1AZEA

Nmr structure of the complex between the c32s-y7v mutant of the nsh3 domain of grb2 with a peptide from sos, 10 structures
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
b'MEAIAKVDFKATADDELSFKRGDILKVLNEESDQNWYKAELNGKDGFIPKNYIEMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GRB2
publication title Molecular and cellular analysis of Grb2 SH3 domain mutants: interaction with Sos and dynamin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (adaptor protein/peptide)
total genus 10
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1997-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1azeA00
1HJDA 2KE9A 2OI3A 2V1RA 2O88A 3VS1A 2YUPA 2ESWA 2KRNA 5FWBA 1ZUKA 1K76A 4F14A 2DF6A 2EYZA 2HCKA 1VYUA 2HBWA 2AKKA 2DILA 2SEMA 2QDLA 2BTTA 1SRMA 4LUEA 2BZYA 1WI7A 2L3SA 3ULRB 1UJYA 2P4RA 1RI9A 1MV0B 4OMPA 2ECZA 2ROTA 1GFDA 1UHCA 2DVJA 2L0AA 1GCPA 4J9DA 3EG3A 1TUCA 1VYVA 2C0TA 2J6OA 3KFVA 4AFZC 2DMOA 2L2PA 1OOTA 2EGEA 4WCIA 2D8JA 2EYYA 2DYBA 1QCFA 2DM1A 1SHGA 2VVKA 1VYTA 1S1NA 2RQWA 1UFFA 3REAB 1HD3A 1TG0A 1X2QA 2M0YA 2D1XA 2GTOA 1ABQA 1RUWA 3H0IA 2SRCA 1RLQC 1X6BA 1NYGA 4Y92A 3VS5A 5ECAA 3I9QA 4ZNXA 1H8KA 1WX6A 1M3AA 1NG2A 3JV3A 1B3QA 1UGVA 2GQIA 1GL5A 2A28A 2RMOA 4RTZA 2RQRA 2AZVA 2LJ1A 2K3BA 2DRKA 1IO6A 1SEMA 1RLPC 1WXBA 2RPNA 2ED1A 1J3TA 1PRLC 4D8DA 2PZ1A 2DL8A 2A37A 2GTJA 3EGUA 1NYFA 1GBQA 2EKHA 5HCKA 3M0RA 3FJ5A 1OEBA 5GJWB 4CC3A 1QKWA 2B86A 4HVWA 2RN8A 4EIKA 3M0TA 3EHQA 2JT4A 4LNPA 1K1ZA 5IHNA 2O9VA 1PKTA 4Z89A 1AZEA 1AWJA 1YWPA 5I11A 1KSWA 2FG0A 1PHTA 1PRMC 1BB9A 2YUOA 2J06A 3EG0A 3M0QA 1SHFA 1WXTA 4IIMA 2ROLA 1SRLA 2EBPA 2ED0A 4RTXA 2LZ6B 1UHFA 3NMZC 2CUBA 2JMCA 2O31A 2DRMA 1ZBJA 2FRYA 3NHNA 1K0XA 4OMOA 4GBQA 2FPFA 2PTKA 5EC7A 3A98A 5IHIA 3IQLA 3H0HA 4JJCA 3UA6A 4J9CA 3UA7A 2C0OA 2EYWA 1K4US 1G83A 5I22A 5IHKA 2D0NA 3ZL7C 1M3BA 3M0PA 1E6GA 2YT6A 4AFSC 3TVTA 1NEBA 3VS7A 1SPKA 1NM7A 1T0JA 1YWOA 4LN2A 2JS2A 4CC7A 3QWXX 4R0KA 2EPDA 2VKNA 1NEGA 5L23A 2GBQA 2L3PA 3M0SA 1B07A 2AZSA 4AFQC 2KYMA 2DL4A 4CC2A 2D8HA 3LH5A 2YUQA 2CSQA 2X3WD 1GFCA 2DBMA 2LQNA 3REBB 2JM8A 2G6FX 1CSKA 4DEYA 3TSZA 2A36A 1NLOC 4JZ3A 1ZLMA 1FMKA 2JMAA 2X3XD 1GRIA 2HDAA 1Y57A 2XMFA 3THKA 5IXBA 1I07A 1BU1A 3EHRA 3VS6A 1MUZA 2KT8A 4OMLA 1Z9QA 1K0SA 1W70A 2LX7A 1GCQC 1UUEA 3TSWA 2ABLA 2LJ3A 2KGTA 1A0NB 2J7IA 1N5ZA 1EFNA 4J9IA 2EQIA 2MIOA 2NWMA 4A63B 2V1QA 1Y0MA 2DA9A 2EGCA 3GBQA 1WLPB 2MCNA 3VS0A 2KXDA 2AK5A 1AVZC 1UE9A 4OMMA 1KJWA 1UDLA 1WA7A 1G2BA 1QLYA 2FPEA 2O2OA 4LE9A 2CDTA 2KBTA 2W0ZA 2PNIA 2CSIA 4F16A 1I0CA 1ZSGA 2K7AA 1UG1A 2LP5A 4ORZA 4RTUA 4OMNA 2CT4A 1GBRA 2A08A 2RF0A 1YP5A 3H0FA 3I5RA 4IIOA 1KIKA 2F2VA 1YN8A 1PNJA 1ZX6A 1KFZA 2EYXA 1GCQA 2CH4W 1TUDA 2KNBB 4J9BA 4RTWA 4Z8AA 2KYBA 3PE0A 1OPKA 4AG2C 4ESRA 2JW4A 1NLPC 2F2XA 2JS0A 5FW9A 2CUDA 1LCKA 2J05A 2FEIA 2DE0X 2E5KA 2J6KA 1JXMA 1ZUUA 4RUGA 1X2KA 2K79A 2DL5A 2DL7A 1YCSB 3U23A 2RNAA 3EG2A 3R6NA 3VRZA 2EGAA 4HCKA 5GJVB 2KR3A 2C0IA 1M8MA 2CT3A 2JM9A 2DX1A 1OPLA 3M0UA 1AWXA 1JXOA 2KEAA 2DL3A 4RTVA 2RQVA 2VWFA 4QT7A 2HSPA 2CH4A 1H3HA 2KXCA 4J9EA 5FWCA 1ZUYA 2GGRA 2DLPA 3SHWA 1WXUA 2YDLA 1T0HA 4J9HA 1WFWA 3PVQA 3C0CA 1AZGB 2I0NA 2FO0A 2BZXA 2KRMA 1T3LA 2L3QA 1W6XA 1BK2A 3NPFA 1Z9ZA 3UF4A 4M4ZA 4CC4B 1YNZA 1U5SA 1JU5C 3RBBB 2O9SA 2IIMA 2JXBA 1U3OA 1PWTA 4KRTA 1CKAA 2LMJA 1UJ0A 1H92A 3I35A 1UTIA 2AKLA 2K9GA 1V1CA 1BBZA 2K2MA 1W1FA 2CREA 2FRWA 2YSQA 4HXJA 1AD5A 4JPBW 1X6GA 3VRYA 2M51A 2LQWA 2LCSA 2EVRA 4JJBA 1FYNA 4K11A 2KRSA 3EG1A 2EW3A 1WDXA 1OV3A 1X69A 3H41A 5IXFA 4JZ4A 4OMQA 4AFUC 4RTYA 1JO8A 1SSHA 4J9GA 2DBKA 1K9AA 2RQUA 4GLMA 1JEGA 2YUNA 3VS3A 1M27C 2LNHB 2FPDA 1PKSA 1WIEA 2DNUA 1VA7A 4X1VA 3RNJA 2BZ8A 2J6FA 3O5ZA 3SEMA 2KT1A 1AEYA 1ABOA 4HVVA 4AG1C 1X43A 3I5SA 4F17A 1HSQA 1I1JA 5IH2A 2K6DA 3UATA 2HEQA 2W10A 1ARKA 1U06A 4RTTA 3VS2A 1AOJA 1CKBA 1QKXA 3QWYA 4FSSA 4Z88A 1AWOA 2OJ2A 4LUDA 1E7OA 1M30A 1M3CA 2NUZA 1AWWA 2RQTA 4HVUA 1JQQA 2H8HA 4D8KA 4E6RA 3CQTA 4DEXA 4JJDA 1QWFA 2MOXA 2KROA 3NGPA 2OAWA 2ENMA 1E6HA 2GNCA 1XOVA 2JTEA 4J9FA 2F2WA 3VS4A 1T3SA 1QWEA 1MV3A 1X27A 2LJ0A 3PVLA 2DJQA 1WYXA 1UECA
chains in the Genus database with same CATH superfamily
2AHJB 2KE9A 2OI3A 2V1RA 2DXBA 2KRNA 3X26B 4F14A 2EYZA 3CC7A 3L2ZA 1KD1C 2AKKA 2SEMA 2QAZA 2CZ1B 2QDLA 2BTTA 2BZYA 3JCMe 1TUGB 1D0ZA 3ULRB 2XDPA 2RM4A 3PNWC 5CKBA 3EH2A 1VQ5T 2ECZA 2FZKB 4KH1B 2ROTA 4EMGA 1GCPA 4EPCA 1YJWT 1K9MU 4FYWB 1VYVA 3CC7Q 1EIFA 2X51A 4D6WA 4AFZC 2DMOA 3CCUA 2DM1A 1SHGA 5A0GA 1S1NA 2RQWA 2PVOB 1HD3A 1TG0A 4PJOG 2GQVA 1X2QA 4KGVB 1I5OB 3L2UA 3GP8A 2DXUA 3CPWA 4M77C 5HK3A 1PD0A 1X6BA 1Y71A 3VS5A 1C6VX 5ECAA 3CCUQ 3RDVA 2XHCA 4KUIA 1H8KA 4E7KA 1WX6A 2BUDA 4R55A 3HKSA 5DY9A 3TCJA 2OTLA 4J83A 2LJ1A 5I2SA 4KH0B 2DRKA 3J7AF 1ZQ1A 1M90R 4CRIA 2PZ1A 3PT9A 2GTJA 1NYFA 1UGRB 3AT1B 5HCKA 3S3NA 2F1LA 1VQ8T 3SWNC 5GANg 3CBOA 3H6ZA 4IURA 4C92G 1MMNA 1QKWA 2B86A 2OTLQ 1BI0A 1QVGA 5J26A 3PFSA 4M75E 1Y96B 2O9VA 4Y28E 4PLIA 1QVGP 1MNEA 4Z02A 2YRVA 1I81A 3LLRA 4A54A 1JB0E 2RH2A 1PHTA 3OYKA 1PRMC 1VQ7T 1WQWA 5GAMd 3EG0A 3M0QA 5CVIA 3V7CA 1S72T 1RAGB 2KAFA 2LZ6B 1UHFA 2EFIA 2MYSA 5KYUB 4RMOA 1ZSZB 1VQOA 3V7SA 1R8OB 3CPWS 1N9SA 2DRMA 1ZBJA 4OMOA 4GBQA 1MNDA 2PVDB 3M56A 4C5EA 5LJ3f 1KC8R 1ZHIA 1OULA 3JSCA 4EMKB 2NUPA 1M3BA 3M0PA 1D1BA 4AFSC 3CCMA 5GAMe 1VQOQ 3TREA 4B9XA 2LX9A 3TVTA 1NEBA 2XDBA 2ZGWA 1NM7A 2F5TX 3V7RA 4QKUA 3CCEA 5KYXA 3VKIA 3QDRB 4JLIA 3QXEB 3OYHA 3G6ET 3CMAA 1NEGA 3CCLA 2L3PA 4BI3A 3FB9A 3OQ5A 2DL4A 3CCMQ 2CSQA 1QVGS 2DBMA 3ZFJA 5AYFA 3CCEQ 3BFMA 1WZOA 2RI2A 1NLOC 1PG5B 3CMAQ 1GRIA 1W4SA 2HDAA 2IPOB 1XJWB 1Y57A 4A4GA 2QK0A 3CCLQ 3THKA 1VQPA 1MUZA 2KT8A 4C8QA 4OGEA 3OYGA 5FU7C 2RHXA 1W70A 2LX7A 3JCMV 3OW2P 1VQLT 1WHGA 3FDRA 3Q1JA 2P0QA 4UC4A 3JCMh 3QYHB 1EFNA 4J9IA 3WVDB 2NWMA 2V1QA 2ZPEB 2R57A 5LJ5f 1Q82C 2YLBA 2Y90A 1K8AC 5D6XA 1WLPB 2KXDA 3RIRA 4ZGEB 2AK5A 3OYIA 2LDMA 4VUBA 4FW1A 2A7YA 1WA7A 1G2BA 4ZN1A 4LE9A 2W0ZA 3G4ST 2CSIA 1RAIB 2YLCA 3FLGA 2CT4A 2Z0WA 1NBEB 1KD1U 5LJ3d 2A08A 3H0FA 3CC2A 5GMKe 1VQ9T 2NYSA 1ZX6A 8ATCB 3MEUA 3QJ6A 5AT1B 1D0YA 5KYNA 4MMLA 2WSFE 4PJOA 4RTWA 2KYBA 1FWZA 2PQWA 1OPKA 5FLXE 2CUDA 4QQ6A 