1TH7A

Crystal structure of an archaeal sm protein from sulfolobus solfataricus
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
78
structure length
78
Chain Sequence
GAMNFLAETAHKVLAESLNNLVLVKLKGNKEVRGMLRSYDQHMNLVLSDSEEIQSDGSGKKLGTIVIRGDNVILISPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small nuclear riboprotein protein
publication title Crystal structure of an archaeal Sm protein from Sulfolobus solfataricus
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Rna binding protein
total genus 16
structure length 78
sequence length 78
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature
pdb deposition date 2004-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1th7A00
2Y90A 1U1TA 4M77C 2EJFA 5GANg 2DZ9A 3JCMe 2YHTA 3QUIA 5LJ5g 3EFSA 3SWNB 3JB9J 4M7DE 1LOJA 1Y96B 4M75A 4C92C 4M7DD 2YLBA 4M77D 4XTWA 3RKWA 5GAN4 3RESA 4M78F 3RKXA 4C8QC 5GAMg 4XTVA 3HFNA 1JBMA 4M7DB 4M7AC 3PGGA 4EMHA 4X9CA 5GANj 4M75G 3JB9H 5LJ5j 4OP0A 1H641 4XTYA 4Y91A 1N9SA 1WQ7A 4EMGA 1KQ1A 5GAN2 3RERA 4V2SA 1KQ2A 3RKYA 4M75C 4M78A 4RCBA 5GAMj 5LJ3f 4QVDA 4MMLA 3SWNC 3JCMc 4A54A 4RCCA 4X9DA 4M75E 4WF2A 4M75D 3L1AA 2DEQA 3M4GA 4EMKA 4M78G 2ZGWA 3BDUA 1JRIA 5GMKi 4J6YA 4M7DC 2EAYA 4JLIA 2DVEA 1M8VA 3JCMg 3QHSA 4M75B 5DY9A 3JCMb 1MGQA 5GMKh 3JCMJ 2EJ9A 3GIBA 4M78C 1M5Q1 1I4K1 5LJ3e 2DKGA 3INZA 4XTXA 5GAOr 5GANd 4M78E 4F7UF 3EFRA 4M78D 2E1HA 4J6WA 4JRKA 4J5YA 2VXEA 3VU3C 5GAN6 5GMKm 1B34A 5LJ5d 5LJ3h 2E65A 4PJOF 1D3BA 2E10A 4PNOA 4M78B 5GAMd 4QVCA 3BW1A 4MMKA 1U1SA 4NL3A 5GAMf 4F7UA 4EMKB 2DTHA 3BY7A 4N0AA 1LJOA 1WNLA 1YCYA 2YLCA 5GMKe 1I5LA 4PJOA 3JB9F 1I8FA 5GMKl 2HNIA 4M77F 2EJGA 2DTOA 2VXFA 4F7UG 4J6XA 5GAOq 4XTUA 1HK9A 1LNXA 4C92F 2RM4A 5GANh 4NOYA 1X01A 4PJOG 5GAMe 4A53A 5GAOn 4XU2A 4C8QF 5LJ5h 4HT9A 3JCMX 4XTZA 4XQ3A 1B34B 2E64A 2DXUA 4DQ2A 3QO3A 3JCMd 4M7AF 4M77A 4EMKC 3FB9A 1D3BB 4F7UE 5GAMh 5GANf 3AHUA 4NL2A 3JCMQ 5GAOp 2CGHA 5LJ5f 4XU1A 4C92A 5GAN5 2FB7A 4HA8A 3QSUA 3JB9G 4PJOE 3V7CA 3V8LA 4M77G 4C8QA 4F7UB 3JCMW 3L2ZA 3SB2A 4JUVA 4HT8A 4M7AA 3V8JA 5GAOm 3JCMP 4C92G 4PJOB 4JRIA 4C8QG 2DXTA 5GAN8 3RIRA 1WQWA 5GANe 2JN0A 5GAN7 3V7RA 4XU0A 3BFMA 1HXDA 5LJ5e 3FJPA 4M7AG 3JB9D 1BIBA 1WPYA 4M77E 2FYKA 1I81A 2EWNA 3SWNA 1TH7A 1Y96A 3HFOA 3JCMh 5LJ3g 5GAN3 4C92E 4C92D 2DZCA 5GMKj 2E41A 4M77B 4C8QE 5GAOl 4C8QD 1BIAA 2I2LA 4XU3A 4N0AC 4M7DA 4M7DF 2K57A 4M7AE 4PJOC 2DTIA 4C92B 3HSBA 3FIFA 5LJ3d 3JCMf 5CAIA 4M7AD 2VC8A 3JCMV 4C8QB 3V7SA 5I21A 1N9RA 5LJ3j 3JB9I 2RD1A 4M7DG 4M75F 4M7AB 4PJOD 2DJZA 2QTXA 2RA2A 2RB6A 3V8KA 3RUXA
chains in the Genus database with same CATH superfamily
1WGSA 4II1A 1K1ZA 1U1TA 2KXDA 1BI1A 2D6FA 1Y96B 2GCXA 1RABB 2COZA 3CCVT 3OS5A 3E1SA 2CDTA 3HFNA 2O01E 4M7DB 4EMHA 2ED1A 2F2WA 2QYZA 1GL5A 2DIGA 1KQSA 5GAMj 4QVDA 2Z0WA 4HVUA 3NTHA 3E2UA 3GBQA 4M75D 4E7SA 4D8KA 4L6V5 4LDYA 1IHWA 1WJSA 3BDLA 3JCMJ 2X35A 5I2MA 1OEBA 3CXCS 3OBYA 1VQNA 3UWNA 4JRKA 5GAN6 2KI7A 3NMZC 5LJ3h 2V26A 2CZ6B 3TEEA 2RQRA 1RAFB 3EH1A 4OMMA 4N4HA 1VQNT 1P92A 1WXBA 1PKSA 1FMKA 2EJGA 4JZ4A 2RI2A 1VQ6A 4J9CA 1OU9A 4HT9A 5EG2A 1OU8A 2GTOA 1B7TA 1YWPA 2AK5A 1W1FA 3R6OA 3HPWA 2L89A 3CCMQ 4XU1A 5CKEA 1VQ6T 2EPDA 1RI0A 4F7UB 4ATOA 2QA4A 3H0HA 2PQWA 1TS9A 2Y4XA 4C8QG 3QBYA 2JN0A 4M7AG 2E6ZA 4FIBA 1UUEA 3PMTA 2QQ9A 2RMOA 5GAN3 2QA4T 4FW1A 1BIAA 3VS7A 4LD6A 5FU7C 4C92B 5LJ3d 1W70A 2VC8A 4KGZB 3CBPA 3FDRA 3QWXX 3OYMA 2LZ6B 2K3BA 5A0LA 1QVGP 2CSQA 1M3AA 4BI3A 5GANg 1VOMA 4Z8AA 1M3CA 2AZSA 3DB4A 1A0NB 2HMAA 3OYCA 1LVKA 2V8JA 3SFMA 1CKAA 3JB9H 2HBWA 2HAXA 3MP8A 3PVLA 3QDRB 3CMAA 2G6FX 3Q1JA 2H8HA 4RCCA 5HY6A 4E7HA 1MNEA 2MPXC 1ABOA 1M4ZA 2J6OA 2EAYA 2KDSA 3JCMg 5IHKA 3OYEA 1B3QA 1I4K1 2DKGA 4IURA 2O88A 1FMWA 3KUFA 2L3PA 2B8AA 3EGXA 3HHTB 1D3BA 3NHNA 2IVWA 3META 3OSSC 3MP1A 3UPUA 2R58A 2DNUA 2ECZA 1OYXA 4RUGA 4LDWA 4PJOA 1EIFA 3X25B 1YJ9A 1I07A 1WX6A 2RM4A 4E7LA 5LJ5h 2R5MA 2JT4A 2KK4A 1BCOA 3VYHB 3I56Q 4PJLA 3M0TA 1VQ9Q 2A36A 1QW1A 1YJ9T 2VVKA 3JRZA 1VQ8A 4TVRA 3V7CA 2X4XA 5KYUB 2ED0A 1QVGS 1MMGA 4KRTA 2YUQA 4JS5A 3RIRA 1HXDA 4C5IA 2RQVA 2J6FA 4M77E 1YN8A 3PFSA 5J39A 4BD3A 3I55Q 1TH7A 3CCSQ 1BKBA 3CMEA 4KULA 2YUNA 3GF5A 1VQ4A 1XJWB 1Q7YR 4PJOC 4R0KA 1ZLMA 2DYIA 3M55A 2FRWA 2RI3A 2D8JA 5LJ3j 1NEGA 4JRQA 4M7DG 4M75F 3QWYA 3CMET 3EFOB 2RB6A 1KC8R 1VQ4T 2L3QA 5IH2A 2Y90A 1UGPB 2PU9B 5FRMA 2EJFA 1YI2Q 3A1PA 4F16A 3OS2A 2KGTA 2DL8A 4J8OA 4J9IA 1JBMA 4HVWA 3MJXA 5HCKA 2CH4W 4UC4A 2BZYA 3T9NA 2LCSA 1FWZA 2RHUA 1C1AA 4KH1B 4QVZA 2DEQA 1IO6A 4ESRA 4IUQA 4RTYA 2LMJA 1NPRA 2VWFA 2J6KA 4FSXA 1UHCA 5HKCA 2IIMA 2FPEA 2EBPA 1S72A 4M78D 3A8OB 2VXEA 3CPWA 3DLMA 1VQMQ 3REAB 2F1LA 3M9QA 4FL6A 2LTOA 1S72T 3OW2P 2XK0A 1I8FA 5GMKl 2OTJQ 3NTIA 3CC2A 4F7UG 2DERA 2W0ZA 4XTUA 4RTTA 3LH5A 2CH4A 3EG9B 4M4ZA 2ESWA 2E64A 3MHXA 3OMGA 4KGXB 4ZN3A 1T0JA 3CC2T 2CGHA 2ZCFB 1JJ2P 2A7YA 2NUPB 3QSUA 3SB2A 3GNFB 4C92G 2HZYA 1QKXA 2EQKA 3H9NA 4QT7A 4PFOA 2YT6A 4MZMA 2LJ3A 1RAEB 1G5VA 1I0CA 1D0XA 4XK8E 3TCJA 4OB2B 4R55A 2HDAA 3JAME 5FWBA 1QCNA 3DKMA 1NEBA 2DJZA 2QTXA 1M1KU 2FZCB 3QZ5B 2PZ1A 4HCCA 2MOXA 2PUKB 3CCEA 3GNGA 3JB9J 2FG0A 2QG9B 4J9HA 2YWWA 3NPFA 5I11A 3M53A 5J3BA 2PVOB 2CYZB 5LJ5j 3CC4A 4Y91A 3I35A 3OYLA 2RJFA 2E12A 3CCET 3QDFA 4GLMA 1PM3A 2MCNA 1MUZA 1KQ2A 2RHIA 3G7ZA 3TSZA 1K73R 2CZ7B 2DL3A 1YHQA 3H41A 9ATCB 3A8MB 3OW2S 4AFZC 3CC4T 5CQXA 4JLIA 4M75B 2XIDA 2E70A 1MGQA 2KY9A 1Y57A 2JNGA 4E2FB 1IXDA 1YHQT 3RBBB 1M1KC 3ASKA 1DJ7B 4J9EA 5GMKm 4D6WA 3VS1A 4Y92A 4QVCA 1JJ2S 1U1SA 1NLOC 1SHFA 4OGEA 4O6JA 2QQRA 2QEXQ 1VQPQ 5C0MA 1SKUB 4Q5WA 5GMKe 2EYQA 3QZ9B 1RUWA 3HL8A 2RI5A 3MO8A 5GAOn 4NOYA 3EH2A 2LRQA 1YIJA 2K5IA 4BI8B 4OMOA 3A8LB 2RF0A 1H3HA 1ZA1B 1TSFA 2KXCA 1Y07A 3L2ZA 3G71A 1YIJT 2ZAEA 1LCKA 2RK2A 1N8RR 1SF9A 2DX1A 1BIBA 1X69A 3MP6A 1Q82R 1PG5B 1M30A 4JDSA 1BCMA 5CKHA 3G71T 1PSEA 3C95A 3PTAA 5GJVB 3MEAA 2K57A 3ULRB 4BUGA 4MDXA 5KYXB 4J7FA 1PNJA 3FLGA 4PJNA 4DBRA 2L2PA 1SSHA 3C12A 2DO3A 2J7IA 3G6EQ 3G4SA 3EFSA 3SWNB 1LOJA 4CC2A 2YLBA 3PVQA 2MWPA 4M78F 3A5ZB 1EZZB 4RTVA 3EAEA 3G4ST 2DBKA 2KNBB 2XI9A 2D1XA 2OX7A 4J9BA 5DLOA 1K8AU 5CVIA 3FEOA 4BI4A 2K2MA 2X9HA 4EMGA 1QVPA 2ENMA 2X4WA 1PRMC 2QASA 4C0DC 3MEVA 3CC7Q 4OMPA 1WXTA 1D1AA 4BB7A 2ZPBB 4GBQA 2NYSA 1WHHA 1OV3A 3VS6A 1B34A 1UGVA 1WLPB 3OB9A 2JUFA 5GAMd 1M1FA 1VIEA 1NG2A 4EMKB 3S6WA 3UATA 1UB4A 3CCJQ 2CP3A 3OQ5A 2QK0A 5GAOq 5FU6C 3L42A 4CC3A 1K8AC 5KCOA 4HCBA 4EPCA 2KT8A 1WHJA 1OULA 1M2OA 4WTOB 3HKSA 2XD0A 2LT1A 1IZ6A 1WYXA 4FW2A 5LJ5f 2K5LA 2PNIA 3BE3A 1ZSZA 3CCQQ 1GBRA 4JUVA 1SRLA 1RAAB 6AT1B 2ROTA 4LUEA 1X2QA 3M0PA 1KQSP 3EG0A 4LDXA 1XQHA 3CPFA 1PSFA 4N4GA 3URGA 4PK4A 1M27C 1QVFA 4C8QE 2EQJA 1V76A 1IGUA 2LC4A 4M7AE 4C5GA 2DTIA 1H92A 1FXXA 3FIFA 1N9RA 4E6RA 3CD6A 2D0QB 4BY6C 1RAHB 2HKNA 