1J3TA

Solution structure of the second sh3 domain of human intersectin 2 (kiaa1256)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
74
structure length
74
Chain Sequence
GSSGSSGVENLKAQALCSWTAKKDNHLNFSKHDIITVLEQQENWWFGEVHGGRGWFPKSYVKIIPGSESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis/exocytosis
molecule keywords Intersectin 2
publication title Solution structure of the second SH3 domain of human intersectin 2 (KIAA1256)
rcsb
source organism Homo sapiens
total genus 11
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2003-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1j3tA00
2A36A 3UF4A 2YUOA 5L23A 2CSIA 3ULRB 1XOVA 4CC2A 1SHGA 2RMOA 2DYBA 4OMPA 1OOTA 2KRMA 1E6HA 2ESWA 4F16A 1M3AA 2K9GA 1WFWA 2L3SA 1G2BA 3I35A 3ZL7C 2DVJA 4F14A 2KT1A 2JMCA 2F2XA 1M27C 1Z9ZA 3I5RA 2GQIA 4LUDA 1BU1A 4J9GA 1NYFA 1WYXA 1U3OA 1RLQC 3O5ZA 2B86A 2DL5A 3I9QA 1ZLMA 2J6OA 4JPBW 3LH5A 1YN8A 2DLPA 2CT3A 2CUDA 2D0NA 1W1FA 4F17A 2A28A 1ABQA 1CKBA 2KYMA 3UA7A 5IXBA 4HVUA 4J9BA 1ZUUA 3UATA 2D8HA 4AG1C 2BZYA 3EG1A 1JXMA 2RN8A 2DRMA 4R0KA 2RQVA 4LN2A 4RTTA 1AWXA 2M51A 2L3PA 2J6FA 1AVZC 4J9EA 4AG2C 4DEYA 1X27A 4LUEA 3REBB 2K79A 3SEMA 2J06A 2NWMA 2RQUA 2VWFA 2ABLA 1AWJA 2EPDA 2DL7A 2LQNA 1AEYA 2VKNA 2V1QA 2BTTA 2ENMA 4Z88A 3PVLA 2GNCA 1AOJA 1GCQA 1UUEA 2FPDA 4Z89A 4J9HA 1M3CA 3TSWA 1UJ0A 1JU5C 2K3BA 1T0HA 1VYVA 2EW3A 1ZBJA 2F2WA 1SPKA 3IQLA 2PZ1A 3H0FA 2X3XD 4Y92A 4OMLA 2AZSA 2KXDA 1GFDA 2LCSA 2GGRA 2DNUA 2V1RA 2OI3A 1AZGB 2O2OA 4RTXA 1M3BA 1UTIA 1X6GA 2KNBB 4M4ZA 3JV3A 2DJQA 4ESRA 2KGTA 3RBBB 1B07A 3CQTA 3REAB 2KROA 1QWEA 2LJ0A 3EG0A 4LNPA 3M0QA 2D1XA 4GBQA 2GTJA 3M0PA 2GTOA 1TG0A 1JO8A 2W0ZA 1X6BA 4RUGA 5IH2A 2YUPA 2EGCA 2EKHA 3PVQA 3VS6A 2BZ8A 2W10A 4J9FA 1ZUKA 2YSQA 1OPLA 2CDTA 2FRWA 1GCQC 2MIOA 1N5ZA 2K7AA 1CKAA 1RLPC 1UE9A 4Z8AA 2KEAA 2KE9A 2H8HA 1JXOA 1SRMA 1FMKA 3EHQA 2KT8A 3EHRA 3M0TA 2EYXA 1UHFA 2D8JA 1U06A 4HCKA 4X1VA 1YCSB 4HVVA 4AFUC 3TVTA 2A08A 5I22A 1OEBA 1G83A 3GBQA 2PNIA 2YUQA 1PKTA 1AZEA 1RUWA 2EBPA 4CC4B 4D8KA 2JW4A 1KFZA 2JS2A 1S1NA 1ARKA 1TUCA 4E6RA 3NMZC 2ECZA 1WI7A 5FWBA 1I1JA 3I5SA 2BZXA 3EG2A 1UDLA 2CREA 1GCPA 3R6NA 4ORZA 3VRZA 1GRIA 1M30A 3NGPA 2FRYA 1K4US 1PKSA 4AFSC 1K76A 2X3WD 2C0TA 4RTYA 1WIEA 2JMAA 2LP5A 2EYZA 3C0CA 5IHNA 2EYYA 3NPFA 2LNHB 2L2PA 1NLPC 3VS0A 1K9AA 1X43A 2RF0A 2HDAA 1I0CA 1WLPB 2YT6A 2YUNA 1K0SA 2KRNA 1UFFA 4RTZA 1SHFA 4AFQC 1YWOA 4JZ3A 5HCKA 1NG2A 4JJDA 1GL5A 1YWPA 2NUZA 1UG1A 2O9SA 2FO0A 1TUDA 1NYGA 1YNZA 1X2QA 1PHTA 2J6KA 3THKA 1HJDA 2DBMA 2HCKA 2SRCA 2KR3A 4KRTA 1QWFA 1LCKA 3A98A 1X2KA 2RQTA 5EC7A 1SEMA 3QWYA 2RNAA 4OMNA 4D8DA 3M0RA 2C0OA 1IO6A 3VS2A 4QT7A 2FEIA 1WDXA 1Z9QA 5GJWB 3VS4A 5FWCA 2K6DA 1VYUA 4JZ4A 1PRLC 3SHWA 2EGAA 2RQWA 4CC3A 2DBKA 1T3LA 1WA7A 1WXBA 3H0IA 1T0JA 2QDLA 2JS0A 2EYWA 2CSQA 4DEXA 3H41A 1KIKA 2J7IA 1T3SA 5IHIA 4AFZC 4HVWA 1JEGA 1YP5A 1CSKA 1GBRA 3KFVA 1ZX6A 2RQRA 1H8KA 2LQWA 2FG0A 1M8MA 1WX6A 2KXCA 3RNJA 5FW9A 2DE0X 2OAWA 1H3HA 1OV3A 2HEQA 1AD5A 2DMOA 2EGEA 1SRLA 2HBWA 3VS7A 2L0AA 1U5SA 3M0SA 1K0XA 3EG3A 1QKXA 2CT4A 1PNJA 2MOXA 1MV3A 3EGUA 2VVKA 4RTWA 1PRMC 2G6FX 4RTUA 1KJWA 1UGVA 1FYNA 3H0HA 1RI9A 5GJVB 2L3QA 2DF6A 1GFCA 2KBTA 2DM1A 2LJ3A 1Y57A 2YDLA 3UA6A 1EFNA 1UHCA 2DX1A 4IIOA 2SEMA 2LX7A 1A0NB 4J9CA 1H92A 1GBQA 4HXJA 2C0IA 2XMFA 3U23A 1QLYA 3VS1A 2JTEA 1ZUYA 2HSPA 2DRKA 2DA9A 3VS5A 2CH4A 3NHNA 4K11A 2CH4W 1NEBA 4WCIA 1OPKA 2J05A 1NEGA 4J9IA 3M0UA 4GLMA 1UECA 5ECAA 1NLOC 1PWTA 1MUZA 2EQIA 5I11A 1W6XA 2FPEA 1HD3A 1W70A 2RPNA 1E6GA 4CC7A 1J3TA 4A63B 1SSHA 4J9DA 2AKKA 1BB9A 2KRSA 5IXFA 1VA7A 4EIKA 2ED1A 5IHKA 3VS3A 2F2VA 2I0NA 2O31A 1AWWA 1BBZA 1JQQA 4JJBA 1K1ZA 2LZ6B 1KSWA 1Y0MA 4OMOA 1VYTA 1V1CA 4OMMA 2ROLA 1MV0B 2IIMA 2MCNA 2DL4A 2AK5A 2O88A 2DL3A 2GBQA 3PE0A 1QCFA 2M0YA 4FSSA 2AZVA 2ED0A 1BK2A 2DL8A 2A37A 4LE9A 2JM9A 2JM8A 4IIMA 3TSZA 4RTVA 2KYBA 2EVRA 2FPFA 3VRYA 2O9VA 4OMQA 1NM7A 2K2MA 2P4RA 3QWXX 2LJ1A 1UJYA 1HSQA 1ABOA 1B3QA 2PTKA 2E5KA 1E7OA 1WXTA 2LMJA 2JT4A 2ROTA 1X69A 2OJ2A 2DILA 2JXBA 2CUBA 1QKWA 4JJCA 1WXUA 3FJ5A 2AKLA 1I07A 1AWOA 1ZSGA 4ZNXA
chains in the Genus database with same CATH superfamily
5FLXE 3UF4A 2QA4Q 2GFUA 2HMAA 4RCBA 4M78G 1XOVA 1NJIC 3P8BB 2RMOA 3KBGA 3CCMA 1M1FA 2DXBA 2DYBA 4JDSA 5GAN7 2KRMA 1Q81C 2ESWA 4KGVB 4C0GA 4F16A 2K3XA 3EGDB 3PIPA 2XIDA 4QQGA 3X28B 1V29B 1D0XA 3VU3C 2DYIA 1WNLA 3JCMP 1YI2T 2B86A 3J7AF 4J6YA 2JTMA 2DLPA 3LH5A 2CUDA 2HQEA 1IREB 3MO8A 1YHQA 4M7AC 1TUGB 1AT1B 5HK3A 2PQWA 3UATA 3QBYA 4TVRA 2D8HA 4AG1C 3EFSA 3EG1A 1JRIA 4R0KA 1G3TA 3PIOA 2M51A 1I5LA 3HTRA 2QYZA 2QQRA 4EMHA 3M54A 4ZN3A 4AG2C 2DTIA 2QA4T 4LUEA 5GMKm 1D1AA 5CQYA 2YWWA 3MKDA 3UPUA 2K79A 1AEYA 2V1QA 2P0QA 3I56A 4JS4A 2ENMA 3JCMJ 1AOJA 1GCQA 2NUTB 2CYZB 3MP6A 3TSWA 2K3BA 1VQNQ 1T0HA 1VYVA 4PJJA 2HL5C 1Q86R 1LNXA 2DD4A 1MMNA 1MNEA 4ZGEB 1RI0A 2LQ8A 4XU0A 3QZ5B 3VYGA 2DNUA 4FU6A 3L1AA 3OS5A 1XNIA 2O2OA 1NPPA 1UTIA 5CR2A 3H9NA 3R6OA 4ESRA 3CCMQ 3CQTA 4XQ3A 1M5Q1 2LJ0A 1VQLA 2VYTA 3MCAB 2D1XA 4GBQA 4QKUA 2GTJA 3M0PA 4C92B 2RJCA 4RUGA 2RM4A 4HCZA 2LCLA 2E12A 4J9FA 3MP1A 4IUPA 3CMAA 5I2MA 1ZUKA 2YSQA 4BDYA 4ZTJA 1YJWA 1CKAA 1UE9A 2EJGA 4IUVA 1YJ9A 1Q82R 4XTYA 2KE9A 4PFOA 2H8HA 1YHQQ 3EHRA 2HZYA 4ME7A 2EYXA 2D8JA 1PD0A 1YCSB 3CCVA 4OB0B 5FU7B 5I22A 1VQNT 3M57A 3GBQA 1ZSZB 1Y96A 1JJ2S 5I21A 1K8AR 4M78C 4QVZA 5LJ5j 1MNDA 1KFZA 2JS2A 5CCAA 2ECZA 3CBMA 2LNVA 5LJ5h 4J7IA 1VQKA 3OW2A 2CS7A 2EYQA 3CCMT 1MMDA 3RIRA 1QP3A 3R6NA 1RAEB 3L2UA 3JCMW 4ORZA 3I56Q 2ZPGB 3CPFA 1VQ8A 3CXCP 1PKSA 5CK9A 2ZPBB 1TSFA 5C6SA 1ZA1B 2QAZA 2LT4A 2JMAA 3C0CA 2EYZA 4RG8A 3OYHA 4F7UE 3NPFA 1NLPC 5CKDA 3VUZA 3CD6A 1U1TA 3QPHA 2FYKA 1W2BA 1LVKA 3FRNA 4FT4A 1HYOA 2KRNA 4A54A 1UFFA 2DETA 3KUFA 3SWNC 2V8JA 2DEUA 5GAN5 4QQ6A 1GL5A 1QW1A 2NUZA 1XTDA 4N0AC 2D9TA 1YHQT 2O9SA 4AT1B 1VIEA 3Q1JA 3M56A 2J6KA 5J26A 3NFCA 1VQLQ 4WF2A 2KR3A 3G6ET 2CP6A 1QWFA 4QVCA 1OI1A 2QEXA 4ZTFA 1SEMA 2HSEB 2V8IA 3M0RA 4PJOD 2LCCA 2DO3A 3CC2A 2PU9B 1K73U 3X26B 1YJWQ 4PJOF 3META 1YITA 3VS4A 5FWCA 2K6DA 1YJ9Q 1VYUA 2DBKA 3LYIA 2CZ6B 3QJYA 1KK7A 1WXBA 9ATCB 3TEEA 3I56T 1UGQB 2VXFA 2DD5A 3CCVQ 1VQ9A 5IN1A 3H41A 