1TH7A

Crystal structure of an archaeal sm protein from sulfolobus solfataricus
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
78
structure length
78
Chain Sequence
b'GAMNFLAETAHKVLAESLNNLVLVKLKGNKEVRGMLRSYDQHMNLVLSDSEEIQSDGSGKKLGTIVIRGDNVILISPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small nuclear riboprotein protein
molecule tags Rna binding protein
source organism Sulfolobus solfataricus
publication title Crystal structure of an archaeal Sm protein from Sulfolobus solfataricus
pubmed doi rcsb
total genus 16
structure length 78
sequence length 78
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature
pdb deposition date 2004-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1th7A00
4M75D 3INZA 3QO3A 4M7AA 3SB2A 1LJOA 3JB9G 3JCMW 2QTXA 3PGGA 4X9CA 2DTOA 1M5Q1 2I2LA 3JB9H 1N9SA 4JUVA 5GAOm 2E10A 3AHUA 4XU2A 2DXUA 5GMKh 5I21A 1KQ2A 4C92D 3JB9F 2E64A 2DJZA 4M7DG 4C92B 2E41A 4J6XA 4J6WA 4QVDA 4M7DB 4PJOB 4PJOC 5GAN8 4PJOD 3JCMg 4EMHA 3RKWA 1HXDA 5GAMj 4N0AA 3JCMh 5GAN7 5GAMe 2DTIA 1Y96B 4M77D 2DEQA 4OP0A 5GMKm 5GAMd 2DTHA 4M78C 3JCMV 2YLCA 1WPYA 3V7SA 3EFSA 1I5LA 3VU3C 3JCMJ 4M75B 5LJ3e 3V7RA 2DKGA 1WQ7A 5GAOq 1M8VA 3JCMX 5LJ3h 2RA2A 4M7AF 5GMKj 4C92E 5GAOr 5LJ3g 2CGHA 5GANf 2YLBA 3FIFA 4A53A 2E1HA 4EMKA 5GAN4 3L1AA 4XTXA 3RKYA 5GAMh 1TH7A 1KQ1A 5GANe 2RD1A 1D3BA 4C8QE 3BY7A 4M7DD 4JRKA 3JCMQ 3V7CA 5GAN2 5DY9A 4M7AG 1WQWA 4M77F 4PJOG 3BFMA 2RB6A 1MGQA 4M7DA 2YHTA 4M77C 2DVEA 4C92A 5GANh 4M7DC 5LJ5g 2VXEA 2VC8A 3EFRA 2E65A 2DXTA 2JN0A 4M78G 3HFNA 4EMGA 4F7UE 4X9DA 4RCCA 4V2SA 4A54A 4F7UB 4XTZA 1LNXA 1U1TA 3M4GA 4RCBA 4C92F 5LJ5d 3SWNA 3BW1A 4M7DE 5LJ5f 4M77E 3SWNB 1BIBA 1HK9A 2RM4A 3FB9A 4M75C 4XU1A 3JCMf 3V8LA 4C8QA 5GMKe 3JCMd 3JCMb 1I4K1 4J6YA 5GANg 3FJPA 4M78B 3V8JA 1D3BB 4M75F 3QSUA 4XTYA 4DQ2A 4PNOA 4F7UF 2DZCA 4XU0A 5LJ5h 4PJOE 5GMKl 2FB7A 2DZ9A 3RIRA 3SWNC 3RESA 2ZGWA 4C92C 4C8QG 5CAIA 4M7AE 1B34A 2EJ9A 3QUIA 3BDUA 3JCMc 4EMKC 4NL3A 4C8QC 4M7AD 4M75A 2EWNA 5GAN5 3V8KA 3HSBA 1BIAA 4M78E 5GAMg 5LJ5e 1X01A 5GAN3 1JBMA 3L2ZA 4EMKB 1Y96A 4NL2A 3JB9I 1JRIA 4M7DF 3JCMe 4PJOA 4M77A 4M78D 5GANj 2K57A 4PJOF 1LOJA 4M77B 4HT8A 4M75G 4HT9A 4N0AC 4F7UG 2EAYA 5GAOp 1I81A 1N9RA 3JB9D 5GMKi 2Y90A 4XTUA 4JLIA 5GAMf 5GAOn 5LJ5j 3QHSA 3JCMP 3RKXA 1YCYA 1H641 4M77G 4WF2A 3HFOA 3RUXA 5LJ3d 1B34B 1U1SA 2FYKA 4C8QB 1I8FA 4XTVA 5LJ3f 4C8QD 4C92G 5GANd 4Y91A 4M7AC 1WNLA 4M7AB 4F7UA 4JRIA 4HA8A 2EJFA 2HNIA 3JB9J 4M78F 4MMLA 2EJGA 4M78A 4C8QF 5GAOl 4XU3A 4XQ3A 3RERA 5LJ3j 4M75E 4QVCA 4NOYA 4MMKA 4XTWA 5GAN6 4J5YA 3GIBA 2VXFA
chains in the Genus database with same CATH superfamily
2ZPBB 2MOXA 3WXMB 1D1CA 2KRNA 4FT4A 1M2VB 4JUVA 4O6JA 1X69A 2E10A 1M3AA 2CREA 4C92D 2DJZA 2QASA 4M7DG 2QG9B 3C4SA 3CCQQ 1YNZA 4WCIA 3QBYA 2P4TA 2LNVA 3H9NA 1HJDA 2DRKA 2HQHA 2DA9A 1Y96B 4OP0A 3PE0A 1YHQA 1WJQA 3VKIA 3GNFB 2RHIA 4ELZC 1MMGA 1K9MU 1K9MR 1VIFA 4DEXA 1CSKA 1JB0E 3M4YA 3OYGA 3EH1A 3V7CA 4C0DB 2DVEA 5GANh 2CP3A 2VXEA 1Q7YU 4M78G 2FRYA 3DB4A 3CMAA 2CUDA 3REBB 3M9QA 4QQGA 5KYXB 2KQWA 4RCBA 2V8KA 3O5ZA 4M77E 3SWNB 1VQ5Q 1D3BB 2P0PA 1IB8A 1MNDA 5HY6A 1B34A 1NE8A 2EGAA 2AHJB 4D6WA 1D1BA 3R6NA 2YDLA 1SSFA 4FYXB 5J39A 1JU5C 4KGVB 2O4XB 1I81A 3JB9D 1NJIR 1OOTA 5M9OA 2JNGA 3FEOA 2BE9B 1VQLT 3JV3A 3OYKA 4LDVA 2DL3A 2EYXA 1VQ4T 2HZYA 2JUFA 1QWFA 2L89A 2EQMA 3RERA 4CRIA 2JTEA 2DPPB 5GAN6 5FU6B 2LQWA 2PUOB 1QMCA 2QTXA 1TOVA 3VUBA 5KE3A 1BI0A 2CP7A 1PD1A 2FL7A 4Z88A 2EQIA 4C92B 4N4GA 5GAMj 2X35A 1BKBA 2DEQA 5GAMd 2BUDA 1JO8A 2Z0WA 3G4SQ 3CC7Q 3L2QA 2DO3A 2K5FA 3E2UA 4PLIA 5LJ3h 5CKDA 2MWOA 2BIVA 2KY9A 1ZUYA 2YLBA 4HVWA 1SF9A 2QYZA 1UGPB 2NUZA 2X3WD 1KHIA 1RAGB 3UDCA 1W6XA 1GFDA 4KRTA 5IHNA 2LTOA 4M77C 1E7OA 2QDLA 3OYBA 3UWNA 2DLPA 3PMTA 4RCCA 3META 3OYIA 2Y4XA 2DNUA 3PVQA 3BW1A 3OB9A 1WHKA 5CK9A 3M54A 1I4K1 3I35A 1I0CA 1YI2A 2RI2A 1NG2A 3EHQA 1PKSA 1NLPC 3PIOA 3RESA 4LDYA 4DOVA 1Y07A 2DYBA 2W10A 1Q86U 2R5AA 2KE9A 3CCET 2NWMA 1KJWA 4LD9K 1NEBA 2RNAA 3CCMA 4J9FA 4RKUE 3I56A 1VQPA 1G3SA 3EGUA 3VS5A 1OQKA 1QCFA 4MDXA 1WDXA 1WGSA 4ZGJB 2EFIA 1N8RC 1VIEA 1BI2A 1PHTA 1PD0A 1ZBXA 2DD4A 2J6OA 4KULA 3RUXA 2OTLT 1I8FA 3I56Q 4C92G 4FU6A 1Q81R 2O9VA 1HD3A 1Z9QA 2PU9B 2LQKA 4NOYA 1OU8A 1M90U 1LVKA 4OMNA 4M7AA 1EZZB 2IG0A 1Q7YR 1NZ9A 1UTIA 1I5OB 1G83A 2DMOA 2DXUA 1YIJT 1TUGB 3OMCA 3QDFA 5CKBA 3OSVA 2RF0A 4ZTJA 4BUGA 1KD1U 2R58A 5IN1A 4KT0E 2IIMA 4M78C 3V7SA 2YT6A 3NTIA 1XTDA 4BDZA 4C92E 3MCAB 4FYYB 3VYGA 3L1AA 5GANe 2QTVA 2L2PA 3OYJA 2K79A 3KBGA 5HCKA 1JJ2A 2LC4A 4E7KA 4C92A 1K1ZA 1RLQC 2JN0A 2W0ZA 1M27C 4MZMA 4F7UB 2PUKB 2R5MA 3L2VA 1K73C 1EX4A 2RM4A 1Q86C 3I5RA 2KSSA 1OV3A 3OY9A 4XTYA 4QKUA 1QVFA 2F2XA 4M7AE 2XU8A 2VVKA 3QUIA 2O01E 1G3TA 3CQTA 2QK0A 2Y4YA 4GY5A 3P8BB 3DB3A 4GLKA 4C0ZA 2LP5A 4C5EA 1WYXA 2KR3A 1SHFA 5GJVB 2PVDB 2WSCE 1GXIE 4PFPA 2J05A 2HL3A 5KYYA 1WHMA 2G3RA 3OBYA 4J9CA 2QAZA 2E70A 1ZLMA 1VQOQ 1M4ZA 3G4ST 4II1A 3HP9A 4Z8AA 4PK4A 2GQVA 2IPOB 3PNWC 5A0GA 2KROA 2PNIA 3VRZA 1BYMA 1SG5A 3F70A 4ME7A 1KD1C 2C0OA 3OYDA 5AT1B 3AHUA 3OYEA 1ZSZC 2E41A 2LJ0A 4KBMB 5C0MA 4KUIA 4RTZA 1AWOA 2DTIA 3VUZA 3CMAQ 3JCMJ 1YWOA 1MMDA 2RA2A 5I11A 1S72Q 1YJ9Q 5FRMA 1VQ8A 3I5SA 4KH0B 1KQSP 3FJ5A 2F1LA 4C0DC 3CPWA 2NYSA 1TG0A 2CUBA 4HCZA 3EGDA 4PKCC 5IXFA 3QZ9B 4LUEA 1LNXA 4J9EA 3M4GA 1RLPC 4PFZA 1OX8A 3H41A 3QZ5B 2L5QA 3JCMf 2CDTA 4L6V5 2KEAA 5KYWB 2KT8A 1WIEA 2AT1B 1AD5A 4LDUA 3OW2P 1FX7A 3NPFA 2QA4Q 2EWNA 1X01A 1TU0B 2EYWA 2PVGB 1YJ9T 1BB9A 1M30A 3NTHA 1N9RA 4WTOB 5GAOp 3VS1A 4JLIA 1UE9A 2ZPFB 2HCKA 1RABB 3RKXA 4IKFA 2FYKA 4JLGA 2LMJA 4Y91A 2LT1A 3T9NA 2DRMA 4KUDK 1IZ6A 2SEMA 2EJFA 2BE7D 2E6ZA 5GAOl 5CQYA 2DF6A 2KVQG 1K8AR 3OS5A 2PQWA 2ESWA 1LPLA 2D6FA 5D6XA 4PLLA 4Y92A 1M5Q1 1TWBA 2D0QB 2GFAA 2X4WA 2ZCFB 6AT1B 2XHCA 2FVUA 4M77D 5FWCA 1QQJA 2P4RA 1QVFS 3JCMV 3I55A 2FO0A 1QVPA 2HSEB 4M75B 1OPKA 3CC2Q 1ARKA 4J7FA 4X1VA 4LDWA 3TU4K 1K9MC 3CCJT 2E1HA 5GAN4 3RKYA 2M0OA 2MK5A 1V29B 2DE0X 4FW2A 4OB3B 1GCPA 3WVDB 3HL8A 4ORZA 1GL5A 1FYNA 3MEUA 4ANJA 2LVMA 2XDDA 2HBWA 1NJIU 1UECA 4F7UE 1NEGA 2QA4T 4ZGDB 4MZPA 2YSQA 4M7DE 3C0CA 4UC4A 1SSHA 2RQRA 2L3PA 1HK9A 3V8LA 1AOJA 3JCMd 4NS5A 2ABLA 3QSUA 1V1CA 1VQKQ 1YIJA 2X4JA 4Y28E 1PG5B 1CKBA 2HBPA 3LH0A 4NL3A 4FCYA 1PRMC 5J26A 2GGRA 4J9BA 2COYA 3CD6T 5GAN5 3ZL7C 2F5TX 1KSWA 1XNIA 3QG1A 1IGUA 3M0TA 2QDYB 3PTAA 3OYAA 1Q7YC 1M1FA 4F7UG 2E3HA 1TS9A 3HKSA 4M77G 1B34B 2LT4A 2RPNA 2RJCA 5C6SA 2COWA 1D1AA 2RK1A 1D0YA 3I9QA 1BCOA 2O31A 4XTWA 2O9SA 3GIBA 1IRXA 2XMFA 3QO3A 3OA6A 1UUEA 2F2VA 4JJNK 1VQMA 1GBRA 4IUUA 2COZA 2LQNA 3X26B 2VV5A 4D8KA 1OULA 4ZN1A 5IAYA 4N4HA 9ATCB 5DLQE 4J6WA 3G71A 4JS5A 1KFZA 5GAN8 4E7ZA 3MKDA 3G1JA 2YRVA 5GAMe 5HK3A 1ACMB 1VQ5A 1GBQA 3CC7T 3G71Q 1QP2A 3LWHA 3M56A 3NHNA 1Q82C 