1GBRA

Orientation of peptide fragments from sos proteins bound to the n-terminal sh3 domain of grb2 determined by nmr spectroscopy
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
74
structure length
74
Chain Sequence
b'GSRRASVGSMEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPEFIVTD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GROWTH FACTOR RECEPTOR-BOUND PROTEIN 2
publication title Orientation of peptide fragments from Sos proteins bound to the N-terminal SH3 domain of Grb2 determined by NMR spectroscopy.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signal transduction protein
total genus 7
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 1994-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1gbrA00
2A28A 2DBKA 1X6GA 2RQUA 5EC7A 1B07A 4DEYA 1NYFA 2LQNA 1UHFA 1Z9QA 4OMNA 2EW3A 2O88A 1VYUA 3VS4A 1YWPA 1K9AA 1E6GA 1ABOA 2O9VA 1NLOC 3QWXX 1V1CA 3M0PA 1X69A 1KSWA 2EVRA 1M8MA 4RTYA 5IXFA 4GLMA 4RTWA 3UA6A 1HSQA 2K6DA 3THKA 3NMZC 3I5SA 3UATA 2FPDA 2C0TA 4ZNXA 1UE9A 1UTIA 3M0TA 1WXBA 4JZ3A 2L0AA 3H0IA 3VRYA 2J6OA 2KROA 1M3AA 2LCSA 2FRWA 2JW4A 2DRKA 2LX7A 2V1QA 1WA7A 4J9HA 4AFSC 3IQLA 2JMAA 1W6XA 3LH5A 2JS2A 4HVUA 1FYNA 4WCIA 2X3XD 2L3SA 4OMOA 4AFQC 1G2BA 2J7IA 1K1ZA 4ESRA 1UUEA 4JPBW 3I5RA 4F16A 1I07A 5IH2A 1K76A 3EHQA 1MUZA 1AWOA 1PWTA 2J05A 4EIKA 1I1JA 2XMFA 2BZ8A 2FG0A 1PHTA 2EQIA 4J9EA 1GRIA 1UG1A 1QWFA 3ZL7C 1U06A 2ABLA 2OJ2A 1H8KA 3I35A 5I22A 4R0KA 1GCPA 5IXBA 2D8HA 2YUNA 2FPFA 1T3SA 4E6RA 2BZXA 1PRMC 2IIMA 2B86A 1CKBA 1I0CA 2OI3A 4D8DA 1X6BA 1G83A 2ROLA 2EKHA 5L23A 2JMCA 2BTTA 3VRZA 2EGEA 4Z89A 1ZBJA 2H8HA 3TSWA 1N5ZA 1YWOA 1UECA 2LJ0A 2KXCA 1QWEA 2DILA 2F2WA 2KRNA 4JJCA 1GBRA 3R6NA 4J9DA 3U23A 4J9BA 3VS6A 2X3WD 2DMOA 2CT3A 2DNUA 2CH4A 3A98A 2EYZA 1AWXA 1AVZC 2CUDA 2RQVA 1KJWA 2CSIA 1ZLMA 1WX6A 2GQIA 2FPEA 1K0XA 1XOVA 1U3OA 4RTTA 2DE0X 4J9IA 2LQWA 1VYVA 3VS1A 1SSHA 1SHFA 2HSPA 2YUPA 3TSZA 2HCKA 3M0RA 2LJ1A 2DL5A 4JZ4A 4HVWA 2LP5A 4RUGA 1AD5A 5GJWB 2JM9A 1JXOA 1X43A 2CDTA 2RNAA 1AZGB 3C0CA 1SHGA 2O31A 3PVQA 2CUBA 2KRSA 4F17A 1GCQC 1RI9A 4OMLA 4Z88A 3FJ5A 3GBQA 1TG0A 2DJQA 2AKKA 2RMOA 2DL3A 2K79A 1SEMA 4LUDA 1UJ0A 2RQTA 1WLPB 2SEMA 2E5KA 2L2PA 4J9FA 2CSQA 1YN8A 1Z9ZA 1JO8A 3PVLA 3RBBB 2KXDA 1X27A 3M0UA 1AZEA 1W1FA 2NWMA 2RQWA 4K11A 2DL8A 2G6FX 1YP5A 2DF6A 2ROTA 1AOJA 4CC4B 3H0FA 5I11A 2EGAA 2DBMA 2CREA 1KIKA 4J9CA 2ED0A 3M0QA 2NUZA 1T0JA 2M0YA 3VS3A 3H41A 1M3CA 1H3HA 4J9GA 2CH4W 3NGPA 1JXMA 2PZ1A 2MCNA 4CC2A 1OEBA 2DL4A 1X2KA 1OV3A 1RUWA 1OPLA 5FWBA 5IHKA 2YDLA 2L3PA 2A37A 1MV0B 2DL7A 4CC3A 4LNPA 2KR3A 5FW9A 4GBQA 1TUCA 3NHNA 1PRLC 1NG2A 2JTEA 2GTJA 2KYMA 2K3BA 2K7AA 3QWYA 3RNJA 2PNIA 2K9GA 1CSKA 2W0ZA 1NYGA 2LZ6B 2C0IA 4D8KA 1B3QA 2J06A 3H0HA 1NEBA 3UF4A 1Y57A 2J6KA 3VS0A 2W10A 2DRMA 3EHRA 2KT8A 2CT4A 1W70A 3EG3A 1UJYA 3EG2A 4RTZA 4RTVA 2RF0A 1PKSA 1M30A 3I9QA 2KYBA 2ECZA 4IIOA 2RPNA 2RQRA 2GGRA 1J3TA 1AWJA 4AG1C 2LJ3A 4QT7A 2ENMA 2PTKA 2VKNA 1ARKA 5IHNA 1QKWA 4CC7A 1S1NA 2YSQA 2AZSA 1JU5C 2AKLA 4OMQA 2KGTA 2A36A 1WXUA 2BZYA 1GFCA 2SRCA 1T0HA 2HDAA 1QLYA 3ULRB 1X2QA 2JXBA 2F2VA 2GNCA 5ECAA 2EYXA 2I0NA 1HD3A 1Y0MA 1IO6A 2DVJA 2FRYA 1TUDA 4JJDA 1UFFA 2YUOA 2C0OA 2M51A 1SRLA 1ZSGA 3EGUA 1JQQA 1WXTA 2EYYA 2YUQA 2VVKA 3KFVA 1GBQA 1WFWA 1UDLA 4HVVA 3SHWA 4HCKA 2O2OA 1FMKA 1M27C 1PKTA 2D1XA 3PE0A 5HCKA 2HEQA 2FEIA 1EFNA 2LNHB 2EBPA 1CKAA 3TVTA 2J6FA 2DLPA 2FO0A 5GJVB 2KT1A 2AZVA 2VWFA 1K4US 4KRTA 4IIMA 1BU1A 1ABQA 1U5SA 2V1RA 1MV3A 4AFUC 1SPKA 2MOXA 2RN8A 2OAWA 1ZX6A 1YNZA 2ESWA 2L3QA 2GTOA 1A0NB 1UHCA 2KBTA 2AK5A 1YCSB 2HBWA 2MIOA 1KFZA 2O9SA 1QCFA 1OOTA 5IHIA 4RTUA 1SRMA 2K2MA 2KEAA 2LMJA 1E6HA 1UGVA 1AEYA 2YT6A 3M0SA 2JS0A 1H92A 1RLQC 3SEMA 1NM7A 5FWCA 3EG0A 4LUEA 2DYBA 4FSSA 1VA7A 2KRMA 1BK2A 1K0SA 3UA7A 1VYTA 2F2XA 3NPFA 1BB9A 4M4ZA 1GFDA 2ED1A 2KNBB 3EG1A 4Z8AA 4AFZC 1WIEA 2JM8A 4Y92A 1WDXA 1T3LA 2DA9A 4AG2C 3JV3A 1LCKA 1JEGA 4DEXA 4OMMA 1E7OA 1HJDA 3REBB 4F14A 3CQTA 4LN2A 1BBZA 1AWWA 3REAB 1WYXA 1ZUUA 1RLPC 4JJBA 4ORZA 2KE9A 1QKXA 2JT4A 4OMPA 1NLPC 1PNJA 3O5ZA 4RTXA 2D8JA 3VS2A 2EPDA 3VS7A 2P4RA 3VS5A 1ZUYA 4X1VA 2DM1A 1ZUKA 2A08A 2EGCA 1GL5A 2EYWA 2QDLA 1NEGA 2GBQA 2D0NA 4A63B 4LE9A 1WI7A 2DX1A 1M3BA 1GCQA 1OPKA 4HXJA
chains in the Genus database with same CATH superfamily
2CZ1B 2DBKA 1VQLQ 3QIIA 2K5FA 2CZ7B 4PJMA 1Z9QA 1VUBA 5CQXA 5J26A 2O88A 1G3SA 1K8AU 2DD5A 1BI2A 2E3IA 4QW2A 3ZEHA 1K9AA 1E6GA 2R5AA 2O9VA 4BD3A 1JJ2A 2ZPEB 1Q86R 1MGQA 1D09B 3NMZC 3UATA 4M75F 2NYSA 4DBQA 1YCYA 2ZZDA 1BI1A 1XTDA 3VRYA 4C0GA 2LCSA 3JCMe 4BI4A 5L8RE 1IZ6A 3RUXA 4C92A 1EIFA 8AT1B 1FMVA 2NUPA 4JUVA 1FYNA 2BUDA 1I5OB 1YITQ 3X25B 4C8QD 2J7IA 4C0FA 5GAN2 2HL5C 5GAN8 1G3TA 1WNLA 4JPBW 4XU2A 3MP6A 5IH2A 5GAN3 4LDXA 1D3BB 3HRSA 2J05A 4EIKA 2BZ8A 3CCMA 3QJYA 5A0DA 3OYJA 2E3HA 1PHTA 2EQIA 3HKSA 2ZPHB 1GRIA 1JJ2P 4QVDA 2AT1B 4LD6A 2ABLA 2OJ2A 5CCAA 2OTLT 3CMAQ 2YUNA 2AHJB 2FPFA 4E6RA 3OY9A 1RAFB 5IAYA 1BIAA 2PQWA 1CKBA 4DBFA 2EKHA 3CCRQ 1I4K1 3CC7Q 2BTTA 3NTIA 3VRZA 3HTRA 5FLXE 2LJ0A 2HKQB 5GAN6 1NJIR 5D6WA 4C92F 2EFIA 4J83A 4IUQA 1OI1A 1GBRA 3LLRA 2QXFA 3CBPA 3ER0A 4J9BA 4ZN3A 1PM3A 3VS6A 2DMOA 5HK0A 4NL2A 1Y96B 2PU9B 3CCSQ 3OYNA 4OVAA 3R6OA 3CC4T 2HL3A 1U3OA 2DE0X 2MWOA 1SSHA 4TVRA 2HSPA 3TSZA 3V8LA 4VUBA 2LJ1A 2COYA 4CI0C 1R77A 3OW2A 4C5HA 1X43A 4BY6B 1EX4A 1YJ9Q 1AZGB 5FU7B 4LD9K 2ZPGB 4LDWA 2EAYA 1SHGA 5GANj 3QDFA 1GCQC 1KD1R 4XTXA 3UDCA 4HA8A 5AT1B 1B34B 3CEYA 1M8VA 1WLPB 2SEMA 3MEVA 3V7CA 4M77D 4ZGEB 3OYEA 3QUIA 5GAOp 1VQ5A 1AZEA 3M0UA 1W1FA 2M9UA 2E4HA 2NWMA 2RI5A 3JCMX 4FW2A 3PT9A 1AOJA 3OW2P 1VQ9A 2KK4A 2DBMA 1KIKA 2X4JA 1KC8U 2ED0A 5LJ5f 3O8VA 3OQ5A 5FROA 2CH4W 1K9MC 4C0ZA 3HFNA 3NGPA 3I55Q 2C06A 1RUWA 3UT1A 5KYUA 1FXXA 1RI0A 5IHKA 3DB3A 3JB9G 1S72T 3META 2RHXA 2L3PA 1BCMA 4V2SA 2A37A 3PGGA 3QJ6A 2DERA 4B6MA 3NHNA 3RMSA 2MAMA 1K73C 3VKIA 4F04B 2EKOA 2JTMA 1AT1B 3CMEA 4PFOA 4FW1A 2PNIA 1H641 2LZ6B 3VYHB 3JB9J 2CP6A 2XG8D 3OS5A 1B3QA 5D7UA 2YXYA 3VS0A 4WF2A 1N9RA 3MEUA 2DIQA 1W70A 1UJYA 2DEQA 1Q7YC 3EG2A 3A8OB 2VASA 1W2BP 1YITT 4JRIA 3QG1A 2X9HA 3TREA 3CC2Q 2MYSA 4IIOA 4M77C 2EJGA 2F69A 1AWJA 2LJ3A 1KC8R 2QDYB 4B9XA 