1AWOA

The solution nmr structure of abl sh3 and its relationship to sh2 in the sh(32) construct, 20 structures
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
57
structure length
57
Chain Sequence
b'SLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ABL TYROSINE KINASE
publication title The solution structure of Abl SH3, and its relationship to SH2 in the SH(32) construct.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Kinase
total genus 4
structure length 57
sequence length 57
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1997-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1awoA00
1AZGB 1NEBA 4J9DA 1OEBA 3I5SA 4LNPA 2DJQA 2I0NA 3M0TA 2EVRA 4CC3A 2A08A 2JTEA 3M0PA 1M30A 2F2VA 2RQWA 4HXJA 4JZ4A 1Y57A 2C0OA 2YDLA 2KYMA 2LCSA 2YUNA 3VS0A 1M3BA 4OMPA 3THKA 2EKHA 1FYNA 4OMMA 3VS6A 4F16A 4DEXA 1YWOA 3EHRA 1PNJA 1GRIA 4Z89A 1WDXA 2LQWA 2KYBA 2RMOA 4RTWA 4GLMA 2GQIA 1NEGA 2KRSA 1EFNA 1T0JA 1G2BA 2K9GA 1UJ0A 1PRMC 2OI3A 2VKNA 3TSWA 1PHTA 4AFZC 3VS1A 1YNZA 2W10A 2J6KA 1SHFA 1ZUUA 2DBMA 1NLOC 1WIEA 3I9QA 2OJ2A 2KEAA 3UA7A 1ZBJA 5L23A 3SHWA 2X3XD 1SHGA 1AWXA 2F2WA 1E6GA 4RTUA 1K9AA 1HJDA 3VS7A 4HVWA 4CC7A 1RLPC 2FPFA 3EHQA 2L2PA 2DM1A 1BK2A 3RBBB 2HEQA 1HD3A 3REBB 4RTXA 2EYWA 2D1XA 1RLQC 1WFWA 1QKWA 1GFCA 1Z9ZA 1W70A 3PVQA 1M3CA 2JM9A 1MUZA 5GJWB 2DA9A 2RQVA 4CC4B 1NYGA 1HSQA 4X1VA 2D8JA 3EG3A 1OPLA 2BZ8A 1CKAA 2J6OA 3NPFA 1JXOA 3I35A 5ECAA 4R0KA 2EW3A 3U23A 2CUDA 2KGTA 4A63B 1JU5C 5HCKA 1X69A 2JMAA 1NM7A 3RNJA 2J6FA 2A37A 1X2KA 1CKBA 3CQTA 2DYBA 1TUCA 1Z9QA 2H8HA 2DF6A 2JS0A 2DRMA 1JEGA 4HCKA 1LCKA 4J9EA 1SPKA 5IXFA 3M0UA 2ABLA 3GBQA 1YWPA 2KE9A 2W0ZA 3NGPA 2BZYA 2F2XA 1KJWA 1B3QA 4ORZA 1MV3A 2K79A 5EC7A 2O88A 1G83A 4CC2A 1W6XA 2IIMA 5GJVB 3H0IA 4J9FA 1PRLC 1VYTA 1XOVA 2LP5A 3EG0A 3UATA 2CREA 1KIKA 1ZUYA 2ROLA 1OV3A 2VWFA 2AKLA 5IH2A 2K7AA 2GTOA 2FO0A 2AK5A 2EGEA 3M0SA 1UDLA 4Z88A 1K0SA 2LZ6B 1W1FA 2G6FX 2LMJA 4M4ZA 3VRYA 4AG1C 3QWYA 1TUDA 5I22A 1A0NB 3M0RA 1M8MA 5I11A 2YT6A 1SEMA 2DLPA 4J9BA 2C0IA 2NWMA 3NHNA 3EG2A 2DVJA 3PE0A 2CUBA 2M0YA 1QWEA 2E5KA 2EYYA 2DNUA 2MCNA 1ZX6A 1NYFA 2EGAA 1X27A 2FRYA 4J9IA 1WA7A 2AZVA 3FJ5A 2FG0A 1GBRA 4AFUC 1GCPA 1MV0B 2HBWA 2HCKA 1VYUA 4IIOA 2J7IA 2ED1A 3ZL7C 2JMCA 2ECZA 4HVVA 1AVZC 2K2MA 2ROTA 3LH5A 1GFDA 1UECA 1VYVA 3VS3A 1UJYA 1M3AA 3C0CA 4AFQC 3H0HA 1K4US 1WXBA 2B86A 4F14A 3IQLA 2L3SA 3SEMA 1I07A 5IHKA 1AZEA 2FEIA 5IHIA 1YN8A 1S1NA 3VRZA 1H92A 1UHCA 4RTZA 1JXMA 4LE9A 2BZXA 1PWTA 2DX1A 1WX6A 1JO8A 2O9VA 1NLPC 2CSIA 1ARKA 3JV3A 4J9HA 1AD5A 2KBTA 1QKXA 1KSWA 3I5RA 1BB9A 3M0QA 2P4RA 2GNCA 2X3WD 4RUGA 2A28A 2FPDA 1X6GA 1IO6A 2V1RA 2CDTA 2O2OA 1E6HA 2L3PA 2PZ1A 2RQTA 2EBPA 2RN8A 1UHFA 1V1CA 1UE9A 3TSZA 2V1QA 2KRMA 4OMQA 1U3OA 1YP5A 2CT3A 4EIKA 1AWWA 1Y0MA 1YCSB 2KNBB 2DILA 1X2QA 3R6NA 2GBQA 1CSKA 4J9GA 4QT7A 4WCIA 4JJDA 4KRTA 4F17A 2DL7A 3PVLA 1GL5A 1WI7A 1GCQC 3UA6A 4LUDA 2KT8A 1H8KA 4RTTA 2FPEA 3H0FA 1U5SA 4DEYA 1WXTA 5FW9A 1K0XA 2EGCA 2JS2A 1WXUA 3EGUA 1E7OA 3VS2A 1H3HA 2JT4A 3VS5A 4E6RA 2BTTA 4RTYA 2D0NA 4FSSA 1SRMA 5IHNA 2CH4W 2LJ3A 1UGVA 2ESWA 1UTIA 2O9SA 3KFVA 2EQIA 2AKKA 1GCQA 1JQQA 1N5ZA 1PKSA 2D8HA 2LX7A 2RNAA 2A36A 1QCFA 1ABQA 2FRWA 4J9CA 2K3BA 2MOXA 4HVUA 1T3LA 2PTKA 5FWBA 2CSQA 2KR3A 1SSHA 1M27C 1WLPB 1ZSGA 1WYXA 2SEMA 4JJBA 2SRCA 1T0HA 2PNIA 2ENMA 4GBQA 2DRKA 1ZLMA 2EYZA 1AWOA 3H41A 2NUZA 2RQUA 2JW4A 1UUEA 2KT1A 1OPKA 3QWXX 4IIMA 2KRNA 1PKTA 2M51A 1J3TA 2DL3A 2RPNA 1SRLA 4Z8AA 1X43A 3VS4A 5IXBA 1OOTA 1KFZA 1TG0A 2L3QA 1ZUKA 2LJ0A 2DL4A 2LNHB 4K11A 2CT4A 1AWJA 1I0CA 1I1JA 1UFFA 2KXCA 4ZNXA 1UG1A 2JM8A 2KROA 4JZ3A 1QWFA 1X6BA 4OMLA 2HDAA 2QDLA 2AZSA 3NMZC 2DMOA 2RQRA 4RTVA 1VA7A 2GGRA 2MIOA 2DBKA 4OMNA 1ABOA 2YUOA 1RI9A 2DL8A 1AEYA 1U06A 4OMOA 2J05A 2VVKA 1BU1A 2J06A 2DE0X 1GBQA 1K1ZA 2EYXA 4LUEA 1QLYA 3ULRB 2YUQA 2K6DA 3REAB 3TVTA 1B07A 4LN2A 2ED0A 2O31A 1AOJA 2RF0A 2KXDA 2L0AA 2OAWA 2DL5A 2LQNA 1BBZA 4D8KA 4ESRA 2LJ1A 2XMFA 3O5ZA 4JJCA 1K76A 2YUPA 3EG1A 4AG2C 4JPBW 4Y92A 5FWCA 2HSPA 1FMKA 2EPDA 3UF4A 1RUWA 1T3SA 1NG2A 2C0TA 2GTJA 4D8DA 3A98A 2YSQA 2CH4A 4AFSC 2JXBA
chains in the Genus database with same CATH superfamily
1NEBA 3PFSA 4J9DA 6AT1B 4ZTJA 1Q86U 2COWA 4CC3A 2A08A 4J6XA 1Y57A 3SFMA 1P92A 3OS1A 3OY9A 3HHTB 1NBEB 3FLGA 1JJ2P 2HMAA 2YDLA 4M77A 3VS0A 1TWBA 2EKHA 2RA2A 3VS6A 5HK0A 1XTDA 2NUPA 1VQNT 1QCNA 5KYWB 4HCBA 1S72Q 4HT9A 4M78E 1GRIA 3V8LA 1WDXA 3CCLA 2GQIA 1IB8A 2KRSA 1EFNA 1T0JA 4UC4A 1G2BA 4M75F 4JUVA 4KBMB 1EIFA 2ZPEB 3LGFA 2EIFA 1PRMC 1OYXA 2OI3A 2VKNA 2DXBA 4C5EA 3M59A 3EGDA 2R5AA 3G4SQ 1SHFA 1ZUUA 1IGUA 2E70A 3CPFA 2CP3A 1WIEA 5KCOA 1QCOA 3I9QA 2OJ2A 2CP0A 2RJCA 3QZ9B 1OU9A 1ZBJA 5AT1B 8ATCB 1MNDA 2GFUA 1SHGA 1VQPQ 1AWXA 3NTHA 1TUGB 3TEEA 4RTUA 3VS7A 4HVWA 4M7DB 4CC7A 3QJ6A 4IURA 3EAEA 1VQKT 3CC2T 1NJIC 2L2PA 1BCMA 4L6V5 3RBBB 5GMKe 4L5GA 1MMGA 4ZGDB 3OS2A 5CIUA 4RTXA 1D0YA 1VQ6T 2D1XA 2I2LA 1VQ5T 3NTKA 2RHIA 1KK7A 2LX9A 2BKDN 1OI1A 9ATCB 2QEXT 2AT1B 4HA8A 4KUIA 1ZA2B 4CC4B 2PVDB 2OX7A 2OTJA 8AT1B 1VQOA 3X25B 2QTXA 4A4GA 1ACMB 4R0KA 2EW3A 2O4XB 4P5NA 3HRTA 5HCKA 1X69A 2HKQB 4R55A 2JMAA 3BY7A 2EQKA 3RNJA 2Y4XA 4OGEA 4R56A 2F1LA 2DK3A 2E5QA 4A4HA 5KYXB 3SWNB 4J9EA 1LCKA 3V8KA 3FDRA 1SPKA 3FJPA 3OYDA 2KE9A 3NGPA 2F2XA 1KJWA 3GP8A 2YHTA 4NL2A 2VASA 5CO7A 2EWNA 2AHJB 3QYGB 3I56Q 1S72A 3OYGA 1G83A 4CC2A 1FMVA 1V29B 4J9FA 1XOVA 3URGA 3EG0A 3PGGA 3CC4A 1KHIA 4QVCA 2ROLA 1YHQT 1KIKA 2VWFA 4KGXB 4N0AC 5IH2A 1YIJQ 1QVFS 2K7AA 2FO0A 3OYMA 3CCRA 4XTZA 1UDLA 4OB1B 1K0SA 2LMJA 4AG1C 1SF9A 4VUBA 3QWYA 4M77D 4IUPA 1TUDA 1I5OB 2K2VA 3JB9J 4MDXA 4M78G 1A0NB 2HL3A 2QA4Q 4J6YA 1M8MA 5I11A 5GAN8 5GMKm 4M78C 1SEMA 1H3ZA 4J9BA 4EMGA 1YJ9A 5GAN7 4PFOA 2CP5A 2IG0A 3EG2A 3NTIA 4CI0C 2M0YA 3DLLA 2DNUA 1YITQ 2MCNA 4OVAA 2EGAA 3L2RA 1MHNA 1WA7A 5LJ5j 3OYAA 3LWIA 4AFUC 1QVFP 2QTVA 3S3OA 4IIOA 2RJEA 1GFDA 1AVZC 5GAMh 1VYVA 3RDVA 3CBOA 5CKDA 1M3AA 3CMAT 2OTLA 4NS5A 3A1PA 3PMIA 4AFQC 2KDSA 3H0HA 2X4XA 4PKCC 1Q86R 2PVOB 4F14A 3CBMA 2K4YA 3IQLA 4V2SA 5CKBA 4QVZA 5IHIA 1YN8A 3QPHA 3N5BB 3VRZA 4PK4A 3KXTA 1N9SA 2QQSA 1JXMA 4J5YA 2O9VA 1M2VB 1NLPC 4FW2A 1OX9A 1LNXA 1IZ6A 3Q1JA 