1TH7A

Crystal structure of an archaeal sm protein from sulfolobus solfataricus
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
78
structure length
78
Chain Sequence
GAMNFLAETAHKVLAESLNNLVLVKLKGNKEVRGMLRSYDQHMNLVLSDSEEIQSDGSGKKLGTIVIRGDNVILISPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an archaeal Sm protein from Sulfolobus solfataricus
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Rna binding protein
molecule keywords Small nuclear riboprotein protein
total genus 16
structure length 78
sequence length 78
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature
pdb deposition date 2004-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1th7A00
5GANg 1N9SA 4XU1A 5GAN3 1LOJA 5GAN4 5GAOm 4M77F 4M78C 4XU0A 3SB2A 2DTOA 3JCMe 2DEQA 3BY7A 3L1AA 4X9CA 1X01A 4EMKA 3JCMX 4PJOG 3HSBA 4M78G 1JRIA 3RKWA 3JCMP 1JBMA 1LJOA 2FB7A 4M75D 2E41A 4M78B 5LJ3e 5GAMg 5GAOp 4X9DA 2ZGWA 2RM4A 4XTXA 3SWNB 5GMKi 3JCMd 3RUXA 2EJGA 2YHTA 4C8QA 5DY9A 2E10A 4M77E 4C92E 2DTIA 5GAMe 4XU2A 2DXUA 4NL3A 3FB9A 4F7UB 3GIBA 2QTXA 4M7AE 2DKGA 3SWNC 4C92F 1TH7A 4MMLA 4WF2A 2DZ9A 4Y91A 5LJ3j 3RERA 4DQ2A 3BW1A 1I81A 4M75B 5GMKh 1BIAA 4M7DD 5GANh 1Y96A 1YCYA 2YLCA 3M4GA 1MGQA 4M75C 3JCMQ 4M7AA 5GAN2 1M5Q1 4M75F 3RKXA 4NOYA 5GMKm 2VXEA 5GANe 5GAMf 1M8VA 4M75A 3V7CA 2RA2A 4C92C 2E65A 5GMKj 2EJ9A 3FJPA 4M7AB 4PJOC 2HNIA 3HFOA 4C92B 5LJ3h 3SWNA 1N9RA 4MMKA 1KQ2A 5LJ3g 1WQ7A 3PGGA 4C8QD 4M7DB 5GAMh 1I5LA 1H641 1HXDA 4PJOF 4HA8A 4XQ3A 3RIRA 5GMKe 5LJ3d 4M78E 4M77D 4XU3A 3V8KA 3AHUA 3JB9D 4M78A 3QSUA 4M7DA 3JCMW 3QUIA 4A53A 3V8LA 3BFMA 5LJ5e 1Y96B 2YLBA 1WQWA 1D3BA 2DXTA 3EFSA 4F7UA 5GAOr 2K57A 4C92A 4M7AD 2JN0A 3JCMJ 5LJ5h 4M77C 3JCMf 5LJ5g 4J6WA 4C8QB 3INZA 4XTWA 5GAMj 4HT8A 1B34B 4C8QF 4M77G 4RCBA 1U1TA 3BDUA 4RCCA 4F7UE 4M77A 5LJ3f 3JB9I 4M77B 4F7UF 5GAOn 4EMGA 5LJ5j 5GAN8 3JCMc 2DVEA 4C8QE 4C92G 4M7DF 4OP0A 4C8QG 3V8JA 3QHSA 3JB9H 1WPYA 3RESA 2DTHA 5LJ5f 1LNXA 3QO3A 1KQ1A 4A54A 5GAN6 4PJOD 4PJOA 2EWNA 4EMHA 5CAIA 4N0AC 3VU3C 5I21A 5GANd 3JB9J 4PNOA 2VXFA 4QVCA 2VC8A 4M7DG 1I8FA 3EFRA 4M78F 5GAN7 4XTYA 4M7DE 2Y90A 3FIFA 2E1HA 4N0AA 4XTZA 4C92D 3JCMb 3V7RA 4J6XA 2EAYA 2RB6A 5GANf 1WNLA 4QVDA 1B34A 3JCMh 3RKYA 4EMKB 2DJZA 5LJ5d 3JB9G 4PJOB 4M7AC 4M75G 4XTVA 1I4K1 4JRKA 4J5YA 2RD1A 5GMKl 2E64A 1D3BB 4XTUA 5GAN5 1BIBA 4JLIA 4M7AG 4EMKC 4V2SA 4NL2A 5GAOq 4J6YA 3JB9F 4M75E 2EJFA 4JRIA 5GANj 4M7DC 3V7SA 2I2LA 2FYKA 4M7AF 3L2ZA 4M78D 4HT9A 4PJOE 3HFNA 5GAMd 3JCMV 1HK9A 1U1SA 5GAOl 4C8QC 2DZCA 2CGHA 3JCMg 4F7UG 4JUVA
chains in the Genus database with same CATH superfamily
1XQHA 1MMAA 2FHDA 2O9SA 5IH2A 2FVUA 5IXBA 1Y07A 1Q82R 1ZUUA 3CXCP 3RKWA 2E12A 1SRMA 1YJ9Q 2EGEA 3QWXX 3RUXA 2O9VA 5KYYA 5DY9A 2KEAA 1ZSZA 2GQVA 3DKMA 2HQXA 3A8LB 2JNGA 1NM7A 3QZ5B 1G3WA 4FL6A 4FT2A 2L5QA 5GMKm 1WI7A 1M8VA 2R57A 2CP3A 4HXJA 3UPUA 2RA2A 1VQOQ 1VQKQ 3MP8A 4DBFA 1QVGS 2H8HA 1K0SA 1QVFP 1KFZA 4CC3A 4M7DB 1M1KU 2DNUA 5KYNA 4HVUA 4HA8A 4ME7A 2NYSA 3UF4A 2JVVA 2RK2A 1BCMA 2M51A 4MDWA 2E4HA 5LJ5h 4A4EA 1EX4A 3VUZA 2QGGA 1FX7A 2XI9A 1Y71A 3BDUA 2KNBB 4C8QG 2EYZA 3RESA 1Z9ZA 2QA4Q 2EQKA 5CAIA 1LPLA 4DBRA 4II1A 1K73R 2PVDB 4KH0B 1G8XA 2OAWA 3NTIA 3CCVT 2GFUA 5DLQE 1TWBA 2LRQA 4FSSA 2J6FA 3OBWA 1BK2A 5CR2A 2RD1A 3OW2A 3OYMA 2X9HA 5FROA 4Z89A 3M59A 2JS0A 4M7AF 3JCMV 5GAOl 2CP0A 5GMKe 1V29B 4JUVA 5GANg 5LL6S 1WDXA 2P0QA 3URGA 4N4GA 2DETA 3CCRA 2VUBA 2SEMA 3CC2Q 2FO0A 1K76A 4C5GA 4OGEA 3CC4T 2K9GA 1M90U 1IB8A 3JCMd 1W70A 2YHTA 3QYGB 2K5FA 1U8RA 2NUPA 1X69A 4F14A 3CC7Q 2DZ9A 3A8MB 4AT1B 3QJYA 2OI3A 1VQ7T 2OTJA 5GAN2 3VUBA 5GAMf 5FLXE 1M30A 4JPBW 3CCJT 1B3QA 1QW1A 2KXCA 5GAMh 4PFZA 3S3MA 2OTJT 3FJ5A 3VJPA 1HYOA 2CP6A 3MJXA 3L42A 1OZ2A 2EQJA 3MEVA 2CDTA 2QYZA 2DXBA 2RJFA 2DLPA 2QEXT 4M77G 1QVGP 1W1FA 3FEOA 4KGZB 2AZSA 3CC2A 2K5LA 2V26A 2LDMA 4ZGJB 1YFNA 3H6ZA 4ZN3A 1Y7XA 3I5RA 3OYFA 3CCST 4AFZC 1H3ZA 4N4HA 4PJOD 2EWNA 5EC7A 4PJNA 2LCLA 5A0LA 1BCOA 3D7SB 4E7KA 1YITA 4PLLA 1AZEA 1A0NB 4N0AA 5D6WA 1ZUKA 4J6XA 2EAYA 2KMTA 2L3QA 1VYTA 3JCMh 3JB9G 4KBMB 1IGQA 2K5IA 4B9WA 1KD1C 3ER0A 2XDDA 4EMKC 2PQWA 3OSSC 2FYKA 2BIVA 3EG9B 5AT1B 4E2FB 3ZFJA 2HEQA 1UJ0A 4F7UG 1NLPC 2NUZA 2FZKB 4E7HA 2ENMA 2WSEE 1DJ7B 4EMKA 2KVQG 2MF2A 3OBYA 3OMCA 5GAMg 2ZPHB 4BUGA 2DIGA 3MHXA 5HKCA 1X2KA 4PJJA 2A7YA 1TUDA 1QQJA 3S6WA 3JV3A 4M75C 3OYHA 2VXEA 1R0CB 3TQ7P 2DIQA 2EQUA 2X51A 2KE9A 1KQSP 1I0CA 3OS5A 5LJ3h 4RTYA 2NUTB 1VIEA 1PD0A 1VQPQ 1VQLA 2B8AA 3VKIA 5A0GA 2DO3A 3RIRA 1D0ZA 3CCSA 2K7AA 1VQ4A 1YJWT 4Q5WA 1OYXA 2ROLA 2XDBA 3CEYA 4C92A 2EBPA 4F17A 3CBOA 3G6EA 3CC4A 3TREA 5GAMj 3NTHA 4C8QF 2DMOA 4JZ4A 2MWPA 4OP0A 4OB3B 1SEMA 3JSCA 5KYUB 2EGAA 4A4KA 1M4ZA 1YHQT 1K8AC 4FSXA 3OYKA 1IREB 4OMFB 3OYGA 4GBQA 2QA4T 1WNLA 2DJZA 1OU9A 1I4K1 3IQLA 3UWNA 4M7AG 2RMOA 3CCLA 1VQLQ 2QDLA 5CKBA 2HL3A 3E9FA 2I2LA 5GJVB 3LLRA 3MEAA 3CCSQ 2WSCE 3ZEHA 1MMNA 1VQLT 2E6NA 2R58A 3M0QA 2A08A 2CT4A 1MV0B 4L5GA 1WHMA 1WXTA 2L0AA 4AMCA 3VRYA 2F2XA 1S1NA 2P4RA 4Z02A 1UDLA 1ZSZC 2ZGWA 2AKLA 1G83A 1KD1R 5GJWB 2EPDA 2M0YA 3DB4A 3OW2S 3SWNC 3RERA 3PFSA 4J9HA 3JCMQ 3NFCA 3RKXA 2BE9B 2EQIA 2HKQB 2E3IA 5I11A 4E7LA 3CMEA 3OB9A 2K2MA 4ZN1A 4PJLA 2HBWA 1X27A 3V8LA 2H3JA 1WQWA 2G6FX 5GAOr 1N8RC 1SSFA 3R6OA 3OYLA 3G1JA 1YJ9A 1W6XA 3JB9I 3CPFA 3CD6T 3X28B 1NPRA 1WPYA 4OMPA 1VQ4T 1YJWA 2CSIA 1SKUB 3H0IA 5KYWB 3G71Q 2L3PA 2FPFA 2K3BA 2PZ1A 2Y90A 2DJQA 1AVZC 1O9SA 4JS4A 1RUWA 8AT1B 1NLOC 4O5VA 4LXCA 4HVVA 3QDFA 5GMKl 2E64A 4PLIA 3CMEQ 2DL5A 4M75E 1VQ6T 4PJMA 2X4JA 2JM8A 1PCXA 5CO7A 1PG5B 3VS0A 1PRMC 2BUDA 2EIFA 3JCMX 1R77A 2HDAA 2X4XA 1MV3A 2DVJA 2KSSA 2XHCA 5KYYB 1QCFA 1QKXA 3I5SA 2E10A 4M77E 5I22A 4NL3A 2YT6A 4F7UB 4OMOA 4FYVB 4BB7A 1VQNA 1C1AA 4M75B 3AT1B 4MDXA 1K73U 3LGFA 2HSEB 2V8JA 5IHIA 1IXDA 3M0SA 4M7AB 4E47A 2LQWA 4C92B 1KJWA 1M90C 3GLXA 1NJIC 2O4XA 3THKA 3WVEB 3I35A 1AZGB 1ZHIA 4FYXB 1M2OA 3QSUA 4F7UA 4JJNK 3ULRB 2KRSA 2JN0A 4WCIA 1VQMQ 2RQWA 4RTVA 1CKAA 1NYGA 2EKHA 3CCRQ 2X4WA 1WHGA 4EMGA 1T3LA 3V8JA 1OQKA 1KQ1A 3CCJQ 5CKHA 1Q86U 1M90R 5KH6A 3P8HA 3OYAA 3CC7A 1J3TA 2PTKA 2AZVA 3S3OA 1VQNQ 2F2VA 3J81E 2OTJQ 1G2BA 4FU6A 4HVWA 4C0FA 1NE8A 3QWYA 2DXCA 4EMKB 4M7AC 2AIRB 1U3OA 1K4US 1GL5A 2EW3A 1Q7YU 2CT3A 1GBQA 5C6SA 2EJFA 1PRLC 1RAGB 1S72A 4B6MA 4TVRA 1LOJA 4M77F 4J9CA 1VQMA 1ZSZB 2O88A 4E7IA 1RLQC 2HZYA 2XD0A 4X9DA 4A63B 1HSQA 2COZA 1S72T 2B86A 1KQSA 2JTFA 3VS1A 2VWFA 1OI1A 4C92E 3CCJA 1IHVA 3DLLA 3EH2A 2AK5A 1MMGA 2Y4YA 3DLMA 2XMFA 4M7DD 2JM9A 1KG1A 4DEXA 2O31A 2M0OA 4DOWA 4KUIA 4LUEA 1AWJA 1PSFA 5GMKj 4JJBA 3EFOB 5KYUA 1I5LA 1HXDA 2DL8A 1JEGA 4ZNXA 5FU7C 1IRXA 3GNGA 1TG0A 3UDCA 1XTDA 2LCSA 3AHUA 1M1KR 2DXTA 3MO8A 3NPFA 3JCMJ 2BE7D 2JTMA 3UA7A 2FL7A 2RJDA 1QP2A 4AG1C 1BYMA 2QTVA 2QXFA 1ZSGA 3OS0A 