4E7HA 4CC7A 1S1NA 2DEUA 2QQBA 2YSQA 2Y4YA 3ZBDA 4M7DF 2A36A 1VQ7A 1GFCA 2SRCA 4BDYA 3HSBA 1X2QA 3CMAT 2QA4A 2F2VA 2GNCA 2JN0A 5ECAA 1UEBA 2CZ6B 1QVGS 2I0NA 1VQ4Q 5KYXA 3RESA 1IO6A 2RJDA 2VV5A 2DVJA 1TUDA 1U1TA 2YUOA 5GAOr 3J81E 2HNIA 3RKWA 1WXTA 2WSCE 2VVKA 2EQJA 3KFVA 4HVVA 1YJNT 3CCLQ 3C95A 2DXCA 4FYYB 4HKEA 5LJ3d 2MPXC 3G71T 1BIBA 4YTLA 4QVCA 4E7JA 1IREB 4M7DB 3OYYA 3A8HB 1VQKQ 2YWWA 4L6V5 5HY6A 5GAOm 1Q86C 4M78E 2EIFA 5IN1A 1VOMA 5LJ5g 3SWNA 1YNZA 1UHCA 3M53A 1O9SA 3QXEB 4FYWB 4HT9A 4M7AA 3M54A 1YCSB 1YIJQ 1VQ8A 4C8QG 1VQ6T 1LOJA 3H9NA 4RTUA 1YJ9T 1SRMA 1AEYA 4IUVA 1VQPQ 2ZPBB 2L5QA 4BE0A 4MDWA 2RO0A 4II1A 3EG0A 3OB9A 3G6ET 4LUEA 1QCNA 4FSSA 1YI2Q 1VA7A 3NPFA 2XK0A 4D6WA 1I81A 4C5IA 2KNBB 3L2UA 4Z8AA 4AFZC 4PFZA 4M78B 4C5EA 1SKUB 2JM8A 3GOXA 1D1BA 1XJWB 3HRTA 5CKBA 4AG2C 3JV3A 5LL6S 4MMLA 5KCHA 2KSSA 2QK0A 4ELZC 1AWWA 2DK3A 2OAUA 1K8AC 4KGZB 2KE9A 3GPLA 4L59A 2ZCFB 2X4WA 1QKXA 3OYBA 1PNJA 5CR2A 3DLMA 2WSFE 4M7AF 1Q81U 5I21A 2DXBA 2XDPA 3CC7A 4JS5A 3JCMc 3G7ZA 2VGMA 4JRKA 2DM1A 2A08A 2EGCA 1G3YA 2LQKA 2CKKA 2EYWA 3V7RA 4A63B 3JRZA 3CCJA 5LJ3e 3M5AA 4ATOA 2QI2A 4J6XA 2X51A 2V8IA 3BW1A 2NUTA 2A28A 3H8ZA 2A3LA 2RQUA 1B07A 1LVKA 1WHLA 2QEXA 3HL8A 3BDLA 2XIDA 1OULA 2OTLQ 4PLLA 4PJOE 2XI9A 1KQSA 1ABOA 2GFUA 2GQVA 3OYGA 1V1CA 3M0PA 1M8MA 2VXEA 3X20B 2O4XB 4GLMA 2DXTA 3CCQT 3UA6A 4NOYA 2X35A 2CP2A 2C0TA 4ZNXA 1WXBA 4JZ3A 2A0FB 1M3AA 1M1KC 3G4SQ 2DRKA 3ASKA 1WA7A 1M1FA 3IQLA 4PJOG 3OS1A 3LH5A 4HVUA 4AFQC 3JB9D 2M02A 1G2BA 1YJWA 1OZ3A 1ZA1B 3LH0A 2EJFA 3CC4Q 2VYTA 3JCMd 3I5RA 4F16A 4BY6C 5J3BA 5GAMg 1K76A 3EHQA 1MUZA 1PWTA 2G3RA 3LWHA 4MZPA 1KQSP 2L89A 1MNDA 4BB7A 3I35A 2M16A 4R0KA 3C94A 3QSUA 3CCLT 1YBYA 2BZXA 2HKNA 4E2FB 1I0CA 4D8DA 4FSXA 3I56Q 1G83A 1TUGB 1ZSZB 5CIUA 3LGFA 3I55A 3JCMQ 4IURA 2JMCA 4Z89A 1ZBJA 1VIEA 1N5ZA 3ME9A 5CKHA 4WTOB 1QWEA 2DILA 4OP0A 4ZTJA 3P8BB 4J9DA 2NUTB 2RJFA 3JCMV 3U23A 4XQ3A 3CCEA 3UWNA 2V26A 2HSEB 2CT3A 3A98A 5GAMe 1AWXA 2CUDA 3OSSC 4AMCA 2CSIA 1K0XA 3EG9A 1M2VA 4XAXB 4RTTA 1VQPT 1QP3A 4J9IA 2LQWA 2DJZA 1WPYA 1SHFA 4PJNA 4F7UA 3EGDA 5AYFA 4OB1B 3E2UA 3OYHA 4FU6A 2K3XA 4JZ4A 1VIFA 2A7YA 8ATCB 5LJ3h 2JM9A 2QQSA 3UPUA 3CC2A 3LYIA 1S72Q 3CBOA 3RKXA 3CXCA 1X6OA 3VJPA 4F17A 3PNWC 2E70A 2DJQA 1M90R 2K79A 3A8GB 1QVFA 1NJIU 1UJ0A 2E5KA 3OA6A 4J9FA 4M75E 3URGA 1N8RC 1YN8A 1WHHA 2LNVA 2RHZA 4IKFA 3HP9A 5GMKm 4MZMA 2G6FX 2KVQG 1PD1A 1TXQA 4F7UF 2LQ8A 5I11A 2EGAA 1Y07A 4J9CA 3BFMA 2CYZB 4C0DC 2NUZA 3MEWA 2JNGA 2H3JA 2ZPIB 3VS3A 4M75G 1RADB 1H3HA 1IB8A 3SD4A 2P0PA 3CXCP 4M78D 4A4KA 2PZ1A 1ZA2B 2JVVA 4CC2A 1OEBA 4FYVB 5GAN7 4M75B 2Y4XA 3LWIA 2YDLA 4ELYC 1RAGB 3HRUA 4E7ZA 1QVFP 5GAN5 5FW9A 4GBQA 3EH1A 5C0MA 1VQ5T 2HQHA 1PRLC 1KD1U 1NG2A 2JTEA 4QQ6A 2GTJA 3MO8A 1TWBA 2HQEA 1VQOQ 3MP8A 3OYCA 3QWYA 3QBYA 1HK9A 2K9GA 1NYGA 1F1BB 2MF2A 1FMWA 4F7UB 4XU0A 1D0YA 3FB9A 3G4ST 1NPRA 2J06A 3OYAA 1YJNQ 4C92E 1TU0B 3UF4A 2J6KA 3G71Q 2OTJA 3EHRA 2CT4A 3OYIA 3EG3A 4RTZA 1VQNA 3CCUT 1PKSA 1M30A 2CP7A 5M9OA 4QVZA 1QVPA 2DZCA 1M9SA 2GGRA 4ME7A 4QT7A 2Z0WA 2QG9B 1C1AA 2YRDA 1OQKA 1X01A 2AKLA 4E47A 2EWNA 3SB2A 2KGTA 5GANf 1WXUA 3CMET 3PFSA 1QP2A 2DKGA 1JJ2S 1T0HA 2HDAA 4C8QC 3OSVA 1KK7A 1PSFA 1VQ6Q 4C92B 4DBHA 1Y0MA 1RL2A 3I56T 2FRYA 4MZTA 5CKEA 3OYFA 2NUPB 2E6NA 4M78C 2CZ0B 4BDZA 1UGRB 3G6EQ 3EGUA 4R55A 3A8MB 2EYYA 1WFWA 4DA4A 1XNIA 2COWA 5CKFA 4C5GA 2O2OA 2HAXA 2RM4A 4OB3B 5CK9A 2EQKA 2LX9A 4PJOD 1EFNA 1VQMA 1VQ7T 4RG2A 2LNHB 3JCMh 5FU6B 1CKAA 2QTVA 5GJVB 2KT1A 2AZVA 3N5BB 4EMKC 4Y91A 1AHJB 2O01E 3FDRA 1ABQA 1U5SA 2LDMA 4ZGDB 2QQRA 3L2ZA 3M4GA 4AFUC 5GMKe 3CD6A 2FL7A 2R58A 2OAWA 1A0NB 4FYXB 2KBTA 4XTWA 1WQ7A 3OBWA 2MIOA 1Q82R 1X75C 3AHUA 2K2MA 2LMJA 1Q81C 2K5LA 2YT6A 1WJSA 2H3EB 3TEEA 3SEMA 2XU8A 2DYBA 3D7SB 1BK2A 5DM7R 1K0SA 2RI2A 1LNXA 2F2XA 2LTOA 1BB9A 1GFDA 1UGSB 2RK2A 2ED1A 4XU1A 3EG1A 4N0AC 4KT0E 1C0MA 3G1JA 4Y92A 3RKYA 4Q5WA 1YHQA 4PFPA 2DA9A 2K57A 3E1SA 1LCKA 2GFAA 1HJDA 3REBB 5LJ3f 4F14A 2QQAA 4RCCA 4LN2A 2EQMA 3CCQQ 3GNFB 1VQ8T 5CAIA 2EYQA 1ZUUA 1RLPC 3OW2S 5CQYA 1BKBA 5C6SA 4OMPA 4ZTFA 3EFSA 3FLGA 5LJ3j 4PJOC 3VS2A 2HD0A 2QTXA 4J6YA 1ZUYA 4C8QA 3QKJA 1MMDA 4X1VA 5LJ5d 4E7KA 4M7DE 2YHTA 5GANg 3MJXA 1Q95G 1NEGA 2D0NA 3S3OA 4KBMB 1MMGA 1GCQA 5DLOA 3CBMA 1VQOT 4HXJA 2K2VA 1M1GA 3M57A 1X6GA 5EC7A 4DEYA 2XD0A 2LQNA 1V29B 1UHFA 1IGQA 3QHSA 2JZ2A 2EW3A 4M7DG 2GF7A 1VYUA 1YWPA 2CP5A 3KUFA 1X69A 5KYUB 1G3WA 5EG2A 1VQLA 1JBMA 2FPDA 1W2BS 4O5VA 1S72A 4EMKA 3GF5A 3GP8A 3M0TA 2J6OA 2KROA 3CCJT 2JW4A 3S6WA 5KYYA 2QGGA 4M75D 1EZZB 1W6XA 3HHTB 3CCMQ 3HFOA 2E64A 3P8DA 2L3RA 2JS2A 2QEXT 2X3XD 2L3SA 1U1SA 5GMKh 1KG1A 3CCVT 4ESRA 1RABB 2MWPA 1I07A 1AWOA 2E10A 2XMFA 3L2VA 4M78G 4PKCC 2FG0A 4J9EA 2E1HA 3JCMJ 1RACB 1QWFA 1YITA 2RA2A 3ZL7C 1U06A 1H8KA 5I22A 3P8HA 5IXBA 1MMAA 2RJCA 1T3SA 2K3YA 1PRMC 1GXIE 2EJ9A 4PJJA 3PIPA 1ZBXA 3ZFJA 3A1PA 5DLQE 3WVDB 1BI3A 2NLUA 5L23A 3QPHA 5GAMj 2H8HA 3EAEA 5LJ5e 2LT1A 5KYXB 3CMAA 1YJWT 5GMKl 4M77A 5D6YA 4Y28E 2F2WA 5GAN4 2DVEA 2KY9A 4EMGA 4JJCA 3R6NA 1UB4A 2DPPB 2BKDN 1N9SA 3CCRA 2ZPFB 3OS0A 2DNUA 4LDVA 4C92D 4M7AE 2EYZA 1NJIC 1AVZC 4DQ2A 1K9MU 4E7LA 1LJOA 1WX6A 4XK8E 4B9WA 4Z02A 4A4EA 1XOVA 4PL6A 3E9GA 4J6WA 3VS1A 4M75C 3CCSA 2HCKA 5GAMd 3JCMf 2FVUA 4LDYA 4X9CA 2MMPA 3NFCA 1BYMA 2YLCA 2CDTA 5D6XA 2IG0A 3CPWA 3JCMb 3C0CA 4ANJA 5KYWA 2FYKA 3SWNB 2COZA 2F5TX 3PVQA 2KRSA 4M7AB 2GCXA 1RI9A 1VQ5Q 4OMLA 4Z88A 4M77F 1TOVA 2AKKA 4OB2B 2DL3A 1SEMA 2RQTA 1YJ9A 3S3MA 1Q7YU 4KH1B 2L2PA 2RH2A 3TQ7P 1KHIA 4IUPA 2CSQA 1KD1C 1TSFA 1Z9ZA 2XICA 1BI0A 4KUDK 3RBBB 1X27A 2RQWA 4RKUE 2HZYA 4K11A 2DL8A 1TTHB 4QQDA 2DF6A 1K9MR 2LCCA 2LT4A 3CCUQ 5IT9E 3OYDA 3H0FA 2CREA 2RHYA 3L2RA 4OB0B 3M0QA 1RAAB 1R0BG 4RCBA 3E9FA 4A53A 3H41A 2CS7A 4J9GA 4C92C 3JAME 2WACA 5FU7C 3QYHB 2BE9B 3TCJA 1D0XA 1HYOA 2MCNA 1X2KA 1OV3A 3CMEQ 1OPLA 1PG5B 1FWZA 5FWBA 3V8JA 2DL7A 4LNPA 1M5Q1 3X26B 4BE1A 3S3NA 2K3BA 2BE7D 3J80E 2K7AA 1M90U 1CSKA 3PIOA 4D8KA 1Q7YR 5FU6C 1NEBA 5A2QE 3QZ9B 5LJ5h 2K5IA 2W10A 3QDRB 3CCMT 2KT8A 5KH6A 4BI8B 3VV0A 2D0QB 1D3BA 1PCXA 1O75A 1N6AA 1NE8A 1VQ7Q 3GIBA 2RF0A 2FZCB 2KYBA 3C4SA 2RPNA 2KI7A 5HK3A 2JOYA 1J3TA 4J5YA 3QZ5B 2VKNA 1ARKA 2VXFA 2AZSA 