3JV3A 1BI2A 1VQ7T 3MPUB 4QVDA 2X3WD 1M8VA 3OYHA 4PJOA 2FPDA 1X6GA 1IO6A 4XAXB 3JCMh 3CPWS 1E6HA 2EBPA 4FT2A 5FU6C 2V1QA 1U3OA 4M77F 2CT3A 3ZFJA 1Y0MA 2KNBB 2DILA 3CC7T 5FU7C 3OYEA 3LX7A 4PL6A 4WCIA 3JCMP 4DA4A 1WHJA 4C0DC 5DLOA 1GCQC 1SKUB 3CCMT 5GAOl 1H8KA 2CGHA 4RCBA 5FRNA 2FPEA 5I21A 3H0FA 1WZOA 1WXTA 5FW9A 2LVMA 2CP7A 1I4K1 3P8BB 2KI7A 3CPWP 3EGUA 4IUUA 3J7AF 3META 2WSCE 2VC8A 4O5VA 2RH2A 3JB9I 2DD4A 2NUTB 2WSEE 1YITA 2COZA 5GMKh 3G71T 4M7AF 1X75C 2XIDA 1JQQA 1IHVA 2RNAA 1PKSA 2RJFA 1OZ3A 1B7TA 3C4SA 1Q81C 1M4ZA 1WLPB 1WYXA 5HKCA 3UWNA 2PNIA 4C8QE 1M5Q1 5LJ3h 2LT4A 2EQMA 2DJZA 4PJMA 5LJ5d 2EYZA 2NUZA 3OS0A 1YCYA 3TQ7P 3SDZA 3UT1A 4JJNK 3VS4A 3EFSA 1OOTA 1K9MC 1TG0A 2KY9A 1VQ8Q 1KG1A 1PSEA 5GANh 1PD0A 3JCMW 3PIOA 1OQKA 3PIPA 2V8JA 4ZNXA 4E47A 1UG1A 4JZ3A 5GAOr 1C6VX 1QWFA 2HDAA 1K8AU 4GY5A 2DMOA 2M02A 4JRIA 4DOWA 4RMOA 2FB7A 4XTUA 1YJWA 2E12A 1KD1U 2R5MA 5GAMg 1ABOA 4HCZA 2YUOA 4RCCA 1YI2Q 1F1BB 1RI9A 1VQLA 4BUGA 1RAGB 1BU1A 1M1KC 2DE0X 4E7SA 5C6SA 2YUQA 2K6DA 5LL6S 1N6AA 1B07A 4J7FA 3EGXA 2O31A 2YRVA 2RF0A 3V7SA 3ER0A 4M78B 5KYUB 1BI0A 5A0GA 2NLUA 4F7UG 3UPUA 4D8KA 4JJCA 4EMKC 4BY6C 1OU8A 3EG1A 4AG2C 4JPBW 1QVFA 1TS9A 2HBPA 3FRNA 1D0XA 2H3JA 3JCMg 3A98A 4E7ZA 1H641 3EG9A 5LJ3j 1AZGB 1TU0B 3MO8A 4Z02A 1WJRA 1M1FA 4GLKA 4PFZA 3M0TA 2EVRA 2LQ8A 5LJ5e 3M0PA 2C0OA 1LVKA 3BE3A 3SB2A 1EZZB 2JN0A 2KYMA 1Q82R 2KQWA 5GANj 1IRXA 3NFCA 3FIFA 3CCJA 4F16A 1RAFB 1G3SA 4DEXA 3VYHB 3JCMb 3QBYA 1KHCA 1PNJA 5I2MA 4Z89A 2ZZDA 3JB9F 4RTWA 3RR6A 3CCEA 4GLMA 1I81A 3HRUA 3CD6A 3C95A 2DERA 1UEBA 2EYQA 2XK0A 3JRZA 1BKBA 3L2WA 1PHTA 1PD1A 5FU6B 3CCQT 3CCLQ 3VS1A 1VQ8A 1YNZA 3CCVT 2DBMA 4IUQA 3QDFA 3CMET 4C8QG 4PJOF 4C8QC 3OW2S 4C92E 2KEAA 5FU7B 3JCMd 5GAMf 1RAIB 5M9OA 2D6FA 4C0DB 3OYIA 3ZBDA 4TVRA 1QVGA 3CPWA 1K9AA 1MNEA 3MCAB 1R0CB 5LJ3g 2D9TA 2DM1A 3VV0A 3GF5A 3LH0A 3OSSC 2HD0A 2KK4A 1WFWA 3G6EA 1QKWA 1S72T 5A0DA 1W70A 1M3CA 1EX4A 3OW2P 5GANg 5GMKl 2L89A 3CEYA 5CVIA 5ECAA 2X4WA 4A63B 1N9RA 3OYCA 3G4ST 3JAME 2OTJQ 3QKJA 2Y4YA 3MEAA 1CKBA 3HL8A 3CQTA 2RD1A 1VQMA 1Z9QA 2JS0A 3J81E 1G3TA 3QZ5B 2K3YA 2OAUA 2QQAA 1VQPT 1YWPA 2LCCA 4J7IA 1N8RU 3A8HB 2BZYA 5HY6A 4QQ6A 5LJ3d 1MV3A 3EH1A 1Q7YC 5EC7A 2MF2A 1K8AR 5GJVB 3A8MB 1W2BP 2LP5A 5GAN3 3JCMe 2CREA 1QW1A 1KD1R 1NJIU 3AT1B 2GTOA 2AK5A 3M0SA 4Z88A 5CCAA 3F70A 5GANd 2PU9B 1KC8R 3KUFA 2ZPBB 3I55A 4XTXA 3CC4Q 3HSBA 1BIAA 1D3BB 4N4IA 3CCRQ 5KYYB 4E7HA 1ZQ1A 2CKKA 2HZYA 4M75G 2DFUA 2E5KA 3OMGA 2HQHA 4M75C 1MMNA 1X27A 2FRYA 1ZSZC 2ZGWA 4J9IA 1YJ9Q 1N8RC 2MI6A 4F7UB 4EMKB 4BY6B 4ZN1A 3EFOA 1BI3A 3MJXA 2Y90A 4C0ZA 4C92G 2YWWA 3ZL7C 5KCHA 4C92C 2ECZA 2K2MA 3C94A 4M7AA 1UECA 1WHKA 4MZMA 3DKMA 4C5GA 3S6WA 3I56T 3RKWA 2RJDA 3TCJA 2M16A 1I07A 2P4TA 1YIJT 3CCUA 1AT1B 4XQ3A 3OS5A 2OTLQ 4RTZA 4XTWA 2BZXA 1PWTA 2DX1A 2IPOB 2P84A 1JB0E 2FZGB 5LJ5h 4PFPA 1AD5A 4NL3A 2QA4T 5LJ3e 3QXEB 4PJLA 4C5IA 2A28A 5GAN2 3A5ZB 2CDTA 4PNOA 2PZ1A 2XHCA 5D6XA 1UHFA 1V1CA 1YITT 3TSZA 4OMQA 1YP5A 4M77E 4ELZC 5CKFA 5GANe 3JSCA 4KRTA 4ELYC 4BDYA 2X4YA 3QUIA 3HKSA 4C8QB 2HQXA 3UA6A 2RB6A 1JBMA 3ME9A 2E3HA 3CCSA 3OYLA 3RIRA 1U5SA 4E2FB 2EGCA 2JS2A 3HTRA 1H3HA 3OB9A 3VS5A 4E6RA 2BTTA 2EJ9A 4E7JA 4RTYA 2D0NA 3GPLA 2DVEA 3OYJA 4JRKA 2K5LA 3X28B 1DJ7B 2ESWA 1UTIA 2DXUA 2ZPFB 2DD5A 2O9SA 3KFVA 4XU1A 2VXEA 2D8HA 2XICA 2YXYA 1VQ9A 2A36A 4PJNA 2RHXA 2FRWA 4J8OA 2LRQA 1VQ5Q 2K3BA 4M7DA 4HVUA 3M9QA 5FWBA 4LDWA 2QEXQ 1HK9A 2V26A 2CSQA 2M0OA 2KR3A 1SSHA 3L42A 4FSXA 1TOVA 1FWZA 1T0HA 1MGQA 5IAYA 2K5FA 4GBQA 4B6MA 2L3RA 2DRKA 1MMAA 4N4GA 1Y71A 4QQDA 1RADB 1AWOA 3J80E 2RQUA 2GQVA 1UUEA 3QWXX 2QQBA 1PKTA 4ZGEB 2RK1A 2DL3A 1X6OA 2EKOA 4X9CA 5IXBA 2O4XA 1ZUKA 2ZCFB 1BI1A 2DKGA 3RKXA 4M7AD 2LNHB 1JJ2A 2CT4A 2QK0A 1I1JA 2E6ZA 2KROA 1QMCA 5IT9E 2AZSA 1VQNA 2NYSA 5KYXA 2DXTA 5CKHA 3RMQA 3SWNA 2MIOA 4XU2A 1IREB 2VGNA 4DOVA 2DEUA 4XTVA 2K57A 1YJWQ 1K1ZA 4F7UE 2EYXA 3P8DA 1QLYA 4LUEA 3DB3A 2E41A 2ED0A 1Y96B 1M90C 2OAWA 4LDXA 2ZAEA 2DL5A 3C12A 1C0MA 1LPLA 1VQLQ 1BBZA 1Q81U 3RERA 2XMFA 4M77G 3E2UA 1K76A 4M77C 5LJ5g 4M75B 2X9HA 3L1AA 1SG5A 2C06A 4LDVA 1ZSZB 5FWCA 2JVVA 1FMKA 2EPDA 4BI3A 1RUWA 5KH6A 2C0TA 3OMCA 2CZ0B 4AFSC 1PM3A 1VQKA 2GFAA 4C92B 3CC2A 4J6WA 1OEBA 4XK8E 1N27A 2FHDA 5CQXA 5J3BA 1K9MU 2I0NA 1VQ6A 4A53A 2EJGA 3M4YA 2JTEA 1BIBA 1VQ5A 2RQWA 1PG5B 4HXJA 3SD4A 2QEXA 2XKOC 1K73C 1YI2T 2LCSA 4QQGA 1M3BA 2BUDA 3THKA 2X35A 3OBWA 4Y91A 1NPPA 1Q82C 5A0LA 3EHRA 4A4KA 1X01A 2O01E 2KYBA 2RMOA 4RG2A 3GLXA 1NEGA 5CAIA 3CCJQ 4LD6A 1M1KU 5KE2A 3MEVA 3EG9B 4XU3A 4M7DD 3TSWA 2QASA 4AFZC 3CCEQ 3CD6Q 2W10A 1RI0A 3MKDA 1Y07A 3UA7A 2QGGA 1XJWB 1SSFA 4JRQA 3QDRB 1RABB 3JCMQ 4QW2A 2YRCA 4E7IA 3MP8A 3L2QA 5FRMA 1KQ1A 1HJDA 1D1CA 1RLPC 1Y7XA 1YHQA 3JB9D 2IVWA 1FX7A 3EHQA 4KGVB 4E7LA 2PQWA 3HFNA 3REBB 4Q5WA 2EYWA 4XTYA 5LJ5f 3V7CA 3E9GA 1Z9ZA 3PVQA 3EH2A 4IUVA 3H9NA 1U8RA 2RI5A 2HKNA 2JM9A 3PTAA 2DIQA 1MUZA 5GJWB 2E4HA 1NYGA 2JUFA 4X1VA 4PJOD 2RHUA 3G6EQ 4A4FA 3V7RA 1QVPA 2BZ8A 1CKAA 4BDZA 1JXOA 3U23A 2CUDA 2KGTA 1JU5C 3CCLT 2E3IA 1GXIE 1NM7A 1NZ9A 2XDBA 2A37A 4FYYB 1TUCA 2NUTA 3LYIA 2CZ6B 2DRMA 3P8HA 3RUXA 4HCKA 4JLIA 2MWPA 4M7DF 5IXFA 3CMAA 3M0UA 3GBQA 4BE1A 5J39A 4OP0A 2CZ7B 3E19A 1VQMQ 2E6NA 4PLLA 1RAHB 4FCYA 4ORZA 2K79A 3WVDB 2O88A 3H0IA 2XU8A 1PRLC 3UATA 2B8AA 1ZUYA 1R0BG 1VQ7A 4J83A 4FT4A 5FLXE 4EDUA 1WJSA 2E64A 3L2VA 3VRYA 2XI9A 1KQSS 1KC8C 4M75E 2RHZA 3M0RA 3HPWA 2YT6A 1VOMA 1RAEB 1WHLA 4MMKA 5IN1A 3I55Q 4FM4B 1VQOT 2OTJT 4LDYA 3OYBA 3CC7A 4OGCA 2BIVA 3OBYA 1IGQA 4ZN3A 3FJ5A 3M4GA 4N0AA 3CCMA 4M77B 2HBWA 2MK5A 3QYHB 4C0FA 2EFIA 4EPCA 4PJOG 2NUPB 1VYUA 5GAOn 4DQ2A 4PJOC 4HVVA 2ROTA 3VS3A 2HQEA 1UJYA 2DTOA 3TREA 3C0CA 1KQSP 3WVEB 4M78A 3LWHA 1K4US 5KYUA 4AT1B 2LQKA 3SEMA 1D1AA 2FEIA 1Q7YU 2DTHA 1S1NA 1BCOA 2QG9B 2EQJA 1XQHA 1UHCA 3EGDB 5D7UA 3G71A 1WX6A 3RKYA 1V76A 3JCMf 1JO8A 3CC4T 1W4SA 3QO3A 5GAOp 1ARKA 5EG2A 3CCUQ 4J9HA 4WF2A 1QKXA 1KSWA 3CCRT 4WTOB 2P4RA 3EFOB 2EQUA 1W2BS 2FYKA 2O2OA 4IKFA 4OMFB 2RN8A 3LLRA 4M7AB 1UE9A 5KE3A 2KRMA 2DTIA 3HP9A 4EIKA 3VYGA 1YJ9T 1LOJA 1AWWA 4ZGJB 1WHGA 1X2QA 2GBQA 3E1SA 4J9GA 4F04B 2CS7A 1BYMA 4HKEA 2DL7A 3WXMB 1WPYA 1TH7A 1GL5A 1G3YA 