1BI3A 2FRWA 1YWPA 2K5LA 3H0FA 1OU9A 2M1HA 2RD1A 2XG8D 4C8QE 2ZPIB 3GF5A 3EAEA 2JZ2A 3PIPA 2EW3A 1UGSB 3QJYA 1OEBA 3QYHB 4OMMA 2VC8A 3EFRA 2LDMA 2MYSA 4F04B 2VGNA 4CC7A 2G6FX 2CZ0B 1VQ8Q 2LCLA 3CCRA 1YJNA 1JXMA 4L5GA 1AVZC 2KT1A 4HVVA 1GFCA 3JCMb 4J6YA 2DIGA 3V8JA 4ZTFA 3JSCA 4F7UF 1QVGS 1VQ6T 1YFNA 2JTMA 3FRNA 1UDLA 2BZXA 3RIRA 3CCQA 3CBPA 3V8KA 2FPDA 2PZ1A 4CI0C 3JB9I 2HD0A 3ER0A 2ENMA 2V26A 2YUQA 5GANj 2DIQA 2X3XD 3CC4A 2K57A 2EAYA 1VQ8T 2PVOB 5GAMf 2C06A 4RTXA 4A4EA 3VYHB 1H641 3HFOA 3EG0A 2HEQA 1DJ7B 4AT1B 2QEXA 2RK2A 3ZEHA 3CMEA 1AEYA 1KQSA 2AKKA 2RH2A 4XQ3A 2RJFA 2XKOC 2LJ3A 3ULRB 2FZCB 5LJ3j 2NUTA 5KE2A 2JS0A 4RMOA 4J9HA 4M75D 1BCMA 3CCST 1KC8C 4J9GA 1B3QA 4ZNXA 2I2LA 1IXDA 2A08A 1K0SA 1ZSZB 5L23A 5I21A 5GMKh 2E64A 3MHXA 3NTKA 4M7DB 3JCMg 4EMHA 3RKWA 1KC8U 1MUZA 1M1KU 1PCXA 5CCAA 1SPKA 4JJBA 5J3BA 3D7SB 1UG1A 1IHVA 2DYIA 1WZOA 1X6BA 4EDUA 1AWXA 5GANf 2CZ6B 1ZHIA 2RI5A 4XTXA 1VOMA 1K73U 1YHQT 2XICA 2DILA 2JM8A 1WQWA 2HAXA 3CEYA 2YHTA 1QVGP 1AZGB 4JZ3A 3URGA 4GLMA 4OVAA 3PT9A 2QQBA 1PWTA 1QLYA 1RACB 2XDPA 3HFNA 3MEWA 4A54A 1GRIA 4KGXB 3QPHA 1M8MA 4AFSC 3SWNA 3E9FA 4JJDA 2DFUA 4HVUA 4BI3A 3VRYA 2VYTA 4OMFB 4RTWA 1NLOC 3MO8A 3S6WA 1YP5A 5CIUA 4M7AD 2KK4A 1Y71A 2MMPA 1RADB 1BIAA 5GAN3 1WFWA 4EMKB 1Y96A 3P8HA 3A8OB 3CPWP 2QXFA 2H3EB 2P84A 3M0QA 3G6EA 3CPFA 3FDRA 2D0NA 3LGFA 4OGCA 1EIFA 2CP2A 4DBRA 5KCOA 2E4HA 1U8RA 1NPRA 4XTVA 2AKLA 3VS2A 5IH2A 5FWBA 3A8GB 1ABOA 4M78F 1YITQ 2I0NA 1K76A 1K8AU 4P5NA 1H3HA 4PJNA 2QQSA 4X9CA 2KXCA 1VQNT 2FHDA 3JB9H 1N5ZA 3QXEB 3OSSC 1TTHB 5FRNA 3JB9F 1ZA1B 2XK0A 2ED1A 1B07A 1E6GA 2JT4A 5GMKm 1F1BB 5A2QE 3X28B 3C95A 3ASKA 1OX9A 3J7AF 2EVRA 1RAFB 2HKQB 1VQ7A 2FPFA 5GAMh 4LNPA 2EGEA 4KGZB 1VQKT 5DY9A 1MGQA 1VQ4Q 5CQXA 2AIRB 1WHHA 4EMGA 4X9DA 4A4KA 2JS2A 4PJJA 4AFQC 5FLXE 4A4GA 1WXTA 3SD4A 4FSSA 3M58A 4K11A 2YXYA 4HCKA 2EYZA 4C5HA 1W2BP 3LYIA 3MP1A 2IVWA 2CS7A 3HHTB 2B8AA 3MEAA 4C0GA 2RHZA 2M51A 1OI1A 3OYLA 1S1NA 2LX7A 3TQ7P 4M77B 5CVIA 4M75G 2YWWA 5I2MA 2FZKB 3CCVT 3OQ5A 4C8QB 5L8RE 1UGQB 3I56T 3SHWA 5KYXA 4XU3A 4X34A 2HKNA 3CCLQ 4QQDA 2OTLA 2R57A 1WI7A 1QVFP 8AT1B 1I07A 4E47A 1LJOA 5FW9A 1Q86R 1UJ0A 3NFCA 3J81E 4RTUA 2K3YA 3VJPA 1SRMA 3EGDB 2QEXQ 4J6XA 4ATOA 2NLUA 1VQ9T 3DLMA 4PL6A 2JMCA 4HKEA 1IO6A 2DTHA 2YLCA 1GCQA 2XI9A 5A0DA 3EFOA 2DJQA 1JJ2S 2WACA 1G3WA 1GCQC 2DKGA 2M16A 3VS6A 2KXDA 3JCMX 2K6DA 3A1PA 2GFUA 2KYMA 2A0FB 2CP6A 2E3IA 3OW2A 2L8DA 2DVJA 3X24B 3BY7A 1NBEB 4JRKA 2AZVA 2K7AA 4A63B 2QEXT 5LJ5g 2O88A 3UA6A 2D1XA 4IUQA 4OB2B 2O2OA 4MZTA 4XTZA 1AHJB 1RUWA 1X27A 1W4SA 5KYUB 3VS0A 4RG8A 4C8QA 2YUPA 4IURA 1EFNA 3FJPA 3O8VA 5GANg 3GP8A 4BI4A 3VV0A 3C94A 2EQUA 2V1QA 1FMKA 3THKA 4B9WA 1X75C 3L42A 4E7JA 3SWNC 5IXBA 5CAIA 1WHGA 4EMKC 1NM7A 5KYYB 1Q81C 1VYVA 3RMQA 3HSBA 4PJOA 4NL2A 3M59A 3M5AA 3FLGA 1O75A 3EGXA 2OX7A 2B86A 3CXCP 4Z89A 1M2VA 4DBQA 3QHSA 2K5IA 5GANd 5KYWA 3EHRA 4J9IA 1M2OA 2E5QA 4M78A 2E12A 1OYXA 4M75E 4ELYC 1M90R 5CR2A 2DD5A 2VWFA 3SB2A 2FZGB 1PRLC 4XAXB 5ECAA 3LH5A 4DBHA 2DTOA 1RAHB 4OB0B 1OZ2A 4Q5WA 4JZ4A 3TSWA 3I55T 4FYVB 3CCUT 2HQEA 1IHWA 1UHFA 2MI6A 4LD6A 3CPWS 3VU3C 3X20B 1R77A 3C12A 1YITA 2RN8A 2HSPA 3OW2S 1WLPB 3TREA 4BACA 4M7AF 3TCJA 4AFZC 5GAOr 5LJ3g 2ROLA 1AWJA 2VGMA 1Q82R 1YN8A 1SKUB 4BY6C 2M02A 2MAMA 3JCMQ 3RBBB 2CT4A 1ZQ1A 1SRLA 2RB6A 2X9HA 2HQXA 2EKHA 4QW2A 4V2SA 1VQLA 2MPXC 4AMCA 1N6AA 1C1AA 2L3SA 2C0IA 1C6VX 4BDYA 1MNEA 1M3CA 1K8AC 2A37A 1SHGA 3CD6A 1TXQA 4XK8E 2V8IA 3R6OA 3CCLT 4J9DA 2D8JA 5GAMg 3L2ZA 3PVLA 1BBZA 1S72T 1T0HA 3MP8A 2CT3A 2JMAA 3VS3A 2ROTA 1QKXA 4JPBW 3SFMA 2DXCA 2KI7A 2DX1A 4E7HA 3DKMA 4OMLA 1YJ9A 5IT9E 1VQOA 1UB4A 2XD0A 5AYFA 4CC3A 4Z02A 1UJYA 3A98A 1J3TA 2J06A 3H8ZA 4EIKA 5CKHA 4CC2A 3JCMW 3RR6A 1BK2A 1ZX6A 3PGGA 1N9SA 3EGXB 3HPWA 4AG1C 2K3XA 2X4YA 4QVDA 2D9TA 4PJOD 3UA7A 1X6OA 4N0AA 1MV3A 2SRCA 3HRUA 2BZYA 3H6ZA 1WHJA 1U06A 2KAFA 4R56A 1H92A 3LX7A 4LN2A 3EG2A 4BB7A 3CCEA 2LZ6B 2ED0A 1TH7A 1M3BA 3G4SA 2GNCA 3LWIA 2KYBA 1T0JA 1C0MA 3NGPA 5HK0A 3QYGB 1E6HA 4AG2C 2NUPA 3HRSA 1U5SA 2EBPA 3L2RA 2F69A 3RNJA 1NYFA 1ABQA 1I1JA 3FB9A 3ZFJA 3M0UA 4HCCA 3A5ZB 1AZEA 1X43A 2RHXA 3CCQT 1UGVA 1NYGA 5GMKl 2DL5A 3KUFA 2A3LA 2LX9A 4E2FB 2RQVA 2GQIA 4EPCA 1MV0B 1Q95G 2E6NA 1JBMA 2P0KA 1WXUA 1FMWA 1VYTA 3SDZA 5I2SA 3OS2A 3M0RA 2DK3A 4B9XA 1KK7A 3LGLA 3EG1A 5IHKA 3QJ6A 5LJ3d 1U1SA 4C8QD 1UHCA 3PMIA 1Z9ZA 1ZBJA 1QP3A 4IUTA 2KBTA 3NMZC 3CCEQ 2MIOA 2DL4A 5D6YA 1MHNA 1VUBA 3GBQA 4HT9A 4J5YA 4DBFA 1T3SA 2LRQA 4ZN3A 3CCJQ 3LLRA 1FWZA 3M53A 1K73R 4BD3A 3Q1JA 1WJSA 2DXBA 2QQ9A 3EFOB 2E5KA 3JCMh 7AT1B 2JOYA 1TUDA 1WX6A 1OZ3A 2OAUA 5LJ3e 3GPLA 2ZPGB 5GMKj 1G3YA 4DEYA 3CBOA 3CC7A 3SEMA 4HXJA 2OTLQ 1ZUUA 1ZSZA 4IUPA 4PFOA 1JEGA 2E65A 2DXTA 2QQRA 2CSQA 5EG2A 3OS0A 3QKJA 3CMAT 4FT2A 5LJ5d 1HYOA 2FEIA 2OAWA 3OYMA 2YRCA 1Q81U 1AWWA 4IIMA 4BI8B 5GMKe 5KH6A 4CC4B 2DM1A 4C0FA 4PNOA 1H3ZA 4PJOE 3OBWA 3N5BB 1VQ6Q 4C92C 4DA4A 4ZGEB 2EYQA 3CCUA 4LXCA 4C8QC 3EG9A 3VS4A 4M78E 1VQ6A 2X4XA 1QVGA 2DL8A 3REAB 3CBMA 4BE0A 2Y90A 3CMEQ 1YCYA 4YTLA 4PJOC 3MJXA 5LJ3f 3CC4T 1VA7A 2V8JA 2RJEA 1K4US 4F7UA 1LCKA 1XJWB 1YJWA 1R0BG 3JB9J 4MMLA 2EJGA 5CKEA 4C8QF 3FC3A 2CP0A 2VKNA 4OGEA 2F2WA 1HSQA 5CO7A 2OTJA 3MPUB 4PJLA 2KDSA 2CP5A 4JRPA 1PM3A 1D0XA 4RTYA 5HKCA 2EPDA 2ZPHB 3A8HB 1A0NB 2HMAA 1JXOA 3CXCA 3TEEA 3CCLA 4FL6A 4ESRA 1R0CB 2P0QA 2DL7A 4O5VA 5A0LA 1S72A 3FIFA 1TUCA 1KG1A 4JJCA 2FG0A 2VB6A 5GAN2 5I22A 3TSZA 1BI1A 1VQOT 3X25B 4E7LA 2LNHB 3QIIA 4E7SA 2QQAA 4FIBA 2M0YA 2ATCB 2L3QA 5LJ5f 5DLOA 4IIOA 4M78B 4M75F 2DZCA 5LJ5h 1QCOA 2VUBA 4KH1B 1ZA2B 4C5IA 4C8QG 2EJ9A 1SEMA 1AT1B 3LW5E 2RJDA 2DBMA 1XQHA 1RAAB 1RI0A 3OYNA 4PJOF 1PSFA 4C5GA 2CZ1B 1JQQA 3CCMT 5GJWB 2K9GA 2WSEE 1VQPT 2EGCA 1PC0A 1Y0MA 5D7UA 5GAOn 1WJRA 3JCMP 4N4IA 3A8LB 4AFUC 2JTFA 2LQ8A 2QGFB 3G7ZA 4M7AB 1ZUKA 1YJWQ 1R8OB 3G6ET 3S3NA 3CCRT 1YJNT 1FXXA 1G5VA 2GBQA 2PTKA 2C0TA 3E9GA 4MMKA 2KNBB 3EH2A 1JJ2P 1M1GA 1W2BA 2GTOA 1RAEB 1W1FA 4RUGA 2KGTA 3OYHA 3ZBDA 5GAOm 1VQNQ 5FU7B 2JVVA 2JXBA 2J6KA 3BE3A 4E7IA 1PKTA 1RI9A 2BKDN 2RI3A 1BU1A 5GAOq 2ZAEA 3VS7A 1M8VA 1VQPQ 2L3RA 3CCMQ 3OYFA 4A53A 4EMKA 4QQ6A 2K2VA 5DM7R 1D3BA 1KHCA 2QI2A 1Y57A 2H8HA 2X51A 4M7AG 4TVRA 1QCNA 4M7DA 4BE2A 4J83A 3RMSA 4M7DC 3G6EQ 3PFSA 1K0XA 2KRMA 5CKFA 3QDRB 3RDVA 3CC2T 4OB1B 2CSIA 2A36A 5KYNA 4C92F 4OMPA 1QW1A 1BIBA 2K2MA 4M75C 4XU1A 3UF4A 4OF1A 4DQ2A 2DAQA 2ECZA 2FB7A 4E6RA 4F14A 3BDUA 4R55A 3EG9B 4LUDA 4LE9A 3QWYA 1VQMQ 3TVTA 3G71T 3E1SA 3WVEB 2OI3A 4M77A 1CKAA 1KD1R 1KC8R 2AZSA 2OTJQ 2GTJA 1WXBA 5D6WA 2GF7A 4OMQA 2CH4W 4XTUA 2DBKA 4WF2A 3CC4Q 3GLXA 4PJMA 1WNLA 1UGRB 4HA8A 1VQ7Q 2HNIA 1B7TA 4M4ZA 2EIFA 2WSFE 4FM4B 3CCVA 4QVCA 1Y7XA 3KXTA 2VXFA 1IGQA 2RQUA 4FW1A 2VASA 2RO0A 1NPPA 2ZZDA 1KQ2A 4HCBA 4A4HA 3CXCS 2YUNA 