1KIKA 2CKKA 1T3SA 4AFZC 2FZGB 4HVWA 3L2WA 3TCJA 2IPOB 4XAXB 1CSKA 3OS0A 3KFVA 3CMET 3E19A 2KY9A 2RQRA 1B34B 1H8KA 1LJOA 1NJIR 2L3RA 3HFOA 4M77E 1H3HA 2HEQA 3CC7Q 5GAMe 4NS5A 1Q81R 1SSFA 3HFNA 4A4HA 4C92A 2HBWA 2L0AA 2YLCA 4OVAA 3EG3A 1Q7YU 1M2VA 1VQ8Q 2GCXA 1WHJA 1Q82U 2G6FX 1RACB 1KJWA 1UGVA 1FYNA 3BFMA 1K9MU 3H0HA 5DM7R 2L3QA 2COWA 3X20B 1GFCA 1S72A 4M7DA 2DM1A 4EMGA 3CPWS 3UA6A 2QQBA 3FDRA 4JRPA 4MZTA 2PVGB 5LJ3d 1ZSZA 2JTEA 3RKXA 3CC4Q 3LGFA 2E5QA 2HSPA 3OB9A 3VS5A 2OTLA 2CH4A 4EMKC 1OPKA 1NEGA 4R56A 1XJWB 2QEXQ 4JRQA 4M7AD 1P92A 2FL7A 3URGA 3JCMV 1HD3A 3H6ZA 4M7AF 4NL2A 2A3LA 3M4GA 4RCCA 2LC4A 4M77G 4KH0B 3CC2Q 1J3TA 2XK0A 2X4XA 4B9XA 5FRNA 3CC7T 1YITQ 2P0KA 1D1CA 3MP8A 2I0NA 2O01E 3PMTA 5GAOp 2JUFA 4JJBA 2QQAA 3G71A 1K73C 1Y0MA 4OMOA 1VYTA 1VQ9Q 1ACMB 4OMMA 2ROLA 2IIMA 3FJPA 5KYYA 3L2ZA 3EG9B 3OMGA 4F7UB 2P0PA 2O88A 4FSSA 2RHUA 5FROA 3H8ZA 2EIFA 1R77A 4IIMA 3G7ZA 2KYBA 3S3MA 1UGRB 2RI3A 3NTHA 4HA8A 1OZ2A 2K2MA 3M59A 3EGXB 2DPPB 3CCLA 1UJYA 2OX7A 3QJ6A 3CC4T 2RJEA 4X9DA 1WQWA 5KE2A 4E2FB 1NE8A 4ELYC 2OTJT 4PLLA 2QGGA 4N4IA 4JJCA 4IURA 1RABB 1VQMQ 2AKLA 3OYNA 2LDMA 4ZNXA 1A0NB 2O4XA 1Q7YC 1OULA 2CP7A 1S72Q 3ULRB 1I8FA 1Q82C 4CC2A 3JCMQ 3V7CA 2AHJB 4KT0E 1NZ9A 4OMPA 4KBMB 4FT2A 4BE0A 5D6YA 4E7IA 1K9MC 1E6HA 2LT1A 4FYWB 3ASKA 1B34A 2OTLQ 1WFWA 4NL3A 2ZCFB 3GF5A 2JMCA 2F2XA 1PSFA 2RHXA 5CVIA 1DJ7B 4XTXA 4BD3A 4FM4B 1K8AC 1M27C 1KQSS 2GQVA 3I5RA 2GQIA 4LUDA 3CCEQ 1BU1A 3ER0A 1D3BB 4BUGA 3BW1A 3I9QA 4BACA 1SKUB 4C5EA 4C0FA 2CT3A 2D0NA 3UWNA 1ABQA 1WZOA 4II1A 2X51A 4J9BA 1VQPA 1KQ1A 1X75C 4FYXB 1JXMA 2DRMA 3CXCA 4DBQA 1B7TA 4C92D 3CCRA 2L3PA 4EPCA 1VQMT 1AVZC 4C92F 3JCMf 1S72T 3V8LA 2YXYA 1O9SA 3CBPA 1FWZA 3SEMA 2J06A 1WGSA 1OX8A 2ABLA 4B9WA 4Q5WA 2DL7A 5FU6C 3CCLQ 3ZEHA 5GAN4 2OTLT 3AHUA 4J9HA 5HY6A 4M77C 1KD1U 2F2WA 1SPKA 5LJ3f 2PZ1A 4Y92A 6AT1B 3OS2A 3JCMe 3CCET 4OB2B 2KQWA 2VUBA 1GFDA 1VQ7A 2DXCA 2V1RA 3JB9D 2OI3A 3SFMA 1JB0E 3JB9F 2KNBB 2LQKA 1LOJA 4M4ZA 2KSSA 3JV3A 5CKFA 1FX7A 3RBBB 5HK0A 2EJFA 4OMFB 4NOYA 1RL2A 2RHIA 4M75E 1IHWA 3M0QA 2P84A 4DBFA 5GANf 2GTOA 2W0ZA 1X6BA 3ME9A 5IH2A 1XQHA 4KGZB 5LJ3h 4C8QE 3QXEB 2DZCA 2YHTA 4J5YA 3VS6A 1VQ6A 1VQ5A 2E3HA 2FRWA 1GCQC 2COZA 3JB9I 1N5ZA 3GLXA 1I4K1 3EGXA 4Y28E 2QQSA 1VQ4A 3WVDB 2QGFB 1OU8A 1UB4A 3DKMA 4Z8AA 2KEAA 4PJMA 2XI9A 2NUPA 1G5VA 1JXOA 3MPUB 2LX9A 3EHQA 2KT8A 2YRVA 1YFNA 4OGCA 3M0TA 1U06A 5KE3A 5GANe 1VQPQ 2BE9B 2E1HA 1G83A 4PL6A 2Y4YA 2PNIA 4DQ2A 1PKTA 1AZEA 2M9UA 3UT1A 4XTZA 2JNGA 1HXDA 3CCRQ 2PVOB 3CCJT 1PM3A 5D7UA 1RAHB 4PKCC 3NMZC 4QQDA 3GNGA 1KHCA 2RHYA 2HAXA 1WI7A 4LDXA 4PJOA 1I1JA 2HQHA 3EG2A 4M75G 1YJNA 1NBEB 3VRZA 2ZAEA 2FB7A 2QK0A 1GRIA 1M30A 1K4US 3CPWP 5GAMd 2MK5A 1U8RA 4C8QG 1D3BA 2C0TA 4M7DG 2V26A 3OYYA 4RTYA 2EYYA 5KYWB 1X6OA 1VQ7Q 3CBOA 3PGGA 3G1JA 2HKQB 4AFQC 1YWOA 5CKEA 4JZ3A 4JJDA 5HKCA 3FC3A 2LVMA 2AIRB 1KD1C 1K73R 4IUQA 2FO0A 5GMKi 1X2QA 3THKA 2DBMA 2HCKA 2SRCA 5IT9E 2E3IA 3SB2A 3JB9J 1WHKA 1LCKA 4L6V5 4QVDA 3QWYA 3CCRT 2RNAA 4MMKA 4D8DA 1VQ5Q 3A8MB 4M78B 4QT7A 1QVFP 2FEIA 2GFAA 1Z9QA 4O6JA 4JZ4A 1PRLC 3MEVA 4MDWA 1TS9A 1T3LA 1WA7A 3BE3A 3H0IA 3VYHB 1PG5B 2QDLA 2J7IA 5IHIA 1ZQ1A 2M16A 1YP5A 1Q7YR 2LQWA 8ATCB 5M9OA 3DLLA 5KYUB 4A4EA 3DB3A 4M7AA 3C4SA 1AD5A 3SWNB 1K9MR 1TXQA 4IUTA 2B8AA 1MMGA 2CP2A 3VKIA 3FIFA 2JOYA 1IXDA 2RJDA 3OS1A 3EFRA 3GNFB 5LJ5g 4C8QB 2PUOB 2EQUA 3EGUA 4RTWA 3X25B 4E7ZA 3OW2S 4D6WA 1JBMA 4J6XA 1M1KR 3EGDA 1BYMA 2YDLA 1UHCA 4IIOA 4XK8E 2D6FA 5DLOA 1KQSP 4BE1A 1JJ2A 4HXJA 3U23A 5DY9A 1QLYA 3QUIA 1BIAA 5KYXB 3OY9A 3CCSA 1OZ3A 2ZPHB 1G8XA 1WJSA 2CH4W 4JLGA 3G4SA 2IVWA 1PWTA 2DKGA 1MUZA 3INZA 5GAN8 1VQOA 4C5IA 2RPNA 3HRTA 1E6GA 4CC7A 1I81A 1VUBA 2JZ2A 4J9DA 1ZBXA 3QKJA 4M75C 2RK2A 1BB9A 4OB3B 2XU8A 1VA7A 4EIKA 2ED1A 5CAIA 1EX4A 2F2VA 2R5AA 1BBZA 5GAN3 3OYBA 4C8QC 4M7DC 1H641 1V1CA 5KYWA 2QTXA 1MV0B 5CIUA 2DL4A 3CMAQ 2E6ZA 5I2SA 4OP0A 3QDFA 2DL3A 2GBQA 2M0YA 2QASA 2FHDA 2AZVA 3E2UA 3P8HA 2ED0A 4ZGJB 2FVUA 2NLUA 5GAMf 2NUTA 4LE9A 4EDUA 1V76A 3QZ9B 4KULA 4FL6A 4X9CA 3CCQA 3OBYA 2FPFA 3SDZA 4OMQA 5J39A 3QYGB 2YRCA 2LJ1A 4PNOA 1M8VA 5A0DA 1UEBA 2WACA 2PTKA 1QP2A 5A2QE 2DAQA 2LMJA 2JT4A 2ROTA 1Q95G 2K57A 2OJ2A 1WJRA 4M78A 4EMKB 5GAOl 1D1BA 3VUBA 1QKWA 1I07A 5GAMh 1ZSGA 1KQ2A 2A36A 3MEAA 2YUOA 2CZ7B 2CSIA 1VQKQ 1SHGA 3OYEA 1YCYA 3HPWA 1VQLT 3JCMd 4X34A 4ZGDB 1OOTA 3VJPA 2RJFA 2F1LA 1M3AA 3CCSQ 2L3SA 3CMAT 2PUKB 3I35A 5KYUA 2DVJA 3ZL7C 4F14A 2KT1A 3CD6Q 3CEYA 4ATOA 3TU4K 1YIJA 4BDZA 1YJWT 3SWNA 1VQOQ 1YJ9T 1NYFA 1WYXA 3LW5E 3GIBA 1U3OA 2EJ9A 1RLQC 4N0AA 4JPBW 1ZLMA 4PFPA 3MHXA 2FZCB 1OU9A 3CCVT 4KUDK 2KI7A 1CKBA 4JS5A 4HVUA 1ZUUA 1WQ7A 3E1SA 1M1KU 3CPWA 2V8KA 4XTVA 4HT8A 2DVEA 1O75A 2J6FA 1GXIE 5GANd 4PJOG 4J9EA 4DEYA 1KD1R 2BUDA 1VQKT 1G3YA 1RAIB 5D6WA 2L8DA 2BIVA 1D09B 3CCQQ 1HK9A 4XTWA 4JJNK 2BE7D 1AWJA 2KK4A 4MMLA 1VQ8T 4JLIA 1C6VX 2BTTA 4J7FA 1R0BG 4Z88A 4P5NA 3OYLA 3I55A 1M3CA 1UJ0A 1JU5C 4V2SA 2JVVA 1WPYA 3CD6T 2R57A 2EW3A 3A1PA 3IQLA 3H0FA 1M9SA 2X3XD 3FLGA 1KC8U 4OMLA 3QSUA 2LCSA 2GGRA 1VQOT 1IGQA 2DXTA 3MEWA 1AZGB 4RTXA 1KG1A 2AT1B 1QVFA 3L2VA 3LGLA 2RHZA 1FMWA 1PD1A 2JJ9A 3JCMc 2DJQA 2KGTA 1B07A 2KROA 2E6NA 7AT1B 2ZPFB 1QWEA 3EG0A 3LH0A 2QEXT 5IAYA 1M90U 2X4YA 2YUPA 5GAOm 4RKUE 2BKDN 2RH2A 2W10A 3CC2T 1YIJQ 3RMSA 5FRMA 1OPLA 2CDTA 1YITT 4FSXA 1R8OB 2K7AA 1N9RA 1RLPC 4FW1A 3A8GB 1YI2A 1Y07A 1BI3A 1FMKA 1SRMA 1VQ9T 3L2QA 4EMKA 3JCMX 1QVPA 4E7JA 2KMTA 1TU0B 2CP5A 1BI2A 1M2OA 5FU6B 4BI4A 4XU3A 1BIBA 1IZ6A 2KVQG 2ZPIB 4M7AG 1RUWA 4M77B 2EBPA 4OF1A 5GAN6 2EQKA 1ZHIA 4CC4B 4D8KA 1M1KC 2MYSA 5L8RE 3EH2A 1JJ2P 3PT9A 1LPLA 2C06A 5J3BA 4E6RA 3OBWA 2WSFE 4M78D 2DJZA 2NYSA 2X4WA 3I5SA 4M78F 2BZXA 3G71Q 1UDLA 2R5MA 1GCPA 1KQSA 4C5HA 1MHNA 1RAGB 4LDYA 2K2VA 1K76A 3I55Q 2X3WD 1EZZB 1QVGS 1YIJT 1MGQA 1K9AA 2HDAA 1I0CA 2XKOC 1WLPB 1PCXA 2YT6A 4DA4A 4JRIA 1K0SA 4HT9A 5AYFA 3OYIA 1Y71A 3S3OA 1WHLA 3PTAA 1UGSB 5D6XA 1I5OB 2EWNA 1NG2A 2F69A 1U1SA 1NPRA 2QG9B 3VV0A 1TUDA 1NYGA 1PSEA 1KC8C 1RAAB 2XDPA 1HJDA 2A0FB 2VXEA 3HSBA 1RAFB 4KRTA 1RADB 3JCMh 3A98A 1X2KA 2M02A 2Y90A 5EC7A 3QHSA 2Z0WA 4FW2A 2E41A 4C92E 2DERA 1Y7XA 3O8VA 4LD6A 2ATCB 2DIGA 3QYHB 