1Q81U 4JJCA 2JZ2A 2KAFA 1V29B 3UDCA 5IHNA 1GCPA 3X20B 1TTHB 1R0CB 3LW5E 1KG1A 2DILA 4ORZA 4FT4A 4ELZC 3CD6T 1M90R 4M75G 4OP0A 4DEXA 3I5RA 2RJDA 1W2BP 3RERA 4BE2A 2LDMA 2K9GA 1UFFA 4E47A 2ZGWA 3BDUA 3RDVA 2ATCB 4IIMA 2FRYA 1WHKA 3EHRA 3JCMb 1M5Q1 1G3SA 1TG0A 1BB9A 3VRYA 1Q81C 5HK3A 3VU3C 4J5YA 5CKDA 2A0FB 4M78B 3GLXA 1QP2A 2EYZA 1OI1A 3CCVQ 2KR3A 4HCZA 1QMCA 1AZEA 2RJCA 4X1VA 2HNIA 3EGDB 1VYVA 1O9SA 1YNZA 1KQSS 4FYYB 1X43A 1S1NA 2YRDA 2A37A 1VQ7Q 5GAMe 2CP7A 3I5SA 2AT1B 2OAUA 3A8GB 2GFAA 4M77A 4LDVA 4AT1B 4NL2A 5FLXE 1M3BA 2QI2A 2GNCA 3OYKA 1YP5A 1V1CA 5GAN8 5GANe 4XU0A 2NUTB 1WPYA 1NYFA 1QP3A 3KXTA 2DL4A 3HFOA 4P5NA 1VQNQ 3CCMA 1UGRB 2QXFA 1E6GA 3LYIA 5KYYB 3TVTA 1W2BS 1F1BB 4JJDA 5FROA 2RD1A 2WSEE 5D6YA 3DLLA 2HSPA 2K5FA 3E19A 3QJYA 1NE8A 3CCMT 3SDZA 4M77C 4C5EA 3JCMe 1Q95G 4QW2A 4M7DE 1KFZA 4OB0B 5GAMg 1CSKA 4JZ3A 5D6WA 2VGMA 5KYWB 4FU6A 2BZXA 1WZOA 3C0CA 1VQKQ 3L1AA 2DD5A 2HD0A 4KUDK 1AWWA 2DXBA 1SEMA 2F2VA 3EFRA 1UECA 4RTUA 2DBMA 1EFNA 4PJOF 4F04B 3C94A 5IHIA 3LWHA 2EGEA 5CO7A 1O75A 3BY7A 3THKA 4J9DA 3WXMB 1WDXA 1YJWA 4HXJA 3OYYA 3EG1A 3CMAT 3DB3A 2L3SA 3M58A 5I2SA 1VUBA 2LJ0A 2BUDA 2XKOC 1HD3A 1MNDA 4F7UE 1YJWT 2EFIA 3AHUA 2KMTA 3G1JA 2ROLA 1TUDA 2HQEA 2O9VA 3O5ZA 3OMCA 5FU7B 1SPKA 1KHIA 5CK9A 2F2XA 3ZEHA 2E5QA 4QQGA 2VUBA 2PUOB 3I56A 1JB0E 4C92E 1YJNA 3IQLA 3PIPA 1VQ9A 2XDDA 4ZN1A 1G3WA 4B9WA 2X3WD 1M9SA 3REBB 1RLQC 3I56T 1YJNT 2CSIA 3VRZA 3CPWP 1VQ9T 2EQMA 2WACA 2YSQA 4FSSA 3J80E 2LQKA 5DM7R 1KD1C 1AWOA 1VQ8T 2I0NA 3X26B 3CCSA 4J7IA 5GAN4 1GCQA 2O4XA 1NJIU 2K3XA 2QTVA 1WQ7A 4C0FA 1KQ1A 2M9UA 3CCST 2LQWA 4CRIA 1YI2A 3H0IA 4M78G 3GP8A 3MKDA 4KBMB 1HJDA 1H8KA 4DBHA 5GMKh 1HSQA 4FYWB 5LJ3e 1MV3A 3CMEQ 4RG2A 5GAOr 3J7AF 4KH0B 1YI2T 5LJ5d 3ZL7C 1SRMA 1VQ4Q 4PNOA 1MMNA 2RQTA 1GCQC 1G3TA 4IIOA 1NJIC 5M9OA 2DTOA 2VXFA 4MZPA 4N4IA 4A53A 1N6AA 4XU2A 1VYUA 4Z88A 4XQ3A 3QO3A 3EGXB 1Z9QA 1VQMA 1D3BB 4WCIA 3VYGA 2BIVA 3OYGA 5L8RE 2FB7A 2M51A 2AKKA 2DXCA 1X6GA 2OTJA 4PJOB 2JM8A 3CPWS 1WHLA 2MK5A 1VQMT 3TSWA 1RACB 1PD0A 5LJ3g 5IAYA 1TOVA 1YWOA 2OTJT 1S72Q 2I2LA 3OS0A 5CAIA 1YITQ 3V7SA 1VQLA 4Z02A 2RA2A 4LDUA 1RAGB 1OPLA 4OB3B 2OJ2A 4ZGJB 1RADB 3QYGB 2L0AA 4X34A 1AT1B 4A4GA 3CC2Q 1VQLT 1JXOA 5IXBA 2YRCA 1RI9A 3R6NA 2KRMA 3EG2A 2LNHB 3TQ7P 2DYBA 1C0MA 4ZGDB 1UGQB 1T3SA 4M75C 1NYGA 4A54A 2RN8A 3M4GA 3OBWA 4KGVB 3MCAB 4IUVA 2JXBA 3GIBA 2VASA 4Y28E 2HSEB 3ER0A 3A8HB 3H0FA 2FL7A 2YXYA 2E10A 4GLKA 2CS7A 4NL3A 2JS0A 3L2WA 3M54A 1M1KR 2XDPA 3CCUQ 4RG8A 4YTLA 2KROA 2M16A 2SRCA 2MWOA 2HQXA 3CCEQ 2FVUA 2K2VA 4LXCA 2LQ8A 4ME7A 1KK7A 2JTMA 3JCMX 1TXQA 4OB1B 2WSCE 2F5TX 2LCCA 2E6NA 1K0XA 3FRNA 1UE9A 5GAOp 1X75C 2K4YA 2OI3A 4HA8A 4C8QA 2QEXA 1VQPA 4CC7A 4ZTJA 1B07A 2CKKA 4M7AA 2L3RA 4OVAA 1GXIE 2RHZA 2OTLQ 1Y71A 3O8VA 2P84A 2VKNA 1VQOA 2QGGA 2QEXT 1VQPT 1FYNA 5GMKj 2KYBA 2O31A 3TREA 3QIIA 3JCMV 1VQOT 3M59A 3M0RA 3S3NA 3L2QA 1QCFA 1R0BG 2QQSA 3C4SA 4ZNXA 4R56A 5LJ5g 4CI0C 2V8IA 2K79A 4AFQC 2BTTA 4C8QC 3PT9A 2FPDA 4HCKA 1ZUKA 3E9GA 4M7AC 1M2VA 3RMSA 2W10A 3EGUA 2CP5A 2EW3A 4JS4A 4FYXB 4BE1A 2LP5A 4M75E 5J26A 3G71Q 2FEIA 5I22A 1AZGB 3CCRQ 2JMAA 4A4EA 1Q86U 4LE9A 4BACA 4L5GA 3VKIA 2NWMA 3L2VA 2CZ1B 2E1HA 2DETA 2K7AA 2VGNA 3QPHA 1KIKA 4O5VA 3KFVA 2MYSA 4MMKA 1PHTA 2YRVA 3UT1A 2BE9B 1WA7A 3CC7A 2BE7D 1LJOA 2V8KA 5EC7A 2CT4A 2QQAA 3G4SQ 5FRNA 1LPLA 2GQIA 1BI0A 2P4RA 1YCSB 5GANh 1OOTA 4PJOG 3CC7T 2P0KA 2BKDN 4DBFA 2DXUA 1X6OA 2EYXA 4FM4B 1K8AR 1D1CA 1I1JA 2ZPGB 1FX7A 2KBTA 2M0YA 2FZGB 3UA6A 1K9MU 3OSVA 3RR6A 1Q86C 3JCMW 3F70A 3V8JA 2EVRA 5KYYA 1M1GA 3CCJA 3VJPA 2DXTA 1WQWA 2GFUA 3EHQA 4PFPA 1Y96A 3JCMh 3X24B 2LQNA 3CCJT 4ZTFA 4M7DA 2JS2A 2ZZDA 1X6BA 2XDBA 1KHCA 3CCQA 1JQQA 1UGSB 3JB9I 4PJOD 1ZHIA 2YUOA 1FMVA 2JMCA 3FJ5A 3RUXA 1VA7A 3TU4K 3M57A 4JPBW 3QG1A 3S3MA 1VQ5Q 2DF6A 4A4HA 1PKTA 3CCLQ 1BK2A 3CCQT 4OMLA 4C0DB 4XTWA 3RKWA 2R57A 1QWFA 1TUGB 2H3JA 1K9MC 2P4TA 4OGCA 1G2BA 2HL5C 4X9CA 5FWCA 3VS4A 5IN1A 3L2UA 4RCBA 4EIKA 2GBQA 1QVFS 4WF2A 4M7DC 4M78C 1TU0B 1PCXA 4XTXA 8ATCB 2DD4A 3CBMA 4OMQA 3RMQA 1E6HA 2DK3A 2HBPA 1QKWA 2CT3A 5FU6B 1ACMB 3H6ZA 3CQTA 3NGPA 1MMDA 3I9QA 4F7UA 2LX7A 1Q81R 1WNLA 3QYHB 4PJJA 4C5HA 4M77F 4J6XA 4Z89A 2RJEA 2CZ0B 2J05A 3FC3A 1R8OB 1B34B 2A28A 3UF4A 3HRSA 4RMOA 2X4JA 3VS3A 4C92A 4PJMA 1GFCA 1R77A 2KE9A 3V8LA 2Y4YA 1E7OA 3OYJA 2RO0A 2K6DA 1GFDA 2DMOA 4DA4A 1VQ7A 3JB9D 4ELYC 4BY6B 4F14A 2C0IA 4GY5A 3ME9A 2HL3A 1MV0B 1UTIA 1BI2A 2XU8A 3L2RA 1VQ7T 1ZSZB 3M0SA 2RQWA 1G3YA 3EG3A 1AOJA 4CC4B 3V8KA 3CXCA 1U5SA 2GQVA 3N5BB 4AG2C 2L5QA 1IHVA 4C92C 3LWIA 1NZ9A 5FW9A 4B9XA 2E3HA 2EQUA 2V1RA 1D0YA 2VV5A 1Z9ZA 3OYHA 5GANj 2A08A 3LLRA 1ZUUA 3OYNA 4MMLA 3SD4A 1QCOA 4DBQA 4FCYA 1JRIA 2RHYA 5DY9A 1W2BA 2AZVA 2P0PA 1VQ6Q 4M78E 2CUBA 1OPKA 1VQKA 3KBGA 2DTHA 5KYUA 1PWTA 4N0AA 1I5LA 2XHCA 5CKBA 3H8ZA 4E7JA 1OX8A 2QA4Q 3VUZA 5KCHA 2CUDA 1AVZC 1VQKT 1GBQA 5IT9E 2YDLA 3WVEB 2DM1A 2DA9A 4ANJA 2RHXA 2EYWA 1OQKA 1CKBA 3CEYA 3EFOA 3PE0A 3M5AA 3D7SB 1KJWA 1D0ZA 1SG5A 1W6XA 5ECAA 3M56A 2JOYA 3NTKA 2O2OA 4OF1A 3UA7A 2ZPEB 1G83A 2PVDB 2KSSA 2KVQG 2JJ9A 4M77B 4K11A 4A63B 1UG1A 4C8QD 1K4US 3AT1B 4N0AC 1D09B 1KD1U 3HSBA 4M7AD 2PTKA 4BDZA 1VYTA 1IB8A 5AYFA 3HTRA 2DAQA 3OYDA 3CMAQ 2VYTA 2JTFA 2X4YA 2D9TA 1BBZA 2DZ9A 4J83A 3X28B 1YJWQ 3QUIA 2JTEA 1K76A 3QKJA 2BZ8A 4XTVA 2YUPA 3A98A 2QDYB 1WHMA 1KD1R 1H641 5CR2A 3NFCA 2D0NA 5A0DA 4V2SA 2MI6A 1AHJB 1VIFA 2SEMA 4ZGEB 3P8DA 1U06A 1WJRA 2LJ1A 5IXFA 5LL6S 2DVEA 3I55A 1KSWA 2EJ9A 1YJ9Q 2ABLA 1JO8A 4BE0A 1T3LA 2XG8D 5A2QE 1YJNQ 3EG9A 1QVGA 1Q7YU 1BYMA 4DEYA 2COWA 2LVMA 3I55T 1WJQA 3PNWC 1AWXA 1VQ8Q 3GOXA 5GAMf 2NUPA 1KC8U 2CP0A 1YBYA 4FYVB 3JB9F 2JVVA 2X3XD 1UJ0A 4AFSC 1JXMA 1HK9A 3SHWA 2QAZA 3VS5A 1NJIR 4J9GA 1MHNA 2OAWA 5GANf 4PL6A 1D1BA 2LCLA 3ZFJA 2CREA 3M0QA 4QQ6A 1Q7YC 3BFMA 3FJPA 1NPPA 2FYKA 2F5KA 2LNVA 1SSFA 2GTJA 1XNIA 1EX4A 2MF2A 4JRPA 1KC8C 4NS5A 2PVGB 2FHDA 3JCMf 1C6VX 2QQBA 2P0QA 5HK0A 2M1HA 4OMNA 1Y0MA 2RNAA 2YHTA 2AKLA 2WSFE 2VB6A 4M7DD 4M75A 3LGLA 3RESA 3VS0A 1NLPC 4IKFA 2DL7A 1YITA 7AT1B 2M02A 4LNPA 4DOWA 2QDLA 4E7IA 2FO0A 2GGRA 5AT1B 3WVDB 4A4KA 4HVVA 4HKEA 2ZPHB 3M4YA 1YITT 5D6XA 5GMKi 4RTZA 4J6YA 1M8MA 2E3IA 2LT4A 3VS2A 1JU5C 3HP9A 4XAXB 2O4XB 4PFZA 1G8XA 1QLYA 2RQUA 1PC0A 1NM7A 4E7ZA 1N27A 5L23A 1ZQ1A 1VQLQ 2GF7A 2DIQA 2C0OA 3MEWA 2JM9A 1WIEA 1YCYA 3E9FA 2R5AA 3OA6A 1AEYA 1U3OA 4B6MA 4IUTA 4C8QF 2H3EB 4XTZA 2C06A 4DQ2A 2RH2A 3OS1A 4M7AF 1WXUA 1J3TA 1W4SA 1BI3A 2L8DA 2G3RA 2HKQB 5KE2A 3VUBA 4PJOE 4LN2A 4M77G 1K73U 5KYXA 3CCUA 2DVJA 2ZPIB 1BU1A 4HT8A 1N5ZA 4A4FA 1NBEB 2KT1A 1OZ2A 3V7RA 1XOVA 5LJ5e 1ARKA 4RTWA 5CKFA 3SWNA 3CCUT 1ABQA 2HEQA 3OY9A 4C92D 2DEUA 3QJ6A 1IREB 2MAMA 5GAOl 2IPOB 3OW2A 3SEMA 4EDUA 2KQWA 4PLLA 1RL2A 3CC4Q 1JEGA 1HYOA 3HRUA 5GJWB 2OTLA 3RNJA 