2AK5A

Beta pix-sh3 complexed with a cbl-b peptide
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
60
structure length
60
Chain Sequence
NSQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTHNGRTGWFPSNYVREIKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis/exocytosis
molecule keywords Rho guanine nucleotide exchange factor 7
publication title Cbl promotes clustering of endocytic adaptor proteins.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 11
structure length 60
sequence length 60
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ak5A00
4Z89A 2KYBA 4AFZC 1OEBA 2M0YA 1OPLA 2O9VA 5L23A 1SHFA 1YWPA 2DM1A 2KE9A 1UG1A 3M0PA 1KJWA 4GBQA 2KRNA 1NYFA 1PKTA 1UDLA 1QCFA 2BTTA 4CC7A 2JS0A 5GJVB 1PRMC 3NGPA 2DVJA 2YUPA 1T3LA 2ROLA 1W6XA 4RTVA 3JV3A 4JJDA 1QKWA 4F16A 3UA7A 4OMOA 5I22A 2YSQA 1K4US 4AG2C 2JT4A 1QWFA 2I0NA 3VS1A 1GBRA 4J9FA 2AZVA 2CUBA 1IO6A 2FO0A 2AZSA 2K9GA 1QKXA 1NEGA 1M3BA 1YWOA 2BZXA 2LMJA 2OI3A 2E5KA 1JEGA 1RLPC 1Z9ZA 1M30A 5IHNA 2X3XD 2J6KA 3UA6A 2ENMA 1YP5A 4Y92A 3REBB 4ZNXA 2AK5A 2QDLA 2EYWA 2GNCA 2DE0X 2GBQA 2DL7A 5IXFA 2DILA 2JS2A 1WFWA 1PWTA 3VS6A 2L3QA 1GCQA 1GL5A 1GRIA 1N5ZA 1KSWA 2O9SA 4J9IA 3H0HA 4A63B 2F2VA 2ABLA 1RLQC 1G83A 2JMCA 1UGVA 4RTWA 2RQVA 4RTUA 1M8MA 1NEBA 4ORZA 1LCKA 2EGAA 1W70A 2DJQA 2O2OA 1M3AA 2RN8A 2OAWA 1WXUA 2RNAA 1RUWA 1SHGA 1ZUYA 1JU5C 4IIOA 4E6RA 1TUCA 1YNZA 2LP5A 2M51A 3I35A 1GFDA 2DRMA 1I1JA 1ABOA 3I5SA 3VS0A 2L3PA 2LJ0A 3H41A 2LJ3A 4D8DA 1AZEA 3CQTA 2JMAA 2KXDA 1OOTA 3EG3A 4IIMA 4LUEA 1AWXA 1X27A 1MV0B 3H0FA 2W0ZA 3THKA 1E6GA 1M27C 1MV3A 2KXCA 4JJBA 1PRLC 2YUOA 3I9QA 1Y0MA 1OV3A 1WA7A 1ZLMA 3NMZC 4J9CA 2ESWA 3ZL7C 2FG0A 3EHQA 3QWYA 2KRMA 4JJCA 1HJDA 2JXBA 4OMPA 4OMQA 2G6FX 4QT7A 1BB9A 2ECZA 2O88A 4FSSA 1X43A 3IQLA 1T0HA 2YT6A 2K79A 2X3WD 4F14A 1VYTA 2CSIA 2EBPA 3ULRB 2RQTA 1ZSGA 3PE0A 5FWBA 3TVTA 2BZYA 1UHCA 1CSKA 1V1CA 1H92A 2DX1A 2KGTA 1G2BA 4LN2A 1AEYA 4HCKA 2C0OA 2FPFA 1AWOA 3NPFA 2JW4A 1AOJA 4CC3A 3M0SA 4M4ZA 4F17A 1NG2A 1QLYA 2KROA 2LQWA 4AFUC 4HXJA 5IH2A 2HSPA 1ZUKA 1JQQA 3H0IA 1WI7A 1NYGA 1TUDA 1VYUA 3M0QA 1I0CA 4JPBW 4AG1C 1VA7A 2DA9A 3KFVA 4J9DA 4DEYA 1BK2A 3EG0A 1KFZA 2CH4A 2OJ2A 4EIKA 2GGRA 1K76A 2AKLA 2B86A 3GBQA 1B3QA 1WIEA 2KYMA 4J9EA 2LZ6B 2RPNA 2LQNA 2VVKA 4X1VA 2FEIA 3VS3A 1GBQA 2KEAA 2CSQA 3SEMA 1B07A 3RNJA 4AFSC 1X2QA 5I11A 1ARKA 2DL4A 1HSQA 2DBMA 3QWXX 5FWCA 1FMKA 2CT3A 1JXOA 2CREA 1QWEA 2CUDA 1UJYA 2EW3A 2V1QA 2EGEA 2ED0A 3EG1A 2F2WA 2PNIA 1X2KA 2P4RA 4ESRA 2RQRA 2MCNA 2D1XA 2L3SA 3VS5A 2SEMA 1UHFA 4RUGA 4D8KA 3M0TA 1UUEA 2AKKA 2L2PA 3VS4A 3REAB 2A37A 1H8KA 4LE9A 1K0XA 3TSWA 2EKHA 2JM8A 2KRSA 1H3HA 5FW9A 2CDTA 2IIMA 1NLOC 1YN8A 2MIOA 3PVQA 1J3TA 3EG2A 1S1NA 1X69A 3PVLA 1SEMA 1U06A 1Z9QA 5ECAA 2NUZA 2A08A 4AFQC 2FRYA 2EYZA 3M0UA 2L0AA 2YUNA 3RBBB 1NLPC 2RMOA 1NM7A 2EVRA 4CC4B 2RQWA 2YUQA 2PTKA 3UF4A 4J9HA 1WXTA 1GCQC 4HVWA 1SPKA 2ED1A 2K7AA 1YCSB 1JXMA 1UECA 2DL5A 2VWFA 1XOVA 2DF6A 1Y57A 2LJ1A 2LX7A 1AWWA 1PNJA 2EPDA 4KRTA 4LUDA 2DMOA 2MOXA 2RQUA 1SRLA 1GCPA 2W10A 2D8HA 3VRYA 1AWJA 1SRMA 4J9GA 1PKSA 2A28A 1U5SA 4RTXA 2EQIA 2FRWA 1UE9A 2J6OA 2O31A 2D8JA 2ROTA 4JZ3A 2HEQA 2KR3A 1M3CA 1FYNA 2KT1A 1AD5A 2BZ8A 2SRCA 3I5RA 2F2XA 4JZ4A 1RI9A 4CC2A 4GLMA 2J06A 1CKAA 1UFFA 1WDXA 2YDLA 5GJWB 4OMNA 1X6BA 2J7IA 2EGCA 2DRKA 2H8HA 2LCSA 3VRZA 1A0NB 3U23A 2C0IA 3A98A 1UJ0A 1ZBJA 1WLPB 2K6DA 1UTIA 4OMMA 1EFNA 1W1FA 1SSHA 1T3SA 1ZUUA 5IHKA 1K1ZA 1E7OA 3TSZA 5EC7A 4OMLA 3VS7A 1BBZA 4K11A 1WX6A 4WCIA 2K3BA 2K2MA 1AZGB 4RTZA 1E6HA 1WXBA 3VS2A 2JM9A 4J9BA 2DBKA 2FPDA 4R0KA 2PZ1A 1HD3A 5IHIA 1CKBA 2KBTA 2KT8A 1ABQA 2C0TA 2GTOA 4RTYA 2KNBB 3UATA 2DYBA 2HDAA 2GQIA 1PHTA 3SHWA 5HCKA 2RF0A 3M0RA 2HCKA 1KIKA 2JTEA 2DL3A 2FPEA 4HVUA 1VYVA 1T0JA 2NWMA 1MUZA 2A36A 1ZX6A 3EGUA 1TG0A 1AVZC 2HBWA 2LNHB 1JO8A 4Z8AA 5IXBA 4HVVA 3FJ5A 1GFCA 2CH4W 2DNUA 1WYXA 2VKNA 2XMFA 2EYXA 1OPKA 1I07A 4LNPA 2V1RA 4Z88A 2J6FA 2J05A 3O5ZA 4RTTA 1K0SA 1U3OA 2EYYA 2DLPA 3NHNA 4DEXA 3EHRA 1BU1A 2GTJA 2DL8A 2CT4A 1X6GA 3LH5A 3R6NA 2D0NA 3C0CA 1K9AA
chains in the Genus database with same CATH superfamily
4Z89A 2XI9A 1OEBA 3CCQQ 3ZEHA 1WHJA 1ZA1B 1YI2A 3M0PA 1KJWA 4IUQA 2KRNA 4RCCA 3MO8A 2BIVA 1YJNT 3BDLA 1QW1A 3MEWA 4BE2A 2E4HA 2R57A 4FT2A 1PRMC 2YUPA 5GANh 1D1BA 1TUGB 1W6XA 2EQJA 3JV3A 1M1KC 2MAMA 4KH1B 4C0GA 3OS5A 2LT1A 2COZA 3I56T 1YJWT 4LD6A 1U1SA 2YSQA 4FSXA 4BI4A 3MEUA 4AG2C 1K8AU 1K4US 2JT4A 2COYA 2QA4T 2ZAEA 4M7DD 2C06A 3OYHA 1M3BA 1RAGB 2LMJA 3OYDA 2E5KA 1JEGA 1Z9ZA 1M30A 4IKFA 3UA6A 1HXDA 2ENMA 1RACB 1YP5A 2K5LA 2GBQA 2RJFA 3CCUT 1B7TA 3L1AA 1PWTA 4L5GA 3VS6A 1Q82C 5GMKh 1VQ4Q 3CCLQ 2EKOA 4E7IA 2O9SA 1VQ6A 1W4SA 1MMAA 3H0HA 4A63B 4N4IA 3JB9F 3GLXA 3OYBA 4QQ6A 2FYKA 3CC4A 3G6EA 1G8XA 3OW2S 3CXCP 2DJQA 3CD6T 4M7AC 1M3AA 4KGXB 1SHGA 3RMSA 3OQ5A 1SG5A 1TUCA 2OTLA 1VQNT 2V26A 3OYMA 1I1JA 3SDZA 1QVFP 1IHWA 3PNWC 2L3PA 1I5OB 3TCJA 3H41A 4D8DA 4J5YA 3HHTB 1OOTA 4KUDK 2W0ZA 1M27C 1VQOA 3I9QA 4XTXA 1BKBA 3NTHA 2BUDA 2QGGA 5CK9A 1ZLMA 4J9CA 3ZL7C 2YWWA 4JJCA 3TREA 4OMPA 4OMQA 1C6VX 4JRQA 1BB9A 4O6JA 4FSSA 3L2RA 1Q82U 1T0HA 3CCST 4J6YA 4PK4A 1NBEB 4XU3A 1YJNQ 2DK3A 5GAMe 4XU1A 4M78B 1BI3A 3ULRB 3PE0A 4ZTJA 5FU7B 2A0FB 2NYSA 1O9SA 3RERA 1I81A 1V1CA 2DX1A 3JCMe 2KGTA 1KHIA 2LDMA 4E47A 4PJJA 3CBPA 2C0OA 2FPFA 3ER0A 3CXCA 1AWOA 4L59A 2EFIA 1M1FA 5A0DA 1AOJA 4C5IA 2QA4Q 3T9NA 1HK9A 4AFUC 2VXFA 5IH2A 1KD1U 3MCAB 4M7AE 4FM4B 1JQQA 3UPUA 1QVFA 1NYGA 1BI0A 5KYNA 3M0QA 2DJZA 5LJ5g 1BK2A 3C95A 4AMCA 1QVGP 4ZN3A 1VQ6T 3CCUQ 1KFZA 2OJ2A 2GGRA 1K9MC 1FWZA 5CR2A 4IURA 1WIEA 2XIDA 5CVIA 2RI3A 4A4EA 2RPNA 1QCNA 3CC4T 2QQAA 2LQNA 8AT1B 2CP2A 2OX7A 3MP8A 1MMGA 3SEMA 1B07A 3ZBDA 2OTLT 3CD6Q 3AHUA 4M78A 4AFSC 5LJ3h 2DL4A 4PJOC 1OX8A 5FWCA 2A3LA 1KQ2A 1K73C 2Z0WA 1VQNQ 3A8HB 3G4ST 1UJYA 2EW3A 4BD3A 2EGEA 1OQKA 2QGFB 4JJNK 2F2WA 1X2KA 4MDXA 2RQRA 4OB3B 3KXTA 2QG9B 2L3SA 2O4XB 3PT9A 4D8KA 3M0TA 4QW2A 2RI2A 2A37A 1TS9A 3FRNA 4M7AB 4M77B 5KYWB 2EKHA 2JM8A 1H3HA 5FW9A 1YN8A 2MIOA 2P0PA 3PVQA 5A0LA 1QVGA 2QXFA 4N0AC 5KE2A 3E9GA 2RD1A 4BACA 2HZYA 2AT1B 4FYVB 4C92G 2NUZA 4AFQC 5GAN7 3OYLA 3M58A 2Y90A 2EYZA 2YXYA 