5A0GA 4XTUA 1M90C 5LJ3g 5LJ3j 1D0YA 4KH1B 3SHWA 3JCMb 3EG9A 4F7UA 3G71T 4CC3A 1YI2Q 4L59A 1YBYA 3ZFJA 2QTVA 2WSEE 2Y4XA 1T0JA 3E9FA 2JS0A 3EAEA 2CSQA 4DEXA 4M7DE 5GMKh 2EFIA 5GMKe 1GBRA 3D7SB 1ZX6A 1M1GA 2HBPA 4Y91A 5GANj 1X01A 2KDSA 3PFSA 2CZ1B 1M8MA 1WX6A 4DBRA 3JB9H 3RNJA 2E64A 3CCLT 5GANh 5KH6A 1Y96B 3AT1B 1VIFA 3VS7A 3BDUA 3L42A 1K0XA 3V7SA 3X24B 8AT1B 1QKXA 2K5FA 2DTOA 3QG1A 1MV3A 4C92G 2VVKA 3GP8A 4RTUA 1UGPB 3M9QA 1RI9A 5GJVB 3OSVA 2R58A 4C0DB 2DF6A 2KBTA 3JRZA 1Y57A 3WVEB 1EFNA 2DX1A 3HP9A 1FXXA 1H92A 1GBQA 2C0IA 1ZUYA 4J83A 4LXCA 2DRKA 1W4SA 2DA9A 3OYGA 4M77A 3NTKA 2XDBA 4K11A 4WCIA 1NEBA 2J05A 1OX9A 3M0UA 2P4TA 3G6EA 1UECA 2HD0A 5EG2A 4ZN1A 2MMPA 5I11A 4FYVB 2FPEA 1W70A 5C0MA 3JB9G 2M0OA 4A63B 2F5KA 1SSHA 5KCHA 4FCYA 2OAUA 5IXFA 1BI1A 4PJLA 1VQPT 3J80E 2O31A 2XG8D 3C12A 3RR6A 2EQJA 1ZA2B 2RK1A 2COYA 1VQ6Q 2CGHA 3LWIA 4C0DC 4IUUA 2HQXA 4PK4A 4A53A 3PE0A 1C0MA 1QCFA 2G3RA 3CMEA 4DOWA 1VQ4Q 3V8KA 2XD0A 3S3NA 2JM9A 4HCCA 3TSZA 2EVRA 4BI8B 2MAMA 3VRYA 2O9VA 2P4RA 2CP0A 3QWXX 4E47A 2DK3A 2K4YA 1HSQA 1ABOA 1B3QA 1MMAA 1WXTA 3L2RA 4BI3A 2E10A 2DILA 2JXBA 2CUBA 1FMVA 4J6WA 1VQ7T 2RI5A 4A4FA 4GLKA 2VV5A 3FJ5A 2E4HA 1AWOA 1N9SA 2MWPA 5L23A 3CCUA 1M2VB 1N8RR 4LD9K 4OB1B 4E7LA 3WXMB 4M75B 2IG0A 3UDCA 1YJNQ 5LL6S 5LJ5f 4M7DB 2K9GA 3RESA 1G2BA 3MEUA 1VQ6T 2EQMA 1VQ5T 4BE2A 1SF9A 1M4ZA 2K5IA 3G6EQ 1Z9ZA 4E7HA 1VQ4T 4F7UF 2RI2A 4J9GA 4C0ZA 3O5ZA 4N4GA 3J81E 4J8OA 2DL5A 4MDXA 2J6OA 1YN8A 1W1FA 4F17A 2A28A 3CC7A 2KYMA 3UA7A 5IXBA 3OYKA 1W2BS 1IGUA 5LJ5e 4C92C 2BZYA 3OYJA 2RN8A 2RQVA 4LN2A 4RTTA 1AWXA 4XU2A 3S6WA 3OYFA 1QCOA 3CMEQ 4MZPA 3M58A 1X27A 3PMIA 1H3ZA 2YLBA 4XU1A 3REBB 3BDLA 1KC8R 4DOVA 5KYYB 2PVDB 1TTHB 2F5TX 1QVGP 2NWMA 2RQUA 1IB8A 2VWFA 3F70A 1YJNT 3RERA 2EPDA 2LQNA 2VKNA 4FIBA 5CKHA 3PVLA 5FU7C 2GNCA 1UUEA 2FPDA 4Z89A 3CC4A 1ZSZC 4DBHA 3M5AA 3NTIA 1BI0A 1ZBJA 2M1HA 2CZ0B 2OTJA 2AZSA 2KXDA 4C5GA 1M90R 5CKBA 1C1AA 4JRKA 4M77D 2WSCE 4ELZC 1M3BA 3CCUQ 1X6GA 4ANJA 4M77F 2I2LA 2LRQA 5GAN2 3REAB 5GAMg 5GAMj 1IRXA 4LNPA 3MJXA 1Q86U 2O4XB 2HL3A 1AHJB 2XICA 1TG0A 1JO8A 2ZPEB 2MI6A 2EGCA 2EKHA 3PVQA 4IKFA 2BZ8A 4PJOE 4QW2A 4F7UG 1QMCA 2MIOA 3M55A 5KCOA 4MZMA 1F1BB 2CP3A 4PLIA 3GPLA 1UHFA 4HCKA 4X1VA 3RMQA 3OYDA 4HVVA 1QQJA 4Z02A 3TQ7P 4AFUC 3TVTA 3QIIA 2A08A 3G4SQ 1OEBA 1N8RU 2YUQA 1N27A 1WHHA 4M75A 4BB7A 2RD1A 2DZ9A 1SG5A 2JW4A 1VQMA 3CCUT 1S1NA 3OQ5A 3C95A 1TUCA 1ARKA 4C8QA 1BCOA 2E65A 2A7YA 5FWBA 3ZBDA 2DEQA 4RMOA 2CREA 4HCBA 2X4JA 2JN0A 3EFOB 1TOVA 4CRIA 4CI0C 1K8AU 2L5QA 2FRYA 3NGPA 4BY6B 3OMCA 3JAME 4AFSC 1WIEA 2LP5A 2QXFA 4KGXB 4JUVA 5IHNA 4O5VA 2LNHB 2L2PA 2MF2A 2DIQA 4LDVA 3VS0A 3OYMA 1X43A 2RF0A 2YUNA 3A8HB 2OTJQ 3FEOA 5KYXA 4RTZA 1D0ZA 1SHFA 3CCEA 3A5ZB 5HCKA 4PJNA 1YWPA 2HNIA 3EH1A 2EAYA 1UG1A 3HRUA 5GAOn 3CCST 1YNZA 4A4KA 1PHTA 2JTFA 3G4ST 4M7AE 3N5BB 4LDUA 5DLQE 2ZGWA 2RQTA 1QVFS 3BY7A 3V8JA 2K5LA 4OMNA 4N4HA 2C0OA 3C94A 1IO6A 2MPXC 2DXUA 3VS2A 4E7SA 1Q86C 3QO3A 3RDVA 1WDXA 2ZZDA 5GJWB 2DFUA 3FB9A 2E70A 3M53A 2EGAA 2RO0A 2RQWA 4BY6C 4B6MA 3KXTA 1OQKA 3P8DA 5GAOr 3PNWC 2EYWA 1WHMA 1JEGA 4PFZA 3HHTB 3T9NA 2NUPB 1KHIA 5A0LA 4OGEA 4RG2A 2FG0A 2QQ9A 1TH7A 3CCQT 4FYYB 2EKOA 2KXCA 5FW9A 2DE0X 1N8RC 2OAWA 1OV3A 4E7KA 2DMOA 3CCJA 5AT1B 1G3SA 2EGEA 1SRLA 2GF7A 3V7RA 1U5SA 3DB4A 3M0SA 2RA2A 2H3EB 2K3YA 2XHCA 2CT4A 1PNJA 3RKWA 2MOXA 1NJIU 4PJOB 1BKBA 1PRMC 2VGMA 3RUXA 3QDRB 2QA4A 1Q81U 2X35A 3TREA 2L89A 2H3JA 5CQXA 2LJ3A 3CXCS 1WJQA 4KUIA 3OW2P 2SEMA 2LX7A 1VOMA 1R0CB 4J9CA 1QCNA 2DTHA 2X9HA 3VS1A 2XMFA 3LX7A 5CO7A 4LDWA 1IHVA 4A4GA 1BCMA 3NHNA 2D0QB 3M4YA 2HKNA 4L5GA 4R55A 4J9IA 4GLMA 1EIFA 3LWHA 3LLRA 5ECAA 1NLOC 2LTOA 2VB6A 2EQIA 1W2BP 1W6XA 4AMCA 3SD4A 3JCMg 5GMKl 1PC0A 2AKKA 2KRSA 4M78E 3EFOA 1TWBA 4UC4A 5IHKA 3VS3A 2QI2A 3HRSA 4WTOB 1QVGA 1G3WA 1AWWA 1JQQA 4M75D 1K1ZA 2LZ6B 1KSWA 4PJOC 2MWOA 2YRDA 4M75F 1N6AA 2MCNA 3A8OB 2QDYB 2AK5A 4C8QD 4M7DD 4F04B 3HKSA 2KAFA 4C8QF 1OYXA 4VUBA 3OSSC 4M7DF 5LJ5d 4GY5A 3OYAA 1BK2A 2DL8A 2A37A 5KYNA 2XDDA 5GMKj 3E9GA 2JM8A 3RKYA 4RTVA 3OYCA 3HL8A 3CCJQ 3JSCA 1NM7A 3I55T 3OA6A 4HKEA 3DLMA 2E5KA 1E7OA 1WHGA 4M7AB 1VQNA 2FZKB 1X69A 5GANg 3GOXA 2RB6A 1WXUA 2VASA 4YTLA 2VC8A 2VGNA 5GAOq 3A8LB 5LJ3e
chains in the Genus database with same CATH topology
2A36A 3UF4A 2YUOA 5L23A 2CSIA 3ULRB 1XOVA 4CC2A 1SHGA 2RMOA 2DYBA 4OMPA 1OOTA 2KRMA 1E6HA 2ESWA 4F16A 1M3AA 2K9GA 1WFWA 2L3SA 1G2BA 3I35A 3ZL7C 2DVJA 4F14A 2KT1A 2JMCA 2F2XA 1M27C 1Z9ZA 3I5RA 2GQIA 4LUDA 1BU1A 4J9GA 1NYFA 1WYXA 1U3OA 1RLQC 3O5ZA 2B86A 2DL5A 3I9QA 1ZLMA 2J6OA 4JPBW 3LH5A 1YN8A 2DLPA 2CT3A 2CUDA 2D0NA 1W1FA 4F17A 2A28A 1ABQA 1CKBA 2KYMA 3UA7A 5IXBA 4HVUA 4J9BA 1ZUUA 3UATA 2D8HA 4AG1C 2BZYA 3EG1A 1JXMA 2RN8A 2DRMA 4R0KA 2RQVA 4LN2A 4RTTA 1AWXA 2M51A 2L3PA 2J6FA 1AVZC 4J9EA 4AG2C 4DEYA 1X27A 4LUEA 3REBB 2K79A 3SEMA 2J06A 2NWMA 2RQUA 2VWFA 2ABLA 1AWJA 2EPDA 2DL7A 2LQNA 1AEYA 2VKNA 2V1QA 2BTTA 2ENMA 4Z88A 3PVLA 2GNCA 1AOJA 1GCQA 1UUEA 2FPDA 4Z89A 4J9HA 1M3CA 3TSWA 1UJ0A 1JU5C 2K3BA 1T0HA 1VYVA 2EW3A 1ZBJA 2F2WA 1SPKA 3IQLA 2PZ1A 3H0FA 2X3XD 4Y92A 4OMLA 2AZSA 2KXDA 1GFDA 2LCSA 2GGRA 2DNUA 2V1RA 2OI3A 1AZGB 2O2OA 4RTXA 1M3BA 1UTIA 1X6GA 2KNBB 4M4ZA 3JV3A 2DJQA 4ESRA 2KGTA 3RBBB 1B07A 3CQTA 3REAB 2KROA 1QWEA 2LJ0A 3EG0A 4LNPA 3M0QA 2D1XA 4GBQA 2GTJA 3M0PA 2GTOA 1TG0A 1JO8A 2W0ZA 1X6BA 4RUGA 5IH2A 2YUPA 2EGCA 2EKHA 3PVQA 3VS6A 2BZ8A 2W10A 4J9FA 1ZUKA 2YSQA 1OPLA 2CDTA 2FRWA 1GCQC 2MIOA 1N5ZA 2K7AA 1CKAA 1RLPC 1UE9A 4Z8AA 2KEAA 2KE9A 2H8HA 1JXOA 1SRMA 1FMKA 3EHQA 2KT8A 3EHRA 3M0TA 2EYXA 1UHFA 2D8JA 1U06A 4HCKA 4X1VA 1YCSB 4HVVA 4AFUC 3TVTA 2A08A 5I22A 1OEBA 1G83A 3GBQA 2PNIA 2YUQA 1PKTA 1AZEA 1RUWA 2EBPA 4CC4B 4D8KA 2JW4A 1KFZA 2JS2A 1S1NA 1ARKA 1TUCA 4E6RA 3NMZC 2ECZA 1WI7A 5FWBA 1I1JA 3I5SA 2BZXA 3EG2A 1UDLA 2CREA 1GCPA 3R6NA 4ORZA 3VRZA 1GRIA 1M30A 3NGPA 2FRYA 1K4US 1PKSA 4AFSC 1K76A 2X3WD 2C0TA 4RTYA 1WIEA 2JMAA 2LP5A 2EYZA 3C0CA 5IHNA 2EYYA 3NPFA 2LNHB 2L2PA 1NLPC 3VS0A 1K9AA 1X43A 2RF0A 2HDAA 1I0CA 1WLPB 2YT6A 2YUNA 1K0SA 2KRNA 1UFFA 4RTZA 1SHFA 4AFQC 1YWOA 4JZ3A 5HCKA 1NG2A 4JJDA 1GL5A 1YWPA 2NUZA 1UG1A 2O9SA 2FO0A 1TUDA 1NYGA 