1UJYA 4CI0C 4R55A 3VU3C 4OMQA 2VXFA 3CPWP 1K9MC 1V76A 2GF7A 2E1HA 2K2VA 3OY9A 3VS5A 2DA9A 3RMSA 2DL4A 3CC2T 1Q86R 3ZL7C 2MOXA 5LJ5d 2HBPA 2JS2A 1OPKA 4BE0A 1VQPA 1MHNA 3QDRB 2V1RA 4LUDA 1EZZB 4EPCA 1K8AR 1D1BA 4EDUA 1WHKA 5IHKA 3M56A 2VYTA 1LJOA 1NYFA 3HL8A 4X34A 2JT4A 2DBMA 5FWCA 3SWNB 5GMKi 1PNJA 2J6KA 3FC3A 3C12A 1RAAB 1UGVA 1KK7A 3OW2P 4FYYB 4C92F 4LDXA 2LJ0A 4OMLA 3LX7A 3OA6A 2DF6A 2OTLQ 3OYJA 1KSWA 3QKJA 3E2UA 2DPPB 2NLUA 1T0HA 4NOYA 1OPLA 3QBYA 4C92C 4M4ZA 4KGVB 4FCYA 1E6GA 4FW1A 2LTOA 3PGGA 2KT1A 2ROTA 2RN8A 5D6YA 4JS5A 1H641 5LJ3d 4M78A 3L2RA 1IO6A 2QG9B 1BKBA 2RQRA 4A53A 3HKSA 2J6OA 2LC4A 1JQQA 2QAZA 1VA7A 2K4YA 3LGLA 3OSVA 1RAIB 1ZQ1A 3O8VA 3CCRT 1RLPC 1O75A 2L89A 2OTLA 2YUQA 2A37A 2YRVA 4C92D 3G4SA 2A36A 2JUFA 3PTAA 3L2WA 2EQMA 2COWA 1GFCA 1N5ZA 4UC4A 4BI3A 2YRCA 4OMNA 1BIBA 2D0NA 4JJCA 4J6YA 1UGQB 2KI7A 3E1SA 1WLPB 2CZ6B 3CD6Q 2FG0A 1I07A 3V7SA 4Z88A 1X6BA 3BDLA 5LJ5f 1M3BA 2RI3A 1YJNT 1N9SA 1UHCA 1VQOT 3C94A 3JCMe 2GQIA 2DILA 1WFWA 3VS6A 1K8AU 4XTXA 4EIKA 2KDSA 2A0FB 3M58A 1BU1A 1YJWQ 2O4XB 2QQBA 1M27C 1PKSA 1VQ8T 2RHZA 3META 3PVLA 1UGSB 3G71A 1M3CA 3X26B 5GANh 1YCYA 3G4SQ 4RG2A 3A8OB 5CCAA 4HCKA 3QIIA 1MNEA 5IN1A 3HHTB 1UGPB 1JO8A 1ARKA 2KQWA 1Q82C 1YHQQ 4YTLA 2PUKB 9ATCB 3CD6A 4HCBA 4CC4B 4CRIA 3V8KA 4LDUA 1FWZA 2KYMA 3SFMA 2KY9A 2W10A 2I0NA 6AT1B 4M7DG 3EG2A 2PNIA 1PWTA 3CCMQ 4DA4A 2ESWA 4M77A 5LJ3f 1BI3A 1C6VX 4M77B 3EG0A 1WXUA 5KE2A 3C4SA 3VS7A 3FLGA 4A54A 3SDZA 2K3XA 3EGXA 1NG2A 3VS4A 2K6DA 4OGCA 1T3SA 2DBKA 3EFRA 3M5AA 4M7DE 2KAFA 3LWHA 5J26A 3QXEB 1GCQC 1W4SA 2VVKA 3NMZC 4C5IA 3E9GA 4F04B 4J5YA 4HCZA 1VQ5Q 1QP3A 1YN8A 3U23A 4NL2A 4L6V5 1TUGB 2FRYA 3LH5A 4J9EA 5GANj 2D8HA 2KYBA 1HK9A 4J9GA 2VGMA 1AHJB 4XU0A 1AT1B 2X35A 3FRNA 1SRLA 1WYXA 2E3HA 3CCMA 4QT7A 4J7FA 3MEWA 3RMQA 1SHGA 3KXTA 3QG1A 2K79A 2KRMA 4XK8E 2HQEA 1KD1U 3OYCA 2AKKA 2ZPEB 1QVPA 2F5KA 1MNDA 5FW9A 2YUOA 4ELZC 1M1FA 1YI2Q 1M5Q1 3KUFA 3PVQA 2O01E 3PT9A 1RADB 1WIEA 5KYXA 2QQAA 2EJ9A 3FJPA 5FU7B 1R8OB 1VQ5A 3M54A 1SSHA 2RQUA 4OMMA 4BACA 4IIOA 2VGNA 1VQKT 1JJ2P 5CVIA 2BKDN 1S72Q 2LX7A 3CBPA 4IUTA 3JB9D 2PU9B 3O5ZA 2E5QA 5LJ5e 3CPWA 1Y96B 1D3BA 4P5NA 1M2VB 1BB9A 2COYA 4J6WA 4C8QB 4PK4A 3HRSA 1K0XA 4JLGA 1RI9A 1Q81C 5ECAA 5LJ5j 2J7IA 2L2PA 3TSWA 4OVAA 2IG0A 2FRWA 4N0AC 3GNFB 1PD1A 2VC8A 4MZMA 4NS5A 3EG1A 2QDYB 1BI1A 3JCMb 4J83A 4PL6A 4K11A 2BTTA 4QVDA 1B34A 4LD9K 2LMJA 4FYWB 2C0IA 3GP8A 4JRKA 5J39A 2DRMA 4J9IA 4GLMA 2RH2A 5L8RE 1JU5C 4HT9A 3HFNA 4VUBA 1XJWB 1W2BA 3J80E 4ZTFA 4Y92A 1G3YA 4JRQA 1JJ2S 4IUQA 4PKCC 4DOVA 4BI4A 1EFNA 3L1AA 3CXCS 1X01A 3CMAQ 1FYNA 1UE9A 1YNZA 2HMAA 1VQPT 1GFDA 1TUCA 4M75D 5LJ3e 1OZ3A 1Q81R 1N27A 2DL3A 5I2SA 3CBMA 3A5ZB 3MPUB 1VQ5T 4FT4A 2DTIA 3A1PA 3REAB 2RNAA 4A4GA 3LWIA 2QTXA 1X75C 2DKGA 5D7UA 2CZ7B 4WF2A 5LJ3j 2RF0A 4DBHA 1AWXA 1TSFA 3HRTA 2RO0A 3EG9A 3RR6A 1HJDA 1I1JA 3EGDA 1GXIE 2CSQA 4J7IA 1OX8A 2RI5A 2CS7A 3ASKA 1K9AA 2BZ8A 2NWMA 2Y4XA 2DYIA 4C5EA 1WHJA 3TVTA 4JDSA 1GCQA 3EAEA 2MIOA 1ABQA 4GY5A 2LNHB 2D8JA 1MMDA 3JCMf 1JXMA 5FRMA 1X6OA 2F5TX 2L3RA 1U1TA 2W0ZA 1MUZA 2YUNA 2GGRA 5GAN8 3SD4A 1T0JA 5FU6C 2F69A 3M9QA 3MP1A 4C5HA 3M4YA 3JB9J 5CIUA 1RACB 2CP5A 4PNOA 5CKEA 2RHXA 1I8FA 3NGPA 3GBQA 1RABB 3FIFA 2CH4A 3V7RA 5IHNA 2RB6A 2XICA 2P4TA 1F1BB 3A8HB 4IUUA 4M75G 4XTVA 1QVFA 1GBRA 1BI2A 1OV3A 2OJ2A 2KR3A 4Y28E 2CZ0B 5CQYA 2V8KA 1Q7YR 2RPNA 1ABOA 5GAMd 4RTWA 4J8OA 4ORZA 3VYGA 3JCMg 2EYXA 3GF5A 4MZPA 4XU1A 5GAOm 1XNIA 2D6FA 1WX6A 3BY7A 4LDWA 1U06A 2VB6A 1H92A 3TEEA 1QCNA 2E41A 5GAOp 4A4HA 2RM4A 5FU6B 1D1AA 3QYHB 2F2WA 2QGFB 3M0TA 4AFQC 2YRDA 1Q81U 1I81A 1BIAA 5IXFA 3H0FA 3I55T 3ME9A 2L3SA 4R56A 1PKTA 1PHTA 1C0MA 5I2MA 3CCEA 2SRCA 3HFOA 2GBQA 3EHRA 2QASA 1N9RA 2X3WD 1YIJQ 2RJCA 3GOXA 1V1CA 4X1VA 3X24B 2O2OA 4LDVA 5A2QE 3RNJA 1NEBA 1FMWA 3JCMW 3QUIA 2YLBA 2CZ1B 4E7SA 1ACMB 1U5SA 1ZUYA 4OB1B 4M77C 4GLKA 2LJ1A 4RCBA 2LVMA 4LN2A 2DVEA 2XK0A 3M57A 4BY6B 1VQNT 4R0KA 2LT4A 4PJOA 1E6HA 4D8KA 4LDYA 2YXYA 2QQSA 5I21A 2NUPB 3SHWA 5GANd 1AWOA 3LW5E 4DBQA 5KCOA 1QMCA 1SF9A 4M78F 1BBZA 3H8ZA 4IKFA 3QZ9B 3M53A 4ATOA 2DE0X 3CCEQ 1AWWA 1NZ9A 2IPOB 2QEXQ 8ATCB 1PM3A 1YIJA 1YHQA 4PFPA 2DAQA 1Z9QA 2JJ9A 3CCET 4AFSC 1ZA1B 3EHQA 1IGUA 3CCQQ 2M1HA 2CGHA 3I56Q 5GAN3 1QWEA 3CXCA 2RK1A 3EG3A 4WTOB 1SHFA 1JJ2A 1UB4A 2HD0A 4PFOA 4PJOG 3I56T 1KC8R 3JCMP 1JBMA 4M78B 1WA7A 4BY6C 2RHUA 2P0KA 1ZX6A 3VS2A 2JMCA 1AD5A 5GAMe 4OB2B 1N8RR 2PVGB 2EYWA 1YCSB 3RDVA 5KCHA 2ABLA 1TH7A 2L8DA 4Y91A 1VQMT 2XU8A 2MWOA 1Y96A 2YLCA 2KK4A 3M4GA 4QKUA 3VV0A 2NUTA 3NHNA 3V7CA 1WJRA 4BI8B 3HP9A 7AT1B 1YP5A 2KRNA 3CCQA 4M7DA 1B07A 3EGUA 2MK5A 4MZTA 3I56A 2K57A 4RUGA 5HK0A 2G3RA 2ZPIB 2PUOB 2GNCA 5IT9E 4OF1A 4C92G 1EIFA 2K3YA 3M0UA 3QO3A 1QCOA 4E7JA 5J3BA 4Z8AA 3WVDB 5CK9A 2M16A 2DD4A 1YWOA 1B7TA 2HCKA 2RI2A 2XDPA 3OS1A 1YI2A 2P84A 1Y0MA 3OS2A 5IAYA 3CMET 1M3AA 1RI0A 4KT0E 1RAFB 2GCXA 3OYYA 3PMTA 1VQ6Q 3I55A 3L2VA 5GAN5 2J05A 4KH1B 2DL7A 1IZ6A 2A28A 3WXMB 1WHLA 3OYDA 4C0DC 3L2ZA 5HK3A 2D9TA 2GFAA 2LX9A 3GPLA 1OU8A 1M1KC 3OYBA 2C0TA 1LCKA 1I5OB 1GRIA 1M1GA 2DEQA 1H3HA 1VYUA 2BZXA 3CCLT 1E7OA 2ED0A 2E5KA 1UEBA 1N6AA 3PIPA 1Q7YC 1NPPA 5CQXA 1OEBA 3C95A 1YITT 5HCKA 2X3XD 4XU2A 1WXBA 2F1LA 2RQVA 1RAEB 4MMLA 4RTZA 3MKDA 2JOYA 3BW1A 2QI2A 1MGQA 3HRUA 1QVGA 5GANe 2CUDA 1N8RU 2ZAEA 3X25B 4J9DA 1TOVA 1VQ6A 4O6JA 1KHIA 3I55Q 4BE1A 4PJOC 3HPWA 5DLOA 2QK0A 4RG8A 4C0DB 4ZGEB 5C0MA 4PJOF 1IHWA 2DFUA 5DM7R 4M77D 3P8BB 2RHIA 4RTTA 2DEUA 1Q82U 2LQNA 4JJDA 1M2VA 5LJ5g 1M8MA 3CMAA 2E6ZA 2BZYA 2V1QA 1VQ8A 5GAOn 2EYYA 4BDYA 5KYXB 1K9MU 2HAXA 3MP6A 2X4YA 2LQ8A 2ATCB 3QJ6A 4J9FA 4ZGDB 1VOMA 3EFOA 1PSEA 1YJ9T 2EYQA 3RKYA 4PJOB 1VQOA 3H9NA 1VQKA 1OULA 3H41A 2H3EB 1Q95G 2RJEA 3E19A 4DEYA 2ZPGB 2EVRA 3CCUT 2LZ6B 1D09B 4A4FA 3NTKA 2DZCA 4C8QC 4AFUC 4BD3A 3SB2A 2YSQA 4OB0B 2R5MA 2KBTA 3PE0A 2FB7A 1VQ8Q 1PC0A 2RHYA 2CP7A 2IVWA 1NBEB 4C8QA 3T9NA 3FDRA 2QA4A 4IURA 2YUPA 5L23A 4AG2C 3OQ5A 1D0XA 4ANJA 4M7AA 4M75F 2LP5A 1WHHA 1NJIR 2C06A 1BI0A 4C0GA 1VYVA 2QQ9A 1AEYA 4JRPA 1KQSS 2LT1A 2MPXC 3VRZA 2HNIA 2E70A 4MMKA 2RQTA 4QVZA 4C8QD 2FZCB 5KE3A 3VYHB 1CKBA 5EG2A 4XU3A 2YWWA 5FWBA 3UA6A 2ZCFB 3KBGA 4RKUE 3X20B 5CKFA 1ZBJA 2JTEA 4KUDK 2HSPA 3INZA 4HT8A 4RCCA 2J06A 3F70A 4F7UE 1QVFS 1NEGA 1K1ZA 3JCMc 2ZPBB 1D0YA 2LCCA 3JB9H 3QHSA 4D6WA 2DD5A 3G7ZA 2DTHA 3EGDB 1LNXA 5GAN6 1ZLMA 3JAME 1YIJT 3A98A 1SG5A 1AOJA 2LQKA 4JZ3A 4ZTJA 1ZA2B 5GANf 1Q86C 1UUEA 4CC2A 2P0PA 3N5BB 3J7AF 3KFVA 4V2SA 3CC7T 1G5VA 3JB9F 4E6RA 3QPHA 1SPKA 2CKKA 2JW4A 2JXBA 5GAN4 1TTHB 4IUVA 4M78C 4LNPA 4M78G 4ESRA 1TS9A 2R5AA 3MEUA 3TSZA 4KGXB 2LJ3A 3M0RA 2C0OA 3PMIA 3FB9A 1YI2T 3S3NA 1QLYA 4IUPA 2KT8A 1YITQ 3Q1JA 5M9OA 3CCMT 2OX7A 2MYSA 4QW2A 1K73C 1UGRB 2M9UA 2OTLT 1VUBA 1QWFA 1JXOA 1WJQA 3R6NA 