1TH7A

Crystal structure of an archaeal sm protein from sulfolobus solfataricus
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
78
structure length
78
Chain Sequence
GAMNFLAETAHKVLAESLNNLVLVKLKGNKEVRGMLRSYDQHMNLVLSDSEEIQSDGSGKKLGTIVIRGDNVILISPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Small nuclear riboprotein protein
publication title Crystal structure of an archaeal Sm protein from Sulfolobus solfataricus
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 16
structure length 78
sequence length 78
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature
pdb deposition date 2004-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1th7A00
3EFRA 2DXTA 4F7UA 2E10A 4NL3A 4M75A 5GANe 3JCMJ 3JCMV 4HT8A 4JUVA 3JCMQ 2ZGWA 4M77C 5GAMe 3QSUA 3RKYA 2K57A 3GIBA 3HSBA 4RCBA 1WQ7A 3SWNB 5GMKl 2E64A 5LJ3f 5GANf 5GAN8 1WQWA 3EFSA 5LJ5f 4M7AF 4PJOA 3FB9A 1M5Q1 2DZCA 5GMKe 4HA8A 4M78B 1MGQA 4M7AG 4EMHA 5GAMd 4M7DA 1WNLA 2YLCA 1I81A 4XTZA 5GMKj 1WPYA 1N9RA 1LOJA 4F7UB 4HT9A 5GMKh 4M77E 3JCMh 3BDUA 4A53A 4C92C 3RERA 3V8KA 3SWNC 3L1AA 1JRIA 4WF2A 5GAMg 5GAN2 3JCMd 3JCMb 4M77F 2DJZA 3BY7A 2Y90A 4XTVA 4XTXA 4DQ2A 5GAOm 3JCMP 2RD1A 3JCMX 2DTOA 3QO3A 4M78C 3JCMc 2EWNA 4M77G 3V7SA 4PJOB 4V2SA 3JCMg 3AHUA 4C8QE 4M7AE 1BIBA 4M7DB 4J6YA 2RA2A 4M75C 4QVDA 2EAYA 4C92E 4C8QF 1JBMA 5GAMf 4M7AD 3JB9H 1YCYA 1HK9A 3FJPA 1BIAA 5GMKi 5CAIA 2DTIA 4C92F 3JCMe 2YLBA 4C8QG 5GAN5 3JB9D 3JB9F 2EJGA 4M78E 2E65A 1LJOA 4PJOC 4J6XA 2YHTA 3JCMf 4C92G 3JB9G 3BW1A 4EMKA 4M78F 3JB9J 4M7DC 4XU3A 5I21A 5GAN3 3RESA 4Y91A 5GMKm 4M77D 4M75E 1TH7A 1N9SA 5GAOn 4M78G 1H641 4F7UF 3RKXA 4MMKA 5GAN4 4N0AA 3PGGA 4M75F 3BFMA 4OP0A 2JN0A 4F7UG 5LJ5j 4XU2A 3V7RA 3RIRA 4M75G 4PJOE 2DKGA 4M7AA 2EJFA 4EMGA 4C8QD 1KQ1A 2HNIA 4PJOF 2E1HA 1I4K1 4EMKB 4JRKA 2DTHA 4J5YA 4C92D 1B34A 1D3BA 4XQ3A 2DZ9A 4PJOG 3HFOA 3RUXA 4MMLA 1I5LA 4XTYA 1HXDA 1KQ2A 5GAN7 4QVCA 4XTUA 3JB9I 3JCMW 1U1TA 3VU3C 2VC8A 3QUIA 4M77A 4M78D 4NOYA 4A54A 4JRIA 4F7UE 2QTXA 3RKWA 3SB2A 4J6WA 2VXFA 4XU0A 4M7AB 4C8QB 5LJ3e 3M4GA 5GAN6 1Y96A 4EMKC 5LJ5e 4M75D 5GAOr 3HFNA 4C92B 5GANj 4XU1A 5LJ3j 2DVEA 5GAOl 3INZA 5GANh 5GAMj 5LJ3h 2CGHA 1B34B 1D3BB 1I8FA 2FB7A 4C8QA 4XTWA 5LJ5h 4N0AC 1U1SA 2RB6A 3L2ZA 5GAMh 5GANd 5GAOp 5LJ3d 5GAOq 4NL2A 5DY9A 5LJ5d 4M7DE 4C92A 3QHSA 1X01A 4PJOD 4X9CA 3SWNA 2DXUA 2I2LA 4M77B 3V8LA 4C8QC 2EJ9A 2E41A 4M7AC 3V8JA 4M7DD 4M7DF 2FYKA 5GANg 4PNOA 4RCCA 4M75B 4JLIA 5LJ3g 1M8VA 2VXEA 4M78A 2DEQA 3V7CA 5LJ5g 1Y96B 4M7DG 3FIFA 1LNXA 4X9DA 2RM4A
chains in the Genus database with same CATH superfamily
2RJEA 1X6GA 1AHJB 1VOMA 2XKOC 1ZSGA 3QKJA 2RI2A 5GANe 2LRQA 4J9CA 1VQ6A 2ED1A 1OX8A 2QQAA 2XG8D 3MKDA 3H0IA 1MGQA 1OPKA 2QQSA 3EG9B 1KC8U 4B6MA 4BUGA 3NTHA 3A98A 3BDUA 1SRLA 3ULRB 1YJNT 4XAXB 2AZSA 1EZZB 1MV3A 4AT1B 2A7YA 2R57A 3V7SA 1M90C 3DLLA 1ZA2B 1G5VA 2P0PA 5CQYA 2XD0A 2L8DA 2H3JA 1G83A 3JB9H 3FJPA 3EHRA 2DEUA 1YIJT 2ZAEA 4PJOC 2QI2A 1AWOA 1H3HA 3M4YA 1U06A 3OYFA 4M78G 3CCST 3I56A 4F7UF 1VUBA 3MJXA 1D1CA 1PHTA 2DKGA 2ZPFB 3CMAA 3CC7T 4OMFB 2E1HA 4BD3A 4EMKB 1AVZC 4J9FA 1Q86R 4XTYA 1WJRA 3QUIA 2HDAA 3CMET 1N8RR 2DLPA 3A8MB 2QTXA 1YHQA 1TUCA 2EQKA 1FXXA 1Y96A 4AG1C 4N4HA 5GANj 3MCAB 1TS9A 1MNEA 3LGFA 3QHSA 3X24B 1FX7A 2C06A 2DXUA 2RHZA 4FW2A 4BI8B 2L2PA 5LJ5g 2V1QA 1LNXA 1QVFS 1TTHB 1UGVA 3OMGA 1RUWA 3QSUA 2HSPA 3GIBA 1YN8A 4RTWA 3THKA 3QJYA 2DXCA 4PJOA 2KE9A 4IUUA 1K73R 1PKTA 2MWPA 3LH5A 4OMQA 1I07A 1BB9A 4CC2A 4EDUA 1G8XA 3BE3A 3GF5A 4J8OA 3PFSA 2Y90A 4XTVA 1TXQA 3QO3A 1UECA 2EKOA 1AOJA 1VQKQ 4RG2A 3JCMg 4JZ4A 3LGLA 5C6SA 4M7DB 2FRYA 2RF0A 3LW5E 4MZPA 4DBQA 2DERA 4M7AD 4QQGA 2LJ1A 1VQLQ 2CP5A 1HK9A 2OAWA 3I56T 2F5TX 3J81E 2ZZDA 4J6XA 1TU0B 2X51A 1BKBA 2GBQA 2EGCA 2QAZA 3OYCA 5I21A 1YJWA 3A8GB 1GCQC 1SEMA 1KC8C 2LCLA 3O8VA 3GNGA 2LQNA 3M57A 2SEMA 2ZPEB 1T0JA 3CC2A 3M0QA 3CCET 2W10A 5FWBA 2PVOB 2JJ9A 1SKUB 2R5MA 5IXBA 1YHQT 1A0NB 4PJOG 1IREB 1HXDA 1Y0MA 4BACA 2DIQA 2DVJA 2RQRA 4BI4A 1MMNA 1K8AU 3OYKA 1GL5A 1VQMQ 2YRCA 3G6EQ 3UT1A 4XU1A 1X75C 3I5RA 3M53A 4CC7A 1NZ9A 2FB7A 4Z89A 3L2ZA 4FYXB 4DBRA 1Z9QA 1E6HA 1VQPT 4KGVB 4HKEA 2CYZB 3CCLA 2MYSA 4FYWB 5GANg 2DYBA 3LX7A 1VQOQ 4PKCC 4F7UA 1UJYA 3H41A 4N4GA 5L8RE 3JCMQ 2DAQA 2K57A 3BDLA 5GMKl 2L3QA 2WSFE 5LJ3f 2KXDA 2KAFA 3VS3A 2YWWA 5GMKe 4N4IA 4JJCA 2YLCA 3QYHB 1GCQA 3HRTA 2DJZA 4OF1A 2R58A 3JCMX 3MEAA 3MO8A 4MZMA 3I55Q 3EGUA 3QJ6A 3DKMA 2ENMA 1TSFA 5HY6A 3TSZA 2KYBA 2RQVA 3CD6Q 1BIAA 1YJWT 1N6AA 3MP1A 3JB9F 2RN8A 4E6RA 2L5QA 4JRQA 1UHCA 2EVRA 3CCJA 3CCVQ 2I0NA 4OMPA 4GLKA 3RESA 3H8ZA 1N9SA 8ATCB 4F7UG 1RABB 1K9AA 2JTMA 2EQJA 4EMGA 1WHGA 2JOYA 2XK0A 2RHYA 2CT4A 1VQ9A 4JRKA 2DMOA 4AG2C 4JLGA 4LDUA 3JV3A 2CSQA 1RAFB 1BK2A 4D8DA 2AHJB 1BYMA 4LXCA 3OB9A 3GPLA 1GFDA 1X27A 3SB2A 2GNCA 1OI1A 3CPFA 5J39A 1UG1A 3CCLT 1WYXA 2O4XA 1KK7A 2CH4A 2GFAA 5DY9A 1YI2Q 4M7DE 1UTIA 3OW2S 2DPPB 2I2LA 2NYSA 4FT2A 4AFZC 4JLIA 3L2UA 4IKFA 3R6OA 2LTOA 2CSIA 2QG9B 2EGAA 4NL3A 2NUPB 4Z8AA 4ELZC 2MMPA 2HZYA 1K8AC 1EIFA 1BCMA 1R77A 1JXMA 4P5NA 3OYNA 1ZBJA 5LJ5f 1RLPC 1VQNQ 3ER0A 2L89A 2EIFA 4PLIA 1ZSZC 1FMKA 2A36A 2KRMA 2QA4A 2KGTA 2HL5C 1V76A 2P84A 4EPCA 2YXYA 3EGDB 2HMAA 2J05A 2RNAA 4XTXA 1NYGA 4FSSA 2DTOA 1IHWA 1SHFA 1CKBA 2P0QA 1KC8R 3AHUA 3ASKA 2EBPA 4ZN3A 2JM8A 2JW4A 1BIBA 5IHIA 3P8DA 4C8QF 1OU9A 3CCJT 1UGQB 1YCSB 3PTAA 2V8KA 3OW2A 1WFWA 4DEYA 3I9QA 1WX6A 4FM4B 3JCMf 2LNVA 2V1RA 4HCKA 4C5GA 3HL8A 1H641 3OS0A 1W2BS 4GLMA 1VQ9T 1U8RA 3FJ5A 2E5KA 1VQ4Q 2E6ZA 3S6WA 2X4YA 3X28B 2JMCA 2F69A 2LJ0A 1BI0A 2QGFB 2FEIA 1QVGS 2EFIA 4ATOA 2RJDA 3L42A 1OU8A 2WSCE 4Y28E 4YTLA 5CVIA 4J6WA 2KROA 1MNDA 1VYTA 4C5IA 3EG0A 1ZSZA 2XMFA 5IAYA 5GAN5 3OYMA 5GAMh 4N0AC 2VKNA 3G7ZA 5GAOq 4DBHA 3CCRQ 1KD1R 1IO6A 3EFOA 2FZCB 1IZ6A 2KRNA 1ZQ1A 2DEQA 2JVVA 2Z0WA 4DEXA 1HJDA 4Y92A 2YRVA 3PVQA 3JCMV 2DILA 1W2BA 2VYTA 5GAMe 1SHGA 3SHWA 1NJIU 2JTFA 2JNGA 1WQ7A 5GANf 5IT9E 3G1JA 3H0HA 2E3IA 2AKLA 5GAMd 2PQWA 2VGMA 2RHUA 4Z02A 2LNHB 2DK3A 2YUOA 1QVGA 4FU6A 3RERA 1H3ZA 1JRIA 2KVQG 1M9SA 1AT1B 2KSSA 1W4SA 2EWNA 2DXBA 1Y07A 5KYYB 3MEVA 4LD9K 2O01E 1X2QA 4ZGDB 2ESWA 5GMKi 2JS2A 3ME9A 2PU9B 3JB9D 1UFFA 3OQ5A 3DB3A 4E7IA 2DM1A 1E7OA 2EYXA 3OW2P 3JB9G 3OYDA 1OOTA 2VB6A 2F2VA 4N0AA 1FWZA 2NUZA 2HBPA 3BFMA 1EX4A 3DLMA 1KQ1A 4IUPA 5CKFA 3GP8A 2CP0A 1D3BA 3CBMA 2CP3A 3MEWA 1ZUKA 2HBWA 2KBTA 1XTDA 3RKWA 1YIJA 1T0HA 2EQIA 4M7AB 2NUTA 4OMMA 5GAOl 3INZA 2EYWA 2FZKB 5GAMj 1NLOC 2EKHA 4C8QA 1BI3A 1WDXA 4HVVA 2HQHA 2CP7A 1B7TA 1Q95G 4FIBA 4IUQA 4FYVB 4ANJA 2DF6A 3EG3A 1BU1A 1UHFA 2GQVA 3H6ZA 1M8MA 3CC7A 3L2WA 1K76A 3HHTB 1MV0B 4L59A 1AZGB 3VV0A 4F04B 1VQ5T 3MEUA 3TCJA 3M0SA 3CMEA 1W2BP 4L6V5 3CEYA 1NPPA 1PWTA 4PK4A 1NPRA 3REAB 1M1FA 3A8HB 2O2OA 3V8KA 2MI6A 4M77F 1QVGP 