3EFRA 3OA6A 3JB9H 3FEOA 1WQWA 1UGSB 2A7YA 4LXCA 4HCCA 3DB4A 1K0XA 5GAN4 2OTLT 2AIRB 2R58A 2JT4A 3CCSQ 1SRMA 5IHNA 2LJ3A 4DBRA 1ZBXA 1PCXA 3D7SB 1GCQA 2LX7A 2FVUA 1QCFA 4J9CA 2MOXA 2KSSA 5LJ3f 2ZPHB 2FZCB 1T3LA 2PTKA 2COYA 3JCMV 2PVGB 1PSFA 4OB2B 1M27C 1ZSGA 2VYTA 4JJBA 1VQ9Q 5CKEA 2XG8D 3RESA 3BDLA 3PNWC 1ZLMA 3H41A 1ZHIA 5GANf 2JOYA 2JW4A 2KT1A 2G3RA 1OPKA 3H8ZA 2KRNA 3KBGA 2M51A 3QJYA 2RPNA 1SRLA 4C92F 3OSVA 1VQ4Q 1KFZA 1YJNQ 1Q86C 2LJ0A 3VKIA 2DL4A 1AWJA 1UFFA 2KXCA 2JM8A 2DXCA 4E7KA 4M78D 1UGRB 3HRSA 4RKUE 4MZPA 1X6BA 4FYVB 4OMLA 4B9WA 1I5LA 4IUTA 4MZTA 1M1GA 2RQRA 2QQRA 4RTVA 1FXXA 1O75A 1NPRA 2LT1A 4OB3B 1WGSA 1B34A 4BACA 2DL8A 3M56A 1IXDA 1G3WA 4OMOA 2CZ1B 1VQNQ 2XDDA 2VXFA 3ULRB 3REAB 3QSUA 4LN2A 2L5QA 4BE2A 3CCQA 2L0AA 4X9DA 2DO3A 2Z0WA 3CCVA 1QP3A 4FYXB 3CMEA 4ESRA 2LJ1A 2DPPB 5KYWA 3VJPA 2HAXA 4Y92A 4L59A 3O8VA 3UF4A 2JNGA 1M2OA 4PLIA 1T3SA 1NG2A 4KH0B 4MMLA 2GTJA 5DM7R 2YSQA 1D3BA 1KQSA 1PC0A 5KYYA 2JXBA 2KVQG 4PJOB 2YLCA 2DYIA 3I5SA 2KAFA 4LNPA 3JCMc 3OYNA 2F5KA 1Q7YR 1OULA 2DJQA 2A3LA 2CP6A 1I8FA 2L8DA 1VQKQ 1M30A 2F2VA 4O6JA 3OW2A 4JZ4A 1O9SA 3H6ZA 3CC2Q 3OYYA 4F7UA 4EMKA 2YUNA 4OMPA 4M7AE 4LD9K 1FYNA 3OYKA 4OMMA 1VQ6Q 3CBPA 2XD0A 1R77A 4M78F 1YJWT 1YWOA 2P0KA 4A4EA 2LQWA 1HYOA 1VIEA 1AHJB 3M5AA 3GIBA 1OX8A 3G4SA 1VQLT 2K9GA 3INZA 1HXDA 3A8LB 1UJ0A 1VQ4A 4DBFA 1M90U 4ATOA 1YJNA 2J6KA 2F5TX 2QI2A 1VQPA 1N8RR 2A0FB 1NLOC 5C0MA 4PJJA 2QYZA 4BB7A 3MP1A 5L23A 3SHWA 2X3XD 3BDUA 2BE9B 2F2WA 1W2BA 1E6GA 3LGLA 2LTOA 1NJIR 2QQ9A 4BI4A 2FPFA 1G8XA 2LCLA 1MMDA 1BK2A 1Q95G 4BD3A 2DIGA 2M9UA 3X26B 2HEQA 1HD3A 4DBQA 1RLQC 7AT1B 3BW1A 1YHQQ 1GFCA 2RI2A 4ZTFA 1K73U 4C8QA 3M57A 1D1BA 2DA9A 2RQVA 1VIFA 2JTMA 4KULA 4B9XA 3M55A 3CCJT 3VUBA 1Q82U 1HSQA 2D8JA 5HK3A 5GAN5 3EG3A 1OPLA 2HNIA 2J6OA 3M58A 3NPFA 3I35A 3CCET 1QVGS 3CD6T 4JDSA 4JS4A 2J6FA 3GNGA 1X2KA 4NOYA 2MPXC 2VUBA 4OB0B 2DYBA 2H8HA 3JCMX 2DF6A 1VQ8T 3BFMA 1JEGA 3CXCS 2MMPA 3X20B 3I56A 4M7DE 1C1AA 1R8OB 2ABLA 1ZA1B 1NE8A 2W0ZA 4JS5A 1WHHA 3PMTA 3L2UA 1B3QA 1YIJA 3EGXB 5KYNA 3CMAQ 2RM4A 4KT0E 1U1TA 1W6XA 2IIMA 2CP2A 1VYTA 1QVGP 1G5VA 1OV3A 2AKLA 2YLBA 2QA4A 2EGEA 5GAMj 2LZ6B 4LDUA 3ZEHA 3GNFB 4M7AG 1W1FA 2G6FX 4M4ZA 2RHYA 4M7AC 3G6ET 4RG8A 3CXCP 5CR2A 1D09B 1RL2A 3V8JA 5I22A 2F69A 2LNVA 1VQ7Q 1RACB 2DLPA 5I2SA 2C0IA 2NWMA 1UB4A 3NHNA 3PE0A 2DVJA 2CUBA 5DLQE 1FMWA 1QWEA 2EYYA 2JTFA 1M2VA 3HFOA 1LJOA 2VGMA 1ZX6A 1NYFA 2K3XA 4PJOE 1QP2A 2AZVA 1WQ7A 2FL7A 4N4HA 2FG0A 1GBRA 1GCPA 1MV0B 3CC7Q 4FU6A 2QXFA 2HCKA 2VV5A 1VQMT 2J7IA 2ED1A 2JMCA 1U1SA 5CK9A 3LH5A 2QGFB 3S3MA 1Y96A 4C0GA 2V8KA 3CCMQ 1VUBA 1WXBA 2B86A 1QQJA 1TTHB 2L3SA 5IHKA 1AZEA 2EJFA 2ZPIB 4X34A 4BE0A 3RMSA 4M75A 4FIBA 1UGQB 4FW1A 1H92A 4LE9A 1ZSZA 3G7ZA 2FZKB 2M1HA 3VUZA 5A2QE 2WACA 4D6WA 3R6OA 2CSIA 5AYFA 2ZPGB 2DAQA 2HL5C 2KBTA 2X51A 2YRDA 2VB6A 1BB9A 3I5RA 3M0QA 4AMCA 2GNCA 4C92A 4C8QD 4RUGA 3G71Q 4JRPA 3QHSA 3I55T 2V1RA 1KC8U 2L3PA 2RQTA 4F7UF 5J26A 2E1HA 1M90R 2MWOA 1OZ2A 3QG1A 2EAYA 2KMTA 3OYFA 1YCSB 2MAMA 3R6NA 2E10A 1CSKA 5D6YA 4QT7A 5GMKj 2DETA 4JJDA 2DZCA 4F17A 3PVLA 4JLGA 1WI7A 4DBHA 2RI3A 2V8IA 4LUDA 2HSEB 4M7DG 2KT8A 3M54A 4M7DC 4RTTA 1KQ2A 2LDMA 4DEYA 5GMKi 1WXUA 4KGZB 1E7OA 1TSFA 3GOXA 1K8AC 3VS2A 3JCMJ 4FYWB 3FB9A 4ANJA 1KD1C 4KH1B 1WJQA 2JJ9A 4FSSA 4CRIA 2PUOB 1K73R 4BI8B 2BE7D 2CH4W 3CCUT 3ASKA 1UGVA 1TXQA 5GAMd 2D0QB 2P0PA 2R57A 2JZ2A 5CQYA 2QAZA 3PT9A 2EQIA 2RO0A 2AKKA 3JB9G 5D6WA 1N5ZA 3T9NA 1ABQA 1Q81R 3UDCA 4Y28E 2DZ9A 2SEMA 2SRCA 4YTLA 4C8QF 3S3NA 2ENMA 2GCXA 3SWNC 2WSFE 2ATCB 3MP6A 2CYZB 4IIMA 1J3TA 4Z8AA 1K9MR 1X43A 5L8RE 2E65A 2RK2A 2L3QA 5GAOm 3MEWA 2GF7A 4FL6A 1D0ZA 4K11A 3CCST 3TU4K 2K5IA 1I0CA 4II1A 2P0QA 1YI2A 2X4JA 4HT8A 1M9SA 4A54A 5DY9A 3OQ5A 2QDLA 3NMZC 1VA7A 2GGRA 3A8OB 3X24B 3AHUA 3LW5E 1RAAB 3A8GB 2DBKA 4OMNA 4M75D 3CXCA 1IHWA 3MEUA 1M1KR 2H3EB 4C5HA 1AEYA 1U06A 2XDPA 3M53A 2J05A 2VVKA 5GAOq 2J06A 2MYSA 1GBQA 3VU3C 4EMHA 4QKUA 3TVTA 1AOJA 1JRIA 1YFNA 4MDWA 2KXDA 5GAN6 3G1JA 4C92D 1VQ9T 1YBYA 4ME7A 4OF1A 2LQNA 1UGPB 2QDYB 2PUKB 1WHMA 3DLMA 2DEQA 1JJ2S 3O5ZA 3E9FA 2YUPA 5GAMe 3CCQQ 1VQOQ 3MHXA 3CCVQ 2HSPA 3CMEQ 4XU0A 3FC3A 3L2ZA 1VQ4T 4D8DA 1XNIA 2LC4A 3QIIA 1YJNT 1WNLA 2CH4A 5FROA 4KUDK 1B34B
chains in the Genus database with same CATH topology
1AZGB 1NEBA 4J9DA 1OEBA 3I5SA 4LNPA 2DJQA 2I0NA 3M0TA 2EVRA 4CC3A 2A08A 2JTEA 3M0PA 1M30A 2F2VA 2RQWA 4HXJA 4JZ4A 1Y57A 2C0OA 2YDLA 2KYMA 2LCSA 2YUNA 3VS0A 1M3BA 4OMPA 3THKA 2EKHA 1FYNA 4OMMA 3VS6A 4F16A 4DEXA 1YWOA 3EHRA 1PNJA 1GRIA 4Z89A 1WDXA 2LQWA 2KYBA 2RMOA 4RTWA 4GLMA 2GQIA 1NEGA 2KRSA 1EFNA 1T0JA 1G2BA 2K9GA 1UJ0A 1PRMC 2OI3A 2VKNA 3TSWA 1PHTA 4AFZC 3VS1A 1YNZA 2W10A 2J6KA 1SHFA 1ZUUA 2DBMA 1NLOC 1WIEA 3I9QA 2OJ2A 2KEAA 3UA7A 1ZBJA 5L23A 3SHWA 2X3XD 1SHGA 1AWXA 2F2WA 1E6GA 4RTUA 1K9AA 1HJDA 3VS7A 4HVWA 4CC7A 1RLPC 2FPFA 3EHQA 2L2PA 2DM1A 1BK2A 3RBBB 2HEQA 1HD3A 3REBB 4RTXA 2EYWA 2D1XA 1RLQC 1WFWA 1QKWA 1GFCA 1Z9ZA 1W70A 3PVQA 1M3CA 2JM9A 1MUZA 5GJWB 2DA9A 2RQVA 4CC4B 1NYGA 1HSQA 4X1VA 2D8JA 3EG3A 1OPLA 2BZ8A 1CKAA 2J6OA 3NPFA 1JXOA 3I35A 5ECAA 4R0KA 2EW3A 3U23A 2CUDA 2KGTA 4A63B 1JU5C 5HCKA 1X69A 2JMAA 1NM7A 3RNJA 2J6FA 2A37A 1X2KA 1CKBA 3CQTA 2DYBA 1TUCA 1Z9QA 2H8HA 2DF6A 2JS0A 2DRMA 1JEGA 4HCKA 1LCKA 4J9EA 1SPKA 5IXFA 3M0UA 2ABLA 3GBQA 1YWPA 2KE9A 2W0ZA 3NGPA 2BZYA 2F2XA 1KJWA 1B3QA 4ORZA 1MV3A 2K79A 5EC7A 2O88A 1G83A 4CC2A 1W6XA 2IIMA 5GJVB 3H0IA 4J9FA 1PRLC 1VYTA 1XOVA 2LP5A 3EG0A 3UATA 2CREA 1KIKA 1ZUYA 2ROLA 1OV3A 2VWFA 2AKLA 5IH2A 2K7AA 2GTOA 2FO0A 2AK5A 2EGEA 3M0SA 1UDLA 4Z88A 1K0SA 2LZ6B 1W1FA 2G6FX 2LMJA 4M4ZA 3VRYA 4AG1C 3QWYA 1TUDA 5I22A 1A0NB 3M0RA 1M8MA 5I11A 2YT6A 1SEMA 2DLPA 4J9BA 2C0IA 2NWMA 3NHNA 3EG2A 2DVJA 3PE0A 2CUBA 2M0YA 1QWEA 2E5KA 2EYYA 2DNUA 2MCNA 1ZX6A 1NYFA 2EGAA 1X27A 2FRYA 4J9IA 1WA7A 2AZVA 3FJ5A 2FG0A 1GBRA 4AFUC 1GCPA 1MV0B 2HBWA 2HCKA 1VYUA 4IIOA 2J7IA 2ED1A 3ZL7C 2JMCA 2ECZA 4HVVA 1AVZC 2K2MA 2ROTA 3LH5A 1GFDA 1UECA 1VYVA 3VS3A 1UJYA 1M3AA 3C0CA 4AFQC 3H0HA 1K4US 1WXBA 2B86A 4F14A 3IQLA 2L3SA 3SEMA 1I07A 5IHKA 1AZEA 2FEIA 5IHIA 1YN8A 1S1NA 3VRZA 1H92A 1UHCA 4RTZA 1JXMA 4LE9A 2BZXA 1PWTA 2DX1A 