2OTLQ

Girodazole bound to the large subunit of haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 2otlQ00
1VQNQ 1VQ7Q 1KQSP 1VQ4Q 1S72Q 3I56Q 3CCLQ 1VQLQ 3CCEQ 3G6EQ 2OTLQ 3CD6Q 1Q82R 1YITQ 3CMEQ 3CCMQ 1Q81R 1YI2Q 1W2BP 1K73R 1Q86R 1VQKQ 3CC7Q 1N8RR 1YJWQ 3CCRQ 3CC4Q 1NJIR 3G4SQ 1VQOQ 2QA4Q 3CCSQ 1VQ8Q 3CCVQ 3I55Q 1QVGP 1JJ2P 3G71Q 1K9MR 3CC2Q 1YHQQ 3CCJQ 1VQ6Q 1YIJQ 1Q7YR 2OTJQ 1QVFP 3CPWP 2QEXQ 1VQ9Q 1M1KR 1YJNQ 1K8AR 3CXCP 3CCQQ 1VQPQ 1KC8R 3CCUQ 3OW2P 1YJ9Q 1KD1R 1VQMQ 3CMAQ 1M90R 1VQ5Q
chains in the Genus database with same CATH superfamily
1IHWA 1VQ9A 1NEGA 4BD3A 3HRSA 2DBKA 1I0CA 2D0NA 5GAN7 5FRNA 3CCEA 4OF1A 1VQKA 2KYBA 2CZ1B 2BKDN 3M56A 2DL4A 2CSQA 2CZ0B 3VYGA 1UGPB 3UPUA 3CC7T 4QT7A 4KH1B 1Q86C 1SHGA 1WHLA 4RTYA 1VQPQ 3O5ZA 4OVAA 2D0QB 4C0GA 3L2WA 1VYTA 3MEVA 2YUQA 2YDLA 4M7AB 3KXTA 3JCMQ 4M77B 4GLKA 1VQ9T 5CQXA 1KHCA 5FU7B 1AD5A 1Q86R 2HDAA 2EQUA 1ZSZB 2M02A 2KR3A 5GAN6 2M16A 1M9SA 3CCET 3RMSA 1D3BB 2KNBB 3RKWA 2W10A 1UE9A 1R8OB 1RAIB 2LT4A 5GAOp 3EH1A 2MWPA 3VKIA 3ME9A 2KI7A 1OZ2A 1X2QA 2E64A 1Q82C 1VIEA 5D6XA 2HQHA 3I5SA 4OGCA 2M9UA 2LRQA 4JJNK 1LNXA 1NBEB 4HCKA 1PKSA 5FW9A 4R0KA 3V8LA 5GANe 3V7CA 1Q82R 1RADB 1YITQ 3EG3A 3PTAA 3CMEQ 1JJ2S 4LUEA 2EFIA 1TTHB 4RTTA 4BE1A 1WHKA 2NUTA 4QQGA 4X1VA 5I11A 4CC2A 3EFOB 3CPFA 5KCHA 1UHCA 4NL3A 1MMNA 4BY6B 3INZA 5CKDA 1VYVA 2C06A 4WCIA 1PRLC 4HA8A 4WTOB 1UJYA 3L2ZA 4II1A 2JVVA 4CC7A 4L59A 5GMKi 5CKEA 1KQSA 2MWOA 4RCCA 4PJOF 2YRDA 1SSFA 2JMCA 2O2OA 2NUPA 2OTLQ 1OPKA 3FRNA 2DM1A 3L2RA 3LH0A 4J6WA 3QYHB 3FEOA 1K8AC 4PJOB 3CCRQ 5GANj 2DO3A 4J83A 1Q81U 3H6ZA 3J80E 3OB9A 4EDUA 4E6RA 2PUKB 1AWJA 1G3WA 2DVJA 1K8AR 1WGSA 1WZOA 5CKFA 5KYUA 1R77A 2RQVA 3OS0A 3HRTA 2KSSA 2ZCFB 4AFZC 1YCYA 2ZPGB 5CKBA 1YWPA 2ROTA 2E3IA 5KYUB 5HCKA 4E7JA 4JUVA 2MCNA 5CIUA 2E1HA 1H3ZA 1Q95G 1VQ8A 4FU6A 1RLPC 4C0DB 3REBB 1KFZA 3LLRA 1VQ7Q 3NGPA 2FB7A 2X3XD 4C8QG 4M7DC 2EJGA 5GAOl 4UC4A 4RTXA 1AOJA 2HKQB 4C5IA 1JEGA 1PC0A 2K2VA 5KYYB 4J7IA 2CZ7B 2RJFA 2QASA 1WA7A 3VV0A 1X6OA 3L2VA 3QDRB 1V1CA 2MK5A 2YUOA 2RPNA 1H92A 2JTEA 5IHKA 2FO0A 2RH2A 1VQ8T 1X69A 4HT8A 2QQSA 3RDVA 2HBPA 4HCZA 2K6DA 2CZ6B 4ATOA 1K1ZA 5KH6A 4HKEA 2XKOC 1W2BP 1GCQA 3CD6A 2DEQA 2K2MA 2RQTA 2A36A 2ZPHB 1V29B 5FROA 6AT1B 1QCFA 1VQ6Q 4OB0B 4JS4A 5CR2A 2KEAA 1I5LA 3QO3A 3FC3A 5GANd 1QP2A 2OI3A 4NS5A 1NEBA 2FPDA 2FL7A 4HCCA 1MV0B 5GAMe 3G4SQ 3OW2S 1TS9A 1PD1A 3V8JA 3CD6T 2CREA 2LMJA 1GRIA 4A4FA 4C8QF 4IUTA 4C8QA 3A8LB 1MHNA 1SPKA 4KT0E 5C0MA 2LQ8A 2DL8A 2BUDA 2EQKA 3OYMA 4C92D 3M55A 4C8QE 2FRWA 2QQRA 4E2FB 5GAMf 1FMVA 2J6OA 1SG5A 1M4ZA 1X01A 4PFZA 1C0MA 3ZL7C 4X9CA 3TVTA 3CXCS 2MYSA 2QTVA 2YRVA 3DLLA 3EHRA 1YHQQ 4AFUC 2ZPFB 5IT9E 1X6BA 1Q7YU 3JCMh 1ARKA 1IGUA 1WDXA 2QGFB 2MIOA 3KUFA 1BK2A 3OYYA 4HVVA 5A0DA 1NLOC 3G7ZA 3CCVQ 2E4HA 1KK7A 3JRZA 2LNHB 5GAMj 1VQOA 4IURA 1WI7A 2L3RA 4PJMA 1KQ2A 4M7DG 4PJNA 1E7OA 1TG0A 2AKLA 3MHXA 4LXCA 2NUZA 1RI0A 2RJCA 2WSCE 1YJ9A 3L2UA 2CUBA 1D0XA 3I56A 2DE0X 4ME7A 4RTZA 4KGXB 2I2LA 1B3QA 4XTWA 3A5ZB 1O75A 1VQOT 3KBGA 2QG9B 1M1FA 4A53A 3CMAA 3JV3A 2FHDA 4PNOA 1OX8A 3VUBA 1FXXA 1YJ9T 3HHTB 3G6EA 1QVFS 1ZA2B 2VGNA 4JRKA 1D0ZA 1KJWA 3I56T 4N0AA 1WHJA 1M2VA 3QZ9B 3VS6A 5KYXB 3PE0A 4RKUE 4J5YA 3UA6A 5HY6A 2FZGB 2I0NA 3QDFA 1N9SA 3E9FA 3EFRA 4E7SA 1TUGB 3CMAT 5IH2A 2RD1A 3G1JA 2ECZA 3A8GB 3G6ET 2EGEA 2DXUA 1K0XA 2K3YA 3JB9G 3MEUA 3CBOA 4JJDA 2JM8A 1PCXA 4M7DE 5I22A 1IRXA 4FW1A 2YWWA 2QAZA 3H0FA 2LT1A 1M3BA 2VGMA 5LL6S 1QW1A 3C94A 2J6FA 4XU0A 3CPWS 5GAMd 1YP5A 4MDWA 2JMAA 1PWTA 2Z0WA 3M4GA 4ORZA 2F5KA 2QA4A 3NTHA 4OGEA 5IN1A 1UECA 5HK3A 3CCUQ 1YIJA 2A37A 3TREA 4V2SA 5LJ5e 5KYWB 3LX7A 1W6XA 2KAFA 4MZTA 3PVLA 1TUDA 3UF4A 3PGGA 2CP3A 4BDZA 1IHVA 2GGRA 2LP5A 2RHIA 2HL3A 2RHZA 2OJ2A 3QUIA 5LJ5f 2CGHA 3LH5A 4HVWA 2QA4T 2DXBA 1OU9A 1Y96A 2DXTA 3OYDA 1YIJT 3M5AA 4QVZA 2DEUA 2KGTA 4KRTA 2WACA 3PMIA 3L42A 1PD0A 4C92B 4DBHA 1OEBA 3JB9F 1I5OB 3HFOA 1M8MA 4FYWB 3G71Q 3OYIA 2OTJQ 2NLUA 3TQ7P 1MMAA 4J7FA 3QG1A 3JB9I 9ATCB 2EPDA 1ABQA 2DERA 3VYHB 5LJ5j 1JXOA 1RABB 2K57A 2P0PA 2JS0A 3CXCA 1D1CA 1JO8A 2SEMA 1G83A 4GBQA 1JB0E 1M2OA 4A4KA 2X3WD 1K9AA 5GANh 1MNDA 2RI5A 3H0IA 4M7AG 2P0QA 4M77G 2EYWA 