1M2OA 3C0CA 2A37A 2FPDA 1NEBA 4FCYA 3SDZA 1W70A 3RDVA 2RHXA 3S3MA 2KEAA 3C12A 2FG0A 1OV3A 1KHCA 1V1CA 1NJIC 5CAIA 1Q81U 1WXUA 2EQUA 4C92F 3M0TA 3P8BB 4C8QG 1T3SA 2EJGA 4M78E 2QTVA 2QGGA 4QW2A 1QWEA 4D8KA 3LH0A 4HXJA 4RTXA 2BE9B 4C0DC 2G3RA 3RKXA 1VQLA 4M75F 2KT8A 2QXFA 1SSFA 3E1SA 3CCQQ 1TUGB 2IVWA 3RBBB 2O88A 1JEGA 2KQWA 4RG8A 1ABOA 4XTUA 1AD5A 2ECZA 1H92A 4M78D 3MP8A 3OS2A 4BB7A 1YJ9Q 2LMJA 3QWYA 2RJCA 4ZNXA 3E19A 1BI1A 4XTWA 2YSQA 1M27C 1VQMA 3G6EA 4JJDA 2K4YA 5IHNA 1LVKA 1XNIA 2D8HA 4GBQA 3CCEA 2D9TA 1WHMA 1RAAB 3CC4Q 3A8LB 3JCMJ 4BE0A 4M77C 1OPLA 5FRMA 1VQOA 2C0OA 4GY5A 3OS1A 2M16A 1OZ2A 4ELYC 4C92C 2X4WA 4BDZA 1M1GA 3FEOA 3JCMb 3BY7A 1VQPA 3SD4A 4IIOA 4J9BA 3M56A 4M7AE 3M59A 1IRXA 4M75C 1SPKA 2KY9A 1VQKT 1S1NA 3WVEB 1TG0A 2DTIA 4IUVA 2K6DA 2EYYA 3NMZC 2QEXQ 3I55A 1VQLT 3OS5A 3VS7A 2DETA 1Q82R 1Y57A 1PSFA 3CD6A 1DJ7B 4FYYB 1X6BA 4C5HA 1M3BA 4II1A 4PJOE 1QWFA 1D0XA 2ZPBB 5CKEA 2K3BA 3OBWA 1VQ6Q 3CCVA 3FRNA 2DTHA 4OGEA 1TWBA 3L2VA 4PL6A 4PFOA 2RI3A 1YNZA 2F1LA 2JUFA 4M77A 1Q81C 2CP6A 2BKDN 3M5AA 4QVZA 1NM7A 5FU7B 1QVFA 2O4XB 3M0RA 4DOWA 1NE8A 4KGZB 4EMKC 4OMNA 2JM9A 1PRMC 1VQMT 4NS5A 3G6ET 2KNBB 1RAGB 4PJOD 1WZOA 4C92A 2RQTA 3KUFA 5I2MA 4PNOA 5GJWB 2HAXA 2DYIA 3EG9A 2GGRA 2E10A 4PLLA 1JXOA 1WHLA 4M75A 4JUVA 9ATCB 1VQOT 4E7JA 3SWNB 1ZUUA 1X43A 3OYEA 1WLPB 4UC4A 2FRWA 4A4FA 2A08A 2P4TA 1SRMA 3CMAQ 2DL4A 1WPYA 1NJIR 1LOJA 3GNFB 5KE2A 5GMKh 1X6OA 1M1KU 4KRTA 1K0SA 2FHDA 1J3TA 2RI5A 1GFCA 3JCMP 2ABLA 2LDMA 4OB1B 1MHNA 1VQNA 3JCMc 4M77G 1U5SA 2LQKA 2MPXC 1S72Q 1QCNA 5CKHA 1NLPC 1M90R 3I55T 2D6FA 1WHKA 2E4HA 2YLBA 3LYIA 4BY6B 3CD6T 2B86A 1QP3A 3O5ZA 4C92G 2M9UA 4EMKA 4IURA 4M7DC 4XU3A 5KYXB 2AZVA 4RTZA 3NTIA 2SRCA 1VYVA 4MDWA 5DLOA 4MMKA 3CCVT 1NEGA 2MK5A 1ARKA 4ZTFA 3REBB 1PRLC 1RAIB 1YBYA 4M75G 2F5KA 2C0TA 2HNIA 2A28A 3PMIA 3QPHA 3RNJA 5HK0A 3HFOA 4CI0C 2AK5A 4A54A 3PIPA 4RKUE 5CR2A 2HSEB 5I2SA 1QVFP 2DVEA 4VUBA 3EFOB 2CGHA 1B34B 3NGPA 1U1SA 4R56A 4OB2B 1OQKA 4C0FA 4KBMB 2GQIA 3C4SA 2QQ9A 3V8LA 3OYGA 3CCMQ 3EGXB 1KSWA 4DBFA 1OULA 1M4ZA 1R0CB 4J9GA 1YI2T 3EG2A 2AIRB 4LDXA 1RAEB 1UDLA 1UE9A 2XDDA 2M0OA 4HT8A 1MMDA 4EIKA 1UGSB 3RKYA 3CCRA 1UGRB 4PJNA 1WQWA 2DRKA 2WSEE 3OBYA 3FB9A 4HA8A 2X3XD 5KYNA 2JS0A 4EMHA 4M7DA 5GMKj 4J83A 1VQNT 3CC2Q 1GBQA 2ROTA 3L1AA 3OYHA 2MOXA 4DQ2A 2DBMA 2OTJQ 4KH0B 1B07A 1Q86U 5M9OA 3VS5A 2JZ2A 4LE9A 4E7SA 2COWA 1UGPB 2K5IA 3PE0A 2RA2A 1N8RU 2CH4W 4AFSC 2P4RA 1D1AA 2CREA 3QG1A 1BI2A 1B3QA 2FPFA 5GAN3 3EH2A 1Q81R 1M1KC 4LNPA 4ZN1A 3ZBDA 3C94A 5FU6B 3CXCS 4ZGEB 2DL7A 5IHKA 4LDWA 3FLGA 1TUDA 5CQXA 2V26A 5HCKA 3ZFJA 3G71Q 5CKDA 1VQ4T 2LC4A 3G4SQ 3UF4A 2LQ8A 3GBQA 2COYA 4HVUA 3CBPA 3CCUQ 1UB4A 4C8QB 5LJ3e 1JB0E 1WJQA 2JTEA 2LCSA 1M30A 5AYFA 2ZPGB 5LJ3d 4RUGA 5KYWB 4X9CA 1WGSA 3DB4A 2E41A 1X2KA 4RCCA 1QCOA 2JMAA 5J3BA 1YITQ 1UUEA 2QASA 3CCRT 1CKAA 2J6KA 2CUDA 2H8HA 1LCKA 2RJFA 5GJVB 2GCXA 3PIOA 2RMOA 1M5Q1 2D0QB 5KYUA 4M78B 5FRNA 3VYHB 3S3NA 4F17A 3VS4A 4E2FB 5GAN2 1WI7A 3A5ZB 3TEEA 3E2UA 2VGNA 3JSCA 2RD1A 3LWIA 2XI9A 1GXIE 1ZBXA 1OYXA 2PVDB 4B9XA 1RADB 1UEBA 4ME7A 2QQBA 4FL6A 1JBMA 2VVKA 2YUQA 1VQ5A 4RMOA 2E65A 2YHTA 4M4ZA 5LL6S 3EAEA 3X20B 1ZLMA 1QKXA 5D6XA 5GMKm 1QLYA 5DM7R 4OP0A 3EH1A 4LN2A 3RIRA 1PM3A 1NYFA 1Q86C 1NG2A 1QP2A 2V8JA 4C0ZA 1QQJA 1I4K1 2QDLA 3OSVA 3L2RA 1FMVA 5A0DA 1N8RC 3PT9A 1QMCA 4RTTA 2EW3A 5GAN7 1C6VX 2QA4Q 2BE7D 5LJ5e 3TU4K 3KFVA 5GAOr 2LCCA 3HFNA 3OSSC 1K4US 4FT4A 1YWPA 2NUPA 2GTJA 5HK3A 3IQLA 4NL2A 5LJ5d 1ZUYA 1V29B 3X25B 2EPDA 4ZTJA 4AFUC 2KDSA 3E9FA 2OX7A 3VS1A 4WCIA 2VXEA 2YDLA 4HVWA 4D6WA 1Y96B 2RM4A 3M55A 3EFRA 2QDYB 1HD3A 4RTYA 1PC0A 3EGDA 1PG5B 1M3CA 2IIMA 2XHCA 4C0DB 2E64A 1D1BA 1KIKA 4M7AF 1AWXA 1K8AR 3VJPA 1VQ7Q 4A4HA 2F2XA 2BZYA 3M9QA 3CC4A 1N9RA 1RLQC 1IHVA 2PUKB 4FSXA 4WF2A 3JCMd 2BTTA 3UDCA 1QW1A 3PNWC 4PJOB 4A4KA 3VS0A 5DLQE 4QQ6A 1M2VA 4C8QE 1M1KR 1FMWA 1WHHA 3PMTA 2HEQA 1PD1A 1VQ8Q 2CP2A 4KULA 3RR6A 3OYIA 3VS2A 1P92A 1RL2A 2DL3A 2KR3A 2IPOB 2PZ1A 3I35A 5GAOn 2KMTA 4J9IA 2HCKA 1WJSA 5GAN4 4OGCA 2JN0A 3P8HA 2LQWA 5LJ5j 4XU2A 2VWFA 1O9SA 2ED0A 2QEXA 2EJFA 2RHIA 1I5OB 2OI3A 2EYZA 1G3WA 1W1FA 1I0CA 4C8QD 3CPWS 1YFNA 2D8JA 3VUBA 1WA7A 2OTLQ 4TVRA 4XQ3A 3RUXA 2LT4A 3VS6A 3CCQT 2L0AA 2J6OA 2YRDA 2E12A 3VU3C 3LWHA 1MMGA 1VQKA 1CSKA 4NOYA 3META 4HCZA 4E7KA 1HYOA 2LP5A 4JJBA 3CBOA 4C92B 1BBZA 2CZ6B 1YJ9T 3UA7A 1X69A 1G2BA 3GOXA 2RB6A 5GANd 2X4XA 4C0GA 3TREA 3ZL7C 1E6GA 4M7AC 1GCPA 4M75B 3HP9A 2DA9A 2DD5A 2NWMA 2DFUA 3UATA 1JJ2S 2DXTA 2EQMA 1YP5A 5D6WA 2EGEA 3OYLA 3HSBA 2QK0A 4E7HA 3CC4T 2CT3A 2DZCA 2D1XA 5KYYA 3CPWA 2PNIA 1YJNQ 3N5BB 2RH2A 4F7UB 2MF2A 5GAMg 2KK4A 1LPLA 1K9MU 1ZHIA 2JXBA 2J6FA 4AFQC 3S3OA 4AMCA 2MAMA 2AT1B 3QWXX 3J7AF 3SFMA 2K79A 1KQSS 1YIJQ 4J6YA 3OYAA 4L5GA 2EAYA 5I22A 1Y7XA 4CC3A 3C95A 4HCBA 2RPNA 3CCSQ 2DD4A 2WACA 3BW1A 3HPWA 4OMLA 2K2MA 2M0YA 2K3XA 4OB3B 1S72A 2QEXT 1JJ2A 1N5ZA 1KD1U 3CC7Q 1VYUA 1SSHA 2CZ7B 4C5EA 4M7AA 4E7ZA 3QYGB 2K5LA 4J5YA 5I11A 3CMEQ 1I5LA 4PFZA 4KT0E 1ACMB 4ZGJB 2MIOA 1VQ6T 3JCMW 4JJNK 1QKWA 4B9WA 4X34A 1GBRA 2K5FA 2VXFA 4XU0A 1JO8A 1PNJA 1G3SA 3ZEHA 3FDRA 2D0NA 1KQSA 1Q7YU 4LD6A 3CQTA 2L3PA 4KGXB 2EJ9A 1SG5A 3V8JA 4M7DF 5C0MA 5EG2A 2E5QA 1PKSA 3FIFA 1PCXA 5A0GA 1K0XA 1MMAA 2CZ1B 1VIEA 5L23A 4RCBA 3CCMA 3OYYA 2LZ6B 2DE0X 2F2WA 2CKKA 2ZPIB 4M7AG 2AKKA 1AZEA 1WNLA 2CUBA 2HKNA 1I81A 1QCFA 1UJ0A 4XTZA 4CC4B 3CPWP 5CK9A 4M77E 2Y4YA 3HRSA 2V8IA 2PVGB 5GAOm 3CMAT 4IUTA 4JRPA 3QZ9B 3QIIA 4V2SA 1YI2A 3OMCA 5FROA 2K3YA 3VUZA 4C92E 3I56Q 3H0FA 1S72T 5A0LA 5KH6A 1IXDA 2OTJA 3M0UA 1LJOA 2BZ8A 1D0YA 3WVDB 1WXBA 5CO7A 3RMSA 1EFNA 3NFCA 3X26B 2PUOB 2M1HA 3J80E 3MHXA 4LUEA 4M77D 4M75E 4PJMA 5FWCA 2DL5A 4PFPA 2H3EB 3CCEQ 1JJ2P 5EC7A 5FLXE 4HCCA 4JZ3A 1H8KA 1YHQQ 1K9MC 3JAME 2FO0A 3EHQA 4ORZA 2RQUA 4J7IA 3QZ5B 1OX9A 5D7UA 4C92D 3OY9A 3EG1A 1ZA1B 2DBKA 2QYZA 4F7UE 4IIMA 1NBEB 2L3RA 3AT1B 4M75D 4F16A 3VRYA 3G71A 2QQRA 3F70A 3G4SA 3D7SB 1VQPQ 4A4GA 1KD1C 1U3OA 1G3YA 1KQSP 5FU7C 3CCUA 2DX1A 1XQHA 2YUPA 2OJ2A 4E7LA 2DRMA 4X9DA 2G6FX 3CCMT 1RI0A 1ZSZB 4ESRA 4BI3A 5A2QE 1VQ4A 2FL7A 4R55A 4A63B 5KYUB 1IGQA 1JQQA 1VA7A 1YITA 2X9HA 2GTOA 4J9EA 4KUIA 2RQWA 1XJWB 2IG0A 3NTKA 1K1ZA 1ABQA 2BIVA 1Q7YC 1KG1A 1G3TA 3SWNC 2A3LA 3NHNA 3JRZA 3CC2T 4BE2A 3R6NA 3TQ7P 8AT1B 2OTJT 1YJWQ 3Q1JA 4R0KA 5GAMf 2DNUA 1YCYA 3HKSA 4FW1A 2B8AA 4PJLA 4O5VA 4WTOB 2KXCA 3A1PA 1SF9A 2M51A 3UWNA 5CKBA 1R8OB 5CCAA 2MCNA 3M0PA 5IXFA 7AT1B 1PD0A 4BY6C 5HKCA 2XDPA 3TSWA 3TVTA 1KFZA 2RK1A 3HTRA 3VRZA 1JU5C 2E70A 4JDSA 3NPFA 4Z88A 3OYBA 1OEBA 1O75A 4A4EA 1VIFA 4MMLA 5IN1A 1KQ2A 4QVCA 1U1TA 2DL8A 3G71T 3A8OB 3G4ST 3HRUA 2FVUA 2CDTA 3CCLQ 2HKQB 2YT6A 3M4GA 5GAN6 3CCUT 2DO3A 4E47A 2ZPHB 1M3AA 5LJ3h 1ZX6A 1D3BB 2E3HA 1WIEA 3M58A 4JPBW 4QKUA 3SWNA 