4MZPA 2P0QA 3JCMc 4DBHA 3V8JA 4OP0A 3E9FA 4J9HA 4HT8A 1GCQC 3CMAA 2ED1A 2FHDA 1Q7YC 1OYXA 2E1HA 4PFPA 1U1TA 3HRUA 2DERA 2DL5A 2HBPA 2WSCE 1M4ZA 1LVKA 1VQ5T 4ATOA 2NUPB 4LUDA 2B8AA 1PSFA 3FLGA 4HCZA 1GCPA 1M90C 2W10A 2D8HA 1BYMA 3CCEA 3RESA 2CP6A 4R55A 4XTZA 1VQ6Q 3GPLA 2O4XA 4FW2A 1ACMB 4C8QF 1KQ1A 4A4FA 2HQXA 5GANf 2EQIA 2HNIA 5CAIA 2DEQA 4M7AA 3FEOA 4M77A 2KR3A 3CC4Q 3DB3A 3G6EQ 5KYWA 1BCOA 1FYNA 3OW2P 1YIJA 3EFRA 4JZ4A 1TWBA 3A1PA 3LW5E 2OTLQ 2GQVA 2YDLA 2J7IA 5IN1A 4C92D 4PJNA 1Q86C 3U23A 3G4SQ 2GF7A 3O8VA 2VC8A 1W1FA 1SSHA 4JRKA 5IHKA 3G71A 1D3BB 3TSZA 4PL6A 3VS7A 1M90U 2V8KA 3VU3C 1R0BG 1P92A 1C0MA 2K3BA 3QYGB 2NUPA 3BW1A 4E7KA 1RADB 3VS2A 5IT9E 4PJOB 4J9BA 2FPDA 2HKQB 5GAOq 2GFAA 4R0KA 3M54A 2LCLA 3VJPA 2MK5A 4M75C 4LXCA 5GANd 2KT8A 1ABQA 2GTOA 4RTYA 2KNBB 3UATA 2GQIA 3SHWA 3OW2A 3M0RA 3CEYA 2JTMA 1NE8A 2HCKA 2FPEA 1OULA 3EAEA 4HVUA 1VYVA 3CCMA 4BE0A 5J26A 1O75A 2PUKB 1MUZA 4EMKC 2A36A 3EGUA 2HBWA 1AVZC 2LNHB 4HVVA 3FJ5A 1GFCA 2CH4W 2DNUA 2VKNA 2QDYB 2EJFA 2E6NA 3CCVT 3CBMA 1VQ5Q 2HL5C 4Z88A 3G7ZA 2J6FA 5HKCA 5LJ5h 1U3OA 3GF5A 3OA6A 3F70A 4BI3A 5GMKl 1D3BA 1R0CB 3J7AF 2EYQA 2XK0A 4OF1A 1BCMA 2DL8A 1YIJT 2CT4A 1X6GA 4QVZA 1WQWA 3ZFJA 2MMPA 2KYBA 4AFZC 2M0YA 1VQ9A 1OPLA 2O9VA 4PJOA 2COWA 4BE1A 2A7YA 1QP3A 3SD4A 1S72T 4NL2A 2MI6A 3QUIA 1PKTA 1VIEA 2WSEE 1FX7A 4CC7A 2JS0A 3DLMA 4J83A 2DVJA 2RK1A 1T3LA 3JB9G 4XU0A 2DIGA 4PFOA 1QKWA 3G71T 4M75E 4F16A 3V7SA 1WGSA 1G3SA 2H3EB 2X4JA 4BUGA 4B9XA 2DKGA 4FT4A 1WHHA 4Y28E 3HSBA 1NZ9A 5CIUA 1N9RA 4J9FA 3RKWA 2EQMA 3OBYA 1QKXA 4JS4A 4N0AA 3A8LB 2OI3A 3HTRA 4FYWB 5DLQE 3JCMP 3JCMX 2XU8A 4JRIA 4Y92A 3REBB 2YHTA 5C0MA 2DE0X 2DL7A 5LJ3f 3V8LA 2DILA 5IXFA 1D0XA 1MHNA 1MMDA 2WACA 2L3QA 3CBOA 1GCQA 1GL5A 1RAIB 2EIFA 1YFNA 1N5ZA 4IUTA 4B6MA 2K5FA 4J9IA 4B9WA 2F2VA 2ABLA 1MNEA 3FJPA 2K2VA 3LGLA 2O2OA 4C0ZA 2OAWA 4J7IA 4XK8E 3VUZA 4IIOA 3OS0A 3EGDB 1SF9A 1GFDA 3JB9D 1JBMA 3NTKA 1M5Q1 3JAME 1YITA 1AZEA 2JMAA 4EMHA 1K8AC 1MV3A 2XDBA 4JLGA 1VQ9T 2HQEA 3P8DA 4XTUA 1YIJQ 2E10A 1OV3A 5AYFA 4EMKB 2JVVA 2FZGB 4KGZB 2ESWA 1JRIA 4OGEA 1VQPA 4MMKA 4Y91A 4IUUA 1HJDA 2JXBA 3QO3A 3V8KA 5FU7C 4HCBA 2ECZA 2O88A 3V7CA 3M4YA 3LH0A 5LJ3d 2K79A 2CSIA 4BDZA 4QQDA 1VQMT 1ZSGA 2AHJB 2KQWA 2DVEA 4F7UB 1UHCA 2H3JA 2FL7A 3G71Q 2ZPGB 1WHGA 4LN2A 1AEYA 4PJMA 4HCKA 3A8MB 3MEAA 2PUOB 1V76A 1U8RA 1PD1A 4UC4A 2KVQG 1NG2A 1W2BS 3EGDA 4M75A 1H641 1VQ7T 4M7DC 5GAN8 3H0IA 5CKFA 3RKXA 1TUDA 2EQKA 1I0CA 4AG1C 1VA7A 3QIIA 2QQRA 3G1JA 3KFVA 4J9DA 4DEYA 3HL8A 1K76A 2WSFE 3GBQA 1B3QA 4EMKA 5J3BA 2VGNA 3CCMQ 2RA2A 2CKKA 2FEIA 2DIQA 3CMET 2D9TA 3DKMA 2JTFA 3MPUB 4M78E 1D0YA 2CSQA 1RL2A 2X51A 1HSQA 2PVOB 2D6FA 3QJ6A 2CGHA 4F7UA 4ELZC 5GMKm 3M5AA 1QWEA 4ME7A 2RHIA 4M77C 2P4RA 2PQWA 1DJ7B 1UHFA 1VQ9Q 1UUEA 3REAB 5GAOn 2VB6A 1K0XA 1MNDA 3HRSA 3TSWA 1KD1C 2JJ9A 5EG2A 2KRSA 5J39A 3CPWS 2OTJA 2O01E 4C8QG 2KDSA 4FCYA 3X28B 4OB2B 1YI2T 4M7DE 1U06A 2L3RA 5ECAA 2A08A 2L89A 2NLUA 1VUBA 1VQMQ 3HPWA 4M78F 5LJ5f 2KMTA 2KSSA 3FIFA 2RI5A 3RBBB 2RMOA 2EVRA 2M0OA 2RQWA 2YUQA 1PM3A 4DOVA 2E41A 2X9HA 3P8HA 1YCSB 5D7UA 4E7SA 1UECA 2VWFA 1ZSZB 4XTWA 2LJ1A 3CCRA 2HAXA 3AT1B 5KH6A 2EPDA 5GAOp 2DEUA 4DOWA 2DMOA 2X4YA 1VQ7Q 2CS7A 2RQUA 1SRLA 1R8OB 3M57A 4YTLA 3L2VA 1Y7XA 4X9DA 1X75C 2E6ZA 5I21A 2X4WA 3BY7A 3OY9A 4M77E 2J6OA 2O31A 2EJ9A 4Z02A 1FXXA 3H8ZA 4XU2A 2KT1A 1WJSA 4RG8A 3I55A 2RHXA 3CMEQ 2E12A 4HCCA 2K3XA 4GLMA 2QTXA 4M7DB 1CKAA 1UFFA 1IZ6A 4C8QD 2P4TA 5GJWB 4DA4A 3G6ET 1TH7A 4E2FB 1RI0A 3VYHB 5HY6A 2ZGWA 2DRKA 2H8HA 5GAMg 4JUVA 1RAAB 5LJ5d 1QVPA 4C0DC 3E19A 3M59A 4LDXA 1WLPB 4OMMA 3M53A 1ZUUA 2LX9A 3JCMg 1E7OA 1ZSZA 2FZCB 2AIRB 4OB1B 5GAMd 1RAHB 1BBZA 1KQSS 4Q5WA 1VQOT 2K2MA 3EGXB 4ZN1A 4RTZA 4M7AF 4EMGA 2DBKA 1VQLA 2DZCA 2XDPA 3RUXA 2PZ1A 1YI2Q 5IHIA 3C4SA 3LYIA 3VUBA 2YLBA 3QBYA 2DTIA 2MWPA 5HCKA 2BKDN 2NWMA 3PIPA 1OZ2A 1QMCA 3R6OA 4M7DA 1TG0A 4Z8AA 3PTAA 4NL3A 2EYXA 3OYNA 1OPKA 1I07A 2V1RA 2VV5A 3CC7A 3S3OA 1M9SA 3O5ZA 1VQ8A 3EFSA 2EYYA 2LT4A 2IVWA 3NHNA 3EHRA 1BU1A 3LGFA 3NFCA 2GTJA 2D0NA 1LOJA 4E7ZA 3EGXA 5FRMA 1M1KR 4PJOE 3M9QA 2KK4A 1V29B 5L8RE 1Q95G 3QSUA 1YWPA 2DM1A 1JB0E 3QJYA 4E7JA 1NYFA 3PMTA 2MPXC 3OS2A 1QCFA 5GAOl 2CP3A 3X24B 3JB9H 5GJVB 1NJIR 2KAFA 2XG8D 2QQSA 4LDYA 5KE3A 2Y4YA 4BY6C 4C92C 3UA7A 3WVEB 5I22A 2IPOB 4M75G 1QWFA 2I0NA 4ANJA 3EH1A 2CUBA 1IO6A 2FO0A 4FYYB 2K9GA 1VQLT 4MMLA 1VQOQ 2OTJQ 2BZXA 3CCJA 4CI0C 2DD4A 1UGSB 1RLPC 1XTDA 4KGVB 3TU4K 5IHNA 2X3XD 3N5BB 4ZNXA 1X6OA 2AK5A 2QDLA 4C0DB 2EYWA 4PKCC 4KH0B 3PGGA 2GNCA 4CRIA 3MHXA 4NS5A 4PJOF 1RAFB 2ZPFB 3EH2A 3CCQA 1GRIA 2RHYA 1YHQA 1KSWA 3M55A 3QZ9B 2ZPIB 5CQXA 3RIRA 1LNXA 2CZ0B 1G83A 2JMCA 1UGVA 4RTWA 3INZA 4RTUA 1M8MA 4PLLA 1LCKA 3C94A 2EGAA 2E3IA 1W70A 2LNVA 2RN8A 2RH2A 1IHVA 3CMAT 3X20B 1ZUYA 3CC7T 4MZTA 5GANj 4QVDA 3HFOA 1JU5C 3BFMA 6AT1B 4E6RA 5D6WA 2CYZB 4RKUE 2LP5A 3OYFA 2M51A 3I35A 3I5SA 2LJ0A 3ME9A 1OU8A 2LJ3A 2HMAA 3UDCA 3CQTA 4QQGA 3GP8A 1AWXA 2GFUA 1X27A 2VYTA 1ZHIA 1WHKA 3THKA 2KXCA 1PRLC 3CCET 5FRNA 4M75D 1Y0MA 3I55Q 3M56A 1WA7A 5KCHA 3NMZC 2X35A 2E70A 2FG0A 2KRMA 1IGQA 1XJWB 4WF2A 2G6FX 1M2VB 3SWNC 3L2ZA 2LTOA 3RR6A 2YT6A 2E5QA 1VQ4A 3CCLA 2RM4A 1VQKA 5GMKj 3OYYA 1VYTA 2DXTA 5GAMh 3OYGA 2EBPA 3LWIA 2L8DA 4JRPA 4RG2A 1LJOA 3TVTA 2BZYA 2QQBA 1PD0A 2NUTB 1H92A 1PG5B 3JCMh 1K9MR 1KQSP 1ZQ1A 3C12A 2JW4A 4JLIA 2P0KA 3M0SA 1QVFS 1FMVA 4IUPA 5KYXB 1QLYA 2KROA 1VQLQ 4L6V5 3GIBA 2HSPA 3OBWA 1KC8R 1WI7A 4JPBW 1NPRA 2DA9A 4BY6B 4C92B 3EG0A 2CH4A 4EIKA 4EPCA 4C0FA 2I2LA 3OYJA 2AKLA 2B86A 2KYMA 5AT1B 2M1HA 1K73R 4J9EA 1MGQA 3JB9I 1BI2A 2R5AA 1QCOA 4OVAA 1M2VA 3X26B 1EZZB 5CCAA 1GXIE 2GCXA 3RNJA 3CCMT 2HSEB 4F7UE 3CMAQ 5I11A 2YRDA 5FROA 3CC7Q 1ARKA 2KI7A 4M78G 2DBMA 3UWNA 1JXOA 2R5MA 3KBGA 3I56A 2CREA 1YJWA 1BI1A 2NUTA 5DY9A 2CUDA 1G3TA 5HK3A 2V1QA 1HYOA 3EG1A 2M16A 2DO3A 2PNIA 4O5VA 2QI2A 4M75F 4ESRA 2BE9B 2MCNA 2D1XA 2QK0A 3VV0A 1KQSA 4EDUA 1NPPA 2Y4XA 3PFSA 2LCCA 3CCEQ 2R58A 4XAXB 1D1AA 2AKKA 2RO0A 4RMOA 3L2UA 4NOYA 5KYXA 2PVDB 3OMGA 5A2QE 5GAOm 2FB7A 2IIMA 1NLOC 1Q7YR 4R56A 1J3TA 2QEXA 4C92A 3LLRA 1SEMA 1Z9QA 3LX7A 5LL6S 2FRYA 4ELYC 1I5LA 1ZSZC 1M90R 2YUNA 4A4KA 