2L5QA 3DLLA 2HZYA 3RERA 3URGA 2FEIA 4IUPA 3CC2Q 3JB9D 1ZUUA 1M1FA 1NPPA 5FU6C 2I2LA 4RCBA 1D1CA 3R6NA 4M75G 2COYA 3VRZA 1TXQA 1BI2A 1WHKA 4M78D 2C0IA 5CAIA 1M1KR 4OB0B 1QP2A 3EFSA 2XKOC 2MMPA 2LCCA 3A8HB 3BDLA 4QT7A 4F04B 4NOYA 2P0KA 2E3IA 4RG8A 2RJCA 1VQNT 2YDLA 1WFWA 3PVQA 3QG1A 5KCOA 4C0DB 3EGDB 2PUKB 1T3LA 2EQKA 3MP6A 1BK2A 1O9SA 5EG2A 4C0GA 3QO3A 1VQMT 1U5SA 1JU5C 2E6NA 4WF2A 2M9UA 5LJ5d 4M7DF 1IRXA 1TH7A 1SKUB 4C92F 4E7IA 3I56T 1Q7YC 1PWTA 2NUPB 1CKAA 2AKLA 5D6WA 3CCRT 3OYBA 5GAMh 1W1FA 2HL5C 4KGZB 1WGSA 4FYYB 4HXJA 2M51A 4OB2B 3PIOA 2M1HA 2EVRA 1NJIR 4JJBA 4KGXB 4PKCC 4K11A 2KRSA 3EG1A 2COWA 3FC3A 1WDXA 1OV3A 4QQGA 4V2SA 4OMQA 1JO8A 2K2VA 4JJNK 3CMEA 2DPPB 1MMDA 3GF5A 3QKJA 2LNHB 3VJPA 1MMGA 3CC4A 5L8RE 2FPDA 3CEYA 5KYWA 1PKSA 2DNUA 1VA7A 3H9NA 1KQ1A 2BZ8A 2OTJT 3SEMA 1AT1B 3OS1A 3A8GB 3FEOA 2V8KA 3I5SA 2CP7A 4BE1A 4C8QB 4LDUA 4OP0A 4JRKA 2VC8A 3OS2A 3CMEQ 2K6DA 2AIRB 2KMTA 4M7DC 2LCLA 3HHTB 4C92C 3CC4Q 1TWBA 3MP1A 2W10A 1UGQB 1WHJA 3OS5A 3VS2A 1ARKA 1AOJA 1WHLA 1QKXA 4FSSA 4Z88A 2XU8A 2M0OA 3MCAB 4J6XA 4LUDA 4DBQA 2RQTA 1JQQA 4F7UE 4DOWA 2E5QA 4D8KA 4ZGJB 3CQTA 1HK9A 5A0LA 1JRIA 4GLKA 1YITT 3NGPA 1HXDA 4J9FA 1T3SA 2CS7A 2LTOA 1X27A 2CZ6B 4A4HA 2O4XB 3X25B 4DBRA 1WJRA 3GPLA 1JJ2A 2O88A 2EKOA 3VS1A 1WQ7A 3SFMA 1VQ7Q 5FWBA 1ZUKA 1K76A 2RHUA 2GFAA 5GMKh 5GAOm 2RHZA 5GMKi 2KDSA 4PJOB 1KHIA 1Q82U 1UJYA 2KY9A 1RI9A 1K8AU 2Y4YA 1IREB 1N6AA 4Q5WA 2EIFA 1UHCA 1N8RR 1WHHA 1TUCA 4ELYC 2C0TA 4M7AA 1WJSA 1FXXA 4MMKA 1OOTA 4WCIA 5LJ3h 2QA4T 2EYYA 3N5BB 2LC4A 2QYZA 1Q86C 4P5NA 2VVKA 4KULA 2PVGB 5GANf 3SD4A 1YIJA 1D3BA 3QYGB 4M78C 2GTOA 1YI2T 1RUWA 2SRCA 1RLQC 2H3EB 5M9OA 2GCXA 3JAME 1VQKA 4Y92A 4FL6A 4N4HA 1NG2A 3JV3A 1UGVA 4JS5A 2GQIA 4DBHA 1GL5A 1YIJQ 2RMOA 1FX7A 3M4GA 1JJ2S 2AZVA 3L2QA 4E7SA 4MZMA 4PFZA 4XTXA 1IO6A 1SEMA 1WXBA 4XTWA 2ED1A 5C6SA 2D6FA 2DO3A 3OYJA 5I2MA 1G8XA 4M75F 2O01E 2A37A 3EGUA 2BIVA 5CR2A 3M0RA 1U1TA 3FJ5A 1M9SA 1OEBA 2ATCB 1MGQA 2G3RA 2JZ2A 5CKFA 4LDWA 2RN8A 4EIKA 3M0TA 3EHQA 3CCQT 4M77A 4C0FA 3A1PA 4Z89A 1AZEA 1AWJA 1M5Q1 3DB4A 3C94A 5IT9E 1OQKA 1BB9A 2YUOA 1YBYA 5LJ5h 1SRLA 2EBPA 2ED0A 3OS0A 3NMZC 1K9MR 2CUBA 2DTHA 2E41A 5KYWB 1K0XA 2V26A 1YCYA 4FT2A 1Q7YU 2FPFA 2JVVA 4M78E 1OYXA 3A98A 2ZZDA 5IHIA 2WACA 4FT4A 3H0HA 4JJCA 3UA6A 3L2WA 3CCVT 1VUBA 2K5LA 1G83A 3SWNA 5IHKA 2D0NA 2ZPFB 2GFUA 1PSEA 2CZ0B 2QGFB 1Q81U 1UGPB 4AT1B 4EMHA 5J3BA 3OMGA 4M75C 5GANd 2CKKA 2VGNA 3VS7A 2RJFA 3FRNA 3QBYA 2JS2A 5CQXA 1RACB 4E7HA 2FHDA 4BACA 5L23A 2DAQA 3KBGA 1B07A 2AZSA 3CD6A 1I8FA 2QGGA 2D8HA 2X3WD 1WJQA 3C95A 3OYAA 1RAHB 2G6FX 1CSKA 5GAN3 1ZSZC 2DD5A 5IAYA 4HCCA 3LH0A 3TSZA 2X35A 1VQ4A 2OAUA 4JZ3A 1ZLMA 3CPWP 1VQNQ 3OYCA 3CD6Q 1I07A 1LVKA 2R5AA 3HTRA 3EHRA 4KBMB 3VS6A 1Z9QA 4C0ZA 1UUEA 3TSWA 2KGTA 1A0NB 1ACMB 4XQ3A 2AT1B 2MIOA 4FYXB 1Y0MA 2HL3A 4BY6C 2DA9A 1VQ4Q 2EGCA 4QVZA 1W2BA 3JCMg 3QSUA 4M7AB 2ZAEA 3VS0A 4LDYA 3D7SB 1RL2A 2ZPGB 4L5GA 1K73C 2IG0A 1UE9A 4OMMA 2KSSA 5A0DA 1KJWA 1UDLA 1V76A 2RK1A 4M7DG 2O2OA 1D3BB 4ELZC 3OYDA 2DZCA 2MAMA 4F16A 2DJZA 2K7AA 3NTIA 1GBRA 3X28B 3MEAA 2E1HA 5GAN7 3I5RA 3EH1A 4IIOA 3G71T 4PNOA 1KIKA 3OB9A 1YN8A 1PNJA 3CBMA 2EWNA 1KFZA 4C8QD 3A5ZB 2CH4W 4HA8A 3RKYA 2NLUA 3L2RA 4J9BA 4B6MA 3PE0A 1NE8A 2DEUA 2X4XA 2JS0A 3M59A 2OTJQ 1X75C 3PGGA 1Y07A 1LCKA 3GNFB 3L1AA 1H3ZA 1Q86U 2DE0X 2J6KA 1X2KA 3S3OA 2RNAA 3TU4K 4M77B 4N4IA 1JBMA 1M8MA 2CT3A 2V8IA 3QHSA 2MWPA 1W2BS 2DKGA 1UB4A 4N4GA 2A3LA 4RTVA 1KG1A 2DL3A 8AT1B 2HSPA 1H3HA 1XNIA 2H3JA 2GGRA 3JB9G 3VU3C 2V8JA 5GMKl 3EGXA 2QG9B 4RG2A 3EFRA 1SG5A 4XTZA 4FIBA 1Q95G 5KE3A 2KRMA 4RCCA 4PJOD 2COZA 4M78G 3GIBA 1Z9ZA 3A8LB 3UF4A 3OYFA 4J8OA 5KCHA 2Y4XA 2IIMA 5KYYA 3SWNB 3I55T 4KRTA 2HBPA 1UJ0A 4N0AC 3E19A 3I35A 2ZPBB 2K9GA 1V1CA 1BBZA 2M16A 1KD1R 2YSQA 1AD5A 3G1JA 4A4FA 2D0QB 1P92A 1YJNT 5GAMg 2LCSA 2EW3A 4JRQA 2LRQA 2VASA 4XU0A 5CK9A 3CCSA 3E1SA 4AFUC 2YRDA 1VQ6T 2DBKA 1YJ9T 1K9AA 1M27C 3GLXA 1BI1A 2JNGA 2KI7A 5HY6A 3E9GA 2LT1A 3MJXA 3RR6A 1X01A 2XG8D 3RNJA 3OYLA 2J6FA 2KT1A 4JS4A 1ABOA 4HVVA 5D7UA 1X43A 1U8RA 2ZCFB 1HSQA 2NUTA 3CCSQ 1I1JA 2DTIA 3MKDA 5GAOq 3UATA 1PC0A 5FRMA 4PFPA 4TVRA 1M1GA 4ME7A 1RI0A 1AWOA 2OJ2A 1E7OA 4BDYA 4HVUA 1AWWA 2E12A 4E6RA 1M2VA 1IHWA 4DEXA 2QEXT 3EG9A 3L2VA 5LJ3e 3CCJA 3SDZA 4MZPA 2OAWA 1WPYA 1I4K1 1XOVA 2F2WA 3VS4A 1IB8A 3RUXA 3PVLA 2DIQA 5I21A 1WYXA 2YUPA 3CXCS 3CC7T 4PLLA 5FU7B 3P8BB 5CO7A 3CCJQ 1RAEB 1KQ2A 2HBWA 2DILA 4OB1B 4M7DA 4C92A 1DJ7B 3MHXA 5IN1A 1SRMA 1BCMA 4LUEA 4WTOB 2CP6A 3QZ9B 1QCNA 2P4RA 3LW5E 4OMPA 1VQ5A 1GFDA 5GAOl 1YJWA 3EG3A 1K73U 1G3YA 4OVAA 3KFVA 2L2PA 3CCUT 2D8JA 2FB7A 4PJJA 1QCFA 3GOXA 3J80E 1YHQT 4MDWA 4BI4A 1UFFA 2RHYA 5LJ3g 1VQ5Q 5KYXB 5FRNA 1YJWQ 1QCOA 2X4YA 4CI0C 2FZGB 4LD9K 3EGXB 4ZNXA 3ZBDA 5LJ5e 2XI9A 1M3AA 3M5AA 4HCBA 2P4TA 2OTLT 2A28A 3RMQA 2QQAA 4RTZA 2DIGA 2K3BA 2JOYA 1R0BG 3VUZA 1QVFA 2RPNA 1KQSA 1J3TA 1PRLC 4DQ2A 5KYYB 3OMCA 1H641 4M7AD 1QVFP 1GBQA 2EKHA 1K9MC 1KQSP 2RI3A 5GJWB 1RADB 1VQ8A 2EQUA 4OMFB 1G3WA 3OBYA 2HMAA 1M4ZA 4HVWA 5GAN4 5DM7R 2RO0A 1EX4A 4C8QE 2QQSA 2L89A 4LNPA 1K1ZA 3JB9F 1R77A 2B8AA 1KSWA 1BCOA 2BKDN 1VQ7A 3FIFA 1Q82R 1QQJA 1D09B 3P8DA 4M78F 1K8AR 1SHFA 1WXTA 3INZA 3J81E 5HK0A 1S72A 1VQ8Q 9ATCB 3LWIA 1VQOT 3QPHA 5FROA 1OZ2A 3NHNA 1OZ3A 3JCMX 5CKDA 2HD0A 3IQLA 4LD6A 3OSVA 4BDZA 1JJ2P 1X6OA 1IGQA 1K4US 2NUTB 4XAXB 3ZL7C 1S72Q 5GAMj 1QW1A 2CP5A 3CCMT 1E6GA 3ASKA 2LT4A 3M9QA 4X9DA 4M77D 4OF1A 5LL6S 1YWOA 4CC7A 3CCET 1QVFS 3JCMW 1KQSS 4PJOE 2DVEA 4PFOA 4R0KA 2MF2A 4A4KA 5GAN5 2EPDA 3CMAT 3G6EA 1M2VB 4GY5A 3CCLT 3EG9B 3JCMf 4B9WA 4AFQC 2KYMA 6AT1B 2VGMA 1IHVA 3G7ZA 1GFCA 2LQNA 2JM8A 2DFUA 1M90C 1B34A 4PJNA 4DEYA 1FMVA 5HKCA 3QZ5B 2A36A 2JMAA 3G6EQ 4E7JA 5IXBA 4DA4A 1GXIE 3MPUB 3AHUA 4A4EA 1VQPT 1NZ9A 4FU6A 4M7DB 4JRPA 4C92B 4OMLA 1LJOA 4M75A 1GCQC 1VQLA 2ABLA 2LJ3A 3KUFA 4A63B 3C4SA 2EJFA 3JRZA 1TU0B 4LXCA 3GBQA 2E65A 4PK4A 1LOJA 1V29B 3UDCA 4R56A 3LGLA 1WHMA 1VQ6A 4DOVA 3CBPA 1Q7YR 2C06A 1VQLQ 1ZSZA 5C0MA 2JN0A 3C12A 2CDTA 2KBTA 3M4YA 1KC8C 2PNIA 2RHIA 3TEEA 1YJNQ 3G4SA 2MK5A 1UG1A 5GAOp 2LP5A 4ORZA 1RAAB 2CGHA 4OMNA 1Q81R 4QW2A 5D6YA 2RF0A 1YP5A 5GMKj 2VV5A 2PU9B 4HKEA 