4LUDA 2OAUA 4KH1B 4M7DD 2MWOA 2KYMA 4M7DG 2NUTB 1KHIA 1K73U 5KE3A 1XOVA 1YITT 2E6NA 2RO0A 3KBGA 2VUBA 2JT4A 4O6JA 1FYNA 3OA6A 1Q82U 2XDBA 2GFUA 2O9SA 2HD0A 2ATCB 3VKIA 4J9DA 2KI7A 3E9GA 2J7IA 2R5AA 4A53A 1M2VB 1AWJA 3UPUA 1Y71A 2K7AA 3MP6A 3QXEB 1VQ7A 5KYXA 2FPEA 3CCJQ 4JS5A 2YUNA 2BUDA 5FW9A 2C0IA 2CZ0B 4K11A 5KCHA 1QVPA 3CXCA 4CRIA 4QVDA 4JS4A 3UA6A 1K9MR 5ECAA 3I5SA 1AWWA 4M78F 3JB9J 1R0BG 1VQ9Q 4Y91A 1TH7A 4DOVA 1AEYA 1RAHB 2DJQA 2BZXA 1VQ8A 3V7RA 4XK8E 3L2QA 2XIDA 4BE1A 2PTKA 1RI9A 4LDYA 4OMOA 3MPUB 1B34A 2LX7A 5FU6C 5IH2A 2FZGB 5CIUA 3EGXA 4PJJA 2K2VA 2VASA 3FC3A 2KT1A 2QA4T 2M02A 2OTLA 5LJ3j 1BCOA 1I8FA 5LJ5h 4MDXA 1IB8A 3KXTA 5GAOp 1X01A 4RTUA 4C8QC 2O9VA 2FYKA 1M8VA 2DIGA 1M90U 3V7CA 1F1BB 1Q7YR 2W0ZA 2LT1A 4OB0B 1W6XA 3CCQA 2ZGWA 4QT7A 4LDVA 5GAN8 3QBYA 4Q5WA 3EFSA 1OZ3A 2O31A 2NLUA 3H9NA 1YWOA 4F14A 3GLXA 4OVAA 1YJ9A 2VV5A 6AT1B 4X1VA 2LJ3A 3PVLA 4HT9A 3JCMh 1VQ7T 3QDFA 4J9HA 3OYJA 5J26A 1I1JA 4J7FA 4M78C 2ZCFB 5AT1B 1C1AA 1YJNA 2P0KA 1K73C 2XU8A 3RMQA 3URGA 1T3LA 3CXCP 3LLRA 4MZTA 3JCMe 2LX9A 1N27A 2XICA 1Q82C 1MUZA 1PSEA 1WXTA 1VQ8T 3SEMA 1D09B 1KJWA 2HQXA 2HL3A 3T9NA 3PGGA 2J06A 4DA4A 2Y4XA 3CCSA 1RACB 2ROLA 4PJOF 3M54A 4RTVA 1GRIA 3WXMB 1WHJA 2DZ9A 1IGUA 3JB9I 5KYWA 2X3WD 3VYGA 2VC8A 3U23A 2OTLT 1C0MA 4JRIA 1D0ZA 2CS7A 2LVMA 2X4JA 2X35A 1TOVA 3QDRB 5GANh 5D6YA 5KCOA 2A0FB 4QQDA 1Z9ZA 4M77B 2K9GA 2KRSA 2HQEA 4BDYA 2L3SA 2COZA 2GF7A 5LJ3g 2RK2A 4M78A 1VQ5Q 4KUDK 1HSQA 2EYQA
chains in the Genus database with same CATH topology
2RJEA 1AHJB 2XDDA 2XKOC 2YRVA 3QKJA 2RI2A 5GANe 3JCMV 2LRQA 2CZ1B 2M0OA 1VIEA 1W2BA 2VYTA 4HT8A 1VQ6A 5GAMe 1UGSB 3RKYA 1NJIU 2JTFA 4RCBA 3CCMA 2JNGA 1WQ7A 3OYYA 3CCRA 5GANf 1UGRB 5IT9E 2QQAA 2XG8D 1WQWA 2WSEE 2CKKA 2ZPIB 3FB9A 3OBYA 4HA8A 1MGQA 4M7AG 4EMHA 5GAMd 4M7DA 2PQWA 2VGMA 1WNLA 2RHUA 2QQSA 1I81A 4Z02A 2DK3A 4XTZA 5GMKj 1KC8U 4J83A 4BUGA 5CK9A 1VQNT 4M77E 3NTHA 1QVGA 2Y4YA 3BDUA 2V8IA 3HRSA 4FU6A 3RERA 1H3ZA 2PVGB 1JRIA 2KVQG 1M9SA 3L1AA 4XAXB 5GAOm 3OYHA 1YJNT 3CMAT 4DQ2A 2KSSA 4IUTA 4JRPA 1W4SA 3QZ9B 2EWNA 1Q86U 2A7YA 2DXBA 2R57A 3QIIA 3V7SA 5A0GA 5M9OA 1M90C 4V2SA 3DLLA 2JZ2A 1YI2A 1Y07A 3MEVA 4LD9K 3OMCA 1UGPB 2O01E 5FROA 2K3YA 2K5IA 4ZGDB 2RA2A 3VUZA 2P0PA 5CQYA 1N8RU 2XD0A 1G5VA 4C92E 2L8DA 2H3JA 3JB9H 5GMKi 3FJPA 3ME9A 1YIJT 2PU9B 1S72T 5A0LA 5KH6A 3JB9D 3OQ5A 4E7IA 3DB3A 2OTJA 1LJOA 4PJOC 2QI2A 3WVDB 3QG1A 1BI2A 5CO7A 3JB9G 3RMSA 3NFCA 3X26B 3M4YA 3OYDA 3OYFA 5GAN3 2PUOB 2M1HA 3J80E 3MHXA 4M77D 4M75E 4M78G 3CCST 3I56A 4F7UF 1VUBA 4N0AA 1FWZA 1M1KC 4ZN1A 2HBPA 3ZBDA 3BFMA 3C94A 5FU6B 3CXCS 4ZGEB 5FLXE 4HCCA 2DKGA 2ZPFB 3CMAA 1K9MC 3DLMA 3CC7T 4LDWA 3JAME 3FLGA 5CQXA 4OMFB 1KQ1A 2E1HA 4BD3A 4IUPA 4J7IA 5CKFA 3ZFJA 3QZ5B 4EMKB 3GP8A 4C92D 5CKDA 1D3BA 1VQ4T 2LC4A 4XTYA 3OY9A 3CBMA 3MEWA 2LQ8A 1WJRA 3QUIA 3CMET 3CBPA 4F7UE 1XTDA 3A8MB 2QTXA 3RKWA 1YIJA 1YHQA 1UB4A 4C8QB 2L3RA 4M7AB 5LJ3e 2EQKA 1JB0E 1WJQA 1FXXA 1Y96A 4N4HA 4M75D 3G71A 5GANj 5GAOl 2QQRA 3F70A 3INZA 3G4SA 3MCAB 5GAMj 5AYFA 4A4GA 4C8QA 1BI3A 2ZPGB 1KD1C 1G3YA 5LJ3d 3LGFA 3QHSA 4FIBA 3X24B 1FX7A 1WGSA 2DXUA 4IUQA 3DB4A 4X9CA 5FU7C 3CCUA 2E41A 2RHZA 2C06A 1XQHA 3H6ZA 4RCCA 2GQVA 4BI8B 5LJ5g 3CC7A 4E7LA 5J3BA 3L2WA 1LNXA 4X9DA 1QVFS 3CCMT 3CCRT 3HHTB 1RI0A 4L59A 4BI3A 5A2QE 3OMGA 1VQ4A 3VV0A 1VQ5T 2FL7A 3MEUA 4R55A 3QSUA 3TCJA 2RJFA 3GIBA 3PIOA 2GCXA 3CMEA 3QJYA 2DXCA 4L6V5 4PJOA 3CEYA 1YITA 1M5Q1 1NPPA 2D0QB 4IUUA 1NPRA 4KUIA 4M78B 5FRNA 3VYHB 2IG0A 3NTKA 1M1FA 2MWPA 3S3NA 3A8HB 2BIVA 1Q7YC 1KG1A 1G3TA 3V8KA 3SWNC 5GAN2 4EDUA 3GF5A 2MI6A 4M77F 2A3LA 3PFSA 2Y90A 3A5ZB 4J8OA 4XTVA 3JRZA 3TEEA 2VGNA 3JSCA 2RD1A 3CC2T 4BE2A 3QO3A 3LWIA 2EKOA 2XI9A 1GXIE 1ZBXA 3SDZA 1OYXA 2PVDB 4RG2A 3JCMg 4B9XA 3LGLA 2OTJT 5C6SA 3Q1JA 4M7DB 2RHXA 3LW5E 4MZPA 1UEBA 4ME7A 3S3MA 2QQBA 4FL6A 3C12A 1JBMA 4QQGA 5GAMf 4M7AD 1VQ5A 1KHCA 1YCYA 1HK9A 4RMOA 3HKSA 1NJIC 5CAIA 1Q81U 2EQUA 4C92F 4C8QG 2B8AA 3P8BB 4O5VA 2EJGA 4M78E 2F5TX 2E65A 4QW2A 3J81E 2ZZDA 3I56T 4J6XA 2YHTA 3LH0A 1BKBA 3UWNA 5LL6S 3OYCA 3EAEA 3X20B 5I21A 4C0DC 1YJWA 5D6XA 5GMKm 5CKBA 1R8OB 2G3RA 3A8GB 5CCAA 1KC8C 5DM7R 2LCLA 3RKXA 3O8VA 4M75F 1VQLA 3GNGA 4OP0A 2QXFA 3M57A 4BY6C 1SSFA 5HKCA 3RIRA 3E1SA 2XDPA 2IVWA 2ZPEB 3CC2A 2RK1A 1Q86C 2V8JA 1QP2A 3CCET 4C0ZA 2E70A 4JDSA 3OYBA 1I4K1 2PVOB 3OSVA 3L2RA 2KQWA 2R5MA 1O75A 5A0DA 1YHQT 4A4EA 4PJOG 1IREB 1VIFA 4MMLA 5IN1A 4RG8A 1N8RC 1HXDA 3PT9A 4BACA 2DIQA 4BI4A 4QVCA 5GAN7 4XTUA 1KQ2A 1U1TA 3G71T 3A8OB 3MP8A 4M78D 1K8AU 3G4ST 3OS2A 4BB7A 3OYKA 3HRUA 2FVUA 2RJCA 3M4GA 5GAN6 5LJ5e 3TU4K 3UT1A 5GAOr 2LCCA 3E19A 3HFNA 3OSSC 3CCUT 4XU1A 1X75C 2DO3A 1BI1A 3M53A 2ZPHB 4FT4A 5LJ3h 4E47A 1D3BB 1NZ9A 2FB7A 4XTWA 5HK3A 3L2ZA 3M58A 4NL2A 5LJ5d 1V29B 1VQPT 3SWNA 4HKEA 3X25B 2CYZB 2OAUA 4ZTJA 3CCLA 1VQMA 2KDSA 2MWOA 3E9FA 4M7DD 3G6EA 5GANg 2K4YA 2VXEA 3LX7A 4D6WA 1Y96B 1XNIA 3CCEA 4M7DG 2RM4A 3M55A 2D9TA 3EFRA 4PKCC 2QDYB 1KHIA 4F7UA 1K73U 5KE3A 3A8LB 4N4GA 1XOVA 3JCMJ 1YITT 2E6NA 2RO0A 3KBGA 5L8RE 3JCMQ 2DAQA 4M77C 4BE0A 2VUBA 2XHCA 2K57A 3BDLA 5GMKl 4C0DB 2E64A 2WSFE 5LJ3f 4O6JA 3OA6A 2KAFA 1Q82U 2XDBA 4M7AF 2GFUA 2HD0A 3VJPA 3VKIA 5GMKe 5FRMA 4A4HA 1VQOA 3E9GA 4N4IA 2YLCA 3M9QA 4GY5A 3OS1A 2M16A 3QYHB 3CC4A 1N9RA 1OZ2A 2R5AA 4ELYC 2PUKB 4FSXA 2X4WA 3HRTA 4A53A 4C92C 4BDZA 1M1GA 4WF2A 3FEOA 3JCMd 3JCMb 2DJZA 3BY7A 3UDCA 3SD4A 4OF1A 2R58A 3UPUA 1VQPA 1Y71A 3MP6A 3JCMX 3MEAA 3QXEB 3MO8A 1QW1A 3PNWC 4MZMA 1VQ7A 4PJOB 4A4KA 3QJ6A 3DKMA 5DLQE 4JS5A 3M56A 2BUDA 4QQ6A 2CZ0B 4C8QE 4M7AE 5HY6A 5KCHA 3M59A 1QVPA 3CXCA 4M75C 4CRIA 4QVDA 3PMTA 2KY9A 1VQKT 4JS4A 1BIAA 3WVEB 2DTIA 1YJWT 4KULA 3OYIA 1N6AA 3MP1A 4IUVA 3JB9F 3I55A 2L5QA 4JRQA 1VQLT 1P92A 3CCJA 1RL2A 4M78F 3OS5A 3JB9J 4GLKA 3RESA 4Y91A 1TH7A 3H8ZA 1N9SA 1PSFA 4DOVA 5GAOn 3CD6A 1DJ7B 2KMTA 5GAN4 1WJSA 1VQ8A 4OGCA 2JN0A 3P8HA 4C5HA 4F7UG 5LJ5j 4XU2A 3V7RA 4II1A 1O9SA 4XK8E 3L2QA 4PJOE 2ZPBB 2JTMA 2EJFA 5CKEA 2RHIA 2XIDA 2QEXA 4BE1A 3OBWA 2EQJA 1G3WA 4LDYA 4EMGA 4C8QD 3CPWS 3CCVA 2JOYA 2XK0A 2RHYA 3VUBA 1VQ9A 3FRNA 4JRKA 2DTHA 4OGEA 4TVRA 1B34A 4XQ3A 3RUXA 2LT4A 3CCQT 4JLGA 3L2VA 4LDUA 4PL6A 5FU6C 1BYMA 2RI3A 2AHJB 2E12A 3VU3C 3LWHA 1VQKA 2JUFA 3OB9A 4M77A 4NOYA 5CIUA 3META 3GPLA 2BKDN 3M5AA 1Q81C 2K2VA 4QVZA 4HCZA 3SB2A 5FU7B 1QVFA 4E7KA 2O4XB 4DOWA 1NE8A 3FC3A 4EMKC 3CBOA 2QA4T 4C92B 2OTLA 2CZ6B 5LJ3j 1OI1A 1YJ9T 3CPFA 5J39A 3CCLT 1VQMT 4NS5A 3G6ET 1I8FA 5LJ5h 2O4XA 4MDXA 3GOXA 2RB6A 5GAOp 3KXTA 2GFAA 5GANd 2X4XA 4C0GA 5DY9A 4PJOD 3TREA 4C92A 3OW2S 1X01A 2DPPB 4M7DE 2I2LA 3KUFA 4C8QC 4M7AC 4FT2A 5I2MA 2FYKA 4PNOA 1M8VA 2DIGA 4JLIA 4M75B 3L2UA 4IKFA 2HAXA 1M90U 3R6OA 3V7CA 2LTOA 2DD5A 3HP9A 2LT1A 1JJ2S 2DXTA 4OB0B 2E10A 2EQMA 4PLLA 3CCQA 