1JU5C 1KQSS 2RK1A 1QLYA 5GMKi 1IHVA 3ULRB 2JXBA 1KC8C 3FRNA 4JDSA 4ZGJB 2X4XA 2B8AA 3GLXA 4KGVB 4M7DD 1FX7A 2D9TA 3DKMA 4JJDA 1MMNA 3T9NA 1G8XA 2M51A 2OTJT 1ZSGA 4J8OA 1JQQA 3SDZA 1VQNT 4R56A 2YUQA 1Y96A 2FZGB 1UDLA 1UGQB 4HCZA 3L1AA 2KAFA 1VQ4A 1FMKA 1M27C 1PKTA 3PE0A 3MCAB 3CPFA 2HEQA 3JB9H 4GY5A 2IPOB 5GMKj 3M56A 4DOVA 1WJRA 2HQXA 2J6FA 2DLPA 2FO0A 1VQ8Q 2VWFA 2IVWA 2PUKB 3CCLA 4FT2A 4F7UE 4IIMA 1BU1A 1IRXA 3C12A 1WZOA 2QGFB 5DY9A 1SPKA 2KDSA 2DYIA 2P0QA 2DTHA 1KFZA 2O9SA 1QCFA 1VQKA 1OOTA 2M1HA 5FRNA 1B34A 3M0SA 3MKDA 1H92A 1RLQC 4PLIA 5FWCA 4F7UG 5HKCA 1VQMT 3EG9B 3FC3A 1M2VB 1KHCA 3UA7A 1PD0A 1YIJA 7AT1B 1IGUA 1VQ9T 4M7DC 3EGDB 1WIEA 1VQPA 1WDXA 4RG8A 1T3LA 5GAOn 2KMTA 1K8AR 2KQWA 5GAOl 2LRQA 3CD6T 1YI2A 4DEXA 4OMMA 1M1KU 1E7OA 4A54A 2XDBA 4JS4A 1BBZA 4OGEA 1JB0E 2P84A 3REAB 1WYXA 4ORZA 1D1AA 1JRIA 1DJ7B 5GAMh 3O5ZA 3CCJQ 2CP0A 2MK5A 1PSEA 4C92G 2D8JA 1C6VX 3CXCS 2EPDA 3VS7A 2RI3A 2DFUA 1Q82U 3DB4A 4M7AD 2QEXQ 2JTFA 1YHQT 3CCVQ 1QVFS 2V8KA 3KXTA 5I2SA 1WI7A 4DOWA 1M3BA 4HCBA 1HXDA 1OPKA 4P5NA 4IUUA 4XTZA 4JRQA 1NYFA 2D6FA 4OMNA 4JRPA 1KQ1A 3SFMA 2YRCA 4DBRA 3VS4A 2X4YA 2RJEA 1WHMA 1NLOC 3QWXX 1ZQ1A 1KSWA 2EVRA 4RTYA 1B7TA 1M1KR 5IXFA 4RTWA 2E5QA 1HSQA 2K6DA 3THKA 3I5SA 1QVGA 4N4GA 3MP1A 2QA4T 4E7IA 2DTIA 1WQWA 1UE9A 2OTLA 1UTIA 1YJWQ 2L0AA 3H0IA 2FRWA 2LX7A 2V1QA 3TU4K 3JB9F 2DAQA 4J9HA 2FZKB 4AFSC 4X9DA 2JMAA 3X24B 5FRMA 1R0CB 3QO3A 4WCIA 4OMOA 2L8DA 1I5LA 4XTUA 2M0OA 4OF1A 3OBYA 1K1ZA 1UUEA 3G4SA 1RAIB 1SSFA 5GANd 3JCMW 4A4FA 1I1JA 2P0KA 2F5KA 4J7IA 5CVIA 1W2BA 1P92A 3SWNC 1VQLT 3OS2A 2FHDA 1UG1A 2PUOB 5A0GA 4M7AC 3CCUA 3F70A 5LJ5j 1GCPA 3M4YA 3CC4A 2D8HA 4M7DA 3RMQA 2CGHA 1QVGP 2IIMA 2B86A 3OYLA 2YLBA 1WJQA 2OI3A 1X6BA 1N8RU 2QASA 2ROLA 3CCEQ 3V8KA 2BIVA 2JUFA 3OMCA 1IHWA 2EGEA 4IUTA 2XKOC 3TSWA 1YWOA 1H3ZA 1UECA 3AT1B 3WXMB 2KXCA 2DO3A 2KRNA 1TH7A 3M58A 2VUBA 1RAHB 3I56A 4PJLA 2X3WD 3H6ZA 1BCOA 1TS9A 2CH4A 2VGNA 4X34A 2RQVA 1KJWA 1ZLMA 2GQIA 3LW5E 2RB6A 2FPEA 2ZAEA 3RDVA 1VYVA 3EH2A 1OX9A 1U8RA 4M78A 1OU8A 3BY7A 2YUPA 3JSCA 1OYXA 2QQ9A 1RAEB 3M9QA 3M0RA 2DL5A 2OX7A 4HVWA 2LP5A 4RUGA 1AD5A 1Y7XA 4C0DB 5GJWB 3OYMA 1ZSZC 4XU3A 1ACMB 1JXOA 5KCOA 3L2QA 3Q1JA 3EFRA 2RNAA 5CKDA 2I2LA 2O31A 3J7AF 2CUBA 3LGLA 3OMGA 3CCRT 1N8RR 3CC7T 1OX8A 2DIGA 2LCLA 3MHXA 3FJ5A 5GAOq 4MMKA 3GBQA 1TG0A 3JCMP 2RMOA 4HT8A 6AT1B 2Y90A 3A8LB 4PK4A 4LUDA 3M59A 5GANe 3VUZA 1JO8A 1YFNA 4O6JA 3QYGB 3PVLA 4C8QF 3DLLA 1M90C 2KXDA 4L5GA 1WGSA 3CCST 1SF9A 4C8QE 1YP5A 2ROTA 3L42A 4M78F 4CC4B 2VB6A 4A4GA 2WSEE 1MNEA 1T0JA 1QW1A 2M0YA 1M3CA 4BI3A 3VYGA 1JXMA 2QAZA 4FM4B 2DL4A 4KUIA 2ATCB 4JLGA 1M2OA 4QKUA 4N0AA 2O4XA 5GAMf 3V7SA 1QMCA 1MV0B 4PNOA 2LC4A 4CC3A 3PMIA 2KR3A 1TUCA 2ZGWA 4C8QB 5KE3A 2YRVA 2KYMA 2OTJQ 3RNJA 1VQNQ 2W0ZA 3RR6A 5LJ3g 2C0IA 2LVMA 4CRIA 3HPWA 3H0HA 1Y57A 1M4ZA 4KULA 1D0ZA 4PJOA 2DRMA 2PVDB 2R5MA 1VQOA 3EFOA 4AT1B 4RTVA 2QYZA 4NS5A 2K4YA 4N4HA 2E65A 3MPUB 1D1CA 3VU3C 3I9QA 2ECZA 4BE2A 2DTOA 4BACA 2RQRA 3FIFA 1YJNA 4FCYA 4AG1C 1WHKA 2ENMA 2PTKA 3NTHA 3G71A 5IHNA 2VC8A 2RHIA 3E19A 1QKWA 3I55T 4KGXB 3M55A 4OMQA 1KQ2A 4EMKB 1V76A 4A4HA 1K73U 2BZYA 1ZSZA 4M7AG 5KYYB 2EYXA 1QCOA 2PVGB 1HD3A 1OU9A 3EGXA 1UFFA 3A5ZB 3CCET 4JLIA 2C0OA 1SRLA 2E6ZA 2MI6A 1NBEB 4QQGA 2F1LA 2XDDA 1VQMQ 3JB9I 1OZ2A 4M77E 4HCCA 3PTAA 1GBQA 1VQ6A 3SHWA 4PJOF 4HCKA 3CCVA 3FJPA 1VQ9Q 4EMHA 1IXDA 3KBGA 2D1XA 4ZN1A 1G5VA 4KH0B 4UC4A 5HCKA 1NPPA 3VUBA 2DETA 3G6EA 3CD6Q 1W4SA 1LPLA 1PC0A 2FEIA 1NZ9A 1WHGA 2EBPA 1R8OB 5J39A 2PVOB 5GANh 3TVTA 3CC2T 4FT4A 1K4US 1Y71A 4KRTA 3FEOA 4M77G 3PMTA 2V1RA 3CPWP 1MV3A 2FB7A 2MOXA 1Q81R 2RN8A 1ZX6A 2ESWA 2L3QA 2GTOA 4M77B 3X28B 2AK5A 2HBWA 1K73R 2AIRB 3BDUA 4J7FA 5IHIA 2KEAA 1VQ4T 1E6HA 1XQHA 3L2WA 4PJOB 1UGVA 4EDUA 3RERA 2JS0A 4XTYA 1YHQQ 3EFOB 3GNGA 4GLKA 1NM7A 3NTKA 3OYKA 1SG5A 4BUGA 1Q82C 2DXUA 2KRMA 3LX7A 1I8FA 4EPCA 1VYTA 4M4ZA 2E12A 2CP3A 1UGPB 4OGCA 2JJ9A 2R57A 3WVEB 5KYNA 4XTVA 3BE3A 1Q86U 1JEGA 9ATCB 2DD4A 3CQTA 4OMFB 2HMAA 5KE2A 2V8JA 4NL3A 1VQKT 5KYWB 1MHNA 2XHCA 4FL6A 2EQUA 4JJBA 3EGXB 2QA4Q 4JJNK 5I2MA 4E7SA 2RD1A 4FIBA 2JT4A 1NLPC 4M75A 1QQJA 1WHJA 3CPWS 4LDUA 4RTXA 4LXCA 4N4IA 2P4RA 3VS5A 1YIJT 3CCQA 1ZHIA 2HBPA 1ZUKA 3INZA 3MEAA 1GL5A 3JCMg 4RMOA 5A0LA 2QDLA 2E41A 2GBQA 2DZ9A 4LE9A 3RIRA 5CO7A 4MDXA 2DX1A 1YI2T 2RHUA 2P4TA 1N27A
chains in the Genus database with same CATH topology
2A28A 2DBKA 1X6GA 2RQUA 5EC7A 1B07A 4DEYA 1NYFA 2LQNA 1UHFA 1Z9QA 4OMNA 2EW3A 2O88A 1VYUA 3VS4A 1YWPA 1K9AA 1E6GA 1ABOA 2O9VA 1NLOC 3QWXX 1V1CA 3M0PA 1X69A 1KSWA 2EVRA 1M8MA 4RTYA 5IXFA 4GLMA 4RTWA 3UA6A 1HSQA 2K6DA 3THKA 3NMZC 3I5SA 3UATA 2FPDA 2C0TA 4ZNXA 1UE9A 1UTIA 3M0TA 1WXBA 4JZ3A 2L0AA 3H0IA 3VRYA 2J6OA 2KROA 1M3AA 2LCSA 2FRWA 2JW4A 2DRKA 2LX7A 2V1QA 1WA7A 4J9HA 4AFSC 3IQLA 2JMAA 1W6XA 3LH5A 2JS2A 4HVUA 1FYNA 4WCIA 2X3XD 2L3SA 4OMOA 4AFQC 1G2BA 2J7IA 1K1ZA 4ESRA 1UUEA 4JPBW 3I5RA 4F16A 1I07A 5IH2A 1K76A 3EHQA 1MUZA 1AWOA 1PWTA 2J05A 4EIKA 1I1JA 2XMFA 2BZ8A 2FG0A 1PHTA 2EQIA 4J9EA 1GRIA 1UG1A 1QWFA 3ZL7C 1U06A 2ABLA 2OJ2A 1H8KA 3I35A 5I22A 4R0KA 1GCPA 5IXBA 2D8HA 2YUNA 2FPFA 1T3SA 4E6RA 2BZXA 1PRMC 2IIMA 2B86A 1CKBA 1I0CA 2OI3A 4D8DA 1X6BA 1G83A 2ROLA 2EKHA 5L23A 2JMCA 2BTTA 3VRZA 2EGEA 4Z89A 1ZBJA 2H8HA 3TSWA 1N5ZA 1YWOA 1UECA 2LJ0A 2KXCA 1QWEA 2DILA 2F2WA 2KRNA 4JJCA 1GBRA 3R6NA 4J9DA 3U23A 4J9BA 3VS6A 2X3WD 2DMOA 2CT3A 2DNUA 2CH4A 3A98A 2EYZA 1AWXA 1AVZC 2CUDA 2RQVA 1KJWA 2CSIA 1ZLMA 1WX6A 2GQIA 2FPEA 1K0XA 1XOVA 1U3OA 4RTTA 2DE0X 4J9IA 2LQWA 1VYVA 3VS1A 1SSHA 1SHFA 2HSPA 2YUPA 3TSZA 2HCKA 3M0RA 2LJ1A 2DL5A 4JZ4A 4HVWA 2LP5A 4RUGA 1AD5A 5GJWB 2JM9A 1JXOA 1X43A 2CDTA 2RNAA 1AZGB 3C0CA 1SHGA 2O31A 3PVQA 2CUBA 2KRSA 4F17A 1GCQC 1RI9A 4OMLA 4Z88A 3FJ5A 3GBQA 1TG0A 2DJQA 2AKKA 2RMOA 2DL3A 2K79A 1SEMA 4LUDA 1UJ0A 2RQTA 1WLPB 2SEMA 2E5KA 2L2PA 4J9FA 2CSQA 1YN8A 1Z9ZA 1JO8A 3PVLA 3RBBB 2KXDA 1X27A 3M0UA 1AZEA 1W1FA 2NWMA 2RQWA 4K11A 2DL8A 2G6FX 1YP5A 2DF6A 2ROTA 1AOJA 4CC4B 3H0FA 5I11A 2EGAA 2DBMA 2CREA 1KIKA 4J9CA 2ED0A 3M0QA 2NUZA 1T0JA 2M0YA 3VS3A 3H41A 1M3CA 1H3HA 4J9GA 2CH4W 3NGPA 1JXMA 2PZ1A 2MCNA 4CC2A 1OEBA 2DL4A 1X2KA 1OV3A 1RUWA 1OPLA 5FWBA 5IHKA 