3E19A 1YIJQ 1HXDA 5GAN7 2D8HA 1RL2A 2JM9A 1YITT 3EFSA 1W70A 1I5LA 4B6MA 2EYYA 2L0AA 2BZ8A 2CGHA 1VQ9A 1KQ1A 2YUOA 2QA4A 2BTTA 2CZ7B 1FMVA 4M7DD 3MEVA 4PJOG 3BFMA 1N8RU 1KQSS 1K9AA 2CYZB 1VQ4A 1YJWT 1U1TA 3S3OA 1VQNA 4RTVA 3HRTA 3DLLA 3IQLA 3GOXA 2RHYA 1QWEA 2OTJT 2RHUA 2JW4A 2MWPA 1D0ZA 1M90C 2XDBA 1M1KR 3J80E 3CCVQ 4IUVA 4XU0A 5IHIA 1YBYA 5LL6S 1YI2Q 3M0PA 1MMAA 2ZGWA 4RG2A 1TSFA 1G2BA 5KCHA 2DEUA 1VQ7T 2ZPEB 3CCUQ 4JRQA 1PSEA 2KMTA 2JJ9A 3JCMe 2LCSA 1VQKA 3BDLA 1LOJA 1H8KA 4FYWB 4N0AC 1QKWA 2RQWA 4GBQA 3UT1A 1G8XA 5GMKi 3H0IA 1YHQQ 4VUBA 1U3OA 5LJ5e 4HT8A 1XOVA 2EQKA 4RTTA 1VQ9Q 2XIDA 1YCSB 1UEBA 2J7IA 4JRIA 1VQMT 4FSXA 3U23A 1P92A 1M1KC 1X6GA 3INZA 1KIKA 1ZSGA 3JB9G 2F5KA 4LDXA 1WA7A 2OJ2A 3A8MB 2RMOA 1VQ5T 1YI2T 1PNJA 3H0HA 1W2BS 4XU2A 1T3LA 1V76A 2HDAA 4PJOB 4J7IA 4R0KA 2MCNA 3CD6Q 3ME9A 3I55Q 2YRDA 3L2UA 2J6FA 4OMOA 1WPYA 2KRSA 3HTRA 3M55A 2K4YA 4L59A 1WQ7A 3V7RA 3UPUA 3QWXX 4QT7A 2LCCA 2QGGA 1X2QA 2H3JA 3CCJA 1N27A 2AK5A 3S3MA 2GCXA 1OPLA 2HL5C 4M77F 1VQLQ 8ATCB 5FU6C 1IREB 2MF2A 4JDSA 3OYCA 3MP6A 2NUTB 4BE1A 4A4FA 2DETA 2LJ1A 2EKOA 3M0SA 2A7YA 1VYUA 1Q82U 2A28A 1O9SA 3AT1B 3P8DA 1WHLA 3L2WA 3M57A 2K3BA 2CH4A 2DZ9A 2DERA 5FU7C 3JCMc 1X2KA 3CCRQ 1YJNQ 4M75A 2V1RA 2CKKA 4F16A 3OS1A 2EQJA 2M9UA 4M7DF 2O4XA 2FPEA 4QVZA 1JRIA 3CCSQ 5FROA 4M78D 1N8RR 4DOWA 1NJIC 5EC7A 3CMET 4JS4A 1RAIB 3UATA 3OMGA 4F17A 1UFFA 3KFVA 5LJ5j 3EG3A 4BY6B 4M7AC 3JAME 3CCSA 1M9SA 4MDWA 1MMNA 4D8DA 3GNGA 3OYYA 3CC2A 2NUPB 3JRZA 4J8OA 5KYUA 2RQTA 1D09B
chains in the Genus database with same CATH topology
2ZPBB 4E47A 3WXMB 4OGEA 1LJOA 5CO7A 2D6FA 2OTJA 5D6XA 4PLLA 3NFCA 3J81E 1M5Q1 2D0QB 2K3YA 2KDSA 3VJPA 4FT4A 4JRPA 2GFAA 4JUVA 1M8VA 4O6JA 2E10A 2X4WA 4C92D 2ZCFB 2DJZA 4M7DG 3C4SA 4J6XA 5HKCA 4ATOA 2NLUA 3QBYA 1VQ9T 2P4TA 2LNVA 2ZPHB 3A8HB 3DLMA 4PL6A 2XHCA 2FVUA 4HKEA 1Y96B 4M77D 4OP0A 3CXCA 3TEEA 1QVFS 2DTHA 3JCMV 2YLCA 3I55A 1YHQA 4FL6A 1QVPA 3CCLA 2XI9A 5A0DA 4M75B 2WACA 1G3WA 1JJ2S 1WJQA 2DKGA 2M16A 2P0QA 3VKIA 4O5VA 4J7FA 5A0LA 3JCMX 3GNFB 2RHIA 4LDWA 2GFUA 4ELZC 3TU4K 1S72A 3FIFA 3CCJT 1K9MC 2E1HA 1K9MU 5GAN4 3RKYA 2M0OA 1VIFA 1V29B 3OW2A 1KG1A 2L8DA 1JB0E 3M4YA 3OYGA 3X24B 3BY7A 4JRKA 4OB3B 3V7CA 5GAN2 3WVDB 3HL8A 3MEUA 4C0DB 2DVEA 2LVMA 5GANh 2QEXT 5LJ5g 2VXEA 1BI1A 2XDDA 1Q7YU 1VQOT 3X25B 4E7LA 1NJIU 3QIIA 4IUQA 4M78G 3DB4A 2QQAA 4F7UE 3CMAA 4OB2B 2QA4T 4MZTA 4XTZA 4ZGDB 4FIBA 3M9QA 4QQGA 1AHJB 2KQWA 4RCBA 4MZPA 4M7DE 2V8KA 5LJ5f 4M77E 4UC4A 5DLOA 3SWNB 1W4SA 4RG8A 1HK9A 3V8LA 4C8QA 3JCMd 4IURA 4NS5A 3FJPA 3O8VA 4M78B 5GANg 1D3BB 3GP8A 4M75F 4BI4A 3QSUA 2DZCA 3C94A 3VV0A 2EQUA 1YIJA 5LJ5h 2X4JA 4B9WA 2VUBA 2P0PA 1X75C 3L42A 4Y28E 4C5IA 4E7JA 3SWNC 5HY6A 4C8QG 5CAIA 2HBPA 1B34A 2EJ9A 1NE8A 4EMKC 3LH0A 4NL3A 1Q81C 2AHJB 5J26A 3LW5E 3CD6T 5GAN5 2RJDA 3RMQA 3HSBA 2F5TX 4D6WA 1XQHA 1XNIA 3QG1A 4PJOA 1RI0A 3M59A 4NL2A 3M5AA 1SSFA 3OYNA 5J39A 3FLGA 2QDYB 4PJOF 1PSFA 3OYAA 4C5GA 3PTAA 1O75A 1Q7YC 1M1FA 2CZ1B 3CCMT 2O4XB 2WSEE 4F7UG 1VQPT 1I81A 3JB9D 5M9OA 5GAOn 1WJRA 2JNGA 3QHSA 3FEOA 3HKSA 3JCMP 4N4IA 3A8LB 4M77G 2JTFA 2K5IA 1B34B 2LQ8A 1VQLT 5GANd 3G7ZA 3OYKA 2LT4A 4M7AB 4LDVA 2RJCA 1VQ4T 1R8OB 3G6ET 5C6SA 2E5QA 3S3NA 3CCRT 2JUFA 1FXXA 4M78A 1YJNT 1G5VA 2E12A 2L89A 2EQMA 2RK1A 3RERA 4CRIA 1OYXA 2DPPB 3E9GA 4M75E 4MMKA 4XTWA 4ELYC 5GAN6 5CR2A 3GIBA 2DD5A 5FU6B 3QO3A 1M1GA 3OA6A 1W2BA 3SB2A 2PUOB 2QTXA 4XAXB 4JJNK 3VUBA 1VQMA 2DTOA 5KE3A 4IUUA 3OYHA 3ZBDA 5GAOm 1BI0A 4OB0B 3X26B 2VV5A 2FL7A 4ZN1A 5FU7B 1OZ2A 2JVVA 5IAYA 4N4HA 4C92B 4Q5WA 5DLQE 4J6WA 3G71A 4JS5A 4E7IA 4N4GA 5GAN8 5GAMj 3I55T 2X35A 3CCUT 1BKBA 2HQEA 2YRVA 5GAMe 5HK3A 2BKDN 2DEQA 5GAMd 1VQ5A 3CC7T 2MI6A 4LD6A 2BUDA 3CPWS 3VU3C 3X20B 2RI3A 3C12A 1YITA 5GAOq 3L2QA 3OW2S 1QP2A 2DO3A 2K5FA 4PLIA 3TREA 5LJ3h 5CKDA 4BACA 2MWOA 2BIVA 4M7AF 3TCJA 3LWHA 2KY9A 2L3RA 3M56A 5LJ3g 5GAOr 2VGMA 2YLBA 3OYFA 4A53A 4EMKA 1Q82C 1BI3A 4QQ6A 2K5LA 1UGPB 2K2VA 4BY6C 2M1HA 2RD1A 1D3BA 1KHCA 2XG8D 5DM7R 1KHIA 2QI2A 2MAMA 3UDCA 4C8QE 2ZPIB 3GF5A 3JCMQ 3EAEA 4M7AG 4TVRA 2JZ2A 1ZQ1A 3PIPA 2RB6A 1UGSB 3QJYA 3QYHB 2HQXA 2LTOA 4M77C 4J83A 4BE2A 4M7DA 3OYBA 3RMSA 3UWNA 4M7DC 2VC8A 3EFRA 2LDMA 3PFSA 4QW2A 2VGNA 5CKFA 3QDRB 3CC2T 3PMTA 4OB1B 4RCCA 3META 3OYIA 1VQLA 4V2SA 2Y4XA 4C92F 3BW1A 1QW1A 2CZ0B 1N6AA 3OB9A 2LCLA 5CK9A 3CCRA 4L5GA 1BIBA 3M54A 1YJNA 4XU1A 4M75C 4OF1A 3JCMb 1I4K1 4J6YA 2DIGA 4BDYA 1YI2A 3V8JA 2RI2A 4ZTFA 1K8AC 3JSCA 4DQ2A 4F7UF 2DAQA 1QVGS 1VQ6T 2JTMA 3FRNA 2FB7A 3RIRA 3PIOA 3CCQA 3RESA 4LDYA 4DOVA 1Y07A 3CD6A 3BDUA 1Q86U 4R55A 4XK8E 2R5AA 2V8IA 3R6OA 3CCET 3CCLT 4LD9K 3CBPA 3V8KA 4CI0C 5GAMg 3E1SA 3G71T 3L2ZA 3JB9I 2HD0A 3ER0A 3WVEB 4M77A 3CCMA 5GANj 2DIQA 4RKUE 3I56A 1VQPA 2K57A 1G3SA 3CC4A 1S72T 3MP8A 3CC4T 4MDXA 2EAYA 1WGSA 4ZGJB 1VQ8T 5D6WA 2GF7A 2PVOB 2EFIA 1N8RC 4XTUA 5GAMf 2C06A 4A4EA 1VIEA 1BI2A 1H641 1ZBXA 2DD4A 3HFOA 4KULA 2DXCA 4WF2A 3RUXA 3SFMA 1I8FA 2OTLT 4C92G 3GLXA 3DKMA 4E7HA 1YJ9A 1DJ7B 1WNLA 5IT9E 4FU6A 2QEXA 2RK2A 1UGRB 1VQOA 1UB4A 4HA8A 3ZEHA 3CMEA 2HNIA 1KQSA 2XD0A 2RH2A 5AYFA 2EIFA 2WSFE 2PU9B 2RJFA 2XKOC 2LQKA 4FM4B 4XQ3A 4Z02A 3CCVA 5LJ3j 4QVCA 4NOYA 1Y7XA 5KE2A 1M90U 3KXTA 3H8ZA 2VXFA 4RMOA 4M75D 5CKHA 4M7AA 2IG0A 3CCST 1KC8C 3JCMW 1NZ9A 3PGGA 2RO0A 2I2LA 1N9SA 1NPPA 3HPWA 2ZZDA 1KQ2A 2DXUA 5GMKh 5I21A 2K3XA 4A4HA 3OMCA 1YIJT 3CXCS 2E64A 3OSVA 5CKBA 4ZTJA 3MHXA 2X4YA 4BUGA 3NTKA 2D9TA 3E19A 4QVDA 1KD1U 2R58A 4M7DB 3JCMg 4EMHA 3RKWA 1HXDA 4PJOD 5IN1A 1X6OA 4N0AA 5GAN7 1KC8U 3HRUA 1RL2A 4KT0E 1YITT 4M78C 3H6ZA 3V7SA 1M1KU 3EFSA 1I5LA 2KAFA 3NTIA 5CCAA 4R56A 5J3BA 1XTDA 3LX7A 4BDZA 4C92E 4EDUA 3MCAB 2CGHA 5GANf 4BB7A 3CCEA 1VQ9A 2CZ6B 1ZHIA 3VYGA 2RI5A 3L1AA 4XTXA 1TH7A 1KQ1A 1K73U 5GANe 2QA4A 1YHQT 2CZ7B 2XICA 3G4SA 3OYJA 4M7DD 3MEVA 1WQWA 3KBGA 4PJOG 3BFMA 2HAXA 1N8RU 1KQSS 3CEYA 1JJ2A 2LC4A 2YHTA 3LWIA 4E7KA 4C92A 2CYZB 3URGA 1VQ4A 2QQBA 3PT9A 2JN0A 4OVAA 2XDPA 3MEWA 1YJWT 3HFNA 5HK0A 3QYGB 4MZMA 4A54A 4F7UB 3HRSA 1U1TA 3S3OA 1VQNA 3L2RA 2PUKB 2R5MA 3QPHA 3L2VA 2F69A 3HRTA 3SWNA 3E9FA 1K73C 3DLLA 4BI3A 3GOXA 2RM4A 3FB9A 3ZFJA 2RHYA 1Q86C 2OTJT 2RHUA 2KSSA 4HCCA 2MWPA 3A5ZB 2VYTA 2RHXA 3OY9A 3CCQT 1M90C 4XTYA 3J80E 4OMFB 2XDBA 4IUVA 4XU0A 5LL6S 1YBYA 3MO8A 3S6WA 5GMKl 1QVFA 2ZGWA 4RG2A 3KUFA 2XU8A 2A3LA 4M7AE 3QUIA 2O01E 1G3TA 2LX9A 5KCHA 5CIUA 4M7AD 2KK4A 2Y4YA 4GY5A 1VQ7T 1Y71A 2ZPEB 4JRQA 3P8BB 4EPCA 3DB3A 2MMPA 4GLKA 2KMTA 1PSEA 1BIAA 4C0ZA 2E6NA 5GAN3 1JBMA 4EMKB 1Y96A 3P8HA 4C5EA 2P0KA 3JCMe 3A8OB 1VQKA 2QXFA 3BDLA 1LOJA 3SDZA 2PVDB 4N0AC 5I2SA 3OS2A 2WSCE 3CPFA 3G6EA 2DK3A 3FDRA 3UT1A 5GMKi 4B9XA 1GXIE 3LGFA 4OGCA 1EIFA 5KCOA 3LGLA 4VUBA 3QJ6A 5LJ3d 2G3RA 5LJ5e 1U8RA 1NPRA 1U1SA 3PMIA 4C8QD 4XTVA 1XOVA 3OBYA 4HT8A 