4NL3A 4M75A 5D6WA 4ELZC 4JUVA 2ZGWA 2MMPA 3OYLA 1VQOT 1K8AC 3HSBA 4E7JA 4LDVA 4E7HA 1EIFA 3SWNB 5GAN8 3QBYA 4Q5WA 3CC4T 4P5NA 3OYNA 3OYEA 3EFSA 5LJ5f 1OZ3A 4UC4A 2NLUA 3ER0A 2L89A 2DZCA 2EIFA 4PLIA 4A4FA 3CPWA 2QA4A 3GLXA 4OVAA 2P4TA 1YJ9A 2VV5A 1WPYA 3N5BB 1LOJA 2RH2A 3GNFB 4EPCA 4F7UB 5KE2A 1X6OA 3JCMh 2MF2A 5GMKh 1M1KU 1VQ7T 4HT9A 2FHDA 2RI5A 5GAMg 3OYJA 2KK4A 3JCMP 4XTXA 1K9MU 2DTOA 1ZHIA 2LDMA 4J7FA 1MHNA 4M78C 4OB1B 5J26A 3JCMc 4M77G 3S3OA 1VQNA 2ZCFB 2MAMA 2P0QA 3AHUA 3ASKA 1YJNA 2P0KA 3J7AF 3SFMA 4ZN3A 2LQKA 1BIBA 1KQSS 4J6YA 3OYAA 5CKHA 3P8DA 4L5GA 1K73C 2XU8A 3RMQA 3URGA 2EAYA 4C8QF 3I55T 2D6FA 3CCJT 1UGQB 3LLRA 4MZTA 3JCMe 3PTAA 2V8KA 2YLBA 3OW2A 2LX9A 3LYIA 1Y7XA 4BY6B 3CD6T 1N27A 2XICA 1Q82C 3C95A 1QP3A 4HCBA 1PSEA 4C92G 4FM4B 2DD4A 2M9UA 3JCMf 1VQ8T 2WACA 2LNVA 3BW1A 3HPWA 4IURA 4EMKA 4M7DC 4XU3A 2K3XA 4OB3B 1S72A 3NTIA 2HQXA 2QEXT 1JJ2A 4C5GA 3HL8A 1H641 3OS0A 4MDWA 1W2BS 5DLOA 4MMKA 3CCVT 3T9NA 3PGGA 1KD1U 4ZTFA 1VQ9T 4DA4A 2Y4XA 2CZ7B 1YBYA 4C5EA 4M75G 1U8RA 4M7AA 2F5KA 3CCSA 2E6ZA 3S6WA 2X4YA 4PJOF 2HNIA 3M54A 3QYGB 3X28B 3PMIA 3WXMB 3QPHA 2K5LA 4J5YA 1I5LA 2F69A 5HK0A 2DZ9A 1BI0A 3HFOA 4KT0E 4CI0C 4ZGJB 1QVGS 1VQ6T 2EFIA 3JB9I 3JCMW 2RJDA 3VYGA 4ATOA 2VC8A 4JJNK 4B9WA 2OTLT 3L42A 4X34A 4A54A 4JRIA 2WSCE 3PIPA 4Y28E 4YTLA 2K5FA 5CVIA 4J6WA 2VXFA 4RKUE 4XU0A 2CS7A 2LVMA 4C5IA 2X4JA 2X35A 5CR2A 1G3SA 3ZEHA 3FDRA 5I2SA 2DVEA 3QDRB 5GANh 4VUBA 5D6YA 5KCOA 2CGHA 1B34B 5IAYA 5GAN5 3OYMA 1KQSA 1Q7YU 5GAMh 4N0AC 1U1SA 4LD6A 4R56A 3G7ZA 4OB2B 5GAOq 4C0FA 4KBMB 4QQDA 3C4SA 2QQ9A 4M77B 3V8LA 3OYGA 2EJ9A 2HQEA 4BDYA 3V8JA 4M7DF 2GF7A 1IZ6A 1M4ZA 5C0MA 1ZQ1A 2RK2A 5EG2A 5LJ3g 1YI2T 4M78A 2DEQA 2E5QA 2JVVA 3FIFA 4KUDK 2EYQA 4LDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EFR A;  2DXT A;  4F7U A;  2E10 A;  4NL3 A;  4M75 A;  5GAN e;  3JCM J;  3JCM V;  4HT8 A;  4JUV A;  3JCM Q;  2ZGW A;  4M77 C;  5GAM e;  3QSU A;  3RKY A;  2K57 A;  3GIB A;  3HSB A;  4RCB A;  1WQ7 A;  3SWN B;  5GMK l;  2E64 A;  5LJ3 f;  5GAN f;  5GAN 8;  1WQW A;  3EFS A;  5LJ5 f;  4M7A F;  4PJO A;  3FB9 A;  1M5Q 1;  2DZC A;  5GMK e;  4HA8 A;  4M78 B;  1MGQ A;  4M7A G;  4EMH A;  5GAM d;  4M7D A;  1WNL A;  2YLC A;  1I81 A;  4XTZ A;  5GMK j;  1WPY A;  1N9R A;  1LOJ A;  4F7U B;  4HT9 A;  5GMK h;  4M77 E;  3JCM h;  3BDU A;  4A53 A;  4C92 C;  3RER A;  3V8K A;  3SWN C;  3L1A A;  1JRI A;  4WF2 A;  5GAM g;  5GAN 2;  3JCM d;  3JCM b;  4M77 F;  2DJZ A;  3BY7 A;  2Y90 A;  4XTV A;  4XTX A;  4DQ2 A;  5GAO m;  3JCM P;  2RD1 A;  3JCM X;  2DTO A;  3QO3 A;  4M78 C;  3JCM c;  2EWN A;  4M77 G;  3V7S A;  4PJO B;  4V2S A;  3JCM g;  3AHU A;  4C8Q E;  4M7A E;  1BIB A;  4M7D B;  4J6Y A;  2RA2 A;  4M75 C;  4QVD A;  2EAY A;  4C92 E;  4C8Q F;  1JBM A;  5GAM f;  4M7A D;  3JB9 H;  1YCY A;  1HK9 A;  3FJP A;  1BIA A;  5GMK i;  5CAI A;  2DTI A;  4C92 F;  3JCM e;  2YLB A;  4C8Q G;  5GAN 5;  3JB9 D;  3JB9 F;  2EJG A;  4M78 E;  2E65 A;  1LJO A;  4PJO C;  4J6X A;  2YHT A;  3JCM f;  4C92 G;  3JB9 G;  3BW1 A;  4EMK A;  4M78 F;  3JB9 J;  4M7D C;  4XU3 A;  5I21 A;  5GAN 3;  3RES A;  4Y91 A;  5GMK m;  4M77 D;  4M75 E;  1TH7 A;  1N9S A;  5GAO n;  4M78 G;  1H64 1;  4F7U F;  3RKX A;  4MMK A;  5GAN 4;  4N0A A;  3PGG A;  4M75 F;  3BFM A;  4OP0 A;  2JN0 A;  4F7U G;  5LJ5 j;  4XU2 A;  3V7R A;  3RIR A;  4M75 G;  4PJO E;  2DKG A;  4M7A A;  2EJF A;  4EMG A;  4C8Q D;  1KQ1 A;  2HNI A;  4PJO F;  2E1H A;  1I4K 1;  4EMK B;  4JRK A;  2DTH A;  4J5Y A;  4C92 D;  1B34 A;  1D3B A;  4XQ3 A;  2DZ9 A;  4PJO G;  3HFO A;  3RUX A;  4MML A;  1I5L A;  4XTY A;  1HXD A;  1KQ2 A;  5GAN 7;  4QVC A;  4XTU A;  3JB9 I;  3JCM W;  1U1T A;  3VU3 C;  2VC8 A;  3QUI A;  4M77 A;  4M78 D;  4NOY A;  4A54 A;  4JRI A;  4F7U E;  2QTX A;  3RKW A;  3SB2 A;  4J6W A;  2VXF A;  4XU0 A;  4M7A B;  4C8Q B;  5LJ3 e;  3M4G A;  5GAN 6;  1Y96 A;  4EMK C;  5LJ5 e;  4M75 D;  5GAO r;  3HFN A;  4C92 B;  5GAN j;  4XU1 A;  5LJ3 j;  2DVE A;  5GAO l;  3INZ A;  5GAN h;  5GAM j;  5LJ3 h;  2CGH A;  1B34 B;  1D3B B;  1I8F A;  2FB7 A;  4C8Q A;  4XTW A;  5LJ5 h;  4N0A C;  1U1S A;  2RB6 A;  3L2Z A;  5GAM h;  5GAN d;  5GAO p;  5LJ3 d;  5GAO q;  4NL2 A;  5DY9 A;  5LJ5 d;  4M7D E;  4C92 A;  3QHS A;  1X01 A;  4PJO D;  4X9C A;  3SWN A;  2DXU A;  2I2L A;  4M77 B;  3V8L A;  4C8Q C;  2EJ9 A;  2E41 A;  4M7A C;  3V8J A;  4M7D D;  4M7D F;  2FYK A;  5GAN g;  4PNO A;  4RCC A;  4M75 B;  4JLI A;  5LJ3 g;  1M8V A;  2VXE A;  4M78 A;  2DEQ A;  3V7C A;  5LJ5 g;  1Y96 B;  4M7D G;  3FIF A;  1LNX A;  4X9D A;  2RM4 A; 
#chains in the Genus database with same CATH topology
 2RJE A;  1X6G A;  1AHJ B;  1VOM A;  2XKO C;  1ZSG A;  3QKJ A;  2RI2 A;  5GAN e;  2LRQ A;  4J9C A;  1VQ6 A;  2ED1 A;  1OX8 A;  2QQA A;  2XG8 D;  3MKD A;  3H0I A;  1MGQ A;  1OPK A;  2QQS A;  3EG9 B;  1KC8 U;  4B6M A;  4BUG A;  3NTH A;  3A98 A;  3BDU A;  1SRL A;  3ULR B;  1YJN T;  4XAX B;  2AZS A;  1EZZ B;  1MV3 A;  4AT1 B;  2A7Y A;  2R57 A;  3V7S A;  1M90 C;  3DLL A;  1ZA2 B;  1G5V A;  2P0P A;  5CQY A;  2XD0 A;  2L8D A;  2H3J A;  1G83 A;  3JB9 H;  3FJP A;  3EHR A;  2DEU A;  1YIJ T;  2ZAE A;  4PJO C;  2QI2 A;  1AWO A;  1H3H A;  3M4Y A;  1U06 A;  3OYF A;  4M78 G;  3CCS T;  3I56 A;  4F7U F;  1VUB A;  3MJX A;  1D1C A;  1PHT A;  2DKG A;  2ZPF B;  3CMA A;  3CC7 T;  4OMF B;  2E1H A;  4BD3 A;  4EMK B;  1AVZ C;  4J9F A;  1Q86 R;  4XTY A;  1WJR A;  3QUI A;  2HDA A;  3CME T;  1N8R R;  2DLP A;  3A8M B;  2QTX A;  1YHQ A;  1TUC A;  2EQK A;  1FXX A;  1Y96 A;  4AG1 C;  4N4H A;  5GAN j;  3MCA B;  1TS9 A;  1MNE A;  3LGF A;  3QHS A;  3X24 B;  1FX7 A;  2C06 A;  2DXU A;  2RHZ A;  4FW2 A;  4BI8 B;  2L2P A;  5LJ5 g;  2V1Q A;  1LNX A;  1QVF S;  1TTH B;  1UGV A;  3OMG A;  1RUW A;  3QSU A;  2HSP A;  3GIB A;  1YN8 A;  4RTW A;  3THK A;  3QJY A;  2DXC A;  4PJO A;  2KE9 A;  4IUU A;  1K73 R;  1PKT A;  2MWP A;  3LH5 A;  4OMQ A;  1I07 A;  1BB9 A;  4CC2 A;  4EDU A;  1G8X A;  3BE3 A;  3GF5 A;  4J8O A;  3PFS A;  2Y90 A;  4XTV A;  1TXQ A;  3QO3 A;  1UEC A;  2EKO A;  1AOJ A;  1VQK Q;  4RG2 A;  3JCM g;  4JZ4 A;  3LGL A;  5C6S A;  4M7D B;  2FRY A;  2RF0 A;  3LW5 E;  4MZP A;  4DBQ A;  2DER A;  4M7A D;  4QQG A;  2LJ1 A;  1VQL Q;  2CP5 A;  1HK9 A;  2OAW A;  3I56 T;  2F5T X;  3J81 E;  2ZZD A;  4J6X A;  1TU0 B;  2X51 A;  1BKB A;  2GBQ A;  2EGC A;  2QAZ A;  3OYC A;  5I21 A;  1YJW A;  3A8G B;  1GCQ C;  1SEM A;  1KC8 C;  2LCL A;  3O8V A;  3GNG A;  2LQN A;  3M57 A;  2SEM A;  2ZPE B;  1T0J A;  3CC2 A;  3M0Q A;  3CCE T;  2W10 A;  5FWB A;  2PVO B;  2JJ9 A;  1SKU B;  2R5M A;  5IXB A;  1YHQ T;  1A0N B;  4PJO G;  1IRE B;  1HXD A;  1Y0M A;  4BAC A;  2DIQ A;  2DVJ A;  2RQR A;  4BI4 A;  1MMN A;  1K8A U;  3OYK A;  1GL5 