2CUBA 2QEXA 2PVOB 5LJ3g 2VASA 3RBBB 2EGCA 1G3TA 1OX9A 1YJNA 1NJIU 4XQ3A 2CH4W 2MAMA 3REBB 3EGXB 2MI6A 4M78E 4N4IA 1W2BP 4QQDA 4KULA 2FPDA 3BFMA 1CSKA 2FEIA 2V8IA 1KC8C 3H0HA 4XTWA 2DM1A 4D8DA 4IIMA 4C8QE 1VQ9A 1KC8U 2KGTA 3CCVQ 4QQGA 1VQ7A 2IIMA 4EMHA 4RTXA 2DRKA 1X6GA 4QQ6A 3UATA 1WGSA 4HKEA 3OYNA 3C0CA 4XTYA 2XIDA 1FMKA 2OAUA 1WJSA 5AYFA 5KYWA 2MCNA 3OYEA 1UECA 2HQHA 1X2QA 3JRZA 1G3SA 4HCCA 3EH1A 4XTUA 1YJNQ 2GTOA 2HL5C 3LYIA 1RL2A 3OYIA 1X43A 1UFFA 4FIBA 5D6XA 3CPWS 4PJOE 2FZGB 4J9BA 1VQ4Q 1U1SA 1M9SA 2GTJA 3CCUQ 3ZBDA 4BE2A 2AHJB 3G71T 2DTOA 3G6EQ 1GCPA 3A8GB 1RAHB 3CC4Q 4X9CA 1VQ9T 3HSBA 2VV5A 1JRIA 2CP2A 1KHCA 1UG1A 2ZZDA 3G6ET 1ZBXA 1VQ9Q 3HTRA 2EJGA 4CC7A 3DB3A 1R0BG 3CCVA 1QKWA 5HY6A 5A0DA 4RTUA 2DXUA 1VQ7Q 3GIBA 4M7AE 4FW2A 2YDLA 1XOVA 4FM4B 4DQ2A 5GMKh 1FXXA 1K9MR 2MMPA 2Z0WA 3L2QA 1TU0B 2KXDA 1UTIA 3LH0A 1VIFA 2A3LA 4M75A 3PNWC 5CKDA 2LNVA 2E65A 3G4ST 2DK3A 2XKOC 3SWNA 1KQ2A 3TU4K 3L2UA 4B9XA 3UT1A 4E7ZA 1WQ7A 1UHFA 2ZPFB 3CCLQ 3BE3A 3M0PA 4KRTA 3PIOA 4L59A 3P8DA 4ELYC 2DX1A 2D0QB 3TCJA 1FMVA 3I9QA 3CCUA 4M7AD 3EFSA 3OMGA 1YWPA 2VKNA 2CREA 2WSFE 1WZOA 2D1XA 1B34B 4BDZA 2DYBA 2EKOA 1TXQA 3MCAB 4F7UF 4M7DF 1Y57A 1LVKA 2AT1B 2XG8D 3CQTA 1YBYA 2QQRA 4XAXB 3SEMA 3CCQT 2HKNA 4RMOA 1H8KA 1JB0E 1W2BS 4C0ZA 2JMAA 4QVCA 5GAN7 3CMAT 2WACA 4XTZA 2ECZA 2M02A 2CYZB 3VS3A 5FRNA 3M55A 1HD3A 1OOTA 2JZ2A 2KROA 2FPEA 1KIKA 1D3BB 4JLIA 4F16A 5GAOq 2EFIA 4JRIA 4LE9A 4M7DC 4M78D 2ED1A 1P92A 4LD6A 2DERA 1D1CA
chains in the Genus database with same CATH topology
1AHJB 1XQHA 2FHDA 2BUDA 3OYBA 4XU0A 2FVUA 1M1GA 2X35A 3FRNA 2EIFA 2DEQA 3JCMX 1Y07A 3CCMA 3RKWA 2E12A 3CCLT 4J7FA 3MEWA 3RMQA 1UEBA 2X4XA 1N6AA 3PIPA 1Q7YC 1NPPA 3KXTA 5CQXA 3RUXA 3QG1A 5DY9A 2KSSA 2XHCA 1YITT 2GQVA 3C95A 2E10A 3DKMA 4M77E 2HQXA 4XK8E 4XU2A 4F7UB 4NL3A 2HQEA 1KD1U 3A8LB 4MMLA 4BB7A 1VQNA 3OYCA 2JNGA 2JOYA 1QVPA 2ZPEB 3BW1A 4M75B 2F5KA 2QI2A 3QZ5B 1MGQA 3HRUA 1G3WA 1M1FA 3LGFA 1M5Q1 2L5QA 3KUFA 4FL6A 4FT2A 4ELZC 5GMKm 2O01E 3PT9A 1QVGA 5GANe 1M8VA 2R57A 1N8RU 3X25B 3UPUA 2V8JA 2RA2A 1VQ6A 2QQAA 4O6JA 1KHIA 4PJOC 2EJ9A 3FJPA 3MP8A 4M7AB 4E47A 4BE1A 5FU7B 3HPWA 1R8OB 4C92B 1QVGS 3M54A 5DLOA 1M90C 1VQ5A 3GLXA 1NJIC 4M7DB 4BACA 2O4XA 1M1KU 2VGNA 4RG8A 3WVEB 4C0DB 4ZGEB 5C0MA 4PJOF 1VQKT 4HA8A 4ME7A 5CVIA 2BKDN 2JVVA 5DM7R 4M77D 3CBPA 1ZHIA 2RK2A 4IUTA 3JB9D 2PU9B 3QSUA 2E5QA 2RHIA 3P8BB 5LJ5e 3CPWA 4MDWA 1Y96B 4F7UA 1D3BA 4P5NA 4JJNK 1Q82U 2JN0A 5LJ5h 5LJ5g 4J6WA 4A4EA 3VUZA 4C8QB 1FX7A 3CMAA 2E6ZA 2XI9A 3HRSA 1Y71A 4JLGA 3BDUA 1Q81C 2X4WA 1VQ8A 5GAOn 4EMGA 5LJ5j 4BDYA 4C8QG 1K9MU 3V8JA 3RESA 2HAXA 3MP6A 1KQ1A 4OVAA 2IG0A 2EQKA 5CKHA 5CAIA 2X4YA 1Q86U 5KH6A 3P8HA 4II1A 4N0AC 3OYAA 3CC7A 2PVDB 2LQ8A 3S3OA 3GNFB 2VC8A 3QJ6A 3J81E 4ZGDB 4MZMA 4NS5A 3NTIA 3CCVT 2QDYB 1BI1A 4FU6A 3JCMb 4J83A 1YJ9T 1PSEA 1NE8A 4PL6A 4C0FA 2GFUA 5DLQE 2LRQA 1M1KC 4QVDA 1B34A 2EYQA 2DXCA 3RKYA 4EMKB 3OBWA 4LD9K 4PJOB 4M7AC 1VQOA 5CR2A 1VQKA 3GP8A 4JRKA 2RD1A 1Q7YU 5J39A 2RJEA 3OW2A 3E19A 5C6SA 3OYMA 2ZPGB 5FROA 2EJFA 3CCUT 3M59A 2RH2A 5L8RE 1S72A 4M7AF 4HT9A 3HFNA 4VUBA 3JCMV 4A4FA 5GAOl 3NTKA 2DZCA 4C8QC 1V29B 5GMKe 4JUVA 1W2BA 4TVRA 5GANg 3J80E 1LOJA 5LL6S 4BD3A 4M77F 4ZTFA 2P0QA 1G3YA 3SB2A 4JRQA 1VQMA 4IUQA 4PKCC 3URGA 4N4GA 4DOVA 1JJ2S 4BI4A 3CXCS 3L1AA 1X01A 4OB0B 2R5MA 3CCRA 1VQPT 2VUBA 2FB7A 4M75D 5LJ3e 1OZ3A 4E7IA 2XD0A 2RHYA 4X9DA 4C5GA 4OGEA 1N27A 2IVWA 3CC4T 1M90U 3JCMd 1S72T 1KQSA 2JTFA 2YHTA 4C8QA 3QYGB 5I2SA 3CBMA 2K5FA 3A5ZB 1U8RA 3T9NA 1OI1A 3FDRA 4FT4A 2DTIA 4IURA 4C92E 3CCJA 2QA4A 1VQ5T 4A4GA 3LWIA 3DLLA 2QTXA 1X75C 2DKGA 2CZ7B 4WF2A 2DZ9A 5LJ3j 2Y4YA 3A8MB 3DLMA 3OQ5A 3QJYA 4M7DD 1KG1A 1VQ7T 2OTJA 4M7AA 5GAN2 2M0OA 4M75F 3VUBA 4DOWA 4KUIA 3HRTA 5GAMf 2RO0A 2C06A 1BI0A 4C0GA 2QQ9A 5FLXE 4JRPA 1PSFA 5GMKj 1KQSS 2LT1A 2HNIA 2E70A 1GXIE 4MMKA 3CCJT 4J7IA 2RI5A 2CS7A 3ASKA 4QVZA 4C8QD 1QW1A 5KE3A 5GAMh 1I5LA 1HXDA 2Y4XA 5FU7C 3VYHB 3S3MA 5EG2A 3GNGA 4XU3A 3UDCA 2OTJT 4C5EA 1XTDA 4JDSA 3VJPA 2ZCFB 3KBGA 3AHUA 3EAEA 3L42A 4GY5A 1OZ2A 4RKUE 2DXTA 3X20B 2EQJA 5CKFA 3MO8A 3MEVA 3JCMJ 4KUDK 2JTMA 3JCMf 2DXBA 3INZA 2RJFA 2FL7A 2RJDA 5FRMA 2QEXT 4HT8A 1QP2A 1X6OA 2F5TX 1U1TA 2L3RA 3F70A 4M77G 4RCCA 4F7UE 1BYMA 3FEOA 1QVFS 3CC2A 5GAN8 2K5LA 2LDMA 3JCMc 4ZGJB 2ZPBB 2LCCA 3SD4A 3JB9H 3H6ZA 3QHSA 4D6WA 4ZN3A 1Y7XA 2DD5A 3OYFA 3G7ZA 3CCST 2DTHA 5FU6C 1LNXA 2QXFA 1H3ZA 5GAN6 4N4HA 3OS0A 2F69A 4PJOD 3M9QA 2EWNA 3JAME 4CI0C 1YIJT 4R55A 3MP1A 3VU3C 4C5HA 3M4YA 3JB9J 5CIUA 2LCLA 4PNOA 5A0LA 2VXFA 5CKEA 2RHXA 4E7KA 1I8FA 1YITA 4PLLA 2LQKA 2GF7A 1K9MC 4N0AA 3FIFA 2E1HA 2K2VA 5D6WA 3OY9A 3V7RA 4J6XA 2EAYA 2KMTA 3RMSA 3CC2T 4ZTJA 2RB6A 5GANf 1Q86C 2XICA 2P4TA 3JCMh 5LJ5d 3JB9G 2HBPA 4KBMB 3A8HB 4IUUA 4M75G 4XTVA 2P0PA 1QVFA 2K5IA 4B9WA 1KD1C 1BI2A 3ER0A 3N5BB 4BE0A 2XDDA 3J7AF 4EMKC 1VQPA 4Y28E 4V2SA 3CC7T 1G5VA 2PQWA 3JB9F 3QPHA 1MHNA 3OSSC 2CZ0B 5CQYA 2FYKA 2V8KA 2BIVA 3ZFJA 5GAMd 2CKKA 3QDRB 4J8OA 3VYGA 3JCMg 4F7UG 3GF5A 4MZPA 5GAN4 4XU1A 4EPCA 1XNIA 5GAOm 4E7HA 4IUVA 2D6FA 2WSEE 4M78C 4EDUA 1DJ7B 3BY7A 4LDWA 3M56A 4EMKA 4M78G 2KVQG 3TEEA 2VYTA 1LJOA 2E41A 3HL8A 2MF2A 2R5AA 3OBYA 3OMCA 4X34A 4A4HA 5GAMg 5GAOp 3MEUA 2ZPHB 2RM4A 3SWNB 5FU6B 4BUGA 5GMKi 3FC3A 3QYHB 2DIGA 3MHXA 5HKCA 3C12A 3PMIA 3FB9A 1YI2T 4C92F 4LDXA 3S3NA 2A7YA 3LX7A 3OA6A 4IUPA 1Q81U 1I81A 3QKJA 3S6WA 1BIAA 3Q1JA 3OYJA 5M9OA 2DPPB 2NLUA 4M75C 3I55T 3CCMT 3ME9A 3OYHA 4NOYA 2VXEA 1K73C 4QW2A 2DIQA 2EQUA 4R56A 1UGRB 2M9UA 3QBYA 2OTLT 1VUBA 4C92C 5I2MA 3CCEA 3OS5A 3HFOA 1WJQA 5LJ3h 2QEXA 1N9RA 2PVOB 5LJ3g 2RJCA 1VIEA 2LTOA 3PGGA 3GOXA 5D6YA 1G3TA 2B8AA 1YJNA 1VQLA 4JS5A 1H641 3VKIA 5A0GA 2DO3A 3X24B 4XQ3A 3RIRA 2MAMA 1NJIU 5LJ3d 4M78E 2MI6A 4LDVA 5A2QE 3CCSA 1VQ4A 1YJWT 4N4IA 4M78A 3L2RA 4Q5WA 1BKBA 1OYXA 4KULA 3QUIA 4QQDA 4A53A 3BFMA 3HKSA 3JCMW 2YLBA 2XDBA 2CZ1B 4MDXA 3CEYA 4C92A 2LC4A 4OB1B 4M77C 3CBOA 3G6EA 2V8IA 1KC8C 3CC4A 4GLKA 4XTWA 3TREA 5GAMj 3NTHA 4C8QF 4RCBA 2K4YA 2LVMA 2MWPA 3LGLA 3OSVA 2DVEA 4C8QE 2XK0A 4OP0A 4OB3B 3JSCA 3M57A 1VQ9A 4BY6B 1KC8U 1VQNT 1ZQ1A 3O8VA 3CCRT 2LT4A 4A4KA 1VQ7A 4QQGA 4PJOA 1M4ZA 1O75A 4LDYA 4EMHA 2QQSA 1YHQT 1K8AC 5I21A 4FSXA 3OYKA 2L89A 5GANd 1IREB 3LW5E 4QQ6A 4OMFB 3OYGA 5KCOA 1WGSA 4HKEA 3OYNA 4M78F 2OTLA 4XTYA 2YRVA 2XIDA 2QA4T 4C92D 2OAUA 3G4SA 1WJSA 2JUFA 5AYFA 3PTAA 3H8ZA 3L2WA 1WNLA 2EQMA 4IKFA 2DJZA 3QZ9B 3M53A 3OYEA 4ATOA 1I4K1 3JRZA 4UC4A 1NZ9A 1G3SA 4HCCA 4BI3A 4XTUA 1BIBA 3UWNA 1YIJA 4M7AG 1YHQA 3CCLA 2DAQA 4J6YA 1UGQB 3E1SA 3LYIA 2CZ6B 5CKBA 1RL2A 3E9FA 3V7SA 2I2LA 3OYIA 3LLRA 3MEAA 3CCET 4FIBA 5D6XA 3CPWS 4PJOE 2WSCE 1U1SA 1M9SA 2M1HA 3BDLA 2CGHA 3ZEHA 5LJ5f 2RI3A 2E6NA 1YJNT 1VQLT 5GAN3 1N9SA 2R58A 3ZBDA 4BE2A 2AHJB 2RK1A 