2CSQA

Solution structure of the second sh3 domain of human rim-binding protein 2
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
97
structure length
97
Chain Sequence
GSSGSSGTDPGAEELPARIFVALFDYDPLTMSPNPDAAEEELPFKEGQIIKVYGDKDADGFYRGETCARLGLIPCNMVSEIQADDEEMMDQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis/exocytosis
molecule keywords RIM binding protein 2
publication title Solution structure of the second SH3 domain of human RIM-binding protein 2
rcsb
source organism Homo sapiens
total genus 7
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2005-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2csqA01
2DL7A 2JMAA 2NWMA 2M51A 1M3CA 3UA6A 4JJDA 4CC3A 2JW4A 2O9SA 2W0ZA 2DLPA 2DE0X 3PVLA 2J06A 4DEXA 2EYYA 3RBBB 1M3AA 2EKHA 1A0NB 2AZSA 2FEIA 1NG2A 1WFWA 4LE9A 3ULRB 3VS5A 2KXDA 1ZUYA 1IO6A 1U5SA 4IIOA 2RN8A 4D8DA 2EYXA 4OMMA 2LP5A 2V1RA 4HVWA 2P4RA 1WX6A 3M0RA 1QWFA 4FSSA 2RQWA 4X1VA 1I07A 1M3BA 1SEMA 2CT4A 1OEBA 3VRYA 2BTTA 1ZUUA 2JM9A 1SRMA 4K11A 2JM8A 2CH4W 4A63B 2RQRA 1GBRA 1AOJA 4F14A 1CKBA 2J6FA 1YNZA 3TVTA 2CSIA 1WIEA 3I9QA 1RI9A 1WXTA 3VS4A 1E7OA 4AFZC 2GNCA 3VRZA 1EFNA 1YN8A 2HBWA 1K0XA 3QWXX 1AWWA 4AG2C 2KRMA 2LJ0A 1HSQA 4ZNXA 2KXCA 2ABLA 4EIKA 4WCIA 1GCQA 3EGUA 2OJ2A 1KJWA 2EYZA 2FG0A 2JT4A 1AWXA 2KGTA 4JJCA 4F17A 1AD5A 1TG0A 1WI7A 2EBPA 1YCSB 4J9DA 4LNPA 1GFCA 2J6KA 1G2BA 4JZ4A 3U23A 2L3SA 1S1NA 3EG3A 1K4US 2GQIA 1GL5A 1X6GA 1OOTA 4LUDA 3O5ZA 1YWPA 3C0CA 3VS7A 2M0YA 1LCKA 1X43A 2O9VA 3QWYA 2V1QA 1KFZA 2ED0A 1GCPA 1UTIA 3EG0A 3M0TA 2MIOA 1TUDA 2HDAA 2DBMA 1QKWA 2EYWA 5EC7A 1PKSA 3FJ5A 3R6NA 1JU5C 1UDLA 2KT1A 1VYUA 2JTEA 4QT7A 1VYVA 3NMZC 2DBKA 1NYFA 5GJVB 1T3LA 2C0TA 1NLOC 3NGPA 2EW3A 2O31A 2EGCA 2I0NA 4Z89A 4F16A 1BB9A 1H8KA 5I22A 2A36A 1GRIA 3I5SA 2DL5A 4RTWA 1PRLC 4OMNA 2SRCA 4OMPA 2FPDA 4J9HA 1JO8A 2H8HA 2BZYA 1NLPC 1G83A 2ROLA 4OMOA 3REBB 2B86A 1NEBA 2YDLA 3KFVA 2A28A 3GBQA 2YUOA 1K76A 2DX1A 2L0AA 1WXBA 1PWTA 1K1ZA 2GBQA 1M27C 2KRSA 2KROA 4LUEA 1ZUKA 1AZGB 2EPDA 2D8HA 2KEAA 4Y92A 1NYGA 1K0SA 1UJYA 4HCKA 1QCFA 1ZX6A 1T0HA 1UUEA 1WLPB 2AKLA 2EGEA 2RQTA 2ENMA 1X2QA 2EQIA 1B3QA 2RQUA 1UJ0A 2PTKA 2KE9A 1AZEA 4J9IA 1YWOA 1I0CA 5IHIA 4JJBA 1KIKA 2LJ1A 3M0UA 1UHFA 2QDLA 1OPKA 2NUZA 2CDTA 2HEQA 4HVUA 5FW9A 3SHWA 1ZLMA 1SPKA 2K6DA 2K9GA 3H0IA 2DYBA 2L2PA 2BZXA 2W10A 3NHNA 1QKXA 1WA7A 2DRKA 2KYBA 1KSWA 1RUWA 5L23A 1GBQA 4D8KA 4RTXA 2GTJA 2FPEA 2LQWA 4J9CA 4J9FA 2CT3A 2DF6A 2SEMA 2ED1A 1ARKA 1H3HA 2JS0A 1T0JA 1E6GA 4IIMA 1N5ZA 1UECA 1TUCA 5FWCA 1WYXA 2D0NA 2FRYA 2YSQA 4RTZA 3NPFA 2LCSA 2AKKA 4GLMA 4RTTA 2F2VA 2XMFA 1Z9ZA 4J9EA 4M4ZA 2LMJA 4RUGA 2L3PA 2LJ3A 4Z88A 1Y0MA 3CQTA 4JPBW 1PRMC 1B07A 2DL4A 1QWEA 4J9GA 1I1JA 3LH5A 1UFFA 2FPFA 2VVKA 2O2OA 1ZBJA 3SEMA 2X3WD 3TSWA 2LX7A 1CKAA 3EHQA 2VKNA 1UG1A 1HJDA 3THKA 3UF4A 2RNAA 4AFSC 2DNUA 2KR3A 4LN2A 3M0PA 1NEGA 1FMKA 5IXBA 1U3OA 4JZ3A 4RTYA 1AVZC 1UHCA 2DMOA 3M0SA 1MV3A 1H92A 2G6FX 4AFUC 2RQVA 1AWJA 1SRLA 2YUPA 4Z8AA 2BZ8A 2F2WA 1J3TA 2A37A 2FO0A 2K79A 4HVVA 2MCNA 4GBQA 4KRTA 3IQLA 2CUDA 1VA7A 2DA9A 2ESWA 1BU1A 1QLYA 2JXBA 1SHGA 4DEYA 1GCQC 1YP5A 3EHRA 2DM1A 2CUBA 2C0OA 2J05A 5I11A 1GFDA 3EG2A 1OV3A 2RPNA 1MV0B 3I35A 2K2MA 1UGVA 4AFQC 1W1FA 1XOVA 1PHTA 5GJWB 2D8JA 2DRMA 1WXUA 2HCKA 3VS3A 2K3BA 2AZVA 1AEYA 2X3XD 1ZSGA 1X27A 1RLPC 1X6BA 2KNBB 2KYMA 1WDXA 4ESRA 2KBTA 2F2XA 2HSPA 2RF0A 4CC2A 1NM7A 1ABOA 3JV3A 1JEGA 3UA7A 1M30A 2C0IA 1RLQC 2D1XA 2ECZA 1JQQA 2DVJA 1E6HA 4RTUA 5IHNA 5IHKA 2YT6A 2CREA 1W6XA 2O88A 1PNJA 2DILA 1SHFA 3H0HA 3VS1A 5FWBA 3ZL7C 1Y57A 2CSQA 3VS2A 2GGRA 2J6OA 1VYTA 2KT8A 3H41A 1BBZA 3A98A 1BK2A 3PVQA 1T3SA 2YUQA 2CH4A 2LQNA 2KRNA 2YUNA 1W70A 2IIMA 1K9AA 2AK5A 1U06A 4ORZA 3H0FA 4E6RA 3PE0A 2OI3A 4CC4B 4HXJA 2LZ6B 4J9BA 2K7AA 2FRWA 3VS0A 1FYNA 2MOXA 4CC7A 2EGAA 4OMQA 1X69A 1ABQA 2GTOA 2PNIA 1CSKA 1MUZA 2JS2A 1UE9A 5IH2A 4AG1C 2E5KA 2J7IA 3TSZA 1X2KA 2PZ1A 1OPLA 1Z9QA 4OMLA 3VS6A 2DL8A 2A08A 1JXOA 2VWFA 1JXMA 2L3QA 5ECAA 1AWOA 3M0QA 1PKTA 5HCKA 2ROTA 2RMOA 1SSHA 3REAB 2JMCA 2DL3A 2LNHB 1V1CA 1M8MA 2EVRA 3RNJA 4RTVA 5IXFA 3UATA 3EG1A 2DJQA 2OAWA 3I5RA 4R0KA 1HD3A
chains in the Genus database with same CATH superfamily
1FX7A 2NWMA 2M51A 3UA6A 3EGXB 1N8RC 5LJ5d 2E65A 1VUBA 3PVLA 5GMKl 5GMKh 4M7AE 4M7AG 1VQ4T 1A0NB 1NG2A 4LE9A 3MEUA 3G71T 1U5SA 1X01A 3DLLA 2RN8A 2HZYA 4QVCA 1YJ9A 5FU7C 1ACMB 3HFNA 2H3JA 2DEQA 3LGFA 4EMGA 3VRYA 5IT9E 1ZUUA 3N5BB 2JM8A 2QQSA 2QG9B 4RKUE 2RI5A 3ASKA 4M7DG 3S3OA 5A0LA 3TVTA 4M77A 3GP8A 3WVDB 1WIEA 4XTYA 5KYNA 3CCLQ 2GF7A 3VS4A 3CCRA 1E7OA 1BIBA 2MWPA 5GAMd 2JJ9A 3VRZA 4OMFB 2HBWA 3QWXX 2LJ0A 3CBMA 1GCQA 2DETA 3Q1JA 2FG0A 1AD5A 4B9WA 3JCMc 2EBPA 2QQ9A 2HMAA 1YCSB 3EGDB 2J6KA 2RO0A 2QK0A 1VQOT 4IUPA 3L2WA 1S1NA 3EG3A 2QA4A 1KHCA 3O5ZA 1Q86R 1D0YA 3VS7A 2M0YA 1BI3A 1LCKA 2HD0A 3L2QA 2K57A 5HKCA 2D6FA 1RAHB 3X24B 3CMEQ 2DPPB 2MIOA 4VUBA 1Q7YR 1QKWA 2CGHA 3OY9A 2CZ0B 5FU7B 3EAEA 1K8AU 4N0AA 2HL5C 3EG9A 4QT7A 4FL6A 2XKOC 3RIRA 3PIOA 1NYFA 2C0TA 2EW3A 1MNEA 4R55A 5CKHA 3OMCA 2IPOB 2LC4A 2DTHA 4OMNA 4XTVA 4J9HA 1JO8A 1N8RR 2FZGB 1ZHIA 1VQ6A 1VQ5T 1G83A 1RABB 3GOXA 1VQ8Q 3KFVA 2A28A 3GBQA 3CCRQ 3QIIA 2R5MA 2DX1A 2Y4YA 1M27C 2LVMA 1V76A 1VIEA 5KCOA 3ER0A 1C1AA 4PJLA 2D8HA 2L8DA 4Y92A 1NYGA 4C5IA 3QZ5B 1UJYA 3JB9G 1ZX6A 3OYLA 3SD4A 1T0HA 2FYKA 3QYHB 2RQTA 2ENMA 2DYIA 2CZ1B 1UJ0A 1FMWA 3CCQT 2PTKA 2KE9A 4MDWA 1VQ7T 1UGRB 1N6AA 2QA4Q 3NTKA 4V2SA 4JJBA 3JB9H 3M0UA 1UHFA 2QDLA 4M78D 5CKBA 5A2QE 4DOWA 1Q95G 5CCAA 2HBPA 1Q82U 4PLIA 4A53A 1WA7A 2E3IA 2KYBA 5A0GA 3HRUA 4PKCC 3JCMg 1ZA2B 5KYUB 5GANj 1K73C 1I5LA 3LW5E 2VASA 5KYXA 4RTXA 1BI2A 2GTJA 1VQMA 3M53A 3EFOA 2VYTA 1N9SA 2DF6A 2ED1A 1YFNA 3RESA 1H3HA 5D6YA 4E2FB 1VQPT 2WSCE 1N5ZA 1UECA 1TUCA 5LJ3j 1WYXA 3CCUT 4PNOA 2MI6A 2NUPA 2LCSA 2AKKA 1WJSA 4RUGA 2L3PA 4BI4A 2LJ3A 1K8AC 1VQ6Q 5C0MA 3CXCA 1KQ2A 1U1SA 4JLGA 2RI2A 3H6ZA 3HRTA 2C06A 2PQWA 1ZBJA 1IGQA 2LX7A 2E4HA 5GAMf 1RAGB 4J7FA 3THKA 4M78G 2KR3A 3TEEA 2EQUA 2NUTB 5LJ3g 1HYOA 4XU0A 4L6V5 5FROA 1I8FA 1TXQA 4YTLA 5GAN8 4M7AA 2F2WA 5GAN3 3M56A 1WZOA 4QVZA 4DOVA 1YJ9T 1WNLA 4OGCA 2ATCB 3BDUA 3IQLA 1VA7A 2JXBA 4DEYA 1BIAA 1PC0A 2DM1A 