VQ7 T;  1ZSZ C;  4KRT A;  4LDV A;  3QII A;  2PVG B;  2QDL A;  2X35 A;  1ZBX A;  1GBR A;  3PE0 A;  3CC2 Q;  2EYQ A;  4RTY A;  2BZX A;  2C0O A;  3TVT A;  2RF0 A;  1VQ4 T;  2AT1 B;  2FZG B;  3QZ5 B;  1MMN A;  3JCM h;  1ZUK A;  1KQ2 A; 
#chains in the Genus database with same CATH homology
 5FWC A;  1YCS B;  2AKK A;  2JM9 A;  4OMO A;  1JU5 C;  2JS0 A;  2CDT A;  1GRI A;  2KR3 A;  3VRY A;  1H8K A;  4JJC A;  1WXU A;  4J9D A;  4RTV A;  2DX1 A;  4Y92 A;  2EQI A;  4CC4 B;  2MIO A;  2DL8 A;  4IIM A;  4F16 A;  2SEM A;  4RTU A;  1AWJ A;  2IIM A;  2YSQ A;  2SRC A;  3NGP A;  4HVU A;  1M3C A;  1WXB A;  1YNZ A;  3C0C A;  2EBP A;  1H92 A;  2CSQ A;  2FEI A;  3I5R A;  5I11 A;  1MUZ A;  2DJQ A;  3KFV A;  2JS2 A;  2D0N A;  2D1X A;  1M8M A;  2O9S A;  4RUG A;  4IIO A;  2I0N A;  3QWY A;  2KRS A;  1WFW A;  3I5S A;  2RQR A;  2CSI A;  1PRL C;  1K1Z A;  1RLP C;  1UEC A;  2DLP A;  1U06 A;  2G6F X;  3O5Z A;  4JZ4 A;  4OMM A;  1X69 A;  2GBQ A;  2KRM A;  2OJ2 A;  5FWB A;  3VS2 A;  1UJ0 A;  1NM7 A;  4HXJ A;  4R0K A;  1KIK A;  4E6R A;  4AFZ C;  1WXT A;  2A08 A;  2DIL A;  1A0N B;  1FYN A;  2GTJ A;  4DEX A;  1HD3 A;  2DM1 A;  1U5S A;  2JT4 A;  2RPN A;  1M27 C;  2VVK A;  2O31 A;  4JPB W;  1X6G A;  1QWE A;  3VS5 A;  1ZUU A;  1GL5 A;  1JEG A;  3TSW A;  3UA6 A;  2L2P A;  1QCF A;  2D8H A;  2KYM A;  1AWW A;  1GFC A;  3I9Q A;  2JMA A;  1X43 A;  3IQL A;  1OPL A;  2FPD A;  2KNB B;  1X2K A;  2AZV A;  1GFD A;  2EYZ A;  2DE0 X;  2OAW A;  1K9A A;  2GGR A;  3THK A;  4RTW A;  3VS3 A;  1ARK A;  1M3A A;  2CUB A;  3R6N A;  5GJV B;  1AWO A;  1M30 A;  1JO8 A;  4HCK A;  1PWT A;  1M3B A;  1QKW A;  1KFZ A;  3UA7 A;  1JXM A;  1PNJ A;  2DL4 A;  3REA B;  1I07 A;  4F14 A;  2KGT A;  1ABQ A;  1UE9 A;  3PVQ A;  4GLM A;  2EYX A;  2K9G A;  1E6H A;  2NUZ A;  1OOT A;  1T0H A;  2DRM A;  1PKS A;  1WA7 A;  2DA9 A;  5ECA A;  4J9C A;  5IH2 A;  1YP5 A;  1CKB A;  1ABO A;  1PKT A;  3H0I A;  1BBZ A;  2M0Y A;  4LUE A;  2LP5 A;  4X1V A;  2O9V A;  2EKH A;  3EHR A;  1ZLM A;  2X3W D;  5IHI A;  3ULR B;  2PZ1 A;  2EPD A;  3VRZ A;  1WI7 A;  2ED0 A;  2KEA A;  4LN2 A;  1E7O A;  3CQT A;  2GTO A;  1TG0 A;  1AEY A;  2LZ6 B;  2J7I A;  3U23 A;  3VS6 A;  2JTE A;  2LJ0 A;  1PHT A;  2CT3 A;  2RN8 A;  2EYY A;  2RQV A;  1SHG A;  2EVR A;  2K79 A;  1BB9 A;  2DF6 A;  2FPE A;  2CH4 W;  2OI3 A;  3VS1 A;  1CKA A;  1NLO C;  1K0X A;  4OMQ A;  1BK2 A;  2J6F A;  3TSZ A;  1T0J A;  2JXB A;  1WYX A;  2F2X A;  1VA7 A;  1SHF A;  1OPK A;  2F2V A;  2V1Q A;  2L3Q A;  1SRL A;  2EW3 A;  1WLP B;  3NPF A;  2KT1 A;  1SPK A;  2AZS A;  1VYV A;  2HBW A;  2DL7 A;  4D8D A;  1KJW A;  1UDL A;  1B3Q A;  1AVZ C;  4K11 A;  2L0A A;  1Y57 A;  3H0F A;  1GCQ A;  3H41 A;  3VS4 A;  2K2M A;  2CT4 A;  4OMN A;  4Z8A A;  4RTX