4L5GA 3CXCA 3G71T 1K73U 1JJ2A 2DTOA 1UB4A 3C94A 2HD0A 3A8GB 3JCMe 1VQOT 4X9CA 1VQ9T 4PJOG 3I56T 3HSBA 2VV5A 1JRIA 3JCMP 1JBMA 4M78B 4Z02A 1KHCA 2ZZDA 3G6ET 4BY6C 2RHUA 1K8AU 1ZBXA 2ZGWA 4XTXA 2P0KA 2KDSA 2EJGA 3M58A 2O4XB 3DB3A 2QQBA 3DB4A 3CCVA 3OW2S 5A0DA 5HY6A 5GAMe 1VQ8T 2DXUA 4OB2B 2RHZA 3META 2PVGB 3GIBA 4M7AE 3SWNC 1UGSB 5KCHA 3G71A 1TH7A 3X26B 2L8DA 4Y91A 3PFSA 2XU8A 1XOVA 4FM4B 4DQ2A 2MWOA 1VQMT 3RERA 5GMKh 1FXXA 2MMPA 5GANh 1Y96A 1YCYA 2YLCA 2KK4A 3L2QA 3M4GA 4RG2A 3NFCA 3A8OB 3VV0A 3RKXA 5CCAA 3JCMQ 3LH0A 3QIIA 1VIFA 2A3LA 4M75A 3V7CA 3PNWC 5IN1A 5CKDA 2LNVA 3HHTB 4E7LA 1UGPB 2E65A 3G4ST 2DK3A 2XKOC 1WJRA 3SWNA 1KQ2A 4BI8B 3TU4K 2KQWA 3L2UA 4B9XA 3UT1A 3CMEA 1Q82C 1WQ7A 2ZPFB 3OB9A 3HP9A 2PUKB 4YTLA 3CD6A 4HCBA 4CRIA 3PIOA 4ZN1A 4L59A 3P8DA 3V8KA 4ELYC 4LDUA 3CCQA 1FWZA 3SFMA 4M7DA 2D0QB 2KY9A 3TCJA 3V8LA 2H3JA 4MZTA 3I56A 1WQWA 3CCUA 3EFSA 3OMGA 5GAOr 1N8RC 2K57A 4M7AD 1SSFA 5HK0A 2G3RA 2WSFE 2ZPIB 3R6OA 2PUOB 1B34B 4BDZA 3OYLA 2EKOA 4DA4A 4M77A 1YJ9A 5LJ3f 1BI3A 3MCAB 4M77B 4F7UF 3CPFA 3JB9I 4OF1A 5IT9E 3CD6T 4C92G 4M7DF 5KE2A 1EIFA 2XG8D 1NPRA 1WPYA 2K3YA 3C4SA 3X28B 1YBYA 2QQRA 4XAXB 3FLGA 3QO3A 4A54A 3CCQT 1VQ4T 1YJWA 3SDZA 4E7JA 4RMOA 2K3XA 1JB0E 5J3BA 3WVDB 5CK9A 1W2BS 2M16A 2DD4A 4C0ZA 4OGCA 4QVCA 4M7DG 3EFRA 5GAN7 3CMAT 2XDPA 2RI2A 2WACA 2KAFA 2Y90A 3M5AA 4XTZA 4M7DE 3OS1A 1YI2A 3OS2A 5IAYA 3LWHA 1O9SA 5J26A 4JS4A 3QXEB 1W4SA 3CMET 1RI0A 2CYZB 4C5IA 5FRNA 2GCXA 3M55A 3E9GA 3OYYA 3PMTA 4KT0E 4O5VA 2JZ2A 3I55A 4J5YA 4HCZA 5GMKl 1QP3A 3L2VA 2E64A 1D3BB 4PLIA 4JLIA 5GAN5 4NL2A 4L6V5 5GAOq 4M75E 2EFIA 4JRIA 1VQ6T 1IZ6A 3WXMB 5GANj 4M7DC 3OYDA 4C0DC 3L2ZA 2X4JA 4M78D 5HK3A 2D9TA 2GFAA 1HK9A 2LX9A 1P92A 4LD6A 3GPLA 5CO7A 2VGMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAN g;  1N9S A;  4XU1 A;  5GAN 3;  1LOJ A;  5GAN 4;  5GAO m;  4M77 F;  4M78 C;  4XU0 A;  3SB2 A;  2DTO A;  3JCM e;  2DEQ A;  3BY7 A;  3L1A A;  4X9C A;  1X01 A;  4EMK A;  3JCM X;  4PJO G;  3HSB A;  4M78 G;  1JRI A;  3RKW A;  3JCM P;  1JBM A;  1LJO A;  2FB7 A;  4M75 D;  2E41 A;  4M78 B;  5LJ3 e;  5GAM g;  5GAO p;  4X9D A;  2ZGW A;  2RM4 A;  4XTX A;  3SWN B;  5GMK i;  3JCM d;  3RUX A;  2EJG A;  2YHT A;  4C8Q A;  5DY9 A;  2E10 A;  4M77 E;  4C92 E;  2DTI A;  5GAM e;  4XU2 A;  2DXU A;  4NL3 A;  3FB9 A;  4F7U B;  3GIB A;  2QTX A;  4M7A E;  2DKG A;  3SWN C;  4C92 F;  1TH7 A;  4MML A;  4WF2 A;  2DZ9 A;  4Y91 A;  5LJ3 j;  3RER A;  4DQ2 A;  3BW1 A;  1I81 A;  4M75 B;  5GMK h;  1BIA A;  4M7D D;  5GAN h;  1Y96 A;  1YCY A;  2YLC A;  3M4G A;  1MGQ A;  4M75 C;  3JCM Q;  4M7A A;  5GAN 2;  1M5Q 1;  4M75 F;  3RKX A;  4NOY A;  5GMK m;  2VXE A;  5GAN e;  5GAM f;  1M8V A;  4M75 A;  3V7C A;  2RA2 A;  4C92 C;  2E65 A;  5GMK j;  2EJ9 A;  3FJP A;  4M7A B;  4PJO C;  2HNI A;  3HFO A;  4C92 B;  5LJ3 h;  3SWN A;  1N9R A;  4MMK A;  1KQ2 A;  5LJ3 g;  1WQ7 A;  3PGG A;  4C8Q D;  4M7D B;  5GAM h;  1I5L A;  1H64 1;  1HXD A;  4PJO F;  4HA8 A;  4XQ3 A;  3RIR A;  5GMK e;  5LJ3 d;  4M78 E;  4M77 D;  4XU3 A;  3V8K A;  3AHU A;  3JB9 D;  4M78 A;  3QSU A;  4M7D A;  3JCM W;  3QUI A;  4A53 A;  3V8L A;  3BFM A;  5LJ5 e;  1Y96 B;  2YLB A;  1WQW A;  1D3B A;  2DXT A;  3EFS A;  4F7U A;  5GAO r;  2K57 A;  4C92 A;  4M7A D;  2JN0 A;  3JCM J;  5LJ5 h;  4M77 C;  3JCM f;  5LJ5 g;  4J6W A;  4C8Q B;  3INZ A;  4XTW A;  5GAM j;  4HT8 A;  1B34 B;  4C8Q F;  4M77 G;  4RCB A;  1U1T A;  3BDU A;  4RCC A;  4F7U E;  4M77 A;  5LJ3 f;  3JB9 I;  4M77 B;  4F7U F;  5GAO n;  4EMG A;  5LJ5 j;  5GAN 8;  3JCM c;  2DVE A;  4C8Q E;  4C92 G;  4M7D F;  4OP0 A;  4C8Q G;  3V8J A;  3QHS A;  3JB9 H;  1WPY A;  3RES A;  2DTH A;  5LJ5 f;  1LNX A;  3QO3 A;  1KQ1 A;  4A54 A;  5GAN 6;  4PJO D;  4PJO A;  2EWN A;  4EMH A;  5CAI A;  4N0A C;  3VU3 C;  5I21 A;  5GAN d;  3JB9 J;  4PNO A;  2VXF A;  4QVC A;  2VC8 A;  4M7D G;  1I8F A;  3EFR A;  4M78 F;  5GAN 7;  4XTY A;  4M7D E;  2Y90 A;  3FIF A;  2E1H A;  4N0A A;  4XTZ A;  4C92 D;  3JCM b;  3V7R A;  4J6X A;  2EAY A;  2RB6 A;  5GAN f;  1WNL A;  4QVD A;  1B34 A;  3JCM h;  3RKY A;  4EMK B;  2DJZ A;  5LJ5 d;  3JB9 G;  4PJO B;  4M7A C;  4M75 G;  4XTV A;  1I4K 1;  4JRK A;  4J5Y A;  2RD1 A;  5GMK l;  2E64 A;  1D3B B;  4XTU A;  5GAN 5;  1BIB A;  4JLI A;  4M7A G;  4EMK C;  4V2S A;  4NL2 A;  5GAO q;  4J6Y A;  3JB9 F;  4M75 E;  2EJF A;  4JRI A;  5GAN j;  4M7D C;  3V7S A;  2I2L A;  2FYK A;  4M7A F;  3L2Z A;  4M78 D;  4HT9 A;  4PJO E;  3HFN A;  5GAM d;  3JCM V;  1HK9 A;  1U1S A;  5GAO l;  4C8Q C;  2DZC A;  2CGH A;  3JCM g;  4F7U G;  4JUV A; 
#chains in the Genus database with same CATH topology
 1XQH A;  1MMA A;  2FHD A;  2O9S A;  5IH2 A;  2FVU A;  5IXB A;  1Y07 A;  1Q82 R;  1ZUU A;  3CXC P;  3RKW A;  2E12 A;  1SRM A;  1YJ9 Q;  2EGE A;  3QWX X;  3RUX A;  2O9V A;  5KYY A;  5DY9 A;  2KEA A;  1ZSZ A;  2GQV A;  3DKM A;  2HQX A;  3A8L B;  2JNG A;  1NM7 A;  3QZ5 B;  1G3W A;  4FL6 A;  4FT2 A;  2L5Q A;  5GMK m;  1WI7 A;  1M8V A;  2R57 A;  2CP3 A;  4HXJ A;  3UPU A;  2RA2 A;  1VQO Q;  1VQK Q;  3MP8 A;  4DBF A;  1QVG S;  2H8H A;  1K0S A;  1QVF P;  1KFZ A;  4CC3 A;  4M7D B;  1M1K U;  2DNU A;  5KYN A;  4HVU A;  4HA8 A;  4ME7 A;  2NYS A;  3UF4 A;  2JVV A;  2RK2 A;  1BCM A;  2M51 A;  4MDW A;  2E4H A;  5LJ5 h;  4A4E A;  1EX4 A;  3VUZ A;  2QGG A;  1FX7 A;  2XI9 A;  1Y71 A;  3BDU A;  2KNB B;  4C8Q G;  2EYZ A;  3RES A;  1Z9Z A;  2QA4 Q;  2EQK A;  5CAI A;  1LPL A;  4DBR A;  4II1 A;  1K73 R;  2PVD B;  4KH0 B;  1G8X A;  2OAW A;  3NTI A;  3CCV T;  2GFU A;  5DLQ E;  1TWB A;  2LRQ A;  4FSS A;  2J6F A;  3OBW A;  1BK2 A;  5CR2 A;  2RD1 A;  3OW2 A;  3OYM A;  2X9H A;  5FRO A;  4Z89 A;  3M59 A;  2JS0 A;  4M7A F;  3JCM V;  5GAO l;  2CP0 A;  5GMK e;  1V29 B;  4JUV A;  5GAN g;  5LL6 S;  1WDX A;  2P0Q A;  3URG A;  4N4G A;  2DET A;  3CCR A;  2VUB A;  2SEM A;  3CC2 Q;  2FO0 A;  1K76 A;  4C5G A;  4OGE A;  3CC4 T;  2K9G A;  1M90 U;  1IB8 A;  3JCM d;  1W70 A;  2YHT A;  3QYG B;  2K5F A;  1U8R A;  2NUP A;  1X69 A;  4F14 A;  3CC7 Q;  2DZ9 A;  3A8M B;  4AT1 B;  3QJY A;  2OI3 A;  1VQ7 T;  2OTJ A;  5GAN 2;  3VUB A;  5GAM f;  5FLX E;  1M30 A;  4JPB W;  3CCJ T;  1B3Q A;  1QW1 A;  2KXC A;  5GAM h;  4PFZ A;  3S3M A;  2OTJ T;  3FJ5 A;  3VJP A;  1HYO A;  2CP6 A;  3MJX A;  3L42 A;  1OZ2 A;  2EQJ A;  3MEV A;  2CDT A;  2QYZ A;  2DXB A;  2RJF A;  2DLP A;  2QEX T;  4M77 G;  1QVG P;  1W1F A;  3FEO A;  4KGZ B;  2AZS A;  3CC2 A;  2K5L A;  2V26 A;  2LDM A;  4ZGJ B;  1YFN A;  3H6Z A;  4ZN3 A;  1Y7X A;  3I5R A;  3OYF A;  3CCS T;  4AFZ C;  1H3Z A;  4N4H A;  4PJO D;  2EWN A;  5EC7 A;  4PJN A;  2LCL A;  5A0L A;  1BCO A;  3D7S B;  4E7K A;  1YIT A;  4PLL A;  1AZE A;  1A0N B;  4N0A A;  5D6W A;  1ZUK A;  4J6X A;  