2KQWA 3CC2T 2F2VA 4O6JA 4ZGDB 1VQ9A 1VQ6Q 1D0XA 2EJ9A 2EYXA 3DB3A 1TUDA 1C1AA 2KNBB 1BKBA 1VOMA 2K4YA 2MPXC 3S6WA 4AG2C 3G4SQ 4ESRA 2JW4A 1PD1A 2R5MA 2XD0A 4X34A 4XU3A 1XTDA 4BD3A 2J05A 5GAOr 2QQ9A 5LJ3j 2QEXA 2E5KA 3PMTA 2DEQA 3RESA 1VQ9Q 3HFNA 1IZ6A 4RUGA 3JCMd 2K5IA 3VV0A 4C8QG 4A53A 1YCSB 4XU2A 2K3YA 2EGAA 1MMAA 2JJ9A 4PL6A 5GJVB 1B7TA 2YWWA 2JM9A 4F7UG 1OPLA 1JXOA 2RQVA 3M55A 5GAMf 2CH4A 3BE3A 2DD4A 4JDSA 4JUVA 2QEXQ 5FWCA 1ZUYA 3BW1A 2DLPA 3SHWA 1TOVA 7AT1B 1VQNA 1G3SA 1ZA1B 2P0PA 4J9HA 1MHNA 2CP0A 2RB6A 3C0CA 1TSFA 2FO0A 2BZXA 1QMCA 2HQHA 3V8KA 3NPFA 2OX7A 1XQHA 4M4ZA 1YNZA 1VQMA 4RKUE 4BI8B 1M2OA 5GANe 2X9HA 1OX8A 2JXBA 3HFOA 1U3OA 2DK3A 3I56A 3FJPA 5CKEA 1EZZB 3QIIA 3CCRA 4EMKC 3S3MA 1YHQA 4HCZA 2HKNA 2FRWA 4XK8E 3HRTA 1TTHB 4JPBW 3VRYA 2CYZB 2R58A 3M58A 2LQWA 5GAN6 1VQMQ 4HT9A 4L6V5 3I56Q 5LJ5j 1O75A 2MWOA 1X69A 3H41A 2K3XA 1W2BP 1R0CB 3META 5IXFA 3CCRQ 3QDFA 1SSHA 2E4HA 1YHQQ 3CMET 3M53A 4M7AE 2RQUA 3O8VA 2YUNA 4FW2A 4FSXA 2JUFA 3CC4T 1B34B 1Q86R 1OI1A 3ER0A 2EQMA 4X1VA 3QUIA 2OTJA 3F70A 1AEYA 2K57A 4N0AA 4AG1C 2LNVA 4F17A 2QDYB 4M75B 1M1KC 3OSSC 4ANJA 2HEQA 4J6YA 2HSEB 1U06A 1CKBA 3QWYA 4IUVA 2YXYA 2VXFA 2NUZA 5J39A 2RA2A 3NTHA 3DLMA 1IXDA 4JJDA 3TQ7P 1QWFA 4BB7A 3OA6A 2HQXA 1YITA 1M90U 3VYHB 2ENMA 1E6HA 2GNCA 3EGDA 4BE0A 1QWEA 1KK7A 1TS9A 2KK4A 1FMWA 1UECA 3BDUA 1HJDA 5DLOA 2QTVA 3PTAA 2RJDA 1HYOA 1OU8A 4II1A 4M77E 2XIDA 2ESWA 2DF6A 2HCKA 3QJYA 3H8ZA 3HSBA 1VYUA 4IUTA 2WSCE 1YITQ 4FCYA 2HQEA 2XDDA 1NJIC 4BY6B 1WI7A 3OYNA 4QVCA 2L3SA 4QQDA 4IKFA 1MV0B 2A0FB 2DVJA 2L0AA 4J7IA 1PM3A 2LQKA 4J9DA 2J6OA 1SSFA 2EGEA 1BIAA 2QA4A 2DYBA 1KC8U 4X9CA 1VYTA 2RD1A 2BE9B 2MI6A 5CIUA 2VB6A 3LYIA 1YIJT 3REAB 3VYGA 2M0YA 2D1XA 1ABQA 1RABB 1YI2A 2VUBA 3H0IA 3PMIA 4BUGA 2YHTA 1VQKT 1NYGA 3CXCA 3EFOA 3OW2A 4ZN3A 3I9QA 2QA4Q 3CXCP 3RKWA 4M7DD 3MEVA 4C92D 1B3QA 4PJMA 1UEBA 2RQRA 4C0DC 4F7UA 4OB3B 4HT8A 1YI2Q 2ZPIB 2K5FA 3HRUA 1PSFA 1RLPC 4C8QF 5GANh 3A8OB 4E7ZA 4IUUA 2VXEA 4D8DA 2DL8A 1VQPQ 2BE7D 4CC3A 4F7UF 2X4WA 1RAFB 1VIEA 2JTFA 2E3HA 2JT4A 1QVPA 2O4XA 3LGFA 1SF9A 3OYMA 5IHNA 3CCQA 3JCMJ 3JB9H 1PKTA 3HRSA 2EQJA 4MDXA 1YWPA 4C5IA 3UWNA 5I11A 4BE2A 5CCAA 4ATOA 2FG0A 2J06A 4M7AG 3LWHA 4IIMA 2ROLA 4RTXA 1N9RA 3JB9J 2E64A 1BYMA 3MP8A 1K73R 2JMCA 2O31A 3CCQQ 3KXTA 1N8RC 2FRYA 3MO8A 2IVWA 4XTYA 2EYQA 2PTKA 2HAXA 5EC7A 1OU9A 1LPLA 3OW2S 4XTUA 2GF7A 3CCVA 4J9CA 3UA7A 2C0OA 2EYWA 4Y91A 4PJOF 5I22A 2HKQB 3VUBA 4C5GA 2ZPHB 3T9NA 2YT6A 3V8LA 4C8QC 3WXMB 2X4JA 2WSEE 5GMKm 1SPKA 2QI2A 4YTLA 1T0JA 2XICA 4LN2A 1WNLA 3UPUA 3QWXX 3ZEHA 4L59A 2VKNA 3CCVQ 1IGUA 2GBQA 3M0SA 3CD6T 2L3RA 3A8MB 1Y7XA 1U1SA 1KHCA 4CC2A 4JLGA 2YRCA 3LH5A 2YUQA 2PUOB 3REBB 3LX7A 2LVMA 4M77G 2M02A 2D9TA 3V8JA 5GANj 3BY7A 1VQ4T 3OYYA 3OY9A 1FMKA 2KVQG 3X24B 2X3XD 2QXFA 2XMFA 4KUDK 1M1KU 1BU1A 1K0SA 2DJQA 2J7IA 1N5ZA 1Q81C 3UT1A 2EQIA 4QVDA 3EAEA 1QP3A 3DKMA 5CQYA 3JCMP 4PJOC 4OGCA 4PJLA 2DXCA 3E2UA 4NS5A 2MCNA 5FU6B 5KE2A 5DLQE 1G3TA 1AVZC 3JCMQ 1QLYA 1UGSB 2FPEA 1OX9A 2QASA 3OYEA 4M78A 1I0CA 1ZSGA 4RTUA 2HNIA 4J6WA 3EFOB 1G5VA 4O5VA 1VIFA 3G71A 1NPRA 1NJIU 1GCQA 4M75D 3X20B 4ZTJA 4LDVA 1ZA2B 2DZ9A 2QQBA 4Z8AA 4F7UB 5CKHA 5LJ5g 1NLPC 3M54A 2F2XA 5FW9A 1BIBA 4NL2A 4E7LA 2DXTA 1C0MA 1F1BB 3G71Q 2RK2A 1JXMA 2CP3A 2QTXA 5A2QE 2K79A 2DL5A 2DETA 2DL7A 5GAN8 3U23A 1BI3A 3EG2A 2F69A 4HCKA 2KR3A 4XTVA 5GAOn 2DX1A 5KH6A 3M0UA 1AWXA 2KEAA 4EDUA 3JCMb 3L42A 1D1AA 2VWFA 2CZ7B 2KXCA 4J9EA 3M57A 3PIPA 1WXUA 2DERA 1T0HA 4AMCA 2EJGA 1ZBXA 2FL7A 1AZGB 2I0NA 4E47A 2L3QA 1W6XA 3HPWA 4FM4B 4CC4B 2DTOA 3E9FA 2QQRA 3RBBB 2O9SA 3CPFA 2FYKA 1N27A 3HL8A 2LMJA 3I55A 2XK0A 1H92A 4ZTFA 1UTIA 3RKXA 2LQ8A 2K2MA 2F5KA 3NFCA 2CREA 1X6GA 4M7DE 2VYTA 4C92E 2EAYA 2P84A 1LNXA 4J5YA 1YJNA 1Y96A 4M7AF 2RI5A 2E6ZA 3HP9A 1FYNA 3GNGA 3JB9I 4E2FB 1M8VA 1PCXA 4NL3A 3I55Q 2CP2A 4MZTA 4JZ4A 2E70A 3CCST 2JTMA 4RTYA 4J9GA 3NTKA 1YJ9A 1N8RU 4GLMA 3OBWA 5KYUA 1JEGA 1I5LA 3VS3A 3WVEB 1WIEA 3SB2A 2FVUA 3O5ZA 1YFNA 1VQKQ 2DYIA 3P8HA 4EMKA 2RJEA 5IH2A 1YJ9Q 1AHJB 2FZCB 5GAN2 3ME9A 2L8DA 4J7FA 4RTTA 3RMSA 4XU1A 1M30A 1M3CA 2H8HA 4C5HA 4KT0E 3CCJT 4M77F 4M7AC 2MOXA 2KROA 3MEWA 4FYVB 3R6OA 4LDXA 2E10A 2JTEA 3JCMc 4DBFA 1MV3A 2LJ0A 4M78B 4JRIA 4IUQA
chains in the Genus database with same CATH topology
1HJDA 2KE9A 2OI3A 2V1RA 2O88A 3VS1A 2YUPA 2ESWA 2KRNA 5FWBA 1ZUKA 1K76A 4F14A 2DF6A 2EYZA 2HCKA 1VYUA 2HBWA 2AKKA 2DILA 2SEMA 2QDLA 2BTTA 1SRMA 4LUEA 2BZYA 1WI7A 2L3SA 3ULRB 1UJYA 2P4RA 1RI9A 1MV0B 4OMPA 2ECZA 2ROTA 1GFDA 1UHCA 2DVJA 2L0AA 1GCPA 4J9DA 3EG3A 1TUCA 1VYVA 2C0TA 2J6OA 3KFVA 4AFZC 2DMOA 2L2PA 1OOTA 2EGEA 4WCIA 2D8JA 2EYYA 2DYBA 1QCFA 2DM1A 1SHGA 2VVKA 1VYTA 1S1NA 2RQWA 1UFFA 3REAB 1HD3A 1TG0A 1X2QA 2M0YA 2D1XA 2GTOA 1ABQA 1RUWA 3H0IA 2SRCA 1RLQC 1X6BA 1NYGA 4Y92A 3VS5A 5ECAA 3I9QA 4ZNXA 1H8KA 1WX6A 1M3AA 1NG2A 3JV3A 1B3QA 1UGVA 2GQIA 1GL5A 2A28A 2RMOA 4RTZA 2RQRA 2AZVA 2LJ1A 2K3BA 2DRKA 1IO6A 1SEMA 1RLPC 1WXBA 2RPNA 2ED1A 1J3TA 1PRLC 4D8DA 2PZ1A 2DL8A 2A37A 2GTJA 3EGUA 1NYFA 1GBQA 2EKHA 5HCKA 3M0RA 3FJ5A 1OEBA 5GJWB 4CC3A 1QKWA 2B86A 4HVWA 2RN8A 4EIKA 3M0TA 3EHQA 2JT4A 4LNPA 1K1ZA 5IHNA 2O9VA 1PKTA 4Z89A 1AZEA 1AWJA 1YWPA 5I11A 1KSWA 2FG0A 1PHTA 1PRMC 1BB9A 2YUOA 2J06A 3EG0A 3M0QA 1SHFA 1WXTA 4IIMA 2ROLA 1SRLA 2EBPA 2ED0A 4RTXA 2LZ6B 1UHFA 3NMZC 2CUBA 2JMCA 2O31A 2DRMA 1ZBJA 2FRYA 3NHNA 1K0XA 4OMOA 4GBQA 2FPFA 2PTKA 5EC7A 3A98A 5IHIA 3IQLA 3H0HA 4JJCA 3UA6A 4J9CA 3UA7A 2C0OA 2EYWA 1K4US 1G83A 5I22A 5IHKA 2D0NA 3ZL7C 1M3BA 3M0PA 1E6GA 2YT6A 4AFSC 3TVTA 1NEBA 3VS7A 1SPKA 1NM7A 1T0JA 1YWOA 4LN2A 2JS2A 4CC7A 3QWXX 4R0KA 2EPDA 2VKNA 1NEGA 5L23A 2GBQA 2L3PA 3M0SA 1B07A 2AZSA 4AFQC 2KYMA 2DL4A 4CC2A 2D8HA 3LH5A 2YUQA 2CSQA 2X3WD 1GFCA 2DBMA 2LQNA 3REBB 2JM8A 2G6FX 1CSKA 4DEYA 3TSZA 2A36A 1NLOC 4JZ3A 1ZLMA 1FMKA 2JMAA 2X3XD 1GRIA 2HDAA 1Y57A 2XMFA 3THKA 5IXBA 1I07A 1BU1A 3EHRA 3VS6A 1MUZA 2KT8A 4OMLA 1Z9QA 1K0SA 1W70A 2LX7A 1GCQC 1UUEA 3TSWA 2ABLA 2LJ3A 2KGTA 1A0NB 2J7IA 1N5ZA 1EFNA 4J9IA 2EQIA 2MIOA 2NWMA 4A63B 2V1QA 1Y0MA 2DA9A 2EGCA 3GBQA 1WLPB 2MCNA 3VS0A 2KXDA 2AK5A 1AVZC 1UE9A 4OMMA 1KJWA 1UDLA 1WA7A 1G2BA 1QLYA 2FPEA 2O2OA 