2L3QA 2ABLA 3ZFJA 2JTFA 3NPFA 5A0LA 3GF5A 1GXIE 2YT6A 2KDSA 3CCJQ 4N4IA 4NOYA 4MDXA 2DTHA 4KGVB 1W1FA 4C0DC 2LX7A 2O31A 2DILA 2AKKA 4PL6A 4RG8A 5AT1B 1WHMA 2K4YA 1SHFA 2RI3A 1UGRB 4FL6A 1QP3A 3CCMA 2MF2A 4JJBA 2XD0A 1X75C 1M3CA 5FLXE 3JCMg 3M0UA 2A0FB 2DIGA 2F2XA 2KY9A 1KD1U 2EVRA 1M1KC 1BCMA 1RL2A 4J9DA 1JQQA 2AZSA 4B6MA 2RJEA 1SEMA 2RQUA 2HBWA 3BY7A 2QTXA 4NL2A 3CCMT 4M7AF 4M7AA 2GF7A 4M77F 4M77A 2GQIA 1M1KR 1F1BB 3KFVA 4EMHA 5I2SA 1GCQC 3NMZC 5LJ3e 2GFUA 1ZSZA 4RG2A 5LJ5d 4M7AE 4OB2B 2P4RA 3H0HA 4M77E 1D3BA 2EGAA 1BIBA 3C12A 1NM7A 2WSFE 3CEYA 2RHYA 5EG2A 2F2WA 2YRCA 2ESWA 3OBYA 1ZUYA 2H3JA 1PRMC 2A7YA 5LJ3f 3L2QA 4FYXB 1VQKT 2F1LA 2LZ6B 4DOVA 3I5RA 3REAB 3DB4A 2YHTA 4F17A 3A8OB 3VS2A 4AFSC 1VQPA 4L5GA 4JLIA 4C8QC 2W0ZA 2LCCA 4PJOG 4KUIA 2J7IA 2VWFA 3GOXA 3EGXA 4A63B 3TEEA 3M9QA 1QKWA 3CCQQ 2E6ZA 1JXMA 1VA7A 3EGXB 2EJFA 1VIFA 3JCMc 1WPYA 5LJ3j 2RHUA 1VQPT 1VOMA 4C5EA 1RAGB 1YCSB 3EFOA 4O6JA 2E5QA 2YUNA 4B9WA 3MP6A 3I9QA 1X27A 4JPBW 1RACB 3GIBA 4MZMA 3RBBB 3X26B 3M4YA 2ATCB 4DEXA 3SWNA 1YJWQ 1W2BS 4OMMA 1CKAA 4LDWA 1KIKA 3CCQA 2KT1A 2R5MA 4IUUA 3PT9A 2QGGA 1EX4A 5GAMh 2DRMA 2RHXA 3SWNB 3S6WA 3OYLA 2GFAA 3ZBDA 1GBQA 1N27A 1T0JA 1YITA 3CMEA 5ECAA 2GTJA 3R6NA 2DF6A 2M1HA 4ANJA 1Q86U 4K11A 1K73U 2EYXA 1UG1A 1WXTA 2QQAA 2R58A 3E1SA 2IPOB 1K76A 3R6OA 2X4XA 5C6SA 4PJOA 1FX7A 1OULA 2O4XB 4LDVA 5CK9A 1VQ4Q 2XMFA 5EC7A 5GAOq 4E7LA 2K7AA 3QWXX 3VS1A 4PJOE 2V26A 1Y71A 4PFPA 4R56A 2CUDA 3CCSQ 3ASKA 2CP0A 1SF9A 4FCYA 2BTTA 1T3SA 1YITT 5KCOA 1HD3A 3CMET 5GAN4 1N8RU 1LPLA 4XTUA 1NJIU 4M75D 2CH4A 4LUDA 2DL7A 3OYNA 3URGA 1BCOA 1IZ6A 2DJZA 4N0AC 4DOWA 5FRMA 4F7UF 4F7UA 2D8HA 2OTLA 1BI0A 1I1JA 2RF0A 3CCRA 1U06A 1WX6A 2JT4A 4BI4A 4F7UB 3OYHA 1X6GA 1RUWA 3EGDA 2RA2A 1NG2A 1RLQC 1AVZC 1RAHB 5LJ3d 3C0CA 3S3MA 3FJ5A 5KYYA 4MZPA 4ZGDB 5FU6C 3V7RA 2P4TA 4FM4B 3VUZA 3EGDB 4HVUA 3P8BB 2HQEA 1OQKA 4OMNA 5GAN5 1X43A 3M0TA 3NTIA 2OTLT 3BW1A 1OZ3A 2VUBA 1E6GA 4QW2A 2VXEA 2R5AA 3TSWA 2KRNA 2D9TA 3QJYA 3CCRT 3LGLA 2X4WA 2ZZDA 5GANg 2F2VA 2XIDA 7AT1B 2ED0A 2EKHA 5J26A 1VQ7A 2QXFA 1C6VX 1D1BA 2XDPA 2DMOA 1BB9A 3GPLA 4BE0A 3JSCA 4QVDA 2COWA 1NYGA 3CC2Q 4M78D 4OMLA 4A54A 5GMKm 1CSKA 3BFMA 1VQMQ 3RERA 3SDZA 2O88A 5FWCA 3A1PA 1XQHA 2HAXA 4E47A 3LYIA 3JCMV 1WIEA 3S3OA 1SSHA 2J06A 3MCAB 1QWEA 1VQ7T 3HSBA 2GCXA 3PIOA 2JUFA 4RTVA 3PNWC 3TCJA 2LJ0A 1VQ5Q 1VQ6A 2EAYA 3N5BB 2QI2A 4A4HA 4A4EA 1TU0B 1YNZA 2ZGWA 2DNUA 1U1SA 1NYFA 1M90U 4IIOA 4RMOA 1UTIA 2MMPA 1O9SA 2E41A 4ZGEB 4E7HA 3E19A 3G4SA 3IQLA 2FG0A 1VQ5A 1TXQA 1M27C 1VYUA 4E7ZA 2NWMA 2QDLA 4J9CA 2BZXA 1VQ6T 3JB9H 3AHUA 5CAIA 1M30A 1GL5A 3M53A 4N4GA 2V1QA 1JJ2A 4KH0B 4Q5WA 1IGQA 3PMTA 2K5LA 2VVKA 3OSSC 1ZLMA 2QEXQ 8ATCB 4KULA 3G4ST 2L89A 1YHQA 3FIFA 1W2BA 2WSEE 5DLQE 2IIMA 4RUGA 1M1GA 1G2BA 4AFQC 4CRIA 2RI2A 2RQWA 2HSPA 5FWBA 1WHGA 1ZSGA 2PTKA 3ULRB 3M0QA 3OSVA 2KT8A 2VB6A 4M75F 4M75A 1NZ9A 4KUDK 3CCVA 3PVQA 4FW2A 1YJNQ 3MP1A 2CDTA 3GBQA 1HYOA 2CP6A 1YHQT 4M75B 1KC8U 4JZ4A 2LQWA 5GAN3 5D6WA 1OU8A 2HQXA 2JOYA 1R0CB 2O01E 2XI9A 1R0BG 5KYXA 4CI0C 1ZA1B 2DK3A 3WVEB 3QWYA 2QDYB 1QVGP 1JU5C 3JCMX 2EJ9A 4FT4A 3CCVT 4BUGA 1ZQ1A 3ER0A 4M4ZA 4TVRA 5GAMg 2A08A 2CSIA 1FMWA 1MMDA 2DYIA 4LDYA 4C92G 3OYCA 1YI2Q 4M7AC 4M77C 1YWOA 3O8VA 2XHCA 2E70A 4XQ3A 5FU7C 4ESRA 2KYMA 1ZSZC 2LC4A 5DM7R 2IG0A 2L3SA 3J81E 4HXJA 3OBWA 3RNJA 4P5NA 2QQ9A 3CCLQ 3H9NA 2E5KA 2ENMA 2V8IA 3LWIA 1BI1A 3MP8A 1D1AA 2MOXA 4M78F 1UHFA 4M78A 1G3YA 1NPPA 2RK1A 5KYWA 4OB3B 1WYXA 2E6NA 2ED1A 4BDYA 1S72Q 4M78B 3OQ5A 1XTDA 1VQLQ 2Y90A 3I35A 2LJ1A 2QK0A 2L0AA 3M57A 3CCLA 2KVQG 1U1TA 1ZUKA 2BIVA 1FMKA 5GJWB 1G3TA 2EWNA 4C0ZA 1P92A 3SB2A 5LJ3h 3VS7A 4C92F 2FPEA 2QQBA 4C92A 1K9MU 3CCUA 3L1AA 4BY6C 1M3AA 1G8XA 4C92E 1D09B 2KXCA 1MMGA 1WXUA 3SWNC 5GMKe 3LW5E 3CC4Q 2K5FA 4ZN1A 4GY5A 2XDDA 4EMKA 2M0YA 3OW2A 1UGSB 2O9VA 2NYSA 1ZX6A 3M0SA 3JCMf 3OS1A 4BI3A 2DIQA 4EMKB 4BB7A 3HKSA 4J6XA 3QHSA 1EIFA 5CVIA 3C95A 4HCBA 3CCUT 3X24B 2M51A 1KD1C 3RESA 4D8DA 2D8JA 2JS2A 4JZ3A 3HL8A 5GAN2 2AZVA 4PJOC 2DL3A 2DJQA 1QMCA 4JLGA 3JB9J 2XU8A 2LX9A 1BI2A 3G71A 1KD1R 1HK9A 3SHWA 2OTJA 4Y92A 3OYGA 1NE8A 3UWNA 1RAFB 3RUXA 2HD0A 3LWHA 2JM9A 2LNVA 2B8AA 