2EAY A;  2KMT A;  2L3Q A;  1VYT A;  3JCM h;  3JB9 G;  4KBM B;  1IGQ A;  2K5I A;  4B9W A;  1KD1 C;  3ER0 A;  2XDD A;  4EMK C;  2PQW A;  3OSS C;  2FYK A;  2BIV A;  3EG9 B;  5AT1 B;  4E2F B;  3ZFJ A;  2HEQ A;  1UJ0 A;  4F7U G;  1NLP C;  2NUZ A;  2FZK B;  4E7H A;  2ENM A;  2WSE E;  1DJ7 B;  4EMK A;  2KVQ G;  2MF2 A;  3OBY A;  3OMC A;  5GAM g;  2ZPH B;  4BUG A;  2DIG A;  3MHX A;  5HKC A;  1X2K A;  4PJJ A;  2A7Y A;  1TUD A;  1QQJ A;  3S6W A;  3JV3 A;  4M75 C;  3OYH A;  2VXE A;  1R0C B;  3TQ7 P;  2DIQ A;  2EQU A;  2X51 A;  2KE9 A;  1KQS P;  1I0C A;  3OS5 A;  5LJ3 h;  4RTY A;  2NUT B;  1VIE A;  1PD0 A;  1VQP Q;  1VQL A;  2B8A A;  3VKI A;  5A0G A;  2DO3 A;  3RIR A;  1D0Z A;  3CCS A;  2K7A A;  1VQ4 A;  1YJW T;  4Q5W A;  1OYX A;  2ROL A;  2XDB A;  3CEY A;  4C92 A;  2EBP A;  4F17 A;  3CBO A;  3G6E A;  3CC4 A;  3TRE A;  5GAM j;  3NTH A;  4C8Q F;  2DMO A;  4JZ4 A;  2MWP A;  4OP0 A;  4OB3 B;  1SEM A;  3JSC A;  5KYU B;  2EGA A;  4A4K A;  1M4Z A;  1YHQ T;  1K8A C;  4FSX A;  3OYK A;  1IRE B;  4OMF B;  3OYG A;  4GBQ A;  2QA4 T;  1WNL A;  2DJZ A;  1OU9 A;  1I4K 1;  3IQL A;  3UWN A;  4M7A G;  2RMO A;  3CCL A;  1VQL Q;  2QDL A;  5CKB A;  2HL3 A;  3E9F A;  2I2L A;  5GJV B;  3LLR A;  3MEA A;  3CCS Q;  2WSC E;  3ZEH A;  1MMN A;  1VQL T;  2E6N A;  2R58 A;  3M0Q A;  2A08 A;  2CT4 A;  1MV0 B;  4L5G A;  1WHM A;  1WXT A;  2L0A A;  4AMC A;  3VRY A;  2F2X A;  1S1N A;  2P4R A;  4Z02 A;  1UDL A;  1ZSZ C;  2ZGW A;  2AKL A;  1G83 A;  1KD1 R;  5GJW B;  2EPD A;  2M0Y A;  3DB4 A;  3OW2 S;  3SWN C;  3RER A;  3PFS A;  4J9H A;  3JCM Q;  3NFC A;  3RKX A;  2BE9 B;  2EQI A;  2HKQ B;  2E3I A;  5I11 A;  4E7L A;  3CME A;  3OB9 A;  2K2M A;  4ZN1 A;  4PJL A;  2HBW A;  1X27 A;  3V8L A;  2H3J A;  1WQW A;  2G6F X;  5GAO r;  1N8R C;  1SSF A;  3R6O A;  3OYL A;  3G1J A;  1YJ9 A;  1W6X A;  3JB9 I;  3CPF A;  3CD6 T;  3X28 B;  1NPR A;  1WPY A;  4OMP A;  1VQ4 T;  1YJW A;  2CSI A;  1SKU B;  3H0I A;  5KYW B;  3G71 Q;  2L3P A;  2FPF A;  2K3B A;  2PZ1 A;  2Y90 A;  2DJQ A;  1AVZ C;  1O9S A;  4JS4 A;  1RUW A;  8AT1 B;  1NLO C;  4O5V A;  4LXC A;  4HVV A;  3QDF A;  5GMK l;  2E64 A;  4PLI A;  3CME Q;  2DL5 A;  4M75 E;  1VQ6 T;  4PJM A;  2X4J A;  2JM8 A;  1PCX A;  5CO7 A;  1PG5 B;  3VS0 A;  1PRM C;  2BUD A;  2EIF A;  3JCM X;  1R77 A;  2HDA A;  2X4X A;  1MV3 A;  2DVJ A;  2KSS A;  2XHC A;  5KYY B;  1QCF A;  1QKX A;  3I5S A;  2E10 A;  4M77 E;  5I22 A;  4NL3 A;  2YT6 A;  4F7U B;  4OMO A;  4FYV B;  4BB7 A;  1VQN A;  1C1A A;  4M75 B;  3AT1 B;  4MDX A;  1K73 U;  3LGF A;  2HSE B;  2V8J A;  5IHI A;  1IXD A;  3M0S A;  4M7A B;  4E47 A;  2LQW A;  4C92 B;  1KJW A;  1M90 C;  3GLX A;  1NJI C;  2O4X A;  3THK A;  3WVE B;  3I35 A;  1AZG B;  1ZHI A;  4FYX B;  1M2O A;  3QSU A;  4F7U A;  4JJN K;  3ULR B;  2KRS A;  2JN0 A;  4WCI A;  1VQM Q;  2RQW A;  4RTV A;  1CKA A;  1NYG A;  2EKH A;  3CCR Q;  2X4W A;  1WHG A;  4EMG A;  1T3L A;  3V8J A;  1OQK A;  1KQ1 A;  3CCJ Q;  5CKH A;  1Q86 U;  1M90 R;  5KH6 A;  3P8H A;  3OYA A;  3CC7 A;  1J3T A;  2PTK A;  2AZV A;  3S3O A;  1VQN Q;  2F2V A;  3J81 E;  2OTJ Q;  1G2B A;  4FU6 A;  4HVW A;  4C0F A;  1NE8 A;  3QWY A;  2DXC A;  4EMK B;  4M7A C;  2AIR B;  1U3O A;  1K4U S;  1GL5 A;  2EW3 A;  1Q7Y U;  2CT3 A;  1GBQ A;  5C6S A;  2EJF A;  1PRL C;  1RAG B;  1S72 A;  4B6M A;  4TVR A;  1LOJ A;  4M77 F;  4J9C A;  1VQM A;  1ZSZ B;  2O88 A;  4E7I A;  1RLQ C;  2HZY A;  2XD0 A;  4X9D A;  4A63 B;  1HSQ A;  2COZ A;  1S72 T;  2B86 A;  1KQS A;  2JTF A;  3VS1 A;  2VWF A;  1OI1 A;  4C92 E;  3CCJ A;  1IHV A;  3DLL A;  3EH2 A;  2AK5 A;  1MMG A;  2Y4Y A;  3DLM A;  2XMF A;  4M7D D;  2JM9 A;  1KG1 A;  4DEX A;  2O31 A;  2M0O A;  4DOW A;  4KUI A;  4LUE A;  1AWJ A;  1PSF A;  5GMK j;  4JJB A;  3EFO B;  5KYU A;  1I5L A;  1HXD A;  2DL8 A;  1JEG A;  4ZNX A;  5FU7 C;  1IRX A;  3GNG A;  1TG0 A;  3UDC A;  1XTD A;  2LCS A;  3AHU A;  1M1K R;  2DXT A;  3MO8 A;  3NPF A;  3JCM J;  2BE7 D;  2JTM A;  3UA7 A;  2FL7 A;  2RJD A;  1QP2 A;  4AG1 C;  1BYM A;  2QTV A;  2QXF A;  1ZSG A;  3OS0 A;  1UJY A;  4CI0 C;  4R55 A;  3VU3 C;  4OMQ A;  2VXF A;  3CPW P;  1K9M C;  1V76 A;  2GF7 A;  2E1H A;  2K2V A;  3OY9 A;  3VS5 A;  2DA9 A;  3RMS A;  2DL4 A;  3CC2 T;  1Q86 R;  3ZL7 C;  2MOX A;  5LJ5 d;  2HBP A;  2JS2 A;  1OPK A;  4BE0 A;  1VQP A;  1MHN A;  3QDR B;  2V1R A;  4LUD A;  1EZZ B;  4EPC A;  1K8A R;  1D1B A;  4EDU A;  1WHK A;  5IHK A;  3M56 A;  2VYT A;  1LJO A;  1NYF A;  3HL8 A;  4X34 A;  2JT4 A;  2DBM A;  5FWC A;  3SWN B;  5GMK i;  1PNJ A;  2J6K A;  3FC3 A;  3C12 A;  1RAA B;  1UGV A;  1KK7 A;  3OW2 P;  4FYY B;  4C92 F;  4LDX A;  2LJ0 A;  4OML A;  3LX7 A;  3OA6 A;  2DF6 A;  2OTL Q;  3OYJ A;  1KSW A;  3QKJ A;  3E2U A;  2DPP B;  2NLU A;  1T0H A;  4NOY A;  1OPL A;  3QBY A;  4C92 C;  4M4Z A;  4KGV B;  4FCY A;  1E6G A;  4FW1 A;  2LTO A;  3PGG A;  2KT1 A;  2ROT A;  2RN8 A;  5D6Y A;  4JS5 A;  1H64 1;  5LJ3 d;  4M78 A;  3L2R A;  1IO6 A;  2QG9 B;  1BKB A;  2RQR A;  4A53 A;  3HKS A;  2J6O A;  2LC4 A;  1JQQ A;  2QAZ A;  1VA7 A;  2K4Y A;  3LGL A;  3OSV A;  1RAI B;  1ZQ1 A;  3O8V A;  3CCR T;  1RLP C;  1O75 A;  2L89 A;  2OTL A;  2YUQ A;  2A37 A;  2YRV A;  4C92 D;  3G4S A;  2A36 A;  2JUF A;  3PTA A;  3L2W A;  2EQM A;  2COW A;  1GFC A;  1N5Z A;  4UC4 A;  4BI3 A;  2YRC A;  4OMN A;  1BIB A;  2D0N A;  4JJC A;  4J6Y A;  1UGQ B;  2KI7 A;  3E1S A;  1WLP B;  2CZ6 B;  3CD6 Q;  2FG0 A;  1I07 A;  3V7S A;  4Z88 A;  1X6B A;  3BDL A;  5LJ5 f;  1M3B A;  2RI3 A;  1YJN T;  1N9S A;  1UHC A;  1VQO T;  3C94 A;  3JCM e;  2GQI A;  2DIL A;  1WFW A;  3VS6 A;  1K8A U;  4XTX A;  4EIK A;  2KDS A;  2A0F B;  3M58 A;  1BU1 A;  1YJW Q;  2O4X B;  2QQB A;  1M27 C;  1PKS A;  1VQ8 T;  2RHZ A;  3MET A;  3PVL A;  1UGS B;  3G71 A;  1M3C A;  3X26 B;  5GAN h;  1YCY A;  3G4S Q;  4RG2 A;  3A8O B;  5CCA A;  4HCK A;  3QII A;  1MNE A;  5IN1 A;  3HHT B;  1UGP B;  1JO8 A;  1ARK A;  2KQW A;  1Q82 C;  1YHQ Q;  4YTL A;  2PUK B;  9ATC B;  3CD6 A;  4HCB A;  4CC4 B;  4CRI A;  3V8K A;  4LDU A;  1FWZ A;  2KYM A;  3SFM A;  2KY9 A;  2W10 A;  2I0N A;  6AT1 B;  4M7D G;  3EG2 A;  2PNI A;  1PWT A;  3CCM Q;  4DA4 A;  2ESW A;  4M77 A;  5LJ3 f;  1BI3 A;  1C6V X;  4M77 B;  3EG0 A;  1WXU A;  5KE2 A;  3C4S A;  3VS7 A;  3FLG A;  4A54 A;  3SDZ A;  2K3X A;  3EGX A;  1NG2 A;  3VS4 A;  2K6D A;  4OGC A;  1T3S A;  2DBK A;  3EFR A;  3M5A A;  4M7D E;  2KAF A;  3LWH A;  5J26 A;  3QXE B;  1GCQ C;  1W4S A;  2VVK A;  3NMZ C;  4C5I A;  3E9G A;  4F04 B;  4J5Y A;  4HCZ A;  1VQ5 Q;  1QP3 A;  1YN8 A;  3U23 A;  4NL2 A;  4L6V 5;  1TUG B;  2FRY A;  3LH5 A;  4J9E A;  5GAN j;  2D8H A;  2KYB A;  1HK9 A;  4J9G A;  2VGM A;  1AHJ B;  4XU0 A;  1AT1 B;  2X35 A;  3FRN A;  1SRL A;  1WYX A;  