2EQKA 1QP3A 2E70A 3A8GB 4IUTA 2XIDA 1UEBA 1M4ZA 4JRIA 3VYHB 1VQMT 4FSXA 3G4ST 4M78F 4II1A 3HP9A 5D6YA 1MHNA 2GQVA 1VUBA 1P92A 3PNWC 1K8AU 1M1KC 5A0GA 4HT9A 4J5YA 3INZA 4P5NA 2LRQA 1BYMA 3JB9G 2F5KA 4ZN3A 3F70A 4ME7A 2QQSA 4LDXA 4X9CA 3A8MB 1KD1C 1VQ5T 1VQNT 2FHDA 3LLRA 3JB9H 1YI2T 3OYDA 1FWZA 3M53A 3QXEB 4BD3A 3Q1JA 1W2BS 3AHUA 4XU2A 3OSSC 1WJSA 3OYEA 5FRNA 3JB9F 2DXBA 2E41A 2QQ9A 4PJOB 2XK0A 4J7IA 4KBMB 5C0MA 4KUIA 3ME9A 3JCMh 5GMKm 2DTIA 3L2UA 3VUZA 5A2QE 2JOYA 3X28B 3C95A 3ASKA 1WPYA 1OZ3A 3JCMJ 2OAUA 5LJ3e 3GPLA 3M55A 3J7AF 2K4YA 4L59A 1WQ7A 3V7RA 2ZPGB 3UPUA 2RA2A 5GMKj 2LCCA 1G3YA 1VQ7A 3CBOA 2H3JA 5FRMA 1VQ8A 5GAMh 3CCJA 1N27A 3S3MA 3CC7A 1VQKT 2GCXA 5DY9A 4M77F 4C0DC 4IUPA 3CPWA 5FU6C 1MGQA 1IREB 2MF2A 4JDSA 3OYCA 4HCZA 3MP6A 4PKCC 2E65A 2DXTA 2QQRA 4BE1A 3QZ9B 5CQXA 4EMGA 5EG2A 4X9DA 4A4FA 1LNXA 4A4KA 3OS0A 3M4GA 3QKJA 2EKOA 3CMAT 2A7YA 4FT2A 5LJ5d 3QZ5B 3OYMA 1Q82U 2L5QA 5FLXE 1Q81U 4A4GA 1O9SA 3P8DA 3JCMf 4BI8B 5GMKe 5KH6A 4L6V5 3SD4A 4C0FA 3L2WA 4PNOA 3M58A 1H3ZA 3M57A 4PJOE 3OBWA 3N5BB 2DZ9A 4C5HA 4C92C 4DA4A 4ZGEB 3LYIA 2EYQA 5FU7C 3JCMc 3CCUA 3MP1A 2IVWA 4C8QC 2CS7A 3HHTB 1FX7A 4LDUA 4M75A 2EWNA 2B8AA 3MEAA 4C0GA 2CKKA 2RHZA 3OS1A 1OI1A 2EQJA 4M78E 1X01A 2M9UA 2O4XA 4QVZA 3OYLA 4M7DF 1JRIA 2PVGB 1VQ6A 5FROA 4M78D 2X4XA 1YJ9T 4DOWA 1NJIC 4M77B 5CVIA 1QVGA 4M75G 3CMET 3CBMA 4JS4A 4BE0A 5GAOp 3NTHA 1N9RA 5I2MA 2Y90A 3OMGA 4JLIA 2ZPFB 3CCVT 5LJ5j 3OQ5A 3RKXA 1YCYA 4BY6B 4YTLA 4C8QB 4IKFA 4PJOC 2FYKA 5L8RE 4M7AC 4JLGA 3JAME 5LJ3f 1UGQB 2LT1A 3T9NA 2V8JA 1M9SA 2RJEA 4MDWA 4Y91A 4F7UA 3I56T 3CCSA 1YJWA 3GNGA 1IZ6A 4KUDK 4HCBA 2EJFA 3JB9J 2E6ZA 2EJGA 3OYYA 4MMLA 5CKEA 4XU3A 4C8QF 5GAOl 4X34A 5CQYA 3FC3A 3CC2A 2KVQG 3JRZA 4J8OA 4QQDA 2OTLA 2R57A 3OS5A 2PQWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M75 D;  3INZ A;  3QO3 A;  4M7A A;  3SB2 A;  1LJO A;  3JB9 G;  3JCM W;  2QTX A;  3PGG A;  4X9C A;  2DTO A;  1M5Q 1;  2I2L A;  3JB9 H;  1N9S A;  4JUV A;  5GAO m;  2E10 A;  3AHU A;  4XU2 A;  2DXU A;  5GMK h;  5I21 A;  1KQ2 A;  4C92 D;  3JB9 F;  2E64 A;  2DJZ A;  4M7D G;  4C92 B;  2E41 A;  4J6X A;  4J6W A;  4QVD A;  4M7D B;  4PJO B;  4PJO C;  5GAN 8;  4PJO D;  3JCM g;  4EMH A;  3RKW A;  1HXD A;  5GAM j;  4N0A A;  3JCM h;  5GAN 7;  5GAM e;  2DTI A;  1Y96 B;  4M77 D;  2DEQ A;  4OP0 A;  5GMK m;  5GAM d;  2DTH A;  4M78 C;  3JCM V;  2YLC A;  1WPY A;  3V7S A;  3EFS A;  1I5L A;  3VU3 C;  3JCM J;  4M75 B;  5LJ3 e;  3V7R A;  2DKG A;  1WQ7 A;  5GAO q;  1M8V A;  3JCM X;  5LJ3 h;  2RA2 A;  4M7A F;  5GMK j;  4C92 E;  5GAO r;  5LJ3 g;  2CGH A;  5GAN f;  2YLB A;  3FIF A;  4A53 A;  2E1H A;  4EMK A;  5GAN 4;  3L1A A;  4XTX A;  3RKY A;  5GAM h;  1TH7 A;  1KQ1 A;  5GAN e;  2RD1 A;  1D3B A;  4C8Q E;  3BY7 A;  4M7D D;  4JRK A;  3JCM Q;  3V7C A;  5GAN 2;  5DY9 A;  4M7A G;  1WQW A;  4M77 F;  4PJO G;  3BFM A;  2RB6 A;  1MGQ A;  4M7D A;  2YHT A;  4M77 C;  2DVE A;  4C92 A;  5GAN h;  4M7D C;  5LJ5 g;  2VXE A;  2VC8 A;  3EFR A;  2E65 A;  2DXT A;  2JN0 A;  4M78 G;  3HFN A;  4EMG A;  4F7U E;  4X9D A;  4RCC A;  4V2S A;  4A54 A;  4F7U B;  4XTZ A;  1LNX A;  1U1T A;  3M4G A;  4RCB A;  4C92 F;  5LJ5 d;  3SWN A;  3BW1 A;  4M7D E;  5LJ5 f;  4M77 E;  3SWN B;  1BIB A;  1HK9 A;  2RM4 A;  3FB9 A;  4M75 C;  4XU1 A;  3JCM f;  3V8L A;  4C8Q A;  5GMK e;  3JCM d;  3JCM b;  1I4K 1;  4J6Y A;  5GAN g;  3FJP A;  4M78 B;  3V8J A;  1D3B B;  4M75 F;  3QSU A;  4XTY A;  4DQ2 A;  4PNO A;  4F7U F;  2DZC A;  4XU0 A;  5LJ5 h;  4PJO E;  5GMK l;  2FB7 A;  2DZ9 A;  3RIR A;  3SWN C;  3RES A;  2ZGW A;  4C92 C;  4C8Q G;  5CAI A;  4M7A E;  1B34 A;  2EJ9 A;  3QUI A;  3BDU A;  3JCM c;  4EMK C;  4NL3 A;  4C8Q C;  4M7A D;  4M75 A;  2EWN A;  5GAN 5;  3V8K A;  3HSB A;  1BIA A;  4M78 E;  5GAM g;  5LJ5 e;  1X01 A;  5GAN 3;  1JBM A;  3L2Z A;  4EMK B;  1Y96 A;  4NL2 A;  3JB9 I;  1JRI A;  4M7D F;  3JCM e;  4PJO A;  4M77 A;  4M78 D;  5GAN j;  2K57 A;  4PJO F;  1LOJ A;  4M77 B;  4HT8 A;  4M75 G;  4HT9 A;  4N0A C;  4F7U G;  2EAY A;  5GAO p;  1I81 A;  1N9R A;  3JB9 D;  5GMK i;  2Y90 A;  4XTU A;  4JLI A;  5GAM f;  5GAO n;  5LJ5 j;  3QHS A;  3JCM P;  3RKX A;  1YCY A;  1H64 1;  4M77 G;  4WF2 A;  3HFO A;  3RUX A;  5LJ3 d;  1B34 B;  1U1S A;  2FYK A;  4C8Q B;  1I8F A;  4XTV A;  5LJ3 f;  4C8Q D;  4C92 G;  5GAN d;  4Y91 A;  4M7A C;  1WNL A;  4M7A B;  4F7U A;  4JRI A;  4HA8 A;  2EJF A;  2HNI A;  3JB9 J;  4M78 F;  4MML A;  2EJG A;  4M78 A;  4C8Q F;  5GAO l;  4XU3 A;  4XQ3 A;  3RER A;  5LJ3 j;  4M75 E;  4QVC A;  4NOY A;  4MMK A;  4XTW A;  5GAN 6;  4J5Y A;  3GIB A;  2VXF A; 
#chains in the Genus database with same CATH topology
 2ZPB B;  2MOX A;  3WXM B;  1D1C A;  2KRN A;  4FT4 A;  1M2V B;  4JUV A;  4O6J A;  1X69 A;  2E10 A;  1M3A A;  2CRE A;  4C92 D;  2DJZ A;  2QAS A;  4M7D G;  2QG9 B;  3C4S A;  3CCQ Q;  1YNZ A;  4WCI A;  3QBY A;  2P4T A;  2LNV A;  3H9N A;  1HJD A;  2DRK A;  2HQH A;  2DA9 A;  1Y96 B;  4OP0 A;  3PE0 A;  1YHQ A;  1WJQ A;  3VKI A;  3GNF B;  2RHI A;  4ELZ C;  1MMG A;  1K9M U;  1K9M R;  1VIF A;  4DEX A;  1CSK A;  1JB0 E;  3M4Y A;  3OYG A;  3EH1 A;  3V7C A;  4C0D B;  2DVE A;  5GAN h;  2CP3 A;  2VXE A;  1Q7Y U;  4M78 G;  2FRY A;  3DB4 A;  3CMA A;  2CUD A;  3REB B;  3M9Q A;  4QQG A;  5KYX B;  2KQW A;  4RCB A;  2V8K A;  3O5Z A;  4M77 E;  3SWN B;  1VQ5 Q;  1D3B B;  2P0P A;  1IB8 A;  1MND A;  5HY6 A;  1B34 A;  1NE8 A;  2EGA A;  2AHJ B;  4D6W A;  1D1B A;  3R6N A;  2YDL A;  1SSF A;  4FYX B;  5J39 A;  1JU5 C;  4KGV B;  2O4X B;  1I81 A;  3JB9 D;  1NJI R;  1OOT A;  5M9O A;  2JNG A;  3FEO A;  2BE9 B;  1VQL T;  3JV3 A;  3OYK A;  4LDV A;  2DL3 A;  2EYX A;  1VQ4 T;  2HZY A;  2JUF A;  1QWF A;  2L89 A;  2EQM A;  3RER A;  4CRI A;  2JTE A;  2DPP B;  5GAN 6;  5FU6 B;  2LQW A;  2PUO B;  1QMC A;  2QTX A;  1TOV A;  3VUB A;  5KE3 A;  1BI0 A;  2CP7 A;  1PD1 A;  2FL7 A;  4Z88 A;  2EQI A;  4C92 B;  4N4G A;  5GAM j;  2X35 A;  1BKB A;  2DEQ A;  5GAM d;  2BUD A;  1JO8 A;  2Z0W A;  3G4S Q;  3CC7 Q;  3L2Q A;  2DO3 A;  2K5F A;  3E2U A;  4PLI A;  5LJ3 h;  5CKD A;  2MWO A;  2BIV A;  2KY9 A;  1ZUY A;  2YLB A;  4HVW A;  1SF9 A;  2QYZ A;  1UGP B;  2NUZ A;  2X3W D;  1KHI A;  1RAG B;  3UDC A;  1W6X A;  1GFD A;  4KRT A;  5IHN A;  2LTO A;  4M77 C;  1E7O A;  2QDL A;  3OYB A;  3UWN A;  2DLP A;  3PMT A;  4RCC A;  3MET A;  3OYI A;  2Y4X A;  2DNU A;  3PVQ A;  3BW1 A;  3OB9 A;  1WHK A;  5CK9 A;  3M54 A;  1I4K 1;  3I35 A;  1I0C A;  1YI2 A;  2RI2 A;  1NG2 A;  3EHQ A;  1PKS A;  1NLP C;  3PIO A;  3RES A;  4LDY A;  4DOV A;  1Y07 A;  2DYB A;  2W10 A;  1Q86 U;  2R5A A;  2KE9 A;  3CCE T;  2NWM A;  1KJW A;  4LD9 K;  1NEB A;  2RNA A;  3CCM A;  4J9F A;  4RKU E;  3I56 A;  1VQP A;  1G3S A;  3EGU A;  3VS5 A;  