A;  1VQM Q;  2YRC A;  3G6E Q;  3UT1 A;  4XU1 A;  1X75 C;  3I5R A;  3M53 A;  4CC7 A;  1NZ9 A;  2FB7 A;  4Z89 A;  3L2Z A;  4FYX B;  4DBR A;  1Z9Q A;  1E6H A;  1VQP T;  4KGV B;  4HKE A;  2CYZ B;  3CCL A;  2MYS A;  4FYW B;  5GAN g;  2DYB A;  3LX7 A;  1VQO Q;  4PKC C;  4F7U A;  1UJY A;  3H41 A;  4N4G A;  5L8R E;  3JCM Q;  2DAQ A;  2K57 A;  3BDL A;  5GMK l;  2L3Q A;  2WSF E;  5LJ3 f;  2KXD A;  2KAF A;  3VS3 A;  2YWW A;  5GMK e;  4N4I A;  4JJC A;  2YLC A;  3QYH B;  1GCQ A;  3HRT A;  2DJZ A;  4OF1 A;  2R58 A;  3JCM X;  3MEA A;  3MO8 A;  4MZM A;  3I55 Q;  3EGU A;  3QJ6 A;  3DKM A;  2ENM A;  1TSF A;  5HY6 A;  3TSZ A;  2KYB A;  2RQV A;  3CD6 Q;  1BIA A;  1YJW T;  1N6A A;  3MP1 A;  3JB9 F;  2RN8 A;  4E6R A;  2L5Q A;  4JRQ A;  1UHC A;  2EVR A;  3CCJ A;  3CCV Q;  2I0N A;  4OMP A;  4GLK A;  3RES A;  3H8Z A;  1N9S A;  8ATC B;  4F7U G;  1RAB B;  1K9A A;  2JTM A;  2EQJ A;  4EMG A;  1WHG A;  2JOY A;  2XK0 A;  2RHY A;  2CT4 A;  1VQ9 A;  4JRK A;  2DMO A;  4AG2 C;  4JLG A;  4LDU A;  3JV3 A;  2CSQ A;  1RAF B;  1BK2 A;  4D8D A;  2AHJ B;  1BYM A;  4LXC A;  3OB9 A;  3GPL A;  1GFD A;  1X27 A;  3SB2 A;  2GNC A;  1OI1 A;  3CPF A;  5J39 A;  1UG1 A;  3CCL T;  1WYX A;  2O4X A;  1KK7 A;  2CH4 A;  2GFA A;  5DY9 A;  1YI2 Q;  4M7D E;  1UTI A;  3OW2 S;  2DPP B;  2I2L A;  2NYS A;  4FT2 A;  4AFZ C;  4JLI A;  3L2U A;  4IKF A;  3R6O A;  2LTO A;  2CSI A;  2QG9 B;  2EGA A;  4NL3 A;  2NUP B;  4Z8A A;  4ELZ C;  2MMP A;  2HZY A;  1K8A C;  1EIF A;  1BCM A;  1R77 A;  1JXM A;  4P5N A;  3OYN A;  1ZBJ A;  5LJ5 f;  1RLP C;  1VQN Q;  3ER0 A;  2L89 A;  2EIF A;  4PLI A;  1ZSZ C;  1FMK A;  2A36 A;  2KRM A;  2QA4 A;  2KGT A;  2HL5 C;  1V76 A;  2P84 A;  4EPC A;  2YXY A;  3EGD B;  2HMA A;  2J05 A;  2RNA A;  4XTX A;  1NYG A;  4FSS A;  2DTO A;  1IHW A;  1SHF A;  1CKB A;  2P0Q A;  1KC8 R;  3AHU A;  3ASK A;  2EBP A;  4ZN3 A;  2JM8 A;  2JW4 A;  1BIB A;  5IHI A;  3P8D A;  4C8Q F;  1OU9 A;  3CCJ T;  1UGQ B;  1YCS B;  3PTA A;  2V8K A;  3OW2 A;  1WFW A;  4DEY A;  3I9Q A;  1WX6 A;  4FM4 B;  3JCM f;  2LNV A;  2V1R A;  4HCK A;  4C5G A;  3HL8 A;  1H64 1;  3OS0 A;  1W2B S;  4GLM A;  1VQ9 T;  1U8R A;  3FJ5 A;  2E5K A;  1VQ4 Q;  2E6Z A;  3S6W A;  2X4Y A;  3X28 B;  2JMC A;  2F69 A;  2LJ0 A;  1BI0 A;  2QGF B;  2FEI A;  1QVG S;  2EFI A;  4ATO A;  2RJD A;  3L42 A;  1OU8 A;  2WSC E;  4Y28 E;  4YTL A;  5CVI A;  4J6W A;  2KRO A;  1MND A;  1VYT A;  4C5I A;  3EG0 A;  1ZSZ A;  2XMF A;  5IAY A;  5GAN 5;  3OYM A;  5GAM h;  4N0A C;  2VKN A;  3G7Z A;  5GAO q;  4DBH A;  3CCR Q;  1KD1 R;  1IO6 A;  3EFO A;  2FZC B;  1IZ6 A;  2KRN A;  1ZQ1 A;  2DEQ A;  2JVV A;  2Z0W A;  4DEX A;  1HJD A;  4Y92 A;  2YRV A;  3PVQ A;  3JCM V;  2DIL A;  1W2B A;  2VYT A;  5GAM e;  1SHG A;  3SHW A;  1NJI U;  2JTF A;  2JNG A;  1WQ7 A;  5GAN f;  5IT9 E;  3G1J A;  3H0H A;  2E3I A;  2AKL A;  5GAM d;  2PQW A;  2VGM A;  2RHU A;  4Z02 A;  2LNH B;  2DK3 A;  2YUO A;  1QVG A;  4FU6 A;  3RER A;  1H3Z A;  1JRI A;  2KVQ G;  1M9S A;  1AT1 B;  2KSS A;  1W4S A;  2EWN A;  2DXB A;  1Y07 A;  5KYY B;  3MEV A;  4LD9 K;  2O01 E;  1X2Q A;  4ZGD B;  2ESW A;  5GMK i;  2JS2 A;  3ME9 A;  2PU9 B;  3JB9 D;  1UFF A;  3OQ5 A;  3DB3 A;  4E7I A;  2DM1 A;  1E7O A;  2EYX A;  3OW2 P;  3JB9 G;  3OYD A;  1OOT A;  2VB6 A;  2F2V A;  4N0A A;  1FWZ A;  2NUZ A;  2HBP A;  3BFM A;  1EX4 A;  3DLM A;  1KQ1 A;  4IUP A;  5CKF A;  3GP8 A;  2CP0 A;  1D3B A;  3CBM A;  2CP3 A;  3MEW A;  1ZUK A;  2HBW A;  2KBT A;  1XTD A;  3RKW A;  1YIJ A;  1T0H A;  2EQI A;  4M7A B;  2NUT A;  4OMM A;  5GAO l;  3INZ A;  2EYW A;  2FZK B;  5GAM j;  1NLO C;  2EKH A;  4C8Q A;  1BI3 A;  1WDX A;  4HVV A;  2HQH A;  2CP7 A;  1B7T A;  1Q95 G;  4FIB A;  4IUQ A;  4FYV B;  4ANJ A;  2DF6 A;  3EG3 A;  1BU1 A;  1UHF A;  2GQV A;  3H6Z A;  1M8M A;  3CC7 A;  3L2W A;  1K76 A;  3HHT B;  1MV0 B;  4L59 A;  1AZG B;  3VV0 A;  4F04 B;  1VQ5 T;  3MEU A;  3TCJ A;  3M0S A;  3CME A;  1W2B P;  4L6V 5;  3CEY A;  1NPP A;  1PWT A;  4PK4 A;  1NPR A;  3REA B;  1M1F A;  3A8H B;  2O2O A;  3V8K A;  2MI6 A;  4M77 F;  1QVG P;  1M2O A;  3C0C A;  2A37 A;  2FPD A;  1NEB A;  4FCY A;  3SDZ A;  1W70 A;  3RDV A;  2RHX A;  3S3M A;  2KEA A;  3C12 A;  2FG0 A;  1OV3 A;  1KHC A;  1V1C A;  1NJI C;  5CAI A;  1Q81 U;  1WXU A;  2EQU A;  4C92 F;  3M0T A;  3P8B B;  4C8Q G;  1T3S A;  2EJG A;  4M78 E;  2QTV A;  2QGG A;  4QW2 A;  1QWE A;  4D8K A;  3LH0 A;  4HXJ A;  4RTX A;  2BE9 B;  4C0D C;  2G3R A;  3RKX A;  1VQL A;  4M75 F;  2KT8 A;  2QXF A;  1SSF A;  3E1S A;  3CCQ Q;  1TUG B;  2IVW A;  3RBB B;  2O88 A;  1JEG A;  2KQW A;  4RG8 A;  1ABO A;  4XTU A;  1AD5 A;  2ECZ A;  1H92 A;  4M78 D;  3MP8 A;  3OS2 A;  4BB7 A;  1YJ9 Q;  2LMJ A;  3QWY A;  2RJC A;  4ZNX A;  3E19 A;  1BI1 A;  4XTW A;  2YSQ A;  1M27 C;  1VQM A;  3G6E A;  4JJD A;  2K4Y A;  5IHN A;  1LVK A;  1XNI A;  2D8H A;  4GBQ A;  3CCE A;  2D9T A;  1WHM A;  1RAA B;  3CC4 Q;  3A8L B;  3JCM J;  4BE0 A;  4M77 C;  1OPL A;  5FRM A;  1VQO A;  2C0O A;  4GY5 A;  3OS1 A;  2M16 A;  1OZ2 A;  4ELY C;  4C92 C;  2X4W A;  4BDZ A;  1M1G A;  3FEO A;  3JCM b;  3BY7 A;  1VQP A;  3SD4 A;  4IIO A;  4J9B A;  3M56 A;  4M7A E;  3M59 A;  1IRX A;  4M75 C;  1SPK A;  2KY9 A;  1VQK T;  1S1N A;  3WVE B;  1TG0 A;  2DTI A;  4IUV A;  2K6D A;  2EYY A;  3NMZ C;  2QEX Q;  3I55 A;  1VQL T;  3OS5 A;  3VS7 A;  2DET A;  1Q82 R;  1Y57 A;  1PSF A;  3CD6 A;  1DJ7 B;  4FYY B;  1X6B A;  4C5H A;  1M3B A;  4II1 A;  4PJO E;  1QWF A;  1D0X A;  2ZPB B;  5CKE A;  2K3B A;  3OBW A;  1VQ6 Q;  3CCV A;  3FRN A;  2DTH A;  4OGE A;  1TWB A;  3L2V A;  4PL6 A;  4PFO A;  2RI3 A;  1YNZ A;  2F1L A;  2JUF A;  4M77 A;  1Q81 C;  2CP6 A;  2BKD N;  3M5A A;  4QVZ A;  1NM7 A;  5FU7 B;  1QVF A;  2O4X B;  3M0R A;  4DOW A;  1NE8 A;  4KGZ B;  4EMK C;  4OMN A;  2JM9 A;  1PRM C;  1VQM T;  4NS5 A;  3G6E T;  2KNB B;  1RAG B;  4PJO D;  1WZO A;  4C92 A;  2RQT A;  3KUF A;  5I2M A;  4PNO A;  5GJW B;  2HAX A;  2DYI A;  3EG9 A;  2GGR A;  2E10 A;  4PLL A;  1JXO A;  1WHL A;  4M75 A;  4JUV A;  9ATC B;  1VQO T;  4E7J A;  3SWN B;  1ZUU A;  1X43 A;  3OYE A;  1WLP B;  4UC4 A;  2FRW A;  4A4F A;  2A08 A;  2P4T A;  1SRM A;  3CMA Q;  2DL4 A;  1WPY A;  1NJI R;  1LOJ A;  3GNF B;  5KE2 A;  5GMK h;  1X6O A;  1M1K U;  4KRT A;  1K0S A;  2FHD A;  1J3T A;  2RI5 A;  1GFC A;  3JCM P;  2ABL A;  2LDM A;  4OB1 B;  1MHN A;  1VQN A;  3JCM c;  4M77 G;  1U5S A;  2LQK A;  2MPX C;  1S72 Q;  1QCN A;  5CKH A;  1NLP C;  1M90 R;  3I55 T;  2D6F A;  1WHK A;  2E4H A;  2YLB A;  3LYI A;  4BY6 B;  3CD6 T;  2B86 A;  1QP3 A;  3O5Z A;  4C92 G;  2M9U A;  4EMK A;  4IUR A;  4M7D C;  4XU3 A;  5KYX B;  2AZV A;  4RTZ A;  3NTI A;  2SRC A;  1VYV A;  4MDW A;  5DLO A;  4MMK A;  3CCV T;  1NEG A;  2MK5 