2E3H A;  3CCM A;  4QT7 A;  4J7F A;  3MEW A;  3RMQ A;  1SHG A;  3KXT A;  3QG1 A;  2K79 A;  2KRM A;  4XK8 E;  2HQE A;  1KD1 U;  3OYC A;  2AKK A;  2ZPE B;  1QVP A;  2F5K A;  1MND A;  5FW9 A;  2YUO A;  4ELZ C;  1M1F A;  1YI2 Q;  1M5Q 1;  3KUF A;  3PVQ A;  2O01 E;  3PT9 A;  1RAD B;  1WIE A;  5KYX A;  2QQA A;  2EJ9 A;  3FJP A;  5FU7 B;  1R8O B;  1VQ5 A;  3M54 A;  1SSH A;  2RQU A;  4OMM A;  4BAC A;  4IIO A;  2VGN A;  1VQK T;  1JJ2 P;  5CVI A;  2BKD N;  1S72 Q;  2LX7 A;  3CBP A;  4IUT A;  3JB9 D;  2PU9 B;  3O5Z A;  2E5Q A;  5LJ5 e;  3CPW A;  1Y96 B;  1D3B A;  4P5N A;  1M2V B;  1BB9 A;  2COY A;  4J6W A;  4C8Q B;  4PK4 A;  3HRS A;  1K0X A;  4JLG A;  1RI9 A;  1Q81 C;  5ECA A;  5LJ5 j;  2J7I A;  2L2P A;  3TSW A;  4OVA A;  2IG0 A;  2FRW A;  4N0A C;  3GNF B;  1PD1 A;  2VC8 A;  4MZM A;  4NS5 A;  3EG1 A;  2QDY B;  1BI1 A;  3JCM b;  4J83 A;  4PL6 A;  4K11 A;  2BTT A;  4QVD A;  1B34 A;  4LD9 K;  2LMJ A;  4FYW B;  2C0I A;  3GP8 A;  4JRK A;  5J39 A;  2DRM A;  4J9I A;  4GLM A;  2RH2 A;  5L8R E;  1JU5 C;  4HT9 A;  3HFN A;  4VUB A;  1XJW B;  1W2B A;  3J80 E;  4ZTF A;  4Y92 A;  1G3Y A;  4JRQ A;  1JJ2 S;  4IUQ A;  4PKC C;  4DOV A;  4BI4 A;  1EFN A;  3L1A A;  3CXC S;  1X01 A;  3CMA Q;  1FYN A;  1UE9 A;  1YNZ A;  2HMA A;  1VQP T;  1GFD A;  1TUC A;  4M75 D;  5LJ3 e;  1OZ3 A;  1Q81 R;  1N27 A;  2DL3 A;  5I2S A;  3CBM A;  3A5Z B;  3MPU B;  1VQ5 T;  4FT4 A;  2DTI A;  3A1P A;  3REA B;  2RNA A;  4A4G A;  3LWI A;  2QTX A;  1X75 C;  2DKG A;  5D7U A;  2CZ7 B;  4WF2 A;  5LJ3 j;  2RF0 A;  4DBH A;  1AWX A;  1TSF A;  3HRT A;  2RO0 A;  3EG9 A;  3RR6 A;  1HJD A;  1I1J A;  3EGD A;  1GXI E;  2CSQ A;  4J7I A;  1OX8 A;  2RI5 A;  2CS7 A;  3ASK A;  1K9A A;  2BZ8 A;  2NWM A;  2Y4X A;  2DYI A;  4C5E A;  1WHJ A;  3TVT A;  4JDS A;  1GCQ A;  3EAE A;  2MIO A;  1ABQ A;  4GY5 A;  2LNH B;  2D8J A;  1MMD A;  3JCM f;  1JXM A;  5FRM A;  1X6O A;  2F5T X;  2L3R A;  1U1T A;  2W0Z A;  1MUZ A;  2YUN A;  2GGR A;  5GAN 8;  3SD4 A;  1T0J A;  5FU6 C;  2F69 A;  3M9Q A;  3MP1 A;  4C5H A;  3M4Y A;  3JB9 J;  5CIU A;  1RAC B;  2CP5 A;  4PNO A;  5CKE A;  2RHX A;  1I8F A;  3NGP A;  3GBQ A;  1RAB B;  3FIF A;  2CH4 A;  3V7R A;  5IHN A;  2RB6 A;  2XIC A;  2P4T A;  1F1B B;  3A8H B;  4IUU A;  4M75 G;  4XTV A;  1QVF A;  1GBR A;  1BI2 A;  1OV3 A;  2OJ2 A;  2KR3 A;  4Y28 E;  2CZ0 B;  5CQY A;  2V8K A;  1Q7Y R;  2RPN A;  1ABO A;  5GAM d;  4RTW A;  4J8O A;  4ORZ A;  3VYG A;  3JCM g;  2EYX A;  3GF5 A;  4MZP A;  4XU1 A;  5GAO m;  1XNI A;  2D6F A;  1WX6 A;  3BY7 A;  4LDW A;  1U06 A;  2VB6 A;  1H92 A;  3TEE A;  1QCN A;  2E41 A;  5GAO p;  4A4H A;  2RM4 A;  5FU6 B;  1D1A A;  3QYH B;  2F2W A;  2QGF B;  3M0T A;  4AFQ C;  2YRD A;  1Q81 U;  1I81 A;  1BIA A;  5IXF A;  3H0F A;  3I55 T;  3ME9 A;  2L3S A;  4R56 A;  1PKT A;  1PHT A;  1C0M A;  5I2M A;  3CCE A;  2SRC A;  3HFO A;  2GBQ A;  3EHR A;  2QAS A;  1N9R A;  2X3W D;  1YIJ Q;  2RJC A;  3GOX A;  1V1C A;  4X1V A;  3X24 B;  2O2O A;  4LDV A;  5A2Q E;  3RNJ A;  1NEB A;  1FMW A;  3JCM W;  3QUI A;  2YLB A;  2CZ1 B;  4E7S A;  1ACM B;  1U5S A;  1ZUY A;  4OB1 B;  4M77 C;  4GLK A;  2LJ1 A;  4RCB A;  2LVM A;  4LN2 A;  2DVE A;  2XK0 A;  3M57 A;  4BY6 B;  1VQN T;  4R0K A;  2LT4 A;  4PJO A;  1E6H A;  4D8K A;  4LDY A;  2YXY A;  2QQS A;  5I21 A;  2NUP B;  3SHW A;  5GAN d;  1AWO A;  3LW5 E;  4DBQ A;  5KCO A;  1QMC A;  1SF9 A;  4M78 F;  1BBZ A;  3H8Z A;  4IKF A;  3QZ9 B;  3M53 A;  4ATO A;  2DE0 X;  3CCE Q;  1AWW A;  1NZ9 A;  2IPO B;  2QEX Q;  8ATC B;  1PM3 A;  1YIJ A;  1YHQ A;  4PFP A;  2DAQ A;  1Z9Q A;  2JJ9 A;  3CCE T;  4AFS C;  1ZA1 B;  3EHQ A;  1IGU A;  3CCQ Q;  2M1H A;  2CGH A;  3I56 Q;  5GAN 3;  1QWE A;  3CXC A;  2RK1 A;  3EG3 A;  4WTO B;  1SHF A;  1JJ2 A;  1UB4 A;  2HD0 A;  4PFO A;  4PJO G;  3I56 T;  1KC8 R;  3JCM P;  1JBM A;  4M78 B;  1WA7 A;  4BY6 C;  2RHU A;  2P0K A;  1ZX6 A;  3VS2 A;  2JMC A;  1AD5 A;  5GAM e;  4OB2 B;  1N8R R;  2PVG B;  2EYW A;  1YCS B;  3RDV A;  5KCH A;  2ABL A;  1TH7 A;  2L8D A;  4Y91 A;  1VQM T;  2XU8 A;  2MWO A;  1Y96 A;  2YLC A;  2KK4 A;  3M4G A;  4QKU A;  3VV0 A;  2NUT A;  3NHN A;  3V7C A;  1WJR A;  4BI8 B;  3HP9 A;  7AT1 B;  1YP5 A;  2KRN A;  3CCQ A;  4M7D A;  1B07 A;  3EGU A;  2MK5 A;  4MZT A;  3I56 A;  2K57 A;  4RUG A;  5HK0 A;  2G3R A;  2ZPI B;  2PUO B;  2GNC A;  5IT9 E;  4OF1 A;  4C92 G;  1EIF A;  2K3Y A;  3M0U A;  3QO3 A;  1QCO A;  4E7J A;  5J3B A;  4Z8A A;  3WVD B;  5CK9 A;  2M16 A;  2DD4 A;  1YWO A;  1B7T A;  2HCK A;  2RI2 A;  2XDP A;  3OS1 A;  1YI2 A;  2P84 A;  1Y0M A;  3OS2 A;  5IAY A;  3CME T;  1M3A A;  1RI0 A;  4KT0 E;  1RAF B;  2GCX A;  3OYY A;  3PMT A;  1VQ6 Q;  3I55 A;  3L2V A;  5GAN 5;  2J05 A;  4KH1 B;  2DL7 A;  1IZ6 A;  2A28 A;  3WXM B;  1WHL A;  3OYD A;  4C0D C;  3L2Z A;  5HK3 A;  2D9T A;  2GFA A;  2LX9 A;  3GPL A;  1OU8 A;  1M1K C;  3OYB A;  2C0T A;  1LCK A;  1I5O B;  1GRI A;  1M1G A;  2DEQ A;  1H3H A;  1VYU A;  2BZX A;  3CCL T;  1E7O A;  2ED0 A;  2E5K A;  1UEB A;  1N6A A;  3PIP A;  1Q7Y C;  1NPP A;  5CQX A;  1OEB A;  3C95 A;  1YIT T;  5HCK A;  2X3X D;  4XU2 A;  1WXB A;  2F1L A;  2RQV A;  1RAE B;  4MML A;  4RTZ A;  3MKD A;  2JOY A;  3BW1 A;  2QI2 A;  1MGQ A;  3HRU A;  1QVG A;  5GAN e;  2CUD A;  1N8R U;  2ZAE A;  3X25 B;  4J9D A;  1TOV A;  1VQ6 A;  4O6J A;  1KHI A;  3I55 Q;  4BE1 A;  4PJO C;  3HPW A;  5DLO A;  2QK0 A;  4RG8 A;  4C0D B;  4ZGE B;  5C0M A;  4PJO F;  1IHW A;  2DFU A;  5DM7 R;  4M77 D;  3P8B B;  2RHI A;  4RTT A;  2DEU A;  1Q82 U;  2LQN A;  4JJD A;  1M2V A;  5LJ5 g;  1M8M A;  3CMA A;  2E6Z A;  2BZY A;  2V1Q A;  1VQ8 A;  5GAO n;  2EYY A;  4BDY A;  5KYX B;  1K9M U;  2HAX A;  3MP6 A;  2X4Y A;  2LQ8 A;  2ATC B;  3QJ6 A;  4J9F A;  4ZGD B;  1VOM A;  3EFO A;  1PSE A;  1YJ9 T;  2EYQ A;  3RKY A;  4PJO B;  1VQO A;  3H9N A;  1VQK A;  1OUL A;  3H41 A;  2H3E B;  1Q95 G;  2RJE A;  3E19 A;  4DEY A;  2ZPG B;  2EVR A;  3CCU T;  2LZ6 B;  1D09 B;  4A4F A;  3NTK A;  2DZC A;  4C8Q C;  4AFU C;  4BD3 A;  3SB2 A;  2YSQ A;  4OB0 B;  2R5M A;  2KBT A;  3PE0 A;  2FB7 A;  1VQ8 Q;  1PC0 A;  2RHY A;  2CP7 A;  2IVW A;  1NBE B;  4C8Q A;  3T9N A;  3FDR A;  2QA4 A;  4IUR A;  2YUP A;  5L23 A;  4AG2 C;  3OQ5 A;  1D0X A;  4ANJ A;  4M7A A;  4M75 F;  2LP5 A;  1WHH A;  1NJI R;  2C06 A;  1BI0 A;  4C0G A;  1VYV A;  2QQ9 A;  1AEY A;  4JRP A;  1KQS S;  2LT1 A;  2MPX C;  3VRZ A;  2HNI A;  2E70 A;  4MMK A;  2RQT A;  4QVZ A;  4C8Q D;  2FZC B;  5KE3 A;  3VYH B;  1CKB A;  5EG2 A;  4XU3 A;  2YWW A;  5FWB A;  3UA6 A;  2ZCF B;  3KBG A;  4RKU E;  3X20 B;  5CKF A;  1ZBJ A;  2JTE A;  4KUD K;  2HSP A;  3INZ A;  4HT8 A;  4RCC A;  2J06 A;  3F70 A;  4F7U E;  1QVF S;  1NEG A;  1K1Z A;  3JCM c;  2ZPB B;  1D0Y A;  2LCC A;  3JB9 H;  