2E12A 2DKGA 2J05A 3NTIA 3EG2A 2RJEA 2KQWA 1OV3A 2Z0WA 4MDXA 1MV0B 2QAZA 4C92C 2K2MA 3OYGA 1JJ2P 1W1FA 4JRIA 2JVVA 4M7DA 1WXUA 3OYNA 1SSFA 2P0QA 1ZSGA 2XHCA 1IHWA 2KYMA 1Q82C 1WDXA 4MZTA 1YIJA 5J39A 1YITQ 3JV3A 3UA7A 2DD4A 4BI3A 3R6OA 1Y96A 3JCMd 2C0IA 3S3MA 1NE8A 2D1XA 2LQKA 2DVJA 3G6EQ 5IHNA 2YT6A 4M7DF 2HKQB 3M54A 5KCHA 2DD5A 1PNJA 1G8XA 3L1AA 5GAMe 3VS1A 1K73R 2ZZDA 4QKUA 4ELYC 3JCMX 1R77A 2M0OA 3PTAA 3JCMW 1VQNT 2KT8A 1SF9A 3SWNC 1BBZA 3JCMV 4B6MA 1BK2A 4PFZA 4E7JA 3CXCS 3OBYA 3DKMA 3P8BB 1YHQA 3MP8A 2EKOA 1W70A 2DERA 3CBOA 3BW1A 3H0FA 4E6RA 5IAYA 2GQVA 3UWNA 3CMAA 4J9BA 2K7AA 1BCOA 3QDFA 4CC7A 3MJXA 2YHTA 2EGAA 4EMKA 1K8AR 4C0ZA 3RKWA 1CSKA 2RJDA 1SKUB 1I81A 1UE9A 2JS2A 3QPHA 5IH2A 2J7IA 1X2KA 2FZKB 2PZ1A 4C92B 4QVDA 3EFRA 2VGMA 4C8QF 3MP1A 5J26A 2OAUA 3VU3C 4LDVA 4OB2B 1LPLA 5ECAA 3M0QA 3JCMJ 4HT9A 2XU8A 2ROTA 1SSHA 2LCLA 4PLLA 1VQ4Q 1KQSA 1DJ7B 2LNHB 2NYSA 1R8OB 2QQAA 3VUZA 1OX8A 4HKEA 3G71Q 2DK3A 2V8KA 3VJPA 3I5RA 2B8AA 2DL7A 1WJQA 4J8OA 1M3CA 4FIBA 3L42A 4BUGA 2DLPA 2RH2A 2J06A 2EKHA 3HPWA 2ZPBB 1ZUYA 5A0DA 3SWNB 1IO6A 2MMPA 2HQHA 4F7UF 1KHIA 1VQ5A 1OZ2A 2LP5A 4HVWA 4XU1A 2P4RA 4JS5A 3CPWP 2LCCA 2X4WA 4X1VA 1I07A 1MMDA 3JB9F 4C0DC 1SEMA 3OSVA 2CT4A 4C92D 1Q82R 4C8QC 3C95A 4K11A 4A63B 2CH4W 4PJNA 2RQRA 4F04B 5LJ5h 4F14A 4KGZB 1VQMT 1Y71A 1CKBA 2HKNA 3KBGA 4ZN1A 1W2BA 2J6FA 2CSIA 3MO8A 3P8HA 4FW2A 3CPWA 3X20B 4AFZC 1HK9A 2QQBA 4M7DB 2EQMA 1EFNA 1YN8A 1ZSZC 1WHLA 1AWWA 4AG2C 3G4SA 2E6NA 2X35A 4EIKA 3J80E 2QI2A 2OJ2A 1VQKA 5CAIA 1Q81U 2EYZA 2JT4A 3C94A 4M75D 4JDSA 3D7SB 1Y96B 1RAIB 4JJNK 2XDBA 2VC8A 4LNPA 1RAEB 5CIUA 4JZ4A 1OI1A 1X6GA 1OOTA 4KBMB 4NL2A 4CI0C 3JCMf 3QWYA 4HT8A 3M4YA 5GMKj 2ED0A 4II1A 1VQPA 2MK5A 5GAMh 4KT0E 5KYYB 1GCPA 1FMVA 4M78A 3CCUA 4DBQA 1NPPA 4C92E 1D3BA 3G7ZA 2EQKA 3M58A 4E7ZA 3EG0A 2HDAA 2DBMA 4IURA 2M02A 1PKSA 1M90C 1JB0E 2LTOA 4FSXA 3A8OB 2E64A 4JLIA 1VQ5Q 1UDLA 2KT1A 4C0DB 4ZN3A 4C8QB 2JNGA 1NZ9A 4LD9K 3MHXA 3OYJA 3VV0A 1NLOC 3NGPA 2JOYA 3CC4T 4Z89A 1BB9A 1H8KA 5I22A 1GRIA 2VXEA 2DZCA 2DXTA 3EFSA 1IRXA 4OMPA 4O6JA 4M75E 5CR2A 1NLPC 4PJOF 2ROLA 4OMOA 3CCQQ 1ZSZB 4D6WA 1NEBA 3L2VA 4A4GA 1G3YA 1VQ7Q 1YIJT 1K76A 4PJJA 2L0AA 2ZPIB 3VUBA 2FVUA 4Z02A 1AZGB 4IUUA 1IB8A 1K0SA 1QW1A 1QCFA 2MAMA 3DB4A 1QVGS 1RADB 3CPFA 2EQIA 6AT1B 4F7UB 1K9MC 1I0CA 3NFCA 1KIKA 1SG5A 2BIVA 2HNIA 2NUZA 8ATCB 3JCMb 2I2LA 1R0BG 3M9QA 4HVUA 1ZLMA 1SPKA 1VQPQ 3MP6A 3WXMB 3OYHA 3CCUQ 1YHQT 1QVFP 3OYAA 1Q81C 2XICA 3HHTB 3CMAT 4QQGA 2DO3A 4M77F 1RUWA 1RL2A 3A8MB 4D8KA 3S6WA 4PJOC 1QMCA 5I2SA 1S72A 4X34A 2E70A 2K5FA 2IG0A 2LQWA 4J9CA 4J9FA 1T0JA 4GLKA 3FEOA 3OSSC 3OYDA 5FWCA 4BY6C 1WQWA 2D0NA 2FRYA 2YSQA 4A4FA 1B34A 1Y07A 4RTZA 1EZZB 4FT2A 4WTOB 4MMLA 1QCNA 4RTTA 2XMFA 1Z9ZA 2DAQA 3CEYA 4E47A 3FJPA 3JSCA 1VQNA 5C6SA 1ZA1B 1I1JA 3LH5A 1X75C 3MPUB 3MEWA 3CCMA 3AT1B 2YRCA 1UG1A 1KD1U 1M90R 1HJDA 1YJ9Q 2JUFA 2RJFA 1EX4A 1UGQB 3HKSA 1X6OA 2DNUA 3EH1A 4C8QE 2CKKA 3GNGA 3M0PA 4FYYB 3GPLA 1KG1A 5IXBA 1BKBA 1MMAA 1U3OA 2HQEA 2MYSA 2PVDB 4IUQA 4M77C 3M0SA 1H92A 4N4IA 2RQVA 1AWJA 2XDPA 2CP6A 2IVWA 2A37A 5GAOr 2EQJA 4EPCA 4GBQA 2DA9A 2XDDA 2YXYA 3LX7A 1M2VA 1GCQC 4IUVA 3OYFA 2KDSA 3X25B 2GFAA 3CD6A 1U1TA 4PJOB 2O4XA 1O9SA 4P5NA 2RPNA 1D1AA 3I35A 3RKYA 3FIFA 4BY6B 2BKDN 5GJWB 4F7UE 1V29B 2D8JA 2CP5A 2DIQA 2HCKA 2K3BA 2AZVA 3H9NA 2RI3A 1RLPC 1X6BA 4JRQA 1K9MR 2KNBB 7AT1B 2BE7D 2KBTA 1NBEB 2F2XA 3G4ST 2E6ZA 4L5GA 1M30A 1VQKT 1VQNQ 5LJ5f 4OGEA 1KC8U 1E6HA 3BDLA 4RTUA 1VQLA 4PK4A 4NOYA 4N0AC 1M1KU 1Q81R 2LT1A 4A4HA 3H0HA 4HCCA 3OS1A 3QJ6A 3ZL7C 4L59A 3OYCA 5KYWA 3H8ZA 1WHHA 5KH6A 4OB1B 2CSQA 3VS2A 2CYZB 4M77B 2G3RA 2J6OA 2R58A 3X26B 2DTOA 5HK3A 3A98A 3PVQA 2XD0A 5GAOp 1T3SA 2YUQA 1YCYA 3V7CA 3JCMh 2YUNA 2IIMA 1K9AA 5FRNA 1U06A 3CC2T 1AT1B 4HXJA 1QCOA 2CS7A 2XIDA 1KD1C 5GANg 1ABQA 2PNIA 3A1PA 1MUZA 3JAME 1VOMA 3OYIA 1N27A 1OPLA 1Z9QA 3OYKA 3PNWC 2AT1B 2K3XA 3RUXA 4C0GA 3KXTA 1RI0A 1WHKA 3CBPA 5DLQE 1YI2T 1AWOA 4XQ3A 2RMOA 2JMCA 5HY6A 2DL3A 3CCJT 5IXFA 4M75A 3UATA 2EFIA 1D09B 2JTMA 1HD3A 5CO7A 3V7SA 3QG1A 3RMQA 4HCBA 3EG9B 4JJDA 5LJ5e 4CC3A 2RHXA 4ANJA 2JW4A 4XAXB 2LRQA 3A5ZB 3CC4A 2DE0X 4DEXA 2EYYA 4PJOE 3RBBB 2VUBA 4M7AF 2AZSA 4HCZA 3V8JA 1WFWA 4NL3A 3VS5A 1VQMQ 4FYXB 1XJWB 1P92A 3CC7A 1MHNA 2EYXA 4E7SA 3SFMA 4LDXA 2RQWA 2WACA 1KC8C 1OEBA 4HA8A 2JM9A 1SRMA 4E7KA 1M1KC 2A7YA 1JJ2A 2QGFB 5I2MA 3FLGA 1S72T 1YNZA 3UDCA 1PD1A 1RI9A 1W4SA 4ZGEB 9ATCB 1WXTA 2K4YA 5D7UA 1BI0A 3PFSA 1RAAB 1RAFB 2QASA 3EH2A 2M1HA 2EJ9A 3FRNA 4KH1B 1OULA 4J6WA 4ZNXA 3J81E 2KXCA 4UC4A 4M77E 3M57A 2D0QB 3OW2P 2ZPHB 3MCAB 2COWA 4J7IA 1AWXA 2KGTA 4F17A 2ZGWA 1WI7A 1LOJA 1IHVA 2QEXT 4M7AC 4B9XA 2FB7A 5GANd 2YLBA 4FCYA 3CCMT 3U23A 1K4US 3HP9A 2GQIA 3GF5A 3V8KA 2MPXC 1YWPA 3C0CA 5KYXB 1X43A 5LJ3d 3TREA 1WHMA 1KD1R 3EFOB 1KFZA 3C4SA 3CC4Q 1UGSB 1QQJA 2P0PA 3JCMP 2CP7A 1UTIA 4KGXB 2ZAEA 4QQ6A 1TUDA 2KSSA 2EYWA 2DXUA 2NUPB 4M7DC 2CP2A 2K3YA 5D6WA 3L2UA 3FJ5A 3UPUA 3R6NA 3RMSA 1JU5C 1YJNA 2JTEA 3EGXA 3AHUA 3TU4K 5M9OA 1YIJQ 1T3LA 2R57A 4JRKA 4LDYA 3CD6T 2K5IA 3I55T 2I0NA 1MGQA 2QGGA 2FHDA 1PSFA 4F16A 2A36A 4KH0B 1EIFA 1TUGB 3BE3A 5GAOm 2DL5A 4RTWA 4IUTA 2FPDA 4EMHA 2H8HA 2BZYA 3RR6A 3REBB 1HXDA 2B86A 2E10A 2YDLA 1XQHA 1PWTA 1K1ZA 2GBQA 3JB9J 1WJRA 2KRSA 1TU0B 1ZUKA 2EPDA 2DFUA 4M7AB 4PJMA 2D9TA 4N4GA 5DM7R 1VQLT 4HCKA 1TSFA 1N8RU 1YHQQ 1M4ZA 1UUEA 1WLPB 2KK4A 2AKLA 4R56A 2EGEA 2LX9A 1X2QA 3I56T 1B3QA 3CMAQ 1R0CB 2RQUA 3BY7A 2EJGA 1AHJB 5HK0A 4EMKC 3CCST 4J9IA 1YWOA 1M1KR 5GAN7 5IHIA 2RJCA 2LJ1A 3P8DA 1OPKA 1WHGA 3OS5A 2CDTA 5GAMj 4BE0A 2VXFA 2K6DA 2K9GA 5CQYA 3H0IA 2DYBA 4Y91A 2BZXA 3EGDA 1QKXA 5GAOn 3GLXA 2HSEB 3FC3A 3OYEA 3OA6A 3T9NA 5KE3A 2FPEA 3WVEB 1N9RA 5DLOA 5GMKm 2SEMA 4QQDA 5EG2A 2JS0A 1VQ9T 1YBYA 1LVKA 2OX7A 4PFOA 3M4GA 3NPFA 4C5EA 4GLMA 2F2VA 1UGPB 4J9EA 4M4ZA 2LMJA 2X9HA 2L5QA 1KQSS 4KULA 2PVOB 3LWHA 4C92G 2E41A 1Y0MA 3CQTA 4JPBW 1U8RA 1B07A 1QWEA 4J9GA 4ATOA 1RACB 1UFFA 3CC2A 2VVKA 5J3BA 2O2OA 3CCLA 1CKAA 3EHQA 2VKNA 4IKFA 4XTWA 1OZ3A 5AYFA 3UF4A 4AFSC 4M78F 3NTHA 4EMKB 1NEGA 4M7DD 1FMKA 3A8LB 3PIPA 4JZ3A 3UT1A 3PMTA 5GANf 1ZQ1A 1AVZC 2DMOA 1MV3A 5AT1B 5IN1A 2LNVA 3CC7T 