3LGFA 2E3HA 4KGZB 2QYZA 3GLXA 1OPLA 1W70A 3I55Q 2E12A 3FLGA 2HZYA 4QKUA 5GMKj 4J9HA 4B9XA 1ZHIA 1TUCA 1B34B 2BE9B 1UGVA 1IB8A 2JN0A 2KE9A 2K79A 2DL5A 2RM4A 1QCNA 3HP9A 3G71T 3JCMW 2OTJT 4D6WA 2DTOA 1JRIA 4BACA 2C0OA 3CC7Q 2C0TA 2GQVA 3E2UA 1UB4A 3JCMP 2X51A 3V7SA 3P8DA 1GFDA 3I55A 1VQ9Q 3VRYA 5LJ5g 5CKHA 2X9HA 3CCJA 2EGCA 5IHIA 3CCEQ 1XJWB 1H3HA 2HKNA 1YBYA 4EPCA 1D0YA 2E65A 2LTOA 1QVFA 2VV5A 5DY9A 1PNJA 1OV3A 2BZ8A 1BU1A 4IKFA 4PLIA 2D6FA 1OX9A 5HK0A 2E10A 2L3PA 3I55T 3GP8A 1UFFA 2DKGA 3FB9A 3CCJT 2EQMA 4OMPA 4ELYC 5DLOA 4ZGJB 1E6HA 4OP0A 3FJPA 1QKXA 1UJ0A 3EG9A 3QJ6A 1C1AA 4Z88A 4R55A 3OYJA 1K73C 5GMKl 4RCBA 4F04B 3EG9B 1KQSP 2ZPEB 3JCMd 2DRKA 4DEYA 1B7TA 1K73R 4VUBA 1BBZA 2CH4W 3CPWA 4JDSA 2FEIA 1MGQA 1ZUUA 3AT1B 1Q81C 2KRMA 1N8RC 3QKJA 1NJIC 1PM3A 3OYEA 2CT4A 2CP2A 2EKOA 4CC3A 4Z89A 3DB3A 2RK2A 2CYZB 2DAQA 1Q81R 2COZA 2RB6A 1N8RR 1TWBA 3JCMb 1NJIR 3UT1A 2JW4A 2SRCA 3TU4K 2YUPA 4YTLA 3JCMJ 5KE2A 4JRIA 4F7UG 4QQDA 1WFWA 4C8QD 5J39A 4LDUA 4AG1C 1QCOA 3BDLA 2VC8A 2R57A 5GAN8 3PFSA 3E9GA 3QIIA 1M1KU 5GAOn 1OYXA 3H8ZA 2P0KA 3H41A 2K3BA 1WQWA 2RO0A 2VYTA 1SRLA 1VUBA 1ZBJA 3OA6A 2YLCA 3P8HA 3VS5A 2O4XA 3UATA 4XU2A 3QBYA 1SKUB 3BE3A 2HEQA 1IREB 5GANf 2EYYA 1GBRA 4PLLA 2KROA 2NUTB 4HT9A 1I81A 4LE9A 2F5TX 4XTVA 4F14A 1YJWA 4FSXA 2PU9B 1WJSA 4XTXA 3CCQT 2EW3A 4M75C 2OAUA 3A8HB 1TOVA 2ZPIB 2LDMA 2G3RA 2XK0A 3M0PA 5LJ3g 3A98A 2GNCA 1AWWA 1PSFA 3VRZA 1MNEA 2JJ9A 1G3SA 2FRYA 4XAXB 2CS7A 2DFUA 4N4HA 3Q1JA 2Y4YA 3X20B 1VQ4A 2J05A 3DKMA 1YJWT 2COYA 2NUPB 3M59A 1AHJB 1Q82U 1VQ8Q 4EMGA 3RMQA 5HKCA 2FPFA 4F7UE 1FYNA 3CCSA 3QSUA 4BE2A 1X2KA 2PZ1A 3M58A 2C0IA 2H3EB 2XG8D 1PSEA 4OB1B 4C5GA 3CBMA 2DVEA 1NPRA 1QWFA 4XTYA 3HTRA 1M90C 3SD4A 4Z02A 1T3LA 3VU3C 1VQ4T 4RTWA 1SRMA 1OOTA 5KE3A 4ZNXA 5IXBA 1LVKA 1XOVA 2GBQA 1WXBA 1AWXA 1N5ZA 2XICA 1M90R 3NTKA 3CCST 3M0RA 3ZEHA 2RMOA 2Y4XA 2KMTA 3EH2A 5KYNA 4PJLA 4M78C 3JAME 1Q7YC 3CD6Q 1M8VA 1ABOA 2B86A 2K9GA 3M54A 2AT1B 2FYKA 4XTZA 3VS4A 1RI9A 4IIMA 2VXFA 1AEYA 4M7DD 2K5IA 3V8KA 1JJ2P 2K3XA 4QQ6A 3WXMB 1Q7YR 3F70A 5D7UA 2F69A 3NFCA 2XDBA 1VQNQ 2CKKA 2EIFA 1K8AU 3EHQA 4GLMA 1QVGS 4PJJA 2PUOB 5M9OA 2FZKB 4C92C 4LD6A 1Y07A 1IO6A 4PFOA 2EYZA 4D8KA 2BZYA 2HMAA 3UA7A 2MPXC 1AT1B 1UDLA 2H8HA 3OS5A 3SEMA 3CC2A 4RTUA 2MAMA 4JRPA 2LCSA 1QLYA 2MI6A 4A4GA 1VQMA 5IXFA 4IUVA 4M75G 1VQNA 4EMKC 1TSFA 5CQYA 1KC8C 1A0NB 3X28B 3S3NA 3DLMA 2D1XA 3RIRA 2BE7D 3QPHA 4F16A 4ZTFA 2HSEB 2DXCA 3HFNA 3C4SA 1KC8R 2DD4A 1OI1A 4LNPA 5LJ5h 1BI3A 3RKXA 3CC2T 4C8QB 2FVUA 5L23A 3GNFB 3FDRA 2VASA 3OYKA 3EGUA 4FYVB 1VQMT 1VQNT 4DBRA 2KQWA 4IUQA 3JB9D 1PHTA 1VQOQ 1QVPA 1ACMB 2V8JA 1N6AA 1WJQA 1YFNA 1YJ9Q 4KBMB 1AZEA 1U8RA 2L5QA 1PG5B 3I56Q 5A0GA 2EBPA 1KSWA 1QQJA 3OMCA 1VQ5T 1IXDA 5GMKh 2KRSA 3MEWA 2ZAEA 2VKNA 5A2QE 1M5Q1 2KBTA 3EFSA 4ZTJA 1ZBXA 1NLPC 3CMAQ 1N9RA 2QEXA 4M78G 5I21A 2JTMA 1AZGB 3G6EQ 4M75E 3EG0A 3HRUA 2PVGB 3RR6A 2RJDA 1G5VA 1K0SA 3OYBA 3TSZA 1WQ7A 5L8RE 3VS0A 4EIKA 2DD5A 2ZPBB 3UDCA 4FYYB 2DPPB 1J3TA 1HSQA 4FSSA 3MKDA 1U5SA 1WJRA 5IHNA 4QVCA 1YJNA 2DA9A 1K9MC 5J3BA 2QEXT 4MMKA 1I07A 3CQTA 4J9BA 3X25B 4XK8E 1UUEA 2RN8A 8AT1B 2M0OA 4J9EA 2KXDA 1K9MR 2HCKA 3OYFA 1GFCA 3QXEB 5D6YA 3OW2P 1V76A 2G6FX 2YLBA 2AK5A 2LQNA 1M2VB 5CCAA 5GAOm 1YJNT 1RAAB 3EG1A 2DETA 3HPWA 4ZN3A 4J9IA 4J9GA 2CP5A 3META 2ROLA 4M7DF 2QA4Q 4M7DA 1YI2A 3VJPA 2YSQA 2YXYA 3GNGA 2OAWA 1YIJQ 4M7AD 1EFNA 4M77D 3CXCP 3WVDB 2X35A 5FU6B 4M7DB 4M78E 2GTOA 2L2PA 5GJVB 3T9NA 3EAEA 2L8DA 1B07A 1I4K1 4O5VA 2X4YA 4XU1A 2DBMA 4CC4B 4XU3A 1WHHA 4OMFB 1CKBA 3OMGA 4X9DA 1LJOA 1YI2T 2PVOB 2JXBA 3EG2A 2PVDB 4LD9K 3U23A 1H8KA 2EQIA 4AMCA 3JCMe 2JZ2A 5GAOr 2EYQA 1S72A 2DZ9A 1VQLA 2JNGA 2A3LA 1QVGA 4J9FA 3CCLT 1PKTA 2J6KA 4JJCA 5IAYA 4LN2A 4OMQA 2IVWA 3OYAA 3QZ5B 2DZCA 2OX7A 1K4US 1MUZA 1UEBA 1EZZB 1U3OA 4X34A 3OS2A 3OY9A 1Y96B 2KK4A 1S72T 4FIBA 4PK4A 1VQLT 3MO8A 2AIRB 4WF2A 4E7IA 2LQKA 1HXDA 4AT1B 1KQSS 3CC4A 1LCKA 1UGQB 1Y7XA 4FT2A 1QVFP 4Z8AA 3CBPA 3D7SB 3SFMA 4DBQA 1BIAA 4AG2C 2PNIA 3A8MB 1HJDA 3QYGB 2HL5C 4DBFA 1H641 1TH7A 2V1RA 5AYFA 2A28A 1T0HA 4OMOA 2LCLA 4Y28E 4IUPA 2LJ3A 1YN8A 1BYMA 1B34A 2HNIA 3VS3A 2DLPA 4DQ2A 2CT3A 2P84A 1WLPB 1AWOA 1LOJA 4J8OA 4DA4A 3BDUA 1JBMA 3CC4T 4C0FA 4PJOD 2EQJA 2DX1A 3J7AF 1KHIA 1I8FA 4MMLA 3CCMQ 1XNIA 2AHJB 4E7KA 4BI8B 4JS5A 2PQWA 1Y57A 2V8KA 1FWZA 3MEAA 4L6V5 1MV3A 4Y91A 2DTIA 3CPWP 1RAEB 4PKCC 2RQRA 1S1NA 3RKYA 1DJ7B 3THKA 3MJXA 1KG1A 2O9SA 2DYBA 3MPUB 4C5HA 1Y0MA 1VQKQ 4LDXA 3NHNA 2RNAA 4ELZC 5I2MA 2LVMA 4JRQA 1BKBA 1WNLA 2FZCB 3CC7A 5CO7A 2X4JA 1W4SA 3PIPA 1Z9QA 1Z9ZA 1KQ1A 1GCPA 2CP7A 4J6YA