2YDLA 2L3PA 2A37A 1MV0B 2DL7A 4CC3A 4LNPA 2KR3A 5FW9A 4GBQA 1TUCA 3NHNA 1PRLC 1NG2A 2JTEA 2GTJA 2KYMA 2K3BA 2K7AA 3QWYA 3RNJA 2PNIA 2K9GA 1CSKA 2W0ZA 1NYGA 2LZ6B 2C0IA 4D8KA 1B3QA 2J06A 3H0HA 1NEBA 3UF4A 1Y57A 2J6KA 3VS0A 2W10A 2DRMA 3EHRA 2KT8A 2CT4A 1W70A 3EG3A 1UJYA 3EG2A 4RTZA 4RTVA 2RF0A 1PKSA 1M30A 3I9QA 2KYBA 2ECZA 4IIOA 2RPNA 2RQRA 2GGRA 1J3TA 1AWJA 4AG1C 2LJ3A 4QT7A 2ENMA 2PTKA 2VKNA 1ARKA 5IHNA 1QKWA 4CC7A 1S1NA 2YSQA 2AZSA 1JU5C 2AKLA 4OMQA 2KGTA 2A36A 1WXUA 2BZYA 1GFCA 2SRCA 1T0HA 2HDAA 1QLYA 3ULRB 1X2QA 2JXBA 2F2VA 2GNCA 5ECAA 2EYXA 2I0NA 1HD3A 1Y0MA 1IO6A 2DVJA 2FRYA 1TUDA 4JJDA 1UFFA 2YUOA 2C0OA 2M51A 1SRLA 1ZSGA 3EGUA 1JQQA 1WXTA 2EYYA 2YUQA 2VVKA 3KFVA 1GBQA 1WFWA 1UDLA 4HVVA 3SHWA 4HCKA 2O2OA 1FMKA 1M27C 1PKTA 2D1XA 3PE0A 5HCKA 2HEQA 2FEIA 1EFNA 2LNHB 2EBPA 1CKAA 3TVTA 2J6FA 2DLPA 2FO0A 5GJVB 2KT1A 2AZVA 2VWFA 1K4US 4KRTA 4IIMA 1BU1A 1ABQA 1U5SA 2V1RA 1MV3A 4AFUC 1SPKA 2MOXA 2RN8A 2OAWA 1ZX6A 1YNZA 2ESWA 2L3QA 2GTOA 1A0NB 1UHCA 2KBTA 2AK5A 1YCSB 2HBWA 2MIOA 1KFZA 2O9SA 1QCFA 1OOTA 5IHIA 4RTUA 1SRMA 2K2MA 2KEAA 2LMJA 1E6HA 1UGVA 1AEYA 2YT6A 3M0SA 2JS0A 1H92A 1RLQC 3SEMA 1NM7A 5FWCA 3EG0A 4LUEA 2DYBA 4FSSA 1VA7A 2KRMA 1BK2A 1K0SA 3UA7A 1VYTA 2F2XA 3NPFA 1BB9A 4M4ZA 1GFDA 2ED1A 2KNBB 3EG1A 4Z8AA 4AFZC 1WIEA 2JM8A 4Y92A 1WDXA 1T3LA 2DA9A 4AG2C 3JV3A 1LCKA 1JEGA 4DEXA 4OMMA 1E7OA 1HJDA 3REBB 4F14A 3CQTA 4LN2A 1BBZA 1AWWA 3REAB 1WYXA 1ZUUA 1RLPC 4JJBA 4ORZA 2KE9A 1QKXA 2JT4A 4OMPA 1NLPC 1PNJA 3O5ZA 4RTXA 2D8JA 3VS2A 2EPDA 3VS7A 2P4RA 3VS5A 1ZUYA 4X1VA 2DM1A 1ZUKA 2A08A 2EGCA 1GL5A 2EYWA 2QDLA 1NEGA 2GBQA 2D0NA 4A63B 4LE9A 1WI7A 2DX1A 1M3BA 1GCQA 1OPKA 4HXJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A28 A;  2DBK A;  1X6G A;  2RQU A;  5EC7 A;  1B07 A;  4DEY A;  1NYF A;  2LQN A;  1UHF A;  1Z9Q A;  4OMN A;  2EW3 A;  2O88 A;  1VYU A;  3VS4 A;  1YWP A;  1K9A A;  1E6G A;  1ABO A;  2O9V A;  1NLO C;  3QWX X;  1V1C A;  3M0P A;  1X69 A;  1KSW A;  2EVR A;  1M8M A;  4RTY A;  5IXF A;  4GLM A;  4RTW A;  3UA6 A;  1HSQ A;  2K6D A;  3THK A;  3NMZ C;  3I5S A;  3UAT A;  2FPD A;  2C0T A;  4ZNX A;  1UE9 A;  1UTI A;  3M0T A;  1WXB A;  4JZ3 A;  2L0A A;  3H0I A;  3VRY A;  2J6O A;  2KRO A;  1M3A A;  2LCS A;  2FRW A;  2JW4 A;  2DRK A;  2LX7 A;  2V1Q A;  1WA7 A;  4J9H A;  4AFS C;  3IQL A;  2JMA A;  1W6X A;  3LH5 A;  2JS2 A;  4HVU A;  1FYN A;  4WCI A;  2X3X D;  2L3S A;  4OMO A;  4AFQ C;  1G2B A;  2J7I A;  1K1Z A;  4ESR A;  1UUE A;  4JPB W;  3I5R A;  4F16 A;  1I07 A;  5IH2 A;  1K76 A;  3EHQ A;  1MUZ A;  1AWO A;  1PWT A;  2J05 A;  4EIK A;  1I1J A;  2XMF A;  2BZ8 A;  2FG0 A;  1PHT A;  2EQI A;  4J9E A;  1GRI A;  1UG1 A;  1QWF A;  3ZL7 C;  1U06 A;  2ABL A;  2OJ2 A;  1H8K A;  3I35 A;  5I22 A;  4R0K A;  1GCP A;  5IXB A;  2D8H A;  2YUN A;  2FPF A;  1T3S A;  4E6R A;  2BZX A;  1PRM C;  2IIM A;  2B86 A;  1CKB A;  1I0C A;  2OI3 A;  4D8D A;  1X6B A;  1G83 A;  2ROL A;  2EKH A;  5L23 A;  2JMC A;  2BTT A;  3VRZ A;  2EGE A;  4Z89 A;  1ZBJ A;  2H8H A;  3TSW A;  1N5Z A;  1YWO A;  1UEC A;  2LJ0 A;  2KXC A;  1QWE A;  2DIL A;  2F2W A;  2KRN A;  4JJC A;  1GBR A;  3R6N A;  4J9D A;  3U23 A;  4J9B A;  3VS6 A;  2X3W D;  2DMO A;  2CT3 A;  2DNU A;  2CH4 A;  3A98 A;  2EYZ A;  1AWX A;  1AVZ C;  2CUD A;  2RQV A;  1KJW A;  2CSI A;  1ZLM A;  1WX6 A;  2GQI A;  2FPE A;  1K0X A;  1XOV A;  1U3O A;  4RTT A;  2DE0 X;  4J9I A;  2LQW A;  1VYV A;  3VS1 A;  1SSH A;  1SHF A;  2HSP A;  2YUP A;  3TSZ A;  2HCK A;  3M0R A;  2LJ1 A;  2DL5 A;  4JZ4 A;  4HVW A;  2LP5 A;  4RUG A;  1AD5 A;  5GJW B;  2JM9 A;  1JXO A;  1X43 A;  2CDT A;  2RNA A;  1AZG B;  3C0C A;  1SHG A;  2O31 A;  3PVQ A;  2CUB A;  2KRS A;  4F17 A;  1GCQ C;  1RI9 A;  4OML A;  4Z88 A;  3FJ5 A;  3GBQ A;  1TG0 A;  2DJQ A;  2AKK A;  2RMO A;  2DL3 A;  2K79 A;  1SEM A;  4LUD A;  1UJ0 A;  2RQT A;  1WLP B;  2SEM A;  2E5K A;  2L2P A;  4J9F A;  2CSQ A;  1YN8 A;  1Z9Z A;  1JO8 A;  3PVL A;  3RBB B;  2KXD A;  1X27 A;  3M0U A;  1AZE A;  1W1F A;  2NWM A;  2RQW A;  4K11 A;  2DL8 A;  2G6F X;  1YP5 A;  2DF6 A;  2ROT A;  1AOJ A;  4CC4 B;  3H0F A;  5I11 A;  2EGA A;  2DBM A;  2CRE A;  1KIK A;  4J9C A;  2ED0 A;  3M0Q A;  2NUZ A;  1T0J A;  2M0Y A;  3VS3 A;  3H41 A;  1M3C A;  1H3H A;  4J9G A;  2CH4 W;  3NGP A;  1JXM A;  2PZ1 A;  2MCN A;  4CC2 A;  1OEB A;  2DL4 A;  1X2K A;  1OV3 A;  1RUW A;  1OPL A;  5FWB A;  5IHK A;  2YDL A;  2L3P A;  2A37 A;  1MV0 B;  2DL7 A;  4CC3 A;  4LNP A;  2KR3 A;  5FW9 A;  4GBQ A;  1TUC A;  3NHN A;  1PRL C;  1NG2 A;  2JTE A;  2GTJ A;  2KYM A;  2K3B A;  2K7A A;  3QWY A;  3RNJ A;  2PNI A;  2K9G A;  1CSK A;  2W0Z A;  1NYG A;  2LZ6 B;  2C0I A;  4D8K A;  1B3Q A;  2J06 A;  3H0H A;  1NEB A;  3UF4 A;  1Y57 A;  2J6K A;  3VS0 A;  2W10 A;  2DRM A;  3EHR A;  2KT8 A;  2CT4 A;  1W70 A;  3EG3 A;  1UJY A;  3EG2 A;  4RTZ A;  4RTV A;  2RF0 A;  1PKS A;  1M30 A;  3I9Q A;  2KYB A;  2ECZ A;  4IIO A;  2RPN A;  2RQR A;  2GGR A;  1J3T A;  1AWJ A;  4AG1 C;  2LJ3 A;  4QT7 A;  2ENM A;  2PTK A;  2VKN A;  1ARK A;  5IHN A;  1QKW A;  4CC7 A;  1S1N A;  2YSQ A;  2AZS A;  1JU5 C;  2AKL A;  4OMQ A;  2KGT A;  2A36 A;  1WXU A;  2BZY A;  1GFC A;  2SRC A;  1T0H A;  2HDA A;  1QLY A;  3ULR B;  1X2Q A;  2JXB A;  2F2V A;  2GNC A;  5ECA A;  2EYX A;  2I0N A;  1HD3 A;  1Y0M A;  1IO6 A;  2DVJ A;  2FRY A;  1TUD A;  4JJD A;  1UFF A;  2YUO A;  2C0O A;  2M51 A;  1SRL A;  1ZSG A;  3EGU A;  1JQQ A;  1WXT A;  2EYY A;  2YUQ A;  2VVK A;  3KFV A;  1GBQ A;  1WFW A;  1UDL A;  4HVV A;  3SHW A;  4HCK A;  2O2O A;  1FMK A;  1M27 C;  1PKT A;  2D1X A;  3PE0 A;  5HCK A;  2HEQ A;  2FEI A;  1EFN A;  2LNH B;  2EBP A;  1CKA A;  3TVT A;  2J6F A;  2DLP A;  2FO0 A;  5GJV B;  2KT1 A;  2AZV A;  2VWF A;  1K4U S;  4KRT A;  4IIM A;  1BU1 A;  1ABQ A;  1U5S A;  2V1R A;  1MV3 A;  4AFU C;  1SPK A;  2MOX A;  2RN8 A;  2OAW A;  1ZX6 A;  1YNZ A;  2ESW A;  2L3Q A;  2GTO A;  1A0N B;  1UHC A;  2KBT A;  2AK5 A;  1YCS B;  2HBW A;  2MIO A;  1KFZ A;  2O9S A;  1QCF A;  1OOT A;  5IHI A;  4RTU A;  1SRM A;  2K2M A;  2KEA A;  2LMJ A;  1E6H A;  1UGV A;  1AEY A;  2YT6 A;  3M0S A;  2JS0 A;  1H92 A;  1RLQ C;  3SEM A;  1NM7 A;  5FWC A;  3EG0 A;  4LUE A;  2DYB A;  4FSS A;  1VA7 A;  2KRM A;  1BK2 A;  1K0S A;  3UA7 A;  1VYT A;  2F2X A;  3NPF A;  1BB9 A;  4M4Z A;  1GFD A;  2ED1 A;  2KNB B;  3EG1 A;  4Z8A A;  4AFZ C;  1WIE A;  2JM8 A;  4Y92 A;  1WDX A;  1T3L A;  2DA9 A;  4AG2 C;  3JV3 A;  1LCK A;  1JEG A;  4DEX A;  4OMM A;  1E7O A;  1HJD A;  3REB B;  4F14 A;  3CQT A;  4LN2 A;  1BBZ A;  1AWW A;  3REA B;  1WYX A;  1ZUU A;  1RLP C;  4JJB A;  4ORZ A;  2KE9 A;  1QKX A;  2JT4 A;  4OMP A;  1NLP C;  1PNJ A;  3O5Z A;  4RTX A;  2D8J A;  3VS2 A;  2EPD A;  3VS7 A;  2P4R A;  3VS5 A;  1ZUY A;  4X1V A;  2DM1 A;  1ZUK A;  2A08 A;  2EGC A;  1GL5 A;  2EYW A;  2QDL A;  1NEG A;  2GBQ A;  2D0N A;  4A63 B;  4LE9 A;  1WI7 A;  2DX1 A;  1M3B A;  1GCQ A;  1OPK A;  4HXJ A; 