1WX6A 1JO8A 2O9VA 1NLPC 2CSIA 1ARKA 3JV3A 4J9HA 1AD5A 2KBTA 1QKXA 1KSWA 3I5RA 1BB9A 3M0QA 2P4RA 2GNCA 2X3WD 4RUGA 2A28A 2FPDA 1X6GA 1IO6A 2V1RA 2CDTA 2O2OA 1E6HA 2L3PA 2PZ1A 2RQTA 2EBPA 2RN8A 1UHFA 1V1CA 1UE9A 3TSZA 2V1QA 2KRMA 4OMQA 1U3OA 1YP5A 2CT3A 4EIKA 1AWWA 1Y0MA 1YCSB 2KNBB 2DILA 1X2QA 3R6NA 2GBQA 1CSKA 4J9GA 4QT7A 4WCIA 4JJDA 4KRTA 4F17A 2DL7A 3PVLA 1GL5A 1WI7A 1GCQC 3UA6A 4LUDA 2KT8A 1H8KA 4RTTA 2FPEA 3H0FA 1U5SA 4DEYA 1WXTA 5FW9A 1K0XA 2EGCA 2JS2A 1WXUA 3EGUA 1E7OA 3VS2A 1H3HA 2JT4A 3VS5A 4E6RA 2BTTA 4RTYA 2D0NA 4FSSA 1SRMA 5IHNA 2CH4W 2LJ3A 1UGVA 2ESWA 1UTIA 2O9SA 3KFVA 2EQIA 2AKKA 1GCQA 1JQQA 1N5ZA 1PKSA 2D8HA 2LX7A 2RNAA 2A36A 1QCFA 1ABQA 2FRWA 4J9CA 2K3BA 2MOXA 4HVUA 1T3LA 2PTKA 5FWBA 2CSQA 2KR3A 1SSHA 1M27C 1WLPB 1ZSGA 1WYXA 2SEMA 4JJBA 2SRCA 1T0HA 2PNIA 2ENMA 4GBQA 2DRKA 1ZLMA 2EYZA 1AWOA 3H41A 2NUZA 2RQUA 2JW4A 1UUEA 2KT1A 1OPKA 3QWXX 4IIMA 2KRNA 1PKTA 2M51A 1J3TA 2DL3A 2RPNA 1SRLA 4Z8AA 1X43A 3VS4A 5IXBA 1OOTA 1KFZA 1TG0A 2L3QA 1ZUKA 2LJ0A 2DL4A 2LNHB 4K11A 2CT4A 1AWJA 1I0CA 1I1JA 1UFFA 2KXCA 4ZNXA 1UG1A 2JM8A 2KROA 4JZ3A 1QWFA 1X6BA 4OMLA 2HDAA 2QDLA 2AZSA 3NMZC 2DMOA 2RQRA 4RTVA 1VA7A 2GGRA 2MIOA 2DBKA 4OMNA 1ABOA 2YUOA 1RI9A 2DL8A 1AEYA 1U06A 4OMOA 2J05A 2VVKA 1BU1A 2J06A 2DE0X 1GBQA 1K1ZA 2EYXA 4LUEA 1QLYA 3ULRB 2YUQA 2K6DA 3REAB 3TVTA 1B07A 4LN2A 2ED0A 2O31A 1AOJA 2RF0A 2KXDA 2L0AA 2OAWA 2DL5A 2LQNA 1BBZA 4D8KA 4ESRA 2LJ1A 2XMFA 3O5ZA 4JJCA 1K76A 2YUPA 3EG1A 4AG2C 4JPBW 4Y92A 5FWCA 2HSPA 1FMKA 2EPDA 3UF4A 1RUWA 1T3SA 1NG2A 2C0TA 2GTJA 4D8DA 3A98A 2YSQA 2CH4A 4AFSC 2JXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AZG B;  1NEB A;  4J9D A;  1OEB A;  3I5S A;  4LNP A;  2DJQ A;  2I0N A;  3M0T A;  2EVR A;  4CC3 A;  2A08 A;  2JTE A;  3M0P A;  1M30 A;  2F2V A;  2RQW A;  4HXJ A;  4JZ4 A;  1Y57 A;  2C0O A;  2YDL A;  2KYM A;  2LCS A;  2YUN A;  3VS0 A;  1M3B A;  4OMP A;  3THK A;  2EKH A;  1FYN A;  4OMM A;  3VS6 A;  4F16 A;  4DEX A;  1YWO A;  3EHR A;  1PNJ A;  1GRI A;  4Z89 A;  1WDX A;  2LQW A;  2KYB A;  2RMO A;  4RTW A;  4GLM A;  2GQI A;  1NEG A;  2KRS A;  1EFN A;  1T0J A;  1G2B A;  2K9G A;  1UJ0 A;  1PRM C;  2OI3 A;  2VKN A;  3TSW A;  1PHT A;  4AFZ C;  3VS1 A;  1YNZ A;  2W10 A;  2J6K A;  1SHF A;  1ZUU A;  2DBM A;  1NLO C;  1WIE A;  3I9Q A;  2OJ2 A;  2KEA A;  3UA7 A;  1ZBJ A;  5L23 A;  3SHW A;  2X3X D;  1SHG A;  1AWX A;  2F2W A;  1E6G A;  4RTU A;  1K9A A;  1HJD A;  3VS7 A;  4HVW A;  4CC7 A;  1RLP C;  2FPF A;  3EHQ A;  2L2P A;  2DM1 A;  1BK2 A;  3RBB B;  2HEQ A;  1HD3 A;  3REB B;  4RTX A;  2EYW A;  2D1X A;  1RLQ C;  1WFW A;  1QKW A;  1GFC A;  1Z9Z A;  1W70 A;  3PVQ A;  1M3C A;  2JM9 A;  1MUZ A;  5GJW B;  2DA9 A;  2RQV A;  4CC4 B;  1NYG A;  1HSQ A;  4X1V A;  2D8J A;  3EG3 A;  1OPL A;  2BZ8 A;  1CKA A;  2J6O A;  3NPF A;  1JXO A;  3I35 A;  5ECA A;  4R0K A;  2EW3 A;  3U23 A;  2CUD A;  2KGT A;  4A63 B;  1JU5 C;  5HCK A;  1X69 A;  2JMA A;  1NM7 A;  3RNJ A;  2J6F A;  2A37 A;  1X2K A;  1CKB A;  3CQT A;  2DYB A;  1TUC A;  1Z9Q A;  2H8H A;  2DF6 A;  2JS0 A;  2DRM A;  1JEG A;  4HCK A;  1LCK A;  4J9E A;  1SPK A;  5IXF A;  3M0U A;  2ABL A;  3GBQ A;  1YWP A;  2KE9 A;  2W0Z A;  3NGP A;  2BZY A;  2F2X A;  1KJW A;  1B3Q A;  4ORZ A;  1MV3 A;  2K79 A;  5EC7 A;  2O88 A;  1G83 A;  4CC2 A;  1W6X A;  2IIM A;  5GJV B;  3H0I A;  4J9F A;  1PRL C;  1VYT A;  1XOV A;  2LP5 A;  3EG0 A;  3UAT A;  2CRE A;  1KIK A;  1ZUY A;  2ROL A;  1OV3 A;  2VWF A;  2AKL A;  5IH2 A;  2K7A A;  2GTO A;  2FO0 A;  2AK5 A;  2EGE A;  3M0S A;  1UDL A;  4Z88 A;  1K0S A;  2LZ6 B;  1W1F A;  2G6F X;  2LMJ A;  4M4Z A;  3VRY A;  4AG1 C;  3QWY A;  1TUD A;  5I22 A;  1A0N B;  3M0R A;  1M8M A;  5I11 A;  2YT6 A;  1SEM A;  2DLP A;  4J9B A;  2C0I A;  2NWM A;  3NHN A;  3EG2 A;  2DVJ A;  3PE0 A;  2CUB A;  2M0Y A;  1QWE A;  2E5K A;  2EYY A;  2DNU A;  2MCN A;  1ZX6 A;  1NYF A;  2EGA A;  1X27 A;  2FRY A;  4J9I A;  1WA7 A;  2AZV A;  3FJ5 A;  2FG0 A;  1GBR A;  4AFU C;  1GCP A;  1MV0 B;  2HBW A;  2HCK A;  1VYU A;  4IIO A;  2J7I A;  2ED1 A;  3ZL7 C;  2JMC A;  2ECZ A;  4HVV A;  1AVZ C;  2K2M A;  2ROT A;  3LH5 A;  1GFD A;  1UEC A;  1VYV A;  3VS3 A;  1UJY A;  1M3A A;  3C0C A;  4AFQ C;  3H0H A;  1K4U S;  1WXB A;  2B86 A;  4F14 A;  3IQL A;  2L3S A;  3SEM A;  1I07 A;  5IHK A;  1AZE A;  2FEI A;  5IHI A;  1YN8 A;  1S1N A;  3VRZ A;  1H92 A;  1UHC A;  4RTZ A;  1JXM A;  4LE9 A;  2BZX A;  1PWT A;  2DX1 A;  1WX6 A;  1JO8 A;  2O9V A;  1NLP C;  2CSI A;  1ARK A;  3JV3 A;  4J9H A;  1AD5 A;  2KBT A;  1QKX A;  1KSW A;  3I5R A;  1BB9 A;  3M0Q A;  2P4R A;  2GNC A;  2X3W D;  4RUG A;  2A28 A;  2FPD A;  1X6G A;  1IO6 A;  2V1R A;  2CDT A;  2O2O A;  1E6H A;  2L3P A;  2PZ1 A;  2RQT A;  2EBP A;  2RN8 A;  1UHF A;  1V1C A;  1UE9 A;  3TSZ A;  2V1Q A;  2KRM A;  4OMQ A;  1U3O A;  1YP5 A;  2CT3 A;  4EIK A;  1AWW A;  1Y0M A;  1YCS B;  2KNB B;  2DIL A;  1X2Q A;  3R6N A;  2GBQ A;  1CSK A;  4J9G A;  4QT7 A;  4WCI A;  4JJD A;  4KRT A;  4F17 A;  2DL7 A;  3PVL A;  1GL5 A;  1WI7 A;  1GCQ C;  3UA6 A;  4LUD A;  2KT8 A;  1H8K A;  4RTT A;  2FPE A;  3H0F A;  1U5S A;  4DEY A;  1WXT A;  5FW9 A;  1K0X A;  2EGC A;  2JS2 A;  1WXU A;  3EGU A;  1E7O A;  3VS2 A;  1H3H A;  2JT4 A;  3VS5 A;  4E6R A;  2BTT A;  4RTY A;  2D0N A;  4FSS A;  1SRM A;  5IHN A;  2CH4 W;  2LJ3 A;  1UGV A;  2ESW A;  1UTI A;  2O9S A;  3KFV A;  2EQI A;  2AKK A;  1GCQ A;  1JQQ A;  1N5Z A;  1PKS A;  2D8H A;  2LX7 A;  2RNA A;  2A36 A;  1QCF A;  1ABQ A;  2FRW A;  4J9C A;  2K3B A;  2MOX A;  4HVU A;  1T3L A;  2PTK A;  5FWB A;  2CSQ A;  2KR3 A;  1SSH A;  1M27 C;  1WLP B;  1ZSG A;  1WYX A;  2SEM A;  4JJB A;  2SRC A;  1T0H A;  2PNI A;  2ENM A;  4GBQ A;  2DRK A;  1ZLM A;  2EYZ A;  1AWO A;  3H41 A;  2NUZ A;  2RQU A;  2JW4 A;  1UUE A;  2KT1 A;  1OPK A;  3QWX X;  4IIM A;  2KRN A;  1PKT A;  2M51 A;  1J3T A;  2DL3 A;  2RPN A;  1SRL A;  4Z8A A;  1X43 A;  3VS4 A;  5IXB A;  1OOT A;  1KFZ A;  1TG0 A;  2L3Q A;  1ZUK A;  2LJ0 A;  2DL4 A;  2LNH B;  4K11 A;  2CT4 A;  1AWJ A;  1I0C A;  1I1J A;  1UFF A;  2KXC A;  4ZNX A;  1UG1 A;  2JM8 A;  2KRO A;  4JZ3 A;  1QWF A;  1X6B A;  4OML A;  2HDA A;  2QDL A;  2AZS A;  3NMZ C;  2DMO A;  2RQR A;  4RTV A;  1VA7 A;  2GGR A;  2MIO A;  2DBK A;  4OMN A;  1ABO A;  2YUO A;  1RI9 A;  2DL8 A;  1AEY A;  1U06 A;  4OMO A;  2J05 A;  2VVK A;  1BU1 A;  2J06 A;  2DE0 X;  1GBQ A;  1K1Z A;  2EYX A;  4LUE A;  1QLY A;  3ULR B;  2YUQ A;  2K6D A;  3REA B;  3TVT A;  1B07 A;  4LN2 A;  2ED0 A;  2O31 A;  1AOJ A;  2RF0 A;  2KXD A;  2L0A A;  2OAW A;  2DL5 A;  2LQN A;  1BBZ A;  4D8K A;  4ESR A;  2LJ1 A;  2XMF A;  3O5Z A;  4JJC A;  1K76 A;  2YUP A;  3EG1 A;  4AG2 C;  4JPB W;  4Y92 A;  5FWC A;  2HSP A;  1FMK A;  2EPD A;  3UF4 A;  1RUW A;  1T3S A;  1NG2 A;  2C0T A;  2GTJ A;  4D8D A;  3A98 A;  2YSQ A;  2CH4 A;  4AFS C;  2JXB A; 