1OQK A;  1QCF A;  4MDX A;  1WDX A;  1WGS A;  4ZGJ B;  2EFI A;  1N8R C;  1VIE A;  1BI2 A;  1PHT A;  1PD0 A;  1ZBX A;  2DD4 A;  2J6O A;  4KUL A;  3RUX A;  2OTL T;  1I8F A;  3I56 Q;  4C92 G;  4FU6 A;  1Q81 R;  2O9V A;  1HD3 A;  1Z9Q A;  2PU9 B;  2LQK A;  4NOY A;  1OU8 A;  1M90 U;  1LVK A;  4OMN A;  4M7A A;  1EZZ B;  2IG0 A;  1Q7Y R;  1NZ9 A;  1UTI A;  1I5O B;  1G83 A;  2DMO A;  2DXU A;  1YIJ T;  1TUG B;  3OMC A;  3QDF A;  5CKB A;  3OSV A;  2RF0 A;  4ZTJ A;  4BUG A;  1KD1 U;  2R58 A;  5IN1 A;  4KT0 E;  2IIM A;  4M78 C;  3V7S A;  2YT6 A;  3NTI A;  1XTD A;  4BDZ A;  4C92 E;  3MCA B;  4FYY B;  3VYG A;  3L1A A;  5GAN e;  2QTV A;  2L2P A;  3OYJ A;  2K79 A;  3KBG A;  5HCK A;  1JJ2 A;  2LC4 A;  4E7K A;  4C92 A;  1K1Z A;  1RLQ C;  2JN0 A;  2W0Z A;  1M27 C;  4MZM A;  4F7U B;  2PUK B;  2R5M A;  3L2V A;  1K73 C;  1EX4 A;  2RM4 A;  1Q86 C;  3I5R A;  2KSS A;  1OV3 A;  3OY9 A;  4XTY A;  4QKU A;  1QVF A;  2F2X A;  4M7A E;  2XU8 A;  2VVK A;  3QUI A;  2O01 E;  1G3T A;  3CQT A;  2QK0 A;  2Y4Y A;  4GY5 A;  3P8B B;  3DB3 A;  4GLK A;  4C0Z A;  2LP5 A;  4C5E A;  1WYX A;  2KR3 A;  1SHF A;  5GJV B;  2PVD B;  2WSC E;  1GXI E;  4PFP A;  2J05 A;  2HL3 A;  5KYY A;  1WHM A;  2G3R A;  3OBY A;  4J9C A;  2QAZ A;  2E70 A;  1ZLM A;  1VQO Q;  1M4Z A;  3G4S T;  4II1 A;  3HP9 A;  4Z8A A;  4PK4 A;  2GQV A;  2IPO B;  3PNW C;  5A0G A;  2KRO A;  2PNI A;  3VRZ A;  1BYM A;  1SG5 A;  3F70 A;  4ME7 A;  1KD1 C;  2C0O A;  3OYD A;  5AT1 B;  3AHU A;  3OYE A;  1ZSZ C;  2E41 A;  2LJ0 A;  4KBM B;  5C0M A;  4KUI A;  4RTZ A;  1AWO A;  2DTI A;  3VUZ A;  3CMA Q;  3JCM J;  1YWO A;  1MMD A;  2RA2 A;  5I11 A;  1S72 Q;  1YJ9 Q;  5FRM A;  1VQ8 A;  3I5S A;  4KH0 B;  1KQS P;  3FJ5 A;  2F1L A;  4C0D C;  3CPW A;  2NYS A;  1TG0 A;  2CUB A;  4HCZ A;  3EGD A;  4PKC C;  5IXF A;  3QZ9 B;  4LUE A;  1LNX A;  4J9E A;  3M4G A;  1RLP C;  4PFZ A;  1OX8 A;  3H41 A;  3QZ5 B;  2L5Q A;  3JCM f;  2CDT A;  4L6V 5;  2KEA A;  5KYW B;  2KT8 A;  1WIE A;  2AT1 B;  1AD5 A;  4LDU A;  3OW2 P;  1FX7 A;  3NPF A;  2QA4 Q;  2EWN A;  1X01 A;  1TU0 B;  2EYW A;  2PVG B;  1YJ9 T;  1BB9 A;  1M30 A;  3NTH A;  1N9R A;  4WTO B;  5GAO p;  3VS1 A;  4JLI A;  1UE9 A;  2ZPF B;  2HCK A;  1RAB B;  3RKX A;  4IKF A;  2FYK A;  4JLG A;  2LMJ A;  4Y91 A;  2LT1 A;  3T9N A;  2DRM A;  4KUD K;  1IZ6 A;  2SEM A;  2EJF A;  2BE7 D;  2E6Z A;  5GAO l;  5CQY A;  2DF6 A;  2KVQ G;  1K8A R;  3OS5 A;  2PQW A;  2ESW A;  1LPL A;  2D6F A;  5D6X A;  4PLL A;  4Y92 A;  1M5Q 1;  1TWB A;  2D0Q B;  2GFA A;  2X4W A;  2ZCF B;  6AT1 B;  2XHC A;  2FVU A;  4M77 D;  5FWC A;  1QQJ A;  2P4R A;  1QVF S;  3JCM V;  3I55 A;  2FO0 A;  1QVP A;  2HSE B;  4M75 B;  1OPK A;  3CC2 Q;  1ARK A;  4J7F A;  4X1V A;  4LDW A;  3TU4 K;  1K9M C;  3CCJ T;  2E1H A;  5GAN 4;  3RKY A;  2M0O A;  2MK5 A;  1V29 B;  2DE0 X;  4FW2 A;  4OB3 B;  1GCP A;  3WVD B;  3HL8 A;  4ORZ A;  1GL5 A;  1FYN A;  3MEU A;  4ANJ A;  2LVM A;  2XDD A;  2HBW A;  1NJI U;  1UEC A;  4F7U E;  1NEG A;  2QA4 T;  4ZGD B;  4MZP A;  2YSQ A;  4M7D E;  3C0C A;  4UC4 A;  1SSH A;  2RQR A;  2L3P A;  1HK9 A;  3V8L A;  1AOJ A;  3JCM d;  4NS5 A;  2ABL A;  3QSU A;  1V1C A;  1VQK Q;  1YIJ A;  2X4J A;  4Y28 E;  1PG5 B;  1CKB A;  2HBP A;  3LH0 A;  4NL3 A;  4FCY A;  1PRM C;  5J26 A;  2GGR A;  4J9B A;  2COY A;  3CD6 T;  5GAN 5;  3ZL7 C;  2F5T X;  1KSW A;  1XNI A;  3QG1 A;  1IGU A;  3M0T A;  2QDY B;  3PTA A;  3OYA A;  1Q7Y C;  1M1F A;  4F7U G;  2E3H A;  1TS9 A;  3HKS A;  4M77 G;  1B34 B;  2LT4 A;  2RPN A;  2RJC A;  5C6S A;  2COW A;  1D1A A;  2RK1 A;  1D0Y A;  3I9Q A;  1BCO A;  2O31 A;  4XTW A;  2O9S A;  3GIB A;  1IRX A;  2XMF A;  3QO3 A;  3OA6 A;  1UUE A;  2F2V A;  4JJN K;  1VQM A;  1GBR A;  4IUU A;  2COZ A;  2LQN A;  3X26 B;  2VV5 A;  4D8K A;  1OUL A;  4ZN1 A;  5IAY A;  4N4H A;  9ATC B;  5DLQ E;  4J6W A;  3G71 A;  4JS5 A;  1KFZ A;  5GAN 8;  4E7Z A;  3MKD A;  3G1J A;  2YRV A;  5GAM e;  5HK3 A;  1ACM B;  1VQ5 A;  1GBQ A;  3CC7 T;  3G71 Q;  1QP2 A;  3LWH A;  3M56 A;  3NHN A;  1Q82 C;  1BI3 A;  2FRW A;  1YWP A;  2K5L A;  3H0F A;  1OU9 A;  2M1H A;  2RD1 A;  2XG8 D;  4C8Q E;  2ZPI B;  3GF5 A;  3EAE A;  2JZ2 A;  3PIP A;  2EW3 A;  1UGS B;  3QJY A;  1OEB A;  3QYH B;  4OMM A;  2VC8 A;  3EFR A;  2LDM A;  2MYS A;  4F04 B;  2VGN A;  4CC7 A;  2G6F X;  2CZ0 B;  1VQ8 Q;  2LCL A;  3CCR A;  1YJN A;  1JXM A;  4L5G A;  1AVZ C;  2KT1 A;  4HVV A;  1GFC A;  3JCM b;  4J6Y A;  2DIG A;  3V8J A;  4ZTF A;  3JSC A;  4F7U F;  1QVG S;  1VQ6 T;  1YFN A;  2JTM A;  3FRN A;  1UDL A;  2BZX A;  3RIR A;  3CCQ A;  3CBP A;  3V8K A;  2FPD A;  2PZ1 A;  4CI0 C;  3JB9 I;  2HD0 A;  3ER0 A;  2ENM A;  2V26 A;  2YUQ A;  5GAN j;  2DIQ A;  2X3X D;  3CC4 A;  2K57 A;  2EAY A;  1VQ8 T;  2PVO B;  5GAM f;  2C06 A;  4RTX A;  4A4E A;  3VYH B;  1H64 1;  3HFO A;  3EG0 A;  2HEQ A;  1DJ7 B;  4AT1 B;  2QEX A;  2RK2 A;  3ZEH A;  3CME A;  1AEY A;  1KQS A;  2AKK A;  2RH2 A;  4XQ3 A;  2RJF A;  2XKO C;  2LJ3 A;  3ULR B;  2FZC B;  5LJ3 j;  2NUT A;  5KE2 A;  2JS0 A;  4RMO A;  4J9H A;  4M75 D;  1BCM A;  3CCS T;  1KC8 C;  4J9G A;  1B3Q A;  4ZNX A;  2I2L A;  1IXD A;  2A08 A;  1K0S A;  1ZSZ B;  5L23 A;  5I21 A;  5GMK h;  2E64 A;  3MHX A;  3NTK A;  4M7D B;  3JCM g;  4EMH A;  3RKW A;  1KC8 U;  1MUZ A;  1M1K U;  1PCX A;  5CCA A;  1SPK A;  4JJB A;  5J3B A;  3D7S B;  1UG1 A;  1IHV A;  2DYI A;  1WZO A;  1X6B A;  4EDU A;  1AWX A;  5GAN f;  2CZ6 B;  1ZHI A;  2RI5 A;  4XTX A;  1VOM A;  1K73 U;  1YHQ T;  2XIC A;  2DIL A;  2JM8 A;  1WQW A;  2HAX A;  3CEY A;  2YHT A;  1QVG P;  1AZG B;  4JZ3 A;  3URG A;  4GLM A;  4OVA A;  3PT9 A;  2QQB A;  1PWT A;  1QLY A;  1RAC B;  2XDP A;  3HFN A;  3MEW A;  4A54 A;  1GRI A;  4KGX B;  3QPH A;  1M8M A;  4AFS C;  3SWN A;  3E9F A;  4JJD A;  2DFU A;  4HVU A;  4BI3 A;  3VRY A;  2VYT A;  4OMF B;  4RTW A;  1NLO C;  3MO8 A;  3S6W A;  1YP5 A;  5CIU A;  4M7A D;  2KK4 A;  1Y71 A;  2MMP A;  1RAD B;  1BIA A;  5GAN 3;  1WFW A;  4EMK B;  1Y96 A;  3P8H A;  3A8O B;  3CPW P;  2QXF A;  2H3E B;  2P84 A;  3M0Q A;  3G6E A;  3CPF A;  3FDR A;  2D0N A;  3LGF A;  4OGC A;  1EIF A;  2CP2 A;  4DBR A;  5KCO A;  2E4H A;  1U8R A;  1NPR A;  4XTV A;  2AKL A;  3VS2 A;  5IH2 A;  5FWB A;  3A8G B;  1ABO A;  4M78 F;  1YIT Q;  2I0N A;  1K76 A;  1K8A U;  4P5N A;  1H3H A;  4PJN A;  2QQS A;  4X9C A;  2KXC A;  1VQN T;  2FHD A;  3JB9 H;  1N5Z A;  3QXE B;  3OSS C;  1TTH B;  5FRN A;  3JB9 F;  1ZA1 B;  2XK0 A;  2ED1 A;  1B07 A;  1E6G A;  2JT4 A;  5GMK m;  1F1B B;  5A2Q E;  3X28 B;  3C95 A;  3ASK A;  1OX9 A;  3J7A F;  2EVR A;  1RAF B;  2HKQ B;  1VQ7 A;  2FPF A;  5GAM h;  4LNP A;  2EGE A;  4KGZ B;  1VQK T;  5DY9 A;  1MGQ A;  1VQ4 Q;  5CQX A;  2AIR B;  1WHH A;  4EMG A;  4X9D A;  4A4K A;  2JS2 