chains in the Genus database with same CATH topology
1VQNQ 1VQ7Q 1KQSP 1VQ4Q 1S72Q 3I56Q 3CCLQ 1VQLQ 3CCEQ 3G6EQ 2OTLQ 3CD6Q 1Q82R 1YITQ 3CMEQ 3CCMQ 1Q81R 1YI2Q 1W2BP 1K73R 1Q86R 1VQKQ 3CC7Q 1N8RR 1YJWQ 3CCRQ 3CC4Q 1NJIR 3G4SQ 1VQOQ 2QA4Q 3CCSQ 1VQ8Q 3CCVQ 3I55Q 1QVGP 1JJ2P 3G71Q 1K9MR 3CC2Q 1YHQQ 3CCJQ 1VQ6Q 1YIJQ 1Q7YR 2OTJQ 1QVFP 3CPWP 2QEXQ 1VQ9Q 1M1KR 1YJNQ 1K8AR 3CXCP 3CCQQ 1VQPQ 1KC8R 3CCUQ 3OW2P 1YJ9Q 1KD1R 1VQMQ 3CMAQ 1M90R 1VQ5Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQN Q;  1VQ7 Q;  1KQS P;  1VQ4 Q;  1S72 Q;  3I56 Q;  3CCL Q;  1VQL Q;  3CCE Q;  3G6E Q;  2OTL Q;  3CD6 Q;  1Q82 R;  1YIT Q;  3CME Q;  3CCM Q;  1Q81 R;  1YI2 Q;  1W2B P;  1K73 R;  1Q86 R;  1VQK Q;  3CC7 Q;  1N8R R;  1YJW Q;  3CCR Q;  3CC4 Q;  1NJI R;  3G4S Q;  1VQO Q;  2QA4 Q;  3CCS Q;  1VQ8 Q;  3CCV Q;  3I55 Q;  1QVG P;  1JJ2 P;  3G71 Q;  1K9M R;  3CC2 Q;  1YHQ Q;  3CCJ Q;  1VQ6 Q;  1YIJ Q;  1Q7Y R;  2OTJ Q;  1QVF P;  3CPW P;  2QEX Q;  1VQ9 Q;  1M1K R;  1YJN Q;  1K8A R;  3CXC P;  3CCQ Q;  1VQP Q;  1KC8 R;  3CCU Q;  3OW2 P;  1YJ9 Q;  1KD1 R;  1VQM Q;  3CMA Q;  1M90 R;  1VQ5 Q; 
#chains in the Genus database with same CATH topology
 1IHW A;  1VQ9 A;  1NEG A;  4BD3 A;  3HRS A;  2DBK A;  1I0C A;  2D0N A;  5GAN 7;  5FRN A;  3CCE A;  4OF1 A;  1VQK A;  2KYB A;  2CZ1 B;  2BKD N;  3M56 A;  2DL4 A;  2CSQ A;  2CZ0 B;  3VYG A;  1UGP B;  3UPU A;  3CC7 T;  4QT7 A;  4KH1 B;  1Q86 C;  1SHG A;  1WHL A;  4RTY A;  1VQP Q;  3O5Z A;  4OVA A;  2D0Q B;  4C0G A;  3L2W A;  1VYT A;  3MEV A;  2YUQ A;  2YDL A;  4M7A B;  3KXT A;  3JCM Q;  4M77 B;  4GLK A;  1VQ9 T;  5CQX A;  1KHC A;  5FU7 B;  1AD5 A;  1Q86 R;  2HDA A;  2EQU A;  1ZSZ B;  2M02 A;  2KR3 A;  5GAN 6;  2M16 A;  1M9S A;  3CCE T;  3RMS A;  1D3B B;  2KNB B;  3RKW A;  2W10 A;  1UE9 A;  1R8O B;  1RAI B;  2LT4 A;  5GAO p;  3EH1 A;  2MWP A;  3VKI A;  3ME9 A;  2KI7 A;  1OZ2 A;  1X2Q A;  2E64 A;  1Q82 C;  1VIE A;  5D6X A;  2HQH A;  3I5S A;  4OGC A;  2M9U A;  2LRQ A;  4JJN K;  1LNX A;  1NBE B;  4HCK A;  1PKS A;  5FW9 A;  4R0K A;  3V8L A;  5GAN e;  3V7C A;  1Q82 R;  1RAD B;  1YIT Q;  3EG3 A;  3PTA A;  3CME Q;  1JJ2 S;  4LUE A;  2EFI A;  1TTH B;  4RTT A;  4BE1 A;  1WHK A;  2NUT A;  4QQG A;  4X1V A;  5I11 A;  4CC2 A;  3EFO B;  3CPF A;  5KCH A;  1UHC A;  4NL3 A;  1MMN A;  4BY6 B;  3INZ A;  5CKD A;  1VYV A;  2C06 A;  4WCI A;  1PRL C;  4HA8 A;  4WTO B;  1UJY A;  3L2Z A;  4II1 A;  2JVV A;  4CC7 A;  4L59 A;  5GMK i;  5CKE A;  1KQS A;  2MWO A;  4RCC A;  4PJO F;  2YRD A;  1SSF A;  2JMC A;  2O2O A;  2NUP A;  2OTL Q;  1OPK A;  3FRN A;  2DM1 A;  3L2R A;  3LH0 A;  4J6W A;  3QYH B;  3FEO A;  1K8A C;  4PJO B;  3CCR Q;  5GAN j;  2DO3 A;  4J83 A;  1Q81 U;  3H6Z A;  3J80 E;  3OB9 A;  4EDU A;  4E6R A;  2PUK B;  1AWJ A;  1G3W A;  2DVJ A;  1K8A R;  1WGS A;  1WZO A;  5CKF A;  5KYU A;  1R77 A;  2RQV A;  3OS0 A;  3HRT A;  2KSS A;  2ZCF B;  4AFZ C;  1YCY A;  2ZPG B;  5CKB A;  1YWP A;  2ROT A;  2E3I A;  5KYU B;  5HCK A;  4E7J A;  4JUV A;  2MCN A;  5CIU A;  2E1H A;  1H3Z A;  1Q95 G;  1VQ8 A;  4FU6 A;  1RLP C;  4C0D B;  3REB B;  1KFZ A;  3LLR A;  1VQ7 Q;  3NGP A;  2FB7 A;  2X3X D;  4C8Q G;  4M7D C;  2EJG A;  5GAO l;  4UC4 A;  4RTX A;  1AOJ A;  2HKQ B;  4C5I A;  1JEG A;  1PC0 A;  2K2V A;  5KYY B;  4J7I A;  2CZ7 B;  2RJF A;  2QAS A;  1WA7 A;  3VV0 A;  1X6O A;  3L2V A;  3QDR B;  1V1C A;  2MK5 A;  2YUO A;  2RPN A;  1H92 A;  2JTE A;  5IHK A;  2FO0 A;  2RH2 A;  1VQ8 T;  1X69 A;  4HT8 A;  2QQS A;  3RDV A;  2HBP A;  4HCZ A;  2K6D A;  2CZ6 B;  4ATO A;  1K1Z A;  5KH6 A;  4HKE A;  2XKO C;  1W2B P;  1GCQ A;  3CD6 A;  2DEQ A;  2K2M A;  2RQT A;  2A36 A;  2ZPH B;  1V29 B;  5FRO A;  6AT1 B;  1QCF A;  1VQ6 Q;  4OB0 B;  4JS4 A;  5CR2 A;  