5KH6A 1AWJA 2A3LA 2V1QA 1YHQQ 2XMFA 2KYMA 3MPUB 1OZ3A 4M77D 1K0SA 1JJ2A 3RKXA 1K73C 3P8BB 3P8HA 3QXEB 2OTLT 1YFNA 3PGGA 4MZTA 3OYFA 4XTYA 1N9SA 5LJ3f 1OX9A 1PRLC 3SWNC 3JCMc 4D8DA 4X9DA 4PLIA 4EMKA 1SHGA 2RPNA 4C0GA 1N8RU 1IGQA 5A0GA 4PKCC 1Q82U 3INZA 1TWBA 1VQOQ 3JSCA 2DL5A 4J6WA 2MMPA 1YIJQ 4DOVA 2E65A 2JW4A 1ZUYA 4J9FA 2CP6A 1ZX6A 2FZKB 1K9AA 4L59A 2EIFA 3GPLA 3S3OA 3LX7A 3G6EA 1UDLA 3CCRA 4IUUA 3OYIA 2EYYA 2HCKA 4QKUA 2COYA 2DLPA 1UHFA 1X01A 2DE0X 2DRMA 2E4HA 2RK1A 2IG0A 3G6ET 4JLGA 3CCRT 4EMKC 3FB9A 3JV3A 5GAMh 4LUDA 1N8RC 4LD9K 5GAN5 4MDWA 1Q82C 1QVFP 2K3YA 5GAOm 5KE3A 3JCMP 4AFUC 1ZSGA 4M7DF 4OMFB 4VUBA 1RAIB 2EGCA 1I81A 1Q86R 2KEAA 5CQYA 1ZA2B 3J81E 2E41A 3OYAA 2MIOA 4F17A 1U8RA 1TUCA 4C8QB 5I21A 3OYBA 3MEUA 2NLUA 2J06A 4M7AB 2EQIA 2DPPB 1X2KA 4QQDA 4JJBA 3LH0A 2EKOA 2ZPFB 4C0ZA 2XICA 2B86A 3U23A 1MMAA 5GAN2 3RKYA 4M78A 1K9MR 4AG1C 2M0OA 2EGAA 1VQ5A 1ZBJA 2CP2A 2FPFA 2AHJB 4FT2A 2AIRB 1UEBA 3CCLA 4RKUE 1T0HA 2KRSA 1M8VA 3QHSA 5C6SA 3EGDA 3VV0A 1VQ5T 1M2VB 2DFUA 1QWEA 5GANd 4F7UF 3HRTA 3CCLT 1Y7XA 1ZBXA 2HQHA 2E5KA 5D7UA 3BW1A 1GRIA 4E7KA 2NUZA 4BDYA 1WFWA 3LGFA 2LX9A 2YLCA 3CBOA 4KUIA 2C0TA 1RLPC 5CCAA 4JJNK 5DLQE 1LNXA 2NUTA 1X27A 4C92F 5KYNA 1M90U 3CXCP 1H3ZA 1QQJA 4KT0E 2DRKA 3JCMd 3ZBDA 1WI7A 1IRXA 3JCMQ 2DJQA 3JB9G 2QGFB 3CD6Q 4JRIA 1UJYA 3M0UA 5CIUA 2EKHA 4RTXA 5GAN7 4IUPA 3PIOA 2D8HA 1XTDA 2EWNA 1ZSZC 2O9SA 2DZCA 1I5OB 4XU3A 2KRNA 4AMCA 8AT1B 2F69A 1AD5A 5KYWA 1WHGA 3CCVA 1M90C 2X51A 3PMIA 1PD1A
chains in the Genus database with same CATH topology
2X4YA 1WGSA 4II1A 4OB3B 3C12A 2D9TA 4ZGJB 2DO3A 3QYGB 3G4SA 1U1TA 2DZ9A 4X34A 4J83A 3X28B 3QUIA 4A4GA 3EFSA 3SWNB 1BI1A 1VQLT 2D6FA 1LOJA 1Y96B 2GCXA 2YLBA 3CCVT 2MWPA 3OS5A 4M78F 3A5ZB 3QKJA 3E1SA 4XTVA 3HFNA 2O01E 4M7DB 4EMHA 3EAEA 3G4ST 4ZGDB 2QDYB 2XI9A 1H641 5CR2A 5DLOA 2DIGA 1K8AU 3NFCA 5CVIA 1UGQB 3FEOA 4BI4A 4EMGA 5A0DA 1QVPA 1KQSA 2MI6A 4V2SA 1AHJB 1VIFA 4M75C 5GAMj 4QVDA 2X4WA 4A54A 4C0DC 3NTHA 3MEVA 4M75D 3M4GA 3P8DA 4ZGEB 3OBWA 1WJRA 4BB7A 4L6V5 4LDYA 2ZPBB 5LL6S 2DVEA 3MCAB 1WJSA 3BDLA 3I55A 3JCMJ 4IUVA 2EJ9A 3GIBA 2X35A 5I2MA 4Y28E 3CXCS 4BE0A 3ER0A 2XG8D 5A2QE 3OBYA 3A8HB 1VQNA 3UWNA 4JRKA 2FL7A 5GAN6 1QVGA 1B34A 5LJ3h 1Q7YU 1BYMA 2E10A 2LVMA 4GLKA 1WJQA 3OB9A 3PNWC 2JUFA 5GAMd 3I55T 1M1FA 2CS7A 1VIEA 2CZ6B 3TEEA 4NL3A 5GAMf 3GOXA 4N4HA 3L2WA 3M54A 4EMKB 1KC8U 1VQNT 2XDPA 1P92A 4RG8A 1YBYA 4YTLA 3S6WA 2M16A 3JB9F 1UB4A 2EJGA 3OQ5A 2JVVA 5GAOq 5FU6C 3L42A 2RI2A 2MWOA 1K8AC 5KCOA 4HCBA 2HQXA 1HK9A 4EPCA 2FVUA 1VQ6A 2K2VA 2LQ8A 4HT9A 4ME7A 2JTMA 3JCMX 5EG2A 2WSCE 4OB1B 2F5TX 2LCCA 2E6NA 3HKSA 2XD0A 2LT1A 1MHNA 3FRNA 3R6OA 5GANf 3HPWA 1IZ6A 2L89A 4LDUA 5GAOp 5LJ5f 1X75C 4PL6A 2K5LA 2K4YA 4XU1A 4HA8A 5CKEA 1VQ6T 1RI0A 4C8QA 4F7UB 2QEXA 1VQPA 2LCLA 4ZTJA 3ZFJA 2CKKA 4JUVA 4M7AA 4ATOA 2L3RA 4OVAA 1GXIE 2QA4A 4QQ6A 2PQWA 2Y4XA 2RHZA 4C8QG 3QBYA 1Y71A 2JN0A 4LDXA 1Q7YC 1XQHA 3BFMA 3CPFA 3FJPA 4M7AG 3O8VA 1PSFA 2E6ZA 1NPPA 2FYKA 4N4GA 3URGA 2F5KA 2LNVA 1VQOA 1SSFA 2QEXT 1VQPT 4FIBA 1XNIA 3PMTA 2QQ9A 5GAN3 2MF2A 1QVFA 5GMKj 2QA4T 4JRPA 4C8QE 1KC8C 1BIAA 2EQJA 4NS5A 2PVGB 4LD6A 2LC4A 5FU7C 4M7AE 4C5GA 2DTIA 2FHDA 3TREA 1FXXA 3FIFA 5LJ3d 3JCMf 4C92B 2QQBA 3QIIA 2VC8A 3JCMV 1N9RA 3CBPA 3FDRA 1VQOT 3M59A 3CD6A 3OYMA 3S3NA 2D0QB 4BY6C 3L2QA 2P0QA 5A0LA 1Q81U 5HK0A 2JZ2A 2KAFA 2M1HA 1V29B 2QQSA 3C4SA 3UDCA 4R56A 4BI3A 5GANg 3X20B 2YHTA 5LJ5g 3LW5E 4CI0C 2WSFE 3DB4A 2V8IA 1KG1A 4M7DD 4M75A 4ELZC 3LGLA 4FT4A 3CD6T 3RESA 3OYCA 4C8QC 2V8JA 3PT9A 3E9GA 4M7AC 3SFMA 4M75G 4IKFA 3JB9H 3RMSA 1YITA 4OP0A 2HAXA 3MP8A 2RJDA 3QDRB 3RERA 3CMAA 4DOWA 4BE2A 4JS4A 2LDMA 3Q1JA 4E7IA 4A4KA 4BE1A 4RCCA 3WVDB 5J26A 4M75E 4HKEA 5HY6A 4E47A 4E7HA 2ZPHB 3M4YA 2ZGWA 3BDUA 1YITT 1M4ZA 5D6XA 5GMKi 4J6YA 2EAYA 2KDSA 3JCMg 3OYEA 2LT4A 3JCMb 3HP9A 4A4EA 1Q86U 1M5Q1 1I4K1 2DKGA 2O4XB 4IURA 1G3SA 4L5GA 4XAXB 3VKIA 4BACA 3L2VA 1Q81C 2CZ1B 2E1HA 3KUFA 4J5YA 3VU3C 5HK3A 2VGNA 3QPHA 5CKDA 2B8AA 3HHTB 4O5VA 1D3BA 4M78B 1N27A 3GLXA 4MMKA 1QP2A 2IVWA 3META 3MP1A 1ZQ1A 2YRVA 3OSSC 3UT1A 1OI1A 2GF7A 3UPUA 2R58A 3CC7A 4HCZA 1OYXA 2DIQA 3MEWA 1LJOA 3E9FA 1YCYA 3OA6A 2R5AA 2RJCA 2V8KA 4LDWA 1EIFA 4PJOA 2HNIA 2QQAA 3X25B 1O9SA 1YJ9A 1KQSS 5FRNA 1BI0A 2RM4A 5GANh 4PJOG 5GAMe 4IUTA 4E7LA 4C8QF 5LJ5h 3CC7T 2P0KA 2BKDN 2R5MA 4XTZA 2KK4A 2C06A 2OAUA 3VYHB 4PJOD 4DQ2A 2RH2A 2DXUA 3A8GB 3OS1A 4M7AF 2GFAA 1W4SA 4M77A 4LDVA 1X6OA 1QW1A 1BI3A 4NL2A 1YJ9T 2L8DA 3JRZA 4FM4B 2G3RA 1VQ8A 4TVRA 5KE2A 5FLXE 3VUBA 2ZPGB 4PJOE 1FX7A 2QI2A 3V7CA 1K9MU 4M77G 3OSVA 2X4XA 1Q86C 3CCUA 3JCMW 1K73U 2ZPIB 4HT8A 3F70A 3OYKA 3V8JA 1QVGS 4A4FA 1M1GA 3CCJA 1OZ2A 3VJPA 4JS5A 2DXTA 5GAN8 3RIRA 1WQWA 5GANe 3V7RA 1XOVA 4XU0A 1HXDA 4C5IA 5LJ5e 2GFUA 4M77E 1WPYA 3PFSA 5J39A 4BD3A 1QP3A 5CKFA 3SWNA 3KXTA 3CCUT 1TH7A 1Y96A 3HFOA 1BKBA 3JCMh 3X24B 5I2SA 3OY9A 3CMEA 4C92D 3QJ6A 4KULA 1IREB 2MAMA 3CCJT 5GAOl 4P5NA 4ZTFA 3GF5A 3CCMA 1UGRB 4M7DA 2QXFA 3OW2A 1VQ4A 3LYIA 4PJOC 2ZZDA 4EDUA 2XDBA 3M55A 1KHCA 2KQWA 4PLLA 1RL2A 3CCQA 1W2BS 1UGSB 2RI3A 5LJ3j 5FROA 4JRQA 3JB9I 2RD1A 1ZHIA 2WSEE 4M75F 5D6YA 3CMET 3DLLA 2K5FA 4M7DG 2RB6A 3HRUA 3E19A 3RUXA 3TU4K 2OTLA 3QJYA 3M57A 1NE8A 3QG1A 5KH6A 3S3MA 2A3LA 3CCMT 1VQ4T 5FRMA 2Y90A 1UGPB 2PU9B 4M77C 3SDZA 2EJFA 4A4HA 4C5EA 3JCMe 3CCQT 3OS2A 4QW2A 4M7DE 1OZ3A 4C0DB 4M77D 4XTWA 3RKWA 1JJ2A 2R57A 4OB0B 2H3JA 3RKXA 1K9MC 5GAMg 4J8OA 1K73C 3P8BB 3P8HA 3QXEB 2P4TA 3G6ET 2OTLT 3CCRT 1JBMA 4OGCA 3PGGA 4X9CA 4MZTA 5D6WA 2VGMA 3OYFA 4XTYA 5IN1A 1N9SA 4UC4A 3L2UA 4FU6A 4RCBA 5LJ3f 3T9NA 3SWNC 3JCMc 1QVFS 4X9DA 1FWZA 2RHUA 4WF2A 4PLIA 3L1AA 2DEQA 2DD5A 4QVZA 4EMKA 2HD0A 4C0GA 1N8RU 4IUQA 4M7DC 4KUDK 5A0GA 2DXBA 4PKCC 1NPRA 4FSXA 4M78C 1Q82U 3INZA 5HKCA 4XTXA 2DD4A 3JSCA 3CBMA 1S72A 3RMQA 2DK3A 3EFRA 4M78D 2HBPA 3A8OB 4J6WA 2VXEA 2MMPA 3CPWA 5FU6B 4DOVA 2E65A 4PJOF 3H6ZA 3DLMA 3C94A 4L59A 2EIFA 3LWHA 3M9QA 4F7UA 3GPLA 4FL6A 2LTOA 5CO7A 3S3OA 1S72T 1O75A 3BY7A 3LX7A 1WNLA 3G6EA 3CCRA 3QYHB 4IUUA 2XK0A 1I8FA 3WXMB 5GMKl 4C5HA 4M77F 3OYIA 1YJWA 3NTIA 3CC2A 3OYYA 4F7UG 4J6XA 4XTUA 3CMAT 2RJEA 1X01A 3DB3A 2CZ0B 2RK1A 2IG0A 3M58A 1R8OB 3FC3A 1B34B 2E64A 1VUBA 3MHXA 3OMGA 4JLGA 4ZN3A 2BUDA 2XKOC 3HRSA 3FB9A 4EMKC 4F7UE 5GAMh 2EFIA 4RMOA 2X4JA 1YJWT 2KMTA 3CC2T 3AHUA 2CGHA 2ZCFB 1N8RC 4C92A 4LD9K 5GAN5 2A7YA 3QSUA 4MDWA 3V8LA 2HQEA 1Q82C 3SB2A 2Y4YA 2K3YA 3GNFB 3OMCA 2RO0A 5FU7B 5KE3A 4C92G 5GAOm 3OYJA 3JCMP 2EQKA 1KHIA 5CK9A 4M7DF 3ZEHA 2E5QA 4OMFB 4QQGA 4VUBA 4DA4A 3JB9D 1VQ7A 2VUBA 4ELYC 4BY6B 1I81A 4MZMA 2PUOB 3ME9A 4GY5A 3I56A 5CQYA 1JB0E 1G5VA 4C92E 1YJNA 3J81E 3PIPA 2E41A 3OYAA 2XDDA 1VQ9A 4XK8E 4ZN1A 1BI2A 2XU8A 3TCJA 4OB2B 4R55A 1G3WA 4B9WA 3L2RA 1U8RA 1VQ7T 4C8QB 5I21A 