3QHS A;  4D6W A;  2DD5 A;  3G7Z A;  2DTH A;  3EGD B;  1LNX A;  5GAN 6;  1ZLM A;  3JAM E;  1YIJ T;  3A98 A;  1SG5 A;  1AOJ A;  2LQK A;  4JZ3 A;  4ZTJ A;  1ZA2 B;  5GAN f;  1Q86 C;  1UUE A;  4CC2 A;  2P0P A;  3N5B B;  3J7A F;  3KFV A;  4V2S A;  3CC7 T;  1G5V A;  3JB9 F;  4E6R A;  3QPH A;  1SPK A;  2CKK A;  2JW4 A;  2JXB A;  5GAN 4;  1TTH B;  4IUV A;  4M78 C;  4LNP A;  4M78 G;  4ESR A;  1TS9 A;  2R5A A;  3MEU A;  3TSZ A;  4KGX B;  2LJ3 A;  3M0R A;  2C0O A;  3PMI A;  3FB9 A;  1YI2 T;  3S3N A;  1QLY A;  4IUP A;  2KT8 A;  1YIT Q;  3Q1J A;  5M9O A;  3CCM T;  2OX7 A;  2MYS A;  4QW2 A;  1K73 C;  1UGR B;  2M9U A;  2OTL T;  1VUB A;  1QWF A;  1JXO A;  1WJQ A;  3R6N A;  2CUB A;  2QEX A;  2PVO B;  5LJ3 g;  2VAS A;  3RBB B;  2EGC A;  1G3T A;  1OX9 A;  1YJN A;  1NJI U;  4XQ3 A;  2CH4 W;  2MAM A;  3REB B;  3EGX B;  2MI6 A;  4M78 E;  4N4I A;  1W2B P;  4QQD A;  4KUL A;  2FPD A;  3BFM A;  1CSK A;  2FEI A;  2V8I A;  1KC8 C;  3H0H A;  4XTW A;  2DM1 A;  4D8D A;  4IIM A;  4C8Q E;  1VQ9 A;  1KC8 U;  2KGT A;  3CCV Q;  4QQG A;  1VQ7 A;  2IIM A;  4EMH A;  4RTX A;  2DRK A;  1X6G A;  4QQ6 A;  3UAT A;  1WGS A;  4HKE A;  3OYN A;  3C0C A;  4XTY A;  2XID A;  1FMK A;  2OAU A;  1WJS A;  5AYF A;  5KYW A;  2MCN A;  3OYE A;  1UEC A;  2HQH A;  1X2Q A;  3JRZ A;  1G3S A;  4HCC A;  3EH1 A;  4XTU A;  1YJN Q;  2GTO A;  2HL5 C;  3LYI A;  1RL2 A;  3OYI A;  1X43 A;  1UFF A;  4FIB A;  5D6X A;  3CPW S;  4PJO E;  2FZG B;  4J9B A;  1VQ4 Q;  1U1S A;  1M9S A;  2GTJ A;  3CCU Q;  3ZBD A;  4BE2 A;  2AHJ B;  3G71 T;  2DTO A;  3G6E Q;  1GCP A;  3A8G B;  1RAH B;  3CC4 Q;  4X9C A;  1VQ9 T;  3HSB A;  2VV5 A;  1JRI A;  2CP2 A;  1KHC A;  1UG1 A;  2ZZD A;  3G6E T;  1ZBX A;  1VQ9 Q;  3HTR A;  2EJG A;  4CC7 A;  3DB3 A;  1R0B G;  3CCV A;  1QKW A;  5HY6 A;  5A0D A;  4RTU A;  2DXU A;  1VQ7 Q;  3GIB A;  4M7A E;  4FW2 A;  2YDL A;  1XOV A;  4FM4 B;  4DQ2 A;  5GMK h;  1FXX A;  1K9M R;  2MMP A;  2Z0W A;  3L2Q A;  1TU0 B;  2KXD A;  1UTI A;  3LH0 A;  1VIF A;  2A3L A;  4M75 A;  3PNW C;  5CKD A;  2LNV A;  2E65 A;  3G4S T;  2DK3 A;  2XKO C;  3SWN A;  1KQ2 A;  3TU4 K;  3L2U A;  4B9X A;  3UT1 A;  4E7Z A;  1WQ7 A;  1UHF A;  2ZPF B;  3CCL Q;  3BE3 A;  3M0P A;  4KRT A;  3PIO A;  4L59 A;  3P8D A;  4ELY C;  2DX1 A;  2D0Q B;  3TCJ A;  1FMV A;  3I9Q A;  3CCU A;  4M7A D;  3EFS A;  3OMG A;  1YWP A;  2VKN A;  2CRE A;  2WSF E;  1WZO A;  2D1X A;  1B34 B;  4BDZ A;  2DYB A;  2EKO A;  1TXQ A;  3MCA B;  4F7U F;  4M7D F;  1Y57 A;  1LVK A;  2AT1 B;  2XG8 D;  3CQT A;  1YBY A;  2QQR A;  4XAX B;  3SEM A;  3CCQ T;  2HKN A;  4RMO A;  1H8K A;  1JB0 E;  1W2B S;  4C0Z A;  2JMA A;  4QVC A;  5GAN 7;  3CMA T;  2WAC A;  4XTZ A;  2ECZ A;  2M02 A;  2CYZ B;  3VS3 A;  5FRN A;  3M55 A;  1HD3 A;  1OOT A;  2JZ2 A;  2KRO A;  2FPE A;  1KIK A;  1D3B B;  4JLI A;  4F16 A;  5GAO q;  2EFI A;  4JRI A;  4LE9 A;  4M7D C;  4M78 D;  2ED1 A;  1P92 A;  4LD6 A;  2DER A;  1D1C A; 
#chains in the Genus database with same CATH homology
 1AHJ B;  1XQH A;  2FHD A;  2BUD A;  3OYB A;  4XU0 A;  2FVU A;  1M1G A;  2X35 A;  3FRN A;  2EIF A;  2DEQ A;  3JCM X;  1Y07 A;  3CCM A;  3RKW A;  2E12 A;  3CCL T;  4J7F A;  3MEW A;  3RMQ A;  1UEB A;  2X4X A;  1N6A A;  3PIP A;  1Q7Y C;  1NPP A;  3KXT A;  5CQX A;  3RUX A;  3QG1 A;  5DY9 A;  2KSS A;  2XHC A;  1YIT T;  2GQV A;  3C95 A;  2E10 A;  3DKM A;  4M77 E;  2HQX A;  4XK8 E;  4XU2 A;  4F7U B;  4NL3 A;  2HQE A;  1KD1 U;  3A8L B;  4MML A;  4BB7 A;  1VQN A;  3OYC A;  2JNG A;  2JOY A;  1QVP A;  2ZPE B;  3BW1 A;  4M75 B;  2F5K A;  2QI2 A;  3QZ5 B;  1MGQ A;  3HRU A;  1G3W A;  1M1F A;  3LGF A;  1M5Q 1;  2L5Q A;  3KUF A;  4FL6 A;  4FT2 A;  4ELZ C;  5GMK m;  2O01 E;  3PT9 A;  1QVG A;  5GAN e;  1M8V A;  2R57 A;  1N8R U;  3X25 B;  3UPU A;  2V8J A;  2RA2 A;  1VQ6 A;  2QQA A;  4O6J A;  1KHI A;  4PJO C;  2EJ9 A;  3FJP A;  3MP8 A;  4M7A B;  4E47 A;  4BE1 A;  5FU7 B;  3HPW A;  1R8O B;  4C92 B;  1QVG S;  3M54 A;  5DLO A;  1M90 C;  1VQ5 A;  3GLX A;  1NJI C;  4M7D B;  4BAC A;  2O4X A;  1M1K U;  2VGN A;  4RG8 A;  3WVE B;  4C0D B;  4ZGE B;  5C0M A;  4PJO F;  1VQK T;  4HA8 A;  4ME7 A;  5CVI A;  2BKD N;  2JVV A;  5DM7 R;  4M77 D;  3CBP A;  1ZHI A;  2RK2 A;  4IUT A;  3JB9 D;  2PU9 B;  3QSU A;  2E5Q A;  2RHI A;  3P8B B;  5LJ5 e;  3CPW A;  4MDW A;  1Y96 B;  4F7U A;  1D3B A;  4P5N A;  4JJN K;  1Q82 U;  2JN0 A;  5LJ5 h;  5LJ5 g;  4J6W A;  4A4E A;  3VUZ A;  4C8Q B;  1FX7 A;  3CMA A;  2E6Z A;  2XI9 A;  3HRS A;  1Y71 A;  4JLG A;  3BDU A;  1Q81 C;  2X4W A;  1VQ8 A;  5GAO n;  4EMG A;  5LJ5 j;  4BDY A;  4C8Q G;  1K9M U;  3V8J A;  3RES A;  2HAX A;  3MP6 A;  1KQ1 A;  4OVA A;  2IG0 A;  2EQK A;  5CKH A;  5CAI A;  2X4Y A;  1Q86 U;  5KH6 A;  3P8H A;  4II1 A;  4N0A C;  3OYA A;  3CC7 A;  2PVD B;  2LQ8 A;  3S3O A;  3GNF B;  2VC8 A;  3QJ6 A;  3J81 E;  4ZGD B;  4MZM A;  4NS5 A;  3NTI A;  3CCV T;  2QDY B;  1BI1 A;  4FU6 A;  3JCM b;  4J83 A;  1YJ9 T;  1PSE A;  1NE8 A;  4PL6 A;  4C0F A;  2GFU A;  5DLQ E;  2LRQ A;  1M1K C;  4QVD A;  1B34 A;  2EYQ A;  2DXC A;  3RKY A;  4EMK B;  3OBW A;  4LD9 K;  4PJO B;  4M7A C;  1VQO A;  5CR2 A;  1VQK A;  3GP8 A;  4JRK A;  2RD1 A;  1Q7Y U;  5J39 A;  2RJE A;  3OW2 A;  3E19 A;  5C6S A;  3OYM A;  2ZPG B;  5FRO A;  2EJF A;  3CCU T;  3M59 A;  2RH2 A;  5L8R E;  1S72 A;  4M7A F;  4HT9 A;  3HFN A;  4VUB A;  3JCM V;  4A4F A;  5GAO l;  3NTK A;  2DZC A;  4C8Q C;  1V29 B;  5GMK e;  4JUV A;  1W2B A;  4TVR A;  5GAN g;  3J80 E;  1LOJ A;  5LL6 S;  4BD3 A;  4M77 F;  4ZTF A;  2P0Q A;  1G3Y A;  3SB2 A;  4JRQ A;  1VQM A;  4IUQ A;  4PKC C;  3URG A;  4N4G A;  4DOV A;  1JJ2 S;  4BI4 A;  3CXC S;  3L1A A;  1X01 A;  4OB0 B;  2R5M A;  3CCR A;  1VQP T;  2VUB A;  2FB7 A;  4M75 D;  5LJ3 e;  1OZ3 A;  4E7I A;  2XD0 A;  2RHY A;  4X9D A;  4C5G A;  4OGE A;  1N27 A;  2IVW A;  3CC4 T;  1M90 U;  3JCM d;  1S72 T;  1KQS A;  2JTF A;  2YHT A;  4C8Q A;  3QYG B;  5I2S A;  3CBM A;  2K5F A;  3A5Z B;  1U8R A;  3T9N A;  1OI1 A;  3FDR A;  4FT4 A;  2DTI A;  4IUR A;  4C92 E;  3CCJ A;  2QA4 A;  1VQ5 T;  4A4G A;  3LWI A;  3DLL A;  2QTX A;  1X75 C;  2DKG A;  2CZ7 B;  4WF2 A;  2DZ9 A;  5LJ3 j;  2Y4Y A;  3A8M B;  3DLM A;  3OQ5 A;  3QJY A;  4M7D D;  1KG1 A;  1VQ7 T;  2OTJ A;  4M7A A;  5GAN 2;  2M0O A;  4M75 F;  3VUB A;  4DOW A;  4KUI A;  3HRT A;  5GAM f;  2RO0 A;  2C06 A;  1BI0 A;  4C0G A;  2QQ9 A;  5FLX E;  4JRP A;  1PSF A;  5GMK j;  1KQS S;  2LT1 A;  2HNI A;  2E70 A;  1GXI E;  4MMK A;  3CCJ T;  4J7I A;  2RI5 A;  2CS7 A;  3ASK A;  4QVZ A;  4C8Q D;  1QW1 A;  5KE3 A;  5GAM h;  1I5L A;  1HXD A;  2Y4X A;  5FU7 C;  3VYH B;  3S3M A;  5EG2 A;  3GNG A;  4XU3 A;  3UDC A;  2OTJ T;  4C5E A;  1XTD A;  4JDS A;  3VJP A;  2ZCF B;  3KBG A;  3AHU A;  3EAE