2RHUA 1OI1A 1NLPC 3L42A 1NM7A 3QZ5B 4CC4B 2PTKA 1UGPB 3CD6A 1WXTA 4HVWA 2DTOA 2VUBA 1JXMA 2LVMA 4KBMB 5LJ3j 1Y57A 1RABB 5CKBA 3SWNB 2DETA 2LX7A 2X4XA 2V8JA 3MJXA 1AWWA 4KRTA 4M78D 2RHZA 2YLCA 1VIFA 5CKEA 1EX4A 3EG9B 3SFMA 4XTYA 3QYHB 4RCBA 2RJEA 1YHQQ 1PKSA 4P5NA 1G5VA 1U5SA 2D8JA 3JCMJ 1Q86R 3OSSC 2HQHA 2HEQA 1M3CA 2DPPB 2DXBA 5M9OA 4M7AG 4M77G 1N8RR 1AD5A 3CCSA 8ATCB 3I5RA 2XICA 1RI9A 4CC2A 5FLXE 5KYYB 2J06A 1M1GA 4OMNA 4XQ3A 1X6BA 2EGCA 4FW1A 2LCSA 3A8OB 3VRZA 3FDRA 4X9CA 3A98A 1X01A 1UJ0A 4A4HA 1JJ2S 4PJLA 1WJRA 1UTIA 1NJIC 3OYKA 3Q1JA 1T3SA 1YITT 1K1ZA 4J8OA 4JS5A 5EC7A 3SWNA 1M8VA 4OMLA 1RAEB 4K11A 1WX6A 1AZGB 2QEXT 2F5TX 1E6HA 3EG9A 1VQKQ 2KY9A 1Q81R 1VQPT 3QXEB 5I2SA 1PSEA 4J6XA 1HD3A 4KUIA 1CKBA 2KBTA 4LDVA 3A8GB 2C0TA 1SSFA 2JOYA 2DYBA 2D0QB 2EQUA 1M1KU 3X25B 3QG1A 5FU6B 1KIKA 4M7AD 4M77D 4KULA 3JCMV 1XQHA 5KYYA 3TEEA 2CP5A 1ZX6A 2FZKB 4ZGEB 2XMFA 5C6SA 3G4SA 4LNPA 1NJIU 5LJ5e 2J05A 2ZPEB 1K0SA 3QDRB 2RB6A 2JN0A 2E65A 1BIBA 1PCXA 2DLPA 3HRTA 4DEXA 5GAMf 4E7HA 7AT1B 2QQ9A 3META 4BI8B 4ZGDB 3JCMb 1N9SA 2ZZDA 1FMWA 3BDUA 2MYSA 2YRVA 4GY5A 2XKOC 3JCMf 3QPHA 1TSFA 1PC0A 5L23A 1SHFA 2KE9A 1UG1A 4A4GA 3PIOA 4PJOG 4GBQA 4WTOB 1UDLA 1UB4A 3P8BB 2OAUA 2BTTA 3I56Q 1YJWQ 5KYUB 4M7DF 3NGPA 2MF2A 4C8QC 2ROLA 5GMKi 5GAN4 1LPLA 4RTVA 4JJDA 2CP7A 2EAYA 2LRQA 4OMOA 5A0GA 4C5HA 4LDUA 2ZPHB 1YJ9A 3OYCA 1YITQ 3V7RA 1VQ5A 3VS1A 1GBRA 1IXDA 2AZVA 3JRZA 2AZSA 4BDYA 1NEGA 1YWOA 4A54A 5LJ5j 2QEXQ 1AT1B 1D1CA 3QDFA 2J6KA 3D7SB 1VQPQ 1KK7A 3JCMQ 1XNIA 1KC8C 2JS2A 2OTJT 1WFWA 2F69A 4FU6A 4DQ2A 2M9UA 3JB9J 2K4YA 5GAMj 1D09B 4M77F 4XTVA 3HP9A 1WHLA 3JCMd 1RLQC 2RQVA 1NEBA 4ORZA 1OX9A 1WZOA 1K8AR 1OU9A 4PJOD 1WJQA 2DZ9A 1WXUA 1N27A 2RNAA 1RUWA 5GAN5 5KYUA 4A53A 3WVDB 2RJCA 2XD0A 1YNZA 3CCRT 3PMIA 2DRMA 1R77A 1ABOA 3VS0A 4FYXB 1W2BP 2KXDA 4JDSA 3EG3A 2DD5A 2JUFA 3MKDA 4IIMA 4LUEA 4C8QE 1MV0B 3H0FA 3LWHA 1K9MU 1E6GA 4JJBA 1UGQB 2YUOA 2CZ1B 4DBFA 2CZ6B 3CCSQ 3RDVA 3HFNA 2HKNA 3EHQA 3QWYA 1KC8U 4QT7A 2XDDA 1X43A 3IQLA 1VOMA 2QAZA 3I55T 2X3WD 4F14A 2VASA 2RQTA 4J7FA 1TXQA 1JJ2P 2ZPBB 1K73U 5FWBA 3FC3A 1TTHB 3MP6A 5HK0A 2EWNA 1YJ9T 1CSKA 2VXEA 1G2BA 1M2OA 3J80E 3OYEA 5GANe 3NPFA 5CO7A 3CCVA 1WPYA 4CC3A 1IGUA 4M4ZA 3OSVA 4F17A 2LQWA 1I4K1 4HXJA 1ZUKA 5DLOA 1VYUA 5D6YA 1W2BA 4C8QB 1Q82R 4FIBA 4PLIA 3S3MA 1G3WA 1EIFA 1G3YA 3CPWP 3L2WA 2ATCB 3OS1A 3MP1A 2P84A 5IAYA 2QYZA 2LZ6B 2K57A 1IREB 3URGA 3CC2A 1S72A 2VVKA 4X1VA 3VS3A 1GBQA 4C5GA 4ZTFA 2DAQA 2DTHA 5GMKe 1OZ3A 1Q7YU 3H6ZA 2KEAA 1N8RC 3A5ZB 1X2QA 3L2QA 3FB9A 3DB4A 2CZ7B 1JJ2A 3QWXX 4MZMA 1FMKA 2CT3A 2MWOA 1KD1R 4C5EA 4F7UG 3CCRQ 1BIAA 5GANg 4AT1B 3GOXA 2ED0A 1YCYA 2HL3A 2JNGA 1N6AA 3RKYA 3JSCA 1I8FA 5GAN6 3NTIA 1C1AA 4V2SA 1UEBA 1VQ8T 3VS5A 1Y07A 2SEMA 4FL6A 4RUGA 2QASA 2L2PA 3EFOB 3VS4A 1IRXA 1H8KA 4LE9A 3M4GA 5GAOr 1Y96B 1QQJA 2CDTA 4C8QA 4C92E 3EG2A 1S1NA 1X69A 2L5QA 3PVLA 3CPWA 4LD9K 4VUBA 1Q81C 3OB9A 2DYIA 3H9NA 5I2MA 1Q86U 3TQ7P 3M0UA 2DFUA 2FVUA 2L0AA 1B34B 2F5KA 1YJ9Q 4N4HA 1N8RU 4PFZA 3UF4A 1MMNA 1SPKA 2K7AA 4DBRA 1D0ZA 3UT1A 2K3YA 1ZBXA 1XOVA 2DF6A 2DXCA 1PNJA 3CXCS 1UGRB 5KCOA 1WQ7A 1AHJB 2MOXA 2IG0A 3CCJT 3VRYA 1AWJA 4IUVA 1SRMA 4J9GA 2A28A 2LQ8A 2ZCFB 3SB2A 3CPFA 1Y71A 2K5IA 3CC2T 4RTXA 4II1A 2FRWA 1UE9A 5CKHA 3EFOA 3HKSA 4C92F 2ROTA 5CKDA 4JZ3A 1ZA2B 2LC4A 2YRCA 5DM7R 1Y96A 2PVGB 9ATCB 4TVRA 3CCQT 1YHQT 2BZ8A 3J81E 1YBYA 2SRCA 4DBQA 3KUFA 1Q81U 2F2XA 2BE7D 2PU9B 3OMCA 1IB8A 4X34A 1VQMA 1H3ZA 1WDXA 2CP0A 3RMQA 2JZ2A 4OMFB 4N4GA 4MDWA 3QHSA 2QTVA 1YJNA 1A0NB 1B34A 2C0IA 1ZBJA 5CQYA 2K6DA 3DLLA 3JCMW 4OB0B 5LJ3e 3QKJA 1EFNA 1F1BB 2V8IA 1VQ8Q 2E3HA 4F04B 4BB7A 3BE3A 1VQ7A 4WCIA 1TOVA 2QA4A 4LDWA 1QP2A 2RK2A 1WXBA 1SKUB 2JM9A 4ZGJB 4HA8A 2E64A 1TU0B 4J6WA 3WXMB 5FU6C 1WNLA 4D6WA 2LQKA 1QVGS 1VQ4T 3CCLT 1VQKT 3ASKA 2F1LA 3GNGA 3OYAA 2EJGA 2HDAA 3CCUA 3CMEA 1PHTA 3S6WA 5GAN2 2RF0A 3CCVQ 2JTEA 2DL3A 4GLKA 3VKIA 1T0JA 4M75B 1KG1A 5D6XA 4HT9A 3OYIA 1JO8A 5IXBA 5GAN3 4M7DG 2RJDA 1WYXA 3GNFB 3VYGA 2VGMA 3E1SA 4F7UF 1WHMA 3S3NA 5LJ3g 4E7LA 2XHCA 3E2UA 2M02A 2DXUA 4M78C 4RTTA 2G3RA 4PNOA 4KT0E 3CCJQ 1KHCA 1VQNA 4QKUA 3MEVA 4HKEA 4QVCA 3CC2Q 1S72Q 4OGCA 3LH5A 3R6NA 2HD0A 3C0CA 1K9AA
chains in the Genus database with same CATH topology
4Z89A 2KYBA 4AFZC 1OEBA 2M0YA 1OPLA 2O9VA 5L23A 1SHFA 1YWPA 2DM1A 2KE9A 1UG1A 3M0PA 1KJWA 4GBQA 2KRNA 1NYFA 1PKTA 1UDLA 1QCFA 2BTTA 4CC7A 2JS0A 5GJVB 1PRMC 3NGPA 2DVJA 2YUPA 1T3LA 2ROLA 1W6XA 4RTVA 3JV3A 4JJDA 1QKWA 4F16A 3UA7A 4OMOA 5I22A 2YSQA 1K4US 4AG2C 2JT4A 1QWFA 2I0NA 3VS1A 1GBRA 4J9FA 2AZVA 2CUBA 1IO6A 2FO0A 2AZSA 2K9GA 1QKXA 1NEGA 1M3BA 1YWOA 2BZXA 2LMJA 2OI3A 2E5KA 1JEGA 1RLPC 1Z9ZA 1M30A 5IHNA 2X3XD 2J6KA 3UA6A 2ENMA 1YP5A 4Y92A 3REBB 4ZNXA 2AK5A 2QDLA 2EYWA 2GNCA 2DE0X 2GBQA 2DL7A 5IXFA 2DILA 2JS2A 1WFWA 1PWTA 3VS6A 2L3QA 1GCQA 1GL5A 1GRIA 1N5ZA 1KSWA 2O9SA 4J9IA 3H0HA 4A63B 2F2VA 2ABLA 1RLQC 1G83A 2JMCA 1UGVA 4RTWA 2RQVA 4RTUA 1M8MA 1NEBA 4ORZA 1LCKA 2EGAA 1W70A 2DJQA 2O2OA 1M3AA 2RN8A 2OAWA 1WXUA 2RNAA 1RUWA 1SHGA 1ZUYA 1JU5C 4IIOA 4E6RA 1TUCA 1YNZA 2LP5A 2M51A 3I35A 1GFDA 2DRMA 1I1JA 1ABOA 3I5SA 3VS0A 2L3PA 2LJ0A 3H41A 2LJ3A 4D8DA 1AZEA 3CQTA 2JMAA 2KXDA 1OOTA 3EG3A 4IIMA 4LUEA 1AWXA 1X27A 1MV0B 3H0FA 2W0ZA 3THKA 1E6GA 1M27C 1MV3A 2KXCA 4JJBA 1PRLC 2YUOA 3I9QA 1Y0MA 1OV3A 1WA7A 1ZLMA 3NMZC 4J9CA 2ESWA 3ZL7C 2FG0A 3EHQA 3QWYA 2KRMA 4JJCA 1HJDA 2JXBA 4OMPA 4OMQA 2G6FX 4QT7A 1BB9A 2ECZA 2O88A 4FSSA 1X43A 3IQLA 1T0HA 2YT6A 2K79A 2X3WD 4F14A 1VYTA 2CSIA 2EBPA 3ULRB 2RQTA 1ZSGA 3PE0A 5FWBA 3TVTA 2BZYA 1UHCA 1CSKA 1V1CA 1H92A 2DX1A 2KGTA 1G2BA 4LN2A 1AEYA 4HCKA 2C0OA 2FPFA 1AWOA 3NPFA 2JW4A 1AOJA 4CC3A 3M0SA 4M4ZA 4F17A 1NG2A 1QLYA 2KROA 2LQWA 4AFUC 4HXJA 5IH2A 2HSPA 1ZUKA 1JQQA 3H0IA 1WI7A 1NYGA 1TUDA 1VYUA 3M0QA 1I0CA 4JPBW 4AG1C 1VA7A 2DA9A 3KFVA 4J9DA 4DEYA 1BK2A 3EG0A 1KFZA 2CH4A 2OJ2A 4EIKA 2GGRA 1K76A 2AKLA 2B86A 3GBQA 1B3QA 1WIEA 2KYMA 4J9EA 2LZ6B 2RPNA 2LQNA 2VVKA 4X1VA 2FEIA 3VS3A 1GBQA 2KEAA 2CSQA 3SEMA 1B07A 3RNJA 4AFSC 1X2QA 5I11A 1ARKA 2DL4A 1HSQA 2DBMA 3QWXX 5FWCA 1FMKA 2CT3A 1JXOA 2CREA 1QWEA 2CUDA 1UJYA 2EW3A 2V1QA 2EGEA 2ED0A 3EG1A 2F2WA 