2YUPA 4M75G 4Z8AA 1YI2A 3QHSA 1IZ6A 1M1FA 2FO0A 2JTFA 3OYMA 3META 5DY9A 1ZBXA 2MCNA 2CUDA 5LJ3f 3CCJA 2P84A 1QLYA 2DIGA 1SHGA 1YP5A 3G4SQ 3EHRA 3L2ZA 3FDRA 5FRMA 3KUFA 2GFUA 4A4KA 1W2BS 3GIBA 1VQKQ 1GFDA 4X9DA 2GCXA 4MMKA 3CMEA 3CPWS 3M59A 4BE2A 1YJWT 2EJFA 4LDWA 3VS3A 4DA4A 1AEYA 1X27A 4OP0A 3BFMA 2HSPA 2CZ6B 4XU2A 2RF0A 5KYUA 1NM7A 2X51A 4CC2A 3JCMe 1JEGA 4C8QD 5I21A 4M78C 3LWIA 1OU8A 3E9GA 3FB9A 1RLQC 2ECZA 4M7DE 1WQ7A 3GNFB 3LGLA 2CREA 2K5LA 3J7AF 3M5AA 3CC2Q 2O88A 4WF2A 2DILA 1VQ8A 4RCBA 1MMNA 1Y57A 3VYGA 3DLMA 4Y28E 1TTHB 2YLCA 3VKIA 1QVFA 2COZA 1NPRA 2QTVA 3SB2A 4AT1B 2OTJT 4FM4B 3HRSA 2DXBA 4MZMA 2YWWA 4JUVA 1D1BA 3TCJA 5GANe 1C0MA 1KQ1A 2KRNA 2AK5A 1GXIE 3PE0A 4CC4B 8AT1B 1K73U 2LZ6B 4FU6A 1YI2Q 2FRWA 1YJNT 1FYNA 2MOXA 5GAOq 2V8IA 2X4XA 3S3NA 2NUTA 2QEXA 1D1CA 2GTOA 2XK0A 5LJ3e 4JRPA 3CCJQ 4AG1C 2O01E 1MNDA 3TSZA 3JB9D 4PFPA 3PMIA 3CCET 3MEVA 1UEBA 3HSBA 4OMLA 3VS6A 4C8QG 2DL8A 2F5TX 1JXOA 3E9FA 2VWFA 2E1HA 2RK1A 1JXMA 3OB9A 1PKTA 5HCKA 3QDRB 4JS4A 3RKXA 3REAB 3E19A 1WHJA 4M78B 2WSFE 1D3BB 1M8MA 1IXDA 3RNJA 4RTVA 2H3EB 3EG1A 5KE2A 1PG5B 4LXCA 4R0KA 1KK7A 1F1BB 2JMAA 2LT4A 2F5KA 2F69A 2A3LA 1D0XA 2OTLT 2O9SA 2W0ZA 3I55A 2YRDA 2KI7A 2L89A 5CKFA 1M3AA 2PU9B 2FEIA 3INZA 3TQ7P 3ULRB 2KXDA 1S72Q 4IIOA 4F7UG 3A8GB 1BYMA 4D8DA 4OMMA 2V1RA 4GY5A 1PSEA 2PUKB 5CKDA 4E7IA 4PL6A 1WX6A 3M0RA 1QWFA 4FSSA 3VYHB 1G5VA 1M3BA 2QDYB 2COYA 2BTTA 2JZ2A 3M55A 2RHYA 1NJIU 3ME9A 1LNXA 1GBRA 2FL7A 1OQKA 1AOJA 2RK2A 2QXFA 4E7LA 3E1SA 2QEXQ 1QVFS 3L2RA 3I56A 2YRVA 2LQ8A 2Y4XA 3I9QA 1TH7A 1VIFA 3CCMQ 4C5GA 3CCSA 2P0KA 1XNIA 4ME7A 5CK9A 2GNCA 3OQ5A 1K0XA 1OYXA 2KRMA 1QP2A 1HSQA 1MMGA 2ABLA 4WCIA 1WPYA 3PT9A 3EGUA 1KJWA 4JJCA 4LDUA 1TG0A 4PJOD 1TWBA 2E3HA 2ZPGB 4J9DA 3HFOA 1GFCA 3QBYA 3CCLT 1G2BA 4C92A 2L3SA 1GL5A 4A54A 3CXCP 4LUDA 2VV5A 4KUDK 4FW1A 2O9VA 3QZ9B 4J6YA 2WSEE 1YITA 2V1QA 1VQ9A 3CD6Q 3I55Q 2RM4A 1TS9A 2F1LA 3CCVA 3G6EA 4C92F 3M0TA 3ZFJA 4TVRA 1B34B 3G1JA 4XK8E 3PGGA 5EC7A 2BUDA 5D6XA 5GANh 4FYWB 1VYUA 1VYVA 3NMZC 2DBKA 4M78E 4C5HA 2X4JA 3LLRA 5GJVB 4XTUA 2MF2A 3MKDA 2O31A 2M9UA 2EGCA 2E5QA 5LJ3h 3CMET 4M77D 3SWNA 3I5SA 1VQLQ 2EYQA 1PRLC 1TOVA 2SRCA 3QUIA 1M9SA 1QVPA 2QQRA 2HAXA 2XI9A 1I4K1 4DBRA 3I56Q 4M75F 4PJOG 4XU3A 4RCCA 2DVEA 3OYBA 3CCSQ 2YUOA 3MEAA 1JBMA 1WXBA 3OBWA 4KUIA 4ZGDB 2KROA 4BE1A 4LUEA 2KY9A 5CQXA 1NJIC 2JN0A 2KEAA 2PVGB 2ZPFB 4LD6A 1G3WA 4BD3A 2M16A 4ELZC 2R5AA 1M2VB 1VQ8T 1AZEA 2KVQG 1VQ4A 3CCRT 2O4XB 2DEUA 3ZEHA 4RG2A 1YJWA 3G71A 4Q5WA 5FU6C 2A0FB 2HEQA 1QP3A 5FW9A 3SHWA 1VQ9Q 2L2PA 2NLUA 2W10A 3CCVQ 3NHNA 2DRKA 4XTXA 1M2OA 4M77G 1KSWA 5L23A 2K2VA 1GBQA 3X28B 4RMOA 2QA4T 4M75C 2RHIA 2EAYA 2MWOA 2CT3A 3QXEB 1PM3A 4DBFA 5KYYA 1ARKA 1BCMA 1E6GA 4IIMA 4J5YA 2RB6A 4BDYA 3OW2A 2CP3A 5CVIA 1M5Q1 5KYWB 4RG8A 1IGUA 3OS2A 2OTJA 4ZGJB 4Z88A 4C8QA 4C0FA 4EDUA 1PRMC 2DL4A 3JB9I 1LJOA 1H641 1M1GA 2FZCB 2FPFA 1Q86U 2EIFA 3CC7Q 3SEMA 3HTRA 2X3WD 3TSWA 4OB0B 1VQOA 4KGVB 4OF1A 1KQSP 1OU9A 2KAFA 2RD1A 5GAN5 2RNAA 5GMKe 2QYZA 2X4YA 3DB3A 4LN2A 4O5VA 2DTIA 4BI8B 3JRZA 3A8HB 1ZSZA 5LJ5j 1Q7YU 1PCXA 3CCEA 4RTYA 1VQ6T 3HL8A 3QJYA 1UHCA 4DQ2A 5FU6B 2EWNA 1G3SA 2G6FX 4AFUC 2KMTA 1SRLA 1M90U 2HQXA 2Y90A 2BZ8A 1YJWQ 1J3TA 2DZ9A 2AHJB 2K79A 4HVVA 4N4HA 2RHUA 4KRTA 2P4TA 2ZCFB 4MZPA 2ESWA 1BU1A 4F7UA 1BI1A 3V7RA 1FXXA 1JJ2S 3QKJA 1JRIA 4M75B 2CUBA 1FWZA 2C0OA 4FYVB 4AMCA 5I11A 5GAN6 3O8VA 3QSUA 3OS0A 1NJIR 5LJ5g 1C6VX 1UGVA 2PUOB 4AFQC 1KC8R 2OTLA 1XTDA 1XOVA 1PHTA 1OX9A 2DRMA 1W2BP 2X3XD 1QVGP 2VB6A 2CZ7B 4J83A 4BACA 4OVAA 4ESRA 2DXCA 1D0ZA 1ABOA 2AIRB 1IREB 2OTJQ 1JQQA 5LL6S 3V8LA 5IHKA 2CP0A 1B7TA 3RERA 1QVGA 1PD0A 4OB3B 5GAN4 1W6XA 4BB7A 1M8VA 1K9MU 2XG8D 3CCQA 1VQOQ 1Y7XA 1SHFA 3OMGA 4ZTJA 1YJNQ 3OW2S 5FWBA 4A4EA 1VQ7A 2V26A 2RHZA 1YITT 1O75A 2ZPEB 3JCMQ 2RA2A 5GAOl 2GGRA 3ZBDA 5FLXE 1VYTA 3LYIA 3H41A 3CCVT 3G6ET 3CCEQ 5GAMg 2CH4A 4M7AD 2V8JA 2LQNA 4QW2A 4ORZA 3QO3A 2OI3A 3LH0A 1Q86C 3VS0A 3E2UA 2QTXA 2BE9B 4OMQA 5GAN2 1X69A 4ZTFA 1I5OB 2DJZA 3OYYA 2E5KA 5GMKi 3URGA 1Q7YC 1H3ZA 3RDVA 4DBHA 1WGSA 2A08A 2HL3A 1G3TA 4XTZA 4BDZA 2L3QA 2L3RA 4J6XA 2OTLQ 3F70A 3C12A 4E7HA 1V1CA 3SDZA 2LDMA 3QYGB 4FT4A 4NS5A 4CRIA 5CKEA 2EVRA 4PJOA 4X9CA 2DJQA 2OAWA 2VGNA 5L8RE 1UB4A
chains in the Genus database with same CATH topology
2DL7A 2JMAA 2NWMA 2M51A 1M3CA 3UA6A 4JJDA 4CC3A 2JW4A 2O9SA 2W0ZA 2DLPA 2DE0X 3PVLA 2J06A 4DEXA 2EYYA 3RBBB 1M3AA 2EKHA 1A0NB 2AZSA 2FEIA 1NG2A 1WFWA 4LE9A 3ULRB 3VS5A 2KXDA 1ZUYA 1IO6A 1U5SA 4IIOA 2RN8A 4D8DA 2EYXA 4OMMA 2LP5A 2V1RA 4HVWA 2P4RA 1WX6A 3M0RA 1QWFA 4FSSA 2RQWA 4X1VA 1I07A 1M3BA 1SEMA 2CT4A 1OEBA 3VRYA 2BTTA 1ZUUA 2JM9A 1SRMA 4K11A 2JM8A 2CH4W 4A63B 2RQRA 1GBRA 1AOJA 4F14A 1CKBA 2J6FA 1YNZA 3TVTA 2CSIA 1WIEA 3I9QA 1RI9A 1WXTA 3VS4A 1E7OA 4AFZC 2GNCA 3VRZA 1EFNA 1YN8A 2HBWA 1K0XA 3QWXX 1AWWA 4AG2C 2KRMA 2LJ0A 1HSQA 4ZNXA 2KXCA 2ABLA 4EIKA 4WCIA 1GCQA 3EGUA 2OJ2A 1KJWA 2EYZA 2FG0A 2JT4A 1AWXA 2KGTA 4JJCA 4F17A 1AD5A 1TG0A 1WI7A 2EBPA 1YCSB 4J9DA 4LNPA 1GFCA 2J6KA 1G2BA 4JZ4A 3U23A 2L3SA 1S1NA 3EG3A 1K4US 2GQIA 1GL5A 1X6GA 1OOTA 4LUDA 3O5ZA 1YWPA 3C0CA 3VS7A 2M0YA 1LCKA 1X43A 2O9VA 3QWYA 2V1QA 1KFZA 2ED0A 1GCPA 1UTIA 3EG0A 3M0TA 2MIOA 1TUDA 2HDAA 2DBMA 1QKWA 2EYWA 5EC7A 1PKSA 3FJ5A 3R6NA 1JU5C 1UDLA 2KT1A 1VYUA 2JTEA 4QT7A 1VYVA 3NMZC 2DBKA 1NYFA 5GJVB 1T3LA 2C0TA 1NLOC 3NGPA 2EW3A 2O31A 2EGCA 2I0NA 4Z89A 4F16A 1BB9A 1H8KA 5I22A 2A36A 1GRIA 3I5SA 2DL5A 4RTWA 1PRLC 4OMNA 2SRCA 4OMPA 2FPDA 4J9HA 1JO8A 2H8HA 2BZYA 1NLPC 1G83A 2ROLA 4OMOA 3REBB 2B86A 1NEBA 2YDLA 3KFVA 2A28A 3GBQA 2YUOA 1K76A 2DX1A 2L0AA 1WXBA 1PWTA 1K1ZA 2GBQA 1M27C 2KRSA 2KROA 4LUEA 1ZUKA 1AZGB 2EPDA 2D8HA 2KEAA 4Y92A 1NYGA 1K0SA 1UJYA 4HCKA 1QCFA 1ZX6A 1T0HA 1UUEA 1WLPB 2AKLA 2EGEA 2RQTA 2ENMA 1X2QA 2EQIA 1B3QA 2RQUA 1UJ0A 2PTKA 2KE9A 1AZEA 4J9IA 1YWOA 1I0CA 5IHIA 4JJBA 1KIKA 2LJ1A 3M0UA 1UHFA 2QDLA 1OPKA 2NUZA 2CDTA 2HEQA 4HVUA 5FW9A 3SHWA 1ZLMA 1SPKA 2K6DA 2K9GA 3H0IA 2DYBA 2L2PA 2BZXA 2W10A 3NHNA 1QKXA 1WA7A 2DRKA 2KYBA 1KSWA 1RUWA 5L23A 1GBQA 4D8KA 4RTXA 2GTJA 2FPEA 2LQWA 4J9CA 4J9FA 2CT3A 2DF6A 2SEMA 2ED1A 1ARKA 1H3HA 2JS0A 1T0JA 1E6GA 4IIMA 1N5ZA 