2KEA A;  1I5L A;  3QO3 A;  3FC3 A;  5GAN d;  1QP2 A;  2OI3 A;  4NS5 A;  1NEB A;  2FPD A;  2FL7 A;  4HCC A;  1MV0 B;  5GAM e;  3G4S Q;  3OW2 S;  1TS9 A;  1PD1 A;  3V8J A;  3CD6 T;  2CRE A;  2LMJ A;  1GRI A;  4A4F A;  4C8Q F;  4IUT A;  4C8Q A;  3A8L B;  1MHN A;  1SPK A;  4KT0 E;  5C0M A;  2LQ8 A;  2DL8 A;  2BUD A;  2EQK A;  3OYM A;  4C92 D;  3M55 A;  4C8Q E;  2FRW A;  2QQR A;  4E2F B;  5GAM f;  1FMV A;  2J6O A;  1SG5 A;  1M4Z A;  1X01 A;  4PFZ A;  1C0M A;  3ZL7 C;  4X9C A;  3TVT A;  3CXC S;  2MYS A;  2QTV A;  2YRV A;  3DLL A;  3EHR A;  1YHQ Q;  4AFU C;  2ZPF B;  5IT9 E;  1X6B A;  1Q7Y U;  3JCM h;  1ARK A;  1IGU A;  1WDX A;  2QGF B;  2MIO A;  3KUF A;  1BK2 A;  3OYY A;  4HVV A;  5A0D A;  1NLO C;  3G7Z A;  3CCV Q;  2E4H A;  1KK7 A;  3JRZ A;  2LNH B;  5GAM j;  1VQO A;  4IUR A;  1WI7 A;  2L3R A;  4PJM A;  1KQ2 A;  4M7D G;  4PJN A;  1E7O A;  1TG0 A;  2AKL A;  3MHX A;  4LXC A;  2NUZ A;  1RI0 A;  2RJC A;  2WSC E;  1YJ9 A;  3L2U A;  2CUB A;  1D0X A;  3I56 A;  2DE0 X;  4ME7 A;  4RTZ A;  4KGX B;  2I2L A;  1B3Q A;  4XTW A;  3A5Z B;  1O75 A;  1VQO T;  3KBG A;  2QG9 B;  1M1F A;  4A53 A;  3CMA A;  3JV3 A;  2FHD A;  4PNO A;  1OX8 A;  3VUB A;  1FXX A;  1YJ9 T;  3HHT B;  3G6E A;  1QVF S;  1ZA2 B;  2VGN A;  4JRK A;  1D0Z A;  1KJW A;  3I56 T;  4N0A A;  1WHJ A;  1M2V A;  3QZ9 B;  3VS6 A;  5KYX B;  3PE0 A;  4RKU E;  4J5Y A;  3UA6 A;  5HY6 A;  2FZG B;  2I0N A;  3QDF A;  1N9S A;  3E9F A;  3EFR A;  4E7S A;  1TUG B;  3CMA T;  5IH2 A;  2RD1 A;  3G1J A;  2ECZ A;  3A8G B;  3G6E T;  2EGE A;  2DXU A;  1K0X A;  2K3Y A;  3JB9 G;  3MEU A;  3CBO A;  4JJD A;  2JM8 A;  1PCX A;  4M7D E;  5I22 A;  1IRX A;  4FW1 A;  2YWW A;  2QAZ A;  3H0F A;  2LT1 A;  1M3B A;  2VGM A;  5LL6 S;  1QW1 A;  3C94 A;  2J6F A;  4XU0 A;  3CPW S;  5GAM d;  1YP5 A;  4MDW A;  2JMA A;  1PWT A;  2Z0W A;  3M4G A;  4ORZ A;  2F5K A;  2QA4 A;  3NTH A;  4OGE A;  5IN1 A;  1UEC A;  5HK3 A;  3CCU Q;  1YIJ A;  2A37 A;  3TRE A;  4V2S A;  5LJ5 e;  5KYW B;  3LX7 A;  1W6X A;  2KAF A;  4MZT A;  3PVL A;  1TUD A;  3UF4 A;  3PGG A;  2CP3 A;  4BDZ A;  1IHV A;  2GGR A;  2LP5 A;  2RHI A;  2HL3 A;  2RHZ A;  2OJ2 A;  3QUI A;  5LJ5 f;  2CGH A;  3LH5 A;  4HVW A;  2QA4 T;  2DXB A;  1OU9 A;  1Y96 A;  2DXT A;  3OYD A;  1YIJ T;  3M5A A;  4QVZ A;  2DEU A;  2KGT A;  4KRT A;  2WAC A;  3PMI A;  3L42 A;  1PD0 A;  4C92 B;  4DBH A;  1OEB A;  3JB9 F;  1I5O B;  3HFO A;  1M8M A;  4FYW B;  3G71 Q;  3OYI A;  2OTJ Q;  2NLU A;  3TQ7 P;  1MMA A;  4J7F A;  3QG1 A;  3JB9 I;  9ATC B;  2EPD A;  1ABQ A;  2DER A;  3VYH B;  5LJ5 j;  1JXO A;  1RAB B;  2K57 A;  2P0P A;  2JS0 A;  3CXC A;  1D1C A;  1JO8 A;  2SEM A;  1G83 A;  4GBQ A;  1JB0 E;  1M2O A;  4A4K A;  2X3W D;  1K9A A;  5GAN h;  1MND A;  2RI5 A;  3H0I A;  4M7A G;  2P0Q A;  4M77 G;  2EYW A;  2L3Q A;  2ABL A;  3ZFJ A;  2JTF A;  3NPF A;  5A0L A;  3GF5 A;  1GXI E;  2YT6 A;  2KDS A;  3CCJ Q;  4N4I A;  4NOY A;  4MDX A;  2DTH A;  4KGV B;  1W1F A;  4C0D C;  2LX7 A;  2O31 A;  2DIL A;  2AKK A;  4PL6 A;  4RG8 A;  5AT1 B;  1WHM A;  2K4Y A;  1SHF A;  2RI3 A;  1UGR B;  4FL6 A;  1QP3 A;  3CCM A;  2MF2 A;  4JJB A;  2XD0 A;  1X75 C;  1M3C A;  5FLX E;  3JCM g;  3M0U A;  2A0F B;  2DIG A;  2F2X A;  2KY9 A;  1KD1 U;  2EVR A;  1M1K C;  1BCM A;  1RL2 A;  4J9D A;  1JQQ A;  2AZS A;  4B6M A;  2RJE A;  1SEM A;  2RQU A;  2HBW A;  3BY7 A;  2QTX A;  4NL2 A;  3CCM T;  4M7A F;  4M7A A;  2GF7 A;  4M77 F;  4M77 A;  2GQI A;  1M1K R;  1F1B B;  3KFV A;  4EMH A;  5I2S A;  1GCQ C;  3NMZ C;  5LJ3 e;  2GFU A;  1ZSZ A;  4RG2 A;  5LJ5 d;  4M7A E;  4OB2 B;  2P4R A;  3H0H A;  4M77 E;  1D3B A;  2EGA A;  1BIB A;  3C12 A;  1NM7 A;  2WSF E;  3CEY A;  2RHY A;  5EG2 A;  2F2W A;  2YRC A;  2ESW A;  3OBY A;  1ZUY A;  2H3J A;  1PRM C;  2A7Y A;  5LJ3 f;  3L2Q A;  4FYX B;  1VQK T;  2F1L A;  2LZ6 B;  4DOV A;  3I5R A;  3REA B;  3DB4 A;  2YHT A;  4F17 A;  3A8O B;  3VS2 A;  4AFS C;  1VQP A;  4L5G A;  4JLI A;  4C8Q C;  2W0Z A;  2LCC A;  4PJO G;  4KUI A;  2J7I A;  2VWF A;  3GOX A;  3EGX A;  4A63 B;  3TEE A;  3M9Q A;  1QKW A;  3CCQ Q;  2E6Z A;  1JXM A;  1VA7 A;  3EGX B;  2EJF A;  1VIF A;  3JCM c;  1WPY A;  5LJ3 