#chains in the Genus database with same CATH topology
 1NEB A;  3PFS A;  4J9D A;  6AT1 B;  4ZTJ A;  1Q86 U;  2COW A;  4CC3 A;  2A08 A;  4J6X A;  1Y57 A;  3SFM A;  1P92 A;  3OS1 A;  3OY9 A;  3HHT B;  1NBE B;  3FLG A;  1JJ2 P;  2HMA A;  2YDL A;  4M77 A;  3VS0 A;  1TWB A;  2EKH A;  2RA2 A;  3VS6 A;  5HK0 A;  1XTD A;  2NUP A;  1VQN T;  1QCN A;  5KYW B;  4HCB A;  1S72 Q;  4HT9 A;  4M78 E;  1GRI A;  3V8L A;  1WDX A;  3CCL A;  2GQI A;  1IB8 A;  2KRS A;  1EFN A;  1T0J A;  4UC4 A;  1G2B A;  4M75 F;  4JUV A;  4KBM B;  1EIF A;  2ZPE B;  3LGF A;  2EIF A;  1PRM C;  1OYX A;  2OI3 A;  2VKN A;  2DXB A;  4C5E A;  3M59 A;  3EGD A;  2R5A A;  3G4S Q;  1SHF A;  1ZUU A;  1IGU A;  2E70 A;  3CPF A;  2CP3 A;  1WIE A;  5KCO A;  1QCO A;  3I9Q A;  2OJ2 A;  2CP0 A;  2RJC A;  3QZ9 B;  1OU9 A;  1ZBJ A;  5AT1 B;  8ATC B;  1MND A;  2GFU A;  1SHG A;  1VQP Q;  1AWX A;  3NTH A;  1TUG B;  3TEE A;  4RTU A;  3VS7 A;  4HVW A;  4M7D B;  4CC7 A;  3QJ6 A;  4IUR A;  3EAE A;  1VQK T;  3CC2 T;  1NJI C;  2L2P A;  1BCM A;  4L6V 5;  3RBB B;  5GMK e;  4L5G A;  1MMG A;  4ZGD B;  3OS2 A;  5CIU A;  4RTX A;  1D0Y A;  1VQ6 T;  2D1X A;  2I2L A;  1VQ5 T;  3NTK A;  2RHI A;  1KK7 A;  2LX9 A;  2BKD N;  1OI1 A;  9ATC B;  2QEX T;  2AT1 B;  4HA8 A;  4KUI A;  1ZA2 B;  4CC4 B;  2PVD B;  2OX7 A;  2OTJ A;  8AT1 B;  1VQO A;  3X25 B;  2QTX A;  4A4G A;  1ACM B;  4R0K A;  2EW3 A;  2O4X B;  4P5N A;  3HRT A;  5HCK A;  1X69 A;  2HKQ B;  4R55 A;  2JMA A;  3BY7 A;  2EQK A;  3RNJ A;  2Y4X A;  4OGE A;  4R56 A;  2F1L A;  2DK3 A;  2E5Q A;  4A4H A;  5KYX B;  3SWN B;  4J9E A;  1LCK A;  3V8K A;  3FDR A;  1SPK A;  3FJP A;  3OYD A;  2KE9 A;  3NGP A;  2F2X A;  1KJW A;  3GP8 A;  2YHT A;  4NL2 A;  2VAS A;  5CO7 A;  2EWN A;  2AHJ B;  3QYG B;  3I56 Q;  1S72 A;  3OYG A;  1G83 A;  4CC2 A;  1FMV A;  1V29 B;  4J9F A;  1XOV A;  3URG A;  3EG0 A;  3PGG A;  3CC4 A;  1KHI A;  4QVC A;  2ROL A;  1YHQ T;  1KIK A;  2VWF A;  4KGX B;  4N0A C;  5IH2 A;  1YIJ Q;  1QVF S;  2K7A A;  2FO0 A;  3OYM A;  3CCR A;  4XTZ A;  1UDL A;  4OB1 B;  1K0S A;  2LMJ A;  4AG1 C;  1SF9 A;  4VUB A;  3QWY A;  4M77 D;  4IUP A;  1TUD A;  1I5O B;  2K2V A;  3JB9 J;  4MDX A;  4M78 G;  1A0N B;  2HL3 A;  2QA4 Q;  4J6Y A;  1M8M A;  5I11 A;  5GAN 8;  5GMK m;  4M78 C;  1SEM A;  1H3Z A;  4J9B A;  4EMG A;  1YJ9 A;  5GAN 7;  4PFO A;  2CP5 A;  2IG0 A;  3EG2 A;  3NTI A;  4CI0 C;  2M0Y A;  3DLL A;  2DNU A;  1YIT Q;  2MCN A;  4OVA A;  2EGA A;  3L2R A;  1MHN A;  1WA7 A;  5LJ5 j;  3OYA A;  3LWI A;  4AFU C;  1QVF P;  2QTV A;  3S3O A;  4IIO A;  2RJE A;  1GFD A;  1AVZ C;  5GAM h;  1VYV A;  3RDV A;  3CBO A;  5CKD A;  1M3A A;  3CMA T;  2OTL A;  4NS5 A;  3A1P A;  3PMI A;  4AFQ C;  2KDS A;  3H0H A;  2X4X A;  4PKC C;  1Q86 R;  2PVO B;  4F14 A;  3CBM A;  2K4Y A;  3IQL A;  4V2S A;  5CKB A;  4QVZ A;  5IHI A;  1YN8 A;  3QPH A;  3N5B B;  3VRZ A;  4PK4 A;  3KXT A;  1N9S A;  2QQS A;  1JXM A;  4J5Y A;  2O9V A;  1M2V B;  1NLP C;  4FW2 A;  1OX9 A;  1LNX A;  1IZ6 A;  3Q1J A;  3JV3 A;  1BI2 A;  1VQ7 T;  3MPU B;  4QVD A;  2X3W D;  1M8V A;  3OYH A;  4PJO A;  2FPD A;  1X6G A;  1IO6 A;  4XAX B;  3JCM h;  3CPW S;  1E6H A;  2EBP A;  4FT2 A;  5FU6 C;  2V1Q A;  1U3O A;  4M77 F;  2CT3 A;  3ZFJ A;  1Y0M A;  2KNB B;  2DIL A;  3CC7 T;  5FU7 C;  3OYE A;  3LX7 A;  4PL6 A;  4WCI A;  3JCM P;  4DA4 A;  1WHJ A;  4C0D C;  5DLO A;  1GCQ C;  1SKU B;  3CCM T;  5GAO l;  1H8K A;  2CGH A;  4RCB A;  5FRN A;  2FPE A;  5I21 A;  3H0F A;  1WZO A;  1WXT A;  5FW9 A;  2LVM A;  2CP7 A;  1I4K 1;  3P8B B;  2KI7 A;  3CPW P;  3EGU A;  4IUU A;  3J7A F;  3MET A;  2WSC E;  2VC8 A;  4O5V A;  2RH2 A;  3JB9 I;  2DD4 A;  2NUT B;  2WSE E;  1YIT A;  2COZ A;  5GMK h;  3G71 T;  4M7A F;  1X75 C;  2XID A;  1JQQ A;  1IHV A;  2RNA A;  1PKS A;  2RJF A;  1OZ3 A;  1B7T A;  3C4S A;  1Q81 C;  1M4Z A;  1WLP B;  1WYX A;  5HKC A;  3UWN A;  2PNI A;  4C8Q E;  1M5Q 1;  5LJ3 h;  2LT4 A;  2EQM A;  2DJZ A;  4PJM A;  5LJ5 d;  2EYZ A;  2NUZ A;  3OS0 A;  1YCY A;  3TQ7 P;  3SDZ A;  3UT1 A;  4JJN K;  3VS4 A;  3EFS A;  1OOT A;  1K9M C;  1TG0 A;  2KY9 A;  1VQ8 Q;  1KG1 A;  1PSE A;  5GAN h;  1PD0 A;  3JCM W;  3PIO A;  1OQK A;  3PIP A;  2V8J A;  4ZNX A;  4E47 A;  1UG1 A;  4JZ3 A;  5GAO r;  1C6V X;  1QWF A;  2HDA A;  1K8A U;  4GY5 A;  2DMO A;  2M02 A;  4JRI A;  4DOW A;  4RMO A;  2FB7 A;  4XTU A;  1YJW A;  2E12 A;  1KD1 U;  2R5M A;  5GAM g;  1ABO A;  4HCZ A;  2YUO A;  4RCC A;  1YI2 Q;  1F1B B;  1RI9 A;  1VQL A;  4BUG A;  1RAG B;  1BU1 A;  1M1K C;  2DE0 X;  4E7S A;  5C6S A;  2YUQ A;  2K6D A;  5LL6 S;  1N6A A;  1B07 A;  4J7F A;  3EGX A;  2O31 A;  2YRV A;  2RF0 A;  3V7S A;  3ER0 A;  4M78 B;  5KYU B;  1BI0 A;  5A0G A;  2NLU A;  4F7U G;  3UPU A;  4D8K A;  4JJC A;  4EMK C;  4BY6 C;  1OU8 A;  3EG1 A;  4AG2 C;  4JPB W;  1QVF A;  1TS9 A;  2HBP A;  3FRN A;  1D0X A;  2H3J A;  3JCM g;  3A98 A;  4E7Z A;  1H64 1;  3EG9 A;  5LJ3 j;  1AZG B;  1TU0 B;  3MO8 A;  4Z02 A;  1WJR A;  1M1F A;  4GLK A;  4PFZ A;  3M0T A;  2EVR A;  2LQ8 A;  5LJ5 e;  3M0P A;  2C0O A;  1LVK A;  3BE3 A;  3SB2 A;  1EZZ B;  2JN0 A;  2KYM A;  1Q82 R;  2KQW A;  5GAN j;  1IRX A;  3NFC A;  3FIF A;  3CCJ A;  4F16 A;  1RAF B;  1G3S A;  4DEX A;  3VYH B;  3JCM b;  3QBY A;  1KHC A;  1PNJ A;  5I2M A;  4Z89 A;  2ZZD A;  3JB9 F;  4RTW A;  3RR6 A;  3CCE A;  4GLM A;  1I81 A;  3HRU A;  3CD6 A;  3C95 A;  2DER A;  1UEB A;  2EYQ A;  2XK0 A;  3JRZ A;  1BKB A;  3L2W A;  1PHT A;  