1UECA 1TUCA 5FWCA 1WYXA 2D0NA 2FRYA 2YSQA 4RTZA 3NPFA 2LCSA 2AKKA 4GLMA 4RTTA 2F2VA 2XMFA 1Z9ZA 4J9EA 4M4ZA 2LMJA 4RUGA 2L3PA 2LJ3A 4Z88A 1Y0MA 3CQTA 4JPBW 1PRMC 1B07A 2DL4A 1QWEA 4J9GA 1I1JA 3LH5A 1UFFA 2FPFA 2VVKA 2O2OA 1ZBJA 3SEMA 2X3WD 3TSWA 2LX7A 1CKAA 3EHQA 2VKNA 1UG1A 1HJDA 3THKA 3UF4A 2RNAA 4AFSC 2DNUA 2KR3A 4LN2A 3M0PA 1NEGA 1FMKA 5IXBA 1U3OA 4JZ3A 4RTYA 1AVZC 1UHCA 2DMOA 3M0SA 1MV3A 1H92A 2G6FX 4AFUC 2RQVA 1AWJA 1SRLA 2YUPA 4Z8AA 2BZ8A 2F2WA 1J3TA 2A37A 2FO0A 2K79A 4HVVA 2MCNA 4GBQA 4KRTA 3IQLA 2CUDA 1VA7A 2DA9A 2ESWA 1BU1A 1QLYA 2JXBA 1SHGA 4DEYA 1GCQC 1YP5A 3EHRA 2DM1A 2CUBA 2C0OA 2J05A 5I11A 1GFDA 3EG2A 1OV3A 2RPNA 1MV0B 3I35A 2K2MA 1UGVA 4AFQC 1W1FA 1XOVA 1PHTA 5GJWB 2D8JA 2DRMA 1WXUA 2HCKA 3VS3A 2K3BA 2AZVA 1AEYA 2X3XD 1ZSGA 1X27A 1RLPC 1X6BA 2KNBB 2KYMA 1WDXA 4ESRA 2KBTA 2F2XA 2HSPA 2RF0A 4CC2A 1NM7A 1ABOA 3JV3A 1JEGA 3UA7A 1M30A 2C0IA 1RLQC 2D1XA 2ECZA 1JQQA 2DVJA 1E6HA 4RTUA 5IHNA 5IHKA 2YT6A 2CREA 1W6XA 2O88A 1PNJA 2DILA 1SHFA 3H0HA 3VS1A 5FWBA 3ZL7C 1Y57A 2CSQA 3VS2A 2GGRA 2J6OA 1VYTA 2KT8A 3H41A 1BBZA 3A98A 1BK2A 3PVQA 1T3SA 2YUQA 2CH4A 2LQNA 2KRNA 2YUNA 1W70A 2IIMA 1K9AA 2AK5A 1U06A 4ORZA 3H0FA 4E6RA 3PE0A 2OI3A 4CC4B 4HXJA 2LZ6B 4J9BA 2K7AA 2FRWA 3VS0A 1FYNA 2MOXA 4CC7A 2EGAA 4OMQA 1X69A 1ABQA 2GTOA 2PNIA 1CSKA 1MUZA 2JS2A 1UE9A 5IH2A 4AG1C 2E5KA 2J7IA 3TSZA 1X2KA 2PZ1A 1OPLA 1Z9QA 4OMLA 3VS6A 2DL8A 2A08A 1JXOA 2VWFA 1JXMA 2L3QA 5ECAA 1AWOA 3M0QA 1PKTA 5HCKA 2ROTA 2RMOA 1SSHA 3REAB 2JMCA 2DL3A 2LNHB 1V1CA 1M8MA 2EVRA 3RNJA 4RTVA 5IXFA 3UATA 3EG1A 2DJQA 2OAWA 3I5RA 4R0KA 1HD3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DL7 A;  2JMA A;  2NWM A;  2M51 A;  1M3C A;  3UA6 A;  4JJD A;  4CC3 A;  2JW4 A;  2O9S A;  2W0Z A;  2DLP A;  2DE0 X;  3PVL A;  2J06 A;  4DEX A;  2EYY A;  3RBB B;  1M3A A;  2EKH A;  1A0N B;  2AZS A;  2FEI A;  1NG2 A;  1WFW A;  4LE9 A;  3ULR B;  3VS5 A;  2KXD A;  1ZUY A;  1IO6 A;  1U5S A;  4IIO A;  2RN8 A;  4D8D A;  2EYX A;  4OMM A;  2LP5 A;  2V1R A;  4HVW A;  2P4R A;  1WX6 A;  3M0R A;  1QWF A;  4FSS A;  2RQW A;  4X1V A;  1I07 A;  1M3B A;  1SEM A;  2CT4 A;  1OEB A;  3VRY A;  2BTT A;  1ZUU A;  2JM9 A;  1SRM A;  4K11 A;  2JM8 A;  2CH4 W;  4A63 B;  2RQR A;  1GBR A;  1AOJ A;  4F14 A;  1CKB A;  2J6F A;  1YNZ A;  3TVT A;  2CSI A;  1WIE A;  3I9Q A;  1RI9 A;  1WXT A;  3VS4 A;  1E7O A;  4AFZ C;  2GNC A;  3VRZ A;  1EFN A;  1YN8 A;  2HBW A;  1K0X A;  3QWX X;  1AWW A;  4AG2 C;  2KRM A;  2LJ0 A;  1HSQ A;  4ZNX A;  2KXC A;  2ABL A;  4EIK A;  4WCI A;  1GCQ A;  3EGU A;  2OJ2 A;  1KJW A;  2EYZ A;  2FG0 A;  2JT4 A;  1AWX A;  2KGT A;  4JJC A;  4F17 A;  1AD5 A;  1TG0 A;  1WI7 A;  2EBP A;  1YCS B;  4J9D A;  4LNP A;  1GFC A;  2J6K A;  1G2B A;  4JZ4 A;  3U23 A;  2L3S A;  1S1N A;  3EG3 A;  1K4U S;  2GQI A;  1GL5 A;  1X6G A;  1OOT A;  4LUD A;  3O5Z A;  1YWP A;  3C0C A;  3VS7 A;  2M0Y A;  1LCK A;  1X43 A;  2O9V A;  3QWY A;  2V1Q A;  1KFZ A;  2ED0 A;  1GCP A;  1UTI A;  3EG0 A;  3M0T A;  2MIO A;  1TUD A;  2HDA A;  2DBM A;  1QKW A;  2EYW A;  5EC7 A;  1PKS A;  3FJ5 A;  3R6N A;  1JU5 C;  1UDL A;  2KT1 A;  1VYU A;  2JTE A;  4QT7 A;  1VYV A;  3NMZ C;  2DBK A;  1NYF A;  5GJV B;  1T3L A;  2C0T A;  1NLO C;  3NGP A;  2EW3 A;  2O31 A;  2EGC A;  2I0N A;  4Z89 A;  4F16 A;  1BB9 A;  1H8K A;  5I22 A;  2A36 A;  1GRI A;  3I5S A;  2DL5 A;  4RTW A;  1PRL C;  4OMN A;  2SRC A;  4OMP A;  2FPD A;  4J9H A;  1JO8 A;  2H8H A;  2BZY A;  1NLP C;  1G83 A;  2ROL A;  4OMO A;  3REB B;  2B86 A;  1NEB A;  2YDL A;  3KFV A;  2A28 A;  3GBQ A;  2YUO A;  1K76 A;  2DX1 A;  2L0A A;  1WXB A;  1PWT A;  1K1Z A;  2GBQ A;  1M27 C;  2KRS A;  2KRO A;  4LUE A;  1ZUK A;  1AZG B;  2EPD A;  2D8H A;  2KEA A;  4Y92 A;  1NYG A;  1K0S A;  1UJY A;  4HCK A;  1QCF A;  1ZX6 A;  1T0H A;  1UUE A;  1WLP B;  2AKL A;  2EGE A;  2RQT A;  2ENM A;  1X2Q A;  2EQI A;  1B3Q A;  2RQU A;  1UJ0 A;  2PTK A;  2KE9 A;  1AZE A;  4J9I A;  1YWO A;  1I0C A;  5IHI A;  4JJB A;  1KIK A;  2LJ1 A;  3M0U A;  1UHF A;  2QDL A;  1OPK A;  2NUZ A;  2CDT A;  2HEQ A;  4HVU A;  5FW9 A;  3SHW A;  1ZLM A;  1SPK A;  2K6D A;  2K9G A;  3H0I A;  2DYB A;  2L2P A;  2BZX A;  2W10 A;  3NHN A;  1QKX A;  1WA7 A;  2DRK A;  2KYB A;  1KSW A;  1RUW A;  5L23 A;  1GBQ A;  4D8K A;  4RTX A;  2GTJ A;  2FPE A;  2LQW A;  4J9C A;  4J9F A;  2CT3 A;  2DF6 A;  2SEM A;  2ED1 A;  1ARK A;  1H3H A;  2JS0 A;  1T0J A;  1E6G A;  4IIM A;  1N5Z A;  1UEC A;  1TUC A;  5FWC A;  1WYX A;  2D0N A;  2FRY A;  2YSQ A;  4RTZ A;  3NPF A;  2LCS A;  2AKK A;  4GLM A;  4RTT A;  2F2V A;  2XMF A;  1Z9Z A;  4J9E A;  4M4Z A;  2LMJ A;  4RUG A;  2L3P A;  2LJ3 A;  4Z88 A;  1Y0M A;  3CQT A;  4JPB W;  1PRM C;  1B07 A;  2DL4 A;  1QWE A;  4J9G A;  1I1J A;  3LH5 A;  1UFF A;  2FPF A;  2VVK A;  2O2O A;  1ZBJ A;  3SEM A;  2X3W D;  3TSW A;  2LX7 A;  1CKA A;  3EHQ A;  2VKN A;  1UG1 A;  1HJD A;  3THK A;  3UF4 A;  2RNA A;  4AFS C;  2DNU A;  2KR3 A;  4LN2 A;  3M0P A;  1NEG A;  1FMK A;  5IXB A;  1U3O A;  4JZ3 A;  4RTY A;  1AVZ C;  1UHC A;  2DMO A;  3M0S A;  1MV3 A;  1H92 A;  2G6F X;  4AFU C;  2RQV A;  1AWJ A;  1SRL A;  2YUP A;  4Z8A A;  2BZ8 A;  2F2W A;  1J3T A;  2A37 A;  2FO0 A;  2K79 A;  4HVV A;  2MCN A;  4GBQ A;  4KRT A;  3IQL A;  2CUD A;  1VA7 A;  2DA9 A;  2ESW A;  1BU1 A;  1QLY A;  2JXB A;  1SHG A;  4DEY A;  1GCQ C;  1YP5 A;  3EHR A;  2DM1 A;  2CUB A;  2C0O A;  2J05 A;  5I11 A;  1GFD A;  3EG2 A;  1OV3 A;  2RPN A;  1MV0 B;  3I35 A;  2K2M A;  1UGV A;  4AFQ C;  1W1F A;  1XOV A;  1PHT A;  5GJW B;  2D8J A;  2DRM A;  1WXU A;  2HCK A;  3VS3 A;  2K3B A;  2AZV A;  1AEY A;  2X3X D;  1ZSG A;  1X27 A;  1RLP C;  1X6B A;  2KNB B;  2KYM A;  1WDX A;  4ESR A;  2KBT A;  2F2X A;  2HSP A;  2RF0 A;  4CC2 A;  1NM7 A;  1ABO A;  3JV3 A;  1JEG A;  3UA7 A;  1M30 A;  2C0I A;  1RLQ C;  2D1X A;  2ECZ A;  1JQQ A;  2DVJ A;  1E6H A;  4RTU A;  5IHN A;  5IHK A;  2YT6 A;  2CRE A;  1W6X A;  2O88 A;  1PNJ A;  2DIL A;  1SHF A;  3H0H A;  3VS1 A;  5FWB A;  3ZL7 C;  1Y57 A;  2CSQ A;  3VS2 A;  2GGR A;  2J6O A;  1VYT A;  2KT8 A;  3H41 A;  1BBZ A;  3A98 A;  1BK2 A;  3PVQ A;  1T3S A;  2YUQ A;  2CH4 A;  2LQN A;  2KRN A;  2YUN A;  1W70 A;  2IIM A;  1K9A A;  2AK5 A;  1U06 A;  4ORZ A;  3H0F A;  4E6R A;  3PE0 A;  2OI3 A;  4CC4 B;  4HXJ A;  2LZ6 B;  4J9B A;  2K7A A;  2FRW A;  3VS0 A;  1FYN A;  2MOX A;  4CC7 A;  2EGA A;  4OMQ A;  1X69 A;  1ABQ A;  2GTO A;  2PNI A;  1CSK A;  1MUZ A;  2JS2 A;  1UE9 A;  5IH2 A;  4AG1 C;  2E5K A;  2J7I A;  3TSZ A;  1X2K A;  2PZ1 A;  1OPL A;  1Z9Q A;  4OML A;  3VS6 A;  2DL8 A;  2A08 A;  1JXO A;  2VWF A;  1JXM A;  2L3Q A;  5ECA A;  1AWO A;  3M0Q A;  1PKT A;  5HCK A;  2ROT A;  2RMO A;  1SSH A;  3REA B;  2JMC A;  2DL3 A;  2LNH B;  1V1C A;  1M8M A;  2EVR A;  3RNJ A;  4RTV A;  5IXF A;  3UAT A;  3EG1 A;  2DJQ A;  2OAW A;  3I5R A;  4R0K A;  1HD3 A; 