#chains in the Genus database with same CATH topology
 2CZ1 B;  2DBK A;  1VQL Q;  3QII A;  2K5F A;  2CZ7 B;  4PJM A;  1Z9Q A;  1VUB A;  5CQX A;  5J26 A;  2O88 A;  1G3S A;  1K8A U;  2DD5 A;  1BI2 A;  2E3I A;  4QW2 A;  3ZEH A;  1K9A A;  1E6G A;  2R5A A;  2O9V A;  4BD3 A;  1JJ2 A;  2ZPE B;  1Q86 R;  1MGQ A;  1D09 B;  3NMZ C;  3UAT A;  4M75 F;  2NYS A;  4DBQ A;  1YCY A;  2ZZD A;  1BI1 A;  1XTD A;  3VRY A;  4C0G A;  2LCS A;  3JCM e;  4BI4 A;  5L8R E;  1IZ6 A;  3RUX A;  4C92 A;  1EIF A;  8AT1 B;  1FMV A;  2NUP A;  4JUV A;  1FYN A;  2BUD A;  1I5O B;  1YIT Q;  3X25 B;  4C8Q D;  2J7I A;  4C0F A;  5GAN 2;  2HL5 C;  5GAN 8;  1G3T A;  1WNL A;  4JPB W;  4XU2 A;  3MP6 A;  5IH2 A;  5GAN 3;  4LDX A;  1D3B B;  3HRS A;  2J05 A;  4EIK A;  2BZ8 A;  3CCM A;  3QJY A;  5A0D A;  3OYJ A;  2E3H A;  1PHT A;  2EQI A;  3HKS A;  2ZPH B;  1GRI A;  1JJ2 P;  4QVD A;  2AT1 B;  4LD6 A;  2ABL A;  2OJ2 A;  5CCA A;  2OTL T;  3CMA Q;  2YUN A;  2AHJ B;  2FPF A;  4E6R A;  3OY9 A;  1RAF B;  5IAY A;  1BIA A;  2PQW A;  1CKB A;  4DBF A;  2EKH A;  3CCR Q;  1I4K 1;  3CC7 Q;  2BTT A;  3NTI A;  3VRZ A;  3HTR A;  5FLX E;  2LJ0 A;  2HKQ B;  5GAN 6;  1NJI R;  5D6W A;  4C92 F;  2EFI A;  4J83 A;  4IUQ A;  1OI1 A;  1GBR A;  3LLR A;  2QXF A;  3CBP A;  3ER0 A;  4J9B A;  4ZN3 A;  1PM3 A;  3VS6 A;  2DMO A;  5HK0 A;  4NL2 A;  1Y96 B;  2PU9 B;  3CCS Q;  3OYN A;  4OVA A;  3R6O A;  3CC4 T;  2HL3 A;  1U3O A;  2DE0 X;  2MWO A;  1SSH A;  4TVR A;  2HSP A;  3TSZ A;  3V8L A;  4VUB A;  2LJ1 A;  2COY A;  4CI0 C;  1R77 A;  3OW2 A;  4C5H A;  1X43 A;  4BY6 B;  1EX4 A;  1YJ9 Q;  1AZG B;  5FU7 B;  4LD9 K;  2ZPG B;  4LDW A;  2EAY A;  1SHG A;  5GAN j;  3QDF A;  1GCQ C;  1KD1 R;  4XTX A;  3UDC A;  4HA8 A;  5AT1 B;  1B34 B;  3CEY A;  1M8V A;  1WLP B;  2SEM A;  3MEV A;  3V7C A;  4M77 D;  4ZGE B;  3OYE A;  3QUI A;  5GAO p;  1VQ5 A;  1AZE A;  3M0U A;  1W1F A;  2M9U A;  2E4H A;  2NWM A;  2RI5 A;  3JCM X;  4FW2 A;  3PT9 A;  1AOJ A;  3OW2 P;  1VQ9 A;  2KK4 A;  2DBM A;  1KIK A;  2X4J A;  1KC8 U;  2ED0 A;  5LJ5 f;  3O8V A;  3OQ5 A;  5FRO A;  2CH4 W;  1K9M C;  4C0Z A;  3HFN A;  3NGP A;  3I55 Q;  2C06 A;  1RUW A;  3UT1 A;  5KYU A;  1FXX A;  1RI0 A;  5IHK A;  3DB3 A;  3JB9 G;  1S72 T;  3MET A;  2RHX A;  2L3P A;  1BCM A;  4V2S A;  2A37 A;  3PGG A;  3QJ6 A;  2DER A;  4B6M A;  3NHN A;  3RMS A;  2MAM A;  1K73 C;  3VKI A;  4F04 B;  2EKO A;  2JTM A;  1AT1 B;  3CME A;  4PFO A;  4FW1 A;  2PNI A;  1H64 1;  2LZ6 B;  3VYH B;  3JB9 J;  2CP6 A;  2XG8 D;  3OS5 A;  1B3Q A;  5D7U A;  2YXY A;  3VS0 A;  4WF2 A;  1N9R A;  3MEU A;  2DIQ A;  1W70 A;  1UJY A;  2DEQ A;  1Q7Y C;  3EG2 A;  3A8O B;  2VAS A;  1W2B P;  1YIT T;  4JRI A;  3QG1 A;  2X9H A;  3TRE A;  3CC2 Q;  2MYS A;  4IIO A;  4M77 C;  2EJG A;  2F69 A;  1AWJ A;  2LJ3 A;  1KC8 R;  2QDY B;  4B9X A;  4E7H A;  4CC7 A;  1S1N A;  2DEU A;  2QQB A;  2YSQ A;  2Y4Y A;  3ZBD A;  4M7D F;  2A36 A;  1VQ7 A;  1GFC A;  2SRC A;  4BDY A;  3HSB A;  1X2Q A;  3CMA T;  2QA4 A;  2F2V A;  2GNC A;  2JN0 A;  5ECA A;  1UEB A;  2CZ6 B;  1QVG S;  2I0N A;  1VQ4 Q;  5KYX A;  3RES A;  1IO6 A;  2RJD A;  2VV5 A;  2DVJ A;  1TUD A;  1U1T A;  2YUO A;  5GAO r;  3J81 E;  2HNI A;  3RKW A;  1WXT A;  2WSC E;  2VVK A;  2EQJ A;  3KFV A;  4HVV A;  1YJN T;  3CCL Q;  3C95 A;  2DXC A;  4FYY B;  4HKE A;  5LJ3 d;  2MPX C;  3G71 T;  1BIB A;  4YTL A;  4QVC A;  4E7J A;  1IRE B;  4M7D B;  3OYY A;  3A8H B;  1VQK Q;  2YWW A;  4L6V 5;  5HY6 A;  5GAO m;  1Q86 C;  4M78 E;  2EIF A;  5IN1 A;  1VOM A;  5LJ5 g;  3SWN A;  1YNZ A;  1UHC A;  3M53 A;  1O9S A;  3QXE B;  4FYW B;  4HT9 A;  4M7A A;  3M54 A;  1YCS B;  1YIJ Q;  1VQ8 A;  4C8Q G;  1VQ6 T;  1LOJ A;  3H9N A;  4RTU A;  1YJ9 T;  1SRM A;  1AEY A;  4IUV A;  1VQP Q;  2ZPB B;  2L5Q A;  4BE0 A;  4MDW A;  2RO0 A;  4II1 A;  3EG0 A;  3OB9 A;  3G6E T;  4LUE A;  1QCN A;  4FSS A;  1YI2 Q;  1VA7 A;  3NPF A;  2XK0 A;  4D6W A;  1I81 A;  4C5I A;  2KNB B;  3L2U A;  4Z8A A;  4AFZ C;  4PFZ A;  4M78 B;  4C5E A;  1SKU B;  2JM8 A;  3GOX A;  1D1B A;  1XJW B;  3HRT A;  5CKB A;  4AG2 C;  3JV3 A;  5LL6 S;  4MML A;  5KCH A;  2KSS A;  2QK0 A;  4ELZ C;  1AWW A;  2DK3 A;  2OAU A;  1K8A C;  4KGZ B;  2KE9 A;  3GPL A;  4L59 A;  2ZCF B;  2X4W A;  1QKX A;  3OYB A;  1PNJ A;  5CR2 A;  3DLM A;  2WSF E;  4M7A F;  1Q81 U;  5I21 A;  2DXB A;  2XDP A;  3CC7 A;  4JS5 A;  3JCM c;  3G7Z A;  2VGM A;  4JRK A;  2DM1 A;  2A08 A;  2EGC A;  1G3Y A;  2LQK A;  2CKK A;  2EYW A;  3V7R A;  4A63 B;  3JRZ A;  3CCJ A;  5LJ3 e;  3M5A A;  4ATO A;  2QI2 A;  4J6X A;  2X51 A;  2V8I A;  3BW1 A;  2NUT A;  2A28 A;  3H8Z A;  2A3L A;  2RQU A;  1B07 A;  1LVK A;  1WHL A;  2QEX A;  3HL8 A;  3BDL A;  2XID A;  1OUL A;  2OTL Q;  4PLL A;  4PJO E;  2XI9 A;  1KQS A;  1ABO A;  2GFU A;  2GQV A;  3OYG A;  1V1C A;  3M0P A;  1M8M A;  2VXE A;  3X20 B;  2O4X B;  4GLM A;  2DXT A;  3CCQ T;  3UA6 A;  4NOY A;  2X35 A;  2CP2 A;  2C0T A;  4ZNX A;  1WXB A;  4JZ3 A;  2A0F B;  1M3A A;  1M1K C;  3G4S Q;  2DRK A;  3ASK A;  1WA7 A;  1M1F A;  3IQL A;  4PJO G;  3OS1 A;  3LH5 A;  4HVU A;  4AFQ C;  3JB9 D;  2M02 A;  1G2B A;  1YJW A;  1OZ3 A;  1ZA1 B;  3LH0 A;  2EJF A;  3CC4 Q;  2VYT A;  3JCM d;  3I5R A;  4F16 A;  4BY6 C;  5J3B A;  5GAM g;  1K76 A;  3EHQ A;  1MUZ A;  1PWT A;  2G3R A;  3LWH A;  4MZP A;  1KQS P;  2L89 A;  1MND A;  4BB7 A;  3I35 A;  2M16 A;  4R0K A;  3C94 A;  3QSU A;  3CCL