j;  2RHU A;  1VQP T;  1VOM A;  4C5E A;  1RAG B;  1YCS B;  3EFO A;  4O6J A;  2E5Q A;  2YUN A;  4B9W A;  3MP6 A;  3I9Q A;  1X27 A;  4JPB W;  1RAC B;  3GIB A;  4MZM A;  3RBB B;  3X26 B;  3M4Y A;  2ATC B;  4DEX A;  3SWN A;  1YJW Q;  1W2B S;  4OMM A;  1CKA A;  4LDW A;  1KIK A;  3CCQ A;  2KT1 A;  2R5M A;  4IUU A;  3PT9 A;  2QGG A;  1EX4 A;  5GAM h;  2DRM A;  2RHX A;  3SWN B;  3S6W A;  3OYL A;  2GFA A;  3ZBD A;  1GBQ A;  1N27 A;  1T0J A;  1YIT A;  3CME A;  5ECA A;  2GTJ A;  3R6N A;  2DF6 A;  2M1H A;  4ANJ A;  1Q86 U;  4K11 A;  1K73 U;  2EYX A;  1UG1 A;  1WXT A;  2QQA A;  2R58 A;  3E1S A;  2IPO B;  1K76 A;  3R6O A;  2X4X A;  5C6S A;  4PJO A;  1FX7 A;  1OUL A;  2O4X B;  4LDV A;  5CK9 A;  1VQ4 Q;  2XMF A;  5EC7 A;  5GAO q;  4E7L A;  2K7A A;  3QWX X;  3VS1 A;  4PJO E;  2V26 A;  1Y71 A;  4PFP A;  4R56 A;  2CUD A;  3CCS Q;  3ASK A;  2CP0 A;  1SF9 A;  4FCY A;  2BTT A;  1T3S A;  1YIT T;  5KCO A;  1HD3 A;  3CME T;  5GAN 4;  1N8R U;  1LPL A;  4XTU A;  1NJI U;  4M75 D;  2CH4 A;  4LUD A;  2DL7 A;  3OYN A;  3URG A;  1BCO A;  1IZ6 A;  2DJZ A;  4N0A C;  4DOW A;  5FRM A;  4F7U F;  4F7U A;  2D8H A;  2OTL A;  1BI0 A;  1I1J A;  2RF0 A;  3CCR A;  1U06 A;  1WX6 A;  2JT4 A;  4BI4 A;  4F7U B;  3OYH A;  1X6G A;  1RUW A;  3EGD A;  2RA2 A;  1NG2 A;  1RLQ C;  1AVZ C;  1RAH B;  5LJ3 d;  3C0C A;  3S3M A;  3FJ5 A;  5KYY A;  4MZP A;  4ZGD B;  5FU6 C;  3V7R A;  2P4T A;  4FM4 B;  3VUZ A;  3EGD B;  4HVU A;  3P8B B;  2HQE A;  1OQK A;  4OMN A;  5GAN 5;  1X43 A;  3M0T A;  3NTI A;  2OTL T;  3BW1 A;  1OZ3 A;  2VUB A;  1E6G A;  4QW2 A;  2VXE A;  2R5A A;  3TSW A;  2KRN A;  2D9T A;  3QJY A;  3CCR T;  3LGL A;  2X4W A;  2ZZD A;  5GAN g;  2F2V A;  2XID A;  7AT1 B;  2ED0 A;  2EKH A;  5J26 A;  1VQ7 A;  2QXF A;  1C6V X;  1D1B A;  2XDP A;  2DMO A;  1BB9 A;  3GPL A;  4BE0 A;  3JSC A;  4QVD A;  2COW A;  1NYG A;  3CC2 Q;  4M78 D;  4OML A;  4A54 A;  5GMK m;  1CSK A;  3BFM A;  1VQM Q;  3RER A;  3SDZ A;  2O88 A;  5FWC A;  3A1P A;  1XQH A;  2HAX A;  4E47 A;  3LYI A;  3JCM V;  1WIE A;  3S3O A;  1SSH A;  2J06 A;  3MCA B;  1QWE A;  1VQ7 T;  3HSB A;  2GCX A;  3PIO A;  2JUF A;  4RTV A;  3PNW C;  3TCJ A;  2LJ0 A;  1VQ5 Q;  1VQ6 A;  2EAY A;  3N5B B;  2QI2 A;  4A4H A;  4A4E A;  1TU0 B;  1YNZ A;  2ZGW A;  2DNU A;  1U1S A;  1NYF A;  1M90 U;  4IIO A;  4RMO A;  1UTI A;  2MMP A;  1O9S A;  2E41 A;  4ZGE B;  4E7H A;  3E19 A;  3G4S A;  3IQL A;  2FG0 A;  1VQ5 A;  1TXQ A;  1M27 C;  1VYU A;  4E7Z A;  2NWM A;  2QDL A;  4J9C A;  2BZX A;  1VQ6 T;  3JB9 H;  3AHU A;  5CAI A;  1M30 A;  1GL5 A;  3M53 A;  4N4G A;  2V1Q A;  1JJ2 A;  4KH0 B;  4Q5W A;  1IGQ A;  3PMT A;  2K5L A;  2VVK A;  3OSS C;  1ZLM A;  2QEX Q;  8ATC B;  4KUL A;  3G4S T;  2L89 A;  1YHQ A;  3FIF A;  1W2B A;  2WSE E;  5DLQ E;  2IIM A;  4RUG A;  1M1G A;  1G2B A;  4AFQ C;  4CRI A;  2RI2 A;  2RQW A;  2HSP A;  5FWB A;  1WHG A;  1ZSG A;  2PTK A;  3ULR B;  3M0Q A;  3OSV A;  2KT8 A;  2VB6 A;  4M75 F;  4M75 A;  1NZ9 A;  4KUD K;  3CCV A;  3PVQ A;  4FW2 A;  1YJN Q;  3MP1 A;  2CDT A;  3GBQ A;  1HYO A;  2CP6 A;  1YHQ T;  4M75 B;  1KC8 U;  4JZ4 A;  2LQW A;  5GAN 3;  5D6W A;  1OU8 A;  2HQX A;  2JOY A;  1R0C B;  2O01 E;  2XI9 A;  1R0B G;  5KYX A;  4CI0 C;  1ZA1 B;  2DK3 A;  3WVE B;  3QWY A;  2QDY B;  1QVG P;  1JU5 C;  3JCM X;  2EJ9 A;  4FT4 A;  3CCV T;  4BUG A;  1ZQ1 A;  3ER0 A;  4M4Z A;  4TVR A;  5GAM g;  2A08 A;  2CSI A;  1FMW A;  1MMD A;  2DYI A;  4LDY A;  4C92 G;  3OYC A;  1YI2 Q;  4M7A C;  4M77 C;  1YWO A;  3O8V A;  2XHC A;  2E70 A;  4XQ3 A;  5FU7 C;  4ESR A;  2KYM A;  1ZSZ C;  2LC4 A;  5DM7 R;  2IG0 A;  2L3S A;  3J81 E;  4HXJ A;  3OBW A;  3RNJ A;  4P5N A;  2QQ9 A;  3CCL Q;  3H9N A;  2E5K A;  2ENM A;  2V8I A;  3LWI A;  1BI1 A;  3MP8 A;  1D1A A;  2MOX A;  4M78 F;  1UHF A;  4M78 A;  1G3Y A;  1NPP A;  2RK1 A;  5KYW A;  4OB3 B;  1WYX A;  2E6N A;  2ED1 A;  4BDY A;  1S72 Q;  4M78 B;  3OQ5 A;  1XTD A;  1VQL Q;  2Y90 A;  3I35 A;  2LJ1 A;  2QK0 A;  2L0A A;  3M57 A;  3CCL A;  2KVQ G;  1U1T A;  1ZUK A;  2BIV A;  1FMK A;  5GJW B;  1G3T A;  2EWN A;  4C0Z A;  1P92 A;  3SB2 A;  5LJ3 h;  3VS7 A;  4C92 F;  2FPE A;  2QQB A;  4C92 A;  1K9M