2PNIA 1X2KA 2P4RA 4ESRA 2RQRA 2MCNA 2D1XA 2L3SA 3VS5A 2SEMA 1UHFA 4RUGA 4D8KA 3M0TA 1UUEA 2AKKA 2L2PA 3VS4A 3REAB 2A37A 1H8KA 4LE9A 1K0XA 3TSWA 2EKHA 2JM8A 2KRSA 1H3HA 5FW9A 2CDTA 2IIMA 1NLOC 1YN8A 2MIOA 3PVQA 1J3TA 3EG2A 1S1NA 1X69A 3PVLA 1SEMA 1U06A 1Z9QA 5ECAA 2NUZA 2A08A 4AFQC 2FRYA 2EYZA 3M0UA 2L0AA 2YUNA 3RBBB 1NLPC 2RMOA 1NM7A 2EVRA 4CC4B 2RQWA 2YUQA 2PTKA 3UF4A 4J9HA 1WXTA 1GCQC 4HVWA 1SPKA 2ED1A 2K7AA 1YCSB 1JXMA 1UECA 2DL5A 2VWFA 1XOVA 2DF6A 1Y57A 2LJ1A 2LX7A 1AWWA 1PNJA 2EPDA 4KRTA 4LUDA 2DMOA 2MOXA 2RQUA 1SRLA 1GCPA 2W10A 2D8HA 3VRYA 1AWJA 1SRMA 4J9GA 1PKSA 2A28A 1U5SA 4RTXA 2EQIA 2FRWA 1UE9A 2J6OA 2O31A 2D8JA 2ROTA 4JZ3A 2HEQA 2KR3A 1M3CA 1FYNA 2KT1A 1AD5A 2BZ8A 2SRCA 3I5RA 2F2XA 4JZ4A 1RI9A 4CC2A 4GLMA 2J06A 1CKAA 1UFFA 1WDXA 2YDLA 5GJWB 4OMNA 1X6BA 2J7IA 2EGCA 2DRKA 2H8HA 2LCSA 3VRZA 1A0NB 3U23A 2C0IA 3A98A 1UJ0A 1ZBJA 1WLPB 2K6DA 1UTIA 4OMMA 1EFNA 1W1FA 1SSHA 1T3SA 1ZUUA 5IHKA 1K1ZA 1E7OA 3TSZA 5EC7A 4OMLA 3VS7A 1BBZA 4K11A 1WX6A 4WCIA 2K3BA 2K2MA 1AZGB 4RTZA 1E6HA 1WXBA 3VS2A 2JM9A 4J9BA 2DBKA 2FPDA 4R0KA 2PZ1A 1HD3A 5IHIA 1CKBA 2KBTA 2KT8A 1ABQA 2C0TA 2GTOA 4RTYA 2KNBB 3UATA 2DYBA 2HDAA 2GQIA 1PHTA 3SHWA 5HCKA 2RF0A 3M0RA 2HCKA 1KIKA 2JTEA 2DL3A 2FPEA 4HVUA 1VYVA 1T0JA 2NWMA 1MUZA 2A36A 1ZX6A 3EGUA 1TG0A 1AVZC 2HBWA 2LNHB 1JO8A 4Z8AA 5IXBA 4HVVA 3FJ5A 1GFCA 2CH4W 2DNUA 1WYXA 2VKNA 2XMFA 2EYXA 1OPKA 1I07A 4LNPA 2V1RA 4Z88A 2J6FA 2J05A 3O5ZA 4RTTA 1K0SA 1U3OA 2EYYA 2DLPA 3NHNA 4DEXA 3EHRA 1BU1A 2GTJA 2DL8A 2CT4A 1X6GA 3LH5A 3R6NA 2D0NA 3C0CA 1K9AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z89 A;  2KYB A;  4AFZ C;  1OEB A;  2M0Y A;  1OPL A;  2O9V A;  5L23 A;  1SHF A;  1YWP A;  2DM1 A;  2KE9 A;  1UG1 A;  3M0P A;  1KJW A;  4GBQ A;  2KRN A;  1NYF A;  1PKT A;  1UDL A;  1QCF A;  2BTT A;  4CC7 A;  2JS0 A;  5GJV B;  1PRM C;  3NGP A;  2DVJ A;  2YUP A;  1T3L A;  2ROL A;  1W6X A;  4RTV A;  3JV3 A;  4JJD A;  1QKW A;  4F16 A;  3UA7 A;  4OMO A;  5I22 A;  2YSQ A;  1K4U S;  4AG2 C;  2JT4 A;  1QWF A;  2I0N A;  3VS1 A;  1GBR A;  4J9F A;  2AZV A;  2CUB A;  1IO6 A;  2FO0 A;  2AZS A;  2K9G A;  1QKX A;  1NEG A;  1M3B A;  1YWO A;  2BZX A;  2LMJ A;  2OI3 A;  2E5K A;  1JEG A;  1RLP C;  1Z9Z A;  1M30 A;  5IHN A;  2X3X D;  2J6K A;  3UA6 A;  2ENM A;  1YP5 A;  4Y92 A;  3REB B;  4ZNX A;  2AK5 A;  2QDL A;  2EYW A;  2GNC A;  2DE0 X;  2GBQ A;  2DL7 A;  5IXF A;  2DIL A;  2JS2 A;  1WFW A;  1PWT A;  3VS6 A;  2L3Q A;  1GCQ A;  1GL5 A;  1GRI A;  1N5Z A;  1KSW A;  2O9S A;  4J9I A;  3H0H A;  4A63 B;  2F2V A;  2ABL A;  1RLQ C;  1G83 A;  2JMC A;  1UGV A;  4RTW A;  2RQV A;  4RTU A;  1M8M A;  1NEB A;  4ORZ A;  1LCK A;  2EGA A;  1W70 A;  2DJQ A;  2O2O A;  1M3A A;  2RN8 A;  2OAW A;  1WXU A;  2RNA A;  1RUW A;  1SHG A;  1ZUY A;  1JU5 C;  4IIO A;  4E6R A;  1TUC A;  1YNZ A;  2LP5 A;  2M51 A;  3I35 A;  1GFD A;  2DRM A;  1I1J A;  1ABO A;  3I5S A;  3VS0 A;  2L3P A;  2LJ0 A;  3H41 A;  2LJ3 A;  4D8D A;  1AZE A;  3CQT A;  2JMA A;  2KXD A;  1OOT A;  3EG3 A;  4IIM A;  4LUE A;  1AWX A;  1X27 A;  1MV0 B;  3H0F A;  2W0Z A;  3THK A;  1E6G A;  1M27 C;  1MV3 A;  2KXC A;  4JJB A;  1PRL C;  2YUO A;  3I9Q A;  1Y0M A;  1OV3 A;  1WA7 A;  1ZLM A;  3NMZ C;  4J9C A;  2ESW A;  3ZL7 C;  2FG0 A;  3EHQ A;  3QWY A;  2KRM A;  4JJC A;  1HJD A;  2JXB A;  4OMP A;  4OMQ A;  2G6F X;  4QT7 A;  1BB9 A;  2ECZ A;  2O88 A;  4FSS A;  1X43 A;  3IQL A;  1T0H A;  2YT6 A;  2K79 A;  2X3W D;  4F14 A;  1VYT A;  2CSI A;  2EBP A;  3ULR B;  2RQT A;  1ZSG A;  3PE0 A;  5FWB A;  3TVT A;  2BZY A;  1UHC A;  1CSK A;  1V1C A;  1H92 A;  2DX1 A;  2KGT A;  1G2B A;  4LN2 A;  1AEY A;  4HCK A;  2C0O A;  2FPF A;  1AWO A;  3NPF A;  2JW4 A;  1AOJ A;  4CC3 A;  3M0S A;  4M4Z A;  4F17 A;  1NG2 A;  1QLY A;  2KRO A;  2LQW A;  4AFU C;  4HXJ A;  5IH2 A;  2HSP A;  1ZUK A;  1JQQ A;  3H0I A;  1WI7 A;  1NYG A;  1TUD A;  1VYU A;  3M0Q A;  1I0C A;  4JPB W;  4AG1 C;  1VA7 A;  2DA9 A;  3KFV A;  4J9D A;  4DEY A;  1BK2 A;  3EG0 A;  1KFZ A;  2CH4 A;  2OJ2 A;  4EIK A;  2GGR A;  1K76 A;  2AKL A;  2B86 A;  3GBQ A;  1B3Q A;  1WIE A;  2KYM A;  4J9E A;  2LZ6 B;  2RPN A;  2LQN A;  2VVK A;  4X1V A;  2FEI A;  3VS3 A;  1GBQ A;  2KEA A;  2CSQ A;  3SEM A;  1B07 A;  3RNJ A;  4AFS C;  1X2Q A;  5I11 A;  1ARK A;  2DL4 A;  1HSQ A;  2DBM A;  3QWX X;  5FWC A;  1FMK A;  2CT3 A;  1JXO A;  2CRE A;  1QWE A;  2CUD A;  1UJY A;  2EW3 A;  2V1Q A;  2EGE A;  2ED0 A;  3EG1 A;  2F2W A;  2PNI A;  1X2K A;  2P4R A;  4ESR A;  2RQR A;  2MCN A;  2D1X A;  2L3S A;  3VS5 A;  2SEM A;  1UHF A;  4RUG A;  4D8K A;  3M0T A;  1UUE A;  2AKK A;  2L2P A;  3VS4 A;  3REA B;  2A37 A;  1H8K A;  4LE9 A;  1K0X A;  3TSW A;  2EKH A;  2JM8 A;  2KRS A;  1H3H A;  5FW9 A;  2CDT A;  2IIM A;  1NLO C;  1YN8 A;  2MIO A;  3PVQ A;  1J3T A;  3EG2 A;  1S1N A;  1X69 A;  3PVL A;  1SEM A;  1U06 A;  1Z9Q A;  5ECA A;  2NUZ A;  2A08 A;  4AFQ C;  2FRY A;  2EYZ A;  3M0U A;  2L0A A;  2YUN A;  3RBB B;  1NLP C;  2RMO A;  1NM7 A;  2EVR A;  4CC4 B;  2RQW A;  2YUQ A;  2PTK A;  3UF4 A;  4J9H A;  1WXT A;  1GCQ C;  4HVW A;  1SPK A;  2ED1 A;  2K7A A;  1YCS B;  1JXM A;  1UEC A;  2DL5 A;  2VWF A;  1XOV A;  2DF6 A;  1Y57 A;  2LJ1 A;  2LX7 A;  1AWW A;  1PNJ A;  2EPD A;  4KRT A;  4LUD A;  2DMO A;  2MOX A;  2RQU A;  1SRL A;  1GCP A;  2W10 A;  2D8H A;  3VRY A;  1AWJ A;  1SRM A;  4J9G A;  1PKS A;  2A28 A;  1U5S A;  4RTX A;  2EQI A;  2FRW A;  1UE9 A;  2J6O A;  2O31 A;  2D8J A;  2ROT A;  4JZ3 A;  2HEQ A;  2KR3 A;  1M3C A;  1FYN A;  2KT1 A;  1AD5 A;  2BZ8 A;  2SRC A;  3I5R A;  2F2X A;  4JZ4 A;  1RI9 A;  4CC2 A;  4GLM A;  2J06 A;  1CKA A;  1UFF A;  1WDX A;  2YDL A;  5GJW B;  4OMN A;  1X6B A;  2J7I A;  2EGC A;  2DRK A;  2H8H A;  2LCS A;  3VRZ A;  1A0N B;  3U23 A;  2C0I A;  3A98 A;  1UJ0 A;  1ZBJ A;  1WLP B;  2K6D A;  1UTI A;  4OMM A;  1EFN A;  1W1F A;  1SSH A;  1T3S A;  1ZUU A;  5IHK A;  1K1Z A;  1E7O A;  3TSZ A;  5EC7 A;  4OML A;  3VS7 A;  1BBZ A;  4K11 A;  1WX6 A;  4WCI A;  2K3B A;  2K2M A;  1AZG B;  4RTZ A;  1E6H A;  1WXB A;  3VS2 A;  2JM9 A;  4J9B A;  2DBK A;  2FPD A;  4R0K A;  2PZ1 A;  1HD3 A;  5IHI A;  1CKB A;  2KBT A;  2KT8 A;  1ABQ A;  2C0T A;  2GTO A;  4RTY A;  2KNB B;  3UAT A;  2DYB A;  2HDA A;  2GQI A;  1PHT A;  3SHW A;  5HCK A;  2RF0 A;  3M0R A;  2HCK A;  1KIK A;  2JTE A;  2DL3 A;  2FPE A;  4HVU A;  1VYV A;  1T0J A;  2NWM A;  1MUZ A;  2A36 A;  1ZX6 A;  3EGU A;  1TG0 A;  1AVZ C;  2HBW A;  2LNH B;  1JO8 A;  4Z8A A;  5IXB A;  4HVV A;  3FJ5 A;  1GFC A;  2CH4 W;  2DNU A;  1WYX A;  2VKN A;  2XMF A;  2EYX A;  1OPK A;  1I07 A;  4LNP A;  2V1R A;  4Z88 A;  2J6F A;  2J05 A;  3O5Z A;  4RTT A;  1K0S A;  1U3O A;  2EYY A;  2DLP A;  3NHN A;  4DEX A;  3EHR A;  1BU1 A;  2GTJ A;  2DL8 A;  2CT4 A;  1X6G A;  3LH5 A;  3R6N A;  2D0N A;  3C0C A;  1K9A A; 