T;  1YBY A;  2BZX A;  2HKN A;  4E2F B;  1I0C A;  4D8D A;  4FSX A;  3I56 Q;  1G83 A;  1TUG B;  1ZSZ B;  5CIU A;  3LGF A;  3I55 A;  3JCM Q;  4IUR A;  2JMC A;  4Z89 A;  1ZBJ A;  1VIE A;  1N5Z A;  3ME9 A;  5CKH A;  4WTO B;  1QWE A;  2DIL A;  4OP0 A;  4ZTJ A;  3P8B B;  4J9D A;  2NUT B;  2RJF A;  3JCM V;  3U23 A;  4XQ3 A;  3CCE A;  3UWN A;  2V26 A;  2HSE B;  2CT3 A;  3A98 A;  5GAM e;  1AWX A;  2CUD A;  3OSS C;  4AMC A;  2CSI A;  1K0X A;  3EG9 A;  1M2V A;  4XAX B;  4RTT A;  1VQP T;  1QP3 A;  4J9I A;  2LQW A;  2DJZ A;  1WPY A;  1SHF A;  4PJN A;  4F7U A;  3EGD A;  5AYF A;  4OB1 B;  3E2U A;  3OYH A;  4FU6 A;  2K3X A;  4JZ4 A;  1VIF A;  2A7Y A;  8ATC B;  5LJ3 h;  2JM9 A;  2QQS A;  3UPU A;  3CC2 A;  3LYI A;  1S72 Q;  3CBO A;  3RKX A;  3CXC A;  1X6O A;  3VJP A;  4F17 A;  3PNW C;  2E70 A;  2DJQ A;  1M90 R;  2K79 A;  3A8G B;  1QVF A;  1NJI U;  1UJ0 A;  2E5K A;  3OA6 A;  4J9F A;  4M75 E;  3URG A;  1N8R C;  1YN8 A;  1WHH A;  2LNV A;  2RHZ A;  4IKF A;  3HP9 A;  5GMK m;  4MZM A;  2G6F X;  2KVQ G;  1PD1 A;  1TXQ A;  4F7U F;  2LQ8 A;  5I11 A;  2EGA A;  1Y07 A;  4J9C A;  3BFM A;  2CYZ B;  4C0D C;  2NUZ A;  3MEW A;  2JNG A;  2H3J A;  2ZPI B;  3VS3 A;  4M75 G;  1RAD B;  1H3H A;  1IB8 A;  3SD4 A;  2P0P A;  3CXC P;  4M78 D;  4A4K A;  2PZ1 A;  1ZA2 B;  2JVV A;  4CC2 A;  1OEB A;  4FYV B;  5GAN 7;  4M75 B;  2Y4X A;  3LWI A;  2YDL A;  4ELY C;  1RAG B;  3HRU A;  4E7Z A;  1QVF P;  5GAN 5;  5FW9 A;  4GBQ A;  3EH1 A;  5C0M A;  1VQ5 T;  2HQH A;  1PRL C;  1KD1 U;  1NG2 A;  2JTE A;  4QQ6 A;  2GTJ A;  3MO8 A;  1TWB A;  2HQE A;  1VQO Q;  3MP8 A;  3OYC A;  3QWY A;  3QBY A;  1HK9 A;  2K9G A;  1NYG A;  1F1B B;  2MF2 A;  1FMW A;  4F7U B;  4XU0 A;  1D0Y A;  3FB9 A;  3G4S T;  1NPR A;  2J06 A;  3OYA A;  1YJN Q;  4C92 E;  1TU0 B;  3UF4 A;  2J6K A;  3G71 Q;  2OTJ A;  3EHR A;  2CT4 A;  3OYI A;  3EG3 A;  4RTZ A;  1VQN A;  3CCU T;  1PKS A;  1M30 A;  2CP7 A;  5M9O A;  4QVZ A;  1QVP A;  2DZC A;  1M9S A;  2GGR A;  4ME7 A;  4QT7 A;  2Z0W A;  2QG9 B;  1C1A A;  2YRD A;  1OQK A;  1X01 A;  2AKL A;  4E47 A;  2EWN A;  3SB2 A;  2KGT A;  5GAN f;  1WXU A;  3CME T;  3PFS A;  1QP2 A;  2DKG A;  1JJ2 S;  1T0H A;  2HDA A;  4C8Q C;  3OSV A;  1KK7 A;  1PSF A;  1VQ6 Q;  4C92 B;  4DBH A;  1Y0M A;  1RL2 A;  3I56 T;  2FRY A;  4MZT A;  5CKE A;  3OYF A;  2NUP B;  2E6N A;  4M78 C;  2CZ0 B;  4BDZ A;  1UGR B;  3G6E Q;  3EGU A;  4R55 A;  3A8M B;  2EYY A;  1WFW A;  4DA4 A;  1XNI A;  2COW A;  5CKF A;  4C5G A;  2O2O A;  2HAX A;  2RM4 A;  4OB3 B;  5CK9 A;  2EQK A;  2LX9 A;  4PJO D;  1EFN A;  1VQM A;  1VQ7 T;  4RG2 A;  2LNH B;  3JCM h;  5FU6 B;  1CKA A;  2QTV A;  5GJV B;  2KT1 A;  2AZV A;  3N5B B;  4EMK C;  4Y91 A;  1AHJ B;  2O01 E;  3FDR A;  1ABQ A;  1U5S A;  2LDM A;  4ZGD B;  2QQR A;  3L2Z A;  3M4G A;  4AFU C;  5GMK e;  3CD6 A;  2FL7 A;  2R58 A;  2OAW A;  1A0N B;  4FYX B;  2KBT A;  4XTW A;  1WQ7 A;  3OBW A;  2MIO A;  1Q82 R;  1X75 C;  3AHU A;  2K2M A;  2LMJ A;  1Q81 C;  2K5L A;  2YT6 A;  1WJS A;  2H3E B;  3TEE A;  3SEM A;  2XU8 A;  2DYB A;  3D7S B;  1BK2 A;  5DM7 R;  1K0S A;  2RI2 A;  1LNX A;  2F2X A;  2LTO A;  1BB9 A;  1GFD A;  1UGS B;  2RK2 A;  2ED1 A;  4XU1 A;  3EG1 A;  4N0A C;  4KT0 E;  1C0M A;  3G1J A;  4Y92 A;  3RKY A;  4Q5W A;  1YHQ A;  4PFP A;  2DA9 A;  2K57 A;  3E1S A;  1LCK A;  2GFA A;  1HJD A;  3REB B;  5LJ3 f;  4F14 A;  2QQA A;  4RCC A;  4LN2 A;  2EQM A;  3CCQ Q;  3GNF B;  1VQ8 T;  5CAI A;  2EYQ A;  1ZUU A;  1RLP C;  3OW2 S;  5CQY A;  1BKB A;  5C6S A;  4OMP A;  4ZTF A;  3EFS A;  3FLG A;  5LJ3 j;  4PJO C;  3VS2 A;  2HD0 A;  2QTX A;  4J6Y A;  1ZUY A;  4C8Q A;  3QKJ A;  1MMD A;  4X1V A;  5LJ5 d;  4E7K A;  4M7D E;  2YHT A;  5GAN g;  3MJX A;  1Q95 G;  1NEG A;  2D0N A;  3S3O A;  4KBM B;  1MMG A;  1GCQ A;  5DLO A;  3CBM A;  1VQO T;  4HXJ A;  2K2V A;  1M1G A;  3M57 A;  1X6G A;  5EC7 A;  4DEY A;  2XD0 A;  2LQN A;  1V29 B;  1UHF A;  1IGQ A;  3QHS A;  2JZ2 A;  2EW3 A;  4M7D G;  2GF7 A;  1VYU A;  1YWP A;  2CP5 A;  3KUF A;  1X69 A;  5KYU B;  1G3W A;  5EG2 A;  1VQL A;  1JBM A;  2FPD A;  1W2B S;  4O5V A;  1S72 A;  4EMK A;  3GF5 A;  3GP8 A;  3M0T A;  2J6O A;  2KRO A;  3CCJ T;  2JW4 A;  3S6W A;  5KYY A;  2QGG A;  4M75 D;  1EZZ B;  1W6X A;  3HHT B;  3CCM Q;  3HFO A;  2E64 A;  3P8D A;  2L3R A;  2JS2 A;  2QEX T;  2X3X D;  2L3S A;  1U1S A;  5GMK h;  1KG1 A;  3CCV T;  4ESR A;  1RAB B;  2MWP A;  1I07 A;  1AWO A;  2E10 A;  2XMF A;  3L2V A;  4M78 G;  4PKC C;  2FG0 A;  4J9E A;  2E1H A;  3JCM J;  1RAC B;  1QWF A;  1YIT A;  2RA2 A;  3ZL7 C;  1U06 A;  1H8K A;  5I22 A;  3P8H A;  5IXB A;  1MMA A;  2RJC A;  1T3S A;  2K3Y A;  1PRM C;  1GXI E;  2EJ9 A;  4PJJ A;  3PIP A;  1ZBX A;  3ZFJ A;  3A1P A;  5DLQ E;  3WVD B;  1BI3 A;  2NLU A;  5L23 A;  3QPH A;  5GAM j;  2H8H A;  3EAE A;  5LJ5 e;  2LT1 A;  5KYX B;  3CMA A;  1YJW T;  5GMK l;  4M77 A;  5D6Y A;  4Y28 E;  2F2W A;  5GAN 4;  2DVE A;  2KY9 A;  4EMG A;  4JJC A;  3R6N A;  1UB4 A;  2DPP B;  2BKD N;  1N9S A;  3CCR A;  2ZPF B;  3OS0 A;  2DNU A;  4LDV A;  4C92 D;  4M7A E;  2EYZ A;  1NJI C;  1AVZ C;  4DQ2 A;  1K9M U;  4E7L A;  1LJO A;  1WX6 A;  4XK8 E;  4B9W A;  4Z02 A;  4A4E A;  1XOV A;  4PL6 A;  3E9G A;  4J6W A;  3VS1 A;  4M75 C;  3CCS A;  2HCK A;  5GAM d;  3JCM f;  2FVU A;  4LDY A;  4X9C A;  2MMP A;  3NFC A;  1BYM A;  2YLC A;  2CDT A;  5D6X A;  2IG0 A;  3CPW A;  3JCM b;  3C0C A;  4ANJ A;  5KYW A;  2FYK A;  3SWN B;  2COZ A;  2F5T X;  3PVQ A;  2KRS A;  4M7A B;  2GCX A;  1RI9 A;  1VQ5 Q;  4OML A;  4Z88 A;  4M77 F;  1TOV A;  2AKK A;  4OB2 B;  2DL3 A;  1SEM A;  2RQT A;  1YJ9 A;  3S3M A;  1Q7Y U;  4KH1 B;  2L2P A;  2RH2 A;  3TQ7 P;  1KHI A;  4IUP A;  2CSQ A;  1KD1 C;  1TSF A;  1Z9Z A;  2XIC A;  1BI0 A;  4KUD K;  3RBB B;  1X27 A;  2RQW A;  4RKU E;  2HZY A;  4K11 A;  2DL8 A;  1TTH B;  4QQD A;  2DF6 A;  1K9M R;  2LCC A;  2LT4 A;  3CCU Q;  5IT9 E;  3OYD A;  3H0F A;  2CRE A;  2RHY A;  3L2R A;  4OB0 B;  3M0Q A;  1RAA B;  1R0B G;  4RCB A;  3E9F A;  4A53 A;  3H41 A;  2CS7 A;  4J9G A;  4C92 C;  3JAM E;  2WAC A;  5FU7 C;  3QYH B;  2BE9 B;  3TCJ A;  1D0X A;  1HYO A;  2MCN A;  1X2K A;  1OV3 A;  3CME Q;  1OPL A;  