A;  4PJJ A;  4AFQ C;  5FLX E;  4A4G A;  1WXT A;  3SD4 A;  4FSS A;  3M58 A;  4K11 A;  2YXY A;  4HCK A;  2EYZ A;  4C5H A;  1W2B P;  3LYI A;  3MP1 A;  2IVW A;  2CS7 A;  3HHT B;  2B8A A;  3MEA A;  4C0G A;  2RHZ A;  2M51 A;  1OI1 A;  3OYL A;  1S1N A;  2LX7 A;  3TQ7 P;  4M77 B;  5CVI A;  4M75 G;  2YWW A;  5I2M A;  2FZK B;  3CCV T;  3OQ5 A;  4C8Q B;  5L8R E;  1UGQ B;  3I56 T;  3SHW A;  5KYX A;  4XU3 A;  4X34 A;  2HKN A;  3CCL Q;  4QQD A;  2OTL A;  2R57 A;  1WI7 A;  1QVF P;  8AT1 B;  1I07 A;  4E47 A;  1LJO A;  5FW9 A;  1Q86 R;  1UJ0 A;  3NFC A;  3J81 E;  4RTU A;  2K3Y A;  3VJP A;  1SRM A;  3EGD B;  2QEX Q;  4J6X A;  4ATO A;  2NLU A;  1VQ9 T;  3DLM A;  4PL6 A;  2JMC A;  4HKE A;  1IO6 A;  2DTH A;  2YLC A;  1GCQ A;  2XI9 A;  5A0D A;  3EFO A;  2DJQ A;  1JJ2 S;  2WAC A;  1G3W A;  1GCQ C;  2DKG A;  2M16 A;  3VS6 A;  2KXD A;  3JCM X;  2K6D A;  3A1P A;  2GFU A;  2KYM A;  2A0F B;  2CP6 A;  2E3I A;  3OW2 A;  2L8D A;  2DVJ A;  3X24 B;  3BY7 A;  1NBE B;  4JRK A;  2AZV A;  2K7A A;  4A63 B;  2QEX T;  5LJ5 g;  2O88 A;  3UA6 A;  2D1X A;  4IUQ A;  4OB2 B;  2O2O A;  4MZT A;  4XTZ A;  1AHJ B;  1RUW A;  1X27 A;  1W4S A;  5KYU B;  3VS0 A;  4RG8 A;  4C8Q A;  2YUP A;  4IUR A;  1EFN A;  3FJP A;  3O8V A;  5GAN g;  3GP8 A;  4BI4 A;  3VV0 A;  3C94 A;  2EQU A;  2V1Q A;  1FMK A;  3THK A;  4B9W A;  1X75 C;  3L42 A;  4E7J A;  3SWN C;  5IXB A;  5CAI A;  1WHG A;  4EMK C;  1NM7 A;  5KYY B;  1Q81 C;  1VYV A;  3RMQ A;  3HSB A;  4PJO A;  4NL2 A;  3M59 A;  3M5A A;  3FLG A;  1O75 A;  3EGX A;  2OX7 A;  2B86 A;  3CXC P;  4Z89 A;  1M2V A;  4DBQ A;  3QHS A;  2K5I A;  5GAN d;  5KYW A;  3EHR A;  4J9I A;  1M2O A;  2E5Q A;  4M78 A;  2E12 A;  1OYX A;  4M75 E;  4ELY C;  1M90 R;  5CR2 A;  2DD5 A;  2VWF A;  3SB2 A;  2FZG B;  1PRL C;  4XAX B;  5ECA A;  3LH5 A;  4DBH A;  2DTO A;  1RAH B;  4OB0 B;  1OZ2 A;  4Q5W A;  4JZ4 A;  3TSW A;  3I55 T;  4FYV B;  3CCU T;  2HQE A;  1IHW A;  1UHF A;  2MI6 A;  4LD6 A;  3CPW S;  3VU3 C;  3X20 B;  1R77 A;  3C12 A;  1YIT A;  2RN8 A;  2HSP A;  3OW2 S;  1WLP B;  3TRE A;  4BAC A;  4M7A F;  3TCJ A;  4AFZ C;  5GAO r;  5LJ3 g;  2ROL A;  1AWJ A;  2VGM A;  1Q82 R;  1YN8 A;  1SKU B;  4BY6 C;  2M02 A;  2MAM A;  3JCM Q;  3RBB B;  2CT4 A;  1ZQ1 A;  1SRL A;  2RB6 A;  2X9H A;  2HQX A;  2EKH A;  4QW2 A;  4V2S A;  1VQL A;  2MPX C;  4AMC A;  1N6A A;  1C1A A;  2L3S A;  2C0I A;  1C6V X;  4BDY A;  1MNE A;  1M3C A;  1K8A C;  2A37 A;  1SHG A;  3CD6 A;  1TXQ A;  4XK8 E;  2V8I A;  3R6O A;  3CCL T;  4J9D A;  2D8J A;  5GAM g;  3L2Z A;  3PVL A;  1BBZ A;  1S72 T;  1T0H A;  3MP8 A;  2CT3 A;  2JMA A;  3VS3 A;  2ROT A;  1QKX A;  4JPB W;  3SFM A;  2DXC A;  2KI7 A;  2DX1 A;  4E7H A;  3DKM A;  4OML A;  1YJ9 A;  5IT9 E;  1VQO A;  1UB4 A;  2XD0 A;  5AYF A;  4CC3 A;  4Z02 A;  1UJY A;  3A98 A;  1J3T A;  2J06 A;  3H8Z A;  4EIK A;  5CKH A;  4CC2 A;  3JCM W;  3RR6 A;  1BK2 A;  1ZX6 A;  3PGG A;  1N9S A;  3EGX B;  3HPW A;  4AG1 C;  2K3X A;  2X4Y A;  4QVD A;  2D9T A;  4PJO D;  3UA7 A;  1X6O A;  4N0A A;  1MV3 A;  2SRC A;  3HRU A;  2BZY A;  3H6Z A;  1WHJ A;  1U06 A;  2KAF A;  4R56 A;  1H92 A;  3LX7 A;  4LN2 A;  3EG2 A;  4BB7 A;  3CCE A;  2LZ6 B;  2ED0 A;  1TH7 A;  1M3B A;  3G4S A;  2GNC A;  3LWI A;  2KYB A;  1T0J A;  1C0M A;  3NGP A;  5HK0 A;  3QYG B;  1E6H A;  4AG2 C;  2NUP A;  3HRS A;  1U5S A;  2EBP A;  3L2R A;  2F69 A;  3RNJ A;  1NYF A;  1ABQ A;  1I1J A;  3FB9 A;  3ZFJ A;  3M0U A;  4HCC A;  3A5Z B;  1AZE A;  1X43 A;  2RHX A;  3CCQ T;  1UGV A;  1NYG A;  5GMK l;  2DL5 A;  3KUF A;  2A3L A;  2LX9 A;  4E2F B;  2RQV A;  2GQI A;  4EPC A;  1MV0 B;  1Q95 G;  2E6N A;  1JBM A;  2P0K A;  1WXU A;  1FMW A;  1VYT A;  3SDZ A;  5I2S A;  3OS2 A;  3M0R A;  2DK3 A;  4B9X A;  1KK7 A;  3LGL A;  3EG1 A;  5IHK A;  3QJ6 A;  5LJ3 d;  1U1S A;  4C8Q D;  1UHC A;  3PMI A;  1Z9Z A;  1ZBJ A;  1QP3 A;  4IUT A;  2KBT A;  3NMZ C;  3CCE Q;  2MIO A;  2DL4 A;  5D6Y A;  1MHN A;  1VUB A;  3GBQ A;  4HT9 A;  4J5Y A;  4DBF A;  1T3S A;  2LRQ A;  4ZN3 A;  3CCJ Q;  3LLR A;  1FWZ A;  3M53 A;  1K73 R;  4BD3 A;  3Q1J A;  1WJS A;  2DXB A;  2QQ9 A;  3EFO B;  2E5K A;  3JCM h;  7AT1 B;  2JOY A;  1TUD A;  1WX6 A;  1OZ3 A;  2OAU A;  5LJ3 e;  3GPL A;  2ZPG B;  5GMK j;  1G3Y A;  4DEY A;  3CBO A;  3CC7 A;  3SEM A;  4HXJ A;  2OTL Q;  1ZUU A;  1ZSZ A;  4IUP A;  4PFO A;  1JEG A;  2E65 A;  2DXT A;  2QQR A;  2CSQ A;  5EG2 A;  3OS0 A;  3QKJ A;  3CMA T;  4FT2 A;  5LJ5 d;  1HYO A;  2FEI A;  2OAW A;  3OYM A;  2YRC A;  1Q81 U;  1AWW A;  4IIM A;  4BI8 B;  5GMK e;  5KH6 A;  4CC4 B;  2DM1 A;  4C0F A;  4PNO A;  1H3Z A;  4PJO E;  3OBW A;  3N5B B;  1VQ6 Q;  4C92 C;  4DA4 A;  4ZGE B;  2EYQ A;  3CCU A;  4LXC A;  4C8Q C;  3EG9 A;  3VS4 A;  4M78 E;  1VQ6 A;  2X4X A;  1QVG A;  2DL8 A;  3REA B;  3CBM A;  4BE0 A;  2Y90 A;  3CME Q;  1YCY A;  4YTL A;  4PJO C;  3MJX A;  5LJ3 f;  3CC4 T;  1VA7 A;  2V8J A;  2RJE A;  1K4U S;  4F7U A;  1LCK A;  1XJW B;  1YJW A;  1R0B G;  3JB9 J;  4MML A;  2EJG A;  5CKE A;  4C8Q F;  3FC3 A;  2CP0 A;  2VKN A;  4OGE A;  2F2W A;  1HSQ A;  5CO7 A;  2OTJ A;  3MPU B;  4PJL A;  2KDS A;  2CP5 A;  4JRP A;  1PM3 A;  1D0X A;  4RTY A;  5HKC A;  2EPD A;  2ZPH B;  3A8H B;  1A0N B;  2HMA A;  1JXO A;  3CXC A;  3TEE A;  3CCL A;  4FL6 A;  4ESR A;  1R0C B;  2P0Q A;  2DL7 A;  4O5V A;  5A0L A;  1S72 A;  3FIF A;  1TUC A;  1KG1 A;  4JJC A;  2FG0 A;  2VB6 A;  5GAN 2;  5I22 A;  3TSZ A;  1BI1 A;  1VQO T;  3X25 B;  4E7L A;  2LNH B;  3QII A;  4E7S A;  2QQA A;  4FIB A;  2M0Y A;  2ATC B;  2L3Q A;  5LJ5 f;  5DLO A;  4IIO A;  4M78 B;  4M75 F;  2DZC A;  5LJ5 h;  1QCO A;  2VUB A;  4KH1 B;  1ZA2 B;  4C5I A;  4C8Q G;  2EJ9 A;  1SEM A;  1AT1 B;  3LW5 E;  2RJD A;  2DBM A;  1XQH A;  1RAA B;  1RI0 A;  3OYN A;  4PJO F;  1PSF A;  4C5G A;  2CZ1 B;  1JQQ A;  3CCM T;  5GJW B;  2K9G A;  2WSE E;  1VQP T;  2EGC A;  1PC0 A;  1Y0M A;  5D7U A;  5GAO n;  1WJR A;  3JCM P;  4N4I A;  3A8L B;  4AFU C;  2JTF A;  2LQ8 A;  2QGF B;  3G7Z A;  4M7A B;  1ZUK A;  1YJW Q;  1R8O B;  3G6E T;  3S3N A;  3CCR T;  1YJN T;  1FXX A;  1G5V A;  2GBQ A;  2PTK A;  2C0T A;  3E9G A;  4MMK A;  2KNB B;  3EH2 A;  1JJ2 P;  1M1G A;  1W2B A;  2GTO A;  1RAE B;  1W1F A;  4RUG A;  2KGT A;  3OYH A;  3ZBD A;  5GAO m;  1VQN Q;  5FU7 B;  2JVV A;  2JXB A;  2J6K A;  3BE3 A;  4E7I A;  1PKT A;  1RI9 A;  2BKD N;  2RI3 A;  1BU1 A;  5GAO q;  2ZAE A;  3VS7 A;  1M8V A;  1VQP Q;  2L3R A;  3CCM Q;  3OYF A;  4A53 A;  4EMK A;  4QQ6 A;  2K2V A;  5DM7 R;  1D3B A;  1KHC A;  2QI2 A;  1Y57 A;  2H8H A;  2X51 A;  4M7A G;  4TVR A;  1QCN A;  4M7D A;  4BE2 A;  4J83 A;  3RMS A;  4M7D C;  3G6E Q;  3PFS A;  1K0X A;  2KRM A;  5CKF A;  3QDR B;  3RDV A;  3CC2 T;  4OB1 B;  2CSI A;  2A36 A;  5KYN A;  4C92 F;  4OMP A;  