A;  1ARK A;  4ZTF A;  3REB B;  1PRL C;  1RAI B;  1YBY A;  4M75 G;  2F5K A;  2C0T A;  2HNI A;  2A28 A;  3PMI A;  3QPH A;  3RNJ A;  5HK0 A;  3HFO A;  4CI0 C;  2AK5 A;  4A54 A;  3PIP A;  4RKU E;  5CR2 A;  2HSE B;  5I2S A;  1QVF P;  2DVE A;  4VUB A;  3EFO B;  2CGH A;  1B34 B;  3NGP A;  1U1S A;  4R56 A;  4OB2 B;  1OQK A;  4C0F A;  4KBM B;  2GQI A;  3C4S A;  2QQ9 A;  3V8L A;  3OYG A;  3CCM Q;  3EGX B;  1KSW A;  4DBF A;  1OUL A;  1M4Z A;  1R0C B;  4J9G A;  1YI2 T;  3EG2 A;  2AIR B;  4LDX A;  1RAE B;  1UDL A;  1UE9 A;  2XDD A;  2M0O A;  4HT8 A;  1MMD A;  4EIK A;  1UGS B;  3RKY A;  3CCR A;  1UGR B;  4PJN A;  1WQW A;  2DRK A;  2WSE E;  3OBY A;  3FB9 A;  4HA8 A;  2X3X D;  5KYN A;  2JS0 A;  4EMH A;  4M7D A;  5GMK j;  4J83 A;  1VQN T;  3CC2 Q;  1GBQ A;  2ROT A;  3L1A A;  3OYH A;  2MOX A;  4DQ2 A;  2DBM A;  2OTJ Q;  4KH0 B;  1B07 A;  1Q86 U;  5M9O A;  3VS5 A;  2JZ2 A;  4LE9 A;  4E7S A;  2COW A;  1UGP B;  2K5I A;  3PE0 A;  2RA2 A;  1N8R U;  2CH4 W;  4AFS C;  2P4R A;  1D1A A;  2CRE A;  3QG1 A;  1BI2 A;  1B3Q A;  2FPF A;  5GAN 3;  3EH2 A;  1Q81 R;  1M1K C;  4LNP A;  4ZN1 A;  3ZBD A;  3C94 A;  5FU6 B;  3CXC S;  4ZGE B;  2DL7 A;  5IHK A;  4LDW A;  3FLG A;  1TUD A;  5CQX A;  2V26 A;  5HCK A;  3ZFJ A;  3G71 Q;  5CKD A;  1VQ4 T;  2LC4 A;  3G4S Q;  3UF4 A;  2LQ8 A;  3GBQ A;  2COY A;  4HVU A;  3CBP A;  3CCU Q;  1UB4 A;  4C8Q B;  5LJ3 e;  1JB0 E;  1WJQ A;  2JTE A;  2LCS A;  1M30 A;  5AYF A;  2ZPG B;  5LJ3 d;  4RUG A;  5KYW B;  4X9C A;  1WGS A;  3DB4 A;  2E41 A;  1X2K A;  4RCC A;  1QCO A;  2JMA A;  5J3B A;  1YIT Q;  1UUE A;  2QAS A;  3CCR T;  1CKA A;  2J6K A;  2CUD A;  2H8H A;  1LCK A;  2RJF A;  5GJV B;  2GCX A;  3PIO A;  2RMO A;  1M5Q 1;  2D0Q B;  5KYU A;  4M78 B;  5FRN A;  3VYH B;  3S3N A;  4F17 A;  3VS4 A;  4E2F B;  5GAN 2;  1WI7 A;  3A5Z B;  3TEE A;  3E2U A;  2VGN A;  3JSC A;  2RD1 A;  3LWI A;  2XI9 A;  1GXI E;  1ZBX A;  1OYX A;  2PVD B;  4B9X A;  1RAD B;  1UEB A;  4ME7 A;  2QQB A;  4FL6 A;  1JBM A;  2VVK A;  2YUQ A;  1VQ5 A;  4RMO A;  2E65 A;  2YHT A;  4M4Z A;  5LL6 S;  3EAE A;  3X20 B;  1ZLM A;  1QKX A;  5D6X A;  5GMK m;  1QLY A;  5DM7 R;  4OP0 A;  3EH1 A;  4LN2 A;  3RIR A;  1PM3 A;  1NYF A;  1Q86 C;  1NG2 A;  1QP2 A;  2V8J A;  4C0Z A;  1QQJ A;  1I4K 1;  2QDL A;  3OSV A;  3L2R A;  1FMV A;  5A0D A;  1N8R C;  3PT9 A;  1QMC A;  4RTT A;  2EW3 A;  5GAN 7;  1C6V X;  2QA4 Q;  2BE7 D;  5LJ5 e;  3TU4 K;  3KFV A;  5GAO r;  2LCC A;  3HFN A;  3OSS C;  1K4U S;  4FT4 A;  1YWP A;  2NUP A;  2GTJ A;  5HK3 A;  3IQL A;  4NL2 A;  5LJ5 d;  1ZUY A;  1V29 B;  3X25 B;  2EPD A;  4ZTJ A;  4AFU C;  2KDS A;  3E9F A;  2OX7 A;  3VS1 A;  4WCI A;  2VXE A;  2YDL A;  4HVW A;  4D6W A;  1Y96 B;  2RM4 A;  3M55 A;  3EFR A;  2QDY B;  1HD3 A;  4RTY A;  1PC0 A;  3EGD A;  1PG5 B;  1M3C A;  2IIM A;  2XHC A;  4C0D B;  2E64 A;  1D1B A;  1KIK A;  4M7A F;  1AWX A;  1K8A R;  3VJP A;  1VQ7 Q;  4A4H A;  2F2X A;  2BZY A;  3M9Q A;  3CC4 A;  1N9R A;  1RLQ C;  1IHV A;  2PUK B;  4FSX A;  4WF2 A;  3JCM d;  2BTT A;  3UDC A;  1QW1 A;  3PNW C;  4PJO B;  4A4K A;  3VS0 A;  5DLQ E;  4QQ6 A;  1M2V A;  4C8Q E;  1M1K R;  1FMW A;  1WHH A;  3PMT A;  2HEQ A;  1PD1 A;  1VQ8 Q;  2CP2 A;  4KUL A;  3RR6 A;  3OYI A;  3VS2 A;  1P92 A;  1RL2 A;  2DL3 A;  2KR3 A;  2IPO B;  2PZ1 A;  3I35 A;  5GAO n;  2KMT A;  4J9I A;  2HCK A;  1WJS A;  5GAN 4;  4OGC A;  2JN0 A;  3P8H A;  2LQW A;  5LJ5 j;  4XU2 A;  2VWF A;  1O9S A;  2ED0 A;  2QEX A;  2EJF A;  2RHI A;  1I5O B;  2OI3 A;  2EYZ A;  1G3W A;  1W1F A;  1I0C A;  4C8Q D;  3CPW S;  1YFN A;  2D8J A;  3VUB A;  1WA7 A;  2OTL Q;  4TVR A;  4XQ3 A;  3RUX A;  2LT4 A;  3VS6 A;  3CCQ T;  2L0A A;  2J6O A;  2YRD A;  2E12 A;  3VU3 C;  3LWH A;  1MMG A;  1VQK A;  1CSK A;  4NOY A;  3MET A;  4HCZ A;  4E7K A;  1HYO A;  2LP5 A;  4JJB A;  3CBO A;  4C92 B;  1BBZ A;  2CZ6 B;  1YJ9 T;  3UA7 A;  1X69 A;  1G2B A;  3GOX A;  2RB6 A;  5GAN d;  2X4X A;  4C0G A;  3TRE A;  3ZL7 C;  1E6G A;  4M7A C;  1GCP A;  4M75 B;  3HP9 A;  2DA9 A;  2DD5 A;  2NWM A;  2DFU A;  3UAT A;  1JJ2 S;  2DXT A;  2EQM A;  1YP5 A;  5D6W A;  2EGE A;  3OYL A;  3HSB A;  2QK0 A;  4E7H A;  3CC4 T;  2CT3 A;  2DZC A;  2D1X A;  5KYY A;  3CPW A;  2PNI A;  1YJN Q;  3N5B B;  2RH2 A;  4F7U B;  2MF2 A;  5GAM g;  2KK4 A;  1LPL A;  1K9M U;  1ZHI A;  2JXB A;  2J6F A;  4AFQ C;  3S3O A;  4AMC A;  2MAM A;  2AT1 B;  3QWX X;  3J7A F;  3SFM A;  2K79 A;  1KQS S;  1YIJ Q;  4J6Y A;  3OYA A;  4L5G A;  2EAY A;  5I22 A;  1Y7X A;  4CC3 A;  3C95 A;  4HCB A;  2RPN A;  3CCS Q;  2DD4 A;  2WAC A;  3BW1 A;  3HPW A;  4OML A;  2K2M A;  2M0Y A;  2K3X A;  4OB3 B;  1S72 A;  2QEX T;  1JJ2 A;  1N5Z A;  1KD1 U;  3CC7 Q;  1VYU A;  1SSH A;  2CZ7 B;  4C5E A;  4M7A A;  4E7Z A;  3QYG B;  2K5L A;  4J5Y A;  5I11 A;  3CME Q;  1I5L A;  4PFZ A;  4KT0 E;  1ACM B;  4ZGJ B;  2MIO A;  1VQ6 T;  3JCM W;  4JJN K;  1QKW A;  4B9W A;  4X34 A;  1GBR A;  2K5F A;  2VXF A;  4XU0 A;  1JO8 A;  1PNJ A;  1G3S A;  3ZEH A;  3FDR A;  2D0N A;  1KQS A;  1Q7Y U;  4LD6 A;  3CQT A;  2L3P A;  4KGX B;  2EJ9 A;  1SG5 A;  3V8J A;  4M7D F;  5C0M A;  5EG2 A;  2E5Q A;  1PKS A;  3FIF A;  1PCX A;  5A0G A;  1K0X A;  1MMA A;  2CZ1 B;  1VIE A;  5L23 A;  4RCB A;  3CCM A;  3OYY A;  2LZ6 B;  2DE0 X;  2F2W A;  2CKK A;  2ZPI B;  4M7A G;  2AKK A;  1AZE A;  1WNL A;  2CUB A;  2HKN A;  1I81 A;  1QCF A;  1UJ0 A;  4XTZ A;  4CC4 B;  3CPW P;  5CK9 A;  4M77 E;  2Y4Y A;  3HRS A;  2V8I A;  2PVG B;  5GAO m;  3CMA T;  4IUT A;  4JRP A;  3QZ9 B;  3QII A;  4V2S A;  1YI2 A;  3OMC A;  5FRO A;  2K3Y A;  3VUZ A;  4C92 E;  3I56 Q;  3H0F A;  1S72 T;  5A0L A;  5KH6 A;  1IXD A;  2OTJ A;  3M0U A;  1LJO A;  2BZ8 A;  1D0Y A;  3WVD B;  1WXB A;  5CO7 A;  3RMS A;  1EFN A;  3NFC A;  3X26 B;  2PUO B;  2M1H A;  3J80 E;  3MHX A;  4LUE A;  4M77 D;  4M75 E;  4PJM A;  5FWC A;  2DL5 A;  4PFP A;  2H3E B;  3CCE Q;  1JJ2 P;  5EC7 A;  5FLX E;  4HCC A;  4JZ3 A;  1H8K A;  1YHQ Q;  1K9M C;  3JAM E;  2FO0 A;  3EHQ A;  4ORZ A;  2RQU A;  4J7I A;  3QZ5 B;  1OX9 A;  5D7U A;  4C92 D;  3OY9 A;  3EG1 A;  1ZA1 B;  2DBK A;  2QYZ A;  4F7U E;  4IIM A;  1NBE B;  2L3R A;  3AT1 B;  4M75 D;  4F16 A;  3VRY A;  3G71 A;  2QQR A;  3F70 A;  3G4S A;  3D7S B;  1VQP Q;  4A4G A;  1KD1 C;  1U3O A;  1G3Y A;  1KQS P;  5FU7 C;  3CCU A;  2DX1 A;  1XQH A;  2YUP A;  2OJ2 A;  4E7L A;  2DRM A;  4X9D A;  2G6F X;  3CCM T;  1RI0 A;  1ZSZ B;  4ESR A;  4BI3 A;  5A2Q E;  1VQ4 A;  2FL7 A;  4R55 A;  4A63 B;  5KYU B;  1IGQ A;  1JQQ A;  1VA7 A;  1YIT A;  2X9H A;  2GTO A;  4J9E A;  4KUI A;  2RQW A;  1XJW B;  2IG0 A;  3NTK A;  1K1Z A;  1ABQ A;  2BIV A;  1Q7Y C;  1KG1 A;  1G3T A;  3SWN C;  2A3L A;  3NHN A;  3JRZ A;  3CC2 T;  4BE2 A;  3R6N A;  3TQ7 P;  8AT1 B;  