1PG5 B;  1FWZ A;  5FWB A;  3V8J A;  2DL7 A;  4LNP A;  1M5Q 1;  3X26 B;  4BE1 A;  3S3N A;  2K3B A;  2BE7 D;  3J80 E;  2K7A A;  1M90 U;  1CSK A;  3PIO A;  4D8K A;  1Q7Y R;  5FU6 C;  1NEB A;  5A2Q E;  3QZ9 B;  5LJ5 h;  2K5I A;  2W10 A;  3QDR B;  3CCM T;  2KT8 A;  5KH6 A;  4BI8 B;  3VV0 A;  2D0Q B;  1D3B A;  1PCX A;  1O75 A;  1N6A A;  1NE8 A;  1VQ7 Q;  3GIB A;  2RF0 A;  2FZC B;  2KYB A;  3C4S A;  2RPN A;  2KI7 A;  5HK3 A;  2JOY A;  1J3T A;  4J5Y A;  3QZ5 B;  2VKN A;  1ARK A;  2VXF A;  2AZS A;  1JU5 C;  1KQS S;  2RK1 A;  1QLY A;  5GMK i;  1IHV A;  3ULR B;  2JXB A;  1KC8 C;  3FRN A;  4JDS A;  4ZGJ B;  2X4X A;  2B8A A;  3GLX A;  4KGV B;  4M7D D;  1FX7 A;  2D9T A;  3DKM A;  4JJD A;  1MMN A;  3T9N A;  1G8X A;  2M51 A;  2OTJ T;  1ZSG A;  4J8O A;  1JQQ A;  3SDZ A;  1VQN T;  4R56 A;  2YUQ A;  1Y96 A;  2FZG B;  1UDL A;  1UGQ B;  4HCZ A;  3L1A A;  2KAF A;  1VQ4 A;  1FMK A;  1M27 C;  1PKT A;  3PE0 A;  3MCA B;  3CPF A;  2HEQ A;  3JB9 H;  4GY5 A;  2IPO B;  5GMK j;  3M56 A;  4DOV A;  1WJR A;  2HQX A;  2J6F A;  2DLP A;  2FO0 A;  1VQ8 Q;  2VWF A;  2IVW A;  2PUK B;  3CCL A;  4FT2 A;  4F7U E;  4IIM A;  1BU1 A;  1IRX A;  3C12 A;  1WZO A;  2QGF B;  5DY9 A;  1SPK A;  2KDS A;  2DYI A;  2P0Q A;  2DTH A;  1KFZ A;  2O9S A;  1QCF A;  1VQK A;  1OOT A;  2M1H A;  5FRN A;  1B34 A;  3M0S A;  3MKD A;  1H92 A;  1RLQ C;  4PLI A;  5FWC A;  4F7U G;  5HKC A;  1VQM T;  3EG9 B;  3FC3 A;  1M2V B;  1KHC A;  3UA7 A;  1PD0 A;  1YIJ A;  7AT1 B;  1IGU A;  1VQ9 T;  4M7D C;  3EGD B;  1WIE A;  1VQP A;  1WDX A;  4RG8 A;  1T3L A;  5GAO n;  2KMT A;  1K8A R;  2KQW A;  5GAO l;  2LRQ A;  3CD6 T;  1YI2 A;  4DEX A;  4OMM A;  1M1K U;  1E7O A;  4A54 A;  2XDB A;  4JS4 A;  1BBZ A;  4OGE A;  1JB0 E;  2P84 A;  3REA B;  1WYX A;  4ORZ A;  1D1A A;  1JRI A;  1DJ7 B;  5GAM h;  3O5Z A;  3CCJ Q;  2CP0 A;  2MK5 A;  1PSE A;  4C92 G;  2D8J A;  1C6V X;  3CXC S;  2EPD A;  3VS7 A;  2RI3 A;  2DFU A;  1Q82 U;  3DB4 A;  4M7A D;  2QEX Q;  2JTF A;  1YHQ T;  3CCV Q;  1QVF S;  2V8K A;  3KXT A;  5I2S A;  1WI7 A;  4DOW A;  1M3B A;  4HCB A;  1HXD A;  1OPK A;  4P5N A;  4IUU A;  4XTZ A;  4JRQ A;  1NYF A;  2D6F A;  4OMN A;  4JRP A;  1KQ1 A;  3SFM A;  2YRC A;  4DBR A;  3VS4 A;  2X4Y A;  2RJE A;  1WHM A;  1NLO C;  3QWX X;  1ZQ1 A;  1KSW A;  2EVR A;  4RTY A;  1B7T A;  1M1K R;  5IXF A;  4RTW A;  2E5Q A;  1HSQ A;  2K6D A;  3THK A;  3I5S A;  1QVG A;  4N4G A;  3MP1 A;  2QA4 T;  4E7I A;  2DTI A;  1WQW A;  1UE9 A;  2OTL A;  1UTI A;  1YJW Q;  2L0A A;  3H0I A;  2FRW A;  2LX7 A;  2V1Q A;  3TU4 K;  3JB9 F;  2DAQ A;  4J9H A;  2FZK B;  4AFS C;  4X9D A;  2JMA A;  3X24 B;  5FRM A;  1R0C B;  3QO3 A;  4WCI A;  4OMO A;  2L8D A;  1I5L A;  4XTU A;  2M0O A;  4OF1 A;  3OBY A;  1K1Z A;  1UUE A;  3G4S A;  1RAI B;  1SSF A;  5GAN d;  3JCM W;  4A4F A;  1I1J A;  2P0K A;  2F5K A;  4J7I A;  5CVI A;  1W2B A;  1P92 A;  3SWN C;  1VQL T;  3OS2 A;  2FHD A;  1UG1 A;  2PUO B;  5A0G A;  4M7A C;  3CCU A;  3F70 A;  5LJ5 j;  1GCP A;  3M4Y A;  3CC4 A;  2D8H A;  4M7D A;  3RMQ A;  2CGH A;  1QVG P;  2IIM A;  2B86 A;  3OYL A;  2YLB A;  1WJQ A;  2OI3 A;  1X6B A;  1N8R U;  2QAS A;  2ROL A;  3CCE Q;  3V8K A;  2BIV A;  2JUF A;  3OMC A;  1IHW A;  2EGE A;  4IUT A;  2XKO C;  3TSW A;  1YWO A;  1H3Z A;  1UEC A;  3AT1 B;  3WXM B;  2KXC A;  2DO3 A;  2KRN A;  1TH7 A;  3M58 A;  2VUB A;  1RAH B;  3I56 A;  4PJL A;  2X3W D;  3H6Z A;  1BCO A;  1TS9 A;  2CH4 A;  2VGN A;  4X34 A;  2RQV A;  1KJW A;  1ZLM A;  2GQI A;  3LW5 E;  2RB6 A;  2FPE A;  2ZAE A;  3RDV A;  1VYV A;  3EH2 A;  1OX9 A;  1U8R A;  4M78 A;  1OU8 A;  3BY7 A;  2YUP A;  3JSC A;  1OYX A;  2QQ9 A;  1RAE B;  3M9Q A;  3M0R A;  2DL5 A;  2OX7 A;  4HVW A;  2LP5 A;  4RUG A;  1AD5 A;  1Y7X A;  4C0D B;  5GJW B;  3OYM A;  1ZSZ C;  4XU3 A;  1ACM B;  1JXO A;  5KCO A;  3L2Q A;  3Q1J A;  3EFR A;  2RNA A;  5CKD A;  2I2L A;  2O31 A;  3J7A F;  2CUB A;  3LGL A;  3OMG A;  3CCR T;  1N8R R;  3CC7 T;  1OX8 A;  2DIG A;  2LCL A;  3MHX A;  3FJ5 A;  5GAO q;  4MMK A;  3GBQ A;  1TG0 A;  3JCM P;  2RMO A;  4HT8 A;  6AT1 B;  2Y90 A;  3A8L B;  4PK4 A;  4LUD A;  3M59 A;  5GAN e;  3VUZ A;  1JO8 A;  1YFN A;  4O6J A;  3QYG B;  3PVL A;  4C8Q F;  3DLL A;  1M90 C;  2KXD A;  4L5G A;  1WGS A;  3CCS T;  1SF9 A;  4C8Q E;  1YP5 A;  2ROT A;  3L42 A;  4M78 F;  4CC4 B;  2VB6 A;  4A4G A;  2WSE E;  1MNE A;  1T0J A;  1QW1 A;  2M0Y A;  1M3C A;  4BI3 A;  3VYG A;  1JXM A;  2QAZ A;  4FM4 B;  2DL4 A;  4KUI A;  2ATC B;  4JLG A;  1M2O A;  4QKU A;  4N0A A;  2O4X A;  5GAM f;  3V7S A;  1QMC A;  1MV0 B;  4PNO A;  2LC4 A;  4CC3 A;  3PMI A;  2KR3 A;  1TUC A;  2ZGW A;  4C8Q B;  5KE3 A;  2YRV A;  2KYM A;  2OTJ Q;  3RNJ A;  1VQN Q;  2W0Z A;  3RR6 A;  5LJ3 g;  2C0I A;  2LVM A;  4CRI A;  3HPW A;  3H0H A;  1Y57 A;  1M4Z A;  4KUL A;  1D0Z A;  4PJO A;  2DRM A;  2PVD B;  2R5M A;  1VQO A;  3EFO A;  4AT1 B;  4RTV A;  2QYZ A;  4NS5 A;  2K4Y A;  4N4H A;  2E65 A;  3MPU B;  1D1C A;  3VU3 C;  3I9Q A;  2ECZ A;  4BE2 A;  2DTO A;  4BAC A;  2RQR A;  3FIF A;  1YJN A;  4FCY A;  4AG1 C;  1WHK A;  2ENM A;  2PTK A;  3NTH A;  3G71 A;  5IHN A;  2VC8 A;  2RHI A;  3E19 A;  1QKW A;  3I55 T;  4KGX B;  3M55 A;  4OMQ A;  1KQ2 A;  4EMK B;  1V76 A;  4A4H A;  1K73 U;  2BZY A;  1ZSZ A;  4M7A G;  5KYY B;  2EYX A;  1QCO A;  2PVG B;  1HD3 A;  1OU9 A;  3EGX A;  1UFF A;  3A5Z B;  3CCE T;  4JLI A;  2C0O A;  1SRL A;  2E6Z A;  2MI6 A;  1NBE B;  4QQG A;  2F1L A;  2XDD A;  1VQM Q;  3JB9 I;  1OZ2 A;  4M77 E;  4HCC A;  3PTA A;  1GBQ A;  1VQ6 A;  3SHW A;  4PJO F;  4HCK A;  3CCV A;  3FJP A;  1VQ9 Q;  4EMH A;  1IXD A;  3KBG A;  2D1X A;  4ZN1 A;  1G5V A;  4KH0 B;  4UC4 A;  5HCK A;  1NPP A;  3VUB A;  2DET A;  3G6E A;  3CD6 Q;  1W4S A;  1LPL A;  1PC0 A;  2FEI A;  1NZ9 A;  1WHG A;  2EBP A;  1R8O B;  5J39 A;  2PVO B;  5GAN h;  3TVT A;  3CC2 T;  4FT4 A;  1K4U S;  1Y71 A;  4KRT A;  3FEO A;  4M77 G;  3PMT A;  2V1R A;  3CPW P;  1MV3 A;  2FB7 A;  2MOX A;  1Q81 R;  2RN8 A;  1ZX6 A;  2ESW A;  2L3Q A;  2GTO A;  4M77 B;  3X28 B;  2AK5 A;  2HBW A;  1K73 R;  2AIR B;  3BDU A;  4J7F A;  5IHI A;  2KEA A;  1VQ4 T;  1E6H A;  1XQH A;  3L2W A;  4PJO B;  1UGV A;  4EDU A;  3RER A;  2JS0 A;  4XTY A;  1YHQ Q;  3EFO B;  3GNG A;  4GLK A;  1NM7 A;  3NTK A;  3OYK A;  1SG5 A;  4BUG A;  1Q82 C;  2DXU A;  2KRM A;  3LX7 A;  1I8F A;  4EPC A;  1VYT A;  4M4Z A;  2E12 A;  2CP3 A;  1UGP B;  4OGC A;  2JJ9 A;  2R57 A;  3WVE B;  5KYN A;  4XTV A;  3BE3 A;  1Q86 U;  1JEG A;  9ATC B;  2DD4 A;  3CQT A;  4OMF B;  2HMA A;  5KE2 A;  2V8J A;  4NL3 A;  1VQK T;  5KYW B;  1MHN A;  2XHC A;  4FL6 A;  2EQU A;  4JJB A;  3EGX B;  2QA4 Q;  4JJN K;  5I2M A;  4E7S A;  2RD1 A;  4FIB A;  2JT4 A;  1NLP C;  4M75 A;  1QQJ A;  1WHJ A;  3CPW S;  4LDU A;  4RTX A;  4LXC A;  4N4I A;  2P4R A;  3VS5 A;  1YIJ T;  3CCQ A;  1ZHI A;  2HBP A;  1ZUK A;  3INZ A;  3MEA A;  1GL5 A;  3JCM g;  4RMO A;  5A0L A;  2QDL A;  2E41 A;  2GBQ A;  2DZ9 A;  4LE9 A;  3RIR A;  5CO7 A;  4MDX A;  2DX1 A;  1YI2 T;  2RHU A;  2P4T A;  1N27 A; 