1PD1 A;  5FU6 B;  3CCQ T;  3CCL Q;  3VS1 A;  1VQ8 A;  1YNZ A;  3CCV T;  2DBM A;  4IUQ A;  3QDF A;  3CME T;  4C8Q G;  4PJO F;  4C8Q C;  3OW2 S;  4C92 E;  2KEA A;  5FU7 B;  3JCM d;  5GAM f;  1RAI B;  5M9O A;  2D6F A;  4C0D B;  3OYI A;  3ZBD A;  4TVR A;  1QVG A;  3CPW A;  1K9A A;  1MNE A;  3MCA B;  1R0C B;  5LJ3 g;  2D9T A;  2DM1 A;  3VV0 A;  3GF5 A;  3LH0 A;  3OSS C;  2HD0 A;  2KK4 A;  1WFW A;  3G6E A;  1QKW A;  1S72 T;  5A0D A;  1W70 A;  1M3C A;  1EX4 A;  3OW2 P;  5GAN g;  5GMK l;  2L89 A;  3CEY A;  5CVI A;  5ECA A;  2X4W A;  4A63 B;  1N9R A;  3OYC A;  3G4S T;  3JAM E;  2OTJ Q;  3QKJ A;  2Y4Y A;  3MEA A;  1CKB A;  3HL8 A;  3CQT A;  2RD1 A;  1VQM A;  1Z9Q A;  2JS0 A;  3J81 E;  1G3T A;  3QZ5 B;  2K3Y A;  2OAU A;  2QQA A;  1VQP T;  1YWP A;  2LCC A;  4J7I A;  1N8R U;  3A8H B;  2BZY A;  5HY6 A;  4QQ6 A;  5LJ3 d;  1MV3 A;  3EH1 A;  1Q7Y C;  5EC7 A;  2MF2 A;  1K8A R;  5GJV B;  3A8M B;  1W2B P;  2LP5 A;  5GAN 3;  3JCM e;  2CRE A;  1QW1 A;  1KD1 R;  1NJI U;  3AT1 B;  2GTO A;  2AK5 A;  3M0S A;  4Z88 A;  5CCA A;  3F70 A;  5GAN d;  2PU9 B;  1KC8 R;  3KUF A;  2ZPB B;  3I55 A;  4XTX A;  3CC4 Q;  3HSB A;  1BIA A;  1D3B B;  4N4I A;  3CCR Q;  5KYY B;  4E7H A;  1ZQ1 A;  2CKK A;  2HZY A;  4M75 G;  2DFU A;  2E5K A;  3OMG A;  2HQH A;  4M75 C;  1MMN A;  1X27 A;  2FRY A;  1ZSZ C;  2ZGW A;  4J9I A;  1YJ9 Q;  1N8R C;  2MI6 A;  4F7U B;  4EMK B;  4BY6 B;  4ZN1 A;  3EFO A;  1BI3 A;  3MJX A;  2Y90 A;  4C0Z A;  4C92 G;  2YWW A;  3ZL7 C;  5KCH A;  4C92 C;  2ECZ A;  2K2M A;  3C94 A;  4M7A A;  1UEC A;  1WHK A;  4MZM A;  3DKM A;  4C5G A;  3S6W A;  3I56 T;  3RKW A;  2RJD A;  3TCJ A;  2M16 A;  1I07 A;  2P4T A;  1YIJ T;  3CCU A;  1AT1 B;  4XQ3 A;  3OS5 A;  2OTL Q;  4RTZ A;  4XTW A;  2BZX A;  1PWT A;  2DX1 A;  2IPO B;  2P84 A;  1JB0 E;  2FZG B;  5LJ5 h;  4PFP A;  1AD5 A;  4NL3 A;  2QA4 T;  5LJ3 e;  3QXE B;  4PJL A;  4C5I A;  2A28 A;  5GAN 2;  3A5Z B;  2CDT A;  4PNO A;  2PZ1 A;  2XHC A;  5D6X A;  1UHF A;  1V1C A;  1YIT T;  3TSZ A;  4OMQ A;  1YP5 A;  4M77 E;  4ELZ C;  5CKF A;  5GAN e;  3JSC A;  4KRT A;  4ELY C;  4BDY A;  2X4Y A;  3QUI A;  3HKS A;  4C8Q B;  2HQX A;  3UA6 A;  2RB6 A;  1JBM A;  3ME9 A;  2E3H A;  3CCS A;  3OYL A;  3RIR A;  1U5S A;  4E2F B;  2EGC A;  2JS2 A;  3HTR A;  1H3H A;  3OB9 A;  3VS5 A;  4E6R A;  2BTT A;  2EJ9 A;  4E7J A;  4RTY A;  2D0N A;  3GPL A;  2DVE A;  3OYJ A;  4JRK A;  2K5L A;  3X28 B;  1DJ7 B;  2ESW A;  1UTI A;  2DXU A;  2ZPF B;  2DD5 A;  2O9S A;  3KFV A;  4XU1 A;  2VXE A;  2D8H A;  2XIC A;  2YXY A;  1VQ9 A;  2A36 A;  4PJN A;  2RHX A;  2FRW A;  4J8O A;  2LRQ A;  1VQ5 Q;  2K3B A;  4M7D A;  4HVU A;  3M9Q A;  5FWB A;  4LDW A;  2QEX Q;  1HK9 A;  2V26 A;  2CSQ A;  2M0O A;  2KR3 A;  1SSH A;  3L42 A;  4FSX A;  1TOV A;  1FWZ A;  1T0H A;  1MGQ A;  5IAY A;  2K5F A;  4GBQ A;  4B6M A;  2L3R A;  2DRK A;  1MMA A;  4N4G A;  1Y71 A;  4QQD A;  1RAD B;  1AWO A;  3J80 E;  2RQU A;  2GQV A;  1UUE A;  3QWX X;  2QQB A;  1PKT A;  4ZGE B;  2RK1 A;  2DL3 A;  1X6O A;  2EKO A;  4X9C A;  5IXB A;  2O4X A;  1ZUK A;  2ZCF B;  1BI1 A;  2DKG A;  3RKX A;  4M7A D;  2LNH B;  1JJ2 A;  2CT4 A;  2QK0 A;  1I1J A;  2E6Z A;  2KRO A;  1QMC A;  5IT9 E;  2AZS A;  1VQN A;  2NYS A;  5KYX A;  2DXT A;  5CKH A;  3RMQ A;  3SWN A;  2MIO A;  4XU2 A;  1IRE B;  2VGN A;  4DOV A;  2DEU A;  4XTV A;  2K57 A;  1YJW Q;  1K1Z A;  4F7U E;  2EYX A;  3P8D A;  1QLY A;  4LUE A;  3DB3 A;  2E41 A;  2ED0 A;  1Y96 B;  1M90 C;  2OAW A;  4LDX A;  2ZAE A;  2DL5 A;  3C12 A;  1C0M A;  1LPL A;  1VQL Q;  1BBZ A;  1Q81 U;  3RER A;  2XMF A;  4M77 G;  3E2U A;  1K76 A;  4M77 C;  5LJ5 g;  4M75 B;  2X9H A;  3L1A A;  1SG5 A;  2C06 A;  4LDV A;  1ZSZ B;  5FWC A;  2JVV A;  1FMK A;  2EPD A;  4BI3 A;  1RUW A;  5KH6 A;  2C0T A;  3OMC A;  2CZ0 B;  4AFS C;  1PM3 A;  1VQK A;  2GFA A;  4C92 B;  3CC2 A;  4J6W A;  1OEB A;  4XK8 E;  1N27 A;  2FHD A;  5CQX A;  5J3B A;  1K9M U;  2I0N A;  1VQ6 A;  4A53 A;  2EJG A;  3M4Y A;  2JTE A;  1BIB A;  1VQ5 A;  2RQW A;  1PG5 B;  4HXJ A;  3SD4 A;  2QEX A;  2XKO C;  1K73 C;  1YI2 T;  2LCS A;  4QQG A;  1M3B A;  2BUD A;  3THK A;  2X35 A;  3OBW A;  4Y91 A;  1NPP A;  1Q82 C;  5A0L A;  3EHR A;  4A4K A;  1X01 A;  2O01 E;  2KYB A;  2RMO A;  4RG2 A;  3GLX A;  1NEG A;  5CAI A;  3CCJ Q;  4LD6 A;  1M1K U;  5KE2 A;  3MEV A;  3EG9 B;  4XU3 A;  4M7D D;  3TSW A;  2QAS A;  4AFZ C;  3CCE Q;  3CD6 Q;  2W10 A;  1RI0 A;  3MKD A;  1Y07 A;  3UA7 A;  2QGG A;  1XJW B;  1SSF A;  4JRQ A;  3QDR B;  1RAB B;  3JCM Q;  4QW2 A;  2YRC A;  4E7I A;  3MP8 A;  3L2Q A;  5FRM A;  1KQ1 A;  1HJD A;  1D1C A;  1RLP C;  1Y7X A;  1YHQ A;  3JB9 D;  2IVW A;  1FX7 A;  3EHQ A;  4KGV B;  4E7L A;  2PQW A;  3HFN A;  3REB B;  4Q5W A;  2EYW A;  4XTY A;  5LJ5 f;  3V7C A;  3E9G A;  1Z9Z A;  3PVQ A;  3EH2 A;  4IUV A;  3H9N A;  1U8R A;  2RI5 A;  2HKN A;  2JM9 A;  3PTA A;  2DIQ A;  1MUZ A;  5GJW B;  2E4H A;  1NYG A;  2JUF A;  4X1V A;  4PJO D;  2RHU A;  3G6E Q;  4A4F A;  3V7R A;  1QVP A;  2BZ8 A;  1CKA A;  4BDZ A;  1JXO A;  3U23 A;  2CUD A;  2KGT A;  1JU5 C;  3CCL T;  2E3I A;  1GXI E;  1NM7 A;  1NZ9 A;  2XDB A;  2A37 A;  4FYY B;  1TUC A;  2NUT A;  3LYI A;  2CZ6 B;  2DRM A;  3P8H A;  3RUX A;  4HCK A;  4JLI A;  2MWP A;  4M7D F;  5IXF A;  3CMA A;  3M0U A;  3GBQ A;  4BE1 A;  5J39 A;  4OP0 A;  2CZ7 B;  3E19 A;  1VQM Q;  2E6N A;  4PLL A;  1RAH B;  4FCY A;  4ORZ A;  2K79 A;  3WVD B;  2O88 A;  3H0I A;  2XU8 A;  1PRL C;  3UAT A;  2B8A A;  1ZUY A;  1R0B G;  1VQ7 A;  4J83 A;  4FT4 A;  5FLX E;  4EDU A;  1WJS A;  2E64 A;  3L2V A;  3VRY A;  2XI9 A;  1KQS S;  1KC8 C;  4M75 E;  2RHZ A;  3M0R A;  3HPW A;  2YT6 A;  1VOM A;  1RAE B;  1WHL A;  4MMK A;  5IN1 A;  3I55 Q;  4FM4 B;  1VQO T;  2OTJ T;  4LDY A;  3OYB A;  3CC7 A;  4OGC A;  2BIV A;  3OBY A;  1IGQ A;  4ZN3 A;  3FJ5 A;  3M4G A;  4N0A A;  3CCM A;  4M77 B;  2HBW A;  2MK5 A;  3QYH B;  4C0F A;  2EFI A;  4EPC A;  4PJO G;  2NUP B;  1VYU A;  5GAO n;  4DQ2 A;  4PJO C;  4HVV A;  2ROT A;  3VS3 A;  2HQE A;  1UJY A;  2DTO A;  3TRE A;  3C0C A;  1KQS P;  3WVE B;  4M78 A;  3LWH A;  1K4U S;  5KYU A;  4AT1 B;  2LQK A;  3SEM A;  1D1A