4LE9A 2CDTA 2KBTA 2W0ZA 2PNIA 2CSIA 4F16A 1I0CA 1ZSGA 2K7AA 1UG1A 2LP5A 4ORZA 4RTUA 4OMNA 2CT4A 1GBRA 2A08A 2RF0A 1YP5A 3H0FA 3I5RA 4IIOA 1KIKA 2F2VA 1YN8A 1PNJA 1ZX6A 1KFZA 2EYXA 1GCQA 2CH4W 1TUDA 2KNBB 4J9BA 4RTWA 4Z8AA 2KYBA 3PE0A 1OPKA 4AG2C 4ESRA 2JW4A 1NLPC 2F2XA 2JS0A 5FW9A 2CUDA 1LCKA 2J05A 2FEIA 2DE0X 2E5KA 2J6KA 1JXMA 1ZUUA 4RUGA 1X2KA 2K79A 2DL5A 2DL7A 1YCSB 3U23A 2RNAA 3EG2A 3R6NA 3VRZA 2EGAA 4HCKA 5GJVB 2KR3A 2C0IA 1M8MA 2CT3A 2JM9A 2DX1A 1OPLA 3M0UA 1AWXA 1JXOA 2KEAA 2DL3A 4RTVA 2RQVA 2VWFA 4QT7A 2HSPA 2CH4A 1H3HA 2KXCA 4J9EA 5FWCA 1ZUYA 2GGRA 2DLPA 3SHWA 1WXUA 2YDLA 1T0HA 4J9HA 1WFWA 3PVQA 3C0CA 1AZGB 2I0NA 2FO0A 2BZXA 2KRMA 1T3LA 2L3QA 1W6XA 1BK2A 3NPFA 1Z9ZA 3UF4A 4M4ZA 4CC4B 1YNZA 1U5SA 1JU5C 3RBBB 2O9SA 2IIMA 2JXBA 1U3OA 1PWTA 4KRTA 1CKAA 2LMJA 1UJ0A 1H92A 3I35A 1UTIA 2AKLA 2K9GA 1V1CA 1BBZA 2K2MA 1W1FA 2CREA 2FRWA 2YSQA 4HXJA 1AD5A 4JPBW 1X6GA 3VRYA 2M51A 2LQWA 2LCSA 2EVRA 4JJBA 1FYNA 4K11A 2KRSA 3EG1A 2EW3A 1WDXA 1OV3A 1X69A 3H41A 5IXFA 4JZ4A 4OMQA 4AFUC 4RTYA 1JO8A 1SSHA 4J9GA 2DBKA 1K9AA 2RQUA 4GLMA 1JEGA 2YUNA 3VS3A 1M27C 2LNHB 2FPDA 1PKSA 1WIEA 2DNUA 1VA7A 4X1VA 3RNJA 2BZ8A 2J6FA 3O5ZA 3SEMA 2KT1A 1AEYA 1ABOA 4HVVA 4AG1C 1X43A 3I5SA 4F17A 1HSQA 1I1JA 5IH2A 2K6DA 3UATA 2HEQA 2W10A 1ARKA 1U06A 4RTTA 3VS2A 1AOJA 1CKBA 1QKXA 3QWYA 4FSSA 4Z88A 1AWOA 2OJ2A 4LUDA 1E7OA 1M30A 1M3CA 2NUZA 1AWWA 2RQTA 4HVUA 1JQQA 2H8HA 4D8KA 4E6RA 3CQTA 4DEXA 4JJDA 1QWFA 2MOXA 2KROA 3NGPA 2OAWA 2ENMA 1E6HA 2GNCA 1XOVA 2JTEA 4J9FA 2F2WA 3VS4A 1T3SA 1QWEA 1MV3A 1X27A 2LJ0A 3PVLA 2DJQA 1WYXA 1UECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HJD A;  2KE9 A;  2OI3 A;  2V1R A;  2O88 A;  3VS1 A;  2YUP A;  2ESW A;  2KRN A;  5FWB A;  1ZUK A;  1K76 A;  4F14 A;  2DF6 A;  2EYZ A;  2HCK A;  1VYU A;  2HBW A;  2AKK A;  2DIL A;  2SEM A;  2QDL A;  2BTT A;  1SRM A;  4LUE A;  2BZY A;  1WI7 A;  2L3S A;  3ULR B;  1UJY A;  2P4R A;  1RI9 A;  1MV0 B;  4OMP A;  2ECZ A;  2ROT A;  1GFD A;  1UHC A;  2DVJ A;  2L0A A;  1GCP A;  4J9D A;  3EG3 A;  1TUC A;  1VYV A;  2C0T A;  2J6O A;  3KFV A;  4AFZ C;  2DMO A;  2L2P A;  1OOT A;  2EGE A;  4WCI A;  2D8J A;  2EYY A;  2DYB A;  1QCF A;  2DM1 A;  1SHG A;  2VVK A;  1VYT A;  1S1N A;  2RQW A;  1UFF A;  3REA B;  1HD3 A;  1TG0 A;  1X2Q A;  2M0Y A;  2D1X A;  2GTO A;  1ABQ A;  1RUW A;  3H0I A;  2SRC A;  1RLQ C;  1X6B A;  1NYG A;  4Y92 A;  3VS5 A;  5ECA A;  3I9Q A;  4ZNX A;  1H8K A;  1WX6 A;  1M3A A;  1NG2 A;  3JV3 A;  1B3Q A;  1UGV A;  2GQI A;  1GL5 A;  2A28 A;  2RMO A;  4RTZ A;  2RQR A;  2AZV A;  2LJ1 A;  2K3B A;  2DRK A;  1IO6 A;  1SEM A;  1RLP C;  1WXB A;  2RPN A;  2ED1 A;  1J3T A;  1PRL C;  4D8D A;  2PZ1 A;  2DL8 A;  2A37 A;  2GTJ A;  3EGU A;  1NYF A;  1GBQ A;  2EKH A;  5HCK A;  3M0R A;  3FJ5 A;  1OEB A;  5GJW B;  4CC3 A;  1QKW A;  2B86 A;  4HVW A;  2RN8 A;  4EIK A;  3M0T A;  3EHQ A;  2JT4 A;  4LNP A;  1K1Z A;  5IHN A;  2O9V A;  1PKT A;  4Z89 A;  1AZE A;  1AWJ A;  1YWP A;  5I11 A;  1KSW A;  2FG0 A;  1PHT A;  1PRM C;  1BB9 A;  2YUO A;  2J06 A;  3EG0 A;  3M0Q A;  1SHF A;  1WXT A;  4IIM A;  2ROL A;  1SRL A;  2EBP A;  2ED0 A;  4RTX A;  2LZ6 B;  1UHF A;  3NMZ C;  2CUB A;  2JMC A;  2O31 A;  2DRM A;  1ZBJ A;  2FRY A;  3NHN A;  1K0X A;  4OMO A;  4GBQ A;  2FPF A;  2PTK A;  5EC7 A;  3A98 A;  5IHI A;  3IQL A;  3H0H A;  4JJC A;  3UA6 A;  4J9C A;  3UA7 A;  2C0O A;  2EYW A;  1K4U S;  1G83 A;  5I22 A;  5IHK A;  2D0N A;  3ZL7 C;  1M3B A;  3M0P A;  1E6G A;  2YT6 A;  4AFS C;  3TVT A;  1NEB A;  3VS7 A;  1SPK A;  1NM7 A;  1T0J A;  1YWO A;  4LN2 A;  2JS2 A;  4CC7 A;  3QWX X;  4R0K A;  2EPD A;  2VKN A;  1NEG A;  5L23 A;  2GBQ A;  2L3P A;  3M0S A;  1B07 A;  2AZS A;  4AFQ C;  2KYM A;  2DL4 A;  4CC2 A;  2D8H A;  3LH5 A;  2YUQ A;  2CSQ A;  2X3W D;  1GFC A;  2DBM A;  2LQN A;  3REB B;  2JM8 A;  2G6F X;  1CSK A;  4DEY A;  3TSZ A;  2A36 A;  1NLO C;  4JZ3 A;  1ZLM A;  1FMK A;  2JMA A;  2X3X D;  1GRI A;  2HDA A;  1Y57 A;  2XMF A;  3THK A;  5IXB A;  1I07 A;  1BU1 A;  3EHR A;  3VS6 A;  1MUZ A;  2KT8 A;  4OML A;  1Z9Q A;  1K0S A;  1W70 A;  2LX7 A;  1GCQ C;  1UUE A;  3TSW A;  2ABL A;  2LJ3 A;  2KGT A;  1A0N B;  2J7I A;  1N5Z A;  1EFN A;  4J9I A;  2EQI A;  2MIO A;  2NWM A;  4A63 B;  2V1Q A;  1Y0M A;  2DA9 A;  2EGC A;  3GBQ A;  1WLP B;  2MCN A;  3VS0 A;  2KXD A;  2AK5 A;  1AVZ C;  1UE9 A;  4OMM A;  1KJW A;  1UDL A;  1WA7 A;  1G2B A;  1QLY A;  2FPE A;  2O2O A;  4LE9 A;  2CDT A;  2KBT A;  2W0Z A;  2PNI A;  2CSI A;  4F16 A;  1I0C A;  1ZSG A;  2K7A A;  1UG1 A;  2LP5 A;  4ORZ A;  4RTU A;  4OMN A;  2CT4 A;  1GBR A;  2A08 A;  2RF0 A;  1YP5 A;  3H0F A;  3I5R A;  4IIO A;  1KIK A;  2F2V A;  1YN8 A;  1PNJ A;  1ZX6 A;  1KFZ A;  2EYX A;  1GCQ A;  2CH4 W;  1TUD A;  2KNB B;  4J9B A;  4RTW A;  4Z8A A;  2KYB A;  3PE0 A;  1OPK A;  4AG2 C;  4ESR A;  2JW4 A;  1NLP C;  2F2X A;  2JS0 A;  5FW9 A;  2CUD A;  1LCK A;  2J05 A;  2FEI A;  2DE0 X;  2E5K A;  2J6K A;  1JXM A;  1ZUU A;  4RUG A;  1X2K A;  2K79 A;  2DL5 A;  2DL7 A;  1YCS B;  3U23 A;  2RNA A;  3EG2 A;  3R6N A;  3VRZ A;  2EGA A;  4HCK A;  5GJV B;  2KR3 A;  2C0I A;  1M8M A;  2CT3 A;  2JM9 A;  2DX1 A;  1OPL A;  3M0U A;  1AWX A;  1JXO A;  2KEA A;  2DL3 A;  4RTV A;  2RQV A;  2VWF A;  4QT7 A;  2HSP A;  2CH4 A;  1H3H A;  2KXC A;  4J9E A;  5FWC A;  1ZUY A;  2GGR A;  2DLP A;  3SHW A;  1WXU A;  2YDL A;  1T0H A;  4J9H A;  1WFW A;  3PVQ A;  3C0C A;  1AZG B;  2I0N A;  2FO0 A;  2BZX A;  2KRM A;  1T3L A;  2L3Q A;  1W6X A;  1BK2 A;  3NPF A;  1Z9Z A;  3UF4 A;  4M4Z A;  4CC4 B;  1YNZ A;  1U5S A;  1JU5 C;  3RBB B;  2O9S A;  2IIM A;  2JXB A;  1U3O A;  1PWT A;  4KRT A;  1CKA A;  2LMJ A;  1UJ0 A;  1H92 A;  3I35 A;  1UTI A;  2AKL A;  2K9G A;  1V1C A;  1BBZ A;  2K2M A;  1W1F A;  2CRE A;  2FRW A;  2YSQ A;  4HXJ A;  1AD5 A;  4JPB W;  1X6G A;  3VRY A;  2M51 A;  2LQW A;  2LCS A;  2EVR A;  4JJB A;  1FYN A;  4K11 A;  2KRS A;  3EG1 A;  2EW3 A;  1WDX A;  1OV3 A;  1X69 A;  3H41 A;  5IXF A;  4JZ4 A;  4OMQ A;  4AFU C;  4RTY A;  1JO8 A;  1SSH A;  4J9G A;  2DBK A;  1K9A A;  2RQU A;  4GLM A;  1JEG A;  2YUN A;  3VS3 A;  1M27 C;  2LNH B;  2FPD A;  1PKS A;  1WIE A;  2DNU A;  1VA7 A;  4X1V A;  3RNJ A;  2BZ8 A;  2J6F A;  3O5Z A;  3SEM A;  2KT1 A;  1AEY A;  1ABO A;  4HVV A;  4AG1 C;  1X43 A;  3I5S A;  4F17 A;  1HSQ A;  1I1J A;  5IH2 A;  2K6D A;  3UAT A;  2HEQ A;  2W10 A;  1ARK A;  1U06 A;  4RTT A;  3VS2 A;  1AOJ A;  1CKB A;  1QKX A;  3QWY A;  4FSS A;  4Z88 A;  1AWO A;  2OJ2 A;  4LUD A;  1E7O A;  1M30 A;  1M3C A;  2NUZ A;  1AWW A;  2RQT A;  4HVU A;  1JQQ A;  2H8H A;  4D8K A;  4E6R A;  3CQT A;  4DEX A;  4JJD A;  1QWF A;  2MOX A;  2KRO A;  3NGP A;  2OAW A;  2ENM A;  1E6H A;  2GNC A;  1XOV A;  2JTE A;  4J9F A;  2F2W A;  3VS4 A;  1T3S A;  1QWE A;  1MV3 A;  1X27 A;  2LJ0 A;  3PVL A;  2DJQ A;  1WYX A;  1UEC A; 