A;  1Z9Q A;  2DYB A;  3RNJ A;  1KSW A;  3EGU A;  3UF4 A;  4LNP A;  2BTT A;  2FO0 A;  1V1C A;  2YUQ A;  1EFN A;  1OV3 A;  2W0Z A;  5I22 A;  3PVL A;  2LX7 A;  1NEB A;  1SEM A;  4JZ3 A;  4WCI A;  4ESR A;  1CSK A;  4J9H A;  2CH4 A;  3EG0 A;  2J06 A;  4AFS C;  3LH5 A;  1QLY A;  2F2W A;  1YWP A;  1AWX A;  1OEB A;  1QKX A;  1BU1 A;  2ESW A;  2ROT A;  1AZE A;  5IXF A;  2AKL A;  2J6O A;  4OML A;  3M0T A;  1H3H A;  1WDX A;  1Z9Z A;  2C0T A;  1T3L A;  1GCP A;  2EGC A;  1UUE A;  2BZ8 A;  2MCN A;  1AZG B;  4CC2 A;  2C0I A;  2VWF A;  2FRY A;  1I1J A;  2P4R A;  2J6K A;  4CC3 A;  4LUD A;  2W10 A;  1VYU A;  1QWF A;  1B07 A;  2DNU A;  2AK5 A;  2DMO A;  3M0Q A;  3FJ5 A;  1ZSG A;  5IXB A;  1NG2 A;  2A28 A;  1JXO A;  4JJD A;  4FSS A;  1UTI A;  2JMC A;  2KRN A;  2PNI A;  2VKN A;  4RTT A;  2YT6 A;  2HSP A;  1RI9 A;  2GNC A;  4GBQ A;  2K6D A;  5GJW B;  1ZUY A;  1WX6 A;  2B86 A;  1W70 A;  1RUW A;  2FG0 A;  1W6X A;  1TUC A;  1YWO A;  3GBQ A;  3M0R A;  1UJY A;  4QT7 A;  4CC7 A;  1JQQ A;  5IHK A;  2YUO A;  3EG3 A;  4EIK A;  3EHQ A;  2RQT A;  1UG1 A;  3SHW A;  2JM8 A;  3VS0 A;  1WIE A;  4J9F A;  4M4Z A;  3NMZ C;  2K3B A;  5L23 A;  1U3O A;  3VS7 A;  1X2Q A;  1E6G A;  1HSQ A;  3REB B;  2LMJ A;  2K7A A;  1YN8 A;  4AFQ C;  1W1F A;  3M0S A;  4ORZ A;  5EC7 A;  2RMO A;  2J05 A;  2HDA A;  1RLQ C;  2DL5 A;  1UFF A;  2LQN A;  2M51 A;  1Y0M A;  2FRW A;  1XOV A;  2H8H A;  3H0H A;  1AD5 A;  2LNH B;  2YDL A;  4LE9 A;  4RTZ A;  3ZL7 C;  2LQW A;  2MOX A;  2ECZ A;  1HJD A;  5HCK A;  2DBK A;  3EG1 A;  2XMF A;  1NYF A;  2E5K A;  1UHC A;  1ZX6 A;  1IO6 A;  3M0P A;  3A98 A;  2CRE A;  4J9E A;  2HCK A;  1TUD A;  5IHN A;  1LCK A;  2CUD A;  2NWM A;  2L3S A;  2RNA A;  2YUP A;  4D8K A;  1J3T A;  2BZY A;  2KT8 A;  1K0S A;  1MV3 A;  1MV0 B;  4J9I A;  2O88 A;  1G83 A;  1N5Z A;  1UGV A;  2LCS A;  2X3X D;  1S1N A;  1UHF A;  2A37 A;  1ZBJ A;  2KXD A;  2PTK A;  3EG2 A;  3I35 A;  1SRM A;  2A36 A;  1PRM C;  2DRK A;  2YUN A;  2ABL A;  2ROL A;  1NLP C;  2ENM A;  1FMK A;  4JJB A;  4Z88 A;  4AG1 C;  2V1R A;  3M0U A;  3RBB B;  4J9G A;  2JW4 A;  2EGA A;  2KXC A;  3NHN A;  2DVJ A;  2KBT A;  4J9B A;  1K76 A;  2GQI A;  2EGE A;  2LJ3 A;  4AG2 C;  2HEQ A;  1NYG A;  1X6B A;  4Z89 A;  4OMP A;  1X27 A;  2ED1 A;  1K4U S;  4DEY A;  1I0C A;  4F17 A;  3QWX X;  2KYB A;  2L3P A;  1AOJ A;  3JV3 A;  3SEM A;  3UAT A;  2O2O A;  5FW9 A;  2KRO A;  1SSH A;  4AFU C;  4HVV A;  1GCQ C;  4ZNX A;  2DL3 A;  4KRT A;  2FPF A;  1NEG A;  2QDL A;  1GBR A;  3PE0 A;  1GBQ A;  1G2B A;  4RTY A;  2DBM A;  2D8J A;  2RQU A;  4A63 B;  2BZX A;  2C0O A;  2KE9 A;  3TVT A;  1VYT A;  4HVW A;  2RF0 A;  2RQW A;  2LJ1 A;  1T3S A;  1ZUK A;  2EYW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...