#chains in the Genus database with same CATH topology
 4Z89 A;  2XI9 A;  1OEB A;  3CCQ Q;  3ZEH A;  1WHJ A;  1ZA1 B;  1YI2 A;  3M0P A;  1KJW A;  4IUQ A;  2KRN A;  4RCC A;  3MO8 A;  2BIV A;  1YJN T;  3BDL A;  1QW1 A;  3MEW A;  4BE2 A;  2E4H A;  2R57 A;  4FT2 A;  1PRM C;  2YUP A;  5GAN h;  1D1B A;  1TUG B;  1W6X A;  2EQJ A;  3JV3 A;  1M1K C;  2MAM A;  4KH1 B;  4C0G A;  3OS5 A;  2LT1 A;  2COZ A;  3I56 T;  1YJW T;  4LD6 A;  1U1S A;  2YSQ A;  4FSX A;  4BI4 A;  3MEU A;  4AG2 C;  1K8A U;  1K4U S;  2JT4 A;  2COY A;  2QA4 T;  2ZAE A;  4M7D D;  2C06 A;  3OYH A;  1M3B A;  1RAG B;  2LMJ A;  3OYD A;  2E5K A;  1JEG A;  1Z9Z A;  1M30 A;  4IKF A;  3UA6 A;  1HXD A;  2ENM A;  1RAC B;  1YP5 A;  2K5L A;  2GBQ A;  2RJF A;  3CCU T;  1B7T A;  3L1A A;  1PWT A;  4L5G A;  3VS6 A;  1Q82 C;  5GMK h;  1VQ4 Q;  3CCL Q;  2EKO A;  4E7I A;  2O9S A;  1VQ6 A;  1W4S A;  1MMA A;  3H0H A;  4A63 B;  4N4I A;  3JB9 F;  3GLX A;  3OYB A;  4QQ6 A;  2FYK A;  3CC4 A;  3G6E A;  1G8X A;  3OW2 S;  3CXC P;  2DJQ A;  3CD6 T;  4M7A C;  1M3A A;  4KGX B;  1SHG A;  3RMS A;  3OQ5 A;  1SG5 A;  1TUC A;  2OTL A;  1VQN T;  2V26 A;  3OYM A;  1I1J A;  3SDZ A;  1QVF P;  1IHW A;  3PNW C;  2L3P A;  1I5O B;  3TCJ A;  3H41 A;  4D8D A;  4J5Y A;  3HHT B;  1OOT A;  4KUD K;  2W0Z A;  1M27 C;  1VQO A;  3I9Q A;  4XTX A;  1BKB A;  3NTH A;  2BUD A;  2QGG A;  5CK9 A;  1ZLM A;  4J9C A;  3ZL7 C;  2YWW A;  4JJC A;  3TRE A;  4OMP A;  4OMQ A;  1C6V X;  4JRQ A;  1BB9 A;  4O6J A;  4FSS A;  3L2R A;  1Q82 U;  1T0H A;  3CCS T;  4J6Y A;  4PK4 A;  1NBE B;  4XU3 A;  1YJN Q;  2DK3 A;  5GAM e;  4XU1 A;  4M78 B;  1BI3 A;  3ULR B;  3PE0 A;  4ZTJ A;  5FU7 B;  2A0F B;  2NYS A;  1O9S A;  3RER A;  1I81 A;  1V1C A;  2DX1 A;  3JCM e;  2KGT A;  1KHI A;  2LDM A;  4E47 A;  4PJJ A;  3CBP A;  2C0O A;  2FPF A;  3ER0 A;  3CXC A;  1AWO A;  4L59 A;  2EFI A;  1M1F A;  5A0D A;  1AOJ A;  4C5I A;  2QA4 Q;  3T9N A;  1HK9 A;  4AFU C;  2VXF A;  5IH2 A;  1KD1 U;  3MCA B;  4M7A E;  4FM4 B;  1JQQ A;  3UPU A;  1QVF A;  1NYG A;  1BI0 A;  5KYN A;  3M0Q A;  2DJZ A;  5LJ5 g;  1BK2 A;  3C95 A;  4AMC A;  1QVG P;  4ZN3 A;  1VQ6 T;  3CCU Q;  1KFZ A;  2OJ2 A;  2GGR A;  1K9M C;  1FWZ A;  5CR2 A;  4IUR A;  1WIE A;  2XID A;  5CVI A;  2RI3 A;  4A4E A;  2RPN A;  1QCN A;  3CC4 T;  2QQA A;  2LQN A;  8AT1 B;  2CP2 A;  2OX7 A;  3MP8 A;  1MMG A;  3SEM A;  1B07 A;  3ZBD A;  2OTL T;  3CD6 Q;  3AHU A;  4M78 A;  4AFS C;  5LJ3 h;  2DL4 A;  4PJO C;  1OX8 A;  5FWC A;  2A3L A;  1KQ2 A;  1K73 C;  2Z0W A;  1VQN Q;  3A8H B;  3G4S T;  1UJY A;  2EW3 A;  4BD3 A;  2EGE A;  1OQK A;  2QGF B;  4JJN K;  2F2W A;  1X2K A;  4MDX A;  2RQR A;  4OB3 B;  3KXT A;  2QG9 B;  2L3S A;  2O4X B;  3PT9 A;  4D8K A;  3M0T A;  4QW2 A;  2RI2 A;  2A37 A;  1TS9 A;  3FRN A;  4M7A B;  4M77 B;  5KYW B;  2EKH A;  2JM8 A;  1H3H A;  5FW9 A;  1YN8 A;  2MIO A;  2P0P A;  3PVQ A;  5A0L A;  1QVG A;  2QXF A;  4N0A C;  5KE2 A;  3E9G A;  2RD1 A;  4BAC A;  2HZY A;  2AT1 B;  4FYV B;  4C92 G;  2NUZ A;  4AFQ C;  5GAN 7;  3OYL A;  3M58 A;  2Y90 A;  2EYZ A;  2YXY A;  4MZP A;  2P0Q A;  3JCM c;  4DBH A;  3V8J A;  4OP0 A;  3E9F A;  4J9H A;  4HT8 A;  1GCQ C;  3CMA A;  2ED1 A;  2FHD A;  1Q7Y C;  1OYX A;  2E1H A;  4PFP A;  1U1T A;  3HRU A;  2DER A;  2DL5 A;  2HBP A;  2WSC E;  1M4Z A;  1LVK A;  1VQ5 T;  4ATO A;  2NUP B;  4LUD A;  2B8A A;  1PSF A;  3FLG A;  4HCZ A;  1GCP A;  1M90 C;  2W10 A;  2D8H A;  1BYM A;  3CCE A;  3RES A;  2CP6 A;  4R55 A;  4XTZ A;  1VQ6 Q;  3GPL A;  2O4X A;  4FW2 A;  1ACM B;  4C8Q F;  1KQ1 A;  4A4F A;  2HQX A;  5GAN f;  2EQI A;  2HNI A;  5CAI A;  2DEQ A;  4M7A A;  3FEO A;  4M77 A;  2KR3 A;  3CC4 Q;  3DB3 A;  3G6E Q;  5KYW A;  1BCO A;  1FYN A;  3OW2 P;  1YIJ A;  3EFR A;  4JZ4 A;  1TWB A;  3A1P A;  3LW5 E;  2OTL Q;  2GQV A;  2YDL A;  2J7I A;  5IN1 A;  4C92 D;  4PJN A;  1Q86 C;  3U23 A;  3G4S Q;  2GF7 A;  3O8V A;  2VC8 A;  1W1F A;  1SSH A;  4JRK A;  5IHK A;  3G71 A;  1D3B B;  3TSZ A;  4PL6 A;  3VS7 A;  1M90 U;  2V8K A;  3VU3 C;  1R0B G;  1P92 A;  1C0M A;  2K3B A;  3QYG B;  2NUP A;  3BW1 A;  4E7K A;  1RAD B;  3VS2 A;  5IT9 E;  4PJO B;  4J9B A;  2FPD A;  2HKQ B;  5GAO q;  2GFA A;  4R0K A;  3M54 A;  2LCL A;  3VJP A;  2MK5 A;  4M75 C;  4LXC A;  5GAN d;  2KT8 A;  1ABQ A;  2GTO A;  4RTY A;  2KNB B;  3UAT A;  2GQI A;  3SHW A;  3OW2 A;  3M0R A;  3CEY A;  2JTM A;  1NE8 A;  2HCK A;  2FPE A;  1OUL A;  3EAE A;  4HVU A;  1VYV A;  3CCM A;  4BE0 A;  5J26 A;  1O75 A;  2PUK B;  1MUZ A;  4EMK C;  2A36 A;  3EGU A;  2HBW A;  1AVZ C;  2LNH B;  4HVV A;  3FJ5 A;  1GFC A;  2CH4 W;  2DNU A;  2VKN A;  2QDY B;  2EJF A;  2E6N A;  3CCV T;  3CBM A;  1VQ5 Q;  2HL5 C;  4Z88 A;  3G7Z A;  2J6F A;  5HKC A;  5LJ5 h;  1U3O A;  3GF5 A;  3OA6 A;  3F70 A;  4BI3 A;  5GMK l;  1D3B A;  1R0C B;  3J7A F;  2EYQ A;  2XK0 A;  4OF1 A;  1BCM A;  2DL8 A;  1YIJ T;  2CT4 A;  1X6G A;  4QVZ A;  1WQW A;  3ZFJ A;  2MMP A;  2KYB A;  4AFZ C;  2M0Y A;  1VQ9 A;  1OPL A;  2O9V A;  4PJO A;  2COW A;  4BE1 A;  2A7Y A;  1QP3 A;  3SD4 A;  1S72 T;  4NL2 A;  2MI6 A;  3QUI A;  1PKT A;  1VIE A;  2WSE E;  1FX7 A;  4CC7 A;  2JS0 A;  3DLM A;  4J83 A;  2DVJ A;  2RK1 A;  1T3L A;  3JB9 G;  4XU0 A;  2DIG A;  4PFO A;  1QKW A;  3G71 T;  4M75 E;  4F16 A;  3V7S A;  1WGS A;  1G3S A;  2H3E B;  2X4J A;  4BUG A;  4B9X A;  2DKG A;  4FT4 A;  1WHH A;  4Y28 E;  3HSB A;  1NZ9 A;  5CIU A;  1N9R A;  4J9F A;  3RKW A;  2EQM A;  3OBY A;  1QKX A;  4JS4 A;  4N0A A;  