#chains in the Genus database with same CATH topology
 2AHJ B;  2KE9 A;  2OI3 A;  2V1R A;  2DXB A;  2KRN A;  3X26 B;  4F14 A;  2EYZ A;  3CC7 A;  3L2Z A;  1KD1 C;  2AKK A;  2SEM A;  2QAZ A;  2CZ1 B;  2QDL A;  2BTT A;  2BZY A;  3JCM e;  1TUG B;  1D0Z A;  3ULR B;  2XDP A;  2RM4 A;  3PNW C;  5CKB A;  3EH2 A;  1VQ5 T;  2ECZ A;  2FZK B;  4KH1 B;  2ROT A;  4EMG A;  1GCP A;  4EPC A;  1YJW T;  1K9M U;  4FYW B;  1VYV A;  3CC7 Q;  1EIF A;  2X51 A;  4D6W A;  4AFZ C;  2DMO A;  3CCU A;  2DM1 A;  1SHG A;  5A0G A;  1S1N A;  2RQW A;  2PVO B;  1HD3 A;  1TG0 A;  4PJO G;  2GQV A;  1X2Q A;  4KGV B;  1I5O B;  3L2U A;  3GP8 A;  2DXU A;  3CPW A;  4M77 C;  5HK3 A;  1PD0 A;  1X6B A;  1Y71 A;  3VS5 A;  1C6V X;  5ECA A;  3CCU Q;  3RDV A;  2XHC A;  4KUI A;  1H8K A;  4E7K A;  1WX6 A;  2BUD A;  4R55 A;  3HKS A;  5DY9 A;  3TCJ A;  2OTL A;  4J83 A;  2LJ1 A;  5I2S A;  4KH0 B;  2DRK A;  3J7A F;  1ZQ1 A;  1M90 R;  4CRI A;  2PZ1 A;  3PT9 A;  2GTJ A;  1NYF A;  1UGR B;  3AT1 B;  5HCK A;  3S3N A;  2F1L A;  1VQ8 T;  3SWN C;  5GAN g;  3CBO A;  3H6Z A;  4IUR A;  4C92 G;  1MMN A;  1QKW A;  2B86 A;  2OTL Q;  1BI0 A;  1QVG A;  5J26 A;  3PFS A;  4M75 E;  1Y96 B;  2O9V A;  4Y28 E;  4PLI A;  1QVG P;  1MNE A;  4Z02 A;  2YRV A;  1I81 A;  3LLR A;  4A54 A;  1JB0 E;  2RH2 A;  1PHT A;  3OYK A;  1PRM C;  1VQ7 T;  1WQW A;  5GAM d;  3EG0 A;  3M0Q A;  5CVI A;  3V7C A;  1S72 T;  1RAG B;  2KAF A;  2LZ6 B;  1UHF A;  2EFI A;  2MYS A;  5KYU B;  4RMO A;  1ZSZ B;  1VQO A;  3V7S A;  1R8O B;  3CPW S;  1N9S A;  2DRM A;  1ZBJ A;  4OMO A;  4GBQ A;  1MND A;  2PVD B;  3M56 A;  4C5E A;  5LJ3 f;  1KC8 R;  1ZHI A;  1OUL A;  3JSC A;  4EMK B;  2NUP A;  1M3B A;  3M0P A;  1D1B A;  4AFS C;  3CCM A;  5GAM e;  1VQO Q;  3TRE A;  4B9X A;  2LX9 A;  3TVT A;  1NEB A;  2XDB A;  2ZGW A;  1NM7 A;  2F5T X;  3V7R A;  4QKU A;  3CCE A;  5KYX A;  3VKI A;  3QDR B;  4JLI A;  3QXE B;  3OYH A;  3G6E T;  3CMA A;  1NEG A;  3CCL A;  2L3P A;  4BI3 A;  3FB9 A;  3OQ5 A;  2DL4 A;  3CCM Q;  2CSQ A;  1QVG S;  2DBM A;  3ZFJ A;  5AYF A;  3CCE Q;  3BFM A;  1WZO A;  2RI2 A;  1NLO C;  1PG5 B;  3CMA Q;  1GRI A;  1W4S A;  2HDA A;  2IPO B;  1XJW B;  1Y57 A;  4A4G A;  2QK0 A;  3CCL Q;  3THK A;  1VQP A;  1MUZ A;  2KT8 A;  4C8Q A;  4OGE A;  3OYG A;  5FU7 C;  2RHX A;  1W70 A;  2LX7 A;  3JCM V;  3OW2 P;  1VQL T;  1WHG A;  3FDR A;  3Q1J A;  2P0Q A;  4UC4 A;  3JCM h;  3QYH B;  1EFN A;  4J9I A;  3WVD B;  2NWM A;  2V1Q A;  2ZPE B;  2R57 A;  5LJ5 f;  1Q82 C;  2YLB A;  2Y90 A;  1K8A C;  5D6X A;  1WLP B;  2KXD A;  3RIR A;  4ZGE B;  2AK5 A;  3OYI A;  2LDM A;  4VUB A;  4FW1 A;  2A7Y A;  1WA7 A;  1G2B A;  4ZN1 A;  4LE9 A;  2W0Z A;  3G4S T;  2CSI A;  1RAI B;  2YLC A;  3FLG A;  2CT4 A;  2Z0W A;  1NBE B;  1KD1 U;  5LJ3 d;  2A08 A;  3H0F A;  3CC2 A;  5GMK e;  1VQ9 T;  2NYS A;  1ZX6 A;  8ATC B;  3MEU A;  3QJ6 A;  5AT1 B;  1D0Y A;  5KYN A;  4MML A;  2WSF E;  4PJO A;  4RTW A;  2KYB A;  1FWZ A;  2PQW A;  1OPK A;  5FLX E;  2CUD A;  4QQ6 A;  2L5Q A;  3DLL A;  2HZY A;  3RER A;  3URG A;  2FEI A;  4IUP A;  3CC2 Q;  3JB9 D;  1ZUU A;  1M1F A;  1NPP A;  5FU6 C;  2I2L A;  4RCB A;  1D1C A;  3R6N A;  4M75 G;  2COY A;  3VRZ A;  1TXQ A;  1BI2 A;  1WHK A;  4M78 D;  2C0I A;  5CAI A;  1M1K R;  4OB0 B;  1QP2 A;  3EFS A;  2XKO C;  2MMP A;  2LCC A;  3A8H B;  3BDL A;  4QT7 A;  4F04 B;  4NOY A;  2P0K A;  2E3I A;  4RG8 A;  2RJC A;  1VQN T;  2YDL A;  1WFW A;  3PVQ A;  3QG1 A;  5KCO A;  4C0D B;  3EGD B;  2PUK B;  1T3L A;  2EQK A;  3MP6 A;  1BK2 A;  1O9S A;  5EG2 A;  4C0G A;  3QO3 A;  1VQM T;  1U5S A;  1JU5 C;  2E6N A;  4WF2 A;  2M9U A;  5LJ5 d;  4M7D F;  1IRX A;  1TH7 A;  1SKU B;  4C92 F;  4E7I A;  3I56 T;  1Q7Y C;  1PWT A;  2NUP B;  1CKA A;  2AKL A;  5D6W A;  3CCR T;  3OYB A;  5GAM h;  1W1F A;  2HL5 C;  4KGZ B;  1WGS A;  4FYY B;  4HXJ A;  2M51 A;  4OB2 B;  3PIO A;  2M1H A;  2EVR A;  1NJI R;  4JJB A;  4KGX B;  4PKC C;  4K11 A;  2KRS A;  3EG1 A;  2COW A;  3FC3 A;  1WDX A;  1OV3 A;  4QQG A;  4V2S A;  4OMQ A;  1JO8 A;  2K2V A;  4JJN K;  3CME A;  2DPP B;  1MMD A;  3GF5 A;  3QKJ A;  2LNH B;  3VJP A;  1MMG A;  3CC4 A;  5L8R E;  2FPD A;  3CEY A;  5KYW A;  1PKS A;  2DNU A;  1VA7 A;  3H9N A;  1KQ1 A;  2BZ8 A;  2OTJ T;  3SEM A;  1AT1 B;  3OS1 A;  3A8G B;  3FEO A;  2V8K A;  3I5S A;  2CP7 A;  4BE1 A;  4C8Q B;  4LDU A;  4OP0 A;  4JRK A;  2VC8 A;  3OS2 A;  3CME Q;  2K6D A;  2AIR B;  2KMT A;  4M7D C;  2LCL A;  3HHT B;  4C92 C;  3CC4 Q;  1TWB A;  3MP1 A;  2W10 A;  1UGQ B;  1WHJ A;  3OS5 A;  3VS2 A;  1ARK A;  1AOJ A;  1WHL A;  1QKX A;  4FSS A;  4Z88 A;  2XU8 A;  2M0O A;  3MCA B;  4J6X A;  4LUD A;  4DBQ A;  2RQT A;  1JQQ A;  4F7U E;  4DOW A;  2E5Q A;  4D8K A;  4ZGJ B;  3CQT A;  1HK9 A;  5A0L A;  1JRI A;  4GLK A;  1YIT T;  3NGP A;  1HXD A;  4J9F A;  1T3S A;  2CS7 A;  2LTO A;  1X27 A;  2CZ6 B;  4A4H A;  2O4X B;  3X25 B;  4DBR A;  1WJR A;  3GPL A;  1JJ2 A;  2O88 A;  2EKO A;  3VS1 A;  1WQ7 A;  3SFM A;  1VQ7 Q;  5FWB A;  1ZUK A;  1K76 A;  2RHU A;  2GFA A;  5GMK h;  5GAO m;  2RHZ A;  5GMK i;  2KDS A;  4PJO B;  1KHI A;  1Q82 U;  1UJY A;  2KY9 A;  1RI9 A;  1K8A U;  2Y4Y A;  1IRE B;  1N6A A;  4Q5W A;  2EIF A;  1UHC A;  1N8R R;  1WHH A;  1TUC A;  4ELY C;  2C0T A;  4M7A A;  1WJS A;  1FXX A;  4MMK A;  1OOT A;  4WCI A;  5LJ3 h;  2QA4 T;  2EYY A;  3N5B B;  2LC4 A;  2QYZ A;  1Q86 C;  4P5N A;  2VVK A;  4KUL A;  2PVG B;  5GAN f;  3SD4 A;  1YIJ A;  1D3B A;  3QYG