A;  2FEI A;  1Q7Y U;  2DTH A;  1S1N A;  1BCO A;  2QG9 B;  2EQJ A;  1XQH A;  1UHC A;  3EGD B;  5D7U A;  3G71 A;  1WX6 A;  3RKY A;  1V76 A;  3JCM f;  1JO8 A;  3CC4 T;  1W4S A;  3QO3 A;  5GAO p;  1ARK A;  5EG2 A;  3CCU Q;  4J9H A;  4WF2 A;  1QKX A;  1KSW A;  3CCR T;  4WTO B;  2P4R A;  3EFO B;  2EQU A;  1W2B S;  2FYK A;  2O2O A;  4IKF A;  4OMF B;  2RN8 A;  3LLR A;  4M7A B;  1UE9 A;  5KE3 A;  2KRM A;  2DTI A;  3HP9 A;  4EIK A;  3VYG A;  1YJ9 T;  1LOJ A;  1AWW A;  4ZGJ B;  1WHG A;  1X2Q A;  2GBQ A;  3E1S A;  4J9G A;  4F04 B;  2CS7 A;  1BYM A;  4HKE A;  2DL7 A;  3WXM B;  1WPY A;  1TH7 A;  1GL5 A;  1G3Y A;  3EFR A;  3OA6 A;  3JB9 H;  3FEO A;  1WQW A;  1UGS B;  2A7Y A;  4LXC A;  4HCC A;  3DB4 A;  1K0X A;  5GAN 4;  2OTL T;  2AIR B;  2R58 A;  2JT4 A;  3CCS Q;  1SRM A;  5IHN A;  2LJ3 A;  4DBR A;  1ZBX A;  1PCX A;  3D7S B;  1GCQ A;  2LX7 A;  2FVU A;  1QCF A;  4J9C A;  2MOX A;  2KSS A;  5LJ3 f;  2ZPH B;  2FZC B;  1T3L A;  2PTK A;  2COY A;  3JCM V;  2PVG B;  1PSF A;  4OB2 B;  1M27 C;  1ZSG A;  2VYT A;  4JJB A;  1VQ9 Q;  5CKE A;  2XG8 D;  3RES A;  3BDL A;  3PNW C;  1ZLM A;  3H41 A;  1ZHI A;  5GAN f;  2JOY A;  2JW4 A;  2KT1 A;  2G3R A;  1OPK A;  3H8Z A;  2KRN A;  3KBG A;  2M51 A;  3QJY A;  2RPN A;  1SRL A;  4C92 F;  3OSV A;  1VQ4 Q;  1KFZ A;  1YJN Q;  1Q86 C;  2LJ0 A;  3VKI A;  2DL4 A;  1AWJ A;  1UFF A;  2KXC A;  2JM8 A;  2DXC A;  4E7K A;  4M78 D;  1UGR B;  3HRS A;  4RKU E;  4MZP A;  1X6B A;  4FYV B;  4OML A;  4B9W A;  1I5L A;  4IUT A;  4MZT A;  1M1G A;  2RQR A;  2QQR A;  4RTV A;  1FXX A;  1O75 A;  1NPR A;  2LT1 A;  4OB3 B;  1WGS A;  1B34 A;  4BAC A;  2DL8 A;  3M56 A;  1IXD A;  1G3W A;  4OMO A;  2CZ1 B;  1VQN Q;  2XDD A;  2VXF A;  3ULR B;  3REA B;  3QSU A;  4LN2 A;  2L5Q A;  4BE2 A;  3CCQ A;  2L0A A;  4X9D A;  2DO3 A;  2Z0W A;  3CCV A;  1QP3 A;  4FYX B;  3CME A;  4ESR A;  2LJ1 A;  2DPP B;  5KYW A;  3VJP A;  2HAX A;  4Y92 A;  4L59 A;  3O8V A;  3UF4 A;  2JNG A;  1M2O A;  4PLI A;  1T3S A;  1NG2 A;  4KH0 B;  4MML A;  2GTJ A;  5DM7 R;  2YSQ A;  1D3B A;  1KQS A;  1PC0 A;  5KYY A;  2JXB A;  2KVQ G;  4PJO B;  2YLC A;  2DYI A;  3I5S A;  2KAF A;  4LNP A;  3JCM c;  3OYN A;  2F5K A;  1Q7Y R;  1OUL A;  2DJQ A;  2A3L A;  2CP6 A;  1I8F A;  2L8D A;  1VQK Q;  1M30 A;  2F2V A;  4O6J A;  3OW2 A;  4JZ4 A;  1O9S A;  3H6Z A;  3CC2 Q;  3OYY A;  4F7U A;  4EMK A;  2YUN A;  4OMP A;  4M7A E;  4LD9 K;  1FYN A;  3OYK A;  4OMM A;  1VQ6 Q;  3CBP A;  2XD0 A;  1R77 A;  4M78 F;  1YJW T;  1YWO A;  2P0K A;  4A4E A;  2LQW A;  1HYO A;  1VIE A;  1AHJ B;  3M5A A;  3GIB A;  1OX8 A;  3G4S A;  1VQL T;  2K9G A;  3INZ A;  1HXD A;  3A8L B;  1UJ0 A;  1VQ4 A;  4DBF A;  1M90 U;  4ATO A;  1YJN A;  2J6K A;  2F5T X;  2QI2 A;  1VQP A;  1N8R R;  2A0F B;  1NLO C;  5C0M A;  4PJJ A;  2QYZ A;  4BB7 A;  3MP1 A;  5L23 A;  3SHW A;  2X3X D;  3BDU A;  2BE9 B;  2F2W A;  1W2B A;  1E6G A;  3LGL A;  2LTO A;  1NJI R;  2QQ9 A;  4BI4 A;  2FPF A;  1G8X A;  2LCL A;  1MMD A;  1BK2 A;  1Q95 G;  4BD3 A;  2DIG A;  2M9U A;  3X26 B;  2HEQ A;  1HD3 A;  4DBQ A;  1RLQ C;  7AT1 B;  3BW1 A;  1YHQ Q;  1GFC A;  2RI2 A;  4ZTF A;  1K73 U;  4C8Q A;  3M57 A;  1D1B A;  2DA9 A;  2RQV A;  1VIF A;  2JTM A;  4KUL A;  4B9X A;  3M55 A;  3CCJ T;  3VUB A;  1Q82 U;  1HSQ A;  2D8J A;  5HK3 A;  5GAN 5;  3EG3 A;  1OPL A;  2HNI A;  2J6O A;  3M58 A;  3NPF A;  3I35 A;  3CCE T;  1QVG S;  3CD6 T;  4JDS A;  4JS4 A;  2J6F A;  3GNG A;  1X2K A;  4NOY A;  2MPX C;  2VUB A;  4OB0 B;  2DYB A;  2H8H A;  3JCM X;  2DF6 A;  1VQ8 T;  3BFM A;  1JEG A;  3CXC S;  2MMP A;  3X20 B;  3I56 A;  4M7D E;  1C1A A;  1R8O B;  2ABL A;  1ZA1 B;  1NE8 A;  2W0Z A;  4JS5 A;  1WHH A;  3PMT A;  3L2U A;  1B3Q A;  1YIJ A;  3EGX B;  5KYN A;  3CMA Q;  2RM4 A;  4KT0 E;  1U1T A;  1W6X A;  2IIM A;  2CP2 A;  1VYT A;  1QVG P;  1G5V A;  1OV3 A;  2AKL A;  2YLB A;  2QA4 A;  2EGE A;  5GAM j;  2LZ6 B;  4LDU A;  3ZEH A;  3GNF B;  4M7A G;  1W1F A;  2G6F X;  4M4Z A;  2RHY A;  4M7A C;  3G6E T;  4RG8 A;  3CXC P;  5CR2 A;  1D09 B;  1RL2 A;  3V8J A;  5I22 A;  2F69 A;  2LNV A;  1VQ7 Q;  1RAC B;  2DLP A;  5I2S A;  2C0I A;  2NWM A;  1UB4 A;  3NHN A;  3PE0 A;  2DVJ A;  2CUB A;  5DLQ E;  1FMW A;  1QWE A;  2EYY A;  2JTF A;  1M2V A;  3HFO A;  1LJO A;  2VGM A;  1ZX6 A;  1NYF A;  2K3X A;  4PJO E;  1QP2 A;  2AZV A;  1WQ7 A;  2FL7 A;  4N4H A;  2FG0 A;  1GBR A;  1GCP A;  1MV0 B;  3CC7 Q;  4FU6 A;  2QXF A;  2HCK A;  2VV5 A;  1VQM T;  2J7I A;  2ED1 A;  2JMC A;  1U1S A;  5CK9 A;  3LH5 A;  2QGF B;  3S3M A;  1Y96 A;  4C0G A;  2V8K A;  3CCM Q;  1VUB A;  1WXB A;  2B86 A;  1QQJ A;  1TTH B;  2L3S A;  5IHK A;  1AZE A;  2EJF A;  2ZPI B;  4X34 A;  4BE0 A;  3RMS A;  4M75 A;  4FIB A;  1UGQ B;  4FW1 A;  1H92 A;  4LE9 A;  1ZSZ A;  3G7Z A;  2FZK B;  2M1H A;  3VUZ A;  5A2Q E;  2WAC A;  4D6W A;  3R6O A;  2CSI A;  5AYF A;  2ZPG B;  2DAQ A;  2HL5 C;  2KBT A;  2X51 A;  2YRD A;  2VB6 A;  1BB9 A;  3I5R A;  3M0Q A;  4AMC A;  2GNC A;  4C92 A;  4C8Q D;  4RUG A;  3G71 Q;  4JRP A;  3QHS A;  3I55 T;  2V1R A;  1KC8 U;  2L3P A;  2RQT A;  4F7U F;  5J26 A;  2E1H A;  1M90 R;  2MWO A;  1OZ2 A;  3QG1 A;  2EAY A;  2KMT A;  3OYF A;  1YCS B;  2MAM A;  3R6N A;  2E10 A;  1CSK A;  5D6Y A;  4QT7 A;  5GMK j;  2DET A;  4JJD A;  2DZC A;  4F17 A;  3PVL A;  4JLG A;  1WI7 A;  4DBH A;  2RI3 A;  2V8I A;  4LUD A;  2HSE B;  4M7D G;  2KT8 A;  3M54 A;  4M7D C;  4RTT A;  1KQ2 A;  2LDM A;  4DEY A;  5GMK i;  1WXU A;  4KGZ B;  1E7O A;  1TSF A;  3GOX A;  1K8A C;  3VS2 A;  3JCM J;  4FYW B;  3FB9 A;  4ANJ A;  1KD1 C;  4KH1 B;  1WJQ A;  2JJ9 A;  4FSS A;  4CRI A;  2PUO B;  1K73 R;  4BI8 B;  2BE7 D;  2CH4 W;  3CCU T;  3ASK A;  1UGV A;  1TXQ A;  5GAM d;  2D0Q B;  2P0P A;  2R57 A;  2JZ2 A;  5CQY A;  2QAZ A;  3PT9 A;  2EQI A;  2RO0 A;  2AKK A;  3JB9 G;  5D6W A;  1N5Z A;  3T9N A;  1ABQ A;  1Q81 R;  3UDC A;  4Y28 E;  2DZ9 A;  2SEM A;  2SRC A;  4YTL A;  4C8Q F;  3S3N A;  2ENM A;  2GCX A;  3SWN C;  2WSF E;  2ATC B;  3MP6 A;  2CYZ B;  4IIM A;  1J3T A;  4Z8A A;  1K9M R;  1X43 A;  5L8R E;  2E65 A;  2RK2 A;  2L3Q A;  5GAO m;  3MEW A;  2GF7 A;  4FL6 A;  1D0Z A;  4K11 A;  3CCS T;  3TU4 K;  2K5I A;  1I0C A;  4II1 A;  2P0Q A;  1YI2 A;  2X4J A;  4HT8 A;  1M9S A;  4A54 A;  5DY9 A;  3OQ5 A;  2QDL A;  3NMZ C;  1VA7 A;  2GGR A;  3A8O B;  3X24 B;  3AHU A;  3LW5 E;  1RAA B;  3A8G B;  2DBK A;  4OMN A;  4M75 D;  3CXC A;  1IHW A;  3MEU A;  1M1K R;  2H3E B;  4C5H A;  1AEY A;  1U06 A;  2XDP A;  3M53 A;  2J05 A;  2VVK A;  5GAO q;  2J06 A;  2MYS A;  1GBQ A;  3VU3 C;  4EMH A;  4QKU A;  3TVT A;  1AOJ A;  1JRI A;  1YFN A;  4MDW A;  2KXD A;  5GAN 6;  3G1J A;  4C92 D;  1VQ9 T;  1YBY A;  4ME7 A;  4OF1 A;  2LQN A;  1UGP B;  2QDY B;  2PUK B;  1WHM A;  3DLM A;  2DEQ A;  1JJ2 S;  3O5Z A;  3E9F A;  2YUP A;  5GAM e;  3CCQ Q;  1VQO Q;  3MHX A;  3CCV Q;  2HSP A;  3CME Q;  4XU0 A;  3FC3 A;  3L2Z A;  1VQ4 T;  4D8D A;  1XNI A;  2LC4 A;  3QII A;  1YJN T;  1WNL A;  2CH4 A;  5FRO A;  4KUD K;  1B34 B; 