1YNZA 1X2QA 1PHTA 2J6KA 3THKA 1HJDA 2DBMA 2HCKA 2SRCA 2KR3A 4KRTA 1QWFA 1LCKA 3A98A 1X2KA 2RQTA 5EC7A 1SEMA 3QWYA 2RNAA 4OMNA 4D8DA 3M0RA 2C0OA 1IO6A 3VS2A 4QT7A 2FEIA 1WDXA 1Z9QA 5GJWB 3VS4A 5FWCA 2K6DA 1VYUA 4JZ4A 1PRLC 3SHWA 2EGAA 2RQWA 4CC3A 2DBKA 1T3LA 1WA7A 1WXBA 3H0IA 1T0JA 2QDLA 2JS0A 2EYWA 2CSQA 4DEXA 3H41A 1KIKA 2J7IA 1T3SA 5IHIA 4AFZC 4HVWA 1JEGA 1YP5A 1CSKA 1GBRA 3KFVA 1ZX6A 2RQRA 1H8KA 2LQWA 2FG0A 1M8MA 1WX6A 2KXCA 3RNJA 5FW9A 2DE0X 2OAWA 1H3HA 1OV3A 2HEQA 1AD5A 2DMOA 2EGEA 1SRLA 2HBWA 3VS7A 2L0AA 1U5SA 3M0SA 1K0XA 3EG3A 1QKXA 2CT4A 1PNJA 2MOXA 1MV3A 3EGUA 2VVKA 4RTWA 1PRMC 2G6FX 4RTUA 1KJWA 1UGVA 1FYNA 3H0HA 1RI9A 5GJVB 2L3QA 2DF6A 1GFCA 2KBTA 2DM1A 2LJ3A 1Y57A 2YDLA 3UA6A 1EFNA 1UHCA 2DX1A 4IIOA 2SEMA 2LX7A 1A0NB 4J9CA 1H92A 1GBQA 4HXJA 2C0IA 2XMFA 3U23A 1QLYA 3VS1A 2JTEA 1ZUYA 2HSPA 2DRKA 2DA9A 3VS5A 2CH4A 3NHNA 4K11A 2CH4W 1NEBA 4WCIA 1OPKA 2J05A 1NEGA 4J9IA 3M0UA 4GLMA 1UECA 5ECAA 1NLOC 1PWTA 1MUZA 2EQIA 5I11A 1W6XA 2FPEA 1HD3A 1W70A 2RPNA 1E6GA 4CC7A 1J3TA 4A63B 1SSHA 4J9DA 2AKKA 1BB9A 2KRSA 5IXFA 1VA7A 4EIKA 2ED1A 5IHKA 3VS3A 2F2VA 2I0NA 2O31A 1AWWA 1BBZA 1JQQA 4JJBA 1K1ZA 2LZ6B 1KSWA 1Y0MA 4OMOA 1VYTA 1V1CA 4OMMA 2ROLA 1MV0B 2IIMA 2MCNA 2DL4A 2AK5A 2O88A 2DL3A 2GBQA 3PE0A 1QCFA 2M0YA 4FSSA 2AZVA 2ED0A 1BK2A 2DL8A 2A37A 4LE9A 2JM9A 2JM8A 4IIMA 3TSZA 4RTVA 2KYBA 2EVRA 2FPFA 3VRYA 2O9VA 4OMQA 1NM7A 2K2MA 2P4RA 3QWXX 2LJ1A 1UJYA 1HSQA 1ABOA 1B3QA 2PTKA 2E5KA 1E7OA 1WXTA 2LMJA 2JT4A 2ROTA 1X69A 2OJ2A 2DILA 2JXBA 2CUBA 1QKWA 4JJCA 1WXUA 3FJ5A 2AKLA 1I07A 1AWOA 1ZSGA 4ZNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A36 A;  3UF4 A;  2YUO A;  5L23 A;  2CSI A;  3ULR B;  1XOV A;  4CC2 A;  1SHG A;  2RMO A;  2DYB A;  4OMP A;  1OOT A;  2KRM A;  1E6H A;  2ESW A;  4F16 A;  1M3A A;  2K9G A;  1WFW A;  2L3S A;  1G2B A;  3I35 A;  3ZL7 C;  2DVJ A;  4F14 A;  2KT1 A;  2JMC A;  2F2X A;  1M27 C;  1Z9Z A;  3I5R A;  2GQI A;  4LUD A;  1BU1 A;  4J9G A;  1NYF A;  1WYX A;  1U3O A;  1RLQ C;  3O5Z A;  2B86 A;  2DL5 A;  3I9Q A;  1ZLM A;  2J6O A;  4JPB W;  3LH5 A;  1YN8 A;  2DLP A;  2CT3 A;  2CUD A;  2D0N A;  1W1F A;  4F17 A;  2A28 A;  1ABQ A;  1CKB A;  2KYM A;  3UA7 A;  5IXB A;  4HVU A;  4J9B A;  1ZUU A;  3UAT A;  2D8H A;  4AG1 C;  2BZY A;  3EG1 A;  1JXM A;  2RN8 A;  2DRM A;  4R0K A;  2RQV A;  4LN2 A;  4RTT A;  1AWX A;  2M51 A;  2L3P A;  2J6F A;  1AVZ C;  4J9E A;  4AG2 C;  4DEY A;  1X27 A;  4LUE A;  3REB B;  2K79 A;  3SEM A;  2J06 A;  2NWM A;  2RQU A;  2VWF A;  2ABL A;  1AWJ A;  2EPD A;  2DL7 A;  2LQN A;  1AEY A;  2VKN A;  2V1Q A;  2BTT A;  2ENM A;  4Z88 A;  3PVL A;  2GNC A;  1AOJ A;  1GCQ A;  1UUE A;  2FPD A;  4Z89 A;  4J9H A;  1M3C A;  3TSW A;  1UJ0 A;  1JU5 C;  2K3B A;  1T0H A;  1VYV A;  2EW3 A;  1ZBJ A;  2F2W A;  1SPK A;  3IQL A;  2PZ1 A;  3H0F A;  2X3X D;  4Y92 A;  4OML A;  2AZS A;  2KXD A;  1GFD A;  2LCS A;  2GGR A;  2DNU A;  2V1R A;  2OI3 A;  1AZG B;  2O2O A;  4RTX A;  1M3B A;  1UTI A;  1X6G A;  2KNB B;  4M4Z A;  3JV3 A;  2DJQ A;  4ESR A;  2KGT A;  3RBB B;  1B07 A;  3CQT A;  3REA B;  2KRO A;  1QWE A;  2LJ0 A;  3EG0 A;  4LNP A;  3M0Q A;  2D1X A;  4GBQ A;  2GTJ A;  3M0P A;  2GTO A;  1TG0 A;  1JO8 A;  2W0Z A;  1X6B A;  4RUG A;  5IH2 A;  2YUP A;  2EGC A;  2EKH A;  3PVQ A;  3VS6 A;  2BZ8 A;  2W10 A;  4J9F A;  1ZUK A;  2YSQ A;  1OPL A;  2CDT A;  2FRW A;  1GCQ C;  2MIO A;  1N5Z A;  2K7A A;  1CKA A;  1RLP C;  1UE9 A;  4Z8A A;  2KEA A;  2KE9 A;  2H8H A;  1JXO A;  1SRM A;  1FMK A;  3EHQ A;  2KT8 A;  3EHR A;  3M0T A;  2EYX A;  1UHF A;  2D8J A;  1U06 A;  4HCK A;  4X1V A;  1YCS B;  4HVV A;  4AFU C;  3TVT A;  2A08 A;  5I22 A;  1OEB A;  1G83 A;  3GBQ A;  2PNI A;  2YUQ A;  1PKT A;  1AZE A;  1RUW A;  2EBP A;  4CC4 B;  4D8K A;  2JW4 A;  1KFZ A;  2JS2 A;  1S1N A;  1ARK A;  1TUC A;  4E6R A;  3NMZ C;  2ECZ A;  1WI7 A;  5FWB A;  1I1J A;  3I5S A;  2BZX A;  3EG2 A;  1UDL A;  2CRE A;  1GCP A;  3R6N A;  4ORZ A;  3VRZ A;  1GRI A;  1M30 A;  3NGP A;  2FRY A;  1K4U S;  1PKS A;  4AFS C;  1K76 A;  2X3W D;  2C0T A;  4RTY A;  1WIE A;  2JMA A;  2LP5 A;  2EYZ A;  3C0C A;  5IHN A;  2EYY A;  3NPF A;  2LNH B;  2L2P A;  1NLP C;  3VS0 A;  1K9A A;  1X43 A;  2RF0 A;  2HDA A;  1I0C A;  1WLP B;  2YT6 A;  2YUN A;  1K0S A;  2KRN A;  1UFF A;  4RTZ A;  1SHF A;  4AFQ C;  1YWO A;  4JZ3 A;  5HCK A;  1NG2 A;  4JJD A;  1GL5 A;  1YWP A;  2NUZ A;  1UG1 A;  2O9S A;  2FO0 A;  1TUD A;  1NYG A;  1YNZ A;  1X2Q A;  1PHT A;  2J6K A;  3THK A;  1HJD A;  2DBM A;  2HCK A;  2SRC A;  2KR3 A;  4KRT A;  1QWF A;  1LCK A;  3A98 A;  1X2K A;  2RQT A;  5EC7 A;  1SEM A;  3QWY A;  2RNA A;  4OMN A;  4D8D A;  3M0R A;  2C0O A;  1IO6 A;  3VS2 A;  4QT7 A;  2FEI A;  1WDX A;  1Z9Q A;  5GJW B;  3VS4 A;  5FWC A;  2K6D A;  1VYU A;  4JZ4 A;  1PRL C;  3SHW A;  2EGA A;  2RQW A;  4CC3 A;  2DBK A;  1T3L A;  1WA7 A;  1WXB A;  3H0I A;  1T0J A;  2QDL A;  2JS0 A;  2EYW A;  2CSQ A;  4DEX A;  3H41 A;  1KIK A;  2J7I A;  1T3S A;  5IHI A;  4AFZ C;  4HVW A;  1JEG A;  1YP5 A;  1CSK A;  1GBR A;  3KFV A;  1ZX6 A;  2RQR A;  1H8K A;  2LQW A;  2FG0 A;  1M8M A;  1WX6 A;  2KXC A;  3RNJ A;  5FW9 A;  2DE0 X;  2OAW A;  1H3H A;  1OV3 A;  2HEQ A;  1AD5 A;  2DMO A;  2EGE A;  1SRL A;  2HBW A;  3VS7 A;  2L0A A;  1U5S A;  3M0S A;  1K0X A;  3EG3 A;  1QKX A;  2CT4 A;  1PNJ A;  2MOX A;  1MV3 A;  3EGU A;  2VVK A;  4RTW A;  1PRM C;  2G6F X;  4RTU A;  1KJW A;  1UGV A;  1FYN A;  3H0H A;  1RI9 A;  5GJV B;  2L3Q A;  2DF6 A;  1GFC A;  2KBT A;  2DM1 A;  2LJ3 A;  1Y57 A;  2YDL A;  3UA6 A;  1EFN A;  1UHC A;  2DX1 A;  4IIO A;  2SEM A;  2LX7 A;  1A0N B;  4J9C A;  1H92 A;  1GBQ A;  4HXJ A;  2C0I A;  2XMF A;  3U23 A;  1QLY A;  3VS1 A;  2JTE A;  1ZUY A;  2HSP A;  2DRK A;  2DA9 A;  3VS5 A;  2CH4 A;  3NHN A;  4K11 A;  2CH4 W;  1NEB A;  4WCI A;  1OPK A;  2J05 A;  1NEG A;  4J9I A;  3M0U A;  4GLM A;  1UEC A;  5ECA A;  1NLO C;  1PWT A;  1MUZ A;  2EQI A;  5I11 A;  1W6X A;  2FPE A;  1HD3 A;  1W70 A;  2RPN A;  1E6G A;  4CC7 A;  1J3T A;  4A63 B;  1SSH A;  4J9D A;  2AKK A;  1BB9 A;  2KRS A;  5IXF A;  1VA7 A;  4EIK A;  2ED1 A;  5IHK A;  3VS3 A;  2F2V A;  2I0N A;  2O31 A;  1AWW A;  1BBZ A;  1JQQ A;  4JJB A;  1K1Z A;  2LZ6 B;  1KSW A;  1Y0M A;  4OMO A;  1VYT A;  1V1C A;  4OMM A;  2ROL A;  1MV0 B;  2IIM A;  2MCN A;  2DL4 A;  2AK5 A;  2O88 A;  2DL3 A;  2GBQ A;  3PE0 A;  1QCF A;  2M0Y A;  4FSS A;  2AZV A;  2ED0 A;  1BK2 A;  2DL8 A;  2A37 A;  4LE9 A;  2JM9 A;  2JM8 A;  4IIM A;  3TSZ A;  4RTV A;  2KYB A;  2EVR A;  2FPF A;  3VRY A;  2O9V A;  4OMQ A;  1NM7 A;  2K2M A;  2P4R A;  3QWX X;  2LJ1 A;  1UJY A;  1HSQ A;  1ABO A;  1B3Q A;  2PTK A;  2E5K A;  1E7O A;  1WXT A;  2LMJ A;  2JT4 A;  2ROT A;  1X69 A;  2OJ2 A;  2DIL A;  2JXB A;  2CUB A;  1QKW A;  4JJC A;  1WXU A;  3FJ5 A;  2AKL A;  1I07 A;  1AWO A;  1ZSG A;  4ZNX A; 