B;  4M78 C;  2GTO A;  1YI2 T;  1RUW A;  2SRC A;  1RLQ C;  2H3E B;  5M9O A;  2GCX A;  3JAM E;  1VQK A;  4Y92 A;  4FL6 A;  4N4H A;  1NG2 A;  3JV3 A;  1UGV A;  4JS5 A;  2GQI A;  4DBH A;  1GL5 A;  1YIJ Q;  2RMO A;  1FX7 A;  3M4G A;  1JJ2 S;  2AZV A;  3L2Q A;  4E7S A;  4MZM A;  4PFZ A;  4XTX A;  1IO6 A;  1SEM A;  1WXB A;  4XTW A;  2ED1 A;  5C6S A;  2D6F A;  2DO3 A;  3OYJ A;  5I2M A;  1G8X A;  4M75 F;  2O01 E;  2A37 A;  3EGU A;  2BIV A;  5CR2 A;  3M0R A;  1U1T A;  3FJ5 A;  1M9S A;  1OEB A;  2ATC B;  1MGQ A;  2G3R A;  2JZ2 A;  5CKF A;  4LDW A;  2RN8 A;  4EIK A;  3M0T A;  3EHQ A;  3CCQ T;  4M77 A;  4C0F A;  3A1P A;  4Z89 A;  1AZE A;  1AWJ A;  1M5Q 1;  3DB4 A;  3C94 A;  5IT9 E;  1OQK A;  1BB9 A;  2YUO A;  1YBY A;  5LJ5 h;  1SRL A;  2EBP A;  2ED0 A;  3OS0 A;  3NMZ C;  1K9M R;  2CUB A;  2DTH A;  2E41 A;  5KYW B;  1K0X A;  2V26 A;  1YCY A;  4FT2 A;  1Q7Y U;  2FPF A;  2JVV A;  4M78 E;  1OYX A;  3A98 A;  2ZZD A;  5IHI A;  2WAC A;  4FT4 A;  3H0H A;  4JJC A;  3UA6 A;  3L2W A;  3CCV T;  1VUB A;  2K5L A;  1G83 A;  3SWN A;  5IHK A;  2D0N A;  2ZPF B;  2GFU A;  1PSE A;  2CZ0 B;  2QGF B;  1Q81 U;  1UGP B;  4AT1 B;  4EMH A;  5J3B A;  3OMG A;  4M75 C;  5GAN d;  2CKK A;  2VGN A;  3VS7 A;  2RJF A;  3FRN A;  3QBY A;  2JS2 A;  5CQX A;  1RAC B;  4E7H A;  2FHD A;  4BAC A;  5L23 A;  2DAQ A;  3KBG A;  1B07 A;  2AZS A;  3CD6 A;  1I8F A;  2QGG A;  2D8H A;  2X3W D;  1WJQ A;  3C95 A;  3OYA A;  1RAH B;  2G6F X;  1CSK A;  5GAN 3;  1ZSZ C;  2DD5 A;  5IAY A;  4HCC A;  3LH0 A;  3TSZ A;  2X35 A;  1VQ4 A;  2OAU A;  4JZ3 A;  1ZLM A;  3CPW P;  1VQN Q;  3OYC A;  3CD6 Q;  1I07 A;  1LVK A;  2R5A A;  3HTR A;  3EHR A;  4KBM B;  3VS6 A;  1Z9Q A;  4C0Z A;  1UUE A;  3TSW A;  2KGT A;  1A0N B;  1ACM B;  4XQ3 A;  2AT1 B;  2MIO A;  4FYX B;  1Y0M A;  2HL3 A;  4BY6 C;  2DA9 A;  1VQ4 Q;  2EGC A;  4QVZ A;  1W2B A;  3JCM g;  3QSU A;  4M7A B;  2ZAE A;  3VS0 A;  4LDY A;  3D7S B;  1RL2 A;  2ZPG B;  4L5G A;  1K73 C;  2IG0 A;  1UE9 A;  4OMM A;  2KSS A;  5A0D A;  1KJW A;  1UDL A;  1V76 A;  2RK1 A;  4M7D G;  2O2O A;  1D3B B;  4ELZ C;  3OYD A;  2DZC A;  2MAM A;  4F16 A;  2DJZ A;  2K7A A;  3NTI A;  1GBR A;  3X28 B;  3MEA A;  2E1H A;  5GAN 7;  3I5R A;  3EH1 A;  4IIO A;  3G71 T;  4PNO A;  1KIK A;  3OB9 A;  1YN8 A;  1PNJ A;  3CBM A;  2EWN A;  1KFZ A;  4C8Q D;  3A5Z B;  2CH4 W;  4HA8 A;  3RKY A;  2NLU A;  3L2R A;  4J9B A;  4B6M A;  3PE0 A;  1NE8 A;  2DEU A;  2X4X A;  2JS0 A;  3M59 A;  2OTJ Q;  1X75 C;  3PGG A;  1Y07 A;  1LCK A;  3GNF B;  3L1A A;  1H3Z A;  1Q86 U;  2DE0 X;  2J6K A;  1X2K A;  3S3O A;  2RNA A;  3TU4 K;  4M77 B;  4N4I A;  1JBM A;  1M8M A;  2CT3 A;  2V8I A;  3QHS A;  2MWP A;  1W2B S;  2DKG A;  1UB4 A;  4N4G A;  2A3L A;  4RTV A;  1KG1 A;  2DL3 A;  8AT1 B;  2HSP A;  1H3H A;  1XNI A;  2H3J A;  2GGR A;  3JB9 G;  3VU3 C;  2V8J A;  5GMK l;  3EGX A;  2QG9 B;  4RG2 A;  3EFR A;  1SG5 A;  4XTZ A;  4FIB A;  1Q95 G;  5KE3 A;  2KRM A;  4RCC A;  4PJO D;  2COZ A;  4M78 G;  3GIB A;  1Z9Z A;  3A8L B;  3UF4 A;  3OYF A;  4J8O A;  5KCH A;  2Y4X A;  2IIM A;  5KYY A;  3SWN B;  3I55 T;  4KRT A;  2HBP A;  1UJ0 A;  4N0A C;  3E19 A;  3I35 A;  2ZPB B;  2K9G A;  1V1C A;  1BBZ A;  2M16 A;  1KD1 R;  2YSQ A;  1AD5 A;  3G1J A;  4A4F A;  2D0Q B;  1P92 A;  1YJN T;  5GAM g;  2LCS A;  2EW3 A;  4JRQ A;  2LRQ A;  2VAS A;  4XU0 A;  5CK9 A;  3CCS A;  3E1S A;  4AFU C;  2YRD A;  1VQ6 T;  2DBK A;  1YJ9 T;  1K9A A;  1M27 C;  3GLX A;  1BI1 A;  2JNG A;  2KI7 A;  5HY6 A;  3E9G A;  2LT1 A;  3MJX A;  3RR6 A;  1X01 A;  2XG8 D;  3RNJ A;  3OYL A;  2J6F A;  2KT1 A;  4JS4 A;  1ABO A;  4HVV A;  5D7U A;  1X43 A;  1U8R A;  2ZCF B;  1HSQ A;  2NUT A;  3CCS Q;  1I1J A;  2DTI A;  3MKD A;  5GAO q;  3UAT A;  1PC0 A;  5FRM A;  4PFP A;  4TVR A;  1M1G A;  4ME7 A;  1RI0 A;  1AWO A;  2OJ2 A;  1E7O A;  4BDY A;  4HVU A;  1AWW A;  2E12 A;  4E6R A;  1M2V A;  1IHW A;  4DEX A;  2QEX T;  3EG9 A;  3L2V A;  5LJ3 e;  3CCJ A;  3SDZ A;  4MZP A;  2OAW A;  1WPY A;  1I4K 1;  1XOV A;  2F2W A;  3VS4 A;  1IB8 A;  3RUX A;  3PVL A;  2DIQ A;  5I21 A;  1WYX A;  2YUP A;  3CXC S;  3CC7 T;  4PLL A;  5FU7 B;  3P8B B;  5CO7 A;  3CCJ Q;  1RAE B;  1KQ2 A;  2HBW A;  2DIL A;  4OB1 B;  4M7D A;  4C92 A;  1DJ7 B;  3MHX A;  5IN1 A;  1SRM A;  1BCM A;  4LUE A;  4WTO B;  2CP6 A;  3QZ9 B;  1QCN A;  2P4R A;  3LW5 E;  4OMP A;  1VQ5 A;  1GFD A;  5GAO l;  1YJW A;  3EG3 A;  1K73 U;  1G3Y A;  4OVA A;  3KFV A;  2L2P A;  3CCU T;  2D8J A;  2FB7 A;  4PJJ A;  1QCF A;  3GOX A;  3J80 E;  1YHQ T;  4MDW A;  4BI4 A;  1UFF A;  2RHY A;  5LJ3 g;  1VQ5 Q;  5KYX B;  5FRN A;  1YJW Q;  1QCO A;  2X4Y A;  4CI0 C;  2FZG B;  4LD9 K;  3EGX B;  4ZNX A;  3ZBD A;  5LJ5 e;  2XI9 A;  1M3A A;  3M5A A;  4HCB A;  2P4T A;  2OTL T;  2A28 A;  3RMQ A;  2QQA A;  4RTZ A;  2DIG A;  2K3B A;  2JOY A;  1R0B G;  3VUZ A;  1QVF A;  2RPN A;  1KQS A;  1J3T A;  1PRL C;  4DQ2 A;  5KYY B;  3OMC A;  1H64 1;  4M7A D;  1QVF P;  1GBQ A;  2EKH A;  1K9M C;  1KQS P;  2RI3 A;  5GJW B;  1RAD B;  1VQ8 A;  2EQU A;  4OMF B;  1G3W A;  3OBY A;  2HMA A;  1M4Z A;  4HVW A;  5GAN 4;  5DM7 R;  2RO0 A;  1EX4 A;  4C8Q E;  2QQS A;  2L89 A;  4LNP A;  1K1Z A;  3JB9 F;  1R77 A;  2B8A A;  1KSW A;  1BCO A;  2BKD N;  1VQ7 A;  3FIF A;  1Q82 R;  1QQJ A;  1D09 B;  3P8D A;  4M78 F;  1K8A R;  1SHF A;  1WXT A;  3INZ A;  3J81 E;  5HK0 A;  1S72 A;  1VQ8 Q;  9ATC B;  3LWI A;  1VQO T;  3QPH A;  5FRO A;  1OZ2 A;  3NHN A;  1OZ3 A;  3JCM X;  5CKD A;  2HD0 A;  3IQL A;  4LD6 A;  3OSV A;  4BDZ A;  1JJ2 P;  1X6O A;  1IGQ A;  1K4U S;  2NUT B;  4XAX B;  3ZL7 C;  1S72 Q;  5GAM j;  1QW1 A;  2CP5 A;  3CCM T;  1E6G A;  3ASK A;  2LT4 A;  3M9Q A;  4X9D A;  4M77 D;  4OF1 A;  5LL6 S;  1YWO A;  4CC7 A;  3CCE T;  1QVF S;  3JCM W;  1KQS S;  4PJO E;  2DVE A;  4PFO A;  4R0K A;  2MF2 A;  4A4K A;  5GAN 5;  2EPD A;  3CMA T;  3G6E A;  1M2V B;  4GY5 A;  3CCL T;  3EG9 B;  3JCM f;  4B9W A;  4AFQ C;  2KYM A;  6AT1 B;  2VGM A;  1IHV A;  3G7Z A;  1GFC A;  2LQN A;  2JM8 A;  2DFU A;  1M90 C;  1B34 A;  4PJN A;  4DEY A;  1FMV A;  5HKC A;  3QZ5 B;  2A36 A;  2JMA A;  3G6E Q;  4E7J A;  5IXB A;  4DA4 A;  1GXI E;  3MPU