A;  3L42 A;  4GY5 A;  1OZ2 A;  4RKU E;  2DXT A;  3X20 B;  2EQJ A;  5CKF A;  3MO8 A;  3MEV A;  3JCM J;  4KUD K;  2JTM A;  3JCM f;  2DXB A;  3INZ A;  2RJF A;  2FL7 A;  2RJD A;  5FRM A;  2QEX T;  4HT8 A;  1QP2 A;  1X6O A;  2F5T X;  1U1T A;  2L3R A;  3F70 A;  4M77 G;  4RCC A;  4F7U E;  1BYM A;  3FEO A;  1QVF S;  3CC2 A;  5GAN 8;  2K5L A;  2LDM A;  3JCM c;  4ZGJ B;  2ZPB B;  2LCC A;  3SD4 A;  3JB9 H;  3H6Z A;  3QHS A;  4D6W A;  4ZN3 A;  1Y7X A;  2DD5 A;  3OYF A;  3G7Z A;  3CCS T;  2DTH A;  5FU6 C;  1LNX A;  2QXF A;  1H3Z A;  5GAN 6;  4N4H A;  3OS0 A;  2F69 A;  4PJO D;  3M9Q A;  2EWN A;  3JAM E;  4CI0 C;  1YIJ T;  4R55 A;  3MP1 A;  3VU3 C;  4C5H A;  3M4Y A;  3JB9 J;  5CIU A;  2LCL A;  4PNO A;  5A0L A;  2VXF A;  5CKE A;  2RHX A;  4E7K A;  1I8F A;  1YIT A;  4PLL A;  2LQK A;  2GF7 A;  1K9M C;  4N0A A;  3FIF A;  2E1H A;  2K2V A;  5D6W A;  3OY9 A;  3V7R A;  4J6X A;  2EAY A;  2KMT A;  3RMS A;  3CC2 T;  4ZTJ A;  2RB6 A;  5GAN f;  1Q86 C;  2XIC A;  2P4T A;  3JCM h;  5LJ5 d;  3JB9 G;  2HBP A;  4KBM B;  3A8H B;  4IUU A;  4M75 G;  4XTV A;  2P0P A;  1QVF A;  2K5I A;  4B9W A;  1KD1 C;  1BI2 A;  3ER0 A;  3N5B B;  4BE0 A;  2XDD A;  3J7A F;  4EMK C;  1VQP A;  4Y28 E;  4V2S A;  3CC7 T;  1G5V A;  2PQW A;  3JB9 F;  3QPH A;  1MHN A;  3OSS C;  2CZ0 B;  5CQY A;  2FYK A;  2V8K A;  2BIV A;  3ZFJ A;  5GAM d;  2CKK A;  3QDR B;  4J8O A;  3VYG A;  3JCM g;  4F7U G;  3GF5 A;  4MZP A;  5GAN 4;  4XU1 A;  4EPC A;  1XNI A;  5GAO m;  4E7H A;  4IUV A;  2D6F A;  2WSE E;  4M78 C;  4EDU A;  1DJ7 B;  3BY7 A;  4LDW A;  3M56 A;  4EMK A;  4M78 G;  2KVQ G;  3TEE A;  2VYT A;  1LJO A;  2E41 A;  3HL8 A;  2MF2 A;  2R5A A;  3OBY A;  3OMC A;  4X34 A;  4A4H A;  5GAM g;  5GAO p;  3MEU A;  2ZPH B;  2RM4 A;  3SWN B;  5FU6 B;  4BUG A;  5GMK i;  3FC3 A;  3QYH B;  2DIG A;  3MHX A;  5HKC A;  3C12 A;  3PMI A;  3FB9 A;  1YI2 T;  4C92 F;  4LDX A;  3S3N A;  2A7Y A;  3LX7 A;  3OA6 A;  4IUP A;  1Q81 U;  1I81 A;  3QKJ A;  3S6W A;  1BIA A;  3Q1J A;  3OYJ A;  5M9O A;  2DPP B;  2NLU A;  4M75 C;  3I55 T;  3CCM T;  3ME9 A;  3OYH A;  4NOY A;  2VXE A;  1K73 C;  4QW2 A;  2DIQ A;  2EQU A;  4R56 A;  1UGR B;  2M9U A;  3QBY A;  2OTL T;  1VUB A;  4C92 C;  5I2M A;  3CCE A;  3OS5 A;  3HFO A;  1WJQ A;  5LJ3 h;  2QEX A;  1N9R A;  2PVO B;  5LJ3 g;  2RJC A;  1VIE A;  2LTO A;  3PGG A;  3GOX A;  5D6Y A;  1G3T A;  2B8A A;  1YJN A;  1VQL A;  4JS5 A;  1H64 1;  3VKI A;  5A0G A;  2DO3 A;  3X24 B;  4XQ3 A;  3RIR A;  2MAM A;  1NJI U;  5LJ3 d;  4M78 E;  2MI6 A;  4LDV A;  5A2Q E;  3CCS A;  1VQ4 A;  1YJW T;  4N4I A;  4M78 A;  3L2R A;  4Q5W A;  1BKB A;  1OYX A;  4KUL A;  3QUI A;  4QQD A;  4A53 A;  3BFM A;  3HKS A;  3JCM W;  2YLB A;  2XDB A;  2CZ1 B;  4MDX A;  3CEY A;  4C92 A;  2LC4 A;  4OB1 B;  4M77 C;  3CBO A;  3G6E A;  2V8I A;  1KC8 C;  3CC4 A;  4GLK A;  4XTW A;  3TRE A;  5GAM j;  3NTH A;  4C8Q F;  4RCB A;  2K4Y A;  2LVM A;  2MWP A;  3LGL A;  3OSV A;  2DVE A;  4C8Q E;  2XK0 A;  4OP0 A;  4OB3 B;  3JSC A;  3M57 A;  1VQ9 A;  4BY6 B;  1KC8 U;  1VQN T;  1ZQ1 A;  3O8V A;  3CCR T;  2LT4 A;  4A4K A;  1VQ7 A;  4QQG A;  4PJO A;  1M4Z A;  1O75 A;  4LDY A;  4EMH A;  2QQS A;  1YHQ T;  1K8A C;  5I21 A;  4FSX A;  3OYK A;  2L89 A;  5GAN d;  1IRE B;  3LW5 E;  4QQ6 A;  4OMF B;  3OYG A;  5KCO A;  1WGS A;  4HKE A;  3OYN A;  4M78 F;  2OTL A;  4XTY A;  2YRV A;  2XID A;  2QA4 T;  4C92 D;  2OAU A;  3G4S A;  1WJS A;  2JUF A;  5AYF A;  3PTA A;  3H8Z A;  3L2W A;  1WNL A;  2EQM A;  4IKF A;  2DJZ A;  3QZ9 B;  3M53 A;  3OYE A;  4ATO A;  1I4K 1;  3JRZ A;  4UC4 A;  1NZ9 A;  1G3S A;  4HCC A;  4BI3 A;  4XTU A;  1BIB A;  3UWN A;  1YIJ A;  4M7A G;  1YHQ A;  3CCL A;  2DAQ A;  4J6Y A;  1UGQ B;  3E1S A;  3LYI A;  2CZ6 B;  5CKB A;  1RL2 A;  3E9F A;  3V7S A;  2I2L A;  3OYI A;  3LLR A;  3MEA A;  3CCE T;  4FIB A;  5D6X A;  3CPW S;  4PJO E;  2WSC E;  1U1S A;  1M9S A;  2M1H A;  3BDL A;  2CGH A;  3ZEH A;  5LJ5 f;  2RI3 A;  2E6N A;  1YJN T;  1VQL T;  5GAN 3;  1N9S A;  2R58 A;  3ZBD A;  4BE2 A;  2AHJ B;  2RK1 A;  4L5G A;  3CXC A;  3G71 T;  1K73 U;  1JJ2 A;  2DTO A;  1UB4 A;  3C94 A;  2HD0 A;  3A8G B;  3JCM e;  1VQO T;  4X9C A;  1VQ9 T;  4PJO G;  3I56 T;  3HSB A;  2VV5 A;  1JRI A;  3JCM P;  1JBM A;  4M78 B;  4Z02 A;  1KHC A;  2ZZD A;  3G6E T;  4BY6 C;  2RHU A;  1K8A U;  1ZBX A;  2ZGW A;  4XTX A;  2P0K A;  2KDS A;  2EJG A;  3M58 A;  2O4X B;  3DB3 A;  2QQB A;  3DB4 A;  3CCV A;  3OW2 S;  5A0D A;  5HY6 A;  5GAM e;  1VQ8 T;  2DXU A;  4OB2 B;  2RHZ A;  3MET A;  2PVG B;  3GIB A;  4M7A E;  3SWN C;  1UGS B;  5KCH A;  3G71 A;  1TH7 A;  3X26 B;  2L8D A;  4Y91 A;  3PFS A;  2XU8 A;  1XOV A;  4FM4 B;  4DQ2 A;  2MWO A;  1VQM T;  3RER A;  5GMK h;  1FXX A;  2MMP A;  5GAN h;  1Y96 A;  1YCY A;  2YLC A;  2KK4 A;  3L2Q A;  3M4G A;  4RG2 A;  3NFC A;  3A8O B;  3VV0 A;  3RKX A;  5CCA A;  3JCM Q;  3LH0 A;  3QII A;  1VIF A;  2A3L A;  4M75 A;  3V7C A;  3PNW C;  5IN1 A;  5CKD A;  2LNV A;  3HHT B;  4E7L A;  1UGP B;  2E65 A;  3G4S T;  2DK3 A;  2XKO C;  1WJR A;  3SWN A;  1KQ2 A;  4BI8 B;  3TU4 K;  2KQW A;  3L2U A;  4B9X A;  3UT1 A;  3CME A;  1Q82 C;  1WQ7 A;  2ZPF B;  3OB9 A;  3HP9 A;  2PUK B;  4YTL A;  3CD6 A;  4HCB A;  4CRI A;  3PIO A;  4ZN1 A;  4L59 A;  3P8D A;  3V8K A;  4ELY C;  4LDU A;  3CCQ A;  1FWZ A;  3SFM A;  4M7D A;  2D0Q B;  2KY9 A;  3TCJ A;  3V8L A;  2H3J A;  4MZT A;  3I56 A;  1WQW A;  3CCU A;  3EFS A;  3OMG A;  5GAO r;  1N8R C;  2K57 A;  4M7A D;  1SSF A;  5HK0 A;  2G3R A;  2WSF E;  2ZPI B;  3R6O A;  2PUO B;  1B34 B;  4BDZ A;  3OYL A;  2EKO A;  4DA4 A;  4M77 A;  1YJ9 A;  5LJ3 f;  1BI3 A;  3MCA B;  4M77 B;  4F7U F;  3CPF A;  3JB9 I;  4OF1 A;  5IT9 E;  3CD6 T;  4C92 G;  4M7D F;  5KE2 A;  1EIF A;  2XG8 D;  1NPR A;  1WPY A;  2K3Y A;  3C4S A;  3X28 B;  1YBY A;  2QQR A;  4XAX B;  3FLG A;  3QO3 A;  4A54 A;  3CCQ T;  1VQ4 T;  1YJW A;  3SDZ A;  4E7J A;  4RMO A;  2K3X A;  1JB0 E;  5J3B A;  3WVD B;  5CK9 A;  1W2B S;  2M16 A;  2DD4 A;  4C0Z A;  4OGC A;  4QVC A;  4M7D G;  3EFR A;  5GAN 7;  3CMA T;  2XDP A;  2RI2 A;  2WAC A;  2KAF A;  2Y90 A;  3M5A A;  4XTZ A;  4M7D E;  3OS1 A;  1YI2 A;  3OS2 A;  5IAY A;  3LWH A;  1O9S A;  5J26 A;  4JS4 A;  3QXE B;  1W4S A;  3CME T;  1RI0 A;  2CYZ B;  4C5I A;  5FRN A;  2GCX A;  3M55 A;  3E9G A;  3OYY A;  3PMT A;  4KT0 E;  4O5V A;  2JZ2 A;  3I55 A;  4J5Y A;  4HCZ A;  5GMK l;  1QP3 A;  3L2V A;  2E64 A;  1D3B B;  4PLI A;  4JLI A;  5GAN 5;  4NL2 A;  4L6V 5;  5GAO q;  4M75 E;  2EFI A;  4JRI A;  1VQ6 T;  1IZ6 A;  3WXM B;  5GAN j;  4M7D C;  3OYD A;  4C0D C;  3L2Z A;  2X4J A;  4M78 D;  5HK3 A;  2D9T A;  2GFA A;  1HK9 A;  2LX9 A;  1P92 A;  4LD6 A;  3GPL A;  5CO7 A;  2VGM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...