#chains in the Genus database with same CATH topology
 5FLX E;  3UF4 A;  2QA4 Q;  2GFU A;  2HMA A;  4RCB A;  4M78 G;  1XOV A;  1NJI C;  3P8B B;  2RMO A;  3KBG A;  3CCM A;  1M1F A;  2DXB A;  2DYB A;  4JDS A;  5GAN 7;  2KRM A;  1Q81 C;  2ESW A;  4KGV B;  4C0G A;  4F16 A;  2K3X A;  3EGD B;  3PIP A;  2XID A;  4QQG A;  3X28 B;  1V29 B;  1D0X A;  3VU3 C;  2DYI A;  1WNL A;  3JCM P;  1YI2 T;  2B86 A;  3J7A F;  4J6Y A;  2JTM A;  2DLP A;  3LH5 A;  2CUD A;  2HQE A;  1IRE B;  3MO8 A;  1YHQ A;  4M7A C;  1TUG B;  1AT1 B;  5HK3 A;  2PQW A;  3UAT A;  3QBY A;  4TVR A;  2D8H A;  4AG1 C;  3EFS A;  3EG1 A;  1JRI A;  4R0K A;  1G3T A;  3PIO A;  2M51 A;  1I5L A;  3HTR A;  2QYZ A;  2QQR A;  4EMH A;  3M54 A;  4ZN3 A;  4AG2 C;  2DTI A;  2QA4 T;  4LUE A;  5GMK m;  1D1A A;  5CQY A;  2YWW A;  3MKD A;  3UPU A;  2K79 A;  1AEY A;  2V1Q A;  2P0Q A;  3I56 A;  4JS4 A;  2ENM A;  3JCM J;  1AOJ A;  1GCQ A;  2NUT B;  2CYZ B;  3MP6 A;  3TSW A;  2K3B A;  1VQN Q;  1T0H A;  1VYV A;  4PJJ A;  2HL5 C;  1Q86 R;  1LNX A;  2DD4 A;  1MMN A;  1MNE A;  4ZGE B;  1RI0 A;  2LQ8 A;  4XU0 A;  3QZ5 B;  3VYG A;  2DNU A;  4FU6 A;  3L1A A;  3OS5 A;  1XNI A;  2O2O A;  1NPP A;  1UTI A;  5CR2 A;  3H9N A;  3R6O A;  4ESR A;  3CCM Q;  3CQT A;  4XQ3 A;  1M5Q 1;  2LJ0 A;  1VQL A;  2VYT A;  3MCA B;  2D1X A;  4GBQ A;  4QKU A;  2GTJ A;  3M0P A;  4C92 B;  2RJC A;  4RUG A;  2RM4 A;  4HCZ A;  2LCL A;  2E12 A;  4J9F A;  3MP1 A;  4IUP A;  3CMA A;  5I2M A;  1ZUK A;  2YSQ A;  4BDY A;  4ZTJ A;  1YJW A;  1CKA A;  1UE9 A;  2EJG A;  4IUV A;  1YJ9 A;  1Q82 R;  4XTY A;  2KE9 A;  4PFO A;  2H8H A;  1YHQ Q;  3EHR A;  2HZY A;  4ME7 A;  2EYX A;  2D8J A;  1PD0 A;  1YCS B;  3CCV A;  4OB0 B;  5FU7 B;  5I22 A;  1VQN T;  3M57 A;  3GBQ A;  1ZSZ B;  1Y96 A;  1JJ2 S;  5I21 A;  1K8A R;  4M78 C;  4QVZ A;  5LJ5 j;  1MND A;  1KFZ A;  2JS2 A;  5CCA A;  2ECZ A;  3CBM A;  2LNV A;  5LJ5 h;  4J7I A;  1VQK A;  3OW2 A;  2CS7 A;  2EYQ A;  3CCM T;  1MMD A;  3RIR A;  1QP3 A;  3R6N A;  1RAE B;  3L2U A;  3JCM W;  4ORZ A;  3I56 Q;  2ZPG B;  3CPF A;  1VQ8 A;  3CXC P;  1PKS A;  5CK9 A;  2ZPB B;  1TSF A;  5C6S A;  1ZA1 B;  2QAZ A;  2LT4 A;  2JMA A;  3C0C A;  2EYZ A;  4RG8 A;  3OYH A;  4F7U E;  3NPF A;  1NLP C;  5CKD A;  3VUZ A;  3CD6 A;  1U1T A;  3QPH A;  2FYK A;  1W2B A;  1LVK A;  3FRN A;  4FT4 A;  1HYO A;  2KRN A;  4A54 A;  1UFF A;  2DET A;  3KUF A;  3SWN C;  2V8J A;  2DEU A;  5GAN 5;  4QQ6 A;  1GL5 A;  1QW1 A;  2NUZ A;  1XTD A;  4N0A C;  2D9T A;  1YHQ T;  2O9S A;  4AT1 B;  1VIE A;  3Q1J A;  3M56 A;  2J6K A;  5J26 A;  3NFC A;  1VQL Q;  4WF2 A;  2KR3 A;  3G6E T;  2CP6 A;  1QWF A;  4QVC A;  1OI1 A;  2QEX A;  4ZTF A;  1SEM A;  2HSE B;  2V8I A;  3M0R A;  4PJO D;  2LCC A;  2DO3 A;  3CC2 A;  2PU9 B;  1K73 U;  3X26 B;  1YJW Q;  4PJO F;  3MET A;  1YIT A;  3VS4 A;  5FWC A;  2K6D A;  1YJ9 Q;  1VYU A;  2DBK A;  3LYI A;  2CZ6 B;  3QJY A;  1KK7 A;  1WXB A;  9ATC B;  3TEE A;  3I56 T;  1UGQ B;  2VXF A;  2DD5 A;  3CCV Q;  1VQ9 A;  5IN1 A;  3H41 A;  1KIK A;  2CKK A;  1T3S A;  4AFZ C;  2FZG B;  4HVW A;  3L2W A;  3TCJ A;  2IPO B;  4XAX B;  1CSK A;  3OS0 A;  3KFV A;  3CME T;  3E19 A;  2KY9 A;  2RQR A;  1B34 B;  1H8K A;  1LJO A;  1NJI R;  2L3R A;  3HFO A;  4M77 E;  1H3H A;  2HEQ A;  3CC7 Q;  5GAM e;  4NS5 A;  1Q81 R;  1SSF A;  3HFN A;  4A4H A;  4C92 A;  2HBW A;  2L0A A;  2YLC A;  4OVA A;  3EG3 A;  1Q7Y U;  1M2V A;  1VQ8 Q;  2GCX A;  1WHJ A;  1Q82 U;  2G6F X;  1RAC B;  1KJW A;  1UGV A;  1FYN A;  3BFM A;  1K9M U;  3H0H A;  5DM7 R;  2L3Q A;  2COW A;  3X20 B;  1GFC A;  1S72 A;  4M7D A;  2DM1 A;  4EMG A;  3CPW S;  3UA6 A;  2QQB A;  3FDR A;  4JRP A;  4MZT A;  2PVG B;  5LJ3 d;  1ZSZ A;  2JTE A;  3RKX A;  3CC4 Q;  3LGF A;  2E5Q A;  2HSP A;  3OB9 A;  3VS5 A;  2OTL A;  2CH4 A;  4EMK C;  1OPK A;  1NEG A;  4R56 A;  1XJW B;  2QEX Q;  4JRQ A;  4M7A D;  1P92 A;  2FL7 A;  3URG A;  3JCM V;  1HD3 A;  3H6Z A;  4M7A F;  4NL2 A;  2A3L A;  3M4G A;  4RCC A;  2LC4 A;  4M77 G;  4KH0 B;  3CC2 Q;  1J3T A;  2XK0 A;  2X4X A;  4B9X A;  5FRN A;  3CC7 T;  1YIT Q;  2P0K A;  1D1C A;  3MP8 A;  2I0N A;  2O01 E;  3PMT A;  5GAO p;  2JUF A;  4JJB A;  2QQA A;  3G71 A;  1K73 C;  1Y0M A;  4OMO A;  1VYT A;  1VQ9 Q;  1ACM B;  4OMM A;  2ROL A;  2IIM A;  3FJP A;  5KYY A;  3L2Z A;  3EG9 B;  3OMG A;  4F7U B;  2P0P A;  2O88 A;  4FSS A;  2RHU A;  5FRO A;  3H8Z A;  2EIF A;  1R77 A;  4IIM A;  3G7Z A;  2KYB A;  3S3M A;  1UGR B;  2RI3 A;  3NTH A;  4HA8 A;  1OZ2 A;  2K2M A;  3M59 A;  3EGX B;  2DPP B;  3CCL A;  1UJY A;  2OX7 A;  3QJ6 A;  3CC4 T;  2RJE A;  4X9D A;  1WQW A;  5KE2 A;  4E2F B;  1NE8 A;  4ELY C;  2OTJ T;  4PLL A;  2QGG A;  4N4I A;  4JJC A;  4IUR A;  1RAB B;  1VQM Q;  2AKL A;  3OYN A;  2LDM A;  4ZNX A;  1A0N B;  2O4X A;  1Q7Y C;  1OUL A;  2CP7 A;  1S72 Q;  3ULR B;  1I8F A;  1Q82 C;  4CC2 A;  3JCM Q;  3V7C A;  2AHJ B;  4KT0 E;  1NZ9 A;  4OMP A;  4KBM B;  4FT2 A;  4BE0 A;  5D6Y A;  4E7I A;  1K9M C;  1E6H A;  2LT1 A;  4FYW B;  3ASK A;  1B34 A;  2OTL Q;  1WFW A;  4NL3 A;  2ZCF B;  3GF5 A;  2JMC A;  2F2X A;  1PSF A;  2RHX A;  5CVI A;  1DJ7 B;  4XTX A;  4BD3 A;  4FM4 B;  1K8A C;  1M27 C;  1KQS S;  2GQV A;  3I5R A;  2GQI A;  4LUD A;  3CCE Q;  1BU1 A;  3ER0 A;  1D3B B;  4BUG A;  3BW1 A;  3I9Q A;  4BAC A;  1SKU B;  4C5E A;  4C0F A;  2CT3 A;  2D0N A;  3UWN A;  1ABQ A;  1WZO A;  4II1 A;  2X51 A;  4J9B A;  1VQP A;  1KQ1 A;  1X75 C;  4FYX B;  1JXM A;  2DRM A;  3CXC