#chains in the Genus database with same CATH topology
 1FX7 A;  2NWM A;  2M51 A;  3UA6 A;  3EGX B;  1N8R C;  5LJ5 d;  2E65 A;  1VUB A;  3PVL A;  5GMK l;  5GMK h;  4M7A E;  4M7A G;  1VQ4 T;  1A0N B;  1NG2 A;  4LE9 A;  3MEU A;  3G71 T;  1U5S A;  1X01 A;  3DLL A;  2RN8 A;  2HZY A;  4QVC A;  1YJ9 A;  5FU7 C;  1ACM B;  3HFN A;  2H3J A;  2DEQ A;  3LGF A;  4EMG A;  3VRY A;  5IT9 E;  1ZUU A;  3N5B B;  2JM8 A;  2QQS A;  2QG9 B;  4RKU E;  2RI5 A;  3ASK A;  4M7D G;  3S3O A;  5A0L A;  3TVT A;  4M77 A;  3GP8 A;  3WVD B;  1WIE A;  4XTY A;  5KYN A;  3CCL Q;  2GF7 A;  3VS4 A;  3CCR A;  1E7O A;  1BIB A;  2MWP A;  5GAM d;  2JJ9 A;  3VRZ A;  4OMF B;  2HBW A;  3QWX X;  2LJ0 A;  3CBM A;  1GCQ A;  2DET A;  3Q1J A;  2FG0 A;  1AD5 A;  4B9W A;  3JCM c;  2EBP A;  2QQ9 A;  2HMA A;  1YCS B;  3EGD B;  2J6K A;  2RO0 A;  2QK0 A;  1VQO T;  4IUP A;  3L2W A;  1S1N A;  3EG3 A;  2QA4 A;  1KHC A;  3O5Z A;  1Q86 R;  1D0Y A;  3VS7 A;  2M0Y A;  1BI3 A;  1LCK A;  2HD0 A;  3L2Q A;  2K57 A;  5HKC A;  2D6F A;  1RAH B;  3X24 B;  3CME Q;  2DPP B;  2MIO A;  4VUB A;  1Q7Y R;  1QKW A;  2CGH A;  3OY9 A;  2CZ0 B;  5FU7 B;  3EAE A;  1K8A U;  4N0A A;  2HL5 C;  3EG9 A;  4QT7 A;  4FL6 A;  2XKO C;  3RIR A;  3PIO A;  1NYF A;  2C0T A;  2EW3 A;  1MNE A;  4R55 A;  5CKH A;  3OMC A;  2IPO B;  2LC4 A;  2DTH A;  4OMN A;  4XTV A;  4J9H A;  1JO8 A;  1N8R R;  2FZG B;  1ZHI A;  1VQ6 A;  1VQ5 T;  1G83 A;  1RAB B;  3GOX A;  1VQ8 Q;  3KFV A;  2A28 A;  3GBQ A;  3CCR Q;  3QII A;  2R5M A;  2DX1 A;  2Y4Y A;  1M27 C;  2LVM A;  1V76 A;  1VIE A;  5KCO A;  3ER0 A;  1C1A A;  4PJL A;  2D8H A;  2L8D A;  4Y92 A;  1NYG A;  4C5I A;  3QZ5 B;  1UJY A;  3JB9 G;  1ZX6 A;  3OYL A;  3SD4 A;  1T0H A;  2FYK A;  3QYH B;  2RQT A;  2ENM A;  2DYI A;  2CZ1 B;  1UJ0 A;  1FMW A;  3CCQ T;  2PTK A;  2KE9 A;  4MDW A;  1VQ7 T;  1UGR B;  1N6A A;  2QA4 Q;  3NTK A;  4V2S A;  4JJB A;  3JB9 H;  3M0U A;  1UHF A;  2QDL A;  4M78 D;  5CKB A;  5A2Q E;  4DOW A;  1Q95 G;  5CCA A;  2HBP A;  1Q82 U;  4PLI A;  4A53 A;  1WA7 A;  2E3I A;  2KYB A;  5A0G A;  3HRU A;  4PKC C;  3JCM g;  1ZA2 B;  5KYU B;  5GAN j;  1K73 C;  1I5L A;  3LW5 E;  2VAS A;  5KYX A;  4RTX A;  1BI2 A;  2GTJ A;  1VQM A;  3M53 A;  3EFO A;  2VYT A;  1N9S A;  2DF6 A;  2ED1 A;  1YFN A;  3RES A;  1H3H A;  5D6Y A;  4E2F B;  1VQP T;  2WSC E;  1N5Z A;  1UEC A;  1TUC A;  5LJ3 j;  1WYX A;  3CCU T;  4PNO A;  2MI6 A;  2NUP A;  2LCS A;  2AKK A;  1WJS A;  4RUG A;  2L3P A;  4BI4 A;  2LJ3 A;  1K8A C;  1VQ6 Q;  5C0M A;  3CXC A;  1KQ2 A;  1U1S A;  4JLG A;  2RI2 A;  3H6Z A;  3HRT A;  2C06 A;  2PQW A;  1ZBJ A;  1IGQ A;  2LX7 A;  2E4H A;  5GAM f;  1RAG B;  4J7F A;  3THK A;  4M78 G;  2KR3 A;  3TEE A;  2EQU A;  2NUT B;  5LJ3 g;  1HYO A;  4XU0 A;  4L6V 5;  5FRO A;  1I8F A;  1TXQ A;  4YTL A;  5GAN 8;  4M7A A;  2F2W A;  5GAN 3;  3M56 A;  1WZO A;  4QVZ A;  4DOV A;  1YJ9 T;  1WNL A;  4OGC A;  2ATC B;  3BDU A;  3IQL A;  1VA7 A;  2JXB A;  4DEY A;  1BIA A;  1PC0 A;  2DM1 A;  2E12 A;  2DKG A;  2J05 A;  3NTI A;  3EG2 A;  2RJE A;  2KQW A;  1OV3 A;  2Z0W A;  4MDX A;  1MV0 B;  2QAZ A;  4C92 C;  2K2M A;  3OYG A;  1JJ2 P;  1W1F A;  4JRI A;  2JVV A;  4M7D A;  1WXU A;  3OYN A;  1SSF A;  2P0Q A;  1ZSG A;  2XHC A;  1IHW A;  2KYM A;  1Q82 C;  1WDX A;  4MZT A;  1YIJ A;  5J39 A;  1YIT Q;  3JV3 A;  3UA7 A;  2DD4 A;  4BI3 A;  3R6O A;  1Y96 A;  3JCM d;  2C0I A;  3S3M A;  1NE8 A;  2D1X A;  2LQK A;  2DVJ A;  3G6E Q;  5IHN A;  2YT6 A;  4M7D F;  2HKQ B;  3M54 A;  5KCH A;  2DD5 A;  1PNJ A;  1G8X A;  3L1A A;  5GAM e;  3VS1 A;  1K73 R;  2ZZD A;  4QKU A;  4ELY C;  3JCM X;  1R77 A;  2M0O A;  3PTA A;  3JCM W;  1VQN T;  2KT8 A;  1SF9 A;  3SWN C;  1BBZ A;  3JCM V;  4B6M A;  1BK2 A;  4PFZ A;  4E7J A;  3CXC S;  3OBY A;  3DKM A;  3P8B B;  1YHQ A;  3MP8 A;  2EKO A;  1W70 A;  2DER A;  3CBO A;  3BW1 A;  3H0F A;  4E6R A;  5IAY A;  2GQV A;  3UWN A;  3CMA A;  4J9B A;  2K7A A;  1BCO A;  3QDF A;  4CC7 A;  3MJX A;  2YHT A;  2EGA A;  4EMK A;  1K8A R;  4C0Z A;  3RKW A;  1CSK A;  2RJD A;  1SKU B;  1I81 A;  1UE9 A;  2JS2 A;  3QPH A;  5IH2 A;  2J7I A;  1X2K A;  2FZK B;  2PZ1 A;  4C92 B;  4QVD A;  3EFR A;  2VGM A;  4C8Q F;  3MP1 A;  5J26 A;  2OAU A;  3VU3 C;  4LDV A;  4OB2 B;  1LPL A;  5ECA A;  3M0Q A;  3JCM J;  4HT9 A;  2XU8 A;  2ROT A;  1SSH A;  2LCL A;  4PLL A;  1VQ4 Q;  1KQS A;  1DJ7 B;  2LNH B;  2NYS A;  1R8O B;  2QQA A;  3VUZ A;  1OX8 A;  4HKE A;  3G71 Q;  2DK3 A;  2V8K A;  3VJP A;  3I5R A;  2B8A A;  2DL7 A;  1WJQ A;  4J8O A;  1M3C A;  4FIB A;  3L42 A;  4BUG A;  2DLP A;  2RH2 A;  2J06 A;  2EKH A;  3HPW A;  2ZPB B;  1ZUY A;  5A0D A;  3SWN B;  1IO6 A;  2MMP A;  2HQH A;  4F7U F;  1KHI A;  1VQ5 A;  1OZ2 A;  2LP5 A;  4HVW A;  4XU1 A;  2P4R A;  4JS5 A;  3CPW P;  2LCC A;  2X4W A;  4X1V A;  1I07 A;  1MMD A;  3JB9 F;  4C0D C;  1SEM A;  3OSV A;  2CT4 A;  4C92 D;  1Q82 R;  4C8Q C;  3C95 A;  4K11 A;  4A63 B;  2CH4 W;  4PJN A;  2RQR A;  4F04 B;  5LJ5 h;  4F14 A;  4KGZ B;  1VQM T;  1Y71 A;  1CKB A;  2HKN A;  3KBG A;  4ZN1 A;  1W2B A;  2J6F A;  2CSI A;  3MO8 A;  3P8H A;  4FW2 A;  3CPW A;  3X20 B;  4AFZ C;  1HK9 A;  2QQB A;  4M7D B;  2EQM A;  1EFN A;  1YN8 A;  1ZSZ C;  1WHL A;  1AWW A;  4AG2 C;  3G4S A;  2E6N A;  2X35 A;  4EIK A;  3J80 E;  2QI2 A;  2OJ2 A;  1VQK A;  5CAI A;  1Q81 U;  2EYZ A;  2JT4 A;  3C94 A;  4M75 D;  4JDS A;  3D7S B;  1Y96 B;  1RAI B;  4JJN K;  2XDB A;  2VC8 A;  4LNP A;  1RAE B;  5CIU