3A8L B;  2OI3 A;  3HTR A;  4FYW B;  5DLQ E;  3JCM P;  3JCM X;  2XU8 A;  4JRI A;  4Y92 A;  3REB B;  2YHT A;  5C0M A;  2DE0 X;  2DL7 A;  5LJ3 f;  3V8L A;  2DIL A;  5IXF A;  1D0X A;  1MHN A;  1MMD A;  2WAC A;  2L3Q A;  3CBO A;  1GCQ A;  1GL5 A;  1RAI B;  2EIF A;  1YFN A;  1N5Z A;  4IUT A;  4B6M A;  2K5F A;  4J9I A;  4B9W A;  2F2V A;  2ABL A;  1MNE A;  3FJP A;  2K2V A;  3LGL A;  2O2O A;  4C0Z A;  2OAW A;  4J7I A;  4XK8 E;  3VUZ A;  4IIO A;  3OS0 A;  3EGD B;  1SF9 A;  1GFD A;  3JB9 D;  1JBM A;  3NTK A;  1M5Q 1;  3JAM E;  1YIT A;  1AZE A;  2JMA A;  4EMH A;  1K8A C;  1MV3 A;  2XDB A;  4JLG A;  1VQ9 T;  2HQE A;  3P8D A;  4XTU A;  1YIJ Q;  2E10 A;  1OV3 A;  5AYF A;  4EMK B;  2JVV A;  2FZG B;  4KGZ B;  2ESW A;  1JRI A;  4OGE A;  1VQP A;  4MMK A;  4Y91 A;  4IUU A;  1HJD A;  2JXB A;  3QO3 A;  3V8K A;  5FU7 C;  4HCB A;  2ECZ A;  2O88 A;  3V7C A;  3M4Y A;  3LH0 A;  5LJ3 d;  2K79 A;  2CSI A;  4BDZ A;  4QQD A;  1VQM T;  1ZSG A;  2AHJ B;  2KQW A;  2DVE A;  4F7U B;  1UHC A;  2H3J A;  2FL7 A;  3G71 Q;  2ZPG B;  1WHG A;  4LN2 A;  1AEY A;  4PJM A;  4HCK A;  3A8M B;  3MEA A;  2PUO B;  1V76 A;  1U8R A;  1PD1 A;  4UC4 A;  2KVQ G;  1NG2 A;  1W2B S;  3EGD A;  4M75 A;  1H64 1;  1VQ7 T;  4M7D C;  5GAN 8;  3H0I A;  5CKF A;  3RKX A;  1TUD A;  2EQK A;  1I0C A;  4AG1 C;  1VA7 A;  3QII A;  2QQR A;  3G1J A;  3KFV A;  4J9D A;  4DEY A;  3HL8 A;  1K76 A;  2WSF E;  3GBQ A;  1B3Q A;  4EMK A;  5J3B A;  2VGN A;  3CCM Q;  2RA2 A;  2CKK A;  2FEI A;  2DIQ A;  3CME T;  2D9T A;  3DKM A;  2JTF A;  3MPU B;  4M78 E;  1D0Y A;  2CSQ A;  1RL2 A;  2X51 A;  1HSQ A;  2PVO B;  2D6F A;  3QJ6 A;  2CGH A;  4F7U A;  4ELZ C;  5GMK m;  3M5A A;  1QWE A;  4ME7 A;  2RHI A;  4M77 C;  2P4R A;  2PQW A;  1DJ7 B;  1UHF A;  1VQ9 Q;  1UUE A;  3REA B;  5GAO n;  2VB6 A;  1K0X A;  1MND A;  3HRS A;  3TSW A;  1KD1 C;  2JJ9 A;  5EG2 A;  2KRS A;  5J39 A;  3CPW S;  2OTJ A;  2O01 E;  4C8Q G;  2KDS A;  4FCY A;  3X28 B;  4OB2 B;  1YI2 T;  4M7D E;  1U06 A;  2L3R A;  5ECA A;  2A08 A;  2L89 A;  2NLU A;  1VUB A;  1VQM Q;  3HPW A;  4M78 F;  5LJ5 f;  2KMT A;  2KSS A;  3FIF A;  2RI5 A;  3RBB B;  2RMO A;  2EVR A;  2M0O A;  2RQW A;  2YUQ A;  1PM3 A;  4DOV A;  2E41 A;  2X9H A;  3P8H A;  1YCS B;  5D7U A;  4E7S A;  1UEC A;  2VWF A;  1ZSZ B;  4XTW A;  2LJ1 A;  3CCR A;  2HAX A;  3AT1 B;  5KH6 A;  2EPD A;  5GAO p;  2DEU A;  4DOW A;  2DMO A;  2X4Y A;  1VQ7 Q;  2CS7 A;  2RQU A;  1SRL A;  1R8O B;  3M57 A;  4YTL A;  3L2V A;  1Y7X A;  4X9D A;  1X75 C;  2E6Z A;  5I21 A;  2X4W A;  3BY7 A;  3OY9 A;  4M77 E;  2J6O A;  2O31 A;  2EJ9 A;  4Z02 A;  1FXX A;  3H8Z A;  4XU2 A;  2KT1 A;  1WJS A;  4RG8 A;  3I55 A;  2RHX A;  3CME Q;  2E12 A;  4HCC A;  2K3X A;  4GLM A;  2QTX A;  4M7D B;  1CKA A;  1UFF A;  1IZ6 A;  4C8Q D;  2P4T A;  5GJW B;  4DA4 A;  3G6E T;  1TH7 A;  4E2F B;  1RI0 A;  3VYH B;  5HY6 A;  2ZGW A;  2DRK A;  2H8H A;  5GAM g;  4JUV A;  1RAA B;  5LJ5 d;  1QVP A;  4C0D C;  3E19 A;  3M59 A;  4LDX A;  1WLP B;  4OMM A;  3M53 A;  1ZUU A;  2LX9 A;  3JCM g;  1E7O A;  1ZSZ A;  2FZC B;  2AIR B;  4OB1 B;  5GAM d;  1RAH B;  1BBZ A;  1KQS S;  4Q5W A;  1VQO T;  2K2M A;  3EGX B;  4ZN1 A;  4RTZ A;  4M7A F;  4EMG A;  2DBK A;  1VQL A;  2DZC A;  2XDP A;  3RUX A;  2PZ1 A;  1YI2 Q;  5IHI A;  3C4S A;  3LYI A;  3VUB A;  2YLB A;  3QBY A;  2DTI A;  2MWP A;  5HCK A;  2BKD N;  2NWM A;  3PIP A;  1OZ2 A;  1QMC A;  3R6O A;  4M7D A;  1TG0 A;  4Z8A A;  3PTA A;  4NL3 A;  2EYX A;  3OYN A;  1OPK A;  1I07 A;  2V1R A;  2VV5 A;  3CC7 A;  3S3O A;  1M9S A;  3O5Z A;  1VQ8 A;  3EFS A;  2EYY A;  2LT4 A;  2IVW A;  3NHN A;  3EHR A;  1BU1 A;  3LGF A;  3NFC A;  2GTJ A;  2D0N A;  1LOJ A;  4E7Z A;  3EGX A;  5FRM A;  1M1K R;  4PJO E;  3M9Q A;  2KK4 A;  1V29 B;  5L8R E;  1Q95 G;  3QSU A;  1YWP A;  2DM1 A;  1JB0 E;  3QJY A;  4E7J A;  1NYF A;  3PMT A;  2MPX C;  3OS2 A;  1QCF A;  5GAO l;  2CP3 A;  3X24 B;  3JB9 H;  5GJV B;  1NJI R;  2KAF A;  2XG8 D;  2QQS A;  4LDY A;  5KE3 A;  2Y4Y A;  4BY6 C;  4C92 C;  3UA7 A;  3WVE B;  5I22 A;  2IPO B;  4M75 G;  1QWF A;  2I0N A;  4ANJ A;  3EH1 A;  2CUB A;  1IO6 A;  2FO0 A;  4FYY B;  2K9G A;  1VQL T;  4MML A;  1VQO Q;  2OTJ Q;  2BZX A;  3CCJ A;  4CI0 C;  2DD4 A;  1UGS B;  1RLP C;  1XTD A;  4KGV B;  3TU4 K;  5IHN A;  2X3X D;  3N5B B;  4ZNX A;  1X6O A;  2AK5 A;  2QDL A;  4C0D B;  2EYW A;  4PKC C;  4KH0 B;  3PGG A;  2GNC A;  4CRI A;  3MHX A;  4NS5 A;  4PJO F;  1RAF B;  2ZPF B;  3EH2 A;  3CCQ A;  1GRI A;  2RHY A;  1YHQ A;  1KSW A;  3M55 A;  3QZ9 B;  2ZPI B;  5CQX A;  3RIR A;  1LNX A;  2CZ0 B;  1G83 A;  2JMC A;  1UGV A;  4RTW A;  3INZ A;  4RTU A;  1M8M A;  4PLL A;  1LCK A;  3C94 A;  2EGA A;  2E3I A;  1W70 A;  2LNV A;  2RN8 A;  2RH2 A;  1IHV A;  3CMA T;  3X20 B;  1ZUY A;  3CC7 T;  4MZT A;  5GAN j;  4QVD A;  3HFO A;  1JU5 C;  3BFM A;  6AT1 B;  4E6R A;  5D6W A;  2CYZ B;  4RKU E;  2LP5 A;  3OYF A;  2M51 A;  3I35 A;  3I5S A;  2LJ0 A;  3ME9 A;  1OU8 A;  2LJ3 A;  2HMA A;  3UDC A;  3CQT A;  4QQG A;  3GP8 A;  1AWX A;  2GFU A;  1X27 A;  2VYT A;  1ZHI A;  1WHK A;  3THK A;  2KXC A;  1PRL C;  3CCE T;  5FRN A;  4M75 D;  1Y0M A;  3I55 Q;  3M56 A;  1WA7 A;  5KCH A;  3NMZ C;  2X35 A;  2E70 A;  2FG0 A;  2KRM A;  1IGQ A;  1XJW B;  4WF2 A;  2G6F X;  1M2V B;  3SWN C;  3L2Z A;  2LTO A;  3RR6 A;  2YT6 A;  2E5Q A;  1VQ4 A;  3CCL A;  2RM4 A;  1VQK A;  5GMK j;  3OYY A;  1VYT A;  2DXT A;  5GAM h;  3OYG A;  2EBP A;  3LWI A;  2L8D A;  4JRP A;  4RG2 A;  1LJO A;  3TVT A;  2BZY A;  2QQB A;  1PD0 A;  2NUT B;  1H92 A;  1PG5 B;  3JCM h;  1K9M R;  1KQS P;  1ZQ1 A;  3C12 A;  2JW4 A;  4JLI A;  2P0K A;  3M0S A;  1QVF S;  1FMV A;  4IUP A;  5KYX B;  1QLY A;  2KRO A;  1VQL Q;  4L6V 5;  3GIB A;  2HSP A;  3OBW A;  1KC8 R;  1WI7 A;  4JPB W;  1NPR A;  2DA9 A;  4BY6 B;  4C92 B;  3EG0 A;  2CH4 A;  4EIK A;  4EPC A;  4C0F A;  2I2L A;  3OYJ A;  2AKL A;  2B86 A;  2KYM A;  5AT1 B;  2M1H A;  1K73 R;  4J9E A;  1MGQ A;  3JB9 I;  1BI2 A;  2R5A A;  1QCO A;  4OVA A;  1M2V A;  3X26 B;  1EZZ B;  5CCA A;  1GXI E;  2GCX A;  3RNJ A;  3CCM T;  2HSE B;  4F7U E;  3CMA Q;  5I11 A;  2YRD A;  5FRO A;  3CC7 Q;  