A;  4DBQ A;  1B7T A;  4C92 D;  3CCR A;  2L3P A;  4EPC A;  1VQM T;  1AVZ C;  4C92 F;  3JCM f;  1S72 T;  3V8L A;  2YXY A;  1O9S A;  3CBP A;  1FWZ A;  3SEM A;  2J06 A;  1WGS A;  1OX8 A;  2ABL A;  4B9W A;  4Q5W A;  2DL7 A;  5FU6 C;  3CCL Q;  3ZEH A;  5GAN 4;  2OTL T;  3AHU A;  4J9H A;  5HY6 A;  4M77 C;  1KD1 U;  2F2W A;  1SPK A;  5LJ3 f;  2PZ1 A;  4Y92 A;  6AT1 B;  3OS2 A;  3JCM e;  3CCE T;  4OB2 B;  2KQW A;  2VUB A;  1GFD A;  1VQ7 A;  2DXC A;  2V1R A;  3JB9 D;  2OI3 A;  3SFM A;  1JB0 E;  3JB9 F;  2KNB B;  2LQK A;  1LOJ A;  4M4Z A;  2KSS A;  3JV3 A;  5CKF A;  1FX7 A;  3RBB B;  5HK0 A;  2EJF A;  4OMF B;  4NOY A;  1RL2 A;  2RHI A;  4M75 E;  1IHW A;  3M0Q A;  2P84 A;  4DBF A;  5GAN f;  2GTO A;  2W0Z A;  1X6B A;  3ME9 A;  5IH2 A;  1XQH A;  4KGZ B;  5LJ3 h;  4C8Q E;  3QXE B;  2DZC A;  2YHT A;  4J5Y A;  3VS6 A;  1VQ6 A;  1VQ5 A;  2E3H A;  2FRW A;  1GCQ C;  2COZ A;  3JB9 I;  1N5Z A;  3GLX A;  1I4K 1;  3EGX A;  4Y28 E;  2QQS A;  1VQ4 A;  3WVD B;  2QGF B;  1OU8 A;  1UB4 A;  3DKM A;  4Z8A A;  2KEA A;  4PJM A;  2XI9 A;  2NUP A;  1G5V A;  1JXO A;  3MPU B;  2LX9 A;  3EHQ A;  2KT8 A;  2YRV A;  1YFN A;  4OGC A;  3M0T A;  1U06 A;  5KE3 A;  5GAN e;  1VQP Q;  2BE9 B;  2E1H A;  1G83 A;  4PL6 A;  2Y4Y A;  2PNI A;  4DQ2 A;  1PKT A;  1AZE A;  2M9U A;  3UT1 A;  4XTZ A;  2JNG A;  1HXD A;  3CCR Q;  2PVO B;  3CCJ T;  1PM3 A;  5D7U A;  1RAH B;  4PKC C;  3NMZ C;  4QQD A;  3GNG A;  1KHC A;  2RHY A;  2HAX A;  1WI7 A;  4LDX A;  4PJO A;  1I1J A;  2HQH A;  3EG2 A;  4M75 G;  1YJN A;  1NBE B;  3VRZ A;  2ZAE A;  2FB7 A;  2QK0 A;  1GRI A;  1M30 A;  1K4U S;  3CPW P;  5GAM d;  2MK5 A;  1U8R A;  4C8Q G;  1D3B A;  2C0T A;  4M7D G;  2V26 A;  3OYY A;  4RTY A;  2EYY A;  5KYW B;  1X6O A;  1VQ7 Q;  3CBO A;  3PGG A;  3G1J A;  2HKQ B;  4AFQ C;  1YWO A;  5CKE A;  4JZ3 A;  4JJD A;  5HKC A;  3FC3 A;  2LVM A;  2AIR B;  1KD1 C;  1K73 R;  4IUQ A;  2FO0 A;  5GMK i;  1X2Q A;  3THK A;  2DBM A;  2HCK A;  2SRC A;  5IT9 E;  2E3I A;  3SB2 A;  3JB9 J;  1WHK A;  1LCK A;  4L6V 5;  4QVD A;  3QWY A;  3CCR T;  2RNA A;  4MMK A;  4D8D A;  1VQ5 Q;  3A8M B;  4M78 B;  4QT7 A;  1QVF P;  2FEI A;  2GFA A;  1Z9Q A;  4O6J A;  4JZ4 A;  1PRL C;  3MEV A;  4MDW A;  1TS9 A;  1T3L A;  1WA7 A;  3BE3 A;  3H0I A;  3VYH B;  1PG5 B;  2QDL A;  2J7I A;  5IHI A;  1ZQ1 A;  2M16 A;  1YP5 A;  1Q7Y R;  2LQW A;  8ATC B;  5M9O A;  3DLL A;  5KYU B;  4A4E A;  3DB3 A;  4M7A A;  3C4S A;  1AD5 A;  3SWN B;  1K9M R;  1TXQ A;  4IUT A;  2B8A A;  1MMG A;  2CP2 A;  3VKI A;  3FIF A;  2JOY A;  1IXD A;  2RJD A;  3OS1 A;  3EFR A;  3GNF B;  5LJ5 g;  4C8Q B;  2PUO B;  2EQU A;  3EGU A;  4RTW A;  3X25 B;  4E7Z A;  3OW2 S;  4D6W A;  1JBM A;  4J6X A;  1M1K R;  3EGD A;  1BYM A;  2YDL A;  1UHC A;  4IIO A;  4XK8 E;  2D6F A;  5DLO A;  1KQS P;  4BE1 A;  1JJ2 A;  4HXJ A;  3U23 A;  5DY9 A;  1QLY A;  3QUI A;  1BIA A;  5KYX B;  3OY9 A;  3CCS A;  1OZ3 A;  2ZPH B;  1G8X A;  1WJS A;  2CH4 W;  4JLG A;  3G4S A;  2IVW A;  1PWT A;  2DKG A;  1MUZ A;  3INZ A;  5GAN 8;  1VQO A;  4C5I A;  2RPN A;  3HRT A;  1E6G A;  4CC7 A;  1I81 A;  1VUB A;  2JZ2 A;  4J9D A;  1ZBX A;  3QKJ A;  4M75 C;  2RK2 A;  1BB9 A;  4OB3 B;  2XU8 A;  1VA7 A;  4EIK A;  2ED1 A;  5CAI A;  1EX4 A;  2F2V A;  2R5A A;  1BBZ A;  5GAN 3;  3OYB A;  4C8Q C;  4M7D C;  1H64 1;  1V1C A;  5KYW A;  2QTX A;  1MV0 B;  5CIU A;  2DL4 A;  3CMA Q;  2E6Z A;  5I2S A;  4OP0 A;  3QDF A;  2DL3 A;  2GBQ A;  2M0Y A;  2QAS A;  2FHD A;  2AZV A;  3E2U A;  3P8H A;  2ED0 A;  4ZGJ B;  2FVU A;  2NLU A;  5GAM f;  2NUT A;  4LE9 A;  4EDU A;  1V76 A;  3QZ9 B;  4KUL A;  4FL6 A;  4X9C A;  3CCQ A;  3OBY A;  2FPF A;  3SDZ A;  4OMQ A;  5J39 A;  3QYG B;  2YRC A;  2LJ1 A;  4PNO A;  1M8V A;  5A0D A;  1UEB A;  2WAC A;  2PTK A;  1QP2 A;  5A2Q E;  2DAQ A;  2LMJ A;  2JT4 A;  2ROT A;  1Q95 G;  2K57 A;  2OJ2 A;  1WJR A;  4M78 A;  4EMK B;  5GAO l;  1D1B A;  3VUB A;  1QKW A;  1I07 A;  5GAM h;  1ZSG A;  1KQ2 A;  2A36 A;  3MEA A;  2YUO A;  2CZ7 B;  2CSI A;  1VQK Q;  1SHG A;  3OYE A;  1YCY A;  3HPW A;  1VQL T;  3JCM d;  4X34 A;  4ZGD B;  1OOT A;  3VJP A;  2RJF A;  2F1L A;  1M3A A;  3CCS Q;  2L3S A;  3CMA T;  2PUK B;  3I35 A;  5KYU A;  2DVJ A;  3ZL7 C;  4F14 A;  2KT1 A;  3CD6 Q;  3CEY A;  4ATO A;  3TU4 K;  1YIJ A;  4BDZ A;  1YJW T;  3SWN A;  1VQO Q;  1YJ9 T;  1NYF A;  1WYX A;  3LW5 E;  3GIB A;  1U3O A;  2EJ9 A;  1RLQ C;  4N0A A;  4JPB W;  1ZLM A;  4PFP A;  3MHX A;  2FZC B;  1OU9 A;  3CCV T;  4KUD K;  2KI7 A;  1CKB A;  4JS5 A;  4HVU A;  1ZUU A;  1WQ7 A;  3E1S A;  1M1K U;  3CPW A;  2V8K A;  4XTV A;  4HT8 A;  2DVE A;  1O75 A;  2J6F A;  1GXI E;  5GAN d;  4PJO G;  4J9E A;  4DEY A;  1KD1 R;  2BUD A;  1VQK T;  1G3Y A;  1RAI B;  5D6W A;  2L8D A;  2BIV A;  1D09 B;  3CCQ Q;  1HK9 A;  4XTW A;  4JJN K;  2BE7 D;  1AWJ A;  2KK4 A;  4MML A;  1VQ8 T;  4JLI A;  1C6V X;  2BTT A;  4J7F A;  1R0B G;  4Z88 A;  4P5N A;  3OYL A;  3I55 A;  1M3C A;  1UJ0 A;  1JU5 C;  4V2S A;  2JVV A;  1WPY A;  3CD6 T;  2R57 A;  2EW3 A;  3A1P A;  3IQL A;  3H0F A;  1M9S A;  2X3X D;  3FLG A;  1KC8 U;  4OML A;  3QSU A;  2LCS A;  2GGR A;  1VQO T;  1IGQ A;  2DXT A;  3MEW A;  1AZG B;  4RTX A;  1KG1 A;  2AT1 B;  1QVF A;  3L2V A;  3LGL A;  2RHZ A;  1FMW A;  1PD1 A;  2JJ9 A;  3JCM c;  2DJQ A;  2KGT A;  1B07 A;  2KRO A;  2E6N A;  7AT1 B;  2ZPF B;  1QWE A;  3EG0 A;  3LH0 A;  2QEX T;  5IAY A;  1M90 U;  2X4Y A;  2YUP A;  5GAO m;  4RKU E;  2BKD N;  2RH2 A;  2W10 A;  3CC2 T;  1YIJ Q;  3RMS A;  5FRM A;  1OPL A;  2CDT A;  1YIT T;  4FSX A;  1R8O B;  2K7A A;  1N9R A;  1RLP C;  4FW1 A;  3A8G B;  1YI2 A;  1Y07 A;  1BI3 A;  1FMK A;  1SRM A;  1VQ9 T;  3L2Q A;  4EMK A;  3JCM X;  1QVP A;  4E7J A;  2KMT A;  1TU0 B;  2CP5 A;  1BI2 A;  1M2O A;  5FU6 B;  4BI4 A;  4XU3 A;  1BIB A;  1IZ6 A;  2KVQ G;  2ZPI B;  4M7A G;  1RUW A;  4M77 B;  2EBP A;  4OF1 A;  5GAN 6;  2EQK A;  1ZHI A;  4CC4 B;  4D8K A;  1M1K C;  2MYS A;  5L8R E;  3EH2 A;  1JJ2 P;  3PT9 A;  1LPL A;  2C06 A;  5J3B A;  4E6R A;  3OBW A;  2WSF E;  4M78 D;  2DJZ A;  2NYS A;  2X4W A;  3I5S A;  4M78 F;  2BZX A;  3G71 Q;  1UDL A;  2R5M A;  1GCP A;  1KQS A;  4C5H