A;  4JZ4 A;  1OI1 A;  1X6G A;  1OOT A;  4KBM B;  4NL2 A;  4CI0 C;  3JCM f;  3QWY A;  4HT8 A;  3M4Y A;  5GMK j;  2ED0 A;  4II1 A;  1VQP A;  2MK5 A;  5GAM h;  4KT0 E;  5KYY B;  1GCP A;  1FMV A;  4M78 A;  3CCU A;  4DBQ A;  1NPP A;  4C92 E;  1D3B A;  3G7Z A;  2EQK A;  3M58 A;  4E7Z A;  3EG0 A;  2HDA A;  2DBM A;  4IUR A;  2M02 A;  1PKS A;  1M90 C;  1JB0 E;  2LTO A;  4FSX A;  3A8O B;  2E64 A;  4JLI A;  1VQ5 Q;  1UDL A;  2KT1 A;  4C0D B;  4ZN3 A;  4C8Q B;  2JNG A;  1NZ9 A;  4LD9 K;  3MHX A;  3OYJ A;  3VV0 A;  1NLO C;  3NGP A;  2JOY A;  3CC4 T;  4Z89 A;  1BB9 A;  1H8K A;  5I22 A;  1GRI A;  2VXE A;  2DZC A;  2DXT A;  3EFS A;  1IRX A;  4OMP A;  4O6J A;  4M75 E;  5CR2 A;  1NLP C;  4PJO F;  2ROL A;  4OMO A;  3CCQ Q;  1ZSZ B;  4D6W A;  1NEB A;  3L2V A;  4A4G A;  1G3Y A;  1VQ7 Q;  1YIJ T;  1K76 A;  4PJJ A;  2L0A A;  2ZPI B;  3VUB A;  2FVU A;  4Z02 A;  1AZG B;  4IUU A;  1IB8 A;  1K0S A;  1QW1 A;  1QCF A;  2MAM A;  3DB4 A;  1QVG S;  1RAD B;  3CPF A;  2EQI A;  6AT1 B;  4F7U B;  1K9M C;  1I0C A;  3NFC A;  1KIK A;  1SG5 A;  2BIV A;  2HNI A;  2NUZ A;  8ATC B;  3JCM b;  2I2L A;  1R0B G;  3M9Q A;  4HVU A;  1ZLM A;  1SPK A;  1VQP Q;  3MP6 A;  3WXM B;  3OYH A;  3CCU Q;  1YHQ T;  1QVF P;  3OYA A;  1Q81 C;  2XIC A;  3HHT B;  3CMA T;  4QQG A;  2DO3 A;  4M77 F;  1RUW A;  1RL2 A;  3A8M B;  4D8K A;  3S6W A;  4PJO C;  1QMC A;  5I2S A;  1S72 A;  4X34 A;  2E70 A;  2K5F A;  2IG0 A;  2LQW A;  4J9C A;  4J9F A;  1T0J A;  4GLK A;  3FEO A;  3OSS C;  3OYD A;  5FWC A;  4BY6 C;  1WQW A;  2D0N A;  2FRY A;  2YSQ A;  4A4F A;  1B34 A;  1Y07 A;  4RTZ A;  1EZZ B;  4FT2 A;  4WTO B;  4MML A;  1QCN A;  4RTT A;  2XMF A;  1Z9Z A;  2DAQ A;  3CEY A;  4E47 A;  3FJP A;  3JSC A;  1VQN A;  5C6S A;  1ZA1 B;  1I1J A;  3LH5 A;  1X75 C;  3MPU B;  3MEW A;  3CCM A;  3AT1 B;  2YRC A;  1UG1 A;  1KD1 U;  1M90 R;  1HJD A;  1YJ9 Q;  2JUF A;  2RJF A;  1EX4 A;  1UGQ B;  3HKS A;  1X6O A;  2DNU A;  3EH1 A;  4C8Q E;  2CKK A;  3GNG A;  3M0P A;  4FYY B;  3GPL A;  1KG1 A;  5IXB A;  1BKB A;  1MMA A;  1U3O A;  2HQE A;  2MYS A;  2PVD B;  4IUQ A;  4M77 C;  3M0S A;  1H92 A;  4N4I A;  2RQV A;  1AWJ A;  2XDP A;  2CP6 A;  2IVW A;  2A37 A;  5GAO r;  2EQJ A;  4EPC A;  4GBQ A;  2DA9 A;  2XDD A;  2YXY A;  3LX7 A;  1M2V A;  1GCQ C;  4IUV A;  3OYF A;  2KDS A;  3X25 B;  2GFA A;  3CD6 A;  1U1T A;  4PJO B;  2O4X A;  1O9S A;  4P5N A;  2RPN A;  1D1A A;  3I35 A;  3RKY A;  3FIF A;  4BY6 B;  2BKD N;  5GJW B;  4F7U E;  1V29 B;  2D8J A;  2CP5 A;  2DIQ A;  2HCK A;  2K3B A;  2AZV A;  3H9N A;  2RI3 A;  1RLP C;  1X6B A;  4JRQ A;  1K9M R;  2KNB B;  7AT1 B;  2BE7 D;  2KBT A;  1NBE B;  2F2X A;  3G4S T;  2E6Z A;  4L5G A;  1M30 A;  1VQK T;  1VQN Q;  5LJ5 f;  4OGE A;  1KC8 U;  1E6H A;  3BDL A;  4RTU A;  1VQL A;  4PK4 A;  4NOY A;  4N0A C;  1M1K U;  1Q81 R;  2LT1 A;  4A4H A;  3H0H A;  4HCC A;  3OS1 A;  3QJ6 A;  3ZL7 C;  4L59 A;  3OYC A;  5KYW A;  3H8Z A;  1WHH A;  5KH6 A;  4OB1 B;  2CSQ A;  3VS2 A;  2CYZ B;  4M77 B;  2G3R A;  2J6O A;  2R58 A;  3X26 B;  2DTO A;  5HK3 A;  3A98 A;  3PVQ A;  2XD0 A;  5GAO p;  1T3S A;  2YUQ A;  1YCY A;  3V7C A;  3JCM h;  2YUN A;  2IIM A;  1K9A A;  5FRN A;  1U06 A;  3CC2 T;  1AT1 B;  4HXJ A;  1QCO A;  2CS7 A;  2XID A;  1KD1 C;  5GAN g;  1ABQ A;  2PNI A;  3A1P A;  1MUZ A;  3JAM E;  1VOM A;  3OYI A;  1N27 A;  1OPL A;  1Z9Q A;  3OYK A;  3PNW C;  2AT1 B;  2K3X A;  3RUX A;  4C0G A;  3KXT A;  1RI0 A;  1WHK A;  3CBP A;  5DLQ E;  1YI2 T;  1AWO A;  4XQ3 A;  2RMO A;  2JMC A;  5HY6 A;  2DL3 A;  3CCJ T;  5IXF A;  4M75 A;  3UAT A;  2EFI A;  1D09 B;  2JTM A;  1HD3 A;  5CO7 A;  3V7S A;  3QG1 A;  3RMQ A;  4HCB A;  3EG9 B;  4JJD A;  5LJ5 e;  4CC3 A;  2RHX A;  4ANJ A;  2JW4 A;  4XAX B;  2LRQ A;  3A5Z B;  3CC4 A;  2DE0 X;  4DEX A;  2EYY A;  4PJO E;  3RBB B;  2VUB A;  4M7A F;  2AZS A;  4HCZ A;  3V8J A;  1WFW A;  4NL3 A;  3VS5 A;  1VQM Q;  4FYX B;  1XJW B;  1P92 A;  3CC7 A;  1MHN A;  2EYX A;  4E7S A;  3SFM A;  4LDX A;  2RQW A;  2WAC A;  1KC8 C;  1OEB A;  4HA8 A;  2JM9 A;  1SRM A;  4E7K A;  1M1K C;  2A7Y A;  1JJ2 A;  2QGF B;  5I2M A;  3FLG A;  1S72 T;  1YNZ A;  3UDC A;  1PD1 A;  1RI9 A;  1W4S A;  4ZGE B;  9ATC B;  1WXT A;  2K4Y A;  5D7U A;  1BI0 A;  3PFS A;  1RAA B;  1RAF B;  2QAS A;  3EH2 A;  2M1H A;  2EJ9 A;  3FRN A;  4KH1 B;  1OUL A;  4J6W A;  4ZNX A;  3J81 E;  2KXC A;  4UC4 A;  4M77 E;  3M57 A;  2D0Q B;  3OW2 P;  2ZPH B;  3MCA B;  2COW A;  4J7I A;  1AWX A;  2KGT A;  4F17 A;  2ZGW A;  1WI7 A;  1LOJ A;  1IHV A;  2QEX T;  4M7A C;  4B9X A;  2FB7 A;  5GAN d;  2YLB A;  4FCY A;  3CCM T;  3U23 A;  1K4U S;  3HP9 A;  2GQI A;  3GF5 A;  3V8K A;  2MPX C;  1YWP A;  3C0C A;  5KYX B;  1X43 A;  5LJ3 d;  3TRE A;  1WHM A;  1KD1 R;  3EFO B;  1KFZ A;  3C4S A;  3CC4 Q;  1UGS B;  1QQJ A;  2P0P A;  3JCM P;  2CP7 A;  1UTI A;  4KGX B;  2ZAE A;  4QQ6 A;  1TUD A;  2KSS A;  2EYW A;  2DXU A;  2NUP B;  4M7D C;  2CP2 A;  2K3Y A;  5D6W A;  3L2U A;  3FJ5 A;  3UPU A;  3R6N A;  3RMS A;  1JU5 C;  1YJN A;  2JTE A;  3EGX A;  3AHU A;  3TU4 K;  5M9O A;  1YIJ Q;  1T3L A;  2R57 A;  4JRK A;  4LDY A;  3CD6 T;  2K5I A;  3I55 T;  2I0N A;  1MGQ A;  2QGG A;  2FHD A;  1PSF A;  4F16 A;  2A36 A;  4KH0 B;  1EIF A;  1TUG B;  3BE3 A;  5GAO m;  2DL5 A;  4RTW A;  4IUT A;  2FPD A;  4EMH A;  2H8H A;  2BZY A;  3RR6 A;  3REB B;  1HXD A;  2B86 A;  2E10 A;  2YDL A;  1XQH A;  1PWT A;  1K1Z A;  2GBQ A;  3JB9 J;  1WJR A;  2KRS A;  1TU0 B;  1ZUK A;  2EPD A;  2DFU A;  4M7A B;  4PJM A;  2D9T A;  4N4G A;  5DM7 R;  1VQL T;  4HCK A;  1TSF A;  1N8R U;  1YHQ Q;  1M4Z A;  1UUE A;  1WLP B;  2KK4 A;  2AKL A;  4R56 A;  2EGE A;  2LX9 A;  1X2Q A;  3I56 T;  1B3Q A;  3CMA Q;  1R0C B;  2RQU A;  3BY7 A;  2EJG A;  1AHJ B;  5HK0 A;  4EMK C;  3CCS T;  4J9I A;  1YWO A;  1M1K R;  5GAN 7;  5IHI A;  2RJC A;  2LJ1 A;  3P8D A;  1OPK A;  1WHG A;  3OS5 A;  2CDT A;  5GAM j;  4BE0 A;  2VXF A;  2K6D A;  2K9G A;  5CQY A;  3H0I A;  2DYB A;  4Y91 A;  2BZX A;  3EGD A;  1QKX A;  5GAO n;  3GLX A;  2HSE B;  3FC3 A;  3OYE A;  3OA6 A;  3T9N A;  5KE3 A;  2FPE A;  3WVE B;  1N9R A;  5DLO A;  5GMK m;  2SEM A;  4QQD A;  5EG2 A;  