3OYBA 1M9SA 1G3YA 3JAME 3MEUA 2NLUA 3I56T 4M7AB 3DKMA 2DJZA 2QTXA 1YJNT 1M1KU 3QZ5B 3V8KA 3CXCA 1VQ9T 2DPPB 2GQVA 2EQMA 2WACA 3J80E 3N5BB 2LQKA 4HCCA 5DM7R 4QQDA 1KD1C 3CCEA 2PUKB 1VQ8T 3GNGA 3X26B 3CCSA 3JB9J 4J7IA 2L5QA 4C92C 3LWIA 5GAN4 3LH0A 1NZ9A 2EKOA 4B9XA 2O4XA 2EQUA 2ZPFB 4C0ZA 2VV5A 1NJIU 3OYHA 5GANj 3M53A 5J3BA 2K3XA 2CYZB 2PVOB 2XICA 5LJ5j 3CC4A 4Y91A 3OYLA 1WQ7A 2RJFA 2E12A 4C0FA 3CCET 1KQ1A 2M9UA 5GAN2 3CCST 1KQ2A 3LLRA 3RKYA 2RHIA 3G7ZA 4M78A 3OYNA 4MMLA 2M0OA 3SD4A 1VQ5A 2CZ7B 1YHQA 2AHJB 4CRIA 4FT2A 1UEBA 3A8MB 3OW2S 4RKUE 1YI2A 4M78G 3GP8A 3CCLA 3CC4T 1JRIA 5CQXA 2RHYA 4JLIA 4KBMB 1M8VA 3QHSA 5C6SA 4M75B 2XIDA 3VV0A 2E70A 5DY9A 1W2BA 1MGQA 5GMKh 2KY9A 5LJ3e 1VQ5T 2JNGA 2P0PA 1YHQT 5GAOr 4RG2A 4M78E 4F7UF 3ASKA 5GANd 1DJ7B 3HRTA 3CCLT 1YI2T 5LJ5d 1M1KC 3J7AF 5GMKm 4D6WA 1Y7XA 1ZBXA 4PNOA 4QVCA 3BW1A 1JJ2S 1U1SA 4E7KA 1VQKA 3KBGA 4BDYA 2DTHA 4OGEA 4O6JA 1G3TA 2QQRA 3LGFA 2LX9A 2YLCA 4N0AA 3CBOA 1NJIC 5C0MA 2XHCA 4Q5WA 5CKBA 3H8ZA 5GMKe 4E7JA 4KUIA 5M9OA 3VUZA 2DTOA 2EYQA 2VXFA 3QZ9B 5KCHA 3HL8A 2RI5A 5CCAA 4JJNK 3MO8A 4MZPA 1LNXA 5DLQE 4C92F 1M90U 5GAOn 1H3ZA 4NOYA 1VQKT 4N4IA 4A53A 1N6AA 4XU2A 2LRQA 4KT0E 1YIJA 5IT9E 4XQ3A 3WVEB 2K5IA 3QO3A 4BI8B 3JCMd 3ZBDA 1VQMA 1D3BB 3A8LB 3JCMQ 3VYGA 2BIVA 3OYGA 5L8RE 2FB7A 3JB9G 1Y07A 3L2ZA 2RHXA 3G71A 2DXCA 1YIJT 3CEYA 3M5AA 2OTJA 4PJOB 4JRIA 3CPWS 5CIUA 1VQMT 2RK2A 5GAN7 3M56A 4IUPA 3PIOA 1BIBA 2JOYA 3MP6A 1XTDA 3NTKA 4OF1A 2EWNA 2ZPEB 4JDSA 5CKHA 5LJ3g 1PSEA 3C95A 5IAYA 3G71T 2PVDB 2KSSA 2DZCA 2KVQG 3PTAA 4M77B 2OTJT 4C8QD 3MEAA 2I2LA 4XU3A 4N0AC 2K57A 1KD1U 3HSBA 4M7AD 3OS0A 5CAIA 4BUGA 1I5LA 4BDZA 4MDXA 3V7SA 1VQLA 2F69A 4Z02A 4J7FA 5AYFA 3CCVA 3FLGA 2DAQA 3OYDA 2RA2A 1M90C 2VYTA 2JTFA 3PMIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y90 A;  1U1T A;  4M77 C;  2EJF A;  5GAN g;  2DZ9 A;  3JCM e;  2YHT A;  3QUI A;  5LJ5 g;  3EFS A;  3SWN B;  3JB9 J;  4M7D E;  1LOJ A;  1Y96 B;  4M75 A;  4C92 C;  4M7D D;  2YLB A;  4M77 D;  4XTW A;  3RKW A;  5GAN 4;  3RES A;  4M78 F;  3RKX A;  4C8Q C;  5GAM g;  4XTV A;  3HFN A;  1JBM A;  4M7D B;  4M7A C;  3PGG A;  4EMH A;  4X9C A;  5GAN j;  4M75 G;  3JB9 H;  5LJ5 j;  4OP0 A;  1H64 1;  4XTY A;  4Y91 A;  1N9S A;  1WQ7 A;  4EMG A;  1KQ1 A;  5GAN 2;  3RER A;  4V2S A;  1KQ2 A;  3RKY A;  4M75 C;  4M78 A;  4RCB A;  5GAM j;  5LJ3 f;  4QVD A;  4MML A;  3SWN C;  3JCM c;  4A54 A;  4RCC A;  4X9D A;  4M75 E;  4WF2 A;  4M75 D;  3L1A A;  2DEQ A;  3M4G A;  4EMK A;  4M78 G;  2ZGW A;  3BDU A;  1JRI A;  5GMK i;  4J6Y A;  4M7D C;  2EAY A;  4JLI A;  2DVE A;  1M8V A;  3JCM g;  3QHS A;  4M75 B;  5DY9 A;  3JCM b;  1MGQ A;  5GMK h;  3JCM J;  2EJ9 A;  3GIB A;  4M78 C;  1M5Q 1;  1I4K 1;  5LJ3 e;  2DKG A;  3INZ A;  4XTX A;  5GAO r;  5GAN d;  4M78 E;  4F7U F;  3EFR A;  4M78 D;  2E1H A;  4J6W A;  4JRK A;  4J5Y A;  2VXE A;  3VU3 C;  5GAN 6;  5GMK m;  1B34 A;  5LJ5 d;  5LJ3 h;  2E65 A;  4PJO F;  1D3B A;  2E10 A;  4PNO A;  4M78 B;  5GAM d;  4QVC A;  3BW1 A;  4MMK A;  1U1S A;  4NL3 A;  5GAM f;  4F7U A;  4EMK B;  2DTH A;  3BY7 A;  4N0A A;  1LJO A;  1WNL A;  1YCY A;  2YLC A;  5GMK e;  1I5L A;  4PJO A;  3JB9 F;  1I8F A;  5GMK l;  2HNI A;  4M77 F;  2EJG A;  2DTO A;  2VXF A;  4F7U G;  4J6X A;  5GAO q;  4XTU A;  1HK9 A;  1LNX A;  4C92 F;  2RM4 A;  5GAN h;  4NOY A;  1X01 A;  4PJO G;  5GAM e;  4A53 A;  5GAO n;  4XU2 A;  4C8Q F;  5LJ5 h;  4HT9 A;  3JCM X;  4XTZ A;  4XQ3 A;  1B34 B;  2E64 A;  2DXU A;  4DQ2 A;  3QO3 A;  3JCM d;  4M7A F;  4M77 A;  4EMK C;  3FB9 A;  1D3B B;  4F7U E;  5GAM h;  5GAN f;  3AHU A;  4NL2 A;  3JCM Q;  5GAO p;  2CGH A;  5LJ5 f;  4XU1 A;  4C92 A;  5GAN 5;  2FB7 A;  4HA8 A;  3QSU A;  3JB9 G;  4PJO E;  3V7C A;  3V8L A;  4M77 G;  4C8Q A;  4F7U B;  3JCM W;  3L2Z A;  3SB2 A;  4JUV A;  4HT8 A;  4M7A A;  3V8J A;  5GAO m;  3JCM P;  4C92 G;  4PJO B;  4JRI A;  4C8Q G;  2DXT A;  5GAN 8;  3RIR A;  1WQW A;  5GAN e;  2JN0 A;  5GAN 7;  3V7R A;  4XU0 A;  3BFM A;  1HXD A;  5LJ5 e;  3FJP A;  4M7A G;  3JB9 D;  1BIB A;  1WPY A;  4M77 E;  2FYK A;  1I81 A;  2EWN A;  3SWN A;  1TH7 A;  1Y96 A;  3HFO A;  3JCM h;  5LJ3 g;  5GAN 3;  4C92 E;  4C92 D;  2DZC A;  5GMK j;  2E41 A;  4M77 B;  4C8Q E;  5GAO l;  4C8Q D;  1BIA A;  2I2L A;  4XU3 A;  4N0A C;  4M7D A;  4M7D F;  2K57 A;  4M7A E;  4PJO C;  2DTI A;  4C92 B;  3HSB A;  3FIF A;  5LJ3 d;  3JCM f;  5CAI A;  4M7A D;  2VC8 A;  3JCM V;  4C8Q B;  3V7S A;  5I21 A;  1N9R A;  5LJ3 j;  3JB9 I;  2RD1 A;  4M7D G;  4M75 F;  4M7A B;  4PJO D;  2DJZ A;  2QTX A;  2RA2 A;  2RB6 A;  3V8K A;  3RUX A; 
#chains in the Genus database with same CATH topology
 1WGS A;  4II1 A;  1K1Z A;  1U1T A;  2KXD A;  1BI1 A;  2D6F A;  1Y96 B;  2GCX A;  1RAB B;  2COZ A;  3CCV T;  3OS5 A;  3E1S A;  2CDT A;  3HFN A;  2O01 E;  4M7D B;  4EMH A;  2ED1 A;  2F2W A;  2QYZ A;  1GL5 A;  2DIG A;  1KQS A;  5GAM j;  4QVD A;  2Z0W A;  4HVU A;  3NTH A;  3E2U A;  3GBQ A;  4M75 D;  4E7S A;  4D8K A;  4L6V 5;  4LDY A;  1IHW A;  1WJS A;  3BDL A;  3JCM J;  2X35 A;  5I2M A;  1OEB A;  3CXC S;  3OBY A;  1VQN A;  3UWN A;  4JRK A;  5GAN 6;  2KI7 A;  3NMZ C;  5LJ3 h;  2V26 A;  2CZ6 B;  3TEE A;  2RQR A;  1RAF B;  3EH1 A;  4OMM A;  4N4H A;  1VQN T;  1P92 A;  1WXB A;  1PKS A;  1FMK A;  2EJG A;  4JZ4 A;  2RI2 A;  1VQ6 A;  4J9C A;  1OU9 A;  4HT9 A;  5EG2 A;  1OU8 A;  2GTO A;  1B7T A;  1YWP A;  2AK5 A;  1W1F A;  3R6O A;  3HPW A;  2L89 A;  3CCM Q;  4XU1 A;  5CKE A;  1VQ6 T;  2EPD A;  1RI0 A;  4F7U B;  4ATO A;  2QA4 A;  3H0H A;  2PQW A;  1TS9 A;  2Y4X A;  4C8Q G;  3QBY A;  2JN0 A;  4M7A G;  2E6Z A;  4FIB A;  1UUE A;  3PMT A;  2QQ9 A;  2RMO A;  5GAN 3;  2QA4 T;  4FW1 A;  1BIA A;  3VS7 A;  4LD6 A;  5FU7 C;  4C92 B;  5LJ3 d;  1W70 A;  2VC8 A;  4KGZ B;  3CBP A;  3FDR A;  3QWX X;  3OYM A;  2LZ6 B;  2K3B A;  5A0L A;  1QVG P;  2CSQ A;  1M3A A;  4BI3 A;  5GAN g;  1VOM A;  4Z8A A;  1M3C A;  2AZS A;  3DB4 A;  1A0N B;  2HMA A;  3OYC A;  1LVK A;  2V8J A;  3SFM A;  1CKA A;  3JB9 H;  2HBW A;  2HAX A;  3MP8 A;  3PVL A;  3QDR B;  3CMA A;  2G6F X;  3Q1J A;  2H8H A;  4RCC A;  5HY6 A;  4E7H A;  1MNE A;  2MPX C;  1ABO A;  1M4Z A;  2J6O A;  2EAY A;  2KDS A;  3JCM g;  5IHK A;  3OYE A;  1B3Q A;  1I4K 1;  2DKG A;  4IUR A;  2O88 A;  1FMW A;  3KUF A;  2L3P A;  2B8A A;  3EGX A;  3HHT B;  1D3B A;  3NHN A;  2IVW A;  3MET A;  3OSS C;  3MP1 A;  3UPU A;  2R58 A;  2DNU A;  2ECZ A;  1OYX A;  4RUG A;  4LDW A;  4PJO A;  1EIF A;  3X25 B;  1YJ9 A;  1I07 A;  1WX6 A;  2RM4 A;  4E7L A;  5LJ5 h;  2R5M A;  2JT4 A;  2KK4 A;  1BCO A;  3VYH B;  3I56 Q;  4PJL A;  3M0T A;  1VQ9 Q;  2A36 A;  1QW1 A;  1YJ9 T;  2VVK A;  3JRZ A;  1VQ8 A;  4TVR A;  3V7C A;  2X4X A;  5KYU B;  2ED0 A;  1QVG S;  1MMG A;  