2OTJ T;  1YJW Q;  3Q1J A;  4R0K A;  5GAM f;  2DNU A;  1YCY A;  3HKS A;  4FW1 A;  2B8A A;  4PJL A;  4O5V A;  4WTO B;  2KXC A;  3A1P A;  1SF9 A;  2M51 A;  3UWN A;  5CKB A;  1R8O B;  5CCA A;  2MCN A;  3M0P A;  5IXF A;  7AT1 B;  1PD0 A;  4BY6 C;  5HKC A;  2XDP A;  3TSW A;  3TVT A;  1KFZ A;  2RK1 A;  3HTR A;  3VRZ A;  1JU5 C;  2E70 A;  4JDS A;  3NPF A;  4Z88 A;  3OYB A;  1OEB A;  1O75 A;  4A4E A;  1VIF A;  4MML A;  5IN1 A;  1KQ2 A;  4QVC A;  1U1T A;  2DL8 A;  3G71 T;  3A8O B;  3G4S T;  3HRU A;  2FVU A;  2CDT A;  3CCL Q;  2HKQ B;  2YT6 A;  3M4G A;  5GAN 6;  3CCU T;  2DO3 A;  4E47 A;  2ZPH B;  1M3A A;  5LJ3 h;  1ZX6 A;  1D3B B;  2E3H A;  1WIE A;  3M58 A;  4JPB W;  4QKU A;  3SWN A;  4LUD A;  2OAU A;  4KH1 B;  4M7D D;  2MWO A;  2KYM A;  4M7D G;  2NUT B;  1KHI A;  1K73 U;  5KE3 A;  1XOV A;  1YIT T;  2E6N A;  2RO0 A;  3KBG A;  2VUB A;  2JT4 A;  4O6J A;  1FYN A;  3OA6 A;  1Q82 U;  2XDB A;  2GFU A;  2O9S A;  2HD0 A;  2ATC B;  3VKI A;  4J9D A;  2KI7 A;  3E9G A;  2J7I A;  2R5A A;  4A53 A;  1M2V B;  1AWJ A;  3UPU A;  1Y71 A;  2K7A A;  3MP6 A;  3QXE B;  1VQ7 A;  5KYX A;  2FPE A;  3CCJ Q;  4JS5 A;  2YUN A;  2BUD A;  5FW9 A;  2C0I A;  2CZ0 B;  4K11 A;  5KCH A;  1QVP A;  3CXC A;  4CRI A;  4QVD A;  4JS4 A;  3UA6 A;  1K9M R;  5ECA A;  3I5S A;  1AWW A;  4M78 F;  3JB9 J;  1R0B G;  1VQ9 Q;  4Y91 A;  1TH7 A;  4DOV A;  1AEY A;  1RAH B;  2DJQ A;  2BZX A;  1VQ8 A;  3V7R A;  4XK8 E;  3L2Q A;  2XID A;  4BE1 A;  2PTK A;  1RI9 A;  4LDY A;  4OMO A;  3MPU B;  1B34 A;  2LX7 A;  5FU6 C;  5IH2 A;  2FZG B;  5CIU A;  3EGX A;  4PJJ A;  2K2V A;  2VAS A;  3FC3 A;  2KT1 A;  2QA4 T;  2M02 A;  2OTL A;  5LJ3 j;  1BCO A;  1I8F A;  5LJ5 h;  4MDX A;  1IB8 A;  3KXT A;  5GAO p;  1X01 A;  4RTU A;  4C8Q C;  2O9V A;  2FYK A;  1M8V A;  2DIG A;  1M90 U;  3V7C A;  1F1B B;  1Q7Y R;  2W0Z A;  2LT1 A;  4OB0 B;  1W6X A;  3CCQ A;  2ZGW A;  4QT7 A;  4LDV A;  5GAN 8;  3QBY A;  4Q5W A;  3EFS A;  1OZ3 A;  2O31 A;  2NLU A;  3H9N A;  1YWO A;  4F14 A;  3GLX A;  4OVA A;  1YJ9 A;  2VV5 A;  6AT1 B;  4X1V A;  2LJ3 A;  3PVL A;  4HT9 A;  3JCM h;  1VQ7 T;  3QDF A;  4J9H A;  3OYJ A;  5J26 A;  1I1J A;  4J7F A;  4M78 C;  2ZCF B;  5AT1 B;  1C1A A;  1YJN A;  2P0K A;  1K73 C;  2XU8 A;  3RMQ A;  3URG A;  1T3L A;  3CXC P;  3LLR A;  4MZT A;  3JCM e;  2LX9 A;  1N27 A;  2XIC A;  1Q82 C;  1MUZ A;  1PSE A;  1WXT A;  1VQ8 T;  3SEM A;  1D09 B;  1KJW A;  2HQX A;  2HL3 A;  3T9N A;  3PGG A;  2J06 A;  4DA4 A;  2Y4X A;  3CCS A;  1RAC B;  2ROL A;  4PJO F;  3M54 A;  4RTV A;  1GRI A;  3WXM B;  1WHJ A;  2DZ9 A;  1IGU A;  3JB9 I;  5KYW A;  2X3W D;  3VYG A;  2VC8 A;  3U23 A;  2OTL T;  1C0M A;  4JRI A;  1D0Z A;  2CS7 A;  2LVM A;  2X4J A;  2X35 A;  1TOV A;  3QDR B;  5GAN h;  5D6Y A;  5KCO A;  2A0F B;  4QQD A;  1Z9Z A;  4M77 B;  2K9G A;  2KRS A;  2HQE A;  4BDY A;  2L3S A;  2COZ A;  2GF7 A;  5LJ3 g;  2RK2 A;  4M78 A;  1VQ5 Q;  4KUD K;  1HSQ A;  2EYQ A; 
#chains in the Genus database with same CATH homology
 2RJE A;  1AHJ B;  2XDD A;  2XKO C;  2YRV A;  3QKJ A;  2RI2 A;  5GAN e;  3JCM V;  2LRQ A;  2CZ1 B;  2M0O A;  1VIE A;  1W2B A;  2VYT A;  4HT8 A;  1VQ6 A;  5GAM e;  1UGS B;  3RKY A;  1NJI U;  2JTF A;  4RCB A;  3CCM A;  2JNG A;  1WQ7 A;  3OYY A;  3CCR A;  5GAN f;  1UGR B;  5IT9 E;  2QQA A;  2XG8 D;  1WQW A;  2WSE E;  2CKK A;  2ZPI B;  3FB9 A;  3OBY A;  4HA8 A;  1MGQ A;  4M7A G;  4EMH A;  5GAM d;  4M7D A;  2PQW A;  2VGM A;  1WNL A;  2RHU A;  2QQS A;  1I81 A;  4Z02 A;  2DK3 A;  4XTZ A;  5GMK j;  1KC8 U;  4J83 A;  4BUG A;  5CK9 A;  1VQN T;  4M77 E;  3NTH A;  1QVG A;  2Y4Y A;  3BDU A;  2V8I A;  3HRS A;  4FU6 A;  3RER A;  1H3Z A;  2PVG B;  1JRI A;  2KVQ G;  1M9S A;  3L1A A;  4XAX B;  5GAO m;  3OYH A;  1YJN T;  3CMA T;  4DQ2 A;  2KSS A;  4IUT A;  4JRP A;  1W4S A;  3QZ9 B;  2EWN A;  1Q86 U;  2A7Y A;  2DXB A;  2R57 A;  3QII A;  3V7S A;  5A0G A;  5M9O A;  1M90 C;  4V2S A;  3DLL A;  2JZ2 A;  1YI2 A;  1Y07 A;  3MEV A;  4LD9 K;  3OMC A;  1UGP B;  2O01 E;  5FRO A;  2K3Y A;  2K5I A;  4ZGD B;  2RA2 A;  3VUZ A;  2P0P A;  5CQY A;  1N8R U;  2XD0 A;  1G5V A;  4C92 E;  2L8D A;  2H3J A;  3JB9 H;  5GMK i;  3FJP A;  3ME9 A;  1YIJ T;  2PU9 B;  1S72 T;  5A0L A;  5KH6 A;  3JB9 D;  3OQ5 A;  4E7I A;  3DB3 A;  2OTJ A;  1LJO A;  4PJO C;  2QI2 A;  3WVD B;  3QG1 A;  1BI2 A;  5CO7 A;  3JB9 G;  3RMS A;  3NFC A;  3X26 B;  3M4Y A;  3OYD A;  3OYF A;  5GAN 3;  2PUO B;  2M1H A;  3J80 E;  3MHX A;  4M77 D;  4M75 E;  4M78 G;  3CCS T;  3I56 A;  4F7U F;  1VUB A;  4N0A A;  1FWZ A;  1M1K C;  4ZN1 A;  2HBP A;  3ZBD A;  3BFM A;  3C94 A;  5FU6 B;  3CXC S;  4ZGE B;  5FLX E;  4HCC A;  2DKG A;  2ZPF B;  3CMA A;  1K9M C;  3DLM A;  3CC7 T;  4LDW A;  3JAM E;  3FLG A;  5CQX A;  4OMF B;  1KQ1 A;  2E1H A;  4BD3 A;  4IUP A;  4J7I A;  5CKF A;  3ZFJ A;  3QZ5 B;  4EMK B;  3GP8 A;  4C92 D;  5CKD A;  1D3B A;  1VQ4 T;  2LC4 A;  4XTY A;  3OY9 A;  3CBM A;  3MEW A;  2LQ8 A;  1WJR A;  3QUI A;  3CME T;  3CBP A;  4F7U E;  1XTD A;  3A8M B;  2QTX A;  3RKW A;  1YIJ A;  1YHQ A;  1UB4 A;  4C8Q B;  2L3R A;  4M7A B;  5LJ3 e;  2EQK A;  1JB0 E;  1WJQ A;  1FXX A;  1Y96 A;  4N4H A;  4M75 D;  3G71 A;  5GAN j;  5GAO l;  2QQR A;  3F70 A;  3INZ A;  3G4S A;  3MCA B;  5GAM j;  5AYF A;  4A4G A;  4C8Q A;  1BI3 A;  2ZPG B;  1KD1 C;  1G3Y A;  5LJ3 d;  3LGF A;  3QHS A;  4FIB A;  3X24 B;  1FX7 A;  1WGS A;  2DXU A;  4IUQ A;  3DB4 A;  4X9C A;  5FU7 C;  3CCU A;  2E41 A;  2RHZ A;  2C06 A;  1XQH A;  3H6Z A;  4RCC A;  2GQV A;  4BI8 B;  5LJ5 g;  3CC7 A;  4E7L A;  5J3B A;  3L2W A;  1LNX A;  4X9D A;  1QVF S;  3CCM T;  3CCR T;  3HHT B;  1RI0 A;  4L59 A;  4BI3 A;  5A2Q E;  3OMG A;  1VQ4 A;  3VV0 A;  1VQ5 T;  2FL7 A;  3MEU A;  4R55 A;  3QSU A;  3TCJ A;  2RJF A;  3GIB A;  3PIO A;  2GCX A;  3CME A;  3QJY A;  2DXC A;  4L6V 5;  4PJO A;  3CEY A;  1YIT A;  1M5Q 1;  1NPP A;  2D0Q B;  4IUU A;  1NPR A;  4KUI A;  4M78 B;  5FRN A;  3VYH B;  2IG0 A;  3NTK A;  1M1F A;  2MWP A;  3S3N A;  3A8H B;  2BIV A;  1Q7Y C;  1KG1 A;  1G3T A;  3V8K A;  3SWN C;  5GAN 2;  4EDU A;  3GF5 A;  2MI6 A;  4M77 F;  2A3L A;  3PFS A;  2Y90 A;  3A5Z B;  4J8O A;  4XTV A;  3JRZ A;  3TEE A;  2VGN A;  3JSC A;  2RD1 A;  3CC2 T;  4BE2 A;  3QO3 A;  3LWI A;  2EKO A;  2XI9 A;  1GXI E;  1ZBX A;  3SDZ A;  1OYX A;  2PVD B;  4RG2 A;  3JCM g;  4B9X A;  3LGL A;  2OTJ T;  5C6S A;  3Q1J A;  4M7D B;  2RHX A;  3LW5 E;  4MZP A;  1UEB A;  4ME7 A;  3S3M A;  2QQB A;  4FL6 A;  3C12 A;  1JBM A;  4QQG A;  5GAM f;  4M7A D;  1VQ5 A;  1KHC A;  1YCY A;  1HK9 A;  4RMO A;  3HKS A;  1NJI C;  5CAI A;  1Q81 U;  2EQU A;  4C92 F;  4C8Q G;  2B8A A;  3P8B B;  4O5V A;  2EJG A;  4M78 E;  2F5T X;  2E65 A;  4QW2 A;  3J81 E;  2ZZD A;  3I56 T;  4J6X A;  2YHT A;  