2JS0 A;  1VQ9 T;  1YBY A;  1LVK A;  2OX7 A;  4PFO A;  3M4G A;  3NPF A;  4C5E A;  4GLM A;  2F2V A;  1UGP B;  4J9E A;  4M4Z A;  2LMJ A;  2X9H A;  2L5Q A;  1KQS S;  4KUL A;  2PVO B;  3LWH A;  4C92 G;  2E41 A;  1Y0M A;  3CQT A;  4JPB W;  1U8R A;  1B07 A;  1QWE A;  4J9G A;  4ATO A;  1RAC B;  1UFF A;  3CC2 A;  2VVK A;  5J3B A;  2O2O A;  3CCL A;  1CKA A;  3EHQ A;  2VKN A;  4IKF A;  4XTW A;  1OZ3 A;  5AYF A;  3UF4 A;  4AFS C;  4M78 F;  3NTH A;  4EMK B;  1NEG A;  4M7D D;  1FMK A;  3A8L B;  3PIP A;  4JZ3 A;  3UT1 A;  3PMT A;  5GAN f;  1ZQ1 A;  1AVZ C;  2DMO A;  1MV3 A;  5AT1 B;  5IN1 A;  2LNV A;  3CC7 T;  2YUP A;  4M75 G;  4Z8A A;  1YI2 A;  3QHS A;  1IZ6 A;  1M1F A;  2FO0 A;  2JTF A;  3OYM A;  3MET A;  5DY9 A;  1ZBX A;  2MCN A;  2CUD A;  5LJ3 f;  3CCJ A;  2P84 A;  1QLY A;  2DIG A;  1SHG A;  1YP5 A;  3G4S Q;  3EHR A;  3L2Z A;  3FDR A;  5FRM A;  3KUF A;  2GFU A;  4A4K A;  1W2B S;  3GIB A;  1VQK Q;  1GFD A;  4X9D A;  2GCX A;  4MMK A;  3CME A;  3CPW S;  3M59 A;  4BE2 A;  1YJW T;  2EJF A;  4LDW A;  3VS3 A;  4DA4 A;  1AEY A;  1X27 A;  4OP0 A;  3BFM A;  2HSP A;  2CZ6 B;  4XU2 A;  2RF0 A;  5KYU A;  1NM7 A;  2X51 A;  4CC2 A;  3JCM e;  1JEG A;  4C8Q D;  5I21 A;  4M78 C;  3LWI A;  1OU8 A;  3E9G A;  3FB9 A;  1RLQ C;  2ECZ A;  4M7D E;  1WQ7 A;  3GNF B;  3LGL A;  2CRE A;  2K5L A;  3J7A F;  3M5A A;  3CC2 Q;  2O88 A;  4WF2 A;  2DIL A;  1VQ8 A;  4RCB A;  1MMN A;  1Y57 A;  3VYG A;  3DLM A;  4Y28 E;  1TTH B;  2YLC A;  3VKI A;  1QVF A;  2COZ A;  1NPR A;  2QTV A;  3SB2 A;  4AT1 B;  2OTJ T;  4FM4 B;  3HRS A;  2DXB A;  4MZM A;  2YWW A;  4JUV A;  1D1B A;  3TCJ A;  5GAN e;  1C0M A;  1KQ1 A;  2KRN A;  2AK5 A;  1GXI E;  3PE0 A;  4CC4 B;  8AT1 B;  1K73 U;  2LZ6 B;  4FU6 A;  1YI2 Q;  2FRW A;  1YJN T;  1FYN A;  2MOX A;  5GAO q;  2V8I A;  2X4X A;  3S3N A;  2NUT A;  2QEX A;  1D1C A;  2GTO A;  2XK0 A;  5LJ3 e;  4JRP A;  3CCJ Q;  4AG1 C;  2O01 E;  1MND A;  3TSZ A;  3JB9 D;  4PFP A;  3PMI A;  3CCE T;  3MEV A;  1UEB A;  3HSB A;  4OML A;  3VS6 A;  4C8Q G;  2DL8 A;  2F5T X;  1JXO A;  3E9F A;  2VWF A;  2E1H A;  2RK1 A;  1JXM A;  3OB9 A;  1PKT A;  5HCK A;  3QDR B;  4JS4 A;  3RKX A;  3REA B;  3E19 A;  1WHJ A;  4M78 B;  2WSF E;  1D3B B;  1M8M A;  1IXD A;  3RNJ A;  4RTV A;  2H3E B;  3EG1 A;  5KE2 A;  1PG5 B;  4LXC A;  4R0K A;  1KK7 A;  1F1B B;  2JMA A;  2LT4 A;  2F5K A;  2F69 A;  2A3L A;  1D0X A;  2OTL T;  2O9S A;  2W0Z A;  3I55 A;  2YRD A;  2KI7 A;  2L89 A;  5CKF A;  1M3A A;  2PU9 B;  2FEI A;  3INZ A;  3TQ7 P;  3ULR B;  2KXD A;  1S72 Q;  4IIO A;  4F7U G;  3A8G B;  1BYM A;  4D8D A;  4OMM A;  2V1R A;  4GY5 A;  1PSE A;  2PUK B;  5CKD A;  4E7I A;  4PL6 A;  1WX6 A;  3M0R A;  1QWF A;  4FSS A;  3VYH B;  1G5V A;  1M3B A;  2QDY B;  2COY A;  2BTT A;  2JZ2 A;  3M55 A;  2RHY A;  1NJI U;  3ME9 A;  1LNX A;  1GBR A;  2FL7 A;  1OQK A;  1AOJ A;  2RK2 A;  2QXF A;  4E7L A;  3E1S A;  2QEX Q;  1QVF S;  3L2R A;  3I56 A;  2YRV A;  2LQ8 A;  2Y4X A;  3I9Q A;  1TH7 A;  1VIF A;  3CCM Q;  4C5G A;  3CCS A;  2P0K A;  1XNI A;  4ME7 A;  5CK9 A;  2GNC A;  3OQ5 A;  1K0X A;  1OYX A;  2KRM A;  1QP2 A;  1HSQ A;  1MMG A;  2ABL A;  4WCI A;  1WPY A;  3PT9 A;  3EGU A;  1KJW A;  4JJC A;  4LDU A;  1TG0 A;  4PJO D;  1TWB A;  2E3H A;  2ZPG B;  4J9D A;  3HFO A;  1GFC A;  3QBY A;  3CCL T;  1G2B A;  4C92 A;  2L3S A;  1GL5 A;  4A54 A;  3CXC P;  4LUD A;  2VV5 A;  4KUD K;  4FW1 A;  2O9V A;  3QZ9 B;  4J6Y A;  2WSE E;  1YIT A;  2V1Q A;  1VQ9 A;  3CD6 Q;  3I55 Q;  2RM4 A;  1TS9 A;  2F1L A;  3CCV A;  3G6E A;  4C92 F;  3M0T A;  3ZFJ A;  4TVR A;  1B34 B;  3G1J A;  4XK8 E;  3PGG A;  5EC7 A;  2BUD A;  5D6X A;  5GAN h;  4FYW B;  1VYU A;  1VYV A;  3NMZ C;  2DBK A;  4M78 E;  4C5H A;  2X4J A;  3LLR A;  5GJV B;  4XTU A;  2MF2 A;  3MKD A;  2O31 A;  2M9U A;  2EGC A;  2E5Q A;  5LJ3 h;  3CME T;  4M77 D;  3SWN A;  3I5S A;  1VQL Q;  2EYQ A;  1PRL C;  1TOV A;  2SRC A;  3QUI A;  1M9S A;  1QVP A;  2QQR A;  2HAX A;  2XI9 A;  1I4K 1;  4DBR A;  3I56 Q;  4M75 F;  4PJO G;  4XU3 A;  4RCC A;  2DVE A;  3OYB A;  3CCS Q;  2YUO A;  3MEA A;  1JBM A;  1WXB A;  3OBW A;  4KUI A;  4ZGD B;  2KRO A;  4BE1 A;  4LUE A;  2KY9 A;  5CQX A;  1NJI C;  2JN0 A;  2KEA A;  2PVG B;  2ZPF B;  4LD6 A;  1G3W A;  4BD3 A;  2M16 A;  4ELZ C;  2R5A A;  1M2V B;  1VQ8 T;  1AZE A;  2KVQ G;  1VQ4 A;  3CCR T;  2O4X B;  2DEU A;  3ZEH A;  4RG2 A;  1YJW A;  3G71 A;  4Q5W A;  5FU6 C;  2A0F B;  2HEQ A;  1QP3 A;  5FW9 A;  3SHW A;  1VQ9 Q;  2L2P A;  2NLU A;  2W10 A;  3CCV Q;  3NHN A;  2DRK A;  4XTX A;  1M2O A;  4M77 G;  1KSW A;  5L23 A;  2K2V A;  1GBQ A;  3X28 B;  4RMO A;  2QA4 T;  4M75 C;  2RHI A;  2EAY A;  2MWO A;  2CT3 A;  3QXE B;  1PM3 A;  4DBF A;  5KYY A;  1ARK A;  1BCM A;  1E6G A;  4IIM A;  4J5Y A;  2RB6 A;  4BDY A;  3OW2 A;  2CP3 A;  5CVI A;  1M5Q 1;  5KYW B;  4RG8 A;  1IGU A;  3OS2 A;  2OTJ A;  4ZGJ B;  4Z88 A;  4C8Q A;  4C0F A;  4EDU A;  1PRM C;  2DL4 A;  3JB9 I;  1LJO A;  1H64 1;  1M1G A;  2FZC B;  2FPF A;  1Q86 U;  2EIF A;  3CC7 Q;  3SEM A;  3HTR A;  2X3W D;  3TSW A;  4OB0 B;  1VQO A;  4KGV B;  4OF1 A;  1KQS P;  1OU9 A;  2KAF A;  2RD1 A;  5GAN 5;  2RNA A;  5GMK e;  2QYZ A;  2X4Y A;  3DB3 A;  4LN2 A;  4O5V A;  2DTI A;  4BI8 B;  3JRZ A;  3A8H B;  1ZSZ A;  5LJ5 j;  1Q7Y U;  1PCX A;  3CCE A;  4RTY A;  1VQ6 T;  3HL8 A;  3QJY A;  1UHC A;  4DQ2 A;  5FU6 B;  2EWN A;  1G3S A;  2G6F X;  4AFU C;  2KMT A;  1SRL A;  1M90 U;  2HQX A;  2Y90 A;  2BZ8 A;  1YJW Q;  1J3T A;  2DZ9 A;  2AHJ B;  2K79 A;  4HVV A;  4N4H A;  2RHU A;  4KRT A;  2P4T A;  2ZCF B;  4MZP A;  2ESW A;  1BU1 A;  4F7U A;  1BI1 A;  3V7R A;  1FXX A;  1JJ2 S;  3QKJ A;  1JRI A;  4M75 B;  2CUB A;  1FWZ A;  2C0O A;  4FYV B;  4AMC A;  5I11 A;  5GAN 6;  3O8V A;  3QSU A;  3OS0 A;  1NJI R;  5LJ5 g;  1C6V X;  1UGV A;  2PUO B;  4AFQ C;  1KC8 R;  2OTL A;  1XTD A;  1XOV A;  1PHT A;  1OX9 A;  2DRM A;  1W2B P;  2X3X D;  1QVG P;  2VB6 A;  2CZ7 B;  4J83 A;  4BAC A;  4OVA A;  4ESR A;  2DXC A;  1D0Z A;  1ABO A;  2AIR B;  1IRE B;  2OTJ Q;  1JQQ A;  5LL6 S;  3V8L A;  5IHK A;  2CP0 A;  1B7T A;  3RER A;  1QVG A;  1PD0 A;  4OB3 B;  5GAN 4;  1W6X A;  4BB7 A;  1M8V A;  1K9M U;  2XG8 D;  3CCQ A;  1VQO Q;  1Y7X A;  1SHF A;  3OMG A;  4ZTJ A;  1YJN Q;  3OW2 S;  5FWB A;  4A4E A;  1VQ7 A;  2V26 A;  2RHZ A;  1YIT T;  1O75 A;  2ZPE B;  3JCM Q;  2RA2 A;  5GAO l;  2GGR A;  3ZBD A;  5FLX E;  1VYT A;  3LYI A;  3H41 A;  3CCV T;  3G6E T;  3CCE Q;  5GAM g;  2CH4 A;  4M7A D;  2V8J A;  2LQN A;  4QW2 A;  4ORZ A;  3QO3 A;  2OI3 A;  3LH0 A;  1Q86 C;  3VS0 A;  3E2U A;  2QTX A;  2BE9 B;  4OMQ A;  5GAN 2;  1X69 A;  4ZTF A;  1I5O B;  2DJZ A;  3OYY A;  2E5K A;  5GMK i;  3URG A;  1Q7Y C;  1H3Z A;  3RDV A;  4DBH A;  1WGS A;  2A08 A;  2HL3 A;  1G3T A;  4XTZ A;  4BDZ A;  2L3Q A;  2L3R A;  4J6X A;  2OTL Q;  3F70 A;  3C12 A;  4E7H A;  1V1C A;  3SDZ A;  2LDM A;  3QYG B;  4FT4 A;  4NS5 A;  4CRI A;  5CKE A;  2EVR A;  4PJO A;  4X9C A;  2DJQ A;  2OAW A;  2VGN A;  5L8R E;  1UB4 A; 