4KRT A;  2YUQ A;  4JS5 A;  3RIR A;  1HXD A;  4C5I A;  2RQV A;  2J6F A;  4M77 E;  1YN8 A;  3PFS A;  5J39 A;  4BD3 A;  3I55 Q;  1TH7 A;  3CCS Q;  1BKB A;  3CME A;  4KUL A;  2YUN A;  3GF5 A;  1VQ4 A;  1XJW B;  1Q7Y R;  4PJO C;  4R0K A;  1ZLM A;  2DYI A;  3M55 A;  2FRW A;  2RI3 A;  2D8J A;  5LJ3 j;  1NEG A;  4JRQ A;  4M7D G;  4M75 F;  3QWY A;  3CME T;  3EFO B;  2RB6 A;  1KC8 R;  1VQ4 T;  2L3Q A;  5IH2 A;  2Y90 A;  1UGP B;  2PU9 B;  5FRM A;  2EJF A;  1YI2 Q;  3A1P A;  4F16 A;  3OS2 A;  2KGT A;  2DL8 A;  4J8O A;  4J9I A;  1JBM A;  4HVW A;  3MJX A;  5HCK A;  2CH4 W;  4UC4 A;  2BZY A;  3T9N A;  2LCS A;  1FWZ A;  2RHU A;  1C1A A;  4KH1 B;  4QVZ A;  2DEQ A;  1IO6 A;  4ESR A;  4IUQ A;  4RTY A;  2LMJ A;  1NPR A;  2VWF A;  2J6K A;  4FSX A;  1UHC A;  5HKC A;  2IIM A;  2FPE A;  2EBP A;  1S72 A;  4M78 D;  3A8O B;  2VXE A;  3CPW A;  3DLM A;  1VQM Q;  3REA B;  2F1L A;  3M9Q A;  4FL6 A;  2LTO A;  1S72 T;  3OW2 P;  2XK0 A;  1I8F A;  5GMK l;  2OTJ Q;  3NTI A;  3CC2 A;  4F7U G;  2DER A;  2W0Z A;  4XTU A;  4RTT A;  3LH5 A;  2CH4 A;  3EG9 B;  4M4Z A;  2ESW A;  2E64 A;  3MHX A;  3OMG A;  4KGX B;  4ZN3 A;  1T0J A;  3CC2 T;  2CGH A;  2ZCF B;  1JJ2 P;  2A7Y A;  2NUP B;  3QSU A;  3SB2 A;  3GNF B;  4C92 G;  2HZY A;  1QKX A;  2EQK A;  3H9N A;  4QT7 A;  4PFO A;  2YT6 A;  4MZM A;  2LJ3 A;  1RAE B;  1G5V A;  1I0C A;  1D0X A;  4XK8 E;  3TCJ A;  4OB2 B;  4R55 A;  2HDA A;  3JAM E;  5FWB A;  1QCN A;  3DKM A;  1NEB A;  2DJZ A;  2QTX A;  1M1K U;  2FZC B;  3QZ5 B;  2PZ1 A;  4HCC A;  2MOX A;  2PUK B;  3CCE A;  3GNG A;  3JB9 J;  2FG0 A;  2QG9 B;  4J9H A;  2YWW A;  3NPF A;  5I11 A;  3M53 A;  5J3B A;  2PVO B;  2CYZ B;  5LJ5 j;  3CC4 A;  4Y91 A;  3I35 A;  3OYL A;  2RJF A;  2E12 A;  3CCE T;  3QDF A;  4GLM A;  1PM3 A;  2MCN A;  1MUZ A;  1KQ2 A;  2RHI A;  3G7Z A;  3TSZ A;  1K73 R;  2CZ7 B;  2DL3 A;  1YHQ A;  3H41 A;  9ATC B;  3A8M B;  3OW2 S;  4AFZ C;  3CC4 T;  5CQX A;  4JLI A;  4M75 B;  2XID A;  2E70 A;  1MGQ A;  2KY9 A;  1Y57 A;  2JNG A;  4E2F B;  1IXD A;  1YHQ T;  3RBB B;  1M1K C;  3ASK A;  1DJ7 B;  4J9E A;  5GMK m;  4D6W A;  3VS1 A;  4Y92 A;  4QVC A;  1JJ2 S;  1U1S A;  1NLO C;  1SHF A;  4OGE A;  4O6J A;  2QQR A;  2QEX Q;  1VQP Q;  5C0M A;  1SKU B;  4Q5W A;  5GMK e;  2EYQ A;  3QZ9 B;  1RUW A;  3HL8 A;  2RI5 A;  3MO8 A;  5GAO n;  4NOY A;  3EH2 A;  2LRQ A;  1YIJ A;  2K5I A;  4BI8 B;  4OMO A;  3A8L B;  2RF0 A;  1H3H A;  1ZA1 B;  1TSF A;  2KXC A;  1Y07 A;  3L2Z A;  3G71 A;  1YIJ T;  2ZAE A;  1LCK A;  2RK2 A;  1N8R R;  1SF9 A;  2DX1 A;  1BIB A;  1X69 A;  3MP6 A;  1Q82 R;  1PG5 B;  1M30 A;  4JDS A;  1BCM A;  5CKH A;  3G71 T;  1PSE A;  3C95 A;  3PTA A;  5GJV B;  3MEA A;  2K57 A;  3ULR B;  4BUG A;  4MDX A;  5KYX B;  4J7F A;  1PNJ A;  3FLG A;  4PJN A;  4DBR A;  2L2P A;  1SSH A;  3C12 A;  2DO3 A;  2J7I A;  3G6E Q;  3G4S A;  3EFS A;  3SWN B;  1LOJ A;  4CC2 A;  2YLB A;  3PVQ A;  2MWP A;  4M78 F;  3A5Z B;  1EZZ B;  4RTV A;  3EAE A;  3G4S T;  2DBK A;  2KNB B;  2XI9 A;  2D1X A;  2OX7 A;  4J9B A;  5DLO A;  1K8A U;  5CVI A;  3FEO A;  4BI4 A;  2K2M A;  2X9H A;  4EMG A;  1QVP A;  2ENM A;  2X4W A;  1PRM C;  2QAS A;  4C0D C;  3MEV A;  3CC7 Q;  4OMP A;  1WXT A;  1D1A A;  4BB7 A;  2ZPB B;  4GBQ A;  2NYS A;  1WHH A;  1OV3 A;  3VS6 A;  1B34 A;  1UGV A;  1WLP B;  3OB9 A;  2JUF A;  5GAM d;  1M1F A;  1VIE A;  1NG2 A;  4EMK B;  3S6W A;  3UAT A;  1UB4 A;  3CCJ Q;  2CP3 A;  3OQ5 A;  2QK0 A;  5GAO q;  5FU6 C;  3L42 A;  4CC3 A;  1K8A C;  5KCO A;  4HCB A;  4EPC A;  2KT8 A;  1WHJ A;  1OUL A;  1M2O A;  4WTO B;  3HKS A;  2XD0 A;  2LT1 A;  1IZ6 A;  1WYX A;  4FW2 A;  5LJ5 f;  2K5L A;  2PNI A;  3BE3 A;  1ZSZ A;  3CCQ Q;  1GBR A;  4JUV A;  1SRL A;  1RAA B;  6AT1 B;  2ROT A;  4LUE A;  1X2Q A;  3M0P A;  1KQS P;  3EG0 A;  4LDX A;  1XQH A;  3CPF A;  1PSF A;  4N4G A;  3URG A;  4PK4 A;  1M27 C;  1QVF A;  4C8Q E;  2EQJ A;  1V76 A;  1IGU A;  2LC4 A;  4M7A E;  4C5G A;  2DTI A;  1H92 A;  1FXX A;  3FIF A;  1N9R A;  4E6R A;  3CD6 A;  2D0Q B;  4BY6 C;  1RAH B;  2HKN A;  1Q81 U;  4JJC A;  2JZ2 A;  2KAF A;  1V29 B;  3UDC A;  5IHN A;  1GCP A;  3X20 B;  1TTH B;  1R0C B;  3LW5 E;  1KG1 A;  2DIL A;  4ORZ A;  4FT4 A;  4ELZ C;  3CD6 T;  1M90 R;  4M75 G;  4OP0 A;  4DEX A;  3I5R A;  2RJD A;  1W2B P;  3RER A;  4BE2 A;  2LDM A;  2K9G A;  1UFF A;  4E47 A;  2ZGW A;  3BDU A;  3RDV A;  2ATC B;  4IIM A;  2FRY A;  1WHK A;  3EHR A;  3JCM b;  1M5Q 1;  1G3S A;  1TG0 A;  1BB9 A;  3VRY A;  1Q81 C;  5HK3 A;  3VU3 C;  4J5Y A;  5CKD A;  2A0F B;  4M78 B;  3GLX A;  1QP2 A;  2EYZ A;  1OI1 A;  3CCV Q;  2KR3 A;  4HCZ A;  1QMC A;  1AZE A;  2RJC A;  4X1V A;  2HNI A;  3EGD B;  1VYV A;  1O9S A;  1YNZ A;  1KQS S;  4FYY B;  1X43 A;  1S1N A;  2YRD A;  2A37 A;  1VQ7 Q;  5GAM e;  2CP7 A;  3I5S A;  2AT1 B;  2OAU A;  3A8G B;  2GFA A;  4M77 A;  4LDV A;  4AT1 B;  4NL2 A;  5FLX E;  1M3B A;  2QI2 A;  2GNC A;  3OYK A;  1YP5 A;  1V1C A;  5GAN 8;  5GAN e;  4XU0 A;  2NUT B;  1WPY A;  1NYF A;  1QP3 A;  3KXT A;  2DL4 A;  3HFO A;  4P5N A;  1VQN Q;  3CCM A;  1UGR B;  2QXF A;  1E6G A;  3LYI A;  5KYY B;  3TVT A;  1W2B S;  1F1B B;  4JJD A;  5FRO A;  2RD1 A;  2WSE E;  5D6Y A;  3DLL A;  2HSP A;  2K5F A;  3E19 A;  3QJY A;  1NE8 A;  3CCM T;  3SDZ A;  4M77 C;  4C5E A;  3JCM e;  1Q95 G;  4QW2 A;  4M7D E;  1KFZ A;  4OB0 B;  5GAM g;  1CSK A;  4JZ3 A;  5D6W A;  2VGM A;  5KYW B;  4FU6 A;  2BZX A;  1WZO A;  3C0C A;  1VQK Q;  3L1A A;  2DD5 A;  2HD0 A;  4KUD K;  1AWW A;  2DXB A;  1SEM A;  2F2V A;  3EFR A;  1UEC A;  4RTU A;  2DBM A;  1EFN A;  4PJO F;  4F04 B;  3C94 A;  5IHI A;  3LWH A;  2EGE A;  5CO7 A;  1O75 A;  3BY7 A;  3THK A;  4J9D A;  3WXM B;  1WDX A;  1YJW A;  4HXJ A;  3OYY A;  3EG1 A;  3CMA T;  3DB3 A;  2L3S A;  3M58 A;  5I2S A;  1VUB A;  2LJ0 A;  2BUD A;  2XKO C;  1HD3 A;  1MND A;  4F7U E;  1YJW T;  2EFI A;  3AHU A;  2KMT A;  3G1J A;  2ROL A;  1TUD A;  2HQE A;  2O9V A;  3O5Z A;  3OMC A;  5FU7 B;  1SPK A;  1KHI A;  5CK9 A;  2F2X A;  3ZEH A;  2E5Q A;  4QQG A;  2VUB A;  2PUO B;  3I56 A;  1JB0 E;  4C92 E;  1YJN A;  3IQL A;  3PIP A;  1VQ9 A;  2XDD A;  4ZN1 A;  1G3W A;  4B9W A;  2X3W D;  1M9S A;  3REB B;  1RLQ C;  3I56 T;  1YJN T;  2CSI A;  3VRZ A;  3CPW P;  1VQ9 T;  2EQM A;  2WAC A;  2YSQ A;  4FSS A;  3J80 E;  2LQK A;  5DM7 R;  1KD1 C;  1AWO A;  1VQ8 T;  2I0N A;  3X26 B;  3CCS A;  4J7I A;  5GAN 4;  1GCQ A;  2O4X A;  1NJI U;  2K3X A;  2QTV A;  1WQ7 A;  4C0F A;  1KQ1 A;  2M9U A;  3CCS T;  2LQW A;  4CRI A;  1YI2 A;  3H0I A;  4M78 G;  3GP8 A;  3MKD A;  4KBM B;  1HJD A;  1H8K A;  4DBH A;  5GMK h;  1HSQ A;  4FYW B;  5LJ3 e;  1MV3 A;  3CME Q;  4RG2 A;  5GAO r;  3J7A F;  4KH0 B;  1YI2 T;  5LJ5 d;  3ZL7 C;  1SRM A;  1VQ4 Q;  4PNO A;  1MMN A;  