1QW1 A;  1BIB A;  2K2M A;  4M75 C;  4XU1 A;  3UF4 A;  4OF1 A;  4DQ2 A;  2DAQ A;  2ECZ A;  2FB7 A;  4E6R A;  4F14 A;  3BDU A;  4R55 A;  3EG9 B;  4LUD A;  4LE9 A;  3QWY A;  1VQM Q;  3TVT A;  3G71 T;  3E1S A;  3WVE B;  2OI3 A;  4M77 A;  1CKA A;  1KD1 R;  1KC8 R;  2AZS A;  2OTJ Q;  2GTJ A;  1WXB A;  5D6W A;  2GF7 A;  4OMQ A;  2CH4 W;  4XTU A;  2DBK A;  4WF2 A;  3CC4 Q;  3GLX A;  4PJM A;  1WNL A;  1UGR B;  4HA8 A;  1VQ7 Q;  2HNI A;  1B7T A;  4M4Z A;  2EIF A;  2WSF E;  4FM4 B;  3CCV A;  4QVC A;  1Y7X A;  3KXT A;  2VXF A;  1IGQ A;  2RQU A;  4FW1 A;  2VAS A;  2RO0 A;  1NPP A;  2ZZD A;  1KQ2 A;  4HCB A;  4A4H A;  3CXC S;  2YUN A;  3E19 A;  1YIJ Q;  1HXD A;  5GAN 7;  2D8H A;  1RL2 A;  2JM9 A;  1YIT T;  3EFS A;  1W70 A;  1I5L A;  4B6M A;  2EYY A;  2L0A A;  2BZ8 A;  2CGH A;  1VQ9 A;  1KQ1 A;  2YUO A;  2QA4 A;  2BTT A;  2CZ7 B;  1FMV A;  4M7D D;  3MEV A;  4PJO G;  3BFM A;  1N8R U;  1KQS S;  1K9A A;  2CYZ B;  1VQ4 A;  1YJW T;  1U1T A;  3S3O A;  1VQN A;  4RTV A;  3HRT A;  3DLL A;  3IQL A;  3GOX A;  2RHY A;  1QWE A;  2OTJ T;  2RHU A;  2JW4 A;  2MWP A;  1D0Z A;  1M90 C;  2XDB A;  1M1K R;  3J80 E;  3CCV Q;  4IUV A;  4XU0 A;  5IHI A;  1YBY A;  5LL6 S;  1YI2 Q;  3M0P A;  1MMA A;  2ZGW A;  4RG2 A;  1TSF A;  1G2B A;  5KCH A;  2DEU A;  1VQ7 T;  2ZPE B;  3CCU Q;  4JRQ A;  1PSE A;  2KMT A;  2JJ9 A;  3JCM e;  2LCS A;  1VQK A;  3BDL A;  1LOJ A;  1H8K A;  4FYW B;  4N0A C;  1QKW A;  2RQW A;  4GBQ A;  3UT1 A;  1G8X A;  5GMK i;  3H0I A;  1YHQ Q;  4VUB A;  1U3O A;  5LJ5 e;  4HT8 A;  1XOV A;  2EQK A;  4RTT A;  1VQ9 Q;  2XID A;  1YCS B;  1UEB A;  2J7I A;  4JRI A;  1VQM T;  4FSX A;  3U23 A;  1P92 A;  1M1K C;  1X6G A;  3INZ A;  1KIK A;  1ZSG A;  3JB9 G;  2F5K A;  4LDX A;  1WA7 A;  2OJ2 A;  3A8M B;  2RMO A;  1VQ5 T;  1YI2 T;  1PNJ A;  3H0H A;  1W2B S;  4XU2 A;  1T3L A;  1V76 A;  2HDA A;  4PJO B;  4J7I A;  4R0K A;  2MCN A;  3CD6 Q;  3ME9 A;  3I55 Q;  2YRD A;  3L2U A;  2J6F A;  4OMO A;  1WPY A;  2KRS A;  3HTR A;  3M55 A;  2K4Y A;  4L59 A;  1WQ7 A;  3V7R A;  3UPU A;  3QWX X;  4QT7 A;  2LCC A;  2QGG A;  1X2Q A;  2H3J A;  3CCJ A;  1N27 A;  2AK5 A;  3S3M A;  2GCX A;  1OPL A;  2HL5 C;  4M77 F;  1VQL Q;  8ATC B;  5FU6 C;  1IRE B;  2MF2 A;  4JDS A;  3OYC A;  3MP6 A;  2NUT B;  4BE1 A;  4A4F A;  2DET A;  2LJ1 A;  2EKO A;  3M0S A;  2A7Y A;  1VYU A;  1Q82 U;  2A28 A;  1O9S A;  3AT1 B;  3P8D A;  1WHL A;  3L2W A;  3M57 A;  2K3B A;  2CH4 A;  2DZ9 A;  2DER A;  5FU7 C;  3JCM c;  1X2K A;  3CCR Q;  1YJN Q;  4M75 A;  2V1R A;  2CKK A;  4F16 A;  3OS1 A;  2EQJ A;  2M9U A;  4M7D F;  2O4X A;  2FPE A;  4QVZ A;  1JRI A;  3CCS Q;  5FRO A;  4M78 D;  1N8R R;  4DOW A;  1NJI C;  5EC7 A;  3CME T;  4JS4 A;  1RAI B;  3UAT A;  3OMG A;  4F17 A;  1UFF A;  3KFV A;  5LJ5 j;  3EG3 A;  4BY6 B;  4M7A C;  3JAM E;  3CCS A;  1M9S A;  4MDW A;  1MMN A;  4D8D A;  3GNG A;  3OYY A;  3CC2 A;  2NUP B;  3JRZ A;  4J8O A;  5KYU A;  2RQT A;  1D09 B; 
#chains in the Genus database with same CATH homology
 2ZPB B;  4E47 A;  3WXM B;  4OGE A;  1LJO A;  5CO7 A;  2D6F A;  2OTJ A;  5D6X A;  4PLL A;  3NFC A;  3J81 E;  1M5Q 1;  2D0Q B;  2K3Y A;  2KDS A;  3VJP A;  4FT4 A;  4JRP A;  2GFA A;  4JUV A;  1M8V A;  4O6J A;  2E10 A;  2X4W A;  4C92 D;  2ZCF B;  2DJZ A;  4M7D G;  3C4S A;  4J6X A;  5HKC A;  4ATO A;  2NLU A;  3QBY A;  1VQ9 T;  2P4T A;  2LNV A;  2ZPH B;  3A8H B;  3DLM A;  4PL6 A;  2XHC A;  2FVU A;  4HKE A;  1Y96 B;  4M77 D;  4OP0 A;  3CXC A;  3TEE A;  1QVF S;  2DTH A;  3JCM V;  2YLC A;  3I55 A;  1YHQ A;  4FL6 A;  1QVP A;  3CCL A;  2XI9 A;  5A0D A;  4M75 B;  2WAC A;  1G3W A;  1JJ2 S;  1WJQ A;  2DKG A;  2M16 A;  2P0Q A;  3VKI A;  4O5V A;  4J7F A;  5A0L A;  3JCM X;  3GNF B;  2RHI A;  4LDW A;  2GFU A;  4ELZ C;  3TU4 K;  1S72 A;  3FIF A;  3CCJ T;  1K9M C;  2E1H A;  1K9M U;  5GAN 4;  3RKY A;  2M0O A;  1VIF A;  1V29 B;  3OW2 A;  1KG1 A;  2L8D A;  1JB0 E;  3M4Y A;  3OYG A;  3X24 B;  3BY7 A;  4JRK A;  4OB3 B;  3V7C A;  5GAN 2;  3WVD B;  3HL8 A;  3MEU A;  4C0D B;  2DVE A;  2LVM A;  5GAN h;  2QEX T;  5LJ5 g;  2VXE A;  1BI1 A;  2XDD A;  1Q7Y U;  1VQO T;  3X25 B;  4E7L A;  1NJI U;  3QII A;  4IUQ A;  4M78 G;  3DB4 A;  2QQA A;  4F7U E;  3CMA A;  4OB2 B;  2QA4 T;  4MZT A;  4XTZ A;  4ZGD B;  4FIB A;  3M9Q A;  4QQG A;  1AHJ B;  2KQW A;  4RCB A;  4MZP A;  4M7D E;  2V8K A;  5LJ5 f;  4M77 E;  4UC4 A;  5DLO A;  3SWN B;  1W4S A;  4RG8 A;  1HK9 A;  3V8L A;  4C8Q A;  3JCM d;  4IUR A;  4NS5 A;  3FJP A;  3O8V A;  4M78 B;  5GAN g;  1D3B B;  3GP8 A;  4M75 F;  4BI4 A;  3QSU A;  2DZC A;  3C94 A;  3VV0 A;  2EQU A;  1YIJ A;  5LJ5 h;  2X4J A;  4B9W A;  2VUB A;  2P0P A;  1X75 C;  3L42 A;  4Y28 E;  4C5I A;  4E7J A;  3SWN C;  5HY6 A;  4C8Q G;  5CAI A;  2HBP A;  1B34 A;  2EJ9 A;  1NE8 A;  4EMK C;  3LH0 A;  4NL3 A;  1Q81 C;  2AHJ B;  5J26 A;  3LW5 E;  3CD6 T;  5GAN 5;  2RJD A;  3RMQ A;  3HSB A;  2F5T X;  4D6W A;  1XQH A;  1XNI A;  3QG1 A;  4PJO A;  1RI0 A;  3M59 A;  4NL2 A;  3M5A A;  1SSF A;  3OYN A;  5J39 A;  3FLG A;  2QDY B;  4PJO F;  1PSF A;  3OYA A;  4C5G A;  3PTA A;  1O75 A;  1Q7Y C;  1M1F A;  2CZ1 B;  3CCM T;  2O4X B;  2WSE E;  4F7U G;  1VQP T;  1I81 A;  3JB9 D;  5M9O A;  5GAO n;  1WJR A;  2JNG A;  3QHS A;  3FEO A;  3HKS A;  3JCM P;  4N4I A;  3A8L B;  4M77 G;  2JTF A;  2K5I A;  1B34 B;  2LQ8 A;  1VQL T;  5GAN d;  3G7Z A;  3OYK A;  2LT4 A;  4M7A B;  4LDV A;  2RJC A;  1VQ4 T;  1R8O B;  3G6E T;  5C6S A;  2E5Q A;  3S3N A;  3CCR T;  2JUF A;  1FXX A;  4M78 A;  1YJN T;  1G5V A;  2E12 A;  2L89 A;  2EQM A;  2RK1 A;  3RER A;  4CRI A;  1OYX A;  2DPP B;  3E9G A;  4M75 E;  4MMK A;  4XTW A;  4ELY C;  5GAN 6;  5CR2 A;  3GIB A;  2DD5 A;  5FU6 B;  3QO3 A;  1M1G A;  3OA6 A;  1W2B A;  3SB2 A;  2PUO B;  2QTX A;  4XAX B;  4JJN K;  3VUB A;  1VQM A;  2DTO A;  5KE3 A;  4IUU A;  3OYH A;  3ZBD A;  5GAO m;  1BI0 A;  4OB0 B;  3X26 B;  2VV5 A;  2FL7 A;  4ZN1 A;  5FU7 B;  1OZ2 A;  2JVV A;  5IAY A;  4N4H A;  4C92 B;  4Q5W A;  5DLQ E;  4J6W A;  3G71 A;  4JS5 A;  4E7I A;  4N4G A;  5GAN 8;  5GAM j;  3I55 T;  2X35 A;  3CCU T;  1BKB A;  2HQE A;  2YRV A;  5GAM e;  5HK3 A;  2BKD N;  2DEQ A;  5GAM d;  1VQ5 A;  3CC7 T;  2MI6 A;  4LD6 A;  2BUD A;  3CPW S;  3VU3 C;  3X20 B;  2RI3 A;  3C12 A;  1YIT A;  5GAO q;  3L2Q A;  3OW2 S;  1QP2 A;  2DO3 A;  2K5F A;  4PLI A;  3TRE A;  5LJ3 h;  5CKD A;  4BAC A;  2MWO A;  2BIV A;  4M7A F;  3TCJ A;  3LWH A;  2KY9 A;  2L3R A;  3M56 A;  5LJ3 g;  5GAO r;  2VGM A;  2YLB A;  3OYF A;  4A53 A;  4EMK A;  1Q82 C;  1BI3 A;  4QQ6 A;  2K5L A;  1UGP B;  2K2V A;  4BY6 C;  2M1H A;  2RD1 A;  1D3B A;  1KHC A;  2XG8 D;  5DM7 R;  1KHI A;  2QI2 A;  2MAM A;  3UDC A;  4C8Q E;  2ZPI B;  3GF5 A;  3JCM Q;  3EAE A;  4M7A G;  4TVR A;  