1ARK A;  2KI7 A;  4M78 G;  2DBM A;  3UWN A;  1JXO A;  2R5M A;  3KBG A;  3I56 A;  2CRE A;  1YJW A;  1BI1 A;  2NUT A;  5DY9 A;  2CUD A;  1G3T A;  5HK3 A;  2V1Q A;  1HYO A;  3EG1 A;  2M16 A;  2DO3 A;  2PNI A;  4O5V A;  2QI2 A;  4M75 F;  4ESR A;  2BE9 B;  2MCN A;  2D1X A;  2QK0 A;  3VV0 A;  1KQS A;  4EDU A;  1NPP A;  2Y4X A;  3PFS A;  2LCC A;  3CCE Q;  2R58 A;  4XAX B;  1D1A A;  2AKK A;  2RO0 A;  4RMO A;  3L2U A;  4NOY A;  5KYX A;  2PVD B;  3OMG A;  5A2Q E;  5GAO m;  2FB7 A;  2IIM A;  1NLO C;  1Q7Y R;  4R56 A;  1J3T A;  2QEX A;  4C92 A;  3LLR A;  1SEM A;  1Z9Q A;  3LX7 A;  5LL6 S;  2FRY A;  4ELY C;  1I5L A;  1ZSZ C;  1M90 R;  2YUN A;  4A4K A;  2RHU A;  1OI1 A;  1NLP C;  3L42 A;  1NM7 A;  3QZ5 B;  4CC4 B;  2PTK A;  1UGP B;  3CD6 A;  1WXT A;  4HVW A;  2DTO A;  2VUB A;  1JXM A;  2LVM A;  4KBM B;  5LJ3 j;  1Y57 A;  1RAB B;  5CKB A;  3SWN B;  2DET A;  2LX7 A;  2X4X A;  2V8J A;  3MJX A;  1AWW A;  4KRT A;  4M78 D;  2RHZ A;  2YLC A;  1VIF A;  5CKE A;  1EX4 A;  3EG9 B;  3SFM A;  4XTY A;  3QYH B;  4RCB A;  2RJE A;  1YHQ Q;  1PKS A;  4P5N A;  1G5V A;  1U5S A;  2D8J A;  3JCM J;  1Q86 R;  3OSS C;  2HQH A;  2HEQ A;  1M3C A;  2DPP B;  2DXB A;  5M9O A;  4M7A G;  4M77 G;  1N8R R;  1AD5 A;  3CCS A;  8ATC B;  3I5R A;  2XIC A;  1RI9 A;  4CC2 A;  5FLX E;  5KYY B;  2J06 A;  1M1G A;  4OMN A;  4XQ3 A;  1X6B A;  2EGC A;  4FW1 A;  2LCS A;  3A8O B;  3VRZ A;  3FDR A;  4X9C A;  3A98 A;  1X01 A;  1UJ0 A;  4A4H A;  1JJ2 S;  4PJL A;  1WJR A;  1UTI A;  1NJI C;  3OYK A;  3Q1J A;  1T3S A;  1YIT T;  1K1Z A;  4J8O A;  4JS5 A;  5EC7 A;  3SWN A;  1M8V A;  4OML A;  1RAE B;  4K11 A;  1WX6 A;  1AZG B;  2QEX T;  2F5T X;  1E6H A;  3EG9 A;  1VQK Q;  2KY9 A;  1Q81 R;  1VQP T;  3QXE B;  5I2S A;  1PSE A;  4J6X A;  1HD3 A;  4KUI A;  1CKB A;  2KBT A;  4LDV A;  3A8G B;  2C0T A;  1SSF A;  2JOY A;  2DYB A;  2D0Q B;  2EQU A;  1M1K U;  3X25 B;  3QG1 A;  5FU6 B;  1KIK A;  4M7A D;  4M77 D;  4KUL A;  3JCM V;  1XQH A;  5KYY A;  3TEE A;  2CP5 A;  1ZX6 A;  2FZK B;  4ZGE B;  2XMF A;  5C6S A;  3G4S A;  4LNP A;  1NJI U;  5LJ5 e;  2J05 A;  2ZPE B;  1K0S A;  3QDR B;  2RB6 A;  2JN0 A;  2E65 A;  1BIB A;  1PCX A;  2DLP A;  3HRT A;  4DEX A;  5GAM f;  4E7H A;  7AT1 B;  2QQ9 A;  3MET A;  4BI8 B;  4ZGD B;  3JCM b;  1N9S A;  2ZZD A;  1FMW A;  3BDU A;  2MYS A;  2YRV A;  4GY5 A;  2XKO C;  3JCM f;  3QPH A;  1TSF A;  1PC0 A;  5L23 A;  1SHF A;  2KE9 A;  1UG1 A;  4A4G A;  3PIO A;  4PJO G;  4GBQ A;  4WTO B;  1UDL A;  1UB4 A;  3P8B B;  2OAU A;  2BTT A;  3I56 Q;  1YJW Q;  5KYU B;  4M7D F;  3NGP A;  2MF2 A;  4C8Q C;  2ROL A;  5GMK i;  5GAN 4;  1LPL A;  4RTV A;  4JJD A;  2CP7 A;  2EAY A;  2LRQ A;  4OMO A;  5A0G A;  4C5H A;  4LDU A;  2ZPH B;  1YJ9 A;  3OYC A;  1YIT Q;  3V7R A;  1VQ5 A;  3VS1 A;  1GBR A;  1IXD A;  2AZV A;  3JRZ A;  2AZS A;  4BDY A;  1NEG A;  1YWO A;  4A54 A;  5LJ5 j;  2QEX Q;  1AT1 B;  1D1C A;  3QDF A;  2J6K A;  3D7S B;  1VQP Q;  1KK7 A;  3JCM Q;  1XNI A;  1KC8 C;  2JS2 A;  2OTJ T;  1WFW A;  2F69 A;  4FU6 A;  4DQ2 A;  2M9U A;  3JB9 J;  2K4Y A;  5GAM j;  1D09 B;  4M77 F;  4XTV A;  3HP9 A;  1WHL A;  3JCM d;  1RLQ C;  2RQV A;  1NEB A;  4ORZ A;  1OX9 A;  1WZO A;  1K8A R;  1OU9 A;  4PJO D;  1WJQ A;  2DZ9 A;  1WXU A;  1N27 A;  2RNA A;  1RUW A;  5GAN 5;  5KYU A;  4A53 A;  3WVD B;  2RJC A;  2XD0 A;  1YNZ A;  3CCR T;  3PMI A;  2DRM A;  1R77 A;  1ABO A;  3VS0 A;  4FYX B;  1W2B P;  2KXD A;  4JDS A;  3EG3 A;  2DD5 A;  2JUF A;  3MKD A;  4IIM A;  4LUE A;  4C8Q E;  1MV0 B;  3H0F A;  3LWH A;  1K9M U;  1E6G A;  4JJB A;  1UGQ B;  2YUO A;  2CZ1 B;  4DBF A;  2CZ6 B;  3CCS Q;  3RDV A;  3HFN A;  2HKN A;  3EHQ A;  3QWY A;  1KC8 U;  4QT7 A;  2XDD A;  1X43 A;  3IQL A;  1VOM A;  2QAZ A;  3I55 T;  2X3W D;  4F14 A;  2VAS A;  2RQT A;  4J7F A;  1TXQ A;  1JJ2 P;  2ZPB B;  1K73 U;  5FWB A;  3FC3 A;  1TTH B;  3MP6 A;  5HK0 A;  2EWN A;  1YJ9 T;  1CSK A;  2VXE A;  1G2B A;  1M2O A;  3J80 E;  3OYE A;  5GAN e;  3NPF A;  5CO7 A;  3CCV A;  1WPY A;  4CC3 A;  1IGU A;  4M4Z A;  3OSV A;  4F17 A;  2LQW A;  1I4K 1;  4HXJ A;  1ZUK A;  5DLO A;  1VYU A;  5D6Y A;  1W2B A;  4C8Q B;  1Q82 R;  4FIB A;  4PLI A;  3S3M A;  1G3W A;  1EIF A;  1G3Y A;  3CPW P;  3L2W A;  2ATC B;  3OS1 A;  3MP1 A;  2P84 A;  5IAY A;  2QYZ A;  2LZ6 B;  2K57 A;  1IRE B;  3URG A;  3CC2 A;  1S72 A;  2VVK A;  4X1V A;  3VS3 A;  1GBQ A;  4C5G A;  4ZTF A;  2DAQ A;  2DTH A;  5GMK e;  1OZ3 A;  1Q7Y U;  3H6Z A;  2KEA A;  1N8R C;  3A5Z B;  1X2Q A;  3L2Q A;  3FB9 A;  3DB4 A;  2CZ7 B;  1JJ2 A;  3QWX X;  4MZM A;  1FMK A;  2CT3 A;  2MWO A;  1KD1 R;  4C5E A;  4F7U G;  3CCR Q;  1BIA A;  5GAN g;  4AT1 B;  3GOX A;  2ED0 A;  1YCY A;  2HL3 A;  2JNG A;  1N6A A;  3RKY A;  3JSC A;  1I8F A;  5GAN 6;  3NTI A;  1C1A A;  4V2S A;  1UEB A;  1VQ8 T;  3VS5 A;  1Y07 A;  2SEM A;  4FL6 A;  4RUG A;  2QAS A;  2L2P A;  3EFO B;  3VS4 A;  1IRX A;  1H8K A;  4LE9 A;  3M4G A;  5GAO r;  1Y96 B;  1QQJ A;  2CDT A;  4C8Q A;  4C92 E;  3EG2 A;  1S1N A;  1X69 A;  2L5Q A;  3PVL A;  3CPW A;  4LD9 K;  4VUB A;  1Q81 C;  3OB9 A;  2DYI A;  3H9N A;  5I2M A;  1Q86 U;  3TQ7 P;  3M0U A;  2DFU A;  2FVU A;  2L0A A;  1B34 B;  2F5K A;  1YJ9 Q;  4N4H A;  1N8R U;  4PFZ A;  3UF4 A;  1MMN A;  1SPK A;  2K7A A;  4DBR A;  1D0Z A;  3UT1 A;  2K3Y A;  1ZBX A;  1XOV A;  2DF6 A;  2DXC A;  1PNJ A;  3CXC S;  1UGR B;  5KCO A;  1WQ7 A;  1AHJ B;  2MOX A;  2IG0 A;  3CCJ T;  3VRY A;  1AWJ A;  4IUV A;  1SRM A;  4J9G A;  2A28 A;  2LQ8 A;  2ZCF B;  3SB2 A;  3CPF A;  1Y71 A;  2K5I A;  3CC2 T;  4RTX A;  4II1 A;  2FRW A;  1UE9 A;  5CKH A;  3EFO A;  3HKS A;  4C92 F;  2ROT A;  5CKD A;  4JZ3 A;  1ZA2 B;  2LC4 A;  2YRC A;  5DM7 R;  1Y96 A;  2PVG B;  9ATC B;  4TVR A;  3CCQ T;  1YHQ T;  2BZ8 A;  3J81 E;  1YBY A;  2SRC A;  4DBQ A;  3KUF A;  1Q81 U;  2F2X A;  2BE7 D;  2PU9 B;  3OMC A;  1IB8 A;  4X34 A;  1VQM A;  1H3Z A;  1WDX A;  2CP0 A;  3RMQ A;  2JZ2 A;  4OMF B;  4N4G A;  4MDW A;  3QHS A;  2QTV A;  1YJN A;  1A0N B;  1B34 A;  2C0I A;  1ZBJ A;  5CQY A;  2K6D A;  3DLL A;  3JCM W;  4OB0 B;  5LJ3 e;  3QKJ A;  1EFN A;  1F1B B;  2V8I A;  1VQ8 Q;  2E3H A;  4F04 B;  4BB7 A;  3BE3 A;  1VQ7 A;  4WCI A;  1TOV A;  2QA4 A;  4LDW A;  1QP2 A;  2RK2 A;  1WXB A;  1SKU B;  2JM9 A;  4ZGJ B;  4HA8 A;  2E64 A;  1TU0 B;  4J6W A;  3WXM B;  5FU6 C;  1WNL A;  4D6W A;  2LQK A;  1QVG S;  1VQ4 T;  3CCL T;  1VQK T;  3ASK A;  2F1L A;  3GNG A;  3OYA A;  2EJG A;  2HDA A;  3CCU A;  3CME A;  1PHT A;  3S6W A;  5GAN 2;  2RF0 A;  3CCV Q;  2JTE A;  2DL3 A;  4GLK A;  3VKI A;  1T0J A;  4M75 B;  1KG1 A;  5D6X A;  4HT9 A;  3OYI A;  1JO8 A;  5IXB A;  5GAN 3;  4M7D G;  2RJD A;  1WYX A;  3GNF B;  3VYG A;  2VGM A;  3E1S A;  4F7U F;  1WHM A;  3S3N A;  5LJ3 g;  4E7L A;  2XHC A;  3E2U A;  2M02 A;  2DXU A;  4M78 C;  4RTT A;  2G3R A;  4PNO A;  4KT0 E;  3CCJ Q;  1KHC A;  1VQN A;  4QKU A;  3MEV A;  4HKE A;  4QVC A;  3CC2 Q;  1S72 Q;  4OGC A;  3LH5 A;  3R6N A;  2HD0 A;  3C0C A;  1K9A A; 