A;  1MHN A;  1RAG B;  4LDY A;  2K2V A;  1K76 A;  3I55 Q;  2X3W D;  1EZZ B;  1QVG S;  1YIJ T;  1MGQ A;  1K9A A;  2HDA A;  1I0C A;  2XKO C;  1WLP B;  1PCX A;  2YT6 A;  4DA4 A;  4JRI A;  1K0S A;  4HT9 A;  5AYF A;  3OYI A;  1Y71 A;  3S3O A;  1WHL A;  3PTA A;  1UGS B;  5D6X A;  1I5O B;  2EWN A;  1NG2 A;  2F69 A;  1U1S A;  1NPR A;  2QG9 B;  3VV0 A;  1TUD A;  1NYG A;  1PSE A;  1KC8 C;  1RAA B;  2XDP A;  1HJD A;  2A0F B;  2VXE A;  3HSB A;  1RAF B;  4KRT A;  1RAD B;  3JCM h;  3A98 A;  1X2K A;  2M02 A;  2Y90 A;  5EC7 A;  3QHS A;  2Z0W A;  4FW2 A;  2E41 A;  4C92 E;  2DER A;  1Y7X A;  3O8V A;  4LD6 A;  2ATC B;  2DIG A;  3QYH B;  5A0G A;  4XTU A;  1M90 C;  5LJ3 g;  5LJ3 j;  1D0Y A;  4KH1 B;  3SHW A;  3JCM b;  3EG9 A;  4F7U A;  3G71 T;  4CC3 A;  1YI2 Q;  4L59 A;  1YBY A;  3ZFJ A;  2QTV A;  2WSE E;  2Y4X A;  1T0J A;  3E9F A;  2JS0 A;  3EAE A;  2CSQ A;  4DEX A;  4M7D E;  5GMK h;  2EFI A;  5GMK e;  1GBR A;  3D7S B;  1ZX6 A;  1M1G A;  2HBP A;  4Y91 A;  5GAN j;  1X01 A;  2KDS A;  3PFS A;  2CZ1 B;  1M8M A;  1WX6 A;  4DBR A;  3JB9 H;  3RNJ A;  2E64 A;  3CCL T;  5GAN h;  5KH6 A;  1Y96 B;  3AT1 B;  1VIF A;  3VS7 A;  3BDU A;  3L42 A;  1K0X A;  3V7S A;  3X24 B;  8AT1 B;  1QKX A;  2K5F A;  2DTO A;  3QG1 A;  1MV3 A;  4C92 G;  2VVK A;  3GP8 A;  4RTU A;  1UGP B;  3M9Q A;  1RI9 A;  5GJV B;  3OSV A;  2R58 A;  4C0D B;  2DF6 A;  2KBT A;  3JRZ A;  1Y57 A;  3WVE B;  1EFN A;  2DX1 A;  3HP9 A;  1FXX A;  1H92 A;  1GBQ A;  2C0I A;  1ZUY A;  4J83 A;  4LXC A;  2DRK A;  1W4S A;  2DA9 A;  3OYG A;  4M77 A;  3NTK A;  2XDB A;  4K11 A;  4WCI A;  1NEB A;  2J05 A;  1OX9 A;  3M0U A;  2P4T A;  3G6E A;  1UEC A;  2HD0 A;  5EG2 A;  4ZN1 A;  2MMP A;  5I11 A;  4FYV B;  2FPE A;  1W70 A;  5C0M A;  3JB9 G;  2M0O A;  4A63 B;  2F5K A;  1SSH A;  5KCH A;  4FCY A;  2OAU A;  5IXF A;  1BI1 A;  4PJL A;  1VQP T;  3J80 E;  2O31 A;  2XG8 D;  3C12 A;  3RR6 A;  2EQJ A;  1ZA2 B;  2RK1 A;  2COY A;  1VQ6 Q;  2CGH A;  3LWI A;  4C0D C;  4IUU A;  2HQX A;  4PK4 A;  4A53 A;  3PE0 A;  1C0M A;  1QCF A;  2G3R A;  3CME A;  4DOW A;  1VQ4 Q;  3V8K A;  2XD0 A;  3S3N A;  2JM9 A;  4HCC A;  3TSZ A;  2EVR A;  4BI8 B;  2MAM A;  3VRY A;  2O9V A;  2P4R A;  2CP0 A;  3QWX X;  4E47 A;  2DK3 A;  2K4Y A;  1HSQ A;  1ABO A;  1B3Q A;  1MMA A;  1WXT A;  3L2R A;  4BI3 A;  2E10 A;  2DIL A;  2JXB A;  2CUB A;  1FMV A;  4J6W A;  1VQ7 T;  2RI5 A;  4A4F A;  4GLK A;  2VV5 A;  3FJ5 A;  2E4H A;  1AWO A;  1N9S A;  2MWP A;  5L23 A;  3CCU A;  1M2V B;  1N8R R;  4LD9 K;  4OB1 B;  4E7L A;  3WXM B;  4M75 B;  2IG0 A;  3UDC A;  1YJN Q;  5LL6 S;  5LJ5 f;  4M7D B;  2K9G A;  3RES A;  1G2B A;  3MEU A;  1VQ6 T;  2EQM A;  1VQ5 T;  4BE2 A;  1SF9 A;  1M4Z A;  2K5I A;  3G6E Q;  1Z9Z A;  4E7H A;  1VQ4 T;  4F7U F;  2RI2 A;  4J9G A;  4C0Z A;  3O5Z A;  4N4G A;  3J81 E;  4J8O A;  2DL5 A;  4MDX A;  2J6O A;  1YN8 A;  1W1F A;  4F17 A;  2A28 A;  3CC7 A;  2KYM A;  3UA7 A;  5IXB A;  3OYK A;  1W2B S;  1IGU A;  5LJ5 e;  4C92 C;  2BZY A;  3OYJ A;  2RN8 A;  2RQV A;  4LN2 A;  4RTT A;  1AWX A;  4XU2 A;  3S6W A;  3OYF A;  1QCO A;  3CME Q;  4MZP A;  3M58 A;  1X27 A;  3PMI A;  1H3Z A;  2YLB A;  4XU1 A;  3REB B;  3BDL A;  1KC8 R;  4DOV A;  5KYY B;  2PVD B;  1TTH B;  2F5T X;  1QVG P;  2NWM A;  2RQU A;  1IB8 A;  2VWF A;  3F70 A;  1YJN T;  3RER A;  2EPD A;  2LQN A;  2VKN A;  4FIB A;  5CKH A;  3PVL A;  5FU7 C;  2GNC A;  1UUE A;  2FPD A;  4Z89 A;  3CC4 A;  1ZSZ C;  4DBH A;  3M5A A;  3NTI A;  1BI0 A;  1ZBJ A;  2M1H A;  2CZ0 B;  2OTJ A;  2AZS A;  2KXD A;  4C5G A;  1M90 R;  5CKB A;  1C1A A;  4JRK A;  4M77 D;  2WSC E;  4ELZ C;  1M3B A;  3CCU Q;  1X6G A;  4ANJ A;  4M77 F;  2I2L A;  2LRQ A;  5GAN 2;  3REA B;  5GAM g;  5GAM j;  1IRX A;  4LNP A;  3MJX A;  1Q86 U;  2O4X B;  2HL3 A;  1AHJ B;  2XIC A;  1TG0 A;  1JO8 A;  2ZPE B;  2MI6 A;  2EGC A;  2EKH A;  3PVQ A;  4IKF A;  2BZ8 A;  4PJO E;  4QW2 A;  4F7U G;  1QMC A;  2MIO A;  3M55 A;  5KCO A;  4MZM A;  1F1B B;  2CP3 A;  4PLI A;  3GPL A;  1UHF A;  4HCK A;  4X1V A;  3RMQ A;  3OYD A;  4HVV A;  1QQJ A;  4Z02 A;  3TQ7 P;  4AFU C;  3TVT A;  3QII A;  2A08 A;  3G4S Q;  1OEB A;  1N8R U;  2YUQ A;  1N27 A;  1WHH A;  4M75 A;  4BB7 A;  2RD1 A;  2DZ9 A;  1SG5 A;  2JW4 A;  1VQM A;  3CCU T;  1S1N A;  3OQ5 A;  3C95 A;  1TUC A;  1ARK A;  4C8Q A;  1BCO A;  2E65 A;  2A7Y A;  5FWB A;  3ZBD A;  2DEQ A;  4RMO A;  2CRE A;  4HCB A;  2X4J A;  2JN0 A;  3EFO B;  1TOV A;  4CRI A;  4CI0 C;  1K8A U;  2L5Q A;  2FRY A;  3NGP A;  4BY6 B;  3OMC A;  3JAM E;  4AFS C;  1WIE A;  2LP5 A;  2QXF A;  4KGX B;  4JUV A;  5IHN A;  4O5V A;  2LNH B;  2L2P A;  2MF2 A;  2DIQ A;  4LDV A;  3VS0 A;  3OYM A;  1X43 A;  2RF0 A;  2YUN A;  3A8H B;  2OTJ Q;  3FEO A;  5KYX A;  4RTZ A;  1D0Z A;  1SHF A;  3CCE A;  3A5Z B;  5HCK A;  4PJN A;  1YWP A;  2HNI A;  3EH1 A;  2EAY A;  1UG1 A;  3HRU A;  5GAO n;  3CCS T;  1YNZ A;  4A4K A;  1PHT A;  2JTF A;  3G4S T;  4M7A E;  3N5B B;  4LDU A;  5DLQ E;  2ZGW A;  2RQT A;  1QVF S;  3BY7 A;  3V8J A;  2K5L A;  4OMN A;  4N4H A;  2C0O A;  3C94 A;  1IO6 A;  2MPX C;  2DXU A;  3VS2 A;  4E7S A;  1Q86 C;  3QO3 A;  3RDV A;  1WDX A;  2ZZD A;  5GJW B;  2DFU A;  3FB9 A;  2E70 A;  3M53 A;  2EGA A;  2RO0 A;  2RQW A;  4BY6 C;  4B6M A;  3KXT A;  1OQK A;  3P8D A;  5GAO r;  3PNW C;  2EYW A;  1WHM A;  1JEG A;  4PFZ A;  3HHT B;  3T9N A;  2NUP B;  1KHI A;  5A0L A;  4OGE A;  4RG2 A;  2FG0 A;  2QQ9 A;  1TH7 A;  3CCQ T;  4FYY B;  2EKO A;  2KXC A;  5FW9 A;  2DE0 X;  1N8R C;  2OAW A;  1OV3 A;  4E7K A;  2DMO A;  3CCJ A;  5AT1 B;  1G3S A;  2EGE A;  1SRL A;  2GF7 A;  3V7R A;  1U5S A;  3DB4 A;  3M0S A;  2RA2 A;  2H3E B;  2K3Y A;  2XHC A;  2CT4 A;  1PNJ A;  3RKW A;  2MOX A;  1NJI U;  4PJO B;  1BKB A;  1PRM C;  2VGM A;  3RUX A;  3QDR B;  2QA4 A;  1Q81 U;  2X35 A;  3TRE A;  2L89 A;  2H3J A;  5CQX A;  2LJ3 A;  3CXC S;  1WJQ A;  4KUI A;  3OW2 P;  2SEM A;  2LX7 A;  1VOM A;  1R0C B;  4J9C A;  1QCN A;  2DTH A;  2X9H A;  3VS1 A;  2XMF A;  3LX7 A;  5CO7 A;  4LDW A;  1IHV A;  4A4G A;  1BCM A;  3NHN A;  2D0Q B;  3M4Y A;  2HKN A;  4L5G A;  4R55 A;  4J9I A;  4GLM A;  1EIF A;  3LWH A;  3LLR A;  5ECA A;  1NLO C;  2LTO A;  2VB6 A;  2EQI A;  1W2B P;  1W6X A;  4AMC A;  3SD4 A;  3JCM g;  5GMK l;  1PC0 A;  2AKK A;  2KRS A;  4M78 E;  3EFO A;  1TWB A;  4UC4 A;  5IHK A;  3VS3 A;  2QI2 A;  3HRS A;  4WTO B;  1QVG A;  1G3W A;  1AWW A;  1JQQ A;  4M75 D;  1K1Z A;  2LZ6 B;  1KSW A;  4PJO C;  2MWO A;  2YRD A;  4M75 F;  1N6A A;  2MCN A;  3A8O B;  2QDY B;  2AK5 A;  4C8Q D;  4M7D D;  4F04 B;  3HKS A;  2KAF A;  4C8Q F;  1OYX A;  4VUB A;  3OSS C;  4M7D F;  5LJ5 d;  4GY5 A;  3OYA A;  1BK2 A;  2DL8 A;  2A37 A;  5KYN A;  2XDD A;  5GMK j;  3E9G A;  2JM8 A;  3RKY A;  4RTV A;  3OYC A;  3HL8 A;  3CCJ Q;  3JSC A;  1NM7 A;  3I55 T;  3OA6 A;  4HKE A;  3DLM A;  2E5K A;  1E7O A;  1WHG A;  4M7A B;  1VQN A;  2FZK B;  1X69 A;  5GAN g;  3GOX A;  2RB6 A;  1WXU A;  2VAS A;  4YTL A;  2VC8 A;  2VGN A;  5GAO q;  3A8L B;  5LJ3 e; 