2JZ2 A;  1ZQ1 A;  3PIP A;  2RB6 A;  1UGS B;  3QJY A;  3QYH B;  2HQX A;  2LTO A;  4M77 C;  4J83 A;  4BE2 A;  4M7D A;  3OYB A;  3RMS A;  3UWN A;  4M7D C;  2VC8 A;  3EFR A;  2LDM A;  3PFS A;  4QW2 A;  2VGN A;  5CKF A;  3QDR B;  3CC2 T;  3PMT A;  4OB1 B;  4RCC A;  3MET A;  3OYI A;  1VQL A;  4V2S A;  2Y4X A;  4C92 F;  3BW1 A;  1QW1 A;  2CZ0 B;  1N6A A;  3OB9 A;  2LCL A;  5CK9 A;  3CCR A;  4L5G A;  1BIB A;  3M54 A;  1YJN A;  4XU1 A;  4M75 C;  4OF1 A;  3JCM b;  1I4K 1;  4J6Y A;  2DIG A;  4BDY A;  1YI2 A;  3V8J A;  2RI2 A;  4ZTF A;  1K8A C;  3JSC A;  4DQ2 A;  4F7U F;  2DAQ A;  1QVG S;  1VQ6 T;  2JTM A;  3FRN A;  2FB7 A;  3RIR A;  3PIO A;  3CCQ A;  3RES A;  4LDY A;  4DOV A;  1Y07 A;  3CD6 A;  3BDU A;  1Q86 U;  4R55 A;  4XK8 E;  2R5A A;  2V8I A;  3R6O A;  3CCE T;  3CCL T;  4LD9 K;  3CBP A;  3V8K A;  4CI0 C;  5GAM g;  3E1S A;  3G71 T;  3L2Z A;  3JB9 I;  2HD0 A;  3ER0 A;  3WVE B;  4M77 A;  3CCM A;  5GAN j;  2DIQ A;  4RKU E;  3I56 A;  1VQP A;  2K57 A;  1G3S A;  3CC4 A;  1S72 T;  3MP8 A;  3CC4 T;  4MDX A;  2EAY A;  1WGS A;  4ZGJ B;  1VQ8 T;  5D6W A;  2GF7 A;  2PVO B;  2EFI A;  1N8R C;  4XTU A;  5GAM f;  2C06 A;  4A4E A;  1VIE A;  1BI2 A;  1H64 1;  1ZBX A;  2DD4 A;  3HFO A;  4KUL A;  2DXC A;  4WF2 A;  3RUX A;  3SFM A;  1I8F A;  2OTL T;  4C92 G;  3GLX A;  3DKM A;  4E7H A;  1YJ9 A;  1DJ7 B;  1WNL A;  5IT9 E;  4FU6 A;  2QEX A;  2RK2 A;  1UGR B;  1VQO A;  1UB4 A;  4HA8 A;  3ZEH A;  3CME A;  2HNI A;  1KQS A;  2XD0 A;  2RH2 A;  5AYF A;  2EIF A;  2WSF E;  2PU9 B;  2RJF A;  2XKO C;  2LQK A;  4FM4 B;  4XQ3 A;  4Z02 A;  3CCV A;  5LJ3 j;  4QVC A;  4NOY A;  1Y7X A;  5KE2 A;  1M90 U;  3KXT A;  3H8Z A;  2VXF A;  4RMO A;  4M75 D;  5CKH A;  4M7A A;  2IG0 A;  3CCS T;  1KC8 C;  3JCM W;  1NZ9 A;  3PGG A;  2RO0 A;  2I2L A;  1N9S A;  1NPP A;  3HPW A;  2ZZD A;  1KQ2 A;  2DXU A;  5GMK h;  5I21 A;  2K3X A;  4A4H A;  3OMC A;  1YIJ T;  3CXC S;  2E64 A;  3OSV A;  5CKB A;  4ZTJ A;  3MHX A;  2X4Y A;  4BUG A;  3NTK A;  2D9T A;  3E19 A;  4QVD A;  1KD1 U;  2R58 A;  4M7D B;  3JCM g;  4EMH A;  3RKW A;  1HXD A;  4PJO D;  5IN1 A;  1X6O A;  4N0A A;  5GAN 7;  1KC8 U;  3HRU A;  1RL2 A;  4KT0 E;  1YIT T;  4M78 C;  3H6Z A;  3V7S A;  1M1K U;  3EFS A;  1I5L A;  2KAF A;  3NTI A;  5CCA A;  4R56 A;  5J3B A;  1XTD A;  3LX7 A;  4BDZ A;  4C92 E;  4EDU A;  3MCA B;  2CGH A;  5GAN f;  4BB7 A;  3CCE A;  1VQ9 A;  2CZ6 B;  1ZHI A;  3VYG A;  2RI5 A;  3L1A A;  4XTX A;  1TH7 A;  1KQ1 A;  1K73 U;  5GAN e;  2QA4 A;  1YHQ T;  2CZ7 B;  2XIC A;  3G4S A;  3OYJ A;  4M7D D;  3MEV A;  1WQW A;  3KBG A;  4PJO G;  3BFM A;  2HAX A;  1N8R U;  1KQS S;  3CEY A;  1JJ2 A;  2LC4 A;  2YHT A;  3LWI A;  4E7K A;  4C92 A;  2CYZ B;  3URG A;  1VQ4 A;  2QQB A;  3PT9 A;  2JN0 A;  4OVA A;  2XDP A;  3MEW A;  1YJW T;  3HFN A;  5HK0 A;  3QYG B;  4MZM A;  4A54 A;  4F7U B;  3HRS A;  1U1T A;  3S3O A;  1VQN A;  3L2R A;  2PUK B;  2R5M A;  3QPH A;  3L2V A;  2F69 A;  3HRT A;  3SWN A;  3E9F A;  1K73 C;  3DLL A;  4BI3 A;  3GOX A;  2RM4 A;  3FB9 A;  3ZFJ A;  2RHY A;  1Q86 C;  2OTJ T;  2RHU A;  2KSS A;  4HCC A;  2MWP A;  3A5Z B;  2VYT A;  2RHX A;  3OY9 A;  3CCQ T;  1M90 C;  4XTY A;  3J80 E;  4OMF B;  2XDB A;  4IUV A;  4XU0 A;  5LL6 S;  1YBY A;  3MO8 A;  3S6W A;  5GMK l;  1QVF A;  2ZGW A;  4RG2 A;  3KUF A;  2XU8 A;  2A3L A;  4M7A E;  3QUI A;  2O01 E;  1G3T A;  2LX9 A;  5KCH A;  5CIU A;  4M7A D;  2KK4 A;  2Y4Y A;  4GY5 A;  1VQ7 T;  1Y71 A;  2ZPE B;  4JRQ A;  3P8B B;  4EPC A;  3DB3 A;  2MMP A;  4GLK A;  2KMT A;  1PSE A;  1BIA A;  4C0Z A;  2E6N A;  5GAN 3;  1JBM A;  4EMK B;  1Y96 A;  3P8H A;  4C5E A;  2P0K A;  3JCM e;  3A8O B;  1VQK A;  2QXF A;  3BDL A;  1LOJ A;  3SDZ A;  2PVD B;  4N0A C;  5I2S A;  3OS2 A;  2WSC E;  3CPF A;  3G6E A;  2DK3 A;  3FDR A;  3UT1 A;  5GMK i;  4B9X A;  1GXI E;  3LGF A;  4OGC A;  1EIF A;  5KCO A;  3LGL A;  4VUB A;  3QJ6 A;  5LJ3 d;  2G3R A;  5LJ5 e;  1U8R A;  1NPR A;  1U1S A;  3PMI A;  4C8Q D;  4XTV A;  1XOV A;  3OBY A;  4HT8 A;  2EQK A;  1QP3 A;  2E70 A;  3A8G B;  4IUT A;  2XID A;  1UEB A;  1M4Z A;  4JRI A;  3VYH B;  1VQM T;  4FSX A;  3G4S T;  4M78 F;  4II1 A;  3HP9 A;  5D6Y A;  1MHN A;  2GQV A;  1VUB A;  1P92 A;  3PNW C;  1K8A U;  1M1K C;  5A0G A;  4HT9 A;  4J5Y A;  3INZ A;  4P5N A;  2LRQ A;  1BYM A;  3JB9 G;  2F5K A;  4ZN3 A;  3F70 A;  4ME7 A;  2QQS A;  4LDX A;  4X9C A;  3A8M B;  1KD1 C;  1VQ5 T;  1VQN T;  2FHD A;  3LLR A;  3JB9 H;  1YI2 T;  3OYD A;  1FWZ A;  3M53 A;  3QXE B;  4BD3 A;  3Q1J A;  1W2B S;  3AHU A;  4XU2 A;  3OSS C;  1WJS A;  3OYE A;  5FRN A;  3JB9 F;  2DXB A;  2E41 A;  2QQ9 A;  4PJO B;  2XK0 A;  4J7I A;  4KBM B;  5C0M A;  4KUI A;  3ME9 A;  3JCM h;  5GMK m;  2DTI A;  3L2U A;  3VUZ A;  5A2Q E;  2JOY A;  3X28 B;  3C95 A;  3ASK A;  1WPY A;  1OZ3 A;  3JCM J;  2OAU A;  5LJ3 e;  3GPL A;  3M55 A;  3J7A F;  2K4Y A;  4L59 A;  1WQ7 A;  3V7R A;  2ZPG B;  3UPU A;  2RA2 A;  5GMK j;  2LCC A;  1G3Y A;  1VQ7 A;  3CBO A;  2H3J A;  5FRM A;  1VQ8 A;  5GAM h;  3CCJ A;  1N27 A;  3S3M A;  3CC7 A;  1VQK T;  2GCX A;  5DY9 A;  4M77 F;  4C0D C;  4IUP A;  3CPW A;  5FU6 C;  1MGQ A;  1IRE B;  2MF2 A;  4JDS A;  3OYC A;  4HCZ A;  3MP6 A;  4PKC C;  2E65 A;  2DXT A;  2QQR A;  4BE1 A;  3QZ9 B;  5CQX A;  4EMG A;  5EG2 A;  4X9D A;  4A4F A;  1LNX A;  4A4K A;  3OS0 A;  3M4G A;  3QKJ A;  2EKO A;  3CMA T;  2A7Y A;  4FT2 A;  5LJ5 d;  3QZ5 B;  3OYM A;  1Q82 U;  2L5Q A;  5FLX E;  1Q81 U;  4A4G A;  1O9S A;  3P8D A;  3JCM f;  4BI8 B;  5GMK e;  5KH6 A;  4L6V 5;  3SD4 A;  4C0F A;  3L2W A;  4PNO A;  3M58 A;  1H3Z A;  3M57 A;  4PJO E;  3OBW A;  3N5B B;  2DZ9 A;  4C5H A;  4C92 C;  4DA4 A;  4ZGE B;  3LYI A;  2EYQ A;  5FU7 C;  3JCM c;  3CCU A;  3MP1 A;  2IVW A;  4C8Q C;  2CS7 A;  3HHT B;  1FX7 A;  4LDU A;  4M75 A;  2EWN A;  2B8A A;  3MEA A;  4C0G A;  2CKK A;  2RHZ A;  3OS1 A;  1OI1 A;  2EQJ A;  4M78 E;  1X01 A;  2M9U A;  2O4X A;  4QVZ A;  3OYL A;  4M7D F;  1JRI A;  2PVG B;  1VQ6 A;  5FRO A;  4M78 D;  2X4X A;  1YJ9 T;  4DOW A;  1NJI C;  4M77 B;  5CVI A;  1QVG A;  4M75 G;  3CME T;  3CBM A;  4JS4 A;  4BE0 A;  5GAO p;  3NTH A;  1N9R A;  5I2M A;  2Y90 A;  3OMG A;  4JLI A;  2ZPF B;  3CCV T;  5LJ5 j;  3OQ5 A;  3RKX A;  1YCY A;  4BY6 B;  4YTL A;  4C8Q B;  4IKF A;  4PJO C;  2FYK A;  5L8R E;  4M7A C;  4JLG A;  3JAM E;  5LJ3 f;  1UGQ B;  2LT1 A;  3T9N A;  2V8J A;  1M9S A;  2RJE A;  4MDW A;  4Y91 A;  4F7U A;  3I56 T;  3CCS A;  1YJW A;  3GNG A;  1IZ6 A;  4KUD K;  4HCB A;  2EJF A;  3JB9 J;  2E6Z A;  2EJG A;  3OYY A;  4MML A;  5CKE A;  4XU3 A;  4C8Q F;  5GAO l;  4X34 A;  5CQY A;  3FC3 A;  3CC2 A;  2KVQ G;  3JRZ A;  4J8O A;  4QQD A;  2OTL A;  2R57 A;  3OS5 A;  2PQW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...