B;  3AHU A;  4A4E A;  1VQP T;  1NZ9 A;  4FU6 A;  4M7D B;  4JRP A;  4C92 B;  4OML A;  1LJO A;  4M75 A;  1GCQ C;  1VQL A;  2ABL A;  2LJ3 A;  3KUF A;  4A63 B;  3C4S A;  2EJF A;  3JRZ A;  1TU0 B;  4LXC A;  3GBQ A;  2E65 A;  4PK4 A;  1LOJ A;  1V29 B;  3UDC A;  4R56 A;  3LGL A;  1WHM A;  1VQ6 A;  4DOV A;  3CBP A;  1Q7Y R;  2C06 A;  1VQL Q;  1ZSZ A;  5C0M A;  2JN0 A;  3C12 A;  2CDT A;  2KBT A;  3M4Y A;  1KC8 C;  2PNI A;  2RHI A;  3TEE A;  1YJN Q;  3G4S A;  2MK5 A;  1UG1 A;  5GAO p;  2LP5 A;  4ORZ A;  1RAA B;  2CGH A;  4OMN A;  1Q81 R;  4QW2 A;  5D6Y A;  2RF0 A;  1YP5 A;  5GMK j;  2VV5 A;  2PU9 B;  4HKE A;  2KQW A;  3CC2 T;  2F2V A;  4O6J A;  4ZGD B;  1VQ9 A;  1VQ6 Q;  1D0X A;  2EJ9 A;  2EYX A;  3DB3 A;  1TUD A;  1C1A A;  2KNB B;  1BKB A;  1VOM A;  2K4Y A;  2MPX C;  3S6W A;  4AG2 C;  3G4S Q;  4ESR A;  2JW4 A;  1PD1 A;  2R5M A;  2XD0 A;  4X34 A;  4XU3 A;  1XTD A;  4BD3 A;  2J05 A;  5GAO r;  2QQ9 A;  5LJ3 j;  2QEX A;  2E5K A;  3PMT A;  2DEQ A;  3RES A;  1VQ9 Q;  3HFN A;  1IZ6 A;  4RUG A;  3JCM d;  2K5I A;  3VV0 A;  4C8Q G;  4A53 A;  1YCS B;  4XU2 A;  2K3Y A;  2EGA A;  1MMA A;  2JJ9 A;  4PL6 A;  5GJV B;  1B7T A;  2YWW A;  2JM9 A;  4F7U G;  1OPL A;  1JXO A;  2RQV A;  3M55 A;  5GAM f;  2CH4 A;  3BE3 A;  2DD4 A;  4JDS A;  4JUV A;  2QEX Q;  5FWC A;  1ZUY A;  3BW1 A;  2DLP A;  3SHW A;  1TOV A;  7AT1 B;  1VQN A;  1G3S A;  1ZA1 B;  2P0P A;  4J9H A;  1MHN A;  2CP0 A;  2RB6 A;  3C0C A;  1TSF A;  2FO0 A;  2BZX A;  1QMC A;  2HQH A;  3V8K A;  3NPF A;  2OX7 A;  1XQH A;  4M4Z A;  1YNZ A;  1VQM A;  4RKU E;  4BI8 B;  1M2O A;  5GAN e;  2X9H A;  1OX8 A;  2JXB A;  3HFO A;  1U3O A;  2DK3 A;  3I56 A;  3FJP A;  5CKE A;  1EZZ B;  3QII A;  3CCR A;  4EMK C;  3S3M A;  1YHQ A;  4HCZ A;  2HKN A;  2FRW A;  4XK8 E;  3HRT A;  1TTH B;  4JPB W;  3VRY A;  2CYZ B;  2R58 A;  3M58 A;  2LQW A;  5GAN 6;  1VQM Q;  4HT9 A;  4L6V 5;  3I56 Q;  5LJ5 j;  1O75 A;  2MWO A;  1X69 A;  3H41 A;  2K3X A;  1W2B P;  1R0C B;  3MET A;  5IXF A;  3CCR Q;  3QDF A;  1SSH A;  2E4H A;  1YHQ Q;  3CME T;  3M53 A;  4M7A E;  2RQU A;  3O8V A;  2YUN A;  4FW2 A;  4FSX A;  2JUF A;  3CC4 T;  1B34 B;  1Q86 R;  1OI1 A;  3ER0 A;  2EQM A;  4X1V A;  3QUI A;  2OTJ A;  3F70 A;  1AEY A;  2K57 A;  4N0A A;  4AG1 C;  2LNV A;  4F17 A;  2QDY B;  4M75 B;  1M1K C;  3OSS C;  4ANJ A;  2HEQ A;  4J6Y A;  2HSE B;  1U06 A;  1CKB A;  3QWY A;  4IUV A;  2YXY A;  2VXF A;  2NUZ A;  5J39 A;  2RA2 A;  3NTH A;  3DLM A;  1IXD A;  4JJD A;  3TQ7 P;  1QWF A;  4BB7 A;  3OA6 A;  2HQX A;  1YIT A;  1M90 U;  3VYH B;  2ENM A;  1E6H A;  2GNC A;  3EGD A;  4BE0 A;  1QWE A;  1KK7 A;  1TS9 A;  2KK4 A;  1FMW A;  1UEC A;  3BDU A;  1HJD A;  5DLO A;  2QTV A;  3PTA A;  2RJD A;  1HYO A;  1OU8 A;  4II1 A;  4M77 E;  2XID A;  2ESW A;  2DF6 A;  2HCK A;  3QJY A;  3H8Z A;  3HSB A;  1VYU A;  4IUT A;  2WSC E;  1YIT Q;  4FCY A;  2HQE A;  2XDD A;  1NJI C;  4BY6 B;  1WI7 A;  3OYN A;  4QVC A;  2L3S A;  4QQD A;  4IKF A;  1MV0 B;  2A0F B;  2DVJ A;  2L0A A;  4J7I A;  1PM3 A;  2LQK A;  4J9D A;  2J6O A;  1SSF A;  2EGE A;  1BIA A;  2QA4 A;  2DYB A;  1KC8 U;  4X9C A;  1VYT A;  2RD1 A;  2BE9 B;  2MI6 A;  5CIU A;  2VB6 A;  3LYI A;  1YIJ T;  3REA B;  3VYG A;  2M0Y A;  2D1X A;  1ABQ A;  1RAB B;  1YI2 A;  2VUB A;  3H0I A;  3PMI A;  4BUG A;  2YHT A;  1VQK T;  1NYG A;  3CXC A;  3EFO A;  3OW2 A;  4ZN3 A;  3I9Q A;  2QA4 Q;  3CXC P;  3RKW A;  4M7D D;  3MEV A;  4C92 D;  1B3Q A;  4PJM A;  1UEB A;  2RQR A;  4C0D C;  4F7U A;  4OB3 B;  4HT8 A;  1YI2 Q;  2ZPI B;  2K5F A;  3HRU A;  1PSF A;  1RLP C;  4C8Q F;  5GAN h;  3A8O B;  4E7Z A;  4IUU A;  2VXE A;  4D8D A;  2DL8 A;  1VQP Q;  2BE7 D;  4CC3 A;  4F7U F;  2X4W A;  1RAF B;  1VIE A;  2JTF A;  2E3H A;  2JT4 A;  1QVP A;  2O4X A;  3LGF A;  1SF9 A;  3OYM A;  5IHN A;  3CCQ A;  3JCM J;  3JB9 H;  1PKT A;  3HRS A;  2EQJ A;  4MDX A;  1YWP A;  4C5I A;  3UWN A;  5I11 A;  4BE2 A;  5CCA A;  4ATO A;  2FG0 A;  2J06 A;  4M7A G;  3LWH A;  4IIM A;  2ROL A;  4RTX A;  1N9R A;  3JB9 J;  2E64 A;  1BYM A;  3MP8 A;  1K73 R;  2JMC A;  2O31 A;  3CCQ Q;  3KXT A;  1N8R C;  2FRY A;  3MO8 A;  2IVW A;  4XTY A;  2EYQ A;  2PTK A;  2HAX A;  5EC7 A;  1OU9 A;  1LPL A;  3OW2 S;  4XTU A;  2GF7 A;  3CCV A;  4J9C A;  3UA7 A;  2C0O A;  2EYW A;  4Y91 A;  4PJO F;  5I22 A;  2HKQ B;  3VUB A;  4C5G A;  2ZPH B;  3T9N A;  2YT6 A;  3V8L A;  4C8Q C;  3WXM B;  2X4J A;  2WSE E;  5GMK m;  1SPK A;  2QI2 A;  4YTL A;  1T0J A;  2XIC A;  4LN2 A;  1WNL A;  3UPU A;  3QWX X;  3ZEH A;  4L59 A;  2VKN A;  3CCV Q;  1IGU A;  2GBQ A;  3M0S A;  3CD6 T;  2L3R A;  3A8M B;  1Y7X A;  1U1S A;  1KHC A;  4CC2 A;  4JLG A;  2YRC A;  3LH5 A;  2YUQ A;  2PUO B;  3REB B;  3LX7 A;  2LVM A;  4M77 G;  2M02 A;  2D9T A;  3V8J A;  5GAN j;  3BY7 A;  1VQ4 T;  3OYY A;  3OY9 A;  1FMK A;  2KVQ G;  3X24 B;  2X3X D;  2QXF A;  2XMF A;  4KUD K;  1M1K U;  1BU1 A;  1K0S A;  2DJQ A;  2J7I A;  1N5Z A;  1Q81 C;  3UT1 A;  2EQI A;  4QVD A;  3EAE A;  1QP3 A;  3DKM A;  5CQY A;  3JCM P;  4PJO C;  4OGC A;  4PJL A;  2DXC A;  3E2U A;  4NS5 A;  2MCN A;  5FU6 B;  5KE2 A;  5DLQ E;  1G3T A;  1AVZ C;  3JCM Q;  1QLY A;  1UGS B;  2FPE A;  1OX9 A;  2QAS A;  3OYE A;  4M78 A;  1I0C A;  1ZSG A;  4RTU A;  2HNI A;  4J6W A;  3EFO B;  1G5V A;  4O5V A;  1VIF A;  3G71 A;  1NPR A;  1NJI U;  1GCQ A;  4M75 D;  3X20 B;  4ZTJ A;  4LDV A;  1ZA2 B;  2DZ9 A;  2QQB A;  4Z8A A;  4F7U B;  5CKH A;  5LJ5 g;  1NLP C;  3M54 A;  2F2X A;  5FW9 A;  1BIB A;  4NL2 A;  4E7L A;  2DXT A;  1C0M A;  1F1B B;  3G71 Q;  2RK2 A;  1JXM A;  2CP3 A;  2QTX A;  5A2Q E;  2K79 A;  2DL5 A;  2DET A;  2DL7 A;  5GAN 8;  3U23 A;  1BI3 A;  3EG2 A;  2F69 A;  4HCK A;  2KR3 A;  4XTV A;  5GAO n;  2DX1 A;  5KH6 A;  3M0U A;  1AWX A;  2KEA A;  4EDU A;  3JCM b;  3L42 A;  1D1A A;  2VWF A;  2CZ7 B;  2KXC A;  4J9E A;  3M57 A;  3PIP A;  1WXU A;  2DER A;  1T0H A;  4AMC A;  2EJG A;  1ZBX A;  2FL7 A;  1AZG B;  2I0N A;  4E47 A;  2L3Q A;  1W6X A;  3HPW A;  4FM4 B;  4CC4 B;  2DTO A;  3E9F A;  2QQR A;  3RBB B;  2O9S A;  3CPF A;  2FYK A;  1N27 A;  3HL8 A;  2LMJ A;  3I55 A;  2XK0 A;  1H92 A;  4ZTF A;  1UTI A;  3RKX A;  2LQ8 A;  2K2M A;  2F5K A;  3NFC A;  2CRE A;  1X6G A;  4M7D E;  2VYT A;  4C92 E;  2EAY A;  2P84 A;  1LNX A;  4J5Y A;  1YJN A;  1Y96 A;  4M7A F;  2RI5 A;  2E6Z A;  3HP9 A;  1FYN A;  3GNG A;  3JB9 I;  4E2F B;  1M8V A;  1PCX A;  4NL3 A;  3I55 Q;  2CP2 A;  4MZT A;  4JZ4 A;  2E70 A;  3CCS T;  2JTM A;  4RTY A;  4J9G A;  3NTK A;  1YJ9 A;  1N8R U;  4GLM A;  3OBW A;  5KYU A;  1JEG A;  1I5L A;  3VS3 A;  3WVE B;  1WIE A;  3SB2 A;  2FVU A;  3O5Z A;  1YFN A;  1VQK Q;  2DYI A;  3P8H A;  4EMK A;  2RJE A;  5IH2 A;  1YJ9 Q;  1AHJ B;  2FZC B;  5GAN 2;  3ME9 A;  2L8D A;  4J7F A;  4RTT A;  3RMS A;  4XU1 A;  1M30 A;  1M3C A;  2H8H A;  4C5H A;  4KT0 E;  3CCJ T;  4M77 F;  4M7A C;  2MOX A;  2KRO A;  3MEW A;  4FYV B;  3R6O A;  4LDX A;  2E10 A;  2JTE A;  3JCM c;  4DBF A;  1MV3 A;  2LJ0 A;  4M78 B;  4JRI A;  4IUQ A; 