#chains in the Genus database with same CATH homology
 4Z89 A;  2KYB A;  4AFZ C;  1OEB A;  2M0Y A;  1OPL A;  2O9V A;  5L23 A;  1SHF A;  1YWP A;  2DM1 A;  2KE9 A;  1UG1 A;  3M0P A;  1KJW A;  4GBQ A;  2KRN A;  1NYF A;  1PKT A;  1UDL A;  1QCF A;  2BTT A;  4CC7 A;  2JS0 A;  5GJV B;  1PRM C;  3NGP A;  2DVJ A;  2YUP A;  1T3L A;  2ROL A;  1W6X A;  4RTV A;  3JV3 A;  4JJD A;  1QKW A;  4F16 A;  3UA7 A;  4OMO A;  5I22 A;  2YSQ A;  1K4U S;  4AG2 C;  2JT4 A;  1QWF A;  2I0N A;  3VS1 A;  1GBR A;  4J9F A;  2AZV A;  2CUB A;  1IO6 A;  2FO0 A;  2AZS A;  2K9G A;  1QKX A;  1NEG A;  1M3B A;  1YWO A;  2BZX A;  2LMJ A;  2OI3 A;  2E5K A;  1JEG A;  1RLP C;  1Z9Z A;  1M30 A;  5IHN A;  2X3X D;  2J6K A;  3UA6 A;  2ENM A;  1YP5 A;  4Y92 A;  3REB B;  4ZNX A;  2AK5 A;  2QDL A;  2EYW A;  2GNC A;  2DE0 X;  2GBQ A;  2DL7 A;  5IXF A;  2DIL A;  2JS2 A;  1WFW A;  1PWT A;  3VS6 A;  2L3Q A;  1GCQ A;  1GL5 A;  1GRI A;  1N5Z A;  1KSW A;  2O9S A;  4J9I A;  3H0H A;  4A63 B;  2F2V A;  2ABL A;  1RLQ C;  1G83 A;  2JMC A;  1UGV A;  4RTW A;  2RQV A;  4RTU A;  1M8M A;  1NEB A;  4ORZ A;  1LCK A;  2EGA A;  1W70 A;  2DJQ A;  2O2O A;  1M3A A;  2RN8 A;  2OAW A;  1WXU A;  2RNA A;  1RUW A;  1SHG A;  1ZUY A;  1JU5 C;  4IIO A;  4E6R A;  1TUC A;  1YNZ A;  2LP5 A;  2M51 A;  3I35 A;  1GFD A;  2DRM A;  1I1J A;  1ABO A;  3I5S A;  3VS0 A;  2L3P A;  2LJ0 A;  3H41 A;  2LJ3 A;  4D8D A;  1AZE A;  3CQT A;  2JMA A;  2KXD A;  1OOT A;  3EG3 A;  4IIM A;  4LUE A;  1AWX A;  1X27 A;  1MV0 B;  3H0F A;  2W0Z A;  3THK A;  1E6G A;  1M27 C;  1MV3 A;  2KXC A;  4JJB A;  1PRL C;  2YUO A;  3I9Q A;  1Y0M A;  1OV3 A;  1WA7 A;  1ZLM A;  3NMZ C;  4J9C A;  2ESW A;  3ZL7 C;  2FG0 A;  3EHQ A;  3QWY A;  2KRM A;  4JJC A;  1HJD A;  2JXB A;  4OMP A;  4OMQ A;  2G6F X;  4QT7 A;  1BB9 A;  2ECZ A;  2O88 A;  4FSS A;  1X43 A;  3IQL A;  1T0H A;  2YT6 A;  2K79 A;  2X3W D;  4F14 A;  1VYT A;  2CSI A;  2EBP A;  3ULR B;  2RQT A;  1ZSG A;  3PE0 A;  5FWB A;  3TVT A;  2BZY A;  1UHC A;  1CSK A;  1V1C A;  1H92 A;  2DX1 A;  2KGT A;  1G2B A;  4LN2 A;  1AEY A;  4HCK A;  2C0O A;  2FPF A;  1AWO A;  3NPF A;  2JW4 A;  1AOJ A;  4CC3 A;  3M0S A;  4M4Z A;  4F17 A;  1NG2 A;  1QLY A;  2KRO A;  2LQW A;  4AFU C;  4HXJ A;  5IH2 A;  2HSP A;  1ZUK A;  1JQQ A;  3H0I A;  1WI7 A;  1NYG A;  1TUD A;  1VYU A;  3M0Q A;  1I0C A;  4JPB W;  4AG1 C;  1VA7 A;  2DA9 A;  3KFV A;  4J9D A;  4DEY A;  1BK2 A;  3EG0 A;  1KFZ A;  2CH4 A;  2OJ2 A;  4EIK A;  2GGR A;  1K76 A;  2AKL A;  2B86 A;  3GBQ A;  1B3Q A;  1WIE A;  2KYM A;  4J9E A;  2LZ6 B;  2RPN A;  2LQN A;  2VVK A;  4X1V A;  2FEI A;  3VS3 A;  1GBQ A;  2KEA A;  2CSQ A;  3SEM A;  1B07 A;  3RNJ A;  4AFS C;  1X2Q A;  5I11 A;  1ARK A;  2DL4 A;  1HSQ A;  2DBM A;  3QWX X;  5FWC A;  1FMK A;  2CT3 A;  1JXO A;  2CRE A;  1QWE A;  2CUD A;  1UJY A;  2EW3 A;  2V1Q A;  2EGE A;  2ED0 A;  3EG1 A;  2F2W A;  2PNI A;  1X2K A;  2P4R A;  4ESR A;  2RQR A;  2MCN A;  2D1X A;  2L3S A;  3VS5 A;  2SEM A;  1UHF A;  4RUG A;  4D8K A;  3M0T A;  1UUE A;  2AKK A;  2L2P A;  3VS4 A;  3REA B;  2A37 A;  1H8K A;  4LE9 A;  1K0X A;  3TSW A;  2EKH A;  2JM8 A;  2KRS A;  1H3H A;  5FW9 A;  2CDT A;  2IIM A;  1NLO C;  1YN8 A;  2MIO A;  3PVQ A;  1J3T A;  3EG2 A;  1S1N A;  1X69 A;  3PVL A;  1SEM A;  1U06 A;  1Z9Q A;  5ECA A;  2NUZ A;  2A08 A;  4AFQ C;  2FRY A;  2EYZ A;  3M0U A;  2L0A A;  2YUN A;  3RBB B;  1NLP C;  2RMO A;  1NM7 A;  2EVR A;  4CC4 B;  2RQW A;  2YUQ A;  2PTK A;  3UF4 A;  4J9H A;  1WXT A;  1GCQ C;  4HVW A;  1SPK A;  2ED1 A;  2K7A A;  1YCS B;  1JXM A;  1UEC A;  2DL5 A;  2VWF A;  1XOV A;  2DF6 A;  1Y57 A;  2LJ1 A;  2LX7 A;  1AWW A;  1PNJ A;  2EPD A;  4KRT A;  4LUD A;  2DMO A;  2MOX A;  2RQU A;  1SRL A;  1GCP A;  2W10 A;  2D8H A;  3VRY A;  1AWJ A;  1SRM A;  4J9G A;  1PKS A;  2A28 A;  1U5S A;  4RTX A;  2EQI A;  2FRW A;  1UE9 A;  2J6O A;  2O31 A;  2D8J A;  2ROT A;  4JZ3 A;  2HEQ A;  2KR3 A;  1M3C A;  1FYN A;  2KT1 A;  1AD5 A;  2BZ8 A;  2SRC A;  3I5R A;  2F2X A;  4JZ4 A;  1RI9 A;  4CC2 A;  4GLM A;  2J06 A;  1CKA A;  1UFF A;  1WDX A;  2YDL A;  5GJW B;  4OMN A;  1X6B A;  2J7I A;  2EGC A;  2DRK A;  2H8H A;  2LCS A;  3VRZ A;  1A0N B;  3U23 A;  2C0I A;  3A98 A;  1UJ0 A;  1ZBJ A;  1WLP B;  2K6D A;  1UTI A;  4OMM A;  1EFN A;  1W1F A;  1SSH A;  1T3S A;  1ZUU A;  5IHK A;  1K1Z A;  1E7O A;  3TSZ A;  5EC7 A;  4OML A;  3VS7 A;  1BBZ A;  4K11 A;  1WX6 A;  4WCI A;  2K3B A;  2K2M A;  1AZG B;  4RTZ A;  1E6H A;  1WXB A;  3VS2 A;  2JM9 A;  4J9B A;  2DBK A;  2FPD A;  4R0K A;  2PZ1 A;  1HD3 A;  5IHI A;  1CKB A;  2KBT A;  2KT8 A;  1ABQ A;  2C0T A;  2GTO A;  4RTY A;  2KNB B;  3UAT A;  2DYB A;  2HDA A;  2GQI A;  1PHT A;  3SHW A;  5HCK A;  2RF0 A;  3M0R A;  2HCK A;  1KIK A;  2JTE A;  2DL3 A;  2FPE A;  4HVU A;  1VYV A;  1T0J A;  2NWM A;  1MUZ A;  2A36 A;  1ZX6 A;  3EGU A;  1TG0 A;  1AVZ C;  2HBW A;  2LNH B;  1JO8 A;  4Z8A A;  5IXB A;  4HVV A;  3FJ5 A;  1GFC A;  2CH4 W;  2DNU A;  1WYX A;  2VKN A;  2XMF A;  2EYX A;  1OPK A;  1I07 A;  4LNP A;  2V1R A;  4Z88 A;  2J6F A;  2J05 A;  3O5Z A;  4RTT A;  1K0S A;  1U3O A;  2EYY A;  2DLP A;  3NHN A;  4DEX A;  3EHR A;  1BU1 A;  2GTJ A;  2DL8 A;  2CT4 A;  1X6G A;  3LH5 A;  3R6N A;  2D0N A;  3C0C A;  1K9A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...