2RQT A;  1GCQ C;  1G3T A;  4IIO A;  1NJI C;  5M9O A;  2DTO A;  2VXF A;  4MZP A;  4N4I A;  4A53 A;  1N6A A;  4XU2 A;  1VYU A;  4Z88 A;  4XQ3 A;  3QO3 A;  3EGX B;  1Z9Q A;  1VQM A;  1D3B B;  4WCI A;  3VYG A;  2BIV A;  3OYG A;  5L8R E;  2FB7 A;  2M51 A;  2AKK A;  2DXC A;  1X6G A;  2OTJ A;  4PJO B;  2JM8 A;  3CPW S;  1WHL A;  2MK5 A;  1VQM T;  3TSW A;  1RAC B;  1PD0 A;  5LJ3 g;  5IAY A;  1TOV A;  1YWO A;  2OTJ T;  1S72 Q;  2I2L A;  3OS0 A;  5CAI A;  1YIT Q;  3V7S A;  1VQL A;  4Z02 A;  2RA2 A;  4LDU A;  1RAG B;  1OPL A;  4OB3 B;  2OJ2 A;  4ZGJ B;  1RAD B;  3QYG B;  2L0A A;  4X34 A;  1AT1 B;  4A4G A;  3CC2 Q;  1VQL T;  1JXO A;  5IXB A;  2YRC A;  1RI9 A;  3R6N A;  2KRM A;  3EG2 A;  2LNH B;  3TQ7 P;  2DYB A;  1C0M A;  4ZGD B;  1UGQ B;  1T3S A;  4M75 C;  1NYG A;  4A54 A;  2RN8 A;  3M4G A;  3OBW A;  4KGV B;  3MCA B;  4IUV A;  2JXB A;  3GIB A;  2VAS A;  4Y28 E;  2HSE B;  3ER0 A;  3A8H B;  3H0F A;  2FL7 A;  2YXY A;  2E10 A;  4GLK A;  2CS7 A;  4NL3 A;  2JS0 A;  3L2W A;  3M54 A;  1M1K R;  2XDP A;  3CCU Q;  4RG8 A;  4YTL A;  2KRO A;  2M16 A;  2SRC A;  2MWO A;  2HQX A;  3CCE Q;  2FVU A;  2K2V A;  4LXC A;  2LQ8 A;  4ME7 A;  1KK7 A;  2JTM A;  3JCM X;  1TXQ A;  4OB1 B;  2WSC E;  2F5T X;  2LCC A;  2E6N A;  1K0X A;  3FRN A;  1UE9 A;  5GAO p;  1X75 C;  2K4Y A;  2OI3 A;  4HA8 A;  4C8Q A;  2QEX A;  1VQP A;  4CC7 A;  4ZTJ A;  1B07 A;  2CKK A;  4M7A A;  2L3R A;  4OVA A;  1GXI E;  2RHZ A;  2OTL Q;  1Y71 A;  3O8V A;  2P84 A;  2VKN A;  1VQO A;  2QGG A;  2QEX T;  1VQP T;  1FYN A;  5GMK j;  2KYB A;  2O31 A;  3TRE A;  3QII A;  3JCM V;  1VQO T;  3M59 A;  3M0R A;  3S3N A;  3L2Q A;  1QCF A;  1R0B G;  2QQS A;  3C4S A;  4ZNX A;  4R56 A;  5LJ5 g;  4CI0 C;  2V8I A;  2K79 A;  4AFQ C;  2BTT A;  4C8Q C;  3PT9 A;  2FPD A;  4HCK A;  1ZUK A;  3E9G A;  4M7A C;  1M2V A;  3RMS A;  2W10 A;  3EGU A;  2CP5 A;  2EW3 A;  4JS4 A;  4FYX B;  4BE1 A;  2LP5 A;  4M75 E;  5J26 A;  3G71 Q;  2FEI A;  5I22 A;  1AZG B;  3CCR Q;  2JMA A;  4A4E A;  1Q86 U;  4LE9 A;  4BAC A;  4L5G A;  3VKI A;  2NWM A;  3L2V A;  2CZ1 B;  2E1H A;  2DET A;  2K7A A;  2VGN A;  3QPH A;  1KIK A;  4O5V A;  3KFV A;  2MYS A;  4MMK A;  1PHT A;  2YRV A;  3UT1 A;  2BE9 B;  1WA7 A;  3CC7 A;  2BE7 D;  1LJO A;  2V8K A;  5EC7 A;  2CT4 A;  2QQA A;  3G4S Q;  5FRN A;  1LPL A;  2GQI A;  1BI0 A;  2P4R A;  1YCS B;  5GAN h;  1OOT A;  4PJO G;  3CC7 T;  2P0K A;  2BKD N;  4DBF A;  2DXU A;  1X6O A;  2EYX A;  4FM4 B;  1K8A R;  1D1C A;  1I1J A;  2ZPG B;  1FX7 A;  2KBT A;  2M0Y A;  2FZG B;  3UA6 A;  1K9M U;  3OSV A;  3RR6 A;  1Q86 C;  3JCM W;  3F70 A;  3V8J A;  2EVR A;  5KYY A;  1M1G A;  3CCJ A;  3VJP A;  2DXT A;  1WQW A;  2GFU A;  3EHQ A;  4PFP A;  1Y96 A;  3JCM h;  3X24 B;  2LQN A;  3CCJ T;  4ZTF A;  4M7D A;  2JS2 A;  2ZZD A;  1X6B A;  2XDB A;  1KHC A;  3CCQ A;  1JQQ A;  1UGS B;  3JB9 I;  4PJO D;  1ZHI A;  2YUO A;  1FMV A;  2JMC A;  3FJ5 A;  3RUX A;  1VA7 A;  3TU4 K;  3M57 A;  4JPB W;  3QG1 A;  3S3M A;  1VQ5 Q;  2DF6 A;  4A4H A;  1PKT A;  3CCL Q;  1BK2 A;  3CCQ T;  4OML A;  4C0D B;  4XTW A;  3RKW A;  2R57 A;  1QWF A;  1TUG B;  2H3J A;  1K9M C;  2P4T A;  4OGC A;  1G2B A;  2HL5 C;  4X9C A;  5FWC A;  3VS4 A;  5IN1 A;  3L2U A;  4RCB A;  4EIK A;  2GBQ A;  1QVF S;  4WF2 A;  4M7D C;  4M78 C;  1TU0 B;  1PCX A;  4XTX A;  8ATC B;  2DD4 A;  3CBM A;  4OMQ A;  3RMQ A;  1E6H A;  2DK3 A;  2HBP A;  1QKW A;  2CT3 A;  5FU6 B;  1ACM B;  3H6Z A;  3CQT A;  3NGP A;  1MMD A;  3I9Q A;  4F7U A;  2LX7 A;  1Q81 R;  1WNL A;  3QYH B;  4PJJ A;  4C5H A;  4M77 F;  4J6X A;  4Z89 A;  2RJE A;  2CZ0 B;  2J05 A;  3FC3 A;  1R8O B;  1B34 B;  2A28 A;  3UF4 A;  3HRS A;  4RMO A;  2X4J A;  3VS3 A;  4C92 A;  4PJM A;  1GFC A;  1R77 A;  2KE9 A;  3V8L A;  2Y4Y A;  1E7O A;  3OYJ A;  2RO0 A;  2K6D A;  1GFD A;  2DMO A;  4DA4 A;  1VQ7 A;  3JB9 D;  4ELY C;  4BY6 B;  4F14 A;  2C0I A;  4GY5 A;  3ME9 A;  2HL3 A;  1MV0 B;  1UTI A;  1BI2 A;  2XU8 A;  3L2R A;  1VQ7 T;  1ZSZ B;  3M0S A;  2RQW A;  1G3Y A;  3EG3 A;  1AOJ A;  4CC4 B;  3V8K A;  3CXC A;  1U5S A;  2GQV A;  3N5B B;  4AG2 C;  2L5Q A;  1IHV A;  4C92 C;  3LWI A;  1NZ9 A;  5FW9 A;  4B9X A;  2E3H A;  2EQU A;  2V1R A;  1D0Y A;  2VV5 A;  1Z9Z A;  3OYH A;  5GAN j;  2A08 A;  3LLR A;  1ZUU A;  3OYN A;  4MML A;  3SD4 A;  1QCO A;  4DBQ A;  4FCY A;  1JRI A;  2RHY A;  5DY9 A;  1W2B A;  2AZV A;  2P0P A;  1VQ6 Q;  4M78 E;  2CUB A;  1OPK A;  1VQK A;  3KBG A;  2DTH A;  5KYU A;  1PWT A;  4N0A A;  1I5L A;  2XHC A;  5CKB A;  3H8Z A;  4E7J A;  1OX8 A;  2QA4 Q;  3VUZ A;  5KCH A;  2CUD A;  1AVZ C;  1VQK T;  1GBQ A;  5IT9 E;  2YDL A;  3WVE B;  2DM1 A;  2DA9 A;  4ANJ A;  2RHX A;  2EYW A;  1OQK A;  1CKB A;  3CEY A;  3EFO A;  3PE0 A;  3M5A A;  3D7S B;  1KJW A;  1D0Z A;  1SG5 A;  1W6X A;  5ECA A;  3M56 A;  2JOY A;  3NTK A;  2O2O A;  4OF1 A;  3UA7 A;  2ZPE B;  1G83 A;  2PVD B;  2KSS A;  2KVQ G;  2JJ9 A;  4M77 B;  4K11 A;  4A63 B;  1UG1 A;  4C8Q D;  1K4U S;  3AT1 B;  4N0A C;  1D09 B;  1KD1 U;  3HSB A;  4M7A D;  2PTK A;  4BDZ A;  1VYT A;  1IB8 A;  5AYF A;  3HTR A;  2DAQ A;  3OYD A;  3CMA Q;  2VYT A;  2JTF A;  2X4Y A;  2D9T A;  1BBZ A;  2DZ9 A;  4J83 A;  3X28 B;  1YJW Q;  3QUI A;  2JTE A;  1K76 A;  3QKJ A;  2BZ8 A;  4XTV A;  2YUP A;  3A98 A;  2QDY B;  1WHM A;  1KD1 R;  1H64 1;  5CR2 A;  3NFC A;  2D0N A;  5A0D A;  4V2S A;  2MI6 A;  1AHJ B;  1VIF A;  2SEM A;  4ZGE B;  3P8D A;  1U06 A;  1WJR A;  2LJ1 A;  5IXF A;  5LL6 S;  2DVE A;  3I55 A;  1KSW A;  2EJ9 A;  1YJ9 Q;  2ABL A;  1JO8 A;  4BE0 A;  1T3L A;  2XG8 D;  5A2Q E;  1YJN Q;  3EG9 A;  1QVG A;  1Q7Y U;  1BYM A;  4DEY A;  2COW A;  2LVM A;  3I55 T;  1WJQ A;  3PNW C;  1AWX A;  1VQ8 Q;  3GOX A;  5GAM f;  2NUP A;  1KC8 U;  2CP0 A;  1YBY A;  4FYV B;  3JB9 F;  2JVV A;  2X3X D;  1UJ0 A;  4AFS C;  1JXM A;  1HK9 A;  3SHW A;  2QAZ A;  3VS5 A;  1NJI R;  4J9G A;  1MHN A;  2OAW A;  5GAN f;  4PL6 A;  1D1B A;  2LCL A;  3ZFJ A;  2CRE A;  3M0Q A;  4QQ6 A;  1Q7Y C;  3BFM A;  3FJP A;  1NPP A;  2FYK A;  2F5K A;  2LNV A;  1SSF A;  2GTJ A;  1XNI A;  1EX4 A;  2MF2 A;  4JRP A;  1KC8 C;  4NS5 A;  2PVG B;  2FHD A;  3JCM f;  1C6V X;  2QQB A;  2P0Q A;  5HK0 A;  2M1H A;  4OMN A;  1Y0M A;  2RNA A;  2YHT A;  2AKL A;  2WSF E;  2VB6 A;  4M7D D;  4M75 A;  3LGL A;  3RES A;  3VS0 A;  1NLP C;  4IKF A;  2DL7 A;  1YIT A;  7AT1 B;  2M02 A;  4LNP A;  4DOW A;  2QDL A;  4E7I A;  2FO0 A;  2GGR A;  5AT1 B;  3WVD B;  4A4K A;  4HVV A;  4HKE A;  2ZPH B;  3M4Y A;  1YIT T;  5D6X A;  5GMK i;  4RTZ A;  4J6Y A;  1M8M A;  2E3I A;  2LT4 A;  3VS2 A;  1JU5 C;  3HP9 A;  4XAX B;  2O4X B;  4PFZ A;  1G8X A;  1QLY A;  2RQU A;  1PC0 A;  1NM7 A;  4E7Z A;  1N27 A;  5L23 A;  1ZQ1 A;  1VQL Q;  2GF7 A;  2DIQ A;  2C0O A;  3MEW A;  2JM9 