#chains in the Genus database with same CATH homology
 1HJD A;  2KE9 A;  2OI3 A;  2V1R A;  2O88 A;  3VS1 A;  2YUP A;  2ESW A;  2KRN A;  5FWB A;  1ZUK A;  1K76 A;  4F14 A;  2DF6 A;  2EYZ A;  2HCK A;  1VYU A;  2HBW A;  2AKK A;  2DIL A;  2SEM A;  2QDL A;  2BTT A;  1SRM A;  4LUE A;  2BZY A;  1WI7 A;  2L3S A;  3ULR B;  1UJY A;  2P4R A;  1RI9 A;  1MV0 B;  4OMP A;  2ECZ A;  2ROT A;  1GFD A;  1UHC A;  2DVJ A;  2L0A A;  1GCP A;  4J9D A;  3EG3 A;  1TUC A;  1VYV A;  2C0T A;  2J6O A;  3KFV A;  4AFZ C;  2DMO A;  2L2P A;  1OOT A;  2EGE A;  4WCI A;  2D8J A;  2EYY A;  2DYB A;  1QCF A;  2DM1 A;  1SHG A;  2VVK A;  1VYT A;  1S1N A;  2RQW A;  1UFF A;  3REA B;  1HD3 A;  1TG0 A;  1X2Q A;  2M0Y A;  2D1X A;  2GTO A;  1ABQ A;  1RUW A;  3H0I A;  2SRC A;  1RLQ C;  1X6B A;  1NYG A;  4Y92 A;  3VS5 A;  5ECA A;  3I9Q A;  4ZNX A;  1H8K A;  1WX6 A;  1M3A A;  1NG2 A;  3JV3 A;  1B3Q A;  1UGV A;  2GQI A;  1GL5 A;  2A28 A;  2RMO A;  4RTZ A;  2RQR A;  2AZV A;  2LJ1 A;  2K3B A;  2DRK A;  1IO6 A;  1SEM A;  1RLP C;  1WXB A;  2RPN A;  2ED1 A;  1J3T A;  1PRL C;  4D8D A;  2PZ1 A;  2DL8 A;  2A37 A;  2GTJ A;  3EGU A;  1NYF A;  1GBQ A;  2EKH A;  5HCK A;  3M0R A;  3FJ5 A;  1OEB A;  5GJW B;  4CC3 A;  1QKW A;  2B86 A;  4HVW A;  2RN8 A;  4EIK A;  3M0T A;  3EHQ A;  2JT4 A;  4LNP A;  1K1Z A;  5IHN A;  2O9V A;  1PKT A;  4Z89 A;  1AZE A;  1AWJ A;  1YWP A;  5I11 A;  1KSW A;  2FG0 A;  1PHT A;  1PRM C;  1BB9 A;  2YUO A;  2J06 A;  3EG0 A;  3M0Q A;  1SHF A;  1WXT A;  4IIM A;  2ROL A;  1SRL A;  2EBP A;  2ED0 A;  4RTX A;  2LZ6 B;  1UHF A;  3NMZ C;  2CUB A;  2JMC A;  2O31 A;  2DRM A;  1ZBJ A;  2FRY A;  3NHN A;  1K0X A;  4OMO A;  4GBQ A;  2FPF A;  2PTK A;  5EC7 A;  3A98 A;  5IHI A;  3IQL A;  3H0H A;  4JJC A;  3UA6 A;  4J9C A;  3UA7 A;  2C0O A;  2EYW A;  1K4U S;  1G83 A;  5I22 A;  5IHK A;  2D0N A;  3ZL7 C;  1M3B A;  3M0P A;  1E6G A;  2YT6 A;  4AFS C;  3TVT A;  1NEB A;  3VS7 A;  1SPK A;  1NM7 A;  1T0J A;  1YWO A;  4LN2 A;  2JS2 A;  4CC7 A;  3QWX X;  4R0K A;  2EPD A;  2VKN A;  1NEG A;  5L23 A;  2GBQ A;  2L3P A;  3M0S A;  1B07 A;  2AZS A;  4AFQ C;  2KYM A;  2DL4 A;  4CC2 A;  2D8H A;  3LH5 A;  2YUQ A;  2CSQ A;  2X3W D;  1GFC A;  2DBM A;  2LQN A;  3REB B;  2JM8 A;  2G6F X;  1CSK A;  4DEY A;  3TSZ A;  2A36 A;  1NLO C;  4JZ3 A;  1ZLM A;  1FMK A;  2JMA A;  2X3X D;  1GRI A;  2HDA A;  1Y57 A;  2XMF A;  3THK A;  5IXB A;  1I07 A;  1BU1 A;  3EHR A;  3VS6 A;  1MUZ A;  2KT8 A;  4OML A;  1Z9Q A;  1K0S A;  1W70 A;  2LX7 A;  1GCQ C;  1UUE A;  3TSW A;  2ABL A;  2LJ3 A;  2KGT A;  1A0N B;  2J7I A;  1N5Z A;  1EFN A;  4J9I A;  2EQI A;  2MIO A;  2NWM A;  4A63 B;  2V1Q A;  1Y0M A;  2DA9 A;  2EGC A;  3GBQ A;  1WLP B;  2MCN A;  3VS0 A;  2KXD A;  2AK5 A;  1AVZ C;  1UE9 A;  4OMM A;  1KJW A;  1UDL A;  1WA7 A;  1G2B A;  1QLY A;  2FPE A;  2O2O A;  4LE9 A;  2CDT A;  2KBT A;  2W0Z A;  2PNI A;  2CSI A;  4F16 A;  1I0C A;  1ZSG A;  2K7A A;  1UG1 A;  2LP5 A;  4ORZ A;  4RTU A;  4OMN A;  2CT4 A;  1GBR A;  2A08 A;  2RF0 A;  1YP5 A;  3H0F A;  3I5R A;  4IIO A;  1KIK A;  2F2V A;  1YN8 A;  1PNJ A;  1ZX6 A;  1KFZ A;  2EYX A;  1GCQ A;  2CH4 W;  1TUD A;  2KNB B;  4J9B A;  4RTW A;  4Z8A A;  2KYB A;  3PE0 A;  1OPK A;  4AG2 C;  4ESR A;  2JW4 A;  1NLP C;  2F2X A;  2JS0 A;  5FW9 A;  2CUD A;  1LCK A;  2J05 A;  2FEI A;  2DE0 X;  2E5K A;  2J6K A;  1JXM A;  1ZUU A;  4RUG A;  1X2K A;  2K79 A;  2DL5 A;  2DL7 A;  1YCS B;  3U23 A;  2RNA A;  3EG2 A;  3R6N A;  3VRZ A;  2EGA A;  4HCK A;  5GJV B;  2KR3 A;  2C0I A;  1M8M A;  2CT3 A;  2JM9 A;  2DX1 A;  1OPL A;  3M0U A;  1AWX A;  1JXO A;  2KEA A;  2DL3 A;  4RTV A;  2RQV A;  2VWF A;  4QT7 A;  2HSP A;  2CH4 A;  1H3H A;  2KXC A;  4J9E A;  5FWC A;  1ZUY A;  2GGR A;  2DLP A;  3SHW A;  1WXU A;  2YDL A;  1T0H A;  4J9H A;  1WFW A;  3PVQ A;  3C0C A;  1AZG B;  2I0N A;  2FO0 A;  2BZX A;  2KRM A;  1T3L A;  2L3Q A;  1W6X A;  1BK2 A;  3NPF A;  1Z9Z A;  3UF4 A;  4M4Z A;  4CC4 B;  1YNZ A;  1U5S A;  1JU5 C;  3RBB B;  2O9S A;  2IIM A;  2JXB A;  1U3O A;  1PWT A;  4KRT A;  1CKA A;  2LMJ A;  1UJ0 A;  1H92 A;  3I35 A;  1UTI A;  2AKL A;  2K9G A;  1V1C A;  1BBZ A;  2K2M A;  1W1F A;  2CRE A;  2FRW A;  2YSQ A;  4HXJ A;  1AD5 A;  4JPB W;  1X6G A;  3VRY A;  2M51 A;  2LQW A;  2LCS A;  2EVR A;  4JJB A;  1FYN A;  4K11 A;  2KRS A;  3EG1 A;  2EW3 A;  1WDX A;  1OV3 A;  1X69 A;  3H41 A;  5IXF A;  4JZ4 A;  4OMQ A;  4AFU C;  4RTY A;  1JO8 A;  1SSH A;  4J9G A;  2DBK A;  1K9A A;  2RQU A;  4GLM A;  1JEG A;  2YUN A;  3VS3 A;  1M27 C;  2LNH B;  2FPD A;  1PKS A;  1WIE A;  2DNU A;  1VA7 A;  4X1V A;  3RNJ A;  2BZ8 A;  2J6F A;  3O5Z A;  3SEM A;  2KT1 A;  1AEY A;  1ABO A;  4HVV A;  4AG1 C;  1X43 A;  3I5S A;  4F17 A;  1HSQ A;  1I1J A;  5IH2 A;  2K6D A;  3UAT A;  2HEQ A;  2W10 A;  1ARK A;  1U06 A;  4RTT A;  3VS2 A;  1AOJ A;  1CKB A;  1QKX A;  3QWY A;  4FSS A;  4Z88 A;  1AWO A;  2OJ2 A;  4LUD A;  1E7O A;  1M30 A;  1M3C A;  2NUZ A;  1AWW A;  2RQT A;  4HVU A;  1JQQ A;  2H8H A;  4D8K A;  4E6R A;  3CQT A;  4DEX A;  4JJD A;  1QWF A;  2MOX A;  2KRO A;  3NGP A;  2OAW A;  2ENM A;  1E6H A;  2GNC A;  1XOV A;  2JTE A;  4J9F A;  2F2W A;  3VS4 A;  1T3S A;  1QWE A;  1MV3 A;  1X27 A;  2LJ0 A;  3PVL A;  2DJQ A;  1WYX A;  1UEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...