#chains in the Genus database with same CATH homology
 2DL7 A;  2JMA A;  2NWM A;  2M51 A;  1M3C A;  3UA6 A;  4JJD A;  4CC3 A;  2JW4 A;  2O9S A;  2W0Z A;  2DLP A;  2DE0 X;  3PVL A;  2J06 A;  4DEX A;  2EYY A;  3RBB B;  1M3A A;  2EKH A;  1A0N B;  2AZS A;  2FEI A;  1NG2 A;  1WFW A;  4LE9 A;  3ULR B;  3VS5 A;  2KXD A;  1ZUY A;  1IO6 A;  1U5S A;  4IIO A;  2RN8 A;  4D8D A;  2EYX A;  4OMM A;  2LP5 A;  2V1R A;  4HVW A;  2P4R A;  1WX6 A;  3M0R A;  1QWF A;  4FSS A;  2RQW A;  4X1V A;  1I07 A;  1M3B A;  1SEM A;  2CT4 A;  1OEB A;  3VRY A;  2BTT A;  1ZUU A;  2JM9 A;  1SRM A;  4K11 A;  2JM8 A;  2CH4 W;  4A63 B;  2RQR A;  1GBR A;  1AOJ A;  4F14 A;  1CKB A;  2J6F A;  1YNZ A;  3TVT A;  2CSI A;  1WIE A;  3I9Q A;  1RI9 A;  1WXT A;  3VS4 A;  1E7O A;  4AFZ C;  2GNC A;  3VRZ A;  1EFN A;  1YN8 A;  2HBW A;  1K0X A;  3QWX X;  1AWW A;  4AG2 C;  2KRM A;  2LJ0 A;  1HSQ A;  4ZNX A;  2KXC A;  2ABL A;  4EIK A;  4WCI A;  1GCQ A;  3EGU A;  2OJ2 A;  1KJW A;  2EYZ A;  2FG0 A;  2JT4 A;  1AWX A;  2KGT A;  4JJC A;  4F17 A;  1AD5 A;  1TG0 A;  1WI7 A;  2EBP A;  1YCS B;  4J9D A;  4LNP A;  1GFC A;  2J6K A;  1G2B A;  4JZ4 A;  3U23 A;  2L3S A;  1S1N A;  3EG3 A;  1K4U S;  2GQI A;  1GL5 A;  1X6G A;  1OOT A;  4LUD A;  3O5Z A;  1YWP A;  3C0C A;  3VS7 A;  2M0Y A;  1LCK A;  1X43 A;  2O9V A;  3QWY A;  2V1Q A;  1KFZ A;  2ED0 A;  1GCP A;  1UTI A;  3EG0 A;  3M0T A;  2MIO A;  1TUD A;  2HDA A;  2DBM A;  1QKW A;  2EYW A;  5EC7 A;  1PKS A;  3FJ5 A;  3R6N A;  1JU5 C;  1UDL A;  2KT1 A;  1VYU A;  2JTE A;  4QT7 A;  1VYV A;  3NMZ C;  2DBK A;  1NYF A;  5GJV B;  1T3L A;  2C0T A;  1NLO C;  3NGP A;  2EW3 A;  2O31 A;  2EGC A;  2I0N A;  4Z89 A;  4F16 A;  1BB9 A;  1H8K A;  5I22 A;  2A36 A;  1GRI A;  3I5S A;  2DL5 A;  4RTW A;  1PRL C;  4OMN A;  2SRC A;  4OMP A;  2FPD A;  4J9H A;  1JO8 A;  2H8H A;  2BZY A;  1NLP C;  1G83 A;  2ROL A;  4OMO A;  3REB B;  2B86 A;  1NEB A;  2YDL A;  3KFV A;  2A28 A;  3GBQ A;  2YUO A;  1K76 A;  2DX1 A;  2L0A A;  1WXB A;  1PWT A;  1K1Z A;  2GBQ A;  1M27 C;  2KRS A;  2KRO A;  4LUE A;  1ZUK A;  1AZG B;  2EPD A;  2D8H A;  2KEA A;  4Y92 A;  1NYG A;  1K0S A;  1UJY A;  4HCK A;  1QCF A;  1ZX6 A;  1T0H A;  1UUE A;  1WLP B;  2AKL A;  2EGE A;  2RQT A;  2ENM A;  1X2Q A;  2EQI A;  1B3Q A;  2RQU A;  1UJ0 A;  2PTK A;  2KE9 A;  1AZE A;  4J9I A;  1YWO A;  1I0C A;  5IHI A;  4JJB A;  1KIK A;  2LJ1 A;  3M0U A;  1UHF A;  2QDL A;  1OPK A;  2NUZ A;  2CDT A;  2HEQ A;  4HVU A;  5FW9 A;  3SHW A;  1ZLM A;  1SPK A;  2K6D A;  2K9G A;  3H0I A;  2DYB A;  2L2P A;  2BZX A;  2W10 A;  3NHN A;  1QKX A;  1WA7 A;  2DRK A;  2KYB A;  1KSW A;  1RUW A;  5L23 A;  1GBQ A;  4D8K A;  4RTX A;  2GTJ A;  2FPE A;  2LQW A;  4J9C A;  4J9F A;  2CT3 A;  2DF6 A;  2SEM A;  2ED1 A;  1ARK A;  1H3H A;  2JS0 A;  1T0J A;  1E6G A;  4IIM A;  1N5Z A;  1UEC A;  1TUC A;  5FWC A;  1WYX A;  2D0N A;  2FRY A;  2YSQ A;  4RTZ A;  3NPF A;  2LCS A;  2AKK A;  4GLM A;  4RTT A;  2F2V A;  2XMF A;  1Z9Z A;  4J9E A;  4M4Z A;  2LMJ A;  4RUG A;  2L3P A;  2LJ3 A;  4Z88 A;  1Y0M A;  3CQT A;  4JPB W;  1PRM C;  1B07 A;  2DL4 A;  1QWE A;  4J9G A;  1I1J A;  3LH5 A;  1UFF A;  2FPF A;  2VVK A;  2O2O A;  1ZBJ A;  3SEM A;  2X3W D;  3TSW A;  2LX7 A;  1CKA A;  3EHQ A;  2VKN A;  1UG1 A;  1HJD A;  3THK A;  3UF4 A;  2RNA A;  4AFS C;  2DNU A;  2KR3 A;  4LN2 A;  3M0P A;  1NEG A;  1FMK A;  5IXB A;  1U3O A;  4JZ3 A;  4RTY A;  1AVZ C;  1UHC A;  2DMO A;  3M0S A;  1MV3 A;  1H92 A;  2G6F X;  4AFU C;  2RQV A;  1AWJ A;  1SRL A;  2YUP A;  4Z8A A;  2BZ8 A;  2F2W A;  1J3T A;  2A37 A;  2FO0 A;  2K79 A;  4HVV A;  2MCN A;  4GBQ A;  4KRT A;  3IQL A;  2CUD A;  1VA7 A;  2DA9 A;  2ESW A;  1BU1 A;  1QLY A;  2JXB A;  1SHG A;  4DEY A;  1GCQ C;  1YP5 A;  3EHR A;  2DM1 A;  2CUB A;  2C0O A;  2J05 A;  5I11 A;  1GFD A;  3EG2 A;  1OV3 A;  2RPN A;  1MV0 B;  3I35 A;  2K2M A;  1UGV A;  4AFQ C;  1W1F A;  1XOV A;  1PHT A;  5GJW B;  2D8J A;  2DRM A;  1WXU A;  2HCK A;  3VS3 A;  2K3B A;  2AZV A;  1AEY A;  2X3X D;  1ZSG A;  1X27 A;  1RLP C;  1X6B A;  2KNB B;  2KYM A;  1WDX A;  4ESR A;  2KBT A;  2F2X A;  2HSP A;  2RF0 A;  4CC2 A;  1NM7 A;  1ABO A;  3JV3 A;  1JEG A;  3UA7 A;  1M30 A;  2C0I A;  1RLQ C;  2D1X A;  2ECZ A;  1JQQ A;  2DVJ A;  1E6H A;  4RTU A;  5IHN A;  5IHK A;  2YT6 A;  2CRE A;  1W6X A;  2O88 A;  1PNJ A;  2DIL A;  1SHF A;  3H0H A;  3VS1 A;  5FWB A;  3ZL7 C;  1Y57 A;  2CSQ A;  3VS2 A;  2GGR A;  2J6O A;  1VYT A;  2KT8 A;  3H41 A;  1BBZ A;  3A98 A;  1BK2 A;  3PVQ A;  1T3S A;  2YUQ A;  2CH4 A;  2LQN A;  2KRN A;  2YUN A;  1W70 A;  2IIM A;  1K9A A;  2AK5 A;  1U06 A;  4ORZ A;  3H0F A;  4E6R A;  3PE0 A;  2OI3 A;  4CC4 B;  4HXJ A;  2LZ6 B;  4J9B A;  2K7A A;  2FRW A;  3VS0 A;  1FYN A;  2MOX A;  4CC7 A;  2EGA A;  4OMQ A;  1X69 A;  1ABQ A;  2GTO A;  2PNI A;  1CSK A;  1MUZ A;  2JS2 A;  1UE9 A;  5IH2 A;  4AG1 C;  2E5K A;  2J7I A;  3TSZ A;  1X2K A;  2PZ1 A;  1OPL A;  1Z9Q A;  4OML A;  3VS6 A;  2DL8 A;  2A08 A;  1JXO A;  2VWF A;  1JXM A;  2L3Q A;  5ECA A;  1AWO A;  3M0Q A;  1PKT A;  5HCK A;  2ROT A;  2RMO A;  1SSH A;  3REA B;  2JMC A;  2DL3 A;  2LNH B;  1V1C A;  1M8M A;  2EVR A;  3RNJ A;  4RTV A;  5IXF A;  3UAT A;  3EG1 A;  2DJQ A;  2OAW A;  3I5R A;  4R0K A;  1HD3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...