A;  1WIE A;  1YCY A;  3E9F A;  2R5A A;  3OA6 A;  1AEY A;  1U3O A;  4B6M A;  4IUT A;  4C8Q F;  2H3E B;  4XTZ A;  2C06 A;  4DQ2 A;  2RH2 A;  3OS1 A;  4M7A F;  1WXU A;  1J3T A;  1W4S A;  1BI3 A;  2L8D A;  2G3R A;  2HKQ B;  5KE2 A;  3VUB A;  4PJO E;  4LN2 A;  4M77 G;  1K73 U;  5KYX A;  3CCU A;  2DVJ A;  2ZPI B;  1BU1 A;  4HT8 A;  1N5Z A;  4A4F A;  1NBE B;  2KT1 A;  1OZ2 A;  3V7R A;  1XOV A;  5LJ5 e;  1ARK A;  4RTW A;  5CKF A;  3SWN A;  3CCU T;  1ABQ A;  2HEQ A;  3OY9 A;  4C92 D;  2DEU A;  3QJ6 A;  1IRE B;  2MAM A;  5GAO l;  2IPO B;  3OW2 A;  3SEM A;  4EDU A;  2KQW A;  4PLL A;  1RL2 A;  3CC4 Q;  1JEG A;  1HYO A;  3HRU A;  5GJW B;  2OTL A;  3RNJ A;  5KH6 A;  1AWJ A;  2A3L A;  2V1Q A;  1YHQ Q;  2XMF A;  2KYM A;  3MPU B;  1OZ3 A;  4M77 D;  1K0S A;  1JJ2 A;  3RKX A;  1K73 C;  3P8B B;  3P8H A;  3QXE B;  2OTL T;  1YFN A;  3PGG A;  4MZT A;  3OYF A;  4XTY A;  1N9S A;  5LJ3 f;  1OX9 A;  1PRL C;  3SWN C;  3JCM c;  4D8D A;  4X9D A;  4PLI A;  4EMK A;  1SHG A;  2RPN A;  4C0G A;  1N8R U;  1IGQ A;  5A0G A;  4PKC C;  1Q82 U;  3INZ A;  1TWB A;  1VQO Q;  3JSC A;  2DL5 A;  4J6W A;  2MMP A;  1YIJ Q;  4DOV A;  2E65 A;  2JW4 A;  1ZUY A;  4J9F A;  2CP6 A;  1ZX6 A;  2FZK B;  1K9A A;  4L59 A;  2EIF A;  3GPL A;  3S3O A;  3LX7 A;  3G6E A;  1UDL A;  3CCR A;  4IUU A;  3OYI A;  2EYY A;  2HCK A;  4QKU A;  2COY A;  2DLP A;  1UHF A;  1X01 A;  2DE0 X;  2DRM A;  2E4H A;  2RK1 A;  2IG0 A;  3G6E T;  4JLG A;  3CCR T;  4EMK C;  3FB9 A;  3JV3 A;  5GAM h;  4LUD A;  1N8R C;  4LD9 K;  5GAN 5;  4MDW A;  1Q82 C;  1QVF P;  2K3Y A;  5GAO m;  5KE3 A;  3JCM P;  4AFU C;  1ZSG A;  4M7D F;  4OMF B;  4VUB A;  1RAI B;  2EGC A;  1I81 A;  1Q86 R;  2KEA A;  5CQY A;  1ZA2 B;  3J81 E;  2E41 A;  3OYA A;  2MIO A;  4F17 A;  1U8R A;  1TUC A;  4C8Q B;  5I21 A;  3OYB A;  3MEU A;  2NLU A;  2J06 A;  4M7A B;  2EQI A;  2DPP B;  1X2K A;  4QQD A;  4JJB A;  3LH0 A;  2EKO A;  2ZPF B;  4C0Z A;  2XIC A;  2B86 A;  3U23 A;  1MMA A;  5GAN 2;  3RKY A;  4M78 A;  1K9M R;  4AG1 C;  2M0O A;  2EGA A;  1VQ5 A;  1ZBJ A;  2CP2 A;  2FPF A;  2AHJ B;  4FT2 A;  2AIR B;  1UEB A;  3CCL A;  4RKU E;  1T0H A;  2KRS A;  1M8V A;  3QHS A;  5C6S A;  3EGD A;  3VV0 A;  1VQ5 T;  1M2V B;  2DFU A;  1QWE A;  5GAN d;  4F7U F;  3HRT A;  3CCL T;  1Y7X A;  1ZBX A;  2HQH A;  2E5K A;  5D7U A;  3BW1 A;  1GRI A;  4E7K A;  2NUZ A;  4BDY A;  1WFW A;  3LGF A;  2LX9 A;  2YLC A;  3CBO A;  4KUI A;  2C0T A;  1RLP C;  5CCA A;  4JJN K;  5DLQ E;  1LNX A;  2NUT A;  1X27 A;  4C92 F;  5KYN A;  1M90 U;  3CXC P;  1H3Z A;  1QQJ A;  4KT0 E;  2DRK A;  3JCM d;  3ZBD A;  1WI7 A;  1IRX A;  3JCM Q;  2DJQ A;  3JB9 G;  2QGF B;  3CD6 Q;  4JRI A;  1UJY A;  3M0U A;  5CIU A;  2EKH A;  4RTX A;  5GAN 7;  4IUP A;  3PIO A;  2D8H A;  1XTD A;  2EWN A;  1ZSZ C;  2O9S A;  2DZC A;  1I5O B;  4XU3 A;  2KRN A;  4AMC A;  8AT1 B;  2F69 A;  1AD5 A;  5KYW A;  1WHG A;  3CCV A;  1M90 C;  2X51 A;  3PMI A;  1PD1 A; 
#chains in the Genus database with same CATH homology
 2X4Y A;  1WGS A;  4II1 A;  4OB3 B;  3C12 A;  2D9T A;  4ZGJ B;  2DO3 A;  3QYG B;  3G4S A;  1U1T A;  2DZ9 A;  4X34 A;  4J83 A;  3X28 B;  3QUI A;  4A4G A;  3EFS A;  3SWN B;  1BI1 A;  1VQL T;  2D6F A;  1LOJ A;  1Y96 B;  2GCX A;  2YLB A;  3CCV T;  2MWP A;  3OS5 A;  4M78 F;  3A5Z B;  3QKJ A;  3E1S A;  4XTV A;  3HFN A;  2O01 E;  4M7D B;  4EMH A;  3EAE A;  3G4S T;  4ZGD B;  2QDY B;  2XI9 A;  1H64 1;  5CR2 A;  5DLO A;  2DIG A;  1K8A U;  3NFC A;  5CVI A;  1UGQ B;  3FEO A;  4BI4 A;  4EMG A;  5A0D A;  1QVP A;  1KQS A;  2MI6 A;  4V2S A;  1AHJ B;  1VIF A;  4M75 C;  5GAM j;  4QVD A;  2X4W A;  4A54 A;  4C0D C;  3NTH A;  3MEV A;  4M75 D;  3M4G A;  3P8D A;  4ZGE B;  3OBW A;  1WJR A;  4BB7 A;  4L6V 5;  4LDY A;  2ZPB B;  5LL6 S;  2DVE A;  3MCA B;  1WJS A;  3BDL A;  3I55 A;  3JCM J;  4IUV A;  2EJ9 A;  3GIB A;  2X35 A;  5I2M A;  4Y28 E;  3CXC S;  4BE0 A;  3ER0 A;  2XG8 D;  5A2Q E;  3OBY A;  3A8H B;  1VQN A;  3UWN A;  4JRK A;  2FL7 A;  5GAN 6;  1QVG A;  1B34 A;  5LJ3 h;  1Q7Y U;  1BYM A;  2E10 A;  2LVM A;  4GLK A;  1WJQ A;  3OB9 A;  3PNW C;  2JUF A;  5GAM d;  3I55 T;  1M1F A;  2CS7 A;  1VIE A;  2CZ6 B;  3TEE A;  4NL3 A;  5GAM f;  3GOX A;  4N4H A;  3L2W A;  3M54 A;  4EMK B;  1KC8 U;  1VQN T;  2XDP A;  1P92 A;  4RG8 A;  1YBY A;  4YTL A;  3S6W A;  2M16 A;  3JB9 F;  1UB4 A;  2EJG A;  3OQ5 A;  2JVV A;  5GAO q;  5FU6 C;  3L42 A;  2RI2 A;  2MWO A;  1K8A C;  5KCO A;  4HCB A;  2HQX A;  1HK9 A;  4EPC A;  2FVU A;  1VQ6 A;  2K2V A;  2LQ8 A;  4HT9 A;  4ME7 A;  2JTM A;  3JCM X;  5EG2 A;  2WSC E;  4OB1 B;  2F5T X;  2LCC A;  2E6N A;  3HKS A;  2XD0 A;  2LT1 A;  1MHN A;  3FRN A;  3R6O A;  5GAN f;  3HPW A;  1IZ6 A;  2L89 A;  4LDU A;  5GAO p;  5LJ5 f;  1X75 C;  4PL6 A;  2K5L A;  2K4Y A;  4XU1 A;  4HA8 A;  5CKE A;  1VQ6 T;  1RI0 A;  4C8Q A;  4F7U B;  2QEX A;  1VQP A;  2LCL A;  4ZTJ A;  3ZFJ A;  2CKK A;  4JUV A;  4M7A A;  4ATO A;  2L3R A;  4OVA A;  1GXI E;  2QA4 A;  4QQ6 A;  2PQW A;  2Y4X A;  2RHZ A;  4C8Q G;  3QBY A;  1Y71 A;  2JN0 A;  4LDX A;  1Q7Y C;  1XQH A;  3BFM A;  3CPF A;  3FJP A;  4M7A G;  3O8V A;  1PSF A;  2E6Z A;  1NPP A;  2FYK A;  4N4G A;  3URG A;  2F5K A;  2LNV A;  1VQO A;  1SSF A;  2QEX T;  1VQP T;  4FIB A;  1XNI A;  3PMT A;  2QQ9 A;  5GAN 3;  2MF2 A;  1QVF A;  5GMK j;  2QA4 T;  4JRP A;  4C8Q E;  1KC8 C;  1BIA A;  2EQJ A;  4NS5 A;  2PVG B;  4LD6 A;  2LC4 A;  5FU7 C;  4M7A E;  4C5G A;  2DTI A;  2FHD A;  3TRE A;  1FXX A;  3FIF A;  5LJ3 d;  3JCM f;  4C92 B;  2QQB A;  3QII A;  2VC8 A;  3JCM V;  1N9R A;  3CBP A;  3FDR A;  1VQO T;  3M59 A;  3CD6 A;  3OYM A;  3S3N A;  2D0Q B;  4BY6 C;  3L2Q A;  2P0Q A;  5A0L A;  1Q81 U;  5HK0 A;  2JZ2 A;  2KAF A;  2M1H A;  1V29 B;  2QQS A;  3C4S A;  3UDC A;  4R56 A;  4BI3 A;  5GAN g;  3X20 B;  2YHT A;  5LJ5 g;  3LW5 E;  4CI0 C;  2WSF E;  3DB4 A;  2V8I A;  1KG1 A;  4M7D D;  4M75 A;  4ELZ C;  3LGL A;  4FT4 A;  3CD6 T;  3RES A;  3OYC A;  4C8Q C;  2V8J A;  3PT9 A;  3E9G A;  4M7A C;  3SFM A;  4M75 G;  4IKF A;  3JB9 H;  3RMS A;  1YIT A;  4OP0 A;  2HAX A;  3MP8 A;  2RJD A;  3QDR B;  3RER A;  3CMA A;  4DOW A;  4BE2 A;  4JS4 A;  2LDM A;  3Q1J A;  4E7I A;  4A4K A;  4BE1 A;  4RCC A;  3WVD B;  5J26 A;  4M75 E;  4HKE A;  5HY6 A;  4E47 A;  4E7H A;  2ZPH B;  3M4Y A;  2ZGW A;  3BDU A;  1YIT T;  1M4Z A;  5D6X A;  5GMK i;  4J6Y A;  2EAY A;  2KDS A;  3JCM g;  3OYE A;  2LT4 A;  3JCM b;  3HP9 A;  4A4E A;  1Q86 U;  1M5Q 1;  1I4K 1;  2DKG A;  2O4X B;  4IUR A;  1G3S A;  4L5G A;  4XAX B;  3VKI A;  4BAC A;  3L2V A;  1Q81 C;  2CZ1 B;  2E1H A;  3KUF A;  4J5Y A;  3VU3 C;  5HK3 A;  2VGN A;  3QPH A;  5CKD A;  2B8A A;  3HHT B;  4O5V A;  1D3B A;  4M78 B;  1N27 A;  3GLX A;  4MMK A;  1QP2 A;  2IVW A;  3MET