#chains in the Genus database with same CATH homology
 2A36 A;  3UF4 A;  2YUO A;  5L23 A;  2CSI A;  3ULR B;  1XOV A;  4CC2 A;  1SHG A;  2RMO A;  2DYB A;  4OMP A;  1OOT A;  2KRM A;  1E6H A;  2ESW A;  4F16 A;  1M3A A;  2K9G A;  1WFW A;  2L3S A;  1G2B A;  3I35 A;  3ZL7 C;  2DVJ A;  4F14 A;  2KT1 A;  2JMC A;  2F2X A;  1M27 C;  1Z9Z A;  3I5R A;  2GQI A;  4LUD A;  1BU1 A;  4J9G A;  1NYF A;  1WYX A;  1U3O A;  1RLQ C;  3O5Z A;  2B86 A;  2DL5 A;  3I9Q A;  1ZLM A;  2J6O A;  4JPB W;  3LH5 A;  1YN8 A;  2DLP A;  2CT3 A;  2CUD A;  2D0N A;  1W1F A;  4F17 A;  2A28 A;  1ABQ A;  1CKB A;  2KYM A;  3UA7 A;  5IXB A;  4HVU A;  4J9B A;  1ZUU A;  3UAT A;  2D8H A;  4AG1 C;  2BZY A;  3EG1 A;  1JXM A;  2RN8 A;  2DRM A;  4R0K A;  2RQV A;  4LN2 A;  4RTT A;  1AWX A;  2M51 A;  2L3P A;  2J6F A;  1AVZ C;  4J9E A;  4AG2 C;  4DEY A;  1X27 A;  4LUE A;  3REB B;  2K79 A;  3SEM A;  2J06 A;  2NWM A;  2RQU A;  2VWF A;  2ABL A;  1AWJ A;  2EPD A;  2DL7 A;  2LQN A;  1AEY A;  2VKN A;  2V1Q A;  2BTT A;  2ENM A;  4Z88 A;  3PVL A;  2GNC A;  1AOJ A;  1GCQ A;  1UUE A;  2FPD A;  4Z89 A;  4J9H A;  1M3C A;  3TSW A;  1UJ0 A;  1JU5 C;  2K3B A;  1T0H A;  1VYV A;  2EW3 A;  1ZBJ A;  2F2W A;  1SPK A;  3IQL A;  2PZ1 A;  3H0F A;  2X3X D;  4Y92 A;  4OML A;  2AZS A;  2KXD A;  1GFD A;  2LCS A;  2GGR A;  2DNU A;  2V1R A;  2OI3 A;  1AZG B;  2O2O A;  4RTX A;  1M3B A;  1UTI A;  1X6G A;  2KNB B;  4M4Z A;  3JV3 A;  2DJQ A;  4ESR A;  2KGT A;  3RBB B;  1B07 A;  3CQT A;  3REA B;  2KRO A;  1QWE A;  2LJ0 A;  3EG0 A;  4LNP A;  3M0Q A;  2D1X A;  4GBQ A;  2GTJ A;  3M0P A;  2GTO A;  1TG0 A;  1JO8 A;  2W0Z A;  1X6B A;  4RUG A;  5IH2 A;  2YUP A;  2EGC A;  2EKH A;  3PVQ A;  3VS6 A;  2BZ8 A;  2W10 A;  4J9F A;  1ZUK A;  2YSQ A;  1OPL A;  2CDT A;  2FRW A;  1GCQ C;  2MIO A;  1N5Z A;  2K7A A;  1CKA A;  1RLP C;  1UE9 A;  4Z8A A;  2KEA A;  2KE9 A;  2H8H A;  1JXO A;  1SRM A;  1FMK A;  3EHQ A;  2KT8 A;  3EHR A;  3M0T A;  2EYX A;  1UHF A;  2D8J A;  1U06 A;  4HCK A;  4X1V A;  1YCS B;  4HVV A;  4AFU C;  3TVT A;  2A08 A;  5I22 A;  1OEB A;  1G83 A;  3GBQ A;  2PNI A;  2YUQ A;  1PKT A;  1AZE A;  1RUW A;  2EBP A;  4CC4 B;  4D8K A;  2JW4 A;  1KFZ A;  2JS2 A;  1S1N A;  1ARK A;  1TUC A;  4E6R A;  3NMZ C;  2ECZ A;  1WI7 A;  5FWB A;  1I1J A;  3I5S A;  2BZX A;  3EG2 A;  1UDL A;  2CRE A;  1GCP A;  3R6N A;  4ORZ A;  3VRZ A;  1GRI A;  1M30 A;  3NGP A;  2FRY A;  1K4U S;  1PKS A;  4AFS C;  1K76 A;  2X3W D;  2C0T A;  4RTY A;  1WIE A;  2JMA A;  2LP5 A;  2EYZ A;  3C0C A;  5IHN A;  2EYY A;  3NPF A;  2LNH B;  2L2P A;  1NLP C;  3VS0 A;  1K9A A;  1X43 A;  2RF0 A;  2HDA A;  1I0C A;  1WLP B;  2YT6 A;  2YUN A;  1K0S A;  2KRN A;  1UFF A;  4RTZ A;  1SHF A;  4AFQ C;  1YWO A;  4JZ3 A;  5HCK A;  1NG2 A;  4JJD A;  1GL5 A;  1YWP A;  2NUZ A;  1UG1 A;  2O9S A;  2FO0 A;  1TUD A;  1NYG A;  1YNZ A;  1X2Q A;  1PHT A;  2J6K A;  3THK A;  1HJD A;  2DBM A;  2HCK A;  2SRC A;  2KR3 A;  4KRT A;  1QWF A;  1LCK A;  3A98 A;  1X2K A;  2RQT A;  5EC7 A;  1SEM A;  3QWY A;  2RNA A;  4OMN A;  4D8D A;  3M0R A;  2C0O A;  1IO6 A;  3VS2 A;  4QT7 A;  2FEI A;  1WDX A;  1Z9Q A;  5GJW B;  3VS4 A;  5FWC A;  2K6D A;  1VYU A;  4JZ4 A;  1PRL C;  3SHW A;  2EGA A;  2RQW A;  4CC3 A;  2DBK A;  1T3L A;  1WA7 A;  1WXB A;  3H0I A;  1T0J A;  2QDL A;  2JS0 A;  2EYW A;  2CSQ A;  4DEX A;  3H41 A;  1KIK A;  2J7I A;  1T3S A;  5IHI A;  4AFZ C;  4HVW A;  1JEG A;  1YP5 A;  1CSK A;  1GBR A;  3KFV A;  1ZX6 A;  2RQR A;  1H8K A;  2LQW A;  2FG0 A;  1M8M A;  1WX6 A;  2KXC A;  3RNJ A;  5FW9 A;  2DE0 X;  2OAW A;  1H3H A;  1OV3 A;  2HEQ A;  1AD5 A;  2DMO A;  2EGE A;  1SRL A;  2HBW A;  3VS7 A;  2L0A A;  1U5S A;  3M0S A;  1K0X A;  3EG3 A;  1QKX A;  2CT4 A;  1PNJ A;  2MOX A;  1MV3 A;  3EGU A;  2VVK A;  4RTW A;  1PRM C;  2G6F X;  4RTU A;  1KJW A;  1UGV A;  1FYN A;  3H0H A;  1RI9 A;  5GJV B;  2L3Q A;  2DF6 A;  1GFC A;  2KBT A;  2DM1 A;  2LJ3 A;  1Y57 A;  2YDL A;  3UA6 A;  1EFN A;  1UHC A;  2DX1 A;  4IIO A;  2SEM A;  2LX7 A;  1A0N B;  4J9C A;  1H92 A;  1GBQ A;  4HXJ A;  2C0I A;  2XMF A;  3U23 A;  1QLY A;  3VS1 A;  2JTE A;  1ZUY A;  2HSP A;  2DRK A;  2DA9 A;  3VS5 A;  2CH4 A;  3NHN A;  4K11 A;  2CH4 W;  1NEB A;  4WCI A;  1OPK A;  2J05 A;  1NEG A;  4J9I A;  3M0U A;  4GLM A;  1UEC A;  5ECA A;  1NLO C;  1PWT A;  1MUZ A;  2EQI A;  5I11 A;  1W6X A;  2FPE A;  1HD3 A;  1W70 A;  2RPN A;  1E6G A;  4CC7 A;  1J3T A;  4A63 B;  1SSH A;  4J9D A;  2AKK A;  1BB9 A;  2KRS A;  5IXF A;  1VA7 A;  4EIK A;  2ED1 A;  5IHK A;  3VS3 A;  2F2V A;  2I0N A;  2O31 A;  1AWW A;  1BBZ A;  1JQQ A;  4JJB A;  1K1Z A;  2LZ6 B;  1KSW A;  1Y0M A;  4OMO A;  1VYT A;  1V1C A;  4OMM A;  2ROL A;  1MV0 B;  2IIM A;  2MCN A;  2DL4 A;  2AK5 A;  2O88 A;  2DL3 A;  2GBQ A;  3PE0 A;  1QCF A;  2M0Y A;  4FSS A;  2AZV A;  2ED0 A;  1BK2 A;  2DL8 A;  2A37 A;  4LE9 A;  2JM9 A;  2JM8 A;  4IIM A;  3TSZ A;  4RTV A;  2KYB A;  2EVR A;  2FPF A;  3VRY A;  2O9V A;  4OMQ A;  1NM7 A;  2K2M A;  2P4R A;  3QWX X;  2LJ1 A;  1UJY A;  1HSQ A;  1ABO A;  1B3Q A;  2PTK A;  2E5K A;  1E7O A;  1WXT A;  2LMJ A;  2JT4 A;  2ROT A;  1X69 A;  2OJ2 A;  2DIL A;  2JXB A;  2CUB A;  1QKW A;  4JJC A;  1WXU A;  3FJ5 A;  2AKL A;  1I07 A;  1AWO A;  1ZSG A;  4ZNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...