U;  3CCU A;  3L1A A;  4BY6 C;  1M3A A;  1G8X A;  4C92 E;  1D09 B;  2KXC A;  1MMG A;  1WXU A;  3SWN C;  5GMK e;  3LW5 E;  3CC4 Q;  2K5F A;  4ZN1 A;  4GY5 A;  2XDD A;  4EMK A;  2M0Y A;  3OW2 A;  1UGS B;  2O9V A;  2NYS A;  1ZX6 A;  3M0S A;  3JCM f;  3OS1 A;  4BI3 A;  2DIQ A;  4EMK B;  4BB7 A;  3HKS A;  4J6X A;  3QHS A;  1EIF A;  5CVI A;  3C95 A;  4HCB A;  3CCU T;  3X24 B;  2M51 A;  1KD1 C;  3RES A;  4D8D A;  2D8J A;  2JS2 A;  4JZ3 A;  3HL8 A;  5GAN 2;  2AZV A;  4PJO C;  2DL3 A;  2DJQ A;  1QMC A;  4JLG A;  3JB9 J;  2XU8 A;  2LX9 A;  1BI2 A;  3G71 A;  1KD1 R;  1HK9 A;  3SHW A;  2OTJ A;  4Y92 A;  3OYG A;  1NE8 A;  3UWN A;  1RAF B;  3RUX A;  2HD0 A;  3LWH A;  2JM9 A;  2LNV A;  2B8A A;  3LGF A;  2E3H A;  4KGZ B;  2QYZ A;  3GLX A;  1OPL A;  1W70 A;  3I55 Q;  2E12 A;  3FLG A;  2HZY A;  4QKU A;  5GMK j;  4J9H A;  4B9X A;  1ZHI A;  1TUC A;  1B34 B;  2BE9 B;  1UGV A;  1IB8 A;  2JN0 A;  2KE9 A;  2K79 A;  2DL5 A;  2RM4 A;  1QCN A;  3HP9 A;  3G71 T;  3JCM W;  2OTJ T;  4D6W A;  2DTO A;  1JRI A;  4BAC A;  2C0O A;  3CC7 Q;  2C0T A;  2GQV A;  3E2U A;  1UB4 A;  3JCM P;  2X51 A;  3V7S A;  3P8D A;  1GFD A;  3I55 A;  1VQ9 Q;  3VRY A;  5LJ5 g;  5CKH A;  2X9H A;  3CCJ A;  2EGC A;  5IHI A;  3CCE Q;  1XJW B;  1H3H A;  2HKN A;  1YBY A;  4EPC A;  1D0Y A;  2E65 A;  2LTO A;  1QVF A;  2VV5 A;  5DY9 A;  1PNJ A;  1OV3 A;  2BZ8 A;  1BU1 A;  4IKF A;  4PLI A;  2D6F A;  1OX9 A;  5HK0 A;  2E10 A;  2L3P A;  3I55 T;  3GP8 A;  1UFF A;  2DKG A;  3FB9 A;  3CCJ T;  2EQM A;  4OMP A;  4ELY C;  5DLO A;  4ZGJ B;  1E6H A;  4OP0 A;  3FJP A;  1QKX A;  1UJ0 A;  3EG9 A;  3QJ6 A;  1C1A A;  4Z88 A;  4R55 A;  3OYJ A;  1K73 C;  5GMK l;  4RCB A;  4F04 B;  3EG9 B;  1KQS P;  2ZPE B;  3JCM d;  2DRK A;  4DEY A;  1B7T A;  1K73 R;  4VUB A;  1BBZ A;  2CH4 W;  3CPW A;  4JDS A;  2FEI A;  1MGQ A;  1ZUU A;  3AT1 B;  1Q81 C;  2KRM A;  1N8R C;  3QKJ A;  1NJI C;  1PM3 A;  3OYE A;  2CT4 A;  2CP2 A;  2EKO A;  4CC3 A;  4Z89 A;  3DB3 A;  2RK2 A;  2CYZ B;  2DAQ A;  1Q81 R;  2COZ A;  2RB6 A;  1N8R R;  1TWB A;  3JCM b;  1NJI R;  3UT1 A;  2JW4 A;  2SRC A;  3TU4 K;  2YUP A;  4YTL A;  3JCM J;  5KE2 A;  4JRI A;  4F7U G;  4QQD A;  1WFW A;  4C8Q D;  5J39 A;  4LDU A;  4AG1 C;  1QCO A;  3BDL A;  2VC8 A;  2R57 A;  5GAN 8;  3PFS A;  3E9G A;  3QII A;  1M1K U;  5GAO n;  1OYX A;  3H8Z A;  2P0K A;  3H41 A;  2K3B A;  1WQW A;  2RO0 A;  2VYT A;  1SRL A;  1VUB A;  1ZBJ A;  3OA6 A;  2YLC A;  3P8H A;  3VS5 A;  2O4X A;  3UAT A;  4XU2 A;  3QBY A;  1SKU B;  3BE3 A;  2HEQ A;  1IRE B;  5GAN f;  2EYY A;  1GBR A;  4PLL A;  2KRO A;  2NUT B;  4HT9 A;  1I81 A;  4LE9 A;  2F5T X;  4XTV A;  4F14 A;  1YJW A;  4FSX A;  2PU9 B;  1WJS A;  4XTX A;  3CCQ T;  2EW3 A;  4M75 C;  2OAU A;  3A8H B;  1TOV A;  2ZPI B;  2LDM A;  2G3R A;  2XK0 A;  3M0P A;  5LJ3 g;  3A98 A;  2GNC A;  1AWW A;  1PSF A;  3VRZ A;  1MNE A;  2JJ9 A;  1G3S A;  2FRY A;  4XAX B;  2CS7 A;  2DFU A;  4N4H A;  3Q1J A;  2Y4Y A;  3X20 B;  1VQ4 A;  2J05 A;  3DKM A;  1YJW T;  2COY A;  2NUP B;  3M59 A;  1AHJ B;  1Q82 U;  1VQ8 Q;  4EMG A;  3RMQ A;  5HKC A;  2FPF A;  4F7U E;  1FYN A;  3CCS A;  3QSU A;  4BE2 A;  1X2K A;  2PZ1 A;  3M58 A;  2C0I A;  2H3E B;  2XG8 D;  1PSE A;  4OB1 B;  4C5G A;  3CBM A;  2DVE A;  1NPR A;  1QWF A;  4XTY A;  3HTR A;  1M90 C;  3SD4 A;  4Z02 A;  1T3L A;  3VU3 C;  1VQ4 T;  4RTW A;  1SRM A;  1OOT A;  5KE3 A;  4ZNX A;  5IXB A;  1LVK A;  1XOV A;  2GBQ A;  1WXB A;  1AWX A;  1N5Z A;  2XIC A;  1M90 R;  3NTK A;  3CCS T;  3M0R A;  3ZEH A;  2RMO A;  2Y4X A;  2KMT A;  3EH2 A;  5KYN A;  4PJL A;  4M78 C;  3JAM E;  1Q7Y C;  3CD6 Q;  1M8V A;  1ABO A;  2B86 A;  2K9G A;  3M54 A;  2AT1 B;  2FYK A;  4XTZ A;  3VS4 A;  1RI9 A;  4IIM A;  2VXF A;  1AEY A;  4M7D D;  2K5I A;  3V8K A;  1JJ2 P;  2K3X A;  4QQ6 A;  3WXM B;  1Q7Y R;  3F70 A;  5D7U A;  2F69 A;  3NFC A;  2XDB A;  1VQN Q;  2CKK A;  2EIF A;  1K8A U;  3EHQ A;  4GLM A;  1QVG S;  4PJJ A;  2PUO B;  5M9O A;  2FZK B;  4C92 C;  4LD6 A;  1Y07 A;  1IO6 A;  4PFO A;  2EYZ A;  4D8K A;  2BZY A;  2HMA A;  3UA7 A;  2MPX C;  1AT1 B;  1UDL A;  2H8H A;  3OS5 A;  3SEM A;  3CC2 A;  4RTU A;  2MAM A;  4JRP A;  