A;  3MP1 A;  1ZQ1 A;  2YRV A;  3OSS C;  3UT1 A;  1OI1 A;  2GF7 A;  3UPU A;  2R58 A;  3CC7 A;  4HCZ A;  1OYX A;  2DIQ A;  3MEW A;  1LJO A;  3E9F A;  1YCY A;  3OA6 A;  2R5A A;  2RJC A;  2V8K A;  4LDW A;  1EIF A;  4PJO A;  2HNI A;  2QQA A;  3X25 B;  1O9S A;  1YJ9 A;  1KQS S;  5FRN A;  1BI0 A;  2RM4 A;  5GAN h;  4PJO G;  5GAM e;  4IUT A;  4E7L A;  4C8Q F;  5LJ5 h;  3CC7 T;  2P0K A;  2BKD N;  2R5M A;  4XTZ A;  2KK4 A;  2C06 A;  2OAU A;  3VYH B;  4PJO D;  4DQ2 A;  2RH2 A;  2DXU A;  3A8G B;  3OS1 A;  4M7A F;  2GFA A;  1W4S A;  4M77 A;  4LDV A;  1X6O A;  1QW1 A;  1BI3 A;  4NL2 A;  1YJ9 T;  2L8D A;  3JRZ A;  4FM4 B;  2G3R A;  1VQ8 A;  4TVR A;  5KE2 A;  5FLX E;  3VUB A;  2ZPG B;  4PJO E;  1FX7 A;  2QI2 A;  3V7C A;  1K9M U;  4M77 G;  3OSV A;  2X4X A;  1Q86 C;  3CCU A;  3JCM W;  1K73 U;  2ZPI B;  4HT8 A;  3F70 A;  3OYK A;  3V8J A;  1QVG S;  4A4F A;  1M1G A;  3CCJ A;  1OZ2 A;  3VJP A;  4JS5 A;  2DXT A;  5GAN 8;  3RIR A;  1WQW A;  5GAN e;  3V7R A;  1XOV A;  4XU0 A;  1HXD A;  4C5I A;  5LJ5 e;  2GFU A;  4M77 E;  1WPY A;  3PFS A;  5J39 A;  4BD3 A;  1QP3 A;  5CKF A;  3SWN A;  3KXT A;  3CCU T;  1TH7 A;  1Y96 A;  3HFO A;  1BKB A;  3JCM h;  3X24 B;  5I2S A;  3OY9 A;  3CME A;  4C92 D;  3QJ6 A;  4KUL A;  1IRE B;  2MAM A;  3CCJ T;  5GAO l;  4P5N A;  4ZTF A;  3GF5 A;  3CCM A;  1UGR B;  4M7D A;  2QXF A;  3OW2 A;  1VQ4 A;  3LYI A;  4PJO C;  2ZZD A;  4EDU A;  2XDB A;  3M55 A;  1KHC A;  2KQW A;  4PLL A;  1RL2 A;  3CCQ A;  1W2B S;  1UGS B;  2RI3 A;  5LJ3 j;  5FRO A;  4JRQ A;  3JB9 I;  2RD1 A;  1ZHI A;  2WSE E;  4M75 F;  5D6Y A;  3CME T;  3DLL A;  2K5F A;  4M7D G;  2RB6 A;  3HRU A;  3E19 A;  3RUX A;  3TU4 K;  2OTL A;  3QJY A;  3M57 A;  1NE8 A;  3QG1 A;  5KH6 A;  3S3M A;  2A3L A;  3CCM T;  1VQ4 T;  5FRM A;  2Y90 A;  1UGP B;  2PU9 B;  4M77 C;  3SDZ A;  2EJF A;  4A4H A;  4C5E A;  3JCM e;  3CCQ T;  3OS2 A;  4QW2 A;  4M7D E;  1OZ3 A;  4C0D B;  4M77 D;  4XTW A;  3RKW A;  1JJ2 A;  2R57 A;  4OB0 B;  2H3J A;  3RKX A;  1K9M C;  5GAM g;  4J8O A;  1K73 C;  3P8B B;  3P8H A;  3QXE B;  2P4T A;  3G6E T;  2OTL T;  3CCR T;  1JBM A;  4OGC A;  3PGG A;  4X9C A;  4MZT A;  5D6W A;  2VGM A;  3OYF A;  4XTY A;  5IN1 A;  1N9S A;  4UC4 A;  3L2U A;  4FU6 A;  4RCB A;  5LJ3 f;  3T9N A;  3SWN C;  3JCM c;  1QVF S;  4X9D A;  1FWZ A;  2RHU A;  4WF2 A;  4PLI A;  3L1A A;  2DEQ A;  2DD5 A;  4QVZ A;  4EMK A;  2HD0 A;  4C0G A;  1N8R U;  4IUQ A;  4M7D C;  4KUD K;  5A0G A;  2DXB A;  4PKC C;  1NPR A;  4FSX A;  4M78 C;  1Q82 U;  3INZ A;  5HKC A;  4XTX A;  2DD4 A;  3JSC A;  3CBM A;  1S72 A;  3RMQ A;  2DK3 A;  3EFR A;  4M78 D;  2HBP A;  3A8O B;  4J6W A;  2VXE A;  2MMP A;  3CPW A;  5FU6 B;  4DOV A;  2E65 A;  4PJO F;  3H6Z A;  3DLM A;  3C94 A;  4L59 A;  2EIF A;  3LWH A;  3M9Q A;  4F7U A;  3GPL A;  4FL6 A;  2LTO A;  5CO7 A;  3S3O A;  1S72 T;  1O75 A;  3BY7 A;  3LX7 A;  1WNL A;  3G6E A;  3CCR A;  3QYH B;  4IUU A;  2XK0 A;  1I8F A;  3WXM B;  5GMK l;  4C5H A;  4M77 F;  3OYI A;  1YJW A;  3NTI A;  3CC2 A;  3OYY A;  4F7U G;  4J6X A;  4XTU A;  3CMA T;  2RJE A;  1X01 A;  3DB3 A;  2CZ0 B;  2RK1 A;  2IG0 A;  3M58 A;  1R8O B;  3FC3 A;  1B34 B;  2E64 A;  1VUB A;  3MHX A;  3OMG A;  4JLG A;  4ZN3 A;  2BUD A;  2XKO C;  3HRS A;  3FB9 A;  4EMK C;  4F7U E;  5GAM h;  2EFI A;  4RMO A;  2X4J A;  1YJW T;  2KMT A;  3CC2 T;  3AHU A;  2CGH A;  2ZCF B;  1N8R C;  4C92 A;  4LD9 K;  5GAN 5;  2A7Y A;  3QSU A;  4MDW A;  3V8L A;  2HQE A;  1Q82 C;  3SB2 A;  2Y4Y A;  2K3Y A;  3GNF B;  3OMC A;  2RO0 A;  5FU7 B;  5KE3 A;  4C92 G;  5GAO m;  3OYJ A;  3JCM P;  2EQK A;  1KHI A;  5CK9 A;  4M7D F;  3ZEH A;  2E5Q A;  4OMF B;  4QQG A;  4VUB A;  4DA4 A;  3JB9 D;  1VQ7 A;  2VUB A;  4ELY C;  4BY6 B;  1I81 A;  4MZM A;  2PUO B;  3ME9 A;  4GY5 A;  3I56 A;  5CQY A;  1JB0 E;  1G5V A;  4C92 E;  1YJN A;  3J81 E;  3PIP A;  2E41 A;  3OYA A;  2XDD A;  1VQ9 A;  4XK8 E;  4ZN1 A;  1BI2 A;  2XU8 A;  3TCJ A;  4OB2 B;  4R55 A;  1G3W A;  4B9W A;  3L2R A;  1U8R A;  1VQ7 T;  4C8Q B;  5I21 A;  3OYB A;  1M9S A;  1G3Y A;  3JAM E;  3MEU A;  2NLU A;  3I56 T;  4M7A B;  3DKM A;  2DJZ A;  2QTX A;  1YJN T;  1M1K U;  3QZ5 B;  3V8K A;  3CXC A;  1VQ9 T;  2DPP B;  2GQV A;  2EQM A;  2WAC A;  3J80 E;  3N5B B;  2LQK A;  4HCC A;  5DM7 R;  4QQD A;  1KD1 C;  3CCE A;  2PUK B;  1VQ8 T;  3GNG A;  3X26 B;  3CCS A;  3JB9 J;  4J7I A;  2L5Q A;  4C92 C;  3LWI A;  5GAN 4;  3LH0 A;  1NZ9 A;  2EKO A;  4B9X A;  2O4X A;  2EQU A;  2ZPF B;  4C0Z A;  2VV5 A;  1NJI U;  3OYH A;  5GAN j;  3M53 A;  5J3B A;  2K3X A;  2CYZ B;  2PVO B;  2XIC A;  5LJ5 j;  3CC4 A;  4Y91 A;  3OYL A;  1WQ7 A;  2RJF A;  2E12 A;  4C0F A;  3CCE T;  1KQ1 A;  2M9U A;  5GAN 2;  3CCS T;  1KQ2 A;  3LLR A;  3RKY A;  2RHI A;  3G7Z A;  4M78 A;  3OYN A;  4MML A;  2M0O A;  3SD4 A;  1VQ5 A;  2CZ7 B;  1YHQ A;  2AHJ B;  4CRI A;  4FT2 A;  1UEB A;  3A8M B;  3OW2 S;  4RKU E;  1YI2 A;  4M78 G;  3GP8 A;  3CCL A;  3CC4 T;  1JRI A;  5CQX A;  2RHY A;  4JLI A;  4KBM B;  1M8V A;  3QHS A;  5C6S A;  4M75 B;  2XID A;  3VV0 A;  2E70 A;  5DY9 A;  1W2B A;  1MGQ A;  5GMK h;  2KY9 A;  5LJ3 e;  1VQ5 T;  2JNG A;  2P0P A;  1YHQ T;  5GAO r;  4RG2 A;  4M78 E;  4F7U F;  3ASK A;  5GAN d;  1DJ7 B;  3HRT A;  3CCL T;  1YI2 T;  5LJ5 d;  1M1K C;  3J7A F;  5GMK m;  4D6W A;  1Y7X A;  1ZBX A;  4PNO A;  4QVC A;  3BW1 A;  1JJ2 S;  1U1S A;  4E7K A;  1VQK A;  3KBG A;  4BDY A;  2DTH A;  4OGE A;  4O6J A;  1G3T A;  2QQR A;  3LGF A;  2LX9 A;  2YLC A;  4N0A A;  3CBO A;  1NJI C;  5C0M A;  2XHC A;  4Q5W A;  5CKB A;  3H8Z A;  5GMK e;  4E7J A;  4KUI A;  5M9O A;  3VUZ A;  2DTO A;  2EYQ A;  2VXF A;  3QZ9 B;  5KCH A;  3HL8 A;  2RI5 A;  5CCA A;  4JJN K;  3MO8 A;  4MZP A;  1LNX A;  5DLQ E;  4C92 F;  1M90 U;  5GAO n;  1H3Z A;  4NOY A;  1VQK T;  4N4I A;  4A53 A;  1N6A A;  4XU2 A;  2LRQ A;  4KT0 E;  1YIJ A;  5IT9 E;  4XQ3 A;  3WVE B;  2K5I A;  3QO3 A;  4BI8 B;  3JCM d;  3ZBD A;  1VQM A;  1D3B B;  3A8L B;  3JCM Q;  3VYG A;  2BIV A;  3OYG A;  5L8R E;  2FB7 A;  3JB9 G;  1Y07 A;  3L2Z A;  2RHX A;  3G71 A;  2DXC A;  1YIJ T;  3CEY A;  3M5A A;  2OTJ A;  4PJO B;  4JRI A;  3CPW S;  5CIU A;  1VQM T;  2RK2 A;  5GAN 7;  3M56 A;  4IUP A;  3PIO A;  1BIB A;  2JOY A;  3MP6 A;  1XTD A;  3NTK A;  4OF1 A;  2EWN A;  2ZPE B;  4JDS A;  5CKH A;  5LJ3 g;  1PSE A;  3C95 A;  5IAY A;  3G71 T;  2PVD B;  2KSS A;  2DZC A;  2KVQ G;  3PTA A;  4M77 B;  2OTJ T;  4C8Q D;  3MEA A;  2I2L A;  4XU3 A;  4N0A C;  2K57 A;  1KD1 U;  3HSB A;  4M7A D;  3OS0 A;  5CAI A;  4BUG A;  1I5L A;  4BDZ A;  4MDX A;  3V7S A;  1VQL A;  2F69 A;  4Z02 A;  4J7F A;  5AYF A;  3CCV A;  3FLG A;  2DAQ A;  3OYD A;  2RA2 A;  1M90 C;  2VYT A;  2JTF A;  3PMI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...