#chains in the Genus database with same CATH homology
 2A28 A;  2DBK A;  1X6G A;  2RQU A;  5EC7 A;  1B07 A;  4DEY A;  1NYF A;  2LQN A;  1UHF A;  1Z9Q A;  4OMN A;  2EW3 A;  2O88 A;  1VYU A;  3VS4 A;  1YWP A;  1K9A A;  1E6G A;  1ABO A;  2O9V A;  1NLO C;  3QWX X;  1V1C A;  3M0P A;  1X69 A;  1KSW A;  2EVR A;  1M8M A;  4RTY A;  5IXF A;  4GLM A;  4RTW A;  3UA6 A;  1HSQ A;  2K6D A;  3THK A;  3NMZ C;  3I5S A;  3UAT A;  2FPD A;  2C0T A;  4ZNX A;  1UE9 A;  1UTI A;  3M0T A;  1WXB A;  4JZ3 A;  2L0A A;  3H0I A;  3VRY A;  2J6O A;  2KRO A;  1M3A A;  2LCS A;  2FRW A;  2JW4 A;  2DRK A;  2LX7 A;  2V1Q A;  1WA7 A;  4J9H A;  4AFS C;  3IQL A;  2JMA A;  1W6X A;  3LH5 A;  2JS2 A;  4HVU A;  1FYN A;  4WCI A;  2X3X D;  2L3S A;  4OMO A;  4AFQ C;  1G2B A;  2J7I A;  1K1Z A;  4ESR A;  1UUE A;  4JPB W;  3I5R A;  4F16 A;  1I07 A;  5IH2 A;  1K76 A;  3EHQ A;  1MUZ A;  1AWO A;  1PWT A;  2J05 A;  4EIK A;  1I1J A;  2XMF A;  2BZ8 A;  2FG0 A;  1PHT A;  2EQI A;  4J9E A;  1GRI A;  1UG1 A;  1QWF A;  3ZL7 C;  1U06 A;  2ABL A;  2OJ2 A;  1H8K A;  3I35 A;  5I22 A;  4R0K A;  1GCP A;  5IXB A;  2D8H A;  2YUN A;  2FPF A;  1T3S A;  4E6R A;  2BZX A;  1PRM C;  2IIM A;  2B86 A;  1CKB A;  1I0C A;  2OI3 A;  4D8D A;  1X6B A;  1G83 A;  2ROL A;  2EKH A;  5L23 A;  2JMC A;  2BTT A;  3VRZ A;  2EGE A;  4Z89 A;  1ZBJ A;  2H8H A;  3TSW A;  1N5Z A;  1YWO A;  1UEC A;  2LJ0 A;  2KXC A;  1QWE A;  2DIL A;  2F2W A;  2KRN A;  4JJC A;  1GBR A;  3R6N A;  4J9D A;  3U23 A;  4J9B A;  3VS6 A;  2X3W D;  2DMO A;  2CT3 A;  2DNU A;  2CH4 A;  3A98 A;  2EYZ A;  1AWX A;  1AVZ C;  2CUD A;  2RQV A;  1KJW A;  2CSI A;  1ZLM A;  1WX6 A;  2GQI A;  2FPE A;  1K0X A;  1XOV A;  1U3O A;  4RTT A;  2DE0 X;  4J9I A;  2LQW A;  1VYV A;  3VS1 A;  1SSH A;  1SHF A;  2HSP A;  2YUP A;  3TSZ A;  2HCK A;  3M0R A;  2LJ1 A;  2DL5 A;  4JZ4 A;  4HVW A;  2LP5 A;  4RUG A;  1AD5 A;  5GJW B;  2JM9 A;  1JXO A;  1X43 A;  2CDT A;  2RNA A;  1AZG B;  3C0C A;  1SHG A;  2O31 A;  3PVQ A;  2CUB A;  2KRS A;  4F17 A;  1GCQ C;  1RI9 A;  4OML A;  4Z88 A;  3FJ5 A;  3GBQ A;  1TG0 A;  2DJQ A;  2AKK A;  2RMO A;  2DL3 A;  2K79 A;  1SEM A;  4LUD A;  1UJ0 A;  2RQT A;  1WLP B;  2SEM A;  2E5K A;  2L2P A;  4J9F A;  2CSQ A;  1YN8 A;  1Z9Z A;  1JO8 A;  3PVL A;  3RBB B;  2KXD A;  1X27 A;  3M0U A;  1AZE A;  1W1F A;  2NWM A;  2RQW A;  4K11 A;  2DL8 A;  2G6F X;  1YP5 A;  2DF6 A;  2ROT A;  1AOJ A;  4CC4 B;  3H0F A;  5I11 A;  2EGA A;  2DBM A;  2CRE A;  1KIK A;  4J9C A;  2ED0 A;  3M0Q A;  2NUZ A;  1T0J A;  2M0Y A;  3VS3 A;  3H41 A;  1M3C A;  1H3H A;  4J9G A;  2CH4 W;  3NGP A;  1JXM A;  2PZ1 A;  2MCN A;  4CC2 A;  1OEB A;  2DL4 A;  1X2K A;  1OV3 A;  1RUW A;  1OPL A;  5FWB A;  5IHK A;  2YDL A;  2L3P A;  2A37 A;  1MV0 B;  2DL7 A;  4CC3 A;  4LNP A;  2KR3 A;  5FW9 A;  4GBQ A;  1TUC A;  3NHN A;  1PRL C;  1NG2 A;  2JTE A;  2GTJ A;  2KYM A;  2K3B A;  2K7A A;  3QWY A;  3RNJ A;  2PNI A;  2K9G A;  1CSK A;  2W0Z A;  1NYG A;  2LZ6 B;  2C0I A;  4D8K A;  1B3Q A;  2J06 A;  3H0H A;  1NEB A;  3UF4 A;  1Y57 A;  2J6K A;  3VS0 A;  2W10 A;  2DRM A;  3EHR A;  2KT8 A;  2CT4 A;  1W70 A;  3EG3 A;  1UJY A;  3EG2 A;  4RTZ A;  4RTV A;  2RF0 A;  1PKS A;  1M30 A;  3I9Q A;  2KYB A;  2ECZ A;  4IIO A;  2RPN A;  2RQR A;  2GGR A;  1J3T A;  1AWJ A;  4AG1 C;  2LJ3 A;  4QT7 A;  2ENM A;  2PTK A;  2VKN A;  1ARK A;  5IHN A;  1QKW A;  4CC7 A;  1S1N A;  2YSQ A;  2AZS A;  1JU5 C;  2AKL A;  4OMQ A;  2KGT A;  2A36 A;  1WXU A;  2BZY A;  1GFC A;  2SRC A;  1T0H A;  2HDA A;  1QLY A;  3ULR B;  1X2Q A;  2JXB A;  2F2V A;  2GNC A;  5ECA A;  2EYX A;  2I0N A;  1HD3 A;  1Y0M A;  1IO6 A;  2DVJ A;  2FRY A;  1TUD A;  4JJD A;  1UFF A;  2YUO A;  2C0O A;  2M51 A;  1SRL A;  1ZSG A;  3EGU A;  1JQQ A;  1WXT A;  2EYY A;  2YUQ A;  2VVK A;  3KFV A;  1GBQ A;  1WFW A;  1UDL A;  4HVV A;  3SHW A;  4HCK A;  2O2O A;  1FMK A;  1M27 C;  1PKT A;  2D1X A;  3PE0 A;  5HCK A;  2HEQ A;  2FEI A;  1EFN A;  2LNH B;  2EBP A;  1CKA A;  3TVT A;  2J6F A;  2DLP A;  2FO0 A;  5GJV B;  2KT1 A;  2AZV A;  2VWF A;  1K4U S;  4KRT A;  4IIM A;  1BU1 A;  1ABQ A;  1U5S A;  2V1R A;  1MV3 A;  4AFU C;  1SPK A;  2MOX A;  2RN8 A;  2OAW A;  1ZX6 A;  1YNZ A;  2ESW A;  2L3Q A;  2GTO A;  1A0N B;  1UHC A;  2KBT A;  2AK5 A;  1YCS B;  2HBW A;  2MIO A;  1KFZ A;  2O9S A;  1QCF A;  1OOT A;  5IHI A;  4RTU A;  1SRM A;  2K2M A;  2KEA A;  2LMJ A;  1E6H A;  1UGV A;  1AEY A;  2YT6 A;  3M0S A;  2JS0 A;  1H92 A;  1RLQ C;  3SEM A;  1NM7 A;  5FWC A;  3EG0 A;  4LUE A;  2DYB A;  4FSS A;  1VA7 A;  2KRM A;  1BK2 A;  1K0S A;  3UA7 A;  1VYT A;  2F2X A;  3NPF A;  1BB9 A;  4M4Z A;  1GFD A;  2ED1 A;  2KNB B;  3EG1 A;  4Z8A A;  4AFZ C;  1WIE A;  2JM8 A;  4Y92 A;  1WDX A;  1T3L A;  2DA9 A;  4AG2 C;  3JV3 A;  1LCK A;  1JEG A;  4DEX A;  4OMM A;  1E7O A;  1HJD A;  3REB B;  4F14 A;  3CQT A;  4LN2 A;  1BBZ A;  1AWW A;  3REA B;  1WYX A;  1ZUU A;  1RLP C;  4JJB A;  4ORZ A;  2KE9 A;  1QKX A;  2JT4 A;  4OMP A;  1NLP C;  1PNJ A;  3O5Z A;  4RTX A;  2D8J A;  3VS2 A;  2EPD A;  3VS7 A;  2P4R A;  3VS5 A;  1ZUY A;  4X1V A;  2DM1 A;  1ZUK A;  2A08 A;  2EGC A;  1GL5 A;  2EYW A;  2QDL A;  1NEG A;  2GBQ A;  2D0N A;  4A63 B;  4LE9 A;  1WI7 A;  2DX1 A;  1M3B A;  1GCQ A;  1OPK A;  4HXJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...