2LCS A;  1QLY A;  2MI6 A;  4A4G A;  1VQM A;  5IXF A;  4IUV A;  4M75 G;  1VQN A;  4EMK C;  1TSF A;  5CQY A;  1KC8 C;  1A0N B;  3X28 B;  3S3N A;  3DLM A;  2D1X A;  3RIR A;  2BE7 D;  3QPH A;  4F16 A;  4ZTF A;  2HSE B;  2DXC A;  3HFN A;  3C4S A;  1KC8 R;  2DD4 A;  1OI1 A;  4LNP A;  5LJ5 h;  1BI3 A;  3RKX A;  3CC2 T;  4C8Q B;  2FVU A;  5L23 A;  3GNF B;  3FDR A;  2VAS A;  3OYK A;  3EGU A;  4FYV B;  1VQM T;  1VQN T;  4DBR A;  2KQW A;  4IUQ A;  3JB9 D;  1PHT A;  1VQO Q;  1QVP A;  1ACM B;  2V8J A;  1N6A A;  1WJQ A;  1YFN A;  1YJ9 Q;  4KBM B;  1AZE A;  1U8R A;  2L5Q A;  1PG5 B;  3I56 Q;  5A0G A;  2EBP A;  1KSW A;  1QQJ A;  3OMC A;  1VQ5 T;  1IXD A;  5GMK h;  2KRS A;  3MEW A;  2ZAE A;  2VKN A;  5A2Q E;  1M5Q 1;  2KBT A;  3EFS A;  4ZTJ A;  1ZBX A;  1NLP C;  3CMA Q;  1N9R A;  2QEX A;  4M78 G;  5I21 A;  2JTM A;  1AZG B;  3G6E Q;  4M75 E;  3EG0 A;  3HRU A;  2PVG B;  3RR6 A;  2RJD A;  1G5V A;  1K0S A;  3OYB A;  3TSZ A;  1WQ7 A;  5L8R E;  3VS0 A;  4EIK A;  2DD5 A;  2ZPB B;  3UDC A;  4FYY B;  2DPP B;  1J3T A;  1HSQ A;  4FSS A;  3MKD A;  1U5S A;  1WJR A;  5IHN A;  4QVC A;  1YJN A;  2DA9 A;  1K9M C;  5J3B A;  2QEX T;  4MMK A;  1I07 A;  3CQT A;  4J9B A;  3X25 B;  4XK8 E;  1UUE A;  2RN8 A;  8AT1 B;  2M0O A;  4J9E A;  2KXD A;  1K9M R;  2HCK A;  3OYF A;  1GFC A;  3QXE B;  5D6Y A;  3OW2 P;  1V76 A;  2G6F X;  2YLB A;  2AK5 A;  2LQN A;  1M2V B;  5CCA A;  5GAO m;  1YJN T;  1RAA B;  3EG1 A;  2DET A;  3HPW A;  4ZN3 A;  4J9I A;  4J9G A;  2CP5 A;  3MET A;  2ROL A;  4M7D F;  2QA4 Q;  4M7D A;  1YI2 A;  3VJP A;  2YSQ A;  2YXY A;  3GNG A;  2OAW A;  1YIJ Q;  4M7A D;  1EFN A;  4M77 D;  3CXC P;  3WVD B;  2X35 A;  5FU6 B;  4M7D B;  4M78 E;  2GTO A;  2L2P A;  5GJV B;  3T9N A;  3EAE A;  2L8D A;  1B07 A;  1I4K 1;  4O5V A;  2X4Y A;  4XU1 A;  2DBM A;  4CC4 B;  4XU3 A;  1WHH A;  4OMF B;  1CKB A;  3OMG A;  4X9D A;  1LJO A;  1YI2 T;  2PVO B;  2JXB A;  3EG2 A;  2PVD B;  4LD9 K;  3U23 A;  1H8K A;  2EQI A;  4AMC A;  3JCM e;  2JZ2 A;  5GAO r;  2EYQ A;  1S72 A;  2DZ9 A;  1VQL A;  2JNG A;  2A3L A;  1QVG A;  4J9F A;  3CCL T;  1PKT A;  2J6K A;  4JJC A;  5IAY A;  4LN2 A;  4OMQ A;  2IVW A;  3OYA A;  3QZ5 B;  2DZC A;  2OX7 A;  1K4U S;  1MUZ A;  1UEB A;  1EZZ B;  1U3O A;  4X34 A;  3OS2 A;  3OY9 A;  1Y96 B;  2KK4 A;  1S72 T;  4FIB A;  4PK4 A;  1VQL T;  3MO8 A;  2AIR B;  4WF2 A;  4E7I A;  2LQK A;  1HXD A;  4AT1 B;  1KQS S;  3CC4 A;  1LCK A;  1UGQ B;  1Y7X A;  4FT2 A;  1QVF P;  4Z8A A;  3CBP A;  3D7S B;  3SFM A;  4DBQ A;  1BIA A;  4AG2 C;  2PNI A;  3A8M B;  1HJD A;  3QYG B;  2HL5 C;  4DBF A;  1H64 1;  1TH7 A;  2V1R A;  5AYF A;  2A28 A;  1T0H A;  4OMO A;  2LCL A;  4Y28 E;  4IUP A;  2LJ3 A;  1YN8 A;  1BYM A;  1B34 A;  2HNI A;  3VS3 A;  2DLP A;  4DQ2 A;  2CT3 A;  2P84 A;  1WLP B;  1AWO A;  1LOJ A;  4J8O A;  4DA4 A;  3BDU A;  1JBM A;  3CC4 T;  4C0F A;  4PJO D;  2EQJ A;  2DX1 A;  3J7A F;  1KHI A;  1I8F A;  4MML A;  3CCM Q;  1XNI A;  2AHJ B;  4E7K A;  4BI8 B;  4JS5 A;  2PQW A;  1Y57 A;  2V8K A;  1FWZ A;  3MEA A;  4L6V 5;  1MV3 A;  4Y91 A;  2DTI A;  3CPW P;  1RAE B;  4PKC C;  2RQR A;  1S1N A;  3RKY A;  1DJ7 B;  3THK A;  3MJX A;  1KG1 A;  2O9S A;  2DYB A;  3MPU B;  4C5H A;  1Y0M A;  1VQK Q;  4LDX A;  3NHN A;  2RNA A;  4ELZ C;  5I2M A;  2LVM A;  4JRQ A;  1BKB A;  1WNL A;  2FZC B;  3CC7 A;  5CO7 A;  2X4J A;  1W4S A;  3PIP A;  1Z9Q A;  1Z9Z A;  1KQ1 A;  1GCP A;  2CP7 A;  4J6Y A; 
#chains in the Genus database with same CATH homology
 1VQN Q;  1VQ7 Q;  1KQS P;  1VQ4 Q;  1S72 Q;  3I56 Q;  3CCL Q;  1VQL Q;  3CCE Q;  3G6E Q;  2OTL Q;  3CD6 Q;  1Q82 R;  1YIT Q;  3CME Q;  3CCM Q;  1Q81 R;  1YI2 Q;  1W2B P;  1K73 R;  1Q86 R;  1VQK Q;  3CC7 Q;  1N8R R;  1YJW Q;  3CCR Q;  3CC4 Q;  1NJI R;  3G4S Q;  1VQO Q;  2QA4 Q;  3CCS Q;  1VQ8 Q;  3CCV Q;  3I55 Q;  1QVG P;  1JJ2 P;  3G71 Q;  1K9M R;  3CC2 Q;  1YHQ Q;  3CCJ Q;  1VQ6 Q;  1YIJ Q;  1Q7Y R;  2OTJ Q;  1QVF P;  3CPW P;  2QEX Q;  1VQ9 Q;  1M1K R;  1YJN Q;  1K8A R;  3CXC P;  3CCQ Q;  1VQP Q;  1KC8 R;  3CCU Q;  3OW2 P;  1YJ9 Q;  1KD1 R;  1VQM Q;  3CMA Q;  1M90 R;  1VQ5 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...