3LH0 A;  1BKB A;  3UWN A;  5LL6 S;  3OYC A;  3EAE A;  3X20 B;  5I21 A;  4C0D C;  1YJW A;  5D6X A;  5GMK m;  5CKB A;  1R8O B;  2G3R A;  3A8G B;  5CCA A;  1KC8 C;  5DM7 R;  2LCL A;  3RKX A;  3O8V A;  4M75 F;  1VQL A;  3GNG A;  4OP0 A;  2QXF A;  3M57 A;  4BY6 C;  1SSF A;  5HKC A;  3RIR A;  3E1S A;  2XDP A;  2IVW A;  2ZPE B;  3CC2 A;  2RK1 A;  1Q86 C;  2V8J A;  1QP2 A;  3CCE T;  4C0Z A;  2E70 A;  4JDS A;  3OYB A;  1I4K 1;  2PVO B;  3OSV A;  3L2R A;  2KQW A;  2R5M A;  1O75 A;  5A0D A;  1YHQ T;  4A4E A;  4PJO G;  1IRE B;  1VIF A;  4MML A;  5IN1 A;  4RG8 A;  1N8R C;  1HXD A;  3PT9 A;  4BAC A;  2DIQ A;  4BI4 A;  4QVC A;  5GAN 7;  4XTU A;  1KQ2 A;  1U1T A;  3G71 T;  3A8O B;  3MP8 A;  4M78 D;  1K8A U;  3G4S T;  3OS2 A;  4BB7 A;  3OYK A;  3HRU A;  2FVU A;  2RJC A;  3M4G A;  5GAN 6;  5LJ5 e;  3TU4 K;  3UT1 A;  5GAO r;  2LCC A;  3E19 A;  3HFN A;  3OSS C;  3CCU T;  4XU1 A;  1X75 C;  2DO3 A;  1BI1 A;  3M53 A;  2ZPH B;  4FT4 A;  5LJ3 h;  4E47 A;  1D3B B;  1NZ9 A;  2FB7 A;  4XTW A;  5HK3 A;  3L2Z A;  3M58 A;  4NL2 A;  5LJ5 d;  1V29 B;  1VQP T;  3SWN A;  4HKE A;  3X25 B;  2CYZ B;  2OAU A;  4ZTJ A;  3CCL A;  1VQM A;  2KDS A;  2MWO A;  3E9F A;  4M7D D;  3G6E A;  5GAN g;  2K4Y A;  2VXE A;  3LX7 A;  4D6W A;  1Y96 B;  1XNI A;  3CCE A;  4M7D G;  2RM4 A;  3M55 A;  2D9T A;  3EFR A;  4PKC C;  2QDY B;  1KHI A;  4F7U A;  1K73 U;  5KE3 A;  3A8L B;  4N4G A;  1XOV A;  3JCM J;  1YIT T;  2E6N A;  2RO0 A;  3KBG A;  5L8R E;  3JCM Q;  2DAQ A;  4M77 C;  4BE0 A;  2VUB A;  2XHC A;  2K57 A;  3BDL A;  5GMK l;  4C0D B;  2E64 A;  2WSF E;  5LJ3 f;  4O6J A;  3OA6 A;  2KAF A;  1Q82 U;  2XDB A;  4M7A F;  2GFU A;  2HD0 A;  3VJP A;  3VKI A;  5GMK e;  5FRM A;  4A4H A;  1VQO A;  3E9G A;  4N4I A;  2YLC A;  3M9Q A;  4GY5 A;  3OS1 A;  2M16 A;  3QYH B;  3CC4 A;  1N9R A;  1OZ2 A;  2R5A A;  4ELY C;  2PUK B;  4FSX A;  2X4W A;  3HRT A;  4A53 A;  4C92 C;  4BDZ A;  1M1G A;  4WF2 A;  3FEO A;  3JCM d;  3JCM b;  2DJZ A;  3BY7 A;  3UDC A;  3SD4 A;  4OF1 A;  2R58 A;  3UPU A;  1VQP A;  1Y71 A;  3MP6 A;  3JCM X;  3MEA A;  3QXE B;  3MO8 A;  1QW1 A;  3PNW C;  4MZM A;  1VQ7 A;  4PJO B;  4A4K A;  3QJ6 A;  3DKM A;  5DLQ E;  4JS5 A;  3M56 A;  2BUD A;  4QQ6 A;  2CZ0 B;  4C8Q E;  4M7A E;  5HY6 A;  5KCH A;  3M59 A;  1QVP A;  3CXC A;  4M75 C;  4CRI A;  4QVD A;  3PMT A;  2KY9 A;  1VQK T;  4JS4 A;  1BIA A;  3WVE B;  2DTI A;  1YJW T;  4KUL A;  3OYI A;  1N6A A;  3MP1 A;  4IUV A;  3JB9 F;  3I55 A;  2L5Q A;  4JRQ A;  1VQL T;  1P92 A;  3CCJ A;  1RL2 A;  4M78 F;  3OS5 A;  3JB9 J;  4GLK A;  3RES A;  4Y91 A;  1TH7 A;  3H8Z A;  1N9S A;  1PSF A;  4DOV A;  5GAO n;  3CD6 A;  1DJ7 B;  2KMT A;  5GAN 4;  1WJS A;  1VQ8 A;  4OGC A;  2JN0 A;  3P8H A;  4C5H A;  4F7U G;  5LJ5 j;  4XU2 A;  3V7R A;  4II1 A;  1O9S A;  4XK8 E;  3L2Q A;  4PJO E;  2ZPB B;  2JTM A;  2EJF A;  5CKE A;  2RHI A;  2XID A;  2QEX A;  4BE1 A;  3OBW A;  2EQJ A;  1G3W A;  4LDY A;  4EMG A;  4C8Q D;  3CPW S;  3CCV A;  2JOY A;  2XK0 A;  2RHY A;  3VUB A;  1VQ9 A;  3FRN A;  4JRK A;  2DTH A;  4OGE A;  4TVR A;  1B34 A;  4XQ3 A;  3RUX A;  2LT4 A;  3CCQ T;  4JLG A;  3L2V A;  4LDU A;  4PL6 A;  5FU6 C;  1BYM A;  2RI3 A;  2AHJ B;  2E12 A;  3VU3 C;  3LWH A;  1VQK A;  2JUF A;  3OB9 A;  4M77 A;  4NOY A;  5CIU A;  3MET A;  3GPL A;  2BKD N;  3M5A A;  1Q81 C;  2K2V A;  4QVZ A;  4HCZ A;  3SB2 A;  5FU7 B;  1QVF A;  4E7K A;  2O4X B;  4DOW A;  1NE8 A;  3FC3 A;  4EMK C;  3CBO A;  2QA4 T;  4C92 B;  2OTL A;  2CZ6 B;  5LJ3 j;  1OI1 A;  1YJ9 T;  3CPF A;  5J39 A;  3CCL T;  1VQM T;  4NS5 A;  3G6E T;  1I8F A;  5LJ5 h;  2O4X A;  4MDX A;  3GOX A;  2RB6 A;  5GAO p;  3KXT A;  2GFA A;  5GAN d;  2X4X A;  4C0G A;  5DY9 A;  4PJO D;  3TRE A;  4C92 A;  3OW2 S;  1X01 A;  2DPP B;  4M7D E;  2I2L A;  3KUF A;  4C8Q C;  4M7A C;  4FT2 A;  5I2M A;  2FYK A;  4PNO A;  1M8V A;  2DIG A;  4JLI A;  4M75 B;  3L2U A;  4IKF A;  2HAX A;  1M90 U;  3R6O A;  3V7C A;  2LTO A;  2DD5 A;  3HP9 A;  2LT1 A;  1JJ2 S;  2DXT A;  4OB0 B;  2E10 A;  2EQM A;  4PLL A;  3CCQ A;  4NL3 A;  4M75 A;  5D6W A;  4ELZ C;  4JUV A;  2ZGW A;  2MMP A;  3OYL A;  1VQO T;  1K8A C;  3HSB A;  4E7J A;  4LDV A;  4E7H A;  1EIF A;  3SWN B;  5GAN 8;  3QBY A;  4Q5W A;  3CC4 T;  4P5N A;  3OYN A;  3OYE A;  3EFS A;  5LJ5 f;  1OZ3 A;  4UC4 A;  2NLU A;  3ER0 A;  2L89 A;  2DZC A;  2EIF A;  4PLI A;  4A4F A;  3CPW A;  2QA4 A;  3GLX A;  4OVA A;  2P4T A;  1YJ9 A;  2VV5 A;  1WPY A;  3N5B B;  1LOJ A;  2RH2 A;  3GNF B;  4EPC A;  4F7U B;  5KE2 A;  1X6O A;  3JCM h;  2MF2 A;  5GMK h;  1M1K U;  1VQ7 T;  4HT9 A;  2FHD A;  2RI5 A;  5GAM g;  3OYJ A;  2KK4 A;  3JCM P;  4XTX A;  1K9M U;  2DTO A;  1ZHI A;  2LDM A;  4J7F A;  1MHN A;  4M78 C;  4OB1 B;  5J26 A;  3JCM c;  4M77 G;  3S3O A;  1VQN A;  2ZCF B;  2MAM A;  2P0Q A;  3AHU A;  3ASK A;  1YJN A;  2P0K A;  3J7A F;  3SFM A;  4ZN3 A;  2LQK A;  1BIB A;  1KQS S;  4J6Y A;  3OYA A;  5CKH A;  3P8D A;  4L5G A;  1K73 C;  2XU8 A;  3RMQ A;  3URG A;  2EAY A;  4C8Q F;  3I55 T;  2D6F A;  3CCJ T;  1UGQ B;  3LLR A;  4MZT A;  3JCM e;  3PTA A;  2V8K A;  2YLB A;  3OW2 A;  2LX9 A;  3LYI A;  1Y7X A;  4BY6 B;  3CD6 T;  1N27 A;  2XIC A;  1Q82 C;  3C95 A;  1QP3 A;  4HCB A;  1PSE A;  4C92 G;  4FM4 B;  2DD4 A;  2M9U A;  3JCM f;  1VQ8 T;  2WAC A;  2LNV A;  3BW1 A;  3HPW A;  4IUR A;  4EMK A;  4M7D C;  4XU3 A;  2K3X A;  4OB3 B;  1S72 A;  3NTI A;  2HQX A;  2QEX T;  1JJ2 A;  4C5G A;  3HL8 A;  1H64 1;  3OS0 A;  4MDW A;  1W2B S;  5DLO A;  4MMK A;  3CCV T;  3T9N A;  3PGG A;  1KD1 U;  4ZTF A;  1VQ9 T;  4DA4 A;  2Y4X A;  2CZ7 B;  1YBY A;  4C5E A;  4M75 G;  1U8R A;  4M7A A;  2F5K A;  3CCS A;  2E6Z A;  3S6W A;  2X4Y A;  4PJO F;  2HNI A;  3M54 A;  3QYG B;  3X28 B;  3PMI A;  3WXM B;  3QPH A;  2K5L A;  4J5Y A;  1I5L A;  2F69 A;  5HK0 A;  2DZ9 A;  1BI0 A;  3HFO A;  4KT0 E;  4CI0 C;  4ZGJ B;  1QVG S;  1VQ6 T;  2EFI A;  3JB9 I;  3JCM W;  2RJD A;  3VYG A;  4ATO A;  2VC8 A;  4JJN K;  4B9W A;  2OTL T;  3L42 A;  4X34 A;  4A54 A;  4JRI A;  2WSC E;  3PIP A;  4Y28 E;  4YTL A;  2K5F A;  5CVI A;  4J6W A;  2VXF A;  4RKU E;  4XU0 A;  2CS7 A;  2LVM A;  4C5I A;  2X4J A;  2X35 A;  5CR2 A;  1G3S A;  3ZEH A;  3FDR A;  5I2S A;  2DVE A;  3QDR B;  5GAN h;  4VUB A;  5D6Y A;  5KCO A;  2CGH A;  1B34 B;  5IAY A;  5GAN 5;  3OYM A;  1KQS A;  1Q7Y U;  5GAM h;  4N0A C;  1U1S A;  4LD6 A;  4R56 A;  3G7Z A;  4OB2 B;  5GAO q;  4C0F A;  4KBM B;  4QQD A;  3C4S A;  2QQ9 A;  4M77 B;  3V8L A;  3OYG A;  2EJ9 A;  2HQE A;  4BDY A;  3V8J A;  4M7D F;  2GF7 A;  1IZ6 A;  1M4Z A;  5C0M A;  1ZQ1 A;  2RK2 A;  5EG2 A;  5LJ3 g;  1YI2 T;  4M78 A;  2DEQ A;  2E5Q A;  2JVV A;  3FIF A;  4KUD K;  2EYQ A;  4LDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...