#chains in the Genus database with same CATH homology
 1AZG B;  1NEB A;  4J9D A;  1OEB A;  3I5S A;  4LNP A;  2DJQ A;  2I0N A;  3M0T A;  2EVR A;  4CC3 A;  2A08 A;  2JTE A;  3M0P A;  1M30 A;  2F2V A;  2RQW A;  4HXJ A;  4JZ4 A;  1Y57 A;  2C0O A;  2YDL A;  2KYM A;  2LCS A;  2YUN A;  3VS0 A;  1M3B A;  4OMP A;  3THK A;  2EKH A;  1FYN A;  4OMM A;  3VS6 A;  4F16 A;  4DEX A;  1YWO A;  3EHR A;  1PNJ A;  1GRI A;  4Z89 A;  1WDX A;  2LQW A;  2KYB A;  2RMO A;  4RTW A;  4GLM A;  2GQI A;  1NEG A;  2KRS A;  1EFN A;  1T0J A;  1G2B A;  2K9G A;  1UJ0 A;  1PRM C;  2OI3 A;  2VKN A;  3TSW A;  1PHT A;  4AFZ C;  3VS1 A;  1YNZ A;  2W10 A;  2J6K A;  1SHF A;  1ZUU A;  2DBM A;  1NLO C;  1WIE A;  3I9Q A;  2OJ2 A;  2KEA A;  3UA7 A;  1ZBJ A;  5L23 A;  3SHW A;  2X3X D;  1SHG A;  1AWX A;  2F2W A;  1E6G A;  4RTU A;  1K9A A;  1HJD A;  3VS7 A;  4HVW A;  4CC7 A;  1RLP C;  2FPF A;  3EHQ A;  2L2P A;  2DM1 A;  1BK2 A;  3RBB B;  2HEQ A;  1HD3 A;  3REB B;  4RTX A;  2EYW A;  2D1X A;  1RLQ C;  1WFW A;  1QKW A;  1GFC A;  1Z9Z A;  1W70 A;  3PVQ A;  1M3C A;  2JM9 A;  1MUZ A;  5GJW B;  2DA9 A;  2RQV A;  4CC4 B;  1NYG A;  1HSQ A;  4X1V A;  2D8J A;  3EG3 A;  1OPL A;  2BZ8 A;  1CKA A;  2J6O A;  3NPF A;  1JXO A;  3I35 A;  5ECA A;  4R0K A;  2EW3 A;  3U23 A;  2CUD A;  2KGT A;  4A63 B;  1JU5 C;  5HCK A;  1X69 A;  2JMA A;  1NM7 A;  3RNJ A;  2J6F A;  2A37 A;  1X2K A;  1CKB A;  3CQT A;  2DYB A;  1TUC A;  1Z9Q A;  2H8H A;  2DF6 A;  2JS0 A;  2DRM A;  1JEG A;  4HCK A;  1LCK A;  4J9E A;  1SPK A;  5IXF A;  3M0U A;  2ABL A;  3GBQ A;  1YWP A;  2KE9 A;  2W0Z A;  3NGP A;  2BZY A;  2F2X A;  1KJW A;  1B3Q A;  4ORZ A;  1MV3 A;  2K79 A;  5EC7 A;  2O88 A;  1G83 A;  4CC2 A;  1W6X A;  2IIM A;  5GJV B;  3H0I A;  4J9F A;  1PRL C;  1VYT A;  1XOV A;  2LP5 A;  3EG0 A;  3UAT A;  2CRE A;  1KIK A;  1ZUY A;  2ROL A;  1OV3 A;  2VWF A;  2AKL A;  5IH2 A;  2K7A A;  2GTO A;  2FO0 A;  2AK5 A;  2EGE A;  3M0S A;  1UDL A;  4Z88 A;  1K0S A;  2LZ6 B;  1W1F A;  2G6F X;  2LMJ A;  4M4Z A;  3VRY A;  4AG1 C;  3QWY A;  1TUD A;  5I22 A;  1A0N B;  3M0R A;  1M8M A;  5I11 A;  2YT6 A;  1SEM A;  2DLP A;  4J9B A;  2C0I A;  2NWM A;  3NHN A;  3EG2 A;  2DVJ A;  3PE0 A;  2CUB A;  2M0Y A;  1QWE A;  2E5K A;  2EYY A;  2DNU A;  2MCN A;  1ZX6 A;  1NYF A;  2EGA A;  1X27 A;  2FRY A;  4J9I A;  1WA7 A;  2AZV A;  3FJ5 A;  2FG0 A;  1GBR A;  4AFU C;  1GCP A;  1MV0 B;  2HBW A;  2HCK A;  1VYU A;  4IIO A;  2J7I A;  2ED1 A;  3ZL7 C;  2JMC A;  2ECZ A;  4HVV A;  1AVZ C;  2K2M A;  2ROT A;  3LH5 A;  1GFD A;  1UEC A;  1VYV A;  3VS3 A;  1UJY A;  1M3A A;  3C0C A;  4AFQ C;  3H0H A;  1K4U S;  1WXB A;  2B86 A;  4F14 A;  3IQL A;  2L3S A;  3SEM A;  1I07 A;  5IHK A;  1AZE A;  2FEI A;  5IHI A;  1YN8 A;  1S1N A;  3VRZ A;  1H92 A;  1UHC A;  4RTZ A;  1JXM A;  4LE9 A;  2BZX A;  1PWT A;  2DX1 A;  1WX6 A;  1JO8 A;  2O9V A;  1NLP C;  2CSI A;  1ARK A;  3JV3 A;  4J9H A;  1AD5 A;  2KBT A;  1QKX A;  1KSW A;  3I5R A;  1BB9 A;  3M0Q A;  2P4R A;  2GNC A;  2X3W D;  4RUG A;  2A28 A;  2FPD A;  1X6G A;  1IO6 A;  2V1R A;  2CDT A;  2O2O A;  1E6H A;  2L3P A;  2PZ1 A;  2RQT A;  2EBP A;  2RN8 A;  1UHF A;  1V1C A;  1UE9 A;  3TSZ A;  2V1Q A;  2KRM A;  4OMQ A;  1U3O A;  1YP5 A;  2CT3 A;  4EIK A;  1AWW A;  1Y0M A;  1YCS B;  2KNB B;  2DIL A;  1X2Q A;  3R6N A;  2GBQ A;  1CSK A;  4J9G A;  4QT7 A;  4WCI A;  4JJD A;  4KRT A;  4F17 A;  2DL7 A;  3PVL A;  1GL5 A;  1WI7 A;  1GCQ C;  3UA6 A;  4LUD A;  2KT8 A;  1H8K A;  4RTT A;  2FPE A;  3H0F A;  1U5S A;  4DEY A;  1WXT A;  5FW9 A;  1K0X A;  2EGC A;  2JS2 A;  1WXU A;  3EGU A;  1E7O A;  3VS2 A;  1H3H A;  2JT4 A;  3VS5 A;  4E6R A;  2BTT A;  4RTY A;  2D0N A;  4FSS A;  1SRM A;  5IHN A;  2CH4 W;  2LJ3 A;  1UGV A;  2ESW A;  1UTI A;  2O9S A;  3KFV A;  2EQI A;  2AKK A;  1GCQ A;  1JQQ A;  1N5Z A;  1PKS A;  2D8H A;  2LX7 A;  2RNA A;  2A36 A;  1QCF A;  1ABQ A;  2FRW A;  4J9C A;  2K3B A;  2MOX A;  4HVU A;  1T3L A;  2PTK A;  5FWB A;  2CSQ A;  2KR3 A;  1SSH A;  1M27 C;  1WLP B;  1ZSG A;  1WYX A;  2SEM A;  4JJB A;  2SRC A;  1T0H A;  2PNI A;  2ENM A;  4GBQ A;  2DRK A;  1ZLM A;  2EYZ A;  1AWO A;  3H41 A;  2NUZ A;  2RQU A;  2JW4 A;  1UUE A;  2KT1 A;  1OPK A;  3QWX X;  4IIM A;  2KRN A;  1PKT A;  2M51 A;  1J3T A;  2DL3 A;  2RPN A;  1SRL A;  4Z8A A;  1X43 A;  3VS4 A;  5IXB A;  1OOT A;  1KFZ A;  1TG0 A;  2L3Q A;  1ZUK A;  2LJ0 A;  2DL4 A;  2LNH B;  4K11 A;  2CT4 A;  1AWJ A;  1I0C A;  1I1J A;  1UFF A;  2KXC A;  4ZNX A;  1UG1 A;  2JM8 A;  2KRO A;  4JZ3 A;  1QWF A;  1X6B A;  4OML A;  2HDA A;  2QDL A;  2AZS A;  3NMZ C;  2DMO A;  2RQR A;  4RTV A;  1VA7 A;  2GGR A;  2MIO A;  2DBK A;  4OMN A;  1ABO A;  2YUO A;  1RI9 A;  2DL8 A;  1AEY A;  1U06 A;  4OMO A;  2J05 A;  2VVK A;  1BU1 A;  2J06 A;  2DE0 X;  1GBQ A;  1K1Z A;  2EYX A;  4LUE A;  1QLY A;  3ULR B;  2YUQ A;  2K6D A;  3REA B;  3TVT A;  1B07 A;  4LN2 A;  2ED0 A;  2O31 A;  1AOJ A;  2RF0 A;  2KXD A;  2L0A A;  2OAW A;  2DL5 A;  2LQN A;  1BBZ A;  4D8K A;  4ESR A;  2LJ1 A;  2XMF A;  3O5Z A;  4JJC A;  1K76 A;  2YUP A;  3EG1 A;  4AG2 C;  4JPB W;  4Y92 A;  5FWC A;  2HSP A;  1FMK A;  2EPD A;  3UF4 A;  1RUW A;  1T3S A;  